data_2MKV
# 
_entry.id   2MKV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2MKV         
RCSB  RCSB103736   
BMRB  19797        
WWPDB D_1000103736 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2JO1  PDB  FXYD1 
unspecified 2JP3  PDB  FXYD4 
unspecified 19797 BMRB .     
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2MKV 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-02-13 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Marassi, F.M.' 1 
'Gong, X.'      2 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the Na,K-ATPase regulatory protein FXYD2b in micelles: Implications for membrane-water interfacial arginines.' 
_citation.journal_abbrev            Biochim.Biophys.Acta 
_citation.journal_volume            1848 
_citation.page_first                299 
_citation.page_last                 306 
_citation.year                      2015 
_citation.journal_id_ASTM           BBACAQ 
_citation.country                   NE 
_citation.journal_id_ISSN           0006-3002 
_citation.journal_id_CSD            0113 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24794573 
_citation.pdbx_database_id_DOI      10.1016/j.bbamem.2014.04.021 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gong, X.M.'    1 
primary 'Ding, Y.'      2 
primary 'Yu, J.'        3 
primary 'Yao, Y.'       4 
primary 'Marassi, F.M.' 5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Sodium/potassium-transporting ATPase subunit gamma' 
_entity.formula_weight             7331.315 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              'M1L, C50S' 
_entity.pdbx_fragment              'UNP residues 9-66' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Na(+)/K(+) ATPase subunit gamma, FXYD domain-containing ion transport regulator 2, Sodium pump gamma chain' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       LDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRSGGNKKRRQINEDEP 
_entity_poly.pdbx_seq_one_letter_code_can   LDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRSGGNKKRRQINEDEP 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  LEU n 
1 2  ASP n 
1 3  ARG n 
1 4  TRP n 
1 5  TYR n 
1 6  LEU n 
1 7  GLY n 
1 8  GLY n 
1 9  SER n 
1 10 PRO n 
1 11 LYS n 
1 12 GLY n 
1 13 ASP n 
1 14 VAL n 
1 15 ASP n 
1 16 PRO n 
1 17 PHE n 
1 18 TYR n 
1 19 TYR n 
1 20 ASP n 
1 21 TYR n 
1 22 GLU n 
1 23 THR n 
1 24 VAL n 
1 25 ARG n 
1 26 ASN n 
1 27 GLY n 
1 28 GLY n 
1 29 LEU n 
1 30 ILE n 
1 31 PHE n 
1 32 ALA n 
1 33 GLY n 
1 34 LEU n 
1 35 ALA n 
1 36 PHE n 
1 37 ILE n 
1 38 VAL n 
1 39 GLY n 
1 40 LEU n 
1 41 LEU n 
1 42 ILE n 
1 43 LEU n 
1 44 LEU n 
1 45 SER n 
1 46 ARG n 
1 47 ARG n 
1 48 PHE n 
1 49 ARG n 
1 50 SER n 
1 51 GLY n 
1 52 GLY n 
1 53 ASN n 
1 54 LYS n 
1 55 LYS n 
1 56 ARG n 
1 57 ARG n 
1 58 GLN n 
1 59 ILE n 
1 60 ASN n 
1 61 GLU n 
1 62 ASP n 
1 63 GLU n 
1 64 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ATP1C, ATP1G1, FXYD2, FXYD2b' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'C41 DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'sequence contains the mutations M1L and C50S' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ATNG_HUMAN 
_struct_ref.pdbx_db_accession          P54710 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2MKV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 64 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P54710 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  64 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       64 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2MKV LEU A 1  ? UNP P54710 MET 1  'ENGINEERED MUTATION' 1  1 
1 2MKV SER A 50 ? UNP P54710 CYS 50 'ENGINEERED MUTATION' 50 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '3D HNCA'         
1 3  1 '3D CBCA(CO)NH'   
1 4  1 '3D C(CO)NH'      
1 5  1 '3D HNCO'         
1 6  1 '3D H(CCO)NH'     
1 7  1 '2D 1H-1H TOCSY'  
1 8  1 '2D 1H-15N HSQC'  
1 9  1 '3D 1H-15N NOESY' 
1 10 1 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      50 
_pdbx_nmr_exptl_sample_conditions.pH                  5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         313 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '0.2 mM [U-99% 13C; U-99% 15N] H2O, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2MKV 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            'Standard simulated annealing protocol for folding and refinement' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2MKV 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2MKV 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' X-PLOR_NIH ? 1 
'Schwieters, Kuszewski, Tjandra and Clore' refinement           X-PLOR_NIH ? 2 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2MKV 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2MKV 
_struct.title                     'Structure of the NA,K-ATPASE regulatory protein FXYD2b in micelles' 
_struct.pdbx_descriptor           'Sodium/potassium-transporting ATPase subunit gamma' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MKV 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            'FXYD2b, Na, K-ATPase, FXYD, micelle, TRANSPORT PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 17 ? GLU A 22 ? PHE A 17 GLU A 22 1 ? 6  
HELX_P HELX_P2 2 THR A 23 ? SER A 50 ? THR A 23 SER A 50 1 ? 28 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2MKV 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . LEU A 1 1  ? -29.576 -21.111 1.478   1.00 0.00 ? 1  LEU A N    1  
ATOM 2     C CA   . LEU A 1 1  ? -31.014 -21.506 1.479   1.00 0.00 ? 1  LEU A CA   1  
ATOM 3     C C    . LEU A 1 1  ? -31.779 -20.632 0.492   1.00 0.00 ? 1  LEU A C    1  
ATOM 4     O O    . LEU A 1 1  ? -32.746 -21.081 -0.127  1.00 0.00 ? 1  LEU A O    1  
ATOM 5     C CB   . LEU A 1 1  ? -31.587 -21.325 2.886   1.00 0.00 ? 1  LEU A CB   1  
ATOM 6     C CG   . LEU A 1 1  ? -32.101 -22.669 3.406   1.00 0.00 ? 1  LEU A CG   1  
ATOM 7     C CD1  . LEU A 1 1  ? -30.929 -23.641 3.552   1.00 0.00 ? 1  LEU A CD1  1  
ATOM 8     C CD2  . LEU A 1 1  ? -32.767 -22.466 4.769   1.00 0.00 ? 1  LEU A CD2  1  
ATOM 9     H H1   . LEU A 1 1  ? -29.497 -20.087 1.636   1.00 0.00 ? 1  LEU A H1   1  
ATOM 10    H H2   . LEU A 1 1  ? -29.152 -21.356 0.559   1.00 0.00 ? 1  LEU A H2   1  
ATOM 11    H H3   . LEU A 1 1  ? -29.077 -21.617 2.236   1.00 0.00 ? 1  LEU A H3   1  
ATOM 12    H HA   . LEU A 1 1  ? -31.103 -22.542 1.187   1.00 0.00 ? 1  LEU A HA   1  
ATOM 13    H HB2  . LEU A 1 1  ? -30.814 -20.955 3.545   1.00 0.00 ? 1  LEU A HB2  1  
ATOM 14    H HB3  . LEU A 1 1  ? -32.402 -20.619 2.855   1.00 0.00 ? 1  LEU A HB3  1  
ATOM 15    H HG   . LEU A 1 1  ? -32.819 -23.073 2.708   1.00 0.00 ? 1  LEU A HG   1  
ATOM 16    H HD11 . LEU A 1 1  ? -31.088 -24.495 2.909   1.00 0.00 ? 1  LEU A HD11 1  
ATOM 17    H HD12 . LEU A 1 1  ? -30.861 -23.973 4.578   1.00 0.00 ? 1  LEU A HD12 1  
ATOM 18    H HD13 . LEU A 1 1  ? -30.012 -23.145 3.272   1.00 0.00 ? 1  LEU A HD13 1  
ATOM 19    H HD21 . LEU A 1 1  ? -33.827 -22.656 4.683   1.00 0.00 ? 1  LEU A HD21 1  
ATOM 20    H HD22 . LEU A 1 1  ? -32.609 -21.451 5.100   1.00 0.00 ? 1  LEU A HD22 1  
ATOM 21    H HD23 . LEU A 1 1  ? -32.336 -23.150 5.486   1.00 0.00 ? 1  LEU A HD23 1  
ATOM 22    N N    . ASP A 1 2  ? -31.340 -19.384 0.354   1.00 0.00 ? 2  ASP A N    1  
ATOM 23    C CA   . ASP A 1 2  ? -31.986 -18.444 -0.558  1.00 0.00 ? 2  ASP A CA   1  
ATOM 24    C C    . ASP A 1 2  ? -31.013 -17.970 -1.635  1.00 0.00 ? 2  ASP A C    1  
ATOM 25    O O    . ASP A 1 2  ? -29.804 -17.918 -1.413  1.00 0.00 ? 2  ASP A O    1  
ATOM 26    C CB   . ASP A 1 2  ? -32.508 -17.237 0.224   1.00 0.00 ? 2  ASP A CB   1  
ATOM 27    C CG   . ASP A 1 2  ? -33.702 -17.647 1.078   1.00 0.00 ? 2  ASP A CG   1  
ATOM 28    O OD1  . ASP A 1 2  ? -34.227 -18.724 0.850   1.00 0.00 ? 2  ASP A OD1  1  
ATOM 29    O OD2  . ASP A 1 2  ? -34.075 -16.877 1.948   1.00 0.00 ? 2  ASP A OD2  1  
ATOM 30    H H    . ASP A 1 2  ? -30.565 -19.089 0.875   1.00 0.00 ? 2  ASP A H    1  
ATOM 31    H HA   . ASP A 1 2  ? -32.822 -18.933 -1.036  1.00 0.00 ? 2  ASP A HA   1  
ATOM 32    H HB2  . ASP A 1 2  ? -31.723 -16.858 0.862   1.00 0.00 ? 2  ASP A HB2  1  
ATOM 33    H HB3  . ASP A 1 2  ? -32.811 -16.465 -0.467  1.00 0.00 ? 2  ASP A HB3  1  
ATOM 34    N N    . ARG A 1 3  ? -31.557 -17.619 -2.798  1.00 0.00 ? 3  ARG A N    1  
ATOM 35    C CA   . ARG A 1 3  ? -30.739 -17.137 -3.910  1.00 0.00 ? 3  ARG A CA   1  
ATOM 36    C C    . ARG A 1 3  ? -29.676 -18.160 -4.302  1.00 0.00 ? 3  ARG A C    1  
ATOM 37    O O    . ARG A 1 3  ? -28.479 -17.877 -4.245  1.00 0.00 ? 3  ARG A O    1  
ATOM 38    C CB   . ARG A 1 3  ? -30.067 -15.813 -3.535  1.00 0.00 ? 3  ARG A CB   1  
ATOM 39    C CG   . ARG A 1 3  ? -31.133 -14.726 -3.383  1.00 0.00 ? 3  ARG A CG   1  
ATOM 40    C CD   . ARG A 1 3  ? -30.467 -13.408 -2.987  1.00 0.00 ? 3  ARG A CD   1  
ATOM 41    N NE   . ARG A 1 3  ? -31.469 -12.356 -2.857  1.00 0.00 ? 3  ARG A NE   1  
ATOM 42    C CZ   . ARG A 1 3  ? -32.185 -12.223 -1.745  1.00 0.00 ? 3  ARG A CZ   1  
ATOM 43    N NH1  . ARG A 1 3  ? -31.998 -13.042 -0.747  1.00 0.00 ? 3  ARG A NH1  1  
ATOM 44    N NH2  . ARG A 1 3  ? -33.076 -11.273 -1.652  1.00 0.00 ? 3  ARG A NH2  1  
ATOM 45    H H    . ARG A 1 3  ? -32.528 -17.681 -2.908  1.00 0.00 ? 3  ARG A H    1  
ATOM 46    H HA   . ARG A 1 3  ? -31.381 -16.965 -4.759  1.00 0.00 ? 3  ARG A HA   1  
ATOM 47    H HB2  . ARG A 1 3  ? -29.534 -15.927 -2.603  1.00 0.00 ? 3  ARG A HB2  1  
ATOM 48    H HB3  . ARG A 1 3  ? -29.375 -15.528 -4.313  1.00 0.00 ? 3  ARG A HB3  1  
ATOM 49    H HG2  . ARG A 1 3  ? -31.654 -14.600 -4.321  1.00 0.00 ? 3  ARG A HG2  1  
ATOM 50    H HG3  . ARG A 1 3  ? -31.837 -15.016 -2.617  1.00 0.00 ? 3  ARG A HG3  1  
ATOM 51    H HD2  . ARG A 1 3  ? -29.959 -13.532 -2.043  1.00 0.00 ? 3  ARG A HD2  1  
ATOM 52    H HD3  . ARG A 1 3  ? -29.749 -13.129 -3.745  1.00 0.00 ? 3  ARG A HD3  1  
ATOM 53    H HE   . ARG A 1 3  ? -31.617 -11.736 -3.602  1.00 0.00 ? 3  ARG A HE   1  
ATOM 54    H HH11 . ARG A 1 3  ? -31.316 -13.770 -0.818  1.00 0.00 ? 3  ARG A HH11 1  
ATOM 55    H HH12 . ARG A 1 3  ? -32.537 -12.942 0.090   1.00 0.00 ? 3  ARG A HH12 1  
ATOM 56    H HH21 . ARG A 1 3  ? -33.219 -10.645 -2.417  1.00 0.00 ? 3  ARG A HH21 1  
ATOM 57    H HH22 . ARG A 1 3  ? -33.614 -11.174 -0.816  1.00 0.00 ? 3  ARG A HH22 1  
ATOM 58    N N    . TRP A 1 4  ? -30.121 -19.345 -4.708  1.00 0.00 ? 4  TRP A N    1  
ATOM 59    C CA   . TRP A 1 4  ? -29.197 -20.400 -5.117  1.00 0.00 ? 4  TRP A CA   1  
ATOM 60    C C    . TRP A 1 4  ? -28.827 -20.246 -6.589  1.00 0.00 ? 4  TRP A C    1  
ATOM 61    O O    . TRP A 1 4  ? -27.990 -20.986 -7.108  1.00 0.00 ? 4  TRP A O    1  
ATOM 62    C CB   . TRP A 1 4  ? -29.830 -21.775 -4.899  1.00 0.00 ? 4  TRP A CB   1  
ATOM 63    C CG   . TRP A 1 4  ? -29.880 -22.085 -3.438  1.00 0.00 ? 4  TRP A CG   1  
ATOM 64    C CD1  . TRP A 1 4  ? -30.965 -21.936 -2.646  1.00 0.00 ? 4  TRP A CD1  1  
ATOM 65    C CD2  . TRP A 1 4  ? -28.817 -22.598 -2.585  1.00 0.00 ? 4  TRP A CD2  1  
ATOM 66    N NE1  . TRP A 1 4  ? -30.637 -22.326 -1.360  1.00 0.00 ? 4  TRP A NE1  1  
ATOM 67    C CE2  . TRP A 1 4  ? -29.323 -22.742 -1.272  1.00 0.00 ? 4  TRP A CE2  1  
ATOM 68    C CE3  . TRP A 1 4  ? -27.475 -22.949 -2.821  1.00 0.00 ? 4  TRP A CE3  1  
ATOM 69    C CZ2  . TRP A 1 4  ? -28.525 -23.218 -0.229  1.00 0.00 ? 4  TRP A CZ2  1  
ATOM 70    C CZ3  . TRP A 1 4  ? -26.670 -23.429 -1.775  1.00 0.00 ? 4  TRP A CZ3  1  
ATOM 71    C CH2  . TRP A 1 4  ? -27.194 -23.563 -0.482  1.00 0.00 ? 4  TRP A CH2  1  
ATOM 72    H H    . TRP A 1 4  ? -31.086 -19.512 -4.739  1.00 0.00 ? 4  TRP A H    1  
ATOM 73    H HA   . TRP A 1 4  ? -28.301 -20.330 -4.522  1.00 0.00 ? 4  TRP A HA   1  
ATOM 74    H HB2  . TRP A 1 4  ? -30.833 -21.777 -5.299  1.00 0.00 ? 4  TRP A HB2  1  
ATOM 75    H HB3  . TRP A 1 4  ? -29.241 -22.526 -5.405  1.00 0.00 ? 4  TRP A HB3  1  
ATOM 76    H HD1  . TRP A 1 4  ? -31.931 -21.572 -2.966  1.00 0.00 ? 4  TRP A HD1  1  
ATOM 77    H HE1  . TRP A 1 4  ? -31.246 -22.316 -0.594  1.00 0.00 ? 4  TRP A HE1  1  
ATOM 78    H HE3  . TRP A 1 4  ? -27.062 -22.850 -3.813  1.00 0.00 ? 4  TRP A HE3  1  
ATOM 79    H HZ2  . TRP A 1 4  ? -28.934 -23.321 0.765   1.00 0.00 ? 4  TRP A HZ2  1  
ATOM 80    H HZ3  . TRP A 1 4  ? -25.641 -23.696 -1.968  1.00 0.00 ? 4  TRP A HZ3  1  
ATOM 81    H HH2  . TRP A 1 4  ? -26.571 -23.932 0.319   1.00 0.00 ? 4  TRP A HH2  1  
ATOM 82    N N    . TYR A 1 5  ? -29.452 -19.283 -7.257  1.00 0.00 ? 5  TYR A N    1  
ATOM 83    C CA   . TYR A 1 5  ? -29.179 -19.042 -8.670  1.00 0.00 ? 5  TYR A CA   1  
ATOM 84    C C    . TYR A 1 5  ? -27.838 -18.336 -8.843  1.00 0.00 ? 5  TYR A C    1  
ATOM 85    O O    . TYR A 1 5  ? -27.527 -17.390 -8.119  1.00 0.00 ? 5  TYR A O    1  
ATOM 86    C CB   . TYR A 1 5  ? -30.291 -18.187 -9.278  1.00 0.00 ? 5  TYR A CB   1  
ATOM 87    C CG   . TYR A 1 5  ? -29.970 -17.903 -10.727 1.00 0.00 ? 5  TYR A CG   1  
ATOM 88    C CD1  . TYR A 1 5  ? -30.185 -18.888 -11.697 1.00 0.00 ? 5  TYR A CD1  1  
ATOM 89    C CD2  . TYR A 1 5  ? -29.458 -16.654 -11.098 1.00 0.00 ? 5  TYR A CD2  1  
ATOM 90    C CE1  . TYR A 1 5  ? -29.888 -18.625 -13.040 1.00 0.00 ? 5  TYR A CE1  1  
ATOM 91    C CE2  . TYR A 1 5  ? -29.161 -16.391 -12.441 1.00 0.00 ? 5  TYR A CE2  1  
ATOM 92    C CZ   . TYR A 1 5  ? -29.376 -17.376 -13.412 1.00 0.00 ? 5  TYR A CZ   1  
ATOM 93    O OH   . TYR A 1 5  ? -29.083 -17.117 -14.735 1.00 0.00 ? 5  TYR A OH   1  
ATOM 94    H H    . TYR A 1 5  ? -30.110 -18.721 -6.795  1.00 0.00 ? 5  TYR A H    1  
ATOM 95    H HA   . TYR A 1 5  ? -29.146 -19.990 -9.186  1.00 0.00 ? 5  TYR A HA   1  
ATOM 96    H HB2  . TYR A 1 5  ? -31.230 -18.718 -9.214  1.00 0.00 ? 5  TYR A HB2  1  
ATOM 97    H HB3  . TYR A 1 5  ? -30.365 -17.255 -8.738  1.00 0.00 ? 5  TYR A HB3  1  
ATOM 98    H HD1  . TYR A 1 5  ? -30.580 -19.851 -11.411 1.00 0.00 ? 5  TYR A HD1  1  
ATOM 99    H HD2  . TYR A 1 5  ? -29.293 -15.893 -10.349 1.00 0.00 ? 5  TYR A HD2  1  
ATOM 100   H HE1  . TYR A 1 5  ? -30.054 -19.385 -13.789 1.00 0.00 ? 5  TYR A HE1  1  
ATOM 101   H HE2  . TYR A 1 5  ? -28.766 -15.427 -12.727 1.00 0.00 ? 5  TYR A HE2  1  
ATOM 102   H HH   . TYR A 1 5  ? -28.144 -17.268 -14.866 1.00 0.00 ? 5  TYR A HH   1  
ATOM 103   N N    . LEU A 1 6  ? -27.050 -18.806 -9.807  1.00 0.00 ? 6  LEU A N    1  
ATOM 104   C CA   . LEU A 1 6  ? -25.740 -18.219 -10.075 1.00 0.00 ? 6  LEU A CA   1  
ATOM 105   C C    . LEU A 1 6  ? -25.697 -17.629 -11.481 1.00 0.00 ? 6  LEU A C    1  
ATOM 106   O O    . LEU A 1 6  ? -26.661 -17.738 -12.239 1.00 0.00 ? 6  LEU A O    1  
ATOM 107   C CB   . LEU A 1 6  ? -24.651 -19.286 -9.934  1.00 0.00 ? 6  LEU A CB   1  
ATOM 108   C CG   . LEU A 1 6  ? -24.848 -20.362 -11.002 1.00 0.00 ? 6  LEU A CG   1  
ATOM 109   C CD1  . LEU A 1 6  ? -23.804 -20.185 -12.106 1.00 0.00 ? 6  LEU A CD1  1  
ATOM 110   C CD2  . LEU A 1 6  ? -24.686 -21.745 -10.367 1.00 0.00 ? 6  LEU A CD2  1  
ATOM 111   H H    . LEU A 1 6  ? -27.355 -19.563 -10.350 1.00 0.00 ? 6  LEU A H    1  
ATOM 112   H HA   . LEU A 1 6  ? -25.551 -17.433 -9.360  1.00 0.00 ? 6  LEU A HA   1  
ATOM 113   H HB2  . LEU A 1 6  ? -23.681 -18.827 -10.059 1.00 0.00 ? 6  LEU A HB2  1  
ATOM 114   H HB3  . LEU A 1 6  ? -24.714 -19.737 -8.956  1.00 0.00 ? 6  LEU A HB3  1  
ATOM 115   H HG   . LEU A 1 6  ? -25.837 -20.272 -11.426 1.00 0.00 ? 6  LEU A HG   1  
ATOM 116   H HD11 . LEU A 1 6  ? -23.954 -20.935 -12.868 1.00 0.00 ? 6  LEU A HD11 1  
ATOM 117   H HD12 . LEU A 1 6  ? -22.814 -20.292 -11.686 1.00 0.00 ? 6  LEU A HD12 1  
ATOM 118   H HD13 . LEU A 1 6  ? -23.904 -19.202 -12.542 1.00 0.00 ? 6  LEU A HD13 1  
ATOM 119   H HD21 . LEU A 1 6  ? -24.637 -22.494 -11.143 1.00 0.00 ? 6  LEU A HD21 1  
ATOM 120   H HD22 . LEU A 1 6  ? -25.531 -21.947 -9.724  1.00 0.00 ? 6  LEU A HD22 1  
ATOM 121   H HD23 . LEU A 1 6  ? -23.777 -21.769 -9.784  1.00 0.00 ? 6  LEU A HD23 1  
ATOM 122   N N    . GLY A 1 7  ? -24.579 -16.996 -11.820 1.00 0.00 ? 7  GLY A N    1  
ATOM 123   C CA   . GLY A 1 7  ? -24.428 -16.384 -13.135 1.00 0.00 ? 7  GLY A CA   1  
ATOM 124   C C    . GLY A 1 7  ? -25.070 -15.002 -13.159 1.00 0.00 ? 7  GLY A C    1  
ATOM 125   O O    . GLY A 1 7  ? -25.100 -14.335 -14.194 1.00 0.00 ? 7  GLY A O    1  
ATOM 126   H H    . GLY A 1 7  ? -23.845 -16.935 -11.173 1.00 0.00 ? 7  GLY A H    1  
ATOM 127   H HA2  . GLY A 1 7  ? -23.377 -16.295 -13.368 1.00 0.00 ? 7  GLY A HA2  1  
ATOM 128   H HA3  . GLY A 1 7  ? -24.906 -17.009 -13.874 1.00 0.00 ? 7  GLY A HA3  1  
ATOM 129   N N    . GLY A 1 8  ? -25.582 -14.581 -12.008 1.00 0.00 ? 8  GLY A N    1  
ATOM 130   C CA   . GLY A 1 8  ? -26.223 -13.276 -11.893 1.00 0.00 ? 8  GLY A CA   1  
ATOM 131   C C    . GLY A 1 8  ? -25.269 -12.259 -11.277 1.00 0.00 ? 8  GLY A C    1  
ATOM 132   O O    . GLY A 1 8  ? -25.694 -11.343 -10.573 1.00 0.00 ? 8  GLY A O    1  
ATOM 133   H H    . GLY A 1 8  ? -25.527 -15.157 -11.218 1.00 0.00 ? 8  GLY A H    1  
ATOM 134   H HA2  . GLY A 1 8  ? -26.521 -12.938 -12.875 1.00 0.00 ? 8  GLY A HA2  1  
ATOM 135   H HA3  . GLY A 1 8  ? -27.098 -13.363 -11.266 1.00 0.00 ? 8  GLY A HA3  1  
ATOM 136   N N    . SER A 1 9  ? -23.977 -12.433 -11.545 1.00 0.00 ? 9  SER A N    1  
ATOM 137   C CA   . SER A 1 9  ? -22.960 -11.532 -11.010 1.00 0.00 ? 9  SER A CA   1  
ATOM 138   C C    . SER A 1 9  ? -22.167 -10.878 -12.147 1.00 0.00 ? 9  SER A C    1  
ATOM 139   O O    . SER A 1 9  ? -21.133 -11.400 -12.565 1.00 0.00 ? 9  SER A O    1  
ATOM 140   C CB   . SER A 1 9  ? -21.999 -12.319 -10.119 1.00 0.00 ? 9  SER A CB   1  
ATOM 141   O OG   . SER A 1 9  ? -21.065 -11.424 -9.531  1.00 0.00 ? 9  SER A OG   1  
ATOM 142   H H    . SER A 1 9  ? -23.701 -13.183 -12.112 1.00 0.00 ? 9  SER A H    1  
ATOM 143   H HA   . SER A 1 9  ? -23.434 -10.771 -10.413 1.00 0.00 ? 9  SER A HA   1  
ATOM 144   H HB2  . SER A 1 9  ? -22.554 -12.816 -9.340  1.00 0.00 ? 9  SER A HB2  1  
ATOM 145   H HB3  . SER A 1 9  ? -21.480 -13.059 -10.715 1.00 0.00 ? 9  SER A HB3  1  
ATOM 146   H HG   . SER A 1 9  ? -21.040 -11.599 -8.586  1.00 0.00 ? 9  SER A HG   1  
ATOM 147   N N    . PRO A 1 10 ? -22.622 -9.754  -12.648 1.00 0.00 ? 10 PRO A N    1  
ATOM 148   C CA   . PRO A 1 10 ? -21.928 -9.025  -13.754 1.00 0.00 ? 10 PRO A CA   1  
ATOM 149   C C    . PRO A 1 10 ? -20.498 -8.644  -13.381 1.00 0.00 ? 10 PRO A C    1  
ATOM 150   O O    . PRO A 1 10 ? -19.986 -9.059  -12.341 1.00 0.00 ? 10 PRO A O    1  
ATOM 151   C CB   . PRO A 1 10 ? -22.782 -7.770  -13.975 1.00 0.00 ? 10 PRO A CB   1  
ATOM 152   C CG   . PRO A 1 10 ? -24.110 -8.074  -13.366 1.00 0.00 ? 10 PRO A CG   1  
ATOM 153   C CD   . PRO A 1 10 ? -23.848 -9.054  -12.229 1.00 0.00 ? 10 PRO A CD   1  
ATOM 154   H HA   . PRO A 1 10 ? -21.931 -9.622  -14.651 1.00 0.00 ? 10 PRO A HA   1  
ATOM 155   H HB2  . PRO A 1 10 ? -22.328 -6.921  -13.482 1.00 0.00 ? 10 PRO A HB2  1  
ATOM 156   H HB3  . PRO A 1 10 ? -22.895 -7.575  -15.029 1.00 0.00 ? 10 PRO A HB3  1  
ATOM 157   H HG2  . PRO A 1 10 ? -24.558 -7.167  -12.985 1.00 0.00 ? 10 PRO A HG2  1  
ATOM 158   H HG3  . PRO A 1 10 ? -24.758 -8.531  -14.098 1.00 0.00 ? 10 PRO A HG3  1  
ATOM 159   H HD2  . PRO A 1 10 ? -23.688 -8.524  -11.300 1.00 0.00 ? 10 PRO A HD2  1  
ATOM 160   H HD3  . PRO A 1 10 ? -24.663 -9.754  -12.134 1.00 0.00 ? 10 PRO A HD3  1  
ATOM 161   N N    . LYS A 1 11 ? -19.859 -7.856  -14.239 1.00 0.00 ? 11 LYS A N    1  
ATOM 162   C CA   . LYS A 1 11 ? -18.487 -7.427  -13.992 1.00 0.00 ? 11 LYS A CA   1  
ATOM 163   C C    . LYS A 1 11 ? -18.444 -6.414  -12.854 1.00 0.00 ? 11 LYS A C    1  
ATOM 164   O O    . LYS A 1 11 ? -17.395 -6.189  -12.251 1.00 0.00 ? 11 LYS A O    1  
ATOM 165   C CB   . LYS A 1 11 ? -17.893 -6.800  -15.258 1.00 0.00 ? 11 LYS A CB   1  
ATOM 166   C CG   . LYS A 1 11 ? -17.399 -7.894  -16.213 1.00 0.00 ? 11 LYS A CG   1  
ATOM 167   C CD   . LYS A 1 11 ? -18.577 -8.744  -16.694 1.00 0.00 ? 11 LYS A CD   1  
ATOM 168   C CE   . LYS A 1 11 ? -18.107 -9.678  -17.811 1.00 0.00 ? 11 LYS A CE   1  
ATOM 169   N NZ   . LYS A 1 11 ? -19.252 -10.512 -18.277 1.00 0.00 ? 11 LYS A NZ   1  
ATOM 170   H H    . LYS A 1 11 ? -20.318 -7.556  -15.051 1.00 0.00 ? 11 LYS A H    1  
ATOM 171   H HA   . LYS A 1 11 ? -17.896 -8.287  -13.717 1.00 0.00 ? 11 LYS A HA   1  
ATOM 172   H HB2  . LYS A 1 11 ? -18.649 -6.208  -15.752 1.00 0.00 ? 11 LYS A HB2  1  
ATOM 173   H HB3  . LYS A 1 11 ? -17.063 -6.164  -14.986 1.00 0.00 ? 11 LYS A HB3  1  
ATOM 174   H HG2  . LYS A 1 11 ? -16.917 -7.435  -17.064 1.00 0.00 ? 11 LYS A HG2  1  
ATOM 175   H HG3  . LYS A 1 11 ? -16.688 -8.526  -15.700 1.00 0.00 ? 11 LYS A HG3  1  
ATOM 176   H HD2  . LYS A 1 11 ? -18.958 -9.332  -15.874 1.00 0.00 ? 11 LYS A HD2  1  
ATOM 177   H HD3  . LYS A 1 11 ? -19.357 -8.099  -17.071 1.00 0.00 ? 11 LYS A HD3  1  
ATOM 178   H HE2  . LYS A 1 11 ? -17.729 -9.092  -18.636 1.00 0.00 ? 11 LYS A HE2  1  
ATOM 179   H HE3  . LYS A 1 11 ? -17.323 -10.320 -17.437 1.00 0.00 ? 11 LYS A HE3  1  
ATOM 180   H HZ1  . LYS A 1 11 ? -20.104 -9.920  -18.351 1.00 0.00 ? 11 LYS A HZ1  1  
ATOM 181   H HZ2  . LYS A 1 11 ? -19.420 -11.280 -17.596 1.00 0.00 ? 11 LYS A HZ2  1  
ATOM 182   H HZ3  . LYS A 1 11 ? -19.030 -10.916 -19.209 1.00 0.00 ? 11 LYS A HZ3  1  
ATOM 183   N N    . GLY A 1 12 ? -19.591 -5.812  -12.560 1.00 0.00 ? 12 GLY A N    1  
ATOM 184   C CA   . GLY A 1 12 ? -19.673 -4.831  -11.483 1.00 0.00 ? 12 GLY A CA   1  
ATOM 185   C C    . GLY A 1 12 ? -19.251 -3.445  -11.958 1.00 0.00 ? 12 GLY A C    1  
ATOM 186   O O    . GLY A 1 12 ? -19.220 -2.497  -11.174 1.00 0.00 ? 12 GLY A O    1  
ATOM 187   H H    . GLY A 1 12 ? -20.399 -6.033  -13.069 1.00 0.00 ? 12 GLY A H    1  
ATOM 188   H HA2  . GLY A 1 12 ? -20.690 -4.787  -11.124 1.00 0.00 ? 12 GLY A HA2  1  
ATOM 189   H HA3  . GLY A 1 12 ? -19.026 -5.138  -10.676 1.00 0.00 ? 12 GLY A HA3  1  
ATOM 190   N N    . ASP A 1 13 ? -18.931 -3.326  -13.243 1.00 0.00 ? 13 ASP A N    1  
ATOM 191   C CA   . ASP A 1 13 ? -18.520 -2.039  -13.791 1.00 0.00 ? 13 ASP A CA   1  
ATOM 192   C C    . ASP A 1 13 ? -19.743 -1.227  -14.208 1.00 0.00 ? 13 ASP A C    1  
ATOM 193   O O    . ASP A 1 13 ? -20.121 -0.270  -13.532 1.00 0.00 ? 13 ASP A O    1  
ATOM 194   C CB   . ASP A 1 13 ? -17.608 -2.251  -15.000 1.00 0.00 ? 13 ASP A CB   1  
ATOM 195   C CG   . ASP A 1 13 ? -16.250 -2.771  -14.544 1.00 0.00 ? 13 ASP A CG   1  
ATOM 196   O OD1  . ASP A 1 13 ? -15.983 -2.713  -13.355 1.00 0.00 ? 13 ASP A OD1  1  
ATOM 197   O OD2  . ASP A 1 13 ? -15.495 -3.222  -15.391 1.00 0.00 ? 13 ASP A OD2  1  
ATOM 198   H H    . ASP A 1 13 ? -18.975 -4.110  -13.829 1.00 0.00 ? 13 ASP A H    1  
ATOM 199   H HA   . ASP A 1 13 ? -17.977 -1.493  -13.034 1.00 0.00 ? 13 ASP A HA   1  
ATOM 200   H HB2  . ASP A 1 13 ? -18.061 -2.968  -15.669 1.00 0.00 ? 13 ASP A HB2  1  
ATOM 201   H HB3  . ASP A 1 13 ? -17.475 -1.312  -15.517 1.00 0.00 ? 13 ASP A HB3  1  
ATOM 202   N N    . VAL A 1 14 ? -20.359 -1.619  -15.321 1.00 0.00 ? 14 VAL A N    1  
ATOM 203   C CA   . VAL A 1 14 ? -21.544 -0.926  -15.818 1.00 0.00 ? 14 VAL A CA   1  
ATOM 204   C C    . VAL A 1 14 ? -22.671 -1.927  -16.066 1.00 0.00 ? 14 VAL A C    1  
ATOM 205   O O    . VAL A 1 14 ? -22.485 -2.920  -16.771 1.00 0.00 ? 14 VAL A O    1  
ATOM 206   C CB   . VAL A 1 14 ? -21.202 -0.186  -17.116 1.00 0.00 ? 14 VAL A CB   1  
ATOM 207   C CG1  . VAL A 1 14 ? -22.434 0.559   -17.639 1.00 0.00 ? 14 VAL A CG1  1  
ATOM 208   C CG2  . VAL A 1 14 ? -20.081 0.819   -16.847 1.00 0.00 ? 14 VAL A CG2  1  
ATOM 209   H H    . VAL A 1 14 ? -20.013 -2.389  -15.819 1.00 0.00 ? 14 VAL A H    1  
ATOM 210   H HA   . VAL A 1 14 ? -21.870 -0.208  -15.080 1.00 0.00 ? 14 VAL A HA   1  
ATOM 211   H HB   . VAL A 1 14 ? -20.874 -0.900  -17.858 1.00 0.00 ? 14 VAL A HB   1  
ATOM 212   H HG11 . VAL A 1 14 ? -23.254 0.437   -16.947 1.00 0.00 ? 14 VAL A HG11 1  
ATOM 213   H HG12 . VAL A 1 14 ? -22.714 0.161   -18.602 1.00 0.00 ? 14 VAL A HG12 1  
ATOM 214   H HG13 . VAL A 1 14 ? -22.201 1.608   -17.739 1.00 0.00 ? 14 VAL A HG13 1  
ATOM 215   H HG21 . VAL A 1 14 ? -20.342 1.774   -17.279 1.00 0.00 ? 14 VAL A HG21 1  
ATOM 216   H HG22 . VAL A 1 14 ? -19.163 0.462   -17.292 1.00 0.00 ? 14 VAL A HG22 1  
ATOM 217   H HG23 . VAL A 1 14 ? -19.944 0.931   -15.781 1.00 0.00 ? 14 VAL A HG23 1  
ATOM 218   N N    . ASP A 1 15 ? -23.832 -1.668  -15.467 1.00 0.00 ? 15 ASP A N    1  
ATOM 219   C CA   . ASP A 1 15 ? -24.981 -2.560  -15.611 1.00 0.00 ? 15 ASP A CA   1  
ATOM 220   C C    . ASP A 1 15 ? -26.210 -1.787  -16.092 1.00 0.00 ? 15 ASP A C    1  
ATOM 221   O O    . ASP A 1 15 ? -27.098 -1.464  -15.303 1.00 0.00 ? 15 ASP A O    1  
ATOM 222   C CB   . ASP A 1 15 ? -25.288 -3.215  -14.261 1.00 0.00 ? 15 ASP A CB   1  
ATOM 223   C CG   . ASP A 1 15 ? -24.085 -4.024  -13.789 1.00 0.00 ? 15 ASP A CG   1  
ATOM 224   O OD1  . ASP A 1 15 ? -23.190 -4.240  -14.590 1.00 0.00 ? 15 ASP A OD1  1  
ATOM 225   O OD2  . ASP A 1 15 ? -24.076 -4.416  -12.633 1.00 0.00 ? 15 ASP A OD2  1  
ATOM 226   H H    . ASP A 1 15 ? -23.913 -0.875  -14.898 1.00 0.00 ? 15 ASP A H    1  
ATOM 227   H HA   . ASP A 1 15 ? -24.746 -3.334  -16.325 1.00 0.00 ? 15 ASP A HA   1  
ATOM 228   H HB2  . ASP A 1 15 ? -25.511 -2.448  -13.534 1.00 0.00 ? 15 ASP A HB2  1  
ATOM 229   H HB3  . ASP A 1 15 ? -26.140 -3.869  -14.363 1.00 0.00 ? 15 ASP A HB3  1  
ATOM 230   N N    . PRO A 1 16 ? -26.268 -1.479  -17.363 1.00 0.00 ? 16 PRO A N    1  
ATOM 231   C CA   . PRO A 1 16 ? -27.400 -0.720  -17.963 1.00 0.00 ? 16 PRO A CA   1  
ATOM 232   C C    . PRO A 1 16 ? -28.582 -1.617  -18.327 1.00 0.00 ? 16 PRO A C    1  
ATOM 233   O O    . PRO A 1 16 ? -29.294 -1.358  -19.297 1.00 0.00 ? 16 PRO A O    1  
ATOM 234   C CB   . PRO A 1 16 ? -26.770 -0.106  -19.210 1.00 0.00 ? 16 PRO A CB   1  
ATOM 235   C CG   . PRO A 1 16 ? -25.723 -1.082  -19.638 1.00 0.00 ? 16 PRO A CG   1  
ATOM 236   C CD   . PRO A 1 16 ? -25.258 -1.823  -18.378 1.00 0.00 ? 16 PRO A CD   1  
ATOM 237   H HA   . PRO A 1 16 ? -27.718 0.066   -17.298 1.00 0.00 ? 16 PRO A HA   1  
ATOM 238   H HB2  . PRO A 1 16 ? -27.514 0.016   -19.985 1.00 0.00 ? 16 PRO A HB2  1  
ATOM 239   H HB3  . PRO A 1 16 ? -26.315 0.844   -18.973 1.00 0.00 ? 16 PRO A HB3  1  
ATOM 240   H HG2  . PRO A 1 16 ? -26.141 -1.782  -20.349 1.00 0.00 ? 16 PRO A HG2  1  
ATOM 241   H HG3  . PRO A 1 16 ? -24.888 -0.560  -20.079 1.00 0.00 ? 16 PRO A HG3  1  
ATOM 242   H HD2  . PRO A 1 16 ? -25.242 -2.889  -18.555 1.00 0.00 ? 16 PRO A HD2  1  
ATOM 243   H HD3  . PRO A 1 16 ? -24.285 -1.475  -18.068 1.00 0.00 ? 16 PRO A HD3  1  
ATOM 244   N N    . PHE A 1 17 ? -28.779 -2.677  -17.551 1.00 0.00 ? 17 PHE A N    1  
ATOM 245   C CA   . PHE A 1 17 ? -29.869 -3.612  -17.808 1.00 0.00 ? 17 PHE A CA   1  
ATOM 246   C C    . PHE A 1 17 ? -31.222 -2.911  -17.743 1.00 0.00 ? 17 PHE A C    1  
ATOM 247   O O    . PHE A 1 17 ? -32.259 -3.526  -17.994 1.00 0.00 ? 17 PHE A O    1  
ATOM 248   C CB   . PHE A 1 17 ? -29.831 -4.756  -16.794 1.00 0.00 ? 17 PHE A CB   1  
ATOM 249   C CG   . PHE A 1 17 ? -28.753 -5.738  -17.186 1.00 0.00 ? 17 PHE A CG   1  
ATOM 250   C CD1  . PHE A 1 17 ? -27.418 -5.479  -16.861 1.00 0.00 ? 17 PHE A CD1  1  
ATOM 251   C CD2  . PHE A 1 17 ? -29.092 -6.911  -17.872 1.00 0.00 ? 17 PHE A CD2  1  
ATOM 252   C CE1  . PHE A 1 17 ? -26.419 -6.391  -17.221 1.00 0.00 ? 17 PHE A CE1  1  
ATOM 253   C CE2  . PHE A 1 17 ? -28.094 -7.822  -18.234 1.00 0.00 ? 17 PHE A CE2  1  
ATOM 254   C CZ   . PHE A 1 17 ? -26.757 -7.563  -17.909 1.00 0.00 ? 17 PHE A CZ   1  
ATOM 255   H H    . PHE A 1 17 ? -28.169 -2.846  -16.802 1.00 0.00 ? 17 PHE A H    1  
ATOM 256   H HA   . PHE A 1 17 ? -29.743 -4.026  -18.797 1.00 0.00 ? 17 PHE A HA   1  
ATOM 257   H HB2  . PHE A 1 17 ? -29.618 -4.359  -15.812 1.00 0.00 ? 17 PHE A HB2  1  
ATOM 258   H HB3  . PHE A 1 17 ? -30.787 -5.258  -16.780 1.00 0.00 ? 17 PHE A HB3  1  
ATOM 259   H HD1  . PHE A 1 17 ? -27.158 -4.574  -16.333 1.00 0.00 ? 17 PHE A HD1  1  
ATOM 260   H HD2  . PHE A 1 17 ? -30.123 -7.111  -18.122 1.00 0.00 ? 17 PHE A HD2  1  
ATOM 261   H HE1  . PHE A 1 17 ? -25.388 -6.190  -16.970 1.00 0.00 ? 17 PHE A HE1  1  
ATOM 262   H HE2  . PHE A 1 17 ? -28.354 -8.727  -18.764 1.00 0.00 ? 17 PHE A HE2  1  
ATOM 263   H HZ   . PHE A 1 17 ? -25.986 -8.267  -18.187 1.00 0.00 ? 17 PHE A HZ   1  
ATOM 264   N N    . TYR A 1 18 ? -31.212 -1.624  -17.409 1.00 0.00 ? 18 TYR A N    1  
ATOM 265   C CA   . TYR A 1 18 ? -32.455 -0.866  -17.324 1.00 0.00 ? 18 TYR A CA   1  
ATOM 266   C C    . TYR A 1 18 ? -33.156 -0.866  -18.679 1.00 0.00 ? 18 TYR A C    1  
ATOM 267   O O    . TYR A 1 18 ? -34.379 -0.966  -18.758 1.00 0.00 ? 18 TYR A O    1  
ATOM 268   C CB   . TYR A 1 18 ? -32.162 0.573   -16.895 1.00 0.00 ? 18 TYR A CB   1  
ATOM 269   C CG   . TYR A 1 18 ? -31.730 0.588   -15.448 1.00 0.00 ? 18 TYR A CG   1  
ATOM 270   C CD1  . TYR A 1 18 ? -32.686 0.716   -14.433 1.00 0.00 ? 18 TYR A CD1  1  
ATOM 271   C CD2  . TYR A 1 18 ? -30.374 0.473   -15.122 1.00 0.00 ? 18 TYR A CD2  1  
ATOM 272   C CE1  . TYR A 1 18 ? -32.285 0.731   -13.091 1.00 0.00 ? 18 TYR A CE1  1  
ATOM 273   C CE2  . TYR A 1 18 ? -29.972 0.487   -13.780 1.00 0.00 ? 18 TYR A CE2  1  
ATOM 274   C CZ   . TYR A 1 18 ? -30.928 0.616   -12.765 1.00 0.00 ? 18 TYR A CZ   1  
ATOM 275   O OH   . TYR A 1 18 ? -30.533 0.630   -11.443 1.00 0.00 ? 18 TYR A OH   1  
ATOM 276   H H    . TYR A 1 18 ? -30.362 -1.176  -17.215 1.00 0.00 ? 18 TYR A H    1  
ATOM 277   H HA   . TYR A 1 18 ? -33.100 -1.327  -16.592 1.00 0.00 ? 18 TYR A HA   1  
ATOM 278   H HB2  . TYR A 1 18 ? -31.374 0.980   -17.511 1.00 0.00 ? 18 TYR A HB2  1  
ATOM 279   H HB3  . TYR A 1 18 ? -33.054 1.171   -17.009 1.00 0.00 ? 18 TYR A HB3  1  
ATOM 280   H HD1  . TYR A 1 18 ? -33.733 0.805   -14.685 1.00 0.00 ? 18 TYR A HD1  1  
ATOM 281   H HD2  . TYR A 1 18 ? -29.637 0.374   -15.904 1.00 0.00 ? 18 TYR A HD2  1  
ATOM 282   H HE1  . TYR A 1 18 ? -33.022 0.830   -12.309 1.00 0.00 ? 18 TYR A HE1  1  
ATOM 283   H HE2  . TYR A 1 18 ? -28.926 0.399   -13.529 1.00 0.00 ? 18 TYR A HE2  1  
ATOM 284   H HH   . TYR A 1 18 ? -30.071 1.455   -11.280 1.00 0.00 ? 18 TYR A HH   1  
ATOM 285   N N    . TYR A 1 19 ? -32.371 -0.774  -19.745 1.00 0.00 ? 19 TYR A N    1  
ATOM 286   C CA   . TYR A 1 19 ? -32.932 -0.788  -21.090 1.00 0.00 ? 19 TYR A CA   1  
ATOM 287   C C    . TYR A 1 19 ? -33.681 -2.099  -21.322 1.00 0.00 ? 19 TYR A C    1  
ATOM 288   O O    . TYR A 1 19 ? -34.817 -2.106  -21.797 1.00 0.00 ? 19 TYR A O    1  
ATOM 289   C CB   . TYR A 1 19 ? -31.815 -0.642  -22.126 1.00 0.00 ? 19 TYR A CB   1  
ATOM 290   C CG   . TYR A 1 19 ? -32.397 -0.745  -23.515 1.00 0.00 ? 19 TYR A CG   1  
ATOM 291   C CD1  . TYR A 1 19 ? -33.070 0.348   -24.074 1.00 0.00 ? 19 TYR A CD1  1  
ATOM 292   C CD2  . TYR A 1 19 ? -32.262 -1.932  -24.243 1.00 0.00 ? 19 TYR A CD2  1  
ATOM 293   C CE1  . TYR A 1 19 ? -33.608 0.253   -25.363 1.00 0.00 ? 19 TYR A CE1  1  
ATOM 294   C CE2  . TYR A 1 19 ? -32.800 -2.027  -25.532 1.00 0.00 ? 19 TYR A CE2  1  
ATOM 295   C CZ   . TYR A 1 19 ? -33.473 -0.935  -26.092 1.00 0.00 ? 19 TYR A CZ   1  
ATOM 296   O OH   . TYR A 1 19 ? -34.003 -1.028  -27.363 1.00 0.00 ? 19 TYR A OH   1  
ATOM 297   H H    . TYR A 1 19 ? -31.401 -0.713  -19.626 1.00 0.00 ? 19 TYR A H    1  
ATOM 298   H HA   . TYR A 1 19 ? -33.621 0.037   -21.195 1.00 0.00 ? 19 TYR A HA   1  
ATOM 299   H HB2  . TYR A 1 19 ? -31.338 0.320   -22.005 1.00 0.00 ? 19 TYR A HB2  1  
ATOM 300   H HB3  . TYR A 1 19 ? -31.087 -1.426  -21.982 1.00 0.00 ? 19 TYR A HB3  1  
ATOM 301   H HD1  . TYR A 1 19 ? -33.174 1.264   -23.511 1.00 0.00 ? 19 TYR A HD1  1  
ATOM 302   H HD2  . TYR A 1 19 ? -31.742 -2.774  -23.812 1.00 0.00 ? 19 TYR A HD2  1  
ATOM 303   H HE1  . TYR A 1 19 ? -34.127 1.096   -25.794 1.00 0.00 ? 19 TYR A HE1  1  
ATOM 304   H HE2  . TYR A 1 19 ? -32.696 -2.943  -26.095 1.00 0.00 ? 19 TYR A HE2  1  
ATOM 305   H HH   . TYR A 1 19 ? -33.283 -0.950  -27.992 1.00 0.00 ? 19 TYR A HH   1  
ATOM 306   N N    . ASP A 1 20 ? -33.029 -3.206  -20.973 1.00 0.00 ? 20 ASP A N    1  
ATOM 307   C CA   . ASP A 1 20 ? -33.629 -4.527  -21.134 1.00 0.00 ? 20 ASP A CA   1  
ATOM 308   C C    . ASP A 1 20 ? -34.664 -4.788  -20.041 1.00 0.00 ? 20 ASP A C    1  
ATOM 309   O O    . ASP A 1 20 ? -35.505 -5.677  -20.168 1.00 0.00 ? 20 ASP A O    1  
ATOM 310   C CB   . ASP A 1 20 ? -32.543 -5.603  -21.076 1.00 0.00 ? 20 ASP A CB   1  
ATOM 311   C CG   . ASP A 1 20 ? -31.561 -5.416  -22.228 1.00 0.00 ? 20 ASP A CG   1  
ATOM 312   O OD1  . ASP A 1 20 ? -31.809 -5.967  -23.287 1.00 0.00 ? 20 ASP A OD1  1  
ATOM 313   O OD2  . ASP A 1 20 ? -30.576 -4.724  -22.033 1.00 0.00 ? 20 ASP A OD2  1  
ATOM 314   H H    . ASP A 1 20 ? -32.129 -3.124  -20.595 1.00 0.00 ? 20 ASP A H    1  
ATOM 315   H HA   . ASP A 1 20 ? -34.116 -4.575  -22.096 1.00 0.00 ? 20 ASP A HA   1  
ATOM 316   H HB2  . ASP A 1 20 ? -32.013 -5.528  -20.138 1.00 0.00 ? 20 ASP A HB2  1  
ATOM 317   H HB3  . ASP A 1 20 ? -33.000 -6.579  -21.152 1.00 0.00 ? 20 ASP A HB3  1  
ATOM 318   N N    . TYR A 1 21 ? -34.589 -4.012  -18.965 1.00 0.00 ? 21 TYR A N    1  
ATOM 319   C CA   . TYR A 1 21 ? -35.517 -4.171  -17.850 1.00 0.00 ? 21 TYR A CA   1  
ATOM 320   C C    . TYR A 1 21 ? -36.946 -3.867  -18.294 1.00 0.00 ? 21 TYR A C    1  
ATOM 321   O O    . TYR A 1 21 ? -37.891 -4.517  -17.856 1.00 0.00 ? 21 TYR A O    1  
ATOM 322   C CB   . TYR A 1 21 ? -35.128 -3.250  -16.692 1.00 0.00 ? 21 TYR A CB   1  
ATOM 323   C CG   . TYR A 1 21 ? -36.026 -3.520  -15.509 1.00 0.00 ? 21 TYR A CG   1  
ATOM 324   C CD1  . TYR A 1 21 ? -35.781 -4.623  -14.683 1.00 0.00 ? 21 TYR A CD1  1  
ATOM 325   C CD2  . TYR A 1 21 ? -37.102 -2.667  -15.237 1.00 0.00 ? 21 TYR A CD2  1  
ATOM 326   C CE1  . TYR A 1 21 ? -36.612 -4.874  -13.584 1.00 0.00 ? 21 TYR A CE1  1  
ATOM 327   C CE2  . TYR A 1 21 ? -37.934 -2.917  -14.140 1.00 0.00 ? 21 TYR A CE2  1  
ATOM 328   C CZ   . TYR A 1 21 ? -37.689 -4.020  -13.312 1.00 0.00 ? 21 TYR A CZ   1  
ATOM 329   O OH   . TYR A 1 21 ? -38.508 -4.268  -12.230 1.00 0.00 ? 21 TYR A OH   1  
ATOM 330   H H    . TYR A 1 21 ? -33.887 -3.330  -18.917 1.00 0.00 ? 21 TYR A H    1  
ATOM 331   H HA   . TYR A 1 21 ? -35.473 -5.195  -17.507 1.00 0.00 ? 21 TYR A HA   1  
ATOM 332   H HB2  . TYR A 1 21 ? -34.101 -3.435  -16.415 1.00 0.00 ? 21 TYR A HB2  1  
ATOM 333   H HB3  . TYR A 1 21 ? -35.240 -2.222  -16.997 1.00 0.00 ? 21 TYR A HB3  1  
ATOM 334   H HD1  . TYR A 1 21 ? -34.951 -5.281  -14.892 1.00 0.00 ? 21 TYR A HD1  1  
ATOM 335   H HD2  . TYR A 1 21 ? -37.292 -1.817  -15.875 1.00 0.00 ? 21 TYR A HD2  1  
ATOM 336   H HE1  . TYR A 1 21 ? -36.424 -5.725  -12.947 1.00 0.00 ? 21 TYR A HE1  1  
ATOM 337   H HE2  . TYR A 1 21 ? -38.764 -2.260  -13.930 1.00 0.00 ? 21 TYR A HE2  1  
ATOM 338   H HH   . TYR A 1 21 ? -39.396 -3.985  -12.459 1.00 0.00 ? 21 TYR A HH   1  
ATOM 339   N N    . GLU A 1 22 ? -37.101 -2.861  -19.142 1.00 0.00 ? 22 GLU A N    1  
ATOM 340   C CA   . GLU A 1 22 ? -38.426 -2.468  -19.611 1.00 0.00 ? 22 GLU A CA   1  
ATOM 341   C C    . GLU A 1 22 ? -39.140 -3.638  -20.288 1.00 0.00 ? 22 GLU A C    1  
ATOM 342   O O    . GLU A 1 22 ? -40.353 -3.792  -20.150 1.00 0.00 ? 22 GLU A O    1  
ATOM 343   C CB   . GLU A 1 22 ? -38.304 -1.308  -20.600 1.00 0.00 ? 22 GLU A CB   1  
ATOM 344   C CG   . GLU A 1 22 ? -37.880 -0.042  -19.854 1.00 0.00 ? 22 GLU A CG   1  
ATOM 345   C CD   . GLU A 1 22 ? -37.566 1.069   -20.851 1.00 0.00 ? 22 GLU A CD   1  
ATOM 346   O OE1  . GLU A 1 22 ? -37.438 0.764   -22.026 1.00 0.00 ? 22 GLU A OE1  1  
ATOM 347   O OE2  . GLU A 1 22 ? -37.458 2.207   -20.426 1.00 0.00 ? 22 GLU A OE2  1  
ATOM 348   H H    . GLU A 1 22 ? -36.317 -2.352  -19.435 1.00 0.00 ? 22 GLU A H    1  
ATOM 349   H HA   . GLU A 1 22 ? -39.013 -2.142  -18.765 1.00 0.00 ? 22 GLU A HA   1  
ATOM 350   H HB2  . GLU A 1 22 ? -37.563 -1.551  -21.349 1.00 0.00 ? 22 GLU A HB2  1  
ATOM 351   H HB3  . GLU A 1 22 ? -39.257 -1.140  -21.078 1.00 0.00 ? 22 GLU A HB3  1  
ATOM 352   H HG2  . GLU A 1 22 ? -38.681 0.277   -19.203 1.00 0.00 ? 22 GLU A HG2  1  
ATOM 353   H HG3  . GLU A 1 22 ? -37.001 -0.251  -19.264 1.00 0.00 ? 22 GLU A HG3  1  
ATOM 354   N N    . THR A 1 23 ? -38.392 -4.460  -21.017 1.00 0.00 ? 23 THR A N    1  
ATOM 355   C CA   . THR A 1 23 ? -38.991 -5.604  -21.701 1.00 0.00 ? 23 THR A CA   1  
ATOM 356   C C    . THR A 1 23 ? -39.551 -6.603  -20.687 1.00 0.00 ? 23 THR A C    1  
ATOM 357   O O    . THR A 1 23 ? -40.456 -7.371  -20.997 1.00 0.00 ? 23 THR A O    1  
ATOM 358   C CB   . THR A 1 23 ? -37.946 -6.298  -22.578 1.00 0.00 ? 23 THR A CB   1  
ATOM 359   O OG1  . THR A 1 23 ? -36.874 -6.755  -21.764 1.00 0.00 ? 23 THR A OG1  1  
ATOM 360   C CG2  . THR A 1 23 ? -37.413 -5.311  -23.618 1.00 0.00 ? 23 THR A CG2  1  
ATOM 361   H H    . THR A 1 23 ? -37.429 -4.295  -21.098 1.00 0.00 ? 23 THR A H    1  
ATOM 362   H HA   . THR A 1 23 ? -39.796 -5.254  -22.329 1.00 0.00 ? 23 THR A HA   1  
ATOM 363   H HB   . THR A 1 23 ? -38.398 -7.137  -23.083 1.00 0.00 ? 23 THR A HB   1  
ATOM 364   H HG1  . THR A 1 23 ? -36.059 -6.389  -22.115 1.00 0.00 ? 23 THR A HG1  1  
ATOM 365   H HG21 . THR A 1 23 ? -38.015 -4.414  -23.604 1.00 0.00 ? 23 THR A HG21 1  
ATOM 366   H HG22 . THR A 1 23 ? -37.461 -5.761  -24.599 1.00 0.00 ? 23 THR A HG22 1  
ATOM 367   H HG23 . THR A 1 23 ? -36.389 -5.060  -23.386 1.00 0.00 ? 23 THR A HG23 1  
ATOM 368   N N    . VAL A 1 24 ? -38.993 -6.591  -19.481 1.00 0.00 ? 24 VAL A N    1  
ATOM 369   C CA   . VAL A 1 24 ? -39.420 -7.507  -18.423 1.00 0.00 ? 24 VAL A CA   1  
ATOM 370   C C    . VAL A 1 24 ? -40.942 -7.593  -18.336 1.00 0.00 ? 24 VAL A C    1  
ATOM 371   O O    . VAL A 1 24 ? -41.483 -8.582  -17.850 1.00 0.00 ? 24 VAL A O    1  
ATOM 372   C CB   . VAL A 1 24 ? -38.863 -7.056  -17.070 1.00 0.00 ? 24 VAL A CB   1  
ATOM 373   C CG1  . VAL A 1 24 ? -39.682 -5.874  -16.549 1.00 0.00 ? 24 VAL A CG1  1  
ATOM 374   C CG2  . VAL A 1 24 ? -38.947 -8.211  -16.070 1.00 0.00 ? 24 VAL A CG2  1  
ATOM 375   H H    . VAL A 1 24 ? -38.254 -5.973  -19.302 1.00 0.00 ? 24 VAL A H    1  
ATOM 376   H HA   . VAL A 1 24 ? -39.030 -8.490  -18.643 1.00 0.00 ? 24 VAL A HA   1  
ATOM 377   H HB   . VAL A 1 24 ? -37.832 -6.757  -17.188 1.00 0.00 ? 24 VAL A HB   1  
ATOM 378   H HG11 . VAL A 1 24 ? -40.064 -5.303  -17.382 1.00 0.00 ? 24 VAL A HG11 1  
ATOM 379   H HG12 . VAL A 1 24 ? -39.054 -5.243  -15.937 1.00 0.00 ? 24 VAL A HG12 1  
ATOM 380   H HG13 . VAL A 1 24 ? -40.508 -6.241  -15.957 1.00 0.00 ? 24 VAL A HG13 1  
ATOM 381   H HG21 . VAL A 1 24 ? -39.286 -7.836  -15.115 1.00 0.00 ? 24 VAL A HG21 1  
ATOM 382   H HG22 . VAL A 1 24 ? -37.972 -8.660  -15.955 1.00 0.00 ? 24 VAL A HG22 1  
ATOM 383   H HG23 . VAL A 1 24 ? -39.644 -8.953  -16.431 1.00 0.00 ? 24 VAL A HG23 1  
ATOM 384   N N    . ARG A 1 25 ? -41.632 -6.569  -18.817 1.00 0.00 ? 25 ARG A N    1  
ATOM 385   C CA   . ARG A 1 25 ? -43.091 -6.603  -18.785 1.00 0.00 ? 25 ARG A CA   1  
ATOM 386   C C    . ARG A 1 25 ? -43.612 -7.616  -19.809 1.00 0.00 ? 25 ARG A C    1  
ATOM 387   O O    . ARG A 1 25 ? -44.365 -8.529  -19.470 1.00 0.00 ? 25 ARG A O    1  
ATOM 388   C CB   . ARG A 1 25 ? -43.659 -5.215  -19.106 1.00 0.00 ? 25 ARG A CB   1  
ATOM 389   C CG   . ARG A 1 25 ? -43.689 -4.344  -17.842 1.00 0.00 ? 25 ARG A CG   1  
ATOM 390   C CD   . ARG A 1 25 ? -44.963 -4.626  -17.035 1.00 0.00 ? 25 ARG A CD   1  
ATOM 391   N NE   . ARG A 1 25 ? -46.144 -4.363  -17.849 1.00 0.00 ? 25 ARG A NE   1  
ATOM 392   C CZ   . ARG A 1 25 ? -46.626 -3.132  -17.984 1.00 0.00 ? 25 ARG A CZ   1  
ATOM 393   N NH1  . ARG A 1 25 ? -46.040 -2.133  -17.384 1.00 0.00 ? 25 ARG A NH1  1  
ATOM 394   N NH2  . ARG A 1 25 ? -47.685 -2.923  -18.717 1.00 0.00 ? 25 ARG A NH2  1  
ATOM 395   H H    . ARG A 1 25 ? -41.148 -5.829  -19.238 1.00 0.00 ? 25 ARG A H    1  
ATOM 396   H HA   . ARG A 1 25 ? -43.411 -6.902  -17.802 1.00 0.00 ? 25 ARG A HA   1  
ATOM 397   H HB2  . ARG A 1 25 ? -43.040 -4.740  -19.852 1.00 0.00 ? 25 ARG A HB2  1  
ATOM 398   H HB3  . ARG A 1 25 ? -44.663 -5.320  -19.489 1.00 0.00 ? 25 ARG A HB3  1  
ATOM 399   H HG2  . ARG A 1 25 ? -42.823 -4.566  -17.236 1.00 0.00 ? 25 ARG A HG2  1  
ATOM 400   H HG3  . ARG A 1 25 ? -43.670 -3.303  -18.126 1.00 0.00 ? 25 ARG A HG3  1  
ATOM 401   H HD2  . ARG A 1 25 ? -44.974 -5.654  -16.715 1.00 0.00 ? 25 ARG A HD2  1  
ATOM 402   H HD3  . ARG A 1 25 ? -44.980 -3.985  -16.166 1.00 0.00 ? 25 ARG A HD3  1  
ATOM 403   H HE   . ARG A 1 25 ? -46.591 -5.108  -18.303 1.00 0.00 ? 25 ARG A HE   1  
ATOM 404   H HH11 . ARG A 1 25 ? -45.230 -2.293  -16.821 1.00 0.00 ? 25 ARG A HH11 1  
ATOM 405   H HH12 . ARG A 1 25 ? -46.402 -1.206  -17.485 1.00 0.00 ? 25 ARG A HH12 1  
ATOM 406   H HH21 . ARG A 1 25 ? -48.134 -3.689  -19.177 1.00 0.00 ? 25 ARG A HH21 1  
ATOM 407   H HH22 . ARG A 1 25 ? -48.047 -1.997  -18.819 1.00 0.00 ? 25 ARG A HH22 1  
ATOM 408   N N    . ASN A 1 26 ? -43.201 -7.438  -21.062 1.00 0.00 ? 26 ASN A N    1  
ATOM 409   C CA   . ASN A 1 26 ? -43.623 -8.328  -22.146 1.00 0.00 ? 26 ASN A CA   1  
ATOM 410   C C    . ASN A 1 26 ? -42.631 -9.473  -22.361 1.00 0.00 ? 26 ASN A C    1  
ATOM 411   O O    . ASN A 1 26 ? -42.845 -10.339 -23.213 1.00 0.00 ? 26 ASN A O    1  
ATOM 412   C CB   . ASN A 1 26 ? -43.761 -7.529  -23.444 1.00 0.00 ? 26 ASN A CB   1  
ATOM 413   C CG   . ASN A 1 26 ? -44.959 -6.590  -23.354 1.00 0.00 ? 26 ASN A CG   1  
ATOM 414   O OD1  . ASN A 1 26 ? -45.858 -6.806  -22.542 1.00 0.00 ? 26 ASN A OD1  1  
ATOM 415   N ND2  . ASN A 1 26 ? -45.023 -5.554  -24.145 1.00 0.00 ? 26 ASN A ND2  1  
ATOM 416   H H    . ASN A 1 26 ? -42.619 -6.674  -21.258 1.00 0.00 ? 26 ASN A H    1  
ATOM 417   H HA   . ASN A 1 26 ? -44.586 -8.745  -21.897 1.00 0.00 ? 26 ASN A HA   1  
ATOM 418   H HB2  . ASN A 1 26 ? -42.862 -6.950  -23.605 1.00 0.00 ? 26 ASN A HB2  1  
ATOM 419   H HB3  . ASN A 1 26 ? -43.901 -8.210  -24.270 1.00 0.00 ? 26 ASN A HB3  1  
ATOM 420   H HD21 . ASN A 1 26 ? -44.306 -5.384  -24.790 1.00 0.00 ? 26 ASN A HD21 1  
ATOM 421   H HD22 . ASN A 1 26 ? -45.790 -4.945  -24.093 1.00 0.00 ? 26 ASN A HD22 1  
ATOM 422   N N    . GLY A 1 27 ? -41.539 -9.465  -21.605 1.00 0.00 ? 27 GLY A N    1  
ATOM 423   C CA   . GLY A 1 27 ? -40.515 -10.497 -21.747 1.00 0.00 ? 27 GLY A CA   1  
ATOM 424   C C    . GLY A 1 27 ? -41.047 -11.897 -21.443 1.00 0.00 ? 27 GLY A C    1  
ATOM 425   O O    . GLY A 1 27 ? -40.720 -12.854 -22.144 1.00 0.00 ? 27 GLY A O    1  
ATOM 426   H H    . GLY A 1 27 ? -41.412 -8.753  -20.944 1.00 0.00 ? 27 GLY A H    1  
ATOM 427   H HA2  . GLY A 1 27 ? -40.140 -10.479 -22.760 1.00 0.00 ? 27 GLY A HA2  1  
ATOM 428   H HA3  . GLY A 1 27 ? -39.703 -10.278 -21.069 1.00 0.00 ? 27 GLY A HA3  1  
ATOM 429   N N    . GLY A 1 28 ? -41.849 -12.019 -20.391 1.00 0.00 ? 28 GLY A N    1  
ATOM 430   C CA   . GLY A 1 28 ? -42.389 -13.322 -20.010 1.00 0.00 ? 28 GLY A CA   1  
ATOM 431   C C    . GLY A 1 28 ? -43.266 -13.918 -21.108 1.00 0.00 ? 28 GLY A C    1  
ATOM 432   O O    . GLY A 1 28 ? -43.182 -15.111 -21.401 1.00 0.00 ? 28 GLY A O    1  
ATOM 433   H H    . GLY A 1 28 ? -42.068 -11.229 -19.854 1.00 0.00 ? 28 GLY A H    1  
ATOM 434   H HA2  . GLY A 1 28 ? -41.569 -13.996 -19.808 1.00 0.00 ? 28 GLY A HA2  1  
ATOM 435   H HA3  . GLY A 1 28 ? -42.979 -13.208 -19.113 1.00 0.00 ? 28 GLY A HA3  1  
ATOM 436   N N    . LEU A 1 29 ? -44.129 -13.093 -21.689 1.00 0.00 ? 29 LEU A N    1  
ATOM 437   C CA   . LEU A 1 29 ? -45.037 -13.576 -22.726 1.00 0.00 ? 29 LEU A CA   1  
ATOM 438   C C    . LEU A 1 29 ? -44.255 -14.144 -23.911 1.00 0.00 ? 29 LEU A C    1  
ATOM 439   O O    . LEU A 1 29 ? -44.554 -15.240 -24.390 1.00 0.00 ? 29 LEU A O    1  
ATOM 440   C CB   . LEU A 1 29 ? -45.942 -12.427 -23.194 1.00 0.00 ? 29 LEU A CB   1  
ATOM 441   C CG   . LEU A 1 29 ? -46.898 -12.908 -24.293 1.00 0.00 ? 29 LEU A CG   1  
ATOM 442   C CD1  . LEU A 1 29 ? -47.784 -14.033 -23.755 1.00 0.00 ? 29 LEU A CD1  1  
ATOM 443   C CD2  . LEU A 1 29 ? -47.783 -11.740 -24.732 1.00 0.00 ? 29 LEU A CD2  1  
ATOM 444   H H    . LEU A 1 29 ? -44.172 -12.165 -21.380 1.00 0.00 ? 29 LEU A H    1  
ATOM 445   H HA   . LEU A 1 29 ? -45.653 -14.357 -22.309 1.00 0.00 ? 29 LEU A HA   1  
ATOM 446   H HB2  . LEU A 1 29 ? -46.516 -12.062 -22.356 1.00 0.00 ? 29 LEU A HB2  1  
ATOM 447   H HB3  . LEU A 1 29 ? -45.328 -11.627 -23.582 1.00 0.00 ? 29 LEU A HB3  1  
ATOM 448   H HG   . LEU A 1 29 ? -46.333 -13.266 -25.141 1.00 0.00 ? 29 LEU A HG   1  
ATOM 449   H HD11 . LEU A 1 29 ? -47.976 -13.869 -22.706 1.00 0.00 ? 29 LEU A HD11 1  
ATOM 450   H HD12 . LEU A 1 29 ? -47.280 -14.981 -23.884 1.00 0.00 ? 29 LEU A HD12 1  
ATOM 451   H HD13 . LEU A 1 29 ? -48.718 -14.046 -24.295 1.00 0.00 ? 29 LEU A HD13 1  
ATOM 452   H HD21 . LEU A 1 29 ? -47.189 -11.023 -25.278 1.00 0.00 ? 29 LEU A HD21 1  
ATOM 453   H HD22 . LEU A 1 29 ? -48.211 -11.265 -23.861 1.00 0.00 ? 29 LEU A HD22 1  
ATOM 454   H HD23 . LEU A 1 29 ? -48.576 -12.107 -25.367 1.00 0.00 ? 29 LEU A HD23 1  
ATOM 455   N N    . ILE A 1 30 ? -43.263 -13.400 -24.385 1.00 0.00 ? 30 ILE A N    1  
ATOM 456   C CA   . ILE A 1 30 ? -42.465 -13.850 -25.525 1.00 0.00 ? 30 ILE A CA   1  
ATOM 457   C C    . ILE A 1 30 ? -41.729 -15.153 -25.212 1.00 0.00 ? 30 ILE A C    1  
ATOM 458   O O    . ILE A 1 30 ? -41.696 -16.076 -26.032 1.00 0.00 ? 30 ILE A O    1  
ATOM 459   C CB   . ILE A 1 30 ? -41.450 -12.770 -25.904 1.00 0.00 ? 30 ILE A CB   1  
ATOM 460   C CG1  . ILE A 1 30 ? -42.188 -11.560 -26.485 1.00 0.00 ? 30 ILE A CG1  1  
ATOM 461   C CG2  . ILE A 1 30 ? -40.480 -13.325 -26.948 1.00 0.00 ? 30 ILE A CG2  1  
ATOM 462   C CD1  . ILE A 1 30 ? -41.224 -10.378 -26.603 1.00 0.00 ? 30 ILE A CD1  1  
ATOM 463   H H    . ILE A 1 30 ? -43.078 -12.520 -23.990 1.00 0.00 ? 30 ILE A H    1  
ATOM 464   H HA   . ILE A 1 30 ? -43.122 -14.015 -26.364 1.00 0.00 ? 30 ILE A HA   1  
ATOM 465   H HB   . ILE A 1 30 ? -40.898 -12.469 -25.025 1.00 0.00 ? 30 ILE A HB   1  
ATOM 466   H HG12 . ILE A 1 30 ? -42.574 -11.810 -27.463 1.00 0.00 ? 30 ILE A HG12 1  
ATOM 467   H HG13 . ILE A 1 30 ? -43.007 -11.291 -25.834 1.00 0.00 ? 30 ILE A HG13 1  
ATOM 468   H HG21 . ILE A 1 30 ? -39.592 -13.693 -26.456 1.00 0.00 ? 30 ILE A HG21 1  
ATOM 469   H HG22 . ILE A 1 30 ? -40.208 -12.542 -27.642 1.00 0.00 ? 30 ILE A HG22 1  
ATOM 470   H HG23 . ILE A 1 30 ? -40.954 -14.133 -27.487 1.00 0.00 ? 30 ILE A HG23 1  
ATOM 471   H HD11 . ILE A 1 30 ? -40.300 -10.710 -27.051 1.00 0.00 ? 30 ILE A HD11 1  
ATOM 472   H HD12 . ILE A 1 30 ? -41.025 -9.977  -25.619 1.00 0.00 ? 30 ILE A HD12 1  
ATOM 473   H HD13 . ILE A 1 30 ? -41.669 -9.612  -27.220 1.00 0.00 ? 30 ILE A HD13 1  
ATOM 474   N N    . PHE A 1 31 ? -41.138 -15.225 -24.024 1.00 0.00 ? 31 PHE A N    1  
ATOM 475   C CA   . PHE A 1 31 ? -40.403 -16.415 -23.614 1.00 0.00 ? 31 PHE A CA   1  
ATOM 476   C C    . PHE A 1 31 ? -41.304 -17.646 -23.589 1.00 0.00 ? 31 PHE A C    1  
ATOM 477   O O    . PHE A 1 31 ? -40.920 -18.715 -24.063 1.00 0.00 ? 31 PHE A O    1  
ATOM 478   C CB   . PHE A 1 31 ? -39.798 -16.197 -22.228 1.00 0.00 ? 31 PHE A CB   1  
ATOM 479   C CG   . PHE A 1 31 ? -39.068 -17.446 -21.794 1.00 0.00 ? 31 PHE A CG   1  
ATOM 480   C CD1  . PHE A 1 31 ? -37.792 -17.721 -22.298 1.00 0.00 ? 31 PHE A CD1  1  
ATOM 481   C CD2  . PHE A 1 31 ? -39.667 -18.329 -20.888 1.00 0.00 ? 31 PHE A CD2  1  
ATOM 482   C CE1  . PHE A 1 31 ? -37.114 -18.877 -21.897 1.00 0.00 ? 31 PHE A CE1  1  
ATOM 483   C CE2  . PHE A 1 31 ? -38.990 -19.487 -20.486 1.00 0.00 ? 31 PHE A CE2  1  
ATOM 484   C CZ   . PHE A 1 31 ? -37.713 -19.761 -20.990 1.00 0.00 ? 31 PHE A CZ   1  
ATOM 485   H H    . PHE A 1 31 ? -41.201 -14.475 -23.397 1.00 0.00 ? 31 PHE A H    1  
ATOM 486   H HA   . PHE A 1 31 ? -39.602 -16.586 -24.317 1.00 0.00 ? 31 PHE A HA   1  
ATOM 487   H HB2  . PHE A 1 31 ? -39.105 -15.369 -22.263 1.00 0.00 ? 31 PHE A HB2  1  
ATOM 488   H HB3  . PHE A 1 31 ? -40.585 -15.978 -21.522 1.00 0.00 ? 31 PHE A HB3  1  
ATOM 489   H HD1  . PHE A 1 31 ? -37.329 -17.040 -22.997 1.00 0.00 ? 31 PHE A HD1  1  
ATOM 490   H HD2  . PHE A 1 31 ? -40.652 -18.117 -20.498 1.00 0.00 ? 31 PHE A HD2  1  
ATOM 491   H HE1  . PHE A 1 31 ? -36.129 -19.090 -22.286 1.00 0.00 ? 31 PHE A HE1  1  
ATOM 492   H HE2  . PHE A 1 31 ? -39.452 -20.168 -19.786 1.00 0.00 ? 31 PHE A HE2  1  
ATOM 493   H HZ   . PHE A 1 31 ? -37.190 -20.654 -20.681 1.00 0.00 ? 31 PHE A HZ   1  
ATOM 494   N N    . ALA A 1 32 ? -42.486 -17.503 -22.999 1.00 0.00 ? 32 ALA A N    1  
ATOM 495   C CA   . ALA A 1 32 ? -43.406 -18.629 -22.880 1.00 0.00 ? 32 ALA A CA   1  
ATOM 496   C C    . ALA A 1 32 ? -43.775 -19.206 -24.245 1.00 0.00 ? 32 ALA A C    1  
ATOM 497   O O    . ALA A 1 32 ? -43.819 -20.425 -24.405 1.00 0.00 ? 32 ALA A O    1  
ATOM 498   C CB   . ALA A 1 32 ? -44.678 -18.183 -22.157 1.00 0.00 ? 32 ALA A CB   1  
ATOM 499   H H    . ALA A 1 32 ? -42.730 -16.640 -22.605 1.00 0.00 ? 32 ALA A H    1  
ATOM 500   H HA   . ALA A 1 32 ? -42.933 -19.401 -22.294 1.00 0.00 ? 32 ALA A HA   1  
ATOM 501   H HB1  . ALA A 1 32 ? -44.512 -18.205 -21.090 1.00 0.00 ? 32 ALA A HB1  1  
ATOM 502   H HB2  . ALA A 1 32 ? -45.488 -18.851 -22.409 1.00 0.00 ? 32 ALA A HB2  1  
ATOM 503   H HB3  . ALA A 1 32 ? -44.932 -17.178 -22.462 1.00 0.00 ? 32 ALA A HB3  1  
ATOM 504   N N    . GLY A 1 33 ? -44.040 -18.349 -25.228 1.00 0.00 ? 33 GLY A N    1  
ATOM 505   C CA   . GLY A 1 33 ? -44.402 -18.838 -26.556 1.00 0.00 ? 33 GLY A CA   1  
ATOM 506   C C    . GLY A 1 33 ? -43.280 -19.685 -27.150 1.00 0.00 ? 33 GLY A C    1  
ATOM 507   O O    . GLY A 1 33 ? -43.526 -20.733 -27.755 1.00 0.00 ? 33 GLY A O    1  
ATOM 508   H H    . GLY A 1 33 ? -44.005 -17.380 -25.071 1.00 0.00 ? 33 GLY A H    1  
ATOM 509   H HA2  . GLY A 1 33 ? -45.299 -19.438 -26.480 1.00 0.00 ? 33 GLY A HA2  1  
ATOM 510   H HA3  . GLY A 1 33 ? -44.590 -17.997 -27.205 1.00 0.00 ? 33 GLY A HA3  1  
ATOM 511   N N    . LEU A 1 34 ? -42.044 -19.243 -26.944 1.00 0.00 ? 34 LEU A N    1  
ATOM 512   C CA   . LEU A 1 34 ? -40.889 -19.986 -27.436 1.00 0.00 ? 34 LEU A CA   1  
ATOM 513   C C    . LEU A 1 34 ? -40.788 -21.324 -26.710 1.00 0.00 ? 34 LEU A C    1  
ATOM 514   O O    . LEU A 1 34 ? -40.407 -22.344 -27.291 1.00 0.00 ? 34 LEU A O    1  
ATOM 515   C CB   . LEU A 1 34 ? -39.608 -19.177 -27.210 1.00 0.00 ? 34 LEU A CB   1  
ATOM 516   C CG   . LEU A 1 34 ? -39.601 -17.948 -28.127 1.00 0.00 ? 34 LEU A CG   1  
ATOM 517   C CD1  . LEU A 1 34 ? -38.421 -17.046 -27.758 1.00 0.00 ? 34 LEU A CD1  1  
ATOM 518   C CD2  . LEU A 1 34 ? -39.472 -18.378 -29.595 1.00 0.00 ? 34 LEU A CD2  1  
ATOM 519   H H    . LEU A 1 34 ? -41.905 -18.423 -26.419 1.00 0.00 ? 34 LEU A H    1  
ATOM 520   H HA   . LEU A 1 34 ? -41.011 -20.167 -28.493 1.00 0.00 ? 34 LEU A HA   1  
ATOM 521   H HB2  . LEU A 1 34 ? -39.570 -18.854 -26.179 1.00 0.00 ? 34 LEU A HB2  1  
ATOM 522   H HB3  . LEU A 1 34 ? -38.749 -19.793 -27.422 1.00 0.00 ? 34 LEU A HB3  1  
ATOM 523   H HG   . LEU A 1 34 ? -40.523 -17.399 -27.992 1.00 0.00 ? 34 LEU A HG   1  
ATOM 524   H HD11 . LEU A 1 34 ? -37.497 -17.586 -27.906 1.00 0.00 ? 34 LEU A HD11 1  
ATOM 525   H HD12 . LEU A 1 34 ? -38.504 -16.750 -26.723 1.00 0.00 ? 34 LEU A HD12 1  
ATOM 526   H HD13 . LEU A 1 34 ? -38.430 -16.167 -28.387 1.00 0.00 ? 34 LEU A HD13 1  
ATOM 527   H HD21 . LEU A 1 34 ? -40.457 -18.482 -30.025 1.00 0.00 ? 34 LEU A HD21 1  
ATOM 528   H HD22 . LEU A 1 34 ? -38.951 -19.320 -29.657 1.00 0.00 ? 34 LEU A HD22 1  
ATOM 529   H HD23 . LEU A 1 34 ? -38.921 -17.626 -30.140 1.00 0.00 ? 34 LEU A HD23 1  
ATOM 530   N N    . ALA A 1 35 ? -41.132 -21.297 -25.428 1.00 0.00 ? 35 ALA A N    1  
ATOM 531   C CA   . ALA A 1 35 ? -41.072 -22.502 -24.612 1.00 0.00 ? 35 ALA A CA   1  
ATOM 532   C C    . ALA A 1 35 ? -41.984 -23.580 -25.193 1.00 0.00 ? 35 ALA A C    1  
ATOM 533   O O    . ALA A 1 35 ? -41.580 -24.730 -25.321 1.00 0.00 ? 35 ALA A O    1  
ATOM 534   C CB   . ALA A 1 35 ? -41.501 -22.186 -23.178 1.00 0.00 ? 35 ALA A CB   1  
ATOM 535   H H    . ALA A 1 35 ? -41.424 -20.438 -25.055 1.00 0.00 ? 35 ALA A H    1  
ATOM 536   H HA   . ALA A 1 35 ? -40.056 -22.869 -24.600 1.00 0.00 ? 35 ALA A HA   1  
ATOM 537   H HB1  . ALA A 1 35 ? -42.576 -22.100 -23.135 1.00 0.00 ? 35 ALA A HB1  1  
ATOM 538   H HB2  . ALA A 1 35 ? -41.052 -21.254 -22.866 1.00 0.00 ? 35 ALA A HB2  1  
ATOM 539   H HB3  . ALA A 1 35 ? -41.176 -22.980 -22.522 1.00 0.00 ? 35 ALA A HB3  1  
ATOM 540   N N    . PHE A 1 36 ? -43.223 -23.207 -25.504 1.00 0.00 ? 36 PHE A N    1  
ATOM 541   C CA   . PHE A 1 36 ? -44.194 -24.168 -26.034 1.00 0.00 ? 36 PHE A CA   1  
ATOM 542   C C    . PHE A 1 36 ? -43.724 -24.794 -27.351 1.00 0.00 ? 36 PHE A C    1  
ATOM 543   O O    . PHE A 1 36 ? -43.896 -25.999 -27.568 1.00 0.00 ? 36 PHE A O    1  
ATOM 544   C CB   . PHE A 1 36 ? -45.547 -23.485 -26.250 1.00 0.00 ? 36 PHE A CB   1  
ATOM 545   C CG   . PHE A 1 36 ? -46.215 -23.255 -24.915 1.00 0.00 ? 36 PHE A CG   1  
ATOM 546   C CD1  . PHE A 1 36 ? -46.694 -24.343 -24.176 1.00 0.00 ? 36 PHE A CD1  1  
ATOM 547   C CD2  . PHE A 1 36 ? -46.353 -21.954 -24.415 1.00 0.00 ? 36 PHE A CD2  1  
ATOM 548   C CE1  . PHE A 1 36 ? -47.312 -24.132 -22.936 1.00 0.00 ? 36 PHE A CE1  1  
ATOM 549   C CE2  . PHE A 1 36 ? -46.970 -21.743 -23.175 1.00 0.00 ? 36 PHE A CE2  1  
ATOM 550   C CZ   . PHE A 1 36 ? -47.449 -22.832 -22.437 1.00 0.00 ? 36 PHE A CZ   1  
ATOM 551   H H    . PHE A 1 36 ? -43.503 -22.290 -25.302 1.00 0.00 ? 36 PHE A H    1  
ATOM 552   H HA   . PHE A 1 36 ? -44.324 -24.957 -25.308 1.00 0.00 ? 36 PHE A HA   1  
ATOM 553   H HB2  . PHE A 1 36 ? -45.396 -22.538 -26.748 1.00 0.00 ? 36 PHE A HB2  1  
ATOM 554   H HB3  . PHE A 1 36 ? -46.174 -24.117 -26.862 1.00 0.00 ? 36 PHE A HB3  1  
ATOM 555   H HD1  . PHE A 1 36 ? -46.588 -25.347 -24.561 1.00 0.00 ? 36 PHE A HD1  1  
ATOM 556   H HD2  . PHE A 1 36 ? -45.985 -21.114 -24.984 1.00 0.00 ? 36 PHE A HD2  1  
ATOM 557   H HE1  . PHE A 1 36 ? -47.681 -24.971 -22.367 1.00 0.00 ? 36 PHE A HE1  1  
ATOM 558   H HE2  . PHE A 1 36 ? -47.075 -20.740 -22.789 1.00 0.00 ? 36 PHE A HE2  1  
ATOM 559   H HZ   . PHE A 1 36 ? -47.925 -22.668 -21.481 1.00 0.00 ? 36 PHE A HZ   1  
ATOM 560   N N    . ILE A 1 37 ? -43.143 -23.989 -28.237 1.00 0.00 ? 37 ILE A N    1  
ATOM 561   C CA   . ILE A 1 37 ? -42.688 -24.517 -29.523 1.00 0.00 ? 37 ILE A CA   1  
ATOM 562   C C    . ILE A 1 37 ? -41.679 -25.643 -29.306 1.00 0.00 ? 37 ILE A C    1  
ATOM 563   O O    . ILE A 1 37 ? -41.740 -26.682 -29.965 1.00 0.00 ? 37 ILE A O    1  
ATOM 564   C CB   . ILE A 1 37 ? -42.043 -23.404 -30.349 1.00 0.00 ? 37 ILE A CB   1  
ATOM 565   C CG1  . ILE A 1 37 ? -43.116 -22.403 -30.781 1.00 0.00 ? 37 ILE A CG1  1  
ATOM 566   C CG2  . ILE A 1 37 ? -41.380 -24.009 -31.588 1.00 0.00 ? 37 ILE A CG2  1  
ATOM 567   C CD1  . ILE A 1 37 ? -42.449 -21.153 -31.355 1.00 0.00 ? 37 ILE A CD1  1  
ATOM 568   H H    . ILE A 1 37 ? -43.045 -23.030 -28.045 1.00 0.00 ? 37 ILE A H    1  
ATOM 569   H HA   . ILE A 1 37 ? -43.537 -24.907 -30.063 1.00 0.00 ? 37 ILE A HA   1  
ATOM 570   H HB   . ILE A 1 37 ? -41.295 -22.900 -29.752 1.00 0.00 ? 37 ILE A HB   1  
ATOM 571   H HG12 . ILE A 1 37 ? -43.746 -22.855 -31.535 1.00 0.00 ? 37 ILE A HG12 1  
ATOM 572   H HG13 . ILE A 1 37 ? -43.718 -22.129 -29.927 1.00 0.00 ? 37 ILE A HG13 1  
ATOM 573   H HG21 . ILE A 1 37 ? -41.492 -23.332 -32.424 1.00 0.00 ? 37 ILE A HG21 1  
ATOM 574   H HG22 . ILE A 1 37 ? -41.850 -24.952 -31.824 1.00 0.00 ? 37 ILE A HG22 1  
ATOM 575   H HG23 . ILE A 1 37 ? -40.329 -24.169 -31.394 1.00 0.00 ? 37 ILE A HG23 1  
ATOM 576   H HD11 . ILE A 1 37 ? -41.406 -21.357 -31.547 1.00 0.00 ? 37 ILE A HD11 1  
ATOM 577   H HD12 . ILE A 1 37 ? -42.533 -20.342 -30.647 1.00 0.00 ? 37 ILE A HD12 1  
ATOM 578   H HD13 . ILE A 1 37 ? -42.936 -20.876 -32.278 1.00 0.00 ? 37 ILE A HD13 1  
ATOM 579   N N    . VAL A 1 38 ? -40.747 -25.420 -28.391 1.00 0.00 ? 38 VAL A N    1  
ATOM 580   C CA   . VAL A 1 38 ? -39.718 -26.416 -28.106 1.00 0.00 ? 38 VAL A CA   1  
ATOM 581   C C    . VAL A 1 38 ? -40.349 -27.747 -27.689 1.00 0.00 ? 38 VAL A C    1  
ATOM 582   O O    . VAL A 1 38 ? -39.877 -28.814 -28.085 1.00 0.00 ? 38 VAL A O    1  
ATOM 583   C CB   . VAL A 1 38 ? -38.801 -25.913 -26.990 1.00 0.00 ? 38 VAL A CB   1  
ATOM 584   C CG1  . VAL A 1 38 ? -37.878 -27.046 -26.539 1.00 0.00 ? 38 VAL A CG1  1  
ATOM 585   C CG2  . VAL A 1 38 ? -37.957 -24.747 -27.510 1.00 0.00 ? 38 VAL A CG2  1  
ATOM 586   H H    . VAL A 1 38 ? -40.740 -24.554 -27.928 1.00 0.00 ? 38 VAL A H    1  
ATOM 587   H HA   . VAL A 1 38 ? -39.127 -26.572 -28.996 1.00 0.00 ? 38 VAL A HA   1  
ATOM 588   H HB   . VAL A 1 38 ? -39.400 -25.582 -26.154 1.00 0.00 ? 38 VAL A HB   1  
ATOM 589   H HG11 . VAL A 1 38 ? -36.922 -26.636 -26.246 1.00 0.00 ? 38 VAL A HG11 1  
ATOM 590   H HG12 . VAL A 1 38 ? -37.737 -27.741 -27.354 1.00 0.00 ? 38 VAL A HG12 1  
ATOM 591   H HG13 . VAL A 1 38 ? -38.322 -27.560 -25.700 1.00 0.00 ? 38 VAL A HG13 1  
ATOM 592   H HG21 . VAL A 1 38 ? -37.678 -24.107 -26.685 1.00 0.00 ? 38 VAL A HG21 1  
ATOM 593   H HG22 . VAL A 1 38 ? -38.531 -24.178 -28.226 1.00 0.00 ? 38 VAL A HG22 1  
ATOM 594   H HG23 . VAL A 1 38 ? -37.066 -25.129 -27.985 1.00 0.00 ? 38 VAL A HG23 1  
ATOM 595   N N    . GLY A 1 39 ? -41.406 -27.679 -26.887 1.00 0.00 ? 39 GLY A N    1  
ATOM 596   C CA   . GLY A 1 39 ? -42.091 -28.879 -26.411 1.00 0.00 ? 39 GLY A CA   1  
ATOM 597   C C    . GLY A 1 39 ? -42.646 -29.707 -27.568 1.00 0.00 ? 39 GLY A C    1  
ATOM 598   O O    . GLY A 1 39 ? -42.634 -30.939 -27.521 1.00 0.00 ? 39 GLY A O    1  
ATOM 599   H H    . GLY A 1 39 ? -41.732 -26.811 -26.596 1.00 0.00 ? 39 GLY A H    1  
ATOM 600   H HA2  . GLY A 1 39 ? -41.395 -29.482 -25.849 1.00 0.00 ? 39 GLY A HA2  1  
ATOM 601   H HA3  . GLY A 1 39 ? -42.907 -28.586 -25.767 1.00 0.00 ? 39 GLY A HA3  1  
ATOM 602   N N    . LEU A 1 40 ? -43.137 -29.035 -28.602 1.00 0.00 ? 40 LEU A N    1  
ATOM 603   C CA   . LEU A 1 40 ? -43.692 -29.750 -29.749 1.00 0.00 ? 40 LEU A CA   1  
ATOM 604   C C    . LEU A 1 40 ? -42.624 -30.665 -30.353 1.00 0.00 ? 40 LEU A C    1  
ATOM 605   O O    . LEU A 1 40 ? -42.884 -31.834 -30.647 1.00 0.00 ? 40 LEU A O    1  
ATOM 606   C CB   . LEU A 1 40 ? -44.184 -28.746 -30.800 1.00 0.00 ? 40 LEU A CB   1  
ATOM 607   C CG   . LEU A 1 40 ? -44.758 -29.482 -32.017 1.00 0.00 ? 40 LEU A CG   1  
ATOM 608   C CD1  . LEU A 1 40 ? -45.942 -30.351 -31.588 1.00 0.00 ? 40 LEU A CD1  1  
ATOM 609   C CD2  . LEU A 1 40 ? -45.236 -28.453 -33.046 1.00 0.00 ? 40 LEU A CD2  1  
ATOM 610   H H    . LEU A 1 40 ? -43.119 -28.051 -28.588 1.00 0.00 ? 40 LEU A H    1  
ATOM 611   H HA   . LEU A 1 40 ? -44.525 -30.352 -29.416 1.00 0.00 ? 40 LEU A HA   1  
ATOM 612   H HB2  . LEU A 1 40 ? -44.951 -28.122 -30.365 1.00 0.00 ? 40 LEU A HB2  1  
ATOM 613   H HB3  . LEU A 1 40 ? -43.357 -28.127 -31.115 1.00 0.00 ? 40 LEU A HB3  1  
ATOM 614   H HG   . LEU A 1 40 ? -43.995 -30.104 -32.462 1.00 0.00 ? 40 LEU A HG   1  
ATOM 615   H HD11 . LEU A 1 40 ? -46.623 -30.468 -32.418 1.00 0.00 ? 40 LEU A HD11 1  
ATOM 616   H HD12 . LEU A 1 40 ? -46.456 -29.877 -30.765 1.00 0.00 ? 40 LEU A HD12 1  
ATOM 617   H HD13 . LEU A 1 40 ? -45.582 -31.320 -31.277 1.00 0.00 ? 40 LEU A HD13 1  
ATOM 618   H HD21 . LEU A 1 40 ? -44.612 -28.506 -33.925 1.00 0.00 ? 40 LEU A HD21 1  
ATOM 619   H HD22 . LEU A 1 40 ? -45.175 -27.464 -32.619 1.00 0.00 ? 40 LEU A HD22 1  
ATOM 620   H HD23 . LEU A 1 40 ? -46.260 -28.666 -33.317 1.00 0.00 ? 40 LEU A HD23 1  
ATOM 621   N N    . LEU A 1 41 ? -41.433 -30.112 -30.555 1.00 0.00 ? 41 LEU A N    1  
ATOM 622   C CA   . LEU A 1 41 ? -40.329 -30.863 -31.152 1.00 0.00 ? 41 LEU A CA   1  
ATOM 623   C C    . LEU A 1 41 ? -40.045 -32.144 -30.367 1.00 0.00 ? 41 LEU A C    1  
ATOM 624   O O    . LEU A 1 41 ? -39.686 -33.165 -30.951 1.00 0.00 ? 41 LEU A O    1  
ATOM 625   C CB   . LEU A 1 41 ? -39.070 -29.985 -31.190 1.00 0.00 ? 41 LEU A CB   1  
ATOM 626   C CG   . LEU A 1 41 ? -37.902 -30.746 -31.837 1.00 0.00 ? 41 LEU A CG   1  
ATOM 627   C CD1  . LEU A 1 41 ? -38.260 -31.120 -33.277 1.00 0.00 ? 41 LEU A CD1  1  
ATOM 628   C CD2  . LEU A 1 41 ? -36.658 -29.853 -31.844 1.00 0.00 ? 41 LEU A CD2  1  
ATOM 629   H H    . LEU A 1 41 ? -41.314 -29.168 -30.348 1.00 0.00 ? 41 LEU A H    1  
ATOM 630   H HA   . LEU A 1 41 ? -40.599 -31.127 -32.163 1.00 0.00 ? 41 LEU A HA   1  
ATOM 631   H HB2  . LEU A 1 41 ? -39.276 -29.093 -31.761 1.00 0.00 ? 41 LEU A HB2  1  
ATOM 632   H HB3  . LEU A 1 41 ? -38.798 -29.709 -30.182 1.00 0.00 ? 41 LEU A HB3  1  
ATOM 633   H HG   . LEU A 1 41 ? -37.694 -31.643 -31.273 1.00 0.00 ? 41 LEU A HG   1  
ATOM 634   H HD11 . LEU A 1 41 ? -38.755 -32.080 -33.287 1.00 0.00 ? 41 LEU A HD11 1  
ATOM 635   H HD12 . LEU A 1 41 ? -37.358 -31.175 -33.869 1.00 0.00 ? 41 LEU A HD12 1  
ATOM 636   H HD13 . LEU A 1 41 ? -38.918 -30.372 -33.693 1.00 0.00 ? 41 LEU A HD13 1  
ATOM 637   H HD21 . LEU A 1 41 ? -36.954 -28.819 -31.746 1.00 0.00 ? 41 LEU A HD21 1  
ATOM 638   H HD22 . LEU A 1 41 ? -36.124 -29.989 -32.773 1.00 0.00 ? 41 LEU A HD22 1  
ATOM 639   H HD23 . LEU A 1 41 ? -36.017 -30.123 -31.018 1.00 0.00 ? 41 LEU A HD23 1  
ATOM 640   N N    . ILE A 1 42 ? -40.199 -32.086 -29.051 1.00 0.00 ? 42 ILE A N    1  
ATOM 641   C CA   . ILE A 1 42 ? -39.945 -33.260 -28.214 1.00 0.00 ? 42 ILE A CA   1  
ATOM 642   C C    . ILE A 1 42 ? -40.864 -34.418 -28.614 1.00 0.00 ? 42 ILE A C    1  
ATOM 643   O O    . ILE A 1 42 ? -40.437 -35.575 -28.677 1.00 0.00 ? 42 ILE A O    1  
ATOM 644   C CB   . ILE A 1 42 ? -40.144 -32.924 -26.734 1.00 0.00 ? 42 ILE A CB   1  
ATOM 645   C CG1  . ILE A 1 42 ? -39.029 -31.978 -26.275 1.00 0.00 ? 42 ILE A CG1  1  
ATOM 646   C CG2  . ILE A 1 42 ? -40.094 -34.213 -25.909 1.00 0.00 ? 42 ILE A CG2  1  
ATOM 647   C CD1  . ILE A 1 42 ? -39.344 -31.428 -24.879 1.00 0.00 ? 42 ILE A CD1  1  
ATOM 648   H H    . ILE A 1 42 ? -40.484 -31.243 -28.650 1.00 0.00 ? 42 ILE A H    1  
ATOM 649   H HA   . ILE A 1 42 ? -38.920 -33.569 -28.361 1.00 0.00 ? 42 ILE A HA   1  
ATOM 650   H HB   . ILE A 1 42 ? -41.105 -32.450 -26.600 1.00 0.00 ? 42 ILE A HB   1  
ATOM 651   H HG12 . ILE A 1 42 ? -38.094 -32.516 -26.245 1.00 0.00 ? 42 ILE A HG12 1  
ATOM 652   H HG13 . ILE A 1 42 ? -38.947 -31.157 -26.971 1.00 0.00 ? 42 ILE A HG13 1  
ATOM 653   H HG21 . ILE A 1 42 ? -39.522 -34.959 -26.441 1.00 0.00 ? 42 ILE A HG21 1  
ATOM 654   H HG22 . ILE A 1 42 ? -41.098 -34.578 -25.749 1.00 0.00 ? 42 ILE A HG22 1  
ATOM 655   H HG23 . ILE A 1 42 ? -39.627 -34.015 -24.956 1.00 0.00 ? 42 ILE A HG23 1  
ATOM 656   H HD11 . ILE A 1 42 ? -39.436 -30.354 -24.928 1.00 0.00 ? 42 ILE A HD11 1  
ATOM 657   H HD12 . ILE A 1 42 ? -38.545 -31.689 -24.202 1.00 0.00 ? 42 ILE A HD12 1  
ATOM 658   H HD13 . ILE A 1 42 ? -40.270 -31.852 -24.520 1.00 0.00 ? 42 ILE A HD13 1  
ATOM 659   N N    . LEU A 1 43 ? -42.131 -34.116 -28.872 1.00 0.00 ? 43 LEU A N    1  
ATOM 660   C CA   . LEU A 1 43 ? -43.076 -35.165 -29.243 1.00 0.00 ? 43 LEU A CA   1  
ATOM 661   C C    . LEU A 1 43 ? -42.601 -35.890 -30.503 1.00 0.00 ? 43 LEU A C    1  
ATOM 662   O O    . LEU A 1 43 ? -42.708 -37.115 -30.601 1.00 0.00 ? 43 LEU A O    1  
ATOM 663   C CB   . LEU A 1 43 ? -44.460 -34.558 -29.490 1.00 0.00 ? 43 LEU A CB   1  
ATOM 664   C CG   . LEU A 1 43 ? -45.055 -34.066 -28.166 1.00 0.00 ? 43 LEU A CG   1  
ATOM 665   C CD1  . LEU A 1 43 ? -46.340 -33.285 -28.443 1.00 0.00 ? 43 LEU A CD1  1  
ATOM 666   C CD2  . LEU A 1 43 ? -45.372 -35.255 -27.248 1.00 0.00 ? 43 LEU A CD2  1  
ATOM 667   H H    . LEU A 1 43 ? -42.436 -33.193 -28.789 1.00 0.00 ? 43 LEU A H    1  
ATOM 668   H HA   . LEU A 1 43 ? -43.144 -35.877 -28.436 1.00 0.00 ? 43 LEU A HA   1  
ATOM 669   H HB2  . LEU A 1 43 ? -44.365 -33.724 -30.171 1.00 0.00 ? 43 LEU A HB2  1  
ATOM 670   H HB3  . LEU A 1 43 ? -45.111 -35.301 -29.927 1.00 0.00 ? 43 LEU A HB3  1  
ATOM 671   H HG   . LEU A 1 43 ? -44.343 -33.415 -27.677 1.00 0.00 ? 43 LEU A HG   1  
ATOM 672   H HD11 . LEU A 1 43 ? -47.114 -33.613 -27.764 1.00 0.00 ? 43 LEU A HD11 1  
ATOM 673   H HD12 . LEU A 1 43 ? -46.656 -33.461 -29.460 1.00 0.00 ? 43 LEU A HD12 1  
ATOM 674   H HD13 . LEU A 1 43 ? -46.158 -32.230 -28.298 1.00 0.00 ? 43 LEU A HD13 1  
ATOM 675   H HD21 . LEU A 1 43 ? -45.387 -36.169 -27.821 1.00 0.00 ? 43 LEU A HD21 1  
ATOM 676   H HD22 . LEU A 1 43 ? -46.337 -35.104 -26.787 1.00 0.00 ? 43 LEU A HD22 1  
ATOM 677   H HD23 . LEU A 1 43 ? -44.617 -35.326 -26.479 1.00 0.00 ? 43 LEU A HD23 1  
ATOM 678   N N    . LEU A 1 44 ? -42.074 -35.138 -31.464 1.00 0.00 ? 44 LEU A N    1  
ATOM 679   C CA   . LEU A 1 44 ? -41.592 -35.740 -32.704 1.00 0.00 ? 44 LEU A CA   1  
ATOM 680   C C    . LEU A 1 44 ? -40.469 -36.737 -32.422 1.00 0.00 ? 44 LEU A C    1  
ATOM 681   O O    . LEU A 1 44 ? -40.303 -37.720 -33.152 1.00 0.00 ? 44 LEU A O    1  
ATOM 682   C CB   . LEU A 1 44 ? -41.080 -34.654 -33.655 1.00 0.00 ? 44 LEU A CB   1  
ATOM 683   C CG   . LEU A 1 44 ? -42.251 -34.058 -34.439 1.00 0.00 ? 44 LEU A CG   1  
ATOM 684   C CD1  . LEU A 1 44 ? -43.252 -33.429 -33.470 1.00 0.00 ? 44 LEU A CD1  1  
ATOM 685   C CD2  . LEU A 1 44 ? -41.727 -32.985 -35.397 1.00 0.00 ? 44 LEU A CD2  1  
ATOM 686   H H    . LEU A 1 44 ? -42.021 -34.170 -31.352 1.00 0.00 ? 44 LEU A H    1  
ATOM 687   H HA   . LEU A 1 44 ? -42.409 -36.261 -33.179 1.00 0.00 ? 44 LEU A HA   1  
ATOM 688   H HB2  . LEU A 1 44 ? -40.597 -33.874 -33.083 1.00 0.00 ? 44 LEU A HB2  1  
ATOM 689   H HB3  . LEU A 1 44 ? -40.371 -35.086 -34.345 1.00 0.00 ? 44 LEU A HB3  1  
ATOM 690   H HG   . LEU A 1 44 ? -42.740 -34.838 -35.005 1.00 0.00 ? 44 LEU A HG   1  
ATOM 691   H HD11 . LEU A 1 44 ? -42.727 -32.782 -32.784 1.00 0.00 ? 44 LEU A HD11 1  
ATOM 692   H HD12 . LEU A 1 44 ? -43.757 -34.207 -32.917 1.00 0.00 ? 44 LEU A HD12 1  
ATOM 693   H HD13 . LEU A 1 44 ? -43.976 -32.852 -34.025 1.00 0.00 ? 44 LEU A HD13 1  
ATOM 694   H HD21 . LEU A 1 44 ? -42.472 -32.782 -36.152 1.00 0.00 ? 44 LEU A HD21 1  
ATOM 695   H HD22 . LEU A 1 44 ? -40.822 -33.337 -35.870 1.00 0.00 ? 44 LEU A HD22 1  
ATOM 696   H HD23 . LEU A 1 44 ? -41.517 -32.082 -34.844 1.00 0.00 ? 44 LEU A HD23 1  
ATOM 697   N N    . SER A 1 45 ? -39.702 -36.490 -31.362 1.00 0.00 ? 45 SER A N    1  
ATOM 698   C CA   . SER A 1 45 ? -38.607 -37.385 -31.015 1.00 0.00 ? 45 SER A CA   1  
ATOM 699   C C    . SER A 1 45 ? -39.157 -38.780 -30.777 1.00 0.00 ? 45 SER A C    1  
ATOM 700   O O    . SER A 1 45 ? -38.569 -39.770 -31.209 1.00 0.00 ? 45 SER A O    1  
ATOM 701   C CB   . SER A 1 45 ? -37.878 -36.898 -29.761 1.00 0.00 ? 45 SER A CB   1  
ATOM 702   O OG   . SER A 1 45 ? -36.799 -37.780 -29.477 1.00 0.00 ? 45 SER A OG   1  
ATOM 703   H H    . SER A 1 45 ? -39.876 -35.701 -30.813 1.00 0.00 ? 45 SER A H    1  
ATOM 704   H HA   . SER A 1 45 ? -37.907 -37.417 -31.836 1.00 0.00 ? 45 SER A HA   1  
ATOM 705   H HB2  . SER A 1 45 ? -37.494 -35.906 -29.924 1.00 0.00 ? 45 SER A HB2  1  
ATOM 706   H HB3  . SER A 1 45 ? -38.565 -36.885 -28.928 1.00 0.00 ? 45 SER A HB3  1  
ATOM 707   H HG   . SER A 1 45 ? -36.616 -38.292 -30.269 1.00 0.00 ? 45 SER A HG   1  
ATOM 708   N N    . ARG A 1 46 ? -40.296 -38.858 -30.099 1.00 0.00 ? 46 ARG A N    1  
ATOM 709   C CA   . ARG A 1 46 ? -40.912 -40.154 -29.833 1.00 0.00 ? 46 ARG A CA   1  
ATOM 710   C C    . ARG A 1 46 ? -41.248 -40.856 -31.146 1.00 0.00 ? 46 ARG A C    1  
ATOM 711   O O    . ARG A 1 46 ? -41.150 -42.079 -31.249 1.00 0.00 ? 46 ARG A O    1  
ATOM 712   C CB   . ARG A 1 46 ? -42.199 -39.999 -29.021 1.00 0.00 ? 46 ARG A CB   1  
ATOM 713   C CG   . ARG A 1 46 ? -42.605 -41.369 -28.464 1.00 0.00 ? 46 ARG A CG   1  
ATOM 714   C CD   . ARG A 1 46 ? -44.130 -41.482 -28.399 1.00 0.00 ? 46 ARG A CD   1  
ATOM 715   N NE   . ARG A 1 46 ? -44.678 -41.692 -29.737 1.00 0.00 ? 46 ARG A NE   1  
ATOM 716   C CZ   . ARG A 1 46 ? -45.989 -41.666 -29.955 1.00 0.00 ? 46 ARG A CZ   1  
ATOM 717   N NH1  . ARG A 1 46 ? -46.811 -41.454 -28.964 1.00 0.00 ? 46 ARG A NH1  1  
ATOM 718   N NH2  . ARG A 1 46 ? -46.453 -41.855 -31.160 1.00 0.00 ? 46 ARG A NH2  1  
ATOM 719   H H    . ARG A 1 46 ? -40.731 -38.041 -29.778 1.00 0.00 ? 46 ARG A H    1  
ATOM 720   H HA   . ARG A 1 46 ? -40.217 -40.764 -29.275 1.00 0.00 ? 46 ARG A HA   1  
ATOM 721   H HB2  . ARG A 1 46 ? -42.032 -39.310 -28.206 1.00 0.00 ? 46 ARG A HB2  1  
ATOM 722   H HB3  . ARG A 1 46 ? -42.986 -39.623 -29.658 1.00 0.00 ? 46 ARG A HB3  1  
ATOM 723   H HG2  . ARG A 1 46 ? -42.215 -42.148 -29.103 1.00 0.00 ? 46 ARG A HG2  1  
ATOM 724   H HG3  . ARG A 1 46 ? -42.197 -41.485 -27.470 1.00 0.00 ? 46 ARG A HG3  1  
ATOM 725   H HD2  . ARG A 1 46 ? -44.400 -42.315 -27.769 1.00 0.00 ? 46 ARG A HD2  1  
ATOM 726   H HD3  . ARG A 1 46 ? -44.538 -40.573 -27.982 1.00 0.00 ? 46 ARG A HD3  1  
ATOM 727   H HE   . ARG A 1 46 ? -44.068 -41.853 -30.487 1.00 0.00 ? 46 ARG A HE   1  
ATOM 728   H HH11 . ARG A 1 46 ? -46.455 -41.310 -28.041 1.00 0.00 ? 46 ARG A HH11 1  
ATOM 729   H HH12 . ARG A 1 46 ? -47.797 -41.435 -29.128 1.00 0.00 ? 46 ARG A HH12 1  
ATOM 730   H HH21 . ARG A 1 46 ? -45.823 -42.018 -31.918 1.00 0.00 ? 46 ARG A HH21 1  
ATOM 731   H HH22 . ARG A 1 46 ? -47.439 -41.837 -31.324 1.00 0.00 ? 46 ARG A HH22 1  
ATOM 732   N N    . ARG A 1 47 ? -41.675 -40.078 -32.142 1.00 0.00 ? 47 ARG A N    1  
ATOM 733   C CA   . ARG A 1 47 ? -42.056 -40.647 -33.434 1.00 0.00 ? 47 ARG A CA   1  
ATOM 734   C C    . ARG A 1 47 ? -40.920 -41.467 -34.038 1.00 0.00 ? 47 ARG A C    1  
ATOM 735   O O    . ARG A 1 47 ? -41.166 -42.437 -34.754 1.00 0.00 ? 47 ARG A O    1  
ATOM 736   C CB   . ARG A 1 47 ? -42.444 -39.548 -34.422 1.00 0.00 ? 47 ARG A CB   1  
ATOM 737   C CG   . ARG A 1 47 ? -43.308 -40.160 -35.530 1.00 0.00 ? 47 ARG A CG   1  
ATOM 738   C CD   . ARG A 1 47 ? -43.037 -39.453 -36.858 1.00 0.00 ? 47 ARG A CD   1  
ATOM 739   N NE   . ARG A 1 47 ? -41.761 -39.897 -37.414 1.00 0.00 ? 47 ARG A NE   1  
ATOM 740   C CZ   . ARG A 1 47 ? -41.229 -39.298 -38.473 1.00 0.00 ? 47 ARG A CZ   1  
ATOM 741   N NH1  . ARG A 1 47 ? -41.847 -38.294 -39.034 1.00 0.00 ? 47 ARG A NH1  1  
ATOM 742   N NH2  . ARG A 1 47 ? -40.088 -39.713 -38.954 1.00 0.00 ? 47 ARG A NH2  1  
ATOM 743   H H    . ARG A 1 47 ? -41.753 -39.114 -32.001 1.00 0.00 ? 47 ARG A H    1  
ATOM 744   H HA   . ARG A 1 47 ? -42.908 -41.294 -33.288 1.00 0.00 ? 47 ARG A HA   1  
ATOM 745   H HB2  . ARG A 1 47 ? -43.002 -38.779 -33.909 1.00 0.00 ? 47 ARG A HB2  1  
ATOM 746   H HB3  . ARG A 1 47 ? -41.553 -39.121 -34.858 1.00 0.00 ? 47 ARG A HB3  1  
ATOM 747   H HG2  . ARG A 1 47 ? -43.073 -41.210 -35.629 1.00 0.00 ? 47 ARG A HG2  1  
ATOM 748   H HG3  . ARG A 1 47 ? -44.351 -40.049 -35.273 1.00 0.00 ? 47 ARG A HG3  1  
ATOM 749   H HD2  . ARG A 1 47 ? -43.829 -39.684 -37.556 1.00 0.00 ? 47 ARG A HD2  1  
ATOM 750   H HD3  . ARG A 1 47 ? -43.007 -38.385 -36.694 1.00 0.00 ? 47 ARG A HD3  1  
ATOM 751   H HE   . ARG A 1 47 ? -41.290 -40.649 -36.998 1.00 0.00 ? 47 ARG A HE   1  
ATOM 752   H HH11 . ARG A 1 47 ? -42.720 -37.975 -38.666 1.00 0.00 ? 47 ARG A HH11 1  
ATOM 753   H HH12 . ARG A 1 47 ? -41.446 -37.842 -39.832 1.00 0.00 ? 47 ARG A HH12 1  
ATOM 754   H HH21 . ARG A 1 47 ? -39.615 -40.481 -38.524 1.00 0.00 ? 47 ARG A HH21 1  
ATOM 755   H HH22 . ARG A 1 47 ? -39.688 -39.261 -39.752 1.00 0.00 ? 47 ARG A HH22 1  
ATOM 756   N N    . PHE A 1 48 ? -39.679 -41.084 -33.758 1.00 0.00 ? 48 PHE A N    1  
ATOM 757   C CA   . PHE A 1 48 ? -38.545 -41.824 -34.306 1.00 0.00 ? 48 PHE A CA   1  
ATOM 758   C C    . PHE A 1 48 ? -38.597 -43.278 -33.850 1.00 0.00 ? 48 PHE A C    1  
ATOM 759   O O    . PHE A 1 48 ? -38.293 -44.187 -34.620 1.00 0.00 ? 48 PHE A O    1  
ATOM 760   C CB   . PHE A 1 48 ? -37.222 -41.188 -33.874 1.00 0.00 ? 48 PHE A CB   1  
ATOM 761   C CG   . PHE A 1 48 ? -36.914 -40.015 -34.773 1.00 0.00 ? 48 PHE A CG   1  
ATOM 762   C CD1  . PHE A 1 48 ? -37.543 -38.786 -34.559 1.00 0.00 ? 48 PHE A CD1  1  
ATOM 763   C CD2  . PHE A 1 48 ? -35.994 -40.158 -35.819 1.00 0.00 ? 48 PHE A CD2  1  
ATOM 764   C CE1  . PHE A 1 48 ? -37.257 -37.697 -35.391 1.00 0.00 ? 48 PHE A CE1  1  
ATOM 765   C CE2  . PHE A 1 48 ? -35.707 -39.070 -36.652 1.00 0.00 ? 48 PHE A CE2  1  
ATOM 766   C CZ   . PHE A 1 48 ? -36.339 -37.839 -36.439 1.00 0.00 ? 48 PHE A CZ   1  
ATOM 767   H H    . PHE A 1 48 ? -39.524 -40.306 -33.184 1.00 0.00 ? 48 PHE A H    1  
ATOM 768   H HA   . PHE A 1 48 ? -38.605 -41.799 -35.384 1.00 0.00 ? 48 PHE A HA   1  
ATOM 769   H HB2  . PHE A 1 48 ? -37.300 -40.851 -32.852 1.00 0.00 ? 48 PHE A HB2  1  
ATOM 770   H HB3  . PHE A 1 48 ? -36.430 -41.918 -33.952 1.00 0.00 ? 48 PHE A HB3  1  
ATOM 771   H HD1  . PHE A 1 48 ? -38.252 -38.679 -33.755 1.00 0.00 ? 48 PHE A HD1  1  
ATOM 772   H HD2  . PHE A 1 48 ? -35.507 -41.108 -35.984 1.00 0.00 ? 48 PHE A HD2  1  
ATOM 773   H HE1  . PHE A 1 48 ? -37.745 -36.747 -35.225 1.00 0.00 ? 48 PHE A HE1  1  
ATOM 774   H HE2  . PHE A 1 48 ? -34.998 -39.181 -37.459 1.00 0.00 ? 48 PHE A HE2  1  
ATOM 775   H HZ   . PHE A 1 48 ? -36.118 -36.999 -37.080 1.00 0.00 ? 48 PHE A HZ   1  
ATOM 776   N N    . ARG A 1 49 ? -39.012 -43.496 -32.607 1.00 0.00 ? 49 ARG A N    1  
ATOM 777   C CA   . ARG A 1 49 ? -39.120 -44.862 -32.109 1.00 0.00 ? 49 ARG A CA   1  
ATOM 778   C C    . ARG A 1 49 ? -40.499 -45.427 -32.440 1.00 0.00 ? 49 ARG A C    1  
ATOM 779   O O    . ARG A 1 49 ? -40.613 -46.488 -33.052 1.00 0.00 ? 49 ARG A O    1  
ATOM 780   C CB   . ARG A 1 49 ? -38.895 -44.905 -30.596 1.00 0.00 ? 49 ARG A CB   1  
ATOM 781   C CG   . ARG A 1 49 ? -37.451 -44.517 -30.280 1.00 0.00 ? 49 ARG A CG   1  
ATOM 782   C CD   . ARG A 1 49 ? -37.216 -44.624 -28.774 1.00 0.00 ? 49 ARG A CD   1  
ATOM 783   N NE   . ARG A 1 49 ? -37.326 -46.015 -28.346 1.00 0.00 ? 49 ARG A NE   1  
ATOM 784   C CZ   . ARG A 1 49 ? -37.332 -46.339 -27.058 1.00 0.00 ? 49 ARG A CZ   1  
ATOM 785   N NH1  . ARG A 1 49 ? -37.245 -45.407 -26.149 1.00 0.00 ? 49 ARG A NH1  1  
ATOM 786   N NH2  . ARG A 1 49 ? -37.427 -47.592 -26.701 1.00 0.00 ? 49 ARG A NH2  1  
ATOM 787   H H    . ARG A 1 49 ? -39.269 -42.726 -32.057 1.00 0.00 ? 49 ARG A H    1  
ATOM 788   H HA   . ARG A 1 49 ? -38.370 -45.467 -32.592 1.00 0.00 ? 49 ARG A HA   1  
ATOM 789   H HB2  . ARG A 1 49 ? -39.569 -44.212 -30.113 1.00 0.00 ? 49 ARG A HB2  1  
ATOM 790   H HB3  . ARG A 1 49 ? -39.086 -45.904 -30.232 1.00 0.00 ? 49 ARG A HB3  1  
ATOM 791   H HG2  . ARG A 1 49 ? -36.777 -45.184 -30.799 1.00 0.00 ? 49 ARG A HG2  1  
ATOM 792   H HG3  . ARG A 1 49 ? -37.272 -43.502 -30.600 1.00 0.00 ? 49 ARG A HG3  1  
ATOM 793   H HD2  . ARG A 1 49 ? -36.230 -44.256 -28.538 1.00 0.00 ? 49 ARG A HD2  1  
ATOM 794   H HD3  . ARG A 1 49 ? -37.953 -44.028 -28.254 1.00 0.00 ? 49 ARG A HD3  1  
ATOM 795   H HE   . ARG A 1 49 ? -37.394 -46.722 -29.021 1.00 0.00 ? 49 ARG A HE   1  
ATOM 796   H HH11 . ARG A 1 49 ? -37.173 -44.448 -26.423 1.00 0.00 ? 49 ARG A HH11 1  
ATOM 797   H HH12 . ARG A 1 49 ? -37.249 -45.651 -25.179 1.00 0.00 ? 49 ARG A HH12 1  
ATOM 798   H HH21 . ARG A 1 49 ? -37.495 -48.306 -27.397 1.00 0.00 ? 49 ARG A HH21 1  
ATOM 799   H HH22 . ARG A 1 49 ? -37.431 -47.836 -25.731 1.00 0.00 ? 49 ARG A HH22 1  
ATOM 800   N N    . SER A 1 50 ? -41.543 -44.712 -32.030 1.00 0.00 ? 50 SER A N    1  
ATOM 801   C CA   . SER A 1 50 ? -42.907 -45.159 -32.292 1.00 0.00 ? 50 SER A CA   1  
ATOM 802   C C    . SER A 1 50 ? -43.246 -45.011 -33.772 1.00 0.00 ? 50 SER A C    1  
ATOM 803   O O    . SER A 1 50 ? -42.880 -44.022 -34.406 1.00 0.00 ? 50 SER A O    1  
ATOM 804   C CB   . SER A 1 50 ? -43.893 -44.341 -31.457 1.00 0.00 ? 50 SER A CB   1  
ATOM 805   O OG   . SER A 1 50 ? -43.651 -44.583 -30.078 1.00 0.00 ? 50 SER A OG   1  
ATOM 806   H H    . SER A 1 50 ? -41.391 -43.892 -31.516 1.00 0.00 ? 50 SER A H    1  
ATOM 807   H HA   . SER A 1 50 ? -42.994 -46.199 -32.015 1.00 0.00 ? 50 SER A HA   1  
ATOM 808   H HB2  . SER A 1 50 ? -43.760 -43.293 -31.663 1.00 0.00 ? 50 SER A HB2  1  
ATOM 809   H HB3  . SER A 1 50 ? -44.905 -44.631 -31.711 1.00 0.00 ? 50 SER A HB3  1  
ATOM 810   H HG   . SER A 1 50 ? -42.901 -45.177 -30.007 1.00 0.00 ? 50 SER A HG   1  
ATOM 811   N N    . GLY A 1 51 ? -43.944 -46.000 -34.319 1.00 0.00 ? 51 GLY A N    1  
ATOM 812   C CA   . GLY A 1 51 ? -44.320 -45.964 -35.727 1.00 0.00 ? 51 GLY A CA   1  
ATOM 813   C C    . GLY A 1 51 ? -45.018 -47.254 -36.139 1.00 0.00 ? 51 GLY A C    1  
ATOM 814   O O    . GLY A 1 51 ? -45.339 -48.095 -35.299 1.00 0.00 ? 51 GLY A O    1  
ATOM 815   H H    . GLY A 1 51 ? -44.207 -46.768 -33.770 1.00 0.00 ? 51 GLY A H    1  
ATOM 816   H HA2  . GLY A 1 51 ? -44.986 -45.129 -35.894 1.00 0.00 ? 51 GLY A HA2  1  
ATOM 817   H HA3  . GLY A 1 51 ? -43.433 -45.836 -36.328 1.00 0.00 ? 51 GLY A HA3  1  
ATOM 818   N N    . GLY A 1 52 ? -45.242 -47.407 -37.440 1.00 0.00 ? 52 GLY A N    1  
ATOM 819   C CA   . GLY A 1 52 ? -45.892 -48.602 -37.964 1.00 0.00 ? 52 GLY A CA   1  
ATOM 820   C C    . GLY A 1 52 ? -44.864 -49.538 -38.590 1.00 0.00 ? 52 GLY A C    1  
ATOM 821   O O    . GLY A 1 52 ? -45.216 -50.478 -39.301 1.00 0.00 ? 52 GLY A O    1  
ATOM 822   H H    . GLY A 1 52 ? -44.951 -46.710 -38.065 1.00 0.00 ? 52 GLY A H    1  
ATOM 823   H HA2  . GLY A 1 52 ? -46.399 -49.113 -37.159 1.00 0.00 ? 52 GLY A HA2  1  
ATOM 824   H HA3  . GLY A 1 52 ? -46.613 -48.315 -38.716 1.00 0.00 ? 52 GLY A HA3  1  
ATOM 825   N N    . ASN A 1 53 ? -43.591 -49.273 -38.312 1.00 0.00 ? 53 ASN A N    1  
ATOM 826   C CA   . ASN A 1 53 ? -42.509 -50.096 -38.842 1.00 0.00 ? 53 ASN A CA   1  
ATOM 827   C C    . ASN A 1 53 ? -41.515 -50.448 -37.740 1.00 0.00 ? 53 ASN A C    1  
ATOM 828   O O    . ASN A 1 53 ? -40.343 -50.710 -38.010 1.00 0.00 ? 53 ASN A O    1  
ATOM 829   C CB   . ASN A 1 53 ? -41.788 -49.351 -39.966 1.00 0.00 ? 53 ASN A CB   1  
ATOM 830   C CG   . ASN A 1 53 ? -42.690 -49.256 -41.192 1.00 0.00 ? 53 ASN A CG   1  
ATOM 831   O OD1  . ASN A 1 53 ? -43.632 -50.035 -41.332 1.00 0.00 ? 53 ASN A OD1  1  
ATOM 832   N ND2  . ASN A 1 53 ? -42.456 -48.342 -42.094 1.00 0.00 ? 53 ASN A ND2  1  
ATOM 833   H H    . ASN A 1 53 ? -43.375 -48.522 -37.721 1.00 0.00 ? 53 ASN A H    1  
ATOM 834   H HA   . ASN A 1 53 ? -42.926 -51.009 -39.241 1.00 0.00 ? 53 ASN A HA   1  
ATOM 835   H HB2  . ASN A 1 53 ? -41.533 -48.356 -39.630 1.00 0.00 ? 53 ASN A HB2  1  
ATOM 836   H HB3  . ASN A 1 53 ? -40.885 -49.883 -40.227 1.00 0.00 ? 53 ASN A HB3  1  
ATOM 837   H HD21 . ASN A 1 53 ? -41.705 -47.722 -41.981 1.00 0.00 ? 53 ASN A HD21 1  
ATOM 838   H HD22 . ASN A 1 53 ? -43.031 -48.275 -42.884 1.00 0.00 ? 53 ASN A HD22 1  
ATOM 839   N N    . LYS A 1 54 ? -41.986 -50.446 -36.496 1.00 0.00 ? 54 LYS A N    1  
ATOM 840   C CA   . LYS A 1 54 ? -41.121 -50.759 -35.362 1.00 0.00 ? 54 LYS A CA   1  
ATOM 841   C C    . LYS A 1 54 ? -39.764 -50.079 -35.531 1.00 0.00 ? 54 LYS A C    1  
ATOM 842   O O    . LYS A 1 54 ? -38.791 -50.708 -35.945 1.00 0.00 ? 54 LYS A O    1  
ATOM 843   C CB   . LYS A 1 54 ? -40.934 -52.275 -35.247 1.00 0.00 ? 54 LYS A CB   1  
ATOM 844   C CG   . LYS A 1 54 ? -40.082 -52.601 -34.015 1.00 0.00 ? 54 LYS A CG   1  
ATOM 845   C CD   . LYS A 1 54 ? -39.944 -54.117 -33.874 1.00 0.00 ? 54 LYS A CD   1  
ATOM 846   C CE   . LYS A 1 54 ? -39.034 -54.438 -32.687 1.00 0.00 ? 54 LYS A CE   1  
ATOM 847   N NZ   . LYS A 1 54 ? -39.651 -53.917 -31.434 1.00 0.00 ? 54 LYS A NZ   1  
ATOM 848   H H    . LYS A 1 54 ? -42.927 -50.227 -36.335 1.00 0.00 ? 54 LYS A H    1  
ATOM 849   H HA   . LYS A 1 54 ? -41.585 -50.395 -34.457 1.00 0.00 ? 54 LYS A HA   1  
ATOM 850   H HB2  . LYS A 1 54 ? -41.900 -52.750 -35.152 1.00 0.00 ? 54 LYS A HB2  1  
ATOM 851   H HB3  . LYS A 1 54 ? -40.439 -52.645 -36.132 1.00 0.00 ? 54 LYS A HB3  1  
ATOM 852   H HG2  . LYS A 1 54 ? -39.103 -52.160 -34.125 1.00 0.00 ? 54 LYS A HG2  1  
ATOM 853   H HG3  . LYS A 1 54 ? -40.560 -52.202 -33.132 1.00 0.00 ? 54 LYS A HG3  1  
ATOM 854   H HD2  . LYS A 1 54 ? -40.920 -54.554 -33.711 1.00 0.00 ? 54 LYS A HD2  1  
ATOM 855   H HD3  . LYS A 1 54 ? -39.513 -54.526 -34.777 1.00 0.00 ? 54 LYS A HD3  1  
ATOM 856   H HE2  . LYS A 1 54 ? -38.908 -55.508 -32.609 1.00 0.00 ? 54 LYS A HE2  1  
ATOM 857   H HE3  . LYS A 1 54 ? -38.071 -53.971 -32.835 1.00 0.00 ? 54 LYS A HE3  1  
ATOM 858   H HZ1  . LYS A 1 54 ? -40.513 -53.386 -31.666 1.00 0.00 ? 54 LYS A HZ1  1  
ATOM 859   H HZ2  . LYS A 1 54 ? -38.976 -53.291 -30.950 1.00 0.00 ? 54 LYS A HZ2  1  
ATOM 860   H HZ3  . LYS A 1 54 ? -39.894 -54.713 -30.811 1.00 0.00 ? 54 LYS A HZ3  1  
ATOM 861   N N    . LYS A 1 55 ? -39.709 -48.791 -35.205 1.00 0.00 ? 55 LYS A N    1  
ATOM 862   C CA   . LYS A 1 55 ? -38.466 -48.038 -35.321 1.00 0.00 ? 55 LYS A CA   1  
ATOM 863   C C    . LYS A 1 55 ? -37.794 -47.897 -33.959 1.00 0.00 ? 55 LYS A C    1  
ATOM 864   O O    . LYS A 1 55 ? -36.703 -47.336 -33.850 1.00 0.00 ? 55 LYS A O    1  
ATOM 865   C CB   . LYS A 1 55 ? -38.747 -46.648 -35.896 1.00 0.00 ? 55 LYS A CB   1  
ATOM 866   C CG   . LYS A 1 55 ? -39.317 -46.780 -37.309 1.00 0.00 ? 55 LYS A CG   1  
ATOM 867   C CD   . LYS A 1 55 ? -39.581 -45.387 -37.883 1.00 0.00 ? 55 LYS A CD   1  
ATOM 868   C CE   . LYS A 1 55 ? -40.202 -45.515 -39.275 1.00 0.00 ? 55 LYS A CE   1  
ATOM 869   N NZ   . LYS A 1 55 ? -39.243 -46.202 -40.186 1.00 0.00 ? 55 LYS A NZ   1  
ATOM 870   H H    . LYS A 1 55 ? -40.517 -48.345 -34.876 1.00 0.00 ? 55 LYS A H    1  
ATOM 871   H HA   . LYS A 1 55 ? -37.800 -48.562 -35.990 1.00 0.00 ? 55 LYS A HA   1  
ATOM 872   H HB2  . LYS A 1 55 ? -39.460 -46.136 -35.266 1.00 0.00 ? 55 LYS A HB2  1  
ATOM 873   H HB3  . LYS A 1 55 ? -37.828 -46.083 -35.934 1.00 0.00 ? 55 LYS A HB3  1  
ATOM 874   H HG2  . LYS A 1 55 ? -38.609 -47.302 -37.936 1.00 0.00 ? 55 LYS A HG2  1  
ATOM 875   H HG3  . LYS A 1 55 ? -40.244 -47.334 -37.273 1.00 0.00 ? 55 LYS A HG3  1  
ATOM 876   H HD2  . LYS A 1 55 ? -40.260 -44.852 -37.234 1.00 0.00 ? 55 LYS A HD2  1  
ATOM 877   H HD3  . LYS A 1 55 ? -38.651 -44.845 -37.955 1.00 0.00 ? 55 LYS A HD3  1  
ATOM 878   H HE2  . LYS A 1 55 ? -41.113 -46.090 -39.212 1.00 0.00 ? 55 LYS A HE2  1  
ATOM 879   H HE3  . LYS A 1 55 ? -40.423 -44.531 -39.663 1.00 0.00 ? 55 LYS A HE3  1  
ATOM 880   H HZ1  . LYS A 1 55 ? -38.362 -45.653 -40.240 1.00 0.00 ? 55 LYS A HZ1  1  
ATOM 881   H HZ2  . LYS A 1 55 ? -39.663 -46.282 -41.135 1.00 0.00 ? 55 LYS A HZ2  1  
ATOM 882   H HZ3  . LYS A 1 55 ? -39.035 -47.153 -39.817 1.00 0.00 ? 55 LYS A HZ3  1  
ATOM 883   N N    . ARG A 1 56 ? -38.454 -48.403 -32.922 1.00 0.00 ? 56 ARG A N    1  
ATOM 884   C CA   . ARG A 1 56 ? -37.910 -48.320 -31.570 1.00 0.00 ? 56 ARG A CA   1  
ATOM 885   C C    . ARG A 1 56 ? -36.697 -49.229 -31.411 1.00 0.00 ? 56 ARG A C    1  
ATOM 886   O O    . ARG A 1 56 ? -35.834 -48.977 -30.569 1.00 0.00 ? 56 ARG A O    1  
ATOM 887   C CB   . ARG A 1 56 ? -38.990 -48.698 -30.549 1.00 0.00 ? 56 ARG A CB   1  
ATOM 888   C CG   . ARG A 1 56 ? -39.371 -50.173 -30.706 1.00 0.00 ? 56 ARG A CG   1  
ATOM 889   C CD   . ARG A 1 56 ? -40.524 -50.502 -29.756 1.00 0.00 ? 56 ARG A CD   1  
ATOM 890   N NE   . ARG A 1 56 ? -40.892 -51.908 -29.874 1.00 0.00 ? 56 ARG A NE   1  
ATOM 891   C CZ   . ARG A 1 56 ? -41.900 -52.417 -29.175 1.00 0.00 ? 56 ARG A CZ   1  
ATOM 892   N NH1  . ARG A 1 56 ? -42.583 -51.654 -28.365 1.00 0.00 ? 56 ARG A NH1  1  
ATOM 893   N NH2  . ARG A 1 56 ? -42.210 -53.679 -29.299 1.00 0.00 ? 56 ARG A NH2  1  
ATOM 894   H H    . ARG A 1 56 ? -39.321 -48.834 -33.067 1.00 0.00 ? 56 ARG A H    1  
ATOM 895   H HA   . ARG A 1 56 ? -37.603 -47.303 -31.383 1.00 0.00 ? 56 ARG A HA   1  
ATOM 896   H HB2  . ARG A 1 56 ? -38.613 -48.528 -29.552 1.00 0.00 ? 56 ARG A HB2  1  
ATOM 897   H HB3  . ARG A 1 56 ? -39.865 -48.085 -30.710 1.00 0.00 ? 56 ARG A HB3  1  
ATOM 898   H HG2  . ARG A 1 56 ? -39.677 -50.360 -31.725 1.00 0.00 ? 56 ARG A HG2  1  
ATOM 899   H HG3  . ARG A 1 56 ? -38.523 -50.796 -30.464 1.00 0.00 ? 56 ARG A HG3  1  
ATOM 900   H HD2  . ARG A 1 56 ? -40.220 -50.299 -28.740 1.00 0.00 ? 56 ARG A HD2  1  
ATOM 901   H HD3  . ARG A 1 56 ? -41.376 -49.886 -30.003 1.00 0.00 ? 56 ARG A HD3  1  
ATOM 902   H HE   . ARG A 1 56 ? -40.386 -52.488 -30.480 1.00 0.00 ? 56 ARG A HE   1  
ATOM 903   H HH11 . ARG A 1 56 ? -42.345 -50.687 -28.269 1.00 0.00 ? 56 ARG A HH11 1  
ATOM 904   H HH12 . ARG A 1 56 ? -43.342 -52.037 -27.838 1.00 0.00 ? 56 ARG A HH12 1  
ATOM 905   H HH21 . ARG A 1 56 ? -41.688 -54.263 -29.919 1.00 0.00 ? 56 ARG A HH21 1  
ATOM 906   H HH22 . ARG A 1 56 ? -42.970 -54.061 -28.772 1.00 0.00 ? 56 ARG A HH22 1  
ATOM 907   N N    . ARG A 1 57 ? -36.633 -50.277 -32.228 1.00 0.00 ? 57 ARG A N    1  
ATOM 908   C CA   . ARG A 1 57 ? -35.517 -51.217 -32.176 1.00 0.00 ? 57 ARG A CA   1  
ATOM 909   C C    . ARG A 1 57 ? -35.089 -51.450 -30.728 1.00 0.00 ? 57 ARG A C    1  
ATOM 910   O O    . ARG A 1 57 ? -33.923 -51.267 -30.376 1.00 0.00 ? 57 ARG A O    1  
ATOM 911   C CB   . ARG A 1 57 ? -34.339 -50.668 -32.986 1.00 0.00 ? 57 ARG A CB   1  
ATOM 912   C CG   . ARG A 1 57 ? -33.312 -51.779 -33.232 1.00 0.00 ? 57 ARG A CG   1  
ATOM 913   C CD   . ARG A 1 57 ? -32.077 -51.188 -33.914 1.00 0.00 ? 57 ARG A CD   1  
ATOM 914   N NE   . ARG A 1 57 ? -31.360 -50.317 -32.989 1.00 0.00 ? 57 ARG A NE   1  
ATOM 915   C CZ   . ARG A 1 57 ? -30.338 -49.572 -33.399 1.00 0.00 ? 57 ARG A CZ   1  
ATOM 916   N NH1  . ARG A 1 57 ? -29.960 -49.612 -34.648 1.00 0.00 ? 57 ARG A NH1  1  
ATOM 917   N NH2  . ARG A 1 57 ? -29.712 -48.801 -32.551 1.00 0.00 ? 57 ARG A NH2  1  
ATOM 918   H H    . ARG A 1 57 ? -37.348 -50.420 -32.883 1.00 0.00 ? 57 ARG A H    1  
ATOM 919   H HA   . ARG A 1 57 ? -35.829 -52.158 -32.605 1.00 0.00 ? 57 ARG A HA   1  
ATOM 920   H HB2  . ARG A 1 57 ? -34.699 -50.296 -33.934 1.00 0.00 ? 57 ARG A HB2  1  
ATOM 921   H HB3  . ARG A 1 57 ? -33.871 -49.864 -32.438 1.00 0.00 ? 57 ARG A HB3  1  
ATOM 922   H HG2  . ARG A 1 57 ? -33.026 -52.225 -32.293 1.00 0.00 ? 57 ARG A HG2  1  
ATOM 923   H HG3  . ARG A 1 57 ? -33.746 -52.532 -33.872 1.00 0.00 ? 57 ARG A HG3  1  
ATOM 924   H HD2  . ARG A 1 57 ? -31.425 -51.987 -34.228 1.00 0.00 ? 57 ARG A HD2  1  
ATOM 925   H HD3  . ARG A 1 57 ? -32.385 -50.618 -34.778 1.00 0.00 ? 57 ARG A HD3  1  
ATOM 926   H HE   . ARG A 1 57 ? -31.635 -50.281 -32.049 1.00 0.00 ? 57 ARG A HE   1  
ATOM 927   H HH11 . ARG A 1 57 ? -30.439 -50.204 -35.296 1.00 0.00 ? 57 ARG A HH11 1  
ATOM 928   H HH12 . ARG A 1 57 ? -29.191 -49.052 -34.955 1.00 0.00 ? 57 ARG A HH12 1  
ATOM 929   H HH21 . ARG A 1 57 ? -30.002 -48.771 -31.595 1.00 0.00 ? 57 ARG A HH21 1  
ATOM 930   H HH22 . ARG A 1 57 ? -28.944 -48.240 -32.860 1.00 0.00 ? 57 ARG A HH22 1  
ATOM 931   N N    . GLN A 1 58 ? -36.046 -51.840 -29.891 1.00 0.00 ? 58 GLN A N    1  
ATOM 932   C CA   . GLN A 1 58 ? -35.761 -52.083 -28.481 1.00 0.00 ? 58 GLN A CA   1  
ATOM 933   C C    . GLN A 1 58 ? -36.417 -53.380 -28.016 1.00 0.00 ? 58 GLN A C    1  
ATOM 934   O O    . GLN A 1 58 ? -37.600 -53.611 -28.261 1.00 0.00 ? 58 GLN A O    1  
ATOM 935   C CB   . GLN A 1 58 ? -36.280 -50.911 -27.638 1.00 0.00 ? 58 GLN A CB   1  
ATOM 936   C CG   . GLN A 1 58 ? -35.859 -51.084 -26.174 1.00 0.00 ? 58 GLN A CG   1  
ATOM 937   C CD   . GLN A 1 58 ? -34.339 -51.049 -26.049 1.00 0.00 ? 58 GLN A CD   1  
ATOM 938   O OE1  . GLN A 1 58 ? -33.702 -50.085 -26.473 1.00 0.00 ? 58 GLN A OE1  1  
ATOM 939   N NE2  . GLN A 1 58 ? -33.716 -52.050 -25.490 1.00 0.00 ? 58 GLN A NE2  1  
ATOM 940   H H    . GLN A 1 58 ? -36.959 -51.960 -30.226 1.00 0.00 ? 58 GLN A H    1  
ATOM 941   H HA   . GLN A 1 58 ? -34.695 -52.164 -28.349 1.00 0.00 ? 58 GLN A HA   1  
ATOM 942   H HB2  . GLN A 1 58 ? -35.873 -49.988 -28.022 1.00 0.00 ? 58 GLN A HB2  1  
ATOM 943   H HB3  . GLN A 1 58 ? -37.358 -50.879 -27.697 1.00 0.00 ? 58 GLN A HB3  1  
ATOM 944   H HG2  . GLN A 1 58 ? -36.282 -50.283 -25.585 1.00 0.00 ? 58 GLN A HG2  1  
ATOM 945   H HG3  . GLN A 1 58 ? -36.225 -52.029 -25.802 1.00 0.00 ? 58 GLN A HG3  1  
ATOM 946   H HE21 . GLN A 1 58 ? -34.225 -52.816 -25.152 1.00 0.00 ? 58 GLN A HE21 1  
ATOM 947   H HE22 . GLN A 1 58 ? -32.740 -52.036 -25.407 1.00 0.00 ? 58 GLN A HE22 1  
ATOM 948   N N    . ILE A 1 59 ? -35.639 -54.218 -27.340 1.00 0.00 ? 59 ILE A N    1  
ATOM 949   C CA   . ILE A 1 59 ? -36.151 -55.487 -26.837 1.00 0.00 ? 59 ILE A CA   1  
ATOM 950   C C    . ILE A 1 59 ? -35.544 -55.795 -25.473 1.00 0.00 ? 59 ILE A C    1  
ATOM 951   O O    . ILE A 1 59 ? -34.344 -55.612 -25.265 1.00 0.00 ? 59 ILE A O    1  
ATOM 952   C CB   . ILE A 1 59 ? -35.814 -56.612 -27.817 1.00 0.00 ? 59 ILE A CB   1  
ATOM 953   C CG1  . ILE A 1 59 ? -36.485 -57.908 -27.356 1.00 0.00 ? 59 ILE A CG1  1  
ATOM 954   C CG2  . ILE A 1 59 ? -34.298 -56.813 -27.861 1.00 0.00 ? 59 ILE A CG2  1  
ATOM 955   C CD1  . ILE A 1 59 ? -36.407 -58.950 -28.473 1.00 0.00 ? 59 ILE A CD1  1  
ATOM 956   H H    . ILE A 1 59 ? -34.704 -53.977 -27.171 1.00 0.00 ? 59 ILE A H    1  
ATOM 957   H HA   . ILE A 1 59 ? -37.224 -55.418 -26.738 1.00 0.00 ? 59 ILE A HA   1  
ATOM 958   H HB   . ILE A 1 59 ? -36.171 -56.350 -28.802 1.00 0.00 ? 59 ILE A HB   1  
ATOM 959   H HG12 . ILE A 1 59 ? -35.979 -58.282 -26.478 1.00 0.00 ? 59 ILE A HG12 1  
ATOM 960   H HG13 . ILE A 1 59 ? -37.521 -57.714 -27.119 1.00 0.00 ? 59 ILE A HG13 1  
ATOM 961   H HG21 . ILE A 1 59 ? -34.035 -57.369 -28.748 1.00 0.00 ? 59 ILE A HG21 1  
ATOM 962   H HG22 . ILE A 1 59 ? -33.982 -57.360 -26.985 1.00 0.00 ? 59 ILE A HG22 1  
ATOM 963   H HG23 . ILE A 1 59 ? -33.809 -55.850 -27.881 1.00 0.00 ? 59 ILE A HG23 1  
ATOM 964   H HD11 . ILE A 1 59 ? -35.403 -58.975 -28.872 1.00 0.00 ? 59 ILE A HD11 1  
ATOM 965   H HD12 . ILE A 1 59 ? -37.099 -58.687 -29.260 1.00 0.00 ? 59 ILE A HD12 1  
ATOM 966   H HD13 . ILE A 1 59 ? -36.662 -59.922 -28.078 1.00 0.00 ? 59 ILE A HD13 1  
ATOM 967   N N    . ASN A 1 60 ? -36.378 -56.261 -24.547 1.00 0.00 ? 60 ASN A N    1  
ATOM 968   C CA   . ASN A 1 60 ? -35.909 -56.589 -23.204 1.00 0.00 ? 60 ASN A CA   1  
ATOM 969   C C    . ASN A 1 60 ? -35.889 -58.100 -22.995 1.00 0.00 ? 60 ASN A C    1  
ATOM 970   O O    . ASN A 1 60 ? -36.897 -58.776 -23.201 1.00 0.00 ? 60 ASN A O    1  
ATOM 971   C CB   . ASN A 1 60 ? -36.824 -55.942 -22.162 1.00 0.00 ? 60 ASN A CB   1  
ATOM 972   C CG   . ASN A 1 60 ? -36.799 -54.426 -22.317 1.00 0.00 ? 60 ASN A CG   1  
ATOM 973   O OD1  . ASN A 1 60 ? -35.739 -53.840 -22.534 1.00 0.00 ? 60 ASN A OD1  1  
ATOM 974   N ND2  . ASN A 1 60 ? -37.912 -53.751 -22.215 1.00 0.00 ? 60 ASN A ND2  1  
ATOM 975   H H    . ASN A 1 60 ? -37.324 -56.386 -24.769 1.00 0.00 ? 60 ASN A H    1  
ATOM 976   H HA   . ASN A 1 60 ? -34.909 -56.205 -23.074 1.00 0.00 ? 60 ASN A HA   1  
ATOM 977   H HB2  . ASN A 1 60 ? -37.833 -56.301 -22.300 1.00 0.00 ? 60 ASN A HB2  1  
ATOM 978   H HB3  . ASN A 1 60 ? -36.482 -56.206 -21.173 1.00 0.00 ? 60 ASN A HB3  1  
ATOM 979   H HD21 . ASN A 1 60 ? -38.755 -54.219 -22.041 1.00 0.00 ? 60 ASN A HD21 1  
ATOM 980   H HD22 . ASN A 1 60 ? -37.904 -52.775 -22.313 1.00 0.00 ? 60 ASN A HD22 1  
ATOM 981   N N    . GLU A 1 61 ? -34.736 -58.619 -22.583 1.00 0.00 ? 61 GLU A N    1  
ATOM 982   C CA   . GLU A 1 61 ? -34.591 -60.051 -22.343 1.00 0.00 ? 61 GLU A CA   1  
ATOM 983   C C    . GLU A 1 61 ? -33.946 -60.301 -20.983 1.00 0.00 ? 61 GLU A C    1  
ATOM 984   O O    . GLU A 1 61 ? -33.110 -59.519 -20.530 1.00 0.00 ? 61 GLU A O    1  
ATOM 985   C CB   . GLU A 1 61 ? -33.729 -60.680 -23.440 1.00 0.00 ? 61 GLU A CB   1  
ATOM 986   C CG   . GLU A 1 61 ? -34.455 -60.580 -24.782 1.00 0.00 ? 61 GLU A CG   1  
ATOM 987   C CD   . GLU A 1 61 ? -33.589 -61.171 -25.889 1.00 0.00 ? 61 GLU A CD   1  
ATOM 988   O OE1  . GLU A 1 61 ? -32.452 -61.510 -25.607 1.00 0.00 ? 61 GLU A OE1  1  
ATOM 989   O OE2  . GLU A 1 61 ? -34.076 -61.275 -27.003 1.00 0.00 ? 61 GLU A OE2  1  
ATOM 990   H H    . GLU A 1 61 ? -33.967 -58.029 -22.435 1.00 0.00 ? 61 GLU A H    1  
ATOM 991   H HA   . GLU A 1 61 ? -35.566 -60.513 -22.358 1.00 0.00 ? 61 GLU A HA   1  
ATOM 992   H HB2  . GLU A 1 61 ? -32.785 -60.157 -23.500 1.00 0.00 ? 61 GLU A HB2  1  
ATOM 993   H HB3  . GLU A 1 61 ? -33.551 -61.719 -23.207 1.00 0.00 ? 61 GLU A HB3  1  
ATOM 994   H HG2  . GLU A 1 61 ? -35.387 -61.125 -24.727 1.00 0.00 ? 61 GLU A HG2  1  
ATOM 995   H HG3  . GLU A 1 61 ? -34.659 -59.543 -25.002 1.00 0.00 ? 61 GLU A HG3  1  
ATOM 996   N N    . ASP A 1 62 ? -34.339 -61.393 -20.338 1.00 0.00 ? 62 ASP A N    1  
ATOM 997   C CA   . ASP A 1 62 ? -33.790 -61.733 -19.029 1.00 0.00 ? 62 ASP A CA   1  
ATOM 998   C C    . ASP A 1 62 ? -32.608 -62.685 -19.176 1.00 0.00 ? 62 ASP A C    1  
ATOM 999   O O    . ASP A 1 62 ? -32.666 -63.647 -19.943 1.00 0.00 ? 62 ASP A O    1  
ATOM 1000  C CB   . ASP A 1 62 ? -34.869 -62.384 -18.162 1.00 0.00 ? 62 ASP A CB   1  
ATOM 1001  C CG   . ASP A 1 62 ? -35.905 -61.342 -17.751 1.00 0.00 ? 62 ASP A CG   1  
ATOM 1002  O OD1  . ASP A 1 62 ? -35.631 -60.165 -17.921 1.00 0.00 ? 62 ASP A OD1  1  
ATOM 1003  O OD2  . ASP A 1 62 ? -36.955 -61.737 -17.271 1.00 0.00 ? 62 ASP A OD2  1  
ATOM 1004  H H    . ASP A 1 62 ? -35.009 -61.981 -20.746 1.00 0.00 ? 62 ASP A H    1  
ATOM 1005  H HA   . ASP A 1 62 ? -33.453 -60.829 -18.546 1.00 0.00 ? 62 ASP A HA   1  
ATOM 1006  H HB2  . ASP A 1 62 ? -35.354 -63.169 -18.724 1.00 0.00 ? 62 ASP A HB2  1  
ATOM 1007  H HB3  . ASP A 1 62 ? -34.413 -62.804 -17.279 1.00 0.00 ? 62 ASP A HB3  1  
ATOM 1008  N N    . GLU A 1 63 ? -31.538 -62.412 -18.437 1.00 0.00 ? 63 GLU A N    1  
ATOM 1009  C CA   . GLU A 1 63 ? -30.350 -63.255 -18.493 1.00 0.00 ? 63 GLU A CA   1  
ATOM 1010  C C    . GLU A 1 63 ? -30.627 -64.607 -17.829 1.00 0.00 ? 63 GLU A C    1  
ATOM 1011  O O    . GLU A 1 63 ? -31.428 -64.685 -16.897 1.00 0.00 ? 63 GLU A O    1  
ATOM 1012  C CB   . GLU A 1 63 ? -29.185 -62.558 -17.778 1.00 0.00 ? 63 GLU A CB   1  
ATOM 1013  C CG   . GLU A 1 63 ? -28.742 -61.333 -18.583 1.00 0.00 ? 63 GLU A CG   1  
ATOM 1014  C CD   . GLU A 1 63 ? -29.815 -60.251 -18.531 1.00 0.00 ? 63 GLU A CD   1  
ATOM 1015  O OE1  . GLU A 1 63 ? -30.617 -60.282 -17.612 1.00 0.00 ? 63 GLU A OE1  1  
ATOM 1016  O OE2  . GLU A 1 63 ? -29.819 -59.405 -19.410 1.00 0.00 ? 63 GLU A OE2  1  
ATOM 1017  H H    . GLU A 1 63 ? -31.551 -61.635 -17.843 1.00 0.00 ? 63 GLU A H    1  
ATOM 1018  H HA   . GLU A 1 63 ? -30.086 -63.406 -19.527 1.00 0.00 ? 63 GLU A HA   1  
ATOM 1019  H HB2  . GLU A 1 63 ? -29.507 -62.243 -16.795 1.00 0.00 ? 63 GLU A HB2  1  
ATOM 1020  H HB3  . GLU A 1 63 ? -28.358 -63.242 -17.681 1.00 0.00 ? 63 GLU A HB3  1  
ATOM 1021  H HG2  . GLU A 1 63 ? -27.823 -60.947 -18.167 1.00 0.00 ? 63 GLU A HG2  1  
ATOM 1022  H HG3  . GLU A 1 63 ? -28.575 -61.620 -19.611 1.00 0.00 ? 63 GLU A HG3  1  
ATOM 1023  N N    . PRO A 1 64 ? -29.990 -65.669 -18.274 1.00 0.00 ? 64 PRO A N    1  
ATOM 1024  C CA   . PRO A 1 64 ? -30.198 -67.025 -17.685 1.00 0.00 ? 64 PRO A CA   1  
ATOM 1025  C C    . PRO A 1 64 ? -29.615 -67.132 -16.278 1.00 0.00 ? 64 PRO A C    1  
ATOM 1026  O O    . PRO A 1 64 ? -29.303 -66.101 -15.706 1.00 0.00 ? 64 PRO A O    1  
ATOM 1027  C CB   . PRO A 1 64 ? -29.471 -67.963 -18.649 1.00 0.00 ? 64 PRO A CB   1  
ATOM 1028  C CG   . PRO A 1 64 ? -28.444 -67.118 -19.325 1.00 0.00 ? 64 PRO A CG   1  
ATOM 1029  C CD   . PRO A 1 64 ? -29.013 -65.701 -19.379 1.00 0.00 ? 64 PRO A CD   1  
ATOM 1030  O OXT  . PRO A 1 64 ? -29.490 -68.246 -15.794 1.00 0.00 ? 64 PRO A OXT  1  
ATOM 1031  H HA   . PRO A 1 64 ? -31.248 -67.266 -17.671 1.00 0.00 ? 64 PRO A HA   1  
ATOM 1032  H HB2  . PRO A 1 64 ? -28.997 -68.767 -18.101 1.00 0.00 ? 64 PRO A HB2  1  
ATOM 1033  H HB3  . PRO A 1 64 ? -30.160 -68.360 -19.378 1.00 0.00 ? 64 PRO A HB3  1  
ATOM 1034  H HG2  . PRO A 1 64 ? -27.523 -67.131 -18.757 1.00 0.00 ? 64 PRO A HG2  1  
ATOM 1035  H HG3  . PRO A 1 64 ? -28.268 -67.477 -20.327 1.00 0.00 ? 64 PRO A HG3  1  
ATOM 1036  H HD2  . PRO A 1 64 ? -28.229 -64.976 -19.221 1.00 0.00 ? 64 PRO A HD2  1  
ATOM 1037  H HD3  . PRO A 1 64 ? -29.509 -65.529 -20.321 1.00 0.00 ? 64 PRO A HD3  1  
ATOM 1038  N N    . LEU A 1 1  ? -20.588 -10.776 -8.307  1.00 0.00 ? 1  LEU A N    2  
ATOM 1039  C CA   . LEU A 1 1  ? -19.312 -10.064 -8.602  1.00 0.00 ? 1  LEU A CA   2  
ATOM 1040  C C    . LEU A 1 1  ? -18.833 -10.452 -9.997  1.00 0.00 ? 1  LEU A C    2  
ATOM 1041  O O    . LEU A 1 1  ? -18.852 -9.636  -10.919 1.00 0.00 ? 1  LEU A O    2  
ATOM 1042  C CB   . LEU A 1 1  ? -18.258 -10.457 -7.560  1.00 0.00 ? 1  LEU A CB   2  
ATOM 1043  C CG   . LEU A 1 1  ? -17.698 -9.208  -6.868  1.00 0.00 ? 1  LEU A CG   2  
ATOM 1044  C CD1  . LEU A 1 1  ? -17.090 -8.267  -7.911  1.00 0.00 ? 1  LEU A CD1  2  
ATOM 1045  C CD2  . LEU A 1 1  ? -18.821 -8.486  -6.120  1.00 0.00 ? 1  LEU A CD2  2  
ATOM 1046  H H1   . LEU A 1 1  ? -20.590 -11.698 -8.787  1.00 0.00 ? 1  LEU A H1   2  
ATOM 1047  H H2   . LEU A 1 1  ? -21.390 -10.205 -8.647  1.00 0.00 ? 1  LEU A H2   2  
ATOM 1048  H H3   . LEU A 1 1  ? -20.674 -10.922 -7.281  1.00 0.00 ? 1  LEU A H3   2  
ATOM 1049  H HA   . LEU A 1 1  ? -19.482 -9.000  -8.566  1.00 0.00 ? 1  LEU A HA   2  
ATOM 1050  H HB2  . LEU A 1 1  ? -18.711 -11.102 -6.819  1.00 0.00 ? 1  LEU A HB2  2  
ATOM 1051  H HB3  . LEU A 1 1  ? -17.452 -10.986 -8.047  1.00 0.00 ? 1  LEU A HB3  2  
ATOM 1052  H HG   . LEU A 1 1  ? -16.931 -9.504  -6.166  1.00 0.00 ? 1  LEU A HG   2  
ATOM 1053  H HD11 . LEU A 1 1  ? -17.016 -8.779  -8.859  1.00 0.00 ? 1  LEU A HD11 2  
ATOM 1054  H HD12 . LEU A 1 1  ? -16.105 -7.963  -7.589  1.00 0.00 ? 1  LEU A HD12 2  
ATOM 1055  H HD13 . LEU A 1 1  ? -17.717 -7.396  -8.020  1.00 0.00 ? 1  LEU A HD13 2  
ATOM 1056  H HD21 . LEU A 1 1  ? -18.956 -7.498  -6.536  1.00 0.00 ? 1  LEU A HD21 2  
ATOM 1057  H HD22 . LEU A 1 1  ? -18.563 -8.404  -5.074  1.00 0.00 ? 1  LEU A HD22 2  
ATOM 1058  H HD23 . LEU A 1 1  ? -19.739 -9.046  -6.221  1.00 0.00 ? 1  LEU A HD23 2  
ATOM 1059  N N    . ASP A 1 2  ? -18.404 -11.701 -10.145 1.00 0.00 ? 2  ASP A N    2  
ATOM 1060  C CA   . ASP A 1 2  ? -17.921 -12.189 -11.432 1.00 0.00 ? 2  ASP A CA   2  
ATOM 1061  C C    . ASP A 1 2  ? -19.077 -12.370 -12.409 1.00 0.00 ? 2  ASP A C    2  
ATOM 1062  O O    . ASP A 1 2  ? -20.217 -12.008 -12.115 1.00 0.00 ? 2  ASP A O    2  
ATOM 1063  C CB   . ASP A 1 2  ? -17.192 -13.523 -11.244 1.00 0.00 ? 2  ASP A CB   2  
ATOM 1064  C CG   . ASP A 1 2  ? -16.301 -13.813 -12.449 1.00 0.00 ? 2  ASP A CG   2  
ATOM 1065  O OD1  . ASP A 1 2  ? -16.234 -12.972 -13.331 1.00 0.00 ? 2  ASP A OD1  2  
ATOM 1066  O OD2  . ASP A 1 2  ? -15.698 -14.873 -12.472 1.00 0.00 ? 2  ASP A OD2  2  
ATOM 1067  H H    . ASP A 1 2  ? -18.410 -12.308 -9.376  1.00 0.00 ? 2  ASP A H    2  
ATOM 1068  H HA   . ASP A 1 2  ? -17.229 -11.467 -11.838 1.00 0.00 ? 2  ASP A HA   2  
ATOM 1069  H HB2  . ASP A 1 2  ? -16.585 -13.475 -10.353 1.00 0.00 ? 2  ASP A HB2  2  
ATOM 1070  H HB3  . ASP A 1 2  ? -17.918 -14.315 -11.139 1.00 0.00 ? 2  ASP A HB3  2  
ATOM 1071  N N    . ARG A 1 3  ? -18.776 -12.939 -13.571 1.00 0.00 ? 3  ARG A N    2  
ATOM 1072  C CA   . ARG A 1 3  ? -19.795 -13.173 -14.586 1.00 0.00 ? 3  ARG A CA   2  
ATOM 1073  C C    . ARG A 1 3  ? -20.439 -14.542 -14.386 1.00 0.00 ? 3  ARG A C    2  
ATOM 1074  O O    . ARG A 1 3  ? -21.364 -14.916 -15.104 1.00 0.00 ? 3  ARG A O    2  
ATOM 1075  C CB   . ARG A 1 3  ? -19.174 -13.097 -15.982 1.00 0.00 ? 3  ARG A CB   2  
ATOM 1076  C CG   . ARG A 1 3  ? -18.735 -11.660 -16.267 1.00 0.00 ? 3  ARG A CG   2  
ATOM 1077  C CD   . ARG A 1 3  ? -18.086 -11.587 -17.650 1.00 0.00 ? 3  ARG A CD   2  
ATOM 1078  N NE   . ARG A 1 3  ? -17.684 -10.218 -17.949 1.00 0.00 ? 3  ARG A NE   2  
ATOM 1079  C CZ   . ARG A 1 3  ? -16.538 -9.723  -17.489 1.00 0.00 ? 3  ARG A CZ   2  
ATOM 1080  N NH1  . ARG A 1 3  ? -15.751 -10.467 -16.761 1.00 0.00 ? 3  ARG A NH1  2  
ATOM 1081  N NH2  . ARG A 1 3  ? -16.201 -8.494  -17.767 1.00 0.00 ? 3  ARG A NH2  2  
ATOM 1082  H H    . ARG A 1 3  ? -17.851 -13.218 -13.743 1.00 0.00 ? 3  ARG A H    2  
ATOM 1083  H HA   . ARG A 1 3  ? -20.556 -12.412 -14.502 1.00 0.00 ? 3  ARG A HA   2  
ATOM 1084  H HB2  . ARG A 1 3  ? -18.315 -13.753 -16.029 1.00 0.00 ? 3  ARG A HB2  2  
ATOM 1085  H HB3  . ARG A 1 3  ? -19.901 -13.403 -16.718 1.00 0.00 ? 3  ARG A HB3  2  
ATOM 1086  H HG2  . ARG A 1 3  ? -19.597 -11.010 -16.239 1.00 0.00 ? 3  ARG A HG2  2  
ATOM 1087  H HG3  . ARG A 1 3  ? -18.022 -11.346 -15.520 1.00 0.00 ? 3  ARG A HG3  2  
ATOM 1088  H HD2  . ARG A 1 3  ? -17.216 -12.226 -17.670 1.00 0.00 ? 3  ARG A HD2  2  
ATOM 1089  H HD3  . ARG A 1 3  ? -18.794 -11.925 -18.393 1.00 0.00 ? 3  ARG A HD3  2  
ATOM 1090  H HE   . ARG A 1 3  ? -18.267 -9.653  -18.496 1.00 0.00 ? 3  ARG A HE   2  
ATOM 1091  H HH11 . ARG A 1 3  ? -16.009 -11.410 -16.549 1.00 0.00 ? 3  ARG A HH11 2  
ATOM 1092  H HH12 . ARG A 1 3  ? -14.890 -10.094 -16.416 1.00 0.00 ? 3  ARG A HH12 2  
ATOM 1093  H HH21 . ARG A 1 3  ? -16.803 -7.924  -18.326 1.00 0.00 ? 3  ARG A HH21 2  
ATOM 1094  H HH22 . ARG A 1 3  ? -15.339 -8.122  -17.421 1.00 0.00 ? 3  ARG A HH22 2  
ATOM 1095  N N    . TRP A 1 4  ? -19.937 -15.282 -13.403 1.00 0.00 ? 4  TRP A N    2  
ATOM 1096  C CA   . TRP A 1 4  ? -20.464 -16.610 -13.109 1.00 0.00 ? 4  TRP A CA   2  
ATOM 1097  C C    . TRP A 1 4  ? -21.669 -16.519 -12.178 1.00 0.00 ? 4  TRP A C    2  
ATOM 1098  O O    . TRP A 1 4  ? -22.527 -17.402 -12.170 1.00 0.00 ? 4  TRP A O    2  
ATOM 1099  C CB   . TRP A 1 4  ? -19.378 -17.468 -12.456 1.00 0.00 ? 4  TRP A CB   2  
ATOM 1100  C CG   . TRP A 1 4  ? -19.779 -18.907 -12.511 1.00 0.00 ? 4  TRP A CG   2  
ATOM 1101  C CD1  . TRP A 1 4  ? -20.282 -19.612 -11.473 1.00 0.00 ? 4  TRP A CD1  2  
ATOM 1102  C CD2  . TRP A 1 4  ? -19.720 -19.824 -13.642 1.00 0.00 ? 4  TRP A CD2  2  
ATOM 1103  N NE1  . TRP A 1 4  ? -20.536 -20.905 -11.894 1.00 0.00 ? 4  TRP A NE1  2  
ATOM 1104  C CE2  . TRP A 1 4  ? -20.206 -21.085 -13.223 1.00 0.00 ? 4  TRP A CE2  2  
ATOM 1105  C CE3  . TRP A 1 4  ? -19.298 -19.687 -14.976 1.00 0.00 ? 4  TRP A CE3  2  
ATOM 1106  C CZ2  . TRP A 1 4  ? -20.270 -22.172 -14.096 1.00 0.00 ? 4  TRP A CZ2  2  
ATOM 1107  C CZ3  . TRP A 1 4  ? -19.361 -20.778 -15.858 1.00 0.00 ? 4  TRP A CZ3  2  
ATOM 1108  C CH2  . TRP A 1 4  ? -19.846 -22.017 -15.418 1.00 0.00 ? 4  TRP A CH2  2  
ATOM 1109  H H    . TRP A 1 4  ? -19.199 -14.928 -12.864 1.00 0.00 ? 4  TRP A H    2  
ATOM 1110  H HA   . TRP A 1 4  ? -20.769 -17.078 -14.032 1.00 0.00 ? 4  TRP A HA   2  
ATOM 1111  H HB2  . TRP A 1 4  ? -18.446 -17.333 -12.985 1.00 0.00 ? 4  TRP A HB2  2  
ATOM 1112  H HB3  . TRP A 1 4  ? -19.254 -17.169 -11.426 1.00 0.00 ? 4  TRP A HB3  2  
ATOM 1113  H HD1  . TRP A 1 4  ? -20.456 -19.229 -10.479 1.00 0.00 ? 4  TRP A HD1  2  
ATOM 1114  H HE1  . TRP A 1 4  ? -20.904 -21.620 -11.333 1.00 0.00 ? 4  TRP A HE1  2  
ATOM 1115  H HE3  . TRP A 1 4  ? -18.922 -18.736 -15.324 1.00 0.00 ? 4  TRP A HE3  2  
ATOM 1116  H HZ2  . TRP A 1 4  ? -20.646 -23.124 -13.752 1.00 0.00 ? 4  TRP A HZ2  2  
ATOM 1117  H HZ3  . TRP A 1 4  ? -19.033 -20.662 -16.881 1.00 0.00 ? 4  TRP A HZ3  2  
ATOM 1118  H HH2  . TRP A 1 4  ? -19.892 -22.853 -16.101 1.00 0.00 ? 4  TRP A HH2  2  
ATOM 1119  N N    . TYR A 1 5  ? -21.723 -15.452 -11.390 1.00 0.00 ? 5  TYR A N    2  
ATOM 1120  C CA   . TYR A 1 5  ? -22.826 -15.262 -10.455 1.00 0.00 ? 5  TYR A CA   2  
ATOM 1121  C C    . TYR A 1 5  ? -24.080 -14.795 -11.186 1.00 0.00 ? 5  TYR A C    2  
ATOM 1122  O O    . TYR A 1 5  ? -24.004 -13.997 -12.122 1.00 0.00 ? 5  TYR A O    2  
ATOM 1123  C CB   . TYR A 1 5  ? -22.440 -14.232 -9.392  1.00 0.00 ? 5  TYR A CB   2  
ATOM 1124  C CG   . TYR A 1 5  ? -21.362 -14.805 -8.503  1.00 0.00 ? 5  TYR A CG   2  
ATOM 1125  C CD1  . TYR A 1 5  ? -21.711 -15.543 -7.366  1.00 0.00 ? 5  TYR A CD1  2  
ATOM 1126  C CD2  . TYR A 1 5  ? -20.013 -14.598 -8.819  1.00 0.00 ? 5  TYR A CD2  2  
ATOM 1127  C CE1  . TYR A 1 5  ? -20.711 -16.073 -6.543  1.00 0.00 ? 5  TYR A CE1  2  
ATOM 1128  C CE2  . TYR A 1 5  ? -19.013 -15.130 -7.996  1.00 0.00 ? 5  TYR A CE2  2  
ATOM 1129  C CZ   . TYR A 1 5  ? -19.361 -15.868 -6.858  1.00 0.00 ? 5  TYR A CZ   2  
ATOM 1130  O OH   . TYR A 1 5  ? -18.376 -16.390 -6.047  1.00 0.00 ? 5  TYR A OH   2  
ATOM 1131  H H    . TYR A 1 5  ? -21.008 -14.783 -11.437 1.00 0.00 ? 5  TYR A H    2  
ATOM 1132  H HA   . TYR A 1 5  ? -23.036 -16.203 -9.968  1.00 0.00 ? 5  TYR A HA   2  
ATOM 1133  H HB2  . TYR A 1 5  ? -22.073 -13.339 -9.874  1.00 0.00 ? 5  TYR A HB2  2  
ATOM 1134  H HB3  . TYR A 1 5  ? -23.306 -13.990 -8.795  1.00 0.00 ? 5  TYR A HB3  2  
ATOM 1135  H HD1  . TYR A 1 5  ? -22.751 -15.702 -7.124  1.00 0.00 ? 5  TYR A HD1  2  
ATOM 1136  H HD2  . TYR A 1 5  ? -19.745 -14.029 -9.695  1.00 0.00 ? 5  TYR A HD2  2  
ATOM 1137  H HE1  . TYR A 1 5  ? -20.980 -16.642 -5.665  1.00 0.00 ? 5  TYR A HE1  2  
ATOM 1138  H HE2  . TYR A 1 5  ? -17.973 -14.970 -8.238  1.00 0.00 ? 5  TYR A HE2  2  
ATOM 1139  H HH   . TYR A 1 5  ? -17.552 -16.384 -6.539  1.00 0.00 ? 5  TYR A HH   2  
ATOM 1140  N N    . LEU A 1 6  ? -25.231 -15.300 -10.748 1.00 0.00 ? 6  LEU A N    2  
ATOM 1141  C CA   . LEU A 1 6  ? -26.506 -14.937 -11.360 1.00 0.00 ? 6  LEU A CA   2  
ATOM 1142  C C    . LEU A 1 6  ? -27.390 -14.219 -10.341 1.00 0.00 ? 6  LEU A C    2  
ATOM 1143  O O    . LEU A 1 6  ? -26.923 -13.335 -9.621  1.00 0.00 ? 6  LEU A O    2  
ATOM 1144  C CB   . LEU A 1 6  ? -27.211 -16.201 -11.869 1.00 0.00 ? 6  LEU A CB   2  
ATOM 1145  C CG   . LEU A 1 6  ? -28.209 -15.839 -12.981 1.00 0.00 ? 6  LEU A CG   2  
ATOM 1146  C CD1  . LEU A 1 6  ? -27.464 -15.372 -14.238 1.00 0.00 ? 6  LEU A CD1  2  
ATOM 1147  C CD2  . LEU A 1 6  ? -29.051 -17.070 -13.320 1.00 0.00 ? 6  LEU A CD2  2  
ATOM 1148  H H    . LEU A 1 6  ? -25.222 -15.932 -9.999  1.00 0.00 ? 6  LEU A H    2  
ATOM 1149  H HA   . LEU A 1 6  ? -26.323 -14.275 -12.191 1.00 0.00 ? 6  LEU A HA   2  
ATOM 1150  H HB2  . LEU A 1 6  ? -26.475 -16.893 -12.254 1.00 0.00 ? 6  LEU A HB2  2  
ATOM 1151  H HB3  . LEU A 1 6  ? -27.742 -16.669 -11.054 1.00 0.00 ? 6  LEU A HB3  2  
ATOM 1152  H HG   . LEU A 1 6  ? -28.856 -15.046 -12.636 1.00 0.00 ? 6  LEU A HG   2  
ATOM 1153  H HD11 . LEU A 1 6  ? -26.409 -15.572 -14.135 1.00 0.00 ? 6  LEU A HD11 2  
ATOM 1154  H HD12 . LEU A 1 6  ? -27.616 -14.311 -14.371 1.00 0.00 ? 6  LEU A HD12 2  
ATOM 1155  H HD13 . LEU A 1 6  ? -27.847 -15.899 -15.100 1.00 0.00 ? 6  LEU A HD13 2  
ATOM 1156  H HD21 . LEU A 1 6  ? -28.426 -17.951 -13.303 1.00 0.00 ? 6  LEU A HD21 2  
ATOM 1157  H HD22 . LEU A 1 6  ? -29.478 -16.953 -14.306 1.00 0.00 ? 6  LEU A HD22 2  
ATOM 1158  H HD23 . LEU A 1 6  ? -29.844 -17.176 -12.595 1.00 0.00 ? 6  LEU A HD23 2  
ATOM 1159  N N    . GLY A 1 7  ? -28.661 -14.603 -10.278 1.00 0.00 ? 7  GLY A N    2  
ATOM 1160  C CA   . GLY A 1 7  ? -29.587 -13.985 -9.336  1.00 0.00 ? 7  GLY A CA   2  
ATOM 1161  C C    . GLY A 1 7  ? -30.130 -12.669 -9.880  1.00 0.00 ? 7  GLY A C    2  
ATOM 1162  O O    . GLY A 1 7  ? -30.880 -11.969 -9.198  1.00 0.00 ? 7  GLY A O    2  
ATOM 1163  H H    . GLY A 1 7  ? -28.979 -15.314 -10.870 1.00 0.00 ? 7  GLY A H    2  
ATOM 1164  H HA2  . GLY A 1 7  ? -30.410 -14.661 -9.155  1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1165  H HA3  . GLY A 1 7  ? -29.073 -13.796 -8.406  1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1166  N N    . GLY A 1 8  ? -29.750 -12.335 -11.108 1.00 0.00 ? 8  GLY A N    2  
ATOM 1167  C CA   . GLY A 1 8  ? -30.211 -11.095 -11.721 1.00 0.00 ? 8  GLY A CA   2  
ATOM 1168  C C    . GLY A 1 8  ? -29.601 -9.886  -11.021 1.00 0.00 ? 8  GLY A C    2  
ATOM 1169  O O    . GLY A 1 8  ? -30.313 -9.083  -10.418 1.00 0.00 ? 8  GLY A O    2  
ATOM 1170  H H    . GLY A 1 8  ? -29.152 -12.932 -11.604 1.00 0.00 ? 8  GLY A H    2  
ATOM 1171  H HA2  . GLY A 1 8  ? -29.925 -11.087 -12.764 1.00 0.00 ? 8  GLY A HA2  2  
ATOM 1172  H HA3  . GLY A 1 8  ? -31.287 -11.039 -11.649 1.00 0.00 ? 8  GLY A HA3  2  
ATOM 1173  N N    . SER A 1 9  ? -28.279 -9.768  -11.105 1.00 0.00 ? 9  SER A N    2  
ATOM 1174  C CA   . SER A 1 9  ? -27.571 -8.657  -10.476 1.00 0.00 ? 9  SER A CA   2  
ATOM 1175  C C    . SER A 1 9  ? -26.646 -7.981  -11.493 1.00 0.00 ? 9  SER A C    2  
ATOM 1176  O O    . SER A 1 9  ? -26.147 -8.640  -12.406 1.00 0.00 ? 9  SER A O    2  
ATOM 1177  C CB   . SER A 1 9  ? -26.748 -9.183  -9.298  1.00 0.00 ? 9  SER A CB   2  
ATOM 1178  O OG   . SER A 1 9  ? -27.624 -9.728  -8.320  1.00 0.00 ? 9  SER A OG   2  
ATOM 1179  H H    . SER A 1 9  ? -27.767 -10.438 -11.606 1.00 0.00 ? 9  SER A H    2  
ATOM 1180  H HA   . SER A 1 9  ? -28.293 -7.943  -10.112 1.00 0.00 ? 9  SER A HA   2  
ATOM 1181  H HB2  . SER A 1 9  ? -26.080 -9.956  -9.642  1.00 0.00 ? 9  SER A HB2  2  
ATOM 1182  H HB3  . SER A 1 9  ? -26.169 -8.380  -8.870  1.00 0.00 ? 9  SER A HB3  2  
ATOM 1183  H HG   . SER A 1 9  ? -28.468 -9.278  -8.395  1.00 0.00 ? 9  SER A HG   2  
ATOM 1184  N N    . PRO A 1 10 ? -26.404 -6.695  -11.367 1.00 0.00 ? 10 PRO A N    2  
ATOM 1185  C CA   . PRO A 1 10 ? -25.513 -5.960  -12.317 1.00 0.00 ? 10 PRO A CA   2  
ATOM 1186  C C    . PRO A 1 10 ? -24.050 -6.369  -12.170 1.00 0.00 ? 10 PRO A C    2  
ATOM 1187  O O    . PRO A 1 10 ? -23.600 -6.723  -11.079 1.00 0.00 ? 10 PRO A O    2  
ATOM 1188  C CB   . PRO A 1 10 ? -25.713 -4.491  -11.935 1.00 0.00 ? 10 PRO A CB   2  
ATOM 1189  C CG   . PRO A 1 10 ? -26.131 -4.517  -10.506 1.00 0.00 ? 10 PRO A CG   2  
ATOM 1190  C CD   . PRO A 1 10 ? -26.941 -5.798  -10.326 1.00 0.00 ? 10 PRO A CD   2  
ATOM 1191  H HA   . PRO A 1 10 ? -25.842 -6.114  -13.332 1.00 0.00 ? 10 PRO A HA   2  
ATOM 1192  H HB2  . PRO A 1 10 ? -24.786 -3.944  -12.050 1.00 0.00 ? 10 PRO A HB2  2  
ATOM 1193  H HB3  . PRO A 1 10 ? -26.489 -4.048  -12.540 1.00 0.00 ? 10 PRO A HB3  2  
ATOM 1194  H HG2  . PRO A 1 10 ? -25.259 -4.530  -9.865  1.00 0.00 ? 10 PRO A HG2  2  
ATOM 1195  H HG3  . PRO A 1 10 ? -26.748 -3.661  -10.283 1.00 0.00 ? 10 PRO A HG3  2  
ATOM 1196  H HD2  . PRO A 1 10 ? -26.783 -6.209  -9.341  1.00 0.00 ? 10 PRO A HD2  2  
ATOM 1197  H HD3  . PRO A 1 10 ? -27.990 -5.613  -10.499 1.00 0.00 ? 10 PRO A HD3  2  
ATOM 1198  N N    . LYS A 1 11 ? -23.316 -6.320  -13.277 1.00 0.00 ? 11 LYS A N    2  
ATOM 1199  C CA   . LYS A 1 11 ? -21.905 -6.691  -13.266 1.00 0.00 ? 11 LYS A CA   2  
ATOM 1200  C C    . LYS A 1 11 ? -21.032 -5.453  -13.079 1.00 0.00 ? 11 LYS A C    2  
ATOM 1201  O O    . LYS A 1 11 ? -19.808 -5.555  -12.985 1.00 0.00 ? 11 LYS A O    2  
ATOM 1202  C CB   . LYS A 1 11 ? -21.533 -7.376  -14.587 1.00 0.00 ? 11 LYS A CB   2  
ATOM 1203  C CG   . LYS A 1 11 ? -22.435 -8.597  -14.846 1.00 0.00 ? 11 LYS A CG   2  
ATOM 1204  C CD   . LYS A 1 11 ? -22.148 -9.717  -13.837 1.00 0.00 ? 11 LYS A CD   2  
ATOM 1205  C CE   . LYS A 1 11 ? -22.896 -10.982 -14.262 1.00 0.00 ? 11 LYS A CE   2  
ATOM 1206  N NZ   . LYS A 1 11 ? -22.627 -12.072 -13.282 1.00 0.00 ? 11 LYS A NZ   2  
ATOM 1207  H H    . LYS A 1 11 ? -23.732 -6.030  -14.115 1.00 0.00 ? 11 LYS A H    2  
ATOM 1208  H HA   . LYS A 1 11 ? -21.720 -7.365  -12.449 1.00 0.00 ? 11 LYS A HA   2  
ATOM 1209  H HB2  . LYS A 1 11 ? -21.648 -6.672  -15.397 1.00 0.00 ? 11 LYS A HB2  2  
ATOM 1210  H HB3  . LYS A 1 11 ? -20.505 -7.700  -14.540 1.00 0.00 ? 11 LYS A HB3  2  
ATOM 1211  H HG2  . LYS A 1 11 ? -23.469 -8.298  -14.761 1.00 0.00 ? 11 LYS A HG2  2  
ATOM 1212  H HG3  . LYS A 1 11 ? -22.254 -8.966  -15.845 1.00 0.00 ? 11 LYS A HG3  2  
ATOM 1213  H HD2  . LYS A 1 11 ? -21.088 -9.914  -13.807 1.00 0.00 ? 11 LYS A HD2  2  
ATOM 1214  H HD3  . LYS A 1 11 ? -22.490 -9.425  -12.858 1.00 0.00 ? 11 LYS A HD3  2  
ATOM 1215  H HE2  . LYS A 1 11 ? -23.957 -10.780 -14.296 1.00 0.00 ? 11 LYS A HE2  2  
ATOM 1216  H HE3  . LYS A 1 11 ? -22.557 -11.288 -15.241 1.00 0.00 ? 11 LYS A HE3  2  
ATOM 1217  H HZ1  . LYS A 1 11 ? -22.016 -11.711 -12.521 1.00 0.00 ? 11 LYS A HZ1  2  
ATOM 1218  H HZ2  . LYS A 1 11 ? -22.153 -12.863 -13.763 1.00 0.00 ? 11 LYS A HZ2  2  
ATOM 1219  H HZ3  . LYS A 1 11 ? -23.526 -12.401 -12.875 1.00 0.00 ? 11 LYS A HZ3  2  
ATOM 1220  N N    . GLY A 1 12 ? -21.664 -4.285  -13.029 1.00 0.00 ? 12 GLY A N    2  
ATOM 1221  C CA   . GLY A 1 12 ? -20.926 -3.038  -12.857 1.00 0.00 ? 12 GLY A CA   2  
ATOM 1222  C C    . GLY A 1 12 ? -20.346 -2.568  -14.187 1.00 0.00 ? 12 GLY A C    2  
ATOM 1223  O O    . GLY A 1 12 ? -19.591 -1.598  -14.240 1.00 0.00 ? 12 GLY A O    2  
ATOM 1224  H H    . GLY A 1 12 ? -22.641 -4.260  -13.110 1.00 0.00 ? 12 GLY A H    2  
ATOM 1225  H HA2  . GLY A 1 12 ? -21.591 -2.281  -12.469 1.00 0.00 ? 12 GLY A HA2  2  
ATOM 1226  H HA3  . GLY A 1 12 ? -20.119 -3.197  -12.158 1.00 0.00 ? 12 GLY A HA3  2  
ATOM 1227  N N    . ASP A 1 13 ? -20.719 -3.257  -15.260 1.00 0.00 ? 13 ASP A N    2  
ATOM 1228  C CA   . ASP A 1 13 ? -20.242 -2.895  -16.590 1.00 0.00 ? 13 ASP A CA   2  
ATOM 1229  C C    . ASP A 1 13 ? -21.317 -2.126  -17.353 1.00 0.00 ? 13 ASP A C    2  
ATOM 1230  O O    . ASP A 1 13 ? -21.019 -1.197  -18.102 1.00 0.00 ? 13 ASP A O    2  
ATOM 1231  C CB   . ASP A 1 13 ? -19.859 -4.154  -17.370 1.00 0.00 ? 13 ASP A CB   2  
ATOM 1232  C CG   . ASP A 1 13 ? -18.609 -4.786  -16.766 1.00 0.00 ? 13 ASP A CG   2  
ATOM 1233  O OD1  . ASP A 1 13 ? -17.946 -4.115  -15.990 1.00 0.00 ? 13 ASP A OD1  2  
ATOM 1234  O OD2  . ASP A 1 13 ? -18.330 -5.929  -17.088 1.00 0.00 ? 13 ASP A OD2  2  
ATOM 1235  H H    . ASP A 1 13 ? -21.341 -4.006  -15.154 1.00 0.00 ? 13 ASP A H    2  
ATOM 1236  H HA   . ASP A 1 13 ? -19.367 -2.269  -16.491 1.00 0.00 ? 13 ASP A HA   2  
ATOM 1237  H HB2  . ASP A 1 13 ? -20.673 -4.863  -17.328 1.00 0.00 ? 13 ASP A HB2  2  
ATOM 1238  H HB3  . ASP A 1 13 ? -19.665 -3.894  -18.400 1.00 0.00 ? 13 ASP A HB3  2  
ATOM 1239  N N    . VAL A 1 14 ? -22.569 -2.530  -17.156 1.00 0.00 ? 14 VAL A N    2  
ATOM 1240  C CA   . VAL A 1 14 ? -23.690 -1.882  -17.827 1.00 0.00 ? 14 VAL A CA   2  
ATOM 1241  C C    . VAL A 1 14 ? -24.978 -2.086  -17.032 1.00 0.00 ? 14 VAL A C    2  
ATOM 1242  O O    . VAL A 1 14 ? -25.054 -2.974  -16.184 1.00 0.00 ? 14 VAL A O    2  
ATOM 1243  C CB   . VAL A 1 14 ? -23.841 -2.441  -19.248 1.00 0.00 ? 14 VAL A CB   2  
ATOM 1244  C CG1  . VAL A 1 14 ? -24.128 -3.945  -19.192 1.00 0.00 ? 14 VAL A CG1  2  
ATOM 1245  C CG2  . VAL A 1 14 ? -24.994 -1.728  -19.963 1.00 0.00 ? 14 VAL A CG2  2  
ATOM 1246  H H    . VAL A 1 14 ? -22.741 -3.281  -16.550 1.00 0.00 ? 14 VAL A H    2  
ATOM 1247  H HA   . VAL A 1 14 ? -23.486 -0.822  -17.892 1.00 0.00 ? 14 VAL A HA   2  
ATOM 1248  H HB   . VAL A 1 14 ? -22.924 -2.275  -19.794 1.00 0.00 ? 14 VAL A HB   2  
ATOM 1249  H HG11 . VAL A 1 14 ? -23.339 -4.478  -19.701 1.00 0.00 ? 14 VAL A HG11 2  
ATOM 1250  H HG12 . VAL A 1 14 ? -25.070 -4.150  -19.678 1.00 0.00 ? 14 VAL A HG12 2  
ATOM 1251  H HG13 . VAL A 1 14 ? -24.175 -4.268  -18.163 1.00 0.00 ? 14 VAL A HG13 2  
ATOM 1252  H HG21 . VAL A 1 14 ? -24.805 -1.720  -21.027 1.00 0.00 ? 14 VAL A HG21 2  
ATOM 1253  H HG22 . VAL A 1 14 ? -25.068 -0.713  -19.606 1.00 0.00 ? 14 VAL A HG22 2  
ATOM 1254  H HG23 . VAL A 1 14 ? -25.918 -2.248  -19.769 1.00 0.00 ? 14 VAL A HG23 2  
ATOM 1255  N N    . ASP A 1 15 ? -25.981 -1.255  -17.304 1.00 0.00 ? 15 ASP A N    2  
ATOM 1256  C CA   . ASP A 1 15 ? -27.260 -1.346  -16.602 1.00 0.00 ? 15 ASP A CA   2  
ATOM 1257  C C    . ASP A 1 15 ? -28.410 -1.474  -17.599 1.00 0.00 ? 15 ASP A C    2  
ATOM 1258  O O    . ASP A 1 15 ? -29.129 -0.509  -17.858 1.00 0.00 ? 15 ASP A O    2  
ATOM 1259  C CB   . ASP A 1 15 ? -27.470 -0.096  -15.746 1.00 0.00 ? 15 ASP A CB   2  
ATOM 1260  C CG   . ASP A 1 15 ? -26.349 0.028   -14.720 1.00 0.00 ? 15 ASP A CG   2  
ATOM 1261  O OD1  . ASP A 1 15 ? -25.623 -0.936  -14.548 1.00 0.00 ? 15 ASP A OD1  2  
ATOM 1262  O OD2  . ASP A 1 15 ? -26.234 1.085   -14.123 1.00 0.00 ? 15 ASP A OD2  2  
ATOM 1263  H H    . ASP A 1 15 ? -25.858 -0.561  -17.987 1.00 0.00 ? 15 ASP A H    2  
ATOM 1264  H HA   . ASP A 1 15 ? -27.251 -2.208  -15.957 1.00 0.00 ? 15 ASP A HA   2  
ATOM 1265  H HB2  . ASP A 1 15 ? -27.473 0.778   -16.383 1.00 0.00 ? 15 ASP A HB2  2  
ATOM 1266  H HB3  . ASP A 1 15 ? -28.417 -0.167  -15.233 1.00 0.00 ? 15 ASP A HB3  2  
ATOM 1267  N N    . PRO A 1 16 ? -28.586 -2.640  -18.169 1.00 0.00 ? 16 PRO A N    2  
ATOM 1268  C CA   . PRO A 1 16 ? -29.658 -2.899  -19.170 1.00 0.00 ? 16 PRO A CA   2  
ATOM 1269  C C    . PRO A 1 16 ? -31.011 -3.167  -18.518 1.00 0.00 ? 16 PRO A C    2  
ATOM 1270  O O    . PRO A 1 16 ? -32.023 -3.310  -19.204 1.00 0.00 ? 16 PRO A O    2  
ATOM 1271  C CB   . PRO A 1 16 ? -29.144 -4.131  -19.909 1.00 0.00 ? 16 PRO A CB   2  
ATOM 1272  C CG   . PRO A 1 16 ? -28.357 -4.887  -18.893 1.00 0.00 ? 16 PRO A CG   2  
ATOM 1273  C CD   . PRO A 1 16 ? -27.786 -3.854  -17.915 1.00 0.00 ? 16 PRO A CD   2  
ATOM 1274  H HA   . PRO A 1 16 ? -29.733 -2.075  -19.858 1.00 0.00 ? 16 PRO A HA   2  
ATOM 1275  H HB2  . PRO A 1 16 ? -29.974 -4.727  -20.266 1.00 0.00 ? 16 PRO A HB2  2  
ATOM 1276  H HB3  . PRO A 1 16 ? -28.507 -3.839  -20.728 1.00 0.00 ? 16 PRO A HB3  2  
ATOM 1277  H HG2  . PRO A 1 16 ? -29.000 -5.583  -18.369 1.00 0.00 ? 16 PRO A HG2  2  
ATOM 1278  H HG3  . PRO A 1 16 ? -27.549 -5.420  -19.370 1.00 0.00 ? 16 PRO A HG3  2  
ATOM 1279  H HD2  . PRO A 1 16 ? -27.919 -4.196  -16.898 1.00 0.00 ? 16 PRO A HD2  2  
ATOM 1280  H HD3  . PRO A 1 16 ? -26.745 -3.669  -18.120 1.00 0.00 ? 16 PRO A HD3  2  
ATOM 1281  N N    . PHE A 1 17 ? -31.021 -3.245  -17.191 1.00 0.00 ? 17 PHE A N    2  
ATOM 1282  C CA   . PHE A 1 17 ? -32.257 -3.507  -16.463 1.00 0.00 ? 17 PHE A CA   2  
ATOM 1283  C C    . PHE A 1 17 ? -33.288 -2.420  -16.746 1.00 0.00 ? 17 PHE A C    2  
ATOM 1284  O O    . PHE A 1 17 ? -34.465 -2.710  -16.961 1.00 0.00 ? 17 PHE A O    2  
ATOM 1285  C CB   . PHE A 1 17 ? -31.974 -3.565  -14.961 1.00 0.00 ? 17 PHE A CB   2  
ATOM 1286  C CG   . PHE A 1 17 ? -33.262 -3.815  -14.213 1.00 0.00 ? 17 PHE A CG   2  
ATOM 1287  C CD1  . PHE A 1 17 ? -33.793 -5.109  -14.149 1.00 0.00 ? 17 PHE A CD1  2  
ATOM 1288  C CD2  . PHE A 1 17 ? -33.925 -2.753  -13.585 1.00 0.00 ? 17 PHE A CD2  2  
ATOM 1289  C CE1  . PHE A 1 17 ? -34.987 -5.341  -13.456 1.00 0.00 ? 17 PHE A CE1  2  
ATOM 1290  C CE2  . PHE A 1 17 ? -35.119 -2.987  -12.892 1.00 0.00 ? 17 PHE A CE2  2  
ATOM 1291  C CZ   . PHE A 1 17 ? -35.650 -4.280  -12.828 1.00 0.00 ? 17 PHE A CZ   2  
ATOM 1292  H H    . PHE A 1 17 ? -30.184 -3.129  -16.695 1.00 0.00 ? 17 PHE A H    2  
ATOM 1293  H HA   . PHE A 1 17 ? -32.655 -4.458  -16.779 1.00 0.00 ? 17 PHE A HA   2  
ATOM 1294  H HB2  . PHE A 1 17 ? -31.277 -4.365  -14.756 1.00 0.00 ? 17 PHE A HB2  2  
ATOM 1295  H HB3  . PHE A 1 17 ? -31.548 -2.626  -14.638 1.00 0.00 ? 17 PHE A HB3  2  
ATOM 1296  H HD1  . PHE A 1 17 ? -33.282 -5.928  -14.633 1.00 0.00 ? 17 PHE A HD1  2  
ATOM 1297  H HD2  . PHE A 1 17 ? -33.516 -1.756  -13.636 1.00 0.00 ? 17 PHE A HD2  2  
ATOM 1298  H HE1  . PHE A 1 17 ? -35.396 -6.340  -13.405 1.00 0.00 ? 17 PHE A HE1  2  
ATOM 1299  H HE2  . PHE A 1 17 ? -35.631 -2.169  -12.408 1.00 0.00 ? 17 PHE A HE2  2  
ATOM 1300  H HZ   . PHE A 1 17 ? -36.570 -4.460  -12.292 1.00 0.00 ? 17 PHE A HZ   2  
ATOM 1301  N N    . TYR A 1 18 ? -32.846 -1.166  -16.730 1.00 0.00 ? 18 TYR A N    2  
ATOM 1302  C CA   . TYR A 1 18 ? -33.761 -0.057  -16.973 1.00 0.00 ? 18 TYR A CA   2  
ATOM 1303  C C    . TYR A 1 18 ? -34.402 -0.197  -18.350 1.00 0.00 ? 18 TYR A C    2  
ATOM 1304  O O    . TYR A 1 18 ? -35.620 -0.093  -18.487 1.00 0.00 ? 18 TYR A O    2  
ATOM 1305  C CB   . TYR A 1 18 ? -33.009 1.272   -16.889 1.00 0.00 ? 18 TYR A CB   2  
ATOM 1306  C CG   . TYR A 1 18 ? -33.945 2.404   -17.239 1.00 0.00 ? 18 TYR A CG   2  
ATOM 1307  C CD1  . TYR A 1 18 ? -34.876 2.858   -16.296 1.00 0.00 ? 18 TYR A CD1  2  
ATOM 1308  C CD2  . TYR A 1 18 ? -33.881 2.999   -18.503 1.00 0.00 ? 18 TYR A CD2  2  
ATOM 1309  C CE1  . TYR A 1 18 ? -35.742 3.908   -16.620 1.00 0.00 ? 18 TYR A CE1  2  
ATOM 1310  C CE2  . TYR A 1 18 ? -34.749 4.050   -18.827 1.00 0.00 ? 18 TYR A CE2  2  
ATOM 1311  C CZ   . TYR A 1 18 ? -35.679 4.505   -17.885 1.00 0.00 ? 18 TYR A CZ   2  
ATOM 1312  O OH   . TYR A 1 18 ? -36.533 5.539   -18.204 1.00 0.00 ? 18 TYR A OH   2  
ATOM 1313  H H    . TYR A 1 18 ? -31.903 -0.996  -16.526 1.00 0.00 ? 18 TYR A H    2  
ATOM 1314  H HA   . TYR A 1 18 ? -34.537 -0.070  -16.221 1.00 0.00 ? 18 TYR A HA   2  
ATOM 1315  H HB2  . TYR A 1 18 ? -32.633 1.411   -15.886 1.00 0.00 ? 18 TYR A HB2  2  
ATOM 1316  H HB3  . TYR A 1 18 ? -32.183 1.262   -17.585 1.00 0.00 ? 18 TYR A HB3  2  
ATOM 1317  H HD1  . TYR A 1 18 ? -34.924 2.398   -15.320 1.00 0.00 ? 18 TYR A HD1  2  
ATOM 1318  H HD2  . TYR A 1 18 ? -33.163 2.648   -19.230 1.00 0.00 ? 18 TYR A HD2  2  
ATOM 1319  H HE1  . TYR A 1 18 ? -36.460 4.258   -15.894 1.00 0.00 ? 18 TYR A HE1  2  
ATOM 1320  H HE2  . TYR A 1 18 ? -34.699 4.510   -19.802 1.00 0.00 ? 18 TYR A HE2  2  
ATOM 1321  H HH   . TYR A 1 18 ? -36.470 5.695   -19.149 1.00 0.00 ? 18 TYR A HH   2  
ATOM 1322  N N    . TYR A 1 19 ? -33.583 -0.442  -19.366 1.00 0.00 ? 19 TYR A N    2  
ATOM 1323  C CA   . TYR A 1 19 ? -34.099 -0.606  -20.719 1.00 0.00 ? 19 TYR A CA   2  
ATOM 1324  C C    . TYR A 1 19 ? -34.901 -1.899  -20.824 1.00 0.00 ? 19 TYR A C    2  
ATOM 1325  O O    . TYR A 1 19 ? -35.913 -1.963  -21.523 1.00 0.00 ? 19 TYR A O    2  
ATOM 1326  C CB   . TYR A 1 19 ? -32.940 -0.639  -21.719 1.00 0.00 ? 19 TYR A CB   2  
ATOM 1327  C CG   . TYR A 1 19 ? -32.323 0.736   -21.819 1.00 0.00 ? 19 TYR A CG   2  
ATOM 1328  C CD1  . TYR A 1 19 ? -32.810 1.656   -22.755 1.00 0.00 ? 19 TYR A CD1  2  
ATOM 1329  C CD2  . TYR A 1 19 ? -31.262 1.090   -20.976 1.00 0.00 ? 19 TYR A CD2  2  
ATOM 1330  C CE1  . TYR A 1 19 ? -32.238 2.929   -22.849 1.00 0.00 ? 19 TYR A CE1  2  
ATOM 1331  C CE2  . TYR A 1 19 ? -30.689 2.365   -21.070 1.00 0.00 ? 19 TYR A CE2  2  
ATOM 1332  C CZ   . TYR A 1 19 ? -31.177 3.284   -22.007 1.00 0.00 ? 19 TYR A CZ   2  
ATOM 1333  O OH   . TYR A 1 19 ? -30.612 4.540   -22.098 1.00 0.00 ? 19 TYR A OH   2  
ATOM 1334  H H    . TYR A 1 19 ? -32.618 -0.509  -19.210 1.00 0.00 ? 19 TYR A H    2  
ATOM 1335  H HA   . TYR A 1 19 ? -34.742 0.228   -20.956 1.00 0.00 ? 19 TYR A HA   2  
ATOM 1336  H HB2  . TYR A 1 19 ? -32.195 -1.346  -21.383 1.00 0.00 ? 19 TYR A HB2  2  
ATOM 1337  H HB3  . TYR A 1 19 ? -33.310 -0.938  -22.689 1.00 0.00 ? 19 TYR A HB3  2  
ATOM 1338  H HD1  . TYR A 1 19 ? -33.629 1.383   -23.405 1.00 0.00 ? 19 TYR A HD1  2  
ATOM 1339  H HD2  . TYR A 1 19 ? -30.886 0.381   -20.254 1.00 0.00 ? 19 TYR A HD2  2  
ATOM 1340  H HE1  . TYR A 1 19 ? -32.613 3.638   -23.571 1.00 0.00 ? 19 TYR A HE1  2  
ATOM 1341  H HE2  . TYR A 1 19 ? -29.871 2.638   -20.419 1.00 0.00 ? 19 TYR A HE2  2  
ATOM 1342  H HH   . TYR A 1 19 ? -31.054 5.012   -22.809 1.00 0.00 ? 19 TYR A HH   2  
ATOM 1343  N N    . ASP A 1 20 ? -34.435 -2.926  -20.122 1.00 0.00 ? 20 ASP A N    2  
ATOM 1344  C CA   . ASP A 1 20 ? -35.102 -4.223  -20.130 1.00 0.00 ? 20 ASP A CA   2  
ATOM 1345  C C    . ASP A 1 20 ? -36.279 -4.241  -19.159 1.00 0.00 ? 20 ASP A C    2  
ATOM 1346  O O    . ASP A 1 20 ? -37.048 -5.202  -19.122 1.00 0.00 ? 20 ASP A O    2  
ATOM 1347  C CB   . ASP A 1 20 ? -34.109 -5.324  -19.753 1.00 0.00 ? 20 ASP A CB   2  
ATOM 1348  C CG   . ASP A 1 20 ? -33.098 -5.523  -20.877 1.00 0.00 ? 20 ASP A CG   2  
ATOM 1349  O OD1  . ASP A 1 20 ? -33.343 -5.026  -21.962 1.00 0.00 ? 20 ASP A OD1  2  
ATOM 1350  O OD2  . ASP A 1 20 ? -32.092 -6.171  -20.634 1.00 0.00 ? 20 ASP A OD2  2  
ATOM 1351  H H    . ASP A 1 20 ? -33.622 -2.811  -19.585 1.00 0.00 ? 20 ASP A H    2  
ATOM 1352  H HA   . ASP A 1 20 ? -35.470 -4.418  -21.127 1.00 0.00 ? 20 ASP A HA   2  
ATOM 1353  H HB2  . ASP A 1 20 ? -33.589 -5.042  -18.849 1.00 0.00 ? 20 ASP A HB2  2  
ATOM 1354  H HB3  . ASP A 1 20 ? -34.643 -6.248  -19.586 1.00 0.00 ? 20 ASP A HB3  2  
ATOM 1355  N N    . TYR A 1 21 ? -36.410 -3.182  -18.364 1.00 0.00 ? 21 TYR A N    2  
ATOM 1356  C CA   . TYR A 1 21 ? -37.494 -3.109  -17.391 1.00 0.00 ? 21 TYR A CA   2  
ATOM 1357  C C    . TYR A 1 21 ? -38.844 -3.132  -18.097 1.00 0.00 ? 21 TYR A C    2  
ATOM 1358  O O    . TYR A 1 21 ? -39.751 -3.849  -17.688 1.00 0.00 ? 21 TYR A O    2  
ATOM 1359  C CB   . TYR A 1 21 ? -37.373 -1.829  -16.561 1.00 0.00 ? 21 TYR A CB   2  
ATOM 1360  C CG   . TYR A 1 21 ? -38.527 -1.744  -15.591 1.00 0.00 ? 21 TYR A CG   2  
ATOM 1361  C CD1  . TYR A 1 21 ? -38.515 -2.511  -14.420 1.00 0.00 ? 21 TYR A CD1  2  
ATOM 1362  C CD2  . TYR A 1 21 ? -39.609 -0.899  -15.863 1.00 0.00 ? 21 TYR A CD2  2  
ATOM 1363  C CE1  . TYR A 1 21 ? -39.583 -2.432  -13.520 1.00 0.00 ? 21 TYR A CE1  2  
ATOM 1364  C CE2  . TYR A 1 21 ? -40.678 -0.820  -14.962 1.00 0.00 ? 21 TYR A CE2  2  
ATOM 1365  C CZ   . TYR A 1 21 ? -40.666 -1.586  -13.791 1.00 0.00 ? 21 TYR A CZ   2  
ATOM 1366  O OH   . TYR A 1 21 ? -41.719 -1.508  -12.904 1.00 0.00 ? 21 TYR A OH   2  
ATOM 1367  H H    . TYR A 1 21 ? -35.764 -2.448  -18.428 1.00 0.00 ? 21 TYR A H    2  
ATOM 1368  H HA   . TYR A 1 21 ? -37.429 -3.961  -16.730 1.00 0.00 ? 21 TYR A HA   2  
ATOM 1369  H HB2  . TYR A 1 21 ? -36.442 -1.841  -16.014 1.00 0.00 ? 21 TYR A HB2  2  
ATOM 1370  H HB3  . TYR A 1 21 ? -37.394 -0.972  -17.218 1.00 0.00 ? 21 TYR A HB3  2  
ATOM 1371  H HD1  . TYR A 1 21 ? -37.679 -3.165  -14.210 1.00 0.00 ? 21 TYR A HD1  2  
ATOM 1372  H HD2  . TYR A 1 21 ? -39.618 -0.307  -16.767 1.00 0.00 ? 21 TYR A HD2  2  
ATOM 1373  H HE1  . TYR A 1 21 ? -39.573 -3.023  -12.616 1.00 0.00 ? 21 TYR A HE1  2  
ATOM 1374  H HE2  . TYR A 1 21 ? -41.513 -0.167  -15.171 1.00 0.00 ? 21 TYR A HE2  2  
ATOM 1375  H HH   . TYR A 1 21 ? -42.439 -1.044  -13.337 1.00 0.00 ? 21 TYR A HH   2  
ATOM 1376  N N    . GLU A 1 22 ? -38.979 -2.337  -19.151 1.00 0.00 ? 22 GLU A N    2  
ATOM 1377  C CA   . GLU A 1 22 ? -40.233 -2.277  -19.891 1.00 0.00 ? 22 GLU A CA   2  
ATOM 1378  C C    . GLU A 1 22 ? -40.587 -3.650  -20.458 1.00 0.00 ? 22 GLU A C    2  
ATOM 1379  O O    . GLU A 1 22 ? -41.752 -4.044  -20.475 1.00 0.00 ? 22 GLU A O    2  
ATOM 1380  C CB   . GLU A 1 22 ? -40.118 -1.267  -21.034 1.00 0.00 ? 22 GLU A CB   2  
ATOM 1381  C CG   . GLU A 1 22 ? -40.057 0.149   -20.461 1.00 0.00 ? 22 GLU A CG   2  
ATOM 1382  C CD   . GLU A 1 22 ? -39.762 1.150   -21.574 1.00 0.00 ? 22 GLU A CD   2  
ATOM 1383  O OE1  . GLU A 1 22 ? -39.394 0.713   -22.653 1.00 0.00 ? 22 GLU A OE1  2  
ATOM 1384  O OE2  . GLU A 1 22 ? -39.906 2.336   -21.331 1.00 0.00 ? 22 GLU A OE2  2  
ATOM 1385  H H    . GLU A 1 22 ? -38.229 -1.763  -19.419 1.00 0.00 ? 22 GLU A H    2  
ATOM 1386  H HA   . GLU A 1 22 ? -41.021 -1.959  -19.224 1.00 0.00 ? 22 GLU A HA   2  
ATOM 1387  H HB2  . GLU A 1 22 ? -39.220 -1.467  -21.601 1.00 0.00 ? 22 GLU A HB2  2  
ATOM 1388  H HB3  . GLU A 1 22 ? -40.979 -1.354  -21.680 1.00 0.00 ? 22 GLU A HB3  2  
ATOM 1389  H HG2  . GLU A 1 22 ? -41.005 0.393   -20.003 1.00 0.00 ? 22 GLU A HG2  2  
ATOM 1390  H HG3  . GLU A 1 22 ? -39.277 0.201   -19.718 1.00 0.00 ? 22 GLU A HG3  2  
ATOM 1391  N N    . THR A 1 23 ? -39.572 -4.371  -20.919 1.00 0.00 ? 23 THR A N    2  
ATOM 1392  C CA   . THR A 1 23 ? -39.780 -5.700  -21.485 1.00 0.00 ? 23 THR A CA   2  
ATOM 1393  C C    . THR A 1 23 ? -40.370 -6.652  -20.445 1.00 0.00 ? 23 THR A C    2  
ATOM 1394  O O    . THR A 1 23 ? -41.247 -7.451  -20.753 1.00 0.00 ? 23 THR A O    2  
ATOM 1395  C CB   . THR A 1 23 ? -38.451 -6.261  -21.994 1.00 0.00 ? 23 THR A CB   2  
ATOM 1396  O OG1  . THR A 1 23 ? -37.940 -5.414  -23.015 1.00 0.00 ? 23 THR A OG1  2  
ATOM 1397  C CG2  . THR A 1 23 ? -38.666 -7.668  -22.553 1.00 0.00 ? 23 THR A CG2  2  
ATOM 1398  H H    . THR A 1 23 ? -38.665 -4.004  -20.877 1.00 0.00 ? 23 THR A H    2  
ATOM 1399  H HA   . THR A 1 23 ? -40.464 -5.622  -22.315 1.00 0.00 ? 23 THR A HA   2  
ATOM 1400  H HB   . THR A 1 23 ? -37.744 -6.307  -21.179 1.00 0.00 ? 23 THR A HB   2  
ATOM 1401  H HG1  . THR A 1 23 ? -37.949 -5.907  -23.839 1.00 0.00 ? 23 THR A HG1  2  
ATOM 1402  H HG21 . THR A 1 23 ? -39.723 -7.846  -22.677 1.00 0.00 ? 23 THR A HG21 2  
ATOM 1403  H HG22 . THR A 1 23 ? -38.256 -8.395  -21.868 1.00 0.00 ? 23 THR A HG22 2  
ATOM 1404  H HG23 . THR A 1 23 ? -38.171 -7.754  -23.508 1.00 0.00 ? 23 THR A HG23 2  
ATOM 1405  N N    . VAL A 1 24 ? -39.859 -6.577  -19.223 1.00 0.00 ? 24 VAL A N    2  
ATOM 1406  C CA   . VAL A 1 24 ? -40.303 -7.461  -18.144 1.00 0.00 ? 24 VAL A CA   2  
ATOM 1407  C C    . VAL A 1 24 ? -41.820 -7.644  -18.138 1.00 0.00 ? 24 VAL A C    2  
ATOM 1408  O O    . VAL A 1 24 ? -42.322 -8.648  -17.640 1.00 0.00 ? 24 VAL A O    2  
ATOM 1409  C CB   . VAL A 1 24 ? -39.855 -6.903  -16.789 1.00 0.00 ? 24 VAL A CB   2  
ATOM 1410  C CG1  . VAL A 1 24 ? -40.925 -5.956  -16.232 1.00 0.00 ? 24 VAL A CG1  2  
ATOM 1411  C CG2  . VAL A 1 24 ? -39.643 -8.060  -15.811 1.00 0.00 ? 24 VAL A CG2  2  
ATOM 1412  H H    . VAL A 1 24 ? -39.134 -5.942  -19.049 1.00 0.00 ? 24 VAL A H    2  
ATOM 1413  H HA   . VAL A 1 24 ? -39.842 -8.428  -18.282 1.00 0.00 ? 24 VAL A HA   2  
ATOM 1414  H HB   . VAL A 1 24 ? -38.929 -6.362  -16.914 1.00 0.00 ? 24 VAL A HB   2  
ATOM 1415  H HG11 . VAL A 1 24 ? -41.355 -5.373  -17.032 1.00 0.00 ? 24 VAL A HG11 2  
ATOM 1416  H HG12 . VAL A 1 24 ? -40.473 -5.292  -15.509 1.00 0.00 ? 24 VAL A HG12 2  
ATOM 1417  H HG13 . VAL A 1 24 ? -41.701 -6.533  -15.752 1.00 0.00 ? 24 VAL A HG13 2  
ATOM 1418  H HG21 . VAL A 1 24 ? -38.788 -8.642  -16.122 1.00 0.00 ? 24 VAL A HG21 2  
ATOM 1419  H HG22 . VAL A 1 24 ? -40.521 -8.688  -15.800 1.00 0.00 ? 24 VAL A HG22 2  
ATOM 1420  H HG23 . VAL A 1 24 ? -39.470 -7.667  -14.821 1.00 0.00 ? 24 VAL A HG23 2  
ATOM 1421  N N    . ARG A 1 25 ? -42.546 -6.689  -18.698 1.00 0.00 ? 25 ARG A N    2  
ATOM 1422  C CA   . ARG A 1 25 ? -43.999 -6.818  -18.743 1.00 0.00 ? 25 ARG A CA   2  
ATOM 1423  C C    . ARG A 1 25 ? -44.401 -7.867  -19.787 1.00 0.00 ? 25 ARG A C    2  
ATOM 1424  O O    . ARG A 1 25 ? -45.114 -8.824  -19.483 1.00 0.00 ? 25 ARG A O    2  
ATOM 1425  C CB   . ARG A 1 25 ? -44.633 -5.470  -19.095 1.00 0.00 ? 25 ARG A CB   2  
ATOM 1426  C CG   . ARG A 1 25 ? -46.157 -5.614  -19.139 1.00 0.00 ? 25 ARG A CG   2  
ATOM 1427  C CD   . ARG A 1 25 ? -46.790 -4.237  -19.332 1.00 0.00 ? 25 ARG A CD   2  
ATOM 1428  N NE   . ARG A 1 25 ? -48.238 -4.362  -19.454 1.00 0.00 ? 25 ARG A NE   2  
ATOM 1429  C CZ   . ARG A 1 25 ? -49.016 -3.286  -19.514 1.00 0.00 ? 25 ARG A CZ   2  
ATOM 1430  N NH1  . ARG A 1 25 ? -48.488 -2.095  -19.466 1.00 0.00 ? 25 ARG A NH1  2  
ATOM 1431  N NH2  . ARG A 1 25 ? -50.310 -3.423  -19.620 1.00 0.00 ? 25 ARG A NH2  2  
ATOM 1432  H H    . ARG A 1 25 ? -42.090 -5.931  -19.121 1.00 0.00 ? 25 ARG A H    2  
ATOM 1433  H HA   . ARG A 1 25 ? -44.355 -7.131  -17.774 1.00 0.00 ? 25 ARG A HA   2  
ATOM 1434  H HB2  . ARG A 1 25 ? -44.361 -4.739  -18.349 1.00 0.00 ? 25 ARG A HB2  2  
ATOM 1435  H HB3  . ARG A 1 25 ? -44.277 -5.147  -20.063 1.00 0.00 ? 25 ARG A HB3  2  
ATOM 1436  H HG2  . ARG A 1 25 ? -46.436 -6.257  -19.959 1.00 0.00 ? 25 ARG A HG2  2  
ATOM 1437  H HG3  . ARG A 1 25 ? -46.504 -6.040  -18.210 1.00 0.00 ? 25 ARG A HG3  2  
ATOM 1438  H HD2  . ARG A 1 25 ? -46.558 -3.613  -18.483 1.00 0.00 ? 25 ARG A HD2  2  
ATOM 1439  H HD3  . ARG A 1 25 ? -46.391 -3.783  -20.228 1.00 0.00 ? 25 ARG A HD3  2  
ATOM 1440  H HE   . ARG A 1 25 ? -48.643 -5.253  -19.492 1.00 0.00 ? 25 ARG A HE   2  
ATOM 1441  H HH11 . ARG A 1 25 ? -47.496 -1.992  -19.384 1.00 0.00 ? 25 ARG A HH11 2  
ATOM 1442  H HH12 . ARG A 1 25 ? -49.073 -1.285  -19.510 1.00 0.00 ? 25 ARG A HH12 2  
ATOM 1443  H HH21 . ARG A 1 25 ? -50.716 -4.336  -19.658 1.00 0.00 ? 25 ARG A HH21 2  
ATOM 1444  H HH22 . ARG A 1 25 ? -50.896 -2.614  -19.666 1.00 0.00 ? 25 ARG A HH22 2  
ATOM 1445  N N    . ASN A 1 26 ? -43.936 -7.663  -21.016 1.00 0.00 ? 26 ASN A N    2  
ATOM 1446  C CA   . ASN A 1 26 ? -44.240 -8.577  -22.119 1.00 0.00 ? 26 ASN A CA   2  
ATOM 1447  C C    . ASN A 1 26 ? -43.170 -9.657  -22.274 1.00 0.00 ? 26 ASN A C    2  
ATOM 1448  O O    . ASN A 1 26 ? -43.273 -10.519 -23.149 1.00 0.00 ? 26 ASN A O    2  
ATOM 1449  C CB   . ASN A 1 26 ? -44.363 -7.789  -23.425 1.00 0.00 ? 26 ASN A CB   2  
ATOM 1450  C CG   . ASN A 1 26 ? -43.014 -7.188  -23.803 1.00 0.00 ? 26 ASN A CG   2  
ATOM 1451  O OD1  . ASN A 1 26 ? -41.998 -7.498  -23.181 1.00 0.00 ? 26 ASN A OD1  2  
ATOM 1452  N ND2  . ASN A 1 26 ? -42.942 -6.340  -24.793 1.00 0.00 ? 26 ASN A ND2  2  
ATOM 1453  H H    . ASN A 1 26 ? -43.391 -6.867  -21.185 1.00 0.00 ? 26 ASN A H    2  
ATOM 1454  H HA   . ASN A 1 26 ? -45.186 -9.056  -21.918 1.00 0.00 ? 26 ASN A HA   2  
ATOM 1455  H HB2  . ASN A 1 26 ? -44.693 -8.451  -24.213 1.00 0.00 ? 26 ASN A HB2  2  
ATOM 1456  H HB3  . ASN A 1 26 ? -45.084 -6.996  -23.298 1.00 0.00 ? 26 ASN A HB3  2  
ATOM 1457  H HD21 . ASN A 1 26 ? -43.752 -6.095  -25.288 1.00 0.00 ? 26 ASN A HD21 2  
ATOM 1458  H HD22 . ASN A 1 26 ? -42.079 -5.950  -25.042 1.00 0.00 ? 26 ASN A HD22 2  
ATOM 1459  N N    . GLY A 1 27 ? -42.135 -9.597  -21.444 1.00 0.00 ? 27 GLY A N    2  
ATOM 1460  C CA   . GLY A 1 27 ? -41.048 -10.567 -21.528 1.00 0.00 ? 27 GLY A CA   2  
ATOM 1461  C C    . GLY A 1 27 ? -41.527 -11.995 -21.282 1.00 0.00 ? 27 GLY A C    2  
ATOM 1462  O O    . GLY A 1 27 ? -41.113 -12.922 -21.979 1.00 0.00 ? 27 GLY A O    2  
ATOM 1463  H H    . GLY A 1 27 ? -42.096 -8.890  -20.767 1.00 0.00 ? 27 GLY A H    2  
ATOM 1464  H HA2  . GLY A 1 27 ? -40.604 -10.510 -22.512 1.00 0.00 ? 27 GLY A HA2  2  
ATOM 1465  H HA3  . GLY A 1 27 ? -40.299 -10.318 -20.792 1.00 0.00 ? 27 GLY A HA3  2  
ATOM 1466  N N    . GLY A 1 28 ? -42.384 -12.174 -20.283 1.00 0.00 ? 28 GLY A N    2  
ATOM 1467  C CA   . GLY A 1 28 ? -42.886 -13.507 -19.960 1.00 0.00 ? 28 GLY A CA   2  
ATOM 1468  C C    . GLY A 1 28 ? -43.672 -14.111 -21.120 1.00 0.00 ? 28 GLY A C    2  
ATOM 1469  O O    . GLY A 1 28 ? -43.529 -15.296 -21.428 1.00 0.00 ? 28 GLY A O    2  
ATOM 1470  H H    . GLY A 1 28 ? -42.675 -11.406 -19.750 1.00 0.00 ? 28 GLY A H    2  
ATOM 1471  H HA2  . GLY A 1 28 ? -42.050 -14.150 -19.726 1.00 0.00 ? 28 GLY A HA2  2  
ATOM 1472  H HA3  . GLY A 1 28 ? -43.533 -13.439 -19.096 1.00 0.00 ? 28 GLY A HA3  2  
ATOM 1473  N N    . LEU A 1 29 ? -44.524 -13.303 -21.740 1.00 0.00 ? 29 LEU A N    2  
ATOM 1474  C CA   . LEU A 1 29 ? -45.348 -13.794 -22.840 1.00 0.00 ? 29 LEU A CA   2  
ATOM 1475  C C    . LEU A 1 29 ? -44.477 -14.318 -23.979 1.00 0.00 ? 29 LEU A C    2  
ATOM 1476  O O    . LEU A 1 29 ? -44.719 -15.408 -24.501 1.00 0.00 ? 29 LEU A O    2  
ATOM 1477  C CB   . LEU A 1 29 ? -46.248 -12.667 -23.360 1.00 0.00 ? 29 LEU A CB   2  
ATOM 1478  C CG   . LEU A 1 29 ? -47.470 -12.500 -22.446 1.00 0.00 ? 29 LEU A CG   2  
ATOM 1479  C CD1  . LEU A 1 29 ? -48.401 -13.714 -22.566 1.00 0.00 ? 29 LEU A CD1  2  
ATOM 1480  C CD2  . LEU A 1 29 ? -47.003 -12.363 -20.994 1.00 0.00 ? 29 LEU A CD2  2  
ATOM 1481  H H    . LEU A 1 29 ? -44.616 -12.382 -21.417 1.00 0.00 ? 29 LEU A H    2  
ATOM 1482  H HA   . LEU A 1 29 ? -45.968 -14.598 -22.479 1.00 0.00 ? 29 LEU A HA   2  
ATOM 1483  H HB2  . LEU A 1 29 ? -45.685 -11.743 -23.375 1.00 0.00 ? 29 LEU A HB2  2  
ATOM 1484  H HB3  . LEU A 1 29 ? -46.574 -12.898 -24.362 1.00 0.00 ? 29 LEU A HB3  2  
ATOM 1485  H HG   . LEU A 1 29 ? -48.009 -11.610 -22.732 1.00 0.00 ? 29 LEU A HG   2  
ATOM 1486  H HD11 . LEU A 1 29 ? -48.351 -14.296 -21.657 1.00 0.00 ? 29 LEU A HD11 2  
ATOM 1487  H HD12 . LEU A 1 29 ? -48.100 -14.328 -23.401 1.00 0.00 ? 29 LEU A HD12 2  
ATOM 1488  H HD13 . LEU A 1 29 ? -49.415 -13.375 -22.719 1.00 0.00 ? 29 LEU A HD13 2  
ATOM 1489  H HD21 . LEU A 1 29 ? -46.194 -11.650 -20.942 1.00 0.00 ? 29 LEU A HD21 2  
ATOM 1490  H HD22 . LEU A 1 29 ? -46.663 -13.321 -20.631 1.00 0.00 ? 29 LEU A HD22 2  
ATOM 1491  H HD23 . LEU A 1 29 ? -47.825 -12.019 -20.383 1.00 0.00 ? 29 LEU A HD23 2  
ATOM 1492  N N    . ILE A 1 30 ? -43.474 -13.541 -24.373 1.00 0.00 ? 30 ILE A N    2  
ATOM 1493  C CA   . ILE A 1 30 ? -42.590 -13.947 -25.462 1.00 0.00 ? 30 ILE A CA   2  
ATOM 1494  C C    . ILE A 1 30 ? -41.843 -15.235 -25.123 1.00 0.00 ? 30 ILE A C    2  
ATOM 1495  O O    . ILE A 1 30 ? -41.734 -16.143 -25.956 1.00 0.00 ? 30 ILE A O    2  
ATOM 1496  C CB   . ILE A 1 30 ? -41.580 -12.835 -25.751 1.00 0.00 ? 30 ILE A CB   2  
ATOM 1497  C CG1  . ILE A 1 30 ? -42.307 -11.632 -26.357 1.00 0.00 ? 30 ILE A CG1  2  
ATOM 1498  C CG2  . ILE A 1 30 ? -40.526 -13.344 -26.737 1.00 0.00 ? 30 ILE A CG2  2  
ATOM 1499  C CD1  . ILE A 1 30 ? -41.366 -10.425 -26.387 1.00 0.00 ? 30 ILE A CD1  2  
ATOM 1500  H H    . ILE A 1 30 ? -43.338 -12.666 -23.950 1.00 0.00 ? 30 ILE A H    2  
ATOM 1501  H HA   . ILE A 1 30 ? -43.184 -14.112 -26.349 1.00 0.00 ? 30 ILE A HA   2  
ATOM 1502  H HB   . ILE A 1 30 ? -41.098 -12.540 -24.831 1.00 0.00 ? 30 ILE A HB   2  
ATOM 1503  H HG12 . ILE A 1 30 ? -42.619 -11.870 -27.363 1.00 0.00 ? 30 ILE A HG12 2  
ATOM 1504  H HG13 . ILE A 1 30 ? -43.173 -11.395 -25.758 1.00 0.00 ? 30 ILE A HG13 2  
ATOM 1505  H HG21 . ILE A 1 30 ? -39.995 -12.505 -27.162 1.00 0.00 ? 30 ILE A HG21 2  
ATOM 1506  H HG22 . ILE A 1 30 ? -41.010 -13.900 -27.525 1.00 0.00 ? 30 ILE A HG22 2  
ATOM 1507  H HG23 . ILE A 1 30 ? -39.829 -13.985 -26.218 1.00 0.00 ? 30 ILE A HG23 2  
ATOM 1508  H HD11 . ILE A 1 30 ? -40.552 -10.622 -27.071 1.00 0.00 ? 30 ILE A HD11 2  
ATOM 1509  H HD12 . ILE A 1 30 ? -40.970 -10.254 -25.398 1.00 0.00 ? 30 ILE A HD12 2  
ATOM 1510  H HD13 . ILE A 1 30 ? -41.910 -9.552  -26.715 1.00 0.00 ? 30 ILE A HD13 2  
ATOM 1511  N N    . PHE A 1 31 ? -41.332 -15.315 -23.900 1.00 0.00 ? 31 PHE A N    2  
ATOM 1512  C CA   . PHE A 1 31 ? -40.596 -16.493 -23.462 1.00 0.00 ? 31 PHE A CA   2  
ATOM 1513  C C    . PHE A 1 31 ? -41.467 -17.743 -23.516 1.00 0.00 ? 31 PHE A C    2  
ATOM 1514  O O    . PHE A 1 31 ? -41.031 -18.793 -23.990 1.00 0.00 ? 31 PHE A O    2  
ATOM 1515  C CB   . PHE A 1 31 ? -40.090 -16.286 -22.032 1.00 0.00 ? 31 PHE A CB   2  
ATOM 1516  C CG   . PHE A 1 31 ? -39.372 -17.529 -21.566 1.00 0.00 ? 31 PHE A CG   2  
ATOM 1517  C CD1  . PHE A 1 31 ? -38.059 -17.775 -21.981 1.00 0.00 ? 31 PHE A CD1  2  
ATOM 1518  C CD2  . PHE A 1 31 ? -40.019 -18.433 -20.716 1.00 0.00 ? 31 PHE A CD2  2  
ATOM 1519  C CE1  . PHE A 1 31 ? -37.392 -18.928 -21.548 1.00 0.00 ? 31 PHE A CE1  2  
ATOM 1520  C CE2  . PHE A 1 31 ? -39.353 -19.586 -20.282 1.00 0.00 ? 31 PHE A CE2  2  
ATOM 1521  C CZ   . PHE A 1 31 ? -38.040 -19.832 -20.698 1.00 0.00 ? 31 PHE A CZ   2  
ATOM 1522  H H    . PHE A 1 31 ? -41.455 -14.578 -23.265 1.00 0.00 ? 31 PHE A H    2  
ATOM 1523  H HA   . PHE A 1 31 ? -39.745 -16.634 -24.111 1.00 0.00 ? 31 PHE A HA   2  
ATOM 1524  H HB2  . PHE A 1 31 ? -39.409 -15.447 -22.012 1.00 0.00 ? 31 PHE A HB2  2  
ATOM 1525  H HB3  . PHE A 1 31 ? -40.927 -16.087 -21.380 1.00 0.00 ? 31 PHE A HB3  2  
ATOM 1526  H HD1  . PHE A 1 31 ? -37.559 -17.077 -22.637 1.00 0.00 ? 31 PHE A HD1  2  
ATOM 1527  H HD2  . PHE A 1 31 ? -41.034 -18.242 -20.397 1.00 0.00 ? 31 PHE A HD2  2  
ATOM 1528  H HE1  . PHE A 1 31 ? -36.378 -19.117 -21.868 1.00 0.00 ? 31 PHE A HE1  2  
ATOM 1529  H HE2  . PHE A 1 31 ? -39.852 -20.284 -19.628 1.00 0.00 ? 31 PHE A HE2  2  
ATOM 1530  H HZ   . PHE A 1 31 ? -37.525 -20.722 -20.363 1.00 0.00 ? 31 PHE A HZ   2  
ATOM 1531  N N    . ALA A 1 32 ? -42.685 -17.638 -22.995 1.00 0.00 ? 32 ALA A N    2  
ATOM 1532  C CA   . ALA A 1 32 ? -43.587 -18.783 -22.959 1.00 0.00 ? 32 ALA A CA   2  
ATOM 1533  C C    . ALA A 1 32 ? -43.861 -19.328 -24.357 1.00 0.00 ? 32 ALA A C    2  
ATOM 1534  O O    . ALA A 1 32 ? -43.889 -20.543 -24.550 1.00 0.00 ? 32 ALA A O    2  
ATOM 1535  C CB   . ALA A 1 32 ? -44.910 -18.380 -22.304 1.00 0.00 ? 32 ALA A CB   2  
ATOM 1536  H H    . ALA A 1 32 ? -42.970 -16.788 -22.598 1.00 0.00 ? 32 ALA A H    2  
ATOM 1537  H HA   . ALA A 1 32 ? -43.135 -19.562 -22.364 1.00 0.00 ? 32 ALA A HA   2  
ATOM 1538  H HB1  . ALA A 1 32 ? -45.662 -18.242 -23.068 1.00 0.00 ? 32 ALA A HB1  2  
ATOM 1539  H HB2  . ALA A 1 32 ? -44.776 -17.456 -21.760 1.00 0.00 ? 32 ALA A HB2  2  
ATOM 1540  H HB3  . ALA A 1 32 ? -45.226 -19.157 -21.624 1.00 0.00 ? 32 ALA A HB3  2  
ATOM 1541  N N    . GLY A 1 33 ? -44.066 -18.448 -25.332 1.00 0.00 ? 33 GLY A N    2  
ATOM 1542  C CA   . GLY A 1 33 ? -44.337 -18.903 -26.692 1.00 0.00 ? 33 GLY A CA   2  
ATOM 1543  C C    . GLY A 1 33 ? -43.175 -19.731 -27.231 1.00 0.00 ? 33 GLY A C    2  
ATOM 1544  O O    . GLY A 1 33 ? -43.379 -20.762 -27.873 1.00 0.00 ? 33 GLY A O    2  
ATOM 1545  H H    . GLY A 1 33 ? -44.050 -17.484 -25.151 1.00 0.00 ? 33 GLY A H    2  
ATOM 1546  H HA2  . GLY A 1 33 ? -45.233 -19.507 -26.691 1.00 0.00 ? 33 GLY A HA2  2  
ATOM 1547  H HA3  . GLY A 1 33 ? -44.486 -18.046 -27.331 1.00 0.00 ? 33 GLY A HA3  2  
ATOM 1548  N N    . LEU A 1 34 ? -41.955 -19.289 -26.943 1.00 0.00 ? 34 LEU A N    2  
ATOM 1549  C CA   . LEU A 1 34 ? -40.771 -20.019 -27.385 1.00 0.00 ? 34 LEU A CA   2  
ATOM 1550  C C    . LEU A 1 34 ? -40.688 -21.363 -26.664 1.00 0.00 ? 34 LEU A C    2  
ATOM 1551  O O    . LEU A 1 34 ? -40.298 -22.378 -27.245 1.00 0.00 ? 34 LEU A O    2  
ATOM 1552  C CB   . LEU A 1 34 ? -39.509 -19.200 -27.096 1.00 0.00 ? 34 LEU A CB   2  
ATOM 1553  C CG   . LEU A 1 34 ? -39.474 -17.967 -28.007 1.00 0.00 ? 34 LEU A CG   2  
ATOM 1554  C CD1  . LEU A 1 34 ? -38.324 -17.053 -27.581 1.00 0.00 ? 34 LEU A CD1  2  
ATOM 1555  C CD2  . LEU A 1 34 ? -39.274 -18.389 -29.470 1.00 0.00 ? 34 LEU A CD2  2  
ATOM 1556  H H    . LEU A 1 34 ? -41.847 -18.477 -26.398 1.00 0.00 ? 34 LEU A H    2  
ATOM 1557  H HA   . LEU A 1 34 ? -40.842 -20.195 -28.448 1.00 0.00 ? 34 LEU A HA   2  
ATOM 1558  H HB2  . LEU A 1 34 ? -39.521 -18.881 -26.064 1.00 0.00 ? 34 LEU A HB2  2  
ATOM 1559  H HB3  . LEU A 1 34 ? -38.634 -19.806 -27.273 1.00 0.00 ? 34 LEU A HB3  2  
ATOM 1560  H HG   . LEU A 1 34 ? -40.407 -17.429 -27.913 1.00 0.00 ? 34 LEU A HG   2  
ATOM 1561  H HD11 . LEU A 1 34 ? -38.682 -16.343 -26.850 1.00 0.00 ? 34 LEU A HD11 2  
ATOM 1562  H HD12 . LEU A 1 34 ? -37.949 -16.522 -28.443 1.00 0.00 ? 34 LEU A HD12 2  
ATOM 1563  H HD13 . LEU A 1 34 ? -37.533 -17.647 -27.151 1.00 0.00 ? 34 LEU A HD13 2  
ATOM 1564  H HD21 . LEU A 1 34 ? -38.742 -19.327 -29.513 1.00 0.00 ? 34 LEU A HD21 2  
ATOM 1565  H HD22 . LEU A 1 34 ? -38.703 -17.632 -29.987 1.00 0.00 ? 34 LEU A HD22 2  
ATOM 1566  H HD23 . LEU A 1 34 ? -40.237 -18.498 -29.947 1.00 0.00 ? 34 LEU A HD23 2  
ATOM 1567  N N    . ALA A 1 35 ? -41.061 -21.346 -25.390 1.00 0.00 ? 35 ALA A N    2  
ATOM 1568  C CA   . ALA A 1 35 ? -41.028 -22.560 -24.583 1.00 0.00 ? 35 ALA A CA   2  
ATOM 1569  C C    . ALA A 1 35 ? -41.943 -23.618 -25.191 1.00 0.00 ? 35 ALA A C    2  
ATOM 1570  O O    . ALA A 1 35 ? -41.564 -24.776 -25.312 1.00 0.00 ? 35 ALA A O    2  
ATOM 1571  C CB   . ALA A 1 35 ? -41.478 -22.253 -23.155 1.00 0.00 ? 35 ALA A CB   2  
ATOM 1572  H H    . ALA A 1 35 ? -41.363 -20.492 -25.015 1.00 0.00 ? 35 ALA A H    2  
ATOM 1573  H HA   . ALA A 1 35 ? -40.017 -22.939 -24.559 1.00 0.00 ? 35 ALA A HA   2  
ATOM 1574  H HB1  . ALA A 1 35 ? -41.399 -21.191 -22.974 1.00 0.00 ? 35 ALA A HB1  2  
ATOM 1575  H HB2  . ALA A 1 35 ? -40.849 -22.784 -22.456 1.00 0.00 ? 35 ALA A HB2  2  
ATOM 1576  H HB3  . ALA A 1 35 ? -42.503 -22.565 -23.024 1.00 0.00 ? 35 ALA A HB3  2  
ATOM 1577  N N    . PHE A 1 36 ? -43.160 -23.209 -25.529 1.00 0.00 ? 36 PHE A N    2  
ATOM 1578  C CA   . PHE A 1 36 ? -44.159 -24.125 -26.088 1.00 0.00 ? 36 PHE A CA   2  
ATOM 1579  C C    . PHE A 1 36 ? -43.682 -24.784 -27.388 1.00 0.00 ? 36 PHE A C    2  
ATOM 1580  O O    . PHE A 1 36 ? -43.828 -25.998 -27.568 1.00 0.00 ? 36 PHE A O    2  
ATOM 1581  C CB   . PHE A 1 36 ? -45.461 -23.366 -26.357 1.00 0.00 ? 36 PHE A CB   2  
ATOM 1582  C CG   . PHE A 1 36 ? -46.469 -24.302 -26.977 1.00 0.00 ? 36 PHE A CG   2  
ATOM 1583  C CD1  . PHE A 1 36 ? -47.167 -25.213 -26.174 1.00 0.00 ? 36 PHE A CD1  2  
ATOM 1584  C CD2  . PHE A 1 36 ? -46.707 -24.262 -28.357 1.00 0.00 ? 36 PHE A CD2  2  
ATOM 1585  C CE1  . PHE A 1 36 ? -48.103 -26.080 -26.748 1.00 0.00 ? 36 PHE A CE1  2  
ATOM 1586  C CE2  . PHE A 1 36 ? -47.644 -25.130 -28.932 1.00 0.00 ? 36 PHE A CE2  2  
ATOM 1587  C CZ   . PHE A 1 36 ? -48.341 -26.040 -28.128 1.00 0.00 ? 36 PHE A CZ   2  
ATOM 1588  H H    . PHE A 1 36 ? -43.410 -22.284 -25.322 1.00 0.00 ? 36 PHE A H    2  
ATOM 1589  H HA   . PHE A 1 36 ? -44.360 -24.899 -25.364 1.00 0.00 ? 36 PHE A HA   2  
ATOM 1590  H HB2  . PHE A 1 36 ? -45.852 -22.981 -25.426 1.00 0.00 ? 36 PHE A HB2  2  
ATOM 1591  H HB3  . PHE A 1 36 ? -45.267 -22.547 -27.032 1.00 0.00 ? 36 PHE A HB3  2  
ATOM 1592  H HD1  . PHE A 1 36 ? -46.982 -25.245 -25.110 1.00 0.00 ? 36 PHE A HD1  2  
ATOM 1593  H HD2  . PHE A 1 36 ? -46.169 -23.560 -28.977 1.00 0.00 ? 36 PHE A HD2  2  
ATOM 1594  H HE1  . PHE A 1 36 ? -48.641 -26.782 -26.129 1.00 0.00 ? 36 PHE A HE1  2  
ATOM 1595  H HE2  . PHE A 1 36 ? -47.827 -25.098 -29.995 1.00 0.00 ? 36 PHE A HE2  2  
ATOM 1596  H HZ   . PHE A 1 36 ? -49.062 -26.709 -28.571 1.00 0.00 ? 36 PHE A HZ   2  
ATOM 1597  N N    . ILE A 1 37 ? -43.139 -23.987 -28.302 1.00 0.00 ? 37 ILE A N    2  
ATOM 1598  C CA   . ILE A 1 37 ? -42.687 -24.522 -29.587 1.00 0.00 ? 37 ILE A CA   2  
ATOM 1599  C C    . ILE A 1 37 ? -41.645 -25.619 -29.387 1.00 0.00 ? 37 ILE A C    2  
ATOM 1600  O O    . ILE A 1 37 ? -41.697 -26.661 -30.042 1.00 0.00 ? 37 ILE A O    2  
ATOM 1601  C CB   . ILE A 1 37 ? -42.089 -23.396 -30.433 1.00 0.00 ? 37 ILE A CB   2  
ATOM 1602  C CG1  . ILE A 1 37 ? -43.203 -22.436 -30.858 1.00 0.00 ? 37 ILE A CG1  2  
ATOM 1603  C CG2  . ILE A 1 37 ? -41.425 -23.990 -31.676 1.00 0.00 ? 37 ILE A CG2  2  
ATOM 1604  C CD1  . ILE A 1 37 ? -42.586 -21.166 -31.447 1.00 0.00 ? 37 ILE A CD1  2  
ATOM 1605  H H    . ILE A 1 37 ? -43.068 -23.023 -28.128 1.00 0.00 ? 37 ILE A H    2  
ATOM 1606  H HA   . ILE A 1 37 ? -43.536 -24.935 -30.112 1.00 0.00 ? 37 ILE A HA   2  
ATOM 1607  H HB   . ILE A 1 37 ? -41.352 -22.862 -29.851 1.00 0.00 ? 37 ILE A HB   2  
ATOM 1608  H HG12 . ILE A 1 37 ? -43.824 -22.914 -31.602 1.00 0.00 ? 37 ILE A HG12 2  
ATOM 1609  H HG13 . ILE A 1 37 ? -43.802 -22.178 -29.999 1.00 0.00 ? 37 ILE A HG13 2  
ATOM 1610  H HG21 . ILE A 1 37 ? -40.369 -24.121 -31.493 1.00 0.00 ? 37 ILE A HG21 2  
ATOM 1611  H HG22 . ILE A 1 37 ? -41.564 -23.321 -32.513 1.00 0.00 ? 37 ILE A HG22 2  
ATOM 1612  H HG23 . ILE A 1 37 ? -41.873 -24.946 -31.902 1.00 0.00 ? 37 ILE A HG23 2  
ATOM 1613  H HD11 . ILE A 1 37 ? -43.215 -20.799 -32.246 1.00 0.00 ? 37 ILE A HD11 2  
ATOM 1614  H HD12 . ILE A 1 37 ? -41.603 -21.388 -31.835 1.00 0.00 ? 37 ILE A HD12 2  
ATOM 1615  H HD13 . ILE A 1 37 ? -42.507 -20.414 -30.676 1.00 0.00 ? 37 ILE A HD13 2  
ATOM 1616  N N    . VAL A 1 38 ? -40.697 -25.376 -28.493 1.00 0.00 ? 38 VAL A N    2  
ATOM 1617  C CA   . VAL A 1 38 ? -39.642 -26.353 -28.236 1.00 0.00 ? 38 VAL A CA   2  
ATOM 1618  C C    . VAL A 1 38 ? -40.242 -27.690 -27.796 1.00 0.00 ? 38 VAL A C    2  
ATOM 1619  O O    . VAL A 1 38 ? -39.771 -28.753 -28.202 1.00 0.00 ? 38 VAL A O    2  
ATOM 1620  C CB   . VAL A 1 38 ? -38.703 -25.834 -27.146 1.00 0.00 ? 38 VAL A CB   2  
ATOM 1621  C CG1  . VAL A 1 38 ? -37.747 -26.950 -26.723 1.00 0.00 ? 38 VAL A CG1  2  
ATOM 1622  C CG2  . VAL A 1 38 ? -37.899 -24.650 -27.689 1.00 0.00 ? 38 VAL A CG2  2  
ATOM 1623  H H    . VAL A 1 38 ? -40.695 -24.515 -28.024 1.00 0.00 ? 38 VAL A H    2  
ATOM 1624  H HA   . VAL A 1 38 ? -39.075 -26.504 -29.142 1.00 0.00 ? 38 VAL A HA   2  
ATOM 1625  H HB   . VAL A 1 38 ? -39.284 -25.516 -26.292 1.00 0.00 ? 38 VAL A HB   2  
ATOM 1626  H HG11 . VAL A 1 38 ? -36.911 -26.524 -26.188 1.00 0.00 ? 38 VAL A HG11 2  
ATOM 1627  H HG12 . VAL A 1 38 ? -37.386 -27.466 -27.601 1.00 0.00 ? 38 VAL A HG12 2  
ATOM 1628  H HG13 . VAL A 1 38 ? -38.267 -27.647 -26.082 1.00 0.00 ? 38 VAL A HG13 2  
ATOM 1629  H HG21 . VAL A 1 38 ? -37.598 -24.014 -26.869 1.00 0.00 ? 38 VAL A HG21 2  
ATOM 1630  H HG22 . VAL A 1 38 ? -38.508 -24.086 -28.379 1.00 0.00 ? 38 VAL A HG22 2  
ATOM 1631  H HG23 . VAL A 1 38 ? -37.021 -25.017 -28.200 1.00 0.00 ? 38 VAL A HG23 2  
ATOM 1632  N N    . GLY A 1 39 ? -41.273 -27.629 -26.961 1.00 0.00 ? 39 GLY A N    2  
ATOM 1633  C CA   . GLY A 1 39 ? -41.931 -28.829 -26.453 1.00 0.00 ? 39 GLY A CA   2  
ATOM 1634  C C    . GLY A 1 39 ? -42.519 -29.671 -27.580 1.00 0.00 ? 39 GLY A C    2  
ATOM 1635  O O    . GLY A 1 39 ? -42.503 -30.901 -27.514 1.00 0.00 ? 39 GLY A O    2  
ATOM 1636  H H    . GLY A 1 39 ? -41.595 -26.762 -26.664 1.00 0.00 ? 39 GLY A H    2  
ATOM 1637  H HA2  . GLY A 1 39 ? -41.211 -29.421 -25.909 1.00 0.00 ? 39 GLY A HA2  2  
ATOM 1638  H HA3  . GLY A 1 39 ? -42.724 -28.535 -25.783 1.00 0.00 ? 39 GLY A HA3  2  
ATOM 1639  N N    . LEU A 1 40 ? -43.040 -29.013 -28.611 1.00 0.00 ? 40 LEU A N    2  
ATOM 1640  C CA   . LEU A 1 40 ? -43.627 -29.749 -29.728 1.00 0.00 ? 40 LEU A CA   2  
ATOM 1641  C C    . LEU A 1 40 ? -42.568 -30.647 -30.367 1.00 0.00 ? 40 LEU A C    2  
ATOM 1642  O O    . LEU A 1 40 ? -42.837 -31.801 -30.704 1.00 0.00 ? 40 LEU A O    2  
ATOM 1643  C CB   . LEU A 1 40 ? -44.169 -28.770 -30.774 1.00 0.00 ? 40 LEU A CB   2  
ATOM 1644  C CG   . LEU A 1 40 ? -45.399 -28.041 -30.216 1.00 0.00 ? 40 LEU A CG   2  
ATOM 1645  C CD1  . LEU A 1 40 ? -45.816 -26.931 -31.183 1.00 0.00 ? 40 LEU A CD1  2  
ATOM 1646  C CD2  . LEU A 1 40 ? -46.565 -29.023 -30.039 1.00 0.00 ? 40 LEU A CD2  2  
ATOM 1647  H H    . LEU A 1 40 ? -43.021 -28.029 -28.614 1.00 0.00 ? 40 LEU A H    2  
ATOM 1648  H HA   . LEU A 1 40 ? -44.436 -30.361 -29.363 1.00 0.00 ? 40 LEU A HA   2  
ATOM 1649  H HB2  . LEU A 1 40 ? -43.403 -28.047 -31.015 1.00 0.00 ? 40 LEU A HB2  2  
ATOM 1650  H HB3  . LEU A 1 40 ? -44.442 -29.309 -31.669 1.00 0.00 ? 40 LEU A HB3  2  
ATOM 1651  H HG   . LEU A 1 40 ? -45.149 -27.605 -29.260 1.00 0.00 ? 40 LEU A HG   2  
ATOM 1652  H HD11 . LEU A 1 40 ? -45.247 -27.018 -32.098 1.00 0.00 ? 40 LEU A HD11 2  
ATOM 1653  H HD12 . LEU A 1 40 ? -45.624 -25.969 -30.730 1.00 0.00 ? 40 LEU A HD12 2  
ATOM 1654  H HD13 . LEU A 1 40 ? -46.869 -27.022 -31.402 1.00 0.00 ? 40 LEU A HD13 2  
ATOM 1655  H HD21 . LEU A 1 40 ? -46.473 -29.836 -30.742 1.00 0.00 ? 40 LEU A HD21 2  
ATOM 1656  H HD22 . LEU A 1 40 ? -47.498 -28.506 -30.212 1.00 0.00 ? 40 LEU A HD22 2  
ATOM 1657  H HD23 . LEU A 1 40 ? -46.555 -29.415 -29.033 1.00 0.00 ? 40 LEU A HD23 2  
ATOM 1658  N N    . LEU A 1 41 ? -41.374 -30.095 -30.549 1.00 0.00 ? 41 LEU A N    2  
ATOM 1659  C CA   . LEU A 1 41 ? -40.275 -30.832 -31.174 1.00 0.00 ? 41 LEU A CA   2  
ATOM 1660  C C    . LEU A 1 41 ? -39.952 -32.107 -30.394 1.00 0.00 ? 41 LEU A C    2  
ATOM 1661  O O    . LEU A 1 41 ? -39.600 -33.126 -30.984 1.00 0.00 ? 41 LEU A O    2  
ATOM 1662  C CB   . LEU A 1 41 ? -39.025 -29.948 -31.239 1.00 0.00 ? 41 LEU A CB   2  
ATOM 1663  C CG   . LEU A 1 41 ? -39.245 -28.807 -32.239 1.00 0.00 ? 41 LEU A CG   2  
ATOM 1664  C CD1  . LEU A 1 41 ? -38.078 -27.822 -32.153 1.00 0.00 ? 41 LEU A CD1  2  
ATOM 1665  C CD2  . LEU A 1 41 ? -39.339 -29.359 -33.668 1.00 0.00 ? 41 LEU A CD2  2  
ATOM 1666  H H    . LEU A 1 41 ? -41.252 -29.156 -30.316 1.00 0.00 ? 41 LEU A H    2  
ATOM 1667  H HA   . LEU A 1 41 ? -40.563 -31.102 -32.178 1.00 0.00 ? 41 LEU A HA   2  
ATOM 1668  H HB2  . LEU A 1 41 ? -38.834 -29.533 -30.260 1.00 0.00 ? 41 LEU A HB2  2  
ATOM 1669  H HB3  . LEU A 1 41 ? -38.178 -30.541 -31.545 1.00 0.00 ? 41 LEU A HB3  2  
ATOM 1670  H HG   . LEU A 1 41 ? -40.163 -28.291 -31.993 1.00 0.00 ? 41 LEU A HG   2  
ATOM 1671  H HD11 . LEU A 1 41 ? -37.175 -28.306 -32.495 1.00 0.00 ? 41 LEU A HD11 2  
ATOM 1672  H HD12 . LEU A 1 41 ? -37.951 -27.504 -31.128 1.00 0.00 ? 41 LEU A HD12 2  
ATOM 1673  H HD13 . LEU A 1 41 ? -38.284 -26.963 -32.774 1.00 0.00 ? 41 LEU A HD13 2  
ATOM 1674  H HD21 . LEU A 1 41 ? -38.930 -28.635 -34.359 1.00 0.00 ? 41 LEU A HD21 2  
ATOM 1675  H HD22 . LEU A 1 41 ? -40.374 -29.544 -33.916 1.00 0.00 ? 41 LEU A HD22 2  
ATOM 1676  H HD23 . LEU A 1 41 ? -38.782 -30.279 -33.745 1.00 0.00 ? 41 LEU A HD23 2  
ATOM 1677  N N    . ILE A 1 42 ? -40.070 -32.044 -29.075 1.00 0.00 ? 42 ILE A N    2  
ATOM 1678  C CA   . ILE A 1 42 ? -39.782 -33.207 -28.236 1.00 0.00 ? 42 ILE A CA   2  
ATOM 1679  C C    . ILE A 1 42 ? -40.702 -34.376 -28.599 1.00 0.00 ? 42 ILE A C    2  
ATOM 1680  O O    . ILE A 1 42 ? -40.266 -35.529 -28.680 1.00 0.00 ? 42 ILE A O    2  
ATOM 1681  C CB   . ILE A 1 42 ? -39.951 -32.856 -26.758 1.00 0.00 ? 42 ILE A CB   2  
ATOM 1682  C CG1  . ILE A 1 42 ? -38.833 -31.891 -26.337 1.00 0.00 ? 42 ILE A CG1  2  
ATOM 1683  C CG2  . ILE A 1 42 ? -39.873 -34.133 -25.918 1.00 0.00 ? 42 ILE A CG2  2  
ATOM 1684  C CD1  . ILE A 1 42 ? -39.121 -31.328 -24.942 1.00 0.00 ? 42 ILE A CD1  2  
ATOM 1685  H H    . ILE A 1 42 ? -40.353 -31.203 -28.669 1.00 0.00 ? 42 ILE A H    2  
ATOM 1686  H HA   . ILE A 1 42 ? -38.759 -33.510 -28.406 1.00 0.00 ? 42 ILE A HA   2  
ATOM 1687  H HB   . ILE A 1 42 ? -40.912 -32.385 -26.611 1.00 0.00 ? 42 ILE A HB   2  
ATOM 1688  H HG12 . ILE A 1 42 ? -37.892 -32.420 -26.323 1.00 0.00 ? 42 ILE A HG12 2  
ATOM 1689  H HG13 . ILE A 1 42 ? -38.778 -31.078 -27.046 1.00 0.00 ? 42 ILE A HG13 2  
ATOM 1690  H HG21 . ILE A 1 42 ? -39.304 -34.879 -26.452 1.00 0.00 ? 42 ILE A HG21 2  
ATOM 1691  H HG22 . ILE A 1 42 ? -40.869 -34.503 -25.733 1.00 0.00 ? 42 ILE A HG22 2  
ATOM 1692  H HG23 . ILE A 1 42 ? -39.389 -33.918 -24.978 1.00 0.00 ? 42 ILE A HG23 2  
ATOM 1693  H HD11 . ILE A 1 42 ? -38.304 -31.574 -24.280 1.00 0.00 ? 42 ILE A HD11 2  
ATOM 1694  H HD12 . ILE A 1 42 ? -40.036 -31.757 -24.558 1.00 0.00 ? 42 ILE A HD12 2  
ATOM 1695  H HD13 . ILE A 1 42 ? -39.224 -30.255 -25.002 1.00 0.00 ? 42 ILE A HD13 2  
ATOM 1696  N N    . LEU A 1 43 ? -41.979 -34.083 -28.805 1.00 0.00 ? 43 LEU A N    2  
ATOM 1697  C CA   . LEU A 1 43 ? -42.933 -35.133 -29.139 1.00 0.00 ? 43 LEU A CA   2  
ATOM 1698  C C    . LEU A 1 43 ? -42.507 -35.847 -30.418 1.00 0.00 ? 43 LEU A C    2  
ATOM 1699  O O    . LEU A 1 43 ? -42.633 -37.067 -30.524 1.00 0.00 ? 43 LEU A O    2  
ATOM 1700  C CB   . LEU A 1 43 ? -44.329 -34.529 -29.325 1.00 0.00 ? 43 LEU A CB   2  
ATOM 1701  C CG   . LEU A 1 43 ? -44.870 -34.046 -27.973 1.00 0.00 ? 43 LEU A CG   2  
ATOM 1702  C CD1  . LEU A 1 43 ? -46.166 -33.264 -28.194 1.00 0.00 ? 43 LEU A CD1  2  
ATOM 1703  C CD2  . LEU A 1 43 ? -45.151 -35.242 -27.051 1.00 0.00 ? 43 LEU A CD2  2  
ATOM 1704  H H    . LEU A 1 43 ? -42.286 -33.162 -28.710 1.00 0.00 ? 43 LEU A H    2  
ATOM 1705  H HA   . LEU A 1 43 ? -42.965 -35.848 -28.330 1.00 0.00 ? 43 LEU A HA   2  
ATOM 1706  H HB2  . LEU A 1 43 ? -44.265 -33.692 -30.004 1.00 0.00 ? 43 LEU A HB2  2  
ATOM 1707  H HB3  . LEU A 1 43 ? -44.993 -35.272 -29.737 1.00 0.00 ? 43 LEU A HB3  2  
ATOM 1708  H HG   . LEU A 1 43 ? -44.140 -33.399 -27.510 1.00 0.00 ? 43 LEU A HG   2  
ATOM 1709  H HD11 . LEU A 1 43 ? -46.643 -33.608 -29.100 1.00 0.00 ? 43 LEU A HD11 2  
ATOM 1710  H HD12 . LEU A 1 43 ? -45.941 -32.212 -28.283 1.00 0.00 ? 43 LEU A HD12 2  
ATOM 1711  H HD13 . LEU A 1 43 ? -46.829 -33.421 -27.356 1.00 0.00 ? 43 LEU A HD13 2  
ATOM 1712  H HD21 . LEU A 1 43 ? -45.176 -36.153 -27.628 1.00 0.00 ? 43 LEU A HD21 2  
ATOM 1713  H HD22 . LEU A 1 43 ? -46.104 -35.102 -26.562 1.00 0.00 ? 43 LEU A HD22 2  
ATOM 1714  H HD23 . LEU A 1 43 ? -44.372 -35.310 -26.306 1.00 0.00 ? 43 LEU A HD23 2  
ATOM 1715  N N    . LEU A 1 44 ? -42.013 -35.088 -31.391 1.00 0.00 ? 44 LEU A N    2  
ATOM 1716  C CA   . LEU A 1 44 ? -41.583 -35.671 -32.658 1.00 0.00 ? 44 LEU A CA   2  
ATOM 1717  C C    . LEU A 1 44 ? -40.465 -36.691 -32.438 1.00 0.00 ? 44 LEU A C    2  
ATOM 1718  O O    . LEU A 1 44 ? -40.353 -37.674 -33.179 1.00 0.00 ? 44 LEU A O    2  
ATOM 1719  C CB   . LEU A 1 44 ? -41.082 -34.566 -33.598 1.00 0.00 ? 44 LEU A CB   2  
ATOM 1720  C CG   . LEU A 1 44 ? -42.233 -34.050 -34.475 1.00 0.00 ? 44 LEU A CG   2  
ATOM 1721  C CD1  . LEU A 1 44 ? -42.665 -35.129 -35.475 1.00 0.00 ? 44 LEU A CD1  2  
ATOM 1722  C CD2  . LEU A 1 44 ? -43.424 -33.670 -33.591 1.00 0.00 ? 44 LEU A CD2  2  
ATOM 1723  H H    . LEU A 1 44 ? -41.954 -34.123 -31.270 1.00 0.00 ? 44 LEU A H    2  
ATOM 1724  H HA   . LEU A 1 44 ? -42.422 -36.169 -33.116 1.00 0.00 ? 44 LEU A HA   2  
ATOM 1725  H HB2  . LEU A 1 44 ? -40.692 -33.750 -33.007 1.00 0.00 ? 44 LEU A HB2  2  
ATOM 1726  H HB3  . LEU A 1 44 ? -40.297 -34.956 -34.226 1.00 0.00 ? 44 LEU A HB3  2  
ATOM 1727  H HG   . LEU A 1 44 ? -41.898 -33.178 -35.017 1.00 0.00 ? 44 LEU A HG   2  
ATOM 1728  H HD11 . LEU A 1 44 ? -43.673 -35.442 -35.251 1.00 0.00 ? 44 LEU A HD11 2  
ATOM 1729  H HD12 . LEU A 1 44 ? -42.001 -35.979 -35.408 1.00 0.00 ? 44 LEU A HD12 2  
ATOM 1730  H HD13 . LEU A 1 44 ? -42.629 -34.725 -36.477 1.00 0.00 ? 44 LEU A HD13 2  
ATOM 1731  H HD21 . LEU A 1 44 ? -43.990 -32.885 -34.070 1.00 0.00 ? 44 LEU A HD21 2  
ATOM 1732  H HD22 . LEU A 1 44 ? -43.065 -33.322 -32.633 1.00 0.00 ? 44 LEU A HD22 2  
ATOM 1733  H HD23 . LEU A 1 44 ? -44.057 -34.533 -33.446 1.00 0.00 ? 44 LEU A HD23 2  
ATOM 1734  N N    . SER A 1 45 ? -39.639 -36.465 -31.417 1.00 0.00 ? 45 SER A N    2  
ATOM 1735  C CA   . SER A 1 45 ? -38.549 -37.389 -31.137 1.00 0.00 ? 45 SER A CA   2  
ATOM 1736  C C    . SER A 1 45 ? -39.125 -38.767 -30.863 1.00 0.00 ? 45 SER A C    2  
ATOM 1737  O O    . SER A 1 45 ? -38.590 -39.776 -31.324 1.00 0.00 ? 45 SER A O    2  
ATOM 1738  C CB   . SER A 1 45 ? -37.735 -36.921 -29.929 1.00 0.00 ? 45 SER A CB   2  
ATOM 1739  O OG   . SER A 1 45 ? -37.114 -35.678 -30.233 1.00 0.00 ? 45 SER A OG   2  
ATOM 1740  H H    . SER A 1 45 ? -39.768 -35.680 -30.853 1.00 0.00 ? 45 SER A H    2  
ATOM 1741  H HA   . SER A 1 45 ? -37.902 -37.443 -32.000 1.00 0.00 ? 45 SER A HA   2  
ATOM 1742  H HB2  . SER A 1 45 ? -38.379 -36.800 -29.080 1.00 0.00 ? 45 SER A HB2  2  
ATOM 1743  H HB3  . SER A 1 45 ? -36.979 -37.662 -29.700 1.00 0.00 ? 45 SER A HB3  2  
ATOM 1744  H HG   . SER A 1 45 ? -36.487 -35.826 -30.943 1.00 0.00 ? 45 SER A HG   2  
ATOM 1745  N N    . ARG A 1 46 ? -40.236 -38.806 -30.133 1.00 0.00 ? 46 ARG A N    2  
ATOM 1746  C CA   . ARG A 1 46 ? -40.882 -40.079 -29.837 1.00 0.00 ? 46 ARG A CA   2  
ATOM 1747  C C    . ARG A 1 46 ? -41.303 -40.764 -31.135 1.00 0.00 ? 46 ARG A C    2  
ATOM 1748  O O    . ARG A 1 46 ? -41.249 -41.989 -31.245 1.00 0.00 ? 46 ARG A O    2  
ATOM 1749  C CB   . ARG A 1 46 ? -42.109 -39.889 -28.938 1.00 0.00 ? 46 ARG A CB   2  
ATOM 1750  C CG   . ARG A 1 46 ? -42.722 -41.265 -28.643 1.00 0.00 ? 46 ARG A CG   2  
ATOM 1751  C CD   . ARG A 1 46 ? -43.847 -41.138 -27.617 1.00 0.00 ? 46 ARG A CD   2  
ATOM 1752  N NE   . ARG A 1 46 ? -44.467 -42.443 -27.395 1.00 0.00 ? 46 ARG A NE   2  
ATOM 1753  C CZ   . ARG A 1 46 ? -43.922 -43.332 -26.572 1.00 0.00 ? 46 ARG A CZ   2  
ATOM 1754  N NH1  . ARG A 1 46 ? -42.812 -43.050 -25.945 1.00 0.00 ? 46 ARG A NH1  2  
ATOM 1755  N NH2  . ARG A 1 46 ? -44.497 -44.491 -26.390 1.00 0.00 ? 46 ARG A NH2  2  
ATOM 1756  H H    . ARG A 1 46 ? -40.631 -37.975 -29.799 1.00 0.00 ? 46 ARG A H    2  
ATOM 1757  H HA   . ARG A 1 46 ? -40.174 -40.714 -29.326 1.00 0.00 ? 46 ARG A HA   2  
ATOM 1758  H HB2  . ARG A 1 46 ? -41.811 -39.417 -28.013 1.00 0.00 ? 46 ARG A HB2  2  
ATOM 1759  H HB3  . ARG A 1 46 ? -42.837 -39.273 -29.443 1.00 0.00 ? 46 ARG A HB3  2  
ATOM 1760  H HG2  . ARG A 1 46 ? -43.121 -41.683 -29.552 1.00 0.00 ? 46 ARG A HG2  2  
ATOM 1761  H HG3  . ARG A 1 46 ? -41.957 -41.921 -28.253 1.00 0.00 ? 46 ARG A HG3  2  
ATOM 1762  H HD2  . ARG A 1 46 ? -43.443 -40.771 -26.684 1.00 0.00 ? 46 ARG A HD2  2  
ATOM 1763  H HD3  . ARG A 1 46 ? -44.589 -40.443 -27.984 1.00 0.00 ? 46 ARG A HD3  2  
ATOM 1764  H HE   . ARG A 1 46 ? -45.300 -42.665 -27.861 1.00 0.00 ? 46 ARG A HE   2  
ATOM 1765  H HH11 . ARG A 1 46 ? -42.373 -42.162 -26.083 1.00 0.00 ? 46 ARG A HH11 2  
ATOM 1766  H HH12 . ARG A 1 46 ? -42.404 -43.719 -25.325 1.00 0.00 ? 46 ARG A HH12 2  
ATOM 1767  H HH21 . ARG A 1 46 ? -45.347 -44.707 -26.869 1.00 0.00 ? 46 ARG A HH21 2  
ATOM 1768  H HH22 . ARG A 1 46 ? -44.087 -45.160 -25.769 1.00 0.00 ? 46 ARG A HH22 2  
ATOM 1769  N N    . ARG A 1 47 ? -41.741 -39.969 -32.110 1.00 0.00 ? 47 ARG A N    2  
ATOM 1770  C CA   . ARG A 1 47 ? -42.191 -40.519 -33.386 1.00 0.00 ? 47 ARG A CA   2  
ATOM 1771  C C    . ARG A 1 47 ? -41.109 -41.390 -34.002 1.00 0.00 ? 47 ARG A C    2  
ATOM 1772  O O    . ARG A 1 47 ? -41.405 -42.345 -34.720 1.00 0.00 ? 47 ARG A O    2  
ATOM 1773  C CB   . ARG A 1 47 ? -42.523 -39.392 -34.364 1.00 0.00 ? 47 ARG A CB   2  
ATOM 1774  C CG   . ARG A 1 47 ? -43.417 -39.941 -35.477 1.00 0.00 ? 47 ARG A CG   2  
ATOM 1775  C CD   . ARG A 1 47 ? -43.087 -39.250 -36.801 1.00 0.00 ? 47 ARG A CD   2  
ATOM 1776  N NE   . ARG A 1 47 ? -41.833 -39.771 -37.342 1.00 0.00 ? 47 ARG A NE   2  
ATOM 1777  C CZ   . ARG A 1 47 ? -41.259 -39.212 -38.401 1.00 0.00 ? 47 ARG A CZ   2  
ATOM 1778  N NH1  . ARG A 1 47 ? -41.813 -38.183 -38.978 1.00 0.00 ? 47 ARG A NH1  2  
ATOM 1779  N NH2  . ARG A 1 47 ? -40.138 -39.696 -38.865 1.00 0.00 ? 47 ARG A NH2  2  
ATOM 1780  H H    . ARG A 1 47 ? -41.776 -39.005 -31.969 1.00 0.00 ? 47 ARG A H    2  
ATOM 1781  H HA   . ARG A 1 47 ? -43.077 -41.114 -33.223 1.00 0.00 ? 47 ARG A HA   2  
ATOM 1782  H HB2  . ARG A 1 47 ? -43.040 -38.600 -33.842 1.00 0.00 ? 47 ARG A HB2  2  
ATOM 1783  H HB3  . ARG A 1 47 ? -41.610 -39.006 -34.793 1.00 0.00 ? 47 ARG A HB3  2  
ATOM 1784  H HG2  . ARG A 1 47 ? -43.252 -41.004 -35.576 1.00 0.00 ? 47 ARG A HG2  2  
ATOM 1785  H HG3  . ARG A 1 47 ? -44.450 -39.759 -35.228 1.00 0.00 ? 47 ARG A HG3  2  
ATOM 1786  H HD2  . ARG A 1 47 ? -43.882 -39.433 -37.508 1.00 0.00 ? 47 ARG A HD2  2  
ATOM 1787  H HD3  . ARG A 1 47 ? -42.992 -38.187 -36.635 1.00 0.00 ? 47 ARG A HD3  2  
ATOM 1788  H HE   . ARG A 1 47 ? -41.409 -40.545 -36.915 1.00 0.00 ? 47 ARG A HE   2  
ATOM 1789  H HH11 . ARG A 1 47 ? -42.671 -37.812 -38.621 1.00 0.00 ? 47 ARG A HH11 2  
ATOM 1790  H HH12 . ARG A 1 47 ? -41.381 -37.763 -39.775 1.00 0.00 ? 47 ARG A HH12 2  
ATOM 1791  H HH21 . ARG A 1 47 ? -39.713 -40.486 -38.424 1.00 0.00 ? 47 ARG A HH21 2  
ATOM 1792  H HH22 . ARG A 1 47 ? -39.706 -39.276 -39.664 1.00 0.00 ? 47 ARG A HH22 2  
ATOM 1793  N N    . PHE A 1 48 ? -39.855 -41.066 -33.722 1.00 0.00 ? 48 PHE A N    2  
ATOM 1794  C CA   . PHE A 1 48 ? -38.748 -41.845 -34.262 1.00 0.00 ? 48 PHE A CA   2  
ATOM 1795  C C    . PHE A 1 48 ? -38.872 -43.306 -33.829 1.00 0.00 ? 48 PHE A C    2  
ATOM 1796  O O    . PHE A 1 48 ? -38.749 -44.219 -34.646 1.00 0.00 ? 48 PHE A O    2  
ATOM 1797  C CB   . PHE A 1 48 ? -37.416 -41.274 -33.774 1.00 0.00 ? 48 PHE A CB   2  
ATOM 1798  C CG   . PHE A 1 48 ? -36.282 -42.125 -34.292 1.00 0.00 ? 48 PHE A CG   2  
ATOM 1799  C CD1  . PHE A 1 48 ? -35.848 -41.985 -35.615 1.00 0.00 ? 48 PHE A CD1  2  
ATOM 1800  C CD2  . PHE A 1 48 ? -35.663 -43.056 -33.448 1.00 0.00 ? 48 PHE A CD2  2  
ATOM 1801  C CE1  . PHE A 1 48 ? -34.796 -42.775 -36.096 1.00 0.00 ? 48 PHE A CE1  2  
ATOM 1802  C CE2  . PHE A 1 48 ? -34.611 -43.846 -33.928 1.00 0.00 ? 48 PHE A CE2  2  
ATOM 1803  C CZ   . PHE A 1 48 ? -34.178 -43.705 -35.252 1.00 0.00 ? 48 PHE A CZ   2  
ATOM 1804  H H    . PHE A 1 48 ? -39.671 -40.301 -33.138 1.00 0.00 ? 48 PHE A H    2  
ATOM 1805  H HA   . PHE A 1 48 ? -38.777 -41.795 -35.340 1.00 0.00 ? 48 PHE A HA   2  
ATOM 1806  H HB2  . PHE A 1 48 ? -37.302 -40.263 -34.138 1.00 0.00 ? 48 PHE A HB2  2  
ATOM 1807  H HB3  . PHE A 1 48 ? -37.398 -41.272 -32.694 1.00 0.00 ? 48 PHE A HB3  2  
ATOM 1808  H HD1  . PHE A 1 48 ? -36.325 -41.267 -36.267 1.00 0.00 ? 48 PHE A HD1  2  
ATOM 1809  H HD2  . PHE A 1 48 ? -35.997 -43.164 -32.427 1.00 0.00 ? 48 PHE A HD2  2  
ATOM 1810  H HE1  . PHE A 1 48 ? -34.462 -42.666 -37.116 1.00 0.00 ? 48 PHE A HE1  2  
ATOM 1811  H HE2  . PHE A 1 48 ? -34.135 -44.564 -33.277 1.00 0.00 ? 48 PHE A HE2  2  
ATOM 1812  H HZ   . PHE A 1 48 ? -33.366 -44.314 -35.622 1.00 0.00 ? 48 PHE A HZ   2  
ATOM 1813  N N    . ARG A 1 49 ? -39.121 -43.515 -32.539 1.00 0.00 ? 49 ARG A N    2  
ATOM 1814  C CA   . ARG A 1 49 ? -39.263 -44.875 -32.025 1.00 0.00 ? 49 ARG A CA   2  
ATOM 1815  C C    . ARG A 1 49 ? -40.703 -45.368 -32.179 1.00 0.00 ? 49 ARG A C    2  
ATOM 1816  O O    . ARG A 1 49 ? -40.947 -46.428 -32.756 1.00 0.00 ? 49 ARG A O    2  
ATOM 1817  C CB   . ARG A 1 49 ? -38.861 -44.911 -30.548 1.00 0.00 ? 49 ARG A CB   2  
ATOM 1818  C CG   . ARG A 1 49 ? -38.963 -46.343 -30.013 1.00 0.00 ? 49 ARG A CG   2  
ATOM 1819  C CD   . ARG A 1 49 ? -38.470 -46.380 -28.566 1.00 0.00 ? 49 ARG A CD   2  
ATOM 1820  N NE   . ARG A 1 49 ? -38.585 -47.731 -28.028 1.00 0.00 ? 49 ARG A NE   2  
ATOM 1821  C CZ   . ARG A 1 49 ? -38.182 -48.013 -26.794 1.00 0.00 ? 49 ARG A CZ   2  
ATOM 1822  N NH1  . ARG A 1 49 ? -37.675 -47.075 -26.041 1.00 0.00 ? 49 ARG A NH1  2  
ATOM 1823  N NH2  . ARG A 1 49 ? -38.294 -49.230 -26.333 1.00 0.00 ? 49 ARG A NH2  2  
ATOM 1824  H H    . ARG A 1 49 ? -39.215 -42.734 -31.955 1.00 0.00 ? 49 ARG A H    2  
ATOM 1825  H HA   . ARG A 1 49 ? -38.608 -45.531 -32.579 1.00 0.00 ? 49 ARG A HA   2  
ATOM 1826  H HB2  . ARG A 1 49 ? -37.844 -44.561 -30.443 1.00 0.00 ? 49 ARG A HB2  2  
ATOM 1827  H HB3  . ARG A 1 49 ? -39.521 -44.272 -29.980 1.00 0.00 ? 49 ARG A HB3  2  
ATOM 1828  H HG2  . ARG A 1 49 ? -39.992 -46.671 -30.052 1.00 0.00 ? 49 ARG A HG2  2  
ATOM 1829  H HG3  . ARG A 1 49 ? -38.353 -46.997 -30.617 1.00 0.00 ? 49 ARG A HG3  2  
ATOM 1830  H HD2  . ARG A 1 49 ? -37.438 -46.070 -28.532 1.00 0.00 ? 49 ARG A HD2  2  
ATOM 1831  H HD3  . ARG A 1 49 ? -39.065 -45.704 -27.970 1.00 0.00 ? 49 ARG A HD3  2  
ATOM 1832  H HE   . ARG A 1 49 ? -38.964 -48.442 -28.586 1.00 0.00 ? 49 ARG A HE   2  
ATOM 1833  H HH11 . ARG A 1 49 ? -37.589 -46.143 -26.394 1.00 0.00 ? 49 ARG A HH11 2  
ATOM 1834  H HH12 . ARG A 1 49 ? -37.372 -47.289 -25.113 1.00 0.00 ? 49 ARG A HH12 2  
ATOM 1835  H HH21 . ARG A 1 49 ? -38.683 -49.948 -26.909 1.00 0.00 ? 49 ARG A HH21 2  
ATOM 1836  H HH22 . ARG A 1 49 ? -37.991 -49.443 -25.404 1.00 0.00 ? 49 ARG A HH22 2  
ATOM 1837  N N    . SER A 1 50 ? -41.649 -44.603 -31.642 1.00 0.00 ? 50 SER A N    2  
ATOM 1838  C CA   . SER A 1 50 ? -43.061 -44.984 -31.706 1.00 0.00 ? 50 SER A CA   2  
ATOM 1839  C C    . SER A 1 50 ? -43.556 -45.076 -33.148 1.00 0.00 ? 50 SER A C    2  
ATOM 1840  O O    . SER A 1 50 ? -44.277 -46.009 -33.504 1.00 0.00 ? 50 SER A O    2  
ATOM 1841  C CB   . SER A 1 50 ? -43.908 -43.966 -30.944 1.00 0.00 ? 50 SER A CB   2  
ATOM 1842  O OG   . SER A 1 50 ? -45.276 -44.344 -31.019 1.00 0.00 ? 50 SER A OG   2  
ATOM 1843  H H    . SER A 1 50 ? -41.389 -43.797 -31.151 1.00 0.00 ? 50 SER A H    2  
ATOM 1844  H HA   . SER A 1 50 ? -43.180 -45.948 -31.236 1.00 0.00 ? 50 SER A HA   2  
ATOM 1845  H HB2  . SER A 1 50 ? -43.603 -43.942 -29.912 1.00 0.00 ? 50 SER A HB2  2  
ATOM 1846  H HB3  . SER A 1 50 ? -43.770 -42.986 -31.382 1.00 0.00 ? 50 SER A HB3  2  
ATOM 1847  H HG   . SER A 1 50 ? -45.332 -45.155 -31.532 1.00 0.00 ? 50 SER A HG   2  
ATOM 1848  N N    . GLY A 1 51 ? -43.183 -44.099 -33.964 1.00 0.00 ? 51 GLY A N    2  
ATOM 1849  C CA   . GLY A 1 51 ? -43.612 -44.075 -35.358 1.00 0.00 ? 51 GLY A CA   2  
ATOM 1850  C C    . GLY A 1 51 ? -44.779 -43.109 -35.538 1.00 0.00 ? 51 GLY A C    2  
ATOM 1851  O O    . GLY A 1 51 ? -45.059 -42.657 -36.649 1.00 0.00 ? 51 GLY A O    2  
ATOM 1852  H H    . GLY A 1 51 ? -42.620 -43.374 -33.622 1.00 0.00 ? 51 GLY A H    2  
ATOM 1853  H HA2  . GLY A 1 51 ? -42.786 -43.763 -35.982 1.00 0.00 ? 51 GLY A HA2  2  
ATOM 1854  H HA3  . GLY A 1 51 ? -43.927 -45.065 -35.652 1.00 0.00 ? 51 GLY A HA3  2  
ATOM 1855  N N    . GLY A 1 52 ? -45.438 -42.777 -34.432 1.00 0.00 ? 52 GLY A N    2  
ATOM 1856  C CA   . GLY A 1 52 ? -46.555 -41.839 -34.463 1.00 0.00 ? 52 GLY A CA   2  
ATOM 1857  C C    . GLY A 1 52 ? -47.876 -42.531 -34.787 1.00 0.00 ? 52 GLY A C    2  
ATOM 1858  O O    . GLY A 1 52 ? -47.909 -43.505 -35.536 1.00 0.00 ? 52 GLY A O    2  
ATOM 1859  H H    . GLY A 1 52 ? -45.156 -43.157 -33.573 1.00 0.00 ? 52 GLY A H    2  
ATOM 1860  H HA2  . GLY A 1 52 ? -46.638 -41.358 -33.499 1.00 0.00 ? 52 GLY A HA2  2  
ATOM 1861  H HA3  . GLY A 1 52 ? -46.362 -41.089 -35.213 1.00 0.00 ? 52 GLY A HA3  2  
ATOM 1862  N N    . ASN A 1 53 ? -48.953 -42.011 -34.197 1.00 0.00 ? 53 ASN A N    2  
ATOM 1863  C CA   . ASN A 1 53 ? -50.299 -42.554 -34.391 1.00 0.00 ? 53 ASN A CA   2  
ATOM 1864  C C    . ASN A 1 53 ? -50.438 -43.913 -33.715 1.00 0.00 ? 53 ASN A C    2  
ATOM 1865  O O    . ASN A 1 53 ? -49.822 -44.166 -32.680 1.00 0.00 ? 53 ASN A O    2  
ATOM 1866  C CB   . ASN A 1 53 ? -50.628 -42.680 -35.882 1.00 0.00 ? 53 ASN A CB   2  
ATOM 1867  C CG   . ASN A 1 53 ? -50.298 -41.377 -36.602 1.00 0.00 ? 53 ASN A CG   2  
ATOM 1868  O OD1  . ASN A 1 53 ? -50.750 -40.309 -36.192 1.00 0.00 ? 53 ASN A OD1  2  
ATOM 1869  N ND2  . ASN A 1 53 ? -49.530 -41.402 -37.657 1.00 0.00 ? 53 ASN A ND2  2  
ATOM 1870  H H    . ASN A 1 53 ? -48.837 -41.253 -33.587 1.00 0.00 ? 53 ASN A H    2  
ATOM 1871  H HA   . ASN A 1 53 ? -51.008 -41.874 -33.940 1.00 0.00 ? 53 ASN A HA   2  
ATOM 1872  H HB2  . ASN A 1 53 ? -50.060 -43.488 -36.315 1.00 0.00 ? 53 ASN A HB2  2  
ATOM 1873  H HB3  . ASN A 1 53 ? -51.682 -42.888 -35.994 1.00 0.00 ? 53 ASN A HB3  2  
ATOM 1874  H HD21 . ASN A 1 53 ? -49.169 -42.254 -37.981 1.00 0.00 ? 53 ASN A HD21 2  
ATOM 1875  H HD22 . ASN A 1 53 ? -49.313 -40.569 -38.124 1.00 0.00 ? 53 ASN A HD22 2  
ATOM 1876  N N    . LYS A 1 54 ? -51.256 -44.782 -34.298 1.00 0.00 ? 54 LYS A N    2  
ATOM 1877  C CA   . LYS A 1 54 ? -51.471 -46.107 -33.728 1.00 0.00 ? 54 LYS A CA   2  
ATOM 1878  C C    . LYS A 1 54 ? -52.097 -47.036 -34.767 1.00 0.00 ? 54 LYS A C    2  
ATOM 1879  O O    . LYS A 1 54 ? -52.654 -46.579 -35.766 1.00 0.00 ? 54 LYS A O    2  
ATOM 1880  C CB   . LYS A 1 54 ? -52.379 -45.994 -32.496 1.00 0.00 ? 54 LYS A CB   2  
ATOM 1881  C CG   . LYS A 1 54 ? -52.316 -47.290 -31.680 1.00 0.00 ? 54 LYS A CG   2  
ATOM 1882  C CD   . LYS A 1 54 ? -53.143 -47.129 -30.404 1.00 0.00 ? 54 LYS A CD   2  
ATOM 1883  C CE   . LYS A 1 54 ? -53.038 -48.402 -29.561 1.00 0.00 ? 54 LYS A CE   2  
ATOM 1884  N NZ   . LYS A 1 54 ? -53.833 -48.235 -28.310 1.00 0.00 ? 54 LYS A NZ   2  
ATOM 1885  H H    . LYS A 1 54 ? -51.727 -44.529 -35.120 1.00 0.00 ? 54 LYS A H    2  
ATOM 1886  H HA   . LYS A 1 54 ? -50.518 -46.515 -33.422 1.00 0.00 ? 54 LYS A HA   2  
ATOM 1887  H HB2  . LYS A 1 54 ? -52.050 -45.168 -31.882 1.00 0.00 ? 54 LYS A HB2  2  
ATOM 1888  H HB3  . LYS A 1 54 ? -53.396 -45.823 -32.815 1.00 0.00 ? 54 LYS A HB3  2  
ATOM 1889  H HG2  . LYS A 1 54 ? -52.714 -48.105 -32.263 1.00 0.00 ? 54 LYS A HG2  2  
ATOM 1890  H HG3  . LYS A 1 54 ? -51.291 -47.501 -31.417 1.00 0.00 ? 54 LYS A HG3  2  
ATOM 1891  H HD2  . LYS A 1 54 ? -52.769 -46.289 -29.837 1.00 0.00 ? 54 LYS A HD2  2  
ATOM 1892  H HD3  . LYS A 1 54 ? -54.176 -46.957 -30.664 1.00 0.00 ? 54 LYS A HD3  2  
ATOM 1893  H HE2  . LYS A 1 54 ? -53.421 -49.241 -30.123 1.00 0.00 ? 54 LYS A HE2  2  
ATOM 1894  H HE3  . LYS A 1 54 ? -52.003 -48.580 -29.307 1.00 0.00 ? 54 LYS A HE3  2  
ATOM 1895  H HZ1  . LYS A 1 54 ? -54.846 -48.278 -28.536 1.00 0.00 ? 54 LYS A HZ1  2  
ATOM 1896  H HZ2  . LYS A 1 54 ? -53.609 -47.315 -27.878 1.00 0.00 ? 54 LYS A HZ2  2  
ATOM 1897  H HZ3  . LYS A 1 54 ? -53.596 -48.998 -27.645 1.00 0.00 ? 54 LYS A HZ3  2  
ATOM 1898  N N    . LYS A 1 55 ? -52.001 -48.339 -34.528 1.00 0.00 ? 55 LYS A N    2  
ATOM 1899  C CA   . LYS A 1 55 ? -52.562 -49.324 -35.450 1.00 0.00 ? 55 LYS A CA   2  
ATOM 1900  C C    . LYS A 1 55 ? -54.005 -49.649 -35.074 1.00 0.00 ? 55 LYS A C    2  
ATOM 1901  O O    . LYS A 1 55 ? -54.657 -50.473 -35.718 1.00 0.00 ? 55 LYS A O    2  
ATOM 1902  C CB   . LYS A 1 55 ? -51.721 -50.600 -35.421 1.00 0.00 ? 55 LYS A CB   2  
ATOM 1903  C CG   . LYS A 1 55 ? -50.311 -50.291 -35.928 1.00 0.00 ? 55 LYS A CG   2  
ATOM 1904  C CD   . LYS A 1 55 ? -49.467 -51.567 -35.911 1.00 0.00 ? 55 LYS A CD   2  
ATOM 1905  C CE   . LYS A 1 55 ? -48.045 -51.241 -36.371 1.00 0.00 ? 55 LYS A CE   2  
ATOM 1906  N NZ   . LYS A 1 55 ? -48.081 -50.744 -37.776 1.00 0.00 ? 55 LYS A NZ   2  
ATOM 1907  H H    . LYS A 1 55 ? -51.555 -48.639 -33.710 1.00 0.00 ? 55 LYS A H    2  
ATOM 1908  H HA   . LYS A 1 55 ? -52.543 -48.917 -36.450 1.00 0.00 ? 55 LYS A HA   2  
ATOM 1909  H HB2  . LYS A 1 55 ? -51.667 -50.973 -34.407 1.00 0.00 ? 55 LYS A HB2  2  
ATOM 1910  H HB3  . LYS A 1 55 ? -52.175 -51.346 -36.055 1.00 0.00 ? 55 LYS A HB3  2  
ATOM 1911  H HG2  . LYS A 1 55 ? -50.370 -49.912 -36.938 1.00 0.00 ? 55 LYS A HG2  2  
ATOM 1912  H HG3  . LYS A 1 55 ? -49.854 -49.551 -35.290 1.00 0.00 ? 55 LYS A HG3  2  
ATOM 1913  H HD2  . LYS A 1 55 ? -49.437 -51.965 -34.906 1.00 0.00 ? 55 LYS A HD2  2  
ATOM 1914  H HD3  . LYS A 1 55 ? -49.901 -52.296 -36.577 1.00 0.00 ? 55 LYS A HD3  2  
ATOM 1915  H HE2  . LYS A 1 55 ? -47.624 -50.480 -35.731 1.00 0.00 ? 55 LYS A HE2  2  
ATOM 1916  H HE3  . LYS A 1 55 ? -47.437 -52.132 -36.322 1.00 0.00 ? 55 LYS A HE3  2  
ATOM 1917  H HZ1  . LYS A 1 55 ? -47.620 -49.812 -37.827 1.00 0.00 ? 55 LYS A HZ1  2  
ATOM 1918  H HZ2  . LYS A 1 55 ? -49.070 -50.659 -38.088 1.00 0.00 ? 55 LYS A HZ2  2  
ATOM 1919  H HZ3  . LYS A 1 55 ? -47.577 -51.411 -38.395 1.00 0.00 ? 55 LYS A HZ3  2  
ATOM 1920  N N    . ARG A 1 56 ? -54.490 -49.002 -34.022 1.00 0.00 ? 56 ARG A N    2  
ATOM 1921  C CA   . ARG A 1 56 ? -55.851 -49.224 -33.540 1.00 0.00 ? 56 ARG A CA   2  
ATOM 1922  C C    . ARG A 1 56 ? -56.887 -48.696 -34.530 1.00 0.00 ? 56 ARG A C    2  
ATOM 1923  O O    . ARG A 1 56 ? -58.001 -49.213 -34.602 1.00 0.00 ? 56 ARG A O    2  
ATOM 1924  C CB   . ARG A 1 56 ? -56.044 -48.538 -32.187 1.00 0.00 ? 56 ARG A CB   2  
ATOM 1925  C CG   . ARG A 1 56 ? -57.413 -48.912 -31.612 1.00 0.00 ? 56 ARG A CG   2  
ATOM 1926  C CD   . ARG A 1 56 ? -57.583 -48.265 -30.237 1.00 0.00 ? 56 ARG A CD   2  
ATOM 1927  N NE   . ARG A 1 56 ? -58.866 -48.645 -29.656 1.00 0.00 ? 56 ARG A NE   2  
ATOM 1928  C CZ   . ARG A 1 56 ? -59.984 -48.003 -29.976 1.00 0.00 ? 56 ARG A CZ   2  
ATOM 1929  N NH1  . ARG A 1 56 ? -59.948 -47.016 -30.828 1.00 0.00 ? 56 ARG A NH1  2  
ATOM 1930  N NH2  . ARG A 1 56 ? -61.119 -48.361 -29.440 1.00 0.00 ? 56 ARG A NH2  2  
ATOM 1931  H H    . ARG A 1 56 ? -53.915 -48.370 -33.545 1.00 0.00 ? 56 ARG A H    2  
ATOM 1932  H HA   . ARG A 1 56 ? -56.003 -50.285 -33.411 1.00 0.00 ? 56 ARG A HA   2  
ATOM 1933  H HB2  . ARG A 1 56 ? -55.268 -48.857 -31.508 1.00 0.00 ? 56 ARG A HB2  2  
ATOM 1934  H HB3  . ARG A 1 56 ? -55.992 -47.466 -32.316 1.00 0.00 ? 56 ARG A HB3  2  
ATOM 1935  H HG2  . ARG A 1 56 ? -58.190 -48.560 -32.275 1.00 0.00 ? 56 ARG A HG2  2  
ATOM 1936  H HG3  . ARG A 1 56 ? -57.480 -49.984 -31.513 1.00 0.00 ? 56 ARG A HG3  2  
ATOM 1937  H HD2  . ARG A 1 56 ? -56.787 -48.592 -29.586 1.00 0.00 ? 56 ARG A HD2  2  
ATOM 1938  H HD3  . ARG A 1 56 ? -57.540 -47.189 -30.341 1.00 0.00 ? 56 ARG A HD3  2  
ATOM 1939  H HE   . ARG A 1 56 ? -58.903 -49.387 -29.016 1.00 0.00 ? 56 ARG A HE   2  
ATOM 1940  H HH11 . ARG A 1 56 ? -59.079 -46.741 -31.240 1.00 0.00 ? 56 ARG A HH11 2  
ATOM 1941  H HH12 . ARG A 1 56 ? -60.790 -46.531 -31.070 1.00 0.00 ? 56 ARG A HH12 2  
ATOM 1942  H HH21 . ARG A 1 56 ? -61.146 -49.119 -28.788 1.00 0.00 ? 56 ARG A HH21 2  
ATOM 1943  H HH22 . ARG A 1 56 ? -61.960 -47.878 -29.681 1.00 0.00 ? 56 ARG A HH22 2  
ATOM 1944  N N    . ARG A 1 57 ? -56.530 -47.652 -35.270 1.00 0.00 ? 57 ARG A N    2  
ATOM 1945  C CA   . ARG A 1 57 ? -57.466 -47.061 -36.221 1.00 0.00 ? 57 ARG A CA   2  
ATOM 1946  C C    . ARG A 1 57 ? -57.905 -48.092 -37.255 1.00 0.00 ? 57 ARG A C    2  
ATOM 1947  O O    . ARG A 1 57 ? -59.079 -48.145 -37.624 1.00 0.00 ? 57 ARG A O    2  
ATOM 1948  C CB   . ARG A 1 57 ? -56.810 -45.883 -36.944 1.00 0.00 ? 57 ARG A CB   2  
ATOM 1949  C CG   . ARG A 1 57 ? -56.569 -44.739 -35.959 1.00 0.00 ? 57 ARG A CG   2  
ATOM 1950  C CD   . ARG A 1 57 ? -55.758 -43.642 -36.653 1.00 0.00 ? 57 ARG A CD   2  
ATOM 1951  N NE   . ARG A 1 57 ? -54.435 -44.142 -37.009 1.00 0.00 ? 57 ARG A NE   2  
ATOM 1952  C CZ   . ARG A 1 57 ? -53.598 -43.410 -37.737 1.00 0.00 ? 57 ARG A CZ   2  
ATOM 1953  N NH1  . ARG A 1 57 ? -53.947 -42.216 -38.130 1.00 0.00 ? 57 ARG A NH1  2  
ATOM 1954  N NH2  . ARG A 1 57 ? -52.425 -43.886 -38.057 1.00 0.00 ? 57 ARG A NH2  2  
ATOM 1955  H H    . ARG A 1 57 ? -55.637 -47.262 -35.160 1.00 0.00 ? 57 ARG A H    2  
ATOM 1956  H HA   . ARG A 1 57 ? -58.334 -46.705 -35.687 1.00 0.00 ? 57 ARG A HA   2  
ATOM 1957  H HB2  . ARG A 1 57 ? -55.867 -46.201 -37.363 1.00 0.00 ? 57 ARG A HB2  2  
ATOM 1958  H HB3  . ARG A 1 57 ? -57.459 -45.542 -37.736 1.00 0.00 ? 57 ARG A HB3  2  
ATOM 1959  H HG2  . ARG A 1 57 ? -57.517 -44.338 -35.633 1.00 0.00 ? 57 ARG A HG2  2  
ATOM 1960  H HG3  . ARG A 1 57 ? -56.019 -45.105 -35.105 1.00 0.00 ? 57 ARG A HG3  2  
ATOM 1961  H HD2  . ARG A 1 57 ? -56.274 -43.329 -37.548 1.00 0.00 ? 57 ARG A HD2  2  
ATOM 1962  H HD3  . ARG A 1 57 ? -55.657 -42.798 -35.986 1.00 0.00 ? 57 ARG A HD3  2  
ATOM 1963  H HE   . ARG A 1 57 ? -54.162 -45.035 -36.712 1.00 0.00 ? 57 ARG A HE   2  
ATOM 1964  H HH11 . ARG A 1 57 ? -54.845 -41.852 -37.884 1.00 0.00 ? 57 ARG A HH11 2  
ATOM 1965  H HH12 . ARG A 1 57 ? -53.316 -41.667 -38.677 1.00 0.00 ? 57 ARG A HH12 2  
ATOM 1966  H HH21 . ARG A 1 57 ? -52.156 -44.800 -37.755 1.00 0.00 ? 57 ARG A HH21 2  
ATOM 1967  H HH22 . ARG A 1 57 ? -51.795 -43.335 -38.604 1.00 0.00 ? 57 ARG A HH22 2  
ATOM 1968  N N    . GLN A 1 58 ? -56.963 -48.911 -37.717 1.00 0.00 ? 58 GLN A N    2  
ATOM 1969  C CA   . GLN A 1 58 ? -57.285 -49.937 -38.704 1.00 0.00 ? 58 GLN A CA   2  
ATOM 1970  C C    . GLN A 1 58 ? -56.656 -51.273 -38.322 1.00 0.00 ? 58 GLN A C    2  
ATOM 1971  O O    . GLN A 1 58 ? -55.441 -51.449 -38.420 1.00 0.00 ? 58 GLN A O    2  
ATOM 1972  C CB   . GLN A 1 58 ? -56.774 -49.511 -40.082 1.00 0.00 ? 58 GLN A CB   2  
ATOM 1973  C CG   . GLN A 1 58 ? -57.608 -48.334 -40.593 1.00 0.00 ? 58 GLN A CG   2  
ATOM 1974  C CD   . GLN A 1 58 ? -56.985 -47.766 -41.863 1.00 0.00 ? 58 GLN A CD   2  
ATOM 1975  O OE1  . GLN A 1 58 ? -55.769 -47.846 -42.048 1.00 0.00 ? 58 GLN A OE1  2  
ATOM 1976  N NE2  . GLN A 1 58 ? -57.746 -47.194 -42.754 1.00 0.00 ? 58 GLN A NE2  2  
ATOM 1977  H H    . GLN A 1 58 ? -56.044 -48.826 -37.388 1.00 0.00 ? 58 GLN A H    2  
ATOM 1978  H HA   . GLN A 1 58 ? -58.354 -50.058 -38.753 1.00 0.00 ? 58 GLN A HA   2  
ATOM 1979  H HB2  . GLN A 1 58 ? -55.738 -49.212 -40.006 1.00 0.00 ? 58 GLN A HB2  2  
ATOM 1980  H HB3  . GLN A 1 58 ? -56.861 -50.337 -40.770 1.00 0.00 ? 58 GLN A HB3  2  
ATOM 1981  H HG2  . GLN A 1 58 ? -58.611 -48.672 -40.806 1.00 0.00 ? 58 GLN A HG2  2  
ATOM 1982  H HG3  . GLN A 1 58 ? -57.643 -47.564 -39.837 1.00 0.00 ? 58 GLN A HG3  2  
ATOM 1983  H HE21 . GLN A 1 58 ? -58.713 -47.130 -42.605 1.00 0.00 ? 58 GLN A HE21 2  
ATOM 1984  H HE22 . GLN A 1 58 ? -57.353 -46.826 -43.574 1.00 0.00 ? 58 GLN A HE22 2  
ATOM 1985  N N    . ILE A 1 59 ? -57.495 -52.213 -37.891 1.00 0.00 ? 59 ILE A N    2  
ATOM 1986  C CA   . ILE A 1 59 ? -57.028 -53.538 -37.500 1.00 0.00 ? 59 ILE A CA   2  
ATOM 1987  C C    . ILE A 1 59 ? -57.768 -54.605 -38.299 1.00 0.00 ? 59 ILE A C    2  
ATOM 1988  O O    . ILE A 1 59 ? -58.995 -54.569 -38.401 1.00 0.00 ? 59 ILE A O    2  
ATOM 1989  C CB   . ILE A 1 59 ? -57.268 -53.759 -36.005 1.00 0.00 ? 59 ILE A CB   2  
ATOM 1990  C CG1  . ILE A 1 59 ? -56.498 -52.706 -35.204 1.00 0.00 ? 59 ILE A CG1  2  
ATOM 1991  C CG2  . ILE A 1 59 ? -56.779 -55.155 -35.613 1.00 0.00 ? 59 ILE A CG2  2  
ATOM 1992  C CD1  . ILE A 1 59 ? -56.931 -52.760 -33.736 1.00 0.00 ? 59 ILE A CD1  2  
ATOM 1993  H H    . ILE A 1 59 ? -58.454 -52.016 -37.831 1.00 0.00 ? 59 ILE A H    2  
ATOM 1994  H HA   . ILE A 1 59 ? -55.972 -53.618 -37.702 1.00 0.00 ? 59 ILE A HA   2  
ATOM 1995  H HB   . ILE A 1 59 ? -58.324 -53.676 -35.794 1.00 0.00 ? 59 ILE A HB   2  
ATOM 1996  H HG12 . ILE A 1 59 ? -55.439 -52.904 -35.275 1.00 0.00 ? 59 ILE A HG12 2  
ATOM 1997  H HG13 . ILE A 1 59 ? -56.710 -51.725 -35.603 1.00 0.00 ? 59 ILE A HG13 2  
ATOM 1998  H HG21 . ILE A 1 59 ? -56.174 -55.088 -34.721 1.00 0.00 ? 59 ILE A HG21 2  
ATOM 1999  H HG22 . ILE A 1 59 ? -56.191 -55.571 -36.418 1.00 0.00 ? 59 ILE A HG22 2  
ATOM 2000  H HG23 . ILE A 1 59 ? -57.629 -55.794 -35.422 1.00 0.00 ? 59 ILE A HG23 2  
ATOM 2001  H HD11 . ILE A 1 59 ? -57.637 -51.966 -33.539 1.00 0.00 ? 59 ILE A HD11 2  
ATOM 2002  H HD12 . ILE A 1 59 ? -56.066 -52.637 -33.102 1.00 0.00 ? 59 ILE A HD12 2  
ATOM 2003  H HD13 . ILE A 1 59 ? -57.397 -53.712 -33.532 1.00 0.00 ? 59 ILE A HD13 2  
ATOM 2004  N N    . ASN A 1 60 ? -57.028 -55.552 -38.866 1.00 0.00 ? 60 ASN A N    2  
ATOM 2005  C CA   . ASN A 1 60 ? -57.655 -56.609 -39.650 1.00 0.00 ? 60 ASN A CA   2  
ATOM 2006  C C    . ASN A 1 60 ? -58.542 -57.472 -38.758 1.00 0.00 ? 60 ASN A C    2  
ATOM 2007  O O    . ASN A 1 60 ? -58.104 -57.960 -37.715 1.00 0.00 ? 60 ASN A O    2  
ATOM 2008  C CB   . ASN A 1 60 ? -56.581 -57.482 -40.302 1.00 0.00 ? 60 ASN A CB   2  
ATOM 2009  C CG   . ASN A 1 60 ? -55.873 -56.703 -41.404 1.00 0.00 ? 60 ASN A CG   2  
ATOM 2010  O OD1  . ASN A 1 60 ? -56.411 -55.720 -41.915 1.00 0.00 ? 60 ASN A OD1  2  
ATOM 2011  N ND2  . ASN A 1 60 ? -54.691 -57.084 -41.805 1.00 0.00 ? 60 ASN A ND2  2  
ATOM 2012  H H    . ASN A 1 60 ? -56.055 -55.541 -38.753 1.00 0.00 ? 60 ASN A H    2  
ATOM 2013  H HA   . ASN A 1 60 ? -58.261 -56.164 -40.423 1.00 0.00 ? 60 ASN A HA   2  
ATOM 2014  H HB2  . ASN A 1 60 ? -55.861 -57.781 -39.555 1.00 0.00 ? 60 ASN A HB2  2  
ATOM 2015  H HB3  . ASN A 1 60 ? -57.043 -58.362 -40.727 1.00 0.00 ? 60 ASN A HB3  2  
ATOM 2016  H HD21 . ASN A 1 60 ? -54.265 -57.868 -41.396 1.00 0.00 ? 60 ASN A HD21 2  
ATOM 2017  H HD22 . ASN A 1 60 ? -54.229 -56.589 -42.512 1.00 0.00 ? 60 ASN A HD22 2  
ATOM 2018  N N    . GLU A 1 61 ? -59.793 -57.650 -39.171 1.00 0.00 ? 61 GLU A N    2  
ATOM 2019  C CA   . GLU A 1 61 ? -60.737 -58.447 -38.397 1.00 0.00 ? 61 GLU A CA   2  
ATOM 2020  C C    . GLU A 1 61 ? -61.801 -59.041 -39.318 1.00 0.00 ? 61 GLU A C    2  
ATOM 2021  O O    . GLU A 1 61 ? -62.160 -58.441 -40.331 1.00 0.00 ? 61 GLU A O    2  
ATOM 2022  C CB   . GLU A 1 61 ? -61.397 -57.573 -37.325 1.00 0.00 ? 61 GLU A CB   2  
ATOM 2023  C CG   . GLU A 1 61 ? -62.265 -58.434 -36.402 1.00 0.00 ? 61 GLU A CG   2  
ATOM 2024  C CD   . GLU A 1 61 ? -61.392 -59.404 -35.613 1.00 0.00 ? 61 GLU A CD   2  
ATOM 2025  O OE1  . GLU A 1 61 ? -60.203 -59.151 -35.509 1.00 0.00 ? 61 GLU A OE1  2  
ATOM 2026  O OE2  . GLU A 1 61 ? -61.926 -60.386 -35.123 1.00 0.00 ? 61 GLU A OE2  2  
ATOM 2027  H H    . GLU A 1 61 ? -60.091 -57.229 -40.004 1.00 0.00 ? 61 GLU A H    2  
ATOM 2028  H HA   . GLU A 1 61 ? -60.202 -59.251 -37.915 1.00 0.00 ? 61 GLU A HA   2  
ATOM 2029  H HB2  . GLU A 1 61 ? -60.631 -57.082 -36.742 1.00 0.00 ? 61 GLU A HB2  2  
ATOM 2030  H HB3  . GLU A 1 61 ? -62.015 -56.828 -37.803 1.00 0.00 ? 61 GLU A HB3  2  
ATOM 2031  H HG2  . GLU A 1 61 ? -62.799 -57.794 -35.715 1.00 0.00 ? 61 GLU A HG2  2  
ATOM 2032  H HG3  . GLU A 1 61 ? -62.972 -58.992 -36.993 1.00 0.00 ? 61 GLU A HG3  2  
ATOM 2033  N N    . ASP A 1 62 ? -62.304 -60.218 -38.961 1.00 0.00 ? 62 ASP A N    2  
ATOM 2034  C CA   . ASP A 1 62 ? -63.332 -60.879 -39.763 1.00 0.00 ? 62 ASP A CA   2  
ATOM 2035  C C    . ASP A 1 62 ? -64.615 -60.048 -39.798 1.00 0.00 ? 62 ASP A C    2  
ATOM 2036  O O    . ASP A 1 62 ? -65.278 -59.955 -40.832 1.00 0.00 ? 62 ASP A O    2  
ATOM 2037  C CB   . ASP A 1 62 ? -63.635 -62.262 -39.186 1.00 0.00 ? 62 ASP A CB   2  
ATOM 2038  C CG   . ASP A 1 62 ? -62.452 -63.196 -39.422 1.00 0.00 ? 62 ASP A CG   2  
ATOM 2039  O OD1  . ASP A 1 62 ? -62.421 -63.829 -40.465 1.00 0.00 ? 62 ASP A OD1  2  
ATOM 2040  O OD2  . ASP A 1 62 ? -61.594 -63.265 -38.557 1.00 0.00 ? 62 ASP A OD2  2  
ATOM 2041  H H    . ASP A 1 62 ? -61.988 -60.644 -38.137 1.00 0.00 ? 62 ASP A H    2  
ATOM 2042  H HA   . ASP A 1 62 ? -62.965 -60.996 -40.771 1.00 0.00 ? 62 ASP A HA   2  
ATOM 2043  H HB2  . ASP A 1 62 ? -63.817 -62.177 -38.125 1.00 0.00 ? 62 ASP A HB2  2  
ATOM 2044  H HB3  . ASP A 1 62 ? -64.511 -62.668 -39.669 1.00 0.00 ? 62 ASP A HB3  2  
ATOM 2045  N N    . GLU A 1 63 ? -64.960 -59.457 -38.657 1.00 0.00 ? 63 GLU A N    2  
ATOM 2046  C CA   . GLU A 1 63 ? -66.169 -58.644 -38.550 1.00 0.00 ? 63 GLU A CA   2  
ATOM 2047  C C    . GLU A 1 63 ? -65.856 -57.282 -37.938 1.00 0.00 ? 63 GLU A C    2  
ATOM 2048  O O    . GLU A 1 63 ? -66.145 -57.037 -36.766 1.00 0.00 ? 63 GLU A O    2  
ATOM 2049  C CB   . GLU A 1 63 ? -67.204 -59.367 -37.686 1.00 0.00 ? 63 GLU A CB   2  
ATOM 2050  C CG   . GLU A 1 63 ? -67.554 -60.713 -38.323 1.00 0.00 ? 63 GLU A CG   2  
ATOM 2051  C CD   . GLU A 1 63 ? -68.551 -61.463 -37.447 1.00 0.00 ? 63 GLU A CD   2  
ATOM 2052  O OE1  . GLU A 1 63 ? -68.875 -60.956 -36.385 1.00 0.00 ? 63 GLU A OE1  2  
ATOM 2053  O OE2  . GLU A 1 63 ? -68.978 -62.532 -37.851 1.00 0.00 ? 63 GLU A OE2  2  
ATOM 2054  H H    . GLU A 1 63 ? -64.392 -59.582 -37.871 1.00 0.00 ? 63 GLU A H    2  
ATOM 2055  H HA   . GLU A 1 63 ? -66.585 -58.500 -39.536 1.00 0.00 ? 63 GLU A HA   2  
ATOM 2056  H HB2  . GLU A 1 63 ? -66.796 -59.530 -36.699 1.00 0.00 ? 63 GLU A HB2  2  
ATOM 2057  H HB3  . GLU A 1 63 ? -68.096 -58.764 -37.611 1.00 0.00 ? 63 GLU A HB3  2  
ATOM 2058  H HG2  . GLU A 1 63 ? -67.987 -60.545 -39.298 1.00 0.00 ? 63 GLU A HG2  2  
ATOM 2059  H HG3  . GLU A 1 63 ? -66.656 -61.303 -38.426 1.00 0.00 ? 63 GLU A HG3  2  
ATOM 2060  N N    . PRO A 1 64 ? -65.271 -56.399 -38.703 1.00 0.00 ? 64 PRO A N    2  
ATOM 2061  C CA   . PRO A 1 64 ? -64.907 -55.037 -38.230 1.00 0.00 ? 64 PRO A CA   2  
ATOM 2062  C C    . PRO A 1 64 ? -66.090 -54.072 -38.283 1.00 0.00 ? 64 PRO A C    2  
ATOM 2063  O O    . PRO A 1 64 ? -66.458 -53.559 -37.238 1.00 0.00 ? 64 PRO A O    2  
ATOM 2064  C CB   . PRO A 1 64 ? -63.808 -54.610 -39.201 1.00 0.00 ? 64 PRO A CB   2  
ATOM 2065  C CG   . PRO A 1 64 ? -64.076 -55.355 -40.471 1.00 0.00 ? 64 PRO A CG   2  
ATOM 2066  C CD   . PRO A 1 64 ? -64.895 -56.601 -40.110 1.00 0.00 ? 64 PRO A CD   2  
ATOM 2067  O OXT  . PRO A 1 64 ? -66.610 -53.863 -39.366 1.00 0.00 ? 64 PRO A OXT  2  
ATOM 2068  H HA   . PRO A 1 64 ? -64.507 -55.083 -37.231 1.00 0.00 ? 64 PRO A HA   2  
ATOM 2069  H HB2  . PRO A 1 64 ? -63.858 -53.542 -39.374 1.00 0.00 ? 64 PRO A HB2  2  
ATOM 2070  H HB3  . PRO A 1 64 ? -62.839 -54.881 -38.814 1.00 0.00 ? 64 PRO A HB3  2  
ATOM 2071  H HG2  . PRO A 1 64 ? -64.636 -54.728 -41.152 1.00 0.00 ? 64 PRO A HG2  2  
ATOM 2072  H HG3  . PRO A 1 64 ? -63.146 -55.654 -40.926 1.00 0.00 ? 64 PRO A HG3  2  
ATOM 2073  H HD2  . PRO A 1 64 ? -65.776 -56.663 -40.735 1.00 0.00 ? 64 PRO A HD2  2  
ATOM 2074  H HD3  . PRO A 1 64 ? -64.296 -57.490 -40.210 1.00 0.00 ? 64 PRO A HD3  2  
ATOM 2075  N N    . LEU A 1 1  ? -32.372 -6.604  -24.595 1.00 0.00 ? 1  LEU A N    3  
ATOM 2076  C CA   . LEU A 1 1  ? -32.280 -8.009  -25.088 1.00 0.00 ? 1  LEU A CA   3  
ATOM 2077  C C    . LEU A 1 1  ? -30.831 -8.479  -24.993 1.00 0.00 ? 1  LEU A C    3  
ATOM 2078  O O    . LEU A 1 1  ? -29.903 -7.672  -25.012 1.00 0.00 ? 1  LEU A O    3  
ATOM 2079  C CB   . LEU A 1 1  ? -32.752 -8.068  -26.543 1.00 0.00 ? 1  LEU A CB   3  
ATOM 2080  C CG   . LEU A 1 1  ? -34.182 -7.528  -26.643 1.00 0.00 ? 1  LEU A CG   3  
ATOM 2081  C CD1  . LEU A 1 1  ? -34.631 -7.547  -28.106 1.00 0.00 ? 1  LEU A CD1  3  
ATOM 2082  C CD2  . LEU A 1 1  ? -35.126 -8.397  -25.810 1.00 0.00 ? 1  LEU A CD2  3  
ATOM 2083  H H1   . LEU A 1 1  ? -33.352 -6.401  -24.312 1.00 0.00 ? 1  LEU A H1   3  
ATOM 2084  H H2   . LEU A 1 1  ? -32.086 -5.952  -25.353 1.00 0.00 ? 1  LEU A H2   3  
ATOM 2085  H H3   . LEU A 1 1  ? -31.745 -6.483  -23.776 1.00 0.00 ? 1  LEU A H3   3  
ATOM 2086  H HA   . LEU A 1 1  ? -32.902 -8.645  -24.479 1.00 0.00 ? 1  LEU A HA   3  
ATOM 2087  H HB2  . LEU A 1 1  ? -32.096 -7.468  -27.158 1.00 0.00 ? 1  LEU A HB2  3  
ATOM 2088  H HB3  . LEU A 1 1  ? -32.730 -9.092  -26.887 1.00 0.00 ? 1  LEU A HB3  3  
ATOM 2089  H HG   . LEU A 1 1  ? -34.205 -6.512  -26.276 1.00 0.00 ? 1  LEU A HG   3  
ATOM 2090  H HD11 . LEU A 1 1  ? -34.385 -6.605  -28.570 1.00 0.00 ? 1  LEU A HD11 3  
ATOM 2091  H HD12 . LEU A 1 1  ? -35.699 -7.702  -28.150 1.00 0.00 ? 1  LEU A HD12 3  
ATOM 2092  H HD13 . LEU A 1 1  ? -34.128 -8.348  -28.626 1.00 0.00 ? 1  LEU A HD13 3  
ATOM 2093  H HD21 . LEU A 1 1  ? -35.147 -8.036  -24.793 1.00 0.00 ? 1  LEU A HD21 3  
ATOM 2094  H HD22 . LEU A 1 1  ? -34.781 -9.421  -25.821 1.00 0.00 ? 1  LEU A HD22 3  
ATOM 2095  H HD23 . LEU A 1 1  ? -36.121 -8.351  -26.228 1.00 0.00 ? 1  LEU A HD23 3  
ATOM 2096  N N    . ASP A 1 2  ? -30.647 -9.792  -24.890 1.00 0.00 ? 2  ASP A N    3  
ATOM 2097  C CA   . ASP A 1 2  ? -29.307 -10.357 -24.792 1.00 0.00 ? 2  ASP A CA   3  
ATOM 2098  C C    . ASP A 1 2  ? -28.729 -10.613 -26.180 1.00 0.00 ? 2  ASP A C    3  
ATOM 2099  O O    . ASP A 1 2  ? -29.091 -11.584 -26.844 1.00 0.00 ? 2  ASP A O    3  
ATOM 2100  C CB   . ASP A 1 2  ? -29.348 -11.668 -24.004 1.00 0.00 ? 2  ASP A CB   3  
ATOM 2101  C CG   . ASP A 1 2  ? -27.940 -12.236 -23.863 1.00 0.00 ? 2  ASP A CG   3  
ATOM 2102  O OD1  . ASP A 1 2  ? -27.035 -11.680 -24.463 1.00 0.00 ? 2  ASP A OD1  3  
ATOM 2103  O OD2  . ASP A 1 2  ? -27.788 -13.220 -23.159 1.00 0.00 ? 2  ASP A OD2  3  
ATOM 2104  H H    . ASP A 1 2  ? -31.424 -10.388 -24.878 1.00 0.00 ? 2  ASP A H    3  
ATOM 2105  H HA   . ASP A 1 2  ? -28.669 -9.658  -24.271 1.00 0.00 ? 2  ASP A HA   3  
ATOM 2106  H HB2  . ASP A 1 2  ? -29.758 -11.482 -23.021 1.00 0.00 ? 2  ASP A HB2  3  
ATOM 2107  H HB3  . ASP A 1 2  ? -29.970 -12.379 -24.524 1.00 0.00 ? 2  ASP A HB3  3  
ATOM 2108  N N    . ARG A 1 3  ? -27.827 -9.737  -26.609 1.00 0.00 ? 3  ARG A N    3  
ATOM 2109  C CA   . ARG A 1 3  ? -27.201 -9.875  -27.918 1.00 0.00 ? 3  ARG A CA   3  
ATOM 2110  C C    . ARG A 1 3  ? -26.116 -10.948 -27.885 1.00 0.00 ? 3  ARG A C    3  
ATOM 2111  O O    . ARG A 1 3  ? -25.514 -11.207 -26.843 1.00 0.00 ? 3  ARG A O    3  
ATOM 2112  C CB   . ARG A 1 3  ? -26.596 -8.540  -28.355 1.00 0.00 ? 3  ARG A CB   3  
ATOM 2113  C CG   . ARG A 1 3  ? -27.721 -7.541  -28.636 1.00 0.00 ? 3  ARG A CG   3  
ATOM 2114  C CD   . ARG A 1 3  ? -27.123 -6.204  -29.077 1.00 0.00 ? 3  ARG A CD   3  
ATOM 2115  N NE   . ARG A 1 3  ? -28.186 -5.245  -29.350 1.00 0.00 ? 3  ARG A NE   3  
ATOM 2116  C CZ   . ARG A 1 3  ? -27.910 -4.015  -29.772 1.00 0.00 ? 3  ARG A CZ   3  
ATOM 2117  N NH1  . ARG A 1 3  ? -26.671 -3.649  -29.950 1.00 0.00 ? 3  ARG A NH1  3  
ATOM 2118  N NH2  . ARG A 1 3  ? -28.880 -3.174  -30.010 1.00 0.00 ? 3  ARG A NH2  3  
ATOM 2119  H H    . ARG A 1 3  ? -27.578 -8.985  -26.032 1.00 0.00 ? 3  ARG A H    3  
ATOM 2120  H HA   . ARG A 1 3  ? -27.954 -10.165 -28.634 1.00 0.00 ? 3  ARG A HA   3  
ATOM 2121  H HB2  . ARG A 1 3  ? -25.958 -8.157  -27.570 1.00 0.00 ? 3  ARG A HB2  3  
ATOM 2122  H HB3  . ARG A 1 3  ? -26.015 -8.684  -29.254 1.00 0.00 ? 3  ARG A HB3  3  
ATOM 2123  H HG2  . ARG A 1 3  ? -28.358 -7.927  -29.417 1.00 0.00 ? 3  ARG A HG2  3  
ATOM 2124  H HG3  . ARG A 1 3  ? -28.301 -7.392  -27.737 1.00 0.00 ? 3  ARG A HG3  3  
ATOM 2125  H HD2  . ARG A 1 3  ? -26.488 -5.819  -28.293 1.00 0.00 ? 3  ARG A HD2  3  
ATOM 2126  H HD3  . ARG A 1 3  ? -26.535 -6.354  -29.971 1.00 0.00 ? 3  ARG A HD3  3  
ATOM 2127  H HE   . ARG A 1 3  ? -29.120 -5.510  -29.220 1.00 0.00 ? 3  ARG A HE   3  
ATOM 2128  H HH11 . ARG A 1 3  ? -25.928 -4.293  -29.770 1.00 0.00 ? 3  ARG A HH11 3  
ATOM 2129  H HH12 . ARG A 1 3  ? -26.463 -2.723  -30.269 1.00 0.00 ? 3  ARG A HH12 3  
ATOM 2130  H HH21 . ARG A 1 3  ? -29.830 -3.455  -29.874 1.00 0.00 ? 3  ARG A HH21 3  
ATOM 2131  H HH22 . ARG A 1 3  ? -28.673 -2.249  -30.328 1.00 0.00 ? 3  ARG A HH22 3  
ATOM 2132  N N    . TRP A 1 4  ? -25.875 -11.570 -29.034 1.00 0.00 ? 4  TRP A N    3  
ATOM 2133  C CA   . TRP A 1 4  ? -24.866 -12.616 -29.139 1.00 0.00 ? 4  TRP A CA   3  
ATOM 2134  C C    . TRP A 1 4  ? -23.573 -12.053 -29.718 1.00 0.00 ? 4  TRP A C    3  
ATOM 2135  O O    . TRP A 1 4  ? -22.696 -12.803 -30.147 1.00 0.00 ? 4  TRP A O    3  
ATOM 2136  C CB   . TRP A 1 4  ? -25.377 -13.751 -30.030 1.00 0.00 ? 4  TRP A CB   3  
ATOM 2137  C CG   . TRP A 1 4  ? -26.570 -14.386 -29.390 1.00 0.00 ? 4  TRP A CG   3  
ATOM 2138  C CD1  . TRP A 1 4  ? -26.526 -15.434 -28.537 1.00 0.00 ? 4  TRP A CD1  3  
ATOM 2139  C CD2  . TRP A 1 4  ? -27.976 -14.036 -29.539 1.00 0.00 ? 4  TRP A CD2  3  
ATOM 2140  N NE1  . TRP A 1 4  ? -27.817 -15.749 -28.150 1.00 0.00 ? 4  TRP A NE1  3  
ATOM 2141  C CE2  . TRP A 1 4  ? -28.745 -14.916 -28.741 1.00 0.00 ? 4  TRP A CE2  3  
ATOM 2142  C CE3  . TRP A 1 4  ? -28.652 -13.050 -30.280 1.00 0.00 ? 4  TRP A CE3  3  
ATOM 2143  C CZ2  . TRP A 1 4  ? -30.136 -14.821 -28.682 1.00 0.00 ? 4  TRP A CZ2  3  
ATOM 2144  C CZ3  . TRP A 1 4  ? -30.053 -12.953 -30.223 1.00 0.00 ? 4  TRP A CZ3  3  
ATOM 2145  C CH2  . TRP A 1 4  ? -30.793 -13.837 -29.424 1.00 0.00 ? 4  TRP A CH2  3  
ATOM 2146  H H    . TRP A 1 4  ? -26.386 -11.326 -29.835 1.00 0.00 ? 4  TRP A H    3  
ATOM 2147  H HA   . TRP A 1 4  ? -24.667 -13.010 -28.155 1.00 0.00 ? 4  TRP A HA   3  
ATOM 2148  H HB2  . TRP A 1 4  ? -25.654 -13.354 -30.995 1.00 0.00 ? 4  TRP A HB2  3  
ATOM 2149  H HB3  . TRP A 1 4  ? -24.599 -14.489 -30.154 1.00 0.00 ? 4  TRP A HB3  3  
ATOM 2150  H HD1  . TRP A 1 4  ? -25.631 -15.941 -28.209 1.00 0.00 ? 4  TRP A HD1  3  
ATOM 2151  H HE1  . TRP A 1 4  ? -28.062 -16.470 -27.535 1.00 0.00 ? 4  TRP A HE1  3  
ATOM 2152  H HE3  . TRP A 1 4  ? -28.093 -12.364 -30.898 1.00 0.00 ? 4  TRP A HE3  3  
ATOM 2153  H HZ2  . TRP A 1 4  ? -30.701 -15.504 -28.066 1.00 0.00 ? 4  TRP A HZ2  3  
ATOM 2154  H HZ3  . TRP A 1 4  ? -30.562 -12.191 -30.797 1.00 0.00 ? 4  TRP A HZ3  3  
ATOM 2155  H HH2  . TRP A 1 4  ? -31.869 -13.757 -29.384 1.00 0.00 ? 4  TRP A HH2  3  
ATOM 2156  N N    . TYR A 1 5  ? -23.461 -10.726 -29.716 1.00 0.00 ? 5  TYR A N    3  
ATOM 2157  C CA   . TYR A 1 5  ? -22.263 -10.074 -30.235 1.00 0.00 ? 5  TYR A CA   3  
ATOM 2158  C C    . TYR A 1 5  ? -21.440 -9.485  -29.096 1.00 0.00 ? 5  TYR A C    3  
ATOM 2159  O O    . TYR A 1 5  ? -21.864 -8.530  -28.442 1.00 0.00 ? 5  TYR A O    3  
ATOM 2160  C CB   . TYR A 1 5  ? -22.656 -8.948  -31.195 1.00 0.00 ? 5  TYR A CB   3  
ATOM 2161  C CG   . TYR A 1 5  ? -23.412 -9.515  -32.372 1.00 0.00 ? 5  TYR A CG   3  
ATOM 2162  C CD1  . TYR A 1 5  ? -22.717 -9.965  -33.501 1.00 0.00 ? 5  TYR A CD1  3  
ATOM 2163  C CD2  . TYR A 1 5  ? -24.810 -9.579  -32.339 1.00 0.00 ? 5  TYR A CD2  3  
ATOM 2164  C CE1  . TYR A 1 5  ? -23.421 -10.482 -34.595 1.00 0.00 ? 5  TYR A CE1  3  
ATOM 2165  C CE2  . TYR A 1 5  ? -25.514 -10.095 -33.433 1.00 0.00 ? 5  TYR A CE2  3  
ATOM 2166  C CZ   . TYR A 1 5  ? -24.819 -10.547 -34.560 1.00 0.00 ? 5  TYR A CZ   3  
ATOM 2167  O OH   . TYR A 1 5  ? -25.514 -11.052 -35.639 1.00 0.00 ? 5  TYR A OH   3  
ATOM 2168  H H    . TYR A 1 5  ? -24.188 -10.193 -29.335 1.00 0.00 ? 5  TYR A H    3  
ATOM 2169  H HA   . TYR A 1 5  ? -21.664 -10.797 -30.769 1.00 0.00 ? 5  TYR A HA   3  
ATOM 2170  H HB2  . TYR A 1 5  ? -23.283 -8.238  -30.676 1.00 0.00 ? 5  TYR A HB2  3  
ATOM 2171  H HB3  . TYR A 1 5  ? -21.766 -8.451  -31.547 1.00 0.00 ? 5  TYR A HB3  3  
ATOM 2172  H HD1  . TYR A 1 5  ? -21.639 -9.916  -33.527 1.00 0.00 ? 5  TYR A HD1  3  
ATOM 2173  H HD2  . TYR A 1 5  ? -25.346 -9.231  -31.467 1.00 0.00 ? 5  TYR A HD2  3  
ATOM 2174  H HE1  . TYR A 1 5  ? -22.885 -10.832 -35.465 1.00 0.00 ? 5  TYR A HE1  3  
ATOM 2175  H HE2  . TYR A 1 5  ? -26.592 -10.145 -33.407 1.00 0.00 ? 5  TYR A HE2  3  
ATOM 2176  H HH   . TYR A 1 5  ? -25.931 -11.871 -35.365 1.00 0.00 ? 5  TYR A HH   3  
ATOM 2177  N N    . LEU A 1 6  ? -20.257 -10.046 -28.871 1.00 0.00 ? 6  LEU A N    3  
ATOM 2178  C CA   . LEU A 1 6  ? -19.379 -9.552  -27.816 1.00 0.00 ? 6  LEU A CA   3  
ATOM 2179  C C    . LEU A 1 6  ? -18.870 -8.158  -28.171 1.00 0.00 ? 6  LEU A C    3  
ATOM 2180  O O    . LEU A 1 6  ? -18.769 -7.280  -27.314 1.00 0.00 ? 6  LEU A O    3  
ATOM 2181  C CB   . LEU A 1 6  ? -18.193 -10.503 -27.635 1.00 0.00 ? 6  LEU A CB   3  
ATOM 2182  C CG   . LEU A 1 6  ? -18.680 -11.841 -27.064 1.00 0.00 ? 6  LEU A CG   3  
ATOM 2183  C CD1  . LEU A 1 6  ? -17.524 -12.841 -27.055 1.00 0.00 ? 6  LEU A CD1  3  
ATOM 2184  C CD2  . LEU A 1 6  ? -19.199 -11.651 -25.631 1.00 0.00 ? 6  LEU A CD2  3  
ATOM 2185  H H    . LEU A 1 6  ? -19.964 -10.798 -29.426 1.00 0.00 ? 6  LEU A H    3  
ATOM 2186  H HA   . LEU A 1 6  ? -19.933 -9.498  -26.891 1.00 0.00 ? 6  LEU A HA   3  
ATOM 2187  H HB2  . LEU A 1 6  ? -17.726 -10.673 -28.595 1.00 0.00 ? 6  LEU A HB2  3  
ATOM 2188  H HB3  . LEU A 1 6  ? -17.474 -10.061 -26.963 1.00 0.00 ? 6  LEU A HB3  3  
ATOM 2189  H HG   . LEU A 1 6  ? -19.476 -12.224 -27.687 1.00 0.00 ? 6  LEU A HG   3  
ATOM 2190  H HD11 . LEU A 1 6  ? -17.052 -12.855 -28.027 1.00 0.00 ? 6  LEU A HD11 3  
ATOM 2191  H HD12 . LEU A 1 6  ? -17.902 -13.825 -26.824 1.00 0.00 ? 6  LEU A HD12 3  
ATOM 2192  H HD13 . LEU A 1 6  ? -16.800 -12.549 -26.308 1.00 0.00 ? 6  LEU A HD13 3  
ATOM 2193  H HD21 . LEU A 1 6  ? -20.262 -11.464 -25.656 1.00 0.00 ? 6  LEU A HD21 3  
ATOM 2194  H HD22 . LEU A 1 6  ? -18.697 -10.815 -25.168 1.00 0.00 ? 6  LEU A HD22 3  
ATOM 2195  H HD23 . LEU A 1 6  ? -19.007 -12.547 -25.059 1.00 0.00 ? 6  LEU A HD23 3  
ATOM 2196  N N    . GLY A 1 7  ? -18.549 -7.976  -29.447 1.00 0.00 ? 7  GLY A N    3  
ATOM 2197  C CA   . GLY A 1 7  ? -18.043 -6.696  -29.931 1.00 0.00 ? 7  GLY A CA   3  
ATOM 2198  C C    . GLY A 1 7  ? -16.525 -6.639  -29.805 1.00 0.00 ? 7  GLY A C    3  
ATOM 2199  O O    . GLY A 1 7  ? -15.887 -5.701  -30.285 1.00 0.00 ? 7  GLY A O    3  
ATOM 2200  H H    . GLY A 1 7  ? -18.650 -8.725  -30.071 1.00 0.00 ? 7  GLY A H    3  
ATOM 2201  H HA2  . GLY A 1 7  ? -18.321 -6.575  -30.969 1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2202  H HA3  . GLY A 1 7  ? -18.476 -5.898  -29.350 1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2203  N N    . GLY A 1 8  ? -15.959 -7.644  -29.142 1.00 0.00 ? 8  GLY A N    3  
ATOM 2204  C CA   . GLY A 1 8  ? -14.514 -7.703  -28.936 1.00 0.00 ? 8  GLY A CA   3  
ATOM 2205  C C    . GLY A 1 8  ? -14.182 -7.675  -27.447 1.00 0.00 ? 8  GLY A C    3  
ATOM 2206  O O    . GLY A 1 8  ? -13.028 -7.483  -27.061 1.00 0.00 ? 8  GLY A O    3  
ATOM 2207  H H    . GLY A 1 8  ? -16.530 -8.346  -28.767 1.00 0.00 ? 8  GLY A H    3  
ATOM 2208  H HA2  . GLY A 1 8  ? -14.131 -8.616  -29.370 1.00 0.00 ? 8  GLY A HA2  3  
ATOM 2209  H HA3  . GLY A 1 8  ? -14.049 -6.858  -29.416 1.00 0.00 ? 8  GLY A HA3  3  
ATOM 2210  N N    . SER A 1 9  ? -15.202 -7.873  -26.618 1.00 0.00 ? 9  SER A N    3  
ATOM 2211  C CA   . SER A 1 9  ? -15.016 -7.872  -25.171 1.00 0.00 ? 9  SER A CA   3  
ATOM 2212  C C    . SER A 1 9  ? -14.521 -9.248  -24.708 1.00 0.00 ? 9  SER A C    3  
ATOM 2213  O O    . SER A 1 9  ? -14.830 -10.260 -25.341 1.00 0.00 ? 9  SER A O    3  
ATOM 2214  C CB   . SER A 1 9  ? -16.353 -7.544  -24.501 1.00 0.00 ? 9  SER A CB   3  
ATOM 2215  O OG   . SER A 1 9  ? -17.308 -8.532  -24.862 1.00 0.00 ? 9  SER A OG   3  
ATOM 2216  H H    . SER A 1 9  ? -16.098 -8.023  -26.987 1.00 0.00 ? 9  SER A H    3  
ATOM 2217  H HA   . SER A 1 9  ? -14.293 -7.117  -24.909 1.00 0.00 ? 9  SER A HA   3  
ATOM 2218  H HB2  . SER A 1 9  ? -16.239 -7.539  -23.433 1.00 0.00 ? 9  SER A HB2  3  
ATOM 2219  H HB3  . SER A 1 9  ? -16.689 -6.569  -24.830 1.00 0.00 ? 9  SER A HB3  3  
ATOM 2220  H HG   . SER A 1 9  ? -17.052 -9.358  -24.447 1.00 0.00 ? 9  SER A HG   3  
ATOM 2221  N N    . PRO A 1 10 ? -13.762 -9.320  -23.635 1.00 0.00 ? 10 PRO A N    3  
ATOM 2222  C CA   . PRO A 1 10 ? -13.232 -10.622 -23.127 1.00 0.00 ? 10 PRO A CA   3  
ATOM 2223  C C    . PRO A 1 10 ? -14.328 -11.535 -22.578 1.00 0.00 ? 10 PRO A C    3  
ATOM 2224  O O    . PRO A 1 10 ? -14.813 -12.421 -23.281 1.00 0.00 ? 10 PRO A O    3  
ATOM 2225  C CB   . PRO A 1 10 ? -12.254 -10.221 -22.019 1.00 0.00 ? 10 PRO A CB   3  
ATOM 2226  C CG   . PRO A 1 10 ? -12.663 -8.854  -21.590 1.00 0.00 ? 10 PRO A CG   3  
ATOM 2227  C CD   . PRO A 1 10 ? -13.320 -8.188  -22.798 1.00 0.00 ? 10 PRO A CD   3  
ATOM 2228  H HA   . PRO A 1 10 ? -12.693 -11.127 -23.909 1.00 0.00 ? 10 PRO A HA   3  
ATOM 2229  H HB2  . PRO A 1 10 ? -12.324 -10.912 -21.191 1.00 0.00 ? 10 PRO A HB2  3  
ATOM 2230  H HB3  . PRO A 1 10 ? -11.245 -10.199 -22.403 1.00 0.00 ? 10 PRO A HB3  3  
ATOM 2231  H HG2  . PRO A 1 10 ? -13.370 -8.921  -20.772 1.00 0.00 ? 10 PRO A HG2  3  
ATOM 2232  H HG3  . PRO A 1 10 ? -11.800 -8.284  -21.287 1.00 0.00 ? 10 PRO A HG3  3  
ATOM 2233  H HD2  . PRO A 1 10 ? -14.158 -7.586  -22.484 1.00 0.00 ? 10 PRO A HD2  3  
ATOM 2234  H HD3  . PRO A 1 10 ? -12.602 -7.586  -23.336 1.00 0.00 ? 10 PRO A HD3  3  
ATOM 2235  N N    . LYS A 1 11 ? -14.697 -11.333 -21.317 1.00 0.00 ? 11 LYS A N    3  
ATOM 2236  C CA   . LYS A 1 11 ? -15.717 -12.166 -20.686 1.00 0.00 ? 11 LYS A CA   3  
ATOM 2237  C C    . LYS A 1 11 ? -17.106 -11.857 -21.235 1.00 0.00 ? 11 LYS A C    3  
ATOM 2238  O O    . LYS A 1 11 ? -18.009 -12.689 -21.157 1.00 0.00 ? 11 LYS A O    3  
ATOM 2239  C CB   . LYS A 1 11 ? -15.708 -11.940 -19.174 1.00 0.00 ? 11 LYS A CB   3  
ATOM 2240  C CG   . LYS A 1 11 ? -14.411 -12.496 -18.582 1.00 0.00 ? 11 LYS A CG   3  
ATOM 2241  C CD   . LYS A 1 11 ? -14.404 -12.274 -17.067 1.00 0.00 ? 11 LYS A CD   3  
ATOM 2242  C CE   . LYS A 1 11 ? -13.129 -12.872 -16.470 1.00 0.00 ? 11 LYS A CE   3  
ATOM 2243  N NZ   . LYS A 1 11 ? -11.940 -12.165 -17.023 1.00 0.00 ? 11 LYS A NZ   3  
ATOM 2244  H H    . LYS A 1 11 ? -14.263 -10.631 -20.787 1.00 0.00 ? 11 LYS A H    3  
ATOM 2245  H HA   . LYS A 1 11 ? -15.489 -13.202 -20.881 1.00 0.00 ? 11 LYS A HA   3  
ATOM 2246  H HB2  . LYS A 1 11 ? -15.775 -10.881 -18.967 1.00 0.00 ? 11 LYS A HB2  3  
ATOM 2247  H HB3  . LYS A 1 11 ? -16.551 -12.448 -18.728 1.00 0.00 ? 11 LYS A HB3  3  
ATOM 2248  H HG2  . LYS A 1 11 ? -14.345 -13.554 -18.792 1.00 0.00 ? 11 LYS A HG2  3  
ATOM 2249  H HG3  . LYS A 1 11 ? -13.567 -11.987 -19.022 1.00 0.00 ? 11 LYS A HG3  3  
ATOM 2250  H HD2  . LYS A 1 11 ? -14.436 -11.214 -16.860 1.00 0.00 ? 11 LYS A HD2  3  
ATOM 2251  H HD3  . LYS A 1 11 ? -15.265 -12.754 -16.629 1.00 0.00 ? 11 LYS A HD3  3  
ATOM 2252  H HE2  . LYS A 1 11 ? -13.148 -12.758 -15.396 1.00 0.00 ? 11 LYS A HE2  3  
ATOM 2253  H HE3  . LYS A 1 11 ? -13.073 -13.921 -16.718 1.00 0.00 ? 11 LYS A HE3  3  
ATOM 2254  H HZ1  . LYS A 1 11 ? -11.804 -12.440 -18.016 1.00 0.00 ? 11 LYS A HZ1  3  
ATOM 2255  H HZ2  . LYS A 1 11 ? -11.095 -12.425 -16.473 1.00 0.00 ? 11 LYS A HZ2  3  
ATOM 2256  H HZ3  . LYS A 1 11 ? -12.089 -11.138 -16.969 1.00 0.00 ? 11 LYS A HZ3  3  
ATOM 2257  N N    . GLY A 1 12 ? -17.277 -10.663 -21.787 1.00 0.00 ? 12 GLY A N    3  
ATOM 2258  C CA   . GLY A 1 12 ? -18.572 -10.276 -22.336 1.00 0.00 ? 12 GLY A CA   3  
ATOM 2259  C C    . GLY A 1 12 ? -19.527 -9.838  -21.233 1.00 0.00 ? 12 GLY A C    3  
ATOM 2260  O O    . GLY A 1 12 ? -20.742 -9.802  -21.431 1.00 0.00 ? 12 GLY A O    3  
ATOM 2261  H H    . GLY A 1 12 ? -16.529 -10.032 -21.822 1.00 0.00 ? 12 GLY A H    3  
ATOM 2262  H HA2  . GLY A 1 12 ? -18.432 -9.459  -23.029 1.00 0.00 ? 12 GLY A HA2  3  
ATOM 2263  H HA3  . GLY A 1 12 ? -19.000 -11.116 -22.860 1.00 0.00 ? 12 GLY A HA3  3  
ATOM 2264  N N    . ASP A 1 13 ? -18.972 -9.496  -20.074 1.00 0.00 ? 13 ASP A N    3  
ATOM 2265  C CA   . ASP A 1 13 ? -19.792 -9.054  -18.952 1.00 0.00 ? 13 ASP A CA   3  
ATOM 2266  C C    . ASP A 1 13 ? -20.505 -7.755  -19.310 1.00 0.00 ? 13 ASP A C    3  
ATOM 2267  O O    . ASP A 1 13 ? -19.872 -6.780  -19.714 1.00 0.00 ? 13 ASP A O    3  
ATOM 2268  C CB   . ASP A 1 13 ? -18.918 -8.837  -17.716 1.00 0.00 ? 13 ASP A CB   3  
ATOM 2269  C CG   . ASP A 1 13 ? -19.787 -8.472  -16.518 1.00 0.00 ? 13 ASP A CG   3  
ATOM 2270  O OD1  . ASP A 1 13 ? -20.970 -8.249  -16.717 1.00 0.00 ? 13 ASP A OD1  3  
ATOM 2271  O OD2  . ASP A 1 13 ? -19.260 -8.421  -15.420 1.00 0.00 ? 13 ASP A OD2  3  
ATOM 2272  H H    . ASP A 1 13 ? -17.998 -9.535  -19.976 1.00 0.00 ? 13 ASP A H    3  
ATOM 2273  H HA   . ASP A 1 13 ? -20.530 -9.812  -18.733 1.00 0.00 ? 13 ASP A HA   3  
ATOM 2274  H HB2  . ASP A 1 13 ? -18.372 -9.744  -17.501 1.00 0.00 ? 13 ASP A HB2  3  
ATOM 2275  H HB3  . ASP A 1 13 ? -18.219 -8.036  -17.906 1.00 0.00 ? 13 ASP A HB3  3  
ATOM 2276  N N    . VAL A 1 14 ? -21.825 -7.743  -19.155 1.00 0.00 ? 14 VAL A N    3  
ATOM 2277  C CA   . VAL A 1 14 ? -22.615 -6.557  -19.459 1.00 0.00 ? 14 VAL A CA   3  
ATOM 2278  C C    . VAL A 1 14 ? -23.724 -6.386  -18.424 1.00 0.00 ? 14 VAL A C    3  
ATOM 2279  O O    . VAL A 1 14 ? -24.066 -7.333  -17.716 1.00 0.00 ? 14 VAL A O    3  
ATOM 2280  C CB   . VAL A 1 14 ? -23.218 -6.674  -20.862 1.00 0.00 ? 14 VAL A CB   3  
ATOM 2281  C CG1  . VAL A 1 14 ? -22.091 -6.702  -21.897 1.00 0.00 ? 14 VAL A CG1  3  
ATOM 2282  C CG2  . VAL A 1 14 ? -24.028 -7.971  -20.971 1.00 0.00 ? 14 VAL A CG2  3  
ATOM 2283  H H    . VAL A 1 14 ? -22.286 -8.538  -18.815 1.00 0.00 ? 14 VAL A H    3  
ATOM 2284  H HA   . VAL A 1 14 ? -21.971 -5.691  -19.427 1.00 0.00 ? 14 VAL A HA   3  
ATOM 2285  H HB   . VAL A 1 14 ? -23.860 -5.827  -21.052 1.00 0.00 ? 14 VAL A HB   3  
ATOM 2286  H HG11 . VAL A 1 14 ? -21.492 -5.810  -21.800 1.00 0.00 ? 14 VAL A HG11 3  
ATOM 2287  H HG12 . VAL A 1 14 ? -22.515 -6.745  -22.889 1.00 0.00 ? 14 VAL A HG12 3  
ATOM 2288  H HG13 . VAL A 1 14 ? -21.471 -7.571  -21.732 1.00 0.00 ? 14 VAL A HG13 3  
ATOM 2289  H HG21 . VAL A 1 14 ? -25.001 -7.754  -21.384 1.00 0.00 ? 14 VAL A HG21 3  
ATOM 2290  H HG22 . VAL A 1 14 ? -24.142 -8.411  -19.991 1.00 0.00 ? 14 VAL A HG22 3  
ATOM 2291  H HG23 . VAL A 1 14 ? -23.509 -8.665  -21.616 1.00 0.00 ? 14 VAL A HG23 3  
ATOM 2292  N N    . ASP A 1 15 ? -24.287 -5.181  -18.341 1.00 0.00 ? 15 ASP A N    3  
ATOM 2293  C CA   . ASP A 1 15 ? -25.362 -4.917  -17.385 1.00 0.00 ? 15 ASP A CA   3  
ATOM 2294  C C    . ASP A 1 15 ? -26.516 -4.170  -18.052 1.00 0.00 ? 15 ASP A C    3  
ATOM 2295  O O    . ASP A 1 15 ? -26.822 -3.034  -17.687 1.00 0.00 ? 15 ASP A O    3  
ATOM 2296  C CB   . ASP A 1 15 ? -24.825 -4.085  -16.219 1.00 0.00 ? 15 ASP A CB   3  
ATOM 2297  C CG   . ASP A 1 15 ? -24.201 -2.796  -16.742 1.00 0.00 ? 15 ASP A CG   3  
ATOM 2298  O OD1  . ASP A 1 15 ? -23.994 -2.706  -17.941 1.00 0.00 ? 15 ASP A OD1  3  
ATOM 2299  O OD2  . ASP A 1 15 ? -23.941 -1.918  -15.935 1.00 0.00 ? 15 ASP A OD2  3  
ATOM 2300  H H    . ASP A 1 15 ? -23.980 -4.460  -18.929 1.00 0.00 ? 15 ASP A H    3  
ATOM 2301  H HA   . ASP A 1 15 ? -25.729 -5.856  -17.001 1.00 0.00 ? 15 ASP A HA   3  
ATOM 2302  H HB2  . ASP A 1 15 ? -25.637 -3.845  -15.548 1.00 0.00 ? 15 ASP A HB2  3  
ATOM 2303  H HB3  . ASP A 1 15 ? -24.077 -4.655  -15.687 1.00 0.00 ? 15 ASP A HB3  3  
ATOM 2304  N N    . PRO A 1 16 ? -27.160 -4.785  -19.009 1.00 0.00 ? 16 PRO A N    3  
ATOM 2305  C CA   . PRO A 1 16 ? -28.308 -4.175  -19.736 1.00 0.00 ? 16 PRO A CA   3  
ATOM 2306  C C    . PRO A 1 16 ? -29.626 -4.361  -18.993 1.00 0.00 ? 16 PRO A C    3  
ATOM 2307  O O    . PRO A 1 16 ? -30.684 -4.483  -19.611 1.00 0.00 ? 16 PRO A O    3  
ATOM 2308  C CB   . PRO A 1 16 ? -28.317 -4.950  -21.050 1.00 0.00 ? 16 PRO A CB   3  
ATOM 2309  C CG   . PRO A 1 16 ? -27.845 -6.317  -20.680 1.00 0.00 ? 16 PRO A CG   3  
ATOM 2310  C CD   . PRO A 1 16 ? -26.866 -6.137  -19.516 1.00 0.00 ? 16 PRO A CD   3  
ATOM 2311  H HA   . PRO A 1 16 ? -28.124 -3.132  -19.932 1.00 0.00 ? 16 PRO A HA   3  
ATOM 2312  H HB2  . PRO A 1 16 ? -29.318 -4.990  -21.457 1.00 0.00 ? 16 PRO A HB2  3  
ATOM 2313  H HB3  . PRO A 1 16 ? -27.636 -4.504  -21.758 1.00 0.00 ? 16 PRO A HB3  3  
ATOM 2314  H HG2  . PRO A 1 16 ? -28.684 -6.928  -20.374 1.00 0.00 ? 16 PRO A HG2  3  
ATOM 2315  H HG3  . PRO A 1 16 ? -27.338 -6.775  -21.514 1.00 0.00 ? 16 PRO A HG3  3  
ATOM 2316  H HD2  . PRO A 1 16 ? -27.044 -6.880  -18.750 1.00 0.00 ? 16 PRO A HD2  3  
ATOM 2317  H HD3  . PRO A 1 16 ? -25.851 -6.190  -19.868 1.00 0.00 ? 16 PRO A HD3  3  
ATOM 2318  N N    . PHE A 1 17 ? -29.562 -4.394  -17.666 1.00 0.00 ? 17 PHE A N    3  
ATOM 2319  C CA   . PHE A 1 17 ? -30.768 -4.580  -16.868 1.00 0.00 ? 17 PHE A CA   3  
ATOM 2320  C C    . PHE A 1 17 ? -31.747 -3.434  -17.097 1.00 0.00 ? 17 PHE A C    3  
ATOM 2321  O O    . PHE A 1 17 ? -32.954 -3.652  -17.197 1.00 0.00 ? 17 PHE A O    3  
ATOM 2322  C CB   . PHE A 1 17 ? -30.407 -4.656  -15.384 1.00 0.00 ? 17 PHE A CB   3  
ATOM 2323  C CG   . PHE A 1 17 ? -29.720 -5.970  -15.098 1.00 0.00 ? 17 PHE A CG   3  
ATOM 2324  C CD1  . PHE A 1 17 ? -30.477 -7.095  -14.750 1.00 0.00 ? 17 PHE A CD1  3  
ATOM 2325  C CD2  . PHE A 1 17 ? -28.325 -6.063  -15.180 1.00 0.00 ? 17 PHE A CD2  3  
ATOM 2326  C CE1  . PHE A 1 17 ? -29.841 -8.313  -14.484 1.00 0.00 ? 17 PHE A CE1  3  
ATOM 2327  C CE2  . PHE A 1 17 ? -27.688 -7.280  -14.912 1.00 0.00 ? 17 PHE A CE2  3  
ATOM 2328  C CZ   . PHE A 1 17 ? -28.447 -8.405  -14.565 1.00 0.00 ? 17 PHE A CZ   3  
ATOM 2329  H H    . PHE A 1 17 ? -28.694 -4.302  -17.219 1.00 0.00 ? 17 PHE A H    3  
ATOM 2330  H HA   . PHE A 1 17 ? -31.240 -5.506  -17.159 1.00 0.00 ? 17 PHE A HA   3  
ATOM 2331  H HB2  . PHE A 1 17 ? -29.745 -3.841  -15.132 1.00 0.00 ? 17 PHE A HB2  3  
ATOM 2332  H HB3  . PHE A 1 17 ? -31.307 -4.586  -14.790 1.00 0.00 ? 17 PHE A HB3  3  
ATOM 2333  H HD1  . PHE A 1 17 ? -31.553 -7.023  -14.688 1.00 0.00 ? 17 PHE A HD1  3  
ATOM 2334  H HD2  . PHE A 1 17 ? -27.741 -5.195  -15.448 1.00 0.00 ? 17 PHE A HD2  3  
ATOM 2335  H HE1  . PHE A 1 17 ? -30.425 -9.181  -14.217 1.00 0.00 ? 17 PHE A HE1  3  
ATOM 2336  H HE2  . PHE A 1 17 ? -26.612 -7.354  -14.975 1.00 0.00 ? 17 PHE A HE2  3  
ATOM 2337  H HZ   . PHE A 1 17 ? -27.955 -9.346  -14.360 1.00 0.00 ? 17 PHE A HZ   3  
ATOM 2338  N N    . TYR A 1 18 ? -31.229 -2.212  -17.162 1.00 0.00 ? 18 TYR A N    3  
ATOM 2339  C CA   . TYR A 1 18 ? -32.098 -1.058  -17.361 1.00 0.00 ? 18 TYR A CA   3  
ATOM 2340  C C    . TYR A 1 18 ? -32.846 -1.188  -18.684 1.00 0.00 ? 18 TYR A C    3  
ATOM 2341  O O    . TYR A 1 18 ? -34.063 -1.010  -18.737 1.00 0.00 ? 18 TYR A O    3  
ATOM 2342  C CB   . TYR A 1 18 ? -31.267 0.226   -17.368 1.00 0.00 ? 18 TYR A CB   3  
ATOM 2343  C CG   . TYR A 1 18 ? -30.622 0.416   -16.016 1.00 0.00 ? 18 TYR A CG   3  
ATOM 2344  C CD1  . TYR A 1 18 ? -31.306 1.099   -15.003 1.00 0.00 ? 18 TYR A CD1  3  
ATOM 2345  C CD2  . TYR A 1 18 ? -29.340 -0.090  -15.776 1.00 0.00 ? 18 TYR A CD2  3  
ATOM 2346  C CE1  . TYR A 1 18 ? -30.706 1.275   -13.750 1.00 0.00 ? 18 TYR A CE1  3  
ATOM 2347  C CE2  . TYR A 1 18 ? -28.740 0.085   -14.523 1.00 0.00 ? 18 TYR A CE2  3  
ATOM 2348  C CZ   . TYR A 1 18 ? -29.423 0.767   -13.509 1.00 0.00 ? 18 TYR A CZ   3  
ATOM 2349  O OH   . TYR A 1 18 ? -28.834 0.941   -12.274 1.00 0.00 ? 18 TYR A OH   3  
ATOM 2350  H H    . TYR A 1 18 ? -30.263 -2.095  -17.045 1.00 0.00 ? 18 TYR A H    3  
ATOM 2351  H HA   . TYR A 1 18 ? -32.812 -1.011  -16.554 1.00 0.00 ? 18 TYR A HA   3  
ATOM 2352  H HB2  . TYR A 1 18 ? -30.502 0.156   -18.126 1.00 0.00 ? 18 TYR A HB2  3  
ATOM 2353  H HB3  . TYR A 1 18 ? -31.908 1.069   -17.580 1.00 0.00 ? 18 TYR A HB3  3  
ATOM 2354  H HD1  . TYR A 1 18 ? -32.295 1.490   -15.188 1.00 0.00 ? 18 TYR A HD1  3  
ATOM 2355  H HD2  . TYR A 1 18 ? -28.813 -0.618  -16.557 1.00 0.00 ? 18 TYR A HD2  3  
ATOM 2356  H HE1  . TYR A 1 18 ? -31.235 1.801   -12.969 1.00 0.00 ? 18 TYR A HE1  3  
ATOM 2357  H HE2  . TYR A 1 18 ? -27.751 -0.306  -14.337 1.00 0.00 ? 18 TYR A HE2  3  
ATOM 2358  H HH   . TYR A 1 18 ? -28.602 1.868   -12.184 1.00 0.00 ? 18 TYR A HH   3  
ATOM 2359  N N    . TYR A 1 19 ? -32.121 -1.520  -19.747 1.00 0.00 ? 19 TYR A N    3  
ATOM 2360  C CA   . TYR A 1 19 ? -32.744 -1.696  -21.052 1.00 0.00 ? 19 TYR A CA   3  
ATOM 2361  C C    . TYR A 1 19 ? -33.683 -2.898  -21.026 1.00 0.00 ? 19 TYR A C    3  
ATOM 2362  O O    . TYR A 1 19 ? -34.809 -2.842  -21.521 1.00 0.00 ? 19 TYR A O    3  
ATOM 2363  C CB   . TYR A 1 19 ? -31.676 -1.902  -22.127 1.00 0.00 ? 19 TYR A CB   3  
ATOM 2364  C CG   . TYR A 1 19 ? -32.345 -2.037  -23.475 1.00 0.00 ? 19 TYR A CG   3  
ATOM 2365  C CD1  . TYR A 1 19 ? -32.788 -0.894  -24.151 1.00 0.00 ? 19 TYR A CD1  3  
ATOM 2366  C CD2  . TYR A 1 19 ? -32.523 -3.301  -24.047 1.00 0.00 ? 19 TYR A CD2  3  
ATOM 2367  C CE1  . TYR A 1 19 ? -33.410 -1.016  -25.399 1.00 0.00 ? 19 TYR A CE1  3  
ATOM 2368  C CE2  . TYR A 1 19 ? -33.144 -3.424  -25.296 1.00 0.00 ? 19 TYR A CE2  3  
ATOM 2369  C CZ   . TYR A 1 19 ? -33.588 -2.281  -25.972 1.00 0.00 ? 19 TYR A CZ   3  
ATOM 2370  O OH   . TYR A 1 19 ? -34.202 -2.400  -27.202 1.00 0.00 ? 19 TYR A OH   3  
ATOM 2371  H H    . TYR A 1 19 ? -31.154 -1.654  -19.654 1.00 0.00 ? 19 TYR A H    3  
ATOM 2372  H HA   . TYR A 1 19 ? -33.315 -0.811  -21.290 1.00 0.00 ? 19 TYR A HA   3  
ATOM 2373  H HB2  . TYR A 1 19 ? -31.008 -1.052  -22.138 1.00 0.00 ? 19 TYR A HB2  3  
ATOM 2374  H HB3  . TYR A 1 19 ? -31.115 -2.798  -21.913 1.00 0.00 ? 19 TYR A HB3  3  
ATOM 2375  H HD1  . TYR A 1 19 ? -32.652 0.083   -23.709 1.00 0.00 ? 19 TYR A HD1  3  
ATOM 2376  H HD2  . TYR A 1 19 ? -32.181 -4.184  -23.525 1.00 0.00 ? 19 TYR A HD2  3  
ATOM 2377  H HE1  . TYR A 1 19 ? -33.753 -0.133  -25.920 1.00 0.00 ? 19 TYR A HE1  3  
ATOM 2378  H HE2  . TYR A 1 19 ? -33.282 -4.400  -25.738 1.00 0.00 ? 19 TYR A HE2  3  
ATOM 2379  H HH   . TYR A 1 19 ? -34.022 -3.281  -27.539 1.00 0.00 ? 19 TYR A HH   3  
ATOM 2380  N N    . ASP A 1 20 ? -33.188 -3.991  -20.451 1.00 0.00 ? 20 ASP A N    3  
ATOM 2381  C CA   . ASP A 1 20 ? -33.953 -5.231  -20.362 1.00 0.00 ? 20 ASP A CA   3  
ATOM 2382  C C    . ASP A 1 20 ? -35.097 -5.110  -19.359 1.00 0.00 ? 20 ASP A C    3  
ATOM 2383  O O    . ASP A 1 20 ? -35.996 -5.950  -19.336 1.00 0.00 ? 20 ASP A O    3  
ATOM 2384  C CB   . ASP A 1 20 ? -33.033 -6.379  -19.945 1.00 0.00 ? 20 ASP A CB   3  
ATOM 2385  C CG   . ASP A 1 20 ? -32.086 -6.732  -21.087 1.00 0.00 ? 20 ASP A CG   3  
ATOM 2386  O OD1  . ASP A 1 20 ? -32.332 -6.282  -22.195 1.00 0.00 ? 20 ASP A OD1  3  
ATOM 2387  O OD2  . ASP A 1 20 ? -31.129 -7.447  -20.838 1.00 0.00 ? 20 ASP A OD2  3  
ATOM 2388  H H    . ASP A 1 20 ? -32.278 -3.963  -20.089 1.00 0.00 ? 20 ASP A H    3  
ATOM 2389  H HA   . ASP A 1 20 ? -34.365 -5.455  -21.334 1.00 0.00 ? 20 ASP A HA   3  
ATOM 2390  H HB2  . ASP A 1 20 ? -32.458 -6.080  -19.082 1.00 0.00 ? 20 ASP A HB2  3  
ATOM 2391  H HB3  . ASP A 1 20 ? -33.629 -7.244  -19.696 1.00 0.00 ? 20 ASP A HB3  3  
ATOM 2392  N N    . TYR A 1 21 ? -35.065 -4.073  -18.528 1.00 0.00 ? 21 TYR A N    3  
ATOM 2393  C CA   . TYR A 1 21 ? -36.118 -3.887  -17.535 1.00 0.00 ? 21 TYR A CA   3  
ATOM 2394  C C    . TYR A 1 21 ? -37.462 -3.675  -18.222 1.00 0.00 ? 21 TYR A C    3  
ATOM 2395  O O    . TYR A 1 21 ? -38.466 -4.258  -17.823 1.00 0.00 ? 21 TYR A O    3  
ATOM 2396  C CB   . TYR A 1 21 ? -35.805 -2.681  -16.646 1.00 0.00 ? 21 TYR A CB   3  
ATOM 2397  C CG   . TYR A 1 21 ? -36.938 -2.475  -15.667 1.00 0.00 ? 21 TYR A CG   3  
ATOM 2398  C CD1  . TYR A 1 21 ? -37.043 -3.293  -14.536 1.00 0.00 ? 21 TYR A CD1  3  
ATOM 2399  C CD2  . TYR A 1 21 ? -37.884 -1.468  -15.895 1.00 0.00 ? 21 TYR A CD2  3  
ATOM 2400  C CE1  . TYR A 1 21 ? -38.094 -3.102  -13.631 1.00 0.00 ? 21 TYR A CE1  3  
ATOM 2401  C CE2  . TYR A 1 21 ? -38.933 -1.277  -14.989 1.00 0.00 ? 21 TYR A CE2  3  
ATOM 2402  C CZ   . TYR A 1 21 ? -39.040 -2.093  -13.857 1.00 0.00 ? 21 TYR A CZ   3  
ATOM 2403  O OH   . TYR A 1 21 ? -40.075 -1.905  -12.965 1.00 0.00 ? 21 TYR A OH   3  
ATOM 2404  H H    . TYR A 1 21 ? -34.331 -3.426  -18.579 1.00 0.00 ? 21 TYR A H    3  
ATOM 2405  H HA   . TYR A 1 21 ? -36.176 -4.769  -16.917 1.00 0.00 ? 21 TYR A HA   3  
ATOM 2406  H HB2  . TYR A 1 21 ? -34.888 -2.859  -16.106 1.00 0.00 ? 21 TYR A HB2  3  
ATOM 2407  H HB3  . TYR A 1 21 ? -35.698 -1.799  -17.259 1.00 0.00 ? 21 TYR A HB3  3  
ATOM 2408  H HD1  . TYR A 1 21 ? -36.314 -4.069  -14.361 1.00 0.00 ? 21 TYR A HD1  3  
ATOM 2409  H HD2  . TYR A 1 21 ? -37.802 -0.838  -16.768 1.00 0.00 ? 21 TYR A HD2  3  
ATOM 2410  H HE1  . TYR A 1 21 ? -38.176 -3.731  -12.757 1.00 0.00 ? 21 TYR A HE1  3  
ATOM 2411  H HE2  . TYR A 1 21 ? -39.662 -0.499  -15.165 1.00 0.00 ? 21 TYR A HE2  3  
ATOM 2412  H HH   . TYR A 1 21 ? -39.753 -1.355  -12.248 1.00 0.00 ? 21 TYR A HH   3  
ATOM 2413  N N    . GLU A 1 22 ? -37.477 -2.827  -19.243 1.00 0.00 ? 22 GLU A N    3  
ATOM 2414  C CA   . GLU A 1 22 ? -38.714 -2.539  -19.959 1.00 0.00 ? 22 GLU A CA   3  
ATOM 2415  C C    . GLU A 1 22 ? -39.294 -3.810  -20.575 1.00 0.00 ? 22 GLU A C    3  
ATOM 2416  O O    . GLU A 1 22 ? -40.508 -4.010  -20.571 1.00 0.00 ? 22 GLU A O    3  
ATOM 2417  C CB   . GLU A 1 22 ? -38.449 -1.513  -21.063 1.00 0.00 ? 22 GLU A CB   3  
ATOM 2418  C CG   . GLU A 1 22 ? -38.161 -0.149  -20.434 1.00 0.00 ? 22 GLU A CG   3  
ATOM 2419  C CD   . GLU A 1 22 ? -37.720 0.838   -21.509 1.00 0.00 ? 22 GLU A CD   3  
ATOM 2420  O OE1  . GLU A 1 22 ? -37.435 0.398   -22.610 1.00 0.00 ? 22 GLU A OE1  3  
ATOM 2421  O OE2  . GLU A 1 22 ? -37.676 2.022   -21.215 1.00 0.00 ? 22 GLU A OE2  3  
ATOM 2422  H H    . GLU A 1 22 ? -36.650 -2.369  -19.500 1.00 0.00 ? 22 GLU A H    3  
ATOM 2423  H HA   . GLU A 1 22 ? -39.432 -2.127  -19.267 1.00 0.00 ? 22 GLU A HA   3  
ATOM 2424  H HB2  . GLU A 1 22 ? -37.598 -1.827  -21.649 1.00 0.00 ? 22 GLU A HB2  3  
ATOM 2425  H HB3  . GLU A 1 22 ? -39.317 -1.437  -21.701 1.00 0.00 ? 22 GLU A HB3  3  
ATOM 2426  H HG2  . GLU A 1 22 ? -39.055 0.220   -19.953 1.00 0.00 ? 22 GLU A HG2  3  
ATOM 2427  H HG3  . GLU A 1 22 ? -37.376 -0.252  -19.700 1.00 0.00 ? 22 GLU A HG3  3  
ATOM 2428  N N    . THR A 1 23 ? -38.428 -4.663  -21.108 1.00 0.00 ? 23 THR A N    3  
ATOM 2429  C CA   . THR A 1 23 ? -38.880 -5.905  -21.726 1.00 0.00 ? 23 THR A CA   3  
ATOM 2430  C C    . THR A 1 23 ? -39.491 -6.841  -20.683 1.00 0.00 ? 23 THR A C    3  
ATOM 2431  O O    . THR A 1 23 ? -40.379 -7.627  -20.992 1.00 0.00 ? 23 THR A O    3  
ATOM 2432  C CB   . THR A 1 23 ? -37.706 -6.605  -22.414 1.00 0.00 ? 23 THR A CB   3  
ATOM 2433  O OG1  . THR A 1 23 ? -36.696 -6.885  -21.455 1.00 0.00 ? 23 THR A OG1  3  
ATOM 2434  C CG2  . THR A 1 23 ? -37.138 -5.697  -23.507 1.00 0.00 ? 23 THR A CG2  3  
ATOM 2435  H H    . THR A 1 23 ? -37.469 -4.454  -21.094 1.00 0.00 ? 23 THR A H    3  
ATOM 2436  H HA   . THR A 1 23 ? -39.629 -5.673  -22.468 1.00 0.00 ? 23 THR A HA   3  
ATOM 2437  H HB   . THR A 1 23 ? -38.046 -7.526  -22.859 1.00 0.00 ? 23 THR A HB   3  
ATOM 2438  H HG1  . THR A 1 23 ? -35.954 -7.286  -21.913 1.00 0.00 ? 23 THR A HG1  3  
ATOM 2439  H HG21 . THR A 1 23 ? -36.106 -5.955  -23.689 1.00 0.00 ? 23 THR A HG21 3  
ATOM 2440  H HG22 . THR A 1 23 ? -37.201 -4.668  -23.187 1.00 0.00 ? 23 THR A HG22 3  
ATOM 2441  H HG23 . THR A 1 23 ? -37.707 -5.829  -24.415 1.00 0.00 ? 23 THR A HG23 3  
ATOM 2442  N N    . VAL A 1 24 ? -38.990 -6.762  -19.455 1.00 0.00 ? 24 VAL A N    3  
ATOM 2443  C CA   . VAL A 1 24 ? -39.466 -7.623  -18.373 1.00 0.00 ? 24 VAL A CA   3  
ATOM 2444  C C    . VAL A 1 24 ? -40.989 -7.726  -18.358 1.00 0.00 ? 24 VAL A C    3  
ATOM 2445  O O    . VAL A 1 24 ? -41.547 -8.702  -17.864 1.00 0.00 ? 24 VAL A O    3  
ATOM 2446  C CB   . VAL A 1 24 ? -38.983 -7.087  -17.022 1.00 0.00 ? 24 VAL A CB   3  
ATOM 2447  C CG1  . VAL A 1 24 ? -39.965 -6.036  -16.491 1.00 0.00 ? 24 VAL A CG1  3  
ATOM 2448  C CG2  . VAL A 1 24 ? -38.886 -8.242  -16.024 1.00 0.00 ? 24 VAL A CG2  3  
ATOM 2449  H H    . VAL A 1 24 ? -38.256 -6.139  -19.277 1.00 0.00 ? 24 VAL A H    3  
ATOM 2450  H HA   . VAL A 1 24 ? -39.055 -8.612  -18.514 1.00 0.00 ? 24 VAL A HA   3  
ATOM 2451  H HB   . VAL A 1 24 ? -38.008 -6.635  -17.146 1.00 0.00 ? 24 VAL A HB   3  
ATOM 2452  H HG11 . VAL A 1 24 ? -39.449 -5.373  -15.812 1.00 0.00 ? 24 VAL A HG11 3  
ATOM 2453  H HG12 . VAL A 1 24 ? -40.770 -6.528  -15.969 1.00 0.00 ? 24 VAL A HG12 3  
ATOM 2454  H HG13 . VAL A 1 24 ? -40.370 -5.462  -17.313 1.00 0.00 ? 24 VAL A HG13 3  
ATOM 2455  H HG21 . VAL A 1 24 ? -38.051 -8.875  -16.285 1.00 0.00 ? 24 VAL A HG21 3  
ATOM 2456  H HG22 . VAL A 1 24 ? -39.799 -8.819  -16.051 1.00 0.00 ? 24 VAL A HG22 3  
ATOM 2457  H HG23 . VAL A 1 24 ? -38.741 -7.847  -15.029 1.00 0.00 ? 24 VAL A HG23 3  
ATOM 2458  N N    . ARG A 1 25 ? -41.659 -6.727  -18.915 1.00 0.00 ? 25 ARG A N    3  
ATOM 2459  C CA   . ARG A 1 25 ? -43.116 -6.759  -18.961 1.00 0.00 ? 25 ARG A CA   3  
ATOM 2460  C C    . ARG A 1 25 ? -43.586 -7.789  -19.995 1.00 0.00 ? 25 ARG A C    3  
ATOM 2461  O O    . ARG A 1 25 ? -44.379 -8.681  -19.690 1.00 0.00 ? 25 ARG A O    3  
ATOM 2462  C CB   . ARG A 1 25 ? -43.655 -5.376  -19.333 1.00 0.00 ? 25 ARG A CB   3  
ATOM 2463  C CG   . ARG A 1 25 ? -45.186 -5.402  -19.357 1.00 0.00 ? 25 ARG A CG   3  
ATOM 2464  C CD   . ARG A 1 25 ? -45.712 -3.992  -19.629 1.00 0.00 ? 25 ARG A CD   3  
ATOM 2465  N NE   . ARG A 1 25 ? -45.286 -3.545  -20.950 1.00 0.00 ? 25 ARG A NE   3  
ATOM 2466  C CZ   . ARG A 1 25 ? -45.469 -2.290  -21.344 1.00 0.00 ? 25 ARG A CZ   3  
ATOM 2467  N NH1  . ARG A 1 25 ? -46.035 -1.429  -20.541 1.00 0.00 ? 25 ARG A NH1  3  
ATOM 2468  N NH2  . ARG A 1 25 ? -45.080 -1.914  -22.531 1.00 0.00 ? 25 ARG A NH2  3  
ATOM 2469  H H    . ARG A 1 25 ? -41.155 -6.000  -19.336 1.00 0.00 ? 25 ARG A H    3  
ATOM 2470  H HA   . ARG A 1 25 ? -43.496 -7.035  -17.988 1.00 0.00 ? 25 ARG A HA   3  
ATOM 2471  H HB2  . ARG A 1 25 ? -43.320 -4.653  -18.602 1.00 0.00 ? 25 ARG A HB2  3  
ATOM 2472  H HB3  . ARG A 1 25 ? -43.288 -5.097  -20.308 1.00 0.00 ? 25 ARG A HB3  3  
ATOM 2473  H HG2  . ARG A 1 25 ? -45.525 -6.069  -20.137 1.00 0.00 ? 25 ARG A HG2  3  
ATOM 2474  H HG3  . ARG A 1 25 ? -45.557 -5.745  -18.403 1.00 0.00 ? 25 ARG A HG3  3  
ATOM 2475  H HD2  . ARG A 1 25 ? -46.791 -3.998  -19.586 1.00 0.00 ? 25 ARG A HD2  3  
ATOM 2476  H HD3  . ARG A 1 25 ? -45.329 -3.317  -18.879 1.00 0.00 ? 25 ARG A HD3  3  
ATOM 2477  H HE   . ARG A 1 25 ? -44.858 -4.183  -21.560 1.00 0.00 ? 25 ARG A HE   3  
ATOM 2478  H HH11 . ARG A 1 25 ? -46.332 -1.716  -19.630 1.00 0.00 ? 25 ARG A HH11 3  
ATOM 2479  H HH12 . ARG A 1 25 ? -46.172 -0.484  -20.836 1.00 0.00 ? 25 ARG A HH12 3  
ATOM 2480  H HH21 . ARG A 1 25 ? -44.645 -2.572  -23.145 1.00 0.00 ? 25 ARG A HH21 3  
ATOM 2481  H HH22 . ARG A 1 25 ? -45.217 -0.969  -22.828 1.00 0.00 ? 25 ARG A HH22 3  
ATOM 2482  N N    . ASN A 1 26 ? -43.090 -7.638  -21.219 1.00 0.00 ? 26 ASN A N    3  
ATOM 2483  C CA   . ASN A 1 26 ? -43.452 -8.532  -22.319 1.00 0.00 ? 26 ASN A CA   3  
ATOM 2484  C C    . ASN A 1 26 ? -42.468 -9.694  -22.461 1.00 0.00 ? 26 ASN A C    3  
ATOM 2485  O O    . ASN A 1 26 ? -42.644 -10.557 -23.322 1.00 0.00 ? 26 ASN A O    3  
ATOM 2486  C CB   . ASN A 1 26 ? -43.495 -7.745  -23.630 1.00 0.00 ? 26 ASN A CB   3  
ATOM 2487  C CG   . ASN A 1 26 ? -44.315 -8.505  -24.667 1.00 0.00 ? 26 ASN A CG   3  
ATOM 2488  O OD1  . ASN A 1 26 ? -45.303 -9.155  -24.325 1.00 0.00 ? 26 ASN A OD1  3  
ATOM 2489  N ND2  . ASN A 1 26 ? -43.963 -8.462  -25.923 1.00 0.00 ? 26 ASN A ND2  3  
ATOM 2490  H H    . ASN A 1 26 ? -42.483 -6.887  -21.386 1.00 0.00 ? 26 ASN A H    3  
ATOM 2491  H HA   . ASN A 1 26 ? -44.435 -8.933  -22.129 1.00 0.00 ? 26 ASN A HA   3  
ATOM 2492  H HB2  . ASN A 1 26 ? -43.945 -6.780  -23.454 1.00 0.00 ? 26 ASN A HB2  3  
ATOM 2493  H HB3  . ASN A 1 26 ? -42.490 -7.609  -23.999 1.00 0.00 ? 26 ASN A HB3  3  
ATOM 2494  H HD21 . ASN A 1 26 ? -43.176 -7.944  -26.194 1.00 0.00 ? 26 ASN A HD21 3  
ATOM 2495  H HD22 . ASN A 1 26 ? -44.485 -8.947  -26.596 1.00 0.00 ? 26 ASN A HD22 3  
ATOM 2496  N N    . GLY A 1 27 ? -41.426 -9.703  -21.640 1.00 0.00 ? 27 GLY A N    3  
ATOM 2497  C CA   . GLY A 1 27 ? -40.419 -10.756 -21.719 1.00 0.00 ? 27 GLY A CA   3  
ATOM 2498  C C    . GLY A 1 27 ? -41.003 -12.139 -21.443 1.00 0.00 ? 27 GLY A C    3  
ATOM 2499  O O    . GLY A 1 27 ? -40.671 -13.105 -22.129 1.00 0.00 ? 27 GLY A O    3  
ATOM 2500  H H    . GLY A 1 27 ? -41.325 -8.993  -20.973 1.00 0.00 ? 27 GLY A H    3  
ATOM 2501  H HA2  . GLY A 1 27 ? -39.984 -10.751 -22.707 1.00 0.00 ? 27 GLY A HA2  3  
ATOM 2502  H HA3  . GLY A 1 27 ? -39.644 -10.554 -20.995 1.00 0.00 ? 27 GLY A HA3  3  
ATOM 2503  N N    . GLY A 1 28 ? -41.857 -12.240 -20.429 1.00 0.00 ? 28 GLY A N    3  
ATOM 2504  C CA   . GLY A 1 28 ? -42.449 -13.528 -20.078 1.00 0.00 ? 28 GLY A CA   3  
ATOM 2505  C C    . GLY A 1 28 ? -43.293 -14.098 -21.214 1.00 0.00 ? 28 GLY A C    3  
ATOM 2506  O O    . GLY A 1 28 ? -43.226 -15.292 -21.507 1.00 0.00 ? 28 GLY A O    3  
ATOM 2507  H H    . GLY A 1 28 ? -42.078 -11.448 -19.897 1.00 0.00 ? 28 GLY A H    3  
ATOM 2508  H HA2  . GLY A 1 28 ? -41.658 -14.225 -19.843 1.00 0.00 ? 28 GLY A HA2  3  
ATOM 2509  H HA3  . GLY A 1 28 ? -43.074 -13.401 -19.206 1.00 0.00 ? 28 GLY A HA3  3  
ATOM 2510  N N    . LEU A 1 29 ? -44.108 -13.250 -21.832 1.00 0.00 ? 29 LEU A N    3  
ATOM 2511  C CA   . LEU A 1 29 ? -44.977 -13.715 -22.910 1.00 0.00 ? 29 LEU A CA   3  
ATOM 2512  C C    . LEU A 1 29 ? -44.153 -14.287 -24.061 1.00 0.00 ? 29 LEU A C    3  
ATOM 2513  O O    . LEU A 1 29 ? -44.454 -15.368 -24.570 1.00 0.00 ? 29 LEU A O    3  
ATOM 2514  C CB   . LEU A 1 29 ? -45.839 -12.559 -23.420 1.00 0.00 ? 29 LEU A CB   3  
ATOM 2515  C CG   . LEU A 1 29 ? -46.870 -12.167 -22.355 1.00 0.00 ? 29 LEU A CG   3  
ATOM 2516  C CD1  . LEU A 1 29 ? -47.589 -10.889 -22.786 1.00 0.00 ? 29 LEU A CD1  3  
ATOM 2517  C CD2  . LEU A 1 29 ? -47.901 -13.291 -22.168 1.00 0.00 ? 29 LEU A CD2  3  
ATOM 2518  H H    . LEU A 1 29 ? -44.142 -12.319 -21.527 1.00 0.00 ? 29 LEU A H    3  
ATOM 2519  H HA   . LEU A 1 29 ? -45.623 -14.490 -22.526 1.00 0.00 ? 29 LEU A HA   3  
ATOM 2520  H HB2  . LEU A 1 29 ? -45.203 -11.709 -23.631 1.00 0.00 ? 29 LEU A HB2  3  
ATOM 2521  H HB3  . LEU A 1 29 ? -46.346 -12.857 -24.324 1.00 0.00 ? 29 LEU A HB3  3  
ATOM 2522  H HG   . LEU A 1 29 ? -46.361 -11.989 -21.418 1.00 0.00 ? 29 LEU A HG   3  
ATOM 2523  H HD11 . LEU A 1 29 ? -47.057 -10.030 -22.404 1.00 0.00 ? 29 LEU A HD11 3  
ATOM 2524  H HD12 . LEU A 1 29 ? -48.595 -10.892 -22.395 1.00 0.00 ? 29 LEU A HD12 3  
ATOM 2525  H HD13 . LEU A 1 29 ? -47.623 -10.842 -23.864 1.00 0.00 ? 29 LEU A HD13 3  
ATOM 2526  H HD21 . LEU A 1 29 ? -47.585 -13.939 -21.364 1.00 0.00 ? 29 LEU A HD21 3  
ATOM 2527  H HD22 . LEU A 1 29 ? -47.987 -13.864 -23.078 1.00 0.00 ? 29 LEU A HD22 3  
ATOM 2528  H HD23 . LEU A 1 29 ? -48.860 -12.860 -21.924 1.00 0.00 ? 29 LEU A HD23 3  
ATOM 2529  N N    . ILE A 1 30 ? -43.122 -13.560 -24.476 1.00 0.00 ? 30 ILE A N    3  
ATOM 2530  C CA   . ILE A 1 30 ? -42.277 -14.013 -25.577 1.00 0.00 ? 30 ILE A CA   3  
ATOM 2531  C C    . ILE A 1 30 ? -41.580 -15.328 -25.233 1.00 0.00 ? 30 ILE A C    3  
ATOM 2532  O O    . ILE A 1 30 ? -41.521 -16.244 -26.056 1.00 0.00 ? 30 ILE A O    3  
ATOM 2533  C CB   . ILE A 1 30 ? -41.224 -12.946 -25.896 1.00 0.00 ? 30 ILE A CB   3  
ATOM 2534  C CG1  . ILE A 1 30 ? -41.890 -11.718 -26.539 1.00 0.00 ? 30 ILE A CG1  3  
ATOM 2535  C CG2  . ILE A 1 30 ? -40.185 -13.524 -26.858 1.00 0.00 ? 30 ILE A CG2  3  
ATOM 2536  C CD1  . ILE A 1 30 ? -42.066 -11.926 -28.052 1.00 0.00 ? 30 ILE A CD1  3  
ATOM 2537  H H    . ILE A 1 30 ? -42.938 -12.689 -24.063 1.00 0.00 ? 30 ILE A H    3  
ATOM 2538  H HA   . ILE A 1 30 ? -42.896 -14.167 -26.443 1.00 0.00 ? 30 ILE A HA   3  
ATOM 2539  H HB   . ILE A 1 30 ? -40.732 -12.647 -24.981 1.00 0.00 ? 30 ILE A HB   3  
ATOM 2540  H HG12 . ILE A 1 30 ? -42.858 -11.561 -26.087 1.00 0.00 ? 30 ILE A HG12 3  
ATOM 2541  H HG13 . ILE A 1 30 ? -41.273 -10.848 -26.369 1.00 0.00 ? 30 ILE A HG13 3  
ATOM 2542  H HG21 . ILE A 1 30 ? -39.652 -12.718 -27.340 1.00 0.00 ? 30 ILE A HG21 3  
ATOM 2543  H HG22 . ILE A 1 30 ? -40.682 -14.124 -27.606 1.00 0.00 ? 30 ILE A HG22 3  
ATOM 2544  H HG23 . ILE A 1 30 ? -39.488 -14.139 -26.309 1.00 0.00 ? 30 ILE A HG23 3  
ATOM 2545  H HD11 . ILE A 1 30 ? -42.873 -11.302 -28.408 1.00 0.00 ? 30 ILE A HD11 3  
ATOM 2546  H HD12 . ILE A 1 30 ? -42.292 -12.958 -28.263 1.00 0.00 ? 30 ILE A HD12 3  
ATOM 2547  H HD13 . ILE A 1 30 ? -41.153 -11.648 -28.559 1.00 0.00 ? 30 ILE A HD13 3  
ATOM 2548  N N    . PHE A 1 31 ? -41.055 -15.417 -24.016 1.00 0.00 ? 31 PHE A N    3  
ATOM 2549  C CA   . PHE A 1 31 ? -40.364 -16.623 -23.575 1.00 0.00 ? 31 PHE A CA   3  
ATOM 2550  C C    . PHE A 1 31 ? -41.293 -17.831 -23.596 1.00 0.00 ? 31 PHE A C    3  
ATOM 2551  O O    . PHE A 1 31 ? -40.915 -18.907 -24.061 1.00 0.00 ? 31 PHE A O    3  
ATOM 2552  C CB   . PHE A 1 31 ? -39.821 -16.421 -22.158 1.00 0.00 ? 31 PHE A CB   3  
ATOM 2553  C CG   . PHE A 1 31 ? -39.148 -17.690 -21.694 1.00 0.00 ? 31 PHE A CG   3  
ATOM 2554  C CD1  . PHE A 1 31 ? -37.858 -18.002 -22.141 1.00 0.00 ? 31 PHE A CD1  3  
ATOM 2555  C CD2  . PHE A 1 31 ? -39.813 -18.555 -20.815 1.00 0.00 ? 31 PHE A CD2  3  
ATOM 2556  C CE1  . PHE A 1 31 ? -37.234 -19.179 -21.709 1.00 0.00 ? 31 PHE A CE1  3  
ATOM 2557  C CE2  . PHE A 1 31 ? -39.187 -19.731 -20.384 1.00 0.00 ? 31 PHE A CE2  3  
ATOM 2558  C CZ   . PHE A 1 31 ? -37.898 -20.043 -20.830 1.00 0.00 ? 31 PHE A CZ   3  
ATOM 2559  H H    . PHE A 1 31 ? -41.139 -14.671 -23.386 1.00 0.00 ? 31 PHE A H    3  
ATOM 2560  H HA   . PHE A 1 31 ? -39.534 -16.810 -24.238 1.00 0.00 ? 31 PHE A HA   3  
ATOM 2561  H HB2  . PHE A 1 31 ? -39.105 -15.613 -22.160 1.00 0.00 ? 31 PHE A HB2  3  
ATOM 2562  H HB3  . PHE A 1 31 ? -40.635 -16.181 -21.492 1.00 0.00 ? 31 PHE A HB3  3  
ATOM 2563  H HD1  . PHE A 1 31 ? -37.345 -17.337 -22.819 1.00 0.00 ? 31 PHE A HD1  3  
ATOM 2564  H HD2  . PHE A 1 31 ? -40.807 -18.314 -20.471 1.00 0.00 ? 31 PHE A HD2  3  
ATOM 2565  H HE1  . PHE A 1 31 ? -36.239 -19.420 -22.054 1.00 0.00 ? 31 PHE A HE1  3  
ATOM 2566  H HE2  . PHE A 1 31 ? -39.701 -20.396 -19.706 1.00 0.00 ? 31 PHE A HE2  3  
ATOM 2567  H HZ   . PHE A 1 31 ? -37.417 -20.951 -20.497 1.00 0.00 ? 31 PHE A HZ   3  
ATOM 2568  N N    . ALA A 1 32 ? -42.498 -17.660 -23.057 1.00 0.00 ? 32 ALA A N    3  
ATOM 2569  C CA   . ALA A 1 32 ? -43.450 -18.761 -22.990 1.00 0.00 ? 32 ALA A CA   3  
ATOM 2570  C C    . ALA A 1 32 ? -43.767 -19.314 -24.376 1.00 0.00 ? 32 ALA A C    3  
ATOM 2571  O O    . ALA A 1 32 ? -43.838 -20.529 -24.555 1.00 0.00 ? 32 ALA A O    3  
ATOM 2572  C CB   . ALA A 1 32 ? -44.742 -18.288 -22.323 1.00 0.00 ? 32 ALA A CB   3  
ATOM 2573  H H    . ALA A 1 32 ? -42.736 -16.793 -22.670 1.00 0.00 ? 32 ALA A H    3  
ATOM 2574  H HA   . ALA A 1 32 ? -43.024 -19.551 -22.390 1.00 0.00 ? 32 ALA A HA   3  
ATOM 2575  H HB1  . ALA A 1 32 ? -45.327 -17.722 -23.034 1.00 0.00 ? 32 ALA A HB1  3  
ATOM 2576  H HB2  . ALA A 1 32 ? -44.503 -17.663 -21.476 1.00 0.00 ? 32 ALA A HB2  3  
ATOM 2577  H HB3  . ALA A 1 32 ? -45.310 -19.143 -21.990 1.00 0.00 ? 32 ALA A HB3  3  
ATOM 2578  N N    . GLY A 1 33 ? -43.958 -18.439 -25.359 1.00 0.00 ? 33 GLY A N    3  
ATOM 2579  C CA   . GLY A 1 33 ? -44.262 -18.903 -26.707 1.00 0.00 ? 33 GLY A CA   3  
ATOM 2580  C C    . GLY A 1 33 ? -43.128 -19.766 -27.248 1.00 0.00 ? 33 GLY A C    3  
ATOM 2581  O O    . GLY A 1 33 ? -43.365 -20.797 -27.879 1.00 0.00 ? 33 GLY A O    3  
ATOM 2582  H H    . GLY A 1 33 ? -43.903 -17.475 -25.192 1.00 0.00 ? 33 GLY A H    3  
ATOM 2583  H HA2  . GLY A 1 33 ? -45.173 -19.483 -26.686 1.00 0.00 ? 33 GLY A HA2  3  
ATOM 2584  H HA3  . GLY A 1 33 ? -44.397 -18.050 -27.356 1.00 0.00 ? 33 GLY A HA3  3  
ATOM 2585  N N    . LEU A 1 34 ? -41.895 -19.352 -26.974 1.00 0.00 ? 34 LEU A N    3  
ATOM 2586  C CA   . LEU A 1 34 ? -40.730 -20.110 -27.414 1.00 0.00 ? 34 LEU A CA   3  
ATOM 2587  C C    . LEU A 1 34 ? -40.671 -21.444 -26.674 1.00 0.00 ? 34 LEU A C    3  
ATOM 2588  O O    . LEU A 1 34 ? -40.309 -22.475 -27.242 1.00 0.00 ? 34 LEU A O    3  
ATOM 2589  C CB   . LEU A 1 34 ? -39.450 -19.315 -27.142 1.00 0.00 ? 34 LEU A CB   3  
ATOM 2590  C CG   . LEU A 1 34 ? -39.400 -18.085 -28.057 1.00 0.00 ? 34 LEU A CG   3  
ATOM 2591  C CD1  . LEU A 1 34 ? -38.220 -17.199 -27.655 1.00 0.00 ? 34 LEU A CD1  3  
ATOM 2592  C CD2  . LEU A 1 34 ? -39.233 -18.516 -29.521 1.00 0.00 ? 34 LEU A CD2  3  
ATOM 2593  H H    . LEU A 1 34 ? -41.766 -18.539 -26.437 1.00 0.00 ? 34 LEU A H    3  
ATOM 2594  H HA   . LEU A 1 34 ? -40.812 -20.299 -28.474 1.00 0.00 ? 34 LEU A HA   3  
ATOM 2595  H HB2  . LEU A 1 34 ? -39.446 -18.992 -26.110 1.00 0.00 ? 34 LEU A HB2  3  
ATOM 2596  H HB3  . LEU A 1 34 ? -38.588 -19.938 -27.324 1.00 0.00 ? 34 LEU A HB3  3  
ATOM 2597  H HG   . LEU A 1 34 ? -40.318 -17.526 -27.951 1.00 0.00 ? 34 LEU A HG   3  
ATOM 2598  H HD11 . LEU A 1 34 ? -38.252 -16.279 -28.220 1.00 0.00 ? 34 LEU A HD11 3  
ATOM 2599  H HD12 . LEU A 1 34 ? -37.295 -17.715 -27.859 1.00 0.00 ? 34 LEU A HD12 3  
ATOM 2600  H HD13 . LEU A 1 34 ? -38.283 -16.974 -26.600 1.00 0.00 ? 34 LEU A HD13 3  
ATOM 2601  H HD21 . LEU A 1 34 ? -38.882 -19.538 -29.567 1.00 0.00 ? 34 LEU A HD21 3  
ATOM 2602  H HD22 . LEU A 1 34 ? -38.516 -17.871 -30.006 1.00 0.00 ? 34 LEU A HD22 3  
ATOM 2603  H HD23 . LEU A 1 34 ? -40.185 -18.441 -30.028 1.00 0.00 ? 34 LEU A HD23 3  
ATOM 2604  N N    . ALA A 1 35 ? -41.034 -21.400 -25.398 1.00 0.00 ? 35 ALA A N    3  
ATOM 2605  C CA   . ALA A 1 35 ? -41.023 -22.603 -24.572 1.00 0.00 ? 35 ALA A CA   3  
ATOM 2606  C C    . ALA A 1 35 ? -41.974 -23.646 -25.155 1.00 0.00 ? 35 ALA A C    3  
ATOM 2607  O O    . ALA A 1 35 ? -41.628 -24.815 -25.264 1.00 0.00 ? 35 ALA A O    3  
ATOM 2608  C CB   . ALA A 1 35 ? -41.445 -22.264 -23.140 1.00 0.00 ? 35 ALA A CB   3  
ATOM 2609  H H    . ALA A 1 35 ? -41.314 -20.534 -25.032 1.00 0.00 ? 35 ALA A H    3  
ATOM 2610  H HA   . ALA A 1 35 ? -40.024 -23.010 -24.556 1.00 0.00 ? 35 ALA A HA   3  
ATOM 2611  H HB1  . ALA A 1 35 ? -41.525 -23.175 -22.563 1.00 0.00 ? 35 ALA A HB1  3  
ATOM 2612  H HB2  . ALA A 1 35 ? -42.401 -21.764 -23.155 1.00 0.00 ? 35 ALA A HB2  3  
ATOM 2613  H HB3  . ALA A 1 35 ? -40.705 -21.617 -22.691 1.00 0.00 ? 35 ALA A HB3  3  
ATOM 2614  N N    . PHE A 1 36 ? -43.184 -23.208 -25.485 1.00 0.00 ? 36 PHE A N    3  
ATOM 2615  C CA   . PHE A 1 36 ? -44.214 -24.103 -26.024 1.00 0.00 ? 36 PHE A CA   3  
ATOM 2616  C C    . PHE A 1 36 ? -43.766 -24.784 -27.322 1.00 0.00 ? 36 PHE A C    3  
ATOM 2617  O O    . PHE A 1 36 ? -43.937 -25.998 -27.489 1.00 0.00 ? 36 PHE A O    3  
ATOM 2618  C CB   . PHE A 1 36 ? -45.499 -23.314 -26.281 1.00 0.00 ? 36 PHE A CB   3  
ATOM 2619  C CG   . PHE A 1 36 ? -46.542 -24.232 -26.872 1.00 0.00 ? 36 PHE A CG   3  
ATOM 2620  C CD1  . PHE A 1 36 ? -47.256 -25.104 -26.041 1.00 0.00 ? 36 PHE A CD1  3  
ATOM 2621  C CD2  . PHE A 1 36 ? -46.798 -24.209 -28.248 1.00 0.00 ? 36 PHE A CD2  3  
ATOM 2622  C CE1  . PHE A 1 36 ? -48.223 -25.955 -26.587 1.00 0.00 ? 36 PHE A CE1  3  
ATOM 2623  C CE2  . PHE A 1 36 ? -47.765 -25.059 -28.793 1.00 0.00 ? 36 PHE A CE2  3  
ATOM 2624  C CZ   . PHE A 1 36 ? -48.479 -25.933 -27.963 1.00 0.00 ? 36 PHE A CZ   3  
ATOM 2625  H H    . PHE A 1 36 ? -43.407 -22.271 -25.296 1.00 0.00 ? 36 PHE A H    3  
ATOM 2626  H HA   . PHE A 1 36 ? -44.424 -24.867 -25.290 1.00 0.00 ? 36 PHE A HA   3  
ATOM 2627  H HB2  . PHE A 1 36 ? -45.863 -22.906 -25.350 1.00 0.00 ? 36 PHE A HB2  3  
ATOM 2628  H HB3  . PHE A 1 36 ? -45.295 -22.509 -26.971 1.00 0.00 ? 36 PHE A HB3  3  
ATOM 2629  H HD1  . PHE A 1 36 ? -47.058 -25.121 -24.979 1.00 0.00 ? 36 PHE A HD1  3  
ATOM 2630  H HD2  . PHE A 1 36 ? -46.247 -23.536 -28.888 1.00 0.00 ? 36 PHE A HD2  3  
ATOM 2631  H HE1  . PHE A 1 36 ? -48.773 -26.627 -25.946 1.00 0.00 ? 36 PHE A HE1  3  
ATOM 2632  H HE2  . PHE A 1 36 ? -47.963 -25.043 -29.855 1.00 0.00 ? 36 PHE A HE2  3  
ATOM 2633  H HZ   . PHE A 1 36 ? -49.226 -26.589 -28.384 1.00 0.00 ? 36 PHE A HZ   3  
ATOM 2634  N N    . ILE A 1 37 ? -43.216 -24.009 -28.250 1.00 0.00 ? 37 ILE A N    3  
ATOM 2635  C CA   . ILE A 1 37 ? -42.784 -24.564 -29.530 1.00 0.00 ? 37 ILE A CA   3  
ATOM 2636  C C    . ILE A 1 37 ? -41.765 -25.677 -29.311 1.00 0.00 ? 37 ILE A C    3  
ATOM 2637  O O    . ILE A 1 37 ? -41.822 -26.717 -29.963 1.00 0.00 ? 37 ILE A O    3  
ATOM 2638  C CB   . ILE A 1 37 ? -42.166 -23.465 -30.393 1.00 0.00 ? 37 ILE A CB   3  
ATOM 2639  C CG1  . ILE A 1 37 ? -43.259 -22.483 -30.824 1.00 0.00 ? 37 ILE A CG1  3  
ATOM 2640  C CG2  . ILE A 1 37 ? -41.524 -24.089 -31.633 1.00 0.00 ? 37 ILE A CG2  3  
ATOM 2641  C CD1  . ILE A 1 37 ? -42.617 -21.240 -31.442 1.00 0.00 ? 37 ILE A CD1  3  
ATOM 2642  H H    . ILE A 1 37 ? -43.120 -23.047 -28.085 1.00 0.00 ? 37 ILE A H    3  
ATOM 2643  H HA   . ILE A 1 37 ? -43.641 -24.971 -30.045 1.00 0.00 ? 37 ILE A HA   3  
ATOM 2644  H HB   . ILE A 1 37 ? -41.412 -22.940 -29.824 1.00 0.00 ? 37 ILE A HB   3  
ATOM 2645  H HG12 . ILE A 1 37 ? -43.901 -22.957 -31.552 1.00 0.00 ? 37 ILE A HG12 3  
ATOM 2646  H HG13 . ILE A 1 37 ? -43.843 -22.193 -29.963 1.00 0.00 ? 37 ILE A HG13 3  
ATOM 2647  H HG21 . ILE A 1 37 ? -41.337 -23.320 -32.369 1.00 0.00 ? 37 ILE A HG21 3  
ATOM 2648  H HG22 . ILE A 1 37 ? -42.189 -24.830 -32.048 1.00 0.00 ? 37 ILE A HG22 3  
ATOM 2649  H HG23 . ILE A 1 37 ? -40.590 -24.557 -31.359 1.00 0.00 ? 37 ILE A HG23 3  
ATOM 2650  H HD11 . ILE A 1 37 ? -43.136 -20.981 -32.353 1.00 0.00 ? 37 ILE A HD11 3  
ATOM 2651  H HD12 . ILE A 1 37 ? -41.580 -21.443 -31.664 1.00 0.00 ? 37 ILE A HD12 3  
ATOM 2652  H HD13 . ILE A 1 37 ? -42.680 -20.418 -30.746 1.00 0.00 ? 37 ILE A HD13 3  
ATOM 2653  N N    . VAL A 1 38 ? -40.831 -25.444 -28.403 1.00 0.00 ? 38 VAL A N    3  
ATOM 2654  C CA   . VAL A 1 38 ? -39.795 -26.432 -28.117 1.00 0.00 ? 38 VAL A CA   3  
ATOM 2655  C C    . VAL A 1 38 ? -40.425 -27.761 -27.699 1.00 0.00 ? 38 VAL A C    3  
ATOM 2656  O O    . VAL A 1 38 ? -39.955 -28.826 -28.091 1.00 0.00 ? 38 VAL A O    3  
ATOM 2657  C CB   . VAL A 1 38 ? -38.882 -25.922 -27.003 1.00 0.00 ? 38 VAL A CB   3  
ATOM 2658  C CG1  . VAL A 1 38 ? -37.948 -27.048 -26.552 1.00 0.00 ? 38 VAL A CG1  3  
ATOM 2659  C CG2  . VAL A 1 38 ? -38.048 -24.749 -27.524 1.00 0.00 ? 38 VAL A CG2  3  
ATOM 2660  H H    . VAL A 1 38 ? -40.827 -24.580 -27.938 1.00 0.00 ? 38 VAL A H    3  
ATOM 2661  H HA   . VAL A 1 38 ? -39.205 -26.587 -29.009 1.00 0.00 ? 38 VAL A HA   3  
ATOM 2662  H HB   . VAL A 1 38 ? -39.482 -25.595 -26.166 1.00 0.00 ? 38 VAL A HB   3  
ATOM 2663  H HG11 . VAL A 1 38 ? -38.401 -27.580 -25.727 1.00 0.00 ? 38 VAL A HG11 3  
ATOM 2664  H HG12 . VAL A 1 38 ? -37.006 -26.629 -26.235 1.00 0.00 ? 38 VAL A HG12 3  
ATOM 2665  H HG13 . VAL A 1 38 ? -37.783 -27.728 -27.373 1.00 0.00 ? 38 VAL A HG13 3  
ATOM 2666  H HG21 . VAL A 1 38 ? -38.573 -24.266 -28.336 1.00 0.00 ? 38 VAL A HG21 3  
ATOM 2667  H HG22 . VAL A 1 38 ? -37.095 -25.115 -27.879 1.00 0.00 ? 38 VAL A HG22 3  
ATOM 2668  H HG23 . VAL A 1 38 ? -37.885 -24.039 -26.727 1.00 0.00 ? 38 VAL A HG23 3  
ATOM 2669  N N    . GLY A 1 39 ? -41.486 -27.686 -26.903 1.00 0.00 ? 39 GLY A N    3  
ATOM 2670  C CA   . GLY A 1 39 ? -42.182 -28.879 -26.430 1.00 0.00 ? 39 GLY A CA   3  
ATOM 2671  C C    . GLY A 1 39 ? -42.745 -29.695 -27.591 1.00 0.00 ? 39 GLY A C    3  
ATOM 2672  O O    . GLY A 1 39 ? -42.748 -30.924 -27.553 1.00 0.00 ? 39 GLY A O    3  
ATOM 2673  H H    . GLY A 1 39 ? -41.812 -26.816 -26.623 1.00 0.00 ? 39 GLY A H    3  
ATOM 2674  H HA2  . GLY A 1 39 ? -41.491 -29.493 -25.869 1.00 0.00 ? 39 GLY A HA2  3  
ATOM 2675  H HA3  . GLY A 1 39 ? -42.994 -28.581 -25.785 1.00 0.00 ? 39 GLY A HA3  3  
ATOM 2676  N N    . LEU A 1 40 ? -43.224 -29.007 -28.622 1.00 0.00 ? 40 LEU A N    3  
ATOM 2677  C CA   . LEU A 1 40 ? -43.786 -29.705 -29.778 1.00 0.00 ? 40 LEU A CA   3  
ATOM 2678  C C    . LEU A 1 40 ? -42.729 -30.634 -30.377 1.00 0.00 ? 40 LEU A C    3  
ATOM 2679  O O    . LEU A 1 40 ? -43.005 -31.794 -30.686 1.00 0.00 ? 40 LEU A O    3  
ATOM 2680  C CB   . LEU A 1 40 ? -44.249 -28.685 -30.827 1.00 0.00 ? 40 LEU A CB   3  
ATOM 2681  C CG   . LEU A 1 40 ? -44.824 -29.401 -32.055 1.00 0.00 ? 40 LEU A CG   3  
ATOM 2682  C CD1  . LEU A 1 40 ? -46.033 -30.246 -31.645 1.00 0.00 ? 40 LEU A CD1  3  
ATOM 2683  C CD2  . LEU A 1 40 ? -45.269 -28.356 -33.082 1.00 0.00 ? 40 LEU A CD2  3  
ATOM 2684  H H    . LEU A 1 40 ? -43.198 -28.022 -28.598 1.00 0.00 ? 40 LEU A H    3  
ATOM 2685  H HA   . LEU A 1 40 ? -44.634 -30.292 -29.456 1.00 0.00 ? 40 LEU A HA   3  
ATOM 2686  H HB2  . LEU A 1 40 ? -45.008 -28.048 -30.395 1.00 0.00 ? 40 LEU A HB2  3  
ATOM 2687  H HB3  . LEU A 1 40 ? -43.407 -28.079 -31.131 1.00 0.00 ? 40 LEU A HB3  3  
ATOM 2688  H HG   . LEU A 1 40 ? -44.071 -30.038 -32.494 1.00 0.00 ? 40 LEU A HG   3  
ATOM 2689  H HD11 . LEU A 1 40 ? -45.697 -31.224 -31.333 1.00 0.00 ? 40 LEU A HD11 3  
ATOM 2690  H HD12 . LEU A 1 40 ? -46.704 -30.345 -32.485 1.00 0.00 ? 40 LEU A HD12 3  
ATOM 2691  H HD13 . LEU A 1 40 ? -46.548 -29.763 -30.827 1.00 0.00 ? 40 LEU A HD13 3  
ATOM 2692  H HD21 . LEU A 1 40 ? -44.946 -27.377 -32.761 1.00 0.00 ? 40 LEU A HD21 3  
ATOM 2693  H HD22 . LEU A 1 40 ? -46.344 -28.372 -33.169 1.00 0.00 ? 40 LEU A HD22 3  
ATOM 2694  H HD23 . LEU A 1 40 ? -44.826 -28.585 -34.041 1.00 0.00 ? 40 LEU A HD23 3  
ATOM 2695  N N    . LEU A 1 41 ? -41.529 -30.100 -30.560 1.00 0.00 ? 41 LEU A N    3  
ATOM 2696  C CA   . LEU A 1 41 ? -40.428 -30.859 -31.149 1.00 0.00 ? 41 LEU A CA   3  
ATOM 2697  C C    . LEU A 1 41 ? -40.134 -32.128 -30.347 1.00 0.00 ? 41 LEU A C    3  
ATOM 2698  O O    . LEU A 1 41 ? -39.743 -33.141 -30.916 1.00 0.00 ? 41 LEU A O    3  
ATOM 2699  C CB   . LEU A 1 41 ? -39.168 -29.990 -31.199 1.00 0.00 ? 41 LEU A CB   3  
ATOM 2700  C CG   . LEU A 1 41 ? -39.353 -28.862 -32.222 1.00 0.00 ? 41 LEU A CG   3  
ATOM 2701  C CD1  . LEU A 1 41 ? -38.180 -27.886 -32.123 1.00 0.00 ? 41 LEU A CD1  3  
ATOM 2702  C CD2  . LEU A 1 41 ? -39.419 -29.435 -33.644 1.00 0.00 ? 41 LEU A CD2  3  
ATOM 2703  H H    . LEU A 1 41 ? -41.399 -29.160 -30.346 1.00 0.00 ? 41 LEU A H    3  
ATOM 2704  H HA   . LEU A 1 41 ? -40.697 -31.140 -32.156 1.00 0.00 ? 41 LEU A HA   3  
ATOM 2705  H HB2  . LEU A 1 41 ? -38.993 -29.560 -30.222 1.00 0.00 ? 41 LEU A HB2  3  
ATOM 2706  H HB3  . LEU A 1 41 ? -38.319 -30.595 -31.478 1.00 0.00 ? 41 LEU A HB3  3  
ATOM 2707  H HG   . LEU A 1 41 ? -40.272 -28.334 -32.006 1.00 0.00 ? 41 LEU A HG   3  
ATOM 2708  H HD11 . LEU A 1 41 ? -38.530 -26.937 -31.744 1.00 0.00 ? 41 LEU A HD11 3  
ATOM 2709  H HD12 . LEU A 1 41 ? -37.745 -27.745 -33.102 1.00 0.00 ? 41 LEU A HD12 3  
ATOM 2710  H HD13 . LEU A 1 41 ? -37.434 -28.287 -31.453 1.00 0.00 ? 41 LEU A HD13 3  
ATOM 2711  H HD21 . LEU A 1 41 ? -39.034 -30.444 -33.652 1.00 0.00 ? 41 LEU A HD21 3  
ATOM 2712  H HD22 . LEU A 1 41 ? -38.824 -28.820 -34.305 1.00 0.00 ? 41 LEU A HD22 3  
ATOM 2713  H HD23 . LEU A 1 41 ? -40.444 -29.437 -33.984 1.00 0.00 ? 41 LEU A HD23 3  
ATOM 2714  N N    . ILE A 1 42 ? -40.316 -32.061 -29.034 1.00 0.00 ? 42 ILE A N    3  
ATOM 2715  C CA   . ILE A 1 42 ? -40.056 -33.220 -28.177 1.00 0.00 ? 42 ILE A CA   3  
ATOM 2716  C C    . ILE A 1 42 ? -40.956 -34.392 -28.583 1.00 0.00 ? 42 ILE A C    3  
ATOM 2717  O O    . ILE A 1 42 ? -40.509 -35.543 -28.646 1.00 0.00 ? 42 ILE A O    3  
ATOM 2718  C CB   . ILE A 1 42 ? -40.308 -32.868 -26.705 1.00 0.00 ? 42 ILE A CB   3  
ATOM 2719  C CG1  . ILE A 1 42 ? -39.320 -31.782 -26.238 1.00 0.00 ? 42 ILE A CG1  3  
ATOM 2720  C CG2  . ILE A 1 42 ? -40.157 -34.123 -25.839 1.00 0.00 ? 42 ILE A CG2  3  
ATOM 2721  C CD1  . ILE A 1 42 ? -37.862 -32.237 -26.412 1.00 0.00 ? 42 ILE A CD1  3  
ATOM 2722  H H    . ILE A 1 42 ? -40.625 -31.221 -28.647 1.00 0.00 ? 42 ILE A H    3  
ATOM 2723  H HA   . ILE A 1 42 ? -39.027 -33.520 -28.298 1.00 0.00 ? 42 ILE A HA   3  
ATOM 2724  H HB   . ILE A 1 42 ? -41.317 -32.499 -26.604 1.00 0.00 ? 42 ILE A HB   3  
ATOM 2725  H HG12 . ILE A 1 42 ? -39.481 -30.886 -26.818 1.00 0.00 ? 42 ILE A HG12 3  
ATOM 2726  H HG13 . ILE A 1 42 ? -39.501 -31.565 -25.196 1.00 0.00 ? 42 ILE A HG13 3  
ATOM 2727  H HG21 . ILE A 1 42 ? -39.253 -34.643 -26.115 1.00 0.00 ? 42 ILE A HG21 3  
ATOM 2728  H HG22 . ILE A 1 42 ? -41.008 -34.771 -25.993 1.00 0.00 ? 42 ILE A HG22 3  
ATOM 2729  H HG23 . ILE A 1 42 ? -40.106 -33.838 -24.799 1.00 0.00 ? 42 ILE A HG23 3  
ATOM 2730  H HD11 . ILE A 1 42 ? -37.246 -31.752 -25.670 1.00 0.00 ? 42 ILE A HD11 3  
ATOM 2731  H HD12 . ILE A 1 42 ? -37.516 -31.964 -27.398 1.00 0.00 ? 42 ILE A HD12 3  
ATOM 2732  H HD13 . ILE A 1 42 ? -37.789 -33.307 -26.293 1.00 0.00 ? 42 ILE A HD13 3  
ATOM 2733  N N    . LEU A 1 43 ? -42.224 -34.100 -28.851 1.00 0.00 ? 43 LEU A N    3  
ATOM 2734  C CA   . LEU A 1 43 ? -43.167 -35.147 -29.236 1.00 0.00 ? 43 LEU A CA   3  
ATOM 2735  C C    . LEU A 1 43 ? -42.686 -35.846 -30.504 1.00 0.00 ? 43 LEU A C    3  
ATOM 2736  O O    . LEU A 1 43 ? -42.811 -37.065 -30.640 1.00 0.00 ? 43 LEU A O    3  
ATOM 2737  C CB   . LEU A 1 43 ? -44.550 -34.538 -29.481 1.00 0.00 ? 43 LEU A CB   3  
ATOM 2738  C CG   . LEU A 1 43 ? -45.150 -34.057 -28.153 1.00 0.00 ? 43 LEU A CG   3  
ATOM 2739  C CD1  . LEU A 1 43 ? -46.434 -33.274 -28.429 1.00 0.00 ? 43 LEU A CD1  3  
ATOM 2740  C CD2  . LEU A 1 43 ? -45.469 -35.254 -27.247 1.00 0.00 ? 43 LEU A CD2  3  
ATOM 2741  H H    . LEU A 1 43 ? -42.534 -33.179 -28.774 1.00 0.00 ? 43 LEU A H    3  
ATOM 2742  H HA   . LEU A 1 43 ? -43.236 -35.870 -28.440 1.00 0.00 ? 43 LEU A HA   3  
ATOM 2743  H HB2  . LEU A 1 43 ? -44.455 -33.698 -30.154 1.00 0.00 ? 43 LEU A HB2  3  
ATOM 2744  H HB3  . LEU A 1 43 ? -45.200 -35.278 -29.924 1.00 0.00 ? 43 LEU A HB3  3  
ATOM 2745  H HG   . LEU A 1 43 ? -44.439 -33.410 -27.657 1.00 0.00 ? 43 LEU A HG   3  
ATOM 2746  H HD11 . LEU A 1 43 ? -47.195 -33.574 -27.723 1.00 0.00 ? 43 LEU A HD11 3  
ATOM 2747  H HD12 . LEU A 1 43 ? -46.772 -33.480 -29.432 1.00 0.00 ? 43 LEU A HD12 3  
ATOM 2748  H HD13 . LEU A 1 43 ? -46.240 -32.217 -28.322 1.00 0.00 ? 43 LEU A HD13 3  
ATOM 2749  H HD21 . LEU A 1 43 ? -46.438 -35.109 -26.791 1.00 0.00 ? 43 LEU A HD21 3  
ATOM 2750  H HD22 . LEU A 1 43 ? -44.718 -35.329 -26.474 1.00 0.00 ? 43 LEU A HD22 3  
ATOM 2751  H HD23 . LEU A 1 43 ? -45.478 -36.164 -27.826 1.00 0.00 ? 43 LEU A HD23 3  
ATOM 2752  N N    . LEU A 1 44 ? -42.144 -35.069 -31.434 1.00 0.00 ? 44 LEU A N    3  
ATOM 2753  C CA   . LEU A 1 44 ? -41.653 -35.614 -32.695 1.00 0.00 ? 44 LEU A CA   3  
ATOM 2754  C C    . LEU A 1 44 ? -40.568 -36.657 -32.441 1.00 0.00 ? 44 LEU A C    3  
ATOM 2755  O O    . LEU A 1 44 ? -40.468 -37.644 -33.170 1.00 0.00 ? 44 LEU A O    3  
ATOM 2756  C CB   . LEU A 1 44 ? -41.096 -34.478 -33.565 1.00 0.00 ? 44 LEU A CB   3  
ATOM 2757  C CG   . LEU A 1 44 ? -40.598 -35.027 -34.909 1.00 0.00 ? 44 LEU A CG   3  
ATOM 2758  C CD1  . LEU A 1 44 ? -41.755 -35.677 -35.669 1.00 0.00 ? 44 LEU A CD1  3  
ATOM 2759  C CD2  . LEU A 1 44 ? -40.034 -33.873 -35.743 1.00 0.00 ? 44 LEU A CD2  3  
ATOM 2760  H H    . LEU A 1 44 ? -42.091 -34.106 -31.290 1.00 0.00 ? 44 LEU A H    3  
ATOM 2761  H HA   . LEU A 1 44 ? -42.476 -36.082 -33.213 1.00 0.00 ? 44 LEU A HA   3  
ATOM 2762  H HB2  . LEU A 1 44 ? -41.874 -33.751 -33.742 1.00 0.00 ? 44 LEU A HB2  3  
ATOM 2763  H HB3  . LEU A 1 44 ? -40.275 -34.005 -33.048 1.00 0.00 ? 44 LEU A HB3  3  
ATOM 2764  H HG   . LEU A 1 44 ? -39.822 -35.758 -34.740 1.00 0.00 ? 44 LEU A HG   3  
ATOM 2765  H HD11 . LEU A 1 44 ? -41.570 -35.612 -36.731 1.00 0.00 ? 44 LEU A HD11 3  
ATOM 2766  H HD12 . LEU A 1 44 ? -42.675 -35.164 -35.432 1.00 0.00 ? 44 LEU A HD12 3  
ATOM 2767  H HD13 . LEU A 1 44 ? -41.836 -36.715 -35.381 1.00 0.00 ? 44 LEU A HD13 3  
ATOM 2768  H HD21 . LEU A 1 44 ? -39.041 -33.629 -35.397 1.00 0.00 ? 44 LEU A HD21 3  
ATOM 2769  H HD22 . LEU A 1 44 ? -40.674 -33.009 -35.640 1.00 0.00 ? 44 LEU A HD22 3  
ATOM 2770  H HD23 . LEU A 1 44 ? -39.990 -34.168 -36.781 1.00 0.00 ? 44 LEU A HD23 3  
ATOM 2771  N N    . SER A 1 45 ? -39.757 -36.433 -31.412 1.00 0.00 ? 45 SER A N    3  
ATOM 2772  C CA   . SER A 1 45 ? -38.685 -37.365 -31.085 1.00 0.00 ? 45 SER A CA   3  
ATOM 2773  C C    . SER A 1 45 ? -39.260 -38.744 -30.795 1.00 0.00 ? 45 SER A C    3  
ATOM 2774  O O    . SER A 1 45 ? -38.699 -39.755 -31.212 1.00 0.00 ? 45 SER A O    3  
ATOM 2775  C CB   . SER A 1 45 ? -37.901 -36.869 -29.869 1.00 0.00 ? 45 SER A CB   3  
ATOM 2776  O OG   . SER A 1 45 ? -36.857 -37.789 -29.578 1.00 0.00 ? 45 SER A OG   3  
ATOM 2777  H H    . SER A 1 45 ? -39.882 -35.639 -30.862 1.00 0.00 ? 45 SER A H    3  
ATOM 2778  H HA   . SER A 1 45 ? -38.014 -37.435 -31.928 1.00 0.00 ? 45 SER A HA   3  
ATOM 2779  H HB2  . SER A 1 45 ? -37.474 -35.903 -30.081 1.00 0.00 ? 45 SER A HB2  3  
ATOM 2780  H HB3  . SER A 1 45 ? -38.566 -36.786 -29.022 1.00 0.00 ? 45 SER A HB3  3  
ATOM 2781  H HG   . SER A 1 45 ? -36.038 -37.431 -29.931 1.00 0.00 ? 45 SER A HG   3  
ATOM 2782  N N    . ARG A 1 46 ? -40.384 -38.788 -30.086 1.00 0.00 ? 46 ARG A N    3  
ATOM 2783  C CA   . ARG A 1 46 ? -41.008 -40.071 -29.770 1.00 0.00 ? 46 ARG A CA   3  
ATOM 2784  C C    . ARG A 1 46 ? -41.351 -40.820 -31.054 1.00 0.00 ? 46 ARG A C    3  
ATOM 2785  O O    . ARG A 1 46 ? -41.203 -42.040 -31.130 1.00 0.00 ? 46 ARG A O    3  
ATOM 2786  C CB   . ARG A 1 46 ? -42.284 -39.865 -28.944 1.00 0.00 ? 46 ARG A CB   3  
ATOM 2787  C CG   . ARG A 1 46 ? -42.895 -41.230 -28.590 1.00 0.00 ? 46 ARG A CG   3  
ATOM 2788  C CD   . ARG A 1 46 ? -44.094 -41.522 -29.503 1.00 0.00 ? 46 ARG A CD   3  
ATOM 2789  N NE   . ARG A 1 46 ? -44.494 -42.924 -29.382 1.00 0.00 ? 46 ARG A NE   3  
ATOM 2790  C CZ   . ARG A 1 46 ? -45.334 -43.319 -28.431 1.00 0.00 ? 46 ARG A CZ   3  
ATOM 2791  N NH1  . ARG A 1 46 ? -45.811 -42.456 -27.577 1.00 0.00 ? 46 ARG A NH1  3  
ATOM 2792  N NH2  . ARG A 1 46 ? -45.682 -44.575 -28.350 1.00 0.00 ? 46 ARG A NH2  3  
ATOM 2793  H H    . ARG A 1 46 ? -40.799 -37.959 -29.774 1.00 0.00 ? 46 ARG A H    3  
ATOM 2794  H HA   . ARG A 1 46 ? -40.311 -40.663 -29.194 1.00 0.00 ? 46 ARG A HA   3  
ATOM 2795  H HB2  . ARG A 1 46 ? -42.041 -39.334 -28.036 1.00 0.00 ? 46 ARG A HB2  3  
ATOM 2796  H HB3  . ARG A 1 46 ? -42.996 -39.293 -29.518 1.00 0.00 ? 46 ARG A HB3  3  
ATOM 2797  H HG2  . ARG A 1 46 ? -42.152 -42.003 -28.719 1.00 0.00 ? 46 ARG A HG2  3  
ATOM 2798  H HG3  . ARG A 1 46 ? -43.227 -41.219 -27.563 1.00 0.00 ? 46 ARG A HG3  3  
ATOM 2799  H HD2  . ARG A 1 46 ? -44.921 -40.891 -29.217 1.00 0.00 ? 46 ARG A HD2  3  
ATOM 2800  H HD3  . ARG A 1 46 ? -43.827 -41.313 -30.528 1.00 0.00 ? 46 ARG A HD3  3  
ATOM 2801  H HE   . ARG A 1 46 ? -44.140 -43.581 -30.016 1.00 0.00 ? 46 ARG A HE   3  
ATOM 2802  H HH11 . ARG A 1 46 ? -45.544 -41.494 -27.637 1.00 0.00 ? 46 ARG A HH11 3  
ATOM 2803  H HH12 . ARG A 1 46 ? -46.442 -42.755 -26.861 1.00 0.00 ? 46 ARG A HH12 3  
ATOM 2804  H HH21 . ARG A 1 46 ? -45.317 -45.238 -29.004 1.00 0.00 ? 46 ARG A HH21 3  
ATOM 2805  H HH22 . ARG A 1 46 ? -46.314 -44.874 -27.634 1.00 0.00 ? 46 ARG A HH22 3  
ATOM 2806  N N    . ARG A 1 47 ? -41.817 -40.083 -32.057 1.00 0.00 ? 47 ARG A N    3  
ATOM 2807  C CA   . ARG A 1 47 ? -42.187 -40.688 -33.333 1.00 0.00 ? 47 ARG A CA   3  
ATOM 2808  C C    . ARG A 1 47 ? -41.000 -41.415 -33.959 1.00 0.00 ? 47 ARG A C    3  
ATOM 2809  O O    . ARG A 1 47 ? -41.175 -42.421 -34.646 1.00 0.00 ? 47 ARG A O    3  
ATOM 2810  C CB   . ARG A 1 47 ? -42.709 -39.629 -34.309 1.00 0.00 ? 47 ARG A CB   3  
ATOM 2811  C CG   . ARG A 1 47 ? -43.185 -40.319 -35.596 1.00 0.00 ? 47 ARG A CG   3  
ATOM 2812  C CD   . ARG A 1 47 ? -43.767 -39.286 -36.558 1.00 0.00 ? 47 ARG A CD   3  
ATOM 2813  N NE   . ARG A 1 47 ? -44.206 -39.940 -37.790 1.00 0.00 ? 47 ARG A NE   3  
ATOM 2814  C CZ   . ARG A 1 47 ? -44.744 -39.241 -38.783 1.00 0.00 ? 47 ARG A CZ   3  
ATOM 2815  N NH1  . ARG A 1 47 ? -44.883 -37.947 -38.671 1.00 0.00 ? 47 ARG A NH1  3  
ATOM 2816  N NH2  . ARG A 1 47 ? -45.130 -39.846 -39.873 1.00 0.00 ? 47 ARG A NH2  3  
ATOM 2817  H H    . ARG A 1 47 ? -41.915 -39.120 -31.937 1.00 0.00 ? 47 ARG A H    3  
ATOM 2818  H HA   . ARG A 1 47 ? -42.974 -41.408 -33.155 1.00 0.00 ? 47 ARG A HA   3  
ATOM 2819  H HB2  . ARG A 1 47 ? -43.534 -39.097 -33.857 1.00 0.00 ? 47 ARG A HB2  3  
ATOM 2820  H HB3  . ARG A 1 47 ? -41.917 -38.936 -34.547 1.00 0.00 ? 47 ARG A HB3  3  
ATOM 2821  H HG2  . ARG A 1 47 ? -42.352 -40.816 -36.070 1.00 0.00 ? 47 ARG A HG2  3  
ATOM 2822  H HG3  . ARG A 1 47 ? -43.945 -41.047 -35.352 1.00 0.00 ? 47 ARG A HG3  3  
ATOM 2823  H HD2  . ARG A 1 47 ? -44.609 -38.797 -36.095 1.00 0.00 ? 47 ARG A HD2  3  
ATOM 2824  H HD3  . ARG A 1 47 ? -43.011 -38.550 -36.793 1.00 0.00 ? 47 ARG A HD3  3  
ATOM 2825  H HE   . ARG A 1 47 ? -44.105 -40.910 -37.882 1.00 0.00 ? 47 ARG A HE   3  
ATOM 2826  H HH11 . ARG A 1 47 ? -44.586 -37.483 -37.837 1.00 0.00 ? 47 ARG A HH11 3  
ATOM 2827  H HH12 . ARG A 1 47 ? -45.287 -37.422 -39.420 1.00 0.00 ? 47 ARG A HH12 3  
ATOM 2828  H HH21 . ARG A 1 47 ? -45.023 -40.836 -39.961 1.00 0.00 ? 47 ARG A HH21 3  
ATOM 2829  H HH22 . ARG A 1 47 ? -45.534 -39.318 -40.622 1.00 0.00 ? 47 ARG A HH22 3  
ATOM 2830  N N    . PHE A 1 48 ? -39.792 -40.909 -33.725 1.00 0.00 ? 48 PHE A N    3  
ATOM 2831  C CA   . PHE A 1 48 ? -38.606 -41.543 -34.287 1.00 0.00 ? 48 PHE A CA   3  
ATOM 2832  C C    . PHE A 1 48 ? -38.506 -42.984 -33.798 1.00 0.00 ? 48 PHE A C    3  
ATOM 2833  O O    . PHE A 1 48 ? -38.319 -43.906 -34.590 1.00 0.00 ? 48 PHE A O    3  
ATOM 2834  C CB   . PHE A 1 48 ? -37.347 -40.775 -33.882 1.00 0.00 ? 48 PHE A CB   3  
ATOM 2835  C CG   . PHE A 1 48 ? -36.129 -41.486 -34.420 1.00 0.00 ? 48 PHE A CG   3  
ATOM 2836  C CD1  . PHE A 1 48 ? -35.778 -41.352 -35.768 1.00 0.00 ? 48 PHE A CD1  3  
ATOM 2837  C CD2  . PHE A 1 48 ? -35.351 -42.281 -33.569 1.00 0.00 ? 48 PHE A CD2  3  
ATOM 2838  C CE1  . PHE A 1 48 ? -34.650 -42.011 -36.267 1.00 0.00 ? 48 PHE A CE1  3  
ATOM 2839  C CE2  . PHE A 1 48 ? -34.222 -42.942 -34.069 1.00 0.00 ? 48 PHE A CE2  3  
ATOM 2840  C CZ   . PHE A 1 48 ? -33.872 -42.808 -35.418 1.00 0.00 ? 48 PHE A CZ   3  
ATOM 2841  H H    . PHE A 1 48 ? -39.698 -40.121 -33.157 1.00 0.00 ? 48 PHE A H    3  
ATOM 2842  H HA   . PHE A 1 48 ? -38.685 -41.544 -35.363 1.00 0.00 ? 48 PHE A HA   3  
ATOM 2843  H HB2  . PHE A 1 48 ? -37.390 -39.774 -34.288 1.00 0.00 ? 48 PHE A HB2  3  
ATOM 2844  H HB3  . PHE A 1 48 ? -37.286 -40.725 -32.805 1.00 0.00 ? 48 PHE A HB3  3  
ATOM 2845  H HD1  . PHE A 1 48 ? -36.380 -40.738 -36.424 1.00 0.00 ? 48 PHE A HD1  3  
ATOM 2846  H HD2  . PHE A 1 48 ? -35.621 -42.386 -32.530 1.00 0.00 ? 48 PHE A HD2  3  
ATOM 2847  H HE1  . PHE A 1 48 ? -34.380 -41.909 -37.308 1.00 0.00 ? 48 PHE A HE1  3  
ATOM 2848  H HE2  . PHE A 1 48 ? -33.621 -43.555 -33.413 1.00 0.00 ? 48 PHE A HE2  3  
ATOM 2849  H HZ   . PHE A 1 48 ? -33.001 -43.317 -35.803 1.00 0.00 ? 48 PHE A HZ   3  
ATOM 2850  N N    . ARG A 1 49 ? -38.650 -43.172 -32.490 1.00 0.00 ? 49 ARG A N    3  
ATOM 2851  C CA   . ARG A 1 49 ? -38.589 -44.521 -31.941 1.00 0.00 ? 49 ARG A CA   3  
ATOM 2852  C C    . ARG A 1 49 ? -39.776 -45.313 -32.478 1.00 0.00 ? 49 ARG A C    3  
ATOM 2853  O O    . ARG A 1 49 ? -39.611 -46.375 -33.079 1.00 0.00 ? 49 ARG A O    3  
ATOM 2854  C CB   . ARG A 1 49 ? -38.637 -44.471 -30.411 1.00 0.00 ? 49 ARG A CB   3  
ATOM 2855  C CG   . ARG A 1 49 ? -37.867 -45.659 -29.827 1.00 0.00 ? 49 ARG A CG   3  
ATOM 2856  C CD   . ARG A 1 49 ? -38.527 -46.967 -30.267 1.00 0.00 ? 49 ARG A CD   3  
ATOM 2857  N NE   . ARG A 1 49 ? -38.108 -48.060 -29.395 1.00 0.00 ? 49 ARG A NE   3  
ATOM 2858  C CZ   . ARG A 1 49 ? -38.475 -49.312 -29.641 1.00 0.00 ? 49 ARG A CZ   3  
ATOM 2859  N NH1  . ARG A 1 49 ? -39.218 -49.583 -30.678 1.00 0.00 ? 49 ARG A NH1  3  
ATOM 2860  N NH2  . ARG A 1 49 ? -38.091 -50.272 -28.846 1.00 0.00 ? 49 ARG A NH2  3  
ATOM 2861  H H    . ARG A 1 49 ? -38.810 -42.390 -31.921 1.00 0.00 ? 49 ARG A H    3  
ATOM 2862  H HA   . ARG A 1 49 ? -37.670 -44.993 -32.258 1.00 0.00 ? 49 ARG A HA   3  
ATOM 2863  H HB2  . ARG A 1 49 ? -38.190 -43.550 -30.067 1.00 0.00 ? 49 ARG A HB2  3  
ATOM 2864  H HB3  . ARG A 1 49 ? -39.665 -44.516 -30.082 1.00 0.00 ? 49 ARG A HB3  3  
ATOM 2865  H HG2  . ARG A 1 49 ? -36.845 -45.634 -30.175 1.00 0.00 ? 49 ARG A HG2  3  
ATOM 2866  H HG3  . ARG A 1 49 ? -37.881 -45.599 -28.749 1.00 0.00 ? 49 ARG A HG3  3  
ATOM 2867  H HD2  . ARG A 1 49 ? -39.598 -46.861 -30.214 1.00 0.00 ? 49 ARG A HD2  3  
ATOM 2868  H HD3  . ARG A 1 49 ? -38.238 -47.186 -31.285 1.00 0.00 ? 49 ARG A HD3  3  
ATOM 2869  H HE   . ARG A 1 49 ? -37.549 -47.865 -28.616 1.00 0.00 ? 49 ARG A HE   3  
ATOM 2870  H HH11 . ARG A 1 49 ? -39.513 -48.847 -31.289 1.00 0.00 ? 49 ARG A HH11 3  
ATOM 2871  H HH12 . ARG A 1 49 ? -39.495 -50.527 -30.864 1.00 0.00 ? 49 ARG A HH12 3  
ATOM 2872  H HH21 . ARG A 1 49 ? -37.520 -50.065 -28.051 1.00 0.00 ? 49 ARG A HH21 3  
ATOM 2873  H HH22 . ARG A 1 49 ? -38.367 -51.215 -29.031 1.00 0.00 ? 49 ARG A HH22 3  
ATOM 2874  N N    . SER A 1 50 ? -40.975 -44.777 -32.263 1.00 0.00 ? 50 SER A N    3  
ATOM 2875  C CA   . SER A 1 50 ? -42.197 -45.421 -32.733 1.00 0.00 ? 50 SER A CA   3  
ATOM 2876  C C    . SER A 1 50 ? -42.567 -46.607 -31.845 1.00 0.00 ? 50 SER A C    3  
ATOM 2877  O O    . SER A 1 50 ? -41.834 -46.959 -30.921 1.00 0.00 ? 50 SER A O    3  
ATOM 2878  C CB   . SER A 1 50 ? -42.014 -45.901 -34.172 1.00 0.00 ? 50 SER A CB   3  
ATOM 2879  O OG   . SER A 1 50 ? -41.090 -45.050 -34.836 1.00 0.00 ? 50 SER A OG   3  
ATOM 2880  H H    . SER A 1 50 ? -41.038 -43.949 -31.739 1.00 0.00 ? 50 SER A H    3  
ATOM 2881  H HA   . SER A 1 50 ? -43.003 -44.703 -32.707 1.00 0.00 ? 50 SER A HA   3  
ATOM 2882  H HB2  . SER A 1 50 ? -41.630 -46.908 -34.172 1.00 0.00 ? 50 SER A HB2  3  
ATOM 2883  H HB3  . SER A 1 50 ? -42.968 -45.882 -34.680 1.00 0.00 ? 50 SER A HB3  3  
ATOM 2884  H HG   . SER A 1 50 ? -41.052 -44.220 -34.356 1.00 0.00 ? 50 SER A HG   3  
ATOM 2885  N N    . GLY A 1 51 ? -43.714 -47.213 -32.136 1.00 0.00 ? 51 GLY A N    3  
ATOM 2886  C CA   . GLY A 1 51 ? -44.190 -48.361 -31.367 1.00 0.00 ? 51 GLY A CA   3  
ATOM 2887  C C    . GLY A 1 51 ? -45.451 -48.010 -30.582 1.00 0.00 ? 51 GLY A C    3  
ATOM 2888  O O    . GLY A 1 51 ? -45.479 -47.034 -29.834 1.00 0.00 ? 51 GLY A O    3  
ATOM 2889  H H    . GLY A 1 51 ? -44.255 -46.882 -32.882 1.00 0.00 ? 51 GLY A H    3  
ATOM 2890  H HA2  . GLY A 1 51 ? -44.406 -49.175 -32.044 1.00 0.00 ? 51 GLY A HA2  3  
ATOM 2891  H HA3  . GLY A 1 51 ? -43.420 -48.670 -30.675 1.00 0.00 ? 51 GLY A HA3  3  
ATOM 2892  N N    . GLY A 1 52 ? -46.497 -48.809 -30.777 1.00 0.00 ? 52 GLY A N    3  
ATOM 2893  C CA   . GLY A 1 52 ? -47.767 -48.569 -30.099 1.00 0.00 ? 52 GLY A CA   3  
ATOM 2894  C C    . GLY A 1 52 ? -48.659 -47.668 -30.945 1.00 0.00 ? 52 GLY A C    3  
ATOM 2895  O O    . GLY A 1 52 ? -49.769 -47.316 -30.546 1.00 0.00 ? 52 GLY A O    3  
ATOM 2896  H H    . GLY A 1 52 ? -46.417 -49.556 -31.404 1.00 0.00 ? 52 GLY A H    3  
ATOM 2897  H HA2  . GLY A 1 52 ? -48.265 -49.514 -29.934 1.00 0.00 ? 52 GLY A HA2  3  
ATOM 2898  H HA3  . GLY A 1 52 ? -47.581 -48.092 -29.148 1.00 0.00 ? 52 GLY A HA3  3  
ATOM 2899  N N    . ASN A 1 53 ? -48.160 -47.306 -32.123 1.00 0.00 ? 53 ASN A N    3  
ATOM 2900  C CA   . ASN A 1 53 ? -48.908 -46.454 -33.038 1.00 0.00 ? 53 ASN A CA   3  
ATOM 2901  C C    . ASN A 1 53 ? -49.538 -47.298 -34.141 1.00 0.00 ? 53 ASN A C    3  
ATOM 2902  O O    . ASN A 1 53 ? -50.050 -46.769 -35.129 1.00 0.00 ? 53 ASN A O    3  
ATOM 2903  C CB   . ASN A 1 53 ? -47.979 -45.408 -33.656 1.00 0.00 ? 53 ASN A CB   3  
ATOM 2904  C CG   . ASN A 1 53 ? -47.384 -44.528 -32.564 1.00 0.00 ? 53 ASN A CG   3  
ATOM 2905  O OD1  . ASN A 1 53 ? -46.163 -44.469 -32.410 1.00 0.00 ? 53 ASN A OD1  3  
ATOM 2906  N ND2  . ASN A 1 53 ? -48.175 -43.836 -31.792 1.00 0.00 ? 53 ASN A ND2  3  
ATOM 2907  H H    . ASN A 1 53 ? -47.271 -47.630 -32.379 1.00 0.00 ? 53 ASN A H    3  
ATOM 2908  H HA   . ASN A 1 53 ? -49.690 -45.949 -32.491 1.00 0.00 ? 53 ASN A HA   3  
ATOM 2909  H HB2  . ASN A 1 53 ? -47.183 -45.907 -34.190 1.00 0.00 ? 53 ASN A HB2  3  
ATOM 2910  H HB3  . ASN A 1 53 ? -48.541 -44.793 -34.344 1.00 0.00 ? 53 ASN A HB3  3  
ATOM 2911  H HD21 . ASN A 1 53 ? -49.147 -43.885 -31.917 1.00 0.00 ? 53 ASN A HD21 3  
ATOM 2912  H HD22 . ASN A 1 53 ? -47.800 -43.269 -31.086 1.00 0.00 ? 53 ASN A HD22 3  
ATOM 2913  N N    . LYS A 1 54 ? -49.493 -48.613 -33.962 1.00 0.00 ? 54 LYS A N    3  
ATOM 2914  C CA   . LYS A 1 54 ? -50.059 -49.533 -34.942 1.00 0.00 ? 54 LYS A CA   3  
ATOM 2915  C C    . LYS A 1 54 ? -51.467 -49.948 -34.528 1.00 0.00 ? 54 LYS A C    3  
ATOM 2916  O O    . LYS A 1 54 ? -52.129 -50.713 -35.230 1.00 0.00 ? 54 LYS A O    3  
ATOM 2917  C CB   . LYS A 1 54 ? -49.178 -50.783 -35.056 1.00 0.00 ? 54 LYS A CB   3  
ATOM 2918  C CG   . LYS A 1 54 ? -47.727 -50.409 -35.403 1.00 0.00 ? 54 LYS A CG   3  
ATOM 2919  C CD   . LYS A 1 54 ? -47.632 -49.844 -36.827 1.00 0.00 ? 54 LYS A CD   3  
ATOM 2920  C CE   . LYS A 1 54 ? -46.158 -49.695 -37.209 1.00 0.00 ? 54 LYS A CE   3  
ATOM 2921  N NZ   . LYS A 1 54 ? -46.055 -49.143 -38.589 1.00 0.00 ? 54 LYS A NZ   3  
ATOM 2922  H H    . LYS A 1 54 ? -49.075 -48.969 -33.149 1.00 0.00 ? 54 LYS A H    3  
ATOM 2923  H HA   . LYS A 1 54 ? -50.113 -49.045 -35.899 1.00 0.00 ? 54 LYS A HA   3  
ATOM 2924  H HB2  . LYS A 1 54 ? -49.192 -51.313 -34.114 1.00 0.00 ? 54 LYS A HB2  3  
ATOM 2925  H HB3  . LYS A 1 54 ? -49.574 -51.426 -35.829 1.00 0.00 ? 54 LYS A HB3  3  
ATOM 2926  H HG2  . LYS A 1 54 ? -47.376 -49.665 -34.703 1.00 0.00 ? 54 LYS A HG2  3  
ATOM 2927  H HG3  . LYS A 1 54 ? -47.107 -51.289 -35.327 1.00 0.00 ? 54 LYS A HG3  3  
ATOM 2928  H HD2  . LYS A 1 54 ? -48.120 -50.515 -37.517 1.00 0.00 ? 54 LYS A HD2  3  
ATOM 2929  H HD3  . LYS A 1 54 ? -48.100 -48.876 -36.870 1.00 0.00 ? 54 LYS A HD3  3  
ATOM 2930  H HE2  . LYS A 1 54 ? -45.670 -49.026 -36.517 1.00 0.00 ? 54 LYS A HE2  3  
ATOM 2931  H HE3  . LYS A 1 54 ? -45.677 -50.663 -37.172 1.00 0.00 ? 54 LYS A HE3  3  
ATOM 2932  H HZ1  . LYS A 1 54 ? -45.183 -48.582 -38.676 1.00 0.00 ? 54 LYS A HZ1  3  
ATOM 2933  H HZ2  . LYS A 1 54 ? -46.879 -48.536 -38.780 1.00 0.00 ? 54 LYS A HZ2  3  
ATOM 2934  H HZ3  . LYS A 1 54 ? -46.033 -49.924 -39.275 1.00 0.00 ? 54 LYS A HZ3  3  
ATOM 2935  N N    . LYS A 1 55 ? -51.925 -49.441 -33.389 1.00 0.00 ? 55 LYS A N    3  
ATOM 2936  C CA   . LYS A 1 55 ? -53.261 -49.774 -32.908 1.00 0.00 ? 55 LYS A CA   3  
ATOM 2937  C C    . LYS A 1 55 ? -54.315 -49.291 -33.899 1.00 0.00 ? 55 LYS A C    3  
ATOM 2938  O O    . LYS A 1 55 ? -55.267 -50.007 -34.208 1.00 0.00 ? 55 LYS A O    3  
ATOM 2939  C CB   . LYS A 1 55 ? -53.498 -49.129 -31.537 1.00 0.00 ? 55 LYS A CB   3  
ATOM 2940  C CG   . LYS A 1 55 ? -54.889 -49.511 -31.016 1.00 0.00 ? 55 LYS A CG   3  
ATOM 2941  C CD   . LYS A 1 55 ? -55.095 -48.908 -29.626 1.00 0.00 ? 55 LYS A CD   3  
ATOM 2942  C CE   . LYS A 1 55 ? -56.506 -49.237 -29.131 1.00 0.00 ? 55 LYS A CE   3  
ATOM 2943  N NZ   . LYS A 1 55 ? -56.657 -50.712 -29.006 1.00 0.00 ? 55 LYS A NZ   3  
ATOM 2944  H H    . LYS A 1 55 ? -51.360 -48.830 -32.871 1.00 0.00 ? 55 LYS A H    3  
ATOM 2945  H HA   . LYS A 1 55 ? -53.339 -50.847 -32.806 1.00 0.00 ? 55 LYS A HA   3  
ATOM 2946  H HB2  . LYS A 1 55 ? -52.747 -49.475 -30.844 1.00 0.00 ? 55 LYS A HB2  3  
ATOM 2947  H HB3  . LYS A 1 55 ? -53.435 -48.056 -31.631 1.00 0.00 ? 55 LYS A HB3  3  
ATOM 2948  H HG2  . LYS A 1 55 ? -55.645 -49.131 -31.687 1.00 0.00 ? 55 LYS A HG2  3  
ATOM 2949  H HG3  . LYS A 1 55 ? -54.968 -50.587 -30.955 1.00 0.00 ? 55 LYS A HG3  3  
ATOM 2950  H HD2  . LYS A 1 55 ? -54.368 -49.322 -28.942 1.00 0.00 ? 55 LYS A HD2  3  
ATOM 2951  H HD3  . LYS A 1 55 ? -54.974 -47.837 -29.676 1.00 0.00 ? 55 LYS A HD3  3  
ATOM 2952  H HE2  . LYS A 1 55 ? -56.666 -48.775 -28.169 1.00 0.00 ? 55 LYS A HE2  3  
ATOM 2953  H HE3  . LYS A 1 55 ? -57.231 -48.858 -29.836 1.00 0.00 ? 55 LYS A HE3  3  
ATOM 2954  H HZ1  . LYS A 1 55 ? -57.488 -51.024 -29.549 1.00 0.00 ? 55 LYS A HZ1  3  
ATOM 2955  H HZ2  . LYS A 1 55 ? -56.781 -50.964 -28.004 1.00 0.00 ? 55 LYS A HZ2  3  
ATOM 2956  H HZ3  . LYS A 1 55 ? -55.808 -51.182 -29.380 1.00 0.00 ? 55 LYS A HZ3  3  
ATOM 2957  N N    . ARG A 1 56 ? -54.135 -48.071 -34.397 1.00 0.00 ? 56 ARG A N    3  
ATOM 2958  C CA   . ARG A 1 56 ? -55.074 -47.501 -35.356 1.00 0.00 ? 56 ARG A CA   3  
ATOM 2959  C C    . ARG A 1 56 ? -54.914 -48.153 -36.727 1.00 0.00 ? 56 ARG A C    3  
ATOM 2960  O O    . ARG A 1 56 ? -55.878 -48.278 -37.482 1.00 0.00 ? 56 ARG A O    3  
ATOM 2961  C CB   . ARG A 1 56 ? -54.849 -45.991 -35.475 1.00 0.00 ? 56 ARG A CB   3  
ATOM 2962  C CG   . ARG A 1 56 ? -53.484 -45.721 -36.114 1.00 0.00 ? 56 ARG A CG   3  
ATOM 2963  C CD   . ARG A 1 56 ? -53.159 -44.230 -36.009 1.00 0.00 ? 56 ARG A CD   3  
ATOM 2964  N NE   . ARG A 1 56 ? -54.135 -43.448 -36.759 1.00 0.00 ? 56 ARG A NE   3  
ATOM 2965  C CZ   . ARG A 1 56 ? -53.976 -43.205 -38.056 1.00 0.00 ? 56 ARG A CZ   3  
ATOM 2966  N NH1  . ARG A 1 56 ? -52.934 -43.678 -38.687 1.00 0.00 ? 56 ARG A NH1  3  
ATOM 2967  N NH2  . ARG A 1 56 ? -54.861 -42.496 -38.701 1.00 0.00 ? 56 ARG A NH2  3  
ATOM 2968  H H    . ARG A 1 56 ? -53.354 -47.548 -34.115 1.00 0.00 ? 56 ARG A H    3  
ATOM 2969  H HA   . ARG A 1 56 ? -56.079 -47.673 -35.004 1.00 0.00 ? 56 ARG A HA   3  
ATOM 2970  H HB2  . ARG A 1 56 ? -55.626 -45.560 -36.089 1.00 0.00 ? 56 ARG A HB2  3  
ATOM 2971  H HB3  . ARG A 1 56 ? -54.877 -45.546 -34.493 1.00 0.00 ? 56 ARG A HB3  3  
ATOM 2972  H HG2  . ARG A 1 56 ? -52.725 -46.294 -35.601 1.00 0.00 ? 56 ARG A HG2  3  
ATOM 2973  H HG3  . ARG A 1 56 ? -53.509 -46.008 -37.155 1.00 0.00 ? 56 ARG A HG3  3  
ATOM 2974  H HD2  . ARG A 1 56 ? -53.185 -43.932 -34.971 1.00 0.00 ? 56 ARG A HD2  3  
ATOM 2975  H HD3  . ARG A 1 56 ? -52.171 -44.052 -36.406 1.00 0.00 ? 56 ARG A HD3  3  
ATOM 2976  H HE   . ARG A 1 56 ? -54.923 -43.093 -36.297 1.00 0.00 ? 56 ARG A HE   3  
ATOM 2977  H HH11 . ARG A 1 56 ? -52.256 -44.225 -38.196 1.00 0.00 ? 56 ARG A HH11 3  
ATOM 2978  H HH12 . ARG A 1 56 ? -52.815 -43.494 -39.663 1.00 0.00 ? 56 ARG A HH12 3  
ATOM 2979  H HH21 . ARG A 1 56 ? -55.660 -42.136 -38.219 1.00 0.00 ? 56 ARG A HH21 3  
ATOM 2980  H HH22 . ARG A 1 56 ? -54.741 -42.312 -39.676 1.00 0.00 ? 56 ARG A HH22 3  
ATOM 2981  N N    . ARG A 1 57 ? -53.688 -48.558 -37.044 1.00 0.00 ? 57 ARG A N    3  
ATOM 2982  C CA   . ARG A 1 57 ? -53.412 -49.186 -38.332 1.00 0.00 ? 57 ARG A CA   3  
ATOM 2983  C C    . ARG A 1 57 ? -52.463 -50.368 -38.174 1.00 0.00 ? 57 ARG A C    3  
ATOM 2984  O O    . ARG A 1 57 ? -51.467 -50.288 -37.455 1.00 0.00 ? 57 ARG A O    3  
ATOM 2985  C CB   . ARG A 1 57 ? -52.800 -48.160 -39.288 1.00 0.00 ? 57 ARG A CB   3  
ATOM 2986  C CG   . ARG A 1 57 ? -52.552 -48.811 -40.651 1.00 0.00 ? 57 ARG A CG   3  
ATOM 2987  C CD   . ARG A 1 57 ? -52.097 -47.746 -41.650 1.00 0.00 ? 57 ARG A CD   3  
ATOM 2988  N NE   . ARG A 1 57 ? -53.183 -46.809 -41.919 1.00 0.00 ? 57 ARG A NE   3  
ATOM 2989  C CZ   . ARG A 1 57 ? -53.000 -45.751 -42.703 1.00 0.00 ? 57 ARG A CZ   3  
ATOM 2990  N NH1  . ARG A 1 57 ? -51.833 -45.536 -43.246 1.00 0.00 ? 57 ARG A NH1  3  
ATOM 2991  N NH2  . ARG A 1 57 ? -53.987 -44.927 -42.928 1.00 0.00 ? 57 ARG A NH2  3  
ATOM 2992  H H    . ARG A 1 57 ? -52.958 -48.422 -36.404 1.00 0.00 ? 57 ARG A H    3  
ATOM 2993  H HA   . ARG A 1 57 ? -54.341 -49.538 -38.753 1.00 0.00 ? 57 ARG A HA   3  
ATOM 2994  H HB2  . ARG A 1 57 ? -53.478 -47.326 -39.406 1.00 0.00 ? 57 ARG A HB2  3  
ATOM 2995  H HB3  . ARG A 1 57 ? -51.863 -47.806 -38.885 1.00 0.00 ? 57 ARG A HB3  3  
ATOM 2996  H HG2  . ARG A 1 57 ? -51.784 -49.565 -40.557 1.00 0.00 ? 57 ARG A HG2  3  
ATOM 2997  H HG3  . ARG A 1 57 ? -53.464 -49.267 -41.004 1.00 0.00 ? 57 ARG A HG3  3  
ATOM 2998  H HD2  . ARG A 1 57 ? -51.256 -47.207 -41.242 1.00 0.00 ? 57 ARG A HD2  3  
ATOM 2999  H HD3  . ARG A 1 57 ? -51.799 -48.225 -42.572 1.00 0.00 ? 57 ARG A HD3  3  
ATOM 3000  H HE   . ARG A 1 57 ? -54.063 -46.963 -41.514 1.00 0.00 ? 57 ARG A HE   3  
ATOM 3001  H HH11 . ARG A 1 57 ? -51.076 -46.167 -43.073 1.00 0.00 ? 57 ARG A HH11 3  
ATOM 3002  H HH12 . ARG A 1 57 ? -51.696 -44.739 -43.836 1.00 0.00 ? 57 ARG A HH12 3  
ATOM 3003  H HH21 . ARG A 1 57 ? -54.881 -45.092 -42.510 1.00 0.00 ? 57 ARG A HH21 3  
ATOM 3004  H HH22 . ARG A 1 57 ? -53.849 -44.132 -43.517 1.00 0.00 ? 57 ARG A HH22 3  
ATOM 3005  N N    . GLN A 1 58 ? -52.775 -51.461 -38.862 1.00 0.00 ? 58 GLN A N    3  
ATOM 3006  C CA   . GLN A 1 58 ? -51.943 -52.658 -38.802 1.00 0.00 ? 58 GLN A CA   3  
ATOM 3007  C C    . GLN A 1 58 ? -50.584 -52.389 -39.442 1.00 0.00 ? 58 GLN A C    3  
ATOM 3008  O O    . GLN A 1 58 ? -50.462 -51.536 -40.321 1.00 0.00 ? 58 GLN A O    3  
ATOM 3009  C CB   . GLN A 1 58 ? -52.633 -53.814 -39.528 1.00 0.00 ? 58 GLN A CB   3  
ATOM 3010  C CG   . GLN A 1 58 ? -53.857 -54.263 -38.729 1.00 0.00 ? 58 GLN A CG   3  
ATOM 3011  C CD   . GLN A 1 58 ? -54.668 -55.269 -39.538 1.00 0.00 ? 58 GLN A CD   3  
ATOM 3012  O OE1  . GLN A 1 58 ? -54.667 -55.222 -40.769 1.00 0.00 ? 58 GLN A OE1  3  
ATOM 3013  N NE2  . GLN A 1 58 ? -55.364 -56.182 -38.919 1.00 0.00 ? 58 GLN A NE2  3  
ATOM 3014  H H    . GLN A 1 58 ? -53.579 -51.460 -39.422 1.00 0.00 ? 58 GLN A H    3  
ATOM 3015  H HA   . GLN A 1 58 ? -51.796 -52.932 -37.767 1.00 0.00 ? 58 GLN A HA   3  
ATOM 3016  H HB2  . GLN A 1 58 ? -52.941 -53.488 -40.511 1.00 0.00 ? 58 GLN A HB2  3  
ATOM 3017  H HB3  . GLN A 1 58 ? -51.945 -54.641 -39.624 1.00 0.00 ? 58 GLN A HB3  3  
ATOM 3018  H HG2  . GLN A 1 58 ? -53.534 -54.721 -37.805 1.00 0.00 ? 58 GLN A HG2  3  
ATOM 3019  H HG3  . GLN A 1 58 ? -54.473 -53.404 -38.506 1.00 0.00 ? 58 GLN A HG3  3  
ATOM 3020  H HE21 . GLN A 1 58 ? -55.364 -56.217 -37.939 1.00 0.00 ? 58 GLN A HE21 3  
ATOM 3021  H HE22 . GLN A 1 58 ? -55.889 -56.831 -39.432 1.00 0.00 ? 58 GLN A HE22 3  
ATOM 3022  N N    . ILE A 1 59 ? -49.567 -53.117 -38.994 1.00 0.00 ? 59 ILE A N    3  
ATOM 3023  C CA   . ILE A 1 59 ? -48.222 -52.943 -39.531 1.00 0.00 ? 59 ILE A CA   3  
ATOM 3024  C C    . ILE A 1 59 ? -48.191 -53.267 -41.022 1.00 0.00 ? 59 ILE A C    3  
ATOM 3025  O O    . ILE A 1 59 ? -48.930 -54.130 -41.496 1.00 0.00 ? 59 ILE A O    3  
ATOM 3026  C CB   . ILE A 1 59 ? -47.242 -53.854 -38.788 1.00 0.00 ? 59 ILE A CB   3  
ATOM 3027  C CG1  . ILE A 1 59 ? -45.811 -53.536 -39.233 1.00 0.00 ? 59 ILE A CG1  3  
ATOM 3028  C CG2  . ILE A 1 59 ? -47.560 -55.315 -39.110 1.00 0.00 ? 59 ILE A CG2  3  
ATOM 3029  C CD1  . ILE A 1 59 ? -44.820 -54.221 -38.290 1.00 0.00 ? 59 ILE A CD1  3  
ATOM 3030  H H    . ILE A 1 59 ? -49.720 -53.786 -38.294 1.00 0.00 ? 59 ILE A H    3  
ATOM 3031  H HA   . ILE A 1 59 ? -47.919 -51.918 -39.391 1.00 0.00 ? 59 ILE A HA   3  
ATOM 3032  H HB   . ILE A 1 59 ? -47.336 -53.690 -37.725 1.00 0.00 ? 59 ILE A HB   3  
ATOM 3033  H HG12 . ILE A 1 59 ? -45.658 -53.894 -40.240 1.00 0.00 ? 59 ILE A HG12 3  
ATOM 3034  H HG13 . ILE A 1 59 ? -45.652 -52.468 -39.203 1.00 0.00 ? 59 ILE A HG13 3  
ATOM 3035  H HG21 . ILE A 1 59 ? -46.960 -55.639 -39.947 1.00 0.00 ? 59 ILE A HG21 3  
ATOM 3036  H HG22 . ILE A 1 59 ? -48.606 -55.409 -39.358 1.00 0.00 ? 59 ILE A HG22 3  
ATOM 3037  H HG23 . ILE A 1 59 ? -47.337 -55.929 -38.249 1.00 0.00 ? 59 ILE A HG23 3  
ATOM 3038  H HD11 . ILE A 1 59 ? -45.313 -55.038 -37.782 1.00 0.00 ? 59 ILE A HD11 3  
ATOM 3039  H HD12 . ILE A 1 59 ? -44.463 -53.507 -37.562 1.00 0.00 ? 59 ILE A HD12 3  
ATOM 3040  H HD13 . ILE A 1 59 ? -43.986 -54.602 -38.860 1.00 0.00 ? 59 ILE A HD13 3  
ATOM 3041  N N    . ASN A 1 60 ? -47.327 -52.569 -41.753 1.00 0.00 ? 60 ASN A N    3  
ATOM 3042  C CA   . ASN A 1 60 ? -47.201 -52.789 -43.189 1.00 0.00 ? 60 ASN A CA   3  
ATOM 3043  C C    . ASN A 1 60 ? -45.936 -53.583 -43.497 1.00 0.00 ? 60 ASN A C    3  
ATOM 3044  O O    . ASN A 1 60 ? -44.851 -53.249 -43.021 1.00 0.00 ? 60 ASN A O    3  
ATOM 3045  C CB   . ASN A 1 60 ? -47.154 -51.445 -43.920 1.00 0.00 ? 60 ASN A CB   3  
ATOM 3046  C CG   . ASN A 1 60 ? -48.515 -50.762 -43.844 1.00 0.00 ? 60 ASN A CG   3  
ATOM 3047  O OD1  . ASN A 1 60 ? -49.528 -51.420 -43.609 1.00 0.00 ? 60 ASN A OD1  3  
ATOM 3048  N ND2  . ASN A 1 60 ? -48.598 -49.473 -44.030 1.00 0.00 ? 60 ASN A ND2  3  
ATOM 3049  H H    . ASN A 1 60 ? -46.762 -51.898 -41.317 1.00 0.00 ? 60 ASN A H    3  
ATOM 3050  H HA   . ASN A 1 60 ? -48.058 -53.345 -43.536 1.00 0.00 ? 60 ASN A HA   3  
ATOM 3051  H HB2  . ASN A 1 60 ? -46.408 -50.813 -43.462 1.00 0.00 ? 60 ASN A HB2  3  
ATOM 3052  H HB3  . ASN A 1 60 ? -46.894 -51.611 -44.956 1.00 0.00 ? 60 ASN A HB3  3  
ATOM 3053  H HD21 . ASN A 1 60 ? -47.791 -48.951 -44.217 1.00 0.00 ? 60 ASN A HD21 3  
ATOM 3054  H HD22 . ASN A 1 60 ? -49.470 -49.027 -43.982 1.00 0.00 ? 60 ASN A HD22 3  
ATOM 3055  N N    . GLU A 1 61 ? -46.081 -54.633 -44.299 1.00 0.00 ? 61 GLU A N    3  
ATOM 3056  C CA   . GLU A 1 61 ? -44.938 -55.463 -44.664 1.00 0.00 ? 61 GLU A CA   3  
ATOM 3057  C C    . GLU A 1 61 ? -43.922 -54.644 -45.454 1.00 0.00 ? 61 GLU A C    3  
ATOM 3058  O O    . GLU A 1 61 ? -42.714 -54.778 -45.258 1.00 0.00 ? 61 GLU A O    3  
ATOM 3059  C CB   . GLU A 1 61 ? -45.402 -56.656 -45.508 1.00 0.00 ? 61 GLU A CB   3  
ATOM 3060  C CG   . GLU A 1 61 ? -46.216 -57.633 -44.647 1.00 0.00 ? 61 GLU A CG   3  
ATOM 3061  C CD   . GLU A 1 61 ? -47.650 -57.136 -44.489 1.00 0.00 ? 61 GLU A CD   3  
ATOM 3062  O OE1  . GLU A 1 61 ? -47.978 -56.120 -45.081 1.00 0.00 ? 61 GLU A OE1  3  
ATOM 3063  O OE2  . GLU A 1 61 ? -48.404 -57.781 -43.778 1.00 0.00 ? 61 GLU A OE2  3  
ATOM 3064  H H    . GLU A 1 61 ? -46.969 -54.851 -44.653 1.00 0.00 ? 61 GLU A H    3  
ATOM 3065  H HA   . GLU A 1 61 ? -44.466 -55.828 -43.764 1.00 0.00 ? 61 GLU A HA   3  
ATOM 3066  H HB2  . GLU A 1 61 ? -46.012 -56.301 -46.325 1.00 0.00 ? 61 GLU A HB2  3  
ATOM 3067  H HB3  . GLU A 1 61 ? -44.538 -57.167 -45.906 1.00 0.00 ? 61 GLU A HB3  3  
ATOM 3068  H HG2  . GLU A 1 61 ? -46.227 -58.601 -45.125 1.00 0.00 ? 61 GLU A HG2  3  
ATOM 3069  H HG3  . GLU A 1 61 ? -45.761 -57.723 -43.672 1.00 0.00 ? 61 GLU A HG3  3  
ATOM 3070  N N    . ASP A 1 62 ? -44.422 -53.793 -46.345 1.00 0.00 ? 62 ASP A N    3  
ATOM 3071  C CA   . ASP A 1 62 ? -43.547 -52.957 -47.156 1.00 0.00 ? 62 ASP A CA   3  
ATOM 3072  C C    . ASP A 1 62 ? -44.295 -51.739 -47.692 1.00 0.00 ? 62 ASP A C    3  
ATOM 3073  O O    . ASP A 1 62 ? -45.517 -51.646 -47.577 1.00 0.00 ? 62 ASP A O    3  
ATOM 3074  C CB   . ASP A 1 62 ? -42.989 -53.768 -48.327 1.00 0.00 ? 62 ASP A CB   3  
ATOM 3075  C CG   . ASP A 1 62 ? -44.128 -54.229 -49.231 1.00 0.00 ? 62 ASP A CG   3  
ATOM 3076  O OD1  . ASP A 1 62 ? -45.261 -53.873 -48.951 1.00 0.00 ? 62 ASP A OD1  3  
ATOM 3077  O OD2  . ASP A 1 62 ? -43.849 -54.930 -50.190 1.00 0.00 ? 62 ASP A OD2  3  
ATOM 3078  H H    . ASP A 1 62 ? -45.395 -53.732 -46.452 1.00 0.00 ? 62 ASP A H    3  
ATOM 3079  H HA   . ASP A 1 62 ? -42.723 -52.619 -46.545 1.00 0.00 ? 62 ASP A HA   3  
ATOM 3080  H HB2  . ASP A 1 62 ? -42.306 -53.154 -48.895 1.00 0.00 ? 62 ASP A HB2  3  
ATOM 3081  H HB3  . ASP A 1 62 ? -42.464 -54.631 -47.947 1.00 0.00 ? 62 ASP A HB3  3  
ATOM 3082  N N    . GLU A 1 63 ? -43.546 -50.811 -48.278 1.00 0.00 ? 63 GLU A N    3  
ATOM 3083  C CA   . GLU A 1 63 ? -44.137 -49.599 -48.836 1.00 0.00 ? 63 GLU A CA   3  
ATOM 3084  C C    . GLU A 1 63 ? -43.559 -49.312 -50.220 1.00 0.00 ? 63 GLU A C    3  
ATOM 3085  O O    . GLU A 1 63 ? -42.723 -48.423 -50.380 1.00 0.00 ? 63 GLU A O    3  
ATOM 3086  C CB   . GLU A 1 63 ? -43.859 -48.413 -47.908 1.00 0.00 ? 63 GLU A CB   3  
ATOM 3087  C CG   . GLU A 1 63 ? -44.673 -47.197 -48.363 1.00 0.00 ? 63 GLU A CG   3  
ATOM 3088  C CD   . GLU A 1 63 ? -46.160 -47.444 -48.126 1.00 0.00 ? 63 GLU A CD   3  
ATOM 3089  O OE1  . GLU A 1 63 ? -46.477 -48.338 -47.360 1.00 0.00 ? 63 GLU A OE1  3  
ATOM 3090  O OE2  . GLU A 1 63 ? -46.958 -46.734 -48.717 1.00 0.00 ? 63 GLU A OE2  3  
ATOM 3091  H H    . GLU A 1 63 ? -42.576 -50.948 -48.334 1.00 0.00 ? 63 GLU A H    3  
ATOM 3092  H HA   . GLU A 1 63 ? -45.203 -49.735 -48.919 1.00 0.00 ? 63 GLU A HA   3  
ATOM 3093  H HB2  . GLU A 1 63 ? -44.139 -48.675 -46.897 1.00 0.00 ? 63 GLU A HB2  3  
ATOM 3094  H HB3  . GLU A 1 63 ? -42.808 -48.171 -47.938 1.00 0.00 ? 63 GLU A HB3  3  
ATOM 3095  H HG2  . GLU A 1 63 ? -44.361 -46.329 -47.801 1.00 0.00 ? 63 GLU A HG2  3  
ATOM 3096  H HG3  . GLU A 1 63 ? -44.501 -47.024 -49.414 1.00 0.00 ? 63 GLU A HG3  3  
ATOM 3097  N N    . PRO A 1 64 ? -43.989 -50.047 -51.212 1.00 0.00 ? 64 PRO A N    3  
ATOM 3098  C CA   . PRO A 1 64 ? -43.509 -49.873 -52.608 1.00 0.00 ? 64 PRO A CA   3  
ATOM 3099  C C    . PRO A 1 64 ? -44.249 -48.753 -53.337 1.00 0.00 ? 64 PRO A C    3  
ATOM 3100  O O    . PRO A 1 64 ? -45.466 -48.811 -53.390 1.00 0.00 ? 64 PRO A O    3  
ATOM 3101  C CB   . PRO A 1 64 ? -43.800 -51.229 -53.247 1.00 0.00 ? 64 PRO A CB   3  
ATOM 3102  C CG   . PRO A 1 64 ? -44.971 -51.782 -52.499 1.00 0.00 ? 64 PRO A CG   3  
ATOM 3103  C CD   . PRO A 1 64 ? -44.980 -51.128 -51.112 1.00 0.00 ? 64 PRO A CD   3  
ATOM 3104  O OXT  . PRO A 1 64 ? -43.585 -47.856 -53.832 1.00 0.00 ? 64 PRO A OXT  3  
ATOM 3105  H HA   . PRO A 1 64 ? -42.447 -49.689 -52.619 1.00 0.00 ? 64 PRO A HA   3  
ATOM 3106  H HB2  . PRO A 1 64 ? -44.045 -51.103 -54.293 1.00 0.00 ? 64 PRO A HB2  3  
ATOM 3107  H HB3  . PRO A 1 64 ? -42.949 -51.884 -53.137 1.00 0.00 ? 64 PRO A HB3  3  
ATOM 3108  H HG2  . PRO A 1 64 ? -45.886 -51.549 -53.027 1.00 0.00 ? 64 PRO A HG2  3  
ATOM 3109  H HG3  . PRO A 1 64 ? -44.868 -52.851 -52.393 1.00 0.00 ? 64 PRO A HG3  3  
ATOM 3110  H HD2  . PRO A 1 64 ? -45.961 -50.727 -50.894 1.00 0.00 ? 64 PRO A HD2  3  
ATOM 3111  H HD3  . PRO A 1 64 ? -44.682 -51.838 -50.355 1.00 0.00 ? 64 PRO A HD3  3  
ATOM 3112  N N    . LEU A 1 1  ? -30.362 -19.816 -2.250  1.00 0.00 ? 1  LEU A N    4  
ATOM 3113  C CA   . LEU A 1 1  ? -29.897 -19.505 -0.869  1.00 0.00 ? 1  LEU A CA   4  
ATOM 3114  C C    . LEU A 1 1  ? -28.761 -20.453 -0.498  1.00 0.00 ? 1  LEU A C    4  
ATOM 3115  O O    . LEU A 1 1  ? -27.661 -20.016 -0.160  1.00 0.00 ? 1  LEU A O    4  
ATOM 3116  C CB   . LEU A 1 1  ? -31.069 -19.671 0.106   1.00 0.00 ? 1  LEU A CB   4  
ATOM 3117  C CG   . LEU A 1 1  ? -30.620 -19.353 1.538   1.00 0.00 ? 1  LEU A CG   4  
ATOM 3118  C CD1  . LEU A 1 1  ? -30.136 -17.904 1.621   1.00 0.00 ? 1  LEU A CD1  4  
ATOM 3119  C CD2  . LEU A 1 1  ? -31.802 -19.545 2.492   1.00 0.00 ? 1  LEU A CD2  4  
ATOM 3120  H H1   . LEU A 1 1  ? -31.391 -19.688 -2.307  1.00 0.00 ? 1  LEU A H1   4  
ATOM 3121  H H2   . LEU A 1 1  ? -30.120 -20.802 -2.483  1.00 0.00 ? 1  LEU A H2   4  
ATOM 3122  H H3   . LEU A 1 1  ? -29.897 -19.178 -2.926  1.00 0.00 ? 1  LEU A H3   4  
ATOM 3123  H HA   . LEU A 1 1  ? -29.540 -18.487 -0.836  1.00 0.00 ? 1  LEU A HA   4  
ATOM 3124  H HB2  . LEU A 1 1  ? -31.867 -19.000 -0.177  1.00 0.00 ? 1  LEU A HB2  4  
ATOM 3125  H HB3  . LEU A 1 1  ? -31.427 -20.689 0.063   1.00 0.00 ? 1  LEU A HB3  4  
ATOM 3126  H HG   . LEU A 1 1  ? -29.818 -20.017 1.823   1.00 0.00 ? 1  LEU A HG   4  
ATOM 3127  H HD11 . LEU A 1 1  ? -29.084 -17.861 1.385   1.00 0.00 ? 1  LEU A HD11 4  
ATOM 3128  H HD12 . LEU A 1 1  ? -30.295 -17.528 2.621   1.00 0.00 ? 1  LEU A HD12 4  
ATOM 3129  H HD13 . LEU A 1 1  ? -30.687 -17.297 0.918   1.00 0.00 ? 1  LEU A HD13 4  
ATOM 3130  H HD21 . LEU A 1 1  ? -31.591 -19.054 3.430   1.00 0.00 ? 1  LEU A HD21 4  
ATOM 3131  H HD22 . LEU A 1 1  ? -31.958 -20.600 2.664   1.00 0.00 ? 1  LEU A HD22 4  
ATOM 3132  H HD23 . LEU A 1 1  ? -32.691 -19.116 2.054   1.00 0.00 ? 1  LEU A HD23 4  
ATOM 3133  N N    . ASP A 1 2  ? -29.035 -21.752 -0.565  1.00 0.00 ? 2  ASP A N    4  
ATOM 3134  C CA   . ASP A 1 2  ? -28.024 -22.752 -0.233  1.00 0.00 ? 2  ASP A CA   4  
ATOM 3135  C C    . ASP A 1 2  ? -27.173 -23.083 -1.456  1.00 0.00 ? 2  ASP A C    4  
ATOM 3136  O O    . ASP A 1 2  ? -27.424 -24.064 -2.156  1.00 0.00 ? 2  ASP A O    4  
ATOM 3137  C CB   . ASP A 1 2  ? -28.697 -24.024 0.284   1.00 0.00 ? 2  ASP A CB   4  
ATOM 3138  C CG   . ASP A 1 2  ? -27.639 -25.033 0.718   1.00 0.00 ? 2  ASP A CG   4  
ATOM 3139  O OD1  . ASP A 1 2  ? -26.947 -24.757 1.685   1.00 0.00 ? 2  ASP A OD1  4  
ATOM 3140  O OD2  . ASP A 1 2  ? -27.535 -26.066 0.075   1.00 0.00 ? 2  ASP A OD2  4  
ATOM 3141  H H    . ASP A 1 2  ? -29.928 -22.044 -0.841  1.00 0.00 ? 2  ASP A H    4  
ATOM 3142  H HA   . ASP A 1 2  ? -27.384 -22.358 0.541   1.00 0.00 ? 2  ASP A HA   4  
ATOM 3143  H HB2  . ASP A 1 2  ? -29.326 -23.779 1.127   1.00 0.00 ? 2  ASP A HB2  4  
ATOM 3144  H HB3  . ASP A 1 2  ? -29.301 -24.455 -0.500  1.00 0.00 ? 2  ASP A HB3  4  
ATOM 3145  N N    . ARG A 1 3  ? -26.156 -22.263 -1.695  1.00 0.00 ? 3  ARG A N    4  
ATOM 3146  C CA   . ARG A 1 3  ? -25.254 -22.478 -2.823  1.00 0.00 ? 3  ARG A CA   4  
ATOM 3147  C C    . ARG A 1 3  ? -26.031 -22.921 -4.066  1.00 0.00 ? 3  ARG A C    4  
ATOM 3148  O O    . ARG A 1 3  ? -25.618 -23.839 -4.775  1.00 0.00 ? 3  ARG A O    4  
ATOM 3149  C CB   . ARG A 1 3  ? -24.205 -23.533 -2.451  1.00 0.00 ? 3  ARG A CB   4  
ATOM 3150  C CG   . ARG A 1 3  ? -23.063 -22.870 -1.671  1.00 0.00 ? 3  ARG A CG   4  
ATOM 3151  C CD   . ARG A 1 3  ? -23.606 -22.255 -0.378  1.00 0.00 ? 3  ARG A CD   4  
ATOM 3152  N NE   . ARG A 1 3  ? -23.973 -20.860 -0.595  1.00 0.00 ? 3  ARG A NE   4  
ATOM 3153  C CZ   . ARG A 1 3  ? -24.548 -20.143 0.365   1.00 0.00 ? 3  ARG A CZ   4  
ATOM 3154  N NH1  . ARG A 1 3  ? -24.794 -20.685 1.526   1.00 0.00 ? 3  ARG A NH1  4  
ATOM 3155  N NH2  . ARG A 1 3  ? -24.865 -18.896 0.147   1.00 0.00 ? 3  ARG A NH2  4  
ATOM 3156  H H    . ARG A 1 3  ? -26.000 -21.510 -1.089  1.00 0.00 ? 3  ARG A H    4  
ATOM 3157  H HA   . ARG A 1 3  ? -24.750 -21.550 -3.044  1.00 0.00 ? 3  ARG A HA   4  
ATOM 3158  H HB2  . ARG A 1 3  ? -24.663 -24.297 -1.840  1.00 0.00 ? 3  ARG A HB2  4  
ATOM 3159  H HB3  . ARG A 1 3  ? -23.806 -23.981 -3.348  1.00 0.00 ? 3  ARG A HB3  4  
ATOM 3160  H HG2  . ARG A 1 3  ? -22.316 -23.613 -1.429  1.00 0.00 ? 3  ARG A HG2  4  
ATOM 3161  H HG3  . ARG A 1 3  ? -22.615 -22.096 -2.275  1.00 0.00 ? 3  ARG A HG3  4  
ATOM 3162  H HD2  . ARG A 1 3  ? -24.476 -22.805 -0.054  1.00 0.00 ? 3  ARG A HD2  4  
ATOM 3163  H HD3  . ARG A 1 3  ? -22.846 -22.312 0.389   1.00 0.00 ? 3  ARG A HD3  4  
ATOM 3164  H HE   . ARG A 1 3  ? -23.791 -20.443 -1.463  1.00 0.00 ? 3  ARG A HE   4  
ATOM 3165  H HH11 . ARG A 1 3  ? -24.551 -21.641 1.694   1.00 0.00 ? 3  ARG A HH11 4  
ATOM 3166  H HH12 . ARG A 1 3  ? -25.228 -20.146 2.249   1.00 0.00 ? 3  ARG A HH12 4  
ATOM 3167  H HH21 . ARG A 1 3  ? -24.675 -18.480 -0.742  1.00 0.00 ? 3  ARG A HH21 4  
ATOM 3168  H HH22 . ARG A 1 3  ? -25.298 -18.356 0.871   1.00 0.00 ? 3  ARG A HH22 4  
ATOM 3169  N N    . TRP A 1 4  ? -27.153 -22.256 -4.333  1.00 0.00 ? 4  TRP A N    4  
ATOM 3170  C CA   . TRP A 1 4  ? -27.970 -22.587 -5.499  1.00 0.00 ? 4  TRP A CA   4  
ATOM 3171  C C    . TRP A 1 4  ? -27.790 -21.541 -6.594  1.00 0.00 ? 4  TRP A C    4  
ATOM 3172  O O    . TRP A 1 4  ? -28.523 -21.533 -7.583  1.00 0.00 ? 4  TRP A O    4  
ATOM 3173  C CB   . TRP A 1 4  ? -29.448 -22.665 -5.112  1.00 0.00 ? 4  TRP A CB   4  
ATOM 3174  C CG   . TRP A 1 4  ? -29.698 -23.913 -4.327  1.00 0.00 ? 4  TRP A CG   4  
ATOM 3175  C CD1  . TRP A 1 4  ? -29.907 -23.964 -2.993  1.00 0.00 ? 4  TRP A CD1  4  
ATOM 3176  C CD2  . TRP A 1 4  ? -29.768 -25.286 -4.805  1.00 0.00 ? 4  TRP A CD2  4  
ATOM 3177  N NE1  . TRP A 1 4  ? -30.103 -25.282 -2.621  1.00 0.00 ? 4  TRP A NE1  4  
ATOM 3178  C CE2  . TRP A 1 4  ? -30.025 -26.135 -3.703  1.00 0.00 ? 4  TRP A CE2  4  
ATOM 3179  C CE3  . TRP A 1 4  ? -29.635 -25.875 -6.076  1.00 0.00 ? 4  TRP A CE3  4  
ATOM 3180  C CZ2  . TRP A 1 4  ? -30.145 -27.517 -3.854  1.00 0.00 ? 4  TRP A CZ2  4  
ATOM 3181  C CZ3  . TRP A 1 4  ? -29.756 -27.265 -6.233  1.00 0.00 ? 4  TRP A CZ3  4  
ATOM 3182  C CH2  . TRP A 1 4  ? -30.011 -28.084 -5.125  1.00 0.00 ? 4  TRP A CH2  4  
ATOM 3183  H H    . TRP A 1 4  ? -27.433 -21.526 -3.741  1.00 0.00 ? 4  TRP A H    4  
ATOM 3184  H HA   . TRP A 1 4  ? -27.661 -23.547 -5.882  1.00 0.00 ? 4  TRP A HA   4  
ATOM 3185  H HB2  . TRP A 1 4  ? -29.708 -21.805 -4.511  1.00 0.00 ? 4  TRP A HB2  4  
ATOM 3186  H HB3  . TRP A 1 4  ? -30.054 -22.675 -6.005  1.00 0.00 ? 4  TRP A HB3  4  
ATOM 3187  H HD1  . TRP A 1 4  ? -29.922 -23.115 -2.327  1.00 0.00 ? 4  TRP A HD1  4  
ATOM 3188  H HE1  . TRP A 1 4  ? -30.275 -25.592 -1.706  1.00 0.00 ? 4  TRP A HE1  4  
ATOM 3189  H HE3  . TRP A 1 4  ? -29.439 -25.252 -6.937  1.00 0.00 ? 4  TRP A HE3  4  
ATOM 3190  H HZ2  . TRP A 1 4  ? -30.342 -28.142 -2.998  1.00 0.00 ? 4  TRP A HZ2  4  
ATOM 3191  H HZ3  . TRP A 1 4  ? -29.652 -27.705 -7.214  1.00 0.00 ? 4  TRP A HZ3  4  
ATOM 3192  H HH2  . TRP A 1 4  ? -30.102 -29.153 -5.252  1.00 0.00 ? 4  TRP A HH2  4  
ATOM 3193  N N    . TYR A 1 5  ? -26.806 -20.667 -6.417  1.00 0.00 ? 5  TYR A N    4  
ATOM 3194  C CA   . TYR A 1 5  ? -26.535 -19.628 -7.404  1.00 0.00 ? 5  TYR A CA   4  
ATOM 3195  C C    . TYR A 1 5  ? -25.038 -19.338 -7.496  1.00 0.00 ? 5  TYR A C    4  
ATOM 3196  O O    . TYR A 1 5  ? -24.306 -19.490 -6.519  1.00 0.00 ? 5  TYR A O    4  
ATOM 3197  C CB   . TYR A 1 5  ? -27.305 -18.359 -7.030  1.00 0.00 ? 5  TYR A CB   4  
ATOM 3198  C CG   . TYR A 1 5  ? -26.907 -17.917 -5.642  1.00 0.00 ? 5  TYR A CG   4  
ATOM 3199  C CD1  . TYR A 1 5  ? -27.604 -18.402 -4.529  1.00 0.00 ? 5  TYR A CD1  4  
ATOM 3200  C CD2  . TYR A 1 5  ? -25.842 -17.029 -5.467  1.00 0.00 ? 5  TYR A CD2  4  
ATOM 3201  C CE1  . TYR A 1 5  ? -27.237 -17.995 -3.240  1.00 0.00 ? 5  TYR A CE1  4  
ATOM 3202  C CE2  . TYR A 1 5  ? -25.473 -16.622 -4.179  1.00 0.00 ? 5  TYR A CE2  4  
ATOM 3203  C CZ   . TYR A 1 5  ? -26.171 -17.104 -3.065  1.00 0.00 ? 5  TYR A CZ   4  
ATOM 3204  O OH   . TYR A 1 5  ? -25.807 -16.705 -1.796  1.00 0.00 ? 5  TYR A OH   4  
ATOM 3205  H H    . TYR A 1 5  ? -26.242 -20.731 -5.619  1.00 0.00 ? 5  TYR A H    4  
ATOM 3206  H HA   . TYR A 1 5  ? -26.881 -19.969 -8.368  1.00 0.00 ? 5  TYR A HA   4  
ATOM 3207  H HB2  . TYR A 1 5  ? -27.073 -17.578 -7.738  1.00 0.00 ? 5  TYR A HB2  4  
ATOM 3208  H HB3  . TYR A 1 5  ? -28.365 -18.562 -7.052  1.00 0.00 ? 5  TYR A HB3  4  
ATOM 3209  H HD1  . TYR A 1 5  ? -28.427 -19.088 -4.664  1.00 0.00 ? 5  TYR A HD1  4  
ATOM 3210  H HD2  . TYR A 1 5  ? -25.308 -16.657 -6.324  1.00 0.00 ? 5  TYR A HD2  4  
ATOM 3211  H HE1  . TYR A 1 5  ? -27.775 -18.368 -2.382  1.00 0.00 ? 5  TYR A HE1  4  
ATOM 3212  H HE2  . TYR A 1 5  ? -24.651 -15.935 -4.044  1.00 0.00 ? 5  TYR A HE2  4  
ATOM 3213  H HH   . TYR A 1 5  ? -26.602 -16.435 -1.331  1.00 0.00 ? 5  TYR A HH   4  
ATOM 3214  N N    . LEU A 1 6  ? -24.591 -18.909 -8.676  1.00 0.00 ? 6  LEU A N    4  
ATOM 3215  C CA   . LEU A 1 6  ? -23.179 -18.593 -8.883  1.00 0.00 ? 6  LEU A CA   4  
ATOM 3216  C C    . LEU A 1 6  ? -22.776 -17.400 -8.021  1.00 0.00 ? 6  LEU A C    4  
ATOM 3217  O O    . LEU A 1 6  ? -21.728 -17.407 -7.377  1.00 0.00 ? 6  LEU A O    4  
ATOM 3218  C CB   . LEU A 1 6  ? -22.927 -18.284 -10.366 1.00 0.00 ? 6  LEU A CB   4  
ATOM 3219  C CG   . LEU A 1 6  ? -21.446 -17.959 -10.602 1.00 0.00 ? 6  LEU A CG   4  
ATOM 3220  C CD1  . LEU A 1 6  ? -20.582 -19.160 -10.212 1.00 0.00 ? 6  LEU A CD1  4  
ATOM 3221  C CD2  . LEU A 1 6  ? -21.231 -17.646 -12.085 1.00 0.00 ? 6  LEU A CD2  4  
ATOM 3222  H H    . LEU A 1 6  ? -25.222 -18.802 -9.418  1.00 0.00 ? 6  LEU A H    4  
ATOM 3223  H HA   . LEU A 1 6  ? -22.586 -19.448 -8.596  1.00 0.00 ? 6  LEU A HA   4  
ATOM 3224  H HB2  . LEU A 1 6  ? -23.205 -19.142 -10.960 1.00 0.00 ? 6  LEU A HB2  4  
ATOM 3225  H HB3  . LEU A 1 6  ? -23.528 -17.436 -10.659 1.00 0.00 ? 6  LEU A HB3  4  
ATOM 3226  H HG   . LEU A 1 6  ? -21.160 -17.103 -10.010 1.00 0.00 ? 6  LEU A HG   4  
ATOM 3227  H HD11 . LEU A 1 6  ? -19.673 -19.154 -10.796 1.00 0.00 ? 6  LEU A HD11 4  
ATOM 3228  H HD12 . LEU A 1 6  ? -21.125 -20.073 -10.403 1.00 0.00 ? 6  LEU A HD12 4  
ATOM 3229  H HD13 . LEU A 1 6  ? -20.334 -19.100 -9.162  1.00 0.00 ? 6  LEU A HD13 4  
ATOM 3230  H HD21 . LEU A 1 6  ? -20.388 -18.210 -12.453 1.00 0.00 ? 6  LEU A HD21 4  
ATOM 3231  H HD22 . LEU A 1 6  ? -21.037 -16.590 -12.204 1.00 0.00 ? 6  LEU A HD22 4  
ATOM 3232  H HD23 . LEU A 1 6  ? -22.115 -17.915 -12.641 1.00 0.00 ? 6  LEU A HD23 4  
ATOM 3233  N N    . GLY A 1 7  ? -23.631 -16.383 -8.010  1.00 0.00 ? 7  GLY A N    4  
ATOM 3234  C CA   . GLY A 1 7  ? -23.375 -15.184 -7.219  1.00 0.00 ? 7  GLY A CA   4  
ATOM 3235  C C    . GLY A 1 7  ? -22.247 -14.347 -7.809  1.00 0.00 ? 7  GLY A C    4  
ATOM 3236  O O    . GLY A 1 7  ? -21.546 -13.643 -7.081  1.00 0.00 ? 7  GLY A O    4  
ATOM 3237  H H    . GLY A 1 7  ? -24.452 -16.452 -8.542  1.00 0.00 ? 7  GLY A H    4  
ATOM 3238  H HA2  . GLY A 1 7  ? -24.275 -14.588 -7.183  1.00 0.00 ? 7  GLY A HA2  4  
ATOM 3239  H HA3  . GLY A 1 7  ? -23.107 -15.478 -6.215  1.00 0.00 ? 7  GLY A HA3  4  
ATOM 3240  N N    . GLY A 1 8  ? -22.075 -14.410 -9.126  1.00 0.00 ? 8  GLY A N    4  
ATOM 3241  C CA   . GLY A 1 8  ? -21.027 -13.632 -9.776  1.00 0.00 ? 8  GLY A CA   4  
ATOM 3242  C C    . GLY A 1 8  ? -21.598 -12.330 -10.331 1.00 0.00 ? 8  GLY A C    4  
ATOM 3243  O O    . GLY A 1 8  ? -22.493 -12.343 -11.174 1.00 0.00 ? 8  GLY A O    4  
ATOM 3244  H H    . GLY A 1 8  ? -22.664 -14.972 -9.672  1.00 0.00 ? 8  GLY A H    4  
ATOM 3245  H HA2  . GLY A 1 8  ? -20.251 -13.406 -9.058  1.00 0.00 ? 8  GLY A HA2  4  
ATOM 3246  H HA3  . GLY A 1 8  ? -20.608 -14.205 -10.589 1.00 0.00 ? 8  GLY A HA3  4  
ATOM 3247  N N    . SER A 1 9  ? -21.088 -11.208 -9.834  1.00 0.00 ? 9  SER A N    4  
ATOM 3248  C CA   . SER A 1 9  ? -21.567 -9.899  -10.268 1.00 0.00 ? 9  SER A CA   4  
ATOM 3249  C C    . SER A 1 9  ? -20.879 -9.469  -11.571 1.00 0.00 ? 9  SER A C    4  
ATOM 3250  O O    . SER A 1 9  ? -19.737 -9.850  -11.823 1.00 0.00 ? 9  SER A O    4  
ATOM 3251  C CB   . SER A 1 9  ? -21.265 -8.879  -9.163  1.00 0.00 ? 9  SER A CB   4  
ATOM 3252  O OG   . SER A 1 9  ? -19.857 -8.783  -8.988  1.00 0.00 ? 9  SER A OG   4  
ATOM 3253  H H    . SER A 1 9  ? -20.390 -11.254 -9.146  1.00 0.00 ? 9  SER A H    4  
ATOM 3254  H HA   . SER A 1 9  ? -22.632 -9.952  -10.416 1.00 0.00 ? 9  SER A HA   4  
ATOM 3255  H HB2  . SER A 1 9  ? -21.649 -7.913  -9.436  1.00 0.00 ? 9  SER A HB2  4  
ATOM 3256  H HB3  . SER A 1 9  ? -21.730 -9.202  -8.241  1.00 0.00 ? 9  SER A HB3  4  
ATOM 3257  H HG   . SER A 1 9  ? -19.688 -8.150  -8.286  1.00 0.00 ? 9  SER A HG   4  
ATOM 3258  N N    . PRO A 1 10 ? -21.537 -8.675  -12.391 1.00 0.00 ? 10 PRO A N    4  
ATOM 3259  C CA   . PRO A 1 10 ? -20.945 -8.184  -13.675 1.00 0.00 ? 10 PRO A CA   4  
ATOM 3260  C C    . PRO A 1 10 ? -19.723 -7.294  -13.430 1.00 0.00 ? 10 PRO A C    4  
ATOM 3261  O O    . PRO A 1 10 ? -19.050 -7.430  -12.408 1.00 0.00 ? 10 PRO A O    4  
ATOM 3262  C CB   . PRO A 1 10 ? -22.099 -7.415  -14.343 1.00 0.00 ? 10 PRO A CB   4  
ATOM 3263  C CG   . PRO A 1 10 ? -23.027 -7.051  -13.237 1.00 0.00 ? 10 PRO A CG   4  
ATOM 3264  C CD   . PRO A 1 10 ? -22.909 -8.163  -12.201 1.00 0.00 ? 10 PRO A CD   4  
ATOM 3265  H HA   . PRO A 1 10 ? -20.668 -9.022  -14.296 1.00 0.00 ? 10 PRO A HA   4  
ATOM 3266  H HB2  . PRO A 1 10 ? -21.736 -6.524  -14.833 1.00 0.00 ? 10 PRO A HB2  4  
ATOM 3267  H HB3  . PRO A 1 10 ? -22.608 -8.050  -15.053 1.00 0.00 ? 10 PRO A HB3  4  
ATOM 3268  H HG2  . PRO A 1 10 ? -22.735 -6.103  -12.806 1.00 0.00 ? 10 PRO A HG2  4  
ATOM 3269  H HG3  . PRO A 1 10 ? -24.041 -7.001  -13.602 1.00 0.00 ? 10 PRO A HG3  4  
ATOM 3270  H HD2  . PRO A 1 10 ? -23.046 -7.765  -11.209 1.00 0.00 ? 10 PRO A HD2  4  
ATOM 3271  H HD3  . PRO A 1 10 ? -23.627 -8.943  -12.400 1.00 0.00 ? 10 PRO A HD3  4  
ATOM 3272  N N    . LYS A 1 11 ? -19.438 -6.385  -14.358 1.00 0.00 ? 11 LYS A N    4  
ATOM 3273  C CA   . LYS A 1 11 ? -18.293 -5.492  -14.210 1.00 0.00 ? 11 LYS A CA   4  
ATOM 3274  C C    . LYS A 1 11 ? -18.565 -4.466  -13.115 1.00 0.00 ? 11 LYS A C    4  
ATOM 3275  O O    . LYS A 1 11 ? -17.638 -3.902  -12.535 1.00 0.00 ? 11 LYS A O    4  
ATOM 3276  C CB   . LYS A 1 11 ? -18.011 -4.774  -15.530 1.00 0.00 ? 11 LYS A CB   4  
ATOM 3277  C CG   . LYS A 1 11 ? -17.512 -5.784  -16.565 1.00 0.00 ? 11 LYS A CG   4  
ATOM 3278  C CD   . LYS A 1 11 ? -17.228 -5.066  -17.886 1.00 0.00 ? 11 LYS A CD   4  
ATOM 3279  C CE   . LYS A 1 11 ? -16.725 -6.075  -18.918 1.00 0.00 ? 11 LYS A CE   4  
ATOM 3280  N NZ   . LYS A 1 11 ? -16.454 -5.377  -20.206 1.00 0.00 ? 11 LYS A NZ   4  
ATOM 3281  H H    . LYS A 1 11 ? -20.009 -6.307  -15.151 1.00 0.00 ? 11 LYS A H    4  
ATOM 3282  H HA   . LYS A 1 11 ? -17.427 -6.075  -13.938 1.00 0.00 ? 11 LYS A HA   4  
ATOM 3283  H HB2  . LYS A 1 11 ? -18.919 -4.309  -15.888 1.00 0.00 ? 11 LYS A HB2  4  
ATOM 3284  H HB3  . LYS A 1 11 ? -17.257 -4.017  -15.375 1.00 0.00 ? 11 LYS A HB3  4  
ATOM 3285  H HG2  . LYS A 1 11 ? -16.604 -6.249  -16.206 1.00 0.00 ? 11 LYS A HG2  4  
ATOM 3286  H HG3  . LYS A 1 11 ? -18.265 -6.540  -16.723 1.00 0.00 ? 11 LYS A HG3  4  
ATOM 3287  H HD2  . LYS A 1 11 ? -18.137 -4.603  -18.245 1.00 0.00 ? 11 LYS A HD2  4  
ATOM 3288  H HD3  . LYS A 1 11 ? -16.475 -4.307  -17.730 1.00 0.00 ? 11 LYS A HD3  4  
ATOM 3289  H HE2  . LYS A 1 11 ? -15.814 -6.533  -18.559 1.00 0.00 ? 11 LYS A HE2  4  
ATOM 3290  H HE3  . LYS A 1 11 ? -17.474 -6.837  -19.072 1.00 0.00 ? 11 LYS A HE3  4  
ATOM 3291  H HZ1  . LYS A 1 11 ? -15.890 -4.522  -20.027 1.00 0.00 ? 11 LYS A HZ1  4  
ATOM 3292  H HZ2  . LYS A 1 11 ? -17.357 -5.110  -20.651 1.00 0.00 ? 11 LYS A HZ2  4  
ATOM 3293  H HZ3  . LYS A 1 11 ? -15.929 -6.009  -20.842 1.00 0.00 ? 11 LYS A HZ3  4  
ATOM 3294  N N    . GLY A 1 12 ? -19.843 -4.241  -12.828 1.00 0.00 ? 12 GLY A N    4  
ATOM 3295  C CA   . GLY A 1 12 ? -20.230 -3.295  -11.789 1.00 0.00 ? 12 GLY A CA   4  
ATOM 3296  C C    . GLY A 1 12 ? -20.237 -1.861  -12.306 1.00 0.00 ? 12 GLY A C    4  
ATOM 3297  O O    . GLY A 1 12 ? -20.499 -0.927  -11.547 1.00 0.00 ? 12 GLY A O    4  
ATOM 3298  H H    . GLY A 1 12 ? -20.538 -4.731  -13.315 1.00 0.00 ? 12 GLY A H    4  
ATOM 3299  H HA2  . GLY A 1 12 ? -21.217 -3.546  -11.433 1.00 0.00 ? 12 GLY A HA2  4  
ATOM 3300  H HA3  . GLY A 1 12 ? -19.531 -3.367  -10.968 1.00 0.00 ? 12 GLY A HA3  4  
ATOM 3301  N N    . ASP A 1 13 ? -19.951 -1.686  -13.596 1.00 0.00 ? 13 ASP A N    4  
ATOM 3302  C CA   . ASP A 1 13 ? -19.934 -0.353  -14.193 1.00 0.00 ? 13 ASP A CA   4  
ATOM 3303  C C    . ASP A 1 13 ? -21.000 -0.247  -15.281 1.00 0.00 ? 13 ASP A C    4  
ATOM 3304  O O    . ASP A 1 13 ? -20.946 0.638   -16.135 1.00 0.00 ? 13 ASP A O    4  
ATOM 3305  C CB   . ASP A 1 13 ? -18.556 -0.072  -14.797 1.00 0.00 ? 13 ASP A CB   4  
ATOM 3306  C CG   . ASP A 1 13 ? -18.432 1.404   -15.157 1.00 0.00 ? 13 ASP A CG   4  
ATOM 3307  O OD1  . ASP A 1 13 ? -19.429 2.101   -15.073 1.00 0.00 ? 13 ASP A OD1  4  
ATOM 3308  O OD2  . ASP A 1 13 ? -17.340 1.817   -15.512 1.00 0.00 ? 13 ASP A OD2  4  
ATOM 3309  H H    . ASP A 1 13 ? -19.751 -2.462  -14.161 1.00 0.00 ? 13 ASP A H    4  
ATOM 3310  H HA   . ASP A 1 13 ? -20.137 0.383   -13.432 1.00 0.00 ? 13 ASP A HA   4  
ATOM 3311  H HB2  . ASP A 1 13 ? -17.792 -0.332  -14.079 1.00 0.00 ? 13 ASP A HB2  4  
ATOM 3312  H HB3  . ASP A 1 13 ? -18.427 -0.669  -15.687 1.00 0.00 ? 13 ASP A HB3  4  
ATOM 3313  N N    . VAL A 1 14 ? -21.977 -1.146  -15.233 1.00 0.00 ? 14 VAL A N    4  
ATOM 3314  C CA   . VAL A 1 14 ? -23.063 -1.133  -16.206 1.00 0.00 ? 14 VAL A CA   4  
ATOM 3315  C C    . VAL A 1 14 ? -24.376 -1.521  -15.536 1.00 0.00 ? 14 VAL A C    4  
ATOM 3316  O O    . VAL A 1 14 ? -24.384 -2.297  -14.580 1.00 0.00 ? 14 VAL A O    4  
ATOM 3317  C CB   . VAL A 1 14 ? -22.758 -2.111  -17.342 1.00 0.00 ? 14 VAL A CB   4  
ATOM 3318  C CG1  . VAL A 1 14 ? -21.483 -1.674  -18.066 1.00 0.00 ? 14 VAL A CG1  4  
ATOM 3319  C CG2  . VAL A 1 14 ? -22.560 -3.514  -16.767 1.00 0.00 ? 14 VAL A CG2  4  
ATOM 3320  H H    . VAL A 1 14 ? -21.982 -1.812  -14.514 1.00 0.00 ? 14 VAL A H    4  
ATOM 3321  H HA   . VAL A 1 14 ? -23.156 -0.139  -16.616 1.00 0.00 ? 14 VAL A HA   4  
ATOM 3322  H HB   . VAL A 1 14 ? -23.584 -2.119  -18.041 1.00 0.00 ? 14 VAL A HB   4  
ATOM 3323  H HG11 . VAL A 1 14 ? -20.628 -1.871  -17.437 1.00 0.00 ? 14 VAL A HG11 4  
ATOM 3324  H HG12 . VAL A 1 14 ? -21.536 -0.618  -18.282 1.00 0.00 ? 14 VAL A HG12 4  
ATOM 3325  H HG13 . VAL A 1 14 ? -21.387 -2.226  -18.990 1.00 0.00 ? 14 VAL A HG13 4  
ATOM 3326  H HG21 . VAL A 1 14 ? -23.313 -4.178  -17.168 1.00 0.00 ? 14 VAL A HG21 4  
ATOM 3327  H HG22 . VAL A 1 14 ? -22.651 -3.479  -15.691 1.00 0.00 ? 14 VAL A HG22 4  
ATOM 3328  H HG23 . VAL A 1 14 ? -21.581 -3.879  -17.034 1.00 0.00 ? 14 VAL A HG23 4  
ATOM 3329  N N    . ASP A 1 15 ? -25.484 -0.978  -16.036 1.00 0.00 ? 15 ASP A N    4  
ATOM 3330  C CA   . ASP A 1 15 ? -26.794 -1.278  -15.469 1.00 0.00 ? 15 ASP A CA   4  
ATOM 3331  C C    . ASP A 1 15 ? -27.772 -1.692  -16.569 1.00 0.00 ? 15 ASP A C    4  
ATOM 3332  O O    . ASP A 1 15 ? -28.733 -0.978  -16.855 1.00 0.00 ? 15 ASP A O    4  
ATOM 3333  C CB   . ASP A 1 15 ? -27.334 -0.041  -14.751 1.00 0.00 ? 15 ASP A CB   4  
ATOM 3334  C CG   . ASP A 1 15 ? -26.381 0.371   -13.634 1.00 0.00 ? 15 ASP A CG   4  
ATOM 3335  O OD1  . ASP A 1 15 ? -25.279 0.789   -13.947 1.00 0.00 ? 15 ASP A OD1  4  
ATOM 3336  O OD2  . ASP A 1 15 ? -26.767 0.261   -12.482 1.00 0.00 ? 15 ASP A OD2  4  
ATOM 3337  H H    . ASP A 1 15 ? -25.423 -0.354  -16.789 1.00 0.00 ? 15 ASP A H    4  
ATOM 3338  H HA   . ASP A 1 15 ? -26.702 -2.078  -14.754 1.00 0.00 ? 15 ASP A HA   4  
ATOM 3339  H HB2  . ASP A 1 15 ? -27.432 0.770   -15.457 1.00 0.00 ? 15 ASP A HB2  4  
ATOM 3340  H HB3  . ASP A 1 15 ? -28.301 -0.265  -14.328 1.00 0.00 ? 15 ASP A HB3  4  
ATOM 3341  N N    . PRO A 1 16 ? -27.546 -2.825  -17.190 1.00 0.00 ? 16 PRO A N    4  
ATOM 3342  C CA   . PRO A 1 16 ? -28.425 -3.334  -18.284 1.00 0.00 ? 16 PRO A CA   4  
ATOM 3343  C C    . PRO A 1 16 ? -29.776 -3.832  -17.770 1.00 0.00 ? 16 PRO A C    4  
ATOM 3344  O O    . PRO A 1 16 ? -30.702 -4.049  -18.551 1.00 0.00 ? 16 PRO A O    4  
ATOM 3345  C CB   . PRO A 1 16 ? -27.613 -4.476  -18.897 1.00 0.00 ? 16 PRO A CB   4  
ATOM 3346  C CG   . PRO A 1 16 ? -26.735 -4.963  -17.795 1.00 0.00 ? 16 PRO A CG   4  
ATOM 3347  C CD   . PRO A 1 16 ? -26.425 -3.748  -16.920 1.00 0.00 ? 16 PRO A CD   4  
ATOM 3348  H HA   . PRO A 1 16 ? -28.574 -2.567  -19.026 1.00 0.00 ? 16 PRO A HA   4  
ATOM 3349  H HB2  . PRO A 1 16 ? -28.270 -5.265  -19.232 1.00 0.00 ? 16 PRO A HB2  4  
ATOM 3350  H HB3  . PRO A 1 16 ? -27.011 -4.112  -19.715 1.00 0.00 ? 16 PRO A HB3  4  
ATOM 3351  H HG2  . PRO A 1 16 ? -27.251 -5.719  -17.218 1.00 0.00 ? 16 PRO A HG2  4  
ATOM 3352  H HG3  . PRO A 1 16 ? -25.817 -5.362  -18.199 1.00 0.00 ? 16 PRO A HG3  4  
ATOM 3353  H HD2  . PRO A 1 16 ? -26.404 -4.037  -15.880 1.00 0.00 ? 16 PRO A HD2  4  
ATOM 3354  H HD3  . PRO A 1 16 ? -25.489 -3.297  -17.211 1.00 0.00 ? 16 PRO A HD3  4  
ATOM 3355  N N    . PHE A 1 17 ? -29.874 -4.030  -16.460 1.00 0.00 ? 17 PHE A N    4  
ATOM 3356  C CA   . PHE A 1 17 ? -31.112 -4.524  -15.867 1.00 0.00 ? 17 PHE A CA   4  
ATOM 3357  C C    . PHE A 1 17 ? -32.272 -3.572  -16.144 1.00 0.00 ? 17 PHE A C    4  
ATOM 3358  O O    . PHE A 1 17 ? -33.388 -4.011  -16.423 1.00 0.00 ? 17 PHE A O    4  
ATOM 3359  C CB   . PHE A 1 17 ? -30.939 -4.687  -14.356 1.00 0.00 ? 17 PHE A CB   4  
ATOM 3360  C CG   . PHE A 1 17 ? -30.033 -5.863  -14.077 1.00 0.00 ? 17 PHE A CG   4  
ATOM 3361  C CD1  . PHE A 1 17 ? -30.574 -7.148  -13.944 1.00 0.00 ? 17 PHE A CD1  4  
ATOM 3362  C CD2  . PHE A 1 17 ? -28.652 -5.668  -13.950 1.00 0.00 ? 17 PHE A CD2  4  
ATOM 3363  C CE1  . PHE A 1 17 ? -29.734 -8.237  -13.686 1.00 0.00 ? 17 PHE A CE1  4  
ATOM 3364  C CE2  . PHE A 1 17 ? -27.813 -6.757  -13.691 1.00 0.00 ? 17 PHE A CE2  4  
ATOM 3365  C CZ   . PHE A 1 17 ? -28.354 -8.042  -13.558 1.00 0.00 ? 17 PHE A CZ   4  
ATOM 3366  H H    . PHE A 1 17 ? -29.097 -3.859  -15.888 1.00 0.00 ? 17 PHE A H    4  
ATOM 3367  H HA   . PHE A 1 17 ? -31.343 -5.488  -16.294 1.00 0.00 ? 17 PHE A HA   4  
ATOM 3368  H HB2  . PHE A 1 17 ? -30.501 -3.789  -13.945 1.00 0.00 ? 17 PHE A HB2  4  
ATOM 3369  H HB3  . PHE A 1 17 ? -31.902 -4.861  -13.899 1.00 0.00 ? 17 PHE A HB3  4  
ATOM 3370  H HD1  . PHE A 1 17 ? -31.639 -7.298  -14.042 1.00 0.00 ? 17 PHE A HD1  4  
ATOM 3371  H HD2  . PHE A 1 17 ? -28.235 -4.677  -14.052 1.00 0.00 ? 17 PHE A HD2  4  
ATOM 3372  H HE1  . PHE A 1 17 ? -30.150 -9.229  -13.583 1.00 0.00 ? 17 PHE A HE1  4  
ATOM 3373  H HE2  . PHE A 1 17 ? -26.747 -6.608  -13.593 1.00 0.00 ? 17 PHE A HE2  4  
ATOM 3374  H HZ   . PHE A 1 17 ? -27.706 -8.883  -13.358 1.00 0.00 ? 17 PHE A HZ   4  
ATOM 3375  N N    . TYR A 1 18 ? -32.015 -2.270  -16.058 1.00 0.00 ? 18 TYR A N    4  
ATOM 3376  C CA   . TYR A 1 18 ? -33.068 -1.289  -16.296 1.00 0.00 ? 18 TYR A CA   4  
ATOM 3377  C C    . TYR A 1 18 ? -33.621 -1.429  -17.710 1.00 0.00 ? 18 TYR A C    4  
ATOM 3378  O O    . TYR A 1 18 ? -34.834 -1.373  -17.915 1.00 0.00 ? 18 TYR A O    4  
ATOM 3379  C CB   . TYR A 1 18 ? -32.527 0.125   -16.087 1.00 0.00 ? 18 TYR A CB   4  
ATOM 3380  C CG   . TYR A 1 18 ? -32.459 0.423   -14.609 1.00 0.00 ? 18 TYR A CG   4  
ATOM 3381  C CD1  . TYR A 1 18 ? -31.384 -0.048  -13.848 1.00 0.00 ? 18 TYR A CD1  4  
ATOM 3382  C CD2  . TYR A 1 18 ? -33.472 1.174   -14.000 1.00 0.00 ? 18 TYR A CD2  4  
ATOM 3383  C CE1  . TYR A 1 18 ? -31.320 0.229   -12.478 1.00 0.00 ? 18 TYR A CE1  4  
ATOM 3384  C CE2  . TYR A 1 18 ? -33.410 1.451   -12.629 1.00 0.00 ? 18 TYR A CE2  4  
ATOM 3385  C CZ   . TYR A 1 18 ? -32.333 0.980   -11.867 1.00 0.00 ? 18 TYR A CZ   4  
ATOM 3386  O OH   . TYR A 1 18 ? -32.272 1.254   -10.517 1.00 0.00 ? 18 TYR A OH   4  
ATOM 3387  H H    . TYR A 1 18 ? -31.116 -1.969  -15.809 1.00 0.00 ? 18 TYR A H    4  
ATOM 3388  H HA   . TYR A 1 18 ? -33.869 -1.461  -15.592 1.00 0.00 ? 18 TYR A HA   4  
ATOM 3389  H HB2  . TYR A 1 18 ? -31.537 0.199   -16.516 1.00 0.00 ? 18 TYR A HB2  4  
ATOM 3390  H HB3  . TYR A 1 18 ? -33.180 0.837   -16.568 1.00 0.00 ? 18 TYR A HB3  4  
ATOM 3391  H HD1  . TYR A 1 18 ? -30.603 -0.627  -14.317 1.00 0.00 ? 18 TYR A HD1  4  
ATOM 3392  H HD2  . TYR A 1 18 ? -34.302 1.538   -14.587 1.00 0.00 ? 18 TYR A HD2  4  
ATOM 3393  H HE1  . TYR A 1 18 ? -30.490 -0.135  -11.891 1.00 0.00 ? 18 TYR A HE1  4  
ATOM 3394  H HE2  . TYR A 1 18 ? -34.190 2.030   -12.158 1.00 0.00 ? 18 TYR A HE2  4  
ATOM 3395  H HH   . TYR A 1 18 ? -31.377 1.071   -10.217 1.00 0.00 ? 18 TYR A HH   4  
ATOM 3396  N N    . TYR A 1 19 ? -32.740 -1.628  -18.684 1.00 0.00 ? 19 TYR A N    4  
ATOM 3397  C CA   . TYR A 1 19 ? -33.187 -1.794  -20.061 1.00 0.00 ? 19 TYR A CA   4  
ATOM 3398  C C    . TYR A 1 19 ? -33.956 -3.105  -20.194 1.00 0.00 ? 19 TYR A C    4  
ATOM 3399  O O    . TYR A 1 19 ? -34.990 -3.172  -20.858 1.00 0.00 ? 19 TYR A O    4  
ATOM 3400  C CB   . TYR A 1 19 ? -31.985 -1.798  -21.007 1.00 0.00 ? 19 TYR A CB   4  
ATOM 3401  C CG   . TYR A 1 19 ? -31.379 -0.415  -21.055 1.00 0.00 ? 19 TYR A CG   4  
ATOM 3402  C CD1  . TYR A 1 19 ? -30.374 -0.060  -20.148 1.00 0.00 ? 19 TYR A CD1  4  
ATOM 3403  C CD2  . TYR A 1 19 ? -31.822 0.511   -22.008 1.00 0.00 ? 19 TYR A CD2  4  
ATOM 3404  C CE1  . TYR A 1 19 ? -29.812 1.221   -20.193 1.00 0.00 ? 19 TYR A CE1  4  
ATOM 3405  C CE2  . TYR A 1 19 ? -31.260 1.791   -22.052 1.00 0.00 ? 19 TYR A CE2  4  
ATOM 3406  C CZ   . TYR A 1 19 ? -30.255 2.147   -21.144 1.00 0.00 ? 19 TYR A CZ   4  
ATOM 3407  O OH   . TYR A 1 19 ? -29.701 3.411   -21.187 1.00 0.00 ? 19 TYR A OH   4  
ATOM 3408  H H    . TYR A 1 19 ? -31.783 -1.677  -18.474 1.00 0.00 ? 19 TYR A H    4  
ATOM 3409  H HA   . TYR A 1 19 ? -33.839 -0.974  -20.324 1.00 0.00 ? 19 TYR A HA   4  
ATOM 3410  H HB2  . TYR A 1 19 ? -31.248 -2.503  -20.650 1.00 0.00 ? 19 TYR A HB2  4  
ATOM 3411  H HB3  . TYR A 1 19 ? -32.305 -2.083  -21.997 1.00 0.00 ? 19 TYR A HB3  4  
ATOM 3412  H HD1  . TYR A 1 19 ? -30.032 -0.774  -19.414 1.00 0.00 ? 19 TYR A HD1  4  
ATOM 3413  H HD2  . TYR A 1 19 ? -32.597 0.237   -22.707 1.00 0.00 ? 19 TYR A HD2  4  
ATOM 3414  H HE1  . TYR A 1 19 ? -29.037 1.496   -19.492 1.00 0.00 ? 19 TYR A HE1  4  
ATOM 3415  H HE2  . TYR A 1 19 ? -31.602 2.506   -22.786 1.00 0.00 ? 19 TYR A HE2  4  
ATOM 3416  H HH   . TYR A 1 19 ? -30.390 4.026   -21.451 1.00 0.00 ? 19 TYR A HH   4  
ATOM 3417  N N    . ASP A 1 20 ? -33.441 -4.140  -19.536 1.00 0.00 ? 20 ASP A N    4  
ATOM 3418  C CA   . ASP A 1 20 ? -34.074 -5.454  -19.552 1.00 0.00 ? 20 ASP A CA   4  
ATOM 3419  C C    . ASP A 1 20 ? -35.344 -5.445  -18.704 1.00 0.00 ? 20 ASP A C    4  
ATOM 3420  O O    . ASP A 1 20 ? -36.254 -6.245  -18.917 1.00 0.00 ? 20 ASP A O    4  
ATOM 3421  C CB   . ASP A 1 20 ? -33.105 -6.509  -19.014 1.00 0.00 ? 20 ASP A CB   4  
ATOM 3422  C CG   . ASP A 1 20 ? -33.670 -7.905  -19.253 1.00 0.00 ? 20 ASP A CG   4  
ATOM 3423  O OD1  . ASP A 1 20 ? -34.829 -8.001  -19.615 1.00 0.00 ? 20 ASP A OD1  4  
ATOM 3424  O OD2  . ASP A 1 20 ? -32.933 -8.860  -19.068 1.00 0.00 ? 20 ASP A OD2  4  
ATOM 3425  H H    . ASP A 1 20 ? -32.620 -4.013  -19.016 1.00 0.00 ? 20 ASP A H    4  
ATOM 3426  H HA   . ASP A 1 20 ? -34.335 -5.704  -20.569 1.00 0.00 ? 20 ASP A HA   4  
ATOM 3427  H HB2  . ASP A 1 20 ? -32.156 -6.415  -19.522 1.00 0.00 ? 20 ASP A HB2  4  
ATOM 3428  H HB3  . ASP A 1 20 ? -32.961 -6.357  -17.955 1.00 0.00 ? 20 ASP A HB3  4  
ATOM 3429  N N    . TYR A 1 21 ? -35.382 -4.543  -17.729 1.00 0.00 ? 21 TYR A N    4  
ATOM 3430  C CA   . TYR A 1 21 ? -36.525 -4.443  -16.828 1.00 0.00 ? 21 TYR A CA   4  
ATOM 3431  C C    . TYR A 1 21 ? -37.797 -4.087  -17.592 1.00 0.00 ? 21 TYR A C    4  
ATOM 3432  O O    . TYR A 1 21 ? -38.856 -4.647  -17.329 1.00 0.00 ? 21 TYR A O    4  
ATOM 3433  C CB   . TYR A 1 21 ? -36.258 -3.381  -15.760 1.00 0.00 ? 21 TYR A CB   4  
ATOM 3434  C CG   . TYR A 1 21 ? -37.454 -3.275  -14.844 1.00 0.00 ? 21 TYR A CG   4  
ATOM 3435  C CD1  . TYR A 1 21 ? -37.651 -4.227  -13.838 1.00 0.00 ? 21 TYR A CD1  4  
ATOM 3436  C CD2  . TYR A 1 21 ? -38.367 -2.224  -15.004 1.00 0.00 ? 21 TYR A CD2  4  
ATOM 3437  C CE1  . TYR A 1 21 ? -38.760 -4.130  -12.989 1.00 0.00 ? 21 TYR A CE1  4  
ATOM 3438  C CE2  . TYR A 1 21 ? -39.475 -2.127  -14.156 1.00 0.00 ? 21 TYR A CE2  4  
ATOM 3439  C CZ   . TYR A 1 21 ? -39.672 -3.080  -13.148 1.00 0.00 ? 21 TYR A CZ   4  
ATOM 3440  O OH   . TYR A 1 21 ? -40.765 -2.983  -12.312 1.00 0.00 ? 21 TYR A OH   4  
ATOM 3441  H H    . TYR A 1 21 ? -34.619 -3.942  -17.599 1.00 0.00 ? 21 TYR A H    4  
ATOM 3442  H HA   . TYR A 1 21 ? -36.669 -5.394  -16.341 1.00 0.00 ? 21 TYR A HA   4  
ATOM 3443  H HB2  . TYR A 1 21 ? -35.387 -3.660  -15.185 1.00 0.00 ? 21 TYR A HB2  4  
ATOM 3444  H HB3  . TYR A 1 21 ? -36.086 -2.427  -16.235 1.00 0.00 ? 21 TYR A HB3  4  
ATOM 3445  H HD1  . TYR A 1 21 ? -36.947 -5.037  -13.716 1.00 0.00 ? 21 TYR A HD1  4  
ATOM 3446  H HD2  . TYR A 1 21 ? -38.215 -1.490  -15.781 1.00 0.00 ? 21 TYR A HD2  4  
ATOM 3447  H HE1  . TYR A 1 21 ? -38.912 -4.864  -12.213 1.00 0.00 ? 21 TYR A HE1  4  
ATOM 3448  H HE2  . TYR A 1 21 ? -40.180 -1.317  -14.278 1.00 0.00 ? 21 TYR A HE2  4  
ATOM 3449  H HH   . TYR A 1 21 ? -40.443 -2.871  -11.414 1.00 0.00 ? 21 TYR A HH   4  
ATOM 3450  N N    . GLU A 1 22 ? -37.699 -3.142  -18.517 1.00 0.00 ? 22 GLU A N    4  
ATOM 3451  C CA   . GLU A 1 22 ? -38.873 -2.722  -19.276 1.00 0.00 ? 22 GLU A CA   4  
ATOM 3452  C C    . GLU A 1 22 ? -39.492 -3.905  -20.017 1.00 0.00 ? 22 GLU A C    4  
ATOM 3453  O O    . GLU A 1 22 ? -40.716 -4.024  -20.090 1.00 0.00 ? 22 GLU A O    4  
ATOM 3454  C CB   . GLU A 1 22 ? -38.484 -1.636  -20.281 1.00 0.00 ? 22 GLU A CB   4  
ATOM 3455  C CG   . GLU A 1 22 ? -38.151 -0.344  -19.535 1.00 0.00 ? 22 GLU A CG   4  
ATOM 3456  C CD   . GLU A 1 22 ? -37.591 0.690   -20.507 1.00 0.00 ? 22 GLU A CD   4  
ATOM 3457  O OE1  . GLU A 1 22 ? -37.272 0.313   -21.622 1.00 0.00 ? 22 GLU A OE1  4  
ATOM 3458  O OE2  . GLU A 1 22 ? -37.494 1.844   -20.121 1.00 0.00 ? 22 GLU A OE2  4  
ATOM 3459  H H    . GLU A 1 22 ? -36.837 -2.702  -18.671 1.00 0.00 ? 22 GLU A H    4  
ATOM 3460  H HA   . GLU A 1 22 ? -39.603 -2.314  -18.593 1.00 0.00 ? 22 GLU A HA   4  
ATOM 3461  H HB2  . GLU A 1 22 ? -37.619 -1.962  -20.843 1.00 0.00 ? 22 GLU A HB2  4  
ATOM 3462  H HB3  . GLU A 1 22 ? -39.307 -1.458  -20.956 1.00 0.00 ? 22 GLU A HB3  4  
ATOM 3463  H HG2  . GLU A 1 22 ? -39.047 0.045   -19.074 1.00 0.00 ? 22 GLU A HG2  4  
ATOM 3464  H HG3  . GLU A 1 22 ? -37.414 -0.549  -18.772 1.00 0.00 ? 22 GLU A HG3  4  
ATOM 3465  N N    . THR A 1 23 ? -38.654 -4.775  -20.567 1.00 0.00 ? 23 THR A N    4  
ATOM 3466  C CA   . THR A 1 23 ? -39.153 -5.938  -21.296 1.00 0.00 ? 23 THR A CA   4  
ATOM 3467  C C    . THR A 1 23 ? -39.878 -6.898  -20.352 1.00 0.00 ? 23 THR A C    4  
ATOM 3468  O O    . THR A 1 23 ? -40.747 -7.655  -20.773 1.00 0.00 ? 23 THR A O    4  
ATOM 3469  C CB   . THR A 1 23 ? -37.990 -6.667  -21.974 1.00 0.00 ? 23 THR A CB   4  
ATOM 3470  O OG1  . THR A 1 23 ? -37.056 -7.084  -20.988 1.00 0.00 ? 23 THR A OG1  4  
ATOM 3471  C CG2  . THR A 1 23 ? -37.304 -5.726  -22.966 1.00 0.00 ? 23 THR A CG2  4  
ATOM 3472  H H    . THR A 1 23 ? -37.687 -4.632  -20.488 1.00 0.00 ? 23 THR A H    4  
ATOM 3473  H HA   . THR A 1 23 ? -39.845 -5.605  -22.054 1.00 0.00 ? 23 THR A HA   4  
ATOM 3474  H HB   . THR A 1 23 ? -38.365 -7.529  -22.503 1.00 0.00 ? 23 THR A HB   4  
ATOM 3475  H HG1  . THR A 1 23 ? -36.423 -7.671  -21.409 1.00 0.00 ? 23 THR A HG1  4  
ATOM 3476  H HG21 . THR A 1 23 ? -37.886 -5.672  -23.873 1.00 0.00 ? 23 THR A HG21 4  
ATOM 3477  H HG22 . THR A 1 23 ? -36.316 -6.102  -23.194 1.00 0.00 ? 23 THR A HG22 4  
ATOM 3478  H HG23 . THR A 1 23 ? -37.222 -4.741  -22.530 1.00 0.00 ? 23 THR A HG23 4  
ATOM 3479  N N    . VAL A 1 24 ? -39.494 -6.872  -19.081 1.00 0.00 ? 24 VAL A N    4  
ATOM 3480  C CA   . VAL A 1 24 ? -40.081 -7.761  -18.076 1.00 0.00 ? 24 VAL A CA   4  
ATOM 3481  C C    . VAL A 1 24 ? -41.601 -7.830  -18.197 1.00 0.00 ? 24 VAL A C    4  
ATOM 3482  O O    . VAL A 1 24 ? -42.216 -8.806  -17.775 1.00 0.00 ? 24 VAL A O    4  
ATOM 3483  C CB   . VAL A 1 24 ? -39.714 -7.282  -16.669 1.00 0.00 ? 24 VAL A CB   4  
ATOM 3484  C CG1  . VAL A 1 24 ? -40.671 -6.169  -16.229 1.00 0.00 ? 24 VAL A CG1  4  
ATOM 3485  C CG2  . VAL A 1 24 ? -39.817 -8.455  -15.692 1.00 0.00 ? 24 VAL A CG2  4  
ATOM 3486  H H    . VAL A 1 24 ? -38.766 -6.274  -18.814 1.00 0.00 ? 24 VAL A H    4  
ATOM 3487  H HA   . VAL A 1 24 ? -39.679 -8.753  -18.216 1.00 0.00 ? 24 VAL A HA   4  
ATOM 3488  H HB   . VAL A 1 24 ? -38.702 -6.904  -16.672 1.00 0.00 ? 24 VAL A HB   4  
ATOM 3489  H HG11 . VAL A 1 24 ? -41.543 -6.607  -15.771 1.00 0.00 ? 24 VAL A HG11 4  
ATOM 3490  H HG12 . VAL A 1 24 ? -40.971 -5.585  -17.088 1.00 0.00 ? 24 VAL A HG12 4  
ATOM 3491  H HG13 . VAL A 1 24 ? -40.172 -5.529  -15.516 1.00 0.00 ? 24 VAL A HG13 4  
ATOM 3492  H HG21 . VAL A 1 24 ? -39.067 -9.193  -15.934 1.00 0.00 ? 24 VAL A HG21 4  
ATOM 3493  H HG22 . VAL A 1 24 ? -40.798 -8.901  -15.767 1.00 0.00 ? 24 VAL A HG22 4  
ATOM 3494  H HG23 . VAL A 1 24 ? -39.659 -8.098  -14.684 1.00 0.00 ? 24 VAL A HG23 4  
ATOM 3495  N N    . ARG A 1 25 ? -42.206 -6.808  -18.781 1.00 0.00 ? 25 ARG A N    4  
ATOM 3496  C CA   . ARG A 1 25 ? -43.656 -6.820  -18.948 1.00 0.00 ? 25 ARG A CA   4  
ATOM 3497  C C    . ARG A 1 25 ? -44.051 -7.822  -20.036 1.00 0.00 ? 25 ARG A C    4  
ATOM 3498  O O    . ARG A 1 25 ? -44.868 -8.716  -19.812 1.00 0.00 ? 25 ARG A O    4  
ATOM 3499  C CB   . ARG A 1 25 ? -44.156 -5.423  -19.323 1.00 0.00 ? 25 ARG A CB   4  
ATOM 3500  C CG   . ARG A 1 25 ? -45.679 -5.447  -19.471 1.00 0.00 ? 25 ARG A CG   4  
ATOM 3501  C CD   . ARG A 1 25 ? -46.194 -4.024  -19.691 1.00 0.00 ? 25 ARG A CD   4  
ATOM 3502  N NE   . ARG A 1 25 ? -47.638 -4.035  -19.888 1.00 0.00 ? 25 ARG A NE   4  
ATOM 3503  C CZ   . ARG A 1 25 ? -48.471 -4.102  -18.854 1.00 0.00 ? 25 ARG A CZ   4  
ATOM 3504  N NH1  . ARG A 1 25 ? -47.998 -4.160  -17.639 1.00 0.00 ? 25 ARG A NH1  4  
ATOM 3505  N NH2  . ARG A 1 25 ? -49.761 -4.108  -19.054 1.00 0.00 ? 25 ARG A NH2  4  
ATOM 3506  H H    . ARG A 1 25 ? -41.660 -6.080  -19.145 1.00 0.00 ? 25 ARG A H    4  
ATOM 3507  H HA   . ARG A 1 25 ? -44.112 -7.118  -18.015 1.00 0.00 ? 25 ARG A HA   4  
ATOM 3508  H HB2  . ARG A 1 25 ? -43.881 -4.723  -18.547 1.00 0.00 ? 25 ARG A HB2  4  
ATOM 3509  H HB3  . ARG A 1 25 ? -43.710 -5.120  -20.257 1.00 0.00 ? 25 ARG A HB3  4  
ATOM 3510  H HG2  . ARG A 1 25 ? -45.949 -6.061  -20.318 1.00 0.00 ? 25 ARG A HG2  4  
ATOM 3511  H HG3  . ARG A 1 25 ? -46.122 -5.853  -18.575 1.00 0.00 ? 25 ARG A HG3  4  
ATOM 3512  H HD2  . ARG A 1 25 ? -45.957 -3.421  -18.828 1.00 0.00 ? 25 ARG A HD2  4  
ATOM 3513  H HD3  . ARG A 1 25 ? -45.714 -3.601  -20.563 1.00 0.00 ? 25 ARG A HD3  4  
ATOM 3514  H HE   . ARG A 1 25 ? -48.001 -3.995  -20.797 1.00 0.00 ? 25 ARG A HE   4  
ATOM 3515  H HH11 . ARG A 1 25 ? -47.010 -4.156  -17.486 1.00 0.00 ? 25 ARG A HH11 4  
ATOM 3516  H HH12 . ARG A 1 25 ? -48.624 -4.209  -16.860 1.00 0.00 ? 25 ARG A HH12 4  
ATOM 3517  H HH21 . ARG A 1 25 ? -50.122 -4.064  -19.985 1.00 0.00 ? 25 ARG A HH21 4  
ATOM 3518  H HH22 . ARG A 1 25 ? -50.386 -4.157  -18.277 1.00 0.00 ? 25 ARG A HH22 4  
ATOM 3519  N N    . ASN A 1 26 ? -43.462 -7.652  -21.217 1.00 0.00 ? 26 ASN A N    4  
ATOM 3520  C CA   . ASN A 1 26 ? -43.743 -8.529  -22.355 1.00 0.00 ? 26 ASN A CA   4  
ATOM 3521  C C    . ASN A 1 26 ? -42.751 -9.688  -22.439 1.00 0.00 ? 26 ASN A C    4  
ATOM 3522  O O    . ASN A 1 26 ? -42.857 -10.541 -23.324 1.00 0.00 ? 26 ASN A O    4  
ATOM 3523  C CB   . ASN A 1 26 ? -43.688 -7.723  -23.655 1.00 0.00 ? 26 ASN A CB   4  
ATOM 3524  C CG   . ASN A 1 26 ? -44.875 -6.768  -23.728 1.00 0.00 ? 26 ASN A CG   4  
ATOM 3525  O OD1  . ASN A 1 26 ? -45.881 -6.972  -23.048 1.00 0.00 ? 26 ASN A OD1  4  
ATOM 3526  N ND2  . ASN A 1 26 ? -44.817 -5.731  -24.517 1.00 0.00 ? 26 ASN A ND2  4  
ATOM 3527  H H    . ASN A 1 26 ? -42.835 -6.907  -21.325 1.00 0.00 ? 26 ASN A H    4  
ATOM 3528  H HA   . ASN A 1 26 ? -44.738 -8.932  -22.243 1.00 0.00 ? 26 ASN A HA   4  
ATOM 3529  H HB2  . ASN A 1 26 ? -42.770 -7.157  -23.685 1.00 0.00 ? 26 ASN A HB2  4  
ATOM 3530  H HB3  . ASN A 1 26 ? -43.721 -8.399  -24.497 1.00 0.00 ? 26 ASN A HB3  4  
ATOM 3531  H HD21 . ASN A 1 26 ? -44.016 -5.570  -25.057 1.00 0.00 ? 26 ASN A HD21 4  
ATOM 3532  H HD22 . ASN A 1 26 ? -45.576 -5.113  -24.571 1.00 0.00 ? 26 ASN A HD22 4  
ATOM 3533  N N    . GLY A 1 27 ? -41.775 -9.708  -21.537 1.00 0.00 ? 27 GLY A N    4  
ATOM 3534  C CA   . GLY A 1 27 ? -40.761 -10.758 -21.552 1.00 0.00 ? 27 GLY A CA   4  
ATOM 3535  C C    . GLY A 1 27 ? -41.362 -12.147 -21.347 1.00 0.00 ? 27 GLY A C    4  
ATOM 3536  O O    . GLY A 1 27 ? -40.981 -13.100 -22.026 1.00 0.00 ? 27 GLY A O    4  
ATOM 3537  H H    . GLY A 1 27 ? -41.729 -9.007  -20.855 1.00 0.00 ? 27 GLY A H    4  
ATOM 3538  H HA2  . GLY A 1 27 ? -40.245 -10.734 -22.500 1.00 0.00 ? 27 GLY A HA2  4  
ATOM 3539  H HA3  . GLY A 1 27 ? -40.049 -10.566 -20.763 1.00 0.00 ? 27 GLY A HA3  4  
ATOM 3540  N N    . GLY A 1 28 ? -42.287 -12.264 -20.402 1.00 0.00 ? 28 GLY A N    4  
ATOM 3541  C CA   . GLY A 1 28 ? -42.910 -13.553 -20.116 1.00 0.00 ? 28 GLY A CA   4  
ATOM 3542  C C    . GLY A 1 28 ? -43.699 -14.089 -21.309 1.00 0.00 ? 28 GLY A C    4  
ATOM 3543  O O    . GLY A 1 28 ? -43.648 -15.281 -21.610 1.00 0.00 ? 28 GLY A O    4  
ATOM 3544  H H    . GLY A 1 28 ? -42.548 -11.476 -19.879 1.00 0.00 ? 28 GLY A H    4  
ATOM 3545  H HA2  . GLY A 1 28 ? -42.140 -14.264 -19.858 1.00 0.00 ? 28 GLY A HA2  4  
ATOM 3546  H HA3  . GLY A 1 28 ? -43.580 -13.440 -19.276 1.00 0.00 ? 28 GLY A HA3  4  
ATOM 3547  N N    . LEU A 1 29 ? -44.458 -13.213 -21.957 1.00 0.00 ? 29 LEU A N    4  
ATOM 3548  C CA   . LEU A 1 29 ? -45.284 -13.640 -23.084 1.00 0.00 ? 29 LEU A CA   4  
ATOM 3549  C C    . LEU A 1 29 ? -44.432 -14.225 -24.209 1.00 0.00 ? 29 LEU A C    4  
ATOM 3550  O O    . LEU A 1 29 ? -44.754 -15.288 -24.746 1.00 0.00 ? 29 LEU A O    4  
ATOM 3551  C CB   . LEU A 1 29 ? -46.083 -12.448 -23.619 1.00 0.00 ? 29 LEU A CB   4  
ATOM 3552  C CG   . LEU A 1 29 ? -47.156 -12.042 -22.602 1.00 0.00 ? 29 LEU A CG   4  
ATOM 3553  C CD1  . LEU A 1 29 ? -47.810 -10.732 -23.050 1.00 0.00 ? 29 LEU A CD1  4  
ATOM 3554  C CD2  . LEU A 1 29 ? -48.232 -13.132 -22.493 1.00 0.00 ? 29 LEU A CD2  4  
ATOM 3555  H H    . LEU A 1 29 ? -44.489 -12.288 -21.637 1.00 0.00 ? 29 LEU A H    4  
ATOM 3556  H HA   . LEU A 1 29 ? -45.974 -14.395 -22.742 1.00 0.00 ? 29 LEU A HA   4  
ATOM 3557  H HB2  . LEU A 1 29 ? -45.413 -11.616 -23.783 1.00 0.00 ? 29 LEU A HB2  4  
ATOM 3558  H HB3  . LEU A 1 29 ? -46.552 -12.716 -24.555 1.00 0.00 ? 29 LEU A HB3  4  
ATOM 3559  H HG   . LEU A 1 29 ? -46.694 -11.896 -21.636 1.00 0.00 ? 29 LEU A HG   4  
ATOM 3560  H HD11 . LEU A 1 29 ? -47.591 -10.559 -24.093 1.00 0.00 ? 29 LEU A HD11 4  
ATOM 3561  H HD12 . LEU A 1 29 ? -47.419 -9.916  -22.459 1.00 0.00 ? 29 LEU A HD12 4  
ATOM 3562  H HD13 . LEU A 1 29 ? -48.879 -10.798 -22.911 1.00 0.00 ? 29 LEU A HD13 4  
ATOM 3563  H HD21 . LEU A 1 29 ? -49.209 -12.672 -22.478 1.00 0.00 ? 29 LEU A HD21 4  
ATOM 3564  H HD22 . LEU A 1 29 ? -48.085 -13.690 -21.581 1.00 0.00 ? 29 LEU A HD22 4  
ATOM 3565  H HD23 . LEU A 1 29 ? -48.164 -13.801 -23.337 1.00 0.00 ? 29 LEU A HD23 4  
ATOM 3566  N N    . ILE A 1 30 ? -43.356 -13.537 -24.573 1.00 0.00 ? 30 ILE A N    4  
ATOM 3567  C CA   . ILE A 1 30 ? -42.499 -14.019 -25.650 1.00 0.00 ? 30 ILE A CA   4  
ATOM 3568  C C    . ILE A 1 30 ? -41.739 -15.278 -25.236 1.00 0.00 ? 30 ILE A C    4  
ATOM 3569  O O    . ILE A 1 30 ? -41.557 -16.194 -26.041 1.00 0.00 ? 30 ILE A O    4  
ATOM 3570  C CB   . ILE A 1 30 ? -41.519 -12.918 -26.079 1.00 0.00 ? 30 ILE A CB   4  
ATOM 3571  C CG1  . ILE A 1 30 ? -40.637 -12.501 -24.900 1.00 0.00 ? 30 ILE A CG1  4  
ATOM 3572  C CG2  . ILE A 1 30 ? -42.307 -11.702 -26.571 1.00 0.00 ? 30 ILE A CG2  4  
ATOM 3573  C CD1  . ILE A 1 30 ? -39.600 -11.482 -25.376 1.00 0.00 ? 30 ILE A CD1  4  
ATOM 3574  H H    . ILE A 1 30 ? -43.151 -12.679 -24.143 1.00 0.00 ? 30 ILE A H    4  
ATOM 3575  H HA   . ILE A 1 30 ? -43.124 -14.264 -26.496 1.00 0.00 ? 30 ILE A HA   4  
ATOM 3576  H HB   . ILE A 1 30 ? -40.898 -13.288 -26.882 1.00 0.00 ? 30 ILE A HB   4  
ATOM 3577  H HG12 . ILE A 1 30 ? -41.251 -12.062 -24.128 1.00 0.00 ? 30 ILE A HG12 4  
ATOM 3578  H HG13 . ILE A 1 30 ? -40.126 -13.365 -24.505 1.00 0.00 ? 30 ILE A HG13 4  
ATOM 3579  H HG21 . ILE A 1 30 ? -41.632 -11.001 -27.041 1.00 0.00 ? 30 ILE A HG21 4  
ATOM 3580  H HG22 . ILE A 1 30 ? -42.794 -11.225 -25.733 1.00 0.00 ? 30 ILE A HG22 4  
ATOM 3581  H HG23 . ILE A 1 30 ? -43.051 -12.019 -27.286 1.00 0.00 ? 30 ILE A HG23 4  
ATOM 3582  H HD11 . ILE A 1 30 ? -40.101 -10.580 -25.693 1.00 0.00 ? 30 ILE A HD11 4  
ATOM 3583  H HD12 . ILE A 1 30 ? -39.043 -11.895 -26.204 1.00 0.00 ? 30 ILE A HD12 4  
ATOM 3584  H HD13 . ILE A 1 30 ? -38.924 -11.252 -24.566 1.00 0.00 ? 30 ILE A HD13 4  
ATOM 3585  N N    . PHE A 1 31 ? -41.310 -15.331 -23.980 1.00 0.00 ? 31 PHE A N    4  
ATOM 3586  C CA   . PHE A 1 31 ? -40.588 -16.494 -23.481 1.00 0.00 ? 31 PHE A CA   4  
ATOM 3587  C C    . PHE A 1 31 ? -41.458 -17.743 -23.547 1.00 0.00 ? 31 PHE A C    4  
ATOM 3588  O O    . PHE A 1 31 ? -41.016 -18.799 -23.997 1.00 0.00 ? 31 PHE A O    4  
ATOM 3589  C CB   . PHE A 1 31 ? -40.143 -16.252 -22.038 1.00 0.00 ? 31 PHE A CB   4  
ATOM 3590  C CG   . PHE A 1 31 ? -39.436 -17.480 -21.515 1.00 0.00 ? 31 PHE A CG   4  
ATOM 3591  C CD1  . PHE A 1 31 ? -38.107 -17.731 -21.882 1.00 0.00 ? 31 PHE A CD1  4  
ATOM 3592  C CD2  . PHE A 1 31 ? -40.106 -18.367 -20.663 1.00 0.00 ? 31 PHE A CD2  4  
ATOM 3593  C CE1  . PHE A 1 31 ? -37.450 -18.869 -21.396 1.00 0.00 ? 31 PHE A CE1  4  
ATOM 3594  C CE2  . PHE A 1 31 ? -39.449 -19.504 -20.178 1.00 0.00 ? 31 PHE A CE2  4  
ATOM 3595  C CZ   . PHE A 1 31 ? -38.122 -19.756 -20.545 1.00 0.00 ? 31 PHE A CZ   4  
ATOM 3596  H H    . PHE A 1 31 ? -41.496 -14.595 -23.361 1.00 0.00 ? 31 PHE A H    4  
ATOM 3597  H HA   . PHE A 1 31 ? -39.711 -16.647 -24.092 1.00 0.00 ? 31 PHE A HA   4  
ATOM 3598  H HB2  . PHE A 1 31 ? -39.471 -15.407 -22.004 1.00 0.00 ? 31 PHE A HB2  4  
ATOM 3599  H HB3  . PHE A 1 31 ? -41.009 -16.049 -21.424 1.00 0.00 ? 31 PHE A HB3  4  
ATOM 3600  H HD1  . PHE A 1 31 ? -37.591 -17.048 -22.539 1.00 0.00 ? 31 PHE A HD1  4  
ATOM 3601  H HD2  . PHE A 1 31 ? -41.130 -18.173 -20.381 1.00 0.00 ? 31 PHE A HD2  4  
ATOM 3602  H HE1  . PHE A 1 31 ? -36.427 -19.062 -21.680 1.00 0.00 ? 31 PHE A HE1  4  
ATOM 3603  H HE2  . PHE A 1 31 ? -39.966 -20.188 -19.522 1.00 0.00 ? 31 PHE A HE2  4  
ATOM 3604  H HZ   . PHE A 1 31 ? -37.613 -20.632 -20.171 1.00 0.00 ? 31 PHE A HZ   4  
ATOM 3605  N N    . ALA A 1 32 ? -42.693 -17.619 -23.065 1.00 0.00 ? 32 ALA A N    4  
ATOM 3606  C CA   . ALA A 1 32 ? -43.612 -18.751 -23.041 1.00 0.00 ? 32 ALA A CA   4  
ATOM 3607  C C    . ALA A 1 32 ? -43.871 -19.299 -24.441 1.00 0.00 ? 32 ALA A C    4  
ATOM 3608  O O    . ALA A 1 32 ? -43.904 -20.514 -24.630 1.00 0.00 ? 32 ALA A O    4  
ATOM 3609  C CB   . ALA A 1 32 ? -44.939 -18.325 -22.409 1.00 0.00 ? 32 ALA A CB   4  
ATOM 3610  H H    . ALA A 1 32 ? -42.981 -16.762 -22.693 1.00 0.00 ? 32 ALA A H    4  
ATOM 3611  H HA   . ALA A 1 32 ? -43.182 -19.535 -22.436 1.00 0.00 ? 32 ALA A HA   4  
ATOM 3612  H HB1  . ALA A 1 32 ? -44.758 -17.544 -21.685 1.00 0.00 ? 32 ALA A HB1  4  
ATOM 3613  H HB2  . ALA A 1 32 ? -45.393 -19.173 -21.918 1.00 0.00 ? 32 ALA A HB2  4  
ATOM 3614  H HB3  . ALA A 1 32 ? -45.601 -17.956 -23.179 1.00 0.00 ? 32 ALA A HB3  4  
ATOM 3615  N N    . GLY A 1 33 ? -44.053 -18.419 -25.421 1.00 0.00 ? 33 GLY A N    4  
ATOM 3616  C CA   . GLY A 1 33 ? -44.309 -18.876 -26.783 1.00 0.00 ? 33 GLY A CA   4  
ATOM 3617  C C    . GLY A 1 33 ? -43.148 -19.721 -27.296 1.00 0.00 ? 33 GLY A C    4  
ATOM 3618  O O    . GLY A 1 33 ? -43.350 -20.752 -27.942 1.00 0.00 ? 33 GLY A O    4  
ATOM 3619  H H    . GLY A 1 33 ? -44.026 -17.454 -25.238 1.00 0.00 ? 33 GLY A H    4  
ATOM 3620  H HA2  . GLY A 1 33 ? -45.215 -19.467 -26.797 1.00 0.00 ? 33 GLY A HA2  4  
ATOM 3621  H HA3  . GLY A 1 33 ? -44.435 -18.020 -27.429 1.00 0.00 ? 33 GLY A HA3  4  
ATOM 3622  N N    . LEU A 1 34 ? -41.934 -19.296 -26.975 1.00 0.00 ? 34 LEU A N    4  
ATOM 3623  C CA   . LEU A 1 34 ? -40.745 -20.036 -27.375 1.00 0.00 ? 34 LEU A CA   4  
ATOM 3624  C C    . LEU A 1 34 ? -40.701 -21.372 -26.638 1.00 0.00 ? 34 LEU A C    4  
ATOM 3625  O O    . LEU A 1 34 ? -40.319 -22.402 -27.197 1.00 0.00 ? 34 LEU A O    4  
ATOM 3626  C CB   . LEU A 1 34 ? -39.485 -19.216 -27.059 1.00 0.00 ? 34 LEU A CB   4  
ATOM 3627  C CG   . LEU A 1 34 ? -38.228 -19.981 -27.492 1.00 0.00 ? 34 LEU A CG   4  
ATOM 3628  C CD1  . LEU A 1 34 ? -38.267 -20.234 -29.002 1.00 0.00 ? 34 LEU A CD1  4  
ATOM 3629  C CD2  . LEU A 1 34 ? -36.992 -19.145 -27.156 1.00 0.00 ? 34 LEU A CD2  4  
ATOM 3630  H H    . LEU A 1 34 ? -41.836 -18.490 -26.420 1.00 0.00 ? 34 LEU A H    4  
ATOM 3631  H HA   . LEU A 1 34 ? -40.790 -20.221 -28.438 1.00 0.00 ? 34 LEU A HA   4  
ATOM 3632  H HB2  . LEU A 1 34 ? -39.532 -18.274 -27.584 1.00 0.00 ? 34 LEU A HB2  4  
ATOM 3633  H HB3  . LEU A 1 34 ? -39.440 -19.031 -25.996 1.00 0.00 ? 34 LEU A HB3  4  
ATOM 3634  H HG   . LEU A 1 34 ? -38.177 -20.924 -26.969 1.00 0.00 ? 34 LEU A HG   4  
ATOM 3635  H HD11 . LEU A 1 34 ? -38.778 -21.165 -29.196 1.00 0.00 ? 34 LEU A HD11 4  
ATOM 3636  H HD12 . LEU A 1 34 ? -37.258 -20.291 -29.383 1.00 0.00 ? 34 LEU A HD12 4  
ATOM 3637  H HD13 . LEU A 1 34 ? -38.791 -19.427 -29.489 1.00 0.00 ? 34 LEU A HD13 4  
ATOM 3638  H HD21 . LEU A 1 34 ? -37.141 -18.129 -27.490 1.00 0.00 ? 34 LEU A HD21 4  
ATOM 3639  H HD22 . LEU A 1 34 ? -36.127 -19.564 -27.649 1.00 0.00 ? 34 LEU A HD22 4  
ATOM 3640  H HD23 . LEU A 1 34 ? -36.832 -19.152 -26.087 1.00 0.00 ? 34 LEU A HD23 4  
ATOM 3641  N N    . ALA A 1 35 ? -41.085 -21.328 -25.367 1.00 0.00 ? 35 ALA A N    4  
ATOM 3642  C CA   . ALA A 1 35 ? -41.075 -22.528 -24.539 1.00 0.00 ? 35 ALA A CA   4  
ATOM 3643  C C    . ALA A 1 35 ? -41.983 -23.599 -25.141 1.00 0.00 ? 35 ALA A C    4  
ATOM 3644  O O    . ALA A 1 35 ? -41.589 -24.753 -25.249 1.00 0.00 ? 35 ALA A O    4  
ATOM 3645  C CB   . ALA A 1 35 ? -41.546 -22.190 -23.124 1.00 0.00 ? 35 ALA A CB   4  
ATOM 3646  H H    . ALA A 1 35 ? -41.364 -20.460 -25.008 1.00 0.00 ? 35 ALA A H    4  
ATOM 3647  H HA   . ALA A 1 35 ? -40.067 -22.911 -24.490 1.00 0.00 ? 35 ALA A HA   4  
ATOM 3648  H HB1  . ALA A 1 35 ? -41.267 -21.175 -22.885 1.00 0.00 ? 35 ALA A HB1  4  
ATOM 3649  H HB2  . ALA A 1 35 ? -41.085 -22.867 -22.420 1.00 0.00 ? 35 ALA A HB2  4  
ATOM 3650  H HB3  . ALA A 1 35 ? -42.621 -22.290 -23.068 1.00 0.00 ? 35 ALA A HB3  4  
ATOM 3651  N N    . PHE A 1 36 ? -43.209 -23.217 -25.496 1.00 0.00 ? 36 PHE A N    4  
ATOM 3652  C CA   . PHE A 1 36 ? -44.169 -24.174 -26.051 1.00 0.00 ? 36 PHE A CA   4  
ATOM 3653  C C    . PHE A 1 36 ? -43.664 -24.802 -27.353 1.00 0.00 ? 36 PHE A C    4  
ATOM 3654  O O    . PHE A 1 36 ? -43.850 -26.000 -27.583 1.00 0.00 ? 36 PHE A O    4  
ATOM 3655  C CB   . PHE A 1 36 ? -45.513 -23.490 -26.308 1.00 0.00 ? 36 PHE A CB   4  
ATOM 3656  C CG   . PHE A 1 36 ? -46.246 -23.303 -24.999 1.00 0.00 ? 36 PHE A CG   4  
ATOM 3657  C CD1  . PHE A 1 36 ? -46.701 -24.420 -24.289 1.00 0.00 ? 36 PHE A CD1  4  
ATOM 3658  C CD2  . PHE A 1 36 ? -46.465 -22.016 -24.493 1.00 0.00 ? 36 PHE A CD2  4  
ATOM 3659  C CE1  . PHE A 1 36 ? -47.377 -24.252 -23.075 1.00 0.00 ? 36 PHE A CE1  4  
ATOM 3660  C CE2  . PHE A 1 36 ? -47.142 -21.848 -23.278 1.00 0.00 ? 36 PHE A CE2  4  
ATOM 3661  C CZ   . PHE A 1 36 ? -47.597 -22.965 -22.570 1.00 0.00 ? 36 PHE A CZ   4  
ATOM 3662  H H    . PHE A 1 36 ? -43.491 -22.296 -25.314 1.00 0.00 ? 36 PHE A H    4  
ATOM 3663  H HA   . PHE A 1 36 ? -44.321 -24.963 -25.329 1.00 0.00 ? 36 PHE A HA   4  
ATOM 3664  H HB2  . PHE A 1 36 ? -45.344 -22.527 -26.768 1.00 0.00 ? 36 PHE A HB2  4  
ATOM 3665  H HB3  . PHE A 1 36 ? -46.110 -24.103 -26.968 1.00 0.00 ? 36 PHE A HB3  4  
ATOM 3666  H HD1  . PHE A 1 36 ? -46.531 -25.413 -24.679 1.00 0.00 ? 36 PHE A HD1  4  
ATOM 3667  H HD2  . PHE A 1 36 ? -46.117 -21.153 -25.041 1.00 0.00 ? 36 PHE A HD2  4  
ATOM 3668  H HE1  . PHE A 1 36 ? -47.729 -25.115 -22.528 1.00 0.00 ? 36 PHE A HE1  4  
ATOM 3669  H HE2  . PHE A 1 36 ? -47.311 -20.855 -22.888 1.00 0.00 ? 36 PHE A HE2  4  
ATOM 3670  H HZ   . PHE A 1 36 ? -48.119 -22.834 -21.633 1.00 0.00 ? 36 PHE A HZ   4  
ATOM 3671  N N    . ILE A 1 37 ? -43.043 -23.999 -28.210 1.00 0.00 ? 37 ILE A N    4  
ATOM 3672  C CA   . ILE A 1 37 ? -42.550 -24.517 -29.485 1.00 0.00 ? 37 ILE A CA   4  
ATOM 3673  C C    . ILE A 1 37 ? -41.550 -25.648 -29.253 1.00 0.00 ? 37 ILE A C    4  
ATOM 3674  O O    . ILE A 1 37 ? -41.600 -26.681 -29.924 1.00 0.00 ? 37 ILE A O    4  
ATOM 3675  C CB   . ILE A 1 37 ? -41.879 -23.394 -30.279 1.00 0.00 ? 37 ILE A CB   4  
ATOM 3676  C CG1  . ILE A 1 37 ? -42.942 -22.388 -30.730 1.00 0.00 ? 37 ILE A CG1  4  
ATOM 3677  C CG2  . ILE A 1 37 ? -41.182 -23.984 -31.507 1.00 0.00 ? 37 ILE A CG2  4  
ATOM 3678  C CD1  . ILE A 1 37 ? -42.261 -21.130 -31.270 1.00 0.00 ? 37 ILE A CD1  4  
ATOM 3679  H H    . ILE A 1 37 ? -42.933 -23.046 -28.002 1.00 0.00 ? 37 ILE A H    4  
ATOM 3680  H HA   . ILE A 1 37 ? -43.383 -24.897 -30.056 1.00 0.00 ? 37 ILE A HA   4  
ATOM 3681  H HB   . ILE A 1 37 ? -41.151 -22.898 -29.655 1.00 0.00 ? 37 ILE A HB   4  
ATOM 3682  H HG12 . ILE A 1 37 ? -43.549 -22.832 -31.506 1.00 0.00 ? 37 ILE A HG12 4  
ATOM 3683  H HG13 . ILE A 1 37 ? -43.567 -22.124 -29.891 1.00 0.00 ? 37 ILE A HG13 4  
ATOM 3684  H HG21 . ILE A 1 37 ? -40.140 -24.156 -31.281 1.00 0.00 ? 37 ILE A HG21 4  
ATOM 3685  H HG22 . ILE A 1 37 ? -41.262 -23.294 -32.333 1.00 0.00 ? 37 ILE A HG22 4  
ATOM 3686  H HG23 . ILE A 1 37 ? -41.652 -24.920 -31.772 1.00 0.00 ? 37 ILE A HG23 4  
ATOM 3687  H HD11 . ILE A 1 37 ? -42.720 -20.845 -32.205 1.00 0.00 ? 37 ILE A HD11 4  
ATOM 3688  H HD12 . ILE A 1 37 ? -41.211 -21.329 -31.430 1.00 0.00 ? 37 ILE A HD12 4  
ATOM 3689  H HD13 . ILE A 1 37 ? -42.370 -20.327 -30.557 1.00 0.00 ? 37 ILE A HD13 4  
ATOM 3690  N N    . VAL A 1 38 ? -40.640 -25.439 -28.314 1.00 0.00 ? 38 VAL A N    4  
ATOM 3691  C CA   . VAL A 1 38 ? -39.623 -26.442 -28.013 1.00 0.00 ? 38 VAL A CA   4  
ATOM 3692  C C    . VAL A 1 38 ? -40.272 -27.768 -27.613 1.00 0.00 ? 38 VAL A C    4  
ATOM 3693  O O    . VAL A 1 38 ? -39.803 -28.836 -27.998 1.00 0.00 ? 38 VAL A O    4  
ATOM 3694  C CB   . VAL A 1 38 ? -38.724 -25.948 -26.877 1.00 0.00 ? 38 VAL A CB   4  
ATOM 3695  C CG1  . VAL A 1 38 ? -37.814 -27.087 -26.413 1.00 0.00 ? 38 VAL A CG1  4  
ATOM 3696  C CG2  . VAL A 1 38 ? -37.866 -24.785 -27.378 1.00 0.00 ? 38 VAL A CG2  4  
ATOM 3697  H H    . VAL A 1 38 ? -40.639 -24.581 -27.839 1.00 0.00 ? 38 VAL A H    4  
ATOM 3698  H HA   . VAL A 1 38 ? -39.017 -26.600 -28.892 1.00 0.00 ? 38 VAL A HA   4  
ATOM 3699  H HB   . VAL A 1 38 ? -39.336 -25.617 -26.051 1.00 0.00 ? 38 VAL A HB   4  
ATOM 3700  H HG11 . VAL A 1 38 ? -37.455 -27.633 -27.273 1.00 0.00 ? 38 VAL A HG11 4  
ATOM 3701  H HG12 . VAL A 1 38 ? -38.372 -27.753 -25.771 1.00 0.00 ? 38 VAL A HG12 4  
ATOM 3702  H HG13 . VAL A 1 38 ? -36.975 -26.679 -25.868 1.00 0.00 ? 38 VAL A HG13 4  
ATOM 3703  H HG21 . VAL A 1 38 ? -36.931 -25.165 -27.761 1.00 0.00 ? 38 VAL A HG21 4  
ATOM 3704  H HG22 . VAL A 1 38 ? -37.669 -24.104 -26.560 1.00 0.00 ? 38 VAL A HG22 4  
ATOM 3705  H HG23 . VAL A 1 38 ? -38.391 -24.260 -28.162 1.00 0.00 ? 38 VAL A HG23 4  
ATOM 3706  N N    . GLY A 1 39 ? -41.351 -27.687 -26.841 1.00 0.00 ? 39 GLY A N    4  
ATOM 3707  C CA   . GLY A 1 39 ? -42.064 -28.877 -26.387 1.00 0.00 ? 39 GLY A CA   4  
ATOM 3708  C C    . GLY A 1 39 ? -42.606 -29.690 -27.561 1.00 0.00 ? 39 GLY A C    4  
ATOM 3709  O O    . GLY A 1 39 ? -42.617 -30.921 -27.520 1.00 0.00 ? 39 GLY A O    4  
ATOM 3710  H H    . GLY A 1 39 ? -41.676 -26.814 -26.568 1.00 0.00 ? 39 GLY A H    4  
ATOM 3711  H HA2  . GLY A 1 39 ? -41.390 -29.495 -25.812 1.00 0.00 ? 39 GLY A HA2  4  
ATOM 3712  H HA3  . GLY A 1 39 ? -42.889 -28.577 -25.760 1.00 0.00 ? 39 GLY A HA3  4  
ATOM 3713  N N    . LEU A 1 40 ? -43.065 -28.998 -28.599 1.00 0.00 ? 40 LEU A N    4  
ATOM 3714  C CA   . LEU A 1 40 ? -43.616 -29.683 -29.768 1.00 0.00 ? 40 LEU A CA   4  
ATOM 3715  C C    . LEU A 1 40 ? -42.563 -30.612 -30.379 1.00 0.00 ? 40 LEU A C    4  
ATOM 3716  O O    . LEU A 1 40 ? -42.854 -31.764 -30.706 1.00 0.00 ? 40 LEU A O    4  
ATOM 3717  C CB   . LEU A 1 40 ? -44.072 -28.648 -30.806 1.00 0.00 ? 40 LEU A CB   4  
ATOM 3718  C CG   . LEU A 1 40 ? -44.639 -29.347 -32.048 1.00 0.00 ? 40 LEU A CG   4  
ATOM 3719  C CD1  . LEU A 1 40 ? -45.845 -30.205 -31.656 1.00 0.00 ? 40 LEU A CD1  4  
ATOM 3720  C CD2  . LEU A 1 40 ? -45.084 -28.290 -33.060 1.00 0.00 ? 40 LEU A CD2  4  
ATOM 3721  H H    . LEU A 1 40 ? -43.031 -28.016 -28.569 1.00 0.00 ? 40 LEU A H    4  
ATOM 3722  H HA   . LEU A 1 40 ? -44.466 -30.272 -29.458 1.00 0.00 ? 40 LEU A HA   4  
ATOM 3723  H HB2  . LEU A 1 40 ? -44.836 -28.019 -30.370 1.00 0.00 ? 40 LEU A HB2  4  
ATOM 3724  H HB3  . LEU A 1 40 ? -43.231 -28.037 -31.094 1.00 0.00 ? 40 LEU A HB3  4  
ATOM 3725  H HG   . LEU A 1 40 ? -43.881 -29.975 -32.493 1.00 0.00 ? 40 LEU A HG   4  
ATOM 3726  H HD11 . LEU A 1 40 ? -46.367 -29.737 -30.834 1.00 0.00 ? 40 LEU A HD11 4  
ATOM 3727  H HD12 . LEU A 1 40 ? -45.507 -31.185 -31.356 1.00 0.00 ? 40 LEU A HD12 4  
ATOM 3728  H HD13 . LEU A 1 40 ? -46.512 -30.296 -32.499 1.00 0.00 ? 40 LEU A HD13 4  
ATOM 3729  H HD21 . LEU A 1 40 ? -46.149 -28.368 -33.220 1.00 0.00 ? 40 LEU A HD21 4  
ATOM 3730  H HD22 . LEU A 1 40 ? -44.567 -28.448 -33.997 1.00 0.00 ? 40 LEU A HD22 4  
ATOM 3731  H HD23 . LEU A 1 40 ? -44.847 -27.306 -32.682 1.00 0.00 ? 40 LEU A HD23 4  
ATOM 3732  N N    . LEU A 1 41 ? -41.355 -30.091 -30.558 1.00 0.00 ? 41 LEU A N    4  
ATOM 3733  C CA   . LEU A 1 41 ? -40.271 -30.861 -31.164 1.00 0.00 ? 41 LEU A CA   4  
ATOM 3734  C C    . LEU A 1 41 ? -39.981 -32.135 -30.371 1.00 0.00 ? 41 LEU A C    4  
ATOM 3735  O O    . LEU A 1 41 ? -39.628 -33.159 -30.948 1.00 0.00 ? 41 LEU A O    4  
ATOM 3736  C CB   . LEU A 1 41 ? -39.001 -30.005 -31.229 1.00 0.00 ? 41 LEU A CB   4  
ATOM 3737  C CG   . LEU A 1 41 ? -39.189 -28.871 -32.244 1.00 0.00 ? 41 LEU A CG   4  
ATOM 3738  C CD1  . LEU A 1 41 ? -38.003 -27.912 -32.157 1.00 0.00 ? 41 LEU A CD1  4  
ATOM 3739  C CD2  . LEU A 1 41 ? -39.280 -29.439 -33.668 1.00 0.00 ? 41 LEU A CD2  4  
ATOM 3740  H H    . LEU A 1 41 ? -41.209 -29.155 -30.331 1.00 0.00 ? 41 LEU A H    4  
ATOM 3741  H HA   . LEU A 1 41 ? -40.556 -31.135 -32.167 1.00 0.00 ? 41 LEU A HA   4  
ATOM 3742  H HB2  . LEU A 1 41 ? -38.809 -29.583 -30.252 1.00 0.00 ? 41 LEU A HB2  4  
ATOM 3743  H HB3  . LEU A 1 41 ? -38.165 -30.621 -31.521 1.00 0.00 ? 41 LEU A HB3  4  
ATOM 3744  H HG   . LEU A 1 41 ? -40.098 -28.335 -32.012 1.00 0.00 ? 41 LEU A HG   4  
ATOM 3745  H HD11 . LEU A 1 41 ? -37.744 -27.568 -33.149 1.00 0.00 ? 41 LEU A HD11 4  
ATOM 3746  H HD12 . LEU A 1 41 ? -37.156 -28.422 -31.721 1.00 0.00 ? 41 LEU A HD12 4  
ATOM 3747  H HD13 . LEU A 1 41 ? -38.268 -27.065 -31.542 1.00 0.00 ? 41 LEU A HD13 4  
ATOM 3748  H HD21 . LEU A 1 41 ? -38.849 -28.732 -34.363 1.00 0.00 ? 41 LEU A HD21 4  
ATOM 3749  H HD22 . LEU A 1 41 ? -40.315 -29.604 -33.924 1.00 0.00 ? 41 LEU A HD22 4  
ATOM 3750  H HD23 . LEU A 1 41 ? -38.743 -30.372 -33.727 1.00 0.00 ? 41 LEU A HD23 4  
ATOM 3751  N N    . ILE A 1 42 ? -40.120 -32.061 -29.053 1.00 0.00 ? 42 ILE A N    4  
ATOM 3752  C CA   . ILE A 1 42 ? -39.856 -33.220 -28.199 1.00 0.00 ? 42 ILE A CA   4  
ATOM 3753  C C    . ILE A 1 42 ? -40.780 -34.388 -28.559 1.00 0.00 ? 42 ILE A C    4  
ATOM 3754  O O    . ILE A 1 42 ? -40.342 -35.544 -28.631 1.00 0.00 ? 42 ILE A O    4  
ATOM 3755  C CB   . ILE A 1 42 ? -40.046 -32.846 -26.728 1.00 0.00 ? 42 ILE A CB   4  
ATOM 3756  C CG1  . ILE A 1 42 ? -38.928 -31.887 -26.304 1.00 0.00 ? 42 ILE A CG1  4  
ATOM 3757  C CG2  . ILE A 1 42 ? -39.989 -34.110 -25.866 1.00 0.00 ? 42 ILE A CG2  4  
ATOM 3758  C CD1  . ILE A 1 42 ? -39.232 -31.304 -24.919 1.00 0.00 ? 42 ILE A CD1  4  
ATOM 3759  H H    . ILE A 1 42 ? -40.394 -31.211 -28.663 1.00 0.00 ? 42 ILE A H    4  
ATOM 3760  H HA   . ILE A 1 42 ? -38.833 -33.531 -28.345 1.00 0.00 ? 42 ILE A HA   4  
ATOM 3761  H HB   . ILE A 1 42 ? -41.005 -32.366 -26.601 1.00 0.00 ? 42 ILE A HB   4  
ATOM 3762  H HG12 . ILE A 1 42 ? -37.990 -32.422 -26.270 1.00 0.00 ? 42 ILE A HG12 4  
ATOM 3763  H HG13 . ILE A 1 42 ? -38.856 -31.082 -27.021 1.00 0.00 ? 42 ILE A HG13 4  
ATOM 3764  H HG21 . ILE A 1 42 ? -39.842 -33.837 -24.832 1.00 0.00 ? 42 ILE A HG21 4  
ATOM 3765  H HG22 . ILE A 1 42 ? -39.170 -34.733 -26.195 1.00 0.00 ? 42 ILE A HG22 4  
ATOM 3766  H HG23 . ILE A 1 42 ? -40.917 -34.653 -25.966 1.00 0.00 ? 42 ILE A HG23 4  
ATOM 3767  H HD11 . ILE A 1 42 ? -40.152 -31.725 -24.542 1.00 0.00 ? 42 ILE A HD11 4  
ATOM 3768  H HD12 . ILE A 1 42 ? -39.328 -30.233 -24.992 1.00 0.00 ? 42 ILE A HD12 4  
ATOM 3769  H HD13 . ILE A 1 42 ? -38.423 -31.546 -24.244 1.00 0.00 ? 42 ILE A HD13 4  
ATOM 3770  N N    . LEU A 1 43 ? -42.057 -34.093 -28.776 1.00 0.00 ? 43 LEU A N    4  
ATOM 3771  C CA   . LEU A 1 43 ? -43.020 -35.135 -29.115 1.00 0.00 ? 43 LEU A CA   4  
ATOM 3772  C C    . LEU A 1 43 ? -42.607 -35.846 -30.400 1.00 0.00 ? 43 LEU A C    4  
ATOM 3773  O O    . LEU A 1 43 ? -42.757 -37.062 -30.521 1.00 0.00 ? 43 LEU A O    4  
ATOM 3774  C CB   . LEU A 1 43 ? -44.412 -34.522 -29.294 1.00 0.00 ? 43 LEU A CB   4  
ATOM 3775  C CG   . LEU A 1 43 ? -44.946 -34.039 -27.939 1.00 0.00 ? 43 LEU A CG   4  
ATOM 3776  C CD1  . LEU A 1 43 ? -46.240 -33.252 -28.155 1.00 0.00 ? 43 LEU A CD1  4  
ATOM 3777  C CD2  . LEU A 1 43 ? -45.226 -35.235 -27.020 1.00 0.00 ? 43 LEU A CD2  4  
ATOM 3778  H H    . LEU A 1 43 ? -42.357 -33.169 -28.696 1.00 0.00 ? 43 LEU A H    4  
ATOM 3779  H HA   . LEU A 1 43 ? -43.054 -35.855 -28.312 1.00 0.00 ? 43 LEU A HA   4  
ATOM 3780  H HB2  . LEU A 1 43 ? -44.344 -33.682 -29.970 1.00 0.00 ? 43 LEU A HB2  4  
ATOM 3781  H HB3  . LEU A 1 43 ? -45.084 -35.259 -29.707 1.00 0.00 ? 43 LEU A HB3  4  
ATOM 3782  H HG   . LEU A 1 43 ? -44.211 -33.394 -27.478 1.00 0.00 ? 43 LEU A HG   4  
ATOM 3783  H HD11 . LEU A 1 43 ? -46.661 -33.508 -29.115 1.00 0.00 ? 43 LEU A HD11 4  
ATOM 3784  H HD12 . LEU A 1 43 ? -46.027 -32.195 -28.125 1.00 0.00 ? 43 LEU A HD12 4  
ATOM 3785  H HD13 . LEU A 1 43 ? -46.943 -33.501 -27.374 1.00 0.00 ? 43 LEU A HD13 4  
ATOM 3786  H HD21 . LEU A 1 43 ? -45.270 -36.144 -27.599 1.00 0.00 ? 43 LEU A HD21 4  
ATOM 3787  H HD22 . LEU A 1 43 ? -46.168 -35.086 -26.515 1.00 0.00 ? 43 LEU A HD22 4  
ATOM 3788  H HD23 . LEU A 1 43 ? -44.436 -35.315 -26.285 1.00 0.00 ? 43 LEU A HD23 4  
ATOM 3789  N N    . LEU A 1 44 ? -42.099 -35.081 -31.358 1.00 0.00 ? 44 LEU A N    4  
ATOM 3790  C CA   . LEU A 1 44 ? -41.674 -35.637 -32.639 1.00 0.00 ? 44 LEU A CA   4  
ATOM 3791  C C    . LEU A 1 44 ? -40.574 -36.681 -32.442 1.00 0.00 ? 44 LEU A C    4  
ATOM 3792  O O    . LEU A 1 44 ? -40.515 -37.676 -33.169 1.00 0.00 ? 44 LEU A O    4  
ATOM 3793  C CB   . LEU A 1 44 ? -41.165 -34.509 -33.548 1.00 0.00 ? 44 LEU A CB   4  
ATOM 3794  C CG   . LEU A 1 44 ? -40.740 -35.068 -34.913 1.00 0.00 ? 44 LEU A CG   4  
ATOM 3795  C CD1  . LEU A 1 44 ? -41.936 -35.724 -35.606 1.00 0.00 ? 44 LEU A CD1  4  
ATOM 3796  C CD2  . LEU A 1 44 ? -40.218 -33.924 -35.788 1.00 0.00 ? 44 LEU A CD2  4  
ATOM 3797  H H    . LEU A 1 44 ? -42.022 -34.119 -31.218 1.00 0.00 ? 44 LEU A H    4  
ATOM 3798  H HA   . LEU A 1 44 ? -42.521 -36.108 -33.111 1.00 0.00 ? 44 LEU A HA   4  
ATOM 3799  H HB2  . LEU A 1 44 ? -41.953 -33.783 -33.689 1.00 0.00 ? 44 LEU A HB2  4  
ATOM 3800  H HB3  . LEU A 1 44 ? -40.318 -34.029 -33.080 1.00 0.00 ? 44 LEU A HB3  4  
ATOM 3801  H HG   . LEU A 1 44 ? -39.956 -35.800 -34.780 1.00 0.00 ? 44 LEU A HG   4  
ATOM 3802  H HD11 . LEU A 1 44 ? -42.842 -35.210 -35.323 1.00 0.00 ? 44 LEU A HD11 4  
ATOM 3803  H HD12 . LEU A 1 44 ? -42.001 -36.759 -35.307 1.00 0.00 ? 44 LEU A HD12 4  
ATOM 3804  H HD13 . LEU A 1 44 ? -41.809 -35.667 -36.676 1.00 0.00 ? 44 LEU A HD13 4  
ATOM 3805  H HD21 . LEU A 1 44 ? -39.152 -33.823 -35.650 1.00 0.00 ? 44 LEU A HD21 4  
ATOM 3806  H HD22 . LEU A 1 44 ? -40.707 -33.003 -35.507 1.00 0.00 ? 44 LEU A HD22 4  
ATOM 3807  H HD23 . LEU A 1 44 ? -40.427 -34.140 -36.825 1.00 0.00 ? 44 LEU A HD23 4  
ATOM 3808  N N    . SER A 1 45 ? -39.700 -36.450 -31.467 1.00 0.00 ? 45 SER A N    4  
ATOM 3809  C CA   . SER A 1 45 ? -38.611 -37.380 -31.205 1.00 0.00 ? 45 SER A CA   4  
ATOM 3810  C C    . SER A 1 45 ? -39.162 -38.757 -30.861 1.00 0.00 ? 45 SER A C    4  
ATOM 3811  O O    . SER A 1 45 ? -38.617 -39.773 -31.290 1.00 0.00 ? 45 SER A O    4  
ATOM 3812  C CB   . SER A 1 45 ? -37.748 -36.871 -30.049 1.00 0.00 ? 45 SER A CB   4  
ATOM 3813  O OG   . SER A 1 45 ? -37.104 -35.666 -30.439 1.00 0.00 ? 45 SER A OG   4  
ATOM 3814  H H    . SER A 1 45 ? -39.793 -35.654 -30.914 1.00 0.00 ? 45 SER A H    4  
ATOM 3815  H HA   . SER A 1 45 ? -37.997 -37.459 -32.089 1.00 0.00 ? 45 SER A HA   4  
ATOM 3816  H HB2  . SER A 1 45 ? -38.368 -36.680 -29.191 1.00 0.00 ? 45 SER A HB2  4  
ATOM 3817  H HB3  . SER A 1 45 ? -37.010 -37.621 -29.796 1.00 0.00 ? 45 SER A HB3  4  
ATOM 3818  H HG   . SER A 1 45 ? -37.617 -35.271 -31.150 1.00 0.00 ? 45 SER A HG   4  
ATOM 3819  N N    . ARG A 1 46 ? -40.250 -38.793 -30.099 1.00 0.00 ? 46 ARG A N    4  
ATOM 3820  C CA   . ARG A 1 46 ? -40.852 -40.074 -29.737 1.00 0.00 ? 46 ARG A CA   4  
ATOM 3821  C C    . ARG A 1 46 ? -41.311 -40.796 -31.008 1.00 0.00 ? 46 ARG A C    4  
ATOM 3822  O O    . ARG A 1 46 ? -41.191 -42.014 -31.125 1.00 0.00 ? 46 ARG A O    4  
ATOM 3823  C CB   . ARG A 1 46 ? -42.051 -39.854 -28.807 1.00 0.00 ? 46 ARG A CB   4  
ATOM 3824  C CG   . ARG A 1 46 ? -42.219 -41.051 -27.854 1.00 0.00 ? 46 ARG A CG   4  
ATOM 3825  C CD   . ARG A 1 46 ? -42.317 -42.360 -28.645 1.00 0.00 ? 46 ARG A CD   4  
ATOM 3826  N NE   . ARG A 1 46 ? -42.941 -43.401 -27.833 1.00 0.00 ? 46 ARG A NE   4  
ATOM 3827  C CZ   . ARG A 1 46 ? -42.924 -44.674 -28.215 1.00 0.00 ? 46 ARG A CZ   4  
ATOM 3828  N NH1  . ARG A 1 46 ? -42.333 -45.013 -29.329 1.00 0.00 ? 46 ARG A NH1  4  
ATOM 3829  N NH2  . ARG A 1 46 ? -43.493 -45.586 -27.476 1.00 0.00 ? 46 ARG A NH2  4  
ATOM 3830  H H    . ARG A 1 46 ? -40.655 -37.957 -29.792 1.00 0.00 ? 46 ARG A H    4  
ATOM 3831  H HA   . ARG A 1 46 ? -40.117 -40.680 -29.231 1.00 0.00 ? 46 ARG A HA   4  
ATOM 3832  H HB2  . ARG A 1 46 ? -41.894 -38.955 -28.227 1.00 0.00 ? 46 ARG A HB2  4  
ATOM 3833  H HB3  . ARG A 1 46 ? -42.948 -39.743 -29.400 1.00 0.00 ? 46 ARG A HB3  4  
ATOM 3834  H HG2  . ARG A 1 46 ? -41.369 -41.099 -27.189 1.00 0.00 ? 46 ARG A HG2  4  
ATOM 3835  H HG3  . ARG A 1 46 ? -43.119 -40.919 -27.273 1.00 0.00 ? 46 ARG A HG3  4  
ATOM 3836  H HD2  . ARG A 1 46 ? -42.909 -42.202 -29.532 1.00 0.00 ? 46 ARG A HD2  4  
ATOM 3837  H HD3  . ARG A 1 46 ? -41.323 -42.677 -28.926 1.00 0.00 ? 46 ARG A HD3  4  
ATOM 3838  H HE   . ARG A 1 46 ? -43.382 -43.157 -26.993 1.00 0.00 ? 46 ARG A HE   4  
ATOM 3839  H HH11 . ARG A 1 46 ? -41.894 -44.316 -29.894 1.00 0.00 ? 46 ARG A HH11 4  
ATOM 3840  H HH12 . ARG A 1 46 ? -42.319 -45.971 -29.615 1.00 0.00 ? 46 ARG A HH12 4  
ATOM 3841  H HH21 . ARG A 1 46 ? -43.944 -45.326 -26.621 1.00 0.00 ? 46 ARG A HH21 4  
ATOM 3842  H HH22 . ARG A 1 46 ? -43.480 -46.542 -27.764 1.00 0.00 ? 46 ARG A HH22 4  
ATOM 3843  N N    . ARG A 1 47 ? -41.835 -40.030 -31.961 1.00 0.00 ? 47 ARG A N    4  
ATOM 3844  C CA   . ARG A 1 47 ? -42.312 -40.606 -33.215 1.00 0.00 ? 47 ARG A CA   4  
ATOM 3845  C C    . ARG A 1 47 ? -41.207 -41.379 -33.928 1.00 0.00 ? 47 ARG A C    4  
ATOM 3846  O O    . ARG A 1 47 ? -41.483 -42.320 -34.672 1.00 0.00 ? 47 ARG A O    4  
ATOM 3847  C CB   . ARG A 1 47 ? -42.838 -39.502 -34.138 1.00 0.00 ? 47 ARG A CB   4  
ATOM 3848  C CG   . ARG A 1 47 ? -44.345 -39.674 -34.341 1.00 0.00 ? 47 ARG A CG   4  
ATOM 3849  C CD   . ARG A 1 47 ? -44.602 -40.940 -35.164 1.00 0.00 ? 47 ARG A CD   4  
ATOM 3850  N NE   . ARG A 1 47 ? -45.617 -41.769 -34.516 1.00 0.00 ? 47 ARG A NE   4  
ATOM 3851  C CZ   . ARG A 1 47 ? -45.547 -43.101 -34.521 1.00 0.00 ? 47 ARG A CZ   4  
ATOM 3852  N NH1  . ARG A 1 47 ? -44.559 -43.712 -35.115 1.00 0.00 ? 47 ARG A NH1  4  
ATOM 3853  N NH2  . ARG A 1 47 ? -46.477 -43.797 -33.926 1.00 0.00 ? 47 ARG A NH2  4  
ATOM 3854  H H    . ARG A 1 47 ? -41.902 -39.068 -31.821 1.00 0.00 ? 47 ARG A H    4  
ATOM 3855  H HA   . ARG A 1 47 ? -43.121 -41.286 -32.995 1.00 0.00 ? 47 ARG A HA   4  
ATOM 3856  H HB2  . ARG A 1 47 ? -42.642 -38.538 -33.690 1.00 0.00 ? 47 ARG A HB2  4  
ATOM 3857  H HB3  . ARG A 1 47 ? -42.338 -39.564 -35.093 1.00 0.00 ? 47 ARG A HB3  4  
ATOM 3858  H HG2  . ARG A 1 47 ? -44.835 -39.758 -33.382 1.00 0.00 ? 47 ARG A HG2  4  
ATOM 3859  H HG3  . ARG A 1 47 ? -44.737 -38.820 -34.872 1.00 0.00 ? 47 ARG A HG3  4  
ATOM 3860  H HD2  . ARG A 1 47 ? -44.947 -40.662 -36.150 1.00 0.00 ? 47 ARG A HD2  4  
ATOM 3861  H HD3  . ARG A 1 47 ? -43.682 -41.493 -35.254 1.00 0.00 ? 47 ARG A HD3  4  
ATOM 3862  H HE   . ARG A 1 47 ? -46.369 -41.334 -34.063 1.00 0.00 ? 47 ARG A HE   4  
ATOM 3863  H HH11 . ARG A 1 47 ? -43.845 -43.188 -35.574 1.00 0.00 ? 47 ARG A HH11 4  
ATOM 3864  H HH12 . ARG A 1 47 ? -44.515 -44.713 -35.106 1.00 0.00 ? 47 ARG A HH12 4  
ATOM 3865  H HH21 . ARG A 1 47 ? -47.236 -43.332 -33.470 1.00 0.00 ? 47 ARG A HH21 4  
ATOM 3866  H HH22 . ARG A 1 47 ? -46.430 -44.796 -33.927 1.00 0.00 ? 47 ARG A HH22 4  
ATOM 3867  N N    . PHE A 1 48 ? -39.957 -40.990 -33.698 1.00 0.00 ? 48 PHE A N    4  
ATOM 3868  C CA   . PHE A 1 48 ? -38.838 -41.675 -34.334 1.00 0.00 ? 48 PHE A CA   4  
ATOM 3869  C C    . PHE A 1 48 ? -38.827 -43.147 -33.935 1.00 0.00 ? 48 PHE A C    4  
ATOM 3870  O O    . PHE A 1 48 ? -38.697 -44.033 -34.780 1.00 0.00 ? 48 PHE A O    4  
ATOM 3871  C CB   . PHE A 1 48 ? -37.514 -41.023 -33.924 1.00 0.00 ? 48 PHE A CB   4  
ATOM 3872  C CG   . PHE A 1 48 ? -36.365 -41.785 -34.541 1.00 0.00 ? 48 PHE A CG   4  
ATOM 3873  C CD1  . PHE A 1 48 ? -36.036 -41.589 -35.888 1.00 0.00 ? 48 PHE A CD1  4  
ATOM 3874  C CD2  . PHE A 1 48 ? -35.627 -42.687 -33.764 1.00 0.00 ? 48 PHE A CD2  4  
ATOM 3875  C CE1  . PHE A 1 48 ? -34.970 -42.294 -36.458 1.00 0.00 ? 48 PHE A CE1  4  
ATOM 3876  C CE2  . PHE A 1 48 ? -34.561 -43.392 -34.336 1.00 0.00 ? 48 PHE A CE2  4  
ATOM 3877  C CZ   . PHE A 1 48 ? -34.233 -43.196 -35.682 1.00 0.00 ? 48 PHE A CZ   4  
ATOM 3878  H H    . PHE A 1 48 ? -39.786 -40.239 -33.094 1.00 0.00 ? 48 PHE A H    4  
ATOM 3879  H HA   . PHE A 1 48 ? -38.945 -41.603 -35.407 1.00 0.00 ? 48 PHE A HA   4  
ATOM 3880  H HB2  . PHE A 1 48 ? -37.496 -40.000 -34.268 1.00 0.00 ? 48 PHE A HB2  4  
ATOM 3881  H HB3  . PHE A 1 48 ? -37.421 -41.044 -32.849 1.00 0.00 ? 48 PHE A HB3  4  
ATOM 3882  H HD1  . PHE A 1 48 ? -36.606 -40.894 -36.486 1.00 0.00 ? 48 PHE A HD1  4  
ATOM 3883  H HD2  . PHE A 1 48 ? -35.880 -42.837 -32.726 1.00 0.00 ? 48 PHE A HD2  4  
ATOM 3884  H HE1  . PHE A 1 48 ? -34.717 -42.143 -37.498 1.00 0.00 ? 48 PHE A HE1  4  
ATOM 3885  H HE2  . PHE A 1 48 ? -33.991 -44.087 -33.736 1.00 0.00 ? 48 PHE A HE2  4  
ATOM 3886  H HZ   . PHE A 1 48 ? -33.410 -43.741 -36.123 1.00 0.00 ? 48 PHE A HZ   4  
ATOM 3887  N N    . ARG A 1 49 ? -38.959 -43.396 -32.636 1.00 0.00 ? 49 ARG A N    4  
ATOM 3888  C CA   . ARG A 1 49 ? -38.953 -44.774 -32.156 1.00 0.00 ? 49 ARG A CA   4  
ATOM 3889  C C    . ARG A 1 49 ? -40.133 -45.526 -32.769 1.00 0.00 ? 49 ARG A C    4  
ATOM 3890  O O    . ARG A 1 49 ? -39.962 -46.595 -33.355 1.00 0.00 ? 49 ARG A O    4  
ATOM 3891  C CB   . ARG A 1 49 ? -39.057 -44.797 -30.630 1.00 0.00 ? 49 ARG A CB   4  
ATOM 3892  C CG   . ARG A 1 49 ? -39.033 -46.246 -30.133 1.00 0.00 ? 49 ARG A CG   4  
ATOM 3893  C CD   . ARG A 1 49 ? -39.017 -46.258 -28.604 1.00 0.00 ? 49 ARG A CD   4  
ATOM 3894  N NE   . ARG A 1 49 ? -39.048 -47.629 -28.108 1.00 0.00 ? 49 ARG A NE   4  
ATOM 3895  C CZ   . ARG A 1 49 ? -38.974 -47.891 -26.806 1.00 0.00 ? 49 ARG A CZ   4  
ATOM 3896  N NH1  . ARG A 1 49 ? -38.865 -46.914 -25.950 1.00 0.00 ? 49 ARG A NH1  4  
ATOM 3897  N NH2  . ARG A 1 49 ? -39.009 -49.126 -26.387 1.00 0.00 ? 49 ARG A NH2  4  
ATOM 3898  H H    . ARG A 1 49 ? -39.048 -42.627 -32.036 1.00 0.00 ? 49 ARG A H    4  
ATOM 3899  H HA   . ARG A 1 49 ? -38.032 -45.251 -32.458 1.00 0.00 ? 49 ARG A HA   4  
ATOM 3900  H HB2  . ARG A 1 49 ? -38.223 -44.257 -30.204 1.00 0.00 ? 49 ARG A HB2  4  
ATOM 3901  H HB3  . ARG A 1 49 ? -39.981 -44.330 -30.324 1.00 0.00 ? 49 ARG A HB3  4  
ATOM 3902  H HG2  . ARG A 1 49 ? -39.912 -46.764 -30.488 1.00 0.00 ? 49 ARG A HG2  4  
ATOM 3903  H HG3  . ARG A 1 49 ? -38.147 -46.739 -30.504 1.00 0.00 ? 49 ARG A HG3  4  
ATOM 3904  H HD2  . ARG A 1 49 ? -38.119 -45.773 -28.251 1.00 0.00 ? 49 ARG A HD2  4  
ATOM 3905  H HD3  . ARG A 1 49 ? -39.879 -45.723 -28.234 1.00 0.00 ? 49 ARG A HD3  4  
ATOM 3906  H HE   . ARG A 1 49 ? -39.128 -48.370 -28.745 1.00 0.00 ? 49 ARG A HE   4  
ATOM 3907  H HH11 . ARG A 1 49 ? -38.837 -45.966 -26.273 1.00 0.00 ? 49 ARG A HH11 4  
ATOM 3908  H HH12 . ARG A 1 49 ? -38.808 -47.110 -24.971 1.00 0.00 ? 49 ARG A HH12 4  
ATOM 3909  H HH21 . ARG A 1 49 ? -39.091 -49.876 -27.043 1.00 0.00 ? 49 ARG A HH21 4  
ATOM 3910  H HH22 . ARG A 1 49 ? -38.952 -49.323 -25.408 1.00 0.00 ? 49 ARG A HH22 4  
ATOM 3911  N N    . SER A 1 50 ? -41.330 -44.962 -32.629 1.00 0.00 ? 50 SER A N    4  
ATOM 3912  C CA   . SER A 1 50 ? -42.529 -45.592 -33.171 1.00 0.00 ? 50 SER A CA   4  
ATOM 3913  C C    . SER A 1 50 ? -42.537 -45.527 -34.697 1.00 0.00 ? 50 SER A C    4  
ATOM 3914  O O    . SER A 1 50 ? -42.158 -44.516 -35.288 1.00 0.00 ? 50 SER A O    4  
ATOM 3915  C CB   . SER A 1 50 ? -43.775 -44.897 -32.622 1.00 0.00 ? 50 SER A CB   4  
ATOM 3916  O OG   . SER A 1 50 ? -43.846 -45.100 -31.219 1.00 0.00 ? 50 SER A OG   4  
ATOM 3917  H H    . SER A 1 50 ? -41.412 -44.139 -32.103 1.00 0.00 ? 50 SER A H    4  
ATOM 3918  H HA   . SER A 1 50 ? -42.548 -46.628 -32.867 1.00 0.00 ? 50 SER A HA   4  
ATOM 3919  H HB2  . SER A 1 50 ? -43.715 -43.840 -32.823 1.00 0.00 ? 50 SER A HB2  4  
ATOM 3920  H HB3  . SER A 1 50 ? -44.655 -45.304 -33.102 1.00 0.00 ? 50 SER A HB3  4  
ATOM 3921  H HG   . SER A 1 50 ? -44.281 -45.942 -31.061 1.00 0.00 ? 50 SER A HG   4  
ATOM 3922  N N    . GLY A 1 51 ? -42.987 -46.611 -35.329 1.00 0.00 ? 51 GLY A N    4  
ATOM 3923  C CA   . GLY A 1 51 ? -43.057 -46.656 -36.788 1.00 0.00 ? 51 GLY A CA   4  
ATOM 3924  C C    . GLY A 1 51 ? -44.046 -45.622 -37.312 1.00 0.00 ? 51 GLY A C    4  
ATOM 3925  O O    . GLY A 1 51 ? -43.783 -44.933 -38.299 1.00 0.00 ? 51 GLY A O    4  
ATOM 3926  H H    . GLY A 1 51 ? -43.294 -47.377 -34.803 1.00 0.00 ? 51 GLY A H    4  
ATOM 3927  H HA2  . GLY A 1 51 ? -42.077 -46.454 -37.196 1.00 0.00 ? 51 GLY A HA2  4  
ATOM 3928  H HA3  . GLY A 1 51 ? -43.377 -47.640 -37.097 1.00 0.00 ? 51 GLY A HA3  4  
ATOM 3929  N N    . GLY A 1 52 ? -45.193 -45.531 -36.645 1.00 0.00 ? 52 GLY A N    4  
ATOM 3930  C CA   . GLY A 1 52 ? -46.231 -44.588 -37.050 1.00 0.00 ? 52 GLY A CA   4  
ATOM 3931  C C    . GLY A 1 52 ? -46.920 -45.068 -38.323 1.00 0.00 ? 52 GLY A C    4  
ATOM 3932  O O    . GLY A 1 52 ? -46.993 -44.347 -39.317 1.00 0.00 ? 52 GLY A O    4  
ATOM 3933  H H    . GLY A 1 52 ? -45.339 -46.127 -35.881 1.00 0.00 ? 52 GLY A H    4  
ATOM 3934  H HA2  . GLY A 1 52 ? -46.961 -44.499 -36.258 1.00 0.00 ? 52 GLY A HA2  4  
ATOM 3935  H HA3  . GLY A 1 52 ? -45.783 -43.621 -37.235 1.00 0.00 ? 52 GLY A HA3  4  
ATOM 3936  N N    . ASN A 1 53 ? -47.420 -46.300 -38.280 1.00 0.00 ? 53 ASN A N    4  
ATOM 3937  C CA   . ASN A 1 53 ? -48.098 -46.885 -39.430 1.00 0.00 ? 53 ASN A CA   4  
ATOM 3938  C C    . ASN A 1 53 ? -49.613 -46.752 -39.298 1.00 0.00 ? 53 ASN A C    4  
ATOM 3939  O O    . ASN A 1 53 ? -50.367 -47.451 -39.977 1.00 0.00 ? 53 ASN A O    4  
ATOM 3940  C CB   . ASN A 1 53 ? -47.721 -48.364 -39.560 1.00 0.00 ? 53 ASN A CB   4  
ATOM 3941  C CG   . ASN A 1 53 ? -48.257 -49.151 -38.368 1.00 0.00 ? 53 ASN A CG   4  
ATOM 3942  O OD1  . ASN A 1 53 ? -49.032 -48.624 -37.570 1.00 0.00 ? 53 ASN A OD1  4  
ATOM 3943  N ND2  . ASN A 1 53 ? -47.888 -50.391 -38.200 1.00 0.00 ? 53 ASN A ND2  4  
ATOM 3944  H H    . ASN A 1 53 ? -47.331 -46.822 -37.455 1.00 0.00 ? 53 ASN A H    4  
ATOM 3945  H HA   . ASN A 1 53 ? -47.780 -46.368 -40.322 1.00 0.00 ? 53 ASN A HA   4  
ATOM 3946  H HB2  . ASN A 1 53 ? -48.144 -48.761 -40.471 1.00 0.00 ? 53 ASN A HB2  4  
ATOM 3947  H HB3  . ASN A 1 53 ? -46.646 -48.457 -39.594 1.00 0.00 ? 53 ASN A HB3  4  
ATOM 3948  H HD21 . ASN A 1 53 ? -47.271 -50.809 -38.838 1.00 0.00 ? 53 ASN A HD21 4  
ATOM 3949  H HD22 . ASN A 1 53 ? -48.227 -50.905 -37.438 1.00 0.00 ? 53 ASN A HD22 4  
ATOM 3950  N N    . LYS A 1 54 ? -50.056 -45.856 -38.422 1.00 0.00 ? 54 LYS A N    4  
ATOM 3951  C CA   . LYS A 1 54 ? -51.486 -45.652 -38.216 1.00 0.00 ? 54 LYS A CA   4  
ATOM 3952  C C    . LYS A 1 54 ? -52.151 -45.196 -39.510 1.00 0.00 ? 54 LYS A C    4  
ATOM 3953  O O    . LYS A 1 54 ? -53.252 -45.633 -39.838 1.00 0.00 ? 54 LYS A O    4  
ATOM 3954  C CB   . LYS A 1 54 ? -51.715 -44.602 -37.124 1.00 0.00 ? 54 LYS A CB   4  
ATOM 3955  C CG   . LYS A 1 54 ? -51.320 -45.169 -35.755 1.00 0.00 ? 54 LYS A CG   4  
ATOM 3956  C CD   . LYS A 1 54 ? -52.495 -45.941 -35.143 1.00 0.00 ? 54 LYS A CD   4  
ATOM 3957  C CE   . LYS A 1 54 ? -52.106 -46.441 -33.750 1.00 0.00 ? 54 LYS A CE   4  
ATOM 3958  N NZ   . LYS A 1 54 ? -51.835 -45.276 -32.863 1.00 0.00 ? 54 LYS A NZ   4  
ATOM 3959  H H    . LYS A 1 54 ? -49.413 -45.328 -37.904 1.00 0.00 ? 54 LYS A H    4  
ATOM 3960  H HA   . LYS A 1 54 ? -51.930 -46.584 -37.908 1.00 0.00 ? 54 LYS A HA   4  
ATOM 3961  H HB2  . LYS A 1 54 ? -51.116 -43.729 -37.337 1.00 0.00 ? 54 LYS A HB2  4  
ATOM 3962  H HB3  . LYS A 1 54 ? -52.759 -44.325 -37.108 1.00 0.00 ? 54 LYS A HB3  4  
ATOM 3963  H HG2  . LYS A 1 54 ? -50.477 -45.835 -35.874 1.00 0.00 ? 54 LYS A HG2  4  
ATOM 3964  H HG3  . LYS A 1 54 ? -51.045 -44.359 -35.097 1.00 0.00 ? 54 LYS A HG3  4  
ATOM 3965  H HD2  . LYS A 1 54 ? -53.353 -45.288 -35.063 1.00 0.00 ? 54 LYS A HD2  4  
ATOM 3966  H HD3  . LYS A 1 54 ? -52.743 -46.786 -35.766 1.00 0.00 ? 54 LYS A HD3  4  
ATOM 3967  H HE2  . LYS A 1 54 ? -52.913 -47.028 -33.338 1.00 0.00 ? 54 LYS A HE2  4  
ATOM 3968  H HE3  . LYS A 1 54 ? -51.217 -47.052 -33.823 1.00 0.00 ? 54 LYS A HE3  4  
ATOM 3969  H HZ1  . LYS A 1 54 ? -52.336 -45.403 -31.960 1.00 0.00 ? 54 LYS A HZ1  4  
ATOM 3970  H HZ2  . LYS A 1 54 ? -52.167 -44.404 -33.325 1.00 0.00 ? 54 LYS A HZ2  4  
ATOM 3971  H HZ3  . LYS A 1 54 ? -50.813 -45.205 -32.683 1.00 0.00 ? 54 LYS A HZ3  4  
ATOM 3972  N N    . LYS A 1 55 ? -51.470 -44.326 -40.249 1.00 0.00 ? 55 LYS A N    4  
ATOM 3973  C CA   . LYS A 1 55 ? -52.007 -43.833 -41.515 1.00 0.00 ? 55 LYS A CA   4  
ATOM 3974  C C    . LYS A 1 55 ? -52.201 -44.998 -42.480 1.00 0.00 ? 55 LYS A C    4  
ATOM 3975  O O    . LYS A 1 55 ? -53.205 -45.078 -43.186 1.00 0.00 ? 55 LYS A O    4  
ATOM 3976  C CB   . LYS A 1 55 ? -51.049 -42.807 -42.128 1.00 0.00 ? 55 LYS A CB   4  
ATOM 3977  C CG   . LYS A 1 55 ? -51.634 -42.268 -43.438 1.00 0.00 ? 55 LYS A CG   4  
ATOM 3978  C CD   . LYS A 1 55 ? -50.687 -41.222 -44.030 1.00 0.00 ? 55 LYS A CD   4  
ATOM 3979  C CE   . LYS A 1 55 ? -51.268 -40.694 -45.343 1.00 0.00 ? 55 LYS A CE   4  
ATOM 3980  N NZ   . LYS A 1 55 ? -50.348 -39.673 -45.919 1.00 0.00 ? 55 LYS A NZ   4  
ATOM 3981  H H    . LYS A 1 55 ? -50.593 -44.016 -39.943 1.00 0.00 ? 55 LYS A H    4  
ATOM 3982  H HA   . LYS A 1 55 ? -52.962 -43.362 -41.334 1.00 0.00 ? 55 LYS A HA   4  
ATOM 3983  H HB2  . LYS A 1 55 ? -50.907 -41.990 -41.434 1.00 0.00 ? 55 LYS A HB2  4  
ATOM 3984  H HB3  . LYS A 1 55 ? -50.099 -43.277 -42.328 1.00 0.00 ? 55 LYS A HB3  4  
ATOM 3985  H HG2  . LYS A 1 55 ? -51.756 -43.076 -44.142 1.00 0.00 ? 55 LYS A HG2  4  
ATOM 3986  H HG3  . LYS A 1 55 ? -52.592 -41.811 -43.244 1.00 0.00 ? 55 LYS A HG3  4  
ATOM 3987  H HD2  . LYS A 1 55 ? -50.570 -40.406 -43.332 1.00 0.00 ? 55 LYS A HD2  4  
ATOM 3988  H HD3  . LYS A 1 55 ? -49.725 -41.675 -44.220 1.00 0.00 ? 55 LYS A HD3  4  
ATOM 3989  H HE2  . LYS A 1 55 ? -51.382 -41.512 -46.041 1.00 0.00 ? 55 LYS A HE2  4  
ATOM 3990  H HE3  . LYS A 1 55 ? -52.232 -40.245 -45.155 1.00 0.00 ? 55 LYS A HE3  4  
ATOM 3991  H HZ1  . LYS A 1 55 ? -49.709 -40.127 -46.600 1.00 0.00 ? 55 LYS A HZ1  4  
ATOM 3992  H HZ2  . LYS A 1 55 ? -49.793 -39.238 -45.155 1.00 0.00 ? 55 LYS A HZ2  4  
ATOM 3993  H HZ3  . LYS A 1 55 ? -50.905 -38.941 -46.404 1.00 0.00 ? 55 LYS A HZ3  4  
ATOM 3994  N N    . ARG A 1 56 ? -51.223 -45.895 -42.502 1.00 0.00 ? 56 ARG A N    4  
ATOM 3995  C CA   . ARG A 1 56 ? -51.273 -47.058 -43.379 1.00 0.00 ? 56 ARG A CA   4  
ATOM 3996  C C    . ARG A 1 56 ? -52.375 -48.019 -42.944 1.00 0.00 ? 56 ARG A C    4  
ATOM 3997  O O    . ARG A 1 56 ? -53.022 -48.650 -43.779 1.00 0.00 ? 56 ARG A O    4  
ATOM 3998  C CB   . ARG A 1 56 ? -49.927 -47.783 -43.365 1.00 0.00 ? 56 ARG A CB   4  
ATOM 3999  C CG   . ARG A 1 56 ? -48.875 -46.924 -44.070 1.00 0.00 ? 56 ARG A CG   4  
ATOM 4000  C CD   . ARG A 1 56 ? -47.525 -47.642 -44.040 1.00 0.00 ? 56 ARG A CD   4  
ATOM 4001  N NE   . ARG A 1 56 ? -46.512 -46.840 -44.714 1.00 0.00 ? 56 ARG A NE   4  
ATOM 4002  C CZ   . ARG A 1 56 ? -45.257 -47.266 -44.823 1.00 0.00 ? 56 ARG A CZ   4  
ATOM 4003  N NH1  . ARG A 1 56 ? -44.915 -48.420 -44.318 1.00 0.00 ? 56 ARG A NH1  4  
ATOM 4004  N NH2  . ARG A 1 56 ? -44.368 -46.531 -45.432 1.00 0.00 ? 56 ARG A NH2  4  
ATOM 4005  H H    . ARG A 1 56 ? -50.449 -45.768 -41.914 1.00 0.00 ? 56 ARG A H    4  
ATOM 4006  H HA   . ARG A 1 56 ? -51.478 -46.727 -44.387 1.00 0.00 ? 56 ARG A HA   4  
ATOM 4007  H HB2  . ARG A 1 56 ? -49.624 -47.958 -42.342 1.00 0.00 ? 56 ARG A HB2  4  
ATOM 4008  H HB3  . ARG A 1 56 ? -50.021 -48.727 -43.879 1.00 0.00 ? 56 ARG A HB3  4  
ATOM 4009  H HG2  . ARG A 1 56 ? -49.174 -46.759 -45.095 1.00 0.00 ? 56 ARG A HG2  4  
ATOM 4010  H HG3  . ARG A 1 56 ? -48.787 -45.975 -43.563 1.00 0.00 ? 56 ARG A HG3  4  
ATOM 4011  H HD2  . ARG A 1 56 ? -47.227 -47.802 -43.015 1.00 0.00 ? 56 ARG A HD2  4  
ATOM 4012  H HD3  . ARG A 1 56 ? -47.619 -48.598 -44.537 1.00 0.00 ? 56 ARG A HD3  4  
ATOM 4013  H HE   . ARG A 1 56 ? -46.760 -45.972 -45.096 1.00 0.00 ? 56 ARG A HE   4  
ATOM 4014  H HH11 . ARG A 1 56 ? -45.596 -48.983 -43.850 1.00 0.00 ? 56 ARG A HH11 4  
ATOM 4015  H HH12 . ARG A 1 56 ? -43.972 -48.740 -44.399 1.00 0.00 ? 56 ARG A HH12 4  
ATOM 4016  H HH21 . ARG A 1 56 ? -44.631 -45.646 -45.818 1.00 0.00 ? 56 ARG A HH21 4  
ATOM 4017  H HH22 . ARG A 1 56 ? -43.425 -46.852 -45.513 1.00 0.00 ? 56 ARG A HH22 4  
ATOM 4018  N N    . ARG A 1 57 ? -52.573 -48.133 -41.633 1.00 0.00 ? 57 ARG A N    4  
ATOM 4019  C CA   . ARG A 1 57 ? -53.592 -49.032 -41.093 1.00 0.00 ? 57 ARG A CA   4  
ATOM 4020  C C    . ARG A 1 57 ? -53.349 -50.462 -41.562 1.00 0.00 ? 57 ARG A C    4  
ATOM 4021  O O    . ARG A 1 57 ? -54.294 -51.206 -41.826 1.00 0.00 ? 57 ARG A O    4  
ATOM 4022  C CB   . ARG A 1 57 ? -54.989 -48.583 -41.537 1.00 0.00 ? 57 ARG A CB   4  
ATOM 4023  C CG   . ARG A 1 57 ? -55.277 -47.181 -40.997 1.00 0.00 ? 57 ARG A CG   4  
ATOM 4024  C CD   . ARG A 1 57 ? -56.753 -46.844 -41.217 1.00 0.00 ? 57 ARG A CD   4  
ATOM 4025  N NE   . ARG A 1 57 ? -57.065 -46.847 -42.642 1.00 0.00 ? 57 ARG A NE   4  
ATOM 4026  C CZ   . ARG A 1 57 ? -56.897 -45.761 -43.389 1.00 0.00 ? 57 ARG A CZ   4  
ATOM 4027  N NH1  . ARG A 1 57 ? -56.434 -44.663 -42.853 1.00 0.00 ? 57 ARG A NH1  4  
ATOM 4028  N NH2  . ARG A 1 57 ? -57.193 -45.791 -44.659 1.00 0.00 ? 57 ARG A NH2  4  
ATOM 4029  H H    . ARG A 1 57 ? -52.020 -47.611 -41.014 1.00 0.00 ? 57 ARG A H    4  
ATOM 4030  H HA   . ARG A 1 57 ? -53.544 -49.004 -40.015 1.00 0.00 ? 57 ARG A HA   4  
ATOM 4031  H HB2  . ARG A 1 57 ? -55.042 -48.572 -42.615 1.00 0.00 ? 57 ARG A HB2  4  
ATOM 4032  H HB3  . ARG A 1 57 ? -55.725 -49.272 -41.148 1.00 0.00 ? 57 ARG A HB3  4  
ATOM 4033  H HG2  . ARG A 1 57 ? -55.052 -47.149 -39.942 1.00 0.00 ? 57 ARG A HG2  4  
ATOM 4034  H HG3  . ARG A 1 57 ? -54.665 -46.463 -41.520 1.00 0.00 ? 57 ARG A HG3  4  
ATOM 4035  H HD2  . ARG A 1 57 ? -57.365 -47.579 -40.718 1.00 0.00 ? 57 ARG A HD2  4  
ATOM 4036  H HD3  . ARG A 1 57 ? -56.962 -45.868 -40.804 1.00 0.00 ? 57 ARG A HD3  4  
ATOM 4037  H HE   . ARG A 1 57 ? -57.408 -47.667 -43.057 1.00 0.00 ? 57 ARG A HE   4  
ATOM 4038  H HH11 . ARG A 1 57 ? -56.204 -44.639 -41.880 1.00 0.00 ? 57 ARG A HH11 4  
ATOM 4039  H HH12 . ARG A 1 57 ? -56.310 -43.846 -43.416 1.00 0.00 ? 57 ARG A HH12 4  
ATOM 4040  H HH21 . ARG A 1 57 ? -57.546 -46.632 -45.070 1.00 0.00 ? 57 ARG A HH21 4  
ATOM 4041  H HH22 . ARG A 1 57 ? -57.066 -44.973 -45.221 1.00 0.00 ? 57 ARG A HH22 4  
ATOM 4042  N N    . GLN A 1 58 ? -52.079 -50.841 -41.658 1.00 0.00 ? 58 GLN A N    4  
ATOM 4043  C CA   . GLN A 1 58 ? -51.721 -52.189 -42.092 1.00 0.00 ? 58 GLN A CA   4  
ATOM 4044  C C    . GLN A 1 58 ? -50.625 -52.758 -41.196 1.00 0.00 ? 58 GLN A C    4  
ATOM 4045  O O    . GLN A 1 58 ? -49.622 -52.093 -40.933 1.00 0.00 ? 58 GLN A O    4  
ATOM 4046  C CB   . GLN A 1 58 ? -51.238 -52.160 -43.544 1.00 0.00 ? 58 GLN A CB   4  
ATOM 4047  C CG   . GLN A 1 58 ? -50.944 -53.586 -44.017 1.00 0.00 ? 58 GLN A CG   4  
ATOM 4048  C CD   . GLN A 1 58 ? -50.547 -53.574 -45.489 1.00 0.00 ? 58 GLN A CD   4  
ATOM 4049  O OE1  . GLN A 1 58 ? -50.572 -52.524 -46.131 1.00 0.00 ? 58 GLN A OE1  4  
ATOM 4050  N NE2  . GLN A 1 58 ? -50.178 -54.686 -46.065 1.00 0.00 ? 58 GLN A NE2  4  
ATOM 4051  H H    . GLN A 1 58 ? -51.367 -50.207 -41.432 1.00 0.00 ? 58 GLN A H    4  
ATOM 4052  H HA   . GLN A 1 58 ? -52.592 -52.822 -42.025 1.00 0.00 ? 58 GLN A HA   4  
ATOM 4053  H HB2  . GLN A 1 58 ? -52.005 -51.724 -44.168 1.00 0.00 ? 58 GLN A HB2  4  
ATOM 4054  H HB3  . GLN A 1 58 ? -50.339 -51.567 -43.612 1.00 0.00 ? 58 GLN A HB3  4  
ATOM 4055  H HG2  . GLN A 1 58 ? -50.135 -53.998 -43.431 1.00 0.00 ? 58 GLN A HG2  4  
ATOM 4056  H HG3  . GLN A 1 58 ? -51.826 -54.196 -43.890 1.00 0.00 ? 58 GLN A HG3  4  
ATOM 4057  H HE21 . GLN A 1 58 ? -50.157 -55.520 -45.550 1.00 0.00 ? 58 GLN A HE21 4  
ATOM 4058  H HE22 . GLN A 1 58 ? -49.920 -54.686 -47.010 1.00 0.00 ? 58 GLN A HE22 4  
ATOM 4059  N N    . ILE A 1 59 ? -50.821 -53.991 -40.735 1.00 0.00 ? 59 ILE A N    4  
ATOM 4060  C CA   . ILE A 1 59 ? -49.841 -54.642 -39.871 1.00 0.00 ? 59 ILE A CA   4  
ATOM 4061  C C    . ILE A 1 59 ? -49.508 -56.039 -40.384 1.00 0.00 ? 59 ILE A C    4  
ATOM 4062  O O    . ILE A 1 59 ? -50.355 -56.713 -40.971 1.00 0.00 ? 59 ILE A O    4  
ATOM 4063  C CB   . ILE A 1 59 ? -50.388 -54.725 -38.442 1.00 0.00 ? 59 ILE A CB   4  
ATOM 4064  C CG1  . ILE A 1 59 ? -51.713 -55.499 -38.433 1.00 0.00 ? 59 ILE A CG1  4  
ATOM 4065  C CG2  . ILE A 1 59 ? -50.624 -53.312 -37.905 1.00 0.00 ? 59 ILE A CG2  4  
ATOM 4066  C CD1  . ILE A 1 59 ? -52.160 -55.726 -36.989 1.00 0.00 ? 59 ILE A CD1  4  
ATOM 4067  H H    . ILE A 1 59 ? -51.640 -54.473 -40.981 1.00 0.00 ? 59 ILE A H    4  
ATOM 4068  H HA   . ILE A 1 59 ? -48.936 -54.052 -39.860 1.00 0.00 ? 59 ILE A HA   4  
ATOM 4069  H HB   . ILE A 1 59 ? -49.670 -55.230 -37.814 1.00 0.00 ? 59 ILE A HB   4  
ATOM 4070  H HG12 . ILE A 1 59 ? -52.465 -54.928 -38.959 1.00 0.00 ? 59 ILE A HG12 4  
ATOM 4071  H HG13 . ILE A 1 59 ? -51.582 -56.453 -38.919 1.00 0.00 ? 59 ILE A HG13 4  
ATOM 4072  H HG21 . ILE A 1 59 ? -51.387 -52.825 -38.494 1.00 0.00 ? 59 ILE A HG21 4  
ATOM 4073  H HG22 . ILE A 1 59 ? -49.706 -52.745 -37.965 1.00 0.00 ? 59 ILE A HG22 4  
ATOM 4074  H HG23 . ILE A 1 59 ? -50.944 -53.367 -36.874 1.00 0.00 ? 59 ILE A HG23 4  
ATOM 4075  H HD11 . ILE A 1 59 ? -51.331 -56.099 -36.409 1.00 0.00 ? 59 ILE A HD11 4  
ATOM 4076  H HD12 . ILE A 1 59 ? -52.966 -56.446 -36.971 1.00 0.00 ? 59 ILE A HD12 4  
ATOM 4077  H HD13 . ILE A 1 59 ? -52.505 -54.793 -36.567 1.00 0.00 ? 59 ILE A HD13 4  
ATOM 4078  N N    . ASN A 1 60 ? -48.270 -56.471 -40.158 1.00 0.00 ? 60 ASN A N    4  
ATOM 4079  C CA   . ASN A 1 60 ? -47.841 -57.793 -40.601 1.00 0.00 ? 60 ASN A CA   4  
ATOM 4080  C C    . ASN A 1 60 ? -46.825 -58.391 -39.631 1.00 0.00 ? 60 ASN A C    4  
ATOM 4081  O O    . ASN A 1 60 ? -45.977 -57.682 -39.088 1.00 0.00 ? 60 ASN A O    4  
ATOM 4082  C CB   . ASN A 1 60 ? -47.221 -57.697 -41.996 1.00 0.00 ? 60 ASN A CB   4  
ATOM 4083  C CG   . ASN A 1 60 ? -48.249 -57.168 -42.990 1.00 0.00 ? 60 ASN A CG   4  
ATOM 4084  O OD1  . ASN A 1 60 ? -49.409 -57.580 -42.963 1.00 0.00 ? 60 ASN A OD1  4  
ATOM 4085  N ND2  . ASN A 1 60 ? -47.893 -56.272 -43.869 1.00 0.00 ? 60 ASN A ND2  4  
ATOM 4086  H H    . ASN A 1 60 ? -47.637 -55.892 -39.684 1.00 0.00 ? 60 ASN A H    4  
ATOM 4087  H HA   . ASN A 1 60 ? -48.703 -58.441 -40.648 1.00 0.00 ? 60 ASN A HA   4  
ATOM 4088  H HB2  . ASN A 1 60 ? -46.373 -57.030 -41.966 1.00 0.00 ? 60 ASN A HB2  4  
ATOM 4089  H HB3  . ASN A 1 60 ? -46.894 -58.678 -42.310 1.00 0.00 ? 60 ASN A HB3  4  
ATOM 4090  H HD21 . ASN A 1 60 ? -46.969 -55.944 -43.888 1.00 0.00 ? 60 ASN A HD21 4  
ATOM 4091  H HD22 . ASN A 1 60 ? -48.549 -55.926 -44.510 1.00 0.00 ? 60 ASN A HD22 4  
ATOM 4092  N N    . GLU A 1 61 ? -46.908 -59.702 -39.434 1.00 0.00 ? 61 GLU A N    4  
ATOM 4093  C CA   . GLU A 1 61 ? -45.984 -60.397 -38.543 1.00 0.00 ? 61 GLU A CA   4  
ATOM 4094  C C    . GLU A 1 61 ? -45.887 -59.697 -37.188 1.00 0.00 ? 61 GLU A C    4  
ATOM 4095  O O    . GLU A 1 61 ? -44.796 -59.551 -36.637 1.00 0.00 ? 61 GLU A O    4  
ATOM 4096  C CB   . GLU A 1 61 ? -44.595 -60.460 -39.182 1.00 0.00 ? 61 GLU A CB   4  
ATOM 4097  C CG   . GLU A 1 61 ? -44.652 -61.330 -40.439 1.00 0.00 ? 61 GLU A CG   4  
ATOM 4098  C CD   . GLU A 1 61 ? -43.282 -61.365 -41.110 1.00 0.00 ? 61 GLU A CD   4  
ATOM 4099  O OE1  . GLU A 1 61 ? -42.408 -60.641 -40.664 1.00 0.00 ? 61 GLU A OE1  4  
ATOM 4100  O OE2  . GLU A 1 61 ? -43.128 -62.117 -42.058 1.00 0.00 ? 61 GLU A OE2  4  
ATOM 4101  H H    . GLU A 1 61 ? -47.599 -60.216 -39.902 1.00 0.00 ? 61 GLU A H    4  
ATOM 4102  H HA   . GLU A 1 61 ? -46.339 -61.404 -38.389 1.00 0.00 ? 61 GLU A HA   4  
ATOM 4103  H HB2  . GLU A 1 61 ? -44.277 -59.463 -39.447 1.00 0.00 ? 61 GLU A HB2  4  
ATOM 4104  H HB3  . GLU A 1 61 ? -43.895 -60.889 -38.481 1.00 0.00 ? 61 GLU A HB3  4  
ATOM 4105  H HG2  . GLU A 1 61 ? -44.945 -62.334 -40.168 1.00 0.00 ? 61 GLU A HG2  4  
ATOM 4106  H HG3  . GLU A 1 61 ? -45.375 -60.920 -41.127 1.00 0.00 ? 61 GLU A HG3  4  
ATOM 4107  N N    . ASP A 1 62 ? -47.026 -59.275 -36.653 1.00 0.00 ? 62 ASP A N    4  
ATOM 4108  C CA   . ASP A 1 62 ? -47.038 -58.602 -35.358 1.00 0.00 ? 62 ASP A CA   4  
ATOM 4109  C C    . ASP A 1 62 ? -48.400 -58.746 -34.685 1.00 0.00 ? 62 ASP A C    4  
ATOM 4110  O O    . ASP A 1 62 ? -49.360 -59.213 -35.296 1.00 0.00 ? 62 ASP A O    4  
ATOM 4111  C CB   . ASP A 1 62 ? -46.704 -57.119 -35.534 1.00 0.00 ? 62 ASP A CB   4  
ATOM 4112  C CG   . ASP A 1 62 ? -47.766 -56.444 -36.395 1.00 0.00 ? 62 ASP A CG   4  
ATOM 4113  O OD1  . ASP A 1 62 ? -48.712 -57.116 -36.770 1.00 0.00 ? 62 ASP A OD1  4  
ATOM 4114  O OD2  . ASP A 1 62 ? -47.615 -55.265 -36.670 1.00 0.00 ? 62 ASP A OD2  4  
ATOM 4115  H H    . ASP A 1 62 ? -47.869 -59.422 -37.130 1.00 0.00 ? 62 ASP A H    4  
ATOM 4116  H HA   . ASP A 1 62 ? -46.288 -59.054 -34.724 1.00 0.00 ? 62 ASP A HA   4  
ATOM 4117  H HB2  . ASP A 1 62 ? -46.672 -56.643 -34.566 1.00 0.00 ? 62 ASP A HB2  4  
ATOM 4118  H HB3  . ASP A 1 62 ? -45.742 -57.024 -36.013 1.00 0.00 ? 62 ASP A HB3  4  
ATOM 4119  N N    . GLU A 1 63 ? -48.473 -58.337 -33.422 1.00 0.00 ? 63 GLU A N    4  
ATOM 4120  C CA   . GLU A 1 63 ? -49.720 -58.421 -32.670 1.00 0.00 ? 63 GLU A CA   4  
ATOM 4121  C C    . GLU A 1 63 ? -49.884 -57.206 -31.762 1.00 0.00 ? 63 GLU A C    4  
ATOM 4122  O O    . GLU A 1 63 ? -49.707 -57.299 -30.549 1.00 0.00 ? 63 GLU A O    4  
ATOM 4123  C CB   . GLU A 1 63 ? -49.735 -59.696 -31.826 1.00 0.00 ? 63 GLU A CB   4  
ATOM 4124  C CG   . GLU A 1 63 ? -51.130 -59.902 -31.234 1.00 0.00 ? 63 GLU A CG   4  
ATOM 4125  C CD   . GLU A 1 63 ? -51.168 -61.194 -30.425 1.00 0.00 ? 63 GLU A CD   4  
ATOM 4126  O OE1  . GLU A 1 63 ? -50.165 -61.889 -30.407 1.00 0.00 ? 63 GLU A OE1  4  
ATOM 4127  O OE2  . GLU A 1 63 ? -52.200 -61.472 -29.836 1.00 0.00 ? 63 GLU A OE2  4  
ATOM 4128  H H    . GLU A 1 63 ? -47.674 -57.972 -32.987 1.00 0.00 ? 63 GLU A H    4  
ATOM 4129  H HA   . GLU A 1 63 ? -50.546 -58.456 -33.364 1.00 0.00 ? 63 GLU A HA   4  
ATOM 4130  H HB2  . GLU A 1 63 ? -49.478 -60.542 -32.447 1.00 0.00 ? 63 GLU A HB2  4  
ATOM 4131  H HB3  . GLU A 1 63 ? -49.016 -59.606 -31.025 1.00 0.00 ? 63 GLU A HB3  4  
ATOM 4132  H HG2  . GLU A 1 63 ? -51.372 -59.069 -30.590 1.00 0.00 ? 63 GLU A HG2  4  
ATOM 4133  H HG3  . GLU A 1 63 ? -51.854 -59.959 -32.034 1.00 0.00 ? 63 GLU A HG3  4  
ATOM 4134  N N    . PRO A 1 64 ? -50.213 -56.076 -32.329 1.00 0.00 ? 64 PRO A N    4  
ATOM 4135  C CA   . PRO A 1 64 ? -50.405 -54.813 -31.558 1.00 0.00 ? 64 PRO A CA   4  
ATOM 4136  C C    . PRO A 1 64 ? -51.361 -54.997 -30.382 1.00 0.00 ? 64 PRO A C    4  
ATOM 4137  O O    . PRO A 1 64 ? -52.313 -55.745 -30.530 1.00 0.00 ? 64 PRO A O    4  
ATOM 4138  C CB   . PRO A 1 64 ? -50.984 -53.838 -32.586 1.00 0.00 ? 64 PRO A CB   4  
ATOM 4139  C CG   . PRO A 1 64 ? -50.568 -54.366 -33.918 1.00 0.00 ? 64 PRO A CG   4  
ATOM 4140  C CD   . PRO A 1 64 ? -50.441 -55.882 -33.768 1.00 0.00 ? 64 PRO A CD   4  
ATOM 4141  O OXT  . PRO A 1 64 ? -51.127 -54.387 -29.352 1.00 0.00 ? 64 PRO A OXT  4  
ATOM 4142  H HA   . PRO A 1 64 ? -49.453 -54.443 -31.209 1.00 0.00 ? 64 PRO A HA   4  
ATOM 4143  H HB2  . PRO A 1 64 ? -52.062 -53.816 -32.510 1.00 0.00 ? 64 PRO A HB2  4  
ATOM 4144  H HB3  . PRO A 1 64 ? -50.577 -52.850 -32.437 1.00 0.00 ? 64 PRO A HB3  4  
ATOM 4145  H HG2  . PRO A 1 64 ? -51.315 -54.124 -34.661 1.00 0.00 ? 64 PRO A HG2  4  
ATOM 4146  H HG3  . PRO A 1 64 ? -49.614 -53.949 -34.200 1.00 0.00 ? 64 PRO A HG3  4  
ATOM 4147  H HD2  . PRO A 1 64 ? -51.353 -56.369 -34.081 1.00 0.00 ? 64 PRO A HD2  4  
ATOM 4148  H HD3  . PRO A 1 64 ? -49.597 -56.250 -34.332 1.00 0.00 ? 64 PRO A HD3  4  
ATOM 4149  N N    . LEU A 1 1  ? -10.921 -5.020  -14.242 1.00 0.00 ? 1  LEU A N    5  
ATOM 4150  C CA   . LEU A 1 1  ? -10.091 -6.236  -14.017 1.00 0.00 ? 1  LEU A CA   5  
ATOM 4151  C C    . LEU A 1 1  ? -10.489 -7.310  -15.024 1.00 0.00 ? 1  LEU A C    5  
ATOM 4152  O O    . LEU A 1 1  ? -9.632  -7.977  -15.604 1.00 0.00 ? 1  LEU A O    5  
ATOM 4153  C CB   . LEU A 1 1  ? -10.316 -6.747  -12.592 1.00 0.00 ? 1  LEU A CB   5  
ATOM 4154  C CG   . LEU A 1 1  ? -9.990  -5.637  -11.588 1.00 0.00 ? 1  LEU A CG   5  
ATOM 4155  C CD1  . LEU A 1 1  ? -10.256 -6.139  -10.168 1.00 0.00 ? 1  LEU A CD1  5  
ATOM 4156  C CD2  . LEU A 1 1  ? -8.518  -5.237  -11.718 1.00 0.00 ? 1  LEU A CD2  5  
ATOM 4157  H H1   . LEU A 1 1  ? -11.393 -5.088  -15.166 1.00 0.00 ? 1  LEU A H1   5  
ATOM 4158  H H2   . LEU A 1 1  ? -10.312 -4.177  -14.223 1.00 0.00 ? 1  LEU A H2   5  
ATOM 4159  H H3   . LEU A 1 1  ? -11.639 -4.946  -13.494 1.00 0.00 ? 1  LEU A H3   5  
ATOM 4160  H HA   . LEU A 1 1  ? -9.049  -5.989  -14.152 1.00 0.00 ? 1  LEU A HA   5  
ATOM 4161  H HB2  . LEU A 1 1  ? -11.348 -7.045  -12.475 1.00 0.00 ? 1  LEU A HB2  5  
ATOM 4162  H HB3  . LEU A 1 1  ? -9.675  -7.596  -12.407 1.00 0.00 ? 1  LEU A HB3  5  
ATOM 4163  H HG   . LEU A 1 1  ? -10.616 -4.780  -11.788 1.00 0.00 ? 1  LEU A HG   5  
ATOM 4164  H HD11 . LEU A 1 1  ? -11.263 -6.523  -10.105 1.00 0.00 ? 1  LEU A HD11 5  
ATOM 4165  H HD12 . LEU A 1 1  ? -10.137 -5.322  -9.470  1.00 0.00 ? 1  LEU A HD12 5  
ATOM 4166  H HD13 . LEU A 1 1  ? -9.555  -6.924  -9.927  1.00 0.00 ? 1  LEU A HD13 5  
ATOM 4167  H HD21 . LEU A 1 1  ? -8.165  -4.851  -10.772 1.00 0.00 ? 1  LEU A HD21 5  
ATOM 4168  H HD22 . LEU A 1 1  ? -8.417  -4.474  -12.476 1.00 0.00 ? 1  LEU A HD22 5  
ATOM 4169  H HD23 . LEU A 1 1  ? -7.931  -6.100  -11.995 1.00 0.00 ? 1  LEU A HD23 5  
ATOM 4170  N N    . ASP A 1 2  ? -11.795 -7.468  -15.227 1.00 0.00 ? 2  ASP A N    5  
ATOM 4171  C CA   . ASP A 1 2  ? -12.304 -8.459  -16.168 1.00 0.00 ? 2  ASP A CA   5  
ATOM 4172  C C    . ASP A 1 2  ? -13.242 -7.806  -17.179 1.00 0.00 ? 2  ASP A C    5  
ATOM 4173  O O    . ASP A 1 2  ? -14.462 -7.842  -17.022 1.00 0.00 ? 2  ASP A O    5  
ATOM 4174  C CB   . ASP A 1 2  ? -13.050 -9.560  -15.409 1.00 0.00 ? 2  ASP A CB   5  
ATOM 4175  C CG   . ASP A 1 2  ? -14.210 -8.958  -14.622 1.00 0.00 ? 2  ASP A CG   5  
ATOM 4176  O OD1  . ASP A 1 2  ? -14.367 -7.749  -14.665 1.00 0.00 ? 2  ASP A OD1  5  
ATOM 4177  O OD2  . ASP A 1 2  ? -14.925 -9.716  -13.988 1.00 0.00 ? 2  ASP A OD2  5  
ATOM 4178  H H    . ASP A 1 2  ? -12.427 -6.903  -14.738 1.00 0.00 ? 2  ASP A H    5  
ATOM 4179  H HA   . ASP A 1 2  ? -11.476 -8.905  -16.697 1.00 0.00 ? 2  ASP A HA   5  
ATOM 4180  H HB2  . ASP A 1 2  ? -13.433 -10.284 -16.113 1.00 0.00 ? 2  ASP A HB2  5  
ATOM 4181  H HB3  . ASP A 1 2  ? -12.371 -10.048 -14.727 1.00 0.00 ? 2  ASP A HB3  5  
ATOM 4182  N N    . ARG A 1 3  ? -12.661 -7.208  -18.214 1.00 0.00 ? 3  ARG A N    5  
ATOM 4183  C CA   . ARG A 1 3  ? -13.453 -6.545  -19.244 1.00 0.00 ? 3  ARG A CA   5  
ATOM 4184  C C    . ARG A 1 3  ? -13.528 -7.393  -20.512 1.00 0.00 ? 3  ARG A C    5  
ATOM 4185  O O    . ARG A 1 3  ? -14.186 -7.011  -21.480 1.00 0.00 ? 3  ARG A O    5  
ATOM 4186  C CB   . ARG A 1 3  ? -12.842 -5.184  -19.577 1.00 0.00 ? 3  ARG A CB   5  
ATOM 4187  C CG   . ARG A 1 3  ? -12.871 -4.294  -18.333 1.00 0.00 ? 3  ARG A CG   5  
ATOM 4188  C CD   . ARG A 1 3  ? -12.073 -3.017  -18.599 1.00 0.00 ? 3  ARG A CD   5  
ATOM 4189  N NE   . ARG A 1 3  ? -10.665 -3.335  -18.805 1.00 0.00 ? 3  ARG A NE   5  
ATOM 4190  C CZ   . ARG A 1 3  ? -9.789  -2.390  -19.131 1.00 0.00 ? 3  ARG A CZ   5  
ATOM 4191  N NH1  . ARG A 1 3  ? -10.187 -1.154  -19.272 1.00 0.00 ? 3  ARG A NH1  5  
ATOM 4192  N NH2  . ARG A 1 3  ? -8.534  -2.696  -19.312 1.00 0.00 ? 3  ARG A NH2  5  
ATOM 4193  H H    . ARG A 1 3  ? -11.682 -7.213  -18.282 1.00 0.00 ? 3  ARG A H    5  
ATOM 4194  H HA   . ARG A 1 3  ? -14.454 -6.391  -18.870 1.00 0.00 ? 3  ARG A HA   5  
ATOM 4195  H HB2  . ARG A 1 3  ? -11.818 -5.318  -19.902 1.00 0.00 ? 3  ARG A HB2  5  
ATOM 4196  H HB3  . ARG A 1 3  ? -13.411 -4.716  -20.366 1.00 0.00 ? 3  ARG A HB3  5  
ATOM 4197  H HG2  . ARG A 1 3  ? -13.894 -4.038  -18.098 1.00 0.00 ? 3  ARG A HG2  5  
ATOM 4198  H HG3  . ARG A 1 3  ? -12.432 -4.824  -17.501 1.00 0.00 ? 3  ARG A HG3  5  
ATOM 4199  H HD2  . ARG A 1 3  ? -12.460 -2.532  -19.482 1.00 0.00 ? 3  ARG A HD2  5  
ATOM 4200  H HD3  . ARG A 1 3  ? -12.172 -2.352  -17.754 1.00 0.00 ? 3  ARG A HD3  5  
ATOM 4201  H HE   . ARG A 1 3  ? -10.359 -4.260  -18.701 1.00 0.00 ? 3  ARG A HE   5  
ATOM 4202  H HH11 . ARG A 1 3  ? -11.149 -0.919  -19.132 1.00 0.00 ? 3  ARG A HH11 5  
ATOM 4203  H HH12 . ARG A 1 3  ? -9.528  -0.442  -19.517 1.00 0.00 ? 3  ARG A HH12 5  
ATOM 4204  H HH21 . ARG A 1 3  ? -8.230  -3.643  -19.204 1.00 0.00 ? 3  ARG A HH21 5  
ATOM 4205  H HH22 . ARG A 1 3  ? -7.875  -1.985  -19.557 1.00 0.00 ? 3  ARG A HH22 5  
ATOM 4206  N N    . TRP A 1 4  ? -12.848 -8.538  -20.502 1.00 0.00 ? 4  TRP A N    5  
ATOM 4207  C CA   . TRP A 1 4  ? -12.843 -9.427  -21.662 1.00 0.00 ? 4  TRP A CA   5  
ATOM 4208  C C    . TRP A 1 4  ? -13.396 -10.799 -21.286 1.00 0.00 ? 4  TRP A C    5  
ATOM 4209  O O    . TRP A 1 4  ? -13.427 -11.709 -22.114 1.00 0.00 ? 4  TRP A O    5  
ATOM 4210  C CB   . TRP A 1 4  ? -11.417 -9.574  -22.196 1.00 0.00 ? 4  TRP A CB   5  
ATOM 4211  C CG   . TRP A 1 4  ? -11.444 -10.297 -23.505 1.00 0.00 ? 4  TRP A CG   5  
ATOM 4212  C CD1  . TRP A 1 4  ? -11.561 -9.705  -24.715 1.00 0.00 ? 4  TRP A CD1  5  
ATOM 4213  C CD2  . TRP A 1 4  ? -11.347 -11.729 -23.757 1.00 0.00 ? 4  TRP A CD2  5  
ATOM 4214  N NE1  . TRP A 1 4  ? -11.546 -10.682 -25.694 1.00 0.00 ? 4  TRP A NE1  5  
ATOM 4215  C CE2  . TRP A 1 4  ? -11.416 -11.945 -25.154 1.00 0.00 ? 4  TRP A CE2  5  
ATOM 4216  C CE3  . TRP A 1 4  ? -11.210 -12.849 -22.919 1.00 0.00 ? 4  TRP A CE3  5  
ATOM 4217  C CZ2  . TRP A 1 4  ? -11.349 -13.229 -25.700 1.00 0.00 ? 4  TRP A CZ2  5  
ATOM 4218  C CZ3  . TRP A 1 4  ? -11.143 -14.141 -23.464 1.00 0.00 ? 4  TRP A CZ3  5  
ATOM 4219  C CH2  . TRP A 1 4  ? -11.213 -14.331 -24.851 1.00 0.00 ? 4  TRP A CH2  5  
ATOM 4220  H H    . TRP A 1 4  ? -12.336 -8.792  -19.705 1.00 0.00 ? 4  TRP A H    5  
ATOM 4221  H HA   . TRP A 1 4  ? -13.463 -9.003  -22.436 1.00 0.00 ? 4  TRP A HA   5  
ATOM 4222  H HB2  . TRP A 1 4  ? -10.981 -8.596  -22.334 1.00 0.00 ? 4  TRP A HB2  5  
ATOM 4223  H HB3  . TRP A 1 4  ? -10.825 -10.135 -21.488 1.00 0.00 ? 4  TRP A HB3  5  
ATOM 4224  H HD1  . TRP A 1 4  ? -11.653 -8.643  -24.888 1.00 0.00 ? 4  TRP A HD1  5  
ATOM 4225  H HE1  . TRP A 1 4  ? -11.618 -10.517 -26.658 1.00 0.00 ? 4  TRP A HE1  5  
ATOM 4226  H HE3  . TRP A 1 4  ? -11.155 -12.714 -21.850 1.00 0.00 ? 4  TRP A HE3  5  
ATOM 4227  H HZ2  . TRP A 1 4  ? -11.405 -13.368 -26.769 1.00 0.00 ? 4  TRP A HZ2  5  
ATOM 4228  H HZ3  . TRP A 1 4  ? -11.037 -14.995 -22.810 1.00 0.00 ? 4  TRP A HZ3  5  
ATOM 4229  H HH2  . TRP A 1 4  ? -11.161 -15.327 -25.265 1.00 0.00 ? 4  TRP A HH2  5  
ATOM 4230  N N    . TYR A 1 5  ? -13.827 -10.936 -20.035 1.00 0.00 ? 5  TYR A N    5  
ATOM 4231  C CA   . TYR A 1 5  ? -14.376 -12.203 -19.556 1.00 0.00 ? 5  TYR A CA   5  
ATOM 4232  C C    . TYR A 1 5  ? -15.785 -12.001 -19.010 1.00 0.00 ? 5  TYR A C    5  
ATOM 4233  O O    . TYR A 1 5  ? -16.066 -10.992 -18.362 1.00 0.00 ? 5  TYR A O    5  
ATOM 4234  C CB   . TYR A 1 5  ? -13.485 -12.767 -18.447 1.00 0.00 ? 5  TYR A CB   5  
ATOM 4235  C CG   . TYR A 1 5  ? -12.095 -13.016 -18.983 1.00 0.00 ? 5  TYR A CG   5  
ATOM 4236  C CD1  . TYR A 1 5  ? -11.776 -14.250 -19.564 1.00 0.00 ? 5  TYR A CD1  5  
ATOM 4237  C CD2  . TYR A 1 5  ? -11.123 -12.011 -18.895 1.00 0.00 ? 5  TYR A CD2  5  
ATOM 4238  C CE1  . TYR A 1 5  ? -10.483 -14.478 -20.056 1.00 0.00 ? 5  TYR A CE1  5  
ATOM 4239  C CE2  . TYR A 1 5  ? -9.834  -12.240 -19.386 1.00 0.00 ? 5  TYR A CE2  5  
ATOM 4240  C CZ   . TYR A 1 5  ? -9.514  -13.472 -19.967 1.00 0.00 ? 5  TYR A CZ   5  
ATOM 4241  O OH   . TYR A 1 5  ? -8.240  -13.695 -20.450 1.00 0.00 ? 5  TYR A OH   5  
ATOM 4242  H H    . TYR A 1 5  ? -13.776 -10.173 -19.423 1.00 0.00 ? 5  TYR A H    5  
ATOM 4243  H HA   . TYR A 1 5  ? -14.411 -12.909 -20.371 1.00 0.00 ? 5  TYR A HA   5  
ATOM 4244  H HB2  . TYR A 1 5  ? -13.434 -12.060 -17.633 1.00 0.00 ? 5  TYR A HB2  5  
ATOM 4245  H HB3  . TYR A 1 5  ? -13.903 -13.697 -18.090 1.00 0.00 ? 5  TYR A HB3  5  
ATOM 4246  H HD1  . TYR A 1 5  ? -12.523 -15.025 -19.632 1.00 0.00 ? 5  TYR A HD1  5  
ATOM 4247  H HD2  . TYR A 1 5  ? -11.371 -11.060 -18.448 1.00 0.00 ? 5  TYR A HD2  5  
ATOM 4248  H HE1  . TYR A 1 5  ? -10.238 -15.430 -20.503 1.00 0.00 ? 5  TYR A HE1  5  
ATOM 4249  H HE2  . TYR A 1 5  ? -9.085  -11.463 -19.317 1.00 0.00 ? 5  TYR A HE2  5  
ATOM 4250  H HH   . TYR A 1 5  ? -8.191  -14.605 -20.749 1.00 0.00 ? 5  TYR A HH   5  
ATOM 4251  N N    . LEU A 1 6  ? -16.666 -12.960 -19.297 1.00 0.00 ? 6  LEU A N    5  
ATOM 4252  C CA   . LEU A 1 6  ? -18.058 -12.886 -18.853 1.00 0.00 ? 6  LEU A CA   5  
ATOM 4253  C C    . LEU A 1 6  ? -18.160 -12.207 -17.489 1.00 0.00 ? 6  LEU A C    5  
ATOM 4254  O O    . LEU A 1 6  ? -17.291 -12.371 -16.633 1.00 0.00 ? 6  LEU A O    5  
ATOM 4255  C CB   . LEU A 1 6  ? -18.652 -14.295 -18.765 1.00 0.00 ? 6  LEU A CB   5  
ATOM 4256  C CG   . LEU A 1 6  ? -18.584 -14.974 -20.138 1.00 0.00 ? 6  LEU A CG   5  
ATOM 4257  C CD1  . LEU A 1 6  ? -19.115 -16.404 -20.026 1.00 0.00 ? 6  LEU A CD1  5  
ATOM 4258  C CD2  . LEU A 1 6  ? -19.434 -14.198 -21.150 1.00 0.00 ? 6  LEU A CD2  5  
ATOM 4259  H H    . LEU A 1 6  ? -16.378 -13.717 -19.847 1.00 0.00 ? 6  LEU A H    5  
ATOM 4260  H HA   . LEU A 1 6  ? -18.624 -12.310 -19.569 1.00 0.00 ? 6  LEU A HA   5  
ATOM 4261  H HB2  . LEU A 1 6  ? -18.088 -14.876 -18.050 1.00 0.00 ? 6  LEU A HB2  5  
ATOM 4262  H HB3  . LEU A 1 6  ? -19.681 -14.234 -18.447 1.00 0.00 ? 6  LEU A HB3  5  
ATOM 4263  H HG   . LEU A 1 6  ? -17.556 -14.999 -20.475 1.00 0.00 ? 6  LEU A HG   5  
ATOM 4264  H HD11 . LEU A 1 6  ? -19.898 -16.439 -19.282 1.00 0.00 ? 6  LEU A HD11 5  
ATOM 4265  H HD12 . LEU A 1 6  ? -18.311 -17.064 -19.734 1.00 0.00 ? 6  LEU A HD12 5  
ATOM 4266  H HD13 . LEU A 1 6  ? -19.510 -16.718 -20.980 1.00 0.00 ? 6  LEU A HD13 5  
ATOM 4267  H HD21 . LEU A 1 6  ? -20.271 -13.740 -20.644 1.00 0.00 ? 6  LEU A HD21 5  
ATOM 4268  H HD22 . LEU A 1 6  ? -19.800 -14.876 -21.907 1.00 0.00 ? 6  LEU A HD22 5  
ATOM 4269  H HD23 . LEU A 1 6  ? -18.832 -13.432 -21.614 1.00 0.00 ? 6  LEU A HD23 5  
ATOM 4270  N N    . GLY A 1 7  ? -19.223 -11.429 -17.306 1.00 0.00 ? 7  GLY A N    5  
ATOM 4271  C CA   . GLY A 1 7  ? -19.435 -10.703 -16.059 1.00 0.00 ? 7  GLY A CA   5  
ATOM 4272  C C    . GLY A 1 7  ? -18.854 -9.297  -16.164 1.00 0.00 ? 7  GLY A C    5  
ATOM 4273  O O    . GLY A 1 7  ? -19.109 -8.440  -15.318 1.00 0.00 ? 7  GLY A O    5  
ATOM 4274  H H    . GLY A 1 7  ? -19.876 -11.326 -18.029 1.00 0.00 ? 7  GLY A H    5  
ATOM 4275  H HA2  . GLY A 1 7  ? -20.496 -10.641 -15.858 1.00 0.00 ? 7  GLY A HA2  5  
ATOM 4276  H HA3  . GLY A 1 7  ? -18.947 -11.229 -15.252 1.00 0.00 ? 7  GLY A HA3  5  
ATOM 4277  N N    . GLY A 1 8  ? -18.075 -9.075  -17.217 1.00 0.00 ? 8  GLY A N    5  
ATOM 4278  C CA   . GLY A 1 8  ? -17.459 -7.772  -17.445 1.00 0.00 ? 8  GLY A CA   5  
ATOM 4279  C C    . GLY A 1 8  ? -18.424 -6.829  -18.154 1.00 0.00 ? 8  GLY A C    5  
ATOM 4280  O O    . GLY A 1 8  ? -19.517 -7.230  -18.553 1.00 0.00 ? 8  GLY A O    5  
ATOM 4281  H H    . GLY A 1 8  ? -17.912 -9.807  -17.847 1.00 0.00 ? 8  GLY A H    5  
ATOM 4282  H HA2  . GLY A 1 8  ? -17.174 -7.344  -16.495 1.00 0.00 ? 8  GLY A HA2  5  
ATOM 4283  H HA3  . GLY A 1 8  ? -16.578 -7.899  -18.056 1.00 0.00 ? 8  GLY A HA3  5  
ATOM 4284  N N    . SER A 1 9  ? -18.009 -5.575  -18.314 1.00 0.00 ? 9  SER A N    5  
ATOM 4285  C CA   . SER A 1 9  ? -18.843 -4.587  -18.986 1.00 0.00 ? 9  SER A CA   5  
ATOM 4286  C C    . SER A 1 9  ? -18.655 -4.686  -20.503 1.00 0.00 ? 9  SER A C    5  
ATOM 4287  O O    . SER A 1 9  ? -17.571 -5.039  -20.967 1.00 0.00 ? 9  SER A O    5  
ATOM 4288  C CB   . SER A 1 9  ? -18.462 -3.184  -18.507 1.00 0.00 ? 9  SER A CB   5  
ATOM 4289  O OG   . SER A 1 9  ? -18.747 -3.070  -17.119 1.00 0.00 ? 9  SER A OG   5  
ATOM 4290  H H    . SER A 1 9  ? -17.125 -5.315  -17.980 1.00 0.00 ? 9  SER A H    5  
ATOM 4291  H HA   . SER A 1 9  ? -19.875 -4.778  -18.734 1.00 0.00 ? 9  SER A HA   5  
ATOM 4292  H HB2  . SER A 1 9  ? -17.410 -3.022  -18.665 1.00 0.00 ? 9  SER A HB2  5  
ATOM 4293  H HB3  . SER A 1 9  ? -19.024 -2.446  -19.063 1.00 0.00 ? 9  SER A HB3  5  
ATOM 4294  H HG   . SER A 1 9  ? -18.380 -3.838  -16.677 1.00 0.00 ? 9  SER A HG   5  
ATOM 4295  N N    . PRO A 1 10 ? -19.668 -4.387  -21.284 1.00 0.00 ? 10 PRO A N    5  
ATOM 4296  C CA   . PRO A 1 10 ? -19.565 -4.459  -22.771 1.00 0.00 ? 10 PRO A CA   5  
ATOM 4297  C C    . PRO A 1 10 ? -18.638 -3.384  -23.336 1.00 0.00 ? 10 PRO A C    5  
ATOM 4298  O O    . PRO A 1 10 ? -17.455 -3.632  -23.564 1.00 0.00 ? 10 PRO A O    5  
ATOM 4299  C CB   . PRO A 1 10 ? -21.002 -4.250  -23.254 1.00 0.00 ? 10 PRO A CB   5  
ATOM 4300  C CG   . PRO A 1 10 ? -21.697 -3.531  -22.147 1.00 0.00 ? 10 PRO A CG   5  
ATOM 4301  C CD   . PRO A 1 10 ? -21.009 -3.954  -20.850 1.00 0.00 ? 10 PRO A CD   5  
ATOM 4302  H HA   . PRO A 1 10 ? -19.224 -5.436  -23.072 1.00 0.00 ? 10 PRO A HA   5  
ATOM 4303  H HB2  . PRO A 1 10 ? -21.010 -3.654  -24.155 1.00 0.00 ? 10 PRO A HB2  5  
ATOM 4304  H HB3  . PRO A 1 10 ? -21.480 -5.202  -23.430 1.00 0.00 ? 10 PRO A HB3  5  
ATOM 4305  H HG2  . PRO A 1 10 ? -21.603 -2.462  -22.287 1.00 0.00 ? 10 PRO A HG2  5  
ATOM 4306  H HG3  . PRO A 1 10 ? -22.737 -3.813  -22.114 1.00 0.00 ? 10 PRO A HG3  5  
ATOM 4307  H HD2  . PRO A 1 10 ? -20.944 -3.118  -20.171 1.00 0.00 ? 10 PRO A HD2  5  
ATOM 4308  H HD3  . PRO A 1 10 ? -21.536 -4.778  -20.394 1.00 0.00 ? 10 PRO A HD3  5  
ATOM 4309  N N    . LYS A 1 11 ? -19.184 -2.192  -23.558 1.00 0.00 ? 11 LYS A N    5  
ATOM 4310  C CA   . LYS A 1 11 ? -18.392 -1.091  -24.097 1.00 0.00 ? 11 LYS A CA   5  
ATOM 4311  C C    . LYS A 1 11 ? -17.838 -0.223  -22.972 1.00 0.00 ? 11 LYS A C    5  
ATOM 4312  O O    . LYS A 1 11 ? -16.971 0.622   -23.197 1.00 0.00 ? 11 LYS A O    5  
ATOM 4313  C CB   . LYS A 1 11 ? -19.255 -0.240  -25.030 1.00 0.00 ? 11 LYS A CB   5  
ATOM 4314  C CG   . LYS A 1 11 ? -19.674 -1.078  -26.239 1.00 0.00 ? 11 LYS A CG   5  
ATOM 4315  C CD   . LYS A 1 11 ? -20.538 -0.230  -27.177 1.00 0.00 ? 11 LYS A CD   5  
ATOM 4316  C CE   . LYS A 1 11 ? -20.958 -1.074  -28.382 1.00 0.00 ? 11 LYS A CE   5  
ATOM 4317  N NZ   . LYS A 1 11 ? -21.807 -0.253  -29.292 1.00 0.00 ? 11 LYS A NZ   5  
ATOM 4318  H H    . LYS A 1 11 ? -20.133 -2.049  -23.361 1.00 0.00 ? 11 LYS A H    5  
ATOM 4319  H HA   . LYS A 1 11 ? -17.567 -1.499  -24.662 1.00 0.00 ? 11 LYS A HA   5  
ATOM 4320  H HB2  . LYS A 1 11 ? -20.133 0.096   -24.500 1.00 0.00 ? 11 LYS A HB2  5  
ATOM 4321  H HB3  . LYS A 1 11 ? -18.686 0.614   -25.366 1.00 0.00 ? 11 LYS A HB3  5  
ATOM 4322  H HG2  . LYS A 1 11 ? -18.793 -1.414  -26.767 1.00 0.00 ? 11 LYS A HG2  5  
ATOM 4323  H HG3  . LYS A 1 11 ? -20.242 -1.932  -25.905 1.00 0.00 ? 11 LYS A HG3  5  
ATOM 4324  H HD2  . LYS A 1 11 ? -21.417 0.108   -26.648 1.00 0.00 ? 11 LYS A HD2  5  
ATOM 4325  H HD3  . LYS A 1 11 ? -19.970 0.623   -27.517 1.00 0.00 ? 11 LYS A HD3  5  
ATOM 4326  H HE2  . LYS A 1 11 ? -20.078 -1.405  -28.914 1.00 0.00 ? 11 LYS A HE2  5  
ATOM 4327  H HE3  . LYS A 1 11 ? -21.520 -1.932  -28.044 1.00 0.00 ? 11 LYS A HE3  5  
ATOM 4328  H HZ1  . LYS A 1 11 ? -21.664 0.756   -29.085 1.00 0.00 ? 11 LYS A HZ1  5  
ATOM 4329  H HZ2  . LYS A 1 11 ? -22.809 -0.499  -29.146 1.00 0.00 ? 11 LYS A HZ2  5  
ATOM 4330  H HZ3  . LYS A 1 11 ? -21.544 -0.444  -30.279 1.00 0.00 ? 11 LYS A HZ3  5  
ATOM 4331  N N    . GLY A 1 12 ? -18.338 -0.438  -21.760 1.00 0.00 ? 12 GLY A N    5  
ATOM 4332  C CA   . GLY A 1 12 ? -17.880 0.330   -20.607 1.00 0.00 ? 12 GLY A CA   5  
ATOM 4333  C C    . GLY A 1 12 ? -18.473 1.736   -20.607 1.00 0.00 ? 12 GLY A C    5  
ATOM 4334  O O    . GLY A 1 12 ? -17.991 2.621   -19.900 1.00 0.00 ? 12 GLY A O    5  
ATOM 4335  H H    . GLY A 1 12 ? -19.026 -1.126  -21.636 1.00 0.00 ? 12 GLY A H    5  
ATOM 4336  H HA2  . GLY A 1 12 ? -18.176 -0.180  -19.702 1.00 0.00 ? 12 GLY A HA2  5  
ATOM 4337  H HA3  . GLY A 1 12 ? -16.803 0.403   -20.636 1.00 0.00 ? 12 GLY A HA3  5  
ATOM 4338  N N    . ASP A 1 13 ? -19.525 1.936   -21.396 1.00 0.00 ? 13 ASP A N    5  
ATOM 4339  C CA   . ASP A 1 13 ? -20.171 3.244   -21.465 1.00 0.00 ? 13 ASP A CA   5  
ATOM 4340  C C    . ASP A 1 13 ? -21.586 3.122   -22.019 1.00 0.00 ? 13 ASP A C    5  
ATOM 4341  O O    . ASP A 1 13 ? -21.963 3.841   -22.946 1.00 0.00 ? 13 ASP A O    5  
ATOM 4342  C CB   . ASP A 1 13 ? -19.353 4.182   -22.355 1.00 0.00 ? 13 ASP A CB   5  
ATOM 4343  C CG   . ASP A 1 13 ? -19.976 5.573   -22.356 1.00 0.00 ? 13 ASP A CG   5  
ATOM 4344  O OD1  . ASP A 1 13 ? -21.059 5.716   -21.812 1.00 0.00 ? 13 ASP A OD1  5  
ATOM 4345  O OD2  . ASP A 1 13 ? -19.363 6.475   -22.901 1.00 0.00 ? 13 ASP A OD2  5  
ATOM 4346  H H    . ASP A 1 13 ? -19.873 1.193   -21.931 1.00 0.00 ? 13 ASP A H    5  
ATOM 4347  H HA   . ASP A 1 13 ? -20.219 3.662   -20.472 1.00 0.00 ? 13 ASP A HA   5  
ATOM 4348  H HB2  . ASP A 1 13 ? -18.342 4.242   -21.978 1.00 0.00 ? 13 ASP A HB2  5  
ATOM 4349  H HB3  . ASP A 1 13 ? -19.337 3.796   -23.364 1.00 0.00 ? 13 ASP A HB3  5  
ATOM 4350  N N    . VAL A 1 14 ? -22.375 2.226   -21.436 1.00 0.00 ? 14 VAL A N    5  
ATOM 4351  C CA   . VAL A 1 14 ? -23.754 2.041   -21.871 1.00 0.00 ? 14 VAL A CA   5  
ATOM 4352  C C    . VAL A 1 14 ? -24.642 1.659   -20.687 1.00 0.00 ? 14 VAL A C    5  
ATOM 4353  O O    . VAL A 1 14 ? -24.165 1.079   -19.712 1.00 0.00 ? 14 VAL A O    5  
ATOM 4354  C CB   . VAL A 1 14 ? -23.824 0.956   -22.948 1.00 0.00 ? 14 VAL A CB   5  
ATOM 4355  C CG1  . VAL A 1 14 ? -23.043 1.412   -24.182 1.00 0.00 ? 14 VAL A CG1  5  
ATOM 4356  C CG2  . VAL A 1 14 ? -23.211 -0.340  -22.413 1.00 0.00 ? 14 VAL A CG2  5  
ATOM 4357  H H    . VAL A 1 14 ? -22.032 1.698   -20.684 1.00 0.00 ? 14 VAL A H    5  
ATOM 4358  H HA   . VAL A 1 14 ? -24.115 2.969   -22.290 1.00 0.00 ? 14 VAL A HA   5  
ATOM 4359  H HB   . VAL A 1 14 ? -24.856 0.785   -23.222 1.00 0.00 ? 14 VAL A HB   5  
ATOM 4360  H HG11 . VAL A 1 14 ? -23.358 2.407   -24.461 1.00 0.00 ? 14 VAL A HG11 5  
ATOM 4361  H HG12 . VAL A 1 14 ? -23.231 0.732   -25.000 1.00 0.00 ? 14 VAL A HG12 5  
ATOM 4362  H HG13 . VAL A 1 14 ? -21.987 1.420   -23.956 1.00 0.00 ? 14 VAL A HG13 5  
ATOM 4363  H HG21 . VAL A 1 14 ? -22.163 -0.184  -22.206 1.00 0.00 ? 14 VAL A HG21 5  
ATOM 4364  H HG22 . VAL A 1 14 ? -23.318 -1.120  -23.153 1.00 0.00 ? 14 VAL A HG22 5  
ATOM 4365  H HG23 . VAL A 1 14 ? -23.717 -0.634  -21.507 1.00 0.00 ? 14 VAL A HG23 5  
ATOM 4366  N N    . ASP A 1 15 ? -25.930 1.981   -20.780 1.00 0.00 ? 15 ASP A N    5  
ATOM 4367  C CA   . ASP A 1 15 ? -26.871 1.659   -19.710 1.00 0.00 ? 15 ASP A CA   5  
ATOM 4368  C C    . ASP A 1 15 ? -28.137 1.022   -20.282 1.00 0.00 ? 15 ASP A C    5  
ATOM 4369  O O    . ASP A 1 15 ? -29.219 1.599   -20.209 1.00 0.00 ? 15 ASP A O    5  
ATOM 4370  C CB   . ASP A 1 15 ? -27.243 2.929   -18.944 1.00 0.00 ? 15 ASP A CB   5  
ATOM 4371  C CG   . ASP A 1 15 ? -27.809 3.970   -19.904 1.00 0.00 ? 15 ASP A CG   5  
ATOM 4372  O OD1  . ASP A 1 15 ? -27.678 3.775   -21.101 1.00 0.00 ? 15 ASP A OD1  5  
ATOM 4373  O OD2  . ASP A 1 15 ? -28.365 4.945   -19.427 1.00 0.00 ? 15 ASP A OD2  5  
ATOM 4374  H H    . ASP A 1 15 ? -26.258 2.448   -21.577 1.00 0.00 ? 15 ASP A H    5  
ATOM 4375  H HA   . ASP A 1 15 ? -26.406 0.964   -19.027 1.00 0.00 ? 15 ASP A HA   5  
ATOM 4376  H HB2  . ASP A 1 15 ? -27.983 2.692   -18.194 1.00 0.00 ? 15 ASP A HB2  5  
ATOM 4377  H HB3  . ASP A 1 15 ? -26.361 3.328   -18.463 1.00 0.00 ? 15 ASP A HB3  5  
ATOM 4378  N N    . PRO A 1 16 ? -28.013 -0.147  -20.852 1.00 0.00 ? 16 PRO A N    5  
ATOM 4379  C CA   . PRO A 1 16 ? -29.157 -0.885  -21.460 1.00 0.00 ? 16 PRO A CA   5  
ATOM 4380  C C    . PRO A 1 16 ? -30.005 -1.616  -20.422 1.00 0.00 ? 16 PRO A C    5  
ATOM 4381  O O    . PRO A 1 16 ? -30.901 -2.382  -20.773 1.00 0.00 ? 16 PRO A O    5  
ATOM 4382  C CB   . PRO A 1 16 ? -28.469 -1.877  -22.393 1.00 0.00 ? 16 PRO A CB   5  
ATOM 4383  C CG   . PRO A 1 16 ? -27.165 -2.176  -21.732 1.00 0.00 ? 16 PRO A CG   5  
ATOM 4384  C CD   . PRO A 1 16 ? -26.757 -0.905  -20.983 1.00 0.00 ? 16 PRO A CD   5  
ATOM 4385  H HA   . PRO A 1 16 ? -29.770 -0.214  -22.038 1.00 0.00 ? 16 PRO A HA   5  
ATOM 4386  H HB2  . PRO A 1 16 ? -29.061 -2.776  -22.487 1.00 0.00 ? 16 PRO A HB2  5  
ATOM 4387  H HB3  . PRO A 1 16 ? -28.299 -1.431  -23.361 1.00 0.00 ? 16 PRO A HB3  5  
ATOM 4388  H HG2  . PRO A 1 16 ? -27.283 -2.998  -21.040 1.00 0.00 ? 16 PRO A HG2  5  
ATOM 4389  H HG3  . PRO A 1 16 ? -26.421 -2.417  -22.474 1.00 0.00 ? 16 PRO A HG3  5  
ATOM 4390  H HD2  . PRO A 1 16 ? -26.354 -1.154  -20.011 1.00 0.00 ? 16 PRO A HD2  5  
ATOM 4391  H HD3  . PRO A 1 16 ? -26.041 -0.343  -21.559 1.00 0.00 ? 16 PRO A HD3  5  
ATOM 4392  N N    . PHE A 1 17 ? -29.704 -1.407  -19.146 1.00 0.00 ? 17 PHE A N    5  
ATOM 4393  C CA   . PHE A 1 17 ? -30.445 -2.089  -18.092 1.00 0.00 ? 17 PHE A CA   5  
ATOM 4394  C C    . PHE A 1 17 ? -31.929 -1.723  -18.129 1.00 0.00 ? 17 PHE A C    5  
ATOM 4395  O O    . PHE A 1 17 ? -32.785 -2.591  -17.963 1.00 0.00 ? 17 PHE A O    5  
ATOM 4396  C CB   . PHE A 1 17 ? -29.860 -1.723  -16.727 1.00 0.00 ? 17 PHE A CB   5  
ATOM 4397  C CG   . PHE A 1 17 ? -28.513 -2.385  -16.562 1.00 0.00 ? 17 PHE A CG   5  
ATOM 4398  C CD1  . PHE A 1 17 ? -28.431 -3.679  -16.035 1.00 0.00 ? 17 PHE A CD1  5  
ATOM 4399  C CD2  . PHE A 1 17 ? -27.349 -1.707  -16.939 1.00 0.00 ? 17 PHE A CD2  5  
ATOM 4400  C CE1  . PHE A 1 17 ? -27.183 -4.296  -15.884 1.00 0.00 ? 17 PHE A CE1  5  
ATOM 4401  C CE2  . PHE A 1 17 ? -26.102 -2.323  -16.788 1.00 0.00 ? 17 PHE A CE2  5  
ATOM 4402  C CZ   . PHE A 1 17 ? -26.018 -3.618  -16.260 1.00 0.00 ? 17 PHE A CZ   5  
ATOM 4403  H H    . PHE A 1 17 ? -28.968 -0.803  -18.912 1.00 0.00 ? 17 PHE A H    5  
ATOM 4404  H HA   . PHE A 1 17 ? -30.346 -3.154  -18.234 1.00 0.00 ? 17 PHE A HA   5  
ATOM 4405  H HB2  . PHE A 1 17 ? -29.746 -0.650  -16.661 1.00 0.00 ? 17 PHE A HB2  5  
ATOM 4406  H HB3  . PHE A 1 17 ? -30.526 -2.063  -15.947 1.00 0.00 ? 17 PHE A HB3  5  
ATOM 4407  H HD1  . PHE A 1 17 ? -29.330 -4.203  -15.745 1.00 0.00 ? 17 PHE A HD1  5  
ATOM 4408  H HD2  . PHE A 1 17 ? -27.413 -0.709  -17.346 1.00 0.00 ? 17 PHE A HD2  5  
ATOM 4409  H HE1  . PHE A 1 17 ? -27.120 -5.294  -15.477 1.00 0.00 ? 17 PHE A HE1  5  
ATOM 4410  H HE2  . PHE A 1 17 ? -25.201 -1.799  -17.078 1.00 0.00 ? 17 PHE A HE2  5  
ATOM 4411  H HZ   . PHE A 1 17 ? -25.055 -4.093  -16.144 1.00 0.00 ? 17 PHE A HZ   5  
ATOM 4412  N N    . TYR A 1 18 ? -32.239 -0.445  -18.336 1.00 0.00 ? 18 TYR A N    5  
ATOM 4413  C CA   . TYR A 1 18 ? -33.635 -0.015  -18.377 1.00 0.00 ? 18 TYR A CA   5  
ATOM 4414  C C    . TYR A 1 18 ? -34.334 -0.544  -19.625 1.00 0.00 ? 18 TYR A C    5  
ATOM 4415  O O    . TYR A 1 18 ? -35.548 -0.748  -19.628 1.00 0.00 ? 18 TYR A O    5  
ATOM 4416  C CB   . TYR A 1 18 ? -33.721 1.513   -18.352 1.00 0.00 ? 18 TYR A CB   5  
ATOM 4417  C CG   . TYR A 1 18 ? -33.313 2.066   -19.695 1.00 0.00 ? 18 TYR A CG   5  
ATOM 4418  C CD1  . TYR A 1 18 ? -31.972 2.380   -19.945 1.00 0.00 ? 18 TYR A CD1  5  
ATOM 4419  C CD2  . TYR A 1 18 ? -34.276 2.270   -20.690 1.00 0.00 ? 18 TYR A CD2  5  
ATOM 4420  C CE1  . TYR A 1 18 ? -31.593 2.896   -21.190 1.00 0.00 ? 18 TYR A CE1  5  
ATOM 4421  C CE2  . TYR A 1 18 ? -33.900 2.786   -21.935 1.00 0.00 ? 18 TYR A CE2  5  
ATOM 4422  C CZ   . TYR A 1 18 ? -32.557 3.099   -22.185 1.00 0.00 ? 18 TYR A CZ   5  
ATOM 4423  O OH   . TYR A 1 18 ? -32.185 3.608   -23.413 1.00 0.00 ? 18 TYR A OH   5  
ATOM 4424  H H    . TYR A 1 18 ? -31.533 0.225   -18.445 1.00 0.00 ? 18 TYR A H    5  
ATOM 4425  H HA   . TYR A 1 18 ? -34.141 -0.403  -17.506 1.00 0.00 ? 18 TYR A HA   5  
ATOM 4426  H HB2  . TYR A 1 18 ? -34.736 1.810   -18.134 1.00 0.00 ? 18 TYR A HB2  5  
ATOM 4427  H HB3  . TYR A 1 18 ? -33.062 1.897   -17.590 1.00 0.00 ? 18 TYR A HB3  5  
ATOM 4428  H HD1  . TYR A 1 18 ? -31.229 2.224   -19.176 1.00 0.00 ? 18 TYR A HD1  5  
ATOM 4429  H HD2  . TYR A 1 18 ? -35.311 2.027   -20.497 1.00 0.00 ? 18 TYR A HD2  5  
ATOM 4430  H HE1  . TYR A 1 18 ? -30.560 3.138   -21.384 1.00 0.00 ? 18 TYR A HE1  5  
ATOM 4431  H HE2  . TYR A 1 18 ? -34.642 2.943   -22.703 1.00 0.00 ? 18 TYR A HE2  5  
ATOM 4432  H HH   . TYR A 1 18 ? -32.303 2.916   -24.069 1.00 0.00 ? 18 TYR A HH   5  
ATOM 4433  N N    . TYR A 1 19 ? -33.564 -0.773  -20.684 1.00 0.00 ? 19 TYR A N    5  
ATOM 4434  C CA   . TYR A 1 19 ? -34.135 -1.290  -21.923 1.00 0.00 ? 19 TYR A CA   5  
ATOM 4435  C C    . TYR A 1 19 ? -34.769 -2.653  -21.672 1.00 0.00 ? 19 TYR A C    5  
ATOM 4436  O O    . TYR A 1 19 ? -35.910 -2.905  -22.060 1.00 0.00 ? 19 TYR A O    5  
ATOM 4437  C CB   . TYR A 1 19 ? -33.053 -1.407  -22.998 1.00 0.00 ? 19 TYR A CB   5  
ATOM 4438  C CG   . TYR A 1 19 ? -33.647 -2.010  -24.249 1.00 0.00 ? 19 TYR A CG   5  
ATOM 4439  C CD1  . TYR A 1 19 ? -34.427 -1.223  -25.104 1.00 0.00 ? 19 TYR A CD1  5  
ATOM 4440  C CD2  . TYR A 1 19 ? -33.414 -3.357  -24.553 1.00 0.00 ? 19 TYR A CD2  5  
ATOM 4441  C CE1  . TYR A 1 19 ? -34.975 -1.783  -26.264 1.00 0.00 ? 19 TYR A CE1  5  
ATOM 4442  C CE2  . TYR A 1 19 ? -33.963 -3.916  -25.714 1.00 0.00 ? 19 TYR A CE2  5  
ATOM 4443  C CZ   . TYR A 1 19 ? -34.744 -3.129  -26.568 1.00 0.00 ? 19 TYR A CZ   5  
ATOM 4444  O OH   . TYR A 1 19 ? -35.284 -3.681  -27.713 1.00 0.00 ? 19 TYR A OH   5  
ATOM 4445  H H    . TYR A 1 19 ? -32.601 -0.609  -20.622 1.00 0.00 ? 19 TYR A H    5  
ATOM 4446  H HA   . TYR A 1 19 ? -34.900 -0.607  -22.267 1.00 0.00 ? 19 TYR A HA   5  
ATOM 4447  H HB2  . TYR A 1 19 ? -32.661 -0.425  -23.223 1.00 0.00 ? 19 TYR A HB2  5  
ATOM 4448  H HB3  . TYR A 1 19 ? -32.258 -2.039  -22.641 1.00 0.00 ? 19 TYR A HB3  5  
ATOM 4449  H HD1  . TYR A 1 19 ? -34.607 -0.185  -24.868 1.00 0.00 ? 19 TYR A HD1  5  
ATOM 4450  H HD2  . TYR A 1 19 ? -32.812 -3.963  -23.893 1.00 0.00 ? 19 TYR A HD2  5  
ATOM 4451  H HE1  . TYR A 1 19 ? -35.577 -1.176  -26.924 1.00 0.00 ? 19 TYR A HE1  5  
ATOM 4452  H HE2  . TYR A 1 19 ? -33.783 -4.955  -25.950 1.00 0.00 ? 19 TYR A HE2  5  
ATOM 4453  H HH   . TYR A 1 19 ? -36.240 -3.639  -27.640 1.00 0.00 ? 19 TYR A HH   5  
ATOM 4454  N N    . ASP A 1 20 ? -34.014 -3.527  -21.010 1.00 0.00 ? 20 ASP A N    5  
ATOM 4455  C CA   . ASP A 1 20 ? -34.496 -4.865  -20.693 1.00 0.00 ? 20 ASP A CA   5  
ATOM 4456  C C    . ASP A 1 20 ? -35.629 -4.804  -19.672 1.00 0.00 ? 20 ASP A C    5  
ATOM 4457  O O    . ASP A 1 20 ? -36.499 -5.675  -19.642 1.00 0.00 ? 20 ASP A O    5  
ATOM 4458  C CB   . ASP A 1 20 ? -33.352 -5.715  -20.137 1.00 0.00 ? 20 ASP A CB   5  
ATOM 4459  C CG   . ASP A 1 20 ? -32.368 -6.056  -21.252 1.00 0.00 ? 20 ASP A CG   5  
ATOM 4460  O OD1  . ASP A 1 20 ? -32.715 -5.857  -22.404 1.00 0.00 ? 20 ASP A OD1  5  
ATOM 4461  O OD2  . ASP A 1 20 ? -31.281 -6.512  -20.935 1.00 0.00 ? 20 ASP A OD2  5  
ATOM 4462  H H    . ASP A 1 20 ? -33.116 -3.264  -20.723 1.00 0.00 ? 20 ASP A H    5  
ATOM 4463  H HA   . ASP A 1 20 ? -34.866 -5.328  -21.596 1.00 0.00 ? 20 ASP A HA   5  
ATOM 4464  H HB2  . ASP A 1 20 ? -32.840 -5.162  -19.362 1.00 0.00 ? 20 ASP A HB2  5  
ATOM 4465  H HB3  . ASP A 1 20 ? -33.751 -6.627  -19.722 1.00 0.00 ? 20 ASP A HB3  5  
ATOM 4466  N N    . TYR A 1 21 ? -35.605 -3.774  -18.830 1.00 0.00 ? 21 TYR A N    5  
ATOM 4467  C CA   . TYR A 1 21 ? -36.629 -3.612  -17.802 1.00 0.00 ? 21 TYR A CA   5  
ATOM 4468  C C    . TYR A 1 21 ? -38.003 -3.426  -18.435 1.00 0.00 ? 21 TYR A C    5  
ATOM 4469  O O    . TYR A 1 21 ? -38.983 -4.014  -17.987 1.00 0.00 ? 21 TYR A O    5  
ATOM 4470  C CB   . TYR A 1 21 ? -36.301 -2.408  -16.920 1.00 0.00 ? 21 TYR A CB   5  
ATOM 4471  C CG   . TYR A 1 21 ? -37.369 -2.254  -15.863 1.00 0.00 ? 21 TYR A CG   5  
ATOM 4472  C CD1  . TYR A 1 21 ? -37.353 -3.072  -14.728 1.00 0.00 ? 21 TYR A CD1  5  
ATOM 4473  C CD2  . TYR A 1 21 ? -38.373 -1.290  -16.017 1.00 0.00 ? 21 TYR A CD2  5  
ATOM 4474  C CE1  . TYR A 1 21 ? -38.343 -2.929  -13.748 1.00 0.00 ? 21 TYR A CE1  5  
ATOM 4475  C CE2  . TYR A 1 21 ? -39.362 -1.147  -15.036 1.00 0.00 ? 21 TYR A CE2  5  
ATOM 4476  C CZ   . TYR A 1 21 ? -39.346 -1.966  -13.902 1.00 0.00 ? 21 TYR A CZ   5  
ATOM 4477  O OH   . TYR A 1 21 ? -40.322 -1.826  -12.936 1.00 0.00 ? 21 TYR A OH   5  
ATOM 4478  H H    . TYR A 1 21 ? -34.886 -3.112  -18.896 1.00 0.00 ? 21 TYR A H    5  
ATOM 4479  H HA   . TYR A 1 21 ? -36.646 -4.500  -17.186 1.00 0.00 ? 21 TYR A HA   5  
ATOM 4480  H HB2  . TYR A 1 21 ? -35.342 -2.558  -16.445 1.00 0.00 ? 21 TYR A HB2  5  
ATOM 4481  H HB3  . TYR A 1 21 ? -36.266 -1.516  -17.527 1.00 0.00 ? 21 TYR A HB3  5  
ATOM 4482  H HD1  . TYR A 1 21 ? -36.579 -3.816  -14.609 1.00 0.00 ? 21 TYR A HD1  5  
ATOM 4483  H HD2  . TYR A 1 21 ? -38.384 -0.657  -16.892 1.00 0.00 ? 21 TYR A HD2  5  
ATOM 4484  H HE1  . TYR A 1 21 ? -38.331 -3.562  -12.872 1.00 0.00 ? 21 TYR A HE1  5  
ATOM 4485  H HE2  . TYR A 1 21 ? -40.137 -0.404  -15.156 1.00 0.00 ? 21 TYR A HE2  5  
ATOM 4486  H HH   . TYR A 1 21 ? -40.693 -2.693  -12.759 1.00 0.00 ? 21 TYR A HH   5  
ATOM 4487  N N    . GLU A 1 22 ? -38.074 -2.594  -19.468 1.00 0.00 ? 22 GLU A N    5  
ATOM 4488  C CA   . GLU A 1 22 ? -39.349 -2.333  -20.131 1.00 0.00 ? 22 GLU A CA   5  
ATOM 4489  C C    . GLU A 1 22 ? -39.941 -3.638  -20.652 1.00 0.00 ? 22 GLU A C    5  
ATOM 4490  O O    . GLU A 1 22 ? -41.147 -3.846  -20.589 1.00 0.00 ? 22 GLU A O    5  
ATOM 4491  C CB   . GLU A 1 22 ? -39.145 -1.358  -21.292 1.00 0.00 ? 22 GLU A CB   5  
ATOM 4492  C CG   . GLU A 1 22 ? -38.828 0.032   -20.740 1.00 0.00 ? 22 GLU A CG   5  
ATOM 4493  C CD   . GLU A 1 22 ? -38.452 0.972   -21.881 1.00 0.00 ? 22 GLU A CD   5  
ATOM 4494  O OE1  . GLU A 1 22 ? -38.232 0.484   -22.976 1.00 0.00 ? 22 GLU A OE1  5  
ATOM 4495  O OE2  . GLU A 1 22 ? -38.390 2.167   -21.641 1.00 0.00 ? 22 GLU A OE2  5  
ATOM 4496  H H    . GLU A 1 22 ? -37.264 -2.128  -19.767 1.00 0.00 ? 22 GLU A H    5  
ATOM 4497  H HA   . GLU A 1 22 ? -40.032 -1.894  -19.420 1.00 0.00 ? 22 GLU A HA   5  
ATOM 4498  H HB2  . GLU A 1 22 ? -38.325 -1.698  -21.907 1.00 0.00 ? 22 GLU A HB2  5  
ATOM 4499  H HB3  . GLU A 1 22 ? -40.046 -1.311  -21.885 1.00 0.00 ? 22 GLU A HB3  5  
ATOM 4500  H HG2  . GLU A 1 22 ? -39.695 0.421   -20.226 1.00 0.00 ? 22 GLU A HG2  5  
ATOM 4501  H HG3  . GLU A 1 22 ? -38.002 -0.036  -20.047 1.00 0.00 ? 22 GLU A HG3  5  
ATOM 4502  N N    . THR A 1 23 ? -39.088 -4.506  -21.166 1.00 0.00 ? 23 THR A N    5  
ATOM 4503  C CA   . THR A 1 23 ? -39.534 -5.793  -21.691 1.00 0.00 ? 23 THR A CA   5  
ATOM 4504  C C    . THR A 1 23 ? -40.143 -6.661  -20.583 1.00 0.00 ? 23 THR A C    5  
ATOM 4505  O O    . THR A 1 23 ? -41.082 -7.407  -20.816 1.00 0.00 ? 23 THR A O    5  
ATOM 4506  C CB   . THR A 1 23 ? -38.357 -6.534  -22.330 1.00 0.00 ? 23 THR A CB   5  
ATOM 4507  O OG1  . THR A 1 23 ? -37.840 -5.759  -23.402 1.00 0.00 ? 23 THR A OG1  5  
ATOM 4508  C CG2  . THR A 1 23 ? -38.830 -7.889  -22.858 1.00 0.00 ? 23 THR A CG2  5  
ATOM 4509  H H    . THR A 1 23 ? -38.136 -4.279  -21.205 1.00 0.00 ? 23 THR A H    5  
ATOM 4510  H HA   . THR A 1 23 ? -40.285 -5.620  -22.447 1.00 0.00 ? 23 THR A HA   5  
ATOM 4511  H HB   . THR A 1 23 ? -37.585 -6.689  -21.592 1.00 0.00 ? 23 THR A HB   5  
ATOM 4512  H HG1  . THR A 1 23 ? -37.159 -5.181  -23.049 1.00 0.00 ? 23 THR A HG1  5  
ATOM 4513  H HG21 . THR A 1 23 ? -39.905 -7.885  -22.952 1.00 0.00 ? 23 THR A HG21 5  
ATOM 4514  H HG22 . THR A 1 23 ? -38.531 -8.667  -22.171 1.00 0.00 ? 23 THR A HG22 5  
ATOM 4515  H HG23 . THR A 1 23 ? -38.384 -8.073  -23.825 1.00 0.00 ? 23 THR A HG23 5  
ATOM 4516  N N    . VAL A 1 24 ? -39.561 -6.579  -19.392 1.00 0.00 ? 24 VAL A N    5  
ATOM 4517  C CA   . VAL A 1 24 ? -39.983 -7.400  -18.249 1.00 0.00 ? 24 VAL A CA   5  
ATOM 4518  C C    . VAL A 1 24 ? -41.502 -7.597  -18.166 1.00 0.00 ? 24 VAL A C    5  
ATOM 4519  O O    . VAL A 1 24 ? -41.959 -8.583  -17.587 1.00 0.00 ? 24 VAL A O    5  
ATOM 4520  C CB   . VAL A 1 24 ? -39.500 -6.755  -16.948 1.00 0.00 ? 24 VAL A CB   5  
ATOM 4521  C CG1  . VAL A 1 24 ? -40.457 -5.631  -16.537 1.00 0.00 ? 24 VAL A CG1  5  
ATOM 4522  C CG2  . VAL A 1 24 ? -39.453 -7.812  -15.841 1.00 0.00 ? 24 VAL A CG2  5  
ATOM 4523  H H    . VAL A 1 24 ? -38.784 -5.992  -19.288 1.00 0.00 ? 24 VAL A H    5  
ATOM 4524  H HA   . VAL A 1 24 ? -39.519 -8.370  -18.335 1.00 0.00 ? 24 VAL A HA   5  
ATOM 4525  H HB   . VAL A 1 24 ? -38.510 -6.346  -17.097 1.00 0.00 ? 24 VAL A HB   5  
ATOM 4526  H HG11 . VAL A 1 24 ? -40.907 -5.195  -17.416 1.00 0.00 ? 24 VAL A HG11 5  
ATOM 4527  H HG12 . VAL A 1 24 ? -39.909 -4.871  -16.000 1.00 0.00 ? 24 VAL A HG12 5  
ATOM 4528  H HG13 . VAL A 1 24 ? -41.231 -6.034  -15.900 1.00 0.00 ? 24 VAL A HG13 5  
ATOM 4529  H HG21 . VAL A 1 24 ? -39.698 -7.352  -14.894 1.00 0.00 ? 24 VAL A HG21 5  
ATOM 4530  H HG22 . VAL A 1 24 ? -38.462 -8.236  -15.790 1.00 0.00 ? 24 VAL A HG22 5  
ATOM 4531  H HG23 . VAL A 1 24 ? -40.169 -8.591  -16.058 1.00 0.00 ? 24 VAL A HG23 5  
ATOM 4532  N N    . ARG A 1 25 ? -42.284 -6.701  -18.748 1.00 0.00 ? 25 ARG A N    5  
ATOM 4533  C CA   . ARG A 1 25 ? -43.737 -6.876  -18.709 1.00 0.00 ? 25 ARG A CA   5  
ATOM 4534  C C    . ARG A 1 25 ? -44.190 -7.884  -19.770 1.00 0.00 ? 25 ARG A C    5  
ATOM 4535  O O    . ARG A 1 25 ? -44.870 -8.862  -19.459 1.00 0.00 ? 25 ARG A O    5  
ATOM 4536  C CB   . ARG A 1 25 ? -44.461 -5.543  -18.917 1.00 0.00 ? 25 ARG A CB   5  
ATOM 4537  C CG   . ARG A 1 25 ? -43.579 -4.599  -19.725 1.00 0.00 ? 25 ARG A CG   5  
ATOM 4538  C CD   . ARG A 1 25 ? -44.435 -3.472  -20.307 1.00 0.00 ? 25 ARG A CD   5  
ATOM 4539  N NE   . ARG A 1 25 ? -45.327 -3.999  -21.334 1.00 0.00 ? 25 ARG A NE   5  
ATOM 4540  C CZ   . ARG A 1 25 ? -46.204 -3.214  -21.951 1.00 0.00 ? 25 ARG A CZ   5  
ATOM 4541  N NH1  . ARG A 1 25 ? -46.274 -1.948  -21.648 1.00 0.00 ? 25 ARG A NH1  5  
ATOM 4542  N NH2  . ARG A 1 25 ? -46.994 -3.712  -22.863 1.00 0.00 ? 25 ARG A NH2  5  
ATOM 4543  H H    . ARG A 1 25 ? -41.878 -5.957  -19.242 1.00 0.00 ? 25 ARG A H    5  
ATOM 4544  H HA   . ARG A 1 25 ? -44.006 -7.262  -17.737 1.00 0.00 ? 25 ARG A HA   5  
ATOM 4545  H HB2  . ARG A 1 25 ? -45.384 -5.716  -19.449 1.00 0.00 ? 25 ARG A HB2  5  
ATOM 4546  H HB3  . ARG A 1 25 ? -44.677 -5.098  -17.958 1.00 0.00 ? 25 ARG A HB3  5  
ATOM 4547  H HG2  . ARG A 1 25 ? -42.829 -4.177  -19.073 1.00 0.00 ? 25 ARG A HG2  5  
ATOM 4548  H HG3  . ARG A 1 25 ? -43.103 -5.142  -20.528 1.00 0.00 ? 25 ARG A HG3  5  
ATOM 4549  H HD2  . ARG A 1 25 ? -45.023 -3.026  -19.519 1.00 0.00 ? 25 ARG A HD2  5  
ATOM 4550  H HD3  . ARG A 1 25 ? -43.791 -2.721  -20.740 1.00 0.00 ? 25 ARG A HD3  5  
ATOM 4551  H HE   . ARG A 1 25 ? -45.281 -4.949  -21.570 1.00 0.00 ? 25 ARG A HE   5  
ATOM 4552  H HH11 . ARG A 1 25 ? -45.667 -1.566  -20.951 1.00 0.00 ? 25 ARG A HH11 5  
ATOM 4553  H HH12 . ARG A 1 25 ? -46.934 -1.358  -22.114 1.00 0.00 ? 25 ARG A HH12 5  
ATOM 4554  H HH21 . ARG A 1 25 ? -46.940 -4.683  -23.096 1.00 0.00 ? 25 ARG A HH21 5  
ATOM 4555  H HH22 . ARG A 1 25 ? -47.654 -3.123  -23.328 1.00 0.00 ? 25 ARG A HH22 5  
ATOM 4556  N N    . ASN A 1 26 ? -43.808 -7.638  -21.018 1.00 0.00 ? 26 ASN A N    5  
ATOM 4557  C CA   . ASN A 1 26 ? -44.181 -8.529  -22.118 1.00 0.00 ? 26 ASN A CA   5  
ATOM 4558  C C    . ASN A 1 26 ? -43.117 -9.603  -22.341 1.00 0.00 ? 26 ASN A C    5  
ATOM 4559  O O    . ASN A 1 26 ? -43.271 -10.476 -23.198 1.00 0.00 ? 26 ASN A O    5  
ATOM 4560  C CB   . ASN A 1 26 ? -44.362 -7.719  -23.402 1.00 0.00 ? 26 ASN A CB   5  
ATOM 4561  C CG   . ASN A 1 26 ? -45.471 -6.688  -23.217 1.00 0.00 ? 26 ASN A CG   5  
ATOM 4562  O OD1  . ASN A 1 26 ? -45.229 -5.487  -23.340 1.00 0.00 ? 26 ASN A OD1  5  
ATOM 4563  N ND2  . ASN A 1 26 ? -46.680 -7.088  -22.930 1.00 0.00 ? 26 ASN A ND2  5  
ATOM 4564  H H    . ASN A 1 26 ? -43.270 -6.840  -21.208 1.00 0.00 ? 26 ASN A H    5  
ATOM 4565  H HA   . ASN A 1 26 ? -45.117 -9.009  -21.876 1.00 0.00 ? 26 ASN A HA   5  
ATOM 4566  H HB2  . ASN A 1 26 ? -43.438 -7.212  -23.641 1.00 0.00 ? 26 ASN A HB2  5  
ATOM 4567  H HB3  . ASN A 1 26 ? -44.626 -8.385  -24.212 1.00 0.00 ? 26 ASN A HB3  5  
ATOM 4568  H HD21 . ASN A 1 26 ? -46.869 -8.045  -22.834 1.00 0.00 ? 26 ASN A HD21 5  
ATOM 4569  H HD22 . ASN A 1 26 ? -47.397 -6.432  -22.809 1.00 0.00 ? 26 ASN A HD22 5  
ATOM 4570  N N    . GLY A 1 27 ? -42.032 -9.526  -21.578 1.00 0.00 ? 27 GLY A N    5  
ATOM 4571  C CA   . GLY A 1 27 ? -40.944 -10.488 -21.715 1.00 0.00 ? 27 GLY A CA   5  
ATOM 4572  C C    . GLY A 1 27 ? -41.406 -11.913 -21.428 1.00 0.00 ? 27 GLY A C    5  
ATOM 4573  O O    . GLY A 1 27 ? -41.023 -12.849 -22.129 1.00 0.00 ? 27 GLY A O    5  
ATOM 4574  H H    . GLY A 1 27 ? -41.960 -8.809  -20.916 1.00 0.00 ? 27 GLY A H    5  
ATOM 4575  H HA2  . GLY A 1 27 ? -40.557 -10.438 -22.722 1.00 0.00 ? 27 GLY A HA2  5  
ATOM 4576  H HA3  . GLY A 1 27 ? -40.158 -10.229 -21.022 1.00 0.00 ? 27 GLY A HA3  5  
ATOM 4577  N N    . GLY A 1 28 ? -42.222 -12.078 -20.392 1.00 0.00 ? 28 GLY A N    5  
ATOM 4578  C CA   . GLY A 1 28 ? -42.712 -13.404 -20.029 1.00 0.00 ? 28 GLY A CA   5  
ATOM 4579  C C    . GLY A 1 28 ? -43.530 -14.023 -21.157 1.00 0.00 ? 28 GLY A C    5  
ATOM 4580  O O    . GLY A 1 28 ? -43.412 -15.217 -21.437 1.00 0.00 ? 28 GLY A O    5  
ATOM 4581  H H    . GLY A 1 28 ? -42.491 -11.302 -19.857 1.00 0.00 ? 28 GLY A H    5  
ATOM 4582  H HA2  . GLY A 1 28 ? -41.868 -14.043 -19.810 1.00 0.00 ? 28 GLY A HA2  5  
ATOM 4583  H HA3  . GLY A 1 28 ? -43.331 -13.323 -19.148 1.00 0.00 ? 28 GLY A HA3  5  
ATOM 4584  N N    . LEU A 1 29 ? -44.377 -13.215 -21.784 1.00 0.00 ? 29 LEU A N    5  
ATOM 4585  C CA   . LEU A 1 29 ? -45.221 -13.723 -22.859 1.00 0.00 ? 29 LEU A CA   5  
ATOM 4586  C C    . LEU A 1 29 ? -44.363 -14.282 -23.988 1.00 0.00 ? 29 LEU A C    5  
ATOM 4587  O O    . LEU A 1 29 ? -44.620 -15.377 -24.491 1.00 0.00 ? 29 LEU A O    5  
ATOM 4588  C CB   . LEU A 1 29 ? -46.111 -12.601 -23.400 1.00 0.00 ? 29 LEU A CB   5  
ATOM 4589  C CG   . LEU A 1 29 ? -47.163 -12.221 -22.350 1.00 0.00 ? 29 LEU A CG   5  
ATOM 4590  C CD1  . LEU A 1 29 ? -47.915 -10.973 -22.813 1.00 0.00 ? 29 LEU A CD1  5  
ATOM 4591  C CD2  . LEU A 1 29 ? -48.162 -13.372 -22.156 1.00 0.00 ? 29 LEU A CD2  5  
ATOM 4592  H H    . LEU A 1 29 ? -44.445 -12.284 -21.488 1.00 0.00 ? 29 LEU A H    5  
ATOM 4593  H HA   . LEU A 1 29 ? -45.847 -14.513 -22.472 1.00 0.00 ? 29 LEU A HA   5  
ATOM 4594  H HB2  . LEU A 1 29 ? -45.499 -11.738 -23.620 1.00 0.00 ? 29 LEU A HB2  5  
ATOM 4595  H HB3  . LEU A 1 29 ? -46.602 -12.930 -24.304 1.00 0.00 ? 29 LEU A HB3  5  
ATOM 4596  H HG   . LEU A 1 29 ? -46.669 -12.012 -21.413 1.00 0.00 ? 29 LEU A HG   5  
ATOM 4597  H HD11 . LEU A 1 29 ? -48.490 -11.204 -23.696 1.00 0.00 ? 29 LEU A HD11 5  
ATOM 4598  H HD12 . LEU A 1 29 ? -47.204 -10.190 -23.040 1.00 0.00 ? 29 LEU A HD12 5  
ATOM 4599  H HD13 . LEU A 1 29 ? -48.577 -10.640 -22.028 1.00 0.00 ? 29 LEU A HD13 5  
ATOM 4600  H HD21 . LEU A 1 29 ? -48.089 -14.065 -22.980 1.00 0.00 ? 29 LEU A HD21 5  
ATOM 4601  H HD22 . LEU A 1 29 ? -49.165 -12.973 -22.111 1.00 0.00 ? 29 LEU A HD22 5  
ATOM 4602  H HD23 . LEU A 1 29 ? -47.939 -13.887 -21.233 1.00 0.00 ? 29 LEU A HD23 5  
ATOM 4603  N N    . ILE A 1 30 ? -43.346 -13.529 -24.389 1.00 0.00 ? 30 ILE A N    5  
ATOM 4604  C CA   . ILE A 1 30 ? -42.465 -13.966 -25.468 1.00 0.00 ? 30 ILE A CA   5  
ATOM 4605  C C    . ILE A 1 30 ? -41.764 -15.274 -25.104 1.00 0.00 ? 30 ILE A C    5  
ATOM 4606  O O    . ILE A 1 30 ? -41.668 -16.189 -25.926 1.00 0.00 ? 30 ILE A O    5  
ATOM 4607  C CB   . ILE A 1 30 ? -41.417 -12.889 -25.748 1.00 0.00 ? 30 ILE A CB   5  
ATOM 4608  C CG1  . ILE A 1 30 ? -42.097 -11.664 -26.363 1.00 0.00 ? 30 ILE A CG1  5  
ATOM 4609  C CG2  . ILE A 1 30 ? -40.370 -13.433 -26.723 1.00 0.00 ? 30 ILE A CG2  5  
ATOM 4610  C CD1  . ILE A 1 30 ? -41.119 -10.489 -26.379 1.00 0.00 ? 30 ILE A CD1  5  
ATOM 4611  H H    . ILE A 1 30 ? -43.200 -12.646 -23.984 1.00 0.00 ? 30 ILE A H    5  
ATOM 4612  H HA   . ILE A 1 30 ? -43.053 -14.119 -26.359 1.00 0.00 ? 30 ILE A HA   5  
ATOM 4613  H HB   . ILE A 1 30 ? -40.934 -12.607 -24.823 1.00 0.00 ? 30 ILE A HB   5  
ATOM 4614  H HG12 . ILE A 1 30 ? -42.404 -11.893 -27.374 1.00 0.00 ? 30 ILE A HG12 5  
ATOM 4615  H HG13 . ILE A 1 30 ? -42.965 -11.400 -25.777 1.00 0.00 ? 30 ILE A HG13 5  
ATOM 4616  H HG21 . ILE A 1 30 ? -39.704 -14.103 -26.199 1.00 0.00 ? 30 ILE A HG21 5  
ATOM 4617  H HG22 . ILE A 1 30 ? -39.803 -12.613 -27.137 1.00 0.00 ? 30 ILE A HG22 5  
ATOM 4618  H HG23 . ILE A 1 30 ? -40.865 -13.966 -27.521 1.00 0.00 ? 30 ILE A HG23 5  
ATOM 4619  H HD11 . ILE A 1 30 ? -41.626 -9.601  -26.731 1.00 0.00 ? 30 ILE A HD11 5  
ATOM 4620  H HD12 . ILE A 1 30 ? -40.293 -10.716 -27.038 1.00 0.00 ? 30 ILE A HD12 5  
ATOM 4621  H HD13 . ILE A 1 30 ? -40.747 -10.318 -25.380 1.00 0.00 ? 30 ILE A HD13 5  
ATOM 4622  N N    . PHE A 1 31 ? -41.280 -15.359 -23.871 1.00 0.00 ? 31 PHE A N    5  
ATOM 4623  C CA   . PHE A 1 31 ? -40.589 -16.555 -23.408 1.00 0.00 ? 31 PHE A CA   5  
ATOM 4624  C C    . PHE A 1 31 ? -41.497 -17.779 -23.473 1.00 0.00 ? 31 PHE A C    5  
ATOM 4625  O O    . PHE A 1 31 ? -41.082 -18.845 -23.929 1.00 0.00 ? 31 PHE A O    5  
ATOM 4626  C CB   . PHE A 1 31 ? -40.110 -16.353 -21.969 1.00 0.00 ? 31 PHE A CB   5  
ATOM 4627  C CG   . PHE A 1 31 ? -39.458 -17.620 -21.468 1.00 0.00 ? 31 PHE A CG   5  
ATOM 4628  C CD1  . PHE A 1 31 ? -38.149 -17.933 -21.854 1.00 0.00 ? 31 PHE A CD1  5  
ATOM 4629  C CD2  . PHE A 1 31 ? -40.162 -18.480 -20.617 1.00 0.00 ? 31 PHE A CD2  5  
ATOM 4630  C CE1  . PHE A 1 31 ? -37.543 -19.106 -21.387 1.00 0.00 ? 31 PHE A CE1  5  
ATOM 4631  C CE2  . PHE A 1 31 ? -39.558 -19.653 -20.152 1.00 0.00 ? 31 PHE A CE2  5  
ATOM 4632  C CZ   . PHE A 1 31 ? -38.248 -19.966 -20.536 1.00 0.00 ? 31 PHE A CZ   5  
ATOM 4633  H H    . PHE A 1 31 ? -41.390 -14.612 -23.244 1.00 0.00 ? 31 PHE A H    5  
ATOM 4634  H HA   . PHE A 1 31 ? -39.729 -16.726 -24.036 1.00 0.00 ? 31 PHE A HA   5  
ATOM 4635  H HB2  . PHE A 1 31 ? -39.394 -15.543 -21.941 1.00 0.00 ? 31 PHE A HB2  5  
ATOM 4636  H HB3  . PHE A 1 31 ? -40.953 -16.110 -21.340 1.00 0.00 ? 31 PHE A HB3  5  
ATOM 4637  H HD1  . PHE A 1 31 ? -37.606 -17.269 -22.510 1.00 0.00 ? 31 PHE A HD1  5  
ATOM 4638  H HD2  . PHE A 1 31 ? -41.172 -18.238 -20.321 1.00 0.00 ? 31 PHE A HD2  5  
ATOM 4639  H HE1  . PHE A 1 31 ? -36.535 -19.348 -21.684 1.00 0.00 ? 31 PHE A HE1  5  
ATOM 4640  H HE2  . PHE A 1 31 ? -40.101 -20.316 -19.495 1.00 0.00 ? 31 PHE A HE2  5  
ATOM 4641  H HZ   . PHE A 1 31 ? -37.782 -20.870 -20.176 1.00 0.00 ? 31 PHE A HZ   5  
ATOM 4642  N N    . ALA A 1 32 ? -42.723 -17.636 -22.980 1.00 0.00 ? 32 ALA A N    5  
ATOM 4643  C CA   . ALA A 1 32 ? -43.655 -18.758 -22.954 1.00 0.00 ? 32 ALA A CA   5  
ATOM 4644  C C    . ALA A 1 32 ? -43.895 -19.315 -24.353 1.00 0.00 ? 32 ALA A C    5  
ATOM 4645  O O    . ALA A 1 32 ? -43.925 -20.532 -24.533 1.00 0.00 ? 32 ALA A O    5  
ATOM 4646  C CB   . ALA A 1 32 ? -44.987 -18.312 -22.349 1.00 0.00 ? 32 ALA A CB   5  
ATOM 4647  H H    . ALA A 1 32 ? -42.993 -16.778 -22.589 1.00 0.00 ? 32 ALA A H    5  
ATOM 4648  H HA   . ALA A 1 32 ? -43.241 -19.539 -22.334 1.00 0.00 ? 32 ALA A HA   5  
ATOM 4649  H HB1  . ALA A 1 32 ? -44.922 -18.344 -21.273 1.00 0.00 ? 32 ALA A HB1  5  
ATOM 4650  H HB2  . ALA A 1 32 ? -45.774 -18.973 -22.683 1.00 0.00 ? 32 ALA A HB2  5  
ATOM 4651  H HB3  . ALA A 1 32 ? -45.207 -17.303 -22.666 1.00 0.00 ? 32 ALA A HB3  5  
ATOM 4652  N N    . GLY A 1 33 ? -44.061 -18.447 -25.346 1.00 0.00 ? 33 GLY A N    5  
ATOM 4653  C CA   . GLY A 1 33 ? -44.289 -18.920 -26.705 1.00 0.00 ? 33 GLY A CA   5  
ATOM 4654  C C    . GLY A 1 33 ? -43.112 -19.764 -27.179 1.00 0.00 ? 33 GLY A C    5  
ATOM 4655  O O    . GLY A 1 33 ? -43.292 -20.797 -27.825 1.00 0.00 ? 33 GLY A O    5  
ATOM 4656  H H    . GLY A 1 33 ? -44.045 -17.480 -25.179 1.00 0.00 ? 33 GLY A H    5  
ATOM 4657  H HA2  . GLY A 1 33 ? -45.191 -19.516 -26.730 1.00 0.00 ? 33 GLY A HA2  5  
ATOM 4658  H HA3  . GLY A 1 33 ? -44.403 -18.073 -27.365 1.00 0.00 ? 33 GLY A HA3  5  
ATOM 4659  N N    . LEU A 1 34 ? -41.906 -19.327 -26.833 1.00 0.00 ? 34 LEU A N    5  
ATOM 4660  C CA   . LEU A 1 34 ? -40.699 -20.056 -27.206 1.00 0.00 ? 34 LEU A CA   5  
ATOM 4661  C C    . LEU A 1 34 ? -40.680 -21.420 -26.513 1.00 0.00 ? 34 LEU A C    5  
ATOM 4662  O O    . LEU A 1 34 ? -40.295 -22.432 -27.104 1.00 0.00 ? 34 LEU A O    5  
ATOM 4663  C CB   . LEU A 1 34 ? -39.462 -19.242 -26.802 1.00 0.00 ? 34 LEU A CB   5  
ATOM 4664  C CG   . LEU A 1 34 ? -38.179 -19.980 -27.203 1.00 0.00 ? 34 LEU A CG   5  
ATOM 4665  C CD1  . LEU A 1 34 ? -38.139 -20.167 -28.723 1.00 0.00 ? 34 LEU A CD1  5  
ATOM 4666  C CD2  . LEU A 1 34 ? -36.966 -19.155 -26.766 1.00 0.00 ? 34 LEU A CD2  5  
ATOM 4667  H H    . LEU A 1 34 ? -41.826 -18.505 -26.300 1.00 0.00 ? 34 LEU A H    5  
ATOM 4668  H HA   . LEU A 1 34 ? -40.693 -20.201 -28.275 1.00 0.00 ? 34 LEU A HA   5  
ATOM 4669  H HB2  . LEU A 1 34 ? -39.492 -18.281 -27.292 1.00 0.00 ? 34 LEU A HB2  5  
ATOM 4670  H HB3  . LEU A 1 34 ? -39.467 -19.097 -25.732 1.00 0.00 ? 34 LEU A HB3  5  
ATOM 4671  H HG   . LEU A 1 34 ? -38.147 -20.947 -26.722 1.00 0.00 ? 34 LEU A HG   5  
ATOM 4672  H HD11 . LEU A 1 34 ? -37.113 -20.198 -29.055 1.00 0.00 ? 34 LEU A HD11 5  
ATOM 4673  H HD12 . LEU A 1 34 ? -38.647 -19.341 -29.200 1.00 0.00 ? 34 LEU A HD12 5  
ATOM 4674  H HD13 . LEU A 1 34 ? -38.632 -21.091 -28.985 1.00 0.00 ? 34 LEU A HD13 5  
ATOM 4675  H HD21 . LEU A 1 34 ? -36.503 -19.622 -25.910 1.00 0.00 ? 34 LEU A HD21 5  
ATOM 4676  H HD22 . LEU A 1 34 ? -37.283 -18.157 -26.504 1.00 0.00 ? 34 LEU A HD22 5  
ATOM 4677  H HD23 . LEU A 1 34 ? -36.253 -19.104 -27.578 1.00 0.00 ? 34 LEU A HD23 5  
ATOM 4678  N N    . ALA A 1 35 ? -41.109 -21.423 -25.254 1.00 0.00 ? 35 ALA A N    5  
ATOM 4679  C CA   . ALA A 1 35 ? -41.147 -22.656 -24.468 1.00 0.00 ? 35 ALA A CA   5  
ATOM 4680  C C    . ALA A 1 35 ? -42.076 -23.674 -25.125 1.00 0.00 ? 35 ALA A C    5  
ATOM 4681  O O    . ALA A 1 35 ? -41.755 -24.852 -25.220 1.00 0.00 ? 35 ALA A O    5  
ATOM 4682  C CB   . ALA A 1 35 ? -41.633 -22.361 -23.048 1.00 0.00 ? 35 ALA A CB   5  
ATOM 4683  H H    . ALA A 1 35 ? -41.410 -20.571 -24.876 1.00 0.00 ? 35 ALA A H    5  
ATOM 4684  H HA   . ALA A 1 35 ? -40.151 -23.070 -24.418 1.00 0.00 ? 35 ALA A HA   5  
ATOM 4685  H HB1  . ALA A 1 35 ? -41.489 -23.235 -22.430 1.00 0.00 ? 35 ALA A HB1  5  
ATOM 4686  H HB2  . ALA A 1 35 ? -42.683 -22.108 -23.072 1.00 0.00 ? 35 ALA A HB2  5  
ATOM 4687  H HB3  . ALA A 1 35 ? -41.072 -21.534 -22.640 1.00 0.00 ? 35 ALA A HB3  5  
ATOM 4688  N N    . PHE A 1 36 ? -43.250 -23.211 -25.527 1.00 0.00 ? 36 PHE A N    5  
ATOM 4689  C CA   . PHE A 1 36 ? -44.249 -24.090 -26.138 1.00 0.00 ? 36 PHE A CA   5  
ATOM 4690  C C    . PHE A 1 36 ? -43.732 -24.760 -27.418 1.00 0.00 ? 36 PHE A C    5  
ATOM 4691  O O    . PHE A 1 36 ? -43.894 -25.973 -27.607 1.00 0.00 ? 36 PHE A O    5  
ATOM 4692  C CB   . PHE A 1 36 ? -45.509 -23.288 -26.463 1.00 0.00 ? 36 PHE A CB   5  
ATOM 4693  C CG   . PHE A 1 36 ? -46.480 -24.164 -27.216 1.00 0.00 ? 36 PHE A CG   5  
ATOM 4694  C CD1  . PHE A 1 36 ? -47.232 -25.127 -26.531 1.00 0.00 ? 36 PHE A CD1  5  
ATOM 4695  C CD2  . PHE A 1 36 ? -46.629 -24.015 -28.599 1.00 0.00 ? 36 PHE A CD2  5  
ATOM 4696  C CE1  . PHE A 1 36 ? -48.132 -25.939 -27.229 1.00 0.00 ? 36 PHE A CE1  5  
ATOM 4697  C CE2  . PHE A 1 36 ? -47.530 -24.827 -29.299 1.00 0.00 ? 36 PHE A CE2  5  
ATOM 4698  C CZ   . PHE A 1 36 ? -48.281 -25.789 -28.614 1.00 0.00 ? 36 PHE A CZ   5  
ATOM 4699  H H    . PHE A 1 36 ? -43.463 -22.274 -25.343 1.00 0.00 ? 36 PHE A H    5  
ATOM 4700  H HA   . PHE A 1 36 ? -44.509 -24.861 -25.428 1.00 0.00 ? 36 PHE A HA   5  
ATOM 4701  H HB2  . PHE A 1 36 ? -45.966 -22.948 -25.545 1.00 0.00 ? 36 PHE A HB2  5  
ATOM 4702  H HB3  . PHE A 1 36 ? -45.247 -22.436 -27.072 1.00 0.00 ? 36 PHE A HB3  5  
ATOM 4703  H HD1  . PHE A 1 36 ? -47.116 -25.241 -25.464 1.00 0.00 ? 36 PHE A HD1  5  
ATOM 4704  H HD2  . PHE A 1 36 ? -46.050 -23.272 -29.128 1.00 0.00 ? 36 PHE A HD2  5  
ATOM 4705  H HE1  . PHE A 1 36 ? -48.712 -26.681 -26.702 1.00 0.00 ? 36 PHE A HE1  5  
ATOM 4706  H HE2  . PHE A 1 36 ? -47.643 -24.712 -30.367 1.00 0.00 ? 36 PHE A HE2  5  
ATOM 4707  H HZ   . PHE A 1 36 ? -48.975 -26.417 -29.152 1.00 0.00 ? 36 PHE A HZ   5  
ATOM 4708  N N    . ILE A 1 37 ? -43.149 -23.972 -28.316 1.00 0.00 ? 37 ILE A N    5  
ATOM 4709  C CA   . ILE A 1 37 ? -42.674 -24.512 -29.587 1.00 0.00 ? 37 ILE A CA   5  
ATOM 4710  C C    . ILE A 1 37 ? -41.634 -25.613 -29.393 1.00 0.00 ? 37 ILE A C    5  
ATOM 4711  O O    . ILE A 1 37 ? -41.734 -26.674 -30.009 1.00 0.00 ? 37 ILE A O    5  
ATOM 4712  C CB   . ILE A 1 37 ? -42.065 -23.389 -30.425 1.00 0.00 ? 37 ILE A CB   5  
ATOM 4713  C CG1  . ILE A 1 37 ? -43.169 -22.427 -30.868 1.00 0.00 ? 37 ILE A CG1  5  
ATOM 4714  C CG2  . ILE A 1 37 ? -41.381 -23.986 -31.657 1.00 0.00 ? 37 ILE A CG2  5  
ATOM 4715  C CD1  . ILE A 1 37 ? -42.542 -21.162 -31.459 1.00 0.00 ? 37 ILE A CD1  5  
ATOM 4716  H H    . ILE A 1 37 ? -43.079 -23.009 -28.148 1.00 0.00 ? 37 ILE A H    5  
ATOM 4717  H HA   . ILE A 1 37 ? -43.515 -24.921 -30.127 1.00 0.00 ? 37 ILE A HA   5  
ATOM 4718  H HB   . ILE A 1 37 ? -41.335 -22.854 -29.834 1.00 0.00 ? 37 ILE A HB   5  
ATOM 4719  H HG12 . ILE A 1 37 ? -43.786 -22.906 -31.614 1.00 0.00 ? 37 ILE A HG12 5  
ATOM 4720  H HG13 . ILE A 1 37 ? -43.777 -22.160 -30.016 1.00 0.00 ? 37 ILE A HG13 5  
ATOM 4721  H HG21 . ILE A 1 37 ? -40.422 -24.395 -31.374 1.00 0.00 ? 37 ILE A HG21 5  
ATOM 4722  H HG22 . ILE A 1 37 ? -41.238 -23.215 -32.400 1.00 0.00 ? 37 ILE A HG22 5  
ATOM 4723  H HG23 . ILE A 1 37 ? -41.999 -24.771 -32.067 1.00 0.00 ? 37 ILE A HG23 5  
ATOM 4724  H HD11 . ILE A 1 37 ? -43.294 -20.605 -31.997 1.00 0.00 ? 37 ILE A HD11 5  
ATOM 4725  H HD12 . ILE A 1 37 ? -41.746 -21.438 -32.135 1.00 0.00 ? 37 ILE A HD12 5  
ATOM 4726  H HD13 . ILE A 1 37 ? -42.143 -20.553 -30.662 1.00 0.00 ? 37 ILE A HD13 5  
ATOM 4727  N N    . VAL A 1 38 ? -40.629 -25.365 -28.561 1.00 0.00 ? 38 VAL A N    5  
ATOM 4728  C CA   . VAL A 1 38 ? -39.594 -26.375 -28.355 1.00 0.00 ? 38 VAL A CA   5  
ATOM 4729  C C    . VAL A 1 38 ? -40.215 -27.688 -27.881 1.00 0.00 ? 38 VAL A C    5  
ATOM 4730  O O    . VAL A 1 38 ? -39.744 -28.766 -28.236 1.00 0.00 ? 38 VAL A O    5  
ATOM 4731  C CB   . VAL A 1 38 ? -38.534 -25.889 -27.358 1.00 0.00 ? 38 VAL A CB   5  
ATOM 4732  C CG1  . VAL A 1 38 ? -37.777 -24.705 -27.961 1.00 0.00 ? 38 VAL A CG1  5  
ATOM 4733  C CG2  . VAL A 1 38 ? -39.193 -25.443 -26.053 1.00 0.00 ? 38 VAL A CG2  5  
ATOM 4734  H H    . VAL A 1 38 ? -40.574 -24.491 -28.117 1.00 0.00 ? 38 VAL A H    5  
ATOM 4735  H HA   . VAL A 1 38 ? -39.111 -26.557 -29.304 1.00 0.00 ? 38 VAL A HA   5  
ATOM 4736  H HB   . VAL A 1 38 ? -37.837 -26.692 -27.156 1.00 0.00 ? 38 VAL A HB   5  
ATOM 4737  H HG11 . VAL A 1 38 ? -36.789 -25.021 -28.260 1.00 0.00 ? 38 VAL A HG11 5  
ATOM 4738  H HG12 . VAL A 1 38 ? -37.697 -23.917 -27.226 1.00 0.00 ? 38 VAL A HG12 5  
ATOM 4739  H HG13 . VAL A 1 38 ? -38.313 -24.337 -28.824 1.00 0.00 ? 38 VAL A HG13 5  
ATOM 4740  H HG21 . VAL A 1 38 ? -39.902 -26.188 -25.731 1.00 0.00 ? 38 VAL A HG21 5  
ATOM 4741  H HG22 . VAL A 1 38 ? -39.697 -24.506 -26.214 1.00 0.00 ? 38 VAL A HG22 5  
ATOM 4742  H HG23 . VAL A 1 38 ? -38.435 -25.318 -25.294 1.00 0.00 ? 38 VAL A HG23 5  
ATOM 4743  N N    . GLY A 1 39 ? -41.269 -27.592 -27.074 1.00 0.00 ? 39 GLY A N    5  
ATOM 4744  C CA   . GLY A 1 39 ? -41.948 -28.774 -26.548 1.00 0.00 ? 39 GLY A CA   5  
ATOM 4745  C C    . GLY A 1 39 ? -42.540 -29.631 -27.663 1.00 0.00 ? 39 GLY A C    5  
ATOM 4746  O O    . GLY A 1 39 ? -42.513 -30.860 -27.591 1.00 0.00 ? 39 GLY A O    5  
ATOM 4747  H H    . GLY A 1 39 ? -41.593 -26.716 -26.803 1.00 0.00 ? 39 GLY A H    5  
ATOM 4748  H HA2  . GLY A 1 39 ? -41.239 -29.365 -25.989 1.00 0.00 ? 39 GLY A HA2  5  
ATOM 4749  H HA3  . GLY A 1 39 ? -42.742 -28.459 -25.890 1.00 0.00 ? 39 GLY A HA3  5  
ATOM 4750  N N    . LEU A 1 40 ? -43.083 -28.986 -28.690 1.00 0.00 ? 40 LEU A N    5  
ATOM 4751  C CA   . LEU A 1 40 ? -43.682 -29.731 -29.796 1.00 0.00 ? 40 LEU A CA   5  
ATOM 4752  C C    . LEU A 1 40 ? -42.632 -30.642 -30.432 1.00 0.00 ? 40 LEU A C    5  
ATOM 4753  O O    . LEU A 1 40 ? -42.893 -31.815 -30.705 1.00 0.00 ? 40 LEU A O    5  
ATOM 4754  C CB   . LEU A 1 40 ? -44.237 -28.757 -30.844 1.00 0.00 ? 40 LEU A CB   5  
ATOM 4755  C CG   . LEU A 1 40 ? -44.856 -29.529 -32.017 1.00 0.00 ? 40 LEU A CG   5  
ATOM 4756  C CD1  . LEU A 1 40 ? -46.007 -30.402 -31.513 1.00 0.00 ? 40 LEU A CD1  5  
ATOM 4757  C CD2  . LEU A 1 40 ? -45.395 -28.533 -33.048 1.00 0.00 ? 40 LEU A CD2  5  
ATOM 4758  H H    . LEU A 1 40 ? -43.082 -28.000 -28.696 1.00 0.00 ? 40 LEU A H    5  
ATOM 4759  H HA   . LEU A 1 40 ? -44.489 -30.338 -29.412 1.00 0.00 ? 40 LEU A HA   5  
ATOM 4760  H HB2  . LEU A 1 40 ? -44.993 -28.134 -30.387 1.00 0.00 ? 40 LEU A HB2  5  
ATOM 4761  H HB3  . LEU A 1 40 ? -43.437 -28.132 -31.210 1.00 0.00 ? 40 LEU A HB3  5  
ATOM 4762  H HG   . LEU A 1 40 ? -44.106 -30.152 -32.480 1.00 0.00 ? 40 LEU A HG   5  
ATOM 4763  H HD11 . LEU A 1 40 ? -45.624 -31.371 -31.224 1.00 0.00 ? 40 LEU A HD11 5  
ATOM 4764  H HD12 . LEU A 1 40 ? -46.738 -30.525 -32.300 1.00 0.00 ? 40 LEU A HD12 5  
ATOM 4765  H HD13 . LEU A 1 40 ? -46.472 -29.930 -30.660 1.00 0.00 ? 40 LEU A HD13 5  
ATOM 4766  H HD21 . LEU A 1 40 ? -46.472 -28.604 -33.089 1.00 0.00 ? 40 LEU A HD21 5  
ATOM 4767  H HD22 . LEU A 1 40 ? -44.980 -28.760 -34.018 1.00 0.00 ? 40 LEU A HD22 5  
ATOM 4768  H HD23 . LEU A 1 40 ? -45.111 -27.530 -32.762 1.00 0.00 ? 40 LEU A HD23 5  
ATOM 4769  N N    . LEU A 1 41 ? -41.459 -30.079 -30.693 1.00 0.00 ? 41 LEU A N    5  
ATOM 4770  C CA   . LEU A 1 41 ? -40.377 -30.825 -31.331 1.00 0.00 ? 41 LEU A CA   5  
ATOM 4771  C C    . LEU A 1 41 ? -40.013 -32.071 -30.526 1.00 0.00 ? 41 LEU A C    5  
ATOM 4772  O O    . LEU A 1 41 ? -39.641 -33.093 -31.098 1.00 0.00 ? 41 LEU A O    5  
ATOM 4773  C CB   . LEU A 1 41 ? -39.143 -29.930 -31.472 1.00 0.00 ? 41 LEU A CB   5  
ATOM 4774  C CG   . LEU A 1 41 ? -39.415 -28.825 -32.500 1.00 0.00 ? 41 LEU A CG   5  
ATOM 4775  C CD1  . LEU A 1 41 ? -38.258 -27.825 -32.489 1.00 0.00 ? 41 LEU A CD1  5  
ATOM 4776  C CD2  . LEU A 1 41 ? -39.552 -29.424 -33.906 1.00 0.00 ? 41 LEU A CD2  5  
ATOM 4777  H H    . LEU A 1 41 ? -41.345 -29.131 -30.507 1.00 0.00 ? 41 LEU A H    5  
ATOM 4778  H HA   . LEU A 1 41 ? -40.698 -31.130 -32.314 1.00 0.00 ? 41 LEU A HA   5  
ATOM 4779  H HB2  . LEU A 1 41 ? -38.919 -29.481 -30.516 1.00 0.00 ? 41 LEU A HB2  5  
ATOM 4780  H HB3  . LEU A 1 41 ? -38.300 -30.524 -31.791 1.00 0.00 ? 41 LEU A HB3  5  
ATOM 4781  H HG   . LEU A 1 41 ? -40.330 -28.312 -32.237 1.00 0.00 ? 41 LEU A HG   5  
ATOM 4782  H HD11 . LEU A 1 41 ? -37.340 -28.332 -32.751 1.00 0.00 ? 41 LEU A HD11 5  
ATOM 4783  H HD12 . LEU A 1 41 ? -38.163 -27.395 -31.503 1.00 0.00 ? 41 LEU A HD12 5  
ATOM 4784  H HD13 . LEU A 1 41 ? -38.452 -27.040 -33.205 1.00 0.00 ? 41 LEU A HD13 5  
ATOM 4785  H HD21 . LEU A 1 41 ? -39.179 -28.719 -34.635 1.00 0.00 ? 41 LEU A HD21 5  
ATOM 4786  H HD22 . LEU A 1 41 ? -40.593 -29.631 -34.109 1.00 0.00 ? 41 LEU A HD22 5  
ATOM 4787  H HD23 . LEU A 1 41 ? -38.986 -30.341 -33.974 1.00 0.00 ? 41 LEU A HD23 5  
ATOM 4788  N N    . ILE A 1 42 ? -40.112 -31.983 -29.205 1.00 0.00 ? 42 ILE A N    5  
ATOM 4789  C CA   . ILE A 1 42 ? -39.783 -33.121 -28.347 1.00 0.00 ? 42 ILE A CA   5  
ATOM 4790  C C    . ILE A 1 42 ? -40.690 -34.316 -28.656 1.00 0.00 ? 42 ILE A C    5  
ATOM 4791  O O    . ILE A 1 42 ? -40.231 -35.461 -28.718 1.00 0.00 ? 42 ILE A O    5  
ATOM 4792  C CB   . ILE A 1 42 ? -39.924 -32.737 -26.874 1.00 0.00 ? 42 ILE A CB   5  
ATOM 4793  C CG1  . ILE A 1 42 ? -38.821 -31.736 -26.505 1.00 0.00 ? 42 ILE A CG1  5  
ATOM 4794  C CG2  . ILE A 1 42 ? -39.788 -33.992 -26.008 1.00 0.00 ? 42 ILE A CG2  5  
ATOM 4795  C CD1  . ILE A 1 42 ? -39.082 -31.150 -25.112 1.00 0.00 ? 42 ILE A CD1  5  
ATOM 4796  H H    . ILE A 1 42 ? -40.413 -31.144 -28.809 1.00 0.00 ? 42 ILE A H    5  
ATOM 4797  H HA   . ILE A 1 42 ? -38.758 -33.409 -28.534 1.00 0.00 ? 42 ILE A HA   5  
ATOM 4798  H HB   . ILE A 1 42 ? -40.892 -32.291 -26.711 1.00 0.00 ? 42 ILE A HB   5  
ATOM 4799  H HG12 . ILE A 1 42 ? -37.864 -32.239 -26.509 1.00 0.00 ? 42 ILE A HG12 5  
ATOM 4800  H HG13 . ILE A 1 42 ? -38.808 -30.937 -27.231 1.00 0.00 ? 42 ILE A HG13 5  
ATOM 4801  H HG21 . ILE A 1 42 ? -39.197 -34.729 -26.532 1.00 0.00 ? 42 ILE A HG21 5  
ATOM 4802  H HG22 . ILE A 1 42 ? -40.769 -34.397 -25.806 1.00 0.00 ? 42 ILE A HG22 5  
ATOM 4803  H HG23 . ILE A 1 42 ? -39.304 -33.740 -25.077 1.00 0.00 ? 42 ILE A HG23 5  
ATOM 4804  H HD11 . ILE A 1 42 ? -39.162 -30.076 -25.184 1.00 0.00 ? 42 ILE A HD11 5  
ATOM 4805  H HD12 . ILE A 1 42 ? -38.262 -31.405 -24.457 1.00 0.00 ? 42 ILE A HD12 5  
ATOM 4806  H HD13 . ILE A 1 42 ? -40.000 -31.556 -24.713 1.00 0.00 ? 42 ILE A HD13 5  
ATOM 4807  N N    . LEU A 1 43 ? -41.980 -34.053 -28.837 1.00 0.00 ? 43 LEU A N    5  
ATOM 4808  C CA   . LEU A 1 43 ? -42.924 -35.130 -29.120 1.00 0.00 ? 43 LEU A CA   5  
ATOM 4809  C C    . LEU A 1 43 ? -42.516 -35.865 -30.392 1.00 0.00 ? 43 LEU A C    5  
ATOM 4810  O O    . LEU A 1 43 ? -42.625 -37.089 -30.472 1.00 0.00 ? 43 LEU A O    5  
ATOM 4811  C CB   . LEU A 1 43 ? -44.334 -34.560 -29.287 1.00 0.00 ? 43 LEU A CB   5  
ATOM 4812  C CG   . LEU A 1 43 ? -44.855 -34.051 -27.938 1.00 0.00 ? 43 LEU A CG   5  
ATOM 4813  C CD1  . LEU A 1 43 ? -46.176 -33.309 -28.149 1.00 0.00 ? 43 LEU A CD1  5  
ATOM 4814  C CD2  . LEU A 1 43 ? -45.081 -35.225 -26.975 1.00 0.00 ? 43 LEU A CD2  5  
ATOM 4815  H H    . LEU A 1 43 ? -42.301 -33.136 -28.758 1.00 0.00 ? 43 LEU A H    5  
ATOM 4816  H HA   . LEU A 1 43 ? -42.921 -35.826 -28.296 1.00 0.00 ? 43 LEU A HA   5  
ATOM 4817  H HB2  . LEU A 1 43 ? -44.304 -33.740 -29.991 1.00 0.00 ? 43 LEU A HB2  5  
ATOM 4818  H HB3  . LEU A 1 43 ? -44.994 -35.328 -29.664 1.00 0.00 ? 43 LEU A HB3  5  
ATOM 4819  H HG   . LEU A 1 43 ? -44.131 -33.370 -27.511 1.00 0.00 ? 43 LEU A HG   5  
ATOM 4820  H HD11 . LEU A 1 43 ? -46.010 -32.452 -28.786 1.00 0.00 ? 43 LEU A HD11 5  
ATOM 4821  H HD12 . LEU A 1 43 ? -46.560 -32.980 -27.195 1.00 0.00 ? 43 LEU A HD12 5  
ATOM 4822  H HD13 . LEU A 1 43 ? -46.891 -33.972 -28.615 1.00 0.00 ? 43 LEU A HD13 5  
ATOM 4823  H HD21 . LEU A 1 43 ? -45.295 -36.123 -27.534 1.00 0.00 ? 43 LEU A HD21 5  
ATOM 4824  H HD22 . LEU A 1 43 ? -45.915 -35.001 -26.326 1.00 0.00 ? 43 LEU A HD22 5  
ATOM 4825  H HD23 . LEU A 1 43 ? -44.194 -35.376 -26.378 1.00 0.00 ? 43 LEU A HD23 5  
ATOM 4826  N N    . LEU A 1 44 ? -42.056 -35.115 -31.387 1.00 0.00 ? 44 LEU A N    5  
ATOM 4827  C CA   . LEU A 1 44 ? -41.644 -35.707 -32.656 1.00 0.00 ? 44 LEU A CA   5  
ATOM 4828  C C    . LEU A 1 44 ? -40.495 -36.693 -32.452 1.00 0.00 ? 44 LEU A C    5  
ATOM 4829  O O    . LEU A 1 44 ? -40.394 -37.701 -33.163 1.00 0.00 ? 44 LEU A O    5  
ATOM 4830  C CB   . LEU A 1 44 ? -41.205 -34.604 -33.624 1.00 0.00 ? 44 LEU A CB   5  
ATOM 4831  C CG   . LEU A 1 44 ? -42.419 -33.765 -34.041 1.00 0.00 ? 44 LEU A CG   5  
ATOM 4832  C CD1  . LEU A 1 44 ? -41.949 -32.552 -34.848 1.00 0.00 ? 44 LEU A CD1  5  
ATOM 4833  C CD2  . LEU A 1 44 ? -43.379 -34.602 -34.899 1.00 0.00 ? 44 LEU A CD2  5  
ATOM 4834  H H    . LEU A 1 44 ? -42.014 -34.147 -31.283 1.00 0.00 ? 44 LEU A H    5  
ATOM 4835  H HA   . LEU A 1 44 ? -42.483 -36.233 -33.084 1.00 0.00 ? 44 LEU A HA   5  
ATOM 4836  H HB2  . LEU A 1 44 ? -40.483 -33.967 -33.133 1.00 0.00 ? 44 LEU A HB2  5  
ATOM 4837  H HB3  . LEU A 1 44 ? -40.752 -35.046 -34.498 1.00 0.00 ? 44 LEU A HB3  5  
ATOM 4838  H HG   . LEU A 1 44 ? -42.936 -33.421 -33.155 1.00 0.00 ? 44 LEU A HG   5  
ATOM 4839  H HD11 . LEU A 1 44 ? -42.489 -32.510 -35.782 1.00 0.00 ? 44 LEU A HD11 5  
ATOM 4840  H HD12 . LEU A 1 44 ? -40.892 -32.642 -35.047 1.00 0.00 ? 44 LEU A HD12 5  
ATOM 4841  H HD13 . LEU A 1 44 ? -42.134 -31.650 -34.283 1.00 0.00 ? 44 LEU A HD13 5  
ATOM 4842  H HD21 . LEU A 1 44 ? -42.870 -35.481 -35.266 1.00 0.00 ? 44 LEU A HD21 5  
ATOM 4843  H HD22 . LEU A 1 44 ? -43.721 -34.012 -35.736 1.00 0.00 ? 44 LEU A HD22 5  
ATOM 4844  H HD23 . LEU A 1 44 ? -44.226 -34.902 -34.301 1.00 0.00 ? 44 LEU A HD23 5  
ATOM 4845  N N    . SER A 1 45 ? -39.630 -36.412 -31.480 1.00 0.00 ? 45 SER A N    5  
ATOM 4846  C CA   . SER A 1 45 ? -38.506 -37.298 -31.216 1.00 0.00 ? 45 SER A CA   5  
ATOM 4847  C C    . SER A 1 45 ? -39.031 -38.684 -30.890 1.00 0.00 ? 45 SER A C    5  
ATOM 4848  O O    . SER A 1 45 ? -38.481 -39.687 -31.336 1.00 0.00 ? 45 SER A O    5  
ATOM 4849  C CB   . SER A 1 45 ? -37.669 -36.773 -30.048 1.00 0.00 ? 45 SER A CB   5  
ATOM 4850  O OG   . SER A 1 45 ? -37.095 -35.523 -30.406 1.00 0.00 ? 45 SER A OG   5  
ATOM 4851  H H    . SER A 1 45 ? -39.753 -35.615 -30.933 1.00 0.00 ? 45 SER A H    5  
ATOM 4852  H HA   . SER A 1 45 ? -37.883 -37.351 -32.097 1.00 0.00 ? 45 SER A HA   5  
ATOM 4853  H HB2  . SER A 1 45 ? -38.292 -36.645 -29.182 1.00 0.00 ? 45 SER A HB2  5  
ATOM 4854  H HB3  . SER A 1 45 ? -36.886 -37.486 -29.821 1.00 0.00 ? 45 SER A HB3  5  
ATOM 4855  H HG   . SER A 1 45 ? -36.168 -35.668 -30.607 1.00 0.00 ? 45 SER A HG   5  
ATOM 4856  N N    . ARG A 1 46 ? -40.112 -38.738 -30.120 1.00 0.00 ? 46 ARG A N    5  
ATOM 4857  C CA   . ARG A 1 46 ? -40.710 -40.020 -29.766 1.00 0.00 ? 46 ARG A CA   5  
ATOM 4858  C C    . ARG A 1 46 ? -41.170 -40.760 -31.019 1.00 0.00 ? 46 ARG A C    5  
ATOM 4859  O O    . ARG A 1 46 ? -41.080 -41.983 -31.094 1.00 0.00 ? 46 ARG A O    5  
ATOM 4860  C CB   . ARG A 1 46 ? -41.904 -39.817 -28.826 1.00 0.00 ? 46 ARG A CB   5  
ATOM 4861  C CG   . ARG A 1 46 ? -42.491 -41.180 -28.435 1.00 0.00 ? 46 ARG A CG   5  
ATOM 4862  C CD   . ARG A 1 46 ? -43.775 -41.443 -29.229 1.00 0.00 ? 46 ARG A CD   5  
ATOM 4863  N NE   . ARG A 1 46 ? -44.220 -42.822 -29.037 1.00 0.00 ? 46 ARG A NE   5  
ATOM 4864  C CZ   . ARG A 1 46 ? -45.357 -43.256 -29.572 1.00 0.00 ? 46 ARG A CZ   5  
ATOM 4865  N NH1  . ARG A 1 46 ? -46.096 -42.447 -30.280 1.00 0.00 ? 46 ARG A NH1  5  
ATOM 4866  N NH2  . ARG A 1 46 ? -45.736 -44.492 -29.389 1.00 0.00 ? 46 ARG A NH2  5  
ATOM 4867  H H    . ARG A 1 46 ? -40.519 -37.912 -29.789 1.00 0.00 ? 46 ARG A H    5  
ATOM 4868  H HA   . ARG A 1 46 ? -39.968 -40.618 -29.260 1.00 0.00 ? 46 ARG A HA   5  
ATOM 4869  H HB2  . ARG A 1 46 ? -41.577 -39.295 -27.938 1.00 0.00 ? 46 ARG A HB2  5  
ATOM 4870  H HB3  . ARG A 1 46 ? -42.660 -39.232 -29.329 1.00 0.00 ? 46 ARG A HB3  5  
ATOM 4871  H HG2  . ARG A 1 46 ? -41.771 -41.956 -28.649 1.00 0.00 ? 46 ARG A HG2  5  
ATOM 4872  H HG3  . ARG A 1 46 ? -42.718 -41.183 -27.379 1.00 0.00 ? 46 ARG A HG3  5  
ATOM 4873  H HD2  . ARG A 1 46 ? -44.548 -40.772 -28.888 1.00 0.00 ? 46 ARG A HD2  5  
ATOM 4874  H HD3  . ARG A 1 46 ? -43.593 -41.268 -30.278 1.00 0.00 ? 46 ARG A HD3  5  
ATOM 4875  H HE   . ARG A 1 46 ? -43.670 -43.437 -28.508 1.00 0.00 ? 46 ARG A HE   5  
ATOM 4876  H HH11 . ARG A 1 46 ? -45.806 -41.499 -30.418 1.00 0.00 ? 46 ARG A HH11 5  
ATOM 4877  H HH12 . ARG A 1 46 ? -46.951 -42.771 -30.680 1.00 0.00 ? 46 ARG A HH12 5  
ATOM 4878  H HH21 . ARG A 1 46 ? -45.170 -45.113 -28.848 1.00 0.00 ? 46 ARG A HH21 5  
ATOM 4879  H HH22 . ARG A 1 46 ? -46.591 -44.818 -29.793 1.00 0.00 ? 46 ARG A HH22 5  
ATOM 4880  N N    . ARG A 1 47 ? -41.691 -40.013 -31.992 1.00 0.00 ? 47 ARG A N    5  
ATOM 4881  C CA   . ARG A 1 47 ? -42.194 -40.616 -33.223 1.00 0.00 ? 47 ARG A CA   5  
ATOM 4882  C C    . ARG A 1 47 ? -41.117 -41.471 -33.890 1.00 0.00 ? 47 ARG A C    5  
ATOM 4883  O O    . ARG A 1 47 ? -41.429 -42.455 -34.559 1.00 0.00 ? 47 ARG A O    5  
ATOM 4884  C CB   . ARG A 1 47 ? -42.647 -39.519 -34.195 1.00 0.00 ? 47 ARG A CB   5  
ATOM 4885  C CG   . ARG A 1 47 ? -43.860 -39.997 -35.011 1.00 0.00 ? 47 ARG A CG   5  
ATOM 4886  C CD   . ARG A 1 47 ? -43.478 -41.206 -35.871 1.00 0.00 ? 47 ARG A CD   5  
ATOM 4887  N NE   . ARG A 1 47 ? -44.334 -41.286 -37.050 1.00 0.00 ? 47 ARG A NE   5  
ATOM 4888  C CZ   . ARG A 1 47 ? -45.533 -41.857 -36.992 1.00 0.00 ? 47 ARG A CZ   5  
ATOM 4889  N NH1  . ARG A 1 47 ? -45.963 -42.359 -35.867 1.00 0.00 ? 47 ARG A NH1  5  
ATOM 4890  N NH2  . ARG A 1 47 ? -46.279 -41.917 -38.060 1.00 0.00 ? 47 ARG A NH2  5  
ATOM 4891  H H    . ARG A 1 47 ? -41.755 -39.047 -31.875 1.00 0.00 ? 47 ARG A H    5  
ATOM 4892  H HA   . ARG A 1 47 ? -43.039 -41.243 -32.984 1.00 0.00 ? 47 ARG A HA   5  
ATOM 4893  H HB2  . ARG A 1 47 ? -42.920 -38.638 -33.634 1.00 0.00 ? 47 ARG A HB2  5  
ATOM 4894  H HB3  . ARG A 1 47 ? -41.838 -39.279 -34.867 1.00 0.00 ? 47 ARG A HB3  5  
ATOM 4895  H HG2  . ARG A 1 47 ? -44.660 -40.273 -34.339 1.00 0.00 ? 47 ARG A HG2  5  
ATOM 4896  H HG3  . ARG A 1 47 ? -44.195 -39.196 -35.653 1.00 0.00 ? 47 ARG A HG3  5  
ATOM 4897  H HD2  . ARG A 1 47 ? -42.450 -41.113 -36.186 1.00 0.00 ? 47 ARG A HD2  5  
ATOM 4898  H HD3  . ARG A 1 47 ? -43.594 -42.106 -35.287 1.00 0.00 ? 47 ARG A HD3  5  
ATOM 4899  H HE   . ARG A 1 47 ? -44.019 -40.912 -37.900 1.00 0.00 ? 47 ARG A HE   5  
ATOM 4900  H HH11 . ARG A 1 47 ? -45.390 -42.315 -35.048 1.00 0.00 ? 47 ARG A HH11 5  
ATOM 4901  H HH12 . ARG A 1 47 ? -46.865 -42.790 -35.823 1.00 0.00 ? 47 ARG A HH12 5  
ATOM 4902  H HH21 . ARG A 1 47 ? -45.951 -41.531 -38.922 1.00 0.00 ? 47 ARG A HH21 5  
ATOM 4903  H HH22 . ARG A 1 47 ? -47.181 -42.347 -38.016 1.00 0.00 ? 47 ARG A HH22 5  
ATOM 4904  N N    . PHE A 1 48 ? -39.850 -41.118 -33.700 1.00 0.00 ? 48 PHE A N    5  
ATOM 4905  C CA   . PHE A 1 48 ? -38.780 -41.908 -34.305 1.00 0.00 ? 48 PHE A CA   5  
ATOM 4906  C C    . PHE A 1 48 ? -38.851 -43.348 -33.806 1.00 0.00 ? 48 PHE A C    5  
ATOM 4907  O O    . PHE A 1 48 ? -38.670 -44.291 -34.578 1.00 0.00 ? 48 PHE A O    5  
ATOM 4908  C CB   . PHE A 1 48 ? -37.412 -41.309 -33.975 1.00 0.00 ? 48 PHE A CB   5  
ATOM 4909  C CG   . PHE A 1 48 ? -37.136 -40.148 -34.900 1.00 0.00 ? 48 PHE A CG   5  
ATOM 4910  C CD1  . PHE A 1 48 ? -37.747 -38.911 -34.669 1.00 0.00 ? 48 PHE A CD1  5  
ATOM 4911  C CD2  . PHE A 1 48 ? -36.268 -40.308 -35.986 1.00 0.00 ? 48 PHE A CD2  5  
ATOM 4912  C CE1  . PHE A 1 48 ? -37.488 -37.832 -35.524 1.00 0.00 ? 48 PHE A CE1  5  
ATOM 4913  C CE2  . PHE A 1 48 ? -36.009 -39.232 -36.842 1.00 0.00 ? 48 PHE A CE2  5  
ATOM 4914  C CZ   . PHE A 1 48 ? -36.619 -37.992 -36.611 1.00 0.00 ? 48 PHE A CZ   5  
ATOM 4915  H H    . PHE A 1 48 ? -39.635 -40.337 -33.149 1.00 0.00 ? 48 PHE A H    5  
ATOM 4916  H HA   . PHE A 1 48 ? -38.911 -41.906 -35.378 1.00 0.00 ? 48 PHE A HA   5  
ATOM 4917  H HB2  . PHE A 1 48 ? -37.404 -40.967 -32.954 1.00 0.00 ? 48 PHE A HB2  5  
ATOM 4918  H HB3  . PHE A 1 48 ? -36.649 -42.062 -34.109 1.00 0.00 ? 48 PHE A HB3  5  
ATOM 4919  H HD1  . PHE A 1 48 ? -38.418 -38.789 -33.835 1.00 0.00 ? 48 PHE A HD1  5  
ATOM 4920  H HD2  . PHE A 1 48 ? -35.797 -41.266 -36.164 1.00 0.00 ? 48 PHE A HD2  5  
ATOM 4921  H HE1  . PHE A 1 48 ? -37.958 -36.876 -35.346 1.00 0.00 ? 48 PHE A HE1  5  
ATOM 4922  H HE2  . PHE A 1 48 ? -35.340 -39.356 -37.679 1.00 0.00 ? 48 PHE A HE2  5  
ATOM 4923  H HZ   . PHE A 1 48 ? -36.420 -37.162 -37.271 1.00 0.00 ? 48 PHE A HZ   5  
ATOM 4924  N N    . ARG A 1 49 ? -39.152 -43.515 -32.521 1.00 0.00 ? 49 ARG A N    5  
ATOM 4925  C CA   . ARG A 1 49 ? -39.284 -44.855 -31.960 1.00 0.00 ? 49 ARG A CA   5  
ATOM 4926  C C    . ARG A 1 49 ? -40.744 -45.288 -32.023 1.00 0.00 ? 49 ARG A C    5  
ATOM 4927  O O    . ARG A 1 49 ? -41.059 -46.366 -32.525 1.00 0.00 ? 49 ARG A O    5  
ATOM 4928  C CB   . ARG A 1 49 ? -38.798 -44.877 -30.510 1.00 0.00 ? 49 ARG A CB   5  
ATOM 4929  C CG   . ARG A 1 49 ? -37.323 -44.474 -30.458 1.00 0.00 ? 49 ARG A CG   5  
ATOM 4930  C CD   . ARG A 1 49 ? -36.803 -44.625 -29.027 1.00 0.00 ? 49 ARG A CD   5  
ATOM 4931  N NE   . ARG A 1 49 ? -36.755 -46.034 -28.655 1.00 0.00 ? 49 ARG A NE   5  
ATOM 4932  C CZ   . ARG A 1 49 ? -35.744 -46.811 -29.031 1.00 0.00 ? 49 ARG A CZ   5  
ATOM 4933  N NH1  . ARG A 1 49 ? -34.770 -46.315 -29.742 1.00 0.00 ? 49 ARG A NH1  5  
ATOM 4934  N NH2  . ARG A 1 49 ? -35.725 -48.070 -28.689 1.00 0.00 ? 49 ARG A NH2  5  
ATOM 4935  H H    . ARG A 1 49 ? -39.316 -42.722 -31.968 1.00 0.00 ? 49 ARG A H    5  
ATOM 4936  H HA   . ARG A 1 49 ? -38.687 -45.542 -32.543 1.00 0.00 ? 49 ARG A HA   5  
ATOM 4937  H HB2  . ARG A 1 49 ? -39.383 -44.182 -29.924 1.00 0.00 ? 49 ARG A HB2  5  
ATOM 4938  H HB3  . ARG A 1 49 ? -38.912 -45.873 -30.106 1.00 0.00 ? 49 ARG A HB3  5  
ATOM 4939  H HG2  . ARG A 1 49 ? -36.753 -45.112 -31.119 1.00 0.00 ? 49 ARG A HG2  5  
ATOM 4940  H HG3  . ARG A 1 49 ? -37.219 -43.447 -30.771 1.00 0.00 ? 49 ARG A HG3  5  
ATOM 4941  H HD2  . ARG A 1 49 ? -35.812 -44.204 -28.960 1.00 0.00 ? 49 ARG A HD2  5  
ATOM 4942  H HD3  . ARG A 1 49 ? -37.461 -44.097 -28.352 1.00 0.00 ? 49 ARG A HD3  5  
ATOM 4943  H HE   . ARG A 1 49 ? -37.482 -46.416 -28.119 1.00 0.00 ? 49 ARG A HE   5  
ATOM 4944  H HH11 . ARG A 1 49 ? -34.782 -45.348 -30.003 1.00 0.00 ? 49 ARG A HH11 5  
ATOM 4945  H HH12 . ARG A 1 49 ? -34.009 -46.899 -30.024 1.00 0.00 ? 49 ARG A HH12 5  
ATOM 4946  H HH21 . ARG A 1 49 ? -36.473 -48.450 -28.143 1.00 0.00 ? 49 ARG A HH21 5  
ATOM 4947  H HH22 . ARG A 1 49 ? -34.966 -48.654 -28.972 1.00 0.00 ? 49 ARG A HH22 5  
ATOM 4948  N N    . SER A 1 50 ? -41.619 -44.432 -31.496 1.00 0.00 ? 50 SER A N    5  
ATOM 4949  C CA   . SER A 1 50 ? -43.058 -44.701 -31.467 1.00 0.00 ? 50 SER A CA   5  
ATOM 4950  C C    . SER A 1 50 ? -43.419 -45.525 -30.238 1.00 0.00 ? 50 SER A C    5  
ATOM 4951  O O    . SER A 1 50 ? -44.245 -46.435 -30.308 1.00 0.00 ? 50 SER A O    5  
ATOM 4952  C CB   . SER A 1 50 ? -43.495 -45.445 -32.730 1.00 0.00 ? 50 SER A CB   5  
ATOM 4953  O OG   . SER A 1 50 ? -42.708 -45.009 -33.830 1.00 0.00 ? 50 SER A OG   5  
ATOM 4954  H H    . SER A 1 50 ? -41.278 -43.618 -31.076 1.00 0.00 ? 50 SER A H    5  
ATOM 4955  H HA   . SER A 1 50 ? -43.583 -43.759 -31.420 1.00 0.00 ? 50 SER A HA   5  
ATOM 4956  H HB2  . SER A 1 50 ? -43.367 -46.506 -32.593 1.00 0.00 ? 50 SER A HB2  5  
ATOM 4957  H HB3  . SER A 1 50 ? -44.540 -45.238 -32.921 1.00 0.00 ? 50 SER A HB3  5  
ATOM 4958  H HG   . SER A 1 50 ? -41.967 -45.613 -33.922 1.00 0.00 ? 50 SER A HG   5  
ATOM 4959  N N    . GLY A 1 51 ? -42.800 -45.193 -29.109 1.00 0.00 ? 51 GLY A N    5  
ATOM 4960  C CA   . GLY A 1 51 ? -43.065 -45.899 -27.860 1.00 0.00 ? 51 GLY A CA   5  
ATOM 4961  C C    . GLY A 1 51 ? -42.257 -47.187 -27.775 1.00 0.00 ? 51 GLY A C    5  
ATOM 4962  O O    . GLY A 1 51 ? -42.349 -47.923 -26.791 1.00 0.00 ? 51 GLY A O    5  
ATOM 4963  H H    . GLY A 1 51 ? -42.157 -44.453 -29.116 1.00 0.00 ? 51 GLY A H    5  
ATOM 4964  H HA2  . GLY A 1 51 ? -42.801 -45.258 -27.031 1.00 0.00 ? 51 GLY A HA2  5  
ATOM 4965  H HA3  . GLY A 1 51 ? -44.116 -46.138 -27.804 1.00 0.00 ? 51 GLY A HA3  5  
ATOM 4966  N N    . GLY A 1 52 ? -41.465 -47.457 -28.805 1.00 0.00 ? 52 GLY A N    5  
ATOM 4967  C CA   . GLY A 1 52 ? -40.647 -48.663 -28.824 1.00 0.00 ? 52 GLY A CA   5  
ATOM 4968  C C    . GLY A 1 52 ? -41.513 -49.903 -28.637 1.00 0.00 ? 52 GLY A C    5  
ATOM 4969  O O    . GLY A 1 52 ? -42.518 -50.083 -29.325 1.00 0.00 ? 52 GLY A O    5  
ATOM 4970  H H    . GLY A 1 52 ? -41.430 -46.834 -29.561 1.00 0.00 ? 52 GLY A H    5  
ATOM 4971  H HA2  . GLY A 1 52 ? -40.130 -48.727 -29.771 1.00 0.00 ? 52 GLY A HA2  5  
ATOM 4972  H HA3  . GLY A 1 52 ? -39.923 -48.613 -28.026 1.00 0.00 ? 52 GLY A HA3  5  
ATOM 4973  N N    . ASN A 1 53 ? -41.121 -50.751 -27.691 1.00 0.00 ? 53 ASN A N    5  
ATOM 4974  C CA   . ASN A 1 53 ? -41.873 -51.969 -27.408 1.00 0.00 ? 53 ASN A CA   5  
ATOM 4975  C C    . ASN A 1 53 ? -43.139 -51.635 -26.622 1.00 0.00 ? 53 ASN A C    5  
ATOM 4976  O O    . ASN A 1 53 ? -43.163 -50.676 -25.851 1.00 0.00 ? 53 ASN A O    5  
ATOM 4977  C CB   . ASN A 1 53 ? -41.009 -52.940 -26.603 1.00 0.00 ? 53 ASN A CB   5  
ATOM 4978  C CG   . ASN A 1 53 ? -39.799 -53.367 -27.427 1.00 0.00 ? 53 ASN A CG   5  
ATOM 4979  O OD1  . ASN A 1 53 ? -39.917 -53.596 -28.631 1.00 0.00 ? 53 ASN A OD1  5  
ATOM 4980  N ND2  . ASN A 1 53 ? -38.637 -53.485 -26.848 1.00 0.00 ? 53 ASN A ND2  5  
ATOM 4981  H H    . ASN A 1 53 ? -40.320 -50.549 -27.166 1.00 0.00 ? 53 ASN A H    5  
ATOM 4982  H HA   . ASN A 1 53 ? -42.151 -52.435 -28.340 1.00 0.00 ? 53 ASN A HA   5  
ATOM 4983  H HB2  . ASN A 1 53 ? -40.674 -52.456 -25.696 1.00 0.00 ? 53 ASN A HB2  5  
ATOM 4984  H HB3  . ASN A 1 53 ? -41.593 -53.812 -26.348 1.00 0.00 ? 53 ASN A HB3  5  
ATOM 4985  H HD21 . ASN A 1 53 ? -38.544 -53.301 -25.889 1.00 0.00 ? 53 ASN A HD21 5  
ATOM 4986  H HD22 . ASN A 1 53 ? -37.854 -53.759 -27.371 1.00 0.00 ? 53 ASN A HD22 5  
ATOM 4987  N N    . LYS A 1 54 ? -44.184 -52.436 -26.808 1.00 0.00 ? 54 LYS A N    5  
ATOM 4988  C CA   . LYS A 1 54 ? -45.436 -52.213 -26.095 1.00 0.00 ? 54 LYS A CA   5  
ATOM 4989  C C    . LYS A 1 54 ? -46.048 -53.539 -25.657 1.00 0.00 ? 54 LYS A C    5  
ATOM 4990  O O    . LYS A 1 54 ? -46.126 -54.481 -26.444 1.00 0.00 ? 54 LYS A O    5  
ATOM 4991  C CB   . LYS A 1 54 ? -46.426 -51.468 -26.992 1.00 0.00 ? 54 LYS A CB   5  
ATOM 4992  C CG   . LYS A 1 54 ? -45.894 -50.065 -27.288 1.00 0.00 ? 54 LYS A CG   5  
ATOM 4993  C CD   . LYS A 1 54 ? -46.886 -49.322 -28.184 1.00 0.00 ? 54 LYS A CD   5  
ATOM 4994  C CE   . LYS A 1 54 ? -46.354 -47.919 -28.479 1.00 0.00 ? 54 LYS A CE   5  
ATOM 4995  N NZ   . LYS A 1 54 ? -47.317 -47.198 -29.359 1.00 0.00 ? 54 LYS A NZ   5  
ATOM 4996  H H    . LYS A 1 54 ? -44.107 -53.200 -27.417 1.00 0.00 ? 54 LYS A H    5  
ATOM 4997  H HA   . LYS A 1 54 ? -45.240 -51.612 -25.220 1.00 0.00 ? 54 LYS A HA   5  
ATOM 4998  H HB2  . LYS A 1 54 ? -46.548 -52.010 -27.920 1.00 0.00 ? 54 LYS A HB2  5  
ATOM 4999  H HB3  . LYS A 1 54 ? -47.378 -51.391 -26.491 1.00 0.00 ? 54 LYS A HB3  5  
ATOM 5000  H HG2  . LYS A 1 54 ? -45.768 -49.525 -26.360 1.00 0.00 ? 54 LYS A HG2  5  
ATOM 5001  H HG3  . LYS A 1 54 ? -44.941 -50.140 -27.792 1.00 0.00 ? 54 LYS A HG3  5  
ATOM 5002  H HD2  . LYS A 1 54 ? -47.010 -49.863 -29.110 1.00 0.00 ? 54 LYS A HD2  5  
ATOM 5003  H HD3  . LYS A 1 54 ? -47.838 -49.245 -27.680 1.00 0.00 ? 54 LYS A HD3  5  
ATOM 5004  H HE2  . LYS A 1 54 ? -46.236 -47.376 -27.553 1.00 0.00 ? 54 LYS A HE2  5  
ATOM 5005  H HE3  . LYS A 1 54 ? -45.398 -47.994 -28.976 1.00 0.00 ? 54 LYS A HE3  5  
ATOM 5006  H HZ1  . LYS A 1 54 ? -46.840 -46.922 -30.240 1.00 0.00 ? 54 LYS A HZ1  5  
ATOM 5007  H HZ2  . LYS A 1 54 ? -47.662 -46.347 -28.870 1.00 0.00 ? 54 LYS A HZ2  5  
ATOM 5008  H HZ3  . LYS A 1 54 ? -48.118 -47.821 -29.582 1.00 0.00 ? 54 LYS A HZ3  5  
ATOM 5009  N N    . LYS A 1 55 ? -46.490 -53.600 -24.402 1.00 0.00 ? 55 LYS A N    5  
ATOM 5010  C CA   . LYS A 1 55 ? -47.105 -54.814 -23.873 1.00 0.00 ? 55 LYS A CA   5  
ATOM 5011  C C    . LYS A 1 55 ? -48.582 -54.572 -23.571 1.00 0.00 ? 55 LYS A C    5  
ATOM 5012  O O    . LYS A 1 55 ? -49.414 -55.467 -23.724 1.00 0.00 ? 55 LYS A O    5  
ATOM 5013  C CB   . LYS A 1 55 ? -46.376 -55.257 -22.599 1.00 0.00 ? 55 LYS A CB   5  
ATOM 5014  C CG   . LYS A 1 55 ? -46.521 -54.186 -21.515 1.00 0.00 ? 55 LYS A CG   5  
ATOM 5015  C CD   . LYS A 1 55 ? -45.722 -54.603 -20.278 1.00 0.00 ? 55 LYS A CD   5  
ATOM 5016  C CE   . LYS A 1 55 ? -45.938 -53.579 -19.162 1.00 0.00 ? 55 LYS A CE   5  
ATOM 5017  N NZ   . LYS A 1 55 ? -45.434 -52.248 -19.604 1.00 0.00 ? 55 LYS A NZ   5  
ATOM 5018  H H    . LYS A 1 55 ? -46.406 -52.814 -23.821 1.00 0.00 ? 55 LYS A H    5  
ATOM 5019  H HA   . LYS A 1 55 ? -47.026 -55.599 -24.609 1.00 0.00 ? 55 LYS A HA   5  
ATOM 5020  H HB2  . LYS A 1 55 ? -46.800 -56.185 -22.248 1.00 0.00 ? 55 LYS A HB2  5  
ATOM 5021  H HB3  . LYS A 1 55 ? -45.328 -55.402 -22.820 1.00 0.00 ? 55 LYS A HB3  5  
ATOM 5022  H HG2  . LYS A 1 55 ? -46.147 -53.243 -21.885 1.00 0.00 ? 55 LYS A HG2  5  
ATOM 5023  H HG3  . LYS A 1 55 ? -47.561 -54.082 -21.247 1.00 0.00 ? 55 LYS A HG3  5  
ATOM 5024  H HD2  . LYS A 1 55 ? -46.056 -55.576 -19.945 1.00 0.00 ? 55 LYS A HD2  5  
ATOM 5025  H HD3  . LYS A 1 55 ? -44.672 -54.647 -20.525 1.00 0.00 ? 55 LYS A HD3  5  
ATOM 5026  H HE2  . LYS A 1 55 ? -46.993 -53.507 -18.939 1.00 0.00 ? 55 LYS A HE2  5  
ATOM 5027  H HE3  . LYS A 1 55 ? -45.403 -53.892 -18.279 1.00 0.00 ? 55 LYS A HE3  5  
ATOM 5028  H HZ1  . LYS A 1 55 ? -45.083 -52.316 -20.580 1.00 0.00 ? 55 LYS A HZ1  5  
ATOM 5029  H HZ2  . LYS A 1 55 ? -44.660 -51.946 -18.977 1.00 0.00 ? 55 LYS A HZ2  5  
ATOM 5030  H HZ3  . LYS A 1 55 ? -46.205 -51.553 -19.564 1.00 0.00 ? 55 LYS A HZ3  5  
ATOM 5031  N N    . ARG A 1 56 ? -48.897 -53.354 -23.140 1.00 0.00 ? 56 ARG A N    5  
ATOM 5032  C CA   . ARG A 1 56 ? -50.276 -53.003 -22.817 1.00 0.00 ? 56 ARG A CA   5  
ATOM 5033  C C    . ARG A 1 56 ? -51.128 -52.965 -24.081 1.00 0.00 ? 56 ARG A C    5  
ATOM 5034  O O    . ARG A 1 56 ? -52.287 -53.380 -24.066 1.00 0.00 ? 56 ARG A O    5  
ATOM 5035  C CB   . ARG A 1 56 ? -50.329 -51.639 -22.127 1.00 0.00 ? 56 ARG A CB   5  
ATOM 5036  C CG   . ARG A 1 56 ? -49.706 -51.743 -20.734 1.00 0.00 ? 56 ARG A CG   5  
ATOM 5037  C CD   . ARG A 1 56 ? -49.729 -50.370 -20.062 1.00 0.00 ? 56 ARG A CD   5  
ATOM 5038  N NE   . ARG A 1 56 ? -51.106 -49.935 -19.855 1.00 0.00 ? 56 ARG A NE   5  
ATOM 5039  C CZ   . ARG A 1 56 ? -51.383 -48.704 -19.440 1.00 0.00 ? 56 ARG A CZ   5  
ATOM 5040  N NH1  . ARG A 1 56 ? -50.416 -47.859 -19.211 1.00 0.00 ? 56 ARG A NH1  5  
ATOM 5041  N NH2  . ARG A 1 56 ? -52.624 -48.340 -19.260 1.00 0.00 ? 56 ARG A NH2  5  
ATOM 5042  H H    . ARG A 1 56 ? -48.183 -52.691 -23.037 1.00 0.00 ? 56 ARG A H    5  
ATOM 5043  H HA   . ARG A 1 56 ? -50.677 -53.748 -22.146 1.00 0.00 ? 56 ARG A HA   5  
ATOM 5044  H HB2  . ARG A 1 56 ? -49.779 -50.918 -22.714 1.00 0.00 ? 56 ARG A HB2  5  
ATOM 5045  H HB3  . ARG A 1 56 ? -51.357 -51.321 -22.036 1.00 0.00 ? 56 ARG A HB3  5  
ATOM 5046  H HG2  . ARG A 1 56 ? -50.271 -52.447 -20.138 1.00 0.00 ? 56 ARG A HG2  5  
ATOM 5047  H HG3  . ARG A 1 56 ? -48.686 -52.080 -20.819 1.00 0.00 ? 56 ARG A HG3  5  
ATOM 5048  H HD2  . ARG A 1 56 ? -49.228 -50.429 -19.109 1.00 0.00 ? 56 ARG A HD2  5  
ATOM 5049  H HD3  . ARG A 1 56 ? -49.217 -49.657 -20.690 1.00 0.00 ? 56 ARG A HD3  5  
ATOM 5050  H HE   . ARG A 1 56 ? -51.840 -50.562 -20.025 1.00 0.00 ? 56 ARG A HE   5  
ATOM 5051  H HH11 . ARG A 1 56 ? -49.466 -48.137 -19.349 1.00 0.00 ? 56 ARG A HH11 5  
ATOM 5052  H HH12 . ARG A 1 56 ? -50.624 -46.932 -18.899 1.00 0.00 ? 56 ARG A HH12 5  
ATOM 5053  H HH21 . ARG A 1 56 ? -53.365 -48.987 -19.436 1.00 0.00 ? 56 ARG A HH21 5  
ATOM 5054  H HH22 . ARG A 1 56 ? -52.833 -47.413 -18.948 1.00 0.00 ? 56 ARG A HH22 5  
ATOM 5055  N N    . ARG A 1 57 ? -50.539 -52.473 -25.169 1.00 0.00 ? 57 ARG A N    5  
ATOM 5056  C CA   . ARG A 1 57 ? -51.239 -52.383 -26.448 1.00 0.00 ? 57 ARG A CA   5  
ATOM 5057  C C    . ARG A 1 57 ? -52.718 -52.063 -26.250 1.00 0.00 ? 57 ARG A C    5  
ATOM 5058  O O    . ARG A 1 57 ? -53.071 -51.140 -25.516 1.00 0.00 ? 57 ARG A O    5  
ATOM 5059  C CB   . ARG A 1 57 ? -51.094 -53.699 -27.216 1.00 0.00 ? 57 ARG A CB   5  
ATOM 5060  C CG   . ARG A 1 57 ? -49.611 -53.997 -27.437 1.00 0.00 ? 57 ARG A CG   5  
ATOM 5061  C CD   . ARG A 1 57 ? -49.468 -55.253 -28.294 1.00 0.00 ? 57 ARG A CD   5  
ATOM 5062  N NE   . ARG A 1 57 ? -49.941 -54.993 -29.648 1.00 0.00 ? 57 ARG A NE   5  
ATOM 5063  C CZ   . ARG A 1 57 ? -50.057 -55.974 -30.538 1.00 0.00 ? 57 ARG A CZ   5  
ATOM 5064  N NH1  . ARG A 1 57 ? -49.743 -57.196 -30.204 1.00 0.00 ? 57 ARG A NH1  5  
ATOM 5065  N NH2  . ARG A 1 57 ? -50.482 -55.717 -31.744 1.00 0.00 ? 57 ARG A NH2  5  
ATOM 5066  H H    . ARG A 1 57 ? -49.610 -52.165 -25.114 1.00 0.00 ? 57 ARG A H    5  
ATOM 5067  H HA   . ARG A 1 57 ? -50.789 -51.595 -27.033 1.00 0.00 ? 57 ARG A HA   5  
ATOM 5068  H HB2  . ARG A 1 57 ? -51.543 -54.498 -26.645 1.00 0.00 ? 57 ARG A HB2  5  
ATOM 5069  H HB3  . ARG A 1 57 ? -51.588 -53.614 -28.171 1.00 0.00 ? 57 ARG A HB3  5  
ATOM 5070  H HG2  . ARG A 1 57 ? -49.147 -53.161 -27.940 1.00 0.00 ? 57 ARG A HG2  5  
ATOM 5071  H HG3  . ARG A 1 57 ? -49.129 -54.158 -26.484 1.00 0.00 ? 57 ARG A HG3  5  
ATOM 5072  H HD2  . ARG A 1 57 ? -48.431 -55.547 -28.329 1.00 0.00 ? 57 ARG A HD2  5  
ATOM 5073  H HD3  . ARG A 1 57 ? -50.051 -56.053 -27.858 1.00 0.00 ? 57 ARG A HD3  5  
ATOM 5074  H HE   . ARG A 1 57 ? -50.179 -54.078 -29.908 1.00 0.00 ? 57 ARG A HE   5  
ATOM 5075  H HH11 . ARG A 1 57 ? -49.416 -57.394 -29.279 1.00 0.00 ? 57 ARG A HH11 5  
ATOM 5076  H HH12 . ARG A 1 57 ? -49.829 -57.934 -30.873 1.00 0.00 ? 57 ARG A HH12 5  
ATOM 5077  H HH21 . ARG A 1 57 ? -50.723 -54.780 -32.001 1.00 0.00 ? 57 ARG A HH21 5  
ATOM 5078  H HH22 . ARG A 1 57 ? -50.568 -56.454 -32.411 1.00 0.00 ? 57 ARG A HH22 5  
ATOM 5079  N N    . GLN A 1 58 ? -53.577 -52.842 -26.900 1.00 0.00 ? 58 GLN A N    5  
ATOM 5080  C CA   . GLN A 1 58 ? -55.017 -52.647 -26.777 1.00 0.00 ? 58 GLN A CA   5  
ATOM 5081  C C    . GLN A 1 58 ? -55.727 -53.987 -26.609 1.00 0.00 ? 58 GLN A C    5  
ATOM 5082  O O    . GLN A 1 58 ? -55.507 -54.911 -27.393 1.00 0.00 ? 58 GLN A O    5  
ATOM 5083  C CB   . GLN A 1 58 ? -55.557 -51.935 -28.018 1.00 0.00 ? 58 GLN A CB   5  
ATOM 5084  C CG   . GLN A 1 58 ? -54.873 -50.573 -28.165 1.00 0.00 ? 58 GLN A CG   5  
ATOM 5085  C CD   . GLN A 1 58 ? -53.459 -50.757 -28.707 1.00 0.00 ? 58 GLN A CD   5  
ATOM 5086  O OE1  . GLN A 1 58 ? -53.249 -51.519 -29.650 1.00 0.00 ? 58 GLN A OE1  5  
ATOM 5087  N NE2  . GLN A 1 58 ? -52.471 -50.100 -28.163 1.00 0.00 ? 58 GLN A NE2  5  
ATOM 5088  H H    . GLN A 1 58 ? -53.237 -53.579 -27.450 1.00 0.00 ? 58 GLN A H    5  
ATOM 5089  H HA   . GLN A 1 58 ? -55.215 -52.034 -25.911 1.00 0.00 ? 58 GLN A HA   5  
ATOM 5090  H HB2  . GLN A 1 58 ? -55.354 -52.536 -28.893 1.00 0.00 ? 58 GLN A HB2  5  
ATOM 5091  H HB3  . GLN A 1 58 ? -56.620 -51.791 -27.918 1.00 0.00 ? 58 GLN A HB3  5  
ATOM 5092  H HG2  . GLN A 1 58 ? -55.441 -49.959 -28.846 1.00 0.00 ? 58 GLN A HG2  5  
ATOM 5093  H HG3  . GLN A 1 58 ? -54.825 -50.091 -27.200 1.00 0.00 ? 58 GLN A HG3  5  
ATOM 5094  H HE21 . GLN A 1 58 ? -52.641 -49.494 -27.412 1.00 0.00 ? 58 GLN A HE21 5  
ATOM 5095  H HE22 . GLN A 1 58 ? -51.561 -50.212 -28.506 1.00 0.00 ? 58 GLN A HE22 5  
ATOM 5096  N N    . ILE A 1 59 ? -56.584 -54.085 -25.597 1.00 0.00 ? 59 ILE A N    5  
ATOM 5097  C CA   . ILE A 1 59 ? -57.329 -55.317 -25.353 1.00 0.00 ? 59 ILE A CA   5  
ATOM 5098  C C    . ILE A 1 59 ? -58.813 -55.020 -25.164 1.00 0.00 ? 59 ILE A C    5  
ATOM 5099  O O    . ILE A 1 59 ? -59.670 -55.826 -25.524 1.00 0.00 ? 59 ILE A O    5  
ATOM 5100  C CB   . ILE A 1 59 ? -56.770 -56.037 -24.118 1.00 0.00 ? 59 ILE A CB   5  
ATOM 5101  C CG1  . ILE A 1 59 ? -56.842 -55.115 -22.896 1.00 0.00 ? 59 ILE A CG1  5  
ATOM 5102  C CG2  . ILE A 1 59 ? -55.313 -56.431 -24.367 1.00 0.00 ? 59 ILE A CG2  5  
ATOM 5103  C CD1  . ILE A 1 59 ? -56.443 -55.900 -21.643 1.00 0.00 ? 59 ILE A CD1  5  
ATOM 5104  H H    . ILE A 1 59 ? -56.726 -53.315 -25.007 1.00 0.00 ? 59 ILE A H    5  
ATOM 5105  H HA   . ILE A 1 59 ? -57.217 -55.967 -26.209 1.00 0.00 ? 59 ILE A HA   5  
ATOM 5106  H HB   . ILE A 1 59 ? -57.352 -56.928 -23.931 1.00 0.00 ? 59 ILE A HB   5  
ATOM 5107  H HG12 . ILE A 1 59 ? -56.165 -54.283 -23.031 1.00 0.00 ? 59 ILE A HG12 5  
ATOM 5108  H HG13 . ILE A 1 59 ? -57.847 -54.745 -22.775 1.00 0.00 ? 59 ILE A HG13 5  
ATOM 5109  H HG21 . ILE A 1 59 ? -55.195 -57.492 -24.210 1.00 0.00 ? 59 ILE A HG21 5  
ATOM 5110  H HG22 . ILE A 1 59 ? -54.673 -55.893 -23.683 1.00 0.00 ? 59 ILE A HG22 5  
ATOM 5111  H HG23 . ILE A 1 59 ? -55.040 -56.185 -25.383 1.00 0.00 ? 59 ILE A HG23 5  
ATOM 5112  H HD11 . ILE A 1 59 ? -57.116 -56.734 -21.511 1.00 0.00 ? 59 ILE A HD11 5  
ATOM 5113  H HD12 . ILE A 1 59 ? -56.497 -55.252 -20.781 1.00 0.00 ? 59 ILE A HD12 5  
ATOM 5114  H HD13 . ILE A 1 59 ? -55.433 -56.266 -21.757 1.00 0.00 ? 59 ILE A HD13 5  
ATOM 5115  N N    . ASN A 1 60 ? -59.109 -53.852 -24.602 1.00 0.00 ? 60 ASN A N    5  
ATOM 5116  C CA   . ASN A 1 60 ? -60.491 -53.449 -24.374 1.00 0.00 ? 60 ASN A CA   5  
ATOM 5117  C C    . ASN A 1 60 ? -60.557 -51.973 -23.996 1.00 0.00 ? 60 ASN A C    5  
ATOM 5118  O O    . ASN A 1 60 ? -59.566 -51.397 -23.547 1.00 0.00 ? 60 ASN A O    5  
ATOM 5119  C CB   . ASN A 1 60 ? -61.103 -54.295 -23.257 1.00 0.00 ? 60 ASN A CB   5  
ATOM 5120  C CG   . ASN A 1 60 ? -60.321 -54.094 -21.965 1.00 0.00 ? 60 ASN A CG   5  
ATOM 5121  O OD1  . ASN A 1 60 ? -59.633 -53.085 -21.805 1.00 0.00 ? 60 ASN A OD1  5  
ATOM 5122  N ND2  . ASN A 1 60 ? -60.379 -55.000 -21.029 1.00 0.00 ? 60 ASN A ND2  5  
ATOM 5123  H H    . ASN A 1 60 ? -58.383 -53.247 -24.340 1.00 0.00 ? 60 ASN A H    5  
ATOM 5124  H HA   . ASN A 1 60 ? -61.057 -53.605 -25.281 1.00 0.00 ? 60 ASN A HA   5  
ATOM 5125  H HB2  . ASN A 1 60 ? -62.130 -54.000 -23.105 1.00 0.00 ? 60 ASN A HB2  5  
ATOM 5126  H HB3  . ASN A 1 60 ? -61.069 -55.338 -23.537 1.00 0.00 ? 60 ASN A HB3  5  
ATOM 5127  H HD21 . ASN A 1 60 ? -60.924 -55.805 -21.159 1.00 0.00 ? 60 ASN A HD21 5  
ATOM 5128  H HD22 . ASN A 1 60 ? -59.879 -54.878 -20.196 1.00 0.00 ? 60 ASN A HD22 5  
ATOM 5129  N N    . GLU A 1 61 ? -61.727 -51.367 -24.166 1.00 0.00 ? 61 GLU A N    5  
ATOM 5130  C CA   . GLU A 1 61 ? -61.896 -49.961 -23.822 1.00 0.00 ? 61 GLU A CA   5  
ATOM 5131  C C    . GLU A 1 61 ? -61.682 -49.765 -22.322 1.00 0.00 ? 61 GLU A C    5  
ATOM 5132  O O    . GLU A 1 61 ? -60.995 -48.836 -21.897 1.00 0.00 ? 61 GLU A O    5  
ATOM 5133  C CB   . GLU A 1 61 ? -63.302 -49.494 -24.220 1.00 0.00 ? 61 GLU A CB   5  
ATOM 5134  C CG   . GLU A 1 61 ? -63.484 -48.006 -23.888 1.00 0.00 ? 61 GLU A CG   5  
ATOM 5135  C CD   . GLU A 1 61 ? -62.500 -47.164 -24.694 1.00 0.00 ? 61 GLU A CD   5  
ATOM 5136  O OE1  . GLU A 1 61 ? -62.024 -47.652 -25.707 1.00 0.00 ? 61 GLU A OE1  5  
ATOM 5137  O OE2  . GLU A 1 61 ? -62.237 -46.045 -24.288 1.00 0.00 ? 61 GLU A OE2  5  
ATOM 5138  H H    . GLU A 1 61 ? -62.487 -51.876 -24.517 1.00 0.00 ? 61 GLU A H    5  
ATOM 5139  H HA   . GLU A 1 61 ? -61.164 -49.378 -24.360 1.00 0.00 ? 61 GLU A HA   5  
ATOM 5140  H HB2  . GLU A 1 61 ? -63.441 -49.643 -25.280 1.00 0.00 ? 61 GLU A HB2  5  
ATOM 5141  H HB3  . GLU A 1 61 ? -64.036 -50.072 -23.678 1.00 0.00 ? 61 GLU A HB3  5  
ATOM 5142  H HG2  . GLU A 1 61 ? -64.492 -47.710 -24.135 1.00 0.00 ? 61 GLU A HG2  5  
ATOM 5143  H HG3  . GLU A 1 61 ? -63.315 -47.845 -22.835 1.00 0.00 ? 61 GLU A HG3  5  
ATOM 5144  N N    . ASP A 1 62 ? -62.282 -50.649 -21.530 1.00 0.00 ? 62 ASP A N    5  
ATOM 5145  C CA   . ASP A 1 62 ? -62.160 -50.572 -20.079 1.00 0.00 ? 62 ASP A CA   5  
ATOM 5146  C C    . ASP A 1 62 ? -62.655 -51.860 -19.426 1.00 0.00 ? 62 ASP A C    5  
ATOM 5147  O O    . ASP A 1 62 ? -63.305 -52.683 -20.069 1.00 0.00 ? 62 ASP A O    5  
ATOM 5148  C CB   . ASP A 1 62 ? -62.971 -49.384 -19.551 1.00 0.00 ? 62 ASP A CB   5  
ATOM 5149  C CG   . ASP A 1 62 ? -62.466 -48.969 -18.172 1.00 0.00 ? 62 ASP A CG   5  
ATOM 5150  O OD1  . ASP A 1 62 ? -61.543 -49.599 -17.680 1.00 0.00 ? 62 ASP A OD1  5  
ATOM 5151  O OD2  . ASP A 1 62 ? -63.012 -48.024 -17.625 1.00 0.00 ? 62 ASP A OD2  5  
ATOM 5152  H H    . ASP A 1 62 ? -62.820 -51.361 -21.935 1.00 0.00 ? 62 ASP A H    5  
ATOM 5153  H HA   . ASP A 1 62 ? -61.121 -50.426 -19.824 1.00 0.00 ? 62 ASP A HA   5  
ATOM 5154  H HB2  . ASP A 1 62 ? -62.870 -48.554 -20.234 1.00 0.00 ? 62 ASP A HB2  5  
ATOM 5155  H HB3  . ASP A 1 62 ? -64.010 -49.666 -19.481 1.00 0.00 ? 62 ASP A HB3  5  
ATOM 5156  N N    . GLU A 1 63 ? -62.344 -52.024 -18.141 1.00 0.00 ? 63 GLU A N    5  
ATOM 5157  C CA   . GLU A 1 63 ? -62.763 -53.211 -17.401 1.00 0.00 ? 63 GLU A CA   5  
ATOM 5158  C C    . GLU A 1 63 ? -63.431 -52.817 -16.086 1.00 0.00 ? 63 GLU A C    5  
ATOM 5159  O O    . GLU A 1 63 ? -62.866 -53.016 -15.010 1.00 0.00 ? 63 GLU A O    5  
ATOM 5160  C CB   . GLU A 1 63 ? -61.551 -54.098 -17.108 1.00 0.00 ? 63 GLU A CB   5  
ATOM 5161  C CG   . GLU A 1 63 ? -60.916 -54.547 -18.424 1.00 0.00 ? 63 GLU A CG   5  
ATOM 5162  C CD   . GLU A 1 63 ? -59.677 -55.389 -18.143 1.00 0.00 ? 63 GLU A CD   5  
ATOM 5163  O OE1  . GLU A 1 63 ? -59.330 -55.527 -16.981 1.00 0.00 ? 63 GLU A OE1  5  
ATOM 5164  O OE2  . GLU A 1 63 ? -59.091 -55.881 -19.093 1.00 0.00 ? 63 GLU A OE2  5  
ATOM 5165  H H    . GLU A 1 63 ? -61.825 -51.332 -17.679 1.00 0.00 ? 63 GLU A H    5  
ATOM 5166  H HA   . GLU A 1 63 ? -63.465 -53.770 -17.999 1.00 0.00 ? 63 GLU A HA   5  
ATOM 5167  H HB2  . GLU A 1 63 ? -60.829 -53.540 -16.529 1.00 0.00 ? 63 GLU A HB2  5  
ATOM 5168  H HB3  . GLU A 1 63 ? -61.868 -54.966 -16.549 1.00 0.00 ? 63 GLU A HB3  5  
ATOM 5169  H HG2  . GLU A 1 63 ? -61.630 -55.135 -18.982 1.00 0.00 ? 63 GLU A HG2  5  
ATOM 5170  H HG3  . GLU A 1 63 ? -60.637 -53.679 -19.002 1.00 0.00 ? 63 GLU A HG3  5  
ATOM 5171  N N    . PRO A 1 64 ? -64.614 -52.264 -16.152 1.00 0.00 ? 64 PRO A N    5  
ATOM 5172  C CA   . PRO A 1 64 ? -65.368 -51.833 -14.943 1.00 0.00 ? 64 PRO A CA   5  
ATOM 5173  C C    . PRO A 1 64 ? -66.054 -53.006 -14.245 1.00 0.00 ? 64 PRO A C    5  
ATOM 5174  O O    . PRO A 1 64 ? -67.047 -53.483 -14.771 1.00 0.00 ? 64 PRO A O    5  
ATOM 5175  C CB   . PRO A 1 64 ? -66.395 -50.849 -15.497 1.00 0.00 ? 64 PRO A CB   5  
ATOM 5176  C CG   . PRO A 1 64 ? -66.634 -51.276 -16.908 1.00 0.00 ? 64 PRO A CG   5  
ATOM 5177  C CD   . PRO A 1 64 ? -65.363 -51.986 -17.388 1.00 0.00 ? 64 PRO A CD   5  
ATOM 5178  O OXT  . PRO A 1 64 ? -65.577 -53.408 -13.198 1.00 0.00 ? 64 PRO A OXT  5  
ATOM 5179  H HA   . PRO A 1 64 ? -64.712 -51.322 -14.256 1.00 0.00 ? 64 PRO A HA   5  
ATOM 5180  H HB2  . PRO A 1 64 ? -67.311 -50.904 -14.925 1.00 0.00 ? 64 PRO A HB2  5  
ATOM 5181  H HB3  . PRO A 1 64 ? -66.001 -49.845 -15.478 1.00 0.00 ? 64 PRO A HB3  5  
ATOM 5182  H HG2  . PRO A 1 64 ? -67.477 -51.954 -16.949 1.00 0.00 ? 64 PRO A HG2  5  
ATOM 5183  H HG3  . PRO A 1 64 ? -66.823 -50.414 -17.529 1.00 0.00 ? 64 PRO A HG3  5  
ATOM 5184  H HD2  . PRO A 1 64 ? -65.618 -52.905 -17.896 1.00 0.00 ? 64 PRO A HD2  5  
ATOM 5185  H HD3  . PRO A 1 64 ? -64.792 -51.339 -18.034 1.00 0.00 ? 64 PRO A HD3  5  
ATOM 5186  N N    . LEU A 1 1  ? -18.592 -21.217 -20.571 1.00 0.00 ? 1  LEU A N    6  
ATOM 5187  C CA   . LEU A 1 1  ? -18.148 -20.177 -19.603 1.00 0.00 ? 1  LEU A CA   6  
ATOM 5188  C C    . LEU A 1 1  ? -19.005 -18.926 -19.775 1.00 0.00 ? 1  LEU A C    6  
ATOM 5189  O O    . LEU A 1 1  ? -18.810 -18.157 -20.716 1.00 0.00 ? 1  LEU A O    6  
ATOM 5190  C CB   . LEU A 1 1  ? -16.675 -19.838 -19.861 1.00 0.00 ? 1  LEU A CB   6  
ATOM 5191  C CG   . LEU A 1 1  ? -15.827 -21.110 -19.764 1.00 0.00 ? 1  LEU A CG   6  
ATOM 5192  C CD1  . LEU A 1 1  ? -14.365 -20.770 -20.061 1.00 0.00 ? 1  LEU A CD1  6  
ATOM 5193  C CD2  . LEU A 1 1  ? -15.935 -21.700 -18.354 1.00 0.00 ? 1  LEU A CD2  6  
ATOM 5194  H H1   . LEU A 1 1  ? -18.466 -20.865 -21.542 1.00 0.00 ? 1  LEU A H1   6  
ATOM 5195  H H2   . LEU A 1 1  ? -19.597 -21.435 -20.409 1.00 0.00 ? 1  LEU A H2   6  
ATOM 5196  H H3   . LEU A 1 1  ? -18.025 -22.078 -20.443 1.00 0.00 ? 1  LEU A H3   6  
ATOM 5197  H HA   . LEU A 1 1  ? -18.260 -20.551 -18.596 1.00 0.00 ? 1  LEU A HA   6  
ATOM 5198  H HB2  . LEU A 1 1  ? -16.574 -19.412 -20.849 1.00 0.00 ? 1  LEU A HB2  6  
ATOM 5199  H HB3  . LEU A 1 1  ? -16.336 -19.124 -19.125 1.00 0.00 ? 1  LEU A HB3  6  
ATOM 5200  H HG   . LEU A 1 1  ? -16.180 -21.832 -20.486 1.00 0.00 ? 1  LEU A HG   6  
ATOM 5201  H HD11 . LEU A 1 1  ? -13.738 -21.165 -19.276 1.00 0.00 ? 1  LEU A HD11 6  
ATOM 5202  H HD12 . LEU A 1 1  ? -14.248 -19.697 -20.110 1.00 0.00 ? 1  LEU A HD12 6  
ATOM 5203  H HD13 . LEU A 1 1  ? -14.078 -21.208 -21.005 1.00 0.00 ? 1  LEU A HD13 6  
ATOM 5204  H HD21 . LEU A 1 1  ? -16.790 -22.357 -18.304 1.00 0.00 ? 1  LEU A HD21 6  
ATOM 5205  H HD22 . LEU A 1 1  ? -16.052 -20.903 -17.637 1.00 0.00 ? 1  LEU A HD22 6  
ATOM 5206  H HD23 . LEU A 1 1  ? -15.038 -22.258 -18.129 1.00 0.00 ? 1  LEU A HD23 6  
ATOM 5207  N N    . ASP A 1 2  ? -19.947 -18.730 -18.856 1.00 0.00 ? 2  ASP A N    6  
ATOM 5208  C CA   . ASP A 1 2  ? -20.831 -17.570 -18.902 1.00 0.00 ? 2  ASP A CA   6  
ATOM 5209  C C    . ASP A 1 2  ? -20.633 -16.714 -17.654 1.00 0.00 ? 2  ASP A C    6  
ATOM 5210  O O    . ASP A 1 2  ? -20.165 -17.209 -16.630 1.00 0.00 ? 2  ASP A O    6  
ATOM 5211  C CB   . ASP A 1 2  ? -22.289 -18.028 -18.983 1.00 0.00 ? 2  ASP A CB   6  
ATOM 5212  C CG   . ASP A 1 2  ? -22.447 -19.068 -20.087 1.00 0.00 ? 2  ASP A CG   6  
ATOM 5213  O OD1  . ASP A 1 2  ? -22.698 -18.674 -21.213 1.00 0.00 ? 2  ASP A OD1  6  
ATOM 5214  O OD2  . ASP A 1 2  ? -22.316 -20.244 -19.788 1.00 0.00 ? 2  ASP A OD2  6  
ATOM 5215  H H    . ASP A 1 2  ? -20.050 -19.373 -18.125 1.00 0.00 ? 2  ASP A H    6  
ATOM 5216  H HA   . ASP A 1 2  ? -20.600 -16.979 -19.775 1.00 0.00 ? 2  ASP A HA   6  
ATOM 5217  H HB2  . ASP A 1 2  ? -22.582 -18.462 -18.039 1.00 0.00 ? 2  ASP A HB2  6  
ATOM 5218  H HB3  . ASP A 1 2  ? -22.919 -17.179 -19.200 1.00 0.00 ? 2  ASP A HB3  6  
ATOM 5219  N N    . ARG A 1 3  ? -21.004 -15.437 -17.738 1.00 0.00 ? 3  ARG A N    6  
ATOM 5220  C CA   . ARG A 1 3  ? -20.873 -14.533 -16.598 1.00 0.00 ? 3  ARG A CA   6  
ATOM 5221  C C    . ARG A 1 3  ? -22.194 -13.815 -16.345 1.00 0.00 ? 3  ARG A C    6  
ATOM 5222  O O    . ARG A 1 3  ? -22.262 -12.879 -15.547 1.00 0.00 ? 3  ARG A O    6  
ATOM 5223  C CB   . ARG A 1 3  ? -19.776 -13.500 -16.866 1.00 0.00 ? 3  ARG A CB   6  
ATOM 5224  C CG   . ARG A 1 3  ? -18.410 -14.188 -16.875 1.00 0.00 ? 3  ARG A CG   6  
ATOM 5225  C CD   . ARG A 1 3  ? -17.321 -13.151 -17.154 1.00 0.00 ? 3  ARG A CD   6  
ATOM 5226  N NE   . ARG A 1 3  ? -16.007 -13.786 -17.156 1.00 0.00 ? 3  ARG A NE   6  
ATOM 5227  C CZ   . ARG A 1 3  ? -14.904 -13.077 -17.368 1.00 0.00 ? 3  ARG A CZ   6  
ATOM 5228  N NH1  . ARG A 1 3  ? -14.982 -11.792 -17.579 1.00 0.00 ? 3  ARG A NH1  6  
ATOM 5229  N NH2  . ARG A 1 3  ? -13.739 -13.667 -17.365 1.00 0.00 ? 3  ARG A NH2  6  
ATOM 5230  H H    . ARG A 1 3  ? -21.392 -15.090 -18.568 1.00 0.00 ? 3  ARG A H    6  
ATOM 5231  H HA   . ARG A 1 3  ? -20.609 -15.104 -15.720 1.00 0.00 ? 3  ARG A HA   6  
ATOM 5232  H HB2  . ARG A 1 3  ? -19.950 -13.033 -17.824 1.00 0.00 ? 3  ARG A HB2  6  
ATOM 5233  H HB3  . ARG A 1 3  ? -19.792 -12.749 -16.090 1.00 0.00 ? 3  ARG A HB3  6  
ATOM 5234  H HG2  . ARG A 1 3  ? -18.233 -14.650 -15.915 1.00 0.00 ? 3  ARG A HG2  6  
ATOM 5235  H HG3  . ARG A 1 3  ? -18.392 -14.944 -17.647 1.00 0.00 ? 3  ARG A HG3  6  
ATOM 5236  H HD2  . ARG A 1 3  ? -17.499 -12.697 -18.117 1.00 0.00 ? 3  ARG A HD2  6  
ATOM 5237  H HD3  . ARG A 1 3  ? -17.351 -12.389 -16.390 1.00 0.00 ? 3  ARG A HD3  6  
ATOM 5238  H HE   . ARG A 1 3  ? -15.939 -14.750 -17.000 1.00 0.00 ? 3  ARG A HE   6  
ATOM 5239  H HH11 . ARG A 1 3  ? -15.875 -11.340 -17.582 1.00 0.00 ? 3  ARG A HH11 6  
ATOM 5240  H HH12 . ARG A 1 3  ? -14.151 -11.258 -17.737 1.00 0.00 ? 3  ARG A HH12 6  
ATOM 5241  H HH21 . ARG A 1 3  ? -13.679 -14.651 -17.202 1.00 0.00 ? 3  ARG A HH21 6  
ATOM 5242  H HH22 . ARG A 1 3  ? -12.909 -13.134 -17.522 1.00 0.00 ? 3  ARG A HH22 6  
ATOM 5243  N N    . TRP A 1 4  ? -23.239 -14.257 -17.038 1.00 0.00 ? 4  TRP A N    6  
ATOM 5244  C CA   . TRP A 1 4  ? -24.558 -13.650 -16.894 1.00 0.00 ? 4  TRP A CA   6  
ATOM 5245  C C    . TRP A 1 4  ? -25.483 -14.558 -16.091 1.00 0.00 ? 4  TRP A C    6  
ATOM 5246  O O    . TRP A 1 4  ? -26.698 -14.359 -16.072 1.00 0.00 ? 4  TRP A O    6  
ATOM 5247  C CB   . TRP A 1 4  ? -25.170 -13.397 -18.273 1.00 0.00 ? 4  TRP A CB   6  
ATOM 5248  C CG   . TRP A 1 4  ? -24.276 -12.489 -19.057 1.00 0.00 ? 4  TRP A CG   6  
ATOM 5249  C CD1  . TRP A 1 4  ? -24.336 -11.138 -19.042 1.00 0.00 ? 4  TRP A CD1  6  
ATOM 5250  C CD2  . TRP A 1 4  ? -23.198 -12.843 -19.970 1.00 0.00 ? 4  TRP A CD2  6  
ATOM 5251  N NE1  . TRP A 1 4  ? -23.359 -10.640 -19.885 1.00 0.00 ? 4  TRP A NE1  6  
ATOM 5252  C CE2  . TRP A 1 4  ? -22.632 -11.651 -20.480 1.00 0.00 ? 4  TRP A CE2  6  
ATOM 5253  C CE3  . TRP A 1 4  ? -22.660 -14.069 -20.397 1.00 0.00 ? 4  TRP A CE3  6  
ATOM 5254  C CZ2  . TRP A 1 4  ? -21.570 -11.675 -21.385 1.00 0.00 ? 4  TRP A CZ2  6  
ATOM 5255  C CZ3  . TRP A 1 4  ? -21.591 -14.098 -21.310 1.00 0.00 ? 4  TRP A CZ3  6  
ATOM 5256  C CH2  . TRP A 1 4  ? -21.047 -12.903 -21.801 1.00 0.00 ? 4  TRP A CH2  6  
ATOM 5257  H H    . TRP A 1 4  ? -23.120 -15.005 -17.660 1.00 0.00 ? 4  TRP A H    6  
ATOM 5258  H HA   . TRP A 1 4  ? -24.458 -12.706 -16.379 1.00 0.00 ? 4  TRP A HA   6  
ATOM 5259  H HB2  . TRP A 1 4  ? -25.278 -14.335 -18.796 1.00 0.00 ? 4  TRP A HB2  6  
ATOM 5260  H HB3  . TRP A 1 4  ? -26.139 -12.935 -18.157 1.00 0.00 ? 4  TRP A HB3  6  
ATOM 5261  H HD1  . TRP A 1 4  ? -25.031 -10.546 -18.465 1.00 0.00 ? 4  TRP A HD1  6  
ATOM 5262  H HE1  . TRP A 1 4  ? -23.189 -9.690  -20.054 1.00 0.00 ? 4  TRP A HE1  6  
ATOM 5263  H HE3  . TRP A 1 4  ? -23.071 -14.994 -20.025 1.00 0.00 ? 4  TRP A HE3  6  
ATOM 5264  H HZ2  . TRP A 1 4  ? -21.155 -10.751 -21.761 1.00 0.00 ? 4  TRP A HZ2  6  
ATOM 5265  H HZ3  . TRP A 1 4  ? -21.185 -15.044 -21.631 1.00 0.00 ? 4  TRP A HZ3  6  
ATOM 5266  H HH2  . TRP A 1 4  ? -20.225 -12.930 -22.501 1.00 0.00 ? 4  TRP A HH2  6  
ATOM 5267  N N    . TYR A 1 5  ? -24.905 -15.558 -15.438 1.00 0.00 ? 5  TYR A N    6  
ATOM 5268  C CA   . TYR A 1 5  ? -25.694 -16.494 -14.647 1.00 0.00 ? 5  TYR A CA   6  
ATOM 5269  C C    . TYR A 1 5  ? -25.807 -16.024 -13.199 1.00 0.00 ? 5  TYR A C    6  
ATOM 5270  O O    . TYR A 1 5  ? -25.069 -15.143 -12.760 1.00 0.00 ? 5  TYR A O    6  
ATOM 5271  C CB   . TYR A 1 5  ? -25.049 -17.882 -14.697 1.00 0.00 ? 5  TYR A CB   6  
ATOM 5272  C CG   . TYR A 1 5  ? -23.749 -17.867 -13.929 1.00 0.00 ? 5  TYR A CG   6  
ATOM 5273  C CD1  . TYR A 1 5  ? -22.577 -17.411 -14.544 1.00 0.00 ? 5  TYR A CD1  6  
ATOM 5274  C CD2  . TYR A 1 5  ? -23.716 -18.308 -12.601 1.00 0.00 ? 5  TYR A CD2  6  
ATOM 5275  C CE1  . TYR A 1 5  ? -21.372 -17.395 -13.829 1.00 0.00 ? 5  TYR A CE1  6  
ATOM 5276  C CE2  . TYR A 1 5  ? -22.512 -18.291 -11.887 1.00 0.00 ? 5  TYR A CE2  6  
ATOM 5277  C CZ   . TYR A 1 5  ? -21.341 -17.835 -12.502 1.00 0.00 ? 5  TYR A CZ   6  
ATOM 5278  O OH   . TYR A 1 5  ? -20.153 -17.820 -11.797 1.00 0.00 ? 5  TYR A OH   6  
ATOM 5279  H H    . TYR A 1 5  ? -23.934 -15.676 -15.492 1.00 0.00 ? 5  TYR A H    6  
ATOM 5280  H HA   . TYR A 1 5  ? -26.685 -16.559 -15.071 1.00 0.00 ? 5  TYR A HA   6  
ATOM 5281  H HB2  . TYR A 1 5  ? -25.718 -18.606 -14.256 1.00 0.00 ? 5  TYR A HB2  6  
ATOM 5282  H HB3  . TYR A 1 5  ? -24.856 -18.152 -15.724 1.00 0.00 ? 5  TYR A HB3  6  
ATOM 5283  H HD1  . TYR A 1 5  ? -22.601 -17.072 -15.569 1.00 0.00 ? 5  TYR A HD1  6  
ATOM 5284  H HD2  . TYR A 1 5  ? -24.620 -18.659 -12.128 1.00 0.00 ? 5  TYR A HD2  6  
ATOM 5285  H HE1  . TYR A 1 5  ? -20.467 -17.042 -14.303 1.00 0.00 ? 5  TYR A HE1  6  
ATOM 5286  H HE2  . TYR A 1 5  ? -22.488 -18.630 -10.862 1.00 0.00 ? 5  TYR A HE2  6  
ATOM 5287  H HH   . TYR A 1 5  ? -19.433 -17.837 -12.431 1.00 0.00 ? 5  TYR A HH   6  
ATOM 5288  N N    . LEU A 1 6  ? -26.754 -16.609 -12.471 1.00 0.00 ? 6  LEU A N    6  
ATOM 5289  C CA   . LEU A 1 6  ? -26.983 -16.237 -11.079 1.00 0.00 ? 6  LEU A CA   6  
ATOM 5290  C C    . LEU A 1 6  ? -25.667 -16.183 -10.308 1.00 0.00 ? 6  LEU A C    6  
ATOM 5291  O O    . LEU A 1 6  ? -24.667 -16.765 -10.726 1.00 0.00 ? 6  LEU A O    6  
ATOM 5292  C CB   . LEU A 1 6  ? -27.919 -17.251 -10.414 1.00 0.00 ? 6  LEU A CB   6  
ATOM 5293  C CG   . LEU A 1 6  ? -29.256 -17.297 -11.164 1.00 0.00 ? 6  LEU A CG   6  
ATOM 5294  C CD1  . LEU A 1 6  ? -30.157 -18.356 -10.529 1.00 0.00 ? 6  LEU A CD1  6  
ATOM 5295  C CD2  . LEU A 1 6  ? -29.948 -15.932 -11.086 1.00 0.00 ? 6  LEU A CD2  6  
ATOM 5296  H H    . LEU A 1 6  ? -27.323 -17.288 -12.891 1.00 0.00 ? 6  LEU A H    6  
ATOM 5297  H HA   . LEU A 1 6  ? -27.443 -15.262 -11.048 1.00 0.00 ? 6  LEU A HA   6  
ATOM 5298  H HB2  . LEU A 1 6  ? -27.460 -18.228 -10.438 1.00 0.00 ? 6  LEU A HB2  6  
ATOM 5299  H HB3  . LEU A 1 6  ? -28.093 -16.962 -9.389  1.00 0.00 ? 6  LEU A HB3  6  
ATOM 5300  H HG   . LEU A 1 6  ? -29.076 -17.553 -12.199 1.00 0.00 ? 6  LEU A HG   6  
ATOM 5301  H HD11 . LEU A 1 6  ? -30.274 -19.185 -11.213 1.00 0.00 ? 6  LEU A HD11 6  
ATOM 5302  H HD12 . LEU A 1 6  ? -31.124 -17.925 -10.317 1.00 0.00 ? 6  LEU A HD12 6  
ATOM 5303  H HD13 . LEU A 1 6  ? -29.711 -18.707 -9.611  1.00 0.00 ? 6  LEU A HD13 6  
ATOM 5304  H HD21 . LEU A 1 6  ? -29.691 -15.448 -10.155 1.00 0.00 ? 6  LEU A HD21 6  
ATOM 5305  H HD22 . LEU A 1 6  ? -31.017 -16.067 -11.137 1.00 0.00 ? 6  LEU A HD22 6  
ATOM 5306  H HD23 . LEU A 1 6  ? -29.623 -15.317 -11.913 1.00 0.00 ? 6  LEU A HD23 6  
ATOM 5307  N N    . GLY A 1 7  ? -25.677 -15.476 -9.184  1.00 0.00 ? 7  GLY A N    6  
ATOM 5308  C CA   . GLY A 1 7  ? -24.479 -15.343 -8.363  1.00 0.00 ? 7  GLY A CA   6  
ATOM 5309  C C    . GLY A 1 7  ? -23.593 -14.208 -8.866  1.00 0.00 ? 7  GLY A C    6  
ATOM 5310  O O    . GLY A 1 7  ? -22.511 -13.969 -8.327  1.00 0.00 ? 7  GLY A O    6  
ATOM 5311  H H    . GLY A 1 7  ? -26.504 -15.033 -8.901  1.00 0.00 ? 7  GLY A H    6  
ATOM 5312  H HA2  . GLY A 1 7  ? -24.771 -15.143 -7.342  1.00 0.00 ? 7  GLY A HA2  6  
ATOM 5313  H HA3  . GLY A 1 7  ? -23.922 -16.268 -8.399  1.00 0.00 ? 7  GLY A HA3  6  
ATOM 5314  N N    . GLY A 1 8  ? -24.055 -13.511 -9.899  1.00 0.00 ? 8  GLY A N    6  
ATOM 5315  C CA   . GLY A 1 8  ? -23.291 -12.403 -10.459 1.00 0.00 ? 8  GLY A CA   6  
ATOM 5316  C C    . GLY A 1 8  ? -23.617 -11.097 -9.741  1.00 0.00 ? 8  GLY A C    6  
ATOM 5317  O O    . GLY A 1 8  ? -24.784 -10.765 -9.534  1.00 0.00 ? 8  GLY A O    6  
ATOM 5318  H H    . GLY A 1 8  ? -24.923 -13.748 -10.289 1.00 0.00 ? 8  GLY A H    6  
ATOM 5319  H HA2  . GLY A 1 8  ? -22.235 -12.612 -10.358 1.00 0.00 ? 8  GLY A HA2  6  
ATOM 5320  H HA3  . GLY A 1 8  ? -23.533 -12.299 -11.507 1.00 0.00 ? 8  GLY A HA3  6  
ATOM 5321  N N    . SER A 1 9  ? -22.574 -10.367 -9.356  1.00 0.00 ? 9  SER A N    6  
ATOM 5322  C CA   . SER A 1 9  ? -22.751 -9.101  -8.648  1.00 0.00 ? 9  SER A CA   6  
ATOM 5323  C C    . SER A 1 9  ? -22.452 -7.918  -9.579  1.00 0.00 ? 9  SER A C    6  
ATOM 5324  O O    . SER A 1 9  ? -21.637 -8.041  -10.493 1.00 0.00 ? 9  SER A O    6  
ATOM 5325  C CB   . SER A 1 9  ? -21.802 -9.063  -7.447  1.00 0.00 ? 9  SER A CB   6  
ATOM 5326  O OG   . SER A 1 9  ? -20.461 -9.165  -7.908  1.00 0.00 ? 9  SER A OG   6  
ATOM 5327  H H    . SER A 1 9  ? -21.667 -10.693 -9.538  1.00 0.00 ? 9  SER A H    6  
ATOM 5328  H HA   . SER A 1 9  ? -23.767 -9.040  -8.295  1.00 0.00 ? 9  SER A HA   6  
ATOM 5329  H HB2  . SER A 1 9  ? -21.920 -8.138  -6.914  1.00 0.00 ? 9  SER A HB2  6  
ATOM 5330  H HB3  . SER A 1 9  ? -22.028 -9.889  -6.785  1.00 0.00 ? 9  SER A HB3  6  
ATOM 5331  H HG   . SER A 1 9  ? -20.240 -10.098 -7.975  1.00 0.00 ? 9  SER A HG   6  
ATOM 5332  N N    . PRO A 1 10 ? -23.082 -6.780  -9.370  1.00 0.00 ? 10 PRO A N    6  
ATOM 5333  C CA   . PRO A 1 10 ? -22.850 -5.573  -10.220 1.00 0.00 ? 10 PRO A CA   6  
ATOM 5334  C C    . PRO A 1 10 ? -21.479 -4.947  -9.969  1.00 0.00 ? 10 PRO A C    6  
ATOM 5335  O O    . PRO A 1 10 ? -21.348 -4.007  -9.185  1.00 0.00 ? 10 PRO A O    6  
ATOM 5336  C CB   . PRO A 1 10 ? -23.973 -4.616  -9.814  1.00 0.00 ? 10 PRO A CB   6  
ATOM 5337  C CG   . PRO A 1 10 ? -24.335 -5.007  -8.423  1.00 0.00 ? 10 PRO A CG   6  
ATOM 5338  C CD   . PRO A 1 10 ? -24.084 -6.511  -8.317  1.00 0.00 ? 10 PRO A CD   6  
ATOM 5339  H HA   . PRO A 1 10 ? -22.955 -5.828  -11.262 1.00 0.00 ? 10 PRO A HA   6  
ATOM 5340  H HB2  . PRO A 1 10 ? -23.619 -3.595  -9.840  1.00 0.00 ? 10 PRO A HB2  6  
ATOM 5341  H HB3  . PRO A 1 10 ? -24.824 -4.738  -10.466 1.00 0.00 ? 10 PRO A HB3  6  
ATOM 5342  H HG2  . PRO A 1 10 ? -23.716 -4.473  -7.716  1.00 0.00 ? 10 PRO A HG2  6  
ATOM 5343  H HG3  . PRO A 1 10 ? -25.377 -4.800  -8.238  1.00 0.00 ? 10 PRO A HG3  6  
ATOM 5344  H HD2  . PRO A 1 10 ? -23.696 -6.756  -7.340  1.00 0.00 ? 10 PRO A HD2  6  
ATOM 5345  H HD3  . PRO A 1 10 ? -24.991 -7.060  -8.516  1.00 0.00 ? 10 PRO A HD3  6  
ATOM 5346  N N    . LYS A 1 11 ? -20.463 -5.478  -10.641 1.00 0.00 ? 11 LYS A N    6  
ATOM 5347  C CA   . LYS A 1 11 ? -19.105 -4.971  -10.488 1.00 0.00 ? 11 LYS A CA   6  
ATOM 5348  C C    . LYS A 1 11 ? -18.946 -3.629  -11.195 1.00 0.00 ? 11 LYS A C    6  
ATOM 5349  O O    . LYS A 1 11 ? -17.927 -2.956  -11.045 1.00 0.00 ? 11 LYS A O    6  
ATOM 5350  C CB   . LYS A 1 11 ? -18.104 -5.975  -11.064 1.00 0.00 ? 11 LYS A CB   6  
ATOM 5351  C CG   . LYS A 1 11 ? -18.099 -7.242  -10.208 1.00 0.00 ? 11 LYS A CG   6  
ATOM 5352  C CD   . LYS A 1 11 ? -17.090 -8.241  -10.779 1.00 0.00 ? 11 LYS A CD   6  
ATOM 5353  C CE   . LYS A 1 11 ? -17.047 -9.488  -9.892  1.00 0.00 ? 11 LYS A CE   6  
ATOM 5354  N NZ   . LYS A 1 11 ? -18.380 -10.153 -9.906  1.00 0.00 ? 11 LYS A NZ   6  
ATOM 5355  H H    . LYS A 1 11 ? -20.631 -6.226  -11.251 1.00 0.00 ? 11 LYS A H    6  
ATOM 5356  H HA   . LYS A 1 11 ? -18.897 -4.840  -9.437  1.00 0.00 ? 11 LYS A HA   6  
ATOM 5357  H HB2  . LYS A 1 11 ? -18.387 -6.225  -12.077 1.00 0.00 ? 11 LYS A HB2  6  
ATOM 5358  H HB3  . LYS A 1 11 ? -17.116 -5.539  -11.064 1.00 0.00 ? 11 LYS A HB3  6  
ATOM 5359  H HG2  . LYS A 1 11 ? -17.821 -6.990  -9.193  1.00 0.00 ? 11 LYS A HG2  6  
ATOM 5360  H HG3  . LYS A 1 11 ? -19.083 -7.685  -10.212 1.00 0.00 ? 11 LYS A HG3  6  
ATOM 5361  H HD2  . LYS A 1 11 ? -17.389 -8.520  -11.780 1.00 0.00 ? 11 LYS A HD2  6  
ATOM 5362  H HD3  . LYS A 1 11 ? -16.110 -7.789  -10.808 1.00 0.00 ? 11 LYS A HD3  6  
ATOM 5363  H HE2  . LYS A 1 11 ? -16.299 -10.171 -10.269 1.00 0.00 ? 11 LYS A HE2  6  
ATOM 5364  H HE3  . LYS A 1 11 ? -16.796 -9.202  -8.882  1.00 0.00 ? 11 LYS A HE3  6  
ATOM 5365  H HZ1  . LYS A 1 11 ? -19.013 -9.648  -10.556 1.00 0.00 ? 11 LYS A HZ1  6  
ATOM 5366  H HZ2  . LYS A 1 11 ? -18.782 -10.142 -8.946  1.00 0.00 ? 11 LYS A HZ2  6  
ATOM 5367  H HZ3  . LYS A 1 11 ? -18.272 -11.137 -10.226 1.00 0.00 ? 11 LYS A HZ3  6  
ATOM 5368  N N    . GLY A 1 12 ? -19.955 -3.249  -11.971 1.00 0.00 ? 12 GLY A N    6  
ATOM 5369  C CA   . GLY A 1 12 ? -19.909 -1.987  -12.702 1.00 0.00 ? 12 GLY A CA   6  
ATOM 5370  C C    . GLY A 1 12 ? -19.423 -2.207  -14.131 1.00 0.00 ? 12 GLY A C    6  
ATOM 5371  O O    . GLY A 1 12 ? -19.184 -1.251  -14.870 1.00 0.00 ? 12 GLY A O    6  
ATOM 5372  H H    . GLY A 1 12 ? -20.741 -3.829  -12.058 1.00 0.00 ? 12 GLY A H    6  
ATOM 5373  H HA2  . GLY A 1 12 ? -20.897 -1.553  -12.724 1.00 0.00 ? 12 GLY A HA2  6  
ATOM 5374  H HA3  . GLY A 1 12 ? -19.233 -1.311  -12.200 1.00 0.00 ? 12 GLY A HA3  6  
ATOM 5375  N N    . ASP A 1 13 ? -19.299 -3.471  -14.517 1.00 0.00 ? 13 ASP A N    6  
ATOM 5376  C CA   . ASP A 1 13 ? -18.862 -3.797  -15.869 1.00 0.00 ? 13 ASP A CA   6  
ATOM 5377  C C    . ASP A 1 13 ? -19.904 -3.312  -16.870 1.00 0.00 ? 13 ASP A C    6  
ATOM 5378  O O    . ASP A 1 13 ? -19.656 -2.394  -17.651 1.00 0.00 ? 13 ASP A O    6  
ATOM 5379  C CB   . ASP A 1 13 ? -18.671 -5.308  -16.012 1.00 0.00 ? 13 ASP A CB   6  
ATOM 5380  C CG   . ASP A 1 13 ? -17.415 -5.749  -15.267 1.00 0.00 ? 13 ASP A CG   6  
ATOM 5381  O OD1  . ASP A 1 13 ? -16.641 -4.886  -14.888 1.00 0.00 ? 13 ASP A OD1  6  
ATOM 5382  O OD2  . ASP A 1 13 ? -17.245 -6.944  -15.089 1.00 0.00 ? 13 ASP A OD2  6  
ATOM 5383  H H    . ASP A 1 13 ? -19.526 -4.182  -13.882 1.00 0.00 ? 13 ASP A H    6  
ATOM 5384  H HA   . ASP A 1 13 ? -17.923 -3.301  -16.067 1.00 0.00 ? 13 ASP A HA   6  
ATOM 5385  H HB2  . ASP A 1 13 ? -19.529 -5.817  -15.600 1.00 0.00 ? 13 ASP A HB2  6  
ATOM 5386  H HB3  . ASP A 1 13 ? -18.572 -5.559  -17.057 1.00 0.00 ? 13 ASP A HB3  6  
ATOM 5387  N N    . VAL A 1 14 ? -21.084 -3.921  -16.818 1.00 0.00 ? 14 VAL A N    6  
ATOM 5388  C CA   . VAL A 1 14 ? -22.181 -3.534  -17.697 1.00 0.00 ? 14 VAL A CA   6  
ATOM 5389  C C    . VAL A 1 14 ? -23.506 -3.647  -16.949 1.00 0.00 ? 14 VAL A C    6  
ATOM 5390  O O    . VAL A 1 14 ? -23.647 -4.489  -16.063 1.00 0.00 ? 14 VAL A O    6  
ATOM 5391  C CB   . VAL A 1 14 ? -22.205 -4.434  -18.935 1.00 0.00 ? 14 VAL A CB   6  
ATOM 5392  C CG1  . VAL A 1 14 ? -20.899 -4.269  -19.713 1.00 0.00 ? 14 VAL A CG1  6  
ATOM 5393  C CG2  . VAL A 1 14 ? -22.359 -5.894  -18.502 1.00 0.00 ? 14 VAL A CG2  6  
ATOM 5394  H H    . VAL A 1 14 ? -21.226 -4.634  -16.161 1.00 0.00 ? 14 VAL A H    6  
ATOM 5395  H HA   . VAL A 1 14 ? -22.038 -2.511  -18.009 1.00 0.00 ? 14 VAL A HA   6  
ATOM 5396  H HB   . VAL A 1 14 ? -23.035 -4.153  -19.567 1.00 0.00 ? 14 VAL A HB   6  
ATOM 5397  H HG11 . VAL A 1 14 ? -20.092 -4.733  -19.164 1.00 0.00 ? 14 VAL A HG11 6  
ATOM 5398  H HG12 . VAL A 1 14 ? -20.687 -3.220  -19.844 1.00 0.00 ? 14 VAL A HG12 6  
ATOM 5399  H HG13 . VAL A 1 14 ? -20.992 -4.741  -20.680 1.00 0.00 ? 14 VAL A HG13 6  
ATOM 5400  H HG21 . VAL A 1 14 ? -22.370 -5.950  -17.423 1.00 0.00 ? 14 VAL A HG21 6  
ATOM 5401  H HG22 . VAL A 1 14 ? -21.531 -6.473  -18.885 1.00 0.00 ? 14 VAL A HG22 6  
ATOM 5402  H HG23 . VAL A 1 14 ? -23.286 -6.288  -18.892 1.00 0.00 ? 14 VAL A HG23 6  
ATOM 5403  N N    . ASP A 1 15 ? -24.471 -2.797  -17.297 1.00 0.00 ? 15 ASP A N    6  
ATOM 5404  C CA   . ASP A 1 15 ? -25.772 -2.821  -16.634 1.00 0.00 ? 15 ASP A CA   6  
ATOM 5405  C C    . ASP A 1 15 ? -26.901 -2.856  -17.664 1.00 0.00 ? 15 ASP A C    6  
ATOM 5406  O O    . ASP A 1 15 ? -27.689 -1.915  -17.764 1.00 0.00 ? 15 ASP A O    6  
ATOM 5407  C CB   . ASP A 1 15 ? -25.923 -1.579  -15.754 1.00 0.00 ? 15 ASP A CB   6  
ATOM 5408  C CG   . ASP A 1 15 ? -25.758 -0.320  -16.597 1.00 0.00 ? 15 ASP A CG   6  
ATOM 5409  O OD1  . ASP A 1 15 ? -25.317 -0.440  -17.727 1.00 0.00 ? 15 ASP A OD1  6  
ATOM 5410  O OD2  . ASP A 1 15 ? -26.074 0.749   -16.099 1.00 0.00 ? 15 ASP A OD2  6  
ATOM 5411  H H    . ASP A 1 15 ? -24.308 -2.131  -17.996 1.00 0.00 ? 15 ASP A H    6  
ATOM 5412  H HA   . ASP A 1 15 ? -25.838 -3.696  -16.008 1.00 0.00 ? 15 ASP A HA   6  
ATOM 5413  H HB2  . ASP A 1 15 ? -26.902 -1.580  -15.297 1.00 0.00 ? 15 ASP A HB2  6  
ATOM 5414  H HB3  . ASP A 1 15 ? -25.169 -1.594  -14.981 1.00 0.00 ? 15 ASP A HB3  6  
ATOM 5415  N N    . PRO A 1 16 ? -26.986 -3.915  -18.427 1.00 0.00 ? 16 PRO A N    6  
ATOM 5416  C CA   . PRO A 1 16 ? -28.036 -4.075  -19.476 1.00 0.00 ? 16 PRO A CA   6  
ATOM 5417  C C    . PRO A 1 16 ? -29.408 -4.384  -18.884 1.00 0.00 ? 16 PRO A C    6  
ATOM 5418  O O    . PRO A 1 16 ? -30.406 -4.436  -19.604 1.00 0.00 ? 16 PRO A O    6  
ATOM 5419  C CB   . PRO A 1 16 ? -27.522 -5.242  -20.318 1.00 0.00 ? 16 PRO A CB   6  
ATOM 5420  C CG   . PRO A 1 16 ? -26.698 -6.060  -19.384 1.00 0.00 ? 16 PRO A CG   6  
ATOM 5421  C CD   . PRO A 1 16 ? -26.089 -5.084  -18.376 1.00 0.00 ? 16 PRO A CD   6  
ATOM 5422  H HA   . PRO A 1 16 ? -28.087 -3.190  -20.087 1.00 0.00 ? 16 PRO A HA   6  
ATOM 5423  H HB2  . PRO A 1 16 ? -28.352 -5.823  -20.699 1.00 0.00 ? 16 PRO A HB2  6  
ATOM 5424  H HB3  . PRO A 1 16 ? -26.911 -4.879  -21.129 1.00 0.00 ? 16 PRO A HB3  6  
ATOM 5425  H HG2  . PRO A 1 16 ? -27.323 -6.783  -18.876 1.00 0.00 ? 16 PRO A HG2  6  
ATOM 5426  H HG3  . PRO A 1 16 ? -25.911 -6.560  -19.925 1.00 0.00 ? 16 PRO A HG3  6  
ATOM 5427  H HD2  . PRO A 1 16 ? -26.086 -5.524  -17.389 1.00 0.00 ? 16 PRO A HD2  6  
ATOM 5428  H HD3  . PRO A 1 16 ? -25.092 -4.804  -18.672 1.00 0.00 ? 16 PRO A HD3  6  
ATOM 5429  N N    . PHE A 1 17 ? -29.450 -4.605  -17.574 1.00 0.00 ? 17 PHE A N    6  
ATOM 5430  C CA   . PHE A 1 17 ? -30.707 -4.926  -16.909 1.00 0.00 ? 17 PHE A CA   6  
ATOM 5431  C C    . PHE A 1 17 ? -31.724 -3.802  -17.085 1.00 0.00 ? 17 PHE A C    6  
ATOM 5432  O O    . PHE A 1 17 ? -32.910 -4.061  -17.293 1.00 0.00 ? 17 PHE A O    6  
ATOM 5433  C CB   . PHE A 1 17 ? -30.460 -5.165  -15.419 1.00 0.00 ? 17 PHE A CB   6  
ATOM 5434  C CG   . PHE A 1 17 ? -29.735 -6.476  -15.234 1.00 0.00 ? 17 PHE A CG   6  
ATOM 5435  C CD1  . PHE A 1 17 ? -30.462 -7.662  -15.079 1.00 0.00 ? 17 PHE A CD1  6  
ATOM 5436  C CD2  . PHE A 1 17 ? -28.335 -6.505  -15.216 1.00 0.00 ? 17 PHE A CD2  6  
ATOM 5437  C CE1  . PHE A 1 17 ? -29.789 -8.878  -14.906 1.00 0.00 ? 17 PHE A CE1  6  
ATOM 5438  C CE2  . PHE A 1 17 ? -27.663 -7.720  -15.045 1.00 0.00 ? 17 PHE A CE2  6  
ATOM 5439  C CZ   . PHE A 1 17 ? -28.390 -8.908  -14.889 1.00 0.00 ? 17 PHE A CZ   6  
ATOM 5440  H H    . PHE A 1 17 ? -28.623 -4.564  -17.051 1.00 0.00 ? 17 PHE A H    6  
ATOM 5441  H HA   . PHE A 1 17 ? -31.109 -5.831  -17.341 1.00 0.00 ? 17 PHE A HA   6  
ATOM 5442  H HB2  . PHE A 1 17 ? -29.859 -4.360  -15.020 1.00 0.00 ? 17 PHE A HB2  6  
ATOM 5443  H HB3  . PHE A 1 17 ? -31.405 -5.200  -14.897 1.00 0.00 ? 17 PHE A HB3  6  
ATOM 5444  H HD1  . PHE A 1 17 ? -31.541 -7.639  -15.091 1.00 0.00 ? 17 PHE A HD1  6  
ATOM 5445  H HD2  . PHE A 1 17 ? -27.775 -5.590  -15.336 1.00 0.00 ? 17 PHE A HD2  6  
ATOM 5446  H HE1  . PHE A 1 17 ? -30.351 -9.793  -14.786 1.00 0.00 ? 17 PHE A HE1  6  
ATOM 5447  H HE2  . PHE A 1 17 ? -26.583 -7.744  -15.032 1.00 0.00 ? 17 PHE A HE2  6  
ATOM 5448  H HZ   . PHE A 1 17 ? -27.870 -9.845  -14.757 1.00 0.00 ? 17 PHE A HZ   6  
ATOM 5449  N N    . TYR A 1 18 ? -31.268 -2.557  -16.991 1.00 0.00 ? 18 TYR A N    6  
ATOM 5450  C CA   . TYR A 1 18 ? -32.182 -1.428  -17.137 1.00 0.00 ? 18 TYR A CA   6  
ATOM 5451  C C    . TYR A 1 18 ? -32.837 -1.464  -18.513 1.00 0.00 ? 18 TYR A C    6  
ATOM 5452  O O    . TYR A 1 18 ? -34.048 -1.301  -18.638 1.00 0.00 ? 18 TYR A O    6  
ATOM 5453  C CB   . TYR A 1 18 ? -31.423 -0.110  -16.964 1.00 0.00 ? 18 TYR A CB   6  
ATOM 5454  C CG   . TYR A 1 18 ? -30.961 0.021   -15.533 1.00 0.00 ? 18 TYR A CG   6  
ATOM 5455  C CD1  . TYR A 1 18 ? -31.788 0.633   -14.585 1.00 0.00 ? 18 TYR A CD1  6  
ATOM 5456  C CD2  . TYR A 1 18 ? -29.706 -0.469  -15.157 1.00 0.00 ? 18 TYR A CD2  6  
ATOM 5457  C CE1  . TYR A 1 18 ? -31.358 0.756   -13.258 1.00 0.00 ? 18 TYR A CE1  6  
ATOM 5458  C CE2  . TYR A 1 18 ? -29.275 -0.347  -13.831 1.00 0.00 ? 18 TYR A CE2  6  
ATOM 5459  C CZ   . TYR A 1 18 ? -30.102 0.267   -12.881 1.00 0.00 ? 18 TYR A CZ   6  
ATOM 5460  O OH   . TYR A 1 18 ? -29.680 0.387   -11.573 1.00 0.00 ? 18 TYR A OH   6  
ATOM 5461  H H    . TYR A 1 18 ? -30.318 -2.405  -16.801 1.00 0.00 ? 18 TYR A H    6  
ATOM 5462  H HA   . TYR A 1 18 ? -32.947 -1.494  -16.380 1.00 0.00 ? 18 TYR A HA   6  
ATOM 5463  H HB2  . TYR A 1 18 ? -30.567 -0.100  -17.623 1.00 0.00 ? 18 TYR A HB2  6  
ATOM 5464  H HB3  . TYR A 1 18 ? -32.075 0.714   -17.208 1.00 0.00 ? 18 TYR A HB3  6  
ATOM 5465  H HD1  . TYR A 1 18 ? -32.757 1.011   -14.876 1.00 0.00 ? 18 TYR A HD1  6  
ATOM 5466  H HD2  . TYR A 1 18 ? -29.069 -0.941  -15.890 1.00 0.00 ? 18 TYR A HD2  6  
ATOM 5467  H HE1  . TYR A 1 18 ? -31.996 1.229   -12.526 1.00 0.00 ? 18 TYR A HE1  6  
ATOM 5468  H HE2  . TYR A 1 18 ? -28.306 -0.725  -13.540 1.00 0.00 ? 18 TYR A HE2  6  
ATOM 5469  H HH   . TYR A 1 18 ? -28.839 -0.069  -11.489 1.00 0.00 ? 18 TYR A HH   6  
ATOM 5470  N N    . TYR A 1 19 ? -32.036 -1.696  -19.543 1.00 0.00 ? 19 TYR A N    6  
ATOM 5471  C CA   . TYR A 1 19 ? -32.565 -1.777  -20.898 1.00 0.00 ? 19 TYR A CA   6  
ATOM 5472  C C    . TYR A 1 19 ? -33.552 -2.935  -21.003 1.00 0.00 ? 19 TYR A C    6  
ATOM 5473  O O    . TYR A 1 19 ? -34.644 -2.796  -21.554 1.00 0.00 ? 19 TYR A O    6  
ATOM 5474  C CB   . TYR A 1 19 ? -31.423 -1.972  -21.897 1.00 0.00 ? 19 TYR A CB   6  
ATOM 5475  C CG   . TYR A 1 19 ? -31.986 -2.083  -23.292 1.00 0.00 ? 19 TYR A CG   6  
ATOM 5476  C CD1  . TYR A 1 19 ? -32.441 -0.938  -23.956 1.00 0.00 ? 19 TYR A CD1  6  
ATOM 5477  C CD2  . TYR A 1 19 ? -32.052 -3.330  -23.924 1.00 0.00 ? 19 TYR A CD2  6  
ATOM 5478  C CE1  . TYR A 1 19 ? -32.962 -1.039  -25.252 1.00 0.00 ? 19 TYR A CE1  6  
ATOM 5479  C CE2  . TYR A 1 19 ? -32.573 -3.433  -25.220 1.00 0.00 ? 19 TYR A CE2  6  
ATOM 5480  C CZ   . TYR A 1 19 ? -33.028 -2.288  -25.882 1.00 0.00 ? 19 TYR A CZ   6  
ATOM 5481  O OH   . TYR A 1 19 ? -33.541 -2.388  -27.160 1.00 0.00 ? 19 TYR A OH   6  
ATOM 5482  H H    . TYR A 1 19 ? -31.074 -1.820  -19.397 1.00 0.00 ? 19 TYR A H    6  
ATOM 5483  H HA   . TYR A 1 19 ? -33.078 -0.855  -21.129 1.00 0.00 ? 19 TYR A HA   6  
ATOM 5484  H HB2  . TYR A 1 19 ? -30.751 -1.128  -21.844 1.00 0.00 ? 19 TYR A HB2  6  
ATOM 5485  H HB3  . TYR A 1 19 ? -30.883 -2.876  -21.653 1.00 0.00 ? 19 TYR A HB3  6  
ATOM 5486  H HD1  . TYR A 1 19 ? -32.390 0.025   -23.469 1.00 0.00 ? 19 TYR A HD1  6  
ATOM 5487  H HD2  . TYR A 1 19 ? -31.701 -4.214  -23.411 1.00 0.00 ? 19 TYR A HD2  6  
ATOM 5488  H HE1  . TYR A 1 19 ? -33.313 -0.155  -25.764 1.00 0.00 ? 19 TYR A HE1  6  
ATOM 5489  H HE2  . TYR A 1 19 ? -32.625 -4.395  -25.706 1.00 0.00 ? 19 TYR A HE2  6  
ATOM 5490  H HH   . TYR A 1 19 ? -33.158 -1.684  -27.690 1.00 0.00 ? 19 TYR A HH   6  
ATOM 5491  N N    . ASP A 1 20 ? -33.143 -4.082  -20.469 1.00 0.00 ? 20 ASP A N    6  
ATOM 5492  C CA   . ASP A 1 20 ? -33.973 -5.284  -20.496 1.00 0.00 ? 20 ASP A CA   6  
ATOM 5493  C C    . ASP A 1 20 ? -35.104 -5.206  -19.469 1.00 0.00 ? 20 ASP A C    6  
ATOM 5494  O O    . ASP A 1 20 ? -36.017 -6.032  -19.485 1.00 0.00 ? 20 ASP A O    6  
ATOM 5495  C CB   . ASP A 1 20 ? -33.112 -6.516  -20.210 1.00 0.00 ? 20 ASP A CB   6  
ATOM 5496  C CG   . ASP A 1 20 ? -32.191 -6.797  -21.392 1.00 0.00 ? 20 ASP A CG   6  
ATOM 5497  O OD1  . ASP A 1 20 ? -32.428 -6.234  -22.448 1.00 0.00 ? 20 ASP A OD1  6  
ATOM 5498  O OD2  . ASP A 1 20 ? -31.263 -7.571  -21.224 1.00 0.00 ? 20 ASP A OD2  6  
ATOM 5499  H H    . ASP A 1 20 ? -32.259 -4.114  -20.047 1.00 0.00 ? 20 ASP A H    6  
ATOM 5500  H HA   . ASP A 1 20 ? -34.403 -5.386  -21.480 1.00 0.00 ? 20 ASP A HA   6  
ATOM 5501  H HB2  . ASP A 1 20 ? -32.517 -6.341  -19.325 1.00 0.00 ? 20 ASP A HB2  6  
ATOM 5502  H HB3  . ASP A 1 20 ? -33.752 -7.370  -20.045 1.00 0.00 ? 20 ASP A HB3  6  
ATOM 5503  N N    . TYR A 1 21 ? -35.041 -4.222  -18.576 1.00 0.00 ? 21 TYR A N    6  
ATOM 5504  C CA   . TYR A 1 21 ? -36.074 -4.073  -17.553 1.00 0.00 ? 21 TYR A CA   6  
ATOM 5505  C C    . TYR A 1 21 ? -37.425 -3.779  -18.199 1.00 0.00 ? 21 TYR A C    6  
ATOM 5506  O O    . TYR A 1 21 ? -38.445 -4.331  -17.800 1.00 0.00 ? 21 TYR A O    6  
ATOM 5507  C CB   . TYR A 1 21 ? -35.713 -2.943  -16.588 1.00 0.00 ? 21 TYR A CB   6  
ATOM 5508  C CG   . TYR A 1 21 ? -36.772 -2.835  -15.517 1.00 0.00 ? 21 TYR A CG   6  
ATOM 5509  C CD1  . TYR A 1 21 ? -36.785 -3.741  -14.450 1.00 0.00 ? 21 TYR A CD1  6  
ATOM 5510  C CD2  . TYR A 1 21 ? -37.741 -1.826  -15.589 1.00 0.00 ? 21 TYR A CD2  6  
ATOM 5511  C CE1  . TYR A 1 21 ? -37.765 -3.639  -13.455 1.00 0.00 ? 21 TYR A CE1  6  
ATOM 5512  C CE2  . TYR A 1 21 ? -38.722 -1.724  -14.596 1.00 0.00 ? 21 TYR A CE2  6  
ATOM 5513  C CZ   . TYR A 1 21 ? -38.734 -2.630  -13.530 1.00 0.00 ? 21 TYR A CZ   6  
ATOM 5514  O OH   . TYR A 1 21 ? -39.701 -2.530  -12.549 1.00 0.00 ? 21 TYR A OH   6  
ATOM 5515  H H    . TYR A 1 21 ? -34.293 -3.589  -18.601 1.00 0.00 ? 21 TYR A H    6  
ATOM 5516  H HA   . TYR A 1 21 ? -36.149 -4.995  -16.997 1.00 0.00 ? 21 TYR A HA   6  
ATOM 5517  H HB2  . TYR A 1 21 ? -34.757 -3.150  -16.132 1.00 0.00 ? 21 TYR A HB2  6  
ATOM 5518  H HB3  . TYR A 1 21 ? -35.659 -2.012  -17.129 1.00 0.00 ? 21 TYR A HB3  6  
ATOM 5519  H HD1  . TYR A 1 21 ? -36.037 -4.519  -14.393 1.00 0.00 ? 21 TYR A HD1  6  
ATOM 5520  H HD2  . TYR A 1 21 ? -37.732 -1.127  -16.413 1.00 0.00 ? 21 TYR A HD2  6  
ATOM 5521  H HE1  . TYR A 1 21 ? -37.775 -4.338  -12.631 1.00 0.00 ? 21 TYR A HE1  6  
ATOM 5522  H HE2  . TYR A 1 21 ? -39.470 -0.946  -14.652 1.00 0.00 ? 21 TYR A HE2  6  
ATOM 5523  H HH   . TYR A 1 21 ? -39.851 -1.597  -12.376 1.00 0.00 ? 21 TYR A HH   6  
ATOM 5524  N N    . GLU A 1 22 ? -37.427 -2.886  -19.182 1.00 0.00 ? 22 GLU A N    6  
ATOM 5525  C CA   . GLU A 1 22 ? -38.667 -2.509  -19.851 1.00 0.00 ? 22 GLU A CA   6  
ATOM 5526  C C    . GLU A 1 22 ? -39.337 -3.729  -20.479 1.00 0.00 ? 22 GLU A C    6  
ATOM 5527  O O    . GLU A 1 22 ? -40.561 -3.852  -20.453 1.00 0.00 ? 22 GLU A O    6  
ATOM 5528  C CB   . GLU A 1 22 ? -38.377 -1.472  -20.939 1.00 0.00 ? 22 GLU A CB   6  
ATOM 5529  C CG   . GLU A 1 22 ? -37.934 -0.159  -20.291 1.00 0.00 ? 22 GLU A CG   6  
ATOM 5530  C CD   . GLU A 1 22 ? -39.106 0.487   -19.561 1.00 0.00 ? 22 GLU A CD   6  
ATOM 5531  O OE1  . GLU A 1 22 ? -40.232 0.101   -19.832 1.00 0.00 ? 22 GLU A OE1  6  
ATOM 5532  O OE2  . GLU A 1 22 ? -38.861 1.356   -18.741 1.00 0.00 ? 22 GLU A OE2  6  
ATOM 5533  H H    . GLU A 1 22 ? -36.587 -2.449  -19.434 1.00 0.00 ? 22 GLU A H    6  
ATOM 5534  H HA   . GLU A 1 22 ? -39.338 -2.075  -19.126 1.00 0.00 ? 22 GLU A HA   6  
ATOM 5535  H HB2  . GLU A 1 22 ? -37.594 -1.839  -21.585 1.00 0.00 ? 22 GLU A HB2  6  
ATOM 5536  H HB3  . GLU A 1 22 ? -39.272 -1.300  -21.518 1.00 0.00 ? 22 GLU A HB3  6  
ATOM 5537  H HG2  . GLU A 1 22 ? -37.138 -0.357  -19.587 1.00 0.00 ? 22 GLU A HG2  6  
ATOM 5538  H HG3  . GLU A 1 22 ? -37.575 0.514   -21.057 1.00 0.00 ? 22 GLU A HG3  6  
ATOM 5539  N N    . THR A 1 23 ? -38.538 -4.629  -21.041 1.00 0.00 ? 23 THR A N    6  
ATOM 5540  C CA   . THR A 1 23 ? -39.087 -5.828  -21.667 1.00 0.00 ? 23 THR A CA   6  
ATOM 5541  C C    . THR A 1 23 ? -39.752 -6.723  -20.622 1.00 0.00 ? 23 THR A C    6  
ATOM 5542  O O    . THR A 1 23 ? -40.649 -7.496  -20.939 1.00 0.00 ? 23 THR A O    6  
ATOM 5543  C CB   . THR A 1 23 ? -37.974 -6.605  -22.374 1.00 0.00 ? 23 THR A CB   6  
ATOM 5544  O OG1  . THR A 1 23 ? -36.986 -6.984  -21.426 1.00 0.00 ? 23 THR A OG1  6  
ATOM 5545  C CG2  . THR A 1 23 ? -37.339 -5.725  -23.452 1.00 0.00 ? 23 THR A CG2  6  
ATOM 5546  H H    . THR A 1 23 ? -37.569 -4.484  -21.041 1.00 0.00 ? 23 THR A H    6  
ATOM 5547  H HA   . THR A 1 23 ? -39.824 -5.534  -22.398 1.00 0.00 ? 23 THR A HA   6  
ATOM 5548  H HB   . THR A 1 23 ? -38.388 -7.488  -22.836 1.00 0.00 ? 23 THR A HB   6  
ATOM 5549  H HG1  . THR A 1 23 ? -36.139 -6.650  -21.731 1.00 0.00 ? 23 THR A HG1  6  
ATOM 5550  H HG21 . THR A 1 23 ? -37.666 -4.704  -23.320 1.00 0.00 ? 23 THR A HG21 6  
ATOM 5551  H HG22 . THR A 1 23 ? -37.640 -6.076  -24.428 1.00 0.00 ? 23 THR A HG22 6  
ATOM 5552  H HG23 . THR A 1 23 ? -36.263 -5.772  -23.367 1.00 0.00 ? 23 THR A HG23 6  
ATOM 5553  N N    . VAL A 1 24 ? -39.291 -6.621  -19.381 1.00 0.00 ? 24 VAL A N    6  
ATOM 5554  C CA   . VAL A 1 24 ? -39.820 -7.443  -18.291 1.00 0.00 ? 24 VAL A CA   6  
ATOM 5555  C C    . VAL A 1 24 ? -41.345 -7.520  -18.330 1.00 0.00 ? 24 VAL A C    6  
ATOM 5556  O O    . VAL A 1 24 ? -41.931 -8.465  -17.807 1.00 0.00 ? 24 VAL A O    6  
ATOM 5557  C CB   . VAL A 1 24 ? -39.380 -6.877  -16.939 1.00 0.00 ? 24 VAL A CB   6  
ATOM 5558  C CG1  . VAL A 1 24 ? -40.283 -5.702  -16.556 1.00 0.00 ? 24 VAL A CG1  6  
ATOM 5559  C CG2  . VAL A 1 24 ? -39.488 -7.968  -15.870 1.00 0.00 ? 24 VAL A CG2  6  
ATOM 5560  H H    . VAL A 1 24 ? -38.547 -6.011  -19.196 1.00 0.00 ? 24 VAL A H    6  
ATOM 5561  H HA   . VAL A 1 24 ? -39.422 -8.442  -18.388 1.00 0.00 ? 24 VAL A HA   6  
ATOM 5562  H HB   . VAL A 1 24 ? -38.356 -6.538  -17.007 1.00 0.00 ? 24 VAL A HB   6  
ATOM 5563  H HG11 . VAL A 1 24 ? -39.736 -5.021  -15.919 1.00 0.00 ? 24 VAL A HG11 6  
ATOM 5564  H HG12 . VAL A 1 24 ? -41.149 -6.072  -16.027 1.00 0.00 ? 24 VAL A HG12 6  
ATOM 5565  H HG13 . VAL A 1 24 ? -40.599 -5.184  -17.449 1.00 0.00 ? 24 VAL A HG13 6  
ATOM 5566  H HG21 . VAL A 1 24 ? -38.612 -8.599  -15.911 1.00 0.00 ? 24 VAL A HG21 6  
ATOM 5567  H HG22 . VAL A 1 24 ? -40.369 -8.565  -16.051 1.00 0.00 ? 24 VAL A HG22 6  
ATOM 5568  H HG23 . VAL A 1 24 ? -39.556 -7.511  -14.895 1.00 0.00 ? 24 VAL A HG23 6  
ATOM 5569  N N    . ARG A 1 25 ? -41.990 -6.543  -18.949 1.00 0.00 ? 25 ARG A N    6  
ATOM 5570  C CA   . ARG A 1 25 ? -43.448 -6.579  -19.036 1.00 0.00 ? 25 ARG A CA   6  
ATOM 5571  C C    . ARG A 1 25 ? -43.889 -7.645  -20.042 1.00 0.00 ? 25 ARG A C    6  
ATOM 5572  O O    . ARG A 1 25 ? -44.672 -8.539  -19.723 1.00 0.00 ? 25 ARG A O    6  
ATOM 5573  C CB   . ARG A 1 25 ? -43.980 -5.218  -19.484 1.00 0.00 ? 25 ARG A CB   6  
ATOM 5574  C CG   . ARG A 1 25 ? -43.639 -4.159  -18.437 1.00 0.00 ? 25 ARG A CG   6  
ATOM 5575  C CD   . ARG A 1 25 ? -43.966 -2.777  -19.000 1.00 0.00 ? 25 ARG A CD   6  
ATOM 5576  N NE   . ARG A 1 25 ? -43.111 -2.490  -20.146 1.00 0.00 ? 25 ARG A NE   6  
ATOM 5577  C CZ   . ARG A 1 25 ? -43.270 -1.380  -20.859 1.00 0.00 ? 25 ARG A CZ   6  
ATOM 5578  N NH1  . ARG A 1 25 ? -44.209 -0.531  -20.543 1.00 0.00 ? 25 ARG A NH1  6  
ATOM 5579  N NH2  . ARG A 1 25 ? -42.487 -1.139  -21.875 1.00 0.00 ? 25 ARG A NH2  6  
ATOM 5580  H H    . ARG A 1 25 ? -41.475 -5.833  -19.386 1.00 0.00 ? 25 ARG A H    6  
ATOM 5581  H HA   . ARG A 1 25 ? -43.855 -6.816  -18.065 1.00 0.00 ? 25 ARG A HA   6  
ATOM 5582  H HB2  . ARG A 1 25 ? -43.529 -4.949  -20.428 1.00 0.00 ? 25 ARG A HB2  6  
ATOM 5583  H HB3  . ARG A 1 25 ? -45.052 -5.272  -19.600 1.00 0.00 ? 25 ARG A HB3  6  
ATOM 5584  H HG2  . ARG A 1 25 ? -44.222 -4.334  -17.544 1.00 0.00 ? 25 ARG A HG2  6  
ATOM 5585  H HG3  . ARG A 1 25 ? -42.587 -4.209  -18.200 1.00 0.00 ? 25 ARG A HG3  6  
ATOM 5586  H HD2  . ARG A 1 25 ? -45.000 -2.752  -19.312 1.00 0.00 ? 25 ARG A HD2  6  
ATOM 5587  H HD3  . ARG A 1 25 ? -43.806 -2.032  -18.234 1.00 0.00 ? 25 ARG A HD3  6  
ATOM 5588  H HE   . ARG A 1 25 ? -42.406 -3.124  -20.393 1.00 0.00 ? 25 ARG A HE   6  
ATOM 5589  H HH11 . ARG A 1 25 ? -44.808 -0.717  -19.764 1.00 0.00 ? 25 ARG A HH11 6  
ATOM 5590  H HH12 . ARG A 1 25 ? -44.328 0.305   -21.078 1.00 0.00 ? 25 ARG A HH12 6  
ATOM 5591  H HH21 . ARG A 1 25 ? -41.767 -1.790  -22.118 1.00 0.00 ? 25 ARG A HH21 6  
ATOM 5592  H HH22 . ARG A 1 25 ? -42.606 -0.303  -22.412 1.00 0.00 ? 25 ARG A HH22 6  
ATOM 5593  N N    . ASN A 1 26 ? -43.373 -7.527  -21.263 1.00 0.00 ? 26 ASN A N    6  
ATOM 5594  C CA   . ASN A 1 26 ? -43.700 -8.460  -22.342 1.00 0.00 ? 26 ASN A CA   6  
ATOM 5595  C C    . ASN A 1 26 ? -42.690 -9.605  -22.438 1.00 0.00 ? 26 ASN A C    6  
ATOM 5596  O O    . ASN A 1 26 ? -42.820 -10.479 -23.297 1.00 0.00 ? 26 ASN A O    6  
ATOM 5597  C CB   . ASN A 1 26 ? -43.746 -7.714  -23.678 1.00 0.00 ? 26 ASN A CB   6  
ATOM 5598  C CG   . ASN A 1 26 ? -44.964 -6.796  -23.719 1.00 0.00 ? 26 ASN A CG   6  
ATOM 5599  O OD1  . ASN A 1 26 ? -45.918 -6.993  -22.967 1.00 0.00 ? 26 ASN A OD1  6  
ATOM 5600  N ND2  . ASN A 1 26 ? -44.988 -5.798  -24.562 1.00 0.00 ? 26 ASN A ND2  6  
ATOM 5601  H H    . ASN A 1 26 ? -42.768 -6.777  -21.444 1.00 0.00 ? 26 ASN A H    6  
ATOM 5602  H HA   . ASN A 1 26 ? -44.677 -8.878  -22.151 1.00 0.00 ? 26 ASN A HA   6  
ATOM 5603  H HB2  . ASN A 1 26 ? -42.849 -7.124  -23.790 1.00 0.00 ? 26 ASN A HB2  6  
ATOM 5604  H HB3  . ASN A 1 26 ? -43.811 -8.427  -24.485 1.00 0.00 ? 26 ASN A HB3  6  
ATOM 5605  H HD21 . ASN A 1 26 ? -44.228 -5.645  -25.160 1.00 0.00 ? 26 ASN A HD21 6  
ATOM 5606  H HD22 . ASN A 1 26 ? -45.767 -5.205  -24.596 1.00 0.00 ? 26 ASN A HD22 6  
ATOM 5607  N N    . GLY A 1 27 ? -41.674 -9.586  -21.584 1.00 0.00 ? 27 GLY A N    6  
ATOM 5608  C CA   . GLY A 1 27 ? -40.643 -10.621 -21.623 1.00 0.00 ? 27 GLY A CA   6  
ATOM 5609  C C    . GLY A 1 27 ? -41.206 -12.018 -21.367 1.00 0.00 ? 27 GLY A C    6  
ATOM 5610  O O    . GLY A 1 27 ? -40.829 -12.974 -22.044 1.00 0.00 ? 27 GLY A O    6  
ATOM 5611  H H    . GLY A 1 27 ? -41.607 -8.869  -20.921 1.00 0.00 ? 27 GLY A H    6  
ATOM 5612  H HA2  . GLY A 1 27 ? -40.173 -10.607 -22.596 1.00 0.00 ? 27 GLY A HA2  6  
ATOM 5613  H HA3  . GLY A 1 27 ? -39.899 -10.400 -20.872 1.00 0.00 ? 27 GLY A HA3  6  
ATOM 5614  N N    . GLY A 1 28 ? -42.091 -12.139 -20.385 1.00 0.00 ? 28 GLY A N    6  
ATOM 5615  C CA   . GLY A 1 28 ? -42.668 -13.441 -20.057 1.00 0.00 ? 28 GLY A CA   6  
ATOM 5616  C C    . GLY A 1 28 ? -43.459 -14.022 -21.226 1.00 0.00 ? 28 GLY A C    6  
ATOM 5617  O O    . GLY A 1 28 ? -43.365 -15.214 -21.519 1.00 0.00 ? 28 GLY A O    6  
ATOM 5618  H H    . GLY A 1 28 ? -42.351 -11.352 -19.862 1.00 0.00 ? 28 GLY A H    6  
ATOM 5619  H HA2  . GLY A 1 28 ? -41.871 -14.123 -19.797 1.00 0.00 ? 28 GLY A HA2  6  
ATOM 5620  H HA3  . GLY A 1 28 ? -43.327 -13.330 -19.209 1.00 0.00 ? 28 GLY A HA3  6  
ATOM 5621  N N    . LEU A 1 29 ? -44.259 -13.183 -21.870 1.00 0.00 ? 29 LEU A N    6  
ATOM 5622  C CA   . LEU A 1 29 ? -45.084 -13.644 -22.983 1.00 0.00 ? 29 LEU A CA   6  
ATOM 5623  C C    . LEU A 1 29 ? -44.212 -14.218 -24.098 1.00 0.00 ? 29 LEU A C    6  
ATOM 5624  O O    . LEU A 1 29 ? -44.483 -15.305 -24.609 1.00 0.00 ? 29 LEU A O    6  
ATOM 5625  C CB   . LEU A 1 29 ? -45.923 -12.476 -23.518 1.00 0.00 ? 29 LEU A CB   6  
ATOM 5626  C CG   . LEU A 1 29 ? -46.793 -12.932 -24.697 1.00 0.00 ? 29 LEU A CG   6  
ATOM 5627  C CD1  . LEU A 1 29 ? -47.744 -14.042 -24.241 1.00 0.00 ? 29 LEU A CD1  6  
ATOM 5628  C CD2  . LEU A 1 29 ? -47.615 -11.744 -25.203 1.00 0.00 ? 29 LEU A CD2  6  
ATOM 5629  H H    . LEU A 1 29 ? -44.315 -12.254 -21.560 1.00 0.00 ? 29 LEU A H    6  
ATOM 5630  H HA   . LEU A 1 29 ? -45.748 -14.417 -22.626 1.00 0.00 ? 29 LEU A HA   6  
ATOM 5631  H HB2  . LEU A 1 29 ? -46.560 -12.105 -22.728 1.00 0.00 ? 29 LEU A HB2  6  
ATOM 5632  H HB3  . LEU A 1 29 ? -45.264 -11.687 -23.847 1.00 0.00 ? 29 LEU A HB3  6  
ATOM 5633  H HG   . LEU A 1 29 ? -46.166 -13.300 -25.496 1.00 0.00 ? 29 LEU A HG   6  
ATOM 5634  H HD11 . LEU A 1 29 ? -47.255 -14.998 -24.343 1.00 0.00 ? 29 LEU A HD11 6  
ATOM 5635  H HD12 . LEU A 1 29 ? -48.633 -14.026 -24.854 1.00 0.00 ? 29 LEU A HD12 6  
ATOM 5636  H HD13 . LEU A 1 29 ? -48.015 -13.883 -23.209 1.00 0.00 ? 29 LEU A HD13 6  
ATOM 5637  H HD21 . LEU A 1 29 ? -47.469 -11.632 -26.267 1.00 0.00 ? 29 LEU A HD21 6  
ATOM 5638  H HD22 . LEU A 1 29 ? -47.294 -10.845 -24.699 1.00 0.00 ? 29 LEU A HD22 6  
ATOM 5639  H HD23 . LEU A 1 29 ? -48.661 -11.918 -24.998 1.00 0.00 ? 29 LEU A HD23 6  
ATOM 5640  N N    . ILE A 1 30 ? -43.173 -13.484 -24.480 1.00 0.00 ? 30 ILE A N    6  
ATOM 5641  C CA   . ILE A 1 30 ? -42.282 -13.934 -25.546 1.00 0.00 ? 30 ILE A CA   6  
ATOM 5642  C C    . ILE A 1 30 ? -41.589 -15.246 -25.181 1.00 0.00 ? 30 ILE A C    6  
ATOM 5643  O O    . ILE A 1 30 ? -41.500 -16.166 -26.001 1.00 0.00 ? 30 ILE A O    6  
ATOM 5644  C CB   . ILE A 1 30 ? -41.226 -12.862 -25.818 1.00 0.00 ? 30 ILE A CB   6  
ATOM 5645  C CG1  . ILE A 1 30 ? -41.896 -11.635 -26.443 1.00 0.00 ? 30 ILE A CG1  6  
ATOM 5646  C CG2  . ILE A 1 30 ? -40.174 -13.413 -26.782 1.00 0.00 ? 30 ILE A CG2  6  
ATOM 5647  C CD1  . ILE A 1 30 ? -40.913 -10.462 -26.448 1.00 0.00 ? 30 ILE A CD1  6  
ATOM 5648  H H    . ILE A 1 30 ? -43.014 -12.611 -24.064 1.00 0.00 ? 30 ILE A H    6  
ATOM 5649  H HA   . ILE A 1 30 ? -42.861 -14.083 -26.444 1.00 0.00 ? 30 ILE A HA   6  
ATOM 5650  H HB   . ILE A 1 30 ? -40.752 -12.582 -24.889 1.00 0.00 ? 30 ILE A HB   6  
ATOM 5651  H HG12 . ILE A 1 30 ? -42.191 -11.863 -27.456 1.00 0.00 ? 30 ILE A HG12 6  
ATOM 5652  H HG13 . ILE A 1 30 ? -42.768 -11.368 -25.866 1.00 0.00 ? 30 ILE A HG13 6  
ATOM 5653  H HG21 . ILE A 1 30 ? -39.338 -13.800 -26.217 1.00 0.00 ? 30 ILE A HG21 6  
ATOM 5654  H HG22 . ILE A 1 30 ? -39.833 -12.623 -27.434 1.00 0.00 ? 30 ILE A HG22 6  
ATOM 5655  H HG23 . ILE A 1 30 ? -40.607 -14.206 -27.371 1.00 0.00 ? 30 ILE A HG23 6  
ATOM 5656  H HD11 . ILE A 1 30 ? -40.798 -10.085 -25.444 1.00 0.00 ? 30 ILE A HD11 6  
ATOM 5657  H HD12 . ILE A 1 30 ? -41.292 -9.678  -27.087 1.00 0.00 ? 30 ILE A HD12 6  
ATOM 5658  H HD13 . ILE A 1 30 ? -39.955 -10.797 -26.818 1.00 0.00 ? 30 ILE A HD13 6  
ATOM 5659  N N    . PHE A 1 31 ? -41.100 -15.332 -23.949 1.00 0.00 ? 31 PHE A N    6  
ATOM 5660  C CA   . PHE A 1 31 ? -40.415 -16.533 -23.488 1.00 0.00 ? 31 PHE A CA   6  
ATOM 5661  C C    . PHE A 1 31 ? -41.337 -17.746 -23.539 1.00 0.00 ? 31 PHE A C    6  
ATOM 5662  O O    . PHE A 1 31 ? -40.941 -18.819 -23.996 1.00 0.00 ? 31 PHE A O    6  
ATOM 5663  C CB   . PHE A 1 31 ? -39.920 -16.332 -22.055 1.00 0.00 ? 31 PHE A CB   6  
ATOM 5664  C CG   . PHE A 1 31 ? -39.250 -17.596 -21.572 1.00 0.00 ? 31 PHE A CG   6  
ATOM 5665  C CD1  . PHE A 1 31 ? -37.941 -17.890 -21.972 1.00 0.00 ? 31 PHE A CD1  6  
ATOM 5666  C CD2  . PHE A 1 31 ? -39.937 -18.473 -20.725 1.00 0.00 ? 31 PHE A CD2  6  
ATOM 5667  C CE1  . PHE A 1 31 ? -37.319 -19.063 -21.525 1.00 0.00 ? 31 PHE A CE1  6  
ATOM 5668  C CE2  . PHE A 1 31 ? -39.315 -19.646 -20.279 1.00 0.00 ? 31 PHE A CE2  6  
ATOM 5669  C CZ   . PHE A 1 31 ? -38.006 -19.940 -20.679 1.00 0.00 ? 31 PHE A CZ   6  
ATOM 5670  H H    . PHE A 1 31 ? -41.204 -14.585 -23.323 1.00 0.00 ? 31 PHE A H    6  
ATOM 5671  H HA   . PHE A 1 31 ? -39.564 -16.716 -24.125 1.00 0.00 ? 31 PHE A HA   6  
ATOM 5672  H HB2  . PHE A 1 31 ? -39.211 -15.516 -22.030 1.00 0.00 ? 31 PHE A HB2  6  
ATOM 5673  H HB3  . PHE A 1 31 ? -40.756 -16.101 -21.412 1.00 0.00 ? 31 PHE A HB3  6  
ATOM 5674  H HD1  . PHE A 1 31 ? -37.410 -17.214 -22.625 1.00 0.00 ? 31 PHE A HD1  6  
ATOM 5675  H HD2  . PHE A 1 31 ? -40.947 -18.246 -20.418 1.00 0.00 ? 31 PHE A HD2  6  
ATOM 5676  H HE1  . PHE A 1 31 ? -36.310 -19.290 -21.834 1.00 0.00 ? 31 PHE A HE1  6  
ATOM 5677  H HE2  . PHE A 1 31 ? -39.846 -20.323 -19.626 1.00 0.00 ? 31 PHE A HE2  6  
ATOM 5678  H HZ   . PHE A 1 31 ? -37.527 -20.845 -20.334 1.00 0.00 ? 31 PHE A HZ   6  
ATOM 5679  N N    . ALA A 1 32 ? -42.557 -17.582 -23.038 1.00 0.00 ? 32 ALA A N    6  
ATOM 5680  C CA   . ALA A 1 32 ? -43.508 -18.687 -22.998 1.00 0.00 ? 32 ALA A CA   6  
ATOM 5681  C C    . ALA A 1 32 ? -43.783 -19.239 -24.395 1.00 0.00 ? 32 ALA A C    6  
ATOM 5682  O O    . ALA A 1 32 ? -43.863 -20.454 -24.573 1.00 0.00 ? 32 ALA A O    6  
ATOM 5683  C CB   . ALA A 1 32 ? -44.821 -18.218 -22.370 1.00 0.00 ? 32 ALA A CB   6  
ATOM 5684  H H    . ALA A 1 32 ? -42.811 -16.717 -22.656 1.00 0.00 ? 32 ALA A H    6  
ATOM 5685  H HA   . ALA A 1 32 ? -43.098 -19.476 -22.388 1.00 0.00 ? 32 ALA A HA   6  
ATOM 5686  H HB1  . ALA A 1 32 ? -45.650 -18.568 -22.966 1.00 0.00 ? 32 ALA A HB1  6  
ATOM 5687  H HB2  . ALA A 1 32 ? -44.835 -17.138 -22.331 1.00 0.00 ? 32 ALA A HB2  6  
ATOM 5688  H HB3  . ALA A 1 32 ? -44.902 -18.616 -21.369 1.00 0.00 ? 32 ALA A HB3  6  
ATOM 5689  N N    . GLY A 1 33 ? -43.934 -18.364 -25.385 1.00 0.00 ? 33 GLY A N    6  
ATOM 5690  C CA   . GLY A 1 33 ? -44.202 -18.824 -26.743 1.00 0.00 ? 33 GLY A CA   6  
ATOM 5691  C C    . GLY A 1 33 ? -43.067 -19.704 -27.256 1.00 0.00 ? 33 GLY A C    6  
ATOM 5692  O O    . GLY A 1 33 ? -43.304 -20.735 -27.889 1.00 0.00 ? 33 GLY A O    6  
ATOM 5693  H H    . GLY A 1 33 ? -43.877 -17.400 -25.216 1.00 0.00 ? 33 GLY A H    6  
ATOM 5694  H HA2  . GLY A 1 33 ? -45.123 -19.392 -26.749 1.00 0.00 ? 33 GLY A HA2  6  
ATOM 5695  H HA3  . GLY A 1 33 ? -44.307 -17.970 -27.394 1.00 0.00 ? 33 GLY A HA3  6  
ATOM 5696  N N    . LEU A 1 34 ? -41.833 -19.307 -26.959 1.00 0.00 ? 34 LEU A N    6  
ATOM 5697  C CA   . LEU A 1 34 ? -40.673 -20.088 -27.378 1.00 0.00 ? 34 LEU A CA   6  
ATOM 5698  C C    . LEU A 1 34 ? -40.645 -21.425 -26.639 1.00 0.00 ? 34 LEU A C    6  
ATOM 5699  O O    . LEU A 1 34 ? -40.283 -22.459 -27.204 1.00 0.00 ? 34 LEU A O    6  
ATOM 5700  C CB   . LEU A 1 34 ? -39.383 -19.315 -27.086 1.00 0.00 ? 34 LEU A CB   6  
ATOM 5701  C CG   . LEU A 1 34 ? -39.292 -18.094 -28.009 1.00 0.00 ? 34 LEU A CG   6  
ATOM 5702  C CD1  . LEU A 1 34 ? -38.106 -17.226 -27.586 1.00 0.00 ? 34 LEU A CD1  6  
ATOM 5703  C CD2  . LEU A 1 34 ? -39.099 -18.539 -29.466 1.00 0.00 ? 34 LEU A CD2  6  
ATOM 5704  H H    . LEU A 1 34 ? -41.701 -18.494 -26.421 1.00 0.00 ? 34 LEU A H    6  
ATOM 5705  H HA   . LEU A 1 34 ? -40.739 -20.275 -28.439 1.00 0.00 ? 34 LEU A HA   6  
ATOM 5706  H HB2  . LEU A 1 34 ? -39.392 -18.984 -26.058 1.00 0.00 ? 34 LEU A HB2  6  
ATOM 5707  H HB3  . LEU A 1 34 ? -38.531 -19.957 -27.248 1.00 0.00 ? 34 LEU A HB3  6  
ATOM 5708  H HG   . LEU A 1 34 ? -40.202 -17.517 -27.927 1.00 0.00 ? 34 LEU A HG   6  
ATOM 5709  H HD11 . LEU A 1 34 ? -37.957 -16.440 -28.312 1.00 0.00 ? 34 LEU A HD11 6  
ATOM 5710  H HD12 . LEU A 1 34 ? -37.217 -17.835 -27.527 1.00 0.00 ? 34 LEU A HD12 6  
ATOM 5711  H HD13 . LEU A 1 34 ? -38.308 -16.789 -26.619 1.00 0.00 ? 34 LEU A HD13 6  
ATOM 5712  H HD21 . LEU A 1 34 ? -38.490 -17.813 -29.985 1.00 0.00 ? 34 LEU A HD21 6  
ATOM 5713  H HD22 . LEU A 1 34 ? -40.061 -18.613 -29.950 1.00 0.00 ? 34 LEU A HD22 6  
ATOM 5714  H HD23 . LEU A 1 34 ? -38.610 -19.502 -29.495 1.00 0.00 ? 34 LEU A HD23 6  
ATOM 5715  N N    . ALA A 1 35 ? -41.029 -21.382 -25.368 1.00 0.00 ? 35 ALA A N    6  
ATOM 5716  C CA   . ALA A 1 35 ? -41.041 -22.588 -24.548 1.00 0.00 ? 35 ALA A CA   6  
ATOM 5717  C C    . ALA A 1 35 ? -41.989 -23.625 -25.150 1.00 0.00 ? 35 ALA A C    6  
ATOM 5718  O O    . ALA A 1 35 ? -41.644 -24.796 -25.258 1.00 0.00 ? 35 ALA A O    6  
ATOM 5719  C CB   . ALA A 1 35 ? -41.484 -22.251 -23.123 1.00 0.00 ? 35 ALA A CB   6  
ATOM 5720  H H    . ALA A 1 35 ? -41.303 -20.513 -25.007 1.00 0.00 ? 35 ALA A H    6  
ATOM 5721  H HA   . ALA A 1 35 ? -40.044 -23.001 -24.516 1.00 0.00 ? 35 ALA A HA   6  
ATOM 5722  H HB1  . ALA A 1 35 ? -41.559 -23.160 -22.544 1.00 0.00 ? 35 ALA A HB1  6  
ATOM 5723  H HB2  . ALA A 1 35 ? -42.446 -21.763 -23.150 1.00 0.00 ? 35 ALA A HB2  6  
ATOM 5724  H HB3  . ALA A 1 35 ? -40.758 -21.594 -22.666 1.00 0.00 ? 35 ALA A HB3  6  
ATOM 5725  N N    . PHE A 1 36 ? -43.191 -23.183 -25.501 1.00 0.00 ? 36 PHE A N    6  
ATOM 5726  C CA   . PHE A 1 36 ? -44.211 -24.076 -26.059 1.00 0.00 ? 36 PHE A CA   6  
ATOM 5727  C C    . PHE A 1 36 ? -43.743 -24.755 -27.352 1.00 0.00 ? 36 PHE A C    6  
ATOM 5728  O O    . PHE A 1 36 ? -43.919 -25.967 -27.528 1.00 0.00 ? 36 PHE A O    6  
ATOM 5729  C CB   . PHE A 1 36 ? -45.490 -23.288 -26.339 1.00 0.00 ? 36 PHE A CB   6  
ATOM 5730  C CG   . PHE A 1 36 ? -46.518 -24.204 -26.956 1.00 0.00 ? 36 PHE A CG   6  
ATOM 5731  C CD1  . PHE A 1 36 ? -47.243 -25.088 -26.147 1.00 0.00 ? 36 PHE A CD1  6  
ATOM 5732  C CD2  . PHE A 1 36 ? -46.747 -24.173 -28.337 1.00 0.00 ? 36 PHE A CD2  6  
ATOM 5733  C CE1  . PHE A 1 36 ? -48.196 -25.940 -26.718 1.00 0.00 ? 36 PHE A CE1  6  
ATOM 5734  C CE2  . PHE A 1 36 ? -47.700 -25.024 -28.909 1.00 0.00 ? 36 PHE A CE2  6  
ATOM 5735  C CZ   . PHE A 1 36 ? -48.425 -25.907 -28.099 1.00 0.00 ? 36 PHE A CZ   6  
ATOM 5736  H H    . PHE A 1 36 ? -43.417 -22.248 -25.312 1.00 0.00 ? 36 PHE A H    6  
ATOM 5737  H HA   . PHE A 1 36 ? -44.434 -24.840 -25.330 1.00 0.00 ? 36 PHE A HA   6  
ATOM 5738  H HB2  . PHE A 1 36 ? -45.875 -22.886 -25.413 1.00 0.00 ? 36 PHE A HB2  6  
ATOM 5739  H HB3  . PHE A 1 36 ? -45.274 -22.479 -27.021 1.00 0.00 ? 36 PHE A HB3  6  
ATOM 5740  H HD1  . PHE A 1 36 ? -47.067 -25.113 -25.082 1.00 0.00 ? 36 PHE A HD1  6  
ATOM 5741  H HD2  . PHE A 1 36 ? -46.188 -23.492 -28.961 1.00 0.00 ? 36 PHE A HD2  6  
ATOM 5742  H HE1  . PHE A 1 36 ? -48.755 -26.621 -26.094 1.00 0.00 ? 36 PHE A HE1  6  
ATOM 5743  H HE2  . PHE A 1 36 ? -47.877 -24.999 -29.973 1.00 0.00 ? 36 PHE A HE2  6  
ATOM 5744  H HZ   . PHE A 1 36 ? -49.160 -26.564 -28.540 1.00 0.00 ? 36 PHE A HZ   6  
ATOM 5745  N N    . ILE A 1 37 ? -43.171 -23.979 -28.266 1.00 0.00 ? 37 ILE A N    6  
ATOM 5746  C CA   . ILE A 1 37 ? -42.722 -24.532 -29.544 1.00 0.00 ? 37 ILE A CA   6  
ATOM 5747  C C    . ILE A 1 37 ? -41.719 -25.661 -29.321 1.00 0.00 ? 37 ILE A C    6  
ATOM 5748  O O    . ILE A 1 37 ? -41.792 -26.704 -29.969 1.00 0.00 ? 37 ILE A O    6  
ATOM 5749  C CB   . ILE A 1 37 ? -42.071 -23.426 -30.384 1.00 0.00 ? 37 ILE A CB   6  
ATOM 5750  C CG1  . ILE A 1 37 ? -43.137 -22.433 -30.871 1.00 0.00 ? 37 ILE A CG1  6  
ATOM 5751  C CG2  . ILE A 1 37 ? -41.365 -24.048 -31.591 1.00 0.00 ? 37 ILE A CG2  6  
ATOM 5752  C CD1  . ILE A 1 37 ? -43.798 -22.939 -32.162 1.00 0.00 ? 37 ILE A CD1  6  
ATOM 5753  H H    . ILE A 1 37 ? -43.073 -23.017 -28.094 1.00 0.00 ? 37 ILE A H    6  
ATOM 5754  H HA   . ILE A 1 37 ? -43.575 -24.924 -30.072 1.00 0.00 ? 37 ILE A HA   6  
ATOM 5755  H HB   . ILE A 1 37 ? -41.344 -22.904 -29.778 1.00 0.00 ? 37 ILE A HB   6  
ATOM 5756  H HG12 . ILE A 1 37 ? -43.891 -22.317 -30.107 1.00 0.00 ? 37 ILE A HG12 6  
ATOM 5757  H HG13 . ILE A 1 37 ? -42.671 -21.477 -31.061 1.00 0.00 ? 37 ILE A HG13 6  
ATOM 5758  H HG21 . ILE A 1 37 ? -41.974 -24.841 -31.996 1.00 0.00 ? 37 ILE A HG21 6  
ATOM 5759  H HG22 . ILE A 1 37 ? -40.410 -24.448 -31.283 1.00 0.00 ? 37 ILE A HG22 6  
ATOM 5760  H HG23 . ILE A 1 37 ? -41.211 -23.290 -32.346 1.00 0.00 ? 37 ILE A HG23 6  
ATOM 5761  H HD11 . ILE A 1 37 ? -43.183 -22.668 -33.008 1.00 0.00 ? 37 ILE A HD11 6  
ATOM 5762  H HD12 . ILE A 1 37 ? -44.771 -22.484 -32.266 1.00 0.00 ? 37 ILE A HD12 6  
ATOM 5763  H HD13 . ILE A 1 37 ? -43.906 -24.011 -32.127 1.00 0.00 ? 37 ILE A HD13 6  
ATOM 5764  N N    . VAL A 1 38 ? -40.777 -25.442 -28.414 1.00 0.00 ? 38 VAL A N    6  
ATOM 5765  C CA   . VAL A 1 38 ? -39.759 -26.449 -28.133 1.00 0.00 ? 38 VAL A CA   6  
ATOM 5766  C C    . VAL A 1 38 ? -40.406 -27.768 -27.709 1.00 0.00 ? 38 VAL A C    6  
ATOM 5767  O O    . VAL A 1 38 ? -39.950 -28.844 -28.097 1.00 0.00 ? 38 VAL A O    6  
ATOM 5768  C CB   . VAL A 1 38 ? -38.828 -25.956 -27.024 1.00 0.00 ? 38 VAL A CB   6  
ATOM 5769  C CG1  . VAL A 1 38 ? -37.913 -27.099 -26.579 1.00 0.00 ? 38 VAL A CG1  6  
ATOM 5770  C CG2  . VAL A 1 38 ? -37.976 -24.798 -27.548 1.00 0.00 ? 38 VAL A CG2  6  
ATOM 5771  H H    . VAL A 1 38 ? -40.756 -24.577 -27.951 1.00 0.00 ? 38 VAL A H    6  
ATOM 5772  H HA   . VAL A 1 38 ? -39.174 -26.616 -29.027 1.00 0.00 ? 38 VAL A HA   6  
ATOM 5773  H HB   . VAL A 1 38 ? -39.419 -25.620 -26.183 1.00 0.00 ? 38 VAL A HB   6  
ATOM 5774  H HG11 . VAL A 1 38 ? -38.445 -27.741 -25.894 1.00 0.00 ? 38 VAL A HG11 6  
ATOM 5775  H HG12 . VAL A 1 38 ? -37.042 -26.691 -26.087 1.00 0.00 ? 38 VAL A HG12 6  
ATOM 5776  H HG13 . VAL A 1 38 ? -37.606 -27.669 -27.443 1.00 0.00 ? 38 VAL A HG13 6  
ATOM 5777  H HG21 . VAL A 1 38 ? -38.520 -24.273 -28.320 1.00 0.00 ? 38 VAL A HG21 6  
ATOM 5778  H HG22 . VAL A 1 38 ? -37.054 -25.186 -27.956 1.00 0.00 ? 38 VAL A HG22 6  
ATOM 5779  H HG23 . VAL A 1 38 ? -37.755 -24.119 -26.739 1.00 0.00 ? 38 VAL A HG23 6  
ATOM 5780  N N    . GLY A 1 39 ? -41.462 -27.677 -26.911 1.00 0.00 ? 39 GLY A N    6  
ATOM 5781  C CA   . GLY A 1 39 ? -42.169 -28.862 -26.430 1.00 0.00 ? 39 GLY A CA   6  
ATOM 5782  C C    . GLY A 1 39 ? -42.739 -29.677 -27.588 1.00 0.00 ? 39 GLY A C    6  
ATOM 5783  O O    . GLY A 1 39 ? -42.759 -30.906 -27.543 1.00 0.00 ? 39 GLY A O    6  
ATOM 5784  H H    . GLY A 1 39 ? -41.776 -26.801 -26.633 1.00 0.00 ? 39 GLY A H    6  
ATOM 5785  H HA2  . GLY A 1 39 ? -41.482 -29.478 -25.869 1.00 0.00 ? 39 GLY A HA2  6  
ATOM 5786  H HA3  . GLY A 1 39 ? -42.978 -28.553 -25.787 1.00 0.00 ? 39 GLY A HA3  6  
ATOM 5787  N N    . LEU A 1 40 ? -43.212 -28.992 -28.622 1.00 0.00 ? 40 LEU A N    6  
ATOM 5788  C CA   . LEU A 1 40 ? -43.784 -29.699 -29.768 1.00 0.00 ? 40 LEU A CA   6  
ATOM 5789  C C    . LEU A 1 40 ? -42.738 -30.638 -30.376 1.00 0.00 ? 40 LEU A C    6  
ATOM 5790  O O    . LEU A 1 40 ? -43.018 -31.807 -30.650 1.00 0.00 ? 40 LEU A O    6  
ATOM 5791  C CB   . LEU A 1 40 ? -44.259 -28.686 -30.820 1.00 0.00 ? 40 LEU A CB   6  
ATOM 5792  C CG   . LEU A 1 40 ? -44.847 -29.413 -32.038 1.00 0.00 ? 40 LEU A CG   6  
ATOM 5793  C CD1  . LEU A 1 40 ? -46.046 -30.259 -31.605 1.00 0.00 ? 40 LEU A CD1  6  
ATOM 5794  C CD2  . LEU A 1 40 ? -45.308 -28.378 -33.067 1.00 0.00 ? 40 LEU A CD2  6  
ATOM 5795  H H    . LEU A 1 40 ? -43.176 -28.010 -28.607 1.00 0.00 ? 40 LEU A H    6  
ATOM 5796  H HA   . LEU A 1 40 ? -44.627 -30.282 -29.433 1.00 0.00 ? 40 LEU A HA   6  
ATOM 5797  H HB2  . LEU A 1 40 ? -45.015 -28.047 -30.385 1.00 0.00 ? 40 LEU A HB2  6  
ATOM 5798  H HB3  . LEU A 1 40 ? -43.421 -28.083 -31.137 1.00 0.00 ? 40 LEU A HB3  6  
ATOM 5799  H HG   . LEU A 1 40 ? -44.097 -30.051 -32.480 1.00 0.00 ? 40 LEU A HG   6  
ATOM 5800  H HD11 . LEU A 1 40 ? -45.704 -31.234 -31.291 1.00 0.00 ? 40 LEU A HD11 6  
ATOM 5801  H HD12 . LEU A 1 40 ? -46.727 -30.369 -32.436 1.00 0.00 ? 40 LEU A HD12 6  
ATOM 5802  H HD13 . LEU A 1 40 ? -46.553 -29.773 -30.785 1.00 0.00 ? 40 LEU A HD13 6  
ATOM 5803  H HD21 . LEU A 1 40 ? -45.269 -27.392 -32.629 1.00 0.00 ? 40 LEU A HD21 6  
ATOM 5804  H HD22 . LEU A 1 40 ? -46.321 -28.598 -33.371 1.00 0.00 ? 40 LEU A HD22 6  
ATOM 5805  H HD23 . LEU A 1 40 ? -44.658 -28.415 -33.930 1.00 0.00 ? 40 LEU A HD23 6  
ATOM 5806  N N    . LEU A 1 41 ? -41.539 -30.110 -30.599 1.00 0.00 ? 41 LEU A N    6  
ATOM 5807  C CA   . LEU A 1 41 ? -40.457 -30.893 -31.197 1.00 0.00 ? 41 LEU A CA   6  
ATOM 5808  C C    . LEU A 1 41 ? -40.173 -32.160 -30.391 1.00 0.00 ? 41 LEU A C    6  
ATOM 5809  O O    . LEU A 1 41 ? -39.793 -33.181 -30.957 1.00 0.00 ? 41 LEU A O    6  
ATOM 5810  C CB   . LEU A 1 41 ? -39.184 -30.048 -31.281 1.00 0.00 ? 41 LEU A CB   6  
ATOM 5811  C CG   . LEU A 1 41 ? -39.208 -29.203 -32.557 1.00 0.00 ? 41 LEU A CG   6  
ATOM 5812  C CD1  . LEU A 1 41 ? -40.438 -28.297 -32.552 1.00 0.00 ? 41 LEU A CD1  6  
ATOM 5813  C CD2  . LEU A 1 41 ? -37.944 -28.344 -32.621 1.00 0.00 ? 41 LEU A CD2  6  
ATOM 5814  H H    . LEU A 1 41 ? -41.394 -29.168 -30.401 1.00 0.00 ? 41 LEU A H    6  
ATOM 5815  H HA   . LEU A 1 41 ? -40.749 -31.177 -32.197 1.00 0.00 ? 41 LEU A HA   6  
ATOM 5816  H HB2  . LEU A 1 41 ? -39.127 -29.398 -30.419 1.00 0.00 ? 41 LEU A HB2  6  
ATOM 5817  H HB3  . LEU A 1 41 ? -38.322 -30.699 -31.298 1.00 0.00 ? 41 LEU A HB3  6  
ATOM 5818  H HG   . LEU A 1 41 ? -39.246 -29.856 -33.419 1.00 0.00 ? 41 LEU A HG   6  
ATOM 5819  H HD11 . LEU A 1 41 ? -40.485 -27.760 -31.617 1.00 0.00 ? 41 LEU A HD11 6  
ATOM 5820  H HD12 . LEU A 1 41 ? -41.328 -28.895 -32.671 1.00 0.00 ? 41 LEU A HD12 6  
ATOM 5821  H HD13 . LEU A 1 41 ? -40.369 -27.590 -33.367 1.00 0.00 ? 41 LEU A HD13 6  
ATOM 5822  H HD21 . LEU A 1 41 ? -38.004 -27.560 -31.881 1.00 0.00 ? 41 LEU A HD21 6  
ATOM 5823  H HD22 . LEU A 1 41 ? -37.856 -27.904 -33.605 1.00 0.00 ? 41 LEU A HD22 6  
ATOM 5824  H HD23 . LEU A 1 41 ? -37.077 -28.958 -32.425 1.00 0.00 ? 41 LEU A HD23 6  
ATOM 5825  N N    . ILE A 1 42 ? -40.346 -32.086 -29.075 1.00 0.00 ? 42 ILE A N    6  
ATOM 5826  C CA   . ILE A 1 42 ? -40.091 -33.247 -28.217 1.00 0.00 ? 42 ILE A CA   6  
ATOM 5827  C C    . ILE A 1 42 ? -41.010 -34.410 -28.603 1.00 0.00 ? 42 ILE A C    6  
ATOM 5828  O O    . ILE A 1 42 ? -40.572 -35.561 -28.687 1.00 0.00 ? 42 ILE A O    6  
ATOM 5829  C CB   . ILE A 1 42 ? -40.311 -32.885 -26.743 1.00 0.00 ? 42 ILE A CB   6  
ATOM 5830  C CG1  . ILE A 1 42 ? -39.215 -31.924 -26.262 1.00 0.00 ? 42 ILE A CG1  6  
ATOM 5831  C CG2  . ILE A 1 42 ? -40.270 -34.159 -25.897 1.00 0.00 ? 42 ILE A CG2  6  
ATOM 5832  C CD1  . ILE A 1 42 ? -37.969 -32.703 -25.816 1.00 0.00 ? 42 ILE A CD1  6  
ATOM 5833  H H    . ILE A 1 42 ? -40.643 -31.241 -28.690 1.00 0.00 ? 42 ILE A H    6  
ATOM 5834  H HA   . ILE A 1 42 ? -39.068 -33.558 -28.357 1.00 0.00 ? 42 ILE A HA   6  
ATOM 5835  H HB   . ILE A 1 42 ? -41.276 -32.420 -26.629 1.00 0.00 ? 42 ILE A HB   6  
ATOM 5836  H HG12 . ILE A 1 42 ? -38.949 -31.256 -27.069 1.00 0.00 ? 42 ILE A HG12 6  
ATOM 5837  H HG13 . ILE A 1 42 ? -39.589 -31.345 -25.430 1.00 0.00 ? 42 ILE A HG13 6  
ATOM 5838  H HG21 . ILE A 1 42 ? -41.213 -34.678 -25.979 1.00 0.00 ? 42 ILE A HG21 6  
ATOM 5839  H HG22 . ILE A 1 42 ? -40.091 -33.899 -24.864 1.00 0.00 ? 42 ILE A HG22 6  
ATOM 5840  H HG23 . ILE A 1 42 ? -39.475 -34.800 -26.249 1.00 0.00 ? 42 ILE A HG23 6  
ATOM 5841  H HD11 . ILE A 1 42 ? -37.108 -32.053 -25.856 1.00 0.00 ? 42 ILE A HD11 6  
ATOM 5842  H HD12 . ILE A 1 42 ? -37.809 -33.548 -26.465 1.00 0.00 ? 42 ILE A HD12 6  
ATOM 5843  H HD13 . ILE A 1 42 ? -38.108 -33.049 -24.804 1.00 0.00 ? 42 ILE A HD13 6  
ATOM 5844  N N    . LEU A 1 43 ? -42.284 -34.115 -28.837 1.00 0.00 ? 43 LEU A N    6  
ATOM 5845  C CA   . LEU A 1 43 ? -43.228 -35.167 -29.205 1.00 0.00 ? 43 LEU A CA   6  
ATOM 5846  C C    . LEU A 1 43 ? -42.745 -35.896 -30.455 1.00 0.00 ? 43 LEU A C    6  
ATOM 5847  O O    . LEU A 1 43 ? -42.845 -37.123 -30.548 1.00 0.00 ? 43 LEU A O    6  
ATOM 5848  C CB   . LEU A 1 43 ? -44.617 -34.567 -29.462 1.00 0.00 ? 43 LEU A CB   6  
ATOM 5849  C CG   . LEU A 1 43 ? -45.393 -34.436 -28.143 1.00 0.00 ? 43 LEU A CG   6  
ATOM 5850  C CD1  . LEU A 1 43 ? -45.773 -35.824 -27.611 1.00 0.00 ? 43 LEU A CD1  6  
ATOM 5851  C CD2  . LEU A 1 43 ? -44.528 -33.716 -27.105 1.00 0.00 ? 43 LEU A CD2  6  
ATOM 5852  H H    . LEU A 1 43 ? -42.594 -33.194 -28.753 1.00 0.00 ? 43 LEU A H    6  
ATOM 5853  H HA   . LEU A 1 43 ? -43.295 -35.874 -28.395 1.00 0.00 ? 43 LEU A HA   6  
ATOM 5854  H HB2  . LEU A 1 43 ? -44.504 -33.588 -29.905 1.00 0.00 ? 43 LEU A HB2  6  
ATOM 5855  H HB3  . LEU A 1 43 ? -45.165 -35.203 -30.141 1.00 0.00 ? 43 LEU A HB3  6  
ATOM 5856  H HG   . LEU A 1 43 ? -46.294 -33.865 -28.316 1.00 0.00 ? 43 LEU A HG   6  
ATOM 5857  H HD11 . LEU A 1 43 ? -45.520 -36.580 -28.341 1.00 0.00 ? 43 LEU A HD11 6  
ATOM 5858  H HD12 . LEU A 1 43 ? -46.834 -35.855 -27.417 1.00 0.00 ? 43 LEU A HD12 6  
ATOM 5859  H HD13 . LEU A 1 43 ? -45.235 -36.016 -26.695 1.00 0.00 ? 43 LEU A HD13 6  
ATOM 5860  H HD21 . LEU A 1 43 ? -43.848 -34.421 -26.649 1.00 0.00 ? 43 LEU A HD21 6  
ATOM 5861  H HD22 . LEU A 1 43 ? -45.163 -33.285 -26.344 1.00 0.00 ? 43 LEU A HD22 6  
ATOM 5862  H HD23 . LEU A 1 43 ? -43.963 -32.932 -27.588 1.00 0.00 ? 43 LEU A HD23 6  
ATOM 5863  N N    . LEU A 1 44 ? -42.221 -35.142 -31.415 1.00 0.00 ? 44 LEU A N    6  
ATOM 5864  C CA   . LEU A 1 44 ? -41.727 -35.739 -32.652 1.00 0.00 ? 44 LEU A CA   6  
ATOM 5865  C C    . LEU A 1 44 ? -40.591 -36.721 -32.372 1.00 0.00 ? 44 LEU A C    6  
ATOM 5866  O O    . LEU A 1 44 ? -40.408 -37.688 -33.110 1.00 0.00 ? 44 LEU A O    6  
ATOM 5867  C CB   . LEU A 1 44 ? -41.236 -34.651 -33.608 1.00 0.00 ? 44 LEU A CB   6  
ATOM 5868  C CG   . LEU A 1 44 ? -42.418 -34.092 -34.400 1.00 0.00 ? 44 LEU A CG   6  
ATOM 5869  C CD1  . LEU A 1 44 ? -43.486 -33.580 -33.432 1.00 0.00 ? 44 LEU A CD1  6  
ATOM 5870  C CD2  . LEU A 1 44 ? -41.941 -32.940 -35.286 1.00 0.00 ? 44 LEU A CD2  6  
ATOM 5871  H H    . LEU A 1 44 ? -42.171 -34.174 -31.302 1.00 0.00 ? 44 LEU A H    6  
ATOM 5872  H HA   . LEU A 1 44 ? -42.536 -36.273 -33.125 1.00 0.00 ? 44 LEU A HA   6  
ATOM 5873  H HB2  . LEU A 1 44 ? -40.775 -33.855 -33.040 1.00 0.00 ? 44 LEU A HB2  6  
ATOM 5874  H HB3  . LEU A 1 44 ? -40.513 -35.072 -34.291 1.00 0.00 ? 44 LEU A HB3  6  
ATOM 5875  H HG   . LEU A 1 44 ? -42.839 -34.875 -35.017 1.00 0.00 ? 44 LEU A HG   6  
ATOM 5876  H HD11 . LEU A 1 44 ? -44.126 -34.399 -33.138 1.00 0.00 ? 44 LEU A HD11 6  
ATOM 5877  H HD12 . LEU A 1 44 ? -44.076 -32.817 -33.917 1.00 0.00 ? 44 LEU A HD12 6  
ATOM 5878  H HD13 . LEU A 1 44 ? -43.007 -33.166 -32.558 1.00 0.00 ? 44 LEU A HD13 6  
ATOM 5879  H HD21 . LEU A 1 44 ? -40.888 -33.060 -35.496 1.00 0.00 ? 44 LEU A HD21 6  
ATOM 5880  H HD22 . LEU A 1 44 ? -42.101 -32.003 -34.776 1.00 0.00 ? 44 LEU A HD22 6  
ATOM 5881  H HD23 . LEU A 1 44 ? -42.494 -32.945 -36.213 1.00 0.00 ? 44 LEU A HD23 6  
ATOM 5882  N N    . SER A 1 45 ? -39.824 -36.468 -31.313 1.00 0.00 ? 45 SER A N    6  
ATOM 5883  C CA   . SER A 1 45 ? -38.706 -37.340 -30.968 1.00 0.00 ? 45 SER A CA   6  
ATOM 5884  C C    . SER A 1 45 ? -39.204 -38.754 -30.714 1.00 0.00 ? 45 SER A C    6  
ATOM 5885  O O    . SER A 1 45 ? -38.584 -39.726 -31.147 1.00 0.00 ? 45 SER A O    6  
ATOM 5886  C CB   . SER A 1 45 ? -37.979 -36.825 -29.723 1.00 0.00 ? 45 SER A CB   6  
ATOM 5887  O OG   . SER A 1 45 ? -36.879 -37.678 -29.439 1.00 0.00 ? 45 SER A OG   6  
ATOM 5888  H H    . SER A 1 45 ? -40.010 -35.683 -30.765 1.00 0.00 ? 45 SER A H    6  
ATOM 5889  H HA   . SER A 1 45 ? -38.008 -37.356 -31.791 1.00 0.00 ? 45 SER A HA   6  
ATOM 5890  H HB2  . SER A 1 45 ? -37.619 -35.826 -29.898 1.00 0.00 ? 45 SER A HB2  6  
ATOM 5891  H HB3  . SER A 1 45 ? -38.661 -36.821 -28.887 1.00 0.00 ? 45 SER A HB3  6  
ATOM 5892  H HG   . SER A 1 45 ? -37.222 -38.557 -29.258 1.00 0.00 ? 45 SER A HG   6  
ATOM 5893  N N    . ARG A 1 46 ? -40.334 -38.867 -30.023 1.00 0.00 ? 46 ARG A N    6  
ATOM 5894  C CA   . ARG A 1 46 ? -40.899 -40.184 -29.744 1.00 0.00 ? 46 ARG A CA   6  
ATOM 5895  C C    . ARG A 1 46 ? -41.267 -40.895 -31.046 1.00 0.00 ? 46 ARG A C    6  
ATOM 5896  O O    . ARG A 1 46 ? -41.078 -42.105 -31.176 1.00 0.00 ? 46 ARG A O    6  
ATOM 5897  C CB   . ARG A 1 46 ? -42.144 -40.077 -28.856 1.00 0.00 ? 46 ARG A CB   6  
ATOM 5898  C CG   . ARG A 1 46 ? -42.677 -41.488 -28.560 1.00 0.00 ? 46 ARG A CG   6  
ATOM 5899  C CD   . ARG A 1 46 ? -43.859 -41.415 -27.595 1.00 0.00 ? 46 ARG A CD   6  
ATOM 5900  N NE   . ARG A 1 46 ? -44.364 -42.759 -27.321 1.00 0.00 ? 46 ARG A NE   6  
ATOM 5901  C CZ   . ARG A 1 46 ? -45.231 -43.347 -28.140 1.00 0.00 ? 46 ARG A CZ   6  
ATOM 5902  N NH1  . ARG A 1 46 ? -45.642 -42.724 -29.211 1.00 0.00 ? 46 ARG A NH1  6  
ATOM 5903  N NH2  . ARG A 1 46 ? -45.671 -44.546 -27.873 1.00 0.00 ? 46 ARG A NH2  6  
ATOM 5904  H H    . ARG A 1 46 ? -40.795 -38.059 -29.719 1.00 0.00 ? 46 ARG A H    6  
ATOM 5905  H HA   . ARG A 1 46 ? -40.156 -40.775 -29.227 1.00 0.00 ? 46 ARG A HA   6  
ATOM 5906  H HB2  . ARG A 1 46 ? -41.885 -39.584 -27.930 1.00 0.00 ? 46 ARG A HB2  6  
ATOM 5907  H HB3  . ARG A 1 46 ? -42.905 -39.506 -29.368 1.00 0.00 ? 46 ARG A HB3  6  
ATOM 5908  H HG2  . ARG A 1 46 ? -43.000 -41.954 -29.478 1.00 0.00 ? 46 ARG A HG2  6  
ATOM 5909  H HG3  . ARG A 1 46 ? -41.891 -42.080 -28.115 1.00 0.00 ? 46 ARG A HG3  6  
ATOM 5910  H HD2  . ARG A 1 46 ? -43.540 -40.958 -26.669 1.00 0.00 ? 46 ARG A HD2  6  
ATOM 5911  H HD3  . ARG A 1 46 ? -44.645 -40.817 -28.036 1.00 0.00 ? 46 ARG A HD3  6  
ATOM 5912  H HE   . ARG A 1 46 ? -44.061 -43.234 -26.519 1.00 0.00 ? 46 ARG A HE   6  
ATOM 5913  H HH11 . ARG A 1 46 ? -45.307 -41.805 -29.416 1.00 0.00 ? 46 ARG A HH11 6  
ATOM 5914  H HH12 . ARG A 1 46 ? -46.295 -43.167 -29.829 1.00 0.00 ? 46 ARG A HH12 6  
ATOM 5915  H HH21 . ARG A 1 46 ? -45.357 -45.022 -27.052 1.00 0.00 ? 46 ARG A HH21 6  
ATOM 5916  H HH22 . ARG A 1 46 ? -46.322 -44.988 -28.489 1.00 0.00 ? 46 ARG A HH22 6  
ATOM 5917  N N    . ARG A 1 47 ? -41.813 -40.144 -31.999 1.00 0.00 ? 47 ARG A N    6  
ATOM 5918  C CA   . ARG A 1 47 ? -42.229 -40.725 -33.276 1.00 0.00 ? 47 ARG A CA   6  
ATOM 5919  C C    . ARG A 1 47 ? -41.064 -41.434 -33.973 1.00 0.00 ? 47 ARG A C    6  
ATOM 5920  O O    . ARG A 1 47 ? -41.269 -42.411 -34.688 1.00 0.00 ? 47 ARG A O    6  
ATOM 5921  C CB   . ARG A 1 47 ? -42.776 -39.625 -34.197 1.00 0.00 ? 47 ARG A CB   6  
ATOM 5922  C CG   . ARG A 1 47 ? -44.075 -40.085 -34.882 1.00 0.00 ? 47 ARG A CG   6  
ATOM 5923  C CD   . ARG A 1 47 ? -43.774 -41.214 -35.872 1.00 0.00 ? 47 ARG A CD   6  
ATOM 5924  N NE   . ARG A 1 47 ? -44.961 -41.527 -36.665 1.00 0.00 ? 47 ARG A NE   6  
ATOM 5925  C CZ   . ARG A 1 47 ? -45.889 -42.363 -36.212 1.00 0.00 ? 47 ARG A CZ   6  
ATOM 5926  N NH1  . ARG A 1 47 ? -45.751 -42.922 -35.041 1.00 0.00 ? 47 ARG A NH1  6  
ATOM 5927  N NH2  . ARG A 1 47 ? -46.939 -42.628 -36.940 1.00 0.00 ? 47 ARG A NH2  6  
ATOM 5928  H H    . ARG A 1 47 ? -41.954 -39.192 -31.841 1.00 0.00 ? 47 ARG A H    6  
ATOM 5929  H HA   . ARG A 1 47 ? -43.009 -41.445 -33.090 1.00 0.00 ? 47 ARG A HA   6  
ATOM 5930  H HB2  . ARG A 1 47 ? -42.977 -38.739 -33.613 1.00 0.00 ? 47 ARG A HB2  6  
ATOM 5931  H HB3  . ARG A 1 47 ? -42.039 -39.393 -34.951 1.00 0.00 ? 47 ARG A HB3  6  
ATOM 5932  H HG2  . ARG A 1 47 ? -44.778 -40.433 -34.139 1.00 0.00 ? 47 ARG A HG2  6  
ATOM 5933  H HG3  . ARG A 1 47 ? -44.508 -39.252 -35.415 1.00 0.00 ? 47 ARG A HG3  6  
ATOM 5934  H HD2  . ARG A 1 47 ? -42.976 -40.909 -36.533 1.00 0.00 ? 47 ARG A HD2  6  
ATOM 5935  H HD3  . ARG A 1 47 ? -43.470 -42.093 -35.326 1.00 0.00 ? 47 ARG A HD3  6  
ATOM 5936  H HE   . ARG A 1 47 ? -45.075 -41.112 -37.546 1.00 0.00 ? 47 ARG A HE   6  
ATOM 5937  H HH11 . ARG A 1 47 ? -44.946 -42.719 -34.483 1.00 0.00 ? 47 ARG A HH11 6  
ATOM 5938  H HH12 . ARG A 1 47 ? -46.448 -43.551 -34.702 1.00 0.00 ? 47 ARG A HH12 6  
ATOM 5939  H HH21 . ARG A 1 47 ? -47.046 -42.201 -37.839 1.00 0.00 ? 47 ARG A HH21 6  
ATOM 5940  H HH22 . ARG A 1 47 ? -47.638 -43.256 -36.600 1.00 0.00 ? 47 ARG A HH22 6  
ATOM 5941  N N    . PHE A 1 48 ? -39.843 -40.954 -33.768 1.00 0.00 ? 48 PHE A N    6  
ATOM 5942  C CA   . PHE A 1 48 ? -38.689 -41.587 -34.403 1.00 0.00 ? 48 PHE A CA   6  
ATOM 5943  C C    . PHE A 1 48 ? -38.492 -43.013 -33.897 1.00 0.00 ? 48 PHE A C    6  
ATOM 5944  O O    . PHE A 1 48 ? -38.173 -43.914 -34.673 1.00 0.00 ? 48 PHE A O    6  
ATOM 5945  C CB   . PHE A 1 48 ? -37.420 -40.769 -34.153 1.00 0.00 ? 48 PHE A CB   6  
ATOM 5946  C CG   . PHE A 1 48 ? -37.323 -39.662 -35.176 1.00 0.00 ? 48 PHE A CG   6  
ATOM 5947  C CD1  . PHE A 1 48 ? -36.728 -39.910 -36.420 1.00 0.00 ? 48 PHE A CD1  6  
ATOM 5948  C CD2  . PHE A 1 48 ? -37.824 -38.389 -34.886 1.00 0.00 ? 48 PHE A CD2  6  
ATOM 5949  C CE1  . PHE A 1 48 ? -36.634 -38.887 -37.370 1.00 0.00 ? 48 PHE A CE1  6  
ATOM 5950  C CE2  . PHE A 1 48 ? -37.732 -37.365 -35.836 1.00 0.00 ? 48 PHE A CE2  6  
ATOM 5951  C CZ   . PHE A 1 48 ? -37.137 -37.614 -37.077 1.00 0.00 ? 48 PHE A CZ   6  
ATOM 5952  H H    . PHE A 1 48 ? -39.713 -40.181 -33.185 1.00 0.00 ? 48 PHE A H    6  
ATOM 5953  H HA   . PHE A 1 48 ? -38.866 -41.625 -35.469 1.00 0.00 ? 48 PHE A HA   6  
ATOM 5954  H HB2  . PHE A 1 48 ? -37.459 -40.341 -33.162 1.00 0.00 ? 48 PHE A HB2  6  
ATOM 5955  H HB3  . PHE A 1 48 ? -36.558 -41.410 -34.234 1.00 0.00 ? 48 PHE A HB3  6  
ATOM 5956  H HD1  . PHE A 1 48 ? -36.341 -40.893 -36.644 1.00 0.00 ? 48 PHE A HD1  6  
ATOM 5957  H HD2  . PHE A 1 48 ? -38.281 -38.197 -33.930 1.00 0.00 ? 48 PHE A HD2  6  
ATOM 5958  H HE1  . PHE A 1 48 ? -36.176 -39.080 -38.328 1.00 0.00 ? 48 PHE A HE1  6  
ATOM 5959  H HE2  . PHE A 1 48 ? -38.118 -36.382 -35.609 1.00 0.00 ? 48 PHE A HE2  6  
ATOM 5960  H HZ   . PHE A 1 48 ? -37.066 -36.823 -37.810 1.00 0.00 ? 48 PHE A HZ   6  
ATOM 5961  N N    . ARG A 1 49 ? -38.680 -43.217 -32.598 1.00 0.00 ? 49 ARG A N    6  
ATOM 5962  C CA   . ARG A 1 49 ? -38.504 -44.560 -32.052 1.00 0.00 ? 49 ARG A CA   6  
ATOM 5963  C C    . ARG A 1 49 ? -39.529 -45.494 -32.691 1.00 0.00 ? 49 ARG A C    6  
ATOM 5964  O O    . ARG A 1 49 ? -39.176 -46.544 -33.230 1.00 0.00 ? 49 ARG A O    6  
ATOM 5965  C CB   . ARG A 1 49 ? -38.693 -44.536 -30.532 1.00 0.00 ? 49 ARG A CB   6  
ATOM 5966  C CG   . ARG A 1 49 ? -38.471 -45.938 -29.960 1.00 0.00 ? 49 ARG A CG   6  
ATOM 5967  C CD   . ARG A 1 49 ? -38.593 -45.890 -28.437 1.00 0.00 ? 49 ARG A CD   6  
ATOM 5968  N NE   . ARG A 1 49 ? -38.408 -47.221 -27.870 1.00 0.00 ? 49 ARG A NE   6  
ATOM 5969  C CZ   . ARG A 1 49 ? -38.455 -47.422 -26.559 1.00 0.00 ? 49 ARG A CZ   6  
ATOM 5970  N NH1  . ARG A 1 49 ? -38.672 -46.419 -25.750 1.00 0.00 ? 49 ARG A NH1  6  
ATOM 5971  N NH2  . ARG A 1 49 ? -38.287 -48.623 -26.074 1.00 0.00 ? 49 ARG A NH2  6  
ATOM 5972  H H    . ARG A 1 49 ? -38.930 -42.451 -32.040 1.00 0.00 ? 49 ARG A H    6  
ATOM 5973  H HA   . ARG A 1 49 ? -37.509 -44.910 -32.281 1.00 0.00 ? 49 ARG A HA   6  
ATOM 5974  H HB2  . ARG A 1 49 ? -37.983 -43.851 -30.093 1.00 0.00 ? 49 ARG A HB2  6  
ATOM 5975  H HB3  . ARG A 1 49 ? -39.697 -44.211 -30.302 1.00 0.00 ? 49 ARG A HB3  6  
ATOM 5976  H HG2  . ARG A 1 49 ? -39.212 -46.614 -30.361 1.00 0.00 ? 49 ARG A HG2  6  
ATOM 5977  H HG3  . ARG A 1 49 ? -37.484 -46.285 -30.230 1.00 0.00 ? 49 ARG A HG3  6  
ATOM 5978  H HD2  . ARG A 1 49 ? -37.840 -45.227 -28.038 1.00 0.00 ? 49 ARG A HD2  6  
ATOM 5979  H HD3  . ARG A 1 49 ? -39.572 -45.518 -28.170 1.00 0.00 ? 49 ARG A HD3  6  
ATOM 5980  H HE   . ARG A 1 49 ? -38.245 -47.980 -28.469 1.00 0.00 ? 49 ARG A HE   6  
ATOM 5981  H HH11 . ARG A 1 49 ? -38.801 -45.499 -26.119 1.00 0.00 ? 49 ARG A HH11 6  
ATOM 5982  H HH12 . ARG A 1 49 ? -38.707 -46.572 -24.763 1.00 0.00 ? 49 ARG A HH12 6  
ATOM 5983  H HH21 . ARG A 1 49 ? -38.120 -49.391 -26.692 1.00 0.00 ? 49 ARG A HH21 6  
ATOM 5984  H HH22 . ARG A 1 49 ? -38.323 -48.774 -25.087 1.00 0.00 ? 49 ARG A HH22 6  
ATOM 5985  N N    . SER A 1 50 ? -40.797 -45.106 -32.620 1.00 0.00 ? 50 SER A N    6  
ATOM 5986  C CA   . SER A 1 50 ? -41.874 -45.911 -33.190 1.00 0.00 ? 50 SER A CA   6  
ATOM 5987  C C    . SER A 1 50 ? -41.822 -47.342 -32.659 1.00 0.00 ? 50 SER A C    6  
ATOM 5988  O O    . SER A 1 50 ? -42.275 -48.272 -33.322 1.00 0.00 ? 50 SER A O    6  
ATOM 5989  C CB   . SER A 1 50 ? -41.766 -45.933 -34.714 1.00 0.00 ? 50 SER A CB   6  
ATOM 5990  O OG   . SER A 1 50 ? -41.885 -44.610 -35.215 1.00 0.00 ? 50 SER A OG   6  
ATOM 5991  H H    . SER A 1 50 ? -41.018 -44.291 -32.121 1.00 0.00 ? 50 SER A H    6  
ATOM 5992  H HA   . SER A 1 50 ? -42.822 -45.471 -32.916 1.00 0.00 ? 50 SER A HA   6  
ATOM 5993  H HB2  . SER A 1 50 ? -40.811 -46.337 -35.003 1.00 0.00 ? 50 SER A HB2  6  
ATOM 5994  H HB3  . SER A 1 50 ? -42.554 -46.555 -35.119 1.00 0.00 ? 50 SER A HB3  6  
ATOM 5995  H HG   . SER A 1 50 ? -42.663 -44.212 -34.820 1.00 0.00 ? 50 SER A HG   6  
ATOM 5996  N N    . GLY A 1 51 ? -41.274 -47.510 -31.460 1.00 0.00 ? 51 GLY A N    6  
ATOM 5997  C CA   . GLY A 1 51 ? -41.180 -48.836 -30.862 1.00 0.00 ? 51 GLY A CA   6  
ATOM 5998  C C    . GLY A 1 51 ? -40.759 -49.874 -31.900 1.00 0.00 ? 51 GLY A C    6  
ATOM 5999  O O    . GLY A 1 51 ? -41.604 -50.516 -32.524 1.00 0.00 ? 51 GLY A O    6  
ATOM 6000  H H    . GLY A 1 51 ? -40.931 -46.733 -30.971 1.00 0.00 ? 51 GLY A H    6  
ATOM 6001  H HA2  . GLY A 1 51 ? -40.451 -48.815 -30.063 1.00 0.00 ? 51 GLY A HA2  6  
ATOM 6002  H HA3  . GLY A 1 51 ? -42.142 -49.113 -30.458 1.00 0.00 ? 51 GLY A HA3  6  
ATOM 6003  N N    . GLY A 1 52 ? -39.451 -50.037 -32.079 1.00 0.00 ? 52 GLY A N    6  
ATOM 6004  C CA   . GLY A 1 52 ? -38.942 -51.007 -33.044 1.00 0.00 ? 52 GLY A CA   6  
ATOM 6005  C C    . GLY A 1 52 ? -37.421 -51.103 -32.980 1.00 0.00 ? 52 GLY A C    6  
ATOM 6006  O O    . GLY A 1 52 ? -36.766 -50.303 -32.311 1.00 0.00 ? 52 GLY A O    6  
ATOM 6007  H H    . GLY A 1 52 ? -38.822 -49.506 -31.548 1.00 0.00 ? 52 GLY A H    6  
ATOM 6008  H HA2  . GLY A 1 52 ? -39.368 -51.976 -32.833 1.00 0.00 ? 52 GLY A HA2  6  
ATOM 6009  H HA3  . GLY A 1 52 ? -39.232 -50.701 -34.039 1.00 0.00 ? 52 GLY A HA3  6  
ATOM 6010  N N    . ASN A 1 53 ? -36.864 -52.082 -33.689 1.00 0.00 ? 53 ASN A N    6  
ATOM 6011  C CA   . ASN A 1 53 ? -35.417 -52.270 -33.716 1.00 0.00 ? 53 ASN A CA   6  
ATOM 6012  C C    . ASN A 1 53 ? -34.731 -51.066 -34.351 1.00 0.00 ? 53 ASN A C    6  
ATOM 6013  O O    . ASN A 1 53 ? -33.696 -50.603 -33.871 1.00 0.00 ? 53 ASN A O    6  
ATOM 6014  C CB   . ASN A 1 53 ? -35.067 -53.533 -34.505 1.00 0.00 ? 53 ASN A CB   6  
ATOM 6015  C CG   . ASN A 1 53 ? -33.591 -53.872 -34.320 1.00 0.00 ? 53 ASN A CG   6  
ATOM 6016  O OD1  . ASN A 1 53 ? -33.033 -53.650 -33.246 1.00 0.00 ? 53 ASN A OD1  6  
ATOM 6017  N ND2  . ASN A 1 53 ? -32.923 -54.396 -35.311 1.00 0.00 ? 53 ASN A ND2  6  
ATOM 6018  H H    . ASN A 1 53 ? -37.437 -52.680 -34.214 1.00 0.00 ? 53 ASN A H    6  
ATOM 6019  H HA   . ASN A 1 53 ? -35.060 -52.382 -32.703 1.00 0.00 ? 53 ASN A HA   6  
ATOM 6020  H HB2  . ASN A 1 53 ? -35.670 -54.357 -34.150 1.00 0.00 ? 53 ASN A HB2  6  
ATOM 6021  H HB3  . ASN A 1 53 ? -35.268 -53.369 -35.553 1.00 0.00 ? 53 ASN A HB3  6  
ATOM 6022  H HD21 . ASN A 1 53 ? -33.371 -54.572 -36.165 1.00 0.00 ? 53 ASN A HD21 6  
ATOM 6023  H HD22 . ASN A 1 53 ? -31.974 -54.616 -35.200 1.00 0.00 ? 53 ASN A HD22 6  
ATOM 6024  N N    . LYS A 1 54 ? -35.319 -50.567 -35.436 1.00 0.00 ? 54 LYS A N    6  
ATOM 6025  C CA   . LYS A 1 54 ? -34.765 -49.417 -36.143 1.00 0.00 ? 54 LYS A CA   6  
ATOM 6026  C C    . LYS A 1 54 ? -35.839 -48.356 -36.357 1.00 0.00 ? 54 LYS A C    6  
ATOM 6027  O O    . LYS A 1 54 ? -37.025 -48.670 -36.456 1.00 0.00 ? 54 LYS A O    6  
ATOM 6028  C CB   . LYS A 1 54 ? -34.195 -49.854 -37.492 1.00 0.00 ? 54 LYS A CB   6  
ATOM 6029  C CG   . LYS A 1 54 ? -33.009 -50.791 -37.265 1.00 0.00 ? 54 LYS A CG   6  
ATOM 6030  C CD   . LYS A 1 54 ? -32.432 -51.223 -38.614 1.00 0.00 ? 54 LYS A CD   6  
ATOM 6031  C CE   . LYS A 1 54 ? -31.263 -52.181 -38.385 1.00 0.00 ? 54 LYS A CE   6  
ATOM 6032  N NZ   . LYS A 1 54 ? -30.177 -51.471 -37.649 1.00 0.00 ? 54 LYS A NZ   6  
ATOM 6033  H H    . LYS A 1 54 ? -36.142 -50.982 -35.767 1.00 0.00 ? 54 LYS A H    6  
ATOM 6034  H HA   . LYS A 1 54 ? -33.970 -48.991 -35.551 1.00 0.00 ? 54 LYS A HA   6  
ATOM 6035  H HB2  . LYS A 1 54 ? -34.961 -50.370 -38.056 1.00 0.00 ? 54 LYS A HB2  6  
ATOM 6036  H HB3  . LYS A 1 54 ? -33.867 -48.986 -38.043 1.00 0.00 ? 54 LYS A HB3  6  
ATOM 6037  H HG2  . LYS A 1 54 ? -32.249 -50.277 -36.696 1.00 0.00 ? 54 LYS A HG2  6  
ATOM 6038  H HG3  . LYS A 1 54 ? -33.338 -51.664 -36.721 1.00 0.00 ? 54 LYS A HG3  6  
ATOM 6039  H HD2  . LYS A 1 54 ? -33.199 -51.719 -39.191 1.00 0.00 ? 54 LYS A HD2  6  
ATOM 6040  H HD3  . LYS A 1 54 ? -32.083 -50.354 -39.152 1.00 0.00 ? 54 LYS A HD3  6  
ATOM 6041  H HE2  . LYS A 1 54 ? -31.598 -53.027 -37.804 1.00 0.00 ? 54 LYS A HE2  6  
ATOM 6042  H HE3  . LYS A 1 54 ? -30.887 -52.526 -39.339 1.00 0.00 ? 54 LYS A HE3  6  
ATOM 6043  H HZ1  . LYS A 1 54 ? -29.922 -50.603 -38.160 1.00 0.00 ? 54 LYS A HZ1  6  
ATOM 6044  H HZ2  . LYS A 1 54 ? -29.344 -52.092 -37.580 1.00 0.00 ? 54 LYS A HZ2  6  
ATOM 6045  H HZ3  . LYS A 1 54 ? -30.508 -51.226 -36.696 1.00 0.00 ? 54 LYS A HZ3  6  
ATOM 6046  N N    . LYS A 1 55 ? -35.417 -47.098 -36.406 1.00 0.00 ? 55 LYS A N    6  
ATOM 6047  C CA   . LYS A 1 55 ? -36.356 -45.998 -36.581 1.00 0.00 ? 55 LYS A CA   6  
ATOM 6048  C C    . LYS A 1 55 ? -37.122 -46.149 -37.893 1.00 0.00 ? 55 LYS A C    6  
ATOM 6049  O O    . LYS A 1 55 ? -38.332 -45.933 -37.940 1.00 0.00 ? 55 LYS A O    6  
ATOM 6050  C CB   . LYS A 1 55 ? -35.586 -44.677 -36.588 1.00 0.00 ? 55 LYS A CB   6  
ATOM 6051  C CG   . LYS A 1 55 ? -35.031 -44.410 -35.190 1.00 0.00 ? 55 LYS A CG   6  
ATOM 6052  C CD   . LYS A 1 55 ? -34.208 -43.122 -35.202 1.00 0.00 ? 55 LYS A CD   6  
ATOM 6053  C CE   . LYS A 1 55 ? -33.691 -42.842 -33.791 1.00 0.00 ? 55 LYS A CE   6  
ATOM 6054  N NZ   . LYS A 1 55 ? -32.799 -43.958 -33.363 1.00 0.00 ? 55 LYS A NZ   6  
ATOM 6055  H H    . LYS A 1 55 ? -34.462 -46.909 -36.293 1.00 0.00 ? 55 LYS A H    6  
ATOM 6056  H HA   . LYS A 1 55 ? -37.055 -45.993 -35.760 1.00 0.00 ? 55 LYS A HA   6  
ATOM 6057  H HB2  . LYS A 1 55 ? -34.772 -44.740 -37.296 1.00 0.00 ? 55 LYS A HB2  6  
ATOM 6058  H HB3  . LYS A 1 55 ? -36.250 -43.874 -36.871 1.00 0.00 ? 55 LYS A HB3  6  
ATOM 6059  H HG2  . LYS A 1 55 ? -35.849 -44.310 -34.492 1.00 0.00 ? 55 LYS A HG2  6  
ATOM 6060  H HG3  . LYS A 1 55 ? -34.401 -45.233 -34.889 1.00 0.00 ? 55 LYS A HG3  6  
ATOM 6061  H HD2  . LYS A 1 55 ? -33.373 -43.234 -35.877 1.00 0.00 ? 55 LYS A HD2  6  
ATOM 6062  H HD3  . LYS A 1 55 ? -34.829 -42.300 -35.528 1.00 0.00 ? 55 LYS A HD3  6  
ATOM 6063  H HE2  . LYS A 1 55 ? -33.137 -41.915 -33.787 1.00 0.00 ? 55 LYS A HE2  6  
ATOM 6064  H HE3  . LYS A 1 55 ? -34.526 -42.765 -33.109 1.00 0.00 ? 55 LYS A HE3  6  
ATOM 6065  H HZ1  . LYS A 1 55 ? -32.477 -44.484 -34.199 1.00 0.00 ? 55 LYS A HZ1  6  
ATOM 6066  H HZ2  . LYS A 1 55 ? -33.324 -44.596 -32.730 1.00 0.00 ? 55 LYS A HZ2  6  
ATOM 6067  H HZ3  . LYS A 1 55 ? -31.976 -43.571 -32.860 1.00 0.00 ? 55 LYS A HZ3  6  
ATOM 6068  N N    . ARG A 1 56 ? -36.414 -46.512 -38.958 1.00 0.00 ? 56 ARG A N    6  
ATOM 6069  C CA   . ARG A 1 56 ? -37.046 -46.680 -40.261 1.00 0.00 ? 56 ARG A CA   6  
ATOM 6070  C C    . ARG A 1 56 ? -37.948 -47.909 -40.273 1.00 0.00 ? 56 ARG A C    6  
ATOM 6071  O O    . ARG A 1 56 ? -38.826 -48.027 -41.127 1.00 0.00 ? 56 ARG A O    6  
ATOM 6072  C CB   . ARG A 1 56 ? -35.976 -46.821 -41.344 1.00 0.00 ? 56 ARG A CB   6  
ATOM 6073  C CG   . ARG A 1 56 ? -35.235 -45.493 -41.509 1.00 0.00 ? 56 ARG A CG   6  
ATOM 6074  C CD   . ARG A 1 56 ? -34.075 -45.673 -42.490 1.00 0.00 ? 56 ARG A CD   6  
ATOM 6075  N NE   . ARG A 1 56 ? -34.581 -46.028 -43.811 1.00 0.00 ? 56 ARG A NE   6  
ATOM 6076  C CZ   . ARG A 1 56 ? -33.757 -46.391 -44.788 1.00 0.00 ? 56 ARG A CZ   6  
ATOM 6077  N NH1  . ARG A 1 56 ? -32.470 -46.431 -44.573 1.00 0.00 ? 56 ARG A NH1  6  
ATOM 6078  N NH2  . ARG A 1 56 ? -34.233 -46.704 -45.962 1.00 0.00 ? 56 ARG A NH2  6  
ATOM 6079  H H    . ARG A 1 56 ? -35.446 -46.647 -38.879 1.00 0.00 ? 56 ARG A H    6  
ATOM 6080  H HA   . ARG A 1 56 ? -37.642 -45.806 -40.476 1.00 0.00 ? 56 ARG A HA   6  
ATOM 6081  H HB2  . ARG A 1 56 ? -35.274 -47.593 -41.059 1.00 0.00 ? 56 ARG A HB2  6  
ATOM 6082  H HB3  . ARG A 1 56 ? -36.443 -47.089 -42.279 1.00 0.00 ? 56 ARG A HB3  6  
ATOM 6083  H HG2  . ARG A 1 56 ? -35.917 -44.747 -41.892 1.00 0.00 ? 56 ARG A HG2  6  
ATOM 6084  H HG3  . ARG A 1 56 ? -34.850 -45.174 -40.553 1.00 0.00 ? 56 ARG A HG3  6  
ATOM 6085  H HD2  . ARG A 1 56 ? -33.518 -44.751 -42.558 1.00 0.00 ? 56 ARG A HD2  6  
ATOM 6086  H HD3  . ARG A 1 56 ? -33.424 -46.458 -42.131 1.00 0.00 ? 56 ARG A HD3  6  
ATOM 6087  H HE   . ARG A 1 56 ? -35.546 -46.001 -43.980 1.00 0.00 ? 56 ARG A HE   6  
ATOM 6088  H HH11 . ARG A 1 56 ? -32.106 -46.192 -43.674 1.00 0.00 ? 56 ARG A HH11 6  
ATOM 6089  H HH12 . ARG A 1 56 ? -31.850 -46.705 -45.308 1.00 0.00 ? 56 ARG A HH12 6  
ATOM 6090  H HH21 . ARG A 1 56 ? -35.219 -46.672 -46.126 1.00 0.00 ? 56 ARG A HH21 6  
ATOM 6091  H HH22 . ARG A 1 56 ? -33.612 -46.977 -46.697 1.00 0.00 ? 56 ARG A HH22 6  
ATOM 6092  N N    . ARG A 1 57 ? -37.708 -48.820 -39.326 1.00 0.00 ? 57 ARG A N    6  
ATOM 6093  C CA   . ARG A 1 57 ? -38.486 -50.058 -39.215 1.00 0.00 ? 57 ARG A CA   6  
ATOM 6094  C C    . ARG A 1 57 ? -37.848 -51.178 -40.035 1.00 0.00 ? 57 ARG A C    6  
ATOM 6095  O O    . ARG A 1 57 ? -36.626 -51.321 -40.061 1.00 0.00 ? 57 ARG A O    6  
ATOM 6096  C CB   . ARG A 1 57 ? -39.938 -49.842 -39.670 1.00 0.00 ? 57 ARG A CB   6  
ATOM 6097  C CG   . ARG A 1 57 ? -40.851 -50.850 -38.968 1.00 0.00 ? 57 ARG A CG   6  
ATOM 6098  C CD   . ARG A 1 57 ? -41.338 -50.275 -37.636 1.00 0.00 ? 57 ARG A CD   6  
ATOM 6099  N NE   . ARG A 1 57 ? -42.297 -49.203 -37.871 1.00 0.00 ? 57 ARG A NE   6  
ATOM 6100  C CZ   . ARG A 1 57 ? -42.870 -48.562 -36.857 1.00 0.00 ? 57 ARG A CZ   6  
ATOM 6101  N NH1  . ARG A 1 57 ? -42.592 -48.907 -35.631 1.00 0.00 ? 57 ARG A NH1  6  
ATOM 6102  N NH2  . ARG A 1 57 ? -43.712 -47.593 -37.088 1.00 0.00 ? 57 ARG A NH2  6  
ATOM 6103  H H    . ARG A 1 57 ? -36.983 -48.655 -38.687 1.00 0.00 ? 57 ARG A H    6  
ATOM 6104  H HA   . ARG A 1 57 ? -38.494 -50.360 -38.178 1.00 0.00 ? 57 ARG A HA   6  
ATOM 6105  H HB2  . ARG A 1 57 ? -40.247 -48.838 -39.416 1.00 0.00 ? 57 ARG A HB2  6  
ATOM 6106  H HB3  . ARG A 1 57 ? -40.010 -49.981 -40.737 1.00 0.00 ? 57 ARG A HB3  6  
ATOM 6107  H HG2  . ARG A 1 57 ? -41.702 -51.062 -39.600 1.00 0.00 ? 57 ARG A HG2  6  
ATOM 6108  H HG3  . ARG A 1 57 ? -40.304 -51.762 -38.785 1.00 0.00 ? 57 ARG A HG3  6  
ATOM 6109  H HD2  . ARG A 1 57 ? -41.812 -51.055 -37.063 1.00 0.00 ? 57 ARG A HD2  6  
ATOM 6110  H HD3  . ARG A 1 57 ? -40.495 -49.889 -37.082 1.00 0.00 ? 57 ARG A HD3  6  
ATOM 6111  H HE   . ARG A 1 57 ? -42.519 -48.946 -38.790 1.00 0.00 ? 57 ARG A HE   6  
ATOM 6112  H HH11 . ARG A 1 57 ? -41.948 -49.653 -35.455 1.00 0.00 ? 57 ARG A HH11 6  
ATOM 6113  H HH12 . ARG A 1 57 ? -43.020 -48.426 -34.866 1.00 0.00 ? 57 ARG A HH12 6  
ATOM 6114  H HH21 . ARG A 1 57 ? -43.928 -47.333 -38.029 1.00 0.00 ? 57 ARG A HH21 6  
ATOM 6115  H HH22 . ARG A 1 57 ? -44.141 -47.112 -36.325 1.00 0.00 ? 57 ARG A HH22 6  
ATOM 6116  N N    . GLN A 1 58 ? -38.684 -51.955 -40.718 1.00 0.00 ? 58 GLN A N    6  
ATOM 6117  C CA   . GLN A 1 58 ? -38.194 -53.044 -41.554 1.00 0.00 ? 58 GLN A CA   6  
ATOM 6118  C C    . GLN A 1 58 ? -38.944 -53.066 -42.882 1.00 0.00 ? 58 GLN A C    6  
ATOM 6119  O O    . GLN A 1 58 ? -40.162 -52.900 -42.912 1.00 0.00 ? 58 GLN A O    6  
ATOM 6120  C CB   . GLN A 1 58 ? -38.382 -54.383 -40.836 1.00 0.00 ? 58 GLN A CB   6  
ATOM 6121  C CG   . GLN A 1 58 ? -37.522 -54.407 -39.571 1.00 0.00 ? 58 GLN A CG   6  
ATOM 6122  C CD   . GLN A 1 58 ? -37.697 -55.738 -38.848 1.00 0.00 ? 58 GLN A CD   6  
ATOM 6123  O OE1  . GLN A 1 58 ? -37.734 -56.792 -39.484 1.00 0.00 ? 58 GLN A OE1  6  
ATOM 6124  N NE2  . GLN A 1 58 ? -37.807 -55.755 -37.547 1.00 0.00 ? 58 GLN A NE2  6  
ATOM 6125  H H    . GLN A 1 58 ? -39.645 -51.770 -40.686 1.00 0.00 ? 58 GLN A H    6  
ATOM 6126  H HA   . GLN A 1 58 ? -37.143 -52.894 -41.746 1.00 0.00 ? 58 GLN A HA   6  
ATOM 6127  H HB2  . GLN A 1 58 ? -39.422 -54.503 -40.568 1.00 0.00 ? 58 GLN A HB2  6  
ATOM 6128  H HB3  . GLN A 1 58 ? -38.081 -55.186 -41.489 1.00 0.00 ? 58 GLN A HB3  6  
ATOM 6129  H HG2  . GLN A 1 58 ? -36.484 -54.279 -39.841 1.00 0.00 ? 58 GLN A HG2  6  
ATOM 6130  H HG3  . GLN A 1 58 ? -37.824 -53.603 -38.916 1.00 0.00 ? 58 GLN A HG3  6  
ATOM 6131  H HE21 . GLN A 1 58 ? -37.777 -54.914 -37.043 1.00 0.00 ? 58 GLN A HE21 6  
ATOM 6132  H HE22 . GLN A 1 58 ? -37.920 -56.606 -37.075 1.00 0.00 ? 58 GLN A HE22 6  
ATOM 6133  N N    . ILE A 1 59 ? -38.219 -53.268 -43.978 1.00 0.00 ? 59 ILE A N    6  
ATOM 6134  C CA   . ILE A 1 59 ? -38.851 -53.304 -45.291 1.00 0.00 ? 59 ILE A CA   6  
ATOM 6135  C C    . ILE A 1 59 ? -39.851 -54.454 -45.372 1.00 0.00 ? 59 ILE A C    6  
ATOM 6136  O O    . ILE A 1 59 ? -40.795 -54.415 -46.163 1.00 0.00 ? 59 ILE A O    6  
ATOM 6137  C CB   . ILE A 1 59 ? -37.786 -53.452 -46.382 1.00 0.00 ? 59 ILE A CB   6  
ATOM 6138  C CG1  . ILE A 1 59 ? -36.968 -54.730 -46.148 1.00 0.00 ? 59 ILE A CG1  6  
ATOM 6139  C CG2  . ILE A 1 59 ? -36.850 -52.243 -46.348 1.00 0.00 ? 59 ILE A CG2  6  
ATOM 6140  C CD1  . ILE A 1 59 ? -36.043 -54.965 -47.344 1.00 0.00 ? 59 ILE A CD1  6  
ATOM 6141  H H    . ILE A 1 59 ? -37.249 -53.385 -43.910 1.00 0.00 ? 59 ILE A H    6  
ATOM 6142  H HA   . ILE A 1 59 ? -39.378 -52.374 -45.448 1.00 0.00 ? 59 ILE A HA   6  
ATOM 6143  H HB   . ILE A 1 59 ? -38.267 -53.503 -47.348 1.00 0.00 ? 59 ILE A HB   6  
ATOM 6144  H HG12 . ILE A 1 59 ? -36.377 -54.620 -45.251 1.00 0.00 ? 59 ILE A HG12 6  
ATOM 6145  H HG13 . ILE A 1 59 ? -37.633 -55.574 -46.042 1.00 0.00 ? 59 ILE A HG13 6  
ATOM 6146  H HG21 . ILE A 1 59 ? -37.152 -51.576 -45.553 1.00 0.00 ? 59 ILE A HG21 6  
ATOM 6147  H HG22 . ILE A 1 59 ? -36.901 -51.721 -47.293 1.00 0.00 ? 59 ILE A HG22 6  
ATOM 6148  H HG23 . ILE A 1 59 ? -35.837 -52.575 -46.174 1.00 0.00 ? 59 ILE A HG23 6  
ATOM 6149  H HD11 . ILE A 1 59 ? -35.357 -54.137 -47.437 1.00 0.00 ? 59 ILE A HD11 6  
ATOM 6150  H HD12 . ILE A 1 59 ? -36.634 -55.047 -48.244 1.00 0.00 ? 59 ILE A HD12 6  
ATOM 6151  H HD13 . ILE A 1 59 ? -35.487 -55.879 -47.192 1.00 0.00 ? 59 ILE A HD13 6  
ATOM 6152  N N    . ASN A 1 60 ? -39.636 -55.475 -44.549 1.00 0.00 ? 60 ASN A N    6  
ATOM 6153  C CA   . ASN A 1 60 ? -40.521 -56.633 -44.533 1.00 0.00 ? 60 ASN A CA   6  
ATOM 6154  C C    . ASN A 1 60 ? -41.879 -56.260 -43.946 1.00 0.00 ? 60 ASN A C    6  
ATOM 6155  O O    . ASN A 1 60 ? -41.995 -55.292 -43.196 1.00 0.00 ? 60 ASN A O    6  
ATOM 6156  C CB   . ASN A 1 60 ? -39.895 -57.757 -43.705 1.00 0.00 ? 60 ASN A CB   6  
ATOM 6157  C CG   . ASN A 1 60 ? -38.549 -58.155 -44.301 1.00 0.00 ? 60 ASN A CG   6  
ATOM 6158  O OD1  . ASN A 1 60 ? -37.522 -58.065 -43.630 1.00 0.00 ? 60 ASN A OD1  6  
ATOM 6159  N ND2  . ASN A 1 60 ? -38.495 -58.591 -45.529 1.00 0.00 ? 60 ASN A ND2  6  
ATOM 6160  H H    . ASN A 1 60 ? -38.864 -55.454 -43.946 1.00 0.00 ? 60 ASN A H    6  
ATOM 6161  H HA   . ASN A 1 60 ? -40.660 -56.981 -45.545 1.00 0.00 ? 60 ASN A HA   6  
ATOM 6162  H HB2  . ASN A 1 60 ? -39.751 -57.417 -42.690 1.00 0.00 ? 60 ASN A HB2  6  
ATOM 6163  H HB3  . ASN A 1 60 ? -40.554 -58.612 -43.706 1.00 0.00 ? 60 ASN A HB3  6  
ATOM 6164  H HD21 . ASN A 1 60 ? -39.314 -58.662 -46.062 1.00 0.00 ? 60 ASN A HD21 6  
ATOM 6165  H HD22 . ASN A 1 60 ? -37.633 -58.849 -45.919 1.00 0.00 ? 60 ASN A HD22 6  
ATOM 6166  N N    . GLU A 1 61 ? -42.899 -57.045 -44.289 1.00 0.00 ? 61 GLU A N    6  
ATOM 6167  C CA   . GLU A 1 61 ? -44.250 -56.804 -43.790 1.00 0.00 ? 61 GLU A CA   6  
ATOM 6168  C C    . GLU A 1 61 ? -44.547 -55.311 -43.703 1.00 0.00 ? 61 GLU A C    6  
ATOM 6169  O O    . GLU A 1 61 ? -44.468 -54.590 -44.696 1.00 0.00 ? 61 GLU A O    6  
ATOM 6170  C CB   . GLU A 1 61 ? -44.415 -57.438 -42.408 1.00 0.00 ? 61 GLU A CB   6  
ATOM 6171  C CG   . GLU A 1 61 ? -44.129 -58.938 -42.496 1.00 0.00 ? 61 GLU A CG   6  
ATOM 6172  C CD   . GLU A 1 61 ? -45.183 -59.621 -43.359 1.00 0.00 ? 61 GLU A CD   6  
ATOM 6173  O OE1  . GLU A 1 61 ? -46.247 -59.047 -43.524 1.00 0.00 ? 61 GLU A OE1  6  
ATOM 6174  O OE2  . GLU A 1 61 ? -44.912 -60.708 -43.842 1.00 0.00 ? 61 GLU A OE2  6  
ATOM 6175  H H    . GLU A 1 61 ? -42.738 -57.812 -44.877 1.00 0.00 ? 61 GLU A H    6  
ATOM 6176  H HA   . GLU A 1 61 ? -44.958 -57.261 -44.466 1.00 0.00 ? 61 GLU A HA   6  
ATOM 6177  H HB2  . GLU A 1 61 ? -43.723 -56.979 -41.716 1.00 0.00 ? 61 GLU A HB2  6  
ATOM 6178  H HB3  . GLU A 1 61 ? -45.426 -57.287 -42.060 1.00 0.00 ? 61 GLU A HB3  6  
ATOM 6179  H HG2  . GLU A 1 61 ? -43.152 -59.092 -42.931 1.00 0.00 ? 61 GLU A HG2  6  
ATOM 6180  H HG3  . GLU A 1 61 ? -44.148 -59.365 -41.504 1.00 0.00 ? 61 GLU A HG3  6  
ATOM 6181  N N    . ASP A 1 62 ? -44.891 -54.857 -42.501 1.00 0.00 ? 62 ASP A N    6  
ATOM 6182  C CA   . ASP A 1 62 ? -45.202 -53.449 -42.286 1.00 0.00 ? 62 ASP A CA   6  
ATOM 6183  C C    . ASP A 1 62 ? -46.064 -52.914 -43.424 1.00 0.00 ? 62 ASP A C    6  
ATOM 6184  O O    . ASP A 1 62 ? -47.086 -53.506 -43.772 1.00 0.00 ? 62 ASP A O    6  
ATOM 6185  C CB   . ASP A 1 62 ? -43.908 -52.637 -42.197 1.00 0.00 ? 62 ASP A CB   6  
ATOM 6186  C CG   . ASP A 1 62 ? -43.029 -53.178 -41.074 1.00 0.00 ? 62 ASP A CG   6  
ATOM 6187  O OD1  . ASP A 1 62 ? -43.550 -53.390 -39.990 1.00 0.00 ? 62 ASP A OD1  6  
ATOM 6188  O OD2  . ASP A 1 62 ? -41.849 -53.373 -41.313 1.00 0.00 ? 62 ASP A OD2  6  
ATOM 6189  H H    . ASP A 1 62 ? -44.935 -55.485 -41.750 1.00 0.00 ? 62 ASP A H    6  
ATOM 6190  H HA   . ASP A 1 62 ? -45.742 -53.347 -41.357 1.00 0.00 ? 62 ASP A HA   6  
ATOM 6191  H HB2  . ASP A 1 62 ? -43.375 -52.707 -43.133 1.00 0.00 ? 62 ASP A HB2  6  
ATOM 6192  H HB3  . ASP A 1 62 ? -44.146 -51.604 -41.996 1.00 0.00 ? 62 ASP A HB3  6  
ATOM 6193  N N    . GLU A 1 63 ? -45.644 -51.794 -44.001 1.00 0.00 ? 63 GLU A N    6  
ATOM 6194  C CA   . GLU A 1 63 ? -46.385 -51.189 -45.103 1.00 0.00 ? 63 GLU A CA   6  
ATOM 6195  C C    . GLU A 1 63 ? -46.256 -52.048 -46.364 1.00 0.00 ? 63 GLU A C    6  
ATOM 6196  O O    . GLU A 1 63 ? -45.235 -52.706 -46.561 1.00 0.00 ? 63 GLU A O    6  
ATOM 6197  C CB   . GLU A 1 63 ? -45.840 -49.784 -45.377 1.00 0.00 ? 63 GLU A CB   6  
ATOM 6198  C CG   . GLU A 1 63 ? -46.177 -48.866 -44.200 1.00 0.00 ? 63 GLU A CG   6  
ATOM 6199  C CD   . GLU A 1 63 ? -45.600 -47.474 -44.442 1.00 0.00 ? 63 GLU A CD   6  
ATOM 6200  O OE1  . GLU A 1 63 ? -44.938 -47.297 -45.451 1.00 0.00 ? 63 GLU A OE1  6  
ATOM 6201  O OE2  . GLU A 1 63 ? -45.827 -46.608 -43.613 1.00 0.00 ? 63 GLU A OE2  6  
ATOM 6202  H H    . GLU A 1 63 ? -44.821 -51.364 -43.684 1.00 0.00 ? 63 GLU A H    6  
ATOM 6203  H HA   . GLU A 1 63 ? -47.423 -51.114 -44.817 1.00 0.00 ? 63 GLU A HA   6  
ATOM 6204  H HB2  . GLU A 1 63 ? -44.767 -49.834 -45.499 1.00 0.00 ? 63 GLU A HB2  6  
ATOM 6205  H HB3  . GLU A 1 63 ? -46.285 -49.391 -46.277 1.00 0.00 ? 63 GLU A HB3  6  
ATOM 6206  H HG2  . GLU A 1 63 ? -47.250 -48.796 -44.097 1.00 0.00 ? 63 GLU A HG2  6  
ATOM 6207  H HG3  . GLU A 1 63 ? -45.756 -49.274 -43.295 1.00 0.00 ? 63 GLU A HG3  6  
ATOM 6208  N N    . PRO A 1 64 ? -47.254 -52.061 -47.221 1.00 0.00 ? 64 PRO A N    6  
ATOM 6209  C CA   . PRO A 1 64 ? -47.212 -52.867 -48.476 1.00 0.00 ? 64 PRO A CA   6  
ATOM 6210  C C    . PRO A 1 64 ? -46.197 -52.319 -49.476 1.00 0.00 ? 64 PRO A C    6  
ATOM 6211  O O    . PRO A 1 64 ? -45.500 -53.117 -50.080 1.00 0.00 ? 64 PRO A O    6  
ATOM 6212  C CB   . PRO A 1 64 ? -48.634 -52.763 -49.033 1.00 0.00 ? 64 PRO A CB   6  
ATOM 6213  C CG   . PRO A 1 64 ? -49.200 -51.512 -48.448 1.00 0.00 ? 64 PRO A CG   6  
ATOM 6214  C CD   . PRO A 1 64 ? -48.523 -51.319 -47.093 1.00 0.00 ? 64 PRO A CD   6  
ATOM 6215  O OXT  . PRO A 1 64 ? -46.133 -51.109 -49.621 1.00 0.00 ? 64 PRO A OXT  6  
ATOM 6216  H HA   . PRO A 1 64 ? -46.990 -53.898 -48.249 1.00 0.00 ? 64 PRO A HA   6  
ATOM 6217  H HB2  . PRO A 1 64 ? -48.609 -52.695 -50.111 1.00 0.00 ? 64 PRO A HB2  6  
ATOM 6218  H HB3  . PRO A 1 64 ? -49.222 -53.613 -48.724 1.00 0.00 ? 64 PRO A HB3  6  
ATOM 6219  H HG2  . PRO A 1 64 ? -48.987 -50.674 -49.096 1.00 0.00 ? 64 PRO A HG2  6  
ATOM 6220  H HG3  . PRO A 1 64 ? -50.265 -51.616 -48.310 1.00 0.00 ? 64 PRO A HG3  6  
ATOM 6221  H HD2  . PRO A 1 64 ? -48.339 -50.271 -46.910 1.00 0.00 ? 64 PRO A HD2  6  
ATOM 6222  H HD3  . PRO A 1 64 ? -49.124 -51.744 -46.303 1.00 0.00 ? 64 PRO A HD3  6  
ATOM 6223  N N    . LEU A 1 1  ? -7.744  -16.305 -13.348 1.00 0.00 ? 1  LEU A N    7  
ATOM 6224  C CA   . LEU A 1 1  ? -7.002  -15.438 -14.306 1.00 0.00 ? 1  LEU A CA   7  
ATOM 6225  C C    . LEU A 1 1  ? -8.003  -14.727 -15.213 1.00 0.00 ? 1  LEU A C    7  
ATOM 6226  O O    . LEU A 1 1  ? -8.858  -15.363 -15.827 1.00 0.00 ? 1  LEU A O    7  
ATOM 6227  C CB   . LEU A 1 1  ? -6.052  -16.307 -15.140 1.00 0.00 ? 1  LEU A CB   7  
ATOM 6228  C CG   . LEU A 1 1  ? -5.272  -15.439 -16.134 1.00 0.00 ? 1  LEU A CG   7  
ATOM 6229  C CD1  . LEU A 1 1  ? -4.432  -14.405 -15.377 1.00 0.00 ? 1  LEU A CD1  7  
ATOM 6230  C CD2  . LEU A 1 1  ? -4.345  -16.331 -16.963 1.00 0.00 ? 1  LEU A CD2  7  
ATOM 6231  H H1   . LEU A 1 1  ? -8.653  -15.862 -13.111 1.00 0.00 ? 1  LEU A H1   7  
ATOM 6232  H H2   . LEU A 1 1  ? -7.181  -16.425 -12.480 1.00 0.00 ? 1  LEU A H2   7  
ATOM 6233  H H3   . LEU A 1 1  ? -7.915  -17.235 -13.780 1.00 0.00 ? 1  LEU A H3   7  
ATOM 6234  H HA   . LEU A 1 1  ? -6.433  -14.705 -13.756 1.00 0.00 ? 1  LEU A HA   7  
ATOM 6235  H HB2  . LEU A 1 1  ? -5.357  -16.809 -14.482 1.00 0.00 ? 1  LEU A HB2  7  
ATOM 6236  H HB3  . LEU A 1 1  ? -6.624  -17.044 -15.684 1.00 0.00 ? 1  LEU A HB3  7  
ATOM 6237  H HG   . LEU A 1 1  ? -5.962  -14.930 -16.791 1.00 0.00 ? 1  LEU A HG   7  
ATOM 6238  H HD11 . LEU A 1 1  ? -5.022  -13.518 -15.208 1.00 0.00 ? 1  LEU A HD11 7  
ATOM 6239  H HD12 . LEU A 1 1  ? -3.559  -14.154 -15.961 1.00 0.00 ? 1  LEU A HD12 7  
ATOM 6240  H HD13 . LEU A 1 1  ? -4.123  -14.818 -14.428 1.00 0.00 ? 1  LEU A HD13 7  
ATOM 6241  H HD21 . LEU A 1 1  ? -3.947  -15.765 -17.792 1.00 0.00 ? 1  LEU A HD21 7  
ATOM 6242  H HD22 . LEU A 1 1  ? -4.902  -17.177 -17.339 1.00 0.00 ? 1  LEU A HD22 7  
ATOM 6243  H HD23 . LEU A 1 1  ? -3.533  -16.681 -16.344 1.00 0.00 ? 1  LEU A HD23 7  
ATOM 6244  N N    . ASP A 1 2  ? -7.890  -13.406 -15.286 1.00 0.00 ? 2  ASP A N    7  
ATOM 6245  C CA   . ASP A 1 2  ? -8.792  -12.614 -16.116 1.00 0.00 ? 2  ASP A CA   7  
ATOM 6246  C C    . ASP A 1 2  ? -8.344  -12.632 -17.574 1.00 0.00 ? 2  ASP A C    7  
ATOM 6247  O O    . ASP A 1 2  ? -7.373  -13.302 -17.928 1.00 0.00 ? 2  ASP A O    7  
ATOM 6248  C CB   . ASP A 1 2  ? -8.839  -11.171 -15.607 1.00 0.00 ? 2  ASP A CB   7  
ATOM 6249  C CG   . ASP A 1 2  ? -7.491  -10.491 -15.824 1.00 0.00 ? 2  ASP A CG   7  
ATOM 6250  O OD1  . ASP A 1 2  ? -6.594  -11.140 -16.339 1.00 0.00 ? 2  ASP A OD1  7  
ATOM 6251  O OD2  . ASP A 1 2  ? -7.373  -9.329  -15.473 1.00 0.00 ? 2  ASP A OD2  7  
ATOM 6252  H H    . ASP A 1 2  ? -7.190  -12.954 -14.768 1.00 0.00 ? 2  ASP A H    7  
ATOM 6253  H HA   . ASP A 1 2  ? -9.784  -13.036 -16.051 1.00 0.00 ? 2  ASP A HA   7  
ATOM 6254  H HB2  . ASP A 1 2  ? -9.603  -10.629 -16.143 1.00 0.00 ? 2  ASP A HB2  7  
ATOM 6255  H HB3  . ASP A 1 2  ? -9.073  -11.170 -14.553 1.00 0.00 ? 2  ASP A HB3  7  
ATOM 6256  N N    . ARG A 1 3  ? -9.058  -11.889 -18.415 1.00 0.00 ? 3  ARG A N    7  
ATOM 6257  C CA   . ARG A 1 3  ? -8.729  -11.819 -19.836 1.00 0.00 ? 3  ARG A CA   7  
ATOM 6258  C C    . ARG A 1 3  ? -8.824  -13.200 -20.480 1.00 0.00 ? 3  ARG A C    7  
ATOM 6259  O O    . ARG A 1 3  ? -7.823  -13.754 -20.934 1.00 0.00 ? 3  ARG A O    7  
ATOM 6260  C CB   . ARG A 1 3  ? -7.320  -11.251 -20.022 1.00 0.00 ? 3  ARG A CB   7  
ATOM 6261  C CG   . ARG A 1 3  ? -7.095  -10.916 -21.500 1.00 0.00 ? 3  ARG A CG   7  
ATOM 6262  C CD   . ARG A 1 3  ? -5.643  -10.481 -21.708 1.00 0.00 ? 3  ARG A CD   7  
ATOM 6263  N NE   . ARG A 1 3  ? -4.744  -11.614 -21.521 1.00 0.00 ? 3  ARG A NE   7  
ATOM 6264  C CZ   . ARG A 1 3  ? -4.548  -12.503 -22.489 1.00 0.00 ? 3  ARG A CZ   7  
ATOM 6265  N NH1  . ARG A 1 3  ? -5.169  -12.373 -23.630 1.00 0.00 ? 3  ARG A NH1  7  
ATOM 6266  N NH2  . ARG A 1 3  ? -3.736  -13.506 -22.299 1.00 0.00 ? 3  ARG A NH2  7  
ATOM 6267  H H    . ARG A 1 3  ? -9.819  -11.373 -18.075 1.00 0.00 ? 3  ARG A H    7  
ATOM 6268  H HA   . ARG A 1 3  ? -9.433  -11.161 -20.322 1.00 0.00 ? 3  ARG A HA   7  
ATOM 6269  H HB2  . ARG A 1 3  ? -7.210  -10.357 -19.428 1.00 0.00 ? 3  ARG A HB2  7  
ATOM 6270  H HB3  . ARG A 1 3  ? -6.592  -11.984 -19.708 1.00 0.00 ? 3  ARG A HB3  7  
ATOM 6271  H HG2  . ARG A 1 3  ? -7.300  -11.786 -22.104 1.00 0.00 ? 3  ARG A HG2  7  
ATOM 6272  H HG3  . ARG A 1 3  ? -7.753  -10.112 -21.790 1.00 0.00 ? 3  ARG A HG3  7  
ATOM 6273  H HD2  . ARG A 1 3  ? -5.525  -10.096 -22.710 1.00 0.00 ? 3  ARG A HD2  7  
ATOM 6274  H HD3  . ARG A 1 3  ? -5.398  -9.705  -20.998 1.00 0.00 ? 3  ARG A HD3  7  
ATOM 6275  H HE   . ARG A 1 3  ? -4.276  -11.721 -20.668 1.00 0.00 ? 3  ARG A HE   7  
ATOM 6276  H HH11 . ARG A 1 3  ? -5.792  -11.605 -23.776 1.00 0.00 ? 3  ARG A HH11 7  
ATOM 6277  H HH12 . ARG A 1 3  ? -5.022  -13.042 -24.359 1.00 0.00 ? 3  ARG A HH12 7  
ATOM 6278  H HH21 . ARG A 1 3  ? -3.261  -13.606 -21.425 1.00 0.00 ? 3  ARG A HH21 7  
ATOM 6279  H HH22 . ARG A 1 3  ? -3.588  -14.175 -23.028 1.00 0.00 ? 3  ARG A HH22 7  
ATOM 6280  N N    . TRP A 1 4  ? -10.036 -13.746 -20.520 1.00 0.00 ? 4  TRP A N    7  
ATOM 6281  C CA   . TRP A 1 4  ? -10.253 -15.058 -21.119 1.00 0.00 ? 4  TRP A CA   7  
ATOM 6282  C C    . TRP A 1 4  ? -10.520 -14.914 -22.615 1.00 0.00 ? 4  TRP A C    7  
ATOM 6283  O O    . TRP A 1 4  ? -10.443 -15.884 -23.369 1.00 0.00 ? 4  TRP A O    7  
ATOM 6284  C CB   . TRP A 1 4  ? -11.450 -15.746 -20.459 1.00 0.00 ? 4  TRP A CB   7  
ATOM 6285  C CG   . TRP A 1 4  ? -11.122 -16.073 -19.039 1.00 0.00 ? 4  TRP A CG   7  
ATOM 6286  C CD1  . TRP A 1 4  ? -11.445 -15.306 -17.971 1.00 0.00 ? 4  TRP A CD1  7  
ATOM 6287  C CD2  . TRP A 1 4  ? -10.420 -17.235 -18.509 1.00 0.00 ? 4  TRP A CD2  7  
ATOM 6288  N NE1  . TRP A 1 4  ? -10.987 -15.924 -16.822 1.00 0.00 ? 4  TRP A NE1  7  
ATOM 6289  C CE2  . TRP A 1 4  ? -10.347 -17.115 -17.101 1.00 0.00 ? 4  TRP A CE2  7  
ATOM 6290  C CE3  . TRP A 1 4  ? -9.844  -18.371 -19.108 1.00 0.00 ? 4  TRP A CE3  7  
ATOM 6291  C CZ2  . TRP A 1 4  ? -9.726  -18.086 -16.315 1.00 0.00 ? 4  TRP A CZ2  7  
ATOM 6292  C CZ3  . TRP A 1 4  ? -9.218  -19.349 -18.319 1.00 0.00 ? 4  TRP A CZ3  7  
ATOM 6293  C CH2  . TRP A 1 4  ? -9.159  -19.208 -16.926 1.00 0.00 ? 4  TRP A CH2  7  
ATOM 6294  H H    . TRP A 1 4  ? -10.798 -13.253 -20.150 1.00 0.00 ? 4  TRP A H    7  
ATOM 6295  H HA   . TRP A 1 4  ? -9.373  -15.666 -20.973 1.00 0.00 ? 4  TRP A HA   7  
ATOM 6296  H HB2  . TRP A 1 4  ? -12.305 -15.086 -20.487 1.00 0.00 ? 4  TRP A HB2  7  
ATOM 6297  H HB3  . TRP A 1 4  ? -11.681 -16.656 -20.992 1.00 0.00 ? 4  TRP A HB3  7  
ATOM 6298  H HD1  . TRP A 1 4  ? -11.975 -14.367 -18.012 1.00 0.00 ? 4  TRP A HD1  7  
ATOM 6299  H HE1  . TRP A 1 4  ? -11.092 -15.574 -15.913 1.00 0.00 ? 4  TRP A HE1  7  
ATOM 6300  H HE3  . TRP A 1 4  ? -9.884  -18.490 -20.180 1.00 0.00 ? 4  TRP A HE3  7  
ATOM 6301  H HZ2  . TRP A 1 4  ? -9.683  -17.971 -15.242 1.00 0.00 ? 4  TRP A HZ2  7  
ATOM 6302  H HZ3  . TRP A 1 4  ? -8.779  -20.218 -18.790 1.00 0.00 ? 4  TRP A HZ3  7  
ATOM 6303  H HH2  . TRP A 1 4  ? -8.676  -19.963 -16.325 1.00 0.00 ? 4  TRP A HH2  7  
ATOM 6304  N N    . TYR A 1 5  ? -10.842 -13.694 -23.030 1.00 0.00 ? 5  TYR A N    7  
ATOM 6305  C CA   . TYR A 1 5  ? -11.132 -13.413 -24.430 1.00 0.00 ? 5  TYR A CA   7  
ATOM 6306  C C    . TYR A 1 5  ? -10.603 -12.033 -24.811 1.00 0.00 ? 5  TYR A C    7  
ATOM 6307  O O    . TYR A 1 5  ? -10.694 -11.089 -24.027 1.00 0.00 ? 5  TYR A O    7  
ATOM 6308  C CB   . TYR A 1 5  ? -12.644 -13.481 -24.665 1.00 0.00 ? 5  TYR A CB   7  
ATOM 6309  C CG   . TYR A 1 5  ? -12.965 -13.073 -26.083 1.00 0.00 ? 5  TYR A CG   7  
ATOM 6310  C CD1  . TYR A 1 5  ? -12.657 -13.933 -27.146 1.00 0.00 ? 5  TYR A CD1  7  
ATOM 6311  C CD2  . TYR A 1 5  ? -13.575 -11.840 -26.336 1.00 0.00 ? 5  TYR A CD2  7  
ATOM 6312  C CE1  . TYR A 1 5  ? -12.963 -13.557 -28.461 1.00 0.00 ? 5  TYR A CE1  7  
ATOM 6313  C CE2  . TYR A 1 5  ? -13.878 -11.464 -27.650 1.00 0.00 ? 5  TYR A CE2  7  
ATOM 6314  C CZ   . TYR A 1 5  ? -13.573 -12.322 -28.712 1.00 0.00 ? 5  TYR A CZ   7  
ATOM 6315  O OH   . TYR A 1 5  ? -13.871 -11.950 -30.007 1.00 0.00 ? 5  TYR A OH   7  
ATOM 6316  H H    . TYR A 1 5  ? -10.890 -12.963 -22.379 1.00 0.00 ? 5  TYR A H    7  
ATOM 6317  H HA   . TYR A 1 5  ? -10.649 -14.158 -25.046 1.00 0.00 ? 5  TYR A HA   7  
ATOM 6318  H HB2  . TYR A 1 5  ? -12.988 -14.490 -24.496 1.00 0.00 ? 5  TYR A HB2  7  
ATOM 6319  H HB3  . TYR A 1 5  ? -13.143 -12.811 -23.979 1.00 0.00 ? 5  TYR A HB3  7  
ATOM 6320  H HD1  . TYR A 1 5  ? -12.187 -14.885 -26.953 1.00 0.00 ? 5  TYR A HD1  7  
ATOM 6321  H HD2  . TYR A 1 5  ? -13.813 -11.177 -25.517 1.00 0.00 ? 5  TYR A HD2  7  
ATOM 6322  H HE1  . TYR A 1 5  ? -12.726 -14.219 -29.280 1.00 0.00 ? 5  TYR A HE1  7  
ATOM 6323  H HE2  . TYR A 1 5  ? -14.349 -10.511 -27.844 1.00 0.00 ? 5  TYR A HE2  7  
ATOM 6324  H HH   . TYR A 1 5  ? -13.166 -12.264 -30.575 1.00 0.00 ? 5  TYR A HH   7  
ATOM 6325  N N    . LEU A 1 6  ? -10.048 -11.917 -26.015 1.00 0.00 ? 6  LEU A N    7  
ATOM 6326  C CA   . LEU A 1 6  ? -9.509  -10.641 -26.477 1.00 0.00 ? 6  LEU A CA   7  
ATOM 6327  C C    . LEU A 1 6  ? -10.645 -9.652  -26.723 1.00 0.00 ? 6  LEU A C    7  
ATOM 6328  O O    . LEU A 1 6  ? -11.782 -10.052 -26.963 1.00 0.00 ? 6  LEU A O    7  
ATOM 6329  C CB   . LEU A 1 6  ? -8.718  -10.845 -27.773 1.00 0.00 ? 6  LEU A CB   7  
ATOM 6330  C CG   . LEU A 1 6  ? -7.572  -11.834 -27.531 1.00 0.00 ? 6  LEU A CG   7  
ATOM 6331  C CD1  . LEU A 1 6  ? -6.827  -12.080 -28.844 1.00 0.00 ? 6  LEU A CD1  7  
ATOM 6332  C CD2  . LEU A 1 6  ? -6.598  -11.264 -26.495 1.00 0.00 ? 6  LEU A CD2  7  
ATOM 6333  H H    . LEU A 1 6  ? -10.000 -12.693 -26.611 1.00 0.00 ? 6  LEU A H    7  
ATOM 6334  H HA   . LEU A 1 6  ? -8.854  -10.239 -25.721 1.00 0.00 ? 6  LEU A HA   7  
ATOM 6335  H HB2  . LEU A 1 6  ? -9.374  -11.236 -28.535 1.00 0.00 ? 6  LEU A HB2  7  
ATOM 6336  H HB3  . LEU A 1 6  ? -8.312  -9.898  -28.098 1.00 0.00 ? 6  LEU A HB3  7  
ATOM 6337  H HG   . LEU A 1 6  ? -7.978  -12.770 -27.168 1.00 0.00 ? 6  LEU A HG   7  
ATOM 6338  H HD11 . LEU A 1 6  ? -6.817  -13.138 -29.059 1.00 0.00 ? 6  LEU A HD11 7  
ATOM 6339  H HD12 . LEU A 1 6  ? -5.813  -11.720 -28.754 1.00 0.00 ? 6  LEU A HD12 7  
ATOM 6340  H HD13 . LEU A 1 6  ? -7.328  -11.555 -29.644 1.00 0.00 ? 6  LEU A HD13 7  
ATOM 6341  H HD21 . LEU A 1 6  ? -6.919  -11.546 -25.504 1.00 0.00 ? 6  LEU A HD21 7  
ATOM 6342  H HD22 . LEU A 1 6  ? -6.575  -10.187 -26.573 1.00 0.00 ? 6  LEU A HD22 7  
ATOM 6343  H HD23 . LEU A 1 6  ? -5.608  -11.657 -26.678 1.00 0.00 ? 6  LEU A HD23 7  
ATOM 6344  N N    . GLY A 1 7  ? -10.340 -8.362  -26.643 1.00 0.00 ? 7  GLY A N    7  
ATOM 6345  C CA   . GLY A 1 7  ? -11.367 -7.346  -26.841 1.00 0.00 ? 7  GLY A CA   7  
ATOM 6346  C C    . GLY A 1 7  ? -12.108 -7.082  -25.537 1.00 0.00 ? 7  GLY A C    7  
ATOM 6347  O O    . GLY A 1 7  ? -13.305 -6.796  -25.532 1.00 0.00 ? 7  GLY A O    7  
ATOM 6348  H H    . GLY A 1 7  ? -9.421  -8.093  -26.432 1.00 0.00 ? 7  GLY A H    7  
ATOM 6349  H HA2  . GLY A 1 7  ? -10.903 -6.432  -27.183 1.00 0.00 ? 7  GLY A HA2  7  
ATOM 6350  H HA3  . GLY A 1 7  ? -12.071 -7.689  -27.585 1.00 0.00 ? 7  GLY A HA3  7  
ATOM 6351  N N    . GLY A 1 8  ? -11.376 -7.175  -24.431 1.00 0.00 ? 8  GLY A N    7  
ATOM 6352  C CA   . GLY A 1 8  ? -11.960 -6.938  -23.117 1.00 0.00 ? 8  GLY A CA   7  
ATOM 6353  C C    . GLY A 1 8  ? -11.953 -5.448  -22.787 1.00 0.00 ? 8  GLY A C    7  
ATOM 6354  O O    . GLY A 1 8  ? -10.891 -4.832  -22.685 1.00 0.00 ? 8  GLY A O    7  
ATOM 6355  H H    . GLY A 1 8  ? -10.423 -7.386  -24.515 1.00 0.00 ? 8  GLY A H    7  
ATOM 6356  H HA2  . GLY A 1 8  ? -12.977 -7.302  -23.108 1.00 0.00 ? 8  GLY A HA2  7  
ATOM 6357  H HA3  . GLY A 1 8  ? -11.386 -7.466  -22.370 1.00 0.00 ? 8  GLY A HA3  7  
ATOM 6358  N N    . SER A 1 9  ? -13.148 -4.877  -22.642 1.00 0.00 ? 9  SER A N    7  
ATOM 6359  C CA   . SER A 1 9  ? -13.279 -3.453  -22.343 1.00 0.00 ? 9  SER A CA   7  
ATOM 6360  C C    . SER A 1 9  ? -14.193 -3.229  -21.133 1.00 0.00 ? 9  SER A C    7  
ATOM 6361  O O    . SER A 1 9  ? -15.087 -4.038  -20.879 1.00 0.00 ? 9  SER A O    7  
ATOM 6362  C CB   . SER A 1 9  ? -13.855 -2.722  -23.556 1.00 0.00 ? 9  SER A CB   7  
ATOM 6363  O OG   . SER A 1 9  ? -12.959 -2.850  -24.653 1.00 0.00 ? 9  SER A OG   7  
ATOM 6364  H H    . SER A 1 9  ? -13.951 -5.426  -22.757 1.00 0.00 ? 9  SER A H    7  
ATOM 6365  H HA   . SER A 1 9  ? -12.302 -3.062  -22.139 1.00 0.00 ? 9  SER A HA   7  
ATOM 6366  H HB2  . SER A 1 9  ? -14.805 -3.155  -23.822 1.00 0.00 ? 9  SER A HB2  7  
ATOM 6367  H HB3  . SER A 1 9  ? -13.994 -1.676  -23.312 1.00 0.00 ? 9  SER A HB3  7  
ATOM 6368  H HG   . SER A 1 9  ? -12.500 -2.014  -24.759 1.00 0.00 ? 9  SER A HG   7  
ATOM 6369  N N    . PRO A 1 10 ? -14.012 -2.156  -20.385 1.00 0.00 ? 10 PRO A N    7  
ATOM 6370  C CA   . PRO A 1 10 ? -14.874 -1.864  -19.196 1.00 0.00 ? 10 PRO A CA   7  
ATOM 6371  C C    . PRO A 1 10 ? -16.361 -1.925  -19.537 1.00 0.00 ? 10 PRO A C    7  
ATOM 6372  O O    . PRO A 1 10 ? -16.778 -1.524  -20.625 1.00 0.00 ? 10 PRO A O    7  
ATOM 6373  C CB   . PRO A 1 10 ? -14.487 -0.435  -18.814 1.00 0.00 ? 10 PRO A CB   7  
ATOM 6374  C CG   . PRO A 1 10 ? -13.090 -0.273  -19.291 1.00 0.00 ? 10 PRO A CG   7  
ATOM 6375  C CD   . PRO A 1 10 ? -12.978 -1.109  -20.565 1.00 0.00 ? 10 PRO A CD   7  
ATOM 6376  H HA   . PRO A 1 10 ? -14.642 -2.533  -18.385 1.00 0.00 ? 10 PRO A HA   7  
ATOM 6377  H HB2  . PRO A 1 10 ? -15.141 0.273   -19.305 1.00 0.00 ? 10 PRO A HB2  7  
ATOM 6378  H HB3  . PRO A 1 10 ? -14.530 -0.307  -17.744 1.00 0.00 ? 10 PRO A HB3  7  
ATOM 6379  H HG2  . PRO A 1 10 ? -12.890 0.768   -19.505 1.00 0.00 ? 10 PRO A HG2  7  
ATOM 6380  H HG3  . PRO A 1 10 ? -12.398 -0.644  -18.553 1.00 0.00 ? 10 PRO A HG3  7  
ATOM 6381  H HD2  . PRO A 1 10 ? -13.183 -0.503  -21.438 1.00 0.00 ? 10 PRO A HD2  7  
ATOM 6382  H HD3  . PRO A 1 10 ? -11.998 -1.546  -20.621 1.00 0.00 ? 10 PRO A HD3  7  
ATOM 6383  N N    . LYS A 1 11 ? -17.155 -2.425  -18.596 1.00 0.00 ? 11 LYS A N    7  
ATOM 6384  C CA   . LYS A 1 11 ? -18.596 -2.533  -18.798 1.00 0.00 ? 11 LYS A CA   7  
ATOM 6385  C C    . LYS A 1 11 ? -19.295 -1.264  -18.317 1.00 0.00 ? 11 LYS A C    7  
ATOM 6386  O O    . LYS A 1 11 ? -20.519 -1.152  -18.388 1.00 0.00 ? 11 LYS A O    7  
ATOM 6387  C CB   . LYS A 1 11 ? -19.141 -3.740  -18.033 1.00 0.00 ? 11 LYS A CB   7  
ATOM 6388  C CG   . LYS A 1 11 ? -18.550 -5.024  -18.614 1.00 0.00 ? 11 LYS A CG   7  
ATOM 6389  C CD   . LYS A 1 11 ? -19.094 -6.232  -17.847 1.00 0.00 ? 11 LYS A CD   7  
ATOM 6390  C CE   . LYS A 1 11 ? -18.501 -7.516  -18.426 1.00 0.00 ? 11 LYS A CE   7  
ATOM 6391  N NZ   . LYS A 1 11 ? -19.026 -8.690  -17.673 1.00 0.00 ? 11 LYS A NZ   7  
ATOM 6392  H H    . LYS A 1 11 ? -16.768 -2.722  -17.747 1.00 0.00 ? 11 LYS A H    7  
ATOM 6393  H HA   . LYS A 1 11 ? -18.796 -2.667  -19.851 1.00 0.00 ? 11 LYS A HA   7  
ATOM 6394  H HB2  . LYS A 1 11 ? -18.867 -3.657  -16.989 1.00 0.00 ? 11 LYS A HB2  7  
ATOM 6395  H HB3  . LYS A 1 11 ? -20.217 -3.768  -18.122 1.00 0.00 ? 11 LYS A HB3  7  
ATOM 6396  H HG2  . LYS A 1 11 ? -18.822 -5.106  -19.657 1.00 0.00 ? 11 LYS A HG2  7  
ATOM 6397  H HG3  . LYS A 1 11 ? -17.474 -4.999  -18.525 1.00 0.00 ? 11 LYS A HG3  7  
ATOM 6398  H HD2  . LYS A 1 11 ? -18.823 -6.147  -16.805 1.00 0.00 ? 11 LYS A HD2  7  
ATOM 6399  H HD3  . LYS A 1 11 ? -20.170 -6.260  -17.938 1.00 0.00 ? 11 LYS A HD3  7  
ATOM 6400  H HE2  . LYS A 1 11 ? -18.779 -7.604  -19.466 1.00 0.00 ? 11 LYS A HE2  7  
ATOM 6401  H HE3  . LYS A 1 11 ? -17.425 -7.487  -18.343 1.00 0.00 ? 11 LYS A HE3  7  
ATOM 6402  H HZ1  . LYS A 1 11 ? -19.639 -9.257  -18.293 1.00 0.00 ? 11 LYS A HZ1  7  
ATOM 6403  H HZ2  . LYS A 1 11 ? -19.574 -8.358  -16.853 1.00 0.00 ? 11 LYS A HZ2  7  
ATOM 6404  H HZ3  . LYS A 1 11 ? -18.232 -9.277  -17.345 1.00 0.00 ? 11 LYS A HZ3  7  
ATOM 6405  N N    . GLY A 1 12 ? -18.506 -0.310  -17.833 1.00 0.00 ? 12 GLY A N    7  
ATOM 6406  C CA   . GLY A 1 12 ? -19.050 0.952   -17.347 1.00 0.00 ? 12 GLY A CA   7  
ATOM 6407  C C    . GLY A 1 12 ? -19.577 0.810   -15.923 1.00 0.00 ? 12 GLY A C    7  
ATOM 6408  O O    . GLY A 1 12 ? -20.094 1.766   -15.345 1.00 0.00 ? 12 GLY A O    7  
ATOM 6409  H H    . GLY A 1 12 ? -17.537 -0.452  -17.813 1.00 0.00 ? 12 GLY A H    7  
ATOM 6410  H HA2  . GLY A 1 12 ? -18.274 1.703   -17.366 1.00 0.00 ? 12 GLY A HA2  7  
ATOM 6411  H HA3  . GLY A 1 12 ? -19.859 1.262   -17.993 1.00 0.00 ? 12 GLY A HA3  7  
ATOM 6412  N N    . ASP A 1 13 ? -19.438 -0.387  -15.362 1.00 0.00 ? 13 ASP A N    7  
ATOM 6413  C CA   . ASP A 1 13 ? -19.905 -0.627  -14.002 1.00 0.00 ? 13 ASP A CA   7  
ATOM 6414  C C    . ASP A 1 13 ? -21.284 0.000   -13.817 1.00 0.00 ? 13 ASP A C    7  
ATOM 6415  O O    . ASP A 1 13 ? -21.438 0.969   -13.075 1.00 0.00 ? 13 ASP A O    7  
ATOM 6416  C CB   . ASP A 1 13 ? -18.924 -0.025  -12.994 1.00 0.00 ? 13 ASP A CB   7  
ATOM 6417  C CG   . ASP A 1 13 ? -19.276 -0.488  -11.585 1.00 0.00 ? 13 ASP A CG   7  
ATOM 6418  O OD1  . ASP A 1 13 ? -20.356 -1.030  -11.413 1.00 0.00 ? 13 ASP A OD1  7  
ATOM 6419  O OD2  . ASP A 1 13 ? -18.462 -0.294  -10.698 1.00 0.00 ? 13 ASP A OD2  7  
ATOM 6420  H H    . ASP A 1 13 ? -19.015 -1.104  -15.878 1.00 0.00 ? 13 ASP A H    7  
ATOM 6421  H HA   . ASP A 1 13 ? -19.976 -1.692  -13.834 1.00 0.00 ? 13 ASP A HA   7  
ATOM 6422  H HB2  . ASP A 1 13 ? -17.921 -0.342  -13.237 1.00 0.00 ? 13 ASP A HB2  7  
ATOM 6423  H HB3  . ASP A 1 13 ? -18.979 1.052   -13.040 1.00 0.00 ? 13 ASP A HB3  7  
ATOM 6424  N N    . VAL A 1 14 ? -22.281 -0.553  -14.501 1.00 0.00 ? 14 VAL A N    7  
ATOM 6425  C CA   . VAL A 1 14 ? -23.638 -0.028  -14.404 1.00 0.00 ? 14 VAL A CA   7  
ATOM 6426  C C    . VAL A 1 14 ? -24.669 -1.134  -14.604 1.00 0.00 ? 14 VAL A C    7  
ATOM 6427  O O    . VAL A 1 14 ? -24.439 -2.084  -15.354 1.00 0.00 ? 14 VAL A O    7  
ATOM 6428  C CB   . VAL A 1 14 ? -23.850 1.062   -15.456 1.00 0.00 ? 14 VAL A CB   7  
ATOM 6429  C CG1  . VAL A 1 14 ? -23.683 0.464   -16.854 1.00 0.00 ? 14 VAL A CG1  7  
ATOM 6430  C CG2  . VAL A 1 14 ? -25.260 1.639   -15.314 1.00 0.00 ? 14 VAL A CG2  7  
ATOM 6431  H H    . VAL A 1 14 ? -22.102 -1.333  -15.066 1.00 0.00 ? 14 VAL A H    7  
ATOM 6432  H HA   . VAL A 1 14 ? -23.776 0.405   -13.426 1.00 0.00 ? 14 VAL A HA   7  
ATOM 6433  H HB   . VAL A 1 14 ? -23.122 1.847   -15.312 1.00 0.00 ? 14 VAL A HB   7  
ATOM 6434  H HG11 . VAL A 1 14 ? -22.995 1.069   -17.425 1.00 0.00 ? 14 VAL A HG11 7  
ATOM 6435  H HG12 . VAL A 1 14 ? -24.641 0.442   -17.353 1.00 0.00 ? 14 VAL A HG12 7  
ATOM 6436  H HG13 . VAL A 1 14 ? -23.296 -0.541  -16.772 1.00 0.00 ? 14 VAL A HG13 7  
ATOM 6437  H HG21 . VAL A 1 14 ? -25.978 0.936   -15.711 1.00 0.00 ? 14 VAL A HG21 7  
ATOM 6438  H HG22 . VAL A 1 14 ? -25.326 2.567   -15.862 1.00 0.00 ? 14 VAL A HG22 7  
ATOM 6439  H HG23 . VAL A 1 14 ? -25.473 1.820   -14.272 1.00 0.00 ? 14 VAL A HG23 7  
ATOM 6440  N N    . ASP A 1 15 ? -25.804 -1.002  -13.921 1.00 0.00 ? 15 ASP A N    7  
ATOM 6441  C CA   . ASP A 1 15 ? -26.872 -1.992  -14.015 1.00 0.00 ? 15 ASP A CA   7  
ATOM 6442  C C    . ASP A 1 15 ? -28.136 -1.340  -14.586 1.00 0.00 ? 15 ASP A C    7  
ATOM 6443  O O    . ASP A 1 15 ? -29.004 -0.896  -13.836 1.00 0.00 ? 15 ASP A O    7  
ATOM 6444  C CB   . ASP A 1 15 ? -27.171 -2.541  -12.618 1.00 0.00 ? 15 ASP A CB   7  
ATOM 6445  C CG   . ASP A 1 15 ? -25.923 -3.203  -12.042 1.00 0.00 ? 15 ASP A CG   7  
ATOM 6446  O OD1  . ASP A 1 15 ? -24.989 -3.418  -12.796 1.00 0.00 ? 15 ASP A OD1  7  
ATOM 6447  O OD2  . ASP A 1 15 ? -25.920 -3.485  -10.854 1.00 0.00 ? 15 ASP A OD2  7  
ATOM 6448  H H    . ASP A 1 15 ? -25.922 -0.231  -13.328 1.00 0.00 ? 15 ASP A H    7  
ATOM 6449  H HA   . ASP A 1 15 ? -26.558 -2.803  -14.648 1.00 0.00 ? 15 ASP A HA   7  
ATOM 6450  H HB2  . ASP A 1 15 ? -27.477 -1.731  -11.973 1.00 0.00 ? 15 ASP A HB2  7  
ATOM 6451  H HB3  . ASP A 1 15 ? -27.963 -3.269  -12.677 1.00 0.00 ? 15 ASP A HB3  7  
ATOM 6452  N N    . PRO A 1 16 ? -28.243 -1.257  -15.894 1.00 0.00 ? 16 PRO A N    7  
ATOM 6453  C CA   . PRO A 1 16 ? -29.410 -0.625  -16.572 1.00 0.00 ? 16 PRO A CA   7  
ATOM 6454  C C    . PRO A 1 16 ? -30.607 -1.567  -16.727 1.00 0.00 ? 16 PRO A C    7  
ATOM 6455  O O    . PRO A 1 16 ? -31.334 -1.501  -17.718 1.00 0.00 ? 16 PRO A O    7  
ATOM 6456  C CB   . PRO A 1 16 ? -28.839 -0.230  -17.932 1.00 0.00 ? 16 PRO A CB   7  
ATOM 6457  C CG   . PRO A 1 16 ? -27.797 -1.258  -18.228 1.00 0.00 ? 16 PRO A CG   7  
ATOM 6458  C CD   . PRO A 1 16 ? -27.260 -1.751  -16.878 1.00 0.00 ? 16 PRO A CD   7  
ATOM 6459  H HA   . PRO A 1 16 ? -29.709 0.264   -16.043 1.00 0.00 ? 16 PRO A HA   7  
ATOM 6460  H HB2  . PRO A 1 16 ? -29.613 -0.246  -18.687 1.00 0.00 ? 16 PRO A HB2  7  
ATOM 6461  H HB3  . PRO A 1 16 ? -28.385 0.748   -17.878 1.00 0.00 ? 16 PRO A HB3  7  
ATOM 6462  H HG2  . PRO A 1 16 ? -28.237 -2.080  -18.777 1.00 0.00 ? 16 PRO A HG2  7  
ATOM 6463  H HG3  . PRO A 1 16 ? -26.995 -0.818  -18.797 1.00 0.00 ? 16 PRO A HG3  7  
ATOM 6464  H HD2  . PRO A 1 16 ? -27.220 -2.832  -16.867 1.00 0.00 ? 16 PRO A HD2  7  
ATOM 6465  H HD3  . PRO A 1 16 ? -26.288 -1.330  -16.680 1.00 0.00 ? 16 PRO A HD3  7  
ATOM 6466  N N    . PHE A 1 17 ? -30.813 -2.440  -15.747 1.00 0.00 ? 17 PHE A N    7  
ATOM 6467  C CA   . PHE A 1 17 ? -31.929 -3.378  -15.807 1.00 0.00 ? 17 PHE A CA   7  
ATOM 6468  C C    . PHE A 1 17 ? -33.250 -2.621  -15.888 1.00 0.00 ? 17 PHE A C    7  
ATOM 6469  O O    . PHE A 1 17 ? -34.282 -3.188  -16.245 1.00 0.00 ? 17 PHE A O    7  
ATOM 6470  C CB   . PHE A 1 17 ? -31.921 -4.291  -14.579 1.00 0.00 ? 17 PHE A CB   7  
ATOM 6471  C CG   . PHE A 1 17 ? -30.926 -5.404  -14.795 1.00 0.00 ? 17 PHE A CG   7  
ATOM 6472  C CD1  . PHE A 1 17 ? -29.556 -5.155  -14.661 1.00 0.00 ? 17 PHE A CD1  7  
ATOM 6473  C CD2  . PHE A 1 17 ? -31.372 -6.690  -15.124 1.00 0.00 ? 17 PHE A CD2  7  
ATOM 6474  C CE1  . PHE A 1 17 ? -28.632 -6.186  -14.858 1.00 0.00 ? 17 PHE A CE1  7  
ATOM 6475  C CE2  . PHE A 1 17 ? -30.449 -7.723  -15.321 1.00 0.00 ? 17 PHE A CE2  7  
ATOM 6476  C CZ   . PHE A 1 17 ? -29.079 -7.472  -15.188 1.00 0.00 ? 17 PHE A CZ   7  
ATOM 6477  H H    . PHE A 1 17 ? -30.200 -2.462  -14.982 1.00 0.00 ? 17 PHE A H    7  
ATOM 6478  H HA   . PHE A 1 17 ? -31.824 -3.988  -16.692 1.00 0.00 ? 17 PHE A HA   7  
ATOM 6479  H HB2  . PHE A 1 17 ? -31.643 -3.718  -13.707 1.00 0.00 ? 17 PHE A HB2  7  
ATOM 6480  H HB3  . PHE A 1 17 ? -32.906 -4.711  -14.437 1.00 0.00 ? 17 PHE A HB3  7  
ATOM 6481  H HD1  . PHE A 1 17 ? -29.213 -4.163  -14.412 1.00 0.00 ? 17 PHE A HD1  7  
ATOM 6482  H HD2  . PHE A 1 17 ? -32.431 -6.884  -15.226 1.00 0.00 ? 17 PHE A HD2  7  
ATOM 6483  H HE1  . PHE A 1 17 ? -27.575 -5.992  -14.755 1.00 0.00 ? 17 PHE A HE1  7  
ATOM 6484  H HE2  . PHE A 1 17 ? -30.794 -8.714  -15.575 1.00 0.00 ? 17 PHE A HE2  7  
ATOM 6485  H HZ   . PHE A 1 17 ? -28.366 -8.269  -15.339 1.00 0.00 ? 17 PHE A HZ   7  
ATOM 6486  N N    . TYR A 1 18 ? -33.208 -1.333  -15.563 1.00 0.00 ? 18 TYR A N    7  
ATOM 6487  C CA   . TYR A 1 18 ? -34.407 -0.504  -15.613 1.00 0.00 ? 18 TYR A CA   7  
ATOM 6488  C C    . TYR A 1 18 ? -34.975 -0.502  -17.029 1.00 0.00 ? 18 TYR A C    7  
ATOM 6489  O O    . TYR A 1 18 ? -36.177 -0.636  -17.224 1.00 0.00 ? 18 TYR A O    7  
ATOM 6490  C CB   . TYR A 1 18 ? -34.075 0.929   -15.188 1.00 0.00 ? 18 TYR A CB   7  
ATOM 6491  C CG   . TYR A 1 18 ? -35.319 1.780   -15.273 1.00 0.00 ? 18 TYR A CG   7  
ATOM 6492  C CD1  . TYR A 1 18 ? -36.291 1.702   -14.267 1.00 0.00 ? 18 TYR A CD1  7  
ATOM 6493  C CD2  . TYR A 1 18 ? -35.501 2.648   -16.356 1.00 0.00 ? 18 TYR A CD2  7  
ATOM 6494  C CE1  . TYR A 1 18 ? -37.443 2.491   -14.346 1.00 0.00 ? 18 TYR A CE1  7  
ATOM 6495  C CE2  . TYR A 1 18 ? -36.655 3.438   -16.433 1.00 0.00 ? 18 TYR A CE2  7  
ATOM 6496  C CZ   . TYR A 1 18 ? -37.627 3.358   -15.428 1.00 0.00 ? 18 TYR A CZ   7  
ATOM 6497  O OH   . TYR A 1 18 ? -38.764 4.136   -15.506 1.00 0.00 ? 18 TYR A OH   7  
ATOM 6498  H H    . TYR A 1 18 ? -32.360 -0.934  -15.280 1.00 0.00 ? 18 TYR A H    7  
ATOM 6499  H HA   . TYR A 1 18 ? -35.145 -0.909  -14.938 1.00 0.00 ? 18 TYR A HA   7  
ATOM 6500  H HB2  . TYR A 1 18 ? -33.709 0.926   -14.172 1.00 0.00 ? 18 TYR A HB2  7  
ATOM 6501  H HB3  . TYR A 1 18 ? -33.318 1.333   -15.844 1.00 0.00 ? 18 TYR A HB3  7  
ATOM 6502  H HD1  . TYR A 1 18 ? -36.150 1.031   -13.432 1.00 0.00 ? 18 TYR A HD1  7  
ATOM 6503  H HD2  . TYR A 1 18 ? -34.752 2.709   -17.132 1.00 0.00 ? 18 TYR A HD2  7  
ATOM 6504  H HE1  . TYR A 1 18 ? -38.193 2.431   -13.570 1.00 0.00 ? 18 TYR A HE1  7  
ATOM 6505  H HE2  . TYR A 1 18 ? -36.796 4.108   -17.269 1.00 0.00 ? 18 TYR A HE2  7  
ATOM 6506  H HH   . TYR A 1 18 ? -39.491 3.572   -15.779 1.00 0.00 ? 18 TYR A HH   7  
ATOM 6507  N N    . TYR A 1 19 ? -34.097 -0.363  -18.013 1.00 0.00 ? 19 TYR A N    7  
ATOM 6508  C CA   . TYR A 1 19 ? -34.521 -0.361  -19.410 1.00 0.00 ? 19 TYR A CA   7  
ATOM 6509  C C    . TYR A 1 19 ? -35.260 -1.659  -19.732 1.00 0.00 ? 19 TYR A C    7  
ATOM 6510  O O    . TYR A 1 19 ? -36.241 -1.663  -20.476 1.00 0.00 ? 19 TYR A O    7  
ATOM 6511  C CB   . TYR A 1 19 ? -33.304 -0.220  -20.327 1.00 0.00 ? 19 TYR A CB   7  
ATOM 6512  C CG   . TYR A 1 19 ? -33.757 -0.209  -21.768 1.00 0.00 ? 19 TYR A CG   7  
ATOM 6513  C CD1  . TYR A 1 19 ? -34.317 0.951   -22.316 1.00 0.00 ? 19 TYR A CD1  7  
ATOM 6514  C CD2  . TYR A 1 19 ? -33.614 -1.359  -22.554 1.00 0.00 ? 19 TYR A CD2  7  
ATOM 6515  C CE1  . TYR A 1 19 ? -34.736 0.961   -23.652 1.00 0.00 ? 19 TYR A CE1  7  
ATOM 6516  C CE2  . TYR A 1 19 ? -34.034 -1.349  -23.890 1.00 0.00 ? 19 TYR A CE2  7  
ATOM 6517  C CZ   . TYR A 1 19 ? -34.595 -0.188  -24.439 1.00 0.00 ? 19 TYR A CZ   7  
ATOM 6518  O OH   . TYR A 1 19 ? -35.009 -0.178  -25.755 1.00 0.00 ? 19 TYR A OH   7  
ATOM 6519  H H    . TYR A 1 19 ? -33.145 -0.271  -17.797 1.00 0.00 ? 19 TYR A H    7  
ATOM 6520  H HA   . TYR A 1 19 ? -35.185 0.475   -19.576 1.00 0.00 ? 19 TYR A HA   7  
ATOM 6521  H HB2  . TYR A 1 19 ? -32.791 0.704   -20.103 1.00 0.00 ? 19 TYR A HB2  7  
ATOM 6522  H HB3  . TYR A 1 19 ? -32.634 -1.052  -20.168 1.00 0.00 ? 19 TYR A HB3  7  
ATOM 6523  H HD1  . TYR A 1 19 ? -34.426 1.836   -21.709 1.00 0.00 ? 19 TYR A HD1  7  
ATOM 6524  H HD2  . TYR A 1 19 ? -33.183 -2.252  -22.131 1.00 0.00 ? 19 TYR A HD2  7  
ATOM 6525  H HE1  . TYR A 1 19 ? -35.169 1.855   -24.075 1.00 0.00 ? 19 TYR A HE1  7  
ATOM 6526  H HE2  . TYR A 1 19 ? -33.925 -2.234  -24.497 1.00 0.00 ? 19 TYR A HE2  7  
ATOM 6527  H HH   . TYR A 1 19 ? -35.745 -0.788  -25.840 1.00 0.00 ? 19 TYR A HH   7  
ATOM 6528  N N    . ASP A 1 20 ? -34.779 -2.754  -19.155 1.00 0.00 ? 20 ASP A N    7  
ATOM 6529  C CA   . ASP A 1 20 ? -35.391 -4.064  -19.365 1.00 0.00 ? 20 ASP A CA   7  
ATOM 6530  C C    . ASP A 1 20 ? -36.746 -4.142  -18.661 1.00 0.00 ? 20 ASP A C    7  
ATOM 6531  O O    . ASP A 1 20 ? -37.484 -5.116  -18.819 1.00 0.00 ? 20 ASP A O    7  
ATOM 6532  C CB   . ASP A 1 20 ? -34.472 -5.166  -18.833 1.00 0.00 ? 20 ASP A CB   7  
ATOM 6533  C CG   . ASP A 1 20 ? -33.246 -5.300  -19.728 1.00 0.00 ? 20 ASP A CG   7  
ATOM 6534  O OD1  . ASP A 1 20 ? -33.270 -4.754  -20.818 1.00 0.00 ? 20 ASP A OD1  7  
ATOM 6535  O OD2  . ASP A 1 20 ? -32.300 -5.948  -19.310 1.00 0.00 ? 20 ASP A OD2  7  
ATOM 6536  H H    . ASP A 1 20 ? -34.003 -2.673  -18.563 1.00 0.00 ? 20 ASP A H    7  
ATOM 6537  H HA   . ASP A 1 20 ? -35.538 -4.216  -20.424 1.00 0.00 ? 20 ASP A HA   7  
ATOM 6538  H HB2  . ASP A 1 20 ? -34.159 -4.917  -17.830 1.00 0.00 ? 20 ASP A HB2  7  
ATOM 6539  H HB3  . ASP A 1 20 ? -35.009 -6.103  -18.819 1.00 0.00 ? 20 ASP A HB3  7  
ATOM 6540  N N    . TYR A 1 21 ? -37.056 -3.119  -17.870 1.00 0.00 ? 21 TYR A N    7  
ATOM 6541  C CA   . TYR A 1 21 ? -38.313 -3.094  -17.123 1.00 0.00 ? 21 TYR A CA   7  
ATOM 6542  C C    . TYR A 1 21 ? -39.503 -3.116  -18.078 1.00 0.00 ? 21 TYR A C    7  
ATOM 6543  O O    . TYR A 1 21 ? -40.476 -3.831  -17.846 1.00 0.00 ? 21 TYR A O    7  
ATOM 6544  C CB   . TYR A 1 21 ? -38.397 -1.839  -16.253 1.00 0.00 ? 21 TYR A CB   7  
ATOM 6545  C CG   . TYR A 1 21 ? -39.652 -1.897  -15.417 1.00 0.00 ? 21 TYR A CG   7  
ATOM 6546  C CD1  . TYR A 1 21 ? -39.686 -2.683  -14.259 1.00 0.00 ? 21 TYR A CD1  7  
ATOM 6547  C CD2  . TYR A 1 21 ? -40.783 -1.166  -15.799 1.00 0.00 ? 21 TYR A CD2  7  
ATOM 6548  C CE1  . TYR A 1 21 ? -40.849 -2.738  -13.482 1.00 0.00 ? 21 TYR A CE1  7  
ATOM 6549  C CE2  . TYR A 1 21 ? -41.947 -1.220  -15.023 1.00 0.00 ? 21 TYR A CE2  7  
ATOM 6550  C CZ   . TYR A 1 21 ? -41.981 -2.006  -13.864 1.00 0.00 ? 21 TYR A CZ   7  
ATOM 6551  O OH   . TYR A 1 21 ? -43.128 -2.060  -13.100 1.00 0.00 ? 21 TYR A OH   7  
ATOM 6552  H H    . TYR A 1 21 ? -36.411 -2.388  -17.773 1.00 0.00 ? 21 TYR A H    7  
ATOM 6553  H HA   . TYR A 1 21 ? -38.359 -3.962  -16.486 1.00 0.00 ? 21 TYR A HA   7  
ATOM 6554  H HB2  . TYR A 1 21 ? -37.533 -1.784  -15.609 1.00 0.00 ? 21 TYR A HB2  7  
ATOM 6555  H HB3  . TYR A 1 21 ? -38.436 -0.966  -16.886 1.00 0.00 ? 21 TYR A HB3  7  
ATOM 6556  H HD1  . TYR A 1 21 ? -38.813 -3.247  -13.964 1.00 0.00 ? 21 TYR A HD1  7  
ATOM 6557  H HD2  . TYR A 1 21 ? -40.757 -0.559  -16.692 1.00 0.00 ? 21 TYR A HD2  7  
ATOM 6558  H HE1  . TYR A 1 21 ? -40.875 -3.344  -12.589 1.00 0.00 ? 21 TYR A HE1  7  
ATOM 6559  H HE2  . TYR A 1 21 ? -42.820 -0.656  -15.317 1.00 0.00 ? 21 TYR A HE2  7  
ATOM 6560  H HH   . TYR A 1 21 ? -43.867 -2.242  -13.686 1.00 0.00 ? 21 TYR A HH   7  
ATOM 6561  N N    . GLU A 1 22 ? -39.431 -2.335  -19.148 1.00 0.00 ? 22 GLU A N    7  
ATOM 6562  C CA   . GLU A 1 22 ? -40.529 -2.298  -20.104 1.00 0.00 ? 22 GLU A CA   7  
ATOM 6563  C C    . GLU A 1 22 ? -40.765 -3.700  -20.665 1.00 0.00 ? 22 GLU A C    7  
ATOM 6564  O O    . GLU A 1 22 ? -41.902 -4.167  -20.730 1.00 0.00 ? 22 GLU A O    7  
ATOM 6565  C CB   . GLU A 1 22 ? -40.195 -1.324  -21.244 1.00 0.00 ? 22 GLU A CB   7  
ATOM 6566  C CG   . GLU A 1 22 ? -41.353 -1.263  -22.249 1.00 0.00 ? 22 GLU A CG   7  
ATOM 6567  C CD   . GLU A 1 22 ? -42.611 -0.732  -21.571 1.00 0.00 ? 22 GLU A CD   7  
ATOM 6568  O OE1  . GLU A 1 22 ? -42.480 -0.087  -20.542 1.00 0.00 ? 22 GLU A OE1  7  
ATOM 6569  O OE2  . GLU A 1 22 ? -43.687 -0.974  -22.091 1.00 0.00 ? 22 GLU A OE2  7  
ATOM 6570  H H    . GLU A 1 22 ? -38.639 -1.775  -19.290 1.00 0.00 ? 22 GLU A H    7  
ATOM 6571  H HA   . GLU A 1 22 ? -41.423 -1.964  -19.602 1.00 0.00 ? 22 GLU A HA   7  
ATOM 6572  H HB2  . GLU A 1 22 ? -40.026 -0.339  -20.832 1.00 0.00 ? 22 GLU A HB2  7  
ATOM 6573  H HB3  . GLU A 1 22 ? -39.301 -1.658  -21.749 1.00 0.00 ? 22 GLU A HB3  7  
ATOM 6574  H HG2  . GLU A 1 22 ? -41.082 -0.604  -23.061 1.00 0.00 ? 22 GLU A HG2  7  
ATOM 6575  H HG3  . GLU A 1 22 ? -41.547 -2.249  -22.643 1.00 0.00 ? 22 GLU A HG3  7  
ATOM 6576  N N    . THR A 1 23 ? -39.684 -4.372  -21.056 1.00 0.00 ? 23 THR A N    7  
ATOM 6577  C CA   . THR A 1 23 ? -39.792 -5.726  -21.591 1.00 0.00 ? 23 THR A CA   7  
ATOM 6578  C C    . THR A 1 23 ? -40.310 -6.683  -20.521 1.00 0.00 ? 23 THR A C    7  
ATOM 6579  O O    . THR A 1 23 ? -41.162 -7.525  -20.785 1.00 0.00 ? 23 THR A O    7  
ATOM 6580  C CB   . THR A 1 23 ? -38.425 -6.202  -22.085 1.00 0.00 ? 23 THR A CB   7  
ATOM 6581  O OG1  . THR A 1 23 ? -37.971 -5.340  -23.121 1.00 0.00 ? 23 THR A OG1  7  
ATOM 6582  C CG2  . THR A 1 23 ? -38.541 -7.629  -22.622 1.00 0.00 ? 23 THR A CG2  7  
ATOM 6583  H H    . THR A 1 23 ? -38.801 -3.955  -20.978 1.00 0.00 ? 23 THR A H    7  
ATOM 6584  H HA   . THR A 1 23 ? -40.482 -5.722  -22.422 1.00 0.00 ? 23 THR A HA   7  
ATOM 6585  H HB   . THR A 1 23 ? -37.720 -6.185  -21.269 1.00 0.00 ? 23 THR A HB   7  
ATOM 6586  H HG1  . THR A 1 23 ? -38.068 -4.434  -22.817 1.00 0.00 ? 23 THR A HG1  7  
ATOM 6587  H HG21 . THR A 1 23 ? -38.393 -8.330  -21.814 1.00 0.00 ? 23 THR A HG21 7  
ATOM 6588  H HG22 . THR A 1 23 ? -37.789 -7.792  -23.381 1.00 0.00 ? 23 THR A HG22 7  
ATOM 6589  H HG23 . THR A 1 23 ? -39.522 -7.775  -23.049 1.00 0.00 ? 23 THR A HG23 7  
ATOM 6590  N N    . VAL A 1 24 ? -39.760 -6.558  -19.318 1.00 0.00 ? 24 VAL A N    7  
ATOM 6591  C CA   . VAL A 1 24 ? -40.128 -7.431  -18.204 1.00 0.00 ? 24 VAL A CA   7  
ATOM 6592  C C    . VAL A 1 24 ? -41.640 -7.617  -18.101 1.00 0.00 ? 24 VAL A C    7  
ATOM 6593  O O    . VAL A 1 24 ? -42.102 -8.625  -17.579 1.00 0.00 ? 24 VAL A O    7  
ATOM 6594  C CB   . VAL A 1 24 ? -39.586 -6.870  -16.888 1.00 0.00 ? 24 VAL A CB   7  
ATOM 6595  C CG1  . VAL A 1 24 ? -40.226 -7.616  -15.716 1.00 0.00 ? 24 VAL A CG1  7  
ATOM 6596  C CG2  . VAL A 1 24 ? -38.070 -7.064  -16.842 1.00 0.00 ? 24 VAL A CG2  7  
ATOM 6597  H H    . VAL A 1 24 ? -39.050 -5.895  -19.192 1.00 0.00 ? 24 VAL A H    7  
ATOM 6598  H HA   . VAL A 1 24 ? -39.677 -8.399  -18.370 1.00 0.00 ? 24 VAL A HA   7  
ATOM 6599  H HB   . VAL A 1 24 ? -39.821 -5.820  -16.818 1.00 0.00 ? 24 VAL A HB   7  
ATOM 6600  H HG11 . VAL A 1 24 ? -41.205 -7.207  -15.519 1.00 0.00 ? 24 VAL A HG11 7  
ATOM 6601  H HG12 . VAL A 1 24 ? -39.605 -7.507  -14.839 1.00 0.00 ? 24 VAL A HG12 7  
ATOM 6602  H HG13 . VAL A 1 24 ? -40.318 -8.664  -15.963 1.00 0.00 ? 24 VAL A HG13 7  
ATOM 6603  H HG21 . VAL A 1 24 ? -37.699 -7.248  -17.839 1.00 0.00 ? 24 VAL A HG21 7  
ATOM 6604  H HG22 . VAL A 1 24 ? -37.833 -7.907  -16.210 1.00 0.00 ? 24 VAL A HG22 7  
ATOM 6605  H HG23 . VAL A 1 24 ? -37.604 -6.175  -16.444 1.00 0.00 ? 24 VAL A HG23 7  
ATOM 6606  N N    . ARG A 1 25 ? -42.411 -6.669  -18.607 1.00 0.00 ? 25 ARG A N    7  
ATOM 6607  C CA   . ARG A 1 25 ? -43.862 -6.822  -18.560 1.00 0.00 ? 25 ARG A CA   7  
ATOM 6608  C C    . ARG A 1 25 ? -44.308 -7.884  -19.577 1.00 0.00 ? 25 ARG A C    7  
ATOM 6609  O O    . ARG A 1 25 ? -45.010 -8.837  -19.239 1.00 0.00 ? 25 ARG A O    7  
ATOM 6610  C CB   . ARG A 1 25 ? -44.541 -5.486  -18.880 1.00 0.00 ? 25 ARG A CB   7  
ATOM 6611  C CG   . ARG A 1 25 ? -46.062 -5.648  -18.794 1.00 0.00 ? 25 ARG A CG   7  
ATOM 6612  C CD   . ARG A 1 25 ? -46.733 -4.290  -19.004 1.00 0.00 ? 25 ARG A CD   7  
ATOM 6613  N NE   . ARG A 1 25 ? -46.460 -3.797  -20.350 1.00 0.00 ? 25 ARG A NE   7  
ATOM 6614  C CZ   . ARG A 1 25 ? -46.814 -2.569  -20.716 1.00 0.00 ? 25 ARG A CZ   7  
ATOM 6615  N NH1  . ARG A 1 25 ? -47.416 -1.782  -19.866 1.00 0.00 ? 25 ARG A NH1  7  
ATOM 6616  N NH2  . ARG A 1 25 ? -46.560 -2.150  -21.925 1.00 0.00 ? 25 ARG A NH2  7  
ATOM 6617  H H    . ARG A 1 25 ? -41.993 -5.902  -19.053 1.00 0.00 ? 25 ARG A H    7  
ATOM 6618  H HA   . ARG A 1 25 ? -44.153 -7.135  -17.569 1.00 0.00 ? 25 ARG A HA   7  
ATOM 6619  H HB2  . ARG A 1 25 ? -44.217 -4.739  -18.170 1.00 0.00 ? 25 ARG A HB2  7  
ATOM 6620  H HB3  . ARG A 1 25 ? -44.271 -5.175  -19.878 1.00 0.00 ? 25 ARG A HB3  7  
ATOM 6621  H HG2  . ARG A 1 25 ? -46.395 -6.335  -19.558 1.00 0.00 ? 25 ARG A HG2  7  
ATOM 6622  H HG3  . ARG A 1 25 ? -46.328 -6.033  -17.822 1.00 0.00 ? 25 ARG A HG3  7  
ATOM 6623  H HD2  . ARG A 1 25 ? -47.798 -4.395  -18.873 1.00 0.00 ? 25 ARG A HD2  7  
ATOM 6624  H HD3  . ARG A 1 25 ? -46.351 -3.588  -18.278 1.00 0.00 ? 25 ARG A HD3  7  
ATOM 6625  H HE   . ARG A 1 25 ? -46.008 -4.380  -20.994 1.00 0.00 ? 25 ARG A HE   7  
ATOM 6626  H HH11 . ARG A 1 25 ? -47.611 -2.104  -18.938 1.00 0.00 ? 25 ARG A HH11 7  
ATOM 6627  H HH12 . ARG A 1 25 ? -47.682 -0.859  -20.141 1.00 0.00 ? 25 ARG A HH12 7  
ATOM 6628  H HH21 . ARG A 1 25 ? -46.098 -2.753  -22.576 1.00 0.00 ? 25 ARG A HH21 7  
ATOM 6629  H HH22 . ARG A 1 25 ? -46.826 -1.227  -22.200 1.00 0.00 ? 25 ARG A HH22 7  
ATOM 6630  N N    . ASN A 1 26 ? -43.899 -7.682  -20.826 1.00 0.00 ? 26 ASN A N    7  
ATOM 6631  C CA   . ASN A 1 26 ? -44.250 -8.586  -21.924 1.00 0.00 ? 26 ASN A CA   7  
ATOM 6632  C C    . ASN A 1 26 ? -43.201 -9.681  -22.134 1.00 0.00 ? 26 ASN A C    7  
ATOM 6633  O O    . ASN A 1 26 ? -43.348 -10.528 -23.019 1.00 0.00 ? 26 ASN A O    7  
ATOM 6634  C CB   . ASN A 1 26 ? -44.407 -7.786  -23.218 1.00 0.00 ? 26 ASN A CB   7  
ATOM 6635  C CG   . ASN A 1 26 ? -45.658 -6.915  -23.145 1.00 0.00 ? 26 ASN A CG   7  
ATOM 6636  O OD1  . ASN A 1 26 ? -46.559 -7.188  -22.352 1.00 0.00 ? 26 ASN A OD1  7  
ATOM 6637  N ND2  . ASN A 1 26 ? -45.764 -5.877  -23.929 1.00 0.00 ? 26 ASN A ND2  7  
ATOM 6638  H H    . ASN A 1 26 ? -43.371 -6.877  -21.014 1.00 0.00 ? 26 ASN A H    7  
ATOM 6639  H HA   . ASN A 1 26 ? -45.196 -9.053  -21.697 1.00 0.00 ? 26 ASN A HA   7  
ATOM 6640  H HB2  . ASN A 1 26 ? -43.539 -7.156  -23.357 1.00 0.00 ? 26 ASN A HB2  7  
ATOM 6641  H HB3  . ASN A 1 26 ? -44.493 -8.465  -24.053 1.00 0.00 ? 26 ASN A HB3  7  
ATOM 6642  H HD21 . ASN A 1 26 ? -45.045 -5.661  -24.558 1.00 0.00 ? 26 ASN A HD21 7  
ATOM 6643  H HD22 . ASN A 1 26 ? -46.565 -5.313  -23.887 1.00 0.00 ? 26 ASN A HD22 7  
ATOM 6644  N N    . GLY A 1 27 ? -42.139 -9.654  -21.339 1.00 0.00 ? 27 GLY A N    7  
ATOM 6645  C CA   . GLY A 1 27 ? -41.072 -10.642 -21.477 1.00 0.00 ? 27 GLY A CA   7  
ATOM 6646  C C    . GLY A 1 27 ? -41.566 -12.068 -21.238 1.00 0.00 ? 27 GLY A C    7  
ATOM 6647  O O    . GLY A 1 27 ? -41.175 -12.992 -21.952 1.00 0.00 ? 27 GLY A O    7  
ATOM 6648  H H    . GLY A 1 27 ? -42.067 -8.965  -20.645 1.00 0.00 ? 27 GLY A H    7  
ATOM 6649  H HA2  . GLY A 1 27 ? -40.662 -10.576 -22.474 1.00 0.00 ? 27 GLY A HA2  7  
ATOM 6650  H HA3  . GLY A 1 27 ? -40.293 -10.418 -20.763 1.00 0.00 ? 27 GLY A HA3  7  
ATOM 6651  N N    . GLY A 1 28 ? -42.409 -12.250 -20.227 1.00 0.00 ? 28 GLY A N    7  
ATOM 6652  C CA   . GLY A 1 28 ? -42.921 -13.581 -19.910 1.00 0.00 ? 28 GLY A CA   7  
ATOM 6653  C C    . GLY A 1 28 ? -43.729 -14.171 -21.064 1.00 0.00 ? 28 GLY A C    7  
ATOM 6654  O O    . GLY A 1 28 ? -43.584 -15.347 -21.396 1.00 0.00 ? 28 GLY A O    7  
ATOM 6655  H H    . GLY A 1 28 ? -42.681 -11.483 -19.681 1.00 0.00 ? 28 GLY A H    7  
ATOM 6656  H HA2  . GLY A 1 28 ? -42.088 -14.235 -19.693 1.00 0.00 ? 28 GLY A HA2  7  
ATOM 6657  H HA3  . GLY A 1 28 ? -43.552 -13.517 -19.038 1.00 0.00 ? 28 GLY A HA3  7  
ATOM 6658  N N    . LEU A 1 29 ? -44.601 -13.358 -21.651 1.00 0.00 ? 29 LEU A N    7  
ATOM 6659  C CA   . LEU A 1 29 ? -45.448 -13.836 -22.741 1.00 0.00 ? 29 LEU A CA   7  
ATOM 6660  C C    . LEU A 1 29 ? -44.600 -14.330 -23.913 1.00 0.00 ? 29 LEU A C    7  
ATOM 6661  O O    . LEU A 1 29 ? -44.840 -15.413 -24.448 1.00 0.00 ? 29 LEU A O    7  
ATOM 6662  C CB   . LEU A 1 29 ? -46.376 -12.702 -23.205 1.00 0.00 ? 29 LEU A CB   7  
ATOM 6663  C CG   . LEU A 1 29 ? -47.269 -13.175 -24.360 1.00 0.00 ? 29 LEU A CG   7  
ATOM 6664  C CD1  . LEU A 1 29 ? -48.133 -14.350 -23.901 1.00 0.00 ? 29 LEU A CD1  7  
ATOM 6665  C CD2  . LEU A 1 29 ? -48.181 -12.023 -24.793 1.00 0.00 ? 29 LEU A CD2  7  
ATOM 6666  H H    . LEU A 1 29 ? -44.695 -12.445 -21.310 1.00 0.00 ? 29 LEU A H    7  
ATOM 6667  H HA   . LEU A 1 29 ? -46.050 -14.653 -22.380 1.00 0.00 ? 29 LEU A HA   7  
ATOM 6668  H HB2  . LEU A 1 29 ? -46.997 -12.392 -22.377 1.00 0.00 ? 29 LEU A HB2  7  
ATOM 6669  H HB3  . LEU A 1 29 ? -45.779 -11.865 -23.535 1.00 0.00 ? 29 LEU A HB3  7  
ATOM 6670  H HG   . LEU A 1 29 ? -46.656 -13.480 -25.195 1.00 0.00 ? 29 LEU A HG   7  
ATOM 6671  H HD11 . LEU A 1 29 ? -48.372 -14.235 -22.854 1.00 0.00 ? 29 LEU A HD11 7  
ATOM 6672  H HD12 . LEU A 1 29 ? -47.591 -15.273 -24.047 1.00 0.00 ? 29 LEU A HD12 7  
ATOM 6673  H HD13 . LEU A 1 29 ? -49.046 -14.374 -24.477 1.00 0.00 ? 29 LEU A HD13 7  
ATOM 6674  H HD21 . LEU A 1 29 ? -47.924 -11.719 -25.796 1.00 0.00 ? 29 LEU A HD21 7  
ATOM 6675  H HD22 . LEU A 1 29 ? -48.050 -11.188 -24.119 1.00 0.00 ? 29 LEU A HD22 7  
ATOM 6676  H HD23 . LEU A 1 29 ? -49.209 -12.349 -24.766 1.00 0.00 ? 29 LEU A HD23 7  
ATOM 6677  N N    . ILE A 1 30 ? -43.615 -13.533 -24.317 1.00 0.00 ? 30 ILE A N    7  
ATOM 6678  C CA   . ILE A 1 30 ? -42.755 -13.911 -25.436 1.00 0.00 ? 30 ILE A CA   7  
ATOM 6679  C C    . ILE A 1 30 ? -41.978 -15.193 -25.136 1.00 0.00 ? 30 ILE A C    7  
ATOM 6680  O O    . ILE A 1 30 ? -41.873 -16.085 -25.985 1.00 0.00 ? 30 ILE A O    7  
ATOM 6681  C CB   . ILE A 1 30 ? -41.773 -12.777 -25.739 1.00 0.00 ? 30 ILE A CB   7  
ATOM 6682  C CG1  . ILE A 1 30 ? -42.538 -11.581 -26.307 1.00 0.00 ? 30 ILE A CG1  7  
ATOM 6683  C CG2  . ILE A 1 30 ? -40.742 -13.256 -26.763 1.00 0.00 ? 30 ILE A CG2  7  
ATOM 6684  C CD1  . ILE A 1 30 ? -41.620 -10.357 -26.346 1.00 0.00 ? 30 ILE A CD1  7  
ATOM 6685  H H    . ILE A 1 30 ? -43.475 -12.668 -23.876 1.00 0.00 ? 30 ILE A H    7  
ATOM 6686  H HA   . ILE A 1 30 ? -43.371 -14.074 -26.307 1.00 0.00 ? 30 ILE A HA   7  
ATOM 6687  H HB   . ILE A 1 30 ? -41.269 -12.487 -24.828 1.00 0.00 ? 30 ILE A HB   7  
ATOM 6688  H HG12 . ILE A 1 30 ? -42.876 -11.811 -27.307 1.00 0.00 ? 30 ILE A HG12 7  
ATOM 6689  H HG13 . ILE A 1 30 ? -43.392 -11.368 -25.680 1.00 0.00 ? 30 ILE A HG13 7  
ATOM 6690  H HG21 . ILE A 1 30 ? -40.017 -13.893 -26.273 1.00 0.00 ? 30 ILE A HG21 7  
ATOM 6691  H HG22 . ILE A 1 30 ? -40.239 -12.404 -27.194 1.00 0.00 ? 30 ILE A HG22 7  
ATOM 6692  H HG23 . ILE A 1 30 ? -41.240 -13.814 -27.542 1.00 0.00 ? 30 ILE A HG23 7  
ATOM 6693  H HD11 . ILE A 1 30 ? -42.129 -9.542  -26.839 1.00 0.00 ? 30 ILE A HD11 7  
ATOM 6694  H HD12 . ILE A 1 30 ? -40.719 -10.602 -26.889 1.00 0.00 ? 30 ILE A HD12 7  
ATOM 6695  H HD13 . ILE A 1 30 ? -41.366 -10.066 -25.339 1.00 0.00 ? 30 ILE A HD13 7  
ATOM 6696  N N    . PHE A 1 31 ? -41.442 -15.283 -23.925 1.00 0.00 ? 31 PHE A N    7  
ATOM 6697  C CA   . PHE A 1 31 ? -40.677 -16.456 -23.519 1.00 0.00 ? 31 PHE A CA   7  
ATOM 6698  C C    . PHE A 1 31 ? -41.530 -17.718 -23.572 1.00 0.00 ? 31 PHE A C    7  
ATOM 6699  O O    . PHE A 1 31 ? -41.086 -18.759 -24.058 1.00 0.00 ? 31 PHE A O    7  
ATOM 6700  C CB   . PHE A 1 31 ? -40.141 -16.262 -22.100 1.00 0.00 ? 31 PHE A CB   7  
ATOM 6701  C CG   . PHE A 1 31 ? -39.376 -17.493 -21.679 1.00 0.00 ? 31 PHE A CG   7  
ATOM 6702  C CD1  . PHE A 1 31 ? -38.067 -17.692 -22.133 1.00 0.00 ? 31 PHE A CD1  7  
ATOM 6703  C CD2  . PHE A 1 31 ? -39.975 -18.436 -20.834 1.00 0.00 ? 31 PHE A CD2  7  
ATOM 6704  C CE1  . PHE A 1 31 ? -37.357 -18.834 -21.744 1.00 0.00 ? 31 PHE A CE1  7  
ATOM 6705  C CE2  . PHE A 1 31 ? -39.265 -19.578 -20.446 1.00 0.00 ? 31 PHE A CE2  7  
ATOM 6706  C CZ   . PHE A 1 31 ? -37.956 -19.776 -20.901 1.00 0.00 ? 31 PHE A CZ   7  
ATOM 6707  H H    . PHE A 1 31 ? -41.567 -14.558 -23.276 1.00 0.00 ? 31 PHE A H    7  
ATOM 6708  H HA   . PHE A 1 31 ? -39.840 -16.574 -24.189 1.00 0.00 ? 31 PHE A HA   7  
ATOM 6709  H HB2  . PHE A 1 31 ? -39.485 -15.404 -22.077 1.00 0.00 ? 31 PHE A HB2  7  
ATOM 6710  H HB3  . PHE A 1 31 ? -40.966 -16.102 -21.422 1.00 0.00 ? 31 PHE A HB3  7  
ATOM 6711  H HD1  . PHE A 1 31 ? -37.606 -16.964 -22.784 1.00 0.00 ? 31 PHE A HD1  7  
ATOM 6712  H HD2  . PHE A 1 31 ? -40.985 -18.283 -20.483 1.00 0.00 ? 31 PHE A HD2  7  
ATOM 6713  H HE1  . PHE A 1 31 ? -36.347 -18.988 -22.095 1.00 0.00 ? 31 PHE A HE1  7  
ATOM 6714  H HE2  . PHE A 1 31 ? -39.727 -20.305 -19.794 1.00 0.00 ? 31 PHE A HE2  7  
ATOM 6715  H HZ   . PHE A 1 31 ? -37.409 -20.657 -20.599 1.00 0.00 ? 31 PHE A HZ   7  
ATOM 6716  N N    . ALA A 1 32 ? -42.743 -17.633 -23.035 1.00 0.00 ? 32 ALA A N    7  
ATOM 6717  C CA   . ALA A 1 32 ? -43.630 -18.789 -22.995 1.00 0.00 ? 32 ALA A CA   7  
ATOM 6718  C C    . ALA A 1 32 ? -43.914 -19.328 -24.393 1.00 0.00 ? 32 ALA A C    7  
ATOM 6719  O O    . ALA A 1 32 ? -43.914 -20.541 -24.599 1.00 0.00 ? 32 ALA A O    7  
ATOM 6720  C CB   . ALA A 1 32 ? -44.949 -18.406 -22.321 1.00 0.00 ? 32 ALA A CB   7  
ATOM 6721  H H    . ALA A 1 32 ? -43.036 -16.788 -22.633 1.00 0.00 ? 32 ALA A H    7  
ATOM 6722  H HA   . ALA A 1 32 ? -43.161 -19.566 -22.411 1.00 0.00 ? 32 ALA A HA   7  
ATOM 6723  H HB1  . ALA A 1 32 ? -45.159 -17.363 -22.512 1.00 0.00 ? 32 ALA A HB1  7  
ATOM 6724  H HB2  . ALA A 1 32 ? -44.871 -18.569 -21.258 1.00 0.00 ? 32 ALA A HB2  7  
ATOM 6725  H HB3  . ALA A 1 32 ? -45.747 -19.014 -22.722 1.00 0.00 ? 32 ALA A HB3  7  
ATOM 6726  N N    . GLY A 1 33 ? -44.152 -18.447 -25.357 1.00 0.00 ? 33 GLY A N    7  
ATOM 6727  C CA   . GLY A 1 33 ? -44.430 -18.899 -26.718 1.00 0.00 ? 33 GLY A CA   7  
ATOM 6728  C C    . GLY A 1 33 ? -43.255 -19.698 -27.273 1.00 0.00 ? 33 GLY A C    7  
ATOM 6729  O O    . GLY A 1 33 ? -43.439 -20.727 -27.929 1.00 0.00 ? 33 GLY A O    7  
ATOM 6730  H H    . GLY A 1 33 ? -44.150 -17.484 -25.167 1.00 0.00 ? 33 GLY A H    7  
ATOM 6731  H HA2  . GLY A 1 33 ? -45.313 -19.524 -26.709 1.00 0.00 ? 33 GLY A HA2  7  
ATOM 6732  H HA3  . GLY A 1 33 ? -44.606 -18.043 -27.349 1.00 0.00 ? 33 GLY A HA3  7  
ATOM 6733  N N    . LEU A 1 34 ? -42.045 -19.234 -26.979 1.00 0.00 ? 34 LEU A N    7  
ATOM 6734  C CA   . LEU A 1 34 ? -40.845 -19.931 -27.427 1.00 0.00 ? 34 LEU A CA   7  
ATOM 6735  C C    . LEU A 1 34 ? -40.724 -21.274 -26.708 1.00 0.00 ? 34 LEU A C    7  
ATOM 6736  O O    . LEU A 1 34 ? -40.329 -22.286 -27.296 1.00 0.00 ? 34 LEU A O    7  
ATOM 6737  C CB   . LEU A 1 34 ? -39.606 -19.069 -27.142 1.00 0.00 ? 34 LEU A CB   7  
ATOM 6738  C CG   . LEU A 1 34 ? -38.336 -19.781 -27.624 1.00 0.00 ? 34 LEU A CG   7  
ATOM 6739  C CD1  . LEU A 1 34 ? -38.411 -20.018 -29.135 1.00 0.00 ? 34 LEU A CD1  7  
ATOM 6740  C CD2  . LEU A 1 34 ? -37.119 -18.906 -27.313 1.00 0.00 ? 34 LEU A CD2  7  
ATOM 6741  H H    . LEU A 1 34 ? -41.959 -18.434 -26.413 1.00 0.00 ? 34 LEU A H    7  
ATOM 6742  H HA   . LEU A 1 34 ? -40.917 -20.106 -28.490 1.00 0.00 ? 34 LEU A HA   7  
ATOM 6743  H HB2  . LEU A 1 34 ? -39.704 -18.125 -27.657 1.00 0.00 ? 34 LEU A HB2  7  
ATOM 6744  H HB3  . LEU A 1 34 ? -39.533 -18.890 -26.081 1.00 0.00 ? 34 LEU A HB3  7  
ATOM 6745  H HG   . LEU A 1 34 ? -38.235 -20.728 -27.116 1.00 0.00 ? 34 LEU A HG   7  
ATOM 6746  H HD11 . LEU A 1 34 ? -38.898 -20.962 -29.327 1.00 0.00 ? 34 LEU A HD11 7  
ATOM 6747  H HD12 . LEU A 1 34 ? -37.413 -20.039 -29.545 1.00 0.00 ? 34 LEU A HD12 7  
ATOM 6748  H HD13 . LEU A 1 34 ? -38.975 -19.222 -29.597 1.00 0.00 ? 34 LEU A HD13 7  
ATOM 6749  H HD21 . LEU A 1 34 ? -36.228 -19.379 -27.698 1.00 0.00 ? 34 LEU A HD21 7  
ATOM 6750  H HD22 . LEU A 1 34 ? -37.029 -18.781 -26.245 1.00 0.00 ? 34 LEU A HD22 7  
ATOM 6751  H HD23 . LEU A 1 34 ? -37.243 -17.939 -27.779 1.00 0.00 ? 34 LEU A HD23 7  
ATOM 6752  N N    . ALA A 1 35 ? -41.055 -21.260 -25.419 1.00 0.00 ? 35 ALA A N    7  
ATOM 6753  C CA   . ALA A 1 35 ? -40.962 -22.470 -24.611 1.00 0.00 ? 35 ALA A CA   7  
ATOM 6754  C C    . ALA A 1 35 ? -41.852 -23.569 -25.186 1.00 0.00 ? 35 ALA A C    7  
ATOM 6755  O O    . ALA A 1 35 ? -41.415 -24.703 -25.336 1.00 0.00 ? 35 ALA A O    7  
ATOM 6756  C CB   . ALA A 1 35 ? -41.386 -22.171 -23.171 1.00 0.00 ? 35 ALA A CB   7  
ATOM 6757  H H    . ALA A 1 35 ? -41.346 -20.407 -25.036 1.00 0.00 ? 35 ALA A H    7  
ATOM 6758  H HA   . ALA A 1 35 ? -39.939 -22.813 -24.609 1.00 0.00 ? 35 ALA A HA   7  
ATOM 6759  H HB1  . ALA A 1 35 ? -41.335 -23.077 -22.585 1.00 0.00 ? 35 ALA A HB1  7  
ATOM 6760  H HB2  . ALA A 1 35 ? -42.399 -21.794 -23.165 1.00 0.00 ? 35 ALA A HB2  7  
ATOM 6761  H HB3  . ALA A 1 35 ? -40.724 -21.430 -22.748 1.00 0.00 ? 35 ALA A HB3  7  
ATOM 6762  N N    . PHE A 1 36 ? -43.108 -23.234 -25.476 1.00 0.00 ? 36 PHE A N    7  
ATOM 6763  C CA   . PHE A 1 36 ? -44.055 -24.219 -26.003 1.00 0.00 ? 36 PHE A CA   7  
ATOM 6764  C C    . PHE A 1 36 ? -43.597 -24.809 -27.340 1.00 0.00 ? 36 PHE A C    7  
ATOM 6765  O O    . PHE A 1 36 ? -43.755 -26.011 -27.579 1.00 0.00 ? 36 PHE A O    7  
ATOM 6766  C CB   . PHE A 1 36 ? -45.436 -23.583 -26.167 1.00 0.00 ? 36 PHE A CB   7  
ATOM 6767  C CG   . PHE A 1 36 ? -46.231 -23.771 -24.894 1.00 0.00 ? 36 PHE A CG   7  
ATOM 6768  C CD1  . PHE A 1 36 ? -45.877 -23.072 -23.734 1.00 0.00 ? 36 PHE A CD1  7  
ATOM 6769  C CD2  . PHE A 1 36 ? -47.325 -24.644 -24.876 1.00 0.00 ? 36 PHE A CD2  7  
ATOM 6770  C CE1  . PHE A 1 36 ? -46.614 -23.248 -22.557 1.00 0.00 ? 36 PHE A CE1  7  
ATOM 6771  C CE2  . PHE A 1 36 ? -48.063 -24.821 -23.699 1.00 0.00 ? 36 PHE A CE2  7  
ATOM 6772  C CZ   . PHE A 1 36 ? -47.708 -24.122 -22.540 1.00 0.00 ? 36 PHE A CZ   7  
ATOM 6773  H H    . PHE A 1 36 ? -43.416 -22.329 -25.261 1.00 0.00 ? 36 PHE A H    7  
ATOM 6774  H HA   . PHE A 1 36 ? -44.138 -25.025 -25.288 1.00 0.00 ? 36 PHE A HA   7  
ATOM 6775  H HB2  . PHE A 1 36 ? -45.323 -22.527 -26.369 1.00 0.00 ? 36 PHE A HB2  7  
ATOM 6776  H HB3  . PHE A 1 36 ? -45.955 -24.053 -26.988 1.00 0.00 ? 36 PHE A HB3  7  
ATOM 6777  H HD1  . PHE A 1 36 ? -45.034 -22.400 -23.745 1.00 0.00 ? 36 PHE A HD1  7  
ATOM 6778  H HD2  . PHE A 1 36 ? -47.601 -25.184 -25.770 1.00 0.00 ? 36 PHE A HD2  7  
ATOM 6779  H HE1  . PHE A 1 36 ? -46.341 -22.708 -21.662 1.00 0.00 ? 36 PHE A HE1  7  
ATOM 6780  H HE2  . PHE A 1 36 ? -48.906 -25.495 -23.686 1.00 0.00 ? 36 PHE A HE2  7  
ATOM 6781  H HZ   . PHE A 1 36 ? -48.276 -24.258 -21.632 1.00 0.00 ? 36 PHE A HZ   7  
ATOM 6782  N N    . ILE A 1 37 ? -43.047 -23.979 -28.222 1.00 0.00 ? 37 ILE A N    7  
ATOM 6783  C CA   . ILE A 1 37 ? -42.607 -24.475 -29.526 1.00 0.00 ? 37 ILE A CA   7  
ATOM 6784  C C    . ILE A 1 37 ? -41.569 -25.582 -29.356 1.00 0.00 ? 37 ILE A C    7  
ATOM 6785  O O    . ILE A 1 37 ? -41.634 -26.617 -30.027 1.00 0.00 ? 37 ILE A O    7  
ATOM 6786  C CB   . ILE A 1 37 ? -42.005 -23.333 -30.346 1.00 0.00 ? 37 ILE A CB   7  
ATOM 6787  C CG1  . ILE A 1 37 ? -43.113 -22.349 -30.737 1.00 0.00 ? 37 ILE A CG1  7  
ATOM 6788  C CG2  . ILE A 1 37 ? -41.357 -23.901 -31.610 1.00 0.00 ? 37 ILE A CG2  7  
ATOM 6789  C CD1  . ILE A 1 37 ? -42.487 -21.071 -31.301 1.00 0.00 ? 37 ILE A CD1  7  
ATOM 6790  H H    . ILE A 1 37 ? -42.957 -23.022 -28.011 1.00 0.00 ? 37 ILE A H    7  
ATOM 6791  H HA   . ILE A 1 37 ? -43.461 -24.872 -30.054 1.00 0.00 ? 37 ILE A HA   7  
ATOM 6792  H HB   . ILE A 1 37 ? -41.257 -22.821 -29.756 1.00 0.00 ? 37 ILE A HB   7  
ATOM 6793  H HG12 . ILE A 1 37 ? -43.746 -22.801 -31.486 1.00 0.00 ? 37 ILE A HG12 7  
ATOM 6794  H HG13 . ILE A 1 37 ? -43.702 -22.105 -29.866 1.00 0.00 ? 37 ILE A HG13 7  
ATOM 6795  H HG21 . ILE A 1 37 ? -40.352 -24.229 -31.383 1.00 0.00 ? 37 ILE A HG21 7  
ATOM 6796  H HG22 . ILE A 1 37 ? -41.323 -23.140 -32.373 1.00 0.00 ? 37 ILE A HG22 7  
ATOM 6797  H HG23 . ILE A 1 37 ? -41.937 -24.740 -31.965 1.00 0.00 ? 37 ILE A HG23 7  
ATOM 6798  H HD11 . ILE A 1 37 ? -41.441 -21.242 -31.507 1.00 0.00 ? 37 ILE A HD11 7  
ATOM 6799  H HD12 . ILE A 1 37 ? -42.587 -20.273 -30.579 1.00 0.00 ? 37 ILE A HD12 7  
ATOM 6800  H HD13 . ILE A 1 37 ? -42.993 -20.794 -32.213 1.00 0.00 ? 37 ILE A HD13 7  
ATOM 6801  N N    . VAL A 1 38 ? -40.615 -25.359 -28.463 1.00 0.00 ? 38 VAL A N    7  
ATOM 6802  C CA   . VAL A 1 38 ? -39.565 -26.345 -28.224 1.00 0.00 ? 38 VAL A CA   7  
ATOM 6803  C C    . VAL A 1 38 ? -40.165 -27.681 -27.782 1.00 0.00 ? 38 VAL A C    7  
ATOM 6804  O O    . VAL A 1 38 ? -39.700 -28.745 -28.191 1.00 0.00 ? 38 VAL A O    7  
ATOM 6805  C CB   . VAL A 1 38 ? -38.605 -25.834 -27.149 1.00 0.00 ? 38 VAL A CB   7  
ATOM 6806  C CG1  . VAL A 1 38 ? -37.654 -26.960 -26.739 1.00 0.00 ? 38 VAL A CG1  7  
ATOM 6807  C CG2  . VAL A 1 38 ? -37.794 -24.663 -27.710 1.00 0.00 ? 38 VAL A CG2  7  
ATOM 6808  H H    . VAL A 1 38 ? -40.608 -24.506 -27.978 1.00 0.00 ? 38 VAL A H    7  
ATOM 6809  H HA   . VAL A 1 38 ? -39.013 -26.497 -29.139 1.00 0.00 ? 38 VAL A HA   7  
ATOM 6810  H HB   . VAL A 1 38 ? -39.169 -25.507 -26.289 1.00 0.00 ? 38 VAL A HB   7  
ATOM 6811  H HG11 . VAL A 1 38 ? -36.790 -26.539 -26.246 1.00 0.00 ? 38 VAL A HG11 7  
ATOM 6812  H HG12 . VAL A 1 38 ? -37.339 -27.504 -27.617 1.00 0.00 ? 38 VAL A HG12 7  
ATOM 6813  H HG13 . VAL A 1 38 ? -38.162 -27.631 -26.062 1.00 0.00 ? 38 VAL A HG13 7  
ATOM 6814  H HG21 . VAL A 1 38 ? -37.191 -24.233 -26.923 1.00 0.00 ? 38 VAL A HG21 7  
ATOM 6815  H HG22 . VAL A 1 38 ? -38.467 -23.913 -28.098 1.00 0.00 ? 38 VAL A HG22 7  
ATOM 6816  H HG23 . VAL A 1 38 ? -37.152 -25.016 -28.503 1.00 0.00 ? 38 VAL A HG23 7  
ATOM 6817  N N    . GLY A 1 39 ? -41.190 -27.618 -26.937 1.00 0.00 ? 39 GLY A N    7  
ATOM 6818  C CA   . GLY A 1 39 ? -41.846 -28.817 -26.426 1.00 0.00 ? 39 GLY A CA   7  
ATOM 6819  C C    . GLY A 1 39 ? -42.441 -29.659 -27.550 1.00 0.00 ? 39 GLY A C    7  
ATOM 6820  O O    . GLY A 1 39 ? -42.430 -30.888 -27.485 1.00 0.00 ? 39 GLY A O    7  
ATOM 6821  H H    . GLY A 1 39 ? -41.508 -26.750 -26.638 1.00 0.00 ? 39 GLY A H    7  
ATOM 6822  H HA2  . GLY A 1 39 ? -41.123 -29.411 -25.888 1.00 0.00 ? 39 GLY A HA2  7  
ATOM 6823  H HA3  . GLY A 1 39 ? -42.637 -28.525 -25.751 1.00 0.00 ? 39 GLY A HA3  7  
ATOM 6824  N N    . LEU A 1 40 ? -42.961 -29.003 -28.582 1.00 0.00 ? 40 LEU A N    7  
ATOM 6825  C CA   . LEU A 1 40 ? -43.548 -29.744 -29.696 1.00 0.00 ? 40 LEU A CA   7  
ATOM 6826  C C    . LEU A 1 40 ? -42.485 -30.637 -30.331 1.00 0.00 ? 40 LEU A C    7  
ATOM 6827  O O    . LEU A 1 40 ? -42.745 -31.793 -30.663 1.00 0.00 ? 40 LEU A O    7  
ATOM 6828  C CB   . LEU A 1 40 ? -44.101 -28.773 -30.743 1.00 0.00 ? 40 LEU A CB   7  
ATOM 6829  C CG   . LEU A 1 40 ? -45.331 -28.048 -30.181 1.00 0.00 ? 40 LEU A CG   7  
ATOM 6830  C CD1  . LEU A 1 40 ? -45.762 -26.949 -31.153 1.00 0.00 ? 40 LEU A CD1  7  
ATOM 6831  C CD2  . LEU A 1 40 ? -46.489 -29.037 -29.987 1.00 0.00 ? 40 LEU A CD2  7  
ATOM 6832  H H    . LEU A 1 40 ? -42.936 -28.019 -28.593 1.00 0.00 ? 40 LEU A H    7  
ATOM 6833  H HA   . LEU A 1 40 ? -44.351 -30.361 -29.324 1.00 0.00 ? 40 LEU A HA   7  
ATOM 6834  H HB2  . LEU A 1 40 ? -43.341 -28.046 -30.990 1.00 0.00 ? 40 LEU A HB2  7  
ATOM 6835  H HB3  . LEU A 1 40 ? -44.375 -29.317 -31.633 1.00 0.00 ? 40 LEU A HB3  7  
ATOM 6836  H HG   . LEU A 1 40 ? -45.075 -27.602 -29.231 1.00 0.00 ? 40 LEU A HG   7  
ATOM 6837  H HD11 . LEU A 1 40 ? -46.123 -27.396 -32.067 1.00 0.00 ? 40 LEU A HD11 7  
ATOM 6838  H HD12 . LEU A 1 40 ? -44.919 -26.311 -31.372 1.00 0.00 ? 40 LEU A HD12 7  
ATOM 6839  H HD13 . LEU A 1 40 ? -46.550 -26.362 -30.705 1.00 0.00 ? 40 LEU A HD13 7  
ATOM 6840  H HD21 . LEU A 1 40 ? -46.578 -29.283 -28.938 1.00 0.00 ? 40 LEU A HD21 7  
ATOM 6841  H HD22 . LEU A 1 40 ? -46.304 -29.937 -30.551 1.00 0.00 ? 40 LEU A HD22 7  
ATOM 6842  H HD23 . LEU A 1 40 ? -47.409 -28.583 -30.325 1.00 0.00 ? 40 LEU A HD23 7  
ATOM 6843  N N    . LEU A 1 41 ? -41.292 -30.080 -30.506 1.00 0.00 ? 41 LEU A N    7  
ATOM 6844  C CA   . LEU A 1 41 ? -40.184 -30.813 -31.119 1.00 0.00 ? 41 LEU A CA   7  
ATOM 6845  C C    . LEU A 1 41 ? -39.893 -32.104 -30.352 1.00 0.00 ? 41 LEU A C    7  
ATOM 6846  O O    . LEU A 1 41 ? -39.556 -33.125 -30.951 1.00 0.00 ? 41 LEU A O    7  
ATOM 6847  C CB   . LEU A 1 41 ? -38.931 -29.924 -31.142 1.00 0.00 ? 41 LEU A CB   7  
ATOM 6848  C CG   . LEU A 1 41 ? -37.758 -30.666 -31.801 1.00 0.00 ? 41 LEU A CG   7  
ATOM 6849  C CD1  . LEU A 1 41 ? -38.113 -31.022 -33.246 1.00 0.00 ? 41 LEU A CD1  7  
ATOM 6850  C CD2  . LEU A 1 41 ? -36.525 -29.759 -31.797 1.00 0.00 ? 41 LEU A CD2  7  
ATOM 6851  H H    . LEU A 1 41 ? -41.172 -29.143 -30.262 1.00 0.00 ? 41 LEU A H    7  
ATOM 6852  H HA   . LEU A 1 41 ? -40.454 -31.061 -32.133 1.00 0.00 ? 41 LEU A HA   7  
ATOM 6853  H HB2  . LEU A 1 41 ? -39.141 -29.023 -31.699 1.00 0.00 ? 41 LEU A HB2  7  
ATOM 6854  H HB3  . LEU A 1 41 ? -38.662 -29.662 -30.130 1.00 0.00 ? 41 LEU A HB3  7  
ATOM 6855  H HG   . LEU A 1 41 ? -37.541 -31.569 -31.250 1.00 0.00 ? 41 LEU A HG   7  
ATOM 6856  H HD11 . LEU A 1 41 ? -38.606 -31.984 -33.268 1.00 0.00 ? 41 LEU A HD11 7  
ATOM 6857  H HD12 . LEU A 1 41 ? -37.212 -31.066 -33.838 1.00 0.00 ? 41 LEU A HD12 7  
ATOM 6858  H HD13 . LEU A 1 41 ? -38.774 -30.270 -33.651 1.00 0.00 ? 41 LEU A HD13 7  
ATOM 6859  H HD21 . LEU A 1 41 ? -36.734 -28.872 -31.218 1.00 0.00 ? 41 LEU A HD21 7  
ATOM 6860  H HD22 . LEU A 1 41 ? -36.282 -29.478 -32.811 1.00 0.00 ? 41 LEU A HD22 7  
ATOM 6861  H HD23 . LEU A 1 41 ? -35.691 -30.287 -31.359 1.00 0.00 ? 41 LEU A HD23 7  
ATOM 6862  N N    . ILE A 1 42 ? -40.012 -32.050 -29.031 1.00 0.00 ? 42 ILE A N    7  
ATOM 6863  C CA   . ILE A 1 42 ? -39.746 -33.225 -28.202 1.00 0.00 ? 42 ILE A CA   7  
ATOM 6864  C C    . ILE A 1 42 ? -40.678 -34.378 -28.586 1.00 0.00 ? 42 ILE A C    7  
ATOM 6865  O O    . ILE A 1 42 ? -40.257 -35.536 -28.658 1.00 0.00 ? 42 ILE A O    7  
ATOM 6866  C CB   . ILE A 1 42 ? -39.940 -32.884 -26.719 1.00 0.00 ? 42 ILE A CB   7  
ATOM 6867  C CG1  . ILE A 1 42 ? -38.818 -31.950 -26.238 1.00 0.00 ? 42 ILE A CG1  7  
ATOM 6868  C CG2  . ILE A 1 42 ? -39.914 -34.172 -25.892 1.00 0.00 ? 42 ILE A CG2  7  
ATOM 6869  C CD1  . ILE A 1 42 ? -37.580 -32.759 -25.825 1.00 0.00 ? 42 ILE A CD1  7  
ATOM 6870  H H    . ILE A 1 42 ? -40.277 -31.206 -28.619 1.00 0.00 ? 42 ILE A H    7  
ATOM 6871  H HA   . ILE A 1 42 ? -38.729 -33.537 -28.364 1.00 0.00 ? 42 ILE A HA   7  
ATOM 6872  H HB   . ILE A 1 42 ? -40.893 -32.398 -26.586 1.00 0.00 ? 42 ILE A HB   7  
ATOM 6873  H HG12 . ILE A 1 42 ? -38.550 -31.274 -27.038 1.00 0.00 ? 42 ILE A HG12 7  
ATOM 6874  H HG13 . ILE A 1 42 ? -39.168 -31.378 -25.392 1.00 0.00 ? 42 ILE A HG13 7  
ATOM 6875  H HG21 . ILE A 1 42 ? -39.723 -33.933 -24.858 1.00 0.00 ? 42 ILE A HG21 7  
ATOM 6876  H HG22 . ILE A 1 42 ? -39.135 -34.822 -26.263 1.00 0.00 ? 42 ILE A HG22 7  
ATOM 6877  H HG23 . ILE A 1 42 ? -40.869 -34.671 -25.976 1.00 0.00 ? 42 ILE A HG23 7  
ATOM 6878  H HD11 . ILE A 1 42 ? -36.706 -32.126 -25.872 1.00 0.00 ? 42 ILE A HD11 7  
ATOM 6879  H HD12 . ILE A 1 42 ? -37.448 -33.599 -26.485 1.00 0.00 ? 42 ILE A HD12 7  
ATOM 6880  H HD13 . ILE A 1 42 ? -37.708 -33.115 -24.814 1.00 0.00 ? 42 ILE A HD13 7  
ATOM 6881  N N    . LEU A 1 43 ? -41.948 -34.066 -28.819 1.00 0.00 ? 43 LEU A N    7  
ATOM 6882  C CA   . LEU A 1 43 ? -42.908 -35.105 -29.171 1.00 0.00 ? 43 LEU A CA   7  
ATOM 6883  C C    . LEU A 1 43 ? -42.463 -35.835 -30.438 1.00 0.00 ? 43 LEU A C    7  
ATOM 6884  O O    . LEU A 1 43 ? -42.593 -37.054 -30.531 1.00 0.00 ? 43 LEU A O    7  
ATOM 6885  C CB   . LEU A 1 43 ? -44.290 -34.486 -29.397 1.00 0.00 ? 43 LEU A CB   7  
ATOM 6886  C CG   . LEU A 1 43 ? -44.860 -33.989 -28.061 1.00 0.00 ? 43 LEU A CG   7  
ATOM 6887  C CD1  . LEU A 1 43 ? -46.143 -33.197 -28.320 1.00 0.00 ? 43 LEU A CD1  7  
ATOM 6888  C CD2  . LEU A 1 43 ? -45.173 -35.177 -27.140 1.00 0.00 ? 43 LEU A CD2  7  
ATOM 6889  H H    . LEU A 1 43 ? -42.244 -33.141 -28.726 1.00 0.00 ? 43 LEU A H    7  
ATOM 6890  H HA   . LEU A 1 43 ? -42.969 -35.816 -28.362 1.00 0.00 ? 43 LEU A HA   7  
ATOM 6891  H HB2  . LEU A 1 43 ? -44.199 -33.653 -30.078 1.00 0.00 ? 43 LEU A HB2  7  
ATOM 6892  H HB3  . LEU A 1 43 ? -44.955 -35.223 -29.823 1.00 0.00 ? 43 LEU A HB3  7  
ATOM 6893  H HG   . LEU A 1 43 ? -44.135 -33.345 -27.585 1.00 0.00 ? 43 LEU A HG   7  
ATOM 6894  H HD11 . LEU A 1 43 ? -46.906 -33.860 -28.701 1.00 0.00 ? 43 LEU A HD11 7  
ATOM 6895  H HD12 . LEU A 1 43 ? -45.947 -32.421 -29.044 1.00 0.00 ? 43 LEU A HD12 7  
ATOM 6896  H HD13 . LEU A 1 43 ? -46.482 -32.750 -27.397 1.00 0.00 ? 43 LEU A HD13 7  
ATOM 6897  H HD21 . LEU A 1 43 ? -46.129 -35.016 -26.661 1.00 0.00 ? 43 LEU A HD21 7  
ATOM 6898  H HD22 . LEU A 1 43 ? -44.405 -35.258 -26.385 1.00 0.00 ? 43 LEU A HD22 7  
ATOM 6899  H HD23 . LEU A 1 43 ? -45.209 -36.090 -27.714 1.00 0.00 ? 43 LEU A HD23 7  
ATOM 6900  N N    . LEU A 1 44 ? -41.938 -35.090 -31.406 1.00 0.00 ? 44 LEU A N    7  
ATOM 6901  C CA   . LEU A 1 44 ? -41.480 -35.694 -32.656 1.00 0.00 ? 44 LEU A CA   7  
ATOM 6902  C C    . LEU A 1 44 ? -40.362 -36.705 -32.402 1.00 0.00 ? 44 LEU A C    7  
ATOM 6903  O O    . LEU A 1 44 ? -40.221 -37.689 -33.138 1.00 0.00 ? 44 LEU A O    7  
ATOM 6904  C CB   . LEU A 1 44 ? -40.980 -34.608 -33.612 1.00 0.00 ? 44 LEU A CB   7  
ATOM 6905  C CG   . LEU A 1 44 ? -42.154 -34.057 -34.423 1.00 0.00 ? 44 LEU A CG   7  
ATOM 6906  C CD1  . LEU A 1 44 ? -43.214 -33.500 -33.472 1.00 0.00 ? 44 LEU A CD1  7  
ATOM 6907  C CD2  . LEU A 1 44 ? -41.658 -32.939 -35.342 1.00 0.00 ? 44 LEU A CD2  7  
ATOM 6908  H H    . LEU A 1 44 ? -41.869 -34.124 -31.291 1.00 0.00 ? 44 LEU A H    7  
ATOM 6909  H HA   . LEU A 1 44 ? -42.311 -36.205 -33.119 1.00 0.00 ? 44 LEU A HA   7  
ATOM 6910  H HB2  . LEU A 1 44 ? -40.526 -33.810 -33.044 1.00 0.00 ? 44 LEU A HB2  7  
ATOM 6911  H HB3  . LEU A 1 44 ? -40.249 -35.032 -34.286 1.00 0.00 ? 44 LEU A HB3  7  
ATOM 6912  H HG   . LEU A 1 44 ? -42.586 -34.850 -35.016 1.00 0.00 ? 44 LEU A HG   7  
ATOM 6913  H HD11 . LEU A 1 44 ? -42.735 -33.137 -32.576 1.00 0.00 ? 44 LEU A HD11 7  
ATOM 6914  H HD12 . LEU A 1 44 ? -43.915 -34.282 -33.217 1.00 0.00 ? 44 LEU A HD12 7  
ATOM 6915  H HD13 . LEU A 1 44 ? -43.739 -32.690 -33.954 1.00 0.00 ? 44 LEU A HD13 7  
ATOM 6916  H HD21 . LEU A 1 44 ? -42.465 -32.613 -35.980 1.00 0.00 ? 44 LEU A HD21 7  
ATOM 6917  H HD22 . LEU A 1 44 ? -40.846 -33.308 -35.951 1.00 0.00 ? 44 LEU A HD22 7  
ATOM 6918  H HD23 . LEU A 1 44 ? -41.311 -32.109 -34.745 1.00 0.00 ? 44 LEU A HD23 7  
ATOM 6919  N N    . SER A 1 45 ? -39.573 -36.474 -31.353 1.00 0.00 ? 45 SER A N    7  
ATOM 6920  C CA   . SER A 1 45 ? -38.487 -37.392 -31.033 1.00 0.00 ? 45 SER A CA   7  
ATOM 6921  C C    . SER A 1 45 ? -39.066 -38.775 -30.795 1.00 0.00 ? 45 SER A C    7  
ATOM 6922  O O    . SER A 1 45 ? -38.528 -39.775 -31.265 1.00 0.00 ? 45 SER A O    7  
ATOM 6923  C CB   . SER A 1 45 ? -37.732 -36.925 -29.787 1.00 0.00 ? 45 SER A CB   7  
ATOM 6924  O OG   . SER A 1 45 ? -36.667 -37.830 -29.522 1.00 0.00 ? 45 SER A OG   7  
ATOM 6925  H H    . SER A 1 45 ? -39.729 -35.695 -30.786 1.00 0.00 ? 45 SER A H    7  
ATOM 6926  H HA   . SER A 1 45 ? -37.802 -37.430 -31.866 1.00 0.00 ? 45 SER A HA   7  
ATOM 6927  H HB2  . SER A 1 45 ? -37.329 -35.941 -29.952 1.00 0.00 ? 45 SER A HB2  7  
ATOM 6928  H HB3  . SER A 1 45 ? -38.409 -36.899 -28.946 1.00 0.00 ? 45 SER A HB3  7  
ATOM 6929  H HG   . SER A 1 45 ? -36.714 -38.540 -30.166 1.00 0.00 ? 45 SER A HG   7  
ATOM 6930  N N    . ARG A 1 46 ? -40.184 -38.819 -30.080 1.00 0.00 ? 46 ARG A N    7  
ATOM 6931  C CA   . ARG A 1 46 ? -40.851 -40.088 -29.808 1.00 0.00 ? 46 ARG A CA   7  
ATOM 6932  C C    . ARG A 1 46 ? -41.282 -40.764 -31.110 1.00 0.00 ? 46 ARG A C    7  
ATOM 6933  O O    . ARG A 1 46 ? -41.250 -41.988 -31.221 1.00 0.00 ? 46 ARG A O    7  
ATOM 6934  C CB   . ARG A 1 46 ? -42.067 -39.870 -28.890 1.00 0.00 ? 46 ARG A CB   7  
ATOM 6935  C CG   . ARG A 1 46 ? -42.910 -41.158 -28.752 1.00 0.00 ? 46 ARG A CG   7  
ATOM 6936  C CD   . ARG A 1 46 ? -42.068 -42.319 -28.202 1.00 0.00 ? 46 ARG A CD   7  
ATOM 6937  N NE   . ARG A 1 46 ? -42.913 -43.483 -27.951 1.00 0.00 ? 46 ARG A NE   7  
ATOM 6938  C CZ   . ARG A 1 46 ? -43.588 -43.610 -26.812 1.00 0.00 ? 46 ARG A CZ   7  
ATOM 6939  N NH1  . ARG A 1 46 ? -43.499 -42.683 -25.896 1.00 0.00 ? 46 ARG A NH1  7  
ATOM 6940  N NH2  . ARG A 1 46 ? -44.337 -44.657 -26.610 1.00 0.00 ? 46 ARG A NH2  7  
ATOM 6941  H H    . ARG A 1 46 ? -40.576 -37.989 -29.743 1.00 0.00 ? 46 ARG A H    7  
ATOM 6942  H HA   . ARG A 1 46 ? -40.146 -40.727 -29.302 1.00 0.00 ? 46 ARG A HA   7  
ATOM 6943  H HB2  . ARG A 1 46 ? -41.722 -39.568 -27.913 1.00 0.00 ? 46 ARG A HB2  7  
ATOM 6944  H HB3  . ARG A 1 46 ? -42.685 -39.087 -29.304 1.00 0.00 ? 46 ARG A HB3  7  
ATOM 6945  H HG2  . ARG A 1 46 ? -43.727 -40.969 -28.071 1.00 0.00 ? 46 ARG A HG2  7  
ATOM 6946  H HG3  . ARG A 1 46 ? -43.316 -41.435 -29.713 1.00 0.00 ? 46 ARG A HG3  7  
ATOM 6947  H HD2  . ARG A 1 46 ? -41.316 -42.594 -28.924 1.00 0.00 ? 46 ARG A HD2  7  
ATOM 6948  H HD3  . ARG A 1 46 ? -41.588 -42.014 -27.283 1.00 0.00 ? 46 ARG A HD3  7  
ATOM 6949  H HE   . ARG A 1 46 ? -42.984 -44.183 -28.633 1.00 0.00 ? 46 ARG A HE   7  
ATOM 6950  H HH11 . ARG A 1 46 ? -42.925 -41.880 -26.051 1.00 0.00 ? 46 ARG A HH11 7  
ATOM 6951  H HH12 . ARG A 1 46 ? -44.008 -42.778 -25.040 1.00 0.00 ? 46 ARG A HH12 7  
ATOM 6952  H HH21 . ARG A 1 46 ? -44.406 -45.367 -27.313 1.00 0.00 ? 46 ARG A HH21 7  
ATOM 6953  H HH22 . ARG A 1 46 ? -44.845 -44.751 -25.753 1.00 0.00 ? 46 ARG A HH22 7  
ATOM 6954  N N    . ARG A 1 47 ? -41.716 -39.961 -32.082 1.00 0.00 ? 47 ARG A N    7  
ATOM 6955  C CA   . ARG A 1 47 ? -42.184 -40.504 -33.354 1.00 0.00 ? 47 ARG A CA   7  
ATOM 6956  C C    . ARG A 1 47 ? -41.130 -41.393 -34.004 1.00 0.00 ? 47 ARG A C    7  
ATOM 6957  O O    . ARG A 1 47 ? -41.464 -42.300 -34.767 1.00 0.00 ? 47 ARG A O    7  
ATOM 6958  C CB   . ARG A 1 47 ? -42.536 -39.380 -34.330 1.00 0.00 ? 47 ARG A CB   7  
ATOM 6959  C CG   . ARG A 1 47 ? -43.489 -39.927 -35.401 1.00 0.00 ? 47 ARG A CG   7  
ATOM 6960  C CD   . ARG A 1 47 ? -43.186 -39.276 -36.750 1.00 0.00 ? 47 ARG A CD   7  
ATOM 6961  N NE   . ARG A 1 47 ? -41.985 -39.868 -37.333 1.00 0.00 ? 47 ARG A NE   7  
ATOM 6962  C CZ   . ARG A 1 47 ? -41.426 -39.354 -38.423 1.00 0.00 ? 47 ARG A CZ   7  
ATOM 6963  N NH1  . ARG A 1 47 ? -41.948 -38.302 -38.992 1.00 0.00 ? 47 ARG A NH1  7  
ATOM 6964  N NH2  . ARG A 1 47 ? -40.353 -39.903 -38.927 1.00 0.00 ? 47 ARG A NH2  7  
ATOM 6965  H H    . ARG A 1 47 ? -41.741 -38.997 -31.939 1.00 0.00 ? 47 ARG A H    7  
ATOM 6966  H HA   . ARG A 1 47 ? -43.071 -41.090 -33.171 1.00 0.00 ? 47 ARG A HA   7  
ATOM 6967  H HB2  . ARG A 1 47 ? -43.018 -38.574 -33.795 1.00 0.00 ? 47 ARG A HB2  7  
ATOM 6968  H HB3  . ARG A 1 47 ? -41.637 -39.016 -34.803 1.00 0.00 ? 47 ARG A HB3  7  
ATOM 6969  H HG2  . ARG A 1 47 ? -43.362 -40.997 -35.482 1.00 0.00 ? 47 ARG A HG2  7  
ATOM 6970  H HG3  . ARG A 1 47 ? -44.508 -39.709 -35.119 1.00 0.00 ? 47 ARG A HG3  7  
ATOM 6971  H HD2  . ARG A 1 47 ? -44.019 -39.432 -37.418 1.00 0.00 ? 47 ARG A HD2  7  
ATOM 6972  H HD3  . ARG A 1 47 ? -43.034 -38.217 -36.609 1.00 0.00 ? 47 ARG A HD3  7  
ATOM 6973  H HE   . ARG A 1 47 ? -41.584 -40.658 -36.913 1.00 0.00 ? 47 ARG A HE   7  
ATOM 6974  H HH11 . ARG A 1 47 ? -42.770 -37.881 -38.605 1.00 0.00 ? 47 ARG A HH11 7  
ATOM 6975  H HH12 . ARG A 1 47 ? -41.527 -37.915 -39.812 1.00 0.00 ? 47 ARG A HH12 7  
ATOM 6976  H HH21 . ARG A 1 47 ? -39.953 -40.709 -38.492 1.00 0.00 ? 47 ARG A HH21 7  
ATOM 6977  H HH22 . ARG A 1 47 ? -39.933 -39.517 -39.748 1.00 0.00 ? 47 ARG A HH22 7  
ATOM 6978  N N    . PHE A 1 48 ? -39.860 -41.144 -33.709 1.00 0.00 ? 48 PHE A N    7  
ATOM 6979  C CA   . PHE A 1 48 ? -38.801 -41.961 -34.299 1.00 0.00 ? 48 PHE A CA   7  
ATOM 6980  C C    . PHE A 1 48 ? -38.975 -43.426 -33.900 1.00 0.00 ? 48 PHE A C    7  
ATOM 6981  O O    . PHE A 1 48 ? -38.752 -44.326 -34.711 1.00 0.00 ? 48 PHE A O    7  
ATOM 6982  C CB   . PHE A 1 48 ? -37.424 -41.465 -33.851 1.00 0.00 ? 48 PHE A CB   7  
ATOM 6983  C CG   . PHE A 1 48 ? -37.025 -40.277 -34.691 1.00 0.00 ? 48 PHE A CG   7  
ATOM 6984  C CD1  . PHE A 1 48 ? -37.558 -39.015 -34.417 1.00 0.00 ? 48 PHE A CD1  7  
ATOM 6985  C CD2  . PHE A 1 48 ? -36.117 -40.438 -35.746 1.00 0.00 ? 48 PHE A CD2  7  
ATOM 6986  C CE1  . PHE A 1 48 ? -37.187 -37.912 -35.193 1.00 0.00 ? 48 PHE A CE1  7  
ATOM 6987  C CE2  . PHE A 1 48 ? -35.744 -39.335 -36.523 1.00 0.00 ? 48 PHE A CE2  7  
ATOM 6988  C CZ   . PHE A 1 48 ? -36.279 -38.072 -36.248 1.00 0.00 ? 48 PHE A CZ   7  
ATOM 6989  H H    . PHE A 1 48 ? -39.634 -40.414 -33.095 1.00 0.00 ? 48 PHE A H    7  
ATOM 6990  H HA   . PHE A 1 48 ? -38.862 -41.886 -35.374 1.00 0.00 ? 48 PHE A HA   7  
ATOM 6991  H HB2  . PHE A 1 48 ? -37.464 -41.176 -32.813 1.00 0.00 ? 48 PHE A HB2  7  
ATOM 6992  H HB3  . PHE A 1 48 ? -36.699 -42.253 -33.978 1.00 0.00 ? 48 PHE A HB3  7  
ATOM 6993  H HD1  . PHE A 1 48 ? -38.261 -38.894 -33.607 1.00 0.00 ? 48 PHE A HD1  7  
ATOM 6994  H HD2  . PHE A 1 48 ? -35.703 -41.413 -35.957 1.00 0.00 ? 48 PHE A HD2  7  
ATOM 6995  H HE1  . PHE A 1 48 ? -37.600 -36.937 -34.980 1.00 0.00 ? 48 PHE A HE1  7  
ATOM 6996  H HE2  . PHE A 1 48 ? -35.044 -39.460 -37.336 1.00 0.00 ? 48 PHE A HE2  7  
ATOM 6997  H HZ   . PHE A 1 48 ? -35.992 -37.221 -36.847 1.00 0.00 ? 48 PHE A HZ   7  
ATOM 6998  N N    . ARG A 1 49 ? -39.392 -43.660 -32.660 1.00 0.00 ? 49 ARG A N    7  
ATOM 6999  C CA   . ARG A 1 49 ? -39.603 -45.034 -32.209 1.00 0.00 ? 49 ARG A CA   7  
ATOM 7000  C C    . ARG A 1 49 ? -41.033 -45.477 -32.512 1.00 0.00 ? 49 ARG A C    7  
ATOM 7001  O O    . ARG A 1 49 ? -41.247 -46.500 -33.163 1.00 0.00 ? 49 ARG A O    7  
ATOM 7002  C CB   . ARG A 1 49 ? -39.337 -45.148 -30.708 1.00 0.00 ? 49 ARG A CB   7  
ATOM 7003  C CG   . ARG A 1 49 ? -37.863 -44.854 -30.423 1.00 0.00 ? 49 ARG A CG   7  
ATOM 7004  C CD   . ARG A 1 49 ? -37.597 -44.987 -28.924 1.00 0.00 ? 49 ARG A CD   7  
ATOM 7005  N NE   . ARG A 1 49 ? -37.774 -46.372 -28.503 1.00 0.00 ? 49 ARG A NE   7  
ATOM 7006  C CZ   . ARG A 1 49 ? -37.739 -46.711 -27.218 1.00 0.00 ? 49 ARG A CZ   7  
ATOM 7007  N NH1  . ARG A 1 49 ? -37.546 -45.796 -26.308 1.00 0.00 ? 49 ARG A NH1  7  
ATOM 7008  N NH2  . ARG A 1 49 ? -37.899 -47.957 -26.866 1.00 0.00 ? 49 ARG A NH2  7  
ATOM 7009  H H    . ARG A 1 49 ? -39.571 -42.893 -32.076 1.00 0.00 ? 49 ARG A H    7  
ATOM 7010  H HA   . ARG A 1 49 ? -38.918 -45.682 -32.735 1.00 0.00 ? 49 ARG A HA   7  
ATOM 7011  H HB2  . ARG A 1 49 ? -39.956 -44.439 -30.177 1.00 0.00 ? 49 ARG A HB2  7  
ATOM 7012  H HB3  . ARG A 1 49 ? -39.572 -46.150 -30.376 1.00 0.00 ? 49 ARG A HB3  7  
ATOM 7013  H HG2  . ARG A 1 49 ? -37.245 -45.557 -30.964 1.00 0.00 ? 49 ARG A HG2  7  
ATOM 7014  H HG3  . ARG A 1 49 ? -37.628 -43.849 -30.742 1.00 0.00 ? 49 ARG A HG3  7  
ATOM 7015  H HD2  . ARG A 1 49 ? -36.586 -44.676 -28.710 1.00 0.00 ? 49 ARG A HD2  7  
ATOM 7016  H HD3  . ARG A 1 49 ? -38.287 -44.355 -28.381 1.00 0.00 ? 49 ARG A HD3  7  
ATOM 7017  H HE   . ARG A 1 49 ? -37.921 -47.066 -29.178 1.00 0.00 ? 49 ARG A HE   7  
ATOM 7018  H HH11 . ARG A 1 49 ? -37.424 -44.841 -26.577 1.00 0.00 ? 49 ARG A HH11 7  
ATOM 7019  H HH12 . ARG A 1 49 ? -37.519 -46.051 -25.341 1.00 0.00 ? 49 ARG A HH12 7  
ATOM 7020  H HH21 . ARG A 1 49 ? -38.047 -48.658 -27.565 1.00 0.00 ? 49 ARG A HH21 7  
ATOM 7021  H HH22 . ARG A 1 49 ? -37.873 -48.212 -25.900 1.00 0.00 ? 49 ARG A HH22 7  
ATOM 7022  N N    . SER A 1 50 ? -42.007 -44.708 -32.034 1.00 0.00 ? 50 SER A N    7  
ATOM 7023  C CA   . SER A 1 50 ? -43.411 -45.044 -32.262 1.00 0.00 ? 50 SER A CA   7  
ATOM 7024  C C    . SER A 1 50 ? -43.956 -44.298 -33.477 1.00 0.00 ? 50 SER A C    7  
ATOM 7025  O O    . SER A 1 50 ? -43.405 -43.280 -33.887 1.00 0.00 ? 50 SER A O    7  
ATOM 7026  C CB   . SER A 1 50 ? -44.238 -44.685 -31.028 1.00 0.00 ? 50 SER A CB   7  
ATOM 7027  O OG   . SER A 1 50 ? -44.259 -43.272 -30.872 1.00 0.00 ? 50 SER A OG   7  
ATOM 7028  H H    . SER A 1 50 ? -41.779 -43.925 -31.492 1.00 0.00 ? 50 SER A H    7  
ATOM 7029  H HA   . SER A 1 50 ? -43.493 -46.106 -32.439 1.00 0.00 ? 50 SER A HA   7  
ATOM 7030  H HB2  . SER A 1 50 ? -45.248 -45.042 -31.153 1.00 0.00 ? 50 SER A HB2  7  
ATOM 7031  H HB3  . SER A 1 50 ? -43.799 -45.148 -30.156 1.00 0.00 ? 50 SER A HB3  7  
ATOM 7032  H HG   . SER A 1 50 ? -45.009 -42.930 -31.364 1.00 0.00 ? 50 SER A HG   7  
ATOM 7033  N N    . GLY A 1 51 ? -45.042 -44.808 -34.046 1.00 0.00 ? 51 GLY A N    7  
ATOM 7034  C CA   . GLY A 1 51 ? -45.646 -44.170 -35.211 1.00 0.00 ? 51 GLY A CA   7  
ATOM 7035  C C    . GLY A 1 51 ? -44.759 -44.330 -36.438 1.00 0.00 ? 51 GLY A C    7  
ATOM 7036  O O    . GLY A 1 51 ? -44.845 -43.548 -37.386 1.00 0.00 ? 51 GLY A O    7  
ATOM 7037  H H    . GLY A 1 51 ? -45.442 -45.624 -33.680 1.00 0.00 ? 51 GLY A H    7  
ATOM 7038  H HA2  . GLY A 1 51 ? -46.608 -44.624 -35.403 1.00 0.00 ? 51 GLY A HA2  7  
ATOM 7039  H HA3  . GLY A 1 51 ? -45.784 -43.119 -35.007 1.00 0.00 ? 51 GLY A HA3  7  
ATOM 7040  N N    . GLY A 1 52 ? -43.900 -45.342 -36.409 1.00 0.00 ? 52 GLY A N    7  
ATOM 7041  C CA   . GLY A 1 52 ? -42.995 -45.585 -37.525 1.00 0.00 ? 52 GLY A CA   7  
ATOM 7042  C C    . GLY A 1 52 ? -43.778 -45.825 -38.811 1.00 0.00 ? 52 GLY A C    7  
ATOM 7043  O O    . GLY A 1 52 ? -44.733 -46.601 -38.832 1.00 0.00 ? 52 GLY A O    7  
ATOM 7044  H H    . GLY A 1 52 ? -43.876 -45.923 -35.620 1.00 0.00 ? 52 GLY A H    7  
ATOM 7045  H HA2  . GLY A 1 52 ? -42.351 -44.727 -37.655 1.00 0.00 ? 52 GLY A HA2  7  
ATOM 7046  H HA3  . GLY A 1 52 ? -42.392 -46.455 -37.313 1.00 0.00 ? 52 GLY A HA3  7  
ATOM 7047  N N    . ASN A 1 53 ? -43.365 -45.155 -39.882 1.00 0.00 ? 53 ASN A N    7  
ATOM 7048  C CA   . ASN A 1 53 ? -44.031 -45.305 -41.170 1.00 0.00 ? 53 ASN A CA   7  
ATOM 7049  C C    . ASN A 1 53 ? -43.032 -45.156 -42.313 1.00 0.00 ? 53 ASN A C    7  
ATOM 7050  O O    . ASN A 1 53 ? -42.177 -44.270 -42.288 1.00 0.00 ? 53 ASN A O    7  
ATOM 7051  C CB   . ASN A 1 53 ? -45.131 -44.251 -41.316 1.00 0.00 ? 53 ASN A CB   7  
ATOM 7052  C CG   . ASN A 1 53 ? -46.168 -44.419 -40.209 1.00 0.00 ? 53 ASN A CG   7  
ATOM 7053  O OD1  . ASN A 1 53 ? -46.565 -45.541 -39.894 1.00 0.00 ? 53 ASN A OD1  7  
ATOM 7054  N ND2  . ASN A 1 53 ? -46.634 -43.365 -39.597 1.00 0.00 ? 53 ASN A ND2  7  
ATOM 7055  H H    . ASN A 1 53 ? -42.594 -44.556 -39.808 1.00 0.00 ? 53 ASN A H    7  
ATOM 7056  H HA   . ASN A 1 53 ? -44.480 -46.285 -41.222 1.00 0.00 ? 53 ASN A HA   7  
ATOM 7057  H HB2  . ASN A 1 53 ? -44.695 -43.265 -41.249 1.00 0.00 ? 53 ASN A HB2  7  
ATOM 7058  H HB3  . ASN A 1 53 ? -45.612 -44.365 -42.275 1.00 0.00 ? 53 ASN A HB3  7  
ATOM 7059  H HD21 . ASN A 1 53 ? -46.317 -42.473 -39.851 1.00 0.00 ? 53 ASN A HD21 7  
ATOM 7060  H HD22 . ASN A 1 53 ? -47.300 -43.465 -38.886 1.00 0.00 ? 53 ASN A HD22 7  
ATOM 7061  N N    . LYS A 1 54 ? -43.147 -46.021 -43.312 1.00 0.00 ? 54 LYS A N    7  
ATOM 7062  C CA   . LYS A 1 54 ? -42.252 -45.969 -44.461 1.00 0.00 ? 54 LYS A CA   7  
ATOM 7063  C C    . LYS A 1 54 ? -43.019 -46.268 -45.744 1.00 0.00 ? 54 LYS A C    7  
ATOM 7064  O O    . LYS A 1 54 ? -42.695 -47.211 -46.467 1.00 0.00 ? 54 LYS A O    7  
ATOM 7065  C CB   . LYS A 1 54 ? -41.117 -46.980 -44.285 1.00 0.00 ? 54 LYS A CB   7  
ATOM 7066  C CG   . LYS A 1 54 ? -40.216 -46.534 -43.128 1.00 0.00 ? 54 LYS A CG   7  
ATOM 7067  C CD   . LYS A 1 54 ? -38.956 -47.407 -43.058 1.00 0.00 ? 54 LYS A CD   7  
ATOM 7068  C CE   . LYS A 1 54 ? -39.306 -48.809 -42.544 1.00 0.00 ? 54 LYS A CE   7  
ATOM 7069  N NZ   . LYS A 1 54 ? -38.047 -49.568 -42.293 1.00 0.00 ? 54 LYS A NZ   7  
ATOM 7070  H H    . LYS A 1 54 ? -43.850 -46.704 -43.281 1.00 0.00 ? 54 LYS A H    7  
ATOM 7071  H HA   . LYS A 1 54 ? -41.830 -44.978 -44.530 1.00 0.00 ? 54 LYS A HA   7  
ATOM 7072  H HB2  . LYS A 1 54 ? -41.538 -47.949 -44.069 1.00 0.00 ? 54 LYS A HB2  7  
ATOM 7073  H HB3  . LYS A 1 54 ? -40.535 -47.033 -45.194 1.00 0.00 ? 54 LYS A HB3  7  
ATOM 7074  H HG2  . LYS A 1 54 ? -39.926 -45.504 -43.277 1.00 0.00 ? 54 LYS A HG2  7  
ATOM 7075  H HG3  . LYS A 1 54 ? -40.760 -46.620 -42.199 1.00 0.00 ? 54 LYS A HG3  7  
ATOM 7076  H HD2  . LYS A 1 54 ? -38.522 -47.486 -44.045 1.00 0.00 ? 54 LYS A HD2  7  
ATOM 7077  H HD3  . LYS A 1 54 ? -38.242 -46.951 -42.388 1.00 0.00 ? 54 LYS A HD3  7  
ATOM 7078  H HE2  . LYS A 1 54 ? -39.868 -48.728 -41.626 1.00 0.00 ? 54 LYS A HE2  7  
ATOM 7079  H HE3  . LYS A 1 54 ? -39.892 -49.331 -43.283 1.00 0.00 ? 54 LYS A HE3  7  
ATOM 7080  H HZ1  . LYS A 1 54 ? -38.208 -50.577 -42.478 1.00 0.00 ? 54 LYS A HZ1  7  
ATOM 7081  H HZ2  . LYS A 1 54 ? -37.756 -49.436 -41.303 1.00 0.00 ? 54 LYS A HZ2  7  
ATOM 7082  H HZ3  . LYS A 1 54 ? -37.300 -49.218 -42.925 1.00 0.00 ? 54 LYS A HZ3  7  
ATOM 7083  N N    . LYS A 1 55 ? -44.037 -45.456 -46.018 1.00 0.00 ? 55 LYS A N    7  
ATOM 7084  C CA   . LYS A 1 55 ? -44.851 -45.629 -47.218 1.00 0.00 ? 55 LYS A CA   7  
ATOM 7085  C C    . LYS A 1 55 ? -44.628 -44.474 -48.189 1.00 0.00 ? 55 LYS A C    7  
ATOM 7086  O O    . LYS A 1 55 ? -45.309 -44.374 -49.209 1.00 0.00 ? 55 LYS A O    7  
ATOM 7087  C CB   . LYS A 1 55 ? -46.330 -45.694 -46.835 1.00 0.00 ? 55 LYS A CB   7  
ATOM 7088  C CG   . LYS A 1 55 ? -46.582 -46.929 -45.966 1.00 0.00 ? 55 LYS A CG   7  
ATOM 7089  C CD   . LYS A 1 55 ? -48.063 -46.987 -45.585 1.00 0.00 ? 55 LYS A CD   7  
ATOM 7090  C CE   . LYS A 1 55 ? -48.318 -48.217 -44.711 1.00 0.00 ? 55 LYS A CE   7  
ATOM 7091  N NZ   . LYS A 1 55 ? -49.758 -48.268 -44.333 1.00 0.00 ? 55 LYS A NZ   7  
ATOM 7092  H H    . LYS A 1 55 ? -44.240 -44.715 -45.410 1.00 0.00 ? 55 LYS A H    7  
ATOM 7093  H HA   . LYS A 1 55 ? -44.574 -46.553 -47.702 1.00 0.00 ? 55 LYS A HA   7  
ATOM 7094  H HB2  . LYS A 1 55 ? -46.598 -44.804 -46.285 1.00 0.00 ? 55 LYS A HB2  7  
ATOM 7095  H HB3  . LYS A 1 55 ? -46.930 -45.758 -47.730 1.00 0.00 ? 55 LYS A HB3  7  
ATOM 7096  H HG2  . LYS A 1 55 ? -46.316 -47.817 -46.518 1.00 0.00 ? 55 LYS A HG2  7  
ATOM 7097  H HG3  . LYS A 1 55 ? -45.984 -46.867 -45.070 1.00 0.00 ? 55 LYS A HG3  7  
ATOM 7098  H HD2  . LYS A 1 55 ? -48.330 -46.095 -45.038 1.00 0.00 ? 55 LYS A HD2  7  
ATOM 7099  H HD3  . LYS A 1 55 ? -48.663 -47.054 -46.480 1.00 0.00 ? 55 LYS A HD3  7  
ATOM 7100  H HE2  . LYS A 1 55 ? -48.058 -49.109 -45.262 1.00 0.00 ? 55 LYS A HE2  7  
ATOM 7101  H HE3  . LYS A 1 55 ? -47.713 -48.157 -43.819 1.00 0.00 ? 55 LYS A HE3  7  
ATOM 7102  H HZ1  . LYS A 1 55 ? -50.324 -48.550 -45.158 1.00 0.00 ? 55 LYS A HZ1  7  
ATOM 7103  H HZ2  . LYS A 1 55 ? -50.063 -47.328 -44.007 1.00 0.00 ? 55 LYS A HZ2  7  
ATOM 7104  H HZ3  . LYS A 1 55 ? -49.892 -48.960 -43.570 1.00 0.00 ? 55 LYS A HZ3  7  
ATOM 7105  N N    . ARG A 1 56 ? -43.680 -43.601 -47.854 1.00 0.00 ? 56 ARG A N    7  
ATOM 7106  C CA   . ARG A 1 56 ? -43.379 -42.445 -48.698 1.00 0.00 ? 56 ARG A CA   7  
ATOM 7107  C C    . ARG A 1 56 ? -41.936 -42.496 -49.195 1.00 0.00 ? 56 ARG A C    7  
ATOM 7108  O O    . ARG A 1 56 ? -41.448 -41.541 -49.797 1.00 0.00 ? 56 ARG A O    7  
ATOM 7109  C CB   . ARG A 1 56 ? -43.600 -41.153 -47.905 1.00 0.00 ? 56 ARG A CB   7  
ATOM 7110  C CG   . ARG A 1 56 ? -44.104 -40.045 -48.837 1.00 0.00 ? 56 ARG A CG   7  
ATOM 7111  C CD   . ARG A 1 56 ? -45.627 -40.135 -48.978 1.00 0.00 ? 56 ARG A CD   7  
ATOM 7112  N NE   . ARG A 1 56 ? -46.264 -39.974 -47.675 1.00 0.00 ? 56 ARG A NE   7  
ATOM 7113  C CZ   . ARG A 1 56 ? -46.450 -38.770 -47.144 1.00 0.00 ? 56 ARG A CZ   7  
ATOM 7114  N NH1  . ARG A 1 56 ? -46.059 -37.705 -47.790 1.00 0.00 ? 56 ARG A NH1  7  
ATOM 7115  N NH2  . ARG A 1 56 ? -47.024 -38.652 -45.979 1.00 0.00 ? 56 ARG A NH2  7  
ATOM 7116  H H    . ARG A 1 56 ? -43.174 -43.735 -47.026 1.00 0.00 ? 56 ARG A H    7  
ATOM 7117  H HA   . ARG A 1 56 ? -44.037 -42.450 -49.549 1.00 0.00 ? 56 ARG A HA   7  
ATOM 7118  H HB2  . ARG A 1 56 ? -44.332 -41.330 -47.130 1.00 0.00 ? 56 ARG A HB2  7  
ATOM 7119  H HB3  . ARG A 1 56 ? -42.668 -40.844 -47.456 1.00 0.00 ? 56 ARG A HB3  7  
ATOM 7120  H HG2  . ARG A 1 56 ? -43.838 -39.082 -48.424 1.00 0.00 ? 56 ARG A HG2  7  
ATOM 7121  H HG3  . ARG A 1 56 ? -43.648 -40.157 -49.809 1.00 0.00 ? 56 ARG A HG3  7  
ATOM 7122  H HD2  . ARG A 1 56 ? -45.970 -39.353 -49.637 1.00 0.00 ? 56 ARG A HD2  7  
ATOM 7123  H HD3  . ARG A 1 56 ? -45.896 -41.093 -49.393 1.00 0.00 ? 56 ARG A HD3  7  
ATOM 7124  H HE   . ARG A 1 56 ? -46.560 -40.769 -47.182 1.00 0.00 ? 56 ARG A HE   7  
ATOM 7125  H HH11 . ARG A 1 56 ? -45.620 -37.795 -48.684 1.00 0.00 ? 56 ARG A HH11 7  
ATOM 7126  H HH12 . ARG A 1 56 ? -46.199 -36.799 -47.391 1.00 0.00 ? 56 ARG A HH12 7  
ATOM 7127  H HH21 . ARG A 1 56 ? -47.324 -39.468 -45.484 1.00 0.00 ? 56 ARG A HH21 7  
ATOM 7128  H HH22 . ARG A 1 56 ? -47.164 -37.745 -45.579 1.00 0.00 ? 56 ARG A HH22 7  
ATOM 7129  N N    . ARG A 1 57 ? -41.265 -43.615 -48.946 1.00 0.00 ? 57 ARG A N    7  
ATOM 7130  C CA   . ARG A 1 57 ? -39.882 -43.781 -49.379 1.00 0.00 ? 57 ARG A CA   7  
ATOM 7131  C C    . ARG A 1 57 ? -39.695 -45.145 -50.036 1.00 0.00 ? 57 ARG A C    7  
ATOM 7132  O O    . ARG A 1 57 ? -40.365 -46.113 -49.673 1.00 0.00 ? 57 ARG A O    7  
ATOM 7133  C CB   . ARG A 1 57 ? -38.936 -43.649 -48.184 1.00 0.00 ? 57 ARG A CB   7  
ATOM 7134  C CG   . ARG A 1 57 ? -38.983 -42.215 -47.652 1.00 0.00 ? 57 ARG A CG   7  
ATOM 7135  C CD   . ARG A 1 57 ? -37.867 -42.013 -46.624 1.00 0.00 ? 57 ARG A CD   7  
ATOM 7136  N NE   . ARG A 1 57 ? -38.080 -42.878 -45.470 1.00 0.00 ? 57 ARG A NE   7  
ATOM 7137  C CZ   . ARG A 1 57 ? -38.837 -42.490 -44.448 1.00 0.00 ? 57 ARG A CZ   7  
ATOM 7138  N NH1  . ARG A 1 57 ? -39.419 -41.322 -44.469 1.00 0.00 ? 57 ARG A NH1  7  
ATOM 7139  N NH2  . ARG A 1 57 ? -39.001 -43.280 -43.422 1.00 0.00 ? 57 ARG A NH2  7  
ATOM 7140  H H    . ARG A 1 57 ? -41.704 -44.350 -48.468 1.00 0.00 ? 57 ARG A H    7  
ATOM 7141  H HA   . ARG A 1 57 ? -39.645 -43.012 -50.100 1.00 0.00 ? 57 ARG A HA   7  
ATOM 7142  H HB2  . ARG A 1 57 ? -39.243 -44.333 -47.406 1.00 0.00 ? 57 ARG A HB2  7  
ATOM 7143  H HB3  . ARG A 1 57 ? -37.929 -43.883 -48.493 1.00 0.00 ? 57 ARG A HB3  7  
ATOM 7144  H HG2  . ARG A 1 57 ? -38.849 -41.523 -48.470 1.00 0.00 ? 57 ARG A HG2  7  
ATOM 7145  H HG3  . ARG A 1 57 ? -39.939 -42.036 -47.182 1.00 0.00 ? 57 ARG A HG3  7  
ATOM 7146  H HD2  . ARG A 1 57 ? -36.918 -42.253 -47.078 1.00 0.00 ? 57 ARG A HD2  7  
ATOM 7147  H HD3  . ARG A 1 57 ? -37.859 -40.980 -46.306 1.00 0.00 ? 57 ARG A HD3  7  
ATOM 7148  H HE   . ARG A 1 57 ? -37.654 -43.760 -45.446 1.00 0.00 ? 57 ARG A HE   7  
ATOM 7149  H HH11 . ARG A 1 57 ? -39.296 -40.717 -45.256 1.00 0.00 ? 57 ARG A HH11 7  
ATOM 7150  H HH12 . ARG A 1 57 ? -39.986 -41.032 -43.700 1.00 0.00 ? 57 ARG A HH12 7  
ATOM 7151  H HH21 . ARG A 1 57 ? -38.558 -44.177 -43.405 1.00 0.00 ? 57 ARG A HH21 7  
ATOM 7152  H HH22 . ARG A 1 57 ? -39.570 -42.990 -42.653 1.00 0.00 ? 57 ARG A HH22 7  
ATOM 7153  N N    . GLN A 1 58 ? -38.785 -45.217 -51.004 1.00 0.00 ? 58 GLN A N    7  
ATOM 7154  C CA   . GLN A 1 58 ? -38.524 -46.470 -51.705 1.00 0.00 ? 58 GLN A CA   7  
ATOM 7155  C C    . GLN A 1 58 ? -37.024 -46.712 -51.834 1.00 0.00 ? 58 GLN A C    7  
ATOM 7156  O O    . GLN A 1 58 ? -36.233 -45.768 -51.845 1.00 0.00 ? 58 GLN A O    7  
ATOM 7157  C CB   . GLN A 1 58 ? -39.157 -46.431 -53.098 1.00 0.00 ? 58 GLN A CB   7  
ATOM 7158  C CG   . GLN A 1 58 ? -40.682 -46.449 -52.967 1.00 0.00 ? 58 GLN A CG   7  
ATOM 7159  C CD   . GLN A 1 58 ? -41.325 -46.202 -54.327 1.00 0.00 ? 58 GLN A CD   7  
ATOM 7160  O OE1  . GLN A 1 58 ? -40.747 -45.521 -55.173 1.00 0.00 ? 58 GLN A OE1  7  
ATOM 7161  N NE2  . GLN A 1 58 ? -42.495 -46.716 -54.588 1.00 0.00 ? 58 GLN A NE2  7  
ATOM 7162  H H    . GLN A 1 58 ? -38.278 -44.416 -51.255 1.00 0.00 ? 58 GLN A H    7  
ATOM 7163  H HA   . GLN A 1 58 ? -38.962 -47.284 -51.147 1.00 0.00 ? 58 GLN A HA   7  
ATOM 7164  H HB2  . GLN A 1 58 ? -38.849 -45.530 -53.609 1.00 0.00 ? 58 GLN A HB2  7  
ATOM 7165  H HB3  . GLN A 1 58 ? -38.837 -47.293 -53.663 1.00 0.00 ? 58 GLN A HB3  7  
ATOM 7166  H HG2  . GLN A 1 58 ? -40.998 -47.410 -52.589 1.00 0.00 ? 58 GLN A HG2  7  
ATOM 7167  H HG3  . GLN A 1 58 ? -40.991 -45.674 -52.280 1.00 0.00 ? 58 GLN A HG3  7  
ATOM 7168  H HE21 . GLN A 1 58 ? -42.953 -47.258 -53.912 1.00 0.00 ? 58 GLN A HE21 7  
ATOM 7169  H HE22 . GLN A 1 58 ? -42.914 -46.563 -55.460 1.00 0.00 ? 58 GLN A HE22 7  
ATOM 7170  N N    . ILE A 1 59 ? -36.642 -47.985 -51.929 1.00 0.00 ? 59 ILE A N    7  
ATOM 7171  C CA   . ILE A 1 59 ? -35.233 -48.349 -52.057 1.00 0.00 ? 59 ILE A CA   7  
ATOM 7172  C C    . ILE A 1 59 ? -34.998 -49.171 -53.321 1.00 0.00 ? 59 ILE A C    7  
ATOM 7173  O O    . ILE A 1 59 ? -35.919 -49.799 -53.844 1.00 0.00 ? 59 ILE A O    7  
ATOM 7174  C CB   . ILE A 1 59 ? -34.787 -49.141 -50.822 1.00 0.00 ? 59 ILE A CB   7  
ATOM 7175  C CG1  . ILE A 1 59 ? -35.641 -50.405 -50.669 1.00 0.00 ? 59 ILE A CG1  7  
ATOM 7176  C CG2  . ILE A 1 59 ? -34.947 -48.270 -49.575 1.00 0.00 ? 59 ILE A CG2  7  
ATOM 7177  C CD1  . ILE A 1 59 ? -35.064 -51.273 -49.549 1.00 0.00 ? 59 ILE A CD1  7  
ATOM 7178  H H    . ILE A 1 59 ? -37.322 -48.690 -51.911 1.00 0.00 ? 59 ILE A H    7  
ATOM 7179  H HA   . ILE A 1 59 ? -34.643 -47.447 -52.118 1.00 0.00 ? 59 ILE A HA   7  
ATOM 7180  H HB   . ILE A 1 59 ? -33.747 -49.418 -50.933 1.00 0.00 ? 59 ILE A HB   7  
ATOM 7181  H HG12 . ILE A 1 59 ? -36.655 -50.126 -50.423 1.00 0.00 ? 59 ILE A HG12 7  
ATOM 7182  H HG13 . ILE A 1 59 ? -35.636 -50.965 -51.590 1.00 0.00 ? 59 ILE A HG13 7  
ATOM 7183  H HG21 . ILE A 1 59 ? -34.606 -48.817 -48.708 1.00 0.00 ? 59 ILE A HG21 7  
ATOM 7184  H HG22 . ILE A 1 59 ? -35.986 -48.008 -49.451 1.00 0.00 ? 59 ILE A HG22 7  
ATOM 7185  H HG23 . ILE A 1 59 ? -34.360 -47.370 -49.686 1.00 0.00 ? 59 ILE A HG23 7  
ATOM 7186  H HD11 . ILE A 1 59 ? -34.057 -51.569 -49.805 1.00 0.00 ? 59 ILE A HD11 7  
ATOM 7187  H HD12 . ILE A 1 59 ? -35.676 -52.154 -49.426 1.00 0.00 ? 59 ILE A HD12 7  
ATOM 7188  H HD13 . ILE A 1 59 ? -35.050 -50.712 -48.628 1.00 0.00 ? 59 ILE A HD13 7  
ATOM 7189  N N    . ASN A 1 60 ? -33.759 -49.153 -53.807 1.00 0.00 ? 60 ASN A N    7  
ATOM 7190  C CA   . ASN A 1 60 ? -33.402 -49.890 -55.015 1.00 0.00 ? 60 ASN A CA   7  
ATOM 7191  C C    . ASN A 1 60 ? -32.395 -50.993 -54.703 1.00 0.00 ? 60 ASN A C    7  
ATOM 7192  O O    . ASN A 1 60 ? -31.632 -50.897 -53.742 1.00 0.00 ? 60 ASN A O    7  
ATOM 7193  C CB   . ASN A 1 60 ? -32.805 -48.933 -56.049 1.00 0.00 ? 60 ASN A CB   7  
ATOM 7194  C CG   . ASN A 1 60 ? -33.795 -47.816 -56.359 1.00 0.00 ? 60 ASN A CG   7  
ATOM 7195  O OD1  . ASN A 1 60 ? -33.492 -46.641 -56.150 1.00 0.00 ? 60 ASN A OD1  7  
ATOM 7196  N ND2  . ASN A 1 60 ? -34.969 -48.113 -56.847 1.00 0.00 ? 60 ASN A ND2  7  
ATOM 7197  H H    . ASN A 1 60 ? -33.072 -48.627 -53.346 1.00 0.00 ? 60 ASN A H    7  
ATOM 7198  H HA   . ASN A 1 60 ? -34.291 -50.337 -55.432 1.00 0.00 ? 60 ASN A HA   7  
ATOM 7199  H HB2  . ASN A 1 60 ? -31.893 -48.507 -55.657 1.00 0.00 ? 60 ASN A HB2  7  
ATOM 7200  H HB3  . ASN A 1 60 ? -32.586 -49.477 -56.956 1.00 0.00 ? 60 ASN A HB3  7  
ATOM 7201  H HD21 . ASN A 1 60 ? -35.207 -49.048 -57.014 1.00 0.00 ? 60 ASN A HD21 7  
ATOM 7202  H HD22 . ASN A 1 60 ? -35.611 -47.399 -57.048 1.00 0.00 ? 60 ASN A HD22 7  
ATOM 7203  N N    . GLU A 1 61 ? -32.401 -52.037 -55.525 1.00 0.00 ? 61 GLU A N    7  
ATOM 7204  C CA   . GLU A 1 61 ? -31.484 -53.156 -55.336 1.00 0.00 ? 61 GLU A CA   7  
ATOM 7205  C C    . GLU A 1 61 ? -30.047 -52.718 -55.599 1.00 0.00 ? 61 GLU A C    7  
ATOM 7206  O O    . GLU A 1 61 ? -29.804 -51.767 -56.343 1.00 0.00 ? 61 GLU A O    7  
ATOM 7207  C CB   . GLU A 1 61 ? -31.853 -54.300 -56.283 1.00 0.00 ? 61 GLU A CB   7  
ATOM 7208  C CG   . GLU A 1 61 ? -33.282 -54.763 -55.993 1.00 0.00 ? 61 GLU A CG   7  
ATOM 7209  C CD   . GLU A 1 61 ? -33.357 -55.386 -54.601 1.00 0.00 ? 61 GLU A CD   7  
ATOM 7210  O OE1  . GLU A 1 61 ? -32.319 -55.776 -54.093 1.00 0.00 ? 61 GLU A OE1  7  
ATOM 7211  O OE2  . GLU A 1 61 ? -34.450 -55.462 -54.067 1.00 0.00 ? 61 GLU A OE2  7  
ATOM 7212  H H    . GLU A 1 61 ? -33.032 -52.054 -56.275 1.00 0.00 ? 61 GLU A H    7  
ATOM 7213  H HA   . GLU A 1 61 ? -31.564 -53.505 -54.318 1.00 0.00 ? 61 GLU A HA   7  
ATOM 7214  H HB2  . GLU A 1 61 ? -31.785 -53.957 -57.304 1.00 0.00 ? 61 GLU A HB2  7  
ATOM 7215  H HB3  . GLU A 1 61 ? -31.173 -55.125 -56.132 1.00 0.00 ? 61 GLU A HB3  7  
ATOM 7216  H HG2  . GLU A 1 61 ? -33.951 -53.914 -56.042 1.00 0.00 ? 61 GLU A HG2  7  
ATOM 7217  H HG3  . GLU A 1 61 ? -33.578 -55.495 -56.728 1.00 0.00 ? 61 GLU A HG3  7  
ATOM 7218  N N    . ASP A 1 62 ? -29.097 -53.413 -54.981 1.00 0.00 ? 62 ASP A N    7  
ATOM 7219  C CA   . ASP A 1 62 ? -27.686 -53.083 -55.154 1.00 0.00 ? 62 ASP A CA   7  
ATOM 7220  C C    . ASP A 1 62 ? -27.271 -53.239 -56.613 1.00 0.00 ? 62 ASP A C    7  
ATOM 7221  O O    . ASP A 1 62 ? -27.751 -54.127 -57.317 1.00 0.00 ? 62 ASP A O    7  
ATOM 7222  C CB   . ASP A 1 62 ? -26.825 -53.996 -54.278 1.00 0.00 ? 62 ASP A CB   7  
ATOM 7223  C CG   . ASP A 1 62 ? -26.988 -53.616 -52.809 1.00 0.00 ? 62 ASP A CG   7  
ATOM 7224  O OD1  . ASP A 1 62 ? -27.534 -52.556 -52.549 1.00 0.00 ? 62 ASP A OD1  7  
ATOM 7225  O OD2  . ASP A 1 62 ? -26.564 -54.390 -51.968 1.00 0.00 ? 62 ASP A OD2  7  
ATOM 7226  H H    . ASP A 1 62 ? -29.348 -54.161 -54.400 1.00 0.00 ? 62 ASP A H    7  
ATOM 7227  H HA   . ASP A 1 62 ? -27.527 -52.059 -54.852 1.00 0.00 ? 62 ASP A HA   7  
ATOM 7228  H HB2  . ASP A 1 62 ? -27.133 -55.022 -54.419 1.00 0.00 ? 62 ASP A HB2  7  
ATOM 7229  H HB3  . ASP A 1 62 ? -25.789 -53.891 -54.561 1.00 0.00 ? 62 ASP A HB3  7  
ATOM 7230  N N    . GLU A 1 63 ? -26.374 -52.365 -57.060 1.00 0.00 ? 63 GLU A N    7  
ATOM 7231  C CA   . GLU A 1 63 ? -25.895 -52.409 -58.438 1.00 0.00 ? 63 GLU A CA   7  
ATOM 7232  C C    . GLU A 1 63 ? -25.001 -53.635 -58.650 1.00 0.00 ? 63 GLU A C    7  
ATOM 7233  O O    . GLU A 1 63 ? -24.326 -54.077 -57.721 1.00 0.00 ? 63 GLU A O    7  
ATOM 7234  C CB   . GLU A 1 63 ? -25.104 -51.135 -58.745 1.00 0.00 ? 63 GLU A CB   7  
ATOM 7235  C CG   . GLU A 1 63 ? -26.049 -49.933 -58.742 1.00 0.00 ? 63 GLU A CG   7  
ATOM 7236  C CD   . GLU A 1 63 ? -25.265 -48.651 -59.001 1.00 0.00 ? 63 GLU A CD   7  
ATOM 7237  O OE1  . GLU A 1 63 ? -24.053 -48.736 -59.116 1.00 0.00 ? 63 GLU A OE1  7  
ATOM 7238  O OE2  . GLU A 1 63 ? -25.887 -47.605 -59.081 1.00 0.00 ? 63 GLU A OE2  7  
ATOM 7239  H H    . GLU A 1 63 ? -26.027 -51.681 -56.450 1.00 0.00 ? 63 GLU A H    7  
ATOM 7240  H HA   . GLU A 1 63 ? -26.747 -52.459 -59.095 1.00 0.00 ? 63 GLU A HA   7  
ATOM 7241  H HB2  . GLU A 1 63 ? -24.343 -50.995 -57.991 1.00 0.00 ? 63 GLU A HB2  7  
ATOM 7242  H HB3  . GLU A 1 63 ? -24.637 -51.222 -59.714 1.00 0.00 ? 63 GLU A HB3  7  
ATOM 7243  H HG2  . GLU A 1 63 ? -26.793 -50.060 -59.516 1.00 0.00 ? 63 GLU A HG2  7  
ATOM 7244  H HG3  . GLU A 1 63 ? -26.539 -49.864 -57.782 1.00 0.00 ? 63 GLU A HG3  7  
ATOM 7245  N N    . PRO A 1 64 ? -24.973 -54.192 -59.841 1.00 0.00 ? 64 PRO A N    7  
ATOM 7246  C CA   . PRO A 1 64 ? -24.128 -55.388 -60.138 1.00 0.00 ? 64 PRO A CA   7  
ATOM 7247  C C    . PRO A 1 64 ? -22.640 -55.050 -60.144 1.00 0.00 ? 64 PRO A C    7  
ATOM 7248  O O    . PRO A 1 64 ? -21.872 -55.838 -59.616 1.00 0.00 ? 64 PRO A O    7  
ATOM 7249  C CB   . PRO A 1 64 ? -24.591 -55.832 -61.528 1.00 0.00 ? 64 PRO A CB   7  
ATOM 7250  C CG   . PRO A 1 64 ? -25.172 -54.614 -62.163 1.00 0.00 ? 64 PRO A CG   7  
ATOM 7251  C CD   . PRO A 1 64 ? -25.735 -53.758 -61.028 1.00 0.00 ? 64 PRO A CD   7  
ATOM 7252  O OXT  . PRO A 1 64 ? -22.290 -54.010 -60.677 1.00 0.00 ? 64 PRO A OXT  7  
ATOM 7253  H HA   . PRO A 1 64 ? -24.330 -56.171 -59.427 1.00 0.00 ? 64 PRO A HA   7  
ATOM 7254  H HB2  . PRO A 1 64 ? -23.751 -56.192 -62.105 1.00 0.00 ? 64 PRO A HB2  7  
ATOM 7255  H HB3  . PRO A 1 64 ? -25.346 -56.598 -61.445 1.00 0.00 ? 64 PRO A HB3  7  
ATOM 7256  H HG2  . PRO A 1 64 ? -24.401 -54.070 -62.694 1.00 0.00 ? 64 PRO A HG2  7  
ATOM 7257  H HG3  . PRO A 1 64 ? -25.966 -54.887 -62.839 1.00 0.00 ? 64 PRO A HG3  7  
ATOM 7258  H HD2  . PRO A 1 64 ? -25.569 -52.710 -61.232 1.00 0.00 ? 64 PRO A HD2  7  
ATOM 7259  H HD3  . PRO A 1 64 ? -26.787 -53.957 -60.891 1.00 0.00 ? 64 PRO A HD3  7  
ATOM 7260  N N    . LEU A 1 1  ? -25.947 -14.799 -4.239  1.00 0.00 ? 1  LEU A N    8  
ATOM 7261  C CA   . LEU A 1 1  ? -26.936 -15.591 -5.022  1.00 0.00 ? 1  LEU A CA   8  
ATOM 7262  C C    . LEU A 1 1  ? -26.433 -15.760 -6.452  1.00 0.00 ? 1  LEU A C    8  
ATOM 7263  O O    . LEU A 1 1  ? -26.990 -16.537 -7.227  1.00 0.00 ? 1  LEU A O    8  
ATOM 7264  C CB   . LEU A 1 1  ? -28.283 -14.862 -5.026  1.00 0.00 ? 1  LEU A CB   8  
ATOM 7265  C CG   . LEU A 1 1  ? -29.296 -15.655 -4.199  1.00 0.00 ? 1  LEU A CG   8  
ATOM 7266  C CD1  . LEU A 1 1  ? -28.810 -15.752 -2.753  1.00 0.00 ? 1  LEU A CD1  8  
ATOM 7267  C CD2  . LEU A 1 1  ? -30.649 -14.940 -4.235  1.00 0.00 ? 1  LEU A CD2  8  
ATOM 7268  H H1   . LEU A 1 1  ? -26.103 -14.955 -3.223  1.00 0.00 ? 1  LEU A H1   8  
ATOM 7269  H H2   . LEU A 1 1  ? -26.065 -13.787 -4.457  1.00 0.00 ? 1  LEU A H2   8  
ATOM 7270  H H3   . LEU A 1 1  ? -24.984 -15.100 -4.490  1.00 0.00 ? 1  LEU A H3   8  
ATOM 7271  H HA   . LEU A 1 1  ? -27.057 -16.564 -4.568  1.00 0.00 ? 1  LEU A HA   8  
ATOM 7272  H HB2  . LEU A 1 1  ? -28.158 -13.878 -4.599  1.00 0.00 ? 1  LEU A HB2  8  
ATOM 7273  H HB3  . LEU A 1 1  ? -28.639 -14.773 -6.041  1.00 0.00 ? 1  LEU A HB3  8  
ATOM 7274  H HG   . LEU A 1 1  ? -29.401 -16.648 -4.612  1.00 0.00 ? 1  LEU A HG   8  
ATOM 7275  H HD11 . LEU A 1 1  ? -27.929 -15.143 -2.626  1.00 0.00 ? 1  LEU A HD11 8  
ATOM 7276  H HD12 . LEU A 1 1  ? -28.574 -16.781 -2.521  1.00 0.00 ? 1  LEU A HD12 8  
ATOM 7277  H HD13 . LEU A 1 1  ? -29.589 -15.405 -2.088  1.00 0.00 ? 1  LEU A HD13 8  
ATOM 7278  H HD21 . LEU A 1 1  ? -31.196 -15.159 -3.330  1.00 0.00 ? 1  LEU A HD21 8  
ATOM 7279  H HD22 . LEU A 1 1  ? -31.214 -15.283 -5.090  1.00 0.00 ? 1  LEU A HD22 8  
ATOM 7280  H HD23 . LEU A 1 1  ? -30.492 -13.875 -4.312  1.00 0.00 ? 1  LEU A HD23 8  
ATOM 7281  N N    . ASP A 1 2  ? -25.376 -15.025 -6.790  1.00 0.00 ? 2  ASP A N    8  
ATOM 7282  C CA   . ASP A 1 2  ? -24.797 -15.098 -8.130  1.00 0.00 ? 2  ASP A CA   8  
ATOM 7283  C C    . ASP A 1 2  ? -23.302 -15.380 -8.055  1.00 0.00 ? 2  ASP A C    8  
ATOM 7284  O O    . ASP A 1 2  ? -22.731 -15.472 -6.967  1.00 0.00 ? 2  ASP A O    8  
ATOM 7285  C CB   . ASP A 1 2  ? -25.034 -13.781 -8.871  1.00 0.00 ? 2  ASP A CB   8  
ATOM 7286  C CG   . ASP A 1 2  ? -24.297 -12.646 -8.167  1.00 0.00 ? 2  ASP A CG   8  
ATOM 7287  O OD1  . ASP A 1 2  ? -23.619 -12.921 -7.191  1.00 0.00 ? 2  ASP A OD1  8  
ATOM 7288  O OD2  . ASP A 1 2  ? -24.423 -11.518 -8.614  1.00 0.00 ? 2  ASP A OD2  8  
ATOM 7289  H H    . ASP A 1 2  ? -24.976 -14.427 -6.126  1.00 0.00 ? 2  ASP A H    8  
ATOM 7290  H HA   . ASP A 1 2  ? -25.276 -15.894 -8.678  1.00 0.00 ? 2  ASP A HA   8  
ATOM 7291  H HB2  . ASP A 1 2  ? -24.668 -13.870 -9.885  1.00 0.00 ? 2  ASP A HB2  8  
ATOM 7292  H HB3  . ASP A 1 2  ? -26.091 -13.564 -8.889  1.00 0.00 ? 2  ASP A HB3  8  
ATOM 7293  N N    . ARG A 1 3  ? -22.674 -15.515 -9.218  1.00 0.00 ? 3  ARG A N    8  
ATOM 7294  C CA   . ARG A 1 3  ? -21.240 -15.788 -9.284  1.00 0.00 ? 3  ARG A CA   8  
ATOM 7295  C C    . ARG A 1 3  ? -20.838 -16.785 -8.198  1.00 0.00 ? 3  ARG A C    8  
ATOM 7296  O O    . ARG A 1 3  ? -21.614 -17.673 -7.843  1.00 0.00 ? 3  ARG A O    8  
ATOM 7297  C CB   . ARG A 1 3  ? -20.456 -14.481 -9.114  1.00 0.00 ? 3  ARG A CB   8  
ATOM 7298  C CG   . ARG A 1 3  ? -19.162 -14.530 -9.937  1.00 0.00 ? 3  ARG A CG   8  
ATOM 7299  C CD   . ARG A 1 3  ? -18.444 -13.183 -9.833  1.00 0.00 ? 3  ARG A CD   8  
ATOM 7300  N NE   . ARG A 1 3  ? -19.263 -12.128 -10.418 1.00 0.00 ? 3  ARG A NE   8  
ATOM 7301  C CZ   . ARG A 1 3  ? -18.899 -10.852 -10.341 1.00 0.00 ? 3  ARG A CZ   8  
ATOM 7302  N NH1  . ARG A 1 3  ? -17.791 -10.526 -9.733  1.00 0.00 ? 3  ARG A NH1  8  
ATOM 7303  N NH2  . ARG A 1 3  ? -19.649 -9.927  -10.872 1.00 0.00 ? 3  ARG A NH2  8  
ATOM 7304  H H    . ARG A 1 3  ? -23.182 -15.430 -10.052 1.00 0.00 ? 3  ARG A H    8  
ATOM 7305  H HA   . ARG A 1 3  ? -21.011 -16.214 -10.249 1.00 0.00 ? 3  ARG A HA   8  
ATOM 7306  H HB2  . ARG A 1 3  ? -21.064 -13.654 -9.452  1.00 0.00 ? 3  ARG A HB2  8  
ATOM 7307  H HB3  . ARG A 1 3  ? -20.210 -14.340 -8.072  1.00 0.00 ? 3  ARG A HB3  8  
ATOM 7308  H HG2  . ARG A 1 3  ? -18.520 -15.313 -9.562  1.00 0.00 ? 3  ARG A HG2  8  
ATOM 7309  H HG3  . ARG A 1 3  ? -19.399 -14.724 -10.973 1.00 0.00 ? 3  ARG A HG3  8  
ATOM 7310  H HD2  . ARG A 1 3  ? -18.260 -12.956 -8.795  1.00 0.00 ? 3  ARG A HD2  8  
ATOM 7311  H HD3  . ARG A 1 3  ? -17.502 -13.240 -10.359 1.00 0.00 ? 3  ARG A HD3  8  
ATOM 7312  H HE   . ARG A 1 3  ? -20.096 -12.364 -10.877 1.00 0.00 ? 3  ARG A HE   8  
ATOM 7313  H HH11 . ARG A 1 3  ? -17.217 -11.235 -9.326  1.00 0.00 ? 3  ARG A HH11 8  
ATOM 7314  H HH12 . ARG A 1 3  ? -17.517 -9.567  -9.674  1.00 0.00 ? 3  ARG A HH12 8  
ATOM 7315  H HH21 . ARG A 1 3  ? -20.498 -10.176 -11.337 1.00 0.00 ? 3  ARG A HH21 8  
ATOM 7316  H HH22 . ARG A 1 3  ? -19.375 -8.966  -10.813 1.00 0.00 ? 3  ARG A HH22 8  
ATOM 7317  N N    . TRP A 1 4  ? -19.625 -16.636 -7.673  1.00 0.00 ? 4  TRP A N    8  
ATOM 7318  C CA   . TRP A 1 4  ? -19.139 -17.531 -6.632  1.00 0.00 ? 4  TRP A CA   8  
ATOM 7319  C C    . TRP A 1 4  ? -19.581 -17.050 -5.253  1.00 0.00 ? 4  TRP A C    8  
ATOM 7320  O O    . TRP A 1 4  ? -19.709 -17.843 -4.320  1.00 0.00 ? 4  TRP A O    8  
ATOM 7321  C CB   . TRP A 1 4  ? -17.612 -17.607 -6.679  1.00 0.00 ? 4  TRP A CB   8  
ATOM 7322  C CG   . TRP A 1 4  ? -17.131 -18.624 -5.694  1.00 0.00 ? 4  TRP A CG   8  
ATOM 7323  C CD1  . TRP A 1 4  ? -16.955 -19.939 -5.960  1.00 0.00 ? 4  TRP A CD1  8  
ATOM 7324  C CD2  . TRP A 1 4  ? -16.763 -18.436 -4.297  1.00 0.00 ? 4  TRP A CD2  8  
ATOM 7325  N NE1  . TRP A 1 4  ? -16.504 -20.569 -4.814  1.00 0.00 ? 4  TRP A NE1  8  
ATOM 7326  C CE2  . TRP A 1 4  ? -16.368 -19.685 -3.763  1.00 0.00 ? 4  TRP A CE2  8  
ATOM 7327  C CE3  . TRP A 1 4  ? -16.733 -17.314 -3.450  1.00 0.00 ? 4  TRP A CE3  8  
ATOM 7328  C CZ2  . TRP A 1 4  ? -15.960 -19.817 -2.436  1.00 0.00 ? 4  TRP A CZ2  8  
ATOM 7329  C CZ3  . TRP A 1 4  ? -16.321 -17.443 -2.113  1.00 0.00 ? 4  TRP A CZ3  8  
ATOM 7330  C CH2  . TRP A 1 4  ? -15.936 -18.693 -1.607  1.00 0.00 ? 4  TRP A CH2  8  
ATOM 7331  H H    . TRP A 1 4  ? -19.047 -15.914 -7.992  1.00 0.00 ? 4  TRP A H    8  
ATOM 7332  H HA   . TRP A 1 4  ? -19.541 -18.519 -6.803  1.00 0.00 ? 4  TRP A HA   8  
ATOM 7333  H HB2  . TRP A 1 4  ? -17.296 -17.890 -7.673  1.00 0.00 ? 4  TRP A HB2  8  
ATOM 7334  H HB3  . TRP A 1 4  ? -17.196 -16.642 -6.432  1.00 0.00 ? 4  TRP A HB3  8  
ATOM 7335  H HD1  . TRP A 1 4  ? -17.139 -20.418 -6.910  1.00 0.00 ? 4  TRP A HD1  8  
ATOM 7336  H HE1  . TRP A 1 4  ? -16.298 -21.525 -4.739  1.00 0.00 ? 4  TRP A HE1  8  
ATOM 7337  H HE3  . TRP A 1 4  ? -17.027 -16.347 -3.829  1.00 0.00 ? 4  TRP A HE3  8  
ATOM 7338  H HZ2  . TRP A 1 4  ? -15.664 -20.783 -2.051  1.00 0.00 ? 4  TRP A HZ2  8  
ATOM 7339  H HZ3  . TRP A 1 4  ? -16.302 -16.575 -1.470  1.00 0.00 ? 4  TRP A HZ3  8  
ATOM 7340  H HH2  . TRP A 1 4  ? -15.621 -18.786 -0.578  1.00 0.00 ? 4  TRP A HH2  8  
ATOM 7341  N N    . TYR A 1 5  ? -19.812 -15.747 -5.131  1.00 0.00 ? 5  TYR A N    8  
ATOM 7342  C CA   . TYR A 1 5  ? -20.236 -15.174 -3.860  1.00 0.00 ? 5  TYR A CA   8  
ATOM 7343  C C    . TYR A 1 5  ? -21.727 -15.402 -3.639  1.00 0.00 ? 5  TYR A C    8  
ATOM 7344  O O    . TYR A 1 5  ? -22.518 -15.351 -4.581  1.00 0.00 ? 5  TYR A O    8  
ATOM 7345  C CB   . TYR A 1 5  ? -19.943 -13.673 -3.840  1.00 0.00 ? 5  TYR A CB   8  
ATOM 7346  C CG   . TYR A 1 5  ? -18.450 -13.450 -3.849  1.00 0.00 ? 5  TYR A CG   8  
ATOM 7347  C CD1  . TYR A 1 5  ? -17.744 -13.387 -2.640  1.00 0.00 ? 5  TYR A CD1  8  
ATOM 7348  C CD2  . TYR A 1 5  ? -17.770 -13.306 -5.064  1.00 0.00 ? 5  TYR A CD2  8  
ATOM 7349  C CE1  . TYR A 1 5  ? -16.359 -13.181 -2.650  1.00 0.00 ? 5  TYR A CE1  8  
ATOM 7350  C CE2  . TYR A 1 5  ? -16.386 -13.101 -5.074  1.00 0.00 ? 5  TYR A CE2  8  
ATOM 7351  C CZ   . TYR A 1 5  ? -15.680 -13.037 -3.865  1.00 0.00 ? 5  TYR A CZ   8  
ATOM 7352  O OH   . TYR A 1 5  ? -14.315 -12.834 -3.876  1.00 0.00 ? 5  TYR A OH   8  
ATOM 7353  H H    . TYR A 1 5  ? -19.692 -15.161 -5.907  1.00 0.00 ? 5  TYR A H    8  
ATOM 7354  H HA   . TYR A 1 5  ? -19.685 -15.646 -3.059  1.00 0.00 ? 5  TYR A HA   8  
ATOM 7355  H HB2  . TYR A 1 5  ? -20.380 -13.210 -4.712  1.00 0.00 ? 5  TYR A HB2  8  
ATOM 7356  H HB3  . TYR A 1 5  ? -20.366 -13.234 -2.949  1.00 0.00 ? 5  TYR A HB3  8  
ATOM 7357  H HD1  . TYR A 1 5  ? -18.266 -13.498 -1.703  1.00 0.00 ? 5  TYR A HD1  8  
ATOM 7358  H HD2  . TYR A 1 5  ? -18.315 -13.355 -5.995  1.00 0.00 ? 5  TYR A HD2  8  
ATOM 7359  H HE1  . TYR A 1 5  ? -15.814 -13.133 -1.719  1.00 0.00 ? 5  TYR A HE1  8  
ATOM 7360  H HE2  . TYR A 1 5  ? -15.863 -12.989 -6.012  1.00 0.00 ? 5  TYR A HE2  8  
ATOM 7361  H HH   . TYR A 1 5  ? -13.887 -13.693 -3.872  1.00 0.00 ? 5  TYR A HH   8  
ATOM 7362  N N    . LEU A 1 6  ? -22.105 -15.640 -2.384  1.00 0.00 ? 6  LEU A N    8  
ATOM 7363  C CA   . LEU A 1 6  ? -23.505 -15.859 -2.039  1.00 0.00 ? 6  LEU A CA   8  
ATOM 7364  C C    . LEU A 1 6  ? -23.915 -14.927 -0.905  1.00 0.00 ? 6  LEU A C    8  
ATOM 7365  O O    . LEU A 1 6  ? -23.183 -14.771 0.073   1.00 0.00 ? 6  LEU A O    8  
ATOM 7366  C CB   . LEU A 1 6  ? -23.714 -17.312 -1.604  1.00 0.00 ? 6  LEU A CB   8  
ATOM 7367  C CG   . LEU A 1 6  ? -23.315 -18.260 -2.741  1.00 0.00 ? 6  LEU A CG   8  
ATOM 7368  C CD1  . LEU A 1 6  ? -23.453 -19.706 -2.268  1.00 0.00 ? 6  LEU A CD1  8  
ATOM 7369  C CD2  . LEU A 1 6  ? -24.225 -18.035 -3.954  1.00 0.00 ? 6  LEU A CD2  8  
ATOM 7370  H H    . LEU A 1 6  ? -21.431 -15.648 -1.674  1.00 0.00 ? 6  LEU A H    8  
ATOM 7371  H HA   . LEU A 1 6  ? -24.121 -15.656 -2.901  1.00 0.00 ? 6  LEU A HA   8  
ATOM 7372  H HB2  . LEU A 1 6  ? -23.102 -17.517 -0.737  1.00 0.00 ? 6  LEU A HB2  8  
ATOM 7373  H HB3  . LEU A 1 6  ? -24.753 -17.469 -1.352  1.00 0.00 ? 6  LEU A HB3  8  
ATOM 7374  H HG   . LEU A 1 6  ? -22.288 -18.069 -3.020  1.00 0.00 ? 6  LEU A HG   8  
ATOM 7375  H HD11 . LEU A 1 6  ? -24.304 -19.791 -1.609  1.00 0.00 ? 6  LEU A HD11 8  
ATOM 7376  H HD12 . LEU A 1 6  ? -22.558 -20.000 -1.740  1.00 0.00 ? 6  LEU A HD12 8  
ATOM 7377  H HD13 . LEU A 1 6  ? -23.594 -20.352 -3.122  1.00 0.00 ? 6  LEU A HD13 8  
ATOM 7378  H HD21 . LEU A 1 6  ? -24.397 -18.978 -4.453  1.00 0.00 ? 6  LEU A HD21 8  
ATOM 7379  H HD22 . LEU A 1 6  ? -23.751 -17.349 -4.639  1.00 0.00 ? 6  LEU A HD22 8  
ATOM 7380  H HD23 . LEU A 1 6  ? -25.170 -17.623 -3.630  1.00 0.00 ? 6  LEU A HD23 8  
ATOM 7381  N N    . GLY A 1 7  ? -25.090 -14.314 -1.026  1.00 0.00 ? 7  GLY A N    8  
ATOM 7382  C CA   . GLY A 1 7  ? -25.571 -13.411 0.013   1.00 0.00 ? 7  GLY A CA   8  
ATOM 7383  C C    . GLY A 1 7  ? -24.901 -12.044 -0.090  1.00 0.00 ? 7  GLY A C    8  
ATOM 7384  O O    . GLY A 1 7  ? -25.101 -11.181 0.766   1.00 0.00 ? 7  GLY A O    8  
ATOM 7385  H H    . GLY A 1 7  ? -25.646 -14.475 -1.816  1.00 0.00 ? 7  GLY A H    8  
ATOM 7386  H HA2  . GLY A 1 7  ? -26.639 -13.293 -0.088  1.00 0.00 ? 7  GLY A HA2  8  
ATOM 7387  H HA3  . GLY A 1 7  ? -25.353 -13.838 0.981   1.00 0.00 ? 7  GLY A HA3  8  
ATOM 7388  N N    . GLY A 1 8  ? -24.098 -11.858 -1.131  1.00 0.00 ? 8  GLY A N    8  
ATOM 7389  C CA   . GLY A 1 8  ? -23.394 -10.594 -1.322  1.00 0.00 ? 8  GLY A CA   8  
ATOM 7390  C C    . GLY A 1 8  ? -24.356 -9.463  -1.664  1.00 0.00 ? 8  GLY A C    8  
ATOM 7391  O O    . GLY A 1 8  ? -25.392 -9.678  -2.292  1.00 0.00 ? 8  GLY A O    8  
ATOM 7392  H H    . GLY A 1 8  ? -23.968 -12.583 -1.777  1.00 0.00 ? 8  GLY A H    8  
ATOM 7393  H HA2  . GLY A 1 8  ? -22.863 -10.346 -0.414  1.00 0.00 ? 8  GLY A HA2  8  
ATOM 7394  H HA3  . GLY A 1 8  ? -22.682 -10.705 -2.127  1.00 0.00 ? 8  GLY A HA3  8  
ATOM 7395  N N    . SER A 1 9  ? -23.993 -8.252  -1.251  1.00 0.00 ? 9  SER A N    8  
ATOM 7396  C CA   . SER A 1 9  ? -24.812 -7.074  -1.517  1.00 0.00 ? 9  SER A CA   8  
ATOM 7397  C C    . SER A 1 9  ? -24.464 -6.493  -2.898  1.00 0.00 ? 9  SER A C    8  
ATOM 7398  O O    . SER A 1 9  ? -23.284 -6.340  -3.208  1.00 0.00 ? 9  SER A O    8  
ATOM 7399  C CB   . SER A 1 9  ? -24.555 -6.015  -0.444  1.00 0.00 ? 9  SER A CB   8  
ATOM 7400  O OG   . SER A 1 9  ? -25.366 -4.877  -0.705  1.00 0.00 ? 9  SER A OG   8  
ATOM 7401  H H    . SER A 1 9  ? -23.149 -8.144  -0.764  1.00 0.00 ? 9  SER A H    8  
ATOM 7402  H HA   . SER A 1 9  ? -25.846 -7.361  -1.479  1.00 0.00 ? 9  SER A HA   8  
ATOM 7403  H HB2  . SER A 1 9  ? -24.804 -6.413  0.524   1.00 0.00 ? 9  SER A HB2  8  
ATOM 7404  H HB3  . SER A 1 9  ? -23.509 -5.737  -0.458  1.00 0.00 ? 9  SER A HB3  8  
ATOM 7405  H HG   . SER A 1 9  ? -26.281 -5.165  -0.735  1.00 0.00 ? 9  SER A HG   8  
ATOM 7406  N N    . PRO A 1 10 ? -25.429 -6.161  -3.737  1.00 0.00 ? 10 PRO A N    8  
ATOM 7407  C CA   . PRO A 1 10 ? -25.120 -5.589  -5.083  1.00 0.00 ? 10 PRO A CA   8  
ATOM 7408  C C    . PRO A 1 10 ? -24.075 -4.479  -4.993  1.00 0.00 ? 10 PRO A C    8  
ATOM 7409  O O    . PRO A 1 10 ? -24.160 -3.601  -4.134  1.00 0.00 ? 10 PRO A O    8  
ATOM 7410  C CB   . PRO A 1 10 ? -26.464 -5.022  -5.538  1.00 0.00 ? 10 PRO A CB   8  
ATOM 7411  C CG   . PRO A 1 10 ? -27.482 -5.885  -4.879  1.00 0.00 ? 10 PRO A CG   8  
ATOM 7412  C CD   . PRO A 1 10 ? -26.890 -6.288  -3.530  1.00 0.00 ? 10 PRO A CD   8  
ATOM 7413  H HA   . PRO A 1 10 ? -24.799 -6.361  -5.761  1.00 0.00 ? 10 PRO A HA   8  
ATOM 7414  H HB2  . PRO A 1 10 ? -26.567 -3.996  -5.213  1.00 0.00 ? 10 PRO A HB2  8  
ATOM 7415  H HB3  . PRO A 1 10 ? -26.558 -5.090  -6.611  1.00 0.00 ? 10 PRO A HB3  8  
ATOM 7416  H HG2  . PRO A 1 10 ? -28.400 -5.329  -4.737  1.00 0.00 ? 10 PRO A HG2  8  
ATOM 7417  H HG3  . PRO A 1 10 ? -27.666 -6.764  -5.473  1.00 0.00 ? 10 PRO A HG3  8  
ATOM 7418  H HD2  . PRO A 1 10 ? -27.231 -5.621  -2.748  1.00 0.00 ? 10 PRO A HD2  8  
ATOM 7419  H HD3  . PRO A 1 10 ? -27.152 -7.309  -3.306  1.00 0.00 ? 10 PRO A HD3  8  
ATOM 7420  N N    . LYS A 1 11 ? -23.084 -4.538  -5.874  1.00 0.00 ? 11 LYS A N    8  
ATOM 7421  C CA   . LYS A 1 11 ? -22.013 -3.548  -5.882  1.00 0.00 ? 11 LYS A CA   8  
ATOM 7422  C C    . LYS A 1 11 ? -22.308 -2.420  -6.865  1.00 0.00 ? 11 LYS A C    8  
ATOM 7423  O O    . LYS A 1 11 ? -21.490 -1.517  -7.046  1.00 0.00 ? 11 LYS A O    8  
ATOM 7424  C CB   . LYS A 1 11 ? -20.694 -4.221  -6.261  1.00 0.00 ? 11 LYS A CB   8  
ATOM 7425  C CG   . LYS A 1 11 ? -20.317 -5.244  -5.187  1.00 0.00 ? 11 LYS A CG   8  
ATOM 7426  C CD   . LYS A 1 11 ? -18.996 -5.917  -5.562  1.00 0.00 ? 11 LYS A CD   8  
ATOM 7427  C CE   . LYS A 1 11 ? -18.610 -6.923  -4.474  1.00 0.00 ? 11 LYS A CE   8  
ATOM 7428  N NZ   . LYS A 1 11 ? -19.642 -7.994  -4.399  1.00 0.00 ? 11 LYS A NZ   8  
ATOM 7429  H H    . LYS A 1 11 ? -23.066 -5.268  -6.528  1.00 0.00 ? 11 LYS A H    8  
ATOM 7430  H HA   . LYS A 1 11 ? -21.916 -3.131  -4.891  1.00 0.00 ? 11 LYS A HA   8  
ATOM 7431  H HB2  . LYS A 1 11 ? -20.803 -4.720  -7.213  1.00 0.00 ? 11 LYS A HB2  8  
ATOM 7432  H HB3  . LYS A 1 11 ? -19.915 -3.475  -6.331  1.00 0.00 ? 11 LYS A HB3  8  
ATOM 7433  H HG2  . LYS A 1 11 ? -20.212 -4.744  -4.234  1.00 0.00 ? 11 LYS A HG2  8  
ATOM 7434  H HG3  . LYS A 1 11 ? -21.093 -5.992  -5.117  1.00 0.00 ? 11 LYS A HG3  8  
ATOM 7435  H HD2  . LYS A 1 11 ? -19.109 -6.432  -6.504  1.00 0.00 ? 11 LYS A HD2  8  
ATOM 7436  H HD3  . LYS A 1 11 ? -18.223 -5.170  -5.648  1.00 0.00 ? 11 LYS A HD3  8  
ATOM 7437  H HE2  . LYS A 1 11 ? -17.652 -7.360  -4.712  1.00 0.00 ? 11 LYS A HE2  8  
ATOM 7438  H HE3  . LYS A 1 11 ? -18.547 -6.416  -3.523  1.00 0.00 ? 11 LYS A HE3  8  
ATOM 7439  H HZ1  . LYS A 1 11 ? -20.425 -7.767  -5.045  1.00 0.00 ? 11 LYS A HZ1  8  
ATOM 7440  H HZ2  . LYS A 1 11 ? -20.003 -8.060  -3.426  1.00 0.00 ? 11 LYS A HZ2  8  
ATOM 7441  H HZ3  . LYS A 1 11 ? -19.220 -8.903  -4.676  1.00 0.00 ? 11 LYS A HZ3  8  
ATOM 7442  N N    . GLY A 1 12 ? -23.470 -2.474  -7.506  1.00 0.00 ? 12 GLY A N    8  
ATOM 7443  C CA   . GLY A 1 12 ? -23.835 -1.446  -8.474  1.00 0.00 ? 12 GLY A CA   8  
ATOM 7444  C C    . GLY A 1 12 ? -23.095 -1.667  -9.788  1.00 0.00 ? 12 GLY A C    8  
ATOM 7445  O O    . GLY A 1 12 ? -22.956 -0.751  -10.600 1.00 0.00 ? 12 GLY A O    8  
ATOM 7446  H H    . GLY A 1 12 ? -24.086 -3.216  -7.332  1.00 0.00 ? 12 GLY A H    8  
ATOM 7447  H HA2  . GLY A 1 12 ? -24.902 -1.485  -8.650  1.00 0.00 ? 12 GLY A HA2  8  
ATOM 7448  H HA3  . GLY A 1 12 ? -23.574 -0.475  -8.080  1.00 0.00 ? 12 GLY A HA3  8  
ATOM 7449  N N    . ASP A 1 13 ? -22.633 -2.895  -9.990  1.00 0.00 ? 13 ASP A N    8  
ATOM 7450  C CA   . ASP A 1 13 ? -21.915 -3.228  -11.214 1.00 0.00 ? 13 ASP A CA   8  
ATOM 7451  C C    . ASP A 1 13 ? -22.763 -2.827  -12.416 1.00 0.00 ? 13 ASP A C    8  
ATOM 7452  O O    . ASP A 1 13 ? -22.424 -1.895  -13.146 1.00 0.00 ? 13 ASP A O    8  
ATOM 7453  C CB   . ASP A 1 13 ? -21.623 -4.729  -11.262 1.00 0.00 ? 13 ASP A CB   8  
ATOM 7454  C CG   . ASP A 1 13 ? -20.523 -5.078  -10.267 1.00 0.00 ? 13 ASP A CG   8  
ATOM 7455  O OD1  . ASP A 1 13 ? -19.888 -4.164  -9.769  1.00 0.00 ? 13 ASP A OD1  8  
ATOM 7456  O OD2  . ASP A 1 13 ? -20.331 -6.258  -10.016 1.00 0.00 ? 13 ASP A OD2  8  
ATOM 7457  H H    . ASP A 1 13 ? -22.796 -3.571  -9.300  1.00 0.00 ? 13 ASP A H    8  
ATOM 7458  H HA   . ASP A 1 13 ? -20.984 -2.684  -11.239 1.00 0.00 ? 13 ASP A HA   8  
ATOM 7459  H HB2  . ASP A 1 13 ? -22.519 -5.277  -11.014 1.00 0.00 ? 13 ASP A HB2  8  
ATOM 7460  H HB3  . ASP A 1 13 ? -21.302 -4.999  -12.259 1.00 0.00 ? 13 ASP A HB3  8  
ATOM 7461  N N    . VAL A 1 14 ? -23.881 -3.519  -12.596 1.00 0.00 ? 14 VAL A N    8  
ATOM 7462  C CA   . VAL A 1 14 ? -24.794 -3.211  -13.690 1.00 0.00 ? 14 VAL A CA   8  
ATOM 7463  C C    . VAL A 1 14 ? -26.234 -3.385  -13.225 1.00 0.00 ? 14 VAL A C    8  
ATOM 7464  O O    . VAL A 1 14 ? -26.522 -4.256  -12.404 1.00 0.00 ? 14 VAL A O    8  
ATOM 7465  C CB   . VAL A 1 14 ? -24.520 -4.136  -14.877 1.00 0.00 ? 14 VAL A CB   8  
ATOM 7466  C CG1  . VAL A 1 14 ? -23.098 -3.904  -15.389 1.00 0.00 ? 14 VAL A CG1  8  
ATOM 7467  C CG2  . VAL A 1 14 ? -24.669 -5.593  -14.432 1.00 0.00 ? 14 VAL A CG2  8  
ATOM 7468  H H    . VAL A 1 14 ? -24.105 -4.241  -11.971 1.00 0.00 ? 14 VAL A H    8  
ATOM 7469  H HA   . VAL A 1 14 ? -24.642 -2.188  -13.998 1.00 0.00 ? 14 VAL A HA   8  
ATOM 7470  H HB   . VAL A 1 14 ? -25.227 -3.925  -15.668 1.00 0.00 ? 14 VAL A HB   8  
ATOM 7471  H HG11 . VAL A 1 14 ? -22.906 -2.843  -15.450 1.00 0.00 ? 14 VAL A HG11 8  
ATOM 7472  H HG12 . VAL A 1 14 ? -22.992 -4.345  -16.370 1.00 0.00 ? 14 VAL A HG12 8  
ATOM 7473  H HG13 . VAL A 1 14 ? -22.393 -4.360  -14.710 1.00 0.00 ? 14 VAL A HG13 8  
ATOM 7474  H HG21 . VAL A 1 14 ? -23.790 -6.148  -14.721 1.00 0.00 ? 14 VAL A HG21 8  
ATOM 7475  H HG22 . VAL A 1 14 ? -25.541 -6.025  -14.902 1.00 0.00 ? 14 VAL A HG22 8  
ATOM 7476  H HG23 . VAL A 1 14 ? -24.783 -5.631  -13.358 1.00 0.00 ? 14 VAL A HG23 8  
ATOM 7477  N N    . ASP A 1 15 ? -27.138 -2.556  -13.743 1.00 0.00 ? 15 ASP A N    8  
ATOM 7478  C CA   . ASP A 1 15 ? -28.545 -2.638  -13.360 1.00 0.00 ? 15 ASP A CA   8  
ATOM 7479  C C    . ASP A 1 15 ? -29.434 -2.684  -14.600 1.00 0.00 ? 15 ASP A C    8  
ATOM 7480  O O    . ASP A 1 15 ? -30.173 -1.742  -14.879 1.00 0.00 ? 15 ASP A O    8  
ATOM 7481  C CB   . ASP A 1 15 ? -28.917 -1.420  -12.511 1.00 0.00 ? 15 ASP A CB   8  
ATOM 7482  C CG   . ASP A 1 15 ? -28.051 -1.375  -11.258 1.00 0.00 ? 15 ASP A CG   8  
ATOM 7483  O OD1  . ASP A 1 15 ? -26.857 -1.162  -11.393 1.00 0.00 ? 15 ASP A OD1  8  
ATOM 7484  O OD2  . ASP A 1 15 ? -28.594 -1.552  -10.180 1.00 0.00 ? 15 ASP A OD2  8  
ATOM 7485  H H    . ASP A 1 15 ? -26.861 -1.867  -14.383 1.00 0.00 ? 15 ASP A H    8  
ATOM 7486  H HA   . ASP A 1 15 ? -28.704 -3.527  -12.774 1.00 0.00 ? 15 ASP A HA   8  
ATOM 7487  H HB2  . ASP A 1 15 ? -28.763 -0.521  -13.088 1.00 0.00 ? 15 ASP A HB2  8  
ATOM 7488  H HB3  . ASP A 1 15 ? -29.955 -1.489  -12.224 1.00 0.00 ? 15 ASP A HB3  8  
ATOM 7489  N N    . PRO A 1 16 ? -29.373 -3.760  -15.346 1.00 0.00 ? 16 PRO A N    8  
ATOM 7490  C CA   . PRO A 1 16 ? -30.188 -3.930  -16.585 1.00 0.00 ? 16 PRO A CA   8  
ATOM 7491  C C    . PRO A 1 16 ? -31.655 -4.222  -16.280 1.00 0.00 ? 16 PRO A C    8  
ATOM 7492  O O    . PRO A 1 16 ? -32.485 -4.287  -17.189 1.00 0.00 ? 16 PRO A O    8  
ATOM 7493  C CB   . PRO A 1 16 ? -29.522 -5.110  -17.291 1.00 0.00 ? 16 PRO A CB   8  
ATOM 7494  C CG   . PRO A 1 16 ? -28.914 -5.921  -16.198 1.00 0.00 ? 16 PRO A CG   8  
ATOM 7495  C CD   . PRO A 1 16 ? -28.520 -4.939  -15.094 1.00 0.00 ? 16 PRO A CD   8  
ATOM 7496  H HA   . PRO A 1 16 ? -30.107 -3.052  -17.204 1.00 0.00 ? 16 PRO A HA   8  
ATOM 7497  H HB2  . PRO A 1 16 ? -30.260 -5.691  -17.826 1.00 0.00 ? 16 PRO A HB2  8  
ATOM 7498  H HB3  . PRO A 1 16 ? -28.754 -4.762  -17.964 1.00 0.00 ? 16 PRO A HB3  8  
ATOM 7499  H HG2  . PRO A 1 16 ? -29.634 -6.637  -15.824 1.00 0.00 ? 16 PRO A HG2  8  
ATOM 7500  H HG3  . PRO A 1 16 ? -28.035 -6.431  -16.559 1.00 0.00 ? 16 PRO A HG3  8  
ATOM 7501  H HD2  . PRO A 1 16 ? -28.731 -5.368  -14.125 1.00 0.00 ? 16 PRO A HD2  8  
ATOM 7502  H HD3  . PRO A 1 16 ? -27.478 -4.671  -15.175 1.00 0.00 ? 16 PRO A HD3  8  
ATOM 7503  N N    . PHE A 1 17 ? -31.965 -4.412  -15.002 1.00 0.00 ? 17 PHE A N    8  
ATOM 7504  C CA   . PHE A 1 17 ? -33.334 -4.713  -14.600 1.00 0.00 ? 17 PHE A CA   8  
ATOM 7505  C C    . PHE A 1 17 ? -34.281 -3.577  -14.977 1.00 0.00 ? 17 PHE A C    8  
ATOM 7506  O O    . PHE A 1 17 ? -35.409 -3.820  -15.407 1.00 0.00 ? 17 PHE A O    8  
ATOM 7507  C CB   . PHE A 1 17 ? -33.392 -4.944  -13.088 1.00 0.00 ? 17 PHE A CB   8  
ATOM 7508  C CG   . PHE A 1 17 ? -32.734 -6.261  -12.754 1.00 0.00 ? 17 PHE A CG   8  
ATOM 7509  C CD1  . PHE A 1 17 ? -33.489 -7.440  -12.750 1.00 0.00 ? 17 PHE A CD1  8  
ATOM 7510  C CD2  . PHE A 1 17 ? -31.369 -6.303  -12.449 1.00 0.00 ? 17 PHE A CD2  8  
ATOM 7511  C CE1  . PHE A 1 17 ? -32.879 -8.661  -12.441 1.00 0.00 ? 17 PHE A CE1  8  
ATOM 7512  C CE2  . PHE A 1 17 ? -30.758 -7.525  -12.140 1.00 0.00 ? 17 PHE A CE2  8  
ATOM 7513  C CZ   . PHE A 1 17 ? -31.514 -8.704  -12.136 1.00 0.00 ? 17 PHE A CZ   8  
ATOM 7514  H H    . PHE A 1 17 ? -31.263 -4.358  -14.321 1.00 0.00 ? 17 PHE A H    8  
ATOM 7515  H HA   . PHE A 1 17 ? -33.655 -5.615  -15.098 1.00 0.00 ? 17 PHE A HA   8  
ATOM 7516  H HB2  . PHE A 1 17 ? -32.875 -4.142  -12.581 1.00 0.00 ? 17 PHE A HB2  8  
ATOM 7517  H HB3  . PHE A 1 17 ? -34.424 -4.966  -12.766 1.00 0.00 ? 17 PHE A HB3  8  
ATOM 7518  H HD1  . PHE A 1 17 ? -34.542 -7.407  -12.983 1.00 0.00 ? 17 PHE A HD1  8  
ATOM 7519  H HD2  . PHE A 1 17 ? -30.786 -5.395  -12.454 1.00 0.00 ? 17 PHE A HD2  8  
ATOM 7520  H HE1  . PHE A 1 17 ? -33.461 -9.570  -12.436 1.00 0.00 ? 17 PHE A HE1  8  
ATOM 7521  H HE2  . PHE A 1 17 ? -29.704 -7.558  -11.905 1.00 0.00 ? 17 PHE A HE2  8  
ATOM 7522  H HZ   . PHE A 1 17 ? -31.042 -9.646  -11.897 1.00 0.00 ? 17 PHE A HZ   8  
ATOM 7523  N N    . TYR A 1 18 ? -33.832 -2.337  -14.800 1.00 0.00 ? 18 TYR A N    8  
ATOM 7524  C CA   . TYR A 1 18 ? -34.683 -1.193  -15.115 1.00 0.00 ? 18 TYR A CA   8  
ATOM 7525  C C    . TYR A 1 18 ? -35.080 -1.219  -16.588 1.00 0.00 ? 18 TYR A C    8  
ATOM 7526  O O    . TYR A 1 18 ? -36.247 -1.028  -16.924 1.00 0.00 ? 18 TYR A O    8  
ATOM 7527  C CB   . TYR A 1 18 ? -33.951 0.111   -14.802 1.00 0.00 ? 18 TYR A CB   8  
ATOM 7528  C CG   . TYR A 1 18 ? -33.841 0.275   -13.305 1.00 0.00 ? 18 TYR A CG   8  
ATOM 7529  C CD1  . TYR A 1 18 ? -34.848 0.941   -12.596 1.00 0.00 ? 18 TYR A CD1  8  
ATOM 7530  C CD2  . TYR A 1 18 ? -32.730 -0.237  -12.625 1.00 0.00 ? 18 TYR A CD2  8  
ATOM 7531  C CE1  . TYR A 1 18 ? -34.745 1.093   -11.209 1.00 0.00 ? 18 TYR A CE1  8  
ATOM 7532  C CE2  . TYR A 1 18 ? -32.627 -0.085  -11.238 1.00 0.00 ? 18 TYR A CE2  8  
ATOM 7533  C CZ   . TYR A 1 18 ? -33.633 0.580   -10.529 1.00 0.00 ? 18 TYR A CZ   8  
ATOM 7534  O OH   . TYR A 1 18 ? -33.531 0.731   -9.161  1.00 0.00 ? 18 TYR A OH   8  
ATOM 7535  H H    . TYR A 1 18 ? -32.938 -2.201  -14.423 1.00 0.00 ? 18 TYR A H    8  
ATOM 7536  H HA   . TYR A 1 18 ? -35.577 -1.246  -14.512 1.00 0.00 ? 18 TYR A HA   8  
ATOM 7537  H HB2  . TYR A 1 18 ? -32.961 0.082   -15.234 1.00 0.00 ? 18 TYR A HB2  8  
ATOM 7538  H HB3  . TYR A 1 18 ? -34.502 0.943   -15.215 1.00 0.00 ? 18 TYR A HB3  8  
ATOM 7539  H HD1  . TYR A 1 18 ? -35.705 1.337   -13.121 1.00 0.00 ? 18 TYR A HD1  8  
ATOM 7540  H HD2  . TYR A 1 18 ? -31.954 -0.750  -13.173 1.00 0.00 ? 18 TYR A HD2  8  
ATOM 7541  H HE1  . TYR A 1 18 ? -35.522 1.607   -10.662 1.00 0.00 ? 18 TYR A HE1  8  
ATOM 7542  H HE2  . TYR A 1 18 ? -31.768 -0.482  -10.714 1.00 0.00 ? 18 TYR A HE2  8  
ATOM 7543  H HH   . TYR A 1 18 ? -33.498 -0.146  -8.768  1.00 0.00 ? 18 TYR A HH   8  
ATOM 7544  N N    . TYR A 1 19 ? -34.115 -1.472  -17.466 1.00 0.00 ? 19 TYR A N    8  
ATOM 7545  C CA   . TYR A 1 19 ? -34.410 -1.538  -18.892 1.00 0.00 ? 19 TYR A CA   8  
ATOM 7546  C C    . TYR A 1 19 ? -35.242 -2.780  -19.192 1.00 0.00 ? 19 TYR A C    8  
ATOM 7547  O O    . TYR A 1 19 ? -36.145 -2.756  -20.027 1.00 0.00 ? 19 TYR A O    8  
ATOM 7548  C CB   . TYR A 1 19 ? -33.109 -1.580  -19.695 1.00 0.00 ? 19 TYR A CB   8  
ATOM 7549  C CG   . TYR A 1 19 ? -32.416 -0.243  -19.599 1.00 0.00 ? 19 TYR A CG   8  
ATOM 7550  C CD1  . TYR A 1 19 ? -32.700 0.762   -20.532 1.00 0.00 ? 19 TYR A CD1  8  
ATOM 7551  C CD2  . TYR A 1 19 ? -31.489 -0.007  -18.576 1.00 0.00 ? 19 TYR A CD2  8  
ATOM 7552  C CE1  . TYR A 1 19 ? -32.058 2.002   -20.442 1.00 0.00 ? 19 TYR A CE1  8  
ATOM 7553  C CE2  . TYR A 1 19 ? -30.847 1.234   -18.487 1.00 0.00 ? 19 TYR A CE2  8  
ATOM 7554  C CZ   . TYR A 1 19 ? -31.131 2.238   -19.420 1.00 0.00 ? 19 TYR A CZ   8  
ATOM 7555  O OH   . TYR A 1 19 ? -30.498 3.461   -19.331 1.00 0.00 ? 19 TYR A OH   8  
ATOM 7556  H H    . TYR A 1 19 ? -33.197 -1.618  -17.158 1.00 0.00 ? 19 TYR A H    8  
ATOM 7557  H HA   . TYR A 1 19 ? -34.971 -0.660  -19.177 1.00 0.00 ? 19 TYR A HA   8  
ATOM 7558  H HB2  . TYR A 1 19 ? -32.465 -2.350  -19.297 1.00 0.00 ? 19 TYR A HB2  8  
ATOM 7559  H HB3  . TYR A 1 19 ? -33.332 -1.796  -20.730 1.00 0.00 ? 19 TYR A HB3  8  
ATOM 7560  H HD1  . TYR A 1 19 ? -33.415 0.580   -21.320 1.00 0.00 ? 19 TYR A HD1  8  
ATOM 7561  H HD2  . TYR A 1 19 ? -31.270 -0.782  -17.857 1.00 0.00 ? 19 TYR A HD2  8  
ATOM 7562  H HE1  . TYR A 1 19 ? -32.277 2.777   -21.161 1.00 0.00 ? 19 TYR A HE1  8  
ATOM 7563  H HE2  . TYR A 1 19 ? -30.132 1.417   -17.698 1.00 0.00 ? 19 TYR A HE2  8  
ATOM 7564  H HH   . TYR A 1 19 ? -29.564 3.324   -19.503 1.00 0.00 ? 19 TYR A HH   8  
ATOM 7565  N N    . ASP A 1 20 ? -34.921 -3.865  -18.493 1.00 0.00 ? 20 ASP A N    8  
ATOM 7566  C CA   . ASP A 1 20 ? -35.630 -5.127  -18.667 1.00 0.00 ? 20 ASP A CA   8  
ATOM 7567  C C    . ASP A 1 20 ? -37.001 -5.080  -17.998 1.00 0.00 ? 20 ASP A C    8  
ATOM 7568  O O    . ASP A 1 20 ? -37.857 -5.926  -18.257 1.00 0.00 ? 20 ASP A O    8  
ATOM 7569  C CB   . ASP A 1 20 ? -34.809 -6.272  -18.069 1.00 0.00 ? 20 ASP A CB   8  
ATOM 7570  C CG   . ASP A 1 20 ? -35.334 -7.616  -18.567 1.00 0.00 ? 20 ASP A CG   8  
ATOM 7571  O OD1  . ASP A 1 20 ? -36.102 -7.618  -19.514 1.00 0.00 ? 20 ASP A OD1  8  
ATOM 7572  O OD2  . ASP A 1 20 ? -34.958 -8.624  -17.992 1.00 0.00 ? 20 ASP A OD2  8  
ATOM 7573  H H    . ASP A 1 20 ? -34.193 -3.810  -17.840 1.00 0.00 ? 20 ASP A H    8  
ATOM 7574  H HA   . ASP A 1 20 ? -35.762 -5.309  -19.722 1.00 0.00 ? 20 ASP A HA   8  
ATOM 7575  H HB2  . ASP A 1 20 ? -33.774 -6.161  -18.361 1.00 0.00 ? 20 ASP A HB2  8  
ATOM 7576  H HB3  . ASP A 1 20 ? -34.881 -6.238  -16.993 1.00 0.00 ? 20 ASP A HB3  8  
ATOM 7577  N N    . TYR A 1 21 ? -37.199 -4.094  -17.126 1.00 0.00 ? 21 TYR A N    8  
ATOM 7578  C CA   . TYR A 1 21 ? -38.467 -3.958  -16.415 1.00 0.00 ? 21 TYR A CA   8  
ATOM 7579  C C    . TYR A 1 21 ? -39.612 -3.707  -17.387 1.00 0.00 ? 21 TYR A C    8  
ATOM 7580  O O    . TYR A 1 21 ? -40.687 -4.281  -17.248 1.00 0.00 ? 21 TYR A O    8  
ATOM 7581  C CB   . TYR A 1 21 ? -38.387 -2.808  -15.410 1.00 0.00 ? 21 TYR A CB   8  
ATOM 7582  C CG   . TYR A 1 21 ? -39.706 -2.682  -14.685 1.00 0.00 ? 21 TYR A CG   8  
ATOM 7583  C CD1  . TYR A 1 21 ? -40.022 -3.566  -13.645 1.00 0.00 ? 21 TYR A CD1  8  
ATOM 7584  C CD2  . TYR A 1 21 ? -40.614 -1.681  -15.051 1.00 0.00 ? 21 TYR A CD2  8  
ATOM 7585  C CE1  . TYR A 1 21 ? -41.243 -3.448  -12.972 1.00 0.00 ? 21 TYR A CE1  8  
ATOM 7586  C CE2  . TYR A 1 21 ? -41.835 -1.563  -14.378 1.00 0.00 ? 21 TYR A CE2  8  
ATOM 7587  C CZ   . TYR A 1 21 ? -42.150 -2.446  -13.339 1.00 0.00 ? 21 TYR A CZ   8  
ATOM 7588  O OH   . TYR A 1 21 ? -43.355 -2.330  -12.676 1.00 0.00 ? 21 TYR A OH   8  
ATOM 7589  H H    . TYR A 1 21 ? -36.482 -3.451  -16.951 1.00 0.00 ? 21 TYR A H    8  
ATOM 7590  H HA   . TYR A 1 21 ? -38.663 -4.875  -15.876 1.00 0.00 ? 21 TYR A HA   8  
ATOM 7591  H HB2  . TYR A 1 21 ? -37.601 -3.005  -14.697 1.00 0.00 ? 21 TYR A HB2  8  
ATOM 7592  H HB3  . TYR A 1 21 ? -38.180 -1.889  -15.934 1.00 0.00 ? 21 TYR A HB3  8  
ATOM 7593  H HD1  . TYR A 1 21 ? -39.321 -4.339  -13.362 1.00 0.00 ? 21 TYR A HD1  8  
ATOM 7594  H HD2  . TYR A 1 21 ? -40.371 -1.000  -15.853 1.00 0.00 ? 21 TYR A HD2  8  
ATOM 7595  H HE1  . TYR A 1 21 ? -41.487 -4.129  -12.171 1.00 0.00 ? 21 TYR A HE1  8  
ATOM 7596  H HE2  . TYR A 1 21 ? -42.535 -0.791  -14.662 1.00 0.00 ? 21 TYR A HE2  8  
ATOM 7597  H HH   . TYR A 1 21 ? -44.039 -2.174  -13.330 1.00 0.00 ? 21 TYR A HH   8  
ATOM 7598  N N    . GLU A 1 22 ? -39.393 -2.826  -18.353 1.00 0.00 ? 22 GLU A N    8  
ATOM 7599  C CA   . GLU A 1 22 ? -40.442 -2.495  -19.312 1.00 0.00 ? 22 GLU A CA   8  
ATOM 7600  C C    . GLU A 1 22 ? -40.923 -3.749  -20.039 1.00 0.00 ? 22 GLU A C    8  
ATOM 7601  O O    . GLU A 1 22 ? -42.118 -3.904  -20.291 1.00 0.00 ? 22 GLU A O    8  
ATOM 7602  C CB   . GLU A 1 22 ? -39.913 -1.485  -20.333 1.00 0.00 ? 22 GLU A CB   8  
ATOM 7603  C CG   . GLU A 1 22 ? -39.659 -0.143  -19.645 1.00 0.00 ? 22 GLU A CG   8  
ATOM 7604  C CD   . GLU A 1 22 ? -40.983 0.494   -19.235 1.00 0.00 ? 22 GLU A CD   8  
ATOM 7605  O OE1  . GLU A 1 22 ? -42.001 0.099   -19.779 1.00 0.00 ? 22 GLU A OE1  8  
ATOM 7606  O OE2  . GLU A 1 22 ? -40.959 1.367   -18.382 1.00 0.00 ? 22 GLU A OE2  8  
ATOM 7607  H H    . GLU A 1 22 ? -38.530 -2.363  -18.395 1.00 0.00 ? 22 GLU A H    8  
ATOM 7608  H HA   . GLU A 1 22 ? -41.273 -2.054  -18.784 1.00 0.00 ? 22 GLU A HA   8  
ATOM 7609  H HB2  . GLU A 1 22 ? -38.991 -1.853  -20.759 1.00 0.00 ? 22 GLU A HB2  8  
ATOM 7610  H HB3  . GLU A 1 22 ? -40.643 -1.351  -21.119 1.00 0.00 ? 22 GLU A HB3  8  
ATOM 7611  H HG2  . GLU A 1 22 ? -39.051 -0.301  -18.767 1.00 0.00 ? 22 GLU A HG2  8  
ATOM 7612  H HG3  . GLU A 1 22 ? -39.142 0.517   -20.326 1.00 0.00 ? 22 GLU A HG3  8  
ATOM 7613  N N    . THR A 1 23 ? -39.998 -4.642  -20.367 1.00 0.00 ? 23 THR A N    8  
ATOM 7614  C CA   . THR A 1 23 ? -40.364 -5.875  -21.058 1.00 0.00 ? 23 THR A CA   8  
ATOM 7615  C C    . THR A 1 23 ? -41.187 -6.783  -20.142 1.00 0.00 ? 23 THR A C    8  
ATOM 7616  O O    . THR A 1 23 ? -41.975 -7.598  -20.610 1.00 0.00 ? 23 THR A O    8  
ATOM 7617  C CB   . THR A 1 23 ? -39.102 -6.614  -21.509 1.00 0.00 ? 23 THR A CB   8  
ATOM 7618  O OG1  . THR A 1 23 ? -38.308 -6.927  -20.374 1.00 0.00 ? 23 THR A OG1  8  
ATOM 7619  C CG2  . THR A 1 23 ? -38.302 -5.726  -22.464 1.00 0.00 ? 23 THR A CG2  8  
ATOM 7620  H H    . THR A 1 23 ? -39.060 -4.472  -20.144 1.00 0.00 ? 23 THR A H    8  
ATOM 7621  H HA   . THR A 1 23 ? -40.954 -5.629  -21.929 1.00 0.00 ? 23 THR A HA   8  
ATOM 7622  H HB   . THR A 1 23 ? -39.380 -7.524  -22.018 1.00 0.00 ? 23 THR A HB   8  
ATOM 7623  H HG1  . THR A 1 23 ? -37.950 -7.810  -20.496 1.00 0.00 ? 23 THR A HG1  8  
ATOM 7624  H HG21 . THR A 1 23 ? -37.440 -6.268  -22.822 1.00 0.00 ? 23 THR A HG21 8  
ATOM 7625  H HG22 . THR A 1 23 ? -37.978 -4.837  -21.944 1.00 0.00 ? 23 THR A HG22 8  
ATOM 7626  H HG23 . THR A 1 23 ? -38.925 -5.446  -23.301 1.00 0.00 ? 23 THR A HG23 8  
ATOM 7627  N N    . VAL A 1 24 ? -40.970 -6.651  -18.839 1.00 0.00 ? 24 VAL A N    8  
ATOM 7628  C CA   . VAL A 1 24 ? -41.656 -7.488  -17.851 1.00 0.00 ? 24 VAL A CA   8  
ATOM 7629  C C    . VAL A 1 24 ? -43.137 -7.668  -18.179 1.00 0.00 ? 24 VAL A C    8  
ATOM 7630  O O    . VAL A 1 24 ? -43.749 -8.649  -17.760 1.00 0.00 ? 24 VAL A O    8  
ATOM 7631  C CB   . VAL A 1 24 ? -41.527 -6.872  -16.455 1.00 0.00 ? 24 VAL A CB   8  
ATOM 7632  C CG1  . VAL A 1 24 ? -42.582 -5.774  -16.270 1.00 0.00 ? 24 VAL A CG1  8  
ATOM 7633  C CG2  . VAL A 1 24 ? -41.739 -7.959  -15.399 1.00 0.00 ? 24 VAL A CG2  8  
ATOM 7634  H H    . VAL A 1 24 ? -40.290 -6.016  -18.534 1.00 0.00 ? 24 VAL A H    8  
ATOM 7635  H HA   . VAL A 1 24 ? -41.186 -8.459  -17.839 1.00 0.00 ? 24 VAL A HA   8  
ATOM 7636  H HB   . VAL A 1 24 ? -40.542 -6.445  -16.342 1.00 0.00 ? 24 VAL A HB   8  
ATOM 7637  H HG11 . VAL A 1 24 ? -43.492 -6.213  -15.890 1.00 0.00 ? 24 VAL A HG11 8  
ATOM 7638  H HG12 . VAL A 1 24 ? -42.782 -5.297  -17.217 1.00 0.00 ? 24 VAL A HG12 8  
ATOM 7639  H HG13 . VAL A 1 24 ? -42.217 -5.041  -15.568 1.00 0.00 ? 24 VAL A HG13 8  
ATOM 7640  H HG21 . VAL A 1 24 ? -42.684 -8.451  -15.573 1.00 0.00 ? 24 VAL A HG21 8  
ATOM 7641  H HG22 . VAL A 1 24 ? -41.743 -7.509  -14.416 1.00 0.00 ? 24 VAL A HG22 8  
ATOM 7642  H HG23 . VAL A 1 24 ? -40.938 -8.682  -15.461 1.00 0.00 ? 24 VAL A HG23 8  
ATOM 7643  N N    . ARG A 1 25 ? -43.713 -6.741  -18.926 1.00 0.00 ? 25 ARG A N    8  
ATOM 7644  C CA   . ARG A 1 25 ? -45.120 -6.874  -19.287 1.00 0.00 ? 25 ARG A CA   8  
ATOM 7645  C C    . ARG A 1 25 ? -45.290 -7.936  -20.378 1.00 0.00 ? 25 ARG A C    8  
ATOM 7646  O O    . ARG A 1 25 ? -46.069 -8.878  -20.233 1.00 0.00 ? 25 ARG A O    8  
ATOM 7647  C CB   . ARG A 1 25 ? -45.664 -5.532  -19.783 1.00 0.00 ? 25 ARG A CB   8  
ATOM 7648  C CG   . ARG A 1 25 ? -47.166 -5.656  -20.063 1.00 0.00 ? 25 ARG A CG   8  
ATOM 7649  C CD   . ARG A 1 25 ? -47.703 -4.314  -20.561 1.00 0.00 ? 25 ARG A CD   8  
ATOM 7650  N NE   . ARG A 1 25 ? -47.547 -3.300  -19.526 1.00 0.00 ? 25 ARG A NE   8  
ATOM 7651  C CZ   . ARG A 1 25 ? -48.434 -3.180  -18.542 1.00 0.00 ? 25 ARG A CZ   8  
ATOM 7652  N NH1  . ARG A 1 25 ? -49.467 -3.976  -18.496 1.00 0.00 ? 25 ARG A NH1  8  
ATOM 7653  N NH2  . ARG A 1 25 ? -48.270 -2.267  -17.626 1.00 0.00 ? 25 ARG A NH2  8  
ATOM 7654  H H    . ARG A 1 25 ? -43.172 -6.000  -19.269 1.00 0.00 ? 25 ARG A H    8  
ATOM 7655  H HA   . ARG A 1 25 ? -45.679 -7.176  -18.413 1.00 0.00 ? 25 ARG A HA   8  
ATOM 7656  H HB2  . ARG A 1 25 ? -45.501 -4.776  -19.029 1.00 0.00 ? 25 ARG A HB2  8  
ATOM 7657  H HB3  . ARG A 1 25 ? -45.154 -5.251  -20.691 1.00 0.00 ? 25 ARG A HB3  8  
ATOM 7658  H HG2  . ARG A 1 25 ? -47.333 -6.410  -20.819 1.00 0.00 ? 25 ARG A HG2  8  
ATOM 7659  H HG3  . ARG A 1 25 ? -47.680 -5.934  -19.156 1.00 0.00 ? 25 ARG A HG3  8  
ATOM 7660  H HD2  . ARG A 1 25 ? -47.155 -4.012  -21.440 1.00 0.00 ? 25 ARG A HD2  8  
ATOM 7661  H HD3  . ARG A 1 25 ? -48.749 -4.419  -20.809 1.00 0.00 ? 25 ARG A HD3  8  
ATOM 7662  H HE   . ARG A 1 25 ? -46.776 -2.697  -19.554 1.00 0.00 ? 25 ARG A HE   8  
ATOM 7663  H HH11 . ARG A 1 25 ? -49.594 -4.674  -19.199 1.00 0.00 ? 25 ARG A HH11 8  
ATOM 7664  H HH12 . ARG A 1 25 ? -50.134 -3.884  -17.756 1.00 0.00 ? 25 ARG A HH12 8  
ATOM 7665  H HH21 . ARG A 1 25 ? -47.477 -1.657  -17.662 1.00 0.00 ? 25 ARG A HH21 8  
ATOM 7666  H HH22 . ARG A 1 25 ? -48.936 -2.177  -16.885 1.00 0.00 ? 25 ARG A HH22 8  
ATOM 7667  N N    . ASN A 1 26 ? -44.558 -7.757  -21.472 1.00 0.00 ? 26 ASN A N    8  
ATOM 7668  C CA   . ASN A 1 26 ? -44.616 -8.678  -22.608 1.00 0.00 ? 26 ASN A CA   8  
ATOM 7669  C C    . ASN A 1 26 ? -43.544 -9.767  -22.523 1.00 0.00 ? 26 ASN A C    8  
ATOM 7670  O O    . ASN A 1 26 ? -43.457 -10.626 -23.403 1.00 0.00 ? 26 ASN A O    8  
ATOM 7671  C CB   . ASN A 1 26 ? -44.442 -7.899  -23.913 1.00 0.00 ? 26 ASN A CB   8  
ATOM 7672  C CG   . ASN A 1 26 ? -45.673 -7.038  -24.174 1.00 0.00 ? 26 ASN A CG   8  
ATOM 7673  O OD1  . ASN A 1 26 ? -46.745 -7.304  -23.631 1.00 0.00 ? 26 ASN A OD1  8  
ATOM 7674  N ND2  . ASN A 1 26 ? -45.582 -6.013  -24.977 1.00 0.00 ? 26 ASN A ND2  8  
ATOM 7675  H H    . ASN A 1 26 ? -43.971 -6.974  -21.522 1.00 0.00 ? 26 ASN A H    8  
ATOM 7676  H HA   . ASN A 1 26 ? -45.587 -9.150  -22.619 1.00 0.00 ? 26 ASN A HA   8  
ATOM 7677  H HB2  . ASN A 1 26 ? -43.570 -7.266  -23.837 1.00 0.00 ? 26 ASN A HB2  8  
ATOM 7678  H HB3  . ASN A 1 26 ? -44.313 -8.592  -24.730 1.00 0.00 ? 26 ASN A HB3  8  
ATOM 7679  H HD21 . ASN A 1 26 ? -44.728 -5.802  -25.408 1.00 0.00 ? 26 ASN A HD21 8  
ATOM 7680  H HD22 . ASN A 1 26 ? -46.369 -5.454  -25.150 1.00 0.00 ? 26 ASN A HD22 8  
ATOM 7681  N N    . GLY A 1 27 ? -42.717 -9.719  -21.486 1.00 0.00 ? 27 GLY A N    8  
ATOM 7682  C CA   . GLY A 1 27 ? -41.645 -10.699 -21.339 1.00 0.00 ? 27 GLY A CA   8  
ATOM 7683  C C    . GLY A 1 27 ? -42.168 -12.127 -21.193 1.00 0.00 ? 27 GLY A C    8  
ATOM 7684  O O    . GLY A 1 27 ? -41.625 -13.054 -21.793 1.00 0.00 ? 27 GLY A O    8  
ATOM 7685  H H    . GLY A 1 27 ? -42.824 -9.022  -20.806 1.00 0.00 ? 27 GLY A H    8  
ATOM 7686  H HA2  . GLY A 1 27 ? -41.005 -10.649 -22.209 1.00 0.00 ? 27 GLY A HA2  8  
ATOM 7687  H HA3  . GLY A 1 27 ? -41.064 -10.450 -20.464 1.00 0.00 ? 27 GLY A HA3  8  
ATOM 7688  N N    . GLY A 1 28 ? -43.206 -12.309 -20.383 1.00 0.00 ? 28 GLY A N    8  
ATOM 7689  C CA   . GLY A 1 28 ? -43.760 -13.642 -20.165 1.00 0.00 ? 28 GLY A CA   8  
ATOM 7690  C C    . GLY A 1 28 ? -44.305 -14.255 -21.453 1.00 0.00 ? 28 GLY A C    8  
ATOM 7691  O O    . GLY A 1 28 ? -44.079 -15.431 -21.734 1.00 0.00 ? 28 GLY A O    8  
ATOM 7692  H H    . GLY A 1 28 ? -43.597 -11.543 -19.912 1.00 0.00 ? 28 GLY A H    8  
ATOM 7693  H HA2  . GLY A 1 28 ? -42.984 -14.284 -19.773 1.00 0.00 ? 28 GLY A HA2  8  
ATOM 7694  H HA3  . GLY A 1 28 ? -44.560 -13.578 -19.443 1.00 0.00 ? 28 GLY A HA3  8  
ATOM 7695  N N    . LEU A 1 29 ? -45.053 -13.463 -22.210 1.00 0.00 ? 29 LEU A N    8  
ATOM 7696  C CA   . LEU A 1 29 ? -45.655 -13.966 -23.441 1.00 0.00 ? 29 LEU A CA   8  
ATOM 7697  C C    . LEU A 1 29 ? -44.589 -14.447 -24.423 1.00 0.00 ? 29 LEU A C    8  
ATOM 7698  O O    . LEU A 1 29 ? -44.719 -15.523 -25.006 1.00 0.00 ? 29 LEU A O    8  
ATOM 7699  C CB   . LEU A 1 29 ? -46.496 -12.869 -24.099 1.00 0.00 ? 29 LEU A CB   8  
ATOM 7700  C CG   . LEU A 1 29 ? -47.744 -12.591 -23.252 1.00 0.00 ? 29 LEU A CG   8  
ATOM 7701  C CD1  . LEU A 1 29 ? -48.470 -11.363 -23.804 1.00 0.00 ? 29 LEU A CD1  8  
ATOM 7702  C CD2  . LEU A 1 29 ? -48.694 -13.797 -23.284 1.00 0.00 ? 29 LEU A CD2  8  
ATOM 7703  H H    . LEU A 1 29 ? -45.235 -12.549 -21.904 1.00 0.00 ? 29 LEU A H    8  
ATOM 7704  H HA   . LEU A 1 29 ? -46.299 -14.797 -23.198 1.00 0.00 ? 29 LEU A HA   8  
ATOM 7705  H HB2  . LEU A 1 29 ? -45.906 -11.967 -24.174 1.00 0.00 ? 29 LEU A HB2  8  
ATOM 7706  H HB3  . LEU A 1 29 ? -46.791 -13.182 -25.089 1.00 0.00 ? 29 LEU A HB3  8  
ATOM 7707  H HG   . LEU A 1 29 ? -47.443 -12.396 -22.232 1.00 0.00 ? 29 LEU A HG   8  
ATOM 7708  H HD11 . LEU A 1 29 ? -48.441 -11.382 -24.882 1.00 0.00 ? 29 LEU A HD11 8  
ATOM 7709  H HD12 . LEU A 1 29 ? -47.984 -10.467 -23.447 1.00 0.00 ? 29 LEU A HD12 8  
ATOM 7710  H HD13 . LEU A 1 29 ? -49.498 -11.373 -23.470 1.00 0.00 ? 29 LEU A HD13 8  
ATOM 7711  H HD21 . LEU A 1 29 ? -48.551 -14.355 -24.197 1.00 0.00 ? 29 LEU A HD21 8  
ATOM 7712  H HD22 . LEU A 1 29 ? -49.715 -13.451 -23.231 1.00 0.00 ? 29 LEU A HD22 8  
ATOM 7713  H HD23 . LEU A 1 29 ? -48.489 -14.437 -22.437 1.00 0.00 ? 29 LEU A HD23 8  
ATOM 7714  N N    . ILE A 1 30 ? -43.544 -13.652 -24.614 1.00 0.00 ? 30 ILE A N    8  
ATOM 7715  C CA   . ILE A 1 30 ? -42.480 -14.024 -25.542 1.00 0.00 ? 30 ILE A CA   8  
ATOM 7716  C C    . ILE A 1 30 ? -41.781 -15.311 -25.108 1.00 0.00 ? 30 ILE A C    8  
ATOM 7717  O O    . ILE A 1 30 ? -41.545 -16.210 -25.924 1.00 0.00 ? 30 ILE A O    8  
ATOM 7718  C CB   . ILE A 1 30 ? -41.453 -12.894 -25.634 1.00 0.00 ? 30 ILE A CB   8  
ATOM 7719  C CG1  . ILE A 1 30 ? -42.086 -11.689 -26.332 1.00 0.00 ? 30 ILE A CG1  8  
ATOM 7720  C CG2  . ILE A 1 30 ? -40.241 -13.373 -26.438 1.00 0.00 ? 30 ILE A CG2  8  
ATOM 7721  C CD1  . ILE A 1 30 ? -41.174 -10.469 -26.176 1.00 0.00 ? 30 ILE A CD1  8  
ATOM 7722  H H    . ILE A 1 30 ? -43.492 -12.790 -24.149 1.00 0.00 ? 30 ILE A H    8  
ATOM 7723  H HA   . ILE A 1 30 ? -42.911 -14.177 -26.521 1.00 0.00 ? 30 ILE A HA   8  
ATOM 7724  H HB   . ILE A 1 30 ? -41.137 -12.615 -24.640 1.00 0.00 ? 30 ILE A HB   8  
ATOM 7725  H HG12 . ILE A 1 30 ? -42.218 -11.908 -27.382 1.00 0.00 ? 30 ILE A HG12 8  
ATOM 7726  H HG13 . ILE A 1 30 ? -43.045 -11.477 -25.884 1.00 0.00 ? 30 ILE A HG13 8  
ATOM 7727  H HG21 . ILE A 1 30 ? -40.544 -14.166 -27.105 1.00 0.00 ? 30 ILE A HG21 8  
ATOM 7728  H HG22 . ILE A 1 30 ? -39.484 -13.740 -25.763 1.00 0.00 ? 30 ILE A HG22 8  
ATOM 7729  H HG23 . ILE A 1 30 ? -39.842 -12.550 -27.013 1.00 0.00 ? 30 ILE A HG23 8  
ATOM 7730  H HD11 . ILE A 1 30 ? -40.163 -10.799 -25.991 1.00 0.00 ? 30 ILE A HD11 8  
ATOM 7731  H HD12 . ILE A 1 30 ? -41.515 -9.869  -25.346 1.00 0.00 ? 30 ILE A HD12 8  
ATOM 7732  H HD13 . ILE A 1 30 ? -41.202 -9.882  -27.081 1.00 0.00 ? 30 ILE A HD13 8  
ATOM 7733  N N    . PHE A 1 31 ? -41.457 -15.406 -23.822 1.00 0.00 ? 31 PHE A N    8  
ATOM 7734  C CA   . PHE A 1 31 ? -40.790 -16.589 -23.293 1.00 0.00 ? 31 PHE A CA   8  
ATOM 7735  C C    . PHE A 1 31 ? -41.655 -17.834 -23.463 1.00 0.00 ? 31 PHE A C    8  
ATOM 7736  O O    . PHE A 1 31 ? -41.175 -18.884 -23.887 1.00 0.00 ? 31 PHE A O    8  
ATOM 7737  C CB   . PHE A 1 31 ? -40.471 -16.388 -21.811 1.00 0.00 ? 31 PHE A CB   8  
ATOM 7738  C CG   . PHE A 1 31 ? -39.816 -17.634 -21.264 1.00 0.00 ? 31 PHE A CG   8  
ATOM 7739  C CD1  . PHE A 1 31 ? -38.458 -17.874 -21.510 1.00 0.00 ? 31 PHE A CD1  8  
ATOM 7740  C CD2  . PHE A 1 31 ? -40.563 -18.547 -20.513 1.00 0.00 ? 31 PHE A CD2  8  
ATOM 7741  C CE1  . PHE A 1 31 ? -37.850 -19.028 -21.003 1.00 0.00 ? 31 PHE A CE1  8  
ATOM 7742  C CE2  . PHE A 1 31 ? -39.956 -19.703 -20.008 1.00 0.00 ? 31 PHE A CE2  8  
ATOM 7743  C CZ   . PHE A 1 31 ? -38.598 -19.943 -20.252 1.00 0.00 ? 31 PHE A CZ   8  
ATOM 7744  H H    . PHE A 1 31 ? -41.683 -14.681 -23.202 1.00 0.00 ? 31 PHE A H    8  
ATOM 7745  H HA   . PHE A 1 31 ? -39.864 -16.734 -23.828 1.00 0.00 ? 31 PHE A HA   8  
ATOM 7746  H HB2  . PHE A 1 31 ? -39.801 -15.548 -21.698 1.00 0.00 ? 31 PHE A HB2  8  
ATOM 7747  H HB3  . PHE A 1 31 ? -41.384 -16.196 -21.269 1.00 0.00 ? 31 PHE A HB3  8  
ATOM 7748  H HD1  . PHE A 1 31 ? -37.880 -17.169 -22.089 1.00 0.00 ? 31 PHE A HD1  8  
ATOM 7749  H HD2  . PHE A 1 31 ? -41.612 -18.361 -20.325 1.00 0.00 ? 31 PHE A HD2  8  
ATOM 7750  H HE1  . PHE A 1 31 ? -36.802 -19.215 -21.192 1.00 0.00 ? 31 PHE A HE1  8  
ATOM 7751  H HE2  . PHE A 1 31 ? -40.534 -20.407 -19.428 1.00 0.00 ? 31 PHE A HE2  8  
ATOM 7752  H HZ   . PHE A 1 31 ? -38.129 -20.834 -19.862 1.00 0.00 ? 31 PHE A HZ   8  
ATOM 7753  N N    . ALA A 1 32 ? -42.927 -17.715 -23.099 1.00 0.00 ? 32 ALA A N    8  
ATOM 7754  C CA   . ALA A 1 32 ? -43.845 -18.845 -23.181 1.00 0.00 ? 32 ALA A CA   8  
ATOM 7755  C C    . ALA A 1 32 ? -43.962 -19.367 -24.608 1.00 0.00 ? 32 ALA A C    8  
ATOM 7756  O O    . ALA A 1 32 ? -43.995 -20.580 -24.824 1.00 0.00 ? 32 ALA A O    8  
ATOM 7757  C CB   . ALA A 1 32 ? -45.228 -18.427 -22.677 1.00 0.00 ? 32 ALA A CB   8  
ATOM 7758  H H    . ALA A 1 32 ? -43.250 -16.860 -22.742 1.00 0.00 ? 32 ALA A H    8  
ATOM 7759  H HA   . ALA A 1 32 ? -43.474 -19.638 -22.550 1.00 0.00 ? 32 ALA A HA   8  
ATOM 7760  H HB1  . ALA A 1 32 ? -45.294 -18.614 -21.615 1.00 0.00 ? 32 ALA A HB1  8  
ATOM 7761  H HB2  . ALA A 1 32 ? -45.986 -18.999 -23.191 1.00 0.00 ? 32 ALA A HB2  8  
ATOM 7762  H HB3  . ALA A 1 32 ? -45.378 -17.376 -22.868 1.00 0.00 ? 32 ALA A HB3  8  
ATOM 7763  N N    . GLY A 1 33 ? -44.034 -18.468 -25.585 1.00 0.00 ? 33 GLY A N    8  
ATOM 7764  C CA   . GLY A 1 33 ? -44.156 -18.891 -26.975 1.00 0.00 ? 33 GLY A CA   8  
ATOM 7765  C C    . GLY A 1 33 ? -42.954 -19.726 -27.404 1.00 0.00 ? 33 GLY A C    8  
ATOM 7766  O O    . GLY A 1 33 ? -43.104 -20.734 -28.097 1.00 0.00 ? 33 GLY A O    8  
ATOM 7767  H H    . GLY A 1 33 ? -44.016 -17.509 -25.385 1.00 0.00 ? 33 GLY A H    8  
ATOM 7768  H HA2  . GLY A 1 33 ? -45.055 -19.478 -27.090 1.00 0.00 ? 33 GLY A HA2  8  
ATOM 7769  H HA3  . GLY A 1 33 ? -44.219 -18.016 -27.607 1.00 0.00 ? 33 GLY A HA3  8  
ATOM 7770  N N    . LEU A 1 34 ? -41.765 -19.320 -26.969 1.00 0.00 ? 34 LEU A N    8  
ATOM 7771  C CA   . LEU A 1 34 ? -40.556 -20.068 -27.301 1.00 0.00 ? 34 LEU A CA   8  
ATOM 7772  C C    . LEU A 1 34 ? -40.548 -21.404 -26.561 1.00 0.00 ? 34 LEU A C    8  
ATOM 7773  O O    . LEU A 1 34 ? -40.144 -22.434 -27.103 1.00 0.00 ? 34 LEU A O    8  
ATOM 7774  C CB   . LEU A 1 34 ? -39.318 -19.258 -26.911 1.00 0.00 ? 34 LEU A CB   8  
ATOM 7775  C CG   . LEU A 1 34 ? -39.204 -18.019 -27.809 1.00 0.00 ? 34 LEU A CG   8  
ATOM 7776  C CD1  . LEU A 1 34 ? -38.076 -17.121 -27.299 1.00 0.00 ? 34 LEU A CD1  8  
ATOM 7777  C CD2  . LEU A 1 34 ? -38.906 -18.434 -29.257 1.00 0.00 ? 34 LEU A CD2  8  
ATOM 7778  H H    . LEU A 1 34 ? -41.704 -18.530 -26.387 1.00 0.00 ? 34 LEU A H    8  
ATOM 7779  H HA   . LEU A 1 34 ? -40.537 -20.255 -28.363 1.00 0.00 ? 34 LEU A HA   8  
ATOM 7780  H HB2  . LEU A 1 34 ? -39.408 -18.944 -25.881 1.00 0.00 ? 34 LEU A HB2  8  
ATOM 7781  H HB3  . LEU A 1 34 ? -38.434 -19.868 -27.023 1.00 0.00 ? 34 LEU A HB3  8  
ATOM 7782  H HG   . LEU A 1 34 ? -40.137 -17.471 -27.778 1.00 0.00 ? 34 LEU A HG   8  
ATOM 7783  H HD11 . LEU A 1 34 ? -38.378 -16.655 -26.372 1.00 0.00 ? 34 LEU A HD11 8  
ATOM 7784  H HD12 . LEU A 1 34 ? -37.864 -16.357 -28.032 1.00 0.00 ? 34 LEU A HD12 8  
ATOM 7785  H HD13 . LEU A 1 34 ? -37.191 -17.716 -27.130 1.00 0.00 ? 34 LEU A HD13 8  
ATOM 7786  H HD21 . LEU A 1 34 ? -38.300 -17.676 -29.729 1.00 0.00 ? 34 LEU A HD21 8  
ATOM 7787  H HD22 . LEU A 1 34 ? -39.834 -18.540 -29.799 1.00 0.00 ? 34 LEU A HD22 8  
ATOM 7788  H HD23 . LEU A 1 34 ? -38.376 -19.374 -29.268 1.00 0.00 ? 34 LEU A HD23 8  
ATOM 7789  N N    . ALA A 1 35 ? -41.000 -21.360 -25.312 1.00 0.00 ? 35 ALA A N    8  
ATOM 7790  C CA   . ALA A 1 35 ? -41.042 -22.563 -24.486 1.00 0.00 ? 35 ALA A CA   8  
ATOM 7791  C C    . ALA A 1 35 ? -41.950 -23.609 -25.125 1.00 0.00 ? 35 ALA A C    8  
ATOM 7792  O O    . ALA A 1 35 ? -41.590 -24.778 -25.216 1.00 0.00 ? 35 ALA A O    8  
ATOM 7793  C CB   . ALA A 1 35 ? -41.556 -22.219 -23.087 1.00 0.00 ? 35 ALA A CB   8  
ATOM 7794  H H    . ALA A 1 35 ? -41.298 -20.492 -24.968 1.00 0.00 ? 35 ALA A H    8  
ATOM 7795  H HA   . ALA A 1 35 ? -40.044 -22.965 -24.404 1.00 0.00 ? 35 ALA A HA   8  
ATOM 7796  H HB1  . ALA A 1 35 ? -42.615 -22.421 -23.035 1.00 0.00 ? 35 ALA A HB1  8  
ATOM 7797  H HB2  . ALA A 1 35 ? -41.377 -21.174 -22.885 1.00 0.00 ? 35 ALA A HB2  8  
ATOM 7798  H HB3  . ALA A 1 35 ? -41.039 -22.823 -22.357 1.00 0.00 ? 35 ALA A HB3  8  
ATOM 7799  N N    . PHE A 1 36 ? -43.140 -23.181 -25.529 1.00 0.00 ? 36 PHE A N    8  
ATOM 7800  C CA   . PHE A 1 36 ? -44.127 -24.082 -26.130 1.00 0.00 ? 36 PHE A CA   8  
ATOM 7801  C C    . PHE A 1 36 ? -43.602 -24.753 -27.404 1.00 0.00 ? 36 PHE A C    8  
ATOM 7802  O O    . PHE A 1 36 ? -43.769 -25.961 -27.592 1.00 0.00 ? 36 PHE A O    8  
ATOM 7803  C CB   . PHE A 1 36 ? -45.401 -23.303 -26.457 1.00 0.00 ? 36 PHE A CB   8  
ATOM 7804  C CG   . PHE A 1 36 ? -46.401 -24.226 -27.113 1.00 0.00 ? 36 PHE A CG   8  
ATOM 7805  C CD1  . PHE A 1 36 ? -47.148 -25.117 -26.332 1.00 0.00 ? 36 PHE A CD1  8  
ATOM 7806  C CD2  . PHE A 1 36 ? -46.581 -24.190 -28.501 1.00 0.00 ? 36 PHE A CD2  8  
ATOM 7807  C CE1  . PHE A 1 36 ? -48.075 -25.971 -26.940 1.00 0.00 ? 36 PHE A CE1  8  
ATOM 7808  C CE2  . PHE A 1 36 ? -47.508 -25.044 -29.108 1.00 0.00 ? 36 PHE A CE2  8  
ATOM 7809  C CZ   . PHE A 1 36 ? -48.257 -25.935 -28.328 1.00 0.00 ? 36 PHE A CZ   8  
ATOM 7810  H H    . PHE A 1 36 ? -43.384 -22.247 -25.359 1.00 0.00 ? 36 PHE A H    8  
ATOM 7811  H HA   . PHE A 1 36 ? -44.372 -24.850 -25.412 1.00 0.00 ? 36 PHE A HA   8  
ATOM 7812  H HB2  . PHE A 1 36 ? -45.823 -22.905 -25.545 1.00 0.00 ? 36 PHE A HB2  8  
ATOM 7813  H HB3  . PHE A 1 36 ? -45.166 -22.493 -27.129 1.00 0.00 ? 36 PHE A HB3  8  
ATOM 7814  H HD1  . PHE A 1 36 ? -47.010 -25.144 -25.261 1.00 0.00 ? 36 PHE A HD1  8  
ATOM 7815  H HD2  . PHE A 1 36 ? -46.005 -23.503 -29.102 1.00 0.00 ? 36 PHE A HD2  8  
ATOM 7816  H HE1  . PHE A 1 36 ? -48.652 -26.658 -26.338 1.00 0.00 ? 36 PHE A HE1  8  
ATOM 7817  H HE2  . PHE A 1 36 ? -47.648 -25.015 -30.179 1.00 0.00 ? 36 PHE A HE2  8  
ATOM 7818  H HZ   . PHE A 1 36 ? -48.972 -26.594 -28.796 1.00 0.00 ? 36 PHE A HZ   8  
ATOM 7819  N N    . ILE A 1 37 ? -42.997 -23.969 -28.289 1.00 0.00 ? 37 ILE A N    8  
ATOM 7820  C CA   . ILE A 1 37 ? -42.496 -24.506 -29.552 1.00 0.00 ? 37 ILE A CA   8  
ATOM 7821  C C    . ILE A 1 37 ? -41.480 -25.621 -29.316 1.00 0.00 ? 37 ILE A C    8  
ATOM 7822  O O    . ILE A 1 37 ? -41.529 -26.660 -29.975 1.00 0.00 ? 37 ILE A O    8  
ATOM 7823  C CB   . ILE A 1 37 ? -41.845 -23.389 -30.368 1.00 0.00 ? 37 ILE A CB   8  
ATOM 7824  C CG1  . ILE A 1 37 ? -42.924 -22.413 -30.844 1.00 0.00 ? 37 ILE A CG1  8  
ATOM 7825  C CG2  . ILE A 1 37 ? -41.132 -23.991 -31.580 1.00 0.00 ? 37 ILE A CG2  8  
ATOM 7826  C CD1  . ILE A 1 37 ? -42.264 -21.152 -31.406 1.00 0.00 ? 37 ILE A CD1  8  
ATOM 7827  H H    . ILE A 1 37 ? -42.912 -23.008 -28.106 1.00 0.00 ? 37 ILE A H    8  
ATOM 7828  H HA   . ILE A 1 37 ? -43.326 -24.905 -30.114 1.00 0.00 ? 37 ILE A HA   8  
ATOM 7829  H HB   . ILE A 1 37 ? -41.128 -22.865 -29.752 1.00 0.00 ? 37 ILE A HB   8  
ATOM 7830  H HG12 . ILE A 1 37 ? -43.520 -22.884 -31.613 1.00 0.00 ? 37 ILE A HG12 8  
ATOM 7831  H HG13 . ILE A 1 37 ? -43.558 -22.145 -30.012 1.00 0.00 ? 37 ILE A HG13 8  
ATOM 7832  H HG21 . ILE A 1 37 ? -40.934 -23.214 -32.304 1.00 0.00 ? 37 ILE A HG21 8  
ATOM 7833  H HG22 . ILE A 1 37 ? -41.759 -24.748 -32.026 1.00 0.00 ? 37 ILE A HG22 8  
ATOM 7834  H HG23 . ILE A 1 37 ? -40.200 -24.435 -31.264 1.00 0.00 ? 37 ILE A HG23 8  
ATOM 7835  H HD11 . ILE A 1 37 ? -41.265 -21.389 -31.742 1.00 0.00 ? 37 ILE A HD11 8  
ATOM 7836  H HD12 . ILE A 1 37 ? -42.216 -20.398 -30.636 1.00 0.00 ? 37 ILE A HD12 8  
ATOM 7837  H HD13 . ILE A 1 37 ? -42.846 -20.782 -32.237 1.00 0.00 ? 37 ILE A HD13 8  
ATOM 7838  N N    . VAL A 1 38 ? -40.562 -25.404 -28.385 1.00 0.00 ? 38 VAL A N    8  
ATOM 7839  C CA   . VAL A 1 38 ? -39.539 -26.406 -28.093 1.00 0.00 ? 38 VAL A CA   8  
ATOM 7840  C C    . VAL A 1 38 ? -40.181 -27.728 -27.674 1.00 0.00 ? 38 VAL A C    8  
ATOM 7841  O O    . VAL A 1 38 ? -39.716 -28.803 -28.053 1.00 0.00 ? 38 VAL A O    8  
ATOM 7842  C CB   . VAL A 1 38 ? -38.624 -25.906 -26.976 1.00 0.00 ? 38 VAL A CB   8  
ATOM 7843  C CG1  . VAL A 1 38 ? -37.709 -27.043 -26.518 1.00 0.00 ? 38 VAL A CG1  8  
ATOM 7844  C CG2  . VAL A 1 38 ? -37.772 -24.746 -27.497 1.00 0.00 ? 38 VAL A CG2  8  
ATOM 7845  H H    . VAL A 1 38 ? -40.561 -24.550 -27.903 1.00 0.00 ? 38 VAL A H    8  
ATOM 7846  H HA   . VAL A 1 38 ? -38.946 -26.571 -28.981 1.00 0.00 ? 38 VAL A HA   8  
ATOM 7847  H HB   . VAL A 1 38 ? -39.223 -25.569 -26.143 1.00 0.00 ? 38 VAL A HB   8  
ATOM 7848  H HG11 . VAL A 1 38 ? -38.265 -27.719 -25.886 1.00 0.00 ? 38 VAL A HG11 8  
ATOM 7849  H HG12 . VAL A 1 38 ? -36.877 -26.634 -25.964 1.00 0.00 ? 38 VAL A HG12 8  
ATOM 7850  H HG13 . VAL A 1 38 ? -37.339 -27.577 -27.380 1.00 0.00 ? 38 VAL A HG13 8  
ATOM 7851  H HG21 . VAL A 1 38 ? -37.591 -24.043 -26.697 1.00 0.00 ? 38 VAL A HG21 8  
ATOM 7852  H HG22 . VAL A 1 38 ? -38.293 -24.250 -28.303 1.00 0.00 ? 38 VAL A HG22 8  
ATOM 7853  H HG23 . VAL A 1 38 ? -36.829 -25.128 -27.862 1.00 0.00 ? 38 VAL A HG23 8  
ATOM 7854  N N    . GLY A 1 39 ? -41.247 -27.638 -26.890 1.00 0.00 ? 39 GLY A N    8  
ATOM 7855  C CA   . GLY A 1 39 ? -41.958 -28.820 -26.415 1.00 0.00 ? 39 GLY A CA   8  
ATOM 7856  C C    . GLY A 1 39 ? -42.518 -29.639 -27.572 1.00 0.00 ? 39 GLY A C    8  
ATOM 7857  O O    . GLY A 1 39 ? -42.536 -30.869 -27.520 1.00 0.00 ? 39 GLY A O    8  
ATOM 7858  H H    . GLY A 1 39 ? -41.567 -26.759 -26.629 1.00 0.00 ? 39 GLY A H    8  
ATOM 7859  H HA2  . GLY A 1 39 ? -41.275 -29.434 -25.844 1.00 0.00 ? 39 GLY A HA2  8  
ATOM 7860  H HA3  . GLY A 1 39 ? -42.771 -28.509 -25.777 1.00 0.00 ? 39 GLY A HA3  8  
ATOM 7861  N N    . LEU A 1 40 ? -42.990 -28.958 -28.610 1.00 0.00 ? 40 LEU A N    8  
ATOM 7862  C CA   . LEU A 1 40 ? -43.561 -29.654 -29.761 1.00 0.00 ? 40 LEU A CA   8  
ATOM 7863  C C    . LEU A 1 40 ? -42.527 -30.597 -30.380 1.00 0.00 ? 40 LEU A C    8  
ATOM 7864  O O    . LEU A 1 40 ? -42.823 -31.758 -30.659 1.00 0.00 ? 40 LEU A O    8  
ATOM 7865  C CB   . LEU A 1 40 ? -44.029 -28.631 -30.805 1.00 0.00 ? 40 LEU A CB   8  
ATOM 7866  C CG   . LEU A 1 40 ? -44.614 -29.342 -32.031 1.00 0.00 ? 40 LEU A CG   8  
ATOM 7867  C CD1  . LEU A 1 40 ? -45.814 -30.192 -31.614 1.00 0.00 ? 40 LEU A CD1  8  
ATOM 7868  C CD2  . LEU A 1 40 ? -45.070 -28.294 -33.049 1.00 0.00 ? 40 LEU A CD2  8  
ATOM 7869  H H    . LEU A 1 40 ? -42.955 -27.975 -28.593 1.00 0.00 ? 40 LEU A H    8  
ATOM 7870  H HA   . LEU A 1 40 ? -44.410 -30.233 -29.431 1.00 0.00 ? 40 LEU A HA   8  
ATOM 7871  H HB2  . LEU A 1 40 ? -44.785 -27.996 -30.367 1.00 0.00 ? 40 LEU A HB2  8  
ATOM 7872  H HB3  . LEU A 1 40 ? -43.190 -28.025 -31.111 1.00 0.00 ? 40 LEU A HB3  8  
ATOM 7873  H HG   . LEU A 1 40 ? -43.862 -29.974 -32.482 1.00 0.00 ? 40 LEU A HG   8  
ATOM 7874  H HD11 . LEU A 1 40 ? -45.474 -31.171 -31.307 1.00 0.00 ? 40 LEU A HD11 8  
ATOM 7875  H HD12 . LEU A 1 40 ? -46.493 -30.292 -32.447 1.00 0.00 ? 40 LEU A HD12 8  
ATOM 7876  H HD13 . LEU A 1 40 ? -46.324 -29.716 -30.789 1.00 0.00 ? 40 LEU A HD13 8  
ATOM 7877  H HD21 . LEU A 1 40 ? -45.770 -27.619 -32.580 1.00 0.00 ? 40 LEU A HD21 8  
ATOM 7878  H HD22 . LEU A 1 40 ? -45.549 -28.786 -33.882 1.00 0.00 ? 40 LEU A HD22 8  
ATOM 7879  H HD23 . LEU A 1 40 ? -44.215 -27.737 -33.401 1.00 0.00 ? 40 LEU A HD23 8  
ATOM 7880  N N    . LEU A 1 41 ? -41.322 -30.084 -30.609 1.00 0.00 ? 41 LEU A N    8  
ATOM 7881  C CA   . LEU A 1 41 ? -40.257 -30.881 -31.218 1.00 0.00 ? 41 LEU A CA   8  
ATOM 7882  C C    . LEU A 1 41 ? -39.965 -32.142 -30.405 1.00 0.00 ? 41 LEU A C    8  
ATOM 7883  O O    . LEU A 1 41 ? -39.613 -33.177 -30.967 1.00 0.00 ? 41 LEU A O    8  
ATOM 7884  C CB   . LEU A 1 41 ? -38.979 -30.047 -31.338 1.00 0.00 ? 41 LEU A CB   8  
ATOM 7885  C CG   . LEU A 1 41 ? -39.035 -29.204 -32.613 1.00 0.00 ? 41 LEU A CG   8  
ATOM 7886  C CD1  . LEU A 1 41 ? -40.274 -28.311 -32.585 1.00 0.00 ? 41 LEU A CD1  8  
ATOM 7887  C CD2  . LEU A 1 41 ? -37.781 -28.330 -32.698 1.00 0.00 ? 41 LEU A CD2  8  
ATOM 7888  H H    . LEU A 1 41 ? -41.164 -29.144 -30.405 1.00 0.00 ? 41 LEU A H    8  
ATOM 7889  H HA   . LEU A 1 41 ? -40.569 -31.174 -32.210 1.00 0.00 ? 41 LEU A HA   8  
ATOM 7890  H HB2  . LEU A 1 41 ? -38.892 -29.398 -30.480 1.00 0.00 ? 41 LEU A HB2  8  
ATOM 7891  H HB3  . LEU A 1 41 ? -38.124 -30.705 -31.381 1.00 0.00 ? 41 LEU A HB3  8  
ATOM 7892  H HG   . LEU A 1 41 ? -39.080 -29.855 -33.474 1.00 0.00 ? 41 LEU A HG   8  
ATOM 7893  H HD11 . LEU A 1 41 ? -41.155 -28.912 -32.761 1.00 0.00 ? 41 LEU A HD11 8  
ATOM 7894  H HD12 . LEU A 1 41 ? -40.193 -27.555 -33.352 1.00 0.00 ? 41 LEU A HD12 8  
ATOM 7895  H HD13 . LEU A 1 41 ? -40.351 -27.837 -31.619 1.00 0.00 ? 41 LEU A HD13 8  
ATOM 7896  H HD21 . LEU A 1 41 ? -37.107 -28.587 -31.893 1.00 0.00 ? 41 LEU A HD21 8  
ATOM 7897  H HD22 . LEU A 1 41 ? -38.060 -27.290 -32.615 1.00 0.00 ? 41 LEU A HD22 8  
ATOM 7898  H HD23 . LEU A 1 41 ? -37.290 -28.496 -33.645 1.00 0.00 ? 41 LEU A HD23 8  
ATOM 7899  N N    . ILE A 1 42 ? -40.094 -32.044 -29.087 1.00 0.00 ? 42 ILE A N    8  
ATOM 7900  C CA   . ILE A 1 42 ? -39.823 -33.188 -28.214 1.00 0.00 ? 42 ILE A CA   8  
ATOM 7901  C C    . ILE A 1 42 ? -40.755 -34.357 -28.540 1.00 0.00 ? 42 ILE A C    8  
ATOM 7902  O O    . ILE A 1 42 ? -40.328 -35.516 -28.596 1.00 0.00 ? 42 ILE A O    8  
ATOM 7903  C CB   . ILE A 1 42 ? -40.008 -32.787 -26.743 1.00 0.00 ? 42 ILE A CB   8  
ATOM 7904  C CG1  . ILE A 1 42 ? -38.968 -31.721 -26.344 1.00 0.00 ? 42 ILE A CG1  8  
ATOM 7905  C CG2  . ILE A 1 42 ? -39.867 -34.020 -25.847 1.00 0.00 ? 42 ILE A CG2  8  
ATOM 7906  C CD1  . ILE A 1 42 ? -37.534 -32.233 -26.547 1.00 0.00 ? 42 ILE A CD1  8  
ATOM 7907  H H    . ILE A 1 42 ? -40.363 -31.188 -28.707 1.00 0.00 ? 42 ILE A H    8  
ATOM 7908  H HA   . ILE A 1 42 ? -38.805 -33.508 -28.366 1.00 0.00 ? 42 ILE A HA   8  
ATOM 7909  H HB   . ILE A 1 42 ? -40.999 -32.379 -26.616 1.00 0.00 ? 42 ILE A HB   8  
ATOM 7910  H HG12 . ILE A 1 42 ? -39.117 -30.838 -26.948 1.00 0.00 ? 42 ILE A HG12 8  
ATOM 7911  H HG13 . ILE A 1 42 ? -39.108 -31.464 -25.305 1.00 0.00 ? 42 ILE A HG13 8  
ATOM 7912  H HG21 . ILE A 1 42 ? -40.757 -34.626 -25.926 1.00 0.00 ? 42 ILE A HG21 8  
ATOM 7913  H HG22 . ILE A 1 42 ? -39.735 -33.706 -24.823 1.00 0.00 ? 42 ILE A HG22 8  
ATOM 7914  H HG23 . ILE A 1 42 ? -39.010 -34.596 -26.160 1.00 0.00 ? 42 ILE A HG23 8  
ATOM 7915  H HD11 . ILE A 1 42 ? -36.882 -31.768 -25.822 1.00 0.00 ? 42 ILE A HD11 8  
ATOM 7916  H HD12 . ILE A 1 42 ? -37.200 -31.977 -27.541 1.00 0.00 ? 42 ILE A HD12 8  
ATOM 7917  H HD13 . ILE A 1 42 ? -37.499 -33.304 -26.425 1.00 0.00 ? 42 ILE A HD13 8  
ATOM 7918  N N    . LEU A 1 43 ? -42.032 -34.057 -28.750 1.00 0.00 ? 43 LEU A N    8  
ATOM 7919  C CA   . LEU A 1 43 ? -43.002 -35.103 -29.055 1.00 0.00 ? 43 LEU A CA   8  
ATOM 7920  C C    . LEU A 1 43 ? -42.620 -35.834 -30.338 1.00 0.00 ? 43 LEU A C    8  
ATOM 7921  O O    . LEU A 1 43 ? -42.764 -37.053 -30.432 1.00 0.00 ? 43 LEU A O    8  
ATOM 7922  C CB   . LEU A 1 43 ? -44.397 -34.490 -29.211 1.00 0.00 ? 43 LEU A CB   8  
ATOM 7923  C CG   . LEU A 1 43 ? -44.904 -33.995 -27.850 1.00 0.00 ? 43 LEU A CG   8  
ATOM 7924  C CD1  . LEU A 1 43 ? -46.199 -33.207 -28.046 1.00 0.00 ? 43 LEU A CD1  8  
ATOM 7925  C CD2  . LEU A 1 43 ? -45.169 -35.185 -26.915 1.00 0.00 ? 43 LEU A CD2  8  
ATOM 7926  H H    . LEU A 1 43 ? -42.328 -33.131 -28.689 1.00 0.00 ? 43 LEU A H    8  
ATOM 7927  H HA   . LEU A 1 43 ? -43.021 -35.812 -28.242 1.00 0.00 ? 43 LEU A HA   8  
ATOM 7928  H HB2  . LEU A 1 43 ? -44.344 -33.657 -29.898 1.00 0.00 ? 43 LEU A HB2  8  
ATOM 7929  H HB3  . LEU A 1 43 ? -45.078 -35.231 -29.604 1.00 0.00 ? 43 LEU A HB3  8  
ATOM 7930  H HG   . LEU A 1 43 ? -44.159 -33.349 -27.407 1.00 0.00 ? 43 LEU A HG   8  
ATOM 7931  H HD11 . LEU A 1 43 ? -46.586 -33.390 -29.039 1.00 0.00 ? 43 LEU A HD11 8  
ATOM 7932  H HD12 . LEU A 1 43 ? -46.001 -32.153 -27.927 1.00 0.00 ? 43 LEU A HD12 8  
ATOM 7933  H HD13 . LEU A 1 43 ? -46.927 -33.523 -27.315 1.00 0.00 ? 43 LEU A HD13 8  
ATOM 7934  H HD21 . LEU A 1 43 ? -44.369 -35.257 -26.193 1.00 0.00 ? 43 LEU A HD21 8  
ATOM 7935  H HD22 . LEU A 1 43 ? -45.221 -36.098 -27.486 1.00 0.00 ? 43 LEU A HD22 8  
ATOM 7936  H HD23 . LEU A 1 43 ? -46.105 -35.030 -26.398 1.00 0.00 ? 43 LEU A HD23 8  
ATOM 7937  N N    . LEU A 1 44 ? -42.146 -35.085 -31.329 1.00 0.00 ? 44 LEU A N    8  
ATOM 7938  C CA   . LEU A 1 44 ? -41.761 -35.675 -32.606 1.00 0.00 ? 44 LEU A CA   8  
ATOM 7939  C C    . LEU A 1 44 ? -40.641 -36.699 -32.428 1.00 0.00 ? 44 LEU A C    8  
ATOM 7940  O O    . LEU A 1 44 ? -40.556 -37.666 -33.184 1.00 0.00 ? 44 LEU A O    8  
ATOM 7941  C CB   . LEU A 1 44 ? -41.296 -34.581 -33.569 1.00 0.00 ? 44 LEU A CB   8  
ATOM 7942  C CG   . LEU A 1 44 ? -42.489 -34.063 -34.374 1.00 0.00 ? 44 LEU A CG   8  
ATOM 7943  C CD1  . LEU A 1 44 ? -43.556 -33.520 -33.421 1.00 0.00 ? 44 LEU A CD1  8  
ATOM 7944  C CD2  . LEU A 1 44 ? -42.023 -32.942 -35.308 1.00 0.00 ? 44 LEU A CD2  8  
ATOM 7945  H H    . LEU A 1 44 ? -42.071 -34.121 -31.213 1.00 0.00 ? 44 LEU A H    8  
ATOM 7946  H HA   . LEU A 1 44 ? -42.618 -36.171 -33.034 1.00 0.00 ? 44 LEU A HA   8  
ATOM 7947  H HB2  . LEU A 1 44 ? -40.862 -33.766 -33.004 1.00 0.00 ? 44 LEU A HB2  8  
ATOM 7948  H HB3  . LEU A 1 44 ? -40.556 -34.984 -34.243 1.00 0.00 ? 44 LEU A HB3  8  
ATOM 7949  H HG   . LEU A 1 44 ? -42.906 -34.870 -34.960 1.00 0.00 ? 44 LEU A HG   8  
ATOM 7950  H HD11 . LEU A 1 44 ? -43.088 -33.201 -32.502 1.00 0.00 ? 44 LEU A HD11 8  
ATOM 7951  H HD12 . LEU A 1 44 ? -44.277 -34.295 -33.210 1.00 0.00 ? 44 LEU A HD12 8  
ATOM 7952  H HD13 . LEU A 1 44 ? -44.056 -32.680 -33.882 1.00 0.00 ? 44 LEU A HD13 8  
ATOM 7953  H HD21 . LEU A 1 44 ? -42.829 -32.667 -35.972 1.00 0.00 ? 44 LEU A HD21 8  
ATOM 7954  H HD22 . LEU A 1 44 ? -41.179 -33.284 -35.888 1.00 0.00 ? 44 LEU A HD22 8  
ATOM 7955  H HD23 . LEU A 1 44 ? -41.731 -32.083 -34.721 1.00 0.00 ? 44 LEU A HD23 8  
ATOM 7956  N N    . SER A 1 45 ? -39.784 -36.483 -31.434 1.00 0.00 ? 45 SER A N    8  
ATOM 7957  C CA   . SER A 1 45 ? -38.678 -37.401 -31.183 1.00 0.00 ? 45 SER A CA   8  
ATOM 7958  C C    . SER A 1 45 ? -39.206 -38.781 -30.803 1.00 0.00 ? 45 SER A C    8  
ATOM 7959  O O    . SER A 1 45 ? -38.663 -39.801 -31.225 1.00 0.00 ? 45 SER A O    8  
ATOM 7960  C CB   . SER A 1 45 ? -37.788 -36.862 -30.062 1.00 0.00 ? 45 SER A CB   8  
ATOM 7961  O OG   . SER A 1 45 ? -37.177 -35.652 -30.490 1.00 0.00 ? 45 SER A OG   8  
ATOM 7962  H H    . SER A 1 45 ? -39.899 -35.702 -30.860 1.00 0.00 ? 45 SER A H    8  
ATOM 7963  H HA   . SER A 1 45 ? -38.088 -37.489 -32.082 1.00 0.00 ? 45 SER A HA   8  
ATOM 7964  H HB2  . SER A 1 45 ? -38.382 -36.670 -29.186 1.00 0.00 ? 45 SER A HB2  8  
ATOM 7965  H HB3  . SER A 1 45 ? -37.029 -37.596 -29.824 1.00 0.00 ? 45 SER A HB3  8  
ATOM 7966  H HG   . SER A 1 45 ? -37.871 -35.047 -30.758 1.00 0.00 ? 45 SER A HG   8  
ATOM 7967  N N    . ARG A 1 46 ? -40.270 -38.802 -30.007 1.00 0.00 ? 46 ARG A N    8  
ATOM 7968  C CA   . ARG A 1 46 ? -40.869 -40.068 -29.581 1.00 0.00 ? 46 ARG A CA   8  
ATOM 7969  C C    . ARG A 1 46 ? -41.380 -40.856 -30.788 1.00 0.00 ? 46 ARG A C    8  
ATOM 7970  O O    . ARG A 1 46 ? -41.256 -42.080 -30.840 1.00 0.00 ? 46 ARG A O    8  
ATOM 7971  C CB   . ARG A 1 46 ? -42.021 -39.797 -28.604 1.00 0.00 ? 46 ARG A CB   8  
ATOM 7972  C CG   . ARG A 1 46 ? -42.654 -41.115 -28.114 1.00 0.00 ? 46 ARG A CG   8  
ATOM 7973  C CD   . ARG A 1 46 ? -41.654 -41.918 -27.271 1.00 0.00 ? 46 ARG A CD   8  
ATOM 7974  N NE   . ARG A 1 46 ? -41.133 -43.051 -28.034 1.00 0.00 ? 46 ARG A NE   8  
ATOM 7975  C CZ   . ARG A 1 46 ? -40.237 -43.879 -27.505 1.00 0.00 ? 46 ARG A CZ   8  
ATOM 7976  N NH1  . ARG A 1 46 ? -39.792 -43.671 -26.296 1.00 0.00 ? 46 ARG A NH1  8  
ATOM 7977  N NH2  . ARG A 1 46 ? -39.803 -44.900 -28.191 1.00 0.00 ? 46 ARG A NH2  8  
ATOM 7978  H H    . ARG A 1 46 ? -40.662 -37.955 -29.712 1.00 0.00 ? 46 ARG A H    8  
ATOM 7979  H HA   . ARG A 1 46 ? -40.115 -40.656 -29.079 1.00 0.00 ? 46 ARG A HA   8  
ATOM 7980  H HB2  . ARG A 1 46 ? -41.646 -39.244 -27.755 1.00 0.00 ? 46 ARG A HB2  8  
ATOM 7981  H HB3  . ARG A 1 46 ? -42.776 -39.207 -29.103 1.00 0.00 ? 46 ARG A HB3  8  
ATOM 7982  H HG2  . ARG A 1 46 ? -43.520 -40.887 -27.512 1.00 0.00 ? 46 ARG A HG2  8  
ATOM 7983  H HG3  . ARG A 1 46 ? -42.962 -41.707 -28.962 1.00 0.00 ? 46 ARG A HG3  8  
ATOM 7984  H HD2  . ARG A 1 46 ? -40.836 -41.282 -26.975 1.00 0.00 ? 46 ARG A HD2  8  
ATOM 7985  H HD3  . ARG A 1 46 ? -42.155 -42.284 -26.387 1.00 0.00 ? 46 ARG A HD3  8  
ATOM 7986  H HE   . ARG A 1 46 ? -41.455 -43.209 -28.946 1.00 0.00 ? 46 ARG A HE   8  
ATOM 7987  H HH11 . ARG A 1 46 ? -40.123 -42.889 -25.768 1.00 0.00 ? 46 ARG A HH11 8  
ATOM 7988  H HH12 . ARG A 1 46 ? -39.118 -44.294 -25.896 1.00 0.00 ? 46 ARG A HH12 8  
ATOM 7989  H HH21 . ARG A 1 46 ? -40.144 -45.061 -29.117 1.00 0.00 ? 46 ARG A HH21 8  
ATOM 7990  H HH22 . ARG A 1 46 ? -39.130 -45.521 -27.792 1.00 0.00 ? 46 ARG A HH22 8  
ATOM 7991  N N    . ARG A 1 47 ? -41.973 -40.150 -31.744 1.00 0.00 ? 47 ARG A N    8  
ATOM 7992  C CA   . ARG A 1 47 ? -42.522 -40.794 -32.936 1.00 0.00 ? 47 ARG A CA   8  
ATOM 7993  C C    . ARG A 1 47 ? -41.429 -41.431 -33.791 1.00 0.00 ? 47 ARG A C    8  
ATOM 7994  O O    . ARG A 1 47 ? -41.697 -42.365 -34.548 1.00 0.00 ? 47 ARG A O    8  
ATOM 7995  C CB   . ARG A 1 47 ? -43.296 -39.776 -33.775 1.00 0.00 ? 47 ARG A CB   8  
ATOM 7996  C CG   . ARG A 1 47 ? -44.611 -39.433 -33.075 1.00 0.00 ? 47 ARG A CG   8  
ATOM 7997  C CD   . ARG A 1 47 ? -45.734 -40.339 -33.593 1.00 0.00 ? 47 ARG A CD   8  
ATOM 7998  N NE   . ARG A 1 47 ? -45.216 -41.662 -33.935 1.00 0.00 ? 47 ARG A NE   8  
ATOM 7999  C CZ   . ARG A 1 47 ? -45.999 -42.736 -33.911 1.00 0.00 ? 47 ARG A CZ   8  
ATOM 8000  N NH1  . ARG A 1 47 ? -47.249 -42.629 -33.546 1.00 0.00 ? 47 ARG A NH1  8  
ATOM 8001  N NH2  . ARG A 1 47 ? -45.520 -43.901 -34.250 1.00 0.00 ? 47 ARG A NH2  8  
ATOM 8002  H H    . ARG A 1 47 ? -42.053 -39.185 -31.643 1.00 0.00 ? 47 ARG A H    8  
ATOM 8003  H HA   . ARG A 1 47 ? -43.206 -41.566 -32.622 1.00 0.00 ? 47 ARG A HA   8  
ATOM 8004  H HB2  . ARG A 1 47 ? -42.703 -38.879 -33.889 1.00 0.00 ? 47 ARG A HB2  8  
ATOM 8005  H HB3  . ARG A 1 47 ? -43.506 -40.193 -34.749 1.00 0.00 ? 47 ARG A HB3  8  
ATOM 8006  H HG2  . ARG A 1 47 ? -44.498 -39.574 -32.010 1.00 0.00 ? 47 ARG A HG2  8  
ATOM 8007  H HG3  . ARG A 1 47 ? -44.865 -38.402 -33.273 1.00 0.00 ? 47 ARG A HG3  8  
ATOM 8008  H HD2  . ARG A 1 47 ? -46.487 -40.440 -32.828 1.00 0.00 ? 47 ARG A HD2  8  
ATOM 8009  H HD3  . ARG A 1 47 ? -46.176 -39.889 -34.470 1.00 0.00 ? 47 ARG A HD3  8  
ATOM 8010  H HE   . ARG A 1 47 ? -44.276 -41.759 -34.197 1.00 0.00 ? 47 ARG A HE   8  
ATOM 8011  H HH11 . ARG A 1 47 ? -47.620 -41.738 -33.285 1.00 0.00 ? 47 ARG A HH11 8  
ATOM 8012  H HH12 . ARG A 1 47 ? -47.836 -43.437 -33.531 1.00 0.00 ? 47 ARG A HH12 8  
ATOM 8013  H HH21 . ARG A 1 47 ? -44.562 -43.987 -34.526 1.00 0.00 ? 47 ARG A HH21 8  
ATOM 8014  H HH22 . ARG A 1 47 ? -46.108 -44.709 -34.232 1.00 0.00 ? 47 ARG A HH22 8  
ATOM 8015  N N    . PHE A 1 48 ? -40.202 -40.938 -33.670 1.00 0.00 ? 48 PHE A N    8  
ATOM 8016  C CA   . PHE A 1 48 ? -39.102 -41.498 -34.447 1.00 0.00 ? 48 PHE A CA   8  
ATOM 8017  C C    . PHE A 1 48 ? -38.916 -42.971 -34.103 1.00 0.00 ? 48 PHE A C    8  
ATOM 8018  O O    . PHE A 1 48 ? -38.825 -43.824 -34.987 1.00 0.00 ? 48 PHE A O    8  
ATOM 8019  C CB   . PHE A 1 48 ? -37.807 -40.736 -34.156 1.00 0.00 ? 48 PHE A CB   8  
ATOM 8020  C CG   . PHE A 1 48 ? -36.660 -41.392 -34.888 1.00 0.00 ? 48 PHE A CG   8  
ATOM 8021  C CD1  . PHE A 1 48 ? -36.477 -41.157 -36.257 1.00 0.00 ? 48 PHE A CD1  8  
ATOM 8022  C CD2  . PHE A 1 48 ? -35.780 -42.234 -34.199 1.00 0.00 ? 48 PHE A CD2  8  
ATOM 8023  C CE1  . PHE A 1 48 ? -35.414 -41.766 -36.935 1.00 0.00 ? 48 PHE A CE1  8  
ATOM 8024  C CE2  . PHE A 1 48 ? -34.717 -42.842 -34.876 1.00 0.00 ? 48 PHE A CE2  8  
ATOM 8025  C CZ   . PHE A 1 48 ? -34.534 -42.608 -36.244 1.00 0.00 ? 48 PHE A CZ   8  
ATOM 8026  H H    . PHE A 1 48 ? -40.033 -40.210 -33.041 1.00 0.00 ? 48 PHE A H    8  
ATOM 8027  H HA   . PHE A 1 48 ? -39.332 -41.409 -35.498 1.00 0.00 ? 48 PHE A HA   8  
ATOM 8028  H HB2  . PHE A 1 48 ? -37.908 -39.713 -34.488 1.00 0.00 ? 48 PHE A HB2  8  
ATOM 8029  H HB3  . PHE A 1 48 ? -37.610 -40.753 -33.096 1.00 0.00 ? 48 PHE A HB3  8  
ATOM 8030  H HD1  . PHE A 1 48 ? -37.156 -40.509 -36.789 1.00 0.00 ? 48 PHE A HD1  8  
ATOM 8031  H HD2  . PHE A 1 48 ? -35.921 -42.413 -33.144 1.00 0.00 ? 48 PHE A HD2  8  
ATOM 8032  H HE1  . PHE A 1 48 ? -35.273 -41.586 -37.990 1.00 0.00 ? 48 PHE A HE1  8  
ATOM 8033  H HE2  . PHE A 1 48 ? -34.038 -43.491 -34.343 1.00 0.00 ? 48 PHE A HE2  8  
ATOM 8034  H HZ   . PHE A 1 48 ? -33.713 -43.077 -36.768 1.00 0.00 ? 48 PHE A HZ   8  
ATOM 8035  N N    . ARG A 1 49 ? -38.845 -43.255 -32.807 1.00 0.00 ? 49 ARG A N    8  
ATOM 8036  C CA   . ARG A 1 49 ? -38.650 -44.631 -32.370 1.00 0.00 ? 49 ARG A CA   8  
ATOM 8037  C C    . ARG A 1 49 ? -39.829 -45.486 -32.828 1.00 0.00 ? 49 ARG A C    8  
ATOM 8038  O O    . ARG A 1 49 ? -39.640 -46.533 -33.447 1.00 0.00 ? 49 ARG A O    8  
ATOM 8039  C CB   . ARG A 1 49 ? -38.549 -44.677 -30.841 1.00 0.00 ? 49 ARG A CB   8  
ATOM 8040  C CG   . ARG A 1 49 ? -37.207 -44.101 -30.371 1.00 0.00 ? 49 ARG A CG   8  
ATOM 8041  C CD   . ARG A 1 49 ? -36.110 -45.174 -30.439 1.00 0.00 ? 49 ARG A CD   8  
ATOM 8042  N NE   . ARG A 1 49 ? -36.463 -46.303 -29.587 1.00 0.00 ? 49 ARG A NE   8  
ATOM 8043  C CZ   . ARG A 1 49 ? -36.231 -46.275 -28.277 1.00 0.00 ? 49 ARG A CZ   8  
ATOM 8044  N NH1  . ARG A 1 49 ? -35.674 -45.227 -27.735 1.00 0.00 ? 49 ARG A NH1  8  
ATOM 8045  N NH2  . ARG A 1 49 ? -36.560 -47.297 -27.535 1.00 0.00 ? 49 ARG A NH2  8  
ATOM 8046  H H    . ARG A 1 49 ? -38.896 -42.509 -32.174 1.00 0.00 ? 49 ARG A H    8  
ATOM 8047  H HA   . ARG A 1 49 ? -37.745 -45.016 -32.805 1.00 0.00 ? 49 ARG A HA   8  
ATOM 8048  H HB2  . ARG A 1 49 ? -39.352 -44.095 -30.417 1.00 0.00 ? 49 ARG A HB2  8  
ATOM 8049  H HB3  . ARG A 1 49 ? -38.633 -45.701 -30.508 1.00 0.00 ? 49 ARG A HB3  8  
ATOM 8050  H HG2  . ARG A 1 49 ? -36.932 -43.271 -31.007 1.00 0.00 ? 49 ARG A HG2  8  
ATOM 8051  H HG3  . ARG A 1 49 ? -37.303 -43.755 -29.353 1.00 0.00 ? 49 ARG A HG3  8  
ATOM 8052  H HD2  . ARG A 1 49 ? -35.995 -45.516 -31.454 1.00 0.00 ? 49 ARG A HD2  8  
ATOM 8053  H HD3  . ARG A 1 49 ? -35.177 -44.748 -30.101 1.00 0.00 ? 49 ARG A HD3  8  
ATOM 8054  H HE   . ARG A 1 49 ? -36.878 -47.095 -29.985 1.00 0.00 ? 49 ARG A HE   8  
ATOM 8055  H HH11 . ARG A 1 49 ? -35.423 -44.444 -28.302 1.00 0.00 ? 49 ARG A HH11 8  
ATOM 8056  H HH12 . ARG A 1 49 ? -35.502 -45.207 -26.750 1.00 0.00 ? 49 ARG A HH12 8  
ATOM 8057  H HH21 . ARG A 1 49 ? -36.986 -48.100 -27.952 1.00 0.00 ? 49 ARG A HH21 8  
ATOM 8058  H HH22 . ARG A 1 49 ? -36.386 -47.278 -26.551 1.00 0.00 ? 49 ARG A HH22 8  
ATOM 8059  N N    . SER A 1 50 ? -41.042 -45.040 -32.518 1.00 0.00 ? 50 SER A N    8  
ATOM 8060  C CA   . SER A 1 50 ? -42.238 -45.781 -32.902 1.00 0.00 ? 50 SER A CA   8  
ATOM 8061  C C    . SER A 1 50 ? -42.444 -45.755 -34.414 1.00 0.00 ? 50 SER A C    8  
ATOM 8062  O O    . SER A 1 50 ? -43.128 -46.614 -34.969 1.00 0.00 ? 50 SER A O    8  
ATOM 8063  C CB   . SER A 1 50 ? -43.461 -45.186 -32.207 1.00 0.00 ? 50 SER A CB   8  
ATOM 8064  O OG   . SER A 1 50 ? -43.679 -43.867 -32.687 1.00 0.00 ? 50 SER A OG   8  
ATOM 8065  H H    . SER A 1 50 ? -41.139 -44.229 -31.977 1.00 0.00 ? 50 SER A H    8  
ATOM 8066  H HA   . SER A 1 50 ? -42.127 -46.808 -32.585 1.00 0.00 ? 50 SER A HA   8  
ATOM 8067  H HB2  . SER A 1 50 ? -44.329 -45.789 -32.420 1.00 0.00 ? 50 SER A HB2  8  
ATOM 8068  H HB3  . SER A 1 50 ? -43.292 -45.169 -31.137 1.00 0.00 ? 50 SER A HB3  8  
ATOM 8069  H HG   . SER A 1 50 ? -43.053 -43.704 -33.397 1.00 0.00 ? 50 SER A HG   8  
ATOM 8070  N N    . GLY A 1 51 ? -41.854 -44.766 -35.076 1.00 0.00 ? 51 GLY A N    8  
ATOM 8071  C CA   . GLY A 1 51 ? -41.991 -44.644 -36.525 1.00 0.00 ? 51 GLY A CA   8  
ATOM 8072  C C    . GLY A 1 51 ? -43.454 -44.472 -36.924 1.00 0.00 ? 51 GLY A C    8  
ATOM 8073  O O    . GLY A 1 51 ? -44.157 -43.618 -36.384 1.00 0.00 ? 51 GLY A O    8  
ATOM 8074  H H    . GLY A 1 51 ? -41.324 -44.102 -34.587 1.00 0.00 ? 51 GLY A H    8  
ATOM 8075  H HA2  . GLY A 1 51 ? -41.425 -43.786 -36.862 1.00 0.00 ? 51 GLY A HA2  8  
ATOM 8076  H HA3  . GLY A 1 51 ? -41.599 -45.533 -36.993 1.00 0.00 ? 51 GLY A HA3  8  
ATOM 8077  N N    . GLY A 1 52 ? -43.897 -45.271 -37.890 1.00 0.00 ? 52 GLY A N    8  
ATOM 8078  C CA   . GLY A 1 52 ? -45.271 -45.184 -38.375 1.00 0.00 ? 52 GLY A CA   8  
ATOM 8079  C C    . GLY A 1 52 ? -46.263 -45.061 -37.222 1.00 0.00 ? 52 GLY A C    8  
ATOM 8080  O O    . GLY A 1 52 ? -46.061 -45.627 -36.147 1.00 0.00 ? 52 GLY A O    8  
ATOM 8081  H H    . GLY A 1 52 ? -43.282 -45.911 -38.305 1.00 0.00 ? 52 GLY A H    8  
ATOM 8082  H HA2  . GLY A 1 52 ? -45.365 -44.318 -39.014 1.00 0.00 ? 52 GLY A HA2  8  
ATOM 8083  H HA3  . GLY A 1 52 ? -45.502 -46.070 -38.945 1.00 0.00 ? 52 GLY A HA3  8  
ATOM 8084  N N    . ASN A 1 53 ? -47.330 -44.301 -37.458 1.00 0.00 ? 53 ASN A N    8  
ATOM 8085  C CA   . ASN A 1 53 ? -48.352 -44.080 -36.442 1.00 0.00 ? 53 ASN A CA   8  
ATOM 8086  C C    . ASN A 1 53 ? -48.744 -45.383 -35.753 1.00 0.00 ? 53 ASN A C    8  
ATOM 8087  O O    . ASN A 1 53 ? -49.685 -46.059 -36.169 1.00 0.00 ? 53 ASN A O    8  
ATOM 8088  C CB   . ASN A 1 53 ? -49.592 -43.452 -37.081 1.00 0.00 ? 53 ASN A CB   8  
ATOM 8089  C CG   . ASN A 1 53 ? -49.970 -44.218 -38.345 1.00 0.00 ? 53 ASN A CG   8  
ATOM 8090  O OD1  . ASN A 1 53 ? -49.164 -44.336 -39.266 1.00 0.00 ? 53 ASN A OD1  8  
ATOM 8091  N ND2  . ASN A 1 53 ? -51.160 -44.750 -38.442 1.00 0.00 ? 53 ASN A ND2  8  
ATOM 8092  H H    . ASN A 1 53 ? -47.425 -43.869 -38.331 1.00 0.00 ? 53 ASN A H    8  
ATOM 8093  H HA   . ASN A 1 53 ? -47.965 -43.398 -35.701 1.00 0.00 ? 53 ASN A HA   8  
ATOM 8094  H HB2  . ASN A 1 53 ? -50.413 -43.486 -36.380 1.00 0.00 ? 53 ASN A HB2  8  
ATOM 8095  H HB3  . ASN A 1 53 ? -49.381 -42.425 -37.336 1.00 0.00 ? 53 ASN A HB3  8  
ATOM 8096  H HD21 . ASN A 1 53 ? -51.800 -44.656 -37.707 1.00 0.00 ? 53 ASN A HD21 8  
ATOM 8097  H HD22 . ASN A 1 53 ? -51.410 -45.244 -39.250 1.00 0.00 ? 53 ASN A HD22 8  
ATOM 8098  N N    . LYS A 1 54 ? -48.021 -45.722 -34.691 1.00 0.00 ? 54 LYS A N    8  
ATOM 8099  C CA   . LYS A 1 54 ? -48.302 -46.938 -33.938 1.00 0.00 ? 54 LYS A CA   8  
ATOM 8100  C C    . LYS A 1 54 ? -48.540 -48.118 -34.877 1.00 0.00 ? 54 LYS A C    8  
ATOM 8101  O O    . LYS A 1 54 ? -49.639 -48.295 -35.401 1.00 0.00 ? 54 LYS A O    8  
ATOM 8102  C CB   . LYS A 1 54 ? -49.535 -46.730 -33.055 1.00 0.00 ? 54 LYS A CB   8  
ATOM 8103  C CG   . LYS A 1 54 ? -49.435 -47.616 -31.811 1.00 0.00 ? 54 LYS A CG   8  
ATOM 8104  C CD   . LYS A 1 54 ? -48.684 -46.867 -30.705 1.00 0.00 ? 54 LYS A CD   8  
ATOM 8105  C CE   . LYS A 1 54 ? -48.581 -47.759 -29.466 1.00 0.00 ? 54 LYS A CE   8  
ATOM 8106  N NZ   . LYS A 1 54 ? -47.645 -48.885 -29.744 1.00 0.00 ? 54 LYS A NZ   8  
ATOM 8107  H H    . LYS A 1 54 ? -47.285 -45.140 -34.406 1.00 0.00 ? 54 LYS A H    8  
ATOM 8108  H HA   . LYS A 1 54 ? -47.456 -47.161 -33.307 1.00 0.00 ? 54 LYS A HA   8  
ATOM 8109  H HB2  . LYS A 1 54 ? -49.589 -45.693 -32.755 1.00 0.00 ? 54 LYS A HB2  8  
ATOM 8110  H HB3  . LYS A 1 54 ? -50.424 -46.991 -33.609 1.00 0.00 ? 54 LYS A HB3  8  
ATOM 8111  H HG2  . LYS A 1 54 ? -50.429 -47.864 -31.466 1.00 0.00 ? 54 LYS A HG2  8  
ATOM 8112  H HG3  . LYS A 1 54 ? -48.902 -48.521 -32.056 1.00 0.00 ? 54 LYS A HG3  8  
ATOM 8113  H HD2  . LYS A 1 54 ? -47.693 -46.613 -31.050 1.00 0.00 ? 54 LYS A HD2  8  
ATOM 8114  H HD3  . LYS A 1 54 ? -49.221 -45.966 -30.453 1.00 0.00 ? 54 LYS A HD3  8  
ATOM 8115  H HE2  . LYS A 1 54 ? -48.209 -47.178 -28.635 1.00 0.00 ? 54 LYS A HE2  8  
ATOM 8116  H HE3  . LYS A 1 54 ? -49.556 -48.152 -29.223 1.00 0.00 ? 54 LYS A HE3  8  
ATOM 8117  H HZ1  . LYS A 1 54 ? -48.174 -49.781 -29.757 1.00 0.00 ? 54 LYS A HZ1  8  
ATOM 8118  H HZ2  . LYS A 1 54 ? -46.918 -48.923 -29.000 1.00 0.00 ? 54 LYS A HZ2  8  
ATOM 8119  H HZ3  . LYS A 1 54 ? -47.190 -48.741 -30.666 1.00 0.00 ? 54 LYS A HZ3  8  
ATOM 8120  N N    . LYS A 1 55 ? -47.505 -48.923 -35.076 1.00 0.00 ? 55 LYS A N    8  
ATOM 8121  C CA   . LYS A 1 55 ? -47.613 -50.090 -35.945 1.00 0.00 ? 55 LYS A CA   8  
ATOM 8122  C C    . LYS A 1 55 ? -48.634 -51.073 -35.382 1.00 0.00 ? 55 LYS A C    8  
ATOM 8123  O O    . LYS A 1 55 ? -49.391 -51.695 -36.128 1.00 0.00 ? 55 LYS A O    8  
ATOM 8124  C CB   . LYS A 1 55 ? -46.252 -50.779 -36.066 1.00 0.00 ? 55 LYS A CB   8  
ATOM 8125  C CG   . LYS A 1 55 ? -45.299 -49.893 -36.871 1.00 0.00 ? 55 LYS A CG   8  
ATOM 8126  C CD   . LYS A 1 55 ? -43.937 -50.581 -36.985 1.00 0.00 ? 55 LYS A CD   8  
ATOM 8127  C CE   . LYS A 1 55 ? -42.976 -49.687 -37.771 1.00 0.00 ? 55 LYS A CE   8  
ATOM 8128  N NZ   . LYS A 1 55 ? -43.490 -49.503 -39.158 1.00 0.00 ? 55 LYS A NZ   8  
ATOM 8129  H H    . LYS A 1 55 ? -46.655 -48.736 -34.626 1.00 0.00 ? 55 LYS A H    8  
ATOM 8130  H HA   . LYS A 1 55 ? -47.933 -49.771 -36.925 1.00 0.00 ? 55 LYS A HA   8  
ATOM 8131  H HB2  . LYS A 1 55 ? -45.844 -50.946 -35.080 1.00 0.00 ? 55 LYS A HB2  8  
ATOM 8132  H HB3  . LYS A 1 55 ? -46.372 -51.726 -36.571 1.00 0.00 ? 55 LYS A HB3  8  
ATOM 8133  H HG2  . LYS A 1 55 ? -45.706 -49.731 -37.860 1.00 0.00 ? 55 LYS A HG2  8  
ATOM 8134  H HG3  . LYS A 1 55 ? -45.179 -48.945 -36.370 1.00 0.00 ? 55 LYS A HG3  8  
ATOM 8135  H HD2  . LYS A 1 55 ? -43.539 -50.756 -35.996 1.00 0.00 ? 55 LYS A HD2  8  
ATOM 8136  H HD3  . LYS A 1 55 ? -44.051 -51.523 -37.500 1.00 0.00 ? 55 LYS A HD3  8  
ATOM 8137  H HE2  . LYS A 1 55 ? -42.901 -48.725 -37.285 1.00 0.00 ? 55 LYS A HE2  8  
ATOM 8138  H HE3  . LYS A 1 55 ? -42.001 -50.149 -37.808 1.00 0.00 ? 55 LYS A HE3  8  
ATOM 8139  H HZ1  . LYS A 1 55 ? -44.265 -50.175 -39.333 1.00 0.00 ? 55 LYS A HZ1  8  
ATOM 8140  H HZ2  . LYS A 1 55 ? -42.722 -49.676 -39.838 1.00 0.00 ? 55 LYS A HZ2  8  
ATOM 8141  H HZ3  . LYS A 1 55 ? -43.845 -48.533 -39.272 1.00 0.00 ? 55 LYS A HZ3  8  
ATOM 8142  N N    . ARG A 1 56 ? -48.638 -51.215 -34.060 1.00 0.00 ? 56 ARG A N    8  
ATOM 8143  C CA   . ARG A 1 56 ? -49.557 -52.130 -33.392 1.00 0.00 ? 56 ARG A CA   8  
ATOM 8144  C C    . ARG A 1 56 ? -50.997 -51.642 -33.519 1.00 0.00 ? 56 ARG A C    8  
ATOM 8145  O O    . ARG A 1 56 ? -51.922 -52.441 -33.668 1.00 0.00 ? 56 ARG A O    8  
ATOM 8146  C CB   . ARG A 1 56 ? -49.187 -52.236 -31.908 1.00 0.00 ? 56 ARG A CB   8  
ATOM 8147  C CG   . ARG A 1 56 ? -49.949 -53.392 -31.247 1.00 0.00 ? 56 ARG A CG   8  
ATOM 8148  C CD   . ARG A 1 56 ? -49.166 -54.697 -31.420 1.00 0.00 ? 56 ARG A CD   8  
ATOM 8149  N NE   . ARG A 1 56 ? -47.863 -54.589 -30.774 1.00 0.00 ? 56 ARG A NE   8  
ATOM 8150  C CZ   . ARG A 1 56 ? -47.729 -54.762 -29.464 1.00 0.00 ? 56 ARG A CZ   8  
ATOM 8151  N NH1  . ARG A 1 56 ? -48.774 -55.034 -28.730 1.00 0.00 ? 56 ARG A NH1  8  
ATOM 8152  N NH2  . ARG A 1 56 ? -46.552 -54.660 -28.909 1.00 0.00 ? 56 ARG A NH2  8  
ATOM 8153  H H    . ARG A 1 56 ? -48.003 -50.697 -33.521 1.00 0.00 ? 56 ARG A H    8  
ATOM 8154  H HA   . ARG A 1 56 ? -49.474 -53.103 -33.847 1.00 0.00 ? 56 ARG A HA   8  
ATOM 8155  H HB2  . ARG A 1 56 ? -48.124 -52.411 -31.818 1.00 0.00 ? 56 ARG A HB2  8  
ATOM 8156  H HB3  . ARG A 1 56 ? -49.439 -51.313 -31.411 1.00 0.00 ? 56 ARG A HB3  8  
ATOM 8157  H HG2  . ARG A 1 56 ? -50.069 -53.184 -30.193 1.00 0.00 ? 56 ARG A HG2  8  
ATOM 8158  H HG3  . ARG A 1 56 ? -50.919 -53.494 -31.706 1.00 0.00 ? 56 ARG A HG3  8  
ATOM 8159  H HD2  . ARG A 1 56 ? -49.719 -55.506 -30.970 1.00 0.00 ? 56 ARG A HD2  8  
ATOM 8160  H HD3  . ARG A 1 56 ? -49.031 -54.902 -32.472 1.00 0.00 ? 56 ARG A HD3  8  
ATOM 8161  H HE   . ARG A 1 56 ? -47.072 -54.385 -31.317 1.00 0.00 ? 56 ARG A HE   8  
ATOM 8162  H HH11 . ARG A 1 56 ? -49.676 -55.112 -29.156 1.00 0.00 ? 56 ARG A HH11 8  
ATOM 8163  H HH12 . ARG A 1 56 ? -48.673 -55.164 -27.744 1.00 0.00 ? 56 ARG A HH12 8  
ATOM 8164  H HH21 . ARG A 1 56 ? -45.750 -54.453 -29.471 1.00 0.00 ? 56 ARG A HH21 8  
ATOM 8165  H HH22 . ARG A 1 56 ? -46.451 -54.791 -27.923 1.00 0.00 ? 56 ARG A HH22 8  
ATOM 8166  N N    . ARG A 1 57 ? -51.180 -50.328 -33.454 1.00 0.00 ? 57 ARG A N    8  
ATOM 8167  C CA   . ARG A 1 57 ? -52.515 -49.749 -33.557 1.00 0.00 ? 57 ARG A CA   8  
ATOM 8168  C C    . ARG A 1 57 ? -53.427 -50.361 -32.496 1.00 0.00 ? 57 ARG A C    8  
ATOM 8169  O O    . ARG A 1 57 ? -52.962 -50.762 -31.428 1.00 0.00 ? 57 ARG A O    8  
ATOM 8170  C CB   . ARG A 1 57 ? -53.094 -50.012 -34.950 1.00 0.00 ? 57 ARG A CB   8  
ATOM 8171  C CG   . ARG A 1 57 ? -52.166 -49.418 -36.011 1.00 0.00 ? 57 ARG A CG   8  
ATOM 8172  C CD   . ARG A 1 57 ? -52.795 -49.592 -37.395 1.00 0.00 ? 57 ARG A CD   8  
ATOM 8173  N NE   . ARG A 1 57 ? -51.880 -49.120 -38.428 1.00 0.00 ? 57 ARG A NE   8  
ATOM 8174  C CZ   . ARG A 1 57 ? -52.220 -49.155 -39.713 1.00 0.00 ? 57 ARG A CZ   8  
ATOM 8175  N NH1  . ARG A 1 57 ? -53.388 -49.616 -40.066 1.00 0.00 ? 57 ARG A NH1  8  
ATOM 8176  N NH2  . ARG A 1 57 ? -51.384 -48.729 -40.619 1.00 0.00 ? 57 ARG A NH2  8  
ATOM 8177  H H    . ARG A 1 57 ? -50.403 -49.743 -33.335 1.00 0.00 ? 57 ARG A H    8  
ATOM 8178  H HA   . ARG A 1 57 ? -52.451 -48.683 -33.396 1.00 0.00 ? 57 ARG A HA   8  
ATOM 8179  H HB2  . ARG A 1 57 ? -53.189 -51.075 -35.107 1.00 0.00 ? 57 ARG A HB2  8  
ATOM 8180  H HB3  . ARG A 1 57 ? -54.065 -49.547 -35.030 1.00 0.00 ? 57 ARG A HB3  8  
ATOM 8181  H HG2  . ARG A 1 57 ? -52.015 -48.366 -35.811 1.00 0.00 ? 57 ARG A HG2  8  
ATOM 8182  H HG3  . ARG A 1 57 ? -51.217 -49.931 -35.983 1.00 0.00 ? 57 ARG A HG3  8  
ATOM 8183  H HD2  . ARG A 1 57 ? -53.011 -50.637 -37.561 1.00 0.00 ? 57 ARG A HD2  8  
ATOM 8184  H HD3  . ARG A 1 57 ? -53.715 -49.027 -37.441 1.00 0.00 ? 57 ARG A HD3  8  
ATOM 8185  H HE   . ARG A 1 57 ? -51.002 -48.772 -38.171 1.00 0.00 ? 57 ARG A HE   8  
ATOM 8186  H HH11 . ARG A 1 57 ? -54.028 -49.943 -39.372 1.00 0.00 ? 57 ARG A HH11 8  
ATOM 8187  H HH12 . ARG A 1 57 ? -53.643 -49.643 -41.033 1.00 0.00 ? 57 ARG A HH12 8  
ATOM 8188  H HH21 . ARG A 1 57 ? -50.489 -48.376 -40.347 1.00 0.00 ? 57 ARG A HH21 8  
ATOM 8189  H HH22 . ARG A 1 57 ? -51.639 -48.754 -41.586 1.00 0.00 ? 57 ARG A HH22 8  
ATOM 8190  N N    . GLN A 1 58 ? -54.723 -50.434 -32.793 1.00 0.00 ? 58 GLN A N    8  
ATOM 8191  C CA   . GLN A 1 58 ? -55.684 -51.005 -31.852 1.00 0.00 ? 58 GLN A CA   8  
ATOM 8192  C C    . GLN A 1 58 ? -56.597 -51.998 -32.566 1.00 0.00 ? 58 GLN A C    8  
ATOM 8193  O O    . GLN A 1 58 ? -57.137 -51.704 -33.633 1.00 0.00 ? 58 GLN A O    8  
ATOM 8194  C CB   . GLN A 1 58 ? -56.525 -49.889 -31.222 1.00 0.00 ? 58 GLN A CB   8  
ATOM 8195  C CG   . GLN A 1 58 ? -57.413 -50.462 -30.111 1.00 0.00 ? 58 GLN A CG   8  
ATOM 8196  C CD   . GLN A 1 58 ? -56.557 -51.018 -28.978 1.00 0.00 ? 58 GLN A CD   8  
ATOM 8197  O OE1  . GLN A 1 58 ? -55.727 -50.302 -28.418 1.00 0.00 ? 58 GLN A OE1  8  
ATOM 8198  N NE2  . GLN A 1 58 ? -56.709 -52.259 -28.604 1.00 0.00 ? 58 GLN A NE2  8  
ATOM 8199  H H    . GLN A 1 58 ? -55.040 -50.100 -33.656 1.00 0.00 ? 58 GLN A H    8  
ATOM 8200  H HA   . GLN A 1 58 ? -55.146 -51.523 -31.076 1.00 0.00 ? 58 GLN A HA   8  
ATOM 8201  H HB2  . GLN A 1 58 ? -55.869 -49.139 -30.805 1.00 0.00 ? 58 GLN A HB2  8  
ATOM 8202  H HB3  . GLN A 1 58 ? -57.149 -49.438 -31.980 1.00 0.00 ? 58 GLN A HB3  8  
ATOM 8203  H HG2  . GLN A 1 58 ? -58.052 -49.681 -29.726 1.00 0.00 ? 58 GLN A HG2  8  
ATOM 8204  H HG3  . GLN A 1 58 ? -58.025 -51.255 -30.515 1.00 0.00 ? 58 GLN A HG3  8  
ATOM 8205  H HE21 . GLN A 1 58 ? -57.370 -52.828 -29.052 1.00 0.00 ? 58 GLN A HE21 8  
ATOM 8206  H HE22 . GLN A 1 58 ? -56.162 -52.622 -27.877 1.00 0.00 ? 58 GLN A HE22 8  
ATOM 8207  N N    . ILE A 1 59 ? -56.772 -53.170 -31.965 1.00 0.00 ? 59 ILE A N    8  
ATOM 8208  C CA   . ILE A 1 59 ? -57.629 -54.197 -32.548 1.00 0.00 ? 59 ILE A CA   8  
ATOM 8209  C C    . ILE A 1 59 ? -59.098 -53.790 -32.445 1.00 0.00 ? 59 ILE A C    8  
ATOM 8210  O O    . ILE A 1 59 ? -59.899 -54.085 -33.329 1.00 0.00 ? 59 ILE A O    8  
ATOM 8211  C CB   . ILE A 1 59 ? -57.415 -55.530 -31.827 1.00 0.00 ? 59 ILE A CB   8  
ATOM 8212  C CG1  . ILE A 1 59 ? -58.104 -56.655 -32.605 1.00 0.00 ? 59 ILE A CG1  8  
ATOM 8213  C CG2  . ILE A 1 59 ? -58.007 -55.449 -30.419 1.00 0.00 ? 59 ILE A CG2  8  
ATOM 8214  C CD1  . ILE A 1 59 ? -57.666 -58.007 -32.040 1.00 0.00 ? 59 ILE A CD1  8  
ATOM 8215  H H    . ILE A 1 59 ? -56.327 -53.342 -31.109 1.00 0.00 ? 59 ILE A H    8  
ATOM 8216  H HA   . ILE A 1 59 ? -57.372 -54.316 -33.590 1.00 0.00 ? 59 ILE A HA   8  
ATOM 8217  H HB   . ILE A 1 59 ? -56.355 -55.733 -31.760 1.00 0.00 ? 59 ILE A HB   8  
ATOM 8218  H HG12 . ILE A 1 59 ? -59.175 -56.554 -32.510 1.00 0.00 ? 59 ILE A HG12 8  
ATOM 8219  H HG13 . ILE A 1 59 ? -57.828 -56.599 -33.647 1.00 0.00 ? 59 ILE A HG13 8  
ATOM 8220  H HG21 . ILE A 1 59 ? -57.495 -56.147 -29.773 1.00 0.00 ? 59 ILE A HG21 8  
ATOM 8221  H HG22 . ILE A 1 59 ? -59.057 -55.698 -30.456 1.00 0.00 ? 59 ILE A HG22 8  
ATOM 8222  H HG23 . ILE A 1 59 ? -57.886 -54.448 -30.034 1.00 0.00 ? 59 ILE A HG23 8  
ATOM 8223  H HD11 . ILE A 1 59 ? -58.063 -58.800 -32.656 1.00 0.00 ? 59 ILE A HD11 8  
ATOM 8224  H HD12 . ILE A 1 59 ? -58.037 -58.114 -31.032 1.00 0.00 ? 59 ILE A HD12 8  
ATOM 8225  H HD13 . ILE A 1 59 ? -56.586 -58.062 -32.034 1.00 0.00 ? 59 ILE A HD13 8  
ATOM 8226  N N    . ASN A 1 60 ? -59.438 -53.117 -31.350 1.00 0.00 ? 60 ASN A N    8  
ATOM 8227  C CA   . ASN A 1 60 ? -60.812 -52.677 -31.126 1.00 0.00 ? 60 ASN A CA   8  
ATOM 8228  C C    . ASN A 1 60 ? -60.977 -51.205 -31.488 1.00 0.00 ? 60 ASN A C    8  
ATOM 8229  O O    . ASN A 1 60 ? -60.022 -50.433 -31.437 1.00 0.00 ? 60 ASN A O    8  
ATOM 8230  C CB   . ASN A 1 60 ? -61.193 -52.891 -29.659 1.00 0.00 ? 60 ASN A CB   8  
ATOM 8231  C CG   . ASN A 1 60 ? -61.306 -54.382 -29.362 1.00 0.00 ? 60 ASN A CG   8  
ATOM 8232  O OD1  . ASN A 1 60 ? -61.480 -55.187 -30.277 1.00 0.00 ? 60 ASN A OD1  8  
ATOM 8233  N ND2  . ASN A 1 60 ? -61.217 -54.801 -28.129 1.00 0.00 ? 60 ASN A ND2  8  
ATOM 8234  H H    . ASN A 1 60 ? -58.752 -52.921 -30.678 1.00 0.00 ? 60 ASN A H    8  
ATOM 8235  H HA   . ASN A 1 60 ? -61.472 -53.266 -31.744 1.00 0.00 ? 60 ASN A HA   8  
ATOM 8236  H HB2  . ASN A 1 60 ? -60.434 -52.455 -29.025 1.00 0.00 ? 60 ASN A HB2  8  
ATOM 8237  H HB3  . ASN A 1 60 ? -62.141 -52.414 -29.464 1.00 0.00 ? 60 ASN A HB3  8  
ATOM 8238  H HD21 . ASN A 1 60 ? -61.079 -54.157 -27.403 1.00 0.00 ? 60 ASN A HD21 8  
ATOM 8239  H HD22 . ASN A 1 60 ? -61.289 -55.758 -27.930 1.00 0.00 ? 60 ASN A HD22 8  
ATOM 8240  N N    . GLU A 1 61 ? -62.198 -50.829 -31.863 1.00 0.00 ? 61 GLU A N    8  
ATOM 8241  C CA   . GLU A 1 61 ? -62.485 -49.448 -32.241 1.00 0.00 ? 61 GLU A CA   8  
ATOM 8242  C C    . GLU A 1 61 ? -61.594 -49.018 -33.402 1.00 0.00 ? 61 GLU A C    8  
ATOM 8243  O O    . GLU A 1 61 ? -60.794 -48.092 -33.275 1.00 0.00 ? 61 GLU A O    8  
ATOM 8244  C CB   . GLU A 1 61 ? -62.275 -48.512 -31.046 1.00 0.00 ? 61 GLU A CB   8  
ATOM 8245  C CG   . GLU A 1 61 ? -63.300 -48.835 -29.959 1.00 0.00 ? 61 GLU A CG   8  
ATOM 8246  C CD   . GLU A 1 61 ? -63.080 -47.930 -28.750 1.00 0.00 ? 61 GLU A CD   8  
ATOM 8247  O OE1  . GLU A 1 61 ? -62.103 -47.199 -28.753 1.00 0.00 ? 61 GLU A OE1  8  
ATOM 8248  O OE2  . GLU A 1 61 ? -63.890 -47.983 -27.840 1.00 0.00 ? 61 GLU A OE2  8  
ATOM 8249  H H    . GLU A 1 61 ? -62.912 -51.499 -31.895 1.00 0.00 ? 61 GLU A H    8  
ATOM 8250  H HA   . GLU A 1 61 ? -63.516 -49.384 -32.553 1.00 0.00 ? 61 GLU A HA   8  
ATOM 8251  H HB2  . GLU A 1 61 ? -61.279 -48.641 -30.654 1.00 0.00 ? 61 GLU A HB2  8  
ATOM 8252  H HB3  . GLU A 1 61 ? -62.404 -47.489 -31.366 1.00 0.00 ? 61 GLU A HB3  8  
ATOM 8253  H HG2  . GLU A 1 61 ? -64.297 -48.679 -30.346 1.00 0.00 ? 61 GLU A HG2  8  
ATOM 8254  H HG3  . GLU A 1 61 ? -63.190 -49.866 -29.657 1.00 0.00 ? 61 GLU A HG3  8  
ATOM 8255  N N    . ASP A 1 62 ? -61.753 -49.693 -34.535 1.00 0.00 ? 62 ASP A N    8  
ATOM 8256  C CA   . ASP A 1 62 ? -60.969 -49.373 -35.722 1.00 0.00 ? 62 ASP A CA   8  
ATOM 8257  C C    . ASP A 1 62 ? -61.281 -47.956 -36.192 1.00 0.00 ? 62 ASP A C    8  
ATOM 8258  O O    . ASP A 1 62 ? -62.415 -47.492 -36.077 1.00 0.00 ? 62 ASP A O    8  
ATOM 8259  C CB   . ASP A 1 62 ? -61.283 -50.366 -36.843 1.00 0.00 ? 62 ASP A CB   8  
ATOM 8260  C CG   . ASP A 1 62 ? -60.684 -51.729 -36.513 1.00 0.00 ? 62 ASP A CG   8  
ATOM 8261  O OD1  . ASP A 1 62 ? -59.873 -51.795 -35.605 1.00 0.00 ? 62 ASP A OD1  8  
ATOM 8262  O OD2  . ASP A 1 62 ? -61.048 -52.689 -37.175 1.00 0.00 ? 62 ASP A OD2  8  
ATOM 8263  H H    . ASP A 1 62 ? -62.423 -50.407 -34.574 1.00 0.00 ? 62 ASP A H    8  
ATOM 8264  H HA   . ASP A 1 62 ? -59.918 -49.439 -35.478 1.00 0.00 ? 62 ASP A HA   8  
ATOM 8265  H HB2  . ASP A 1 62 ? -62.354 -50.459 -36.948 1.00 0.00 ? 62 ASP A HB2  8  
ATOM 8266  H HB3  . ASP A 1 62 ? -60.861 -50.005 -37.769 1.00 0.00 ? 62 ASP A HB3  8  
ATOM 8267  N N    . GLU A 1 63 ? -60.272 -47.270 -36.718 1.00 0.00 ? 63 GLU A N    8  
ATOM 8268  C CA   . GLU A 1 63 ? -60.461 -45.905 -37.199 1.00 0.00 ? 63 GLU A CA   8  
ATOM 8269  C C    . GLU A 1 63 ? -61.308 -45.904 -38.475 1.00 0.00 ? 63 GLU A C    8  
ATOM 8270  O O    . GLU A 1 63 ? -61.256 -46.856 -39.253 1.00 0.00 ? 63 GLU A O    8  
ATOM 8271  C CB   . GLU A 1 63 ? -59.098 -45.264 -37.484 1.00 0.00 ? 63 GLU A CB   8  
ATOM 8272  C CG   . GLU A 1 63 ? -58.345 -45.041 -36.170 1.00 0.00 ? 63 GLU A CG   8  
ATOM 8273  C CD   . GLU A 1 63 ? -57.914 -46.379 -35.573 1.00 0.00 ? 63 GLU A CD   8  
ATOM 8274  O OE1  . GLU A 1 63 ? -57.837 -47.339 -36.320 1.00 0.00 ? 63 GLU A OE1  8  
ATOM 8275  O OE2  . GLU A 1 63 ? -57.669 -46.421 -34.379 1.00 0.00 ? 63 GLU A OE2  8  
ATOM 8276  H H    . GLU A 1 63 ? -59.389 -47.685 -36.791 1.00 0.00 ? 63 GLU A H    8  
ATOM 8277  H HA   . GLU A 1 63 ? -60.962 -45.339 -36.431 1.00 0.00 ? 63 GLU A HA   8  
ATOM 8278  H HB2  . GLU A 1 63 ? -58.522 -45.919 -38.121 1.00 0.00 ? 63 GLU A HB2  8  
ATOM 8279  H HB3  . GLU A 1 63 ? -59.240 -44.316 -37.979 1.00 0.00 ? 63 GLU A HB3  8  
ATOM 8280  H HG2  . GLU A 1 63 ? -57.469 -44.437 -36.357 1.00 0.00 ? 63 GLU A HG2  8  
ATOM 8281  H HG3  . GLU A 1 63 ? -58.987 -44.529 -35.469 1.00 0.00 ? 63 GLU A HG3  8  
ATOM 8282  N N    . PRO A 1 64 ? -62.081 -44.867 -38.715 1.00 0.00 ? 64 PRO A N    8  
ATOM 8283  C CA   . PRO A 1 64 ? -62.938 -44.780 -39.934 1.00 0.00 ? 64 PRO A CA   8  
ATOM 8284  C C    . PRO A 1 64 ? -62.112 -44.589 -41.203 1.00 0.00 ? 64 PRO A C    8  
ATOM 8285  O O    . PRO A 1 64 ? -60.896 -44.658 -41.112 1.00 0.00 ? 64 PRO A O    8  
ATOM 8286  C CB   . PRO A 1 64 ? -63.828 -43.562 -39.676 1.00 0.00 ? 64 PRO A CB   8  
ATOM 8287  C CG   . PRO A 1 64 ? -63.070 -42.717 -38.708 1.00 0.00 ? 64 PRO A CG   8  
ATOM 8288  C CD   . PRO A 1 64 ? -62.230 -43.671 -37.862 1.00 0.00 ? 64 PRO A CD   8  
ATOM 8289  O OXT  . PRO A 1 64 ? -62.707 -44.378 -42.247 1.00 0.00 ? 64 PRO A OXT  8  
ATOM 8290  H HA   . PRO A 1 64 ? -63.553 -45.661 -40.020 1.00 0.00 ? 64 PRO A HA   8  
ATOM 8291  H HB2  . PRO A 1 64 ? -63.997 -43.021 -40.598 1.00 0.00 ? 64 PRO A HB2  8  
ATOM 8292  H HB3  . PRO A 1 64 ? -64.767 -43.867 -39.241 1.00 0.00 ? 64 PRO A HB3  8  
ATOM 8293  H HG2  . PRO A 1 64 ? -62.431 -42.027 -39.242 1.00 0.00 ? 64 PRO A HG2  8  
ATOM 8294  H HG3  . PRO A 1 64 ? -63.753 -42.176 -38.073 1.00 0.00 ? 64 PRO A HG3  8  
ATOM 8295  H HD2  . PRO A 1 64 ? -61.267 -43.232 -37.644 1.00 0.00 ? 64 PRO A HD2  8  
ATOM 8296  H HD3  . PRO A 1 64 ? -62.749 -43.926 -36.951 1.00 0.00 ? 64 PRO A HD3  8  
ATOM 8297  N N    . LEU A 1 1  ? -21.302 -12.778 -4.562  1.00 0.00 ? 1  LEU A N    9  
ATOM 8298  C CA   . LEU A 1 1  ? -19.916 -13.244 -4.265  1.00 0.00 ? 1  LEU A CA   9  
ATOM 8299  C C    . LEU A 1 1  ? -19.797 -14.722 -4.622  1.00 0.00 ? 1  LEU A C    9  
ATOM 8300  O O    . LEU A 1 1  ? -18.697 -15.235 -4.831  1.00 0.00 ? 1  LEU A O    9  
ATOM 8301  C CB   . LEU A 1 1  ? -19.585 -13.041 -2.778  1.00 0.00 ? 1  LEU A CB   9  
ATOM 8302  C CG   . LEU A 1 1  ? -20.430 -11.904 -2.186  1.00 0.00 ? 1  LEU A CG   9  
ATOM 8303  C CD1  . LEU A 1 1  ? -21.744 -12.467 -1.633  1.00 0.00 ? 1  LEU A CD1  9  
ATOM 8304  C CD2  . LEU A 1 1  ? -19.649 -11.237 -1.052  1.00 0.00 ? 1  LEU A CD2  9  
ATOM 8305  H H1   . LEU A 1 1  ? -21.867 -13.574 -4.916  1.00 0.00 ? 1  LEU A H1   9  
ATOM 8306  H H2   . LEU A 1 1  ? -21.268 -12.029 -5.284  1.00 0.00 ? 1  LEU A H2   9  
ATOM 8307  H H3   . LEU A 1 1  ? -21.738 -12.405 -3.697  1.00 0.00 ? 1  LEU A H3   9  
ATOM 8308  H HA   . LEU A 1 1  ? -19.217 -12.679 -4.866  1.00 0.00 ? 1  LEU A HA   9  
ATOM 8309  H HB2  . LEU A 1 1  ? -19.788 -13.955 -2.239  1.00 0.00 ? 1  LEU A HB2  9  
ATOM 8310  H HB3  . LEU A 1 1  ? -18.539 -12.793 -2.678  1.00 0.00 ? 1  LEU A HB3  9  
ATOM 8311  H HG   . LEU A 1 1  ? -20.644 -11.172 -2.952  1.00 0.00 ? 1  LEU A HG   9  
ATOM 8312  H HD11 . LEU A 1 1  ? -22.516 -11.715 -1.707  1.00 0.00 ? 1  LEU A HD11 9  
ATOM 8313  H HD12 . LEU A 1 1  ? -21.608 -12.740 -0.597  1.00 0.00 ? 1  LEU A HD12 9  
ATOM 8314  H HD13 . LEU A 1 1  ? -22.035 -13.338 -2.200  1.00 0.00 ? 1  LEU A HD13 9  
ATOM 8315  H HD21 . LEU A 1 1  ? -18.745 -10.798 -1.447  1.00 0.00 ? 1  LEU A HD21 9  
ATOM 8316  H HD22 . LEU A 1 1  ? -19.396 -11.976 -0.306  1.00 0.00 ? 1  LEU A HD22 9  
ATOM 8317  H HD23 . LEU A 1 1  ? -20.257 -10.466 -0.602  1.00 0.00 ? 1  LEU A HD23 9  
ATOM 8318  N N    . ASP A 1 2  ? -20.936 -15.407 -4.670  1.00 0.00 ? 2  ASP A N    9  
ATOM 8319  C CA   . ASP A 1 2  ? -20.954 -16.833 -4.976  1.00 0.00 ? 2  ASP A CA   9  
ATOM 8320  C C    . ASP A 1 2  ? -20.538 -17.093 -6.420  1.00 0.00 ? 2  ASP A C    9  
ATOM 8321  O O    . ASP A 1 2  ? -20.328 -16.159 -7.195  1.00 0.00 ? 2  ASP A O    9  
ATOM 8322  C CB   . ASP A 1 2  ? -22.357 -17.397 -4.742  1.00 0.00 ? 2  ASP A CB   9  
ATOM 8323  C CG   . ASP A 1 2  ? -22.651 -17.462 -3.246  1.00 0.00 ? 2  ASP A CG   9  
ATOM 8324  O OD1  . ASP A 1 2  ? -21.721 -17.315 -2.472  1.00 0.00 ? 2  ASP A OD1  9  
ATOM 8325  O OD2  . ASP A 1 2  ? -23.805 -17.656 -2.898  1.00 0.00 ? 2  ASP A OD2  9  
ATOM 8326  H H    . ASP A 1 2  ? -21.781 -14.957 -4.462  1.00 0.00 ? 2  ASP A H    9  
ATOM 8327  H HA   . ASP A 1 2  ? -20.263 -17.339 -4.319  1.00 0.00 ? 2  ASP A HA   9  
ATOM 8328  H HB2  . ASP A 1 2  ? -23.084 -16.760 -5.223  1.00 0.00 ? 2  ASP A HB2  9  
ATOM 8329  H HB3  . ASP A 1 2  ? -22.417 -18.390 -5.160  1.00 0.00 ? 2  ASP A HB3  9  
ATOM 8330  N N    . ARG A 1 3  ? -20.405 -18.375 -6.754  1.00 0.00 ? 3  ARG A N    9  
ATOM 8331  C CA   . ARG A 1 3  ? -19.996 -18.791 -8.095  1.00 0.00 ? 3  ARG A CA   9  
ATOM 8332  C C    . ARG A 1 3  ? -18.592 -18.274 -8.387  1.00 0.00 ? 3  ARG A C    9  
ATOM 8333  O O    . ARG A 1 3  ? -18.052 -17.474 -7.622  1.00 0.00 ? 3  ARG A O    9  
ATOM 8334  C CB   . ARG A 1 3  ? -20.974 -18.248 -9.144  1.00 0.00 ? 3  ARG A CB   9  
ATOM 8335  C CG   . ARG A 1 3  ? -22.398 -18.680 -8.790  1.00 0.00 ? 3  ARG A CG   9  
ATOM 8336  C CD   . ARG A 1 3  ? -23.369 -18.142 -9.842  1.00 0.00 ? 3  ARG A CD   9  
ATOM 8337  N NE   . ARG A 1 3  ? -24.746 -18.410 -9.442  1.00 0.00 ? 3  ARG A NE   9  
ATOM 8338  C CZ   . ARG A 1 3  ? -25.769 -18.025 -10.199 1.00 0.00 ? 3  ARG A CZ   9  
ATOM 8339  N NH1  . ARG A 1 3  ? -25.552 -17.403 -11.326 1.00 0.00 ? 3  ARG A NH1  9  
ATOM 8340  N NH2  . ARG A 1 3  ? -26.993 -18.271 -9.815  1.00 0.00 ? 3  ARG A NH2  9  
ATOM 8341  H H    . ARG A 1 3  ? -20.584 -19.054 -6.071  1.00 0.00 ? 3  ARG A H    9  
ATOM 8342  H HA   . ARG A 1 3  ? -19.992 -19.870 -8.143  1.00 0.00 ? 3  ARG A HA   9  
ATOM 8343  H HB2  . ARG A 1 3  ? -20.918 -17.171 -9.175  1.00 0.00 ? 3  ARG A HB2  9  
ATOM 8344  H HB3  . ARG A 1 3  ? -20.713 -18.646 -10.113 1.00 0.00 ? 3  ARG A HB3  9  
ATOM 8345  H HG2  . ARG A 1 3  ? -22.452 -19.759 -8.767  1.00 0.00 ? 3  ARG A HG2  9  
ATOM 8346  H HG3  . ARG A 1 3  ? -22.664 -18.285 -7.822  1.00 0.00 ? 3  ARG A HG3  9  
ATOM 8347  H HD2  . ARG A 1 3  ? -23.230 -17.077 -9.945  1.00 0.00 ? 3  ARG A HD2  9  
ATOM 8348  H HD3  . ARG A 1 3  ? -23.170 -18.621 -10.790 1.00 0.00 ? 3  ARG A HD3  9  
ATOM 8349  H HE   . ARG A 1 3  ? -24.920 -18.880 -8.600  1.00 0.00 ? 3  ARG A HE   9  
ATOM 8350  H HH11 . ARG A 1 3  ? -24.615 -17.216 -11.620 1.00 0.00 ? 3  ARG A HH11 9  
ATOM 8351  H HH12 . ARG A 1 3  ? -26.321 -17.114 -11.894 1.00 0.00 ? 3  ARG A HH12 9  
ATOM 8352  H HH21 . ARG A 1 3  ? -27.159 -18.749 -8.953  1.00 0.00 ? 3  ARG A HH21 9  
ATOM 8353  H HH22 . ARG A 1 3  ? -27.762 -17.981 -10.383 1.00 0.00 ? 3  ARG A HH22 9  
ATOM 8354  N N    . TRP A 1 4  ? -18.007 -18.720 -9.499  1.00 0.00 ? 4  TRP A N    9  
ATOM 8355  C CA   . TRP A 1 4  ? -16.668 -18.273 -9.876  1.00 0.00 ? 4  TRP A CA   9  
ATOM 8356  C C    . TRP A 1 4  ? -16.667 -17.716 -11.296 1.00 0.00 ? 4  TRP A C    9  
ATOM 8357  O O    . TRP A 1 4  ? -15.851 -16.858 -11.636 1.00 0.00 ? 4  TRP A O    9  
ATOM 8358  C CB   . TRP A 1 4  ? -15.684 -19.440 -9.768  1.00 0.00 ? 4  TRP A CB   9  
ATOM 8359  C CG   . TRP A 1 4  ? -16.223 -20.623 -10.508 1.00 0.00 ? 4  TRP A CG   9  
ATOM 8360  C CD1  . TRP A 1 4  ? -15.986 -20.899 -11.809 1.00 0.00 ? 4  TRP A CD1  9  
ATOM 8361  C CD2  . TRP A 1 4  ? -17.091 -21.685 -10.015 1.00 0.00 ? 4  TRP A CD2  9  
ATOM 8362  N NE1  . TRP A 1 4  ? -16.647 -22.065 -12.147 1.00 0.00 ? 4  TRP A NE1  9  
ATOM 8363  C CE2  . TRP A 1 4  ? -17.343 -22.587 -11.075 1.00 0.00 ? 4  TRP A CE2  9  
ATOM 8364  C CE3  . TRP A 1 4  ? -17.675 -21.950 -8.764  1.00 0.00 ? 4  TRP A CE3  9  
ATOM 8365  C CZ2  . TRP A 1 4  ? -18.148 -23.714 -10.900 1.00 0.00 ? 4  TRP A CZ2  9  
ATOM 8366  C CZ3  . TRP A 1 4  ? -18.485 -23.084 -8.584  1.00 0.00 ? 4  TRP A CZ3  9  
ATOM 8367  C CH2  . TRP A 1 4  ? -18.721 -23.963 -9.650  1.00 0.00 ? 4  TRP A CH2  9  
ATOM 8368  H H    . TRP A 1 4  ? -18.487 -19.341 -10.086 1.00 0.00 ? 4  TRP A H    9  
ATOM 8369  H HA   . TRP A 1 4  ? -16.355 -17.492 -9.201  1.00 0.00 ? 4  TRP A HA   9  
ATOM 8370  H HB2  . TRP A 1 4  ? -14.735 -19.152 -10.195 1.00 0.00 ? 4  TRP A HB2  9  
ATOM 8371  H HB3  . TRP A 1 4  ? -15.547 -19.699 -8.728  1.00 0.00 ? 4  TRP A HB3  9  
ATOM 8372  H HD1  . TRP A 1 4  ? -15.375 -20.308 -12.475 1.00 0.00 ? 4  TRP A HD1  9  
ATOM 8373  H HE1  . TRP A 1 4  ? -16.636 -22.486 -13.032 1.00 0.00 ? 4  TRP A HE1  9  
ATOM 8374  H HE3  . TRP A 1 4  ? -17.500 -21.280 -7.936  1.00 0.00 ? 4  TRP A HE3  9  
ATOM 8375  H HZ2  . TRP A 1 4  ? -18.327 -24.388 -11.724 1.00 0.00 ? 4  TRP A HZ2  9  
ATOM 8376  H HZ3  . TRP A 1 4  ? -18.929 -23.278 -7.619  1.00 0.00 ? 4  TRP A HZ3  9  
ATOM 8377  H HH2  . TRP A 1 4  ? -19.345 -24.833 -9.504  1.00 0.00 ? 4  TRP A HH2  9  
ATOM 8378  N N    . TYR A 1 5  ? -17.584 -18.207 -12.126 1.00 0.00 ? 5  TYR A N    9  
ATOM 8379  C CA   . TYR A 1 5  ? -17.675 -17.746 -13.507 1.00 0.00 ? 5  TYR A CA   9  
ATOM 8380  C C    . TYR A 1 5  ? -19.137 -17.610 -13.923 1.00 0.00 ? 5  TYR A C    9  
ATOM 8381  O O    . TYR A 1 5  ? -19.925 -18.544 -13.772 1.00 0.00 ? 5  TYR A O    9  
ATOM 8382  C CB   . TYR A 1 5  ? -16.960 -18.731 -14.434 1.00 0.00 ? 5  TYR A CB   9  
ATOM 8383  C CG   . TYR A 1 5  ? -17.069 -18.259 -15.864 1.00 0.00 ? 5  TYR A CG   9  
ATOM 8384  C CD1  . TYR A 1 5  ? -16.238 -17.232 -16.326 1.00 0.00 ? 5  TYR A CD1  9  
ATOM 8385  C CD2  . TYR A 1 5  ? -17.993 -18.856 -16.731 1.00 0.00 ? 5  TYR A CD2  9  
ATOM 8386  C CE1  . TYR A 1 5  ? -16.331 -16.800 -17.655 1.00 0.00 ? 5  TYR A CE1  9  
ATOM 8387  C CE2  . TYR A 1 5  ? -18.086 -18.423 -18.060 1.00 0.00 ? 5  TYR A CE2  9  
ATOM 8388  C CZ   . TYR A 1 5  ? -17.255 -17.396 -18.522 1.00 0.00 ? 5  TYR A CZ   9  
ATOM 8389  O OH   . TYR A 1 5  ? -17.344 -16.972 -19.831 1.00 0.00 ? 5  TYR A OH   9  
ATOM 8390  H H    . TYR A 1 5  ? -18.202 -18.899 -11.809 1.00 0.00 ? 5  TYR A H    9  
ATOM 8391  H HA   . TYR A 1 5  ? -17.199 -16.780 -13.586 1.00 0.00 ? 5  TYR A HA   9  
ATOM 8392  H HB2  . TYR A 1 5  ? -15.920 -18.790 -14.157 1.00 0.00 ? 5  TYR A HB2  9  
ATOM 8393  H HB3  . TYR A 1 5  ? -17.415 -19.706 -14.342 1.00 0.00 ? 5  TYR A HB3  9  
ATOM 8394  H HD1  . TYR A 1 5  ? -15.525 -16.771 -15.658 1.00 0.00 ? 5  TYR A HD1  9  
ATOM 8395  H HD2  . TYR A 1 5  ? -18.634 -19.649 -16.375 1.00 0.00 ? 5  TYR A HD2  9  
ATOM 8396  H HE1  . TYR A 1 5  ? -15.690 -16.007 -18.010 1.00 0.00 ? 5  TYR A HE1  9  
ATOM 8397  H HE2  . TYR A 1 5  ? -18.799 -18.882 -18.728 1.00 0.00 ? 5  TYR A HE2  9  
ATOM 8398  H HH   . TYR A 1 5  ? -17.840 -17.631 -20.323 1.00 0.00 ? 5  TYR A HH   9  
ATOM 8399  N N    . LEU A 1 6  ? -19.494 -16.439 -14.439 1.00 0.00 ? 6  LEU A N    9  
ATOM 8400  C CA   . LEU A 1 6  ? -20.865 -16.187 -14.866 1.00 0.00 ? 6  LEU A CA   9  
ATOM 8401  C C    . LEU A 1 6  ? -20.894 -15.038 -15.874 1.00 0.00 ? 6  LEU A C    9  
ATOM 8402  O O    . LEU A 1 6  ? -19.994 -14.200 -15.892 1.00 0.00 ? 6  LEU A O    9  
ATOM 8403  C CB   . LEU A 1 6  ? -21.730 -15.852 -13.641 1.00 0.00 ? 6  LEU A CB   9  
ATOM 8404  C CG   . LEU A 1 6  ? -23.194 -15.646 -14.051 1.00 0.00 ? 6  LEU A CG   9  
ATOM 8405  C CD1  . LEU A 1 6  ? -23.748 -16.928 -14.679 1.00 0.00 ? 6  LEU A CD1  9  
ATOM 8406  C CD2  . LEU A 1 6  ? -24.022 -15.298 -12.810 1.00 0.00 ? 6  LEU A CD2  9  
ATOM 8407  H H    . LEU A 1 6  ? -18.823 -15.730 -14.530 1.00 0.00 ? 6  LEU A H    9  
ATOM 8408  H HA   . LEU A 1 6  ? -21.251 -17.078 -15.336 1.00 0.00 ? 6  LEU A HA   9  
ATOM 8409  H HB2  . LEU A 1 6  ? -21.668 -16.662 -12.931 1.00 0.00 ? 6  LEU A HB2  9  
ATOM 8410  H HB3  . LEU A 1 6  ? -21.359 -14.947 -13.181 1.00 0.00 ? 6  LEU A HB3  9  
ATOM 8411  H HG   . LEU A 1 6  ? -23.261 -14.838 -14.760 1.00 0.00 ? 6  LEU A HG   9  
ATOM 8412  H HD11 . LEU A 1 6  ? -24.803 -17.010 -14.460 1.00 0.00 ? 6  LEU A HD11 9  
ATOM 8413  H HD12 . LEU A 1 6  ? -23.228 -17.784 -14.274 1.00 0.00 ? 6  LEU A HD12 9  
ATOM 8414  H HD13 . LEU A 1 6  ? -23.606 -16.895 -15.749 1.00 0.00 ? 6  LEU A HD13 9  
ATOM 8415  H HD21 . LEU A 1 6  ? -24.039 -14.226 -12.678 1.00 0.00 ? 6  LEU A HD21 9  
ATOM 8416  H HD22 . LEU A 1 6  ? -23.581 -15.761 -11.939 1.00 0.00 ? 6  LEU A HD22 9  
ATOM 8417  H HD23 . LEU A 1 6  ? -25.031 -15.660 -12.936 1.00 0.00 ? 6  LEU A HD23 9  
ATOM 8418  N N    . GLY A 1 7  ? -21.930 -14.999 -16.708 1.00 0.00 ? 7  GLY A N    9  
ATOM 8419  C CA   . GLY A 1 7  ? -22.054 -13.940 -17.703 1.00 0.00 ? 7  GLY A CA   9  
ATOM 8420  C C    . GLY A 1 7  ? -21.394 -14.343 -19.017 1.00 0.00 ? 7  GLY A C    9  
ATOM 8421  O O    . GLY A 1 7  ? -21.454 -13.607 -20.003 1.00 0.00 ? 7  GLY A O    9  
ATOM 8422  H H    . GLY A 1 7  ? -22.629 -15.681 -16.644 1.00 0.00 ? 7  GLY A H    9  
ATOM 8423  H HA2  . GLY A 1 7  ? -23.100 -13.739 -17.878 1.00 0.00 ? 7  GLY A HA2  9  
ATOM 8424  H HA3  . GLY A 1 7  ? -21.577 -13.046 -17.330 1.00 0.00 ? 7  GLY A HA3  9  
ATOM 8425  N N    . GLY A 1 8  ? -20.771 -15.515 -19.027 1.00 0.00 ? 8  GLY A N    9  
ATOM 8426  C CA   . GLY A 1 8  ? -20.109 -16.003 -20.232 1.00 0.00 ? 8  GLY A CA   9  
ATOM 8427  C C    . GLY A 1 8  ? -18.999 -15.053 -20.669 1.00 0.00 ? 8  GLY A C    9  
ATOM 8428  O O    . GLY A 1 8  ? -18.097 -14.736 -19.892 1.00 0.00 ? 8  GLY A O    9  
ATOM 8429  H H    . GLY A 1 8  ? -20.759 -16.060 -18.212 1.00 0.00 ? 8  GLY A H    9  
ATOM 8430  H HA2  . GLY A 1 8  ? -19.688 -16.976 -20.035 1.00 0.00 ? 8  GLY A HA2  9  
ATOM 8431  H HA3  . GLY A 1 8  ? -20.836 -16.083 -21.026 1.00 0.00 ? 8  GLY A HA3  9  
ATOM 8432  N N    . SER A 1 9  ? -19.070 -14.607 -21.921 1.00 0.00 ? 9  SER A N    9  
ATOM 8433  C CA   . SER A 1 9  ? -18.066 -13.694 -22.464 1.00 0.00 ? 9  SER A CA   9  
ATOM 8434  C C    . SER A 1 9  ? -18.737 -12.456 -23.060 1.00 0.00 ? 9  SER A C    9  
ATOM 8435  O O    . SER A 1 9  ? -18.916 -12.367 -24.274 1.00 0.00 ? 9  SER A O    9  
ATOM 8436  C CB   . SER A 1 9  ? -17.264 -14.407 -23.553 1.00 0.00 ? 9  SER A CB   9  
ATOM 8437  O OG   . SER A 1 9  ? -16.182 -13.578 -23.958 1.00 0.00 ? 9  SER A OG   9  
ATOM 8438  H H    . SER A 1 9  ? -19.815 -14.895 -22.490 1.00 0.00 ? 9  SER A H    9  
ATOM 8439  H HA   . SER A 1 9  ? -17.392 -13.400 -21.679 1.00 0.00 ? 9  SER A HA   9  
ATOM 8440  H HB2  . SER A 1 9  ? -16.876 -15.334 -23.169 1.00 0.00 ? 9  SER A HB2  9  
ATOM 8441  H HB3  . SER A 1 9  ? -17.910 -14.612 -24.398 1.00 0.00 ? 9  SER A HB3  9  
ATOM 8442  H HG   . SER A 1 9  ? -16.525 -12.693 -24.103 1.00 0.00 ? 9  SER A HG   9  
ATOM 8443  N N    . PRO A 1 10 ? -19.119 -11.508 -22.235 1.00 0.00 ? 10 PRO A N    9  
ATOM 8444  C CA   . PRO A 1 10 ? -19.791 -10.262 -22.701 1.00 0.00 ? 10 PRO A CA   9  
ATOM 8445  C C    . PRO A 1 10 ? -18.812 -9.261  -23.313 1.00 0.00 ? 10 PRO A C    9  
ATOM 8446  O O    . PRO A 1 10 ? -17.608 -9.328  -23.070 1.00 0.00 ? 10 PRO A O    9  
ATOM 8447  C CB   . PRO A 1 10 ? -20.433 -9.713  -21.430 1.00 0.00 ? 10 PRO A CB   9  
ATOM 8448  C CG   . PRO A 1 10 ? -19.541 -10.167 -20.327 1.00 0.00 ? 10 PRO A CG   9  
ATOM 8449  C CD   . PRO A 1 10 ? -18.951 -11.510 -20.766 1.00 0.00 ? 10 PRO A CD   9  
ATOM 8450  H HA   . PRO A 1 10 ? -20.564 -10.504 -23.414 1.00 0.00 ? 10 PRO A HA   9  
ATOM 8451  H HB2  . PRO A 1 10 ? -20.472 -8.633  -21.466 1.00 0.00 ? 10 PRO A HB2  9  
ATOM 8452  H HB3  . PRO A 1 10 ? -21.422 -10.124 -21.298 1.00 0.00 ? 10 PRO A HB3  9  
ATOM 8453  H HG2  . PRO A 1 10 ? -18.753 -9.445  -20.168 1.00 0.00 ? 10 PRO A HG2  9  
ATOM 8454  H HG3  . PRO A 1 10 ? -20.111 -10.301 -19.420 1.00 0.00 ? 10 PRO A HG3  9  
ATOM 8455  H HD2  . PRO A 1 10 ? -17.907 -11.555 -20.494 1.00 0.00 ? 10 PRO A HD2  9  
ATOM 8456  H HD3  . PRO A 1 10 ? -19.498 -12.329 -20.326 1.00 0.00 ? 10 PRO A HD3  9  
ATOM 8457  N N    . LYS A 1 11 ? -19.344 -8.335  -24.104 1.00 0.00 ? 11 LYS A N    9  
ATOM 8458  C CA   . LYS A 1 11 ? -18.517 -7.320  -24.748 1.00 0.00 ? 11 LYS A CA   9  
ATOM 8459  C C    . LYS A 1 11 ? -18.141 -6.228  -23.751 1.00 0.00 ? 11 LYS A C    9  
ATOM 8460  O O    . LYS A 1 11 ? -17.336 -5.348  -24.051 1.00 0.00 ? 11 LYS A O    9  
ATOM 8461  C CB   . LYS A 1 11 ? -19.272 -6.701  -25.925 1.00 0.00 ? 11 LYS A CB   9  
ATOM 8462  C CG   . LYS A 1 11 ? -19.489 -7.765  -27.006 1.00 0.00 ? 11 LYS A CG   9  
ATOM 8463  C CD   . LYS A 1 11 ? -20.046 -7.125  -28.286 1.00 0.00 ? 11 LYS A CD   9  
ATOM 8464  C CE   . LYS A 1 11 ? -21.503 -6.697  -28.081 1.00 0.00 ? 11 LYS A CE   9  
ATOM 8465  N NZ   . LYS A 1 11 ? -22.074 -6.252  -29.384 1.00 0.00 ? 11 LYS A NZ   9  
ATOM 8466  H H    . LYS A 1 11 ? -20.312 -8.333  -24.259 1.00 0.00 ? 11 LYS A H    9  
ATOM 8467  H HA   . LYS A 1 11 ? -17.615 -7.785  -25.116 1.00 0.00 ? 11 LYS A HA   9  
ATOM 8468  H HB2  . LYS A 1 11 ? -20.225 -6.334  -25.577 1.00 0.00 ? 11 LYS A HB2  9  
ATOM 8469  H HB3  . LYS A 1 11 ? -18.696 -5.884  -26.335 1.00 0.00 ? 11 LYS A HB3  9  
ATOM 8470  H HG2  . LYS A 1 11 ? -18.546 -8.245  -27.228 1.00 0.00 ? 11 LYS A HG2  9  
ATOM 8471  H HG3  . LYS A 1 11 ? -20.189 -8.504  -26.644 1.00 0.00 ? 11 LYS A HG3  9  
ATOM 8472  H HD2  . LYS A 1 11 ? -19.452 -6.261  -28.538 1.00 0.00 ? 11 LYS A HD2  9  
ATOM 8473  H HD3  . LYS A 1 11 ? -19.995 -7.841  -29.093 1.00 0.00 ? 11 LYS A HD3  9  
ATOM 8474  H HE2  . LYS A 1 11 ? -22.075 -7.531  -27.702 1.00 0.00 ? 11 LYS A HE2  9  
ATOM 8475  H HE3  . LYS A 1 11 ? -21.548 -5.880  -27.378 1.00 0.00 ? 11 LYS A HE3  9  
ATOM 8476  H HZ1  . LYS A 1 11 ? -22.945 -6.784  -29.581 1.00 0.00 ? 11 LYS A HZ1  9  
ATOM 8477  H HZ2  . LYS A 1 11 ? -21.381 -6.426  -30.142 1.00 0.00 ? 11 LYS A HZ2  9  
ATOM 8478  H HZ3  . LYS A 1 11 ? -22.292 -5.238  -29.339 1.00 0.00 ? 11 LYS A HZ3  9  
ATOM 8479  N N    . GLY A 1 12 ? -18.740 -6.290  -22.566 1.00 0.00 ? 12 GLY A N    9  
ATOM 8480  C CA   . GLY A 1 12 ? -18.474 -5.301  -21.528 1.00 0.00 ? 12 GLY A CA   9  
ATOM 8481  C C    . GLY A 1 12 ? -19.567 -4.239  -21.503 1.00 0.00 ? 12 GLY A C    9  
ATOM 8482  O O    . GLY A 1 12 ? -19.524 -3.307  -20.699 1.00 0.00 ? 12 GLY A O    9  
ATOM 8483  H H    . GLY A 1 12 ? -19.380 -7.010  -22.387 1.00 0.00 ? 12 GLY A H    9  
ATOM 8484  H HA2  . GLY A 1 12 ? -18.432 -5.794  -20.568 1.00 0.00 ? 12 GLY A HA2  9  
ATOM 8485  H HA3  . GLY A 1 12 ? -17.525 -4.824  -21.726 1.00 0.00 ? 12 GLY A HA3  9  
ATOM 8486  N N    . ASP A 1 13 ? -20.555 -4.398  -22.376 1.00 0.00 ? 13 ASP A N    9  
ATOM 8487  C CA   . ASP A 1 13 ? -21.668 -3.461  -22.438 1.00 0.00 ? 13 ASP A CA   9  
ATOM 8488  C C    . ASP A 1 13 ? -22.878 -4.040  -21.713 1.00 0.00 ? 13 ASP A C    9  
ATOM 8489  O O    . ASP A 1 13 ? -23.543 -4.939  -22.226 1.00 0.00 ? 13 ASP A O    9  
ATOM 8490  C CB   . ASP A 1 13 ? -22.032 -3.172  -23.895 1.00 0.00 ? 13 ASP A CB   9  
ATOM 8491  C CG   . ASP A 1 13 ? -23.170 -2.159  -23.959 1.00 0.00 ? 13 ASP A CG   9  
ATOM 8492  O OD1  . ASP A 1 13 ? -23.694 -1.821  -22.911 1.00 0.00 ? 13 ASP A OD1  9  
ATOM 8493  O OD2  . ASP A 1 13 ? -23.500 -1.735  -25.054 1.00 0.00 ? 13 ASP A OD2  9  
ATOM 8494  H H    . ASP A 1 13 ? -20.540 -5.169  -22.983 1.00 0.00 ? 13 ASP A H    9  
ATOM 8495  H HA   . ASP A 1 13 ? -21.379 -2.536  -21.959 1.00 0.00 ? 13 ASP A HA   9  
ATOM 8496  H HB2  . ASP A 1 13 ? -21.168 -2.774  -24.408 1.00 0.00 ? 13 ASP A HB2  9  
ATOM 8497  H HB3  . ASP A 1 13 ? -22.343 -4.088  -24.375 1.00 0.00 ? 13 ASP A HB3  9  
ATOM 8498  N N    . VAL A 1 14 ? -23.153 -3.530  -20.515 1.00 0.00 ? 14 VAL A N    9  
ATOM 8499  C CA   . VAL A 1 14 ? -24.283 -4.021  -19.732 1.00 0.00 ? 14 VAL A CA   9  
ATOM 8500  C C    . VAL A 1 14 ? -25.071 -2.859  -19.133 1.00 0.00 ? 14 VAL A C    9  
ATOM 8501  O O    . VAL A 1 14 ? -24.515 -2.015  -18.430 1.00 0.00 ? 14 VAL A O    9  
ATOM 8502  C CB   . VAL A 1 14 ? -23.761 -4.925  -18.612 1.00 0.00 ? 14 VAL A CB   9  
ATOM 8503  C CG1  . VAL A 1 14 ? -22.852 -4.115  -17.683 1.00 0.00 ? 14 VAL A CG1  9  
ATOM 8504  C CG2  . VAL A 1 14 ? -24.933 -5.486  -17.808 1.00 0.00 ? 14 VAL A CG2  9  
ATOM 8505  H H    . VAL A 1 14 ? -22.584 -2.821  -20.150 1.00 0.00 ? 14 VAL A H    9  
ATOM 8506  H HA   . VAL A 1 14 ? -24.935 -4.597  -20.370 1.00 0.00 ? 14 VAL A HA   9  
ATOM 8507  H HB   . VAL A 1 14 ? -23.196 -5.739  -19.042 1.00 0.00 ? 14 VAL A HB   9  
ATOM 8508  H HG11 . VAL A 1 14 ? -22.162 -4.780  -17.187 1.00 0.00 ? 14 VAL A HG11 9  
ATOM 8509  H HG12 . VAL A 1 14 ? -23.454 -3.605  -16.947 1.00 0.00 ? 14 VAL A HG12 9  
ATOM 8510  H HG13 . VAL A 1 14 ? -22.300 -3.390  -18.263 1.00 0.00 ? 14 VAL A HG13 9  
ATOM 8511  H HG21 . VAL A 1 14 ? -25.629 -5.969  -18.479 1.00 0.00 ? 14 VAL A HG21 9  
ATOM 8512  H HG22 . VAL A 1 14 ? -25.430 -4.681  -17.287 1.00 0.00 ? 14 VAL A HG22 9  
ATOM 8513  H HG23 . VAL A 1 14 ? -24.566 -6.206  -17.092 1.00 0.00 ? 14 VAL A HG23 9  
ATOM 8514  N N    . ASP A 1 15 ? -26.373 -2.824  -19.414 1.00 0.00 ? 15 ASP A N    9  
ATOM 8515  C CA   . ASP A 1 15 ? -27.232 -1.762  -18.896 1.00 0.00 ? 15 ASP A CA   9  
ATOM 8516  C C    . ASP A 1 15 ? -28.707 -2.161  -18.989 1.00 0.00 ? 15 ASP A C    9  
ATOM 8517  O O    . ASP A 1 15 ? -29.502 -1.478  -19.634 1.00 0.00 ? 15 ASP A O    9  
ATOM 8518  C CB   . ASP A 1 15 ? -27.000 -0.477  -19.694 1.00 0.00 ? 15 ASP A CB   9  
ATOM 8519  C CG   . ASP A 1 15 ? -27.303 -0.717  -21.170 1.00 0.00 ? 15 ASP A CG   9  
ATOM 8520  O OD1  . ASP A 1 15 ? -27.434 -1.869  -21.546 1.00 0.00 ? 15 ASP A OD1  9  
ATOM 8521  O OD2  . ASP A 1 15 ? -27.396 0.255   -21.901 1.00 0.00 ? 15 ASP A OD2  9  
ATOM 8522  H H    . ASP A 1 15 ? -26.762 -3.524  -19.981 1.00 0.00 ? 15 ASP A H    9  
ATOM 8523  H HA   . ASP A 1 15 ? -26.980 -1.577  -17.864 1.00 0.00 ? 15 ASP A HA   9  
ATOM 8524  H HB2  . ASP A 1 15 ? -27.648 0.301   -19.317 1.00 0.00 ? 15 ASP A HB2  9  
ATOM 8525  H HB3  . ASP A 1 15 ? -25.971 -0.169  -19.585 1.00 0.00 ? 15 ASP A HB3  9  
ATOM 8526  N N    . PRO A 1 16 ? -29.080 -3.248  -18.366 1.00 0.00 ? 16 PRO A N    9  
ATOM 8527  C CA   . PRO A 1 16 ? -30.490 -3.748  -18.381 1.00 0.00 ? 16 PRO A CA   9  
ATOM 8528  C C    . PRO A 1 16 ? -31.448 -2.847  -17.605 1.00 0.00 ? 16 PRO A C    9  
ATOM 8529  O O    . PRO A 1 16 ? -32.659 -2.914  -17.792 1.00 0.00 ? 16 PRO A O    9  
ATOM 8530  C CB   . PRO A 1 16 ? -30.390 -5.128  -17.729 1.00 0.00 ? 16 PRO A CB   9  
ATOM 8531  C CG   . PRO A 1 16 ? -29.177 -5.063  -16.867 1.00 0.00 ? 16 PRO A CG   9  
ATOM 8532  C CD   . PRO A 1 16 ? -28.202 -4.128  -17.579 1.00 0.00 ? 16 PRO A CD   9  
ATOM 8533  H HA   . PRO A 1 16 ? -30.830 -3.860  -19.398 1.00 0.00 ? 16 PRO A HA   9  
ATOM 8534  H HB2  . PRO A 1 16 ? -31.269 -5.323  -17.129 1.00 0.00 ? 16 PRO A HB2  9  
ATOM 8535  H HB3  . PRO A 1 16 ? -30.269 -5.892  -18.479 1.00 0.00 ? 16 PRO A HB3  9  
ATOM 8536  H HG2  . PRO A 1 16 ? -29.435 -4.667  -15.893 1.00 0.00 ? 16 PRO A HG2  9  
ATOM 8537  H HG3  . PRO A 1 16 ? -28.736 -6.042  -16.769 1.00 0.00 ? 16 PRO A HG3  9  
ATOM 8538  H HD2  . PRO A 1 16 ? -27.629 -3.561  -16.859 1.00 0.00 ? 16 PRO A HD2  9  
ATOM 8539  H HD3  . PRO A 1 16 ? -27.554 -4.684  -18.234 1.00 0.00 ? 16 PRO A HD3  9  
ATOM 8540  N N    . PHE A 1 17 ? -30.907 -2.030  -16.710 1.00 0.00 ? 17 PHE A N    9  
ATOM 8541  C CA   . PHE A 1 17 ? -31.742 -1.160  -15.886 1.00 0.00 ? 17 PHE A CA   9  
ATOM 8542  C C    . PHE A 1 17 ? -32.613 -0.240  -16.739 1.00 0.00 ? 17 PHE A C    9  
ATOM 8543  O O    . PHE A 1 17 ? -33.413 0.530   -16.207 1.00 0.00 ? 17 PHE A O    9  
ATOM 8544  C CB   . PHE A 1 17 ? -30.859 -0.316  -14.964 1.00 0.00 ? 17 PHE A CB   9  
ATOM 8545  C CG   . PHE A 1 17 ? -30.200 -1.212  -13.944 1.00 0.00 ? 17 PHE A CG   9  
ATOM 8546  C CD1  . PHE A 1 17 ? -30.864 -1.523  -12.753 1.00 0.00 ? 17 PHE A CD1  9  
ATOM 8547  C CD2  . PHE A 1 17 ? -28.923 -1.732  -14.191 1.00 0.00 ? 17 PHE A CD2  9  
ATOM 8548  C CE1  . PHE A 1 17 ? -30.254 -2.354  -11.807 1.00 0.00 ? 17 PHE A CE1  9  
ATOM 8549  C CE2  . PHE A 1 17 ? -28.312 -2.564  -13.246 1.00 0.00 ? 17 PHE A CE2  9  
ATOM 8550  C CZ   . PHE A 1 17 ? -28.978 -2.876  -12.055 1.00 0.00 ? 17 PHE A CZ   9  
ATOM 8551  H H    . PHE A 1 17 ? -29.939 -2.047  -16.563 1.00 0.00 ? 17 PHE A H    9  
ATOM 8552  H HA   . PHE A 1 17 ? -32.386 -1.776  -15.275 1.00 0.00 ? 17 PHE A HA   9  
ATOM 8553  H HB2  . PHE A 1 17 ? -30.102 0.184   -15.549 1.00 0.00 ? 17 PHE A HB2  9  
ATOM 8554  H HB3  . PHE A 1 17 ? -31.467 0.420   -14.457 1.00 0.00 ? 17 PHE A HB3  9  
ATOM 8555  H HD1  . PHE A 1 17 ? -31.848 -1.122  -12.563 1.00 0.00 ? 17 PHE A HD1  9  
ATOM 8556  H HD2  . PHE A 1 17 ? -28.411 -1.492  -15.111 1.00 0.00 ? 17 PHE A HD2  9  
ATOM 8557  H HE1  . PHE A 1 17 ? -30.766 -2.595  -10.887 1.00 0.00 ? 17 PHE A HE1  9  
ATOM 8558  H HE2  . PHE A 1 17 ? -27.329 -2.966  -13.437 1.00 0.00 ? 17 PHE A HE2  9  
ATOM 8559  H HZ   . PHE A 1 17 ? -28.506 -3.518  -11.325 1.00 0.00 ? 17 PHE A HZ   9  
ATOM 8560  N N    . TYR A 1 18 ? -32.475 -0.342  -18.059 1.00 0.00 ? 18 TYR A N    9  
ATOM 8561  C CA   . TYR A 1 18 ? -33.281 0.475   -18.964 1.00 0.00 ? 18 TYR A CA   9  
ATOM 8562  C C    . TYR A 1 18 ? -34.297 -0.394  -19.704 1.00 0.00 ? 18 TYR A C    9  
ATOM 8563  O O    . TYR A 1 18 ? -35.471 -0.038  -19.813 1.00 0.00 ? 18 TYR A O    9  
ATOM 8564  C CB   . TYR A 1 18 ? -32.374 1.183   -19.970 1.00 0.00 ? 18 TYR A CB   9  
ATOM 8565  C CG   . TYR A 1 18 ? -31.483 2.157   -19.240 1.00 0.00 ? 18 TYR A CG   9  
ATOM 8566  C CD1  . TYR A 1 18 ? -30.235 1.739   -18.760 1.00 0.00 ? 18 TYR A CD1  9  
ATOM 8567  C CD2  . TYR A 1 18 ? -31.901 3.479   -19.042 1.00 0.00 ? 18 TYR A CD2  9  
ATOM 8568  C CE1  . TYR A 1 18 ? -29.407 2.642   -18.082 1.00 0.00 ? 18 TYR A CE1  9  
ATOM 8569  C CE2  . TYR A 1 18 ? -31.071 4.381   -18.366 1.00 0.00 ? 18 TYR A CE2  9  
ATOM 8570  C CZ   . TYR A 1 18 ? -29.826 3.963   -17.886 1.00 0.00 ? 18 TYR A CZ   9  
ATOM 8571  O OH   . TYR A 1 18 ? -29.008 4.853   -17.219 1.00 0.00 ? 18 TYR A OH   9  
ATOM 8572  H H    . TYR A 1 18 ? -31.837 -0.990  -18.426 1.00 0.00 ? 18 TYR A H    9  
ATOM 8573  H HA   . TYR A 1 18 ? -33.812 1.220   -18.391 1.00 0.00 ? 18 TYR A HA   9  
ATOM 8574  H HB2  . TYR A 1 18 ? -31.769 0.453   -20.487 1.00 0.00 ? 18 TYR A HB2  9  
ATOM 8575  H HB3  . TYR A 1 18 ? -32.981 1.719   -20.687 1.00 0.00 ? 18 TYR A HB3  9  
ATOM 8576  H HD1  . TYR A 1 18 ? -29.914 0.721   -18.910 1.00 0.00 ? 18 TYR A HD1  9  
ATOM 8577  H HD2  . TYR A 1 18 ? -32.862 3.801   -19.413 1.00 0.00 ? 18 TYR A HD2  9  
ATOM 8578  H HE1  . TYR A 1 18 ? -28.444 2.320   -17.712 1.00 0.00 ? 18 TYR A HE1  9  
ATOM 8579  H HE2  . TYR A 1 18 ? -31.394 5.401   -18.214 1.00 0.00 ? 18 TYR A HE2  9  
ATOM 8580  H HH   . TYR A 1 18 ? -29.088 4.681   -16.278 1.00 0.00 ? 18 TYR A HH   9  
ATOM 8581  N N    . TYR A 1 19 ? -33.834 -1.529  -20.218 1.00 0.00 ? 19 TYR A N    9  
ATOM 8582  C CA   . TYR A 1 19 ? -34.707 -2.441  -20.958 1.00 0.00 ? 19 TYR A CA   9  
ATOM 8583  C C    . TYR A 1 19 ? -35.354 -3.471  -20.035 1.00 0.00 ? 19 TYR A C    9  
ATOM 8584  O O    . TYR A 1 19 ? -36.305 -4.149  -20.422 1.00 0.00 ? 19 TYR A O    9  
ATOM 8585  C CB   . TYR A 1 19 ? -33.903 -3.168  -22.038 1.00 0.00 ? 19 TYR A CB   9  
ATOM 8586  C CG   . TYR A 1 19 ? -33.440 -2.178  -23.079 1.00 0.00 ? 19 TYR A CG   9  
ATOM 8587  C CD1  . TYR A 1 19 ? -34.252 -1.894  -24.184 1.00 0.00 ? 19 TYR A CD1  9  
ATOM 8588  C CD2  . TYR A 1 19 ? -32.198 -1.546  -22.943 1.00 0.00 ? 19 TYR A CD2  9  
ATOM 8589  C CE1  . TYR A 1 19 ? -33.821 -0.978  -25.152 1.00 0.00 ? 19 TYR A CE1  9  
ATOM 8590  C CE2  . TYR A 1 19 ? -31.768 -0.632  -23.911 1.00 0.00 ? 19 TYR A CE2  9  
ATOM 8591  C CZ   . TYR A 1 19 ? -32.579 -0.347  -25.015 1.00 0.00 ? 19 TYR A CZ   9  
ATOM 8592  O OH   . TYR A 1 19 ? -32.155 0.555   -25.969 1.00 0.00 ? 19 TYR A OH   9  
ATOM 8593  H H    . TYR A 1 19 ? -32.883 -1.746  -20.119 1.00 0.00 ? 19 TYR A H    9  
ATOM 8594  H HA   . TYR A 1 19 ? -35.484 -1.865  -21.437 1.00 0.00 ? 19 TYR A HA   9  
ATOM 8595  H HB2  . TYR A 1 19 ? -33.044 -3.644  -21.586 1.00 0.00 ? 19 TYR A HB2  9  
ATOM 8596  H HB3  . TYR A 1 19 ? -34.525 -3.916  -22.505 1.00 0.00 ? 19 TYR A HB3  9  
ATOM 8597  H HD1  . TYR A 1 19 ? -35.210 -2.381  -24.290 1.00 0.00 ? 19 TYR A HD1  9  
ATOM 8598  H HD2  . TYR A 1 19 ? -31.572 -1.765  -22.090 1.00 0.00 ? 19 TYR A HD2  9  
ATOM 8599  H HE1  . TYR A 1 19 ? -34.447 -0.759  -26.005 1.00 0.00 ? 19 TYR A HE1  9  
ATOM 8600  H HE2  . TYR A 1 19 ? -30.810 -0.145  -23.805 1.00 0.00 ? 19 TYR A HE2  9  
ATOM 8601  H HH   . TYR A 1 19 ? -32.469 0.251   -26.824 1.00 0.00 ? 19 TYR A HH   9  
ATOM 8602  N N    . ASP A 1 20 ? -34.833 -3.594  -18.819 1.00 0.00 ? 20 ASP A N    9  
ATOM 8603  C CA   . ASP A 1 20 ? -35.375 -4.558  -17.865 1.00 0.00 ? 20 ASP A CA   9  
ATOM 8604  C C    . ASP A 1 20 ? -36.830 -4.248  -17.534 1.00 0.00 ? 20 ASP A C    9  
ATOM 8605  O O    . ASP A 1 20 ? -37.669 -5.144  -17.507 1.00 0.00 ? 20 ASP A O    9  
ATOM 8606  C CB   . ASP A 1 20 ? -34.551 -4.557  -16.576 1.00 0.00 ? 20 ASP A CB   9  
ATOM 8607  C CG   . ASP A 1 20 ? -35.129 -5.565  -15.590 1.00 0.00 ? 20 ASP A CG   9  
ATOM 8608  O OD1  . ASP A 1 20 ? -35.046 -6.751  -15.868 1.00 0.00 ? 20 ASP A OD1  9  
ATOM 8609  O OD2  . ASP A 1 20 ? -35.647 -5.139  -14.572 1.00 0.00 ? 20 ASP A OD2  9  
ATOM 8610  H H    . ASP A 1 20 ? -34.077 -3.030  -18.560 1.00 0.00 ? 20 ASP A H    9  
ATOM 8611  H HA   . ASP A 1 20 ? -35.324 -5.542  -18.304 1.00 0.00 ? 20 ASP A HA   9  
ATOM 8612  H HB2  . ASP A 1 20 ? -33.532 -4.828  -16.803 1.00 0.00 ? 20 ASP A HB2  9  
ATOM 8613  H HB3  . ASP A 1 20 ? -34.574 -3.571  -16.135 1.00 0.00 ? 20 ASP A HB3  9  
ATOM 8614  N N    . TYR A 1 21 ? -37.127 -2.978  -17.276 1.00 0.00 ? 21 TYR A N    9  
ATOM 8615  C CA   . TYR A 1 21 ? -38.491 -2.587  -16.941 1.00 0.00 ? 21 TYR A CA   9  
ATOM 8616  C C    . TYR A 1 21 ? -39.421 -2.818  -18.127 1.00 0.00 ? 21 TYR A C    9  
ATOM 8617  O O    . TYR A 1 21 ? -40.553 -3.270  -17.964 1.00 0.00 ? 21 TYR A O    9  
ATOM 8618  C CB   . TYR A 1 21 ? -38.524 -1.111  -16.541 1.00 0.00 ? 21 TYR A CB   9  
ATOM 8619  C CG   . TYR A 1 21 ? -37.766 -0.921  -15.248 1.00 0.00 ? 21 TYR A CG   9  
ATOM 8620  C CD1  . TYR A 1 21 ? -38.432 -1.054  -14.023 1.00 0.00 ? 21 TYR A CD1  9  
ATOM 8621  C CD2  . TYR A 1 21 ? -36.402 -0.613  -15.274 1.00 0.00 ? 21 TYR A CD2  9  
ATOM 8622  C CE1  . TYR A 1 21 ? -37.730 -0.878  -12.823 1.00 0.00 ? 21 TYR A CE1  9  
ATOM 8623  C CE2  . TYR A 1 21 ? -35.701 -0.437  -14.075 1.00 0.00 ? 21 TYR A CE2  9  
ATOM 8624  C CZ   . TYR A 1 21 ? -36.364 -0.570  -12.849 1.00 0.00 ? 21 TYR A CZ   9  
ATOM 8625  O OH   . TYR A 1 21 ? -35.674 -0.396  -11.668 1.00 0.00 ? 21 TYR A OH   9  
ATOM 8626  H H    . TYR A 1 21 ? -36.423 -2.296  -17.303 1.00 0.00 ? 21 TYR A H    9  
ATOM 8627  H HA   . TYR A 1 21 ? -38.830 -3.180  -16.108 1.00 0.00 ? 21 TYR A HA   9  
ATOM 8628  H HB2  . TYR A 1 21 ? -38.064 -0.517  -17.318 1.00 0.00 ? 21 TYR A HB2  9  
ATOM 8629  H HB3  . TYR A 1 21 ? -39.548 -0.798  -16.407 1.00 0.00 ? 21 TYR A HB3  9  
ATOM 8630  H HD1  . TYR A 1 21 ? -39.484 -1.292  -14.003 1.00 0.00 ? 21 TYR A HD1  9  
ATOM 8631  H HD2  . TYR A 1 21 ? -35.889 -0.511  -16.218 1.00 0.00 ? 21 TYR A HD2  9  
ATOM 8632  H HE1  . TYR A 1 21 ? -38.244 -0.981  -11.879 1.00 0.00 ? 21 TYR A HE1  9  
ATOM 8633  H HE2  . TYR A 1 21 ? -34.646 -0.201  -14.094 1.00 0.00 ? 21 TYR A HE2  9  
ATOM 8634  H HH   . TYR A 1 21 ? -36.180 -0.808  -10.965 1.00 0.00 ? 21 TYR A HH   9  
ATOM 8635  N N    . GLU A 1 22 ? -38.940 -2.491  -19.319 1.00 0.00 ? 22 GLU A N    9  
ATOM 8636  C CA   . GLU A 1 22 ? -39.744 -2.662  -20.522 1.00 0.00 ? 22 GLU A CA   9  
ATOM 8637  C C    . GLU A 1 22 ? -39.926 -4.142  -20.871 1.00 0.00 ? 22 GLU A C    9  
ATOM 8638  O O    . GLU A 1 22 ? -41.041 -4.591  -21.140 1.00 0.00 ? 22 GLU A O    9  
ATOM 8639  C CB   . GLU A 1 22 ? -39.076 -1.935  -21.694 1.00 0.00 ? 22 GLU A CB   9  
ATOM 8640  C CG   . GLU A 1 22 ? -39.940 -2.064  -22.953 1.00 0.00 ? 22 GLU A CG   9  
ATOM 8641  C CD   . GLU A 1 22 ? -39.313 -1.272  -24.095 1.00 0.00 ? 22 GLU A CD   9  
ATOM 8642  O OE1  . GLU A 1 22 ? -38.271 -0.677  -23.875 1.00 0.00 ? 22 GLU A OE1  9  
ATOM 8643  O OE2  . GLU A 1 22 ? -39.884 -1.273  -25.174 1.00 0.00 ? 22 GLU A OE2  9  
ATOM 8644  H H    . GLU A 1 22 ? -38.034 -2.120  -19.382 1.00 0.00 ? 22 GLU A H    9  
ATOM 8645  H HA   . GLU A 1 22 ? -40.716 -2.223  -20.354 1.00 0.00 ? 22 GLU A HA   9  
ATOM 8646  H HB2  . GLU A 1 22 ? -38.956 -0.890  -21.445 1.00 0.00 ? 22 GLU A HB2  9  
ATOM 8647  H HB3  . GLU A 1 22 ? -38.107 -2.373  -21.880 1.00 0.00 ? 22 GLU A HB3  9  
ATOM 8648  H HG2  . GLU A 1 22 ? -40.013 -3.102  -23.238 1.00 0.00 ? 22 GLU A HG2  9  
ATOM 8649  H HG3  . GLU A 1 22 ? -40.929 -1.678  -22.751 1.00 0.00 ? 22 GLU A HG3  9  
ATOM 8650  N N    . THR A 1 23 ? -38.821 -4.886  -20.906 1.00 0.00 ? 23 THR A N    9  
ATOM 8651  C CA   . THR A 1 23 ? -38.872 -6.302  -21.274 1.00 0.00 ? 23 THR A CA   9  
ATOM 8652  C C    . THR A 1 23 ? -39.642 -7.163  -20.267 1.00 0.00 ? 23 THR A C    9  
ATOM 8653  O O    . THR A 1 23 ? -40.494 -7.949  -20.654 1.00 0.00 ? 23 THR A O    9  
ATOM 8654  C CB   . THR A 1 23 ? -37.447 -6.845  -21.406 1.00 0.00 ? 23 THR A CB   9  
ATOM 8655  O OG1  . THR A 1 23 ? -36.762 -6.127  -22.422 1.00 0.00 ? 23 THR A OG1  9  
ATOM 8656  C CG2  . THR A 1 23 ? -37.495 -8.328  -21.772 1.00 0.00 ? 23 THR A CG2  9  
ATOM 8657  H H    . THR A 1 23 ? -37.951 -4.473  -20.722 1.00 0.00 ? 23 THR A H    9  
ATOM 8658  H HA   . THR A 1 23 ? -39.354 -6.389  -22.233 1.00 0.00 ? 23 THR A HA   9  
ATOM 8659  H HB   . THR A 1 23 ? -36.928 -6.727  -20.467 1.00 0.00 ? 23 THR A HB   9  
ATOM 8660  H HG1  . THR A 1 23 ? -37.010 -6.501  -23.270 1.00 0.00 ? 23 THR A HG1  9  
ATOM 8661  H HG21 . THR A 1 23 ? -38.449 -8.558  -22.221 1.00 0.00 ? 23 THR A HG21 9  
ATOM 8662  H HG22 . THR A 1 23 ? -37.363 -8.924  -20.880 1.00 0.00 ? 23 THR A HG22 9  
ATOM 8663  H HG23 . THR A 1 23 ? -36.703 -8.553  -22.473 1.00 0.00 ? 23 THR A HG23 9  
ATOM 8664  N N    . VAL A 1 24 ? -39.313 -7.044  -18.987 1.00 0.00 ? 24 VAL A N    9  
ATOM 8665  C CA   . VAL A 1 24 ? -39.956 -7.868  -17.959 1.00 0.00 ? 24 VAL A CA   9  
ATOM 8666  C C    . VAL A 1 24 ? -41.478 -7.907  -18.103 1.00 0.00 ? 24 VAL A C    9  
ATOM 8667  O O    . VAL A 1 24 ? -42.114 -8.873  -17.679 1.00 0.00 ? 24 VAL A O    9  
ATOM 8668  C CB   . VAL A 1 24 ? -39.587 -7.380  -16.557 1.00 0.00 ? 24 VAL A CB   9  
ATOM 8669  C CG1  . VAL A 1 24 ? -38.077 -7.508  -16.352 1.00 0.00 ? 24 VAL A CG1  9  
ATOM 8670  C CG2  . VAL A 1 24 ? -40.003 -5.919  -16.392 1.00 0.00 ? 24 VAL A CG2  9  
ATOM 8671  H H    . VAL A 1 24 ? -38.588 -6.437  -18.731 1.00 0.00 ? 24 VAL A H    9  
ATOM 8672  H HA   . VAL A 1 24 ? -39.589 -8.878  -18.066 1.00 0.00 ? 24 VAL A HA   9  
ATOM 8673  H HB   . VAL A 1 24 ? -40.098 -7.985  -15.822 1.00 0.00 ? 24 VAL A HB   9  
ATOM 8674  H HG11 . VAL A 1 24 ? -37.724 -6.691  -15.739 1.00 0.00 ? 24 VAL A HG11 9  
ATOM 8675  H HG12 . VAL A 1 24 ? -37.578 -7.482  -17.309 1.00 0.00 ? 24 VAL A HG12 9  
ATOM 8676  H HG13 . VAL A 1 24 ? -37.859 -8.445  -15.861 1.00 0.00 ? 24 VAL A HG13 9  
ATOM 8677  H HG21 . VAL A 1 24 ? -39.309 -5.422  -15.734 1.00 0.00 ? 24 VAL A HG21 9  
ATOM 8678  H HG22 . VAL A 1 24 ? -40.996 -5.873  -15.971 1.00 0.00 ? 24 VAL A HG22 9  
ATOM 8679  H HG23 . VAL A 1 24 ? -39.998 -5.434  -17.354 1.00 0.00 ? 24 VAL A HG23 9  
ATOM 8680  N N    . ARG A 1 25 ? -42.063 -6.882  -18.707 1.00 0.00 ? 25 ARG A N    9  
ATOM 8681  C CA   . ARG A 1 25 ? -43.514 -6.879  -18.886 1.00 0.00 ? 25 ARG A CA   9  
ATOM 8682  C C    . ARG A 1 25 ? -43.916 -7.880  -19.974 1.00 0.00 ? 25 ARG A C    9  
ATOM 8683  O O    . ARG A 1 25 ? -44.749 -8.757  -19.753 1.00 0.00 ? 25 ARG A O    9  
ATOM 8684  C CB   . ARG A 1 25 ? -43.990 -5.476  -19.280 1.00 0.00 ? 25 ARG A CB   9  
ATOM 8685  C CG   . ARG A 1 25 ? -45.521 -5.393  -19.197 1.00 0.00 ? 25 ARG A CG   9  
ATOM 8686  C CD   . ARG A 1 25 ? -45.948 -5.029  -17.771 1.00 0.00 ? 25 ARG A CD   9  
ATOM 8687  N NE   . ARG A 1 25 ? -45.489 -3.685  -17.443 1.00 0.00 ? 25 ARG A NE   9  
ATOM 8688  C CZ   . ARG A 1 25 ? -45.535 -3.229  -16.196 1.00 0.00 ? 25 ARG A CZ   9  
ATOM 8689  N NH1  . ARG A 1 25 ? -45.990 -3.990  -15.238 1.00 0.00 ? 25 ARG A NH1  9  
ATOM 8690  N NH2  . ARG A 1 25 ? -45.121 -2.020  -15.929 1.00 0.00 ? 25 ARG A NH2  9  
ATOM 8691  H H    . ARG A 1 25 ? -41.508 -6.157  -19.065 1.00 0.00 ? 25 ARG A H    9  
ATOM 8692  H HA   . ARG A 1 25 ? -43.979 -7.167  -17.958 1.00 0.00 ? 25 ARG A HA   9  
ATOM 8693  H HB2  . ARG A 1 25 ? -43.556 -4.751  -18.609 1.00 0.00 ? 25 ARG A HB2  9  
ATOM 8694  H HB3  . ARG A 1 25 ? -43.677 -5.264  -20.291 1.00 0.00 ? 25 ARG A HB3  9  
ATOM 8695  H HG2  . ARG A 1 25 ? -45.875 -4.636  -19.882 1.00 0.00 ? 25 ARG A HG2  9  
ATOM 8696  H HG3  . ARG A 1 25 ? -45.950 -6.346  -19.464 1.00 0.00 ? 25 ARG A HG3  9  
ATOM 8697  H HD2  . ARG A 1 25 ? -47.023 -5.062  -17.703 1.00 0.00 ? 25 ARG A HD2  9  
ATOM 8698  H HD3  . ARG A 1 25 ? -45.526 -5.734  -17.072 1.00 0.00 ? 25 ARG A HD3  9  
ATOM 8699  H HE   . ARG A 1 25 ? -45.143 -3.108  -18.154 1.00 0.00 ? 25 ARG A HE   9  
ATOM 8700  H HH11 . ARG A 1 25 ? -46.306 -4.916  -15.444 1.00 0.00 ? 25 ARG A HH11 9  
ATOM 8701  H HH12 . ARG A 1 25 ? -46.024 -3.646  -14.301 1.00 0.00 ? 25 ARG A HH12 9  
ATOM 8702  H HH21 . ARG A 1 25 ? -44.771 -1.439  -16.662 1.00 0.00 ? 25 ARG A HH21 9  
ATOM 8703  H HH22 . ARG A 1 25 ? -45.154 -1.677  -14.990 1.00 0.00 ? 25 ARG A HH22 9  
ATOM 8704  N N    . ASN A 1 26 ? -43.319 -7.718  -21.151 1.00 0.00 ? 26 ASN A N    9  
ATOM 8705  C CA   . ASN A 1 26 ? -43.616 -8.586  -22.294 1.00 0.00 ? 26 ASN A CA   9  
ATOM 8706  C C    . ASN A 1 26 ? -42.669 -9.784  -22.363 1.00 0.00 ? 26 ASN A C    9  
ATOM 8707  O O    . ASN A 1 26 ? -42.787 -10.625 -23.257 1.00 0.00 ? 26 ASN A O    9  
ATOM 8708  C CB   . ASN A 1 26 ? -43.512 -7.783  -23.592 1.00 0.00 ? 26 ASN A CB   9  
ATOM 8709  C CG   . ASN A 1 26 ? -44.661 -6.785  -23.681 1.00 0.00 ? 26 ASN A CG   9  
ATOM 8710  O OD1  . ASN A 1 26 ? -45.681 -6.950  -23.012 1.00 0.00 ? 26 ASN A OD1  9  
ATOM 8711  N ND2  . ASN A 1 26 ? -44.557 -5.753  -24.473 1.00 0.00 ? 26 ASN A ND2  9  
ATOM 8712  H H    . ASN A 1 26 ? -42.694 -6.972  -21.256 1.00 0.00 ? 26 ASN A H    9  
ATOM 8713  H HA   . ASN A 1 26 ? -44.628 -8.951  -22.198 1.00 0.00 ? 26 ASN A HA   9  
ATOM 8714  H HB2  . ASN A 1 26 ? -42.571 -7.251  -23.608 1.00 0.00 ? 26 ASN A HB2  9  
ATOM 8715  H HB3  . ASN A 1 26 ? -43.558 -8.457  -24.434 1.00 0.00 ? 26 ASN A HB3  9  
ATOM 8716  H HD21 . ASN A 1 26 ? -43.745 -5.624  -25.005 1.00 0.00 ? 26 ASN A HD21 9  
ATOM 8717  H HD22 . ASN A 1 26 ? -45.292 -5.108  -24.535 1.00 0.00 ? 26 ASN A HD22 9  
ATOM 8718  N N    . GLY A 1 27 ? -41.719 -9.847  -21.441 1.00 0.00 ? 27 GLY A N    9  
ATOM 8719  C CA   . GLY A 1 27 ? -40.746 -10.934 -21.435 1.00 0.00 ? 27 GLY A CA   9  
ATOM 8720  C C    . GLY A 1 27 ? -41.397 -12.302 -21.252 1.00 0.00 ? 27 GLY A C    9  
ATOM 8721  O O    . GLY A 1 27 ? -41.015 -13.268 -21.913 1.00 0.00 ? 27 GLY A O    9  
ATOM 8722  H H    . GLY A 1 27 ? -41.663 -9.151  -20.753 1.00 0.00 ? 27 GLY A H    9  
ATOM 8723  H HA2  . GLY A 1 27 ? -40.208 -10.925 -22.372 1.00 0.00 ? 27 GLY A HA2  9  
ATOM 8724  H HA3  . GLY A 1 27 ? -40.046 -10.771 -20.628 1.00 0.00 ? 27 GLY A HA3  9  
ATOM 8725  N N    . GLY A 1 28 ? -42.362 -12.394 -20.342 1.00 0.00 ? 28 GLY A N    9  
ATOM 8726  C CA   . GLY A 1 28 ? -43.022 -13.671 -20.083 1.00 0.00 ? 28 GLY A CA   9  
ATOM 8727  C C    . GLY A 1 28 ? -43.728 -14.208 -21.324 1.00 0.00 ? 28 GLY A C    9  
ATOM 8728  O O    . GLY A 1 28 ? -43.635 -15.397 -21.634 1.00 0.00 ? 28 GLY A O    9  
ATOM 8729  H H    . GLY A 1 28 ? -42.620 -11.606 -19.823 1.00 0.00 ? 28 GLY A H    9  
ATOM 8730  H HA2  . GLY A 1 28 ? -42.283 -14.390 -19.759 1.00 0.00 ? 28 GLY A HA2  9  
ATOM 8731  H HA3  . GLY A 1 28 ? -43.751 -13.535 -19.297 1.00 0.00 ? 28 GLY A HA3  9  
ATOM 8732  N N    . LEU A 1 29 ? -44.453 -13.339 -22.018 1.00 0.00 ? 29 LEU A N    9  
ATOM 8733  C CA   . LEU A 1 29 ? -45.186 -13.772 -23.203 1.00 0.00 ? 29 LEU A CA   9  
ATOM 8734  C C    . LEU A 1 29 ? -44.233 -14.336 -24.252 1.00 0.00 ? 29 LEU A C    9  
ATOM 8735  O O    . LEU A 1 29 ? -44.478 -15.407 -24.808 1.00 0.00 ? 29 LEU A O    9  
ATOM 8736  C CB   . LEU A 1 29 ? -45.962 -12.594 -23.795 1.00 0.00 ? 29 LEU A CB   9  
ATOM 8737  C CG   . LEU A 1 29 ? -47.241 -12.369 -22.989 1.00 0.00 ? 29 LEU A CG   9  
ATOM 8738  C CD1  . LEU A 1 29 ? -46.881 -12.045 -21.538 1.00 0.00 ? 29 LEU A CD1  9  
ATOM 8739  C CD2  . LEU A 1 29 ? -48.023 -11.199 -23.592 1.00 0.00 ? 29 LEU A CD2  9  
ATOM 8740  H H    . LEU A 1 29 ? -44.515 -12.415 -21.699 1.00 0.00 ? 29 LEU A H    9  
ATOM 8741  H HA   . LEU A 1 29 ? -45.887 -14.541 -22.918 1.00 0.00 ? 29 LEU A HA   9  
ATOM 8742  H HB2  . LEU A 1 29 ? -45.348 -11.704 -23.758 1.00 0.00 ? 29 LEU A HB2  9  
ATOM 8743  H HB3  . LEU A 1 29 ? -46.217 -12.812 -24.821 1.00 0.00 ? 29 LEU A HB3  9  
ATOM 8744  H HG   . LEU A 1 29 ? -47.848 -13.263 -23.018 1.00 0.00 ? 29 LEU A HG   9  
ATOM 8745  H HD11 . LEU A 1 29 ? -46.659 -12.961 -21.009 1.00 0.00 ? 29 LEU A HD11 9  
ATOM 8746  H HD12 . LEU A 1 29 ? -47.713 -11.547 -21.063 1.00 0.00 ? 29 LEU A HD12 9  
ATOM 8747  H HD13 . LEU A 1 29 ? -46.015 -11.399 -21.518 1.00 0.00 ? 29 LEU A HD13 9  
ATOM 8748  H HD21 . LEU A 1 29 ? -48.984 -11.550 -23.940 1.00 0.00 ? 29 LEU A HD21 9  
ATOM 8749  H HD22 . LEU A 1 29 ? -47.469 -10.785 -24.421 1.00 0.00 ? 29 LEU A HD22 9  
ATOM 8750  H HD23 . LEU A 1 29 ? -48.169 -10.438 -22.840 1.00 0.00 ? 29 LEU A HD23 9  
ATOM 8751  N N    . ILE A 1 30 ? -43.156 -13.612 -24.528 1.00 0.00 ? 30 ILE A N    9  
ATOM 8752  C CA   . ILE A 1 30 ? -42.187 -14.056 -25.526 1.00 0.00 ? 30 ILE A CA   9  
ATOM 8753  C C    . ILE A 1 30 ? -41.535 -15.377 -25.128 1.00 0.00 ? 30 ILE A C    9  
ATOM 8754  O O    . ILE A 1 30 ? -41.392 -16.283 -25.953 1.00 0.00 ? 30 ILE A O    9  
ATOM 8755  C CB   . ILE A 1 30 ? -41.106 -12.990 -25.706 1.00 0.00 ? 30 ILE A CB   9  
ATOM 8756  C CG1  . ILE A 1 30 ? -41.714 -11.754 -26.373 1.00 0.00 ? 30 ILE A CG1  9  
ATOM 8757  C CG2  . ILE A 1 30 ? -39.985 -13.545 -26.588 1.00 0.00 ? 30 ILE A CG2  9  
ATOM 8758  C CD1  . ILE A 1 30 ? -40.724 -10.590 -26.295 1.00 0.00 ? 30 ILE A CD1  9  
ATOM 8759  H H    . ILE A 1 30 ? -43.020 -12.746 -24.085 1.00 0.00 ? 30 ILE A H    9  
ATOM 8760  H HA   . ILE A 1 30 ? -42.696 -14.190 -26.468 1.00 0.00 ? 30 ILE A HA   9  
ATOM 8761  H HB   . ILE A 1 30 ? -40.703 -12.719 -24.740 1.00 0.00 ? 30 ILE A HB   9  
ATOM 8762  H HG12 . ILE A 1 30 ? -41.930 -11.973 -27.408 1.00 0.00 ? 30 ILE A HG12 9  
ATOM 8763  H HG13 . ILE A 1 30 ? -42.627 -11.481 -25.865 1.00 0.00 ? 30 ILE A HG13 9  
ATOM 8764  H HG21 . ILE A 1 30 ? -39.581 -12.754 -27.200 1.00 0.00 ? 30 ILE A HG21 9  
ATOM 8765  H HG22 . ILE A 1 30 ? -40.381 -14.325 -27.222 1.00 0.00 ? 30 ILE A HG22 9  
ATOM 8766  H HG23 . ILE A 1 30 ? -39.204 -13.952 -25.963 1.00 0.00 ? 30 ILE A HG23 9  
ATOM 8767  H HD11 . ILE A 1 30 ? -41.180 -9.700  -26.705 1.00 0.00 ? 30 ILE A HD11 9  
ATOM 8768  H HD12 . ILE A 1 30 ? -39.837 -10.833 -26.861 1.00 0.00 ? 30 ILE A HD12 9  
ATOM 8769  H HD13 . ILE A 1 30 ? -40.456 -10.413 -25.263 1.00 0.00 ? 30 ILE A HD13 9  
ATOM 8770  N N    . PHE A 1 31 ? -41.138 -15.490 -23.864 1.00 0.00 ? 31 PHE A N    9  
ATOM 8771  C CA   . PHE A 1 31 ? -40.498 -16.705 -23.375 1.00 0.00 ? 31 PHE A CA   9  
ATOM 8772  C C    . PHE A 1 31 ? -41.421 -17.913 -23.500 1.00 0.00 ? 31 PHE A C    9  
ATOM 8773  O O    . PHE A 1 31 ? -41.000 -18.981 -23.947 1.00 0.00 ? 31 PHE A O    9  
ATOM 8774  C CB   . PHE A 1 31 ? -40.087 -16.529 -21.912 1.00 0.00 ? 31 PHE A CB   9  
ATOM 8775  C CG   . PHE A 1 31 ? -39.461 -17.809 -21.408 1.00 0.00 ? 31 PHE A CG   9  
ATOM 8776  C CD1  . PHE A 1 31 ? -38.138 -18.121 -21.743 1.00 0.00 ? 31 PHE A CD1  9  
ATOM 8777  C CD2  . PHE A 1 31 ? -40.204 -18.682 -20.605 1.00 0.00 ? 31 PHE A CD2  9  
ATOM 8778  C CE1  . PHE A 1 31 ? -37.558 -19.305 -21.277 1.00 0.00 ? 31 PHE A CE1  9  
ATOM 8779  C CE2  . PHE A 1 31 ? -39.623 -19.868 -20.137 1.00 0.00 ? 31 PHE A CE2  9  
ATOM 8780  C CZ   . PHE A 1 31 ? -38.300 -20.180 -20.474 1.00 0.00 ? 31 PHE A CZ   9  
ATOM 8781  H H    . PHE A 1 31 ? -41.280 -14.751 -23.234 1.00 0.00 ? 31 PHE A H    9  
ATOM 8782  H HA   . PHE A 1 31 ? -39.609 -16.886 -23.961 1.00 0.00 ? 31 PHE A HA   9  
ATOM 8783  H HB2  . PHE A 1 31 ? -39.371 -15.723 -21.833 1.00 0.00 ? 31 PHE A HB2  9  
ATOM 8784  H HB3  . PHE A 1 31 ? -40.958 -16.296 -21.318 1.00 0.00 ? 31 PHE A HB3  9  
ATOM 8785  H HD1  . PHE A 1 31 ? -37.566 -17.446 -22.364 1.00 0.00 ? 31 PHE A HD1  9  
ATOM 8786  H HD2  . PHE A 1 31 ? -41.224 -18.443 -20.345 1.00 0.00 ? 31 PHE A HD2  9  
ATOM 8787  H HE1  . PHE A 1 31 ? -36.537 -19.546 -21.537 1.00 0.00 ? 31 PHE A HE1  9  
ATOM 8788  H HE2  . PHE A 1 31 ? -40.195 -20.542 -19.518 1.00 0.00 ? 31 PHE A HE2  9  
ATOM 8789  H HZ   . PHE A 1 31 ? -37.852 -21.093 -20.114 1.00 0.00 ? 31 PHE A HZ   9  
ATOM 8790  N N    . ALA A 1 32 ? -42.668 -17.752 -23.071 1.00 0.00 ? 32 ALA A N    9  
ATOM 8791  C CA   . ALA A 1 32 ? -43.623 -18.856 -23.105 1.00 0.00 ? 32 ALA A CA   9  
ATOM 8792  C C    . ALA A 1 32 ? -43.822 -19.381 -24.523 1.00 0.00 ? 32 ALA A C    9  
ATOM 8793  O O    . ALA A 1 32 ? -43.877 -20.593 -24.730 1.00 0.00 ? 32 ALA A O    9  
ATOM 8794  C CB   . ALA A 1 32 ? -44.967 -18.394 -22.541 1.00 0.00 ? 32 ALA A CB   9  
ATOM 8795  H H    . ALA A 1 32 ? -42.942 -16.891 -22.692 1.00 0.00 ? 32 ALA A H    9  
ATOM 8796  H HA   . ALA A 1 32 ? -43.248 -19.657 -22.487 1.00 0.00 ? 32 ALA A HA   9  
ATOM 8797  H HB1  . ALA A 1 32 ? -45.482 -17.798 -23.281 1.00 0.00 ? 32 ALA A HB1  9  
ATOM 8798  H HB2  . ALA A 1 32 ? -44.802 -17.805 -21.653 1.00 0.00 ? 32 ALA A HB2  9  
ATOM 8799  H HB3  . ALA A 1 32 ? -45.569 -19.256 -22.295 1.00 0.00 ? 32 ALA A HB3  9  
ATOM 8800  N N    . GLY A 1 33 ? -43.933 -18.486 -25.501 1.00 0.00 ? 33 GLY A N    9  
ATOM 8801  C CA   . GLY A 1 33 ? -44.125 -18.918 -26.880 1.00 0.00 ? 33 GLY A CA   9  
ATOM 8802  C C    . GLY A 1 33 ? -42.950 -19.767 -27.350 1.00 0.00 ? 33 GLY A C    9  
ATOM 8803  O O    . GLY A 1 33 ? -43.134 -20.784 -28.018 1.00 0.00 ? 33 GLY A O    9  
ATOM 8804  H H    . GLY A 1 33 ? -43.894 -17.526 -25.308 1.00 0.00 ? 33 GLY A H    9  
ATOM 8805  H HA2  . GLY A 1 33 ? -45.034 -19.500 -26.945 1.00 0.00 ? 33 GLY A HA2  9  
ATOM 8806  H HA3  . GLY A 1 33 ? -44.212 -18.051 -27.516 1.00 0.00 ? 33 GLY A HA3  9  
ATOM 8807  N N    . LEU A 1 34 ? -41.745 -19.355 -26.974 1.00 0.00 ? 34 LEU A N    9  
ATOM 8808  C CA   . LEU A 1 34 ? -40.546 -20.100 -27.338 1.00 0.00 ? 34 LEU A CA   9  
ATOM 8809  C C    . LEU A 1 34 ? -40.540 -21.449 -26.621 1.00 0.00 ? 34 LEU A C    9  
ATOM 8810  O O    . LEU A 1 34 ? -40.187 -22.480 -27.195 1.00 0.00 ? 34 LEU A O    9  
ATOM 8811  C CB   . LEU A 1 34 ? -39.299 -19.291 -26.952 1.00 0.00 ? 34 LEU A CB   9  
ATOM 8812  C CG   . LEU A 1 34 ? -38.024 -20.054 -27.332 1.00 0.00 ? 34 LEU A CG   9  
ATOM 8813  C CD1  . LEU A 1 34 ? -37.992 -20.295 -28.843 1.00 0.00 ? 34 LEU A CD1  9  
ATOM 8814  C CD2  . LEU A 1 34 ? -36.805 -19.224 -26.928 1.00 0.00 ? 34 LEU A CD2  9  
ATOM 8815  H H    . LEU A 1 34 ? -41.663 -18.552 -26.413 1.00 0.00 ? 34 LEU A H    9  
ATOM 8816  H HA   . LEU A 1 34 ? -40.546 -20.267 -28.404 1.00 0.00 ? 34 LEU A HA   9  
ATOM 8817  H HB2  . LEU A 1 34 ? -39.315 -18.343 -27.470 1.00 0.00 ? 34 LEU A HB2  9  
ATOM 8818  H HB3  . LEU A 1 34 ? -39.304 -19.115 -25.886 1.00 0.00 ? 34 LEU A HB3  9  
ATOM 8819  H HG   . LEU A 1 34 ? -38.001 -21.003 -26.816 1.00 0.00 ? 34 LEU A HG   9  
ATOM 8820  H HD11 . LEU A 1 34 ? -36.966 -20.360 -29.174 1.00 0.00 ? 34 LEU A HD11 9  
ATOM 8821  H HD12 . LEU A 1 34 ? -38.483 -19.475 -29.349 1.00 0.00 ? 34 LEU A HD12 9  
ATOM 8822  H HD13 . LEU A 1 34 ? -38.503 -21.217 -29.071 1.00 0.00 ? 34 LEU A HD13 9  
ATOM 8823  H HD21 . LEU A 1 34 ? -36.849 -19.010 -25.869 1.00 0.00 ? 34 LEU A HD21 9  
ATOM 8824  H HD22 . LEU A 1 34 ? -36.800 -18.297 -27.482 1.00 0.00 ? 34 LEU A HD22 9  
ATOM 8825  H HD23 . LEU A 1 34 ? -35.904 -19.779 -27.145 1.00 0.00 ? 34 LEU A HD23 9  
ATOM 8826  N N    . ALA A 1 35 ? -40.937 -21.413 -25.353 1.00 0.00 ? 35 ALA A N    9  
ATOM 8827  C CA   . ALA A 1 35 ? -40.978 -22.625 -24.544 1.00 0.00 ? 35 ALA A CA   9  
ATOM 8828  C C    . ALA A 1 35 ? -41.937 -23.640 -25.162 1.00 0.00 ? 35 ALA A C    9  
ATOM 8829  O O    . ALA A 1 35 ? -41.614 -24.815 -25.275 1.00 0.00 ? 35 ALA A O    9  
ATOM 8830  C CB   . ALA A 1 35 ? -41.431 -22.291 -23.121 1.00 0.00 ? 35 ALA A CB   9  
ATOM 8831  H H    . ALA A 1 35 ? -41.201 -20.542 -24.987 1.00 0.00 ? 35 ALA A H    9  
ATOM 8832  H HA   . ALA A 1 35 ? -39.988 -23.057 -24.505 1.00 0.00 ? 35 ALA A HA   9  
ATOM 8833  H HB1  . ALA A 1 35 ? -40.721 -22.695 -22.413 1.00 0.00 ? 35 ALA A HB1  9  
ATOM 8834  H HB2  . ALA A 1 35 ? -42.404 -22.725 -22.942 1.00 0.00 ? 35 ALA A HB2  9  
ATOM 8835  H HB3  . ALA A 1 35 ? -41.488 -21.219 -23.004 1.00 0.00 ? 35 ALA A HB3  9  
ATOM 8836  N N    . PHE A 1 36 ? -43.130 -23.172 -25.516 1.00 0.00 ? 36 PHE A N    9  
ATOM 8837  C CA   . PHE A 1 36 ? -44.167 -24.039 -26.087 1.00 0.00 ? 36 PHE A CA   9  
ATOM 8838  C C    . PHE A 1 36 ? -43.714 -24.720 -27.384 1.00 0.00 ? 36 PHE A C    9  
ATOM 8839  O O    . PHE A 1 36 ? -43.911 -25.927 -27.565 1.00 0.00 ? 36 PHE A O    9  
ATOM 8840  C CB   . PHE A 1 36 ? -45.427 -23.215 -26.360 1.00 0.00 ? 36 PHE A CB   9  
ATOM 8841  C CG   . PHE A 1 36 ? -46.481 -24.097 -26.984 1.00 0.00 ? 36 PHE A CG   9  
ATOM 8842  C CD1  . PHE A 1 36 ? -47.234 -24.961 -26.180 1.00 0.00 ? 36 PHE A CD1  9  
ATOM 8843  C CD2  . PHE A 1 36 ? -46.706 -24.051 -28.365 1.00 0.00 ? 36 PHE A CD2  9  
ATOM 8844  C CE1  . PHE A 1 36 ? -48.213 -25.779 -26.757 1.00 0.00 ? 36 PHE A CE1  9  
ATOM 8845  C CE2  . PHE A 1 36 ? -47.684 -24.870 -28.943 1.00 0.00 ? 36 PHE A CE2  9  
ATOM 8846  C CZ   . PHE A 1 36 ? -48.437 -25.734 -28.138 1.00 0.00 ? 36 PHE A CZ   9  
ATOM 8847  H H    . PHE A 1 36 ? -43.337 -22.235 -25.319 1.00 0.00 ? 36 PHE A H    9  
ATOM 8848  H HA   . PHE A 1 36 ? -44.412 -24.803 -25.364 1.00 0.00 ? 36 PHE A HA   9  
ATOM 8849  H HB2  . PHE A 1 36 ? -45.800 -22.808 -25.432 1.00 0.00 ? 36 PHE A HB2  9  
ATOM 8850  H HB3  . PHE A 1 36 ? -45.189 -22.408 -27.036 1.00 0.00 ? 36 PHE A HB3  9  
ATOM 8851  H HD1  . PHE A 1 36 ? -47.060 -24.996 -25.114 1.00 0.00 ? 36 PHE A HD1  9  
ATOM 8852  H HD2  . PHE A 1 36 ? -46.124 -23.385 -28.984 1.00 0.00 ? 36 PHE A HD2  9  
ATOM 8853  H HE1  . PHE A 1 36 ? -48.794 -26.445 -26.136 1.00 0.00 ? 36 PHE A HE1  9  
ATOM 8854  H HE2  . PHE A 1 36 ? -47.857 -24.837 -30.007 1.00 0.00 ? 36 PHE A HE2  9  
ATOM 8855  H HZ   . PHE A 1 36 ? -49.193 -26.366 -28.583 1.00 0.00 ? 36 PHE A HZ   9  
ATOM 8856  N N    . ILE A 1 37 ? -43.133 -23.948 -28.298 1.00 0.00 ? 37 ILE A N    9  
ATOM 8857  C CA   . ILE A 1 37 ? -42.697 -24.503 -29.579 1.00 0.00 ? 37 ILE A CA   9  
ATOM 8858  C C    . ILE A 1 37 ? -41.702 -25.636 -29.360 1.00 0.00 ? 37 ILE A C    9  
ATOM 8859  O O    . ILE A 1 37 ? -41.775 -26.674 -30.019 1.00 0.00 ? 37 ILE A O    9  
ATOM 8860  C CB   . ILE A 1 37 ? -42.043 -23.402 -30.425 1.00 0.00 ? 37 ILE A CB   9  
ATOM 8861  C CG1  . ILE A 1 37 ? -43.102 -22.396 -30.901 1.00 0.00 ? 37 ILE A CG1  9  
ATOM 8862  C CG2  . ILE A 1 37 ? -41.354 -24.031 -31.637 1.00 0.00 ? 37 ILE A CG2  9  
ATOM 8863  C CD1  . ILE A 1 37 ? -43.808 -22.907 -32.168 1.00 0.00 ? 37 ILE A CD1  9  
ATOM 8864  H H    . ILE A 1 37 ? -43.019 -22.992 -28.122 1.00 0.00 ? 37 ILE A H    9  
ATOM 8865  H HA   . ILE A 1 37 ? -43.555 -24.890 -30.099 1.00 0.00 ? 37 ILE A HA   9  
ATOM 8866  H HB   . ILE A 1 37 ? -41.304 -22.887 -29.825 1.00 0.00 ? 37 ILE A HB   9  
ATOM 8867  H HG12 . ILE A 1 37 ? -43.835 -22.255 -30.121 1.00 0.00 ? 37 ILE A HG12 9  
ATOM 8868  H HG13 . ILE A 1 37 ? -42.625 -21.453 -31.117 1.00 0.00 ? 37 ILE A HG13 9  
ATOM 8869  H HG21 . ILE A 1 37 ? -41.180 -23.272 -32.386 1.00 0.00 ? 37 ILE A HG21 9  
ATOM 8870  H HG22 . ILE A 1 37 ? -41.985 -24.804 -32.049 1.00 0.00 ? 37 ILE A HG22 9  
ATOM 8871  H HG23 . ILE A 1 37 ? -40.411 -24.460 -31.333 1.00 0.00 ? 37 ILE A HG23 9  
ATOM 8872  H HD11 . ILE A 1 37 ? -44.791 -22.465 -32.233 1.00 0.00 ? 37 ILE A HD11 9  
ATOM 8873  H HD12 . ILE A 1 37 ? -43.899 -23.979 -32.138 1.00 0.00 ? 37 ILE A HD12 9  
ATOM 8874  H HD13 . ILE A 1 37 ? -43.233 -22.621 -33.037 1.00 0.00 ? 37 ILE A HD13 9  
ATOM 8875  N N    . VAL A 1 38 ? -40.769 -25.428 -28.445 1.00 0.00 ? 38 VAL A N    9  
ATOM 8876  C CA   . VAL A 1 38 ? -39.755 -26.438 -28.161 1.00 0.00 ? 38 VAL A CA   9  
ATOM 8877  C C    . VAL A 1 38 ? -40.411 -27.754 -27.739 1.00 0.00 ? 38 VAL A C    9  
ATOM 8878  O O    . VAL A 1 38 ? -39.957 -28.830 -28.126 1.00 0.00 ? 38 VAL A O    9  
ATOM 8879  C CB   . VAL A 1 38 ? -38.830 -25.948 -27.048 1.00 0.00 ? 38 VAL A CB   9  
ATOM 8880  C CG1  . VAL A 1 38 ? -37.918 -27.094 -26.599 1.00 0.00 ? 38 VAL A CG1  9  
ATOM 8881  C CG2  . VAL A 1 38 ? -37.975 -24.792 -27.570 1.00 0.00 ? 38 VAL A CG2  9  
ATOM 8882  H H    . VAL A 1 38 ? -40.750 -24.568 -27.973 1.00 0.00 ? 38 VAL A H    9  
ATOM 8883  H HA   . VAL A 1 38 ? -39.170 -26.608 -29.052 1.00 0.00 ? 38 VAL A HA   9  
ATOM 8884  H HB   . VAL A 1 38 ? -39.421 -25.611 -26.209 1.00 0.00 ? 38 VAL A HB   9  
ATOM 8885  H HG11 . VAL A 1 38 ? -37.566 -27.635 -27.466 1.00 0.00 ? 38 VAL A HG11 9  
ATOM 8886  H HG12 . VAL A 1 38 ? -38.472 -27.763 -25.959 1.00 0.00 ? 38 VAL A HG12 9  
ATOM 8887  H HG13 . VAL A 1 38 ? -37.075 -26.692 -26.058 1.00 0.00 ? 38 VAL A HG13 9  
ATOM 8888  H HG21 . VAL A 1 38 ? -38.573 -24.162 -28.211 1.00 0.00 ? 38 VAL A HG21 9  
ATOM 8889  H HG22 . VAL A 1 38 ? -37.139 -25.184 -28.131 1.00 0.00 ? 38 VAL A HG22 9  
ATOM 8890  H HG23 . VAL A 1 38 ? -37.608 -24.211 -26.736 1.00 0.00 ? 38 VAL A HG23 9  
ATOM 8891  N N    . GLY A 1 39 ? -41.472 -27.659 -26.945 1.00 0.00 ? 39 GLY A N    9  
ATOM 8892  C CA   . GLY A 1 39 ? -42.188 -28.836 -26.465 1.00 0.00 ? 39 GLY A CA   9  
ATOM 8893  C C    . GLY A 1 39 ? -42.769 -29.649 -27.619 1.00 0.00 ? 39 GLY A C    9  
ATOM 8894  O O    . GLY A 1 39 ? -42.783 -30.879 -27.576 1.00 0.00 ? 39 GLY A O    9  
ATOM 8895  H H    . GLY A 1 39 ? -41.781 -26.780 -26.669 1.00 0.00 ? 39 GLY A H    9  
ATOM 8896  H HA2  . GLY A 1 39 ? -41.508 -29.459 -25.903 1.00 0.00 ? 39 GLY A HA2  9  
ATOM 8897  H HA3  . GLY A 1 39 ? -42.993 -28.522 -25.819 1.00 0.00 ? 39 GLY A HA3  9  
ATOM 8898  N N    . LEU A 1 40 ? -43.249 -28.963 -28.648 1.00 0.00 ? 40 LEU A N    9  
ATOM 8899  C CA   . LEU A 1 40 ? -43.829 -29.659 -29.797 1.00 0.00 ? 40 LEU A CA   9  
ATOM 8900  C C    . LEU A 1 40 ? -42.787 -30.603 -30.399 1.00 0.00 ? 40 LEU A C    9  
ATOM 8901  O O    . LEU A 1 40 ? -43.079 -31.758 -30.714 1.00 0.00 ? 40 LEU A O    9  
ATOM 8902  C CB   . LEU A 1 40 ? -44.286 -28.637 -30.847 1.00 0.00 ? 40 LEU A CB   9  
ATOM 8903  C CG   . LEU A 1 40 ? -44.882 -29.352 -32.068 1.00 0.00 ? 40 LEU A CG   9  
ATOM 8904  C CD1  . LEU A 1 40 ? -46.095 -30.181 -31.641 1.00 0.00 ? 40 LEU A CD1  9  
ATOM 8905  C CD2  . LEU A 1 40 ? -45.322 -28.307 -33.097 1.00 0.00 ? 40 LEU A CD2  9  
ATOM 8906  H H    . LEU A 1 40 ? -43.207 -27.979 -28.629 1.00 0.00 ? 40 LEU A H    9  
ATOM 8907  H HA   . LEU A 1 40 ? -44.679 -30.236 -29.466 1.00 0.00 ? 40 LEU A HA   9  
ATOM 8908  H HB2  . LEU A 1 40 ? -45.033 -27.989 -30.411 1.00 0.00 ? 40 LEU A HB2  9  
ATOM 8909  H HB3  . LEU A 1 40 ? -43.439 -28.045 -31.161 1.00 0.00 ? 40 LEU A HB3  9  
ATOM 8910  H HG   . LEU A 1 40 ? -44.140 -30.000 -32.509 1.00 0.00 ? 40 LEU A HG   9  
ATOM 8911  H HD11 . LEU A 1 40 ? -46.779 -30.274 -32.473 1.00 0.00 ? 40 LEU A HD11 9  
ATOM 8912  H HD12 . LEU A 1 40 ? -46.596 -29.692 -30.819 1.00 0.00 ? 40 LEU A HD12 9  
ATOM 8913  H HD13 . LEU A 1 40 ? -45.769 -31.162 -31.331 1.00 0.00 ? 40 LEU A HD13 9  
ATOM 8914  H HD21 . LEU A 1 40 ? -44.596 -27.509 -33.133 1.00 0.00 ? 40 LEU A HD21 9  
ATOM 8915  H HD22 . LEU A 1 40 ? -46.285 -27.904 -32.813 1.00 0.00 ? 40 LEU A HD22 9  
ATOM 8916  H HD23 . LEU A 1 40 ? -45.397 -28.769 -34.069 1.00 0.00 ? 40 LEU A HD23 9  
ATOM 8917  N N    . LEU A 1 41 ? -41.577 -30.087 -30.577 1.00 0.00 ? 41 LEU A N    9  
ATOM 8918  C CA   . LEU A 1 41 ? -40.489 -30.860 -31.167 1.00 0.00 ? 41 LEU A CA   9  
ATOM 8919  C C    . LEU A 1 41 ? -40.203 -32.127 -30.361 1.00 0.00 ? 41 LEU A C    9  
ATOM 8920  O O    . LEU A 1 41 ? -39.821 -33.146 -30.927 1.00 0.00 ? 41 LEU A O    9  
ATOM 8921  C CB   . LEU A 1 41 ? -39.220 -30.003 -31.227 1.00 0.00 ? 41 LEU A CB   9  
ATOM 8922  C CG   . LEU A 1 41 ? -39.400 -28.873 -32.248 1.00 0.00 ? 41 LEU A CG   9  
ATOM 8923  C CD1  . LEU A 1 41 ? -38.212 -27.914 -32.159 1.00 0.00 ? 41 LEU A CD1  9  
ATOM 8924  C CD2  . LEU A 1 41 ? -39.483 -29.447 -33.671 1.00 0.00 ? 41 LEU A CD2  9  
ATOM 8925  H H    . LEU A 1 41 ? -41.432 -29.151 -30.355 1.00 0.00 ? 41 LEU A H    9  
ATOM 8926  H HA   . LEU A 1 41 ? -40.764 -31.142 -32.170 1.00 0.00 ? 41 LEU A HA   9  
ATOM 8927  H HB2  . LEU A 1 41 ? -39.034 -29.576 -30.250 1.00 0.00 ? 41 LEU A HB2  9  
ATOM 8928  H HB3  . LEU A 1 41 ? -38.380 -30.618 -31.510 1.00 0.00 ? 41 LEU A HB3  9  
ATOM 8929  H HG   . LEU A 1 41 ? -40.310 -28.334 -32.025 1.00 0.00 ? 41 LEU A HG   9  
ATOM 8930  H HD11 . LEU A 1 41 ? -38.254 -27.212 -32.978 1.00 0.00 ? 41 LEU A HD11 9  
ATOM 8931  H HD12 . LEU A 1 41 ? -37.292 -28.475 -32.211 1.00 0.00 ? 41 LEU A HD12 9  
ATOM 8932  H HD13 . LEU A 1 41 ? -38.254 -27.376 -31.222 1.00 0.00 ? 41 LEU A HD13 9  
ATOM 8933  H HD21 . LEU A 1 41 ? -38.941 -30.379 -33.723 1.00 0.00 ? 41 LEU A HD21 9  
ATOM 8934  H HD22 . LEU A 1 41 ? -39.050 -28.742 -34.365 1.00 0.00 ? 41 LEU A HD22 9  
ATOM 8935  H HD23 . LEU A 1 41 ? -40.517 -29.615 -33.930 1.00 0.00 ? 41 LEU A HD23 9  
ATOM 8936  N N    . ILE A 1 42 ? -40.370 -32.053 -29.044 1.00 0.00 ? 42 ILE A N    9  
ATOM 8937  C CA   . ILE A 1 42 ? -40.105 -33.208 -28.183 1.00 0.00 ? 42 ILE A CA   9  
ATOM 8938  C C    . ILE A 1 42 ? -41.001 -34.396 -28.549 1.00 0.00 ? 42 ILE A C    9  
ATOM 8939  O O    . ILE A 1 42 ? -40.533 -35.534 -28.642 1.00 0.00 ? 42 ILE A O    9  
ATOM 8940  C CB   . ILE A 1 42 ? -40.315 -32.837 -26.713 1.00 0.00 ? 42 ILE A CB   9  
ATOM 8941  C CG1  . ILE A 1 42 ? -39.218 -31.858 -26.279 1.00 0.00 ? 42 ILE A CG1  9  
ATOM 8942  C CG2  . ILE A 1 42 ? -40.244 -34.100 -25.851 1.00 0.00 ? 42 ILE A CG2  9  
ATOM 8943  C CD1  . ILE A 1 42 ? -39.534 -31.282 -24.893 1.00 0.00 ? 42 ILE A CD1  9  
ATOM 8944  H H    . ILE A 1 42 ? -40.661 -31.207 -28.660 1.00 0.00 ? 42 ILE A H    9  
ATOM 8945  H HA   . ILE A 1 42 ? -39.074 -33.504 -28.316 1.00 0.00 ? 42 ILE A HA   9  
ATOM 8946  H HB   . ILE A 1 42 ? -41.284 -32.375 -26.598 1.00 0.00 ? 42 ILE A HB   9  
ATOM 8947  H HG12 . ILE A 1 42 ? -38.271 -32.377 -26.242 1.00 0.00 ? 42 ILE A HG12 9  
ATOM 8948  H HG13 . ILE A 1 42 ? -39.155 -31.051 -26.993 1.00 0.00 ? 42 ILE A HG13 9  
ATOM 8949  H HG21 . ILE A 1 42 ? -39.414 -34.709 -26.176 1.00 0.00 ? 42 ILE A HG21 9  
ATOM 8950  H HG22 . ILE A 1 42 ? -41.163 -34.657 -25.954 1.00 0.00 ? 42 ILE A HG22 9  
ATOM 8951  H HG23 . ILE A 1 42 ? -40.107 -33.823 -24.817 1.00 0.00 ? 42 ILE A HG23 9  
ATOM 8952  H HD11 . ILE A 1 42 ? -39.507 -30.204 -24.937 1.00 0.00 ? 42 ILE A HD11 9  
ATOM 8953  H HD12 . ILE A 1 42 ? -38.796 -31.630 -24.184 1.00 0.00 ? 42 ILE A HD12 9  
ATOM 8954  H HD13 . ILE A 1 42 ? -40.515 -31.606 -24.576 1.00 0.00 ? 42 ILE A HD13 9  
ATOM 8955  N N    . LEU A 1 43 ? -42.291 -34.138 -28.757 1.00 0.00 ? 43 LEU A N    9  
ATOM 8956  C CA   . LEU A 1 43 ? -43.218 -35.214 -29.107 1.00 0.00 ? 43 LEU A CA   9  
ATOM 8957  C C    . LEU A 1 43 ? -42.780 -35.899 -30.401 1.00 0.00 ? 43 LEU A C    9  
ATOM 8958  O O    . LEU A 1 43 ? -42.884 -37.121 -30.536 1.00 0.00 ? 43 LEU A O    9  
ATOM 8959  C CB   . LEU A 1 43 ? -44.637 -34.657 -29.273 1.00 0.00 ? 43 LEU A CB   9  
ATOM 8960  C CG   . LEU A 1 43 ? -45.309 -34.504 -27.900 1.00 0.00 ? 43 LEU A CG   9  
ATOM 8961  C CD1  . LEU A 1 43 ? -45.617 -35.880 -27.297 1.00 0.00 ? 43 LEU A CD1  9  
ATOM 8962  C CD2  . LEU A 1 43 ? -44.380 -33.740 -26.956 1.00 0.00 ? 43 LEU A CD2  9  
ATOM 8963  H H    . LEU A 1 43 ? -42.623 -33.225 -28.667 1.00 0.00 ? 43 LEU A H    9  
ATOM 8964  H HA   . LEU A 1 43 ? -43.219 -35.944 -28.313 1.00 0.00 ? 43 LEU A HA   9  
ATOM 8965  H HB2  . LEU A 1 43 ? -44.583 -33.691 -29.752 1.00 0.00 ? 43 LEU A HB2  9  
ATOM 8966  H HB3  . LEU A 1 43 ? -45.218 -35.328 -29.888 1.00 0.00 ? 43 LEU A HB3  9  
ATOM 8967  H HG   . LEU A 1 43 ? -46.232 -33.955 -28.016 1.00 0.00 ? 43 LEU A HG   9  
ATOM 8968  H HD11 . LEU A 1 43 ? -46.654 -35.917 -26.995 1.00 0.00 ? 43 LEU A HD11 9  
ATOM 8969  H HD12 . LEU A 1 43 ? -44.988 -36.043 -26.433 1.00 0.00 ? 43 LEU A HD12 9  
ATOM 8970  H HD13 . LEU A 1 43 ? -45.430 -36.654 -28.027 1.00 0.00 ? 43 LEU A HD13 9  
ATOM 8971  H HD21 . LEU A 1 43 ? -43.943 -32.906 -27.481 1.00 0.00 ? 43 LEU A HD21 9  
ATOM 8972  H HD22 . LEU A 1 43 ? -43.598 -34.397 -26.607 1.00 0.00 ? 43 LEU A HD22 9  
ATOM 8973  H HD23 . LEU A 1 43 ? -44.946 -33.375 -26.112 1.00 0.00 ? 43 LEU A HD23 9  
ATOM 8974  N N    . LEU A 1 44 ? -42.298 -35.106 -31.350 1.00 0.00 ? 44 LEU A N    9  
ATOM 8975  C CA   . LEU A 1 44 ? -41.853 -35.638 -32.635 1.00 0.00 ? 44 LEU A CA   9  
ATOM 8976  C C    . LEU A 1 44 ? -40.729 -36.652 -32.439 1.00 0.00 ? 44 LEU A C    9  
ATOM 8977  O O    . LEU A 1 44 ? -40.644 -37.639 -33.169 1.00 0.00 ? 44 LEU A O    9  
ATOM 8978  C CB   . LEU A 1 44 ? -41.369 -34.484 -33.525 1.00 0.00 ? 44 LEU A CB   9  
ATOM 8979  C CG   . LEU A 1 44 ? -40.912 -35.014 -34.892 1.00 0.00 ? 44 LEU A CG   9  
ATOM 8980  C CD1  . LEU A 1 44 ? -42.081 -35.704 -35.599 1.00 0.00 ? 44 LEU A CD1  9  
ATOM 8981  C CD2  . LEU A 1 44 ? -40.429 -33.841 -35.750 1.00 0.00 ? 44 LEU A CD2  9  
ATOM 8982  H H    . LEU A 1 44 ? -42.251 -34.144 -31.200 1.00 0.00 ? 44 LEU A H    9  
ATOM 8983  H HA   . LEU A 1 44 ? -42.687 -36.124 -33.115 1.00 0.00 ? 44 LEU A HA   9  
ATOM 8984  H HB2  . LEU A 1 44 ? -42.176 -33.780 -33.666 1.00 0.00 ? 44 LEU A HB2  9  
ATOM 8985  H HB3  . LEU A 1 44 ? -40.541 -33.985 -33.044 1.00 0.00 ? 44 LEU A HB3  9  
ATOM 8986  H HG   . LEU A 1 44 ? -40.105 -35.718 -34.760 1.00 0.00 ? 44 LEU A HG   9  
ATOM 8987  H HD11 . LEU A 1 44 ? -42.113 -36.743 -35.309 1.00 0.00 ? 44 LEU A HD11 9  
ATOM 8988  H HD12 . LEU A 1 44 ? -41.946 -35.632 -36.668 1.00 0.00 ? 44 LEU A HD12 9  
ATOM 8989  H HD13 . LEU A 1 44 ? -43.006 -35.222 -35.320 1.00 0.00 ? 44 LEU A HD13 9  
ATOM 8990  H HD21 . LEU A 1 44 ? -39.356 -33.891 -35.855 1.00 0.00 ? 44 LEU A HD21 9  
ATOM 8991  H HD22 . LEU A 1 44 ? -40.701 -32.910 -35.273 1.00 0.00 ? 44 LEU A HD22 9  
ATOM 8992  H HD23 . LEU A 1 44 ? -40.890 -33.895 -36.724 1.00 0.00 ? 44 LEU A HD23 9  
ATOM 8993  N N    . SER A 1 45 ? -39.867 -36.404 -31.461 1.00 0.00 ? 45 SER A N    9  
ATOM 8994  C CA   . SER A 1 45 ? -38.752 -37.299 -31.188 1.00 0.00 ? 45 SER A CA   9  
ATOM 8995  C C    . SER A 1 45 ? -39.260 -38.690 -30.830 1.00 0.00 ? 45 SER A C    9  
ATOM 8996  O O    . SER A 1 45 ? -38.670 -39.692 -31.227 1.00 0.00 ? 45 SER A O    9  
ATOM 8997  C CB   . SER A 1 45 ? -37.897 -36.754 -30.044 1.00 0.00 ? 45 SER A CB   9  
ATOM 8998  O OG   . SER A 1 45 ? -37.287 -35.537 -30.453 1.00 0.00 ? 45 SER A OG   9  
ATOM 8999  H H    . SER A 1 45 ? -39.983 -35.609 -30.908 1.00 0.00 ? 45 SER A H    9  
ATOM 9000  H HA   . SER A 1 45 ? -38.140 -37.371 -32.074 1.00 0.00 ? 45 SER A HA   9  
ATOM 9001  H HB2  . SER A 1 45 ? -38.514 -36.571 -29.183 1.00 0.00 ? 45 SER A HB2  9  
ATOM 9002  H HB3  . SER A 1 45 ? -37.135 -37.479 -29.789 1.00 0.00 ? 45 SER A HB3  9  
ATOM 9003  H HG   . SER A 1 45 ? -36.424 -35.744 -30.816 1.00 0.00 ? 45 SER A HG   9  
ATOM 9004  N N    . ARG A 1 46 ? -40.358 -38.758 -30.083 1.00 0.00 ? 46 ARG A N    9  
ATOM 9005  C CA   . ARG A 1 46 ? -40.905 -40.058 -29.706 1.00 0.00 ? 46 ARG A CA   9  
ATOM 9006  C C    . ARG A 1 46 ? -41.260 -40.858 -30.956 1.00 0.00 ? 46 ARG A C    9  
ATOM 9007  O O    . ARG A 1 46 ? -40.976 -42.053 -31.042 1.00 0.00 ? 46 ARG A O    9  
ATOM 9008  C CB   . ARG A 1 46 ? -42.156 -39.891 -28.837 1.00 0.00 ? 46 ARG A CB   9  
ATOM 9009  C CG   . ARG A 1 46 ? -42.712 -41.275 -28.473 1.00 0.00 ? 46 ARG A CG   9  
ATOM 9010  C CD   . ARG A 1 46 ? -43.940 -41.594 -29.336 1.00 0.00 ? 46 ARG A CD   9  
ATOM 9011  N NE   . ARG A 1 46 ? -44.319 -42.997 -29.183 1.00 0.00 ? 46 ARG A NE   9  
ATOM 9012  C CZ   . ARG A 1 46 ? -45.375 -43.498 -29.818 1.00 0.00 ? 46 ARG A CZ   9  
ATOM 9013  N NH1  . ARG A 1 46 ? -46.093 -42.732 -30.595 1.00 0.00 ? 46 ARG A NH1  9  
ATOM 9014  N NH2  . ARG A 1 46 ? -45.694 -44.754 -29.665 1.00 0.00 ? 46 ARG A NH2  9  
ATOM 9015  H H    . ARG A 1 46 ? -40.801 -37.937 -29.791 1.00 0.00 ? 46 ARG A H    9  
ATOM 9016  H HA   . ARG A 1 46 ? -40.159 -40.601 -29.145 1.00 0.00 ? 46 ARG A HA   9  
ATOM 9017  H HB2  . ARG A 1 46 ? -41.898 -39.357 -27.934 1.00 0.00 ? 46 ARG A HB2  9  
ATOM 9018  H HB3  . ARG A 1 46 ? -42.904 -39.336 -29.383 1.00 0.00 ? 46 ARG A HB3  9  
ATOM 9019  H HG2  . ARG A 1 46 ? -41.951 -42.023 -28.644 1.00 0.00 ? 46 ARG A HG2  9  
ATOM 9020  H HG3  . ARG A 1 46 ? -42.996 -41.285 -27.431 1.00 0.00 ? 46 ARG A HG3  9  
ATOM 9021  H HD2  . ARG A 1 46 ? -44.765 -40.969 -29.026 1.00 0.00 ? 46 ARG A HD2  9  
ATOM 9022  H HD3  . ARG A 1 46 ? -43.716 -41.394 -30.372 1.00 0.00 ? 46 ARG A HD3  9  
ATOM 9023  H HE   . ARG A 1 46 ? -43.786 -43.579 -28.603 1.00 0.00 ? 46 ARG A HE   9  
ATOM 9024  H HH11 . ARG A 1 46 ? -45.849 -41.770 -30.712 1.00 0.00 ? 46 ARG A HH11 9  
ATOM 9025  H HH12 . ARG A 1 46 ? -46.886 -43.109 -31.071 1.00 0.00 ? 46 ARG A HH12 9  
ATOM 9026  H HH21 . ARG A 1 46 ? -45.144 -45.341 -29.072 1.00 0.00 ? 46 ARG A HH21 9  
ATOM 9027  H HH22 . ARG A 1 46 ? -46.488 -45.130 -30.143 1.00 0.00 ? 46 ARG A HH22 9  
ATOM 9028  N N    . ARG A 1 47 ? -41.892 -40.192 -31.919 1.00 0.00 ? 47 ARG A N    9  
ATOM 9029  C CA   . ARG A 1 47 ? -42.290 -40.858 -33.157 1.00 0.00 ? 47 ARG A CA   9  
ATOM 9030  C C    . ARG A 1 47 ? -41.091 -41.462 -33.883 1.00 0.00 ? 47 ARG A C    9  
ATOM 9031  O O    . ARG A 1 47 ? -41.234 -42.447 -34.607 1.00 0.00 ? 47 ARG A O    9  
ATOM 9032  C CB   . ARG A 1 47 ? -43.007 -39.870 -34.085 1.00 0.00 ? 47 ARG A CB   9  
ATOM 9033  C CG   . ARG A 1 47 ? -44.453 -40.323 -34.314 1.00 0.00 ? 47 ARG A CG   9  
ATOM 9034  C CD   . ARG A 1 47 ? -44.457 -41.586 -35.182 1.00 0.00 ? 47 ARG A CD   9  
ATOM 9035  N NE   . ARG A 1 47 ? -45.306 -42.614 -34.588 1.00 0.00 ? 47 ARG A NE   9  
ATOM 9036  C CZ   . ARG A 1 47 ? -45.389 -43.829 -35.120 1.00 0.00 ? 47 ARG A CZ   9  
ATOM 9037  N NH1  . ARG A 1 47 ? -44.706 -44.119 -36.194 1.00 0.00 ? 47 ARG A NH1  9  
ATOM 9038  N NH2  . ARG A 1 47 ? -46.150 -44.732 -34.567 1.00 0.00 ? 47 ARG A NH2  9  
ATOM 9039  H H    . ARG A 1 47 ? -42.099 -39.249 -31.789 1.00 0.00 ? 47 ARG A H    9  
ATOM 9040  H HA   . ARG A 1 47 ? -42.974 -41.657 -32.912 1.00 0.00 ? 47 ARG A HA   9  
ATOM 9041  H HB2  . ARG A 1 47 ? -43.005 -38.888 -33.633 1.00 0.00 ? 47 ARG A HB2  9  
ATOM 9042  H HB3  . ARG A 1 47 ? -42.491 -39.829 -35.032 1.00 0.00 ? 47 ARG A HB3  9  
ATOM 9043  H HG2  . ARG A 1 47 ? -44.928 -40.530 -33.366 1.00 0.00 ? 47 ARG A HG2  9  
ATOM 9044  H HG3  . ARG A 1 47 ? -44.997 -39.541 -34.823 1.00 0.00 ? 47 ARG A HG3  9  
ATOM 9045  H HD2  . ARG A 1 47 ? -44.832 -41.343 -36.164 1.00 0.00 ? 47 ARG A HD2  9  
ATOM 9046  H HD3  . ARG A 1 47 ? -43.447 -41.961 -35.270 1.00 0.00 ? 47 ARG A HD3  9  
ATOM 9047  H HE   . ARG A 1 47 ? -45.824 -42.405 -33.782 1.00 0.00 ? 47 ARG A HE   9  
ATOM 9048  H HH11 . ARG A 1 47 ? -44.121 -43.427 -36.617 1.00 0.00 ? 47 ARG A HH11 9  
ATOM 9049  H HH12 . ARG A 1 47 ? -44.767 -45.034 -36.593 1.00 0.00 ? 47 ARG A HH12 9  
ATOM 9050  H HH21 . ARG A 1 47 ? -46.673 -44.511 -33.744 1.00 0.00 ? 47 ARG A HH21 9  
ATOM 9051  H HH22 . ARG A 1 47 ? -46.211 -45.647 -34.968 1.00 0.00 ? 47 ARG A HH22 9  
ATOM 9052  N N    . PHE A 1 48 ? -39.907 -40.887 -33.687 1.00 0.00 ? 48 PHE A N    9  
ATOM 9053  C CA   . PHE A 1 48 ? -38.717 -41.424 -34.339 1.00 0.00 ? 48 PHE A CA   9  
ATOM 9054  C C    . PHE A 1 48 ? -38.482 -42.859 -33.881 1.00 0.00 ? 48 PHE A C    9  
ATOM 9055  O O    . PHE A 1 48 ? -38.275 -43.759 -34.694 1.00 0.00 ? 48 PHE A O    9  
ATOM 9056  C CB   . PHE A 1 48 ? -37.491 -40.569 -34.010 1.00 0.00 ? 48 PHE A CB   9  
ATOM 9057  C CG   . PHE A 1 48 ? -36.267 -41.176 -34.658 1.00 0.00 ? 48 PHE A CG   9  
ATOM 9058  C CD1  . PHE A 1 48 ? -36.031 -40.981 -36.023 1.00 0.00 ? 48 PHE A CD1  9  
ATOM 9059  C CD2  . PHE A 1 48 ? -35.372 -41.932 -33.892 1.00 0.00 ? 48 PHE A CD2  9  
ATOM 9060  C CE1  . PHE A 1 48 ? -34.897 -41.544 -36.623 1.00 0.00 ? 48 PHE A CE1  9  
ATOM 9061  C CE2  . PHE A 1 48 ? -34.238 -42.493 -34.492 1.00 0.00 ? 48 PHE A CE2  9  
ATOM 9062  C CZ   . PHE A 1 48 ? -34.001 -42.298 -35.858 1.00 0.00 ? 48 PHE A CZ   9  
ATOM 9063  H H    . PHE A 1 48 ? -39.832 -40.119 -33.089 1.00 0.00 ? 48 PHE A H    9  
ATOM 9064  H HA   . PHE A 1 48 ? -38.871 -41.419 -35.408 1.00 0.00 ? 48 PHE A HA   9  
ATOM 9065  H HB2  . PHE A 1 48 ? -37.639 -39.567 -34.384 1.00 0.00 ? 48 PHE A HB2  9  
ATOM 9066  H HB3  . PHE A 1 48 ? -37.348 -40.539 -32.941 1.00 0.00 ? 48 PHE A HB3  9  
ATOM 9067  H HD1  . PHE A 1 48 ? -36.722 -40.398 -36.615 1.00 0.00 ? 48 PHE A HD1  9  
ATOM 9068  H HD2  . PHE A 1 48 ? -35.556 -42.082 -32.838 1.00 0.00 ? 48 PHE A HD2  9  
ATOM 9069  H HE1  . PHE A 1 48 ? -34.714 -41.393 -37.678 1.00 0.00 ? 48 PHE A HE1  9  
ATOM 9070  H HE2  . PHE A 1 48 ? -33.548 -43.077 -33.902 1.00 0.00 ? 48 PHE A HE2  9  
ATOM 9071  H HZ   . PHE A 1 48 ? -33.127 -42.732 -36.320 1.00 0.00 ? 48 PHE A HZ   9  
ATOM 9072  N N    . ARG A 1 49 ? -38.514 -43.059 -32.566 1.00 0.00 ? 49 ARG A N    9  
ATOM 9073  C CA   . ARG A 1 49 ? -38.299 -44.395 -32.023 1.00 0.00 ? 49 ARG A CA   9  
ATOM 9074  C C    . ARG A 1 49 ? -39.424 -45.317 -32.485 1.00 0.00 ? 49 ARG A C    9  
ATOM 9075  O O    . ARG A 1 49 ? -39.168 -46.349 -33.105 1.00 0.00 ? 49 ARG A O    9  
ATOM 9076  C CB   . ARG A 1 49 ? -38.274 -44.341 -30.491 1.00 0.00 ? 49 ARG A CB   9  
ATOM 9077  C CG   . ARG A 1 49 ? -37.211 -45.304 -29.951 1.00 0.00 ? 49 ARG A CG   9  
ATOM 9078  C CD   . ARG A 1 49 ? -37.554 -46.741 -30.358 1.00 0.00 ? 49 ARG A CD   9  
ATOM 9079  N NE   . ARG A 1 49 ? -36.986 -47.043 -31.666 1.00 0.00 ? 49 ARG A NE   9  
ATOM 9080  C CZ   . ARG A 1 49 ? -35.680 -47.245 -31.817 1.00 0.00 ? 49 ARG A CZ   9  
ATOM 9081  N NH1  . ARG A 1 49 ? -34.886 -47.171 -30.784 1.00 0.00 ? 49 ARG A NH1  9  
ATOM 9082  N NH2  . ARG A 1 49 ? -35.193 -47.516 -32.997 1.00 0.00 ? 49 ARG A NH2  9  
ATOM 9083  H H    . ARG A 1 49 ? -38.674 -42.283 -31.989 1.00 0.00 ? 49 ARG A H    9  
ATOM 9084  H HA   . ARG A 1 49 ? -37.357 -44.776 -32.382 1.00 0.00 ? 49 ARG A HA   9  
ATOM 9085  H HB2  . ARG A 1 49 ? -38.041 -43.334 -30.173 1.00 0.00 ? 49 ARG A HB2  9  
ATOM 9086  H HB3  . ARG A 1 49 ? -39.242 -44.623 -30.106 1.00 0.00 ? 49 ARG A HB3  9  
ATOM 9087  H HG2  . ARG A 1 49 ? -36.244 -45.037 -30.351 1.00 0.00 ? 49 ARG A HG2  9  
ATOM 9088  H HG3  . ARG A 1 49 ? -37.183 -45.237 -28.874 1.00 0.00 ? 49 ARG A HG3  9  
ATOM 9089  H HD2  . ARG A 1 49 ? -37.151 -47.424 -29.628 1.00 0.00 ? 49 ARG A HD2  9  
ATOM 9090  H HD3  . ARG A 1 49 ? -38.628 -46.855 -30.397 1.00 0.00 ? 49 ARG A HD3  9  
ATOM 9091  H HE   . ARG A 1 49 ? -37.575 -47.101 -32.446 1.00 0.00 ? 49 ARG A HE   9  
ATOM 9092  H HH11 . ARG A 1 49 ? -35.259 -46.962 -29.880 1.00 0.00 ? 49 ARG A HH11 9  
ATOM 9093  H HH12 . ARG A 1 49 ? -33.904 -47.321 -30.897 1.00 0.00 ? 49 ARG A HH12 9  
ATOM 9094  H HH21 . ARG A 1 49 ? -35.803 -47.572 -33.788 1.00 0.00 ? 49 ARG A HH21 9  
ATOM 9095  H HH22 . ARG A 1 49 ? -34.212 -47.667 -33.110 1.00 0.00 ? 49 ARG A HH22 9  
ATOM 9096  N N    . SER A 1 50 ? -40.666 -44.932 -32.184 1.00 0.00 ? 50 SER A N    9  
ATOM 9097  C CA   . SER A 1 50 ? -41.832 -45.724 -32.573 1.00 0.00 ? 50 SER A CA   9  
ATOM 9098  C C    . SER A 1 50 ? -41.523 -47.217 -32.512 1.00 0.00 ? 50 SER A C    9  
ATOM 9099  O O    . SER A 1 50 ? -41.307 -47.775 -31.439 1.00 0.00 ? 50 SER A O    9  
ATOM 9100  C CB   . SER A 1 50 ? -42.268 -45.348 -33.990 1.00 0.00 ? 50 SER A CB   9  
ATOM 9101  O OG   . SER A 1 50 ? -42.856 -44.053 -33.971 1.00 0.00 ? 50 SER A OG   9  
ATOM 9102  H H    . SER A 1 50 ? -40.801 -44.118 -31.654 1.00 0.00 ? 50 SER A H    9  
ATOM 9103  H HA   . SER A 1 50 ? -42.642 -45.509 -31.893 1.00 0.00 ? 50 SER A HA   9  
ATOM 9104  H HB2  . SER A 1 50 ? -41.411 -45.340 -34.643 1.00 0.00 ? 50 SER A HB2  9  
ATOM 9105  H HB3  . SER A 1 50 ? -42.986 -46.074 -34.350 1.00 0.00 ? 50 SER A HB3  9  
ATOM 9106  H HG   . SER A 1 50 ? -42.862 -43.743 -33.063 1.00 0.00 ? 50 SER A HG   9  
ATOM 9107  N N    . GLY A 1 51 ? -41.511 -47.857 -33.674 1.00 0.00 ? 51 GLY A N    9  
ATOM 9108  C CA   . GLY A 1 51 ? -41.234 -49.287 -33.740 1.00 0.00 ? 51 GLY A CA   9  
ATOM 9109  C C    . GLY A 1 51 ? -39.894 -49.601 -33.082 1.00 0.00 ? 51 GLY A C    9  
ATOM 9110  O O    . GLY A 1 51 ? -38.965 -48.794 -33.132 1.00 0.00 ? 51 GLY A O    9  
ATOM 9111  H H    . GLY A 1 51 ? -41.706 -47.353 -34.492 1.00 0.00 ? 51 GLY A H    9  
ATOM 9112  H HA2  . GLY A 1 51 ? -42.019 -49.827 -33.230 1.00 0.00 ? 51 GLY A HA2  9  
ATOM 9113  H HA3  . GLY A 1 51 ? -41.201 -49.598 -34.774 1.00 0.00 ? 51 GLY A HA3  9  
ATOM 9114  N N    . GLY A 1 52 ? -39.804 -50.768 -32.450 1.00 0.00 ? 52 GLY A N    9  
ATOM 9115  C CA   . GLY A 1 52 ? -38.573 -51.161 -31.773 1.00 0.00 ? 52 GLY A CA   9  
ATOM 9116  C C    . GLY A 1 52 ? -38.636 -50.824 -30.284 1.00 0.00 ? 52 GLY A C    9  
ATOM 9117  O O    . GLY A 1 52 ? -37.608 -50.745 -29.610 1.00 0.00 ? 52 GLY A O    9  
ATOM 9118  H H    . GLY A 1 52 ? -40.581 -51.366 -32.428 1.00 0.00 ? 52 GLY A H    9  
ATOM 9119  H HA2  . GLY A 1 52 ? -38.428 -52.225 -31.889 1.00 0.00 ? 52 GLY A HA2  9  
ATOM 9120  H HA3  . GLY A 1 52 ? -37.740 -50.639 -32.216 1.00 0.00 ? 52 GLY A HA3  9  
ATOM 9121  N N    . ASN A 1 53 ? -39.851 -50.638 -29.774 1.00 0.00 ? 53 ASN A N    9  
ATOM 9122  C CA   . ASN A 1 53 ? -40.040 -50.326 -28.359 1.00 0.00 ? 53 ASN A CA   9  
ATOM 9123  C C    . ASN A 1 53 ? -41.442 -50.724 -27.905 1.00 0.00 ? 53 ASN A C    9  
ATOM 9124  O O    . ASN A 1 53 ? -42.268 -51.144 -28.714 1.00 0.00 ? 53 ASN A O    9  
ATOM 9125  C CB   . ASN A 1 53 ? -39.827 -48.830 -28.111 1.00 0.00 ? 53 ASN A CB   9  
ATOM 9126  C CG   . ASN A 1 53 ? -40.865 -48.019 -28.877 1.00 0.00 ? 53 ASN A CG   9  
ATOM 9127  O OD1  . ASN A 1 53 ? -41.895 -48.551 -29.288 1.00 0.00 ? 53 ASN A OD1  9  
ATOM 9128  N ND2  . ASN A 1 53 ? -40.655 -46.747 -29.092 1.00 0.00 ? 53 ASN A ND2  9  
ATOM 9129  H H    . ASN A 1 53 ? -40.632 -50.737 -30.359 1.00 0.00 ? 53 ASN A H    9  
ATOM 9130  H HA   . ASN A 1 53 ? -39.316 -50.880 -27.781 1.00 0.00 ? 53 ASN A HA   9  
ATOM 9131  H HB2  . ASN A 1 53 ? -39.922 -48.627 -27.055 1.00 0.00 ? 53 ASN A HB2  9  
ATOM 9132  H HB3  . ASN A 1 53 ? -38.839 -48.550 -28.443 1.00 0.00 ? 53 ASN A HB3  9  
ATOM 9133  H HD21 . ASN A 1 53 ? -39.835 -46.324 -28.763 1.00 0.00 ? 53 ASN A HD21 9  
ATOM 9134  H HD22 . ASN A 1 53 ? -41.317 -46.219 -29.583 1.00 0.00 ? 53 ASN A HD22 9  
ATOM 9135  N N    . LYS A 1 54 ? -41.703 -50.588 -26.607 1.00 0.00 ? 54 LYS A N    9  
ATOM 9136  C CA   . LYS A 1 54 ? -43.012 -50.939 -26.068 1.00 0.00 ? 54 LYS A CA   9  
ATOM 9137  C C    . LYS A 1 54 ? -43.392 -52.353 -26.486 1.00 0.00 ? 54 LYS A C    9  
ATOM 9138  O O    . LYS A 1 54 ? -44.445 -52.573 -27.084 1.00 0.00 ? 54 LYS A O    9  
ATOM 9139  C CB   . LYS A 1 54 ? -44.075 -49.956 -26.572 1.00 0.00 ? 54 LYS A CB   9  
ATOM 9140  C CG   . LYS A 1 54 ? -43.689 -48.510 -26.223 1.00 0.00 ? 54 LYS A CG   9  
ATOM 9141  C CD   . LYS A 1 54 ? -43.749 -48.288 -24.707 1.00 0.00 ? 54 LYS A CD   9  
ATOM 9142  C CE   . LYS A 1 54 ? -43.615 -46.798 -24.404 1.00 0.00 ? 54 LYS A CE   9  
ATOM 9143  N NZ   . LYS A 1 54 ? -43.666 -46.593 -22.929 1.00 0.00 ? 54 LYS A NZ   9  
ATOM 9144  H H    . LYS A 1 54 ? -41.004 -50.248 -26.011 1.00 0.00 ? 54 LYS A H    9  
ATOM 9145  H HA   . LYS A 1 54 ? -42.974 -50.903 -24.994 1.00 0.00 ? 54 LYS A HA   9  
ATOM 9146  H HB2  . LYS A 1 54 ? -44.167 -50.050 -27.644 1.00 0.00 ? 54 LYS A HB2  9  
ATOM 9147  H HB3  . LYS A 1 54 ? -45.022 -50.191 -26.111 1.00 0.00 ? 54 LYS A HB3  9  
ATOM 9148  H HG2  . LYS A 1 54 ? -42.685 -48.315 -26.572 1.00 0.00 ? 54 LYS A HG2  9  
ATOM 9149  H HG3  . LYS A 1 54 ? -44.373 -47.831 -26.708 1.00 0.00 ? 54 LYS A HG3  9  
ATOM 9150  H HD2  . LYS A 1 54 ? -44.690 -48.653 -24.324 1.00 0.00 ? 54 LYS A HD2  9  
ATOM 9151  H HD3  . LYS A 1 54 ? -42.938 -48.813 -24.229 1.00 0.00 ? 54 LYS A HD3  9  
ATOM 9152  H HE2  . LYS A 1 54 ? -42.673 -46.435 -24.787 1.00 0.00 ? 54 LYS A HE2  9  
ATOM 9153  H HE3  . LYS A 1 54 ? -44.427 -46.260 -24.871 1.00 0.00 ? 54 LYS A HE3  9  
ATOM 9154  H HZ1  . LYS A 1 54 ? -42.951 -47.192 -22.471 1.00 0.00 ? 54 LYS A HZ1  9  
ATOM 9155  H HZ2  . LYS A 1 54 ? -44.612 -46.849 -22.577 1.00 0.00 ? 54 LYS A HZ2  9  
ATOM 9156  H HZ3  . LYS A 1 54 ? -43.472 -45.596 -22.711 1.00 0.00 ? 54 LYS A HZ3  9  
ATOM 9157  N N    . LYS A 1 55 ? -42.525 -53.306 -26.172 1.00 0.00 ? 55 LYS A N    9  
ATOM 9158  C CA   . LYS A 1 55 ? -42.780 -54.696 -26.529 1.00 0.00 ? 55 LYS A CA   9  
ATOM 9159  C C    . LYS A 1 55 ? -44.064 -55.191 -25.871 1.00 0.00 ? 55 LYS A C    9  
ATOM 9160  O O    . LYS A 1 55 ? -44.844 -55.916 -26.488 1.00 0.00 ? 55 LYS A O    9  
ATOM 9161  C CB   . LYS A 1 55 ? -41.606 -55.572 -26.084 1.00 0.00 ? 55 LYS A CB   9  
ATOM 9162  C CG   . LYS A 1 55 ? -40.384 -55.265 -26.952 1.00 0.00 ? 55 LYS A CG   9  
ATOM 9163  C CD   . LYS A 1 55 ? -39.210 -56.141 -26.509 1.00 0.00 ? 55 LYS A CD   9  
ATOM 9164  C CE   . LYS A 1 55 ? -38.006 -55.877 -27.416 1.00 0.00 ? 55 LYS A CE   9  
ATOM 9165  N NZ   . LYS A 1 55 ? -37.577 -54.458 -27.273 1.00 0.00 ? 55 LYS A NZ   9  
ATOM 9166  H H    . LYS A 1 55 ? -41.699 -53.074 -25.698 1.00 0.00 ? 55 LYS A H    9  
ATOM 9167  H HA   . LYS A 1 55 ? -42.884 -54.771 -27.600 1.00 0.00 ? 55 LYS A HA   9  
ATOM 9168  H HB2  . LYS A 1 55 ? -41.375 -55.366 -25.049 1.00 0.00 ? 55 LYS A HB2  9  
ATOM 9169  H HB3  . LYS A 1 55 ? -41.871 -56.612 -26.195 1.00 0.00 ? 55 LYS A HB3  9  
ATOM 9170  H HG2  . LYS A 1 55 ? -40.616 -55.471 -27.987 1.00 0.00 ? 55 LYS A HG2  9  
ATOM 9171  H HG3  . LYS A 1 55 ? -40.117 -54.225 -26.842 1.00 0.00 ? 55 LYS A HG3  9  
ATOM 9172  H HD2  . LYS A 1 55 ? -38.951 -55.904 -25.486 1.00 0.00 ? 55 LYS A HD2  9  
ATOM 9173  H HD3  . LYS A 1 55 ? -39.490 -57.180 -26.578 1.00 0.00 ? 55 LYS A HD3  9  
ATOM 9174  H HE2  . LYS A 1 55 ? -37.193 -56.528 -27.132 1.00 0.00 ? 55 LYS A HE2  9  
ATOM 9175  H HE3  . LYS A 1 55 ? -38.281 -56.069 -28.442 1.00 0.00 ? 55 LYS A HE3  9  
ATOM 9176  H HZ1  . LYS A 1 55 ? -37.625 -54.180 -26.272 1.00 0.00 ? 55 LYS A HZ1  9  
ATOM 9177  H HZ2  . LYS A 1 55 ? -38.207 -53.846 -27.833 1.00 0.00 ? 55 LYS A HZ2  9  
ATOM 9178  H HZ3  . LYS A 1 55 ? -36.601 -54.354 -27.612 1.00 0.00 ? 55 LYS A HZ3  9  
ATOM 9179  N N    . ARG A 1 56 ? -44.283 -54.799 -24.618 1.00 0.00 ? 56 ARG A N    9  
ATOM 9180  C CA   . ARG A 1 56 ? -45.485 -55.221 -23.908 1.00 0.00 ? 56 ARG A CA   9  
ATOM 9181  C C    . ARG A 1 56 ? -46.722 -54.572 -24.523 1.00 0.00 ? 56 ARG A C    9  
ATOM 9182  O O    . ARG A 1 56 ? -47.774 -55.200 -24.636 1.00 0.00 ? 56 ARG A O    9  
ATOM 9183  C CB   . ARG A 1 56 ? -45.378 -54.842 -22.429 1.00 0.00 ? 56 ARG A CB   9  
ATOM 9184  C CG   . ARG A 1 56 ? -44.310 -55.707 -21.758 1.00 0.00 ? 56 ARG A CG   9  
ATOM 9185  C CD   . ARG A 1 56 ? -44.197 -55.328 -20.280 1.00 0.00 ? 56 ARG A CD   9  
ATOM 9186  N NE   . ARG A 1 56 ? -43.184 -56.148 -19.625 1.00 0.00 ? 56 ARG A NE   9  
ATOM 9187  C CZ   . ARG A 1 56 ? -42.921 -56.013 -18.330 1.00 0.00 ? 56 ARG A CZ   9  
ATOM 9188  N NH1  . ARG A 1 56 ? -43.577 -55.137 -17.618 1.00 0.00 ? 56 ARG A NH1  9  
ATOM 9189  N NH2  . ARG A 1 56 ? -42.008 -56.756 -17.769 1.00 0.00 ? 56 ARG A NH2  9  
ATOM 9190  H H    . ARG A 1 56 ? -43.630 -54.225 -24.165 1.00 0.00 ? 56 ARG A H    9  
ATOM 9191  H HA   . ARG A 1 56 ? -45.579 -56.294 -23.985 1.00 0.00 ? 56 ARG A HA   9  
ATOM 9192  H HB2  . ARG A 1 56 ? -45.106 -53.799 -22.344 1.00 0.00 ? 56 ARG A HB2  9  
ATOM 9193  H HB3  . ARG A 1 56 ? -46.327 -55.005 -21.944 1.00 0.00 ? 56 ARG A HB3  9  
ATOM 9194  H HG2  . ARG A 1 56 ? -44.586 -56.749 -21.842 1.00 0.00 ? 56 ARG A HG2  9  
ATOM 9195  H HG3  . ARG A 1 56 ? -43.359 -55.545 -22.242 1.00 0.00 ? 56 ARG A HG3  9  
ATOM 9196  H HD2  . ARG A 1 56 ? -43.920 -54.288 -20.198 1.00 0.00 ? 56 ARG A HD2  9  
ATOM 9197  H HD3  . ARG A 1 56 ? -45.152 -55.482 -19.798 1.00 0.00 ? 56 ARG A HD3  9  
ATOM 9198  H HE   . ARG A 1 56 ? -42.687 -56.809 -20.151 1.00 0.00 ? 56 ARG A HE   9  
ATOM 9199  H HH11 . ARG A 1 56 ? -44.278 -54.568 -18.049 1.00 0.00 ? 56 ARG A HH11 9  
ATOM 9200  H HH12 . ARG A 1 56 ? -43.379 -55.036 -16.644 1.00 0.00 ? 56 ARG A HH12 9  
ATOM 9201  H HH21 . ARG A 1 56 ? -41.506 -57.427 -18.314 1.00 0.00 ? 56 ARG A HH21 9  
ATOM 9202  H HH22 . ARG A 1 56 ? -41.809 -56.654 -16.794 1.00 0.00 ? 56 ARG A HH22 9  
ATOM 9203  N N    . ARG A 1 57 ? -46.582 -53.314 -24.933 1.00 0.00 ? 57 ARG A N    9  
ATOM 9204  C CA   . ARG A 1 57 ? -47.688 -52.589 -25.551 1.00 0.00 ? 57 ARG A CA   9  
ATOM 9205  C C    . ARG A 1 57 ? -48.888 -52.512 -24.608 1.00 0.00 ? 57 ARG A C    9  
ATOM 9206  O O    . ARG A 1 57 ? -50.036 -52.518 -25.053 1.00 0.00 ? 57 ARG A O    9  
ATOM 9207  C CB   . ARG A 1 57 ? -48.099 -53.286 -26.851 1.00 0.00 ? 57 ARG A CB   9  
ATOM 9208  C CG   . ARG A 1 57 ? -48.802 -52.287 -27.773 1.00 0.00 ? 57 ARG A CG   9  
ATOM 9209  C CD   . ARG A 1 57 ? -49.202 -52.986 -29.072 1.00 0.00 ? 57 ARG A CD   9  
ATOM 9210  N NE   . ARG A 1 57 ? -48.016 -53.504 -29.754 1.00 0.00 ? 57 ARG A NE   9  
ATOM 9211  C CZ   . ARG A 1 57 ? -47.682 -54.795 -29.712 1.00 0.00 ? 57 ARG A CZ   9  
ATOM 9212  N NH1  . ARG A 1 57 ? -48.380 -55.645 -29.008 1.00 0.00 ? 57 ARG A NH1  9  
ATOM 9213  N NH2  . ARG A 1 57 ? -46.634 -55.214 -30.369 1.00 0.00 ? 57 ARG A NH2  9  
ATOM 9214  H H    . ARG A 1 57 ? -45.716 -52.867 -24.823 1.00 0.00 ? 57 ARG A H    9  
ATOM 9215  H HA   . ARG A 1 57 ? -47.361 -51.587 -25.783 1.00 0.00 ? 57 ARG A HA   9  
ATOM 9216  H HB2  . ARG A 1 57 ? -47.221 -53.674 -27.344 1.00 0.00 ? 57 ARG A HB2  9  
ATOM 9217  H HB3  . ARG A 1 57 ? -48.774 -54.098 -26.625 1.00 0.00 ? 57 ARG A HB3  9  
ATOM 9218  H HG2  . ARG A 1 57 ? -49.684 -51.899 -27.284 1.00 0.00 ? 57 ARG A HG2  9  
ATOM 9219  H HG3  . ARG A 1 57 ? -48.131 -51.472 -27.999 1.00 0.00 ? 57 ARG A HG3  9  
ATOM 9220  H HD2  . ARG A 1 57 ? -49.878 -53.796 -28.850 1.00 0.00 ? 57 ARG A HD2  9  
ATOM 9221  H HD3  . ARG A 1 57 ? -49.703 -52.278 -29.716 1.00 0.00 ? 57 ARG A HD3  9  
ATOM 9222  H HE   . ARG A 1 57 ? -47.458 -52.885 -30.269 1.00 0.00 ? 57 ARG A HE   9  
ATOM 9223  H HH11 . ARG A 1 57 ? -49.174 -55.336 -28.489 1.00 0.00 ? 57 ARG A HH11 9  
ATOM 9224  H HH12 . ARG A 1 57 ? -48.119 -56.610 -28.988 1.00 0.00 ? 57 ARG A HH12 9  
ATOM 9225  H HH21 . ARG A 1 57 ? -46.085 -54.567 -30.900 1.00 0.00 ? 57 ARG A HH21 9  
ATOM 9226  H HH22 . ARG A 1 57 ? -46.379 -56.180 -30.341 1.00 0.00 ? 57 ARG A HH22 9  
ATOM 9227  N N    . GLN A 1 58 ? -48.617 -52.433 -23.308 1.00 0.00 ? 58 GLN A N    9  
ATOM 9228  C CA   . GLN A 1 58 ? -49.687 -52.349 -22.317 1.00 0.00 ? 58 GLN A CA   9  
ATOM 9229  C C    . GLN A 1 58 ? -49.780 -50.936 -21.752 1.00 0.00 ? 58 GLN A C    9  
ATOM 9230  O O    . GLN A 1 58 ? -48.778 -50.226 -21.655 1.00 0.00 ? 58 GLN A O    9  
ATOM 9231  C CB   . GLN A 1 58 ? -49.430 -53.339 -21.175 1.00 0.00 ? 58 GLN A CB   9  
ATOM 9232  C CG   . GLN A 1 58 ? -49.376 -54.768 -21.725 1.00 0.00 ? 58 GLN A CG   9  
ATOM 9233  C CD   . GLN A 1 58 ? -50.707 -55.140 -22.370 1.00 0.00 ? 58 GLN A CD   9  
ATOM 9234  O OE1  . GLN A 1 58 ? -51.748 -55.098 -21.713 1.00 0.00 ? 58 GLN A OE1  9  
ATOM 9235  N NE2  . GLN A 1 58 ? -50.735 -55.505 -23.622 1.00 0.00 ? 58 GLN A NE2  9  
ATOM 9236  H H    . GLN A 1 58 ? -47.684 -52.433 -23.010 1.00 0.00 ? 58 GLN A H    9  
ATOM 9237  H HA   . GLN A 1 58 ? -50.625 -52.594 -22.789 1.00 0.00 ? 58 GLN A HA   9  
ATOM 9238  H HB2  . GLN A 1 58 ? -48.489 -53.101 -20.700 1.00 0.00 ? 58 GLN A HB2  9  
ATOM 9239  H HB3  . GLN A 1 58 ? -50.228 -53.267 -20.451 1.00 0.00 ? 58 GLN A HB3  9  
ATOM 9240  H HG2  . GLN A 1 58 ? -48.593 -54.836 -22.465 1.00 0.00 ? 58 GLN A HG2  9  
ATOM 9241  H HG3  . GLN A 1 58 ? -49.165 -55.454 -20.919 1.00 0.00 ? 58 GLN A HG3  9  
ATOM 9242  H HE21 . GLN A 1 58 ? -49.907 -55.537 -24.142 1.00 0.00 ? 58 GLN A HE21 9  
ATOM 9243  H HE22 . GLN A 1 58 ? -51.587 -55.745 -24.043 1.00 0.00 ? 58 GLN A HE22 9  
ATOM 9244  N N    . ILE A 1 59 ? -50.992 -50.532 -21.387 1.00 0.00 ? 59 ILE A N    9  
ATOM 9245  C CA   . ILE A 1 59 ? -51.213 -49.200 -20.836 1.00 0.00 ? 59 ILE A CA   9  
ATOM 9246  C C    . ILE A 1 59 ? -51.179 -49.229 -19.312 1.00 0.00 ? 59 ILE A C    9  
ATOM 9247  O O    . ILE A 1 59 ? -51.453 -48.224 -18.656 1.00 0.00 ? 59 ILE A O    9  
ATOM 9248  C CB   . ILE A 1 59 ? -52.559 -48.651 -21.323 1.00 0.00 ? 59 ILE A CB   9  
ATOM 9249  C CG1  . ILE A 1 59 ? -53.692 -49.599 -20.912 1.00 0.00 ? 59 ILE A CG1  9  
ATOM 9250  C CG2  . ILE A 1 59 ? -52.535 -48.523 -22.846 1.00 0.00 ? 59 ILE A CG2  9  
ATOM 9251  C CD1  . ILE A 1 59 ? -55.039 -48.947 -21.229 1.00 0.00 ? 59 ILE A CD1  9  
ATOM 9252  H H    . ILE A 1 59 ? -51.752 -51.142 -21.491 1.00 0.00 ? 59 ILE A H    9  
ATOM 9253  H HA   . ILE A 1 59 ? -50.428 -48.547 -21.187 1.00 0.00 ? 59 ILE A HA   9  
ATOM 9254  H HB   . ILE A 1 59 ? -52.726 -47.677 -20.885 1.00 0.00 ? 59 ILE A HB   9  
ATOM 9255  H HG12 . ILE A 1 59 ? -53.602 -50.525 -21.459 1.00 0.00 ? 59 ILE A HG12 9  
ATOM 9256  H HG13 . ILE A 1 59 ? -53.634 -49.800 -19.853 1.00 0.00 ? 59 ILE A HG13 9  
ATOM 9257  H HG21 . ILE A 1 59 ? -51.588 -48.878 -23.224 1.00 0.00 ? 59 ILE A HG21 9  
ATOM 9258  H HG22 . ILE A 1 59 ? -52.669 -47.487 -23.123 1.00 0.00 ? 59 ILE A HG22 9  
ATOM 9259  H HG23 . ILE A 1 59 ? -53.334 -49.113 -23.269 1.00 0.00 ? 59 ILE A HG23 9  
ATOM 9260  H HD11 . ILE A 1 59 ? -55.557 -48.727 -20.307 1.00 0.00 ? 59 ILE A HD11 9  
ATOM 9261  H HD12 . ILE A 1 59 ? -55.634 -49.623 -21.825 1.00 0.00 ? 59 ILE A HD12 9  
ATOM 9262  H HD13 . ILE A 1 59 ? -54.876 -48.032 -21.777 1.00 0.00 ? 59 ILE A HD13 9  
ATOM 9263  N N    . ASN A 1 60 ? -50.845 -50.387 -18.752 1.00 0.00 ? 60 ASN A N    9  
ATOM 9264  C CA   . ASN A 1 60 ? -50.779 -50.534 -17.302 1.00 0.00 ? 60 ASN A CA   9  
ATOM 9265  C C    . ASN A 1 60 ? -49.438 -50.035 -16.776 1.00 0.00 ? 60 ASN A C    9  
ATOM 9266  O O    . ASN A 1 60 ? -48.395 -50.632 -17.040 1.00 0.00 ? 60 ASN A O    9  
ATOM 9267  C CB   . ASN A 1 60 ? -50.970 -52.004 -16.919 1.00 0.00 ? 60 ASN A CB   9  
ATOM 9268  C CG   . ASN A 1 60 ? -51.119 -52.136 -15.408 1.00 0.00 ? 60 ASN A CG   9  
ATOM 9269  O OD1  . ASN A 1 60 ? -51.668 -51.246 -14.757 1.00 0.00 ? 60 ASN A OD1  9  
ATOM 9270  N ND2  . ASN A 1 60 ? -50.662 -53.200 -14.807 1.00 0.00 ? 60 ASN A ND2  9  
ATOM 9271  H H    . ASN A 1 60 ? -50.638 -51.157 -19.321 1.00 0.00 ? 60 ASN A H    9  
ATOM 9272  H HA   . ASN A 1 60 ? -51.571 -49.951 -16.855 1.00 0.00 ? 60 ASN A HA   9  
ATOM 9273  H HB2  . ASN A 1 60 ? -51.855 -52.388 -17.403 1.00 0.00 ? 60 ASN A HB2  9  
ATOM 9274  H HB3  . ASN A 1 60 ? -50.111 -52.572 -17.243 1.00 0.00 ? 60 ASN A HB3  9  
ATOM 9275  H HD21 . ASN A 1 60 ? -50.227 -53.908 -15.328 1.00 0.00 ? 60 ASN A HD21 9  
ATOM 9276  H HD22 . ASN A 1 60 ? -50.755 -53.294 -13.837 1.00 0.00 ? 60 ASN A HD22 9  
ATOM 9277  N N    . GLU A 1 61 ? -49.474 -48.936 -16.028 1.00 0.00 ? 61 GLU A N    9  
ATOM 9278  C CA   . GLU A 1 61 ? -48.256 -48.362 -15.468 1.00 0.00 ? 61 GLU A CA   9  
ATOM 9279  C C    . GLU A 1 61 ? -47.956 -48.968 -14.101 1.00 0.00 ? 61 GLU A C    9  
ATOM 9280  O O    . GLU A 1 61 ? -46.923 -48.680 -13.498 1.00 0.00 ? 61 GLU A O    9  
ATOM 9281  C CB   . GLU A 1 61 ? -48.409 -46.845 -15.333 1.00 0.00 ? 61 GLU A CB   9  
ATOM 9282  C CG   . GLU A 1 61 ? -48.667 -46.233 -16.711 1.00 0.00 ? 61 GLU A CG   9  
ATOM 9283  C CD   . GLU A 1 61 ? -47.440 -46.409 -17.599 1.00 0.00 ? 61 GLU A CD   9  
ATOM 9284  O OE1  . GLU A 1 61 ? -46.368 -46.622 -17.058 1.00 0.00 ? 61 GLU A OE1  9  
ATOM 9285  O OE2  . GLU A 1 61 ? -47.591 -46.327 -18.807 1.00 0.00 ? 61 GLU A OE2  9  
ATOM 9286  H H    . GLU A 1 61 ? -50.336 -48.507 -15.848 1.00 0.00 ? 61 GLU A H    9  
ATOM 9287  H HA   . GLU A 1 61 ? -47.432 -48.572 -16.132 1.00 0.00 ? 61 GLU A HA   9  
ATOM 9288  H HB2  . GLU A 1 61 ? -49.239 -46.624 -14.678 1.00 0.00 ? 61 GLU A HB2  9  
ATOM 9289  H HB3  . GLU A 1 61 ? -47.503 -46.428 -14.920 1.00 0.00 ? 61 GLU A HB3  9  
ATOM 9290  H HG2  . GLU A 1 61 ? -49.513 -46.724 -17.168 1.00 0.00 ? 61 GLU A HG2  9  
ATOM 9291  H HG3  . GLU A 1 61 ? -48.880 -45.181 -16.601 1.00 0.00 ? 61 GLU A HG3  9  
ATOM 9292  N N    . ASP A 1 62 ? -48.866 -49.804 -13.615 1.00 0.00 ? 62 ASP A N    9  
ATOM 9293  C CA   . ASP A 1 62 ? -48.691 -50.440 -12.315 1.00 0.00 ? 62 ASP A CA   9  
ATOM 9294  C C    . ASP A 1 62 ? -47.431 -51.302 -12.303 1.00 0.00 ? 62 ASP A C    9  
ATOM 9295  O O    . ASP A 1 62 ? -46.670 -51.288 -11.336 1.00 0.00 ? 62 ASP A O    9  
ATOM 9296  C CB   . ASP A 1 62 ? -49.908 -51.308 -11.989 1.00 0.00 ? 62 ASP A CB   9  
ATOM 9297  C CG   . ASP A 1 62 ? -49.765 -51.903 -10.593 1.00 0.00 ? 62 ASP A CG   9  
ATOM 9298  O OD1  . ASP A 1 62 ? -48.701 -51.753 -10.012 1.00 0.00 ? 62 ASP A OD1  9  
ATOM 9299  O OD2  . ASP A 1 62 ? -50.719 -52.501 -10.126 1.00 0.00 ? 62 ASP A OD2  9  
ATOM 9300  H H    . ASP A 1 62 ? -49.674 -49.991 -14.138 1.00 0.00 ? 62 ASP A H    9  
ATOM 9301  H HA   . ASP A 1 62 ? -48.598 -49.674 -11.560 1.00 0.00 ? 62 ASP A HA   9  
ATOM 9302  H HB2  . ASP A 1 62 ? -50.801 -50.701 -12.031 1.00 0.00 ? 62 ASP A HB2  9  
ATOM 9303  H HB3  . ASP A 1 62 ? -49.982 -52.107 -12.713 1.00 0.00 ? 62 ASP A HB3  9  
ATOM 9304  N N    . GLU A 1 63 ? -47.222 -52.052 -13.381 1.00 0.00 ? 63 GLU A N    9  
ATOM 9305  C CA   . GLU A 1 63 ? -46.051 -52.920 -13.487 1.00 0.00 ? 63 GLU A CA   9  
ATOM 9306  C C    . GLU A 1 63 ? -45.347 -52.714 -14.825 1.00 0.00 ? 63 GLU A C    9  
ATOM 9307  O O    . GLU A 1 63 ? -45.521 -53.504 -15.754 1.00 0.00 ? 63 GLU A O    9  
ATOM 9308  C CB   . GLU A 1 63 ? -46.480 -54.382 -13.356 1.00 0.00 ? 63 GLU A CB   9  
ATOM 9309  C CG   . GLU A 1 63 ? -45.239 -55.273 -13.270 1.00 0.00 ? 63 GLU A CG   9  
ATOM 9310  C CD   . GLU A 1 63 ? -45.653 -56.730 -13.099 1.00 0.00 ? 63 GLU A CD   9  
ATOM 9311  O OE1  . GLU A 1 63 ? -46.843 -56.978 -12.997 1.00 0.00 ? 63 GLU A OE1  9  
ATOM 9312  O OE2  . GLU A 1 63 ? -44.774 -57.574 -13.071 1.00 0.00 ? 63 GLU A OE2  9  
ATOM 9313  H H    . GLU A 1 63 ? -47.864 -52.023 -14.120 1.00 0.00 ? 63 GLU A H    9  
ATOM 9314  H HA   . GLU A 1 63 ? -45.366 -52.689 -12.684 1.00 0.00 ? 63 GLU A HA   9  
ATOM 9315  H HB2  . GLU A 1 63 ? -47.075 -54.505 -12.463 1.00 0.00 ? 63 GLU A HB2  9  
ATOM 9316  H HB3  . GLU A 1 63 ? -47.064 -54.664 -14.220 1.00 0.00 ? 63 GLU A HB3  9  
ATOM 9317  H HG2  . GLU A 1 63 ? -44.660 -55.168 -14.176 1.00 0.00 ? 63 GLU A HG2  9  
ATOM 9318  H HG3  . GLU A 1 63 ? -44.640 -54.970 -12.425 1.00 0.00 ? 63 GLU A HG3  9  
ATOM 9319  N N    . PRO A 1 64 ? -44.562 -51.674 -14.943 1.00 0.00 ? 64 PRO A N    9  
ATOM 9320  C CA   . PRO A 1 64 ? -43.818 -51.364 -16.200 1.00 0.00 ? 64 PRO A CA   9  
ATOM 9321  C C    . PRO A 1 64 ? -42.989 -52.550 -16.683 1.00 0.00 ? 64 PRO A C    9  
ATOM 9322  O O    . PRO A 1 64 ? -42.984 -52.798 -17.878 1.00 0.00 ? 64 PRO A O    9  
ATOM 9323  C CB   . PRO A 1 64 ? -42.915 -50.187 -15.818 1.00 0.00 ? 64 PRO A CB   9  
ATOM 9324  C CG   . PRO A 1 64 ? -43.552 -49.563 -14.620 1.00 0.00 ? 64 PRO A CG   9  
ATOM 9325  C CD   . PRO A 1 64 ? -44.298 -50.680 -13.891 1.00 0.00 ? 64 PRO A CD   9  
ATOM 9326  O OXT  . PRO A 1 64 ? -42.370 -53.193 -15.850 1.00 0.00 ? 64 PRO A OXT  9  
ATOM 9327  H HA   . PRO A 1 64 ? -44.505 -51.052 -16.970 1.00 0.00 ? 64 PRO A HA   9  
ATOM 9328  H HB2  . PRO A 1 64 ? -41.924 -50.542 -15.575 1.00 0.00 ? 64 PRO A HB2  9  
ATOM 9329  H HB3  . PRO A 1 64 ? -42.871 -49.473 -16.625 1.00 0.00 ? 64 PRO A HB3  9  
ATOM 9330  H HG2  . PRO A 1 64 ? -42.791 -49.140 -13.978 1.00 0.00 ? 64 PRO A HG2  9  
ATOM 9331  H HG3  . PRO A 1 64 ? -44.250 -48.800 -14.926 1.00 0.00 ? 64 PRO A HG3  9  
ATOM 9332  H HD2  . PRO A 1 64 ? -43.678 -51.102 -13.113 1.00 0.00 ? 64 PRO A HD2  9  
ATOM 9333  H HD3  . PRO A 1 64 ? -45.227 -50.313 -13.484 1.00 0.00 ? 64 PRO A HD3  9  
ATOM 9334  N N    . LEU A 1 1  ? -9.849  -11.514 -9.639  1.00 0.00 ? 1  LEU A N    10 
ATOM 9335  C CA   . LEU A 1 1  ? -9.733  -11.895 -11.074 1.00 0.00 ? 1  LEU A CA   10 
ATOM 9336  C C    . LEU A 1 1  ? -10.822 -12.908 -11.416 1.00 0.00 ? 1  LEU A C    10 
ATOM 9337  O O    . LEU A 1 1  ? -11.470 -12.811 -12.458 1.00 0.00 ? 1  LEU A O    10 
ATOM 9338  C CB   . LEU A 1 1  ? -8.351  -12.513 -11.324 1.00 0.00 ? 1  LEU A CB   10 
ATOM 9339  C CG   . LEU A 1 1  ? -7.627  -11.764 -12.450 1.00 0.00 ? 1  LEU A CG   10 
ATOM 9340  C CD1  . LEU A 1 1  ? -8.470  -11.804 -13.727 1.00 0.00 ? 1  LEU A CD1  10 
ATOM 9341  C CD2  . LEU A 1 1  ? -7.394  -10.309 -12.033 1.00 0.00 ? 1  LEU A CD2  10 
ATOM 9342  H H1   . LEU A 1 1  ? -9.759  -10.482 -9.546  1.00 0.00 ? 1  LEU A H1   10 
ATOM 9343  H H2   . LEU A 1 1  ? -9.095  -11.980 -9.095  1.00 0.00 ? 1  LEU A H2   10 
ATOM 9344  H H3   . LEU A 1 1  ? -10.777 -11.812 -9.274  1.00 0.00 ? 1  LEU A H3   10 
ATOM 9345  H HA   . LEU A 1 1  ? -9.858  -11.018 -11.688 1.00 0.00 ? 1  LEU A HA   10 
ATOM 9346  H HB2  . LEU A 1 1  ? -7.765  -12.451 -10.419 1.00 0.00 ? 1  LEU A HB2  10 
ATOM 9347  H HB3  . LEU A 1 1  ? -8.468  -13.549 -11.603 1.00 0.00 ? 1  LEU A HB3  10 
ATOM 9348  H HG   . LEU A 1 1  ? -6.675  -12.241 -12.638 1.00 0.00 ? 1  LEU A HG   10 
ATOM 9349  H HD11 . LEU A 1 1  ? -9.255  -12.539 -13.617 1.00 0.00 ? 1  LEU A HD11 10 
ATOM 9350  H HD12 . LEU A 1 1  ? -7.843  -12.070 -14.564 1.00 0.00 ? 1  LEU A HD12 10 
ATOM 9351  H HD13 . LEU A 1 1  ? -8.909  -10.833 -13.898 1.00 0.00 ? 1  LEU A HD13 10 
ATOM 9352  H HD21 . LEU A 1 1  ? -7.947  -9.655  -12.690 1.00 0.00 ? 1  LEU A HD21 10 
ATOM 9353  H HD22 . LEU A 1 1  ? -6.340  -10.080 -12.102 1.00 0.00 ? 1  LEU A HD22 10 
ATOM 9354  H HD23 . LEU A 1 1  ? -7.728  -10.167 -11.017 1.00 0.00 ? 1  LEU A HD23 10 
ATOM 9355  N N    . ASP A 1 2  ? -11.019 -13.879 -10.530 1.00 0.00 ? 2  ASP A N    10 
ATOM 9356  C CA   . ASP A 1 2  ? -12.032 -14.904 -10.747 1.00 0.00 ? 2  ASP A CA   10 
ATOM 9357  C C    . ASP A 1 2  ? -13.432 -14.309 -10.638 1.00 0.00 ? 2  ASP A C    10 
ATOM 9358  O O    . ASP A 1 2  ? -13.662 -13.377 -9.867  1.00 0.00 ? 2  ASP A O    10 
ATOM 9359  C CB   . ASP A 1 2  ? -11.868 -16.024 -9.719  1.00 0.00 ? 2  ASP A CB   10 
ATOM 9360  C CG   . ASP A 1 2  ? -10.615 -16.838 -10.026 1.00 0.00 ? 2  ASP A CG   10 
ATOM 9361  O OD1  . ASP A 1 2  ? -10.083 -16.681 -11.113 1.00 0.00 ? 2  ASP A OD1  10 
ATOM 9362  O OD2  . ASP A 1 2  ? -10.207 -17.607 -9.172  1.00 0.00 ? 2  ASP A OD2  10 
ATOM 9363  H H    . ASP A 1 2  ? -10.473 -13.906 -9.717  1.00 0.00 ? 2  ASP A H    10 
ATOM 9364  H HA   . ASP A 1 2  ? -11.904 -15.319 -11.736 1.00 0.00 ? 2  ASP A HA   10 
ATOM 9365  H HB2  . ASP A 1 2  ? -11.782 -15.593 -8.732  1.00 0.00 ? 2  ASP A HB2  10 
ATOM 9366  H HB3  . ASP A 1 2  ? -12.731 -16.670 -9.753  1.00 0.00 ? 2  ASP A HB3  10 
ATOM 9367  N N    . ARG A 1 3  ? -14.365 -14.853 -11.414 1.00 0.00 ? 3  ARG A N    10 
ATOM 9368  C CA   . ARG A 1 3  ? -15.740 -14.366 -11.397 1.00 0.00 ? 3  ARG A CA   10 
ATOM 9369  C C    . ARG A 1 3  ? -16.677 -15.368 -12.066 1.00 0.00 ? 3  ARG A C    10 
ATOM 9370  O O    . ARG A 1 3  ? -17.202 -15.110 -13.149 1.00 0.00 ? 3  ARG A O    10 
ATOM 9371  C CB   . ARG A 1 3  ? -15.829 -13.017 -12.116 1.00 0.00 ? 3  ARG A CB   10 
ATOM 9372  C CG   . ARG A 1 3  ? -15.043 -13.074 -13.430 1.00 0.00 ? 3  ARG A CG   10 
ATOM 9373  C CD   . ARG A 1 3  ? -15.113 -11.714 -14.126 1.00 0.00 ? 3  ARG A CD   10 
ATOM 9374  N NE   . ARG A 1 3  ? -14.424 -10.704 -13.332 1.00 0.00 ? 3  ARG A NE   10 
ATOM 9375  C CZ   . ARG A 1 3  ? -13.102 -10.571 -13.384 1.00 0.00 ? 3  ARG A CZ   10 
ATOM 9376  N NH1  . ARG A 1 3  ? -12.399 -11.353 -14.156 1.00 0.00 ? 3  ARG A NH1  10 
ATOM 9377  N NH2  . ARG A 1 3  ? -12.510 -9.657  -12.665 1.00 0.00 ? 3  ARG A NH2  10 
ATOM 9378  H H    . ARG A 1 3  ? -14.123 -15.594 -12.009 1.00 0.00 ? 3  ARG A H    10 
ATOM 9379  H HA   . ARG A 1 3  ? -16.049 -14.231 -10.370 1.00 0.00 ? 3  ARG A HA   10 
ATOM 9380  H HB2  . ARG A 1 3  ? -16.865 -12.791 -12.328 1.00 0.00 ? 3  ARG A HB2  10 
ATOM 9381  H HB3  . ARG A 1 3  ? -15.416 -12.245 -11.487 1.00 0.00 ? 3  ARG A HB3  10 
ATOM 9382  H HG2  . ARG A 1 3  ? -14.011 -13.318 -13.222 1.00 0.00 ? 3  ARG A HG2  10 
ATOM 9383  H HG3  . ARG A 1 3  ? -15.467 -13.828 -14.075 1.00 0.00 ? 3  ARG A HG3  10 
ATOM 9384  H HD2  . ARG A 1 3  ? -14.645 -11.783 -15.096 1.00 0.00 ? 3  ARG A HD2  10 
ATOM 9385  H HD3  . ARG A 1 3  ? -16.148 -11.430 -14.250 1.00 0.00 ? 3  ARG A HD3  10 
ATOM 9386  H HE   . ARG A 1 3  ? -14.945 -10.111 -12.750 1.00 0.00 ? 3  ARG A HE   10 
ATOM 9387  H HH11 . ARG A 1 3  ? -12.853 -12.052 -14.708 1.00 0.00 ? 3  ARG A HH11 10 
ATOM 9388  H HH12 . ARG A 1 3  ? -11.404 -11.253 -14.195 1.00 0.00 ? 3  ARG A HH12 10 
ATOM 9389  H HH21 . ARG A 1 3  ? -13.050 -9.059  -12.073 1.00 0.00 ? 3  ARG A HH21 10 
ATOM 9390  H HH22 . ARG A 1 3  ? -11.516 -9.558  -12.703 1.00 0.00 ? 3  ARG A HH22 10 
ATOM 9391  N N    . TRP A 1 4  ? -16.886 -16.509 -11.411 1.00 0.00 ? 4  TRP A N    10 
ATOM 9392  C CA   . TRP A 1 4  ? -17.765 -17.545 -11.950 1.00 0.00 ? 4  TRP A CA   10 
ATOM 9393  C C    . TRP A 1 4  ? -18.970 -17.751 -11.038 1.00 0.00 ? 4  TRP A C    10 
ATOM 9394  O O    . TRP A 1 4  ? -19.876 -18.522 -11.353 1.00 0.00 ? 4  TRP A O    10 
ATOM 9395  C CB   . TRP A 1 4  ? -17.002 -18.865 -12.078 1.00 0.00 ? 4  TRP A CB   10 
ATOM 9396  C CG   . TRP A 1 4  ? -17.009 -19.574 -10.762 1.00 0.00 ? 4  TRP A CG   10 
ATOM 9397  C CD1  . TRP A 1 4  ? -17.871 -20.558 -10.418 1.00 0.00 ? 4  TRP A CD1  10 
ATOM 9398  C CD2  . TRP A 1 4  ? -16.139 -19.373 -9.611  1.00 0.00 ? 4  TRP A CD2  10 
ATOM 9399  N NE1  . TRP A 1 4  ? -17.585 -20.976 -9.132  1.00 0.00 ? 4  TRP A NE1  10 
ATOM 9400  C CE2  . TRP A 1 4  ? -16.525 -20.275 -8.591  1.00 0.00 ? 4  TRP A CE2  10 
ATOM 9401  C CE3  . TRP A 1 4  ? -15.062 -18.506 -9.355  1.00 0.00 ? 4  TRP A CE3  10 
ATOM 9402  C CZ2  . TRP A 1 4  ? -15.867 -20.316 -7.362  1.00 0.00 ? 4  TRP A CZ2  10 
ATOM 9403  C CZ3  . TRP A 1 4  ? -14.398 -18.543 -8.117  1.00 0.00 ? 4  TRP A CZ3  10 
ATOM 9404  C CH2  . TRP A 1 4  ? -14.799 -19.446 -7.124  1.00 0.00 ? 4  TRP A CH2  10 
ATOM 9405  H H    . TRP A 1 4  ? -16.444 -16.656 -10.549 1.00 0.00 ? 4  TRP A H    10 
ATOM 9406  H HA   . TRP A 1 4  ? -18.111 -17.246 -12.926 1.00 0.00 ? 4  TRP A HA   10 
ATOM 9407  H HB2  . TRP A 1 4  ? -17.478 -19.485 -12.825 1.00 0.00 ? 4  TRP A HB2  10 
ATOM 9408  H HB3  . TRP A 1 4  ? -15.983 -18.664 -12.374 1.00 0.00 ? 4  TRP A HB3  10 
ATOM 9409  H HD1  . TRP A 1 4  ? -18.656 -20.954 -11.047 1.00 0.00 ? 4  TRP A HD1  10 
ATOM 9410  H HE1  . TRP A 1 4  ? -18.063 -21.680 -8.645  1.00 0.00 ? 4  TRP A HE1  10 
ATOM 9411  H HE3  . TRP A 1 4  ? -14.744 -17.807 -10.114 1.00 0.00 ? 4  TRP A HE3  10 
ATOM 9412  H HZ2  . TRP A 1 4  ? -16.182 -21.014 -6.599  1.00 0.00 ? 4  TRP A HZ2  10 
ATOM 9413  H HZ3  . TRP A 1 4  ? -13.572 -17.873 -7.931  1.00 0.00 ? 4  TRP A HZ3  10 
ATOM 9414  H HH2  . TRP A 1 4  ? -14.285 -19.470 -6.174  1.00 0.00 ? 4  TRP A HH2  10 
ATOM 9415  N N    . TYR A 1 5  ? -18.969 -17.064 -9.899  1.00 0.00 ? 5  TYR A N    10 
ATOM 9416  C CA   . TYR A 1 5  ? -20.063 -17.186 -8.942  1.00 0.00 ? 5  TYR A CA   10 
ATOM 9417  C C    . TYR A 1 5  ? -21.286 -16.401 -9.408  1.00 0.00 ? 5  TYR A C    10 
ATOM 9418  O O    . TYR A 1 5  ? -21.238 -15.696 -10.417 1.00 0.00 ? 5  TYR A O    10 
ATOM 9419  C CB   . TYR A 1 5  ? -19.615 -16.680 -7.569  1.00 0.00 ? 5  TYR A CB   10 
ATOM 9420  C CG   . TYR A 1 5  ? -19.239 -15.221 -7.665  1.00 0.00 ? 5  TYR A CG   10 
ATOM 9421  C CD1  . TYR A 1 5  ? -17.926 -14.855 -7.983  1.00 0.00 ? 5  TYR A CD1  10 
ATOM 9422  C CD2  . TYR A 1 5  ? -20.204 -14.232 -7.436  1.00 0.00 ? 5  TYR A CD2  10 
ATOM 9423  C CE1  . TYR A 1 5  ? -17.578 -13.502 -8.073  1.00 0.00 ? 5  TYR A CE1  10 
ATOM 9424  C CE2  . TYR A 1 5  ? -19.858 -12.880 -7.526  1.00 0.00 ? 5  TYR A CE2  10 
ATOM 9425  C CZ   . TYR A 1 5  ? -18.544 -12.515 -7.845  1.00 0.00 ? 5  TYR A CZ   10 
ATOM 9426  O OH   . TYR A 1 5  ? -18.201 -11.181 -7.933  1.00 0.00 ? 5  TYR A OH   10 
ATOM 9427  H H    . TYR A 1 5  ? -18.217 -16.468 -9.697  1.00 0.00 ? 5  TYR A H    10 
ATOM 9428  H HA   . TYR A 1 5  ? -20.332 -18.228 -8.854  1.00 0.00 ? 5  TYR A HA   10 
ATOM 9429  H HB2  . TYR A 1 5  ? -20.424 -16.797 -6.862  1.00 0.00 ? 5  TYR A HB2  10 
ATOM 9430  H HB3  . TYR A 1 5  ? -18.760 -17.249 -7.236  1.00 0.00 ? 5  TYR A HB3  10 
ATOM 9431  H HD1  . TYR A 1 5  ? -17.181 -15.617 -8.159  1.00 0.00 ? 5  TYR A HD1  10 
ATOM 9432  H HD2  . TYR A 1 5  ? -21.217 -14.516 -7.189  1.00 0.00 ? 5  TYR A HD2  10 
ATOM 9433  H HE1  . TYR A 1 5  ? -16.565 -13.220 -8.318  1.00 0.00 ? 5  TYR A HE1  10 
ATOM 9434  H HE2  . TYR A 1 5  ? -20.602 -12.118 -7.349  1.00 0.00 ? 5  TYR A HE2  10 
ATOM 9435  H HH   . TYR A 1 5  ? -17.362 -11.121 -8.397  1.00 0.00 ? 5  TYR A HH   10 
ATOM 9436  N N    . LEU A 1 6  ? -22.383 -16.545 -8.668  1.00 0.00 ? 6  LEU A N    10 
ATOM 9437  C CA   . LEU A 1 6  ? -23.629 -15.861 -9.008  1.00 0.00 ? 6  LEU A CA   10 
ATOM 9438  C C    . LEU A 1 6  ? -23.350 -14.452 -9.524  1.00 0.00 ? 6  LEU A C    10 
ATOM 9439  O O    . LEU A 1 6  ? -22.425 -13.782 -9.065  1.00 0.00 ? 6  LEU A O    10 
ATOM 9440  C CB   . LEU A 1 6  ? -24.536 -15.793 -7.777  1.00 0.00 ? 6  LEU A CB   10 
ATOM 9441  C CG   . LEU A 1 6  ? -25.488 -16.991 -7.780  1.00 0.00 ? 6  LEU A CG   10 
ATOM 9442  C CD1  . LEU A 1 6  ? -24.677 -18.288 -7.797  1.00 0.00 ? 6  LEU A CD1  10 
ATOM 9443  C CD2  . LEU A 1 6  ? -26.356 -16.952 -6.519  1.00 0.00 ? 6  LEU A CD2  10 
ATOM 9444  H H    . LEU A 1 6  ? -22.353 -17.135 -7.887  1.00 0.00 ? 6  LEU A H    10 
ATOM 9445  H HA   . LEU A 1 6  ? -24.133 -16.422 -9.781  1.00 0.00 ? 6  LEU A HA   10 
ATOM 9446  H HB2  . LEU A 1 6  ? -23.931 -15.812 -6.883  1.00 0.00 ? 6  LEU A HB2  10 
ATOM 9447  H HB3  . LEU A 1 6  ? -25.111 -14.878 -7.805  1.00 0.00 ? 6  LEU A HB3  10 
ATOM 9448  H HG   . LEU A 1 6  ? -26.119 -16.950 -8.656  1.00 0.00 ? 6  LEU A HG   10 
ATOM 9449  H HD11 . LEU A 1 6  ? -24.470 -18.569 -8.818  1.00 0.00 ? 6  LEU A HD11 10 
ATOM 9450  H HD12 . LEU A 1 6  ? -25.241 -19.072 -7.313  1.00 0.00 ? 6  LEU A HD12 10 
ATOM 9451  H HD13 . LEU A 1 6  ? -23.747 -18.137 -7.269  1.00 0.00 ? 6  LEU A HD13 10 
ATOM 9452  H HD21 . LEU A 1 6  ? -26.094 -17.779 -5.876  1.00 0.00 ? 6  LEU A HD21 10 
ATOM 9453  H HD22 . LEU A 1 6  ? -27.397 -17.027 -6.798  1.00 0.00 ? 6  LEU A HD22 10 
ATOM 9454  H HD23 . LEU A 1 6  ? -26.190 -16.021 -5.997  1.00 0.00 ? 6  LEU A HD23 10 
ATOM 9455  N N    . GLY A 1 7  ? -24.144 -14.019 -10.497 1.00 0.00 ? 7  GLY A N    10 
ATOM 9456  C CA   . GLY A 1 7  ? -23.966 -12.697 -11.091 1.00 0.00 ? 7  GLY A CA   10 
ATOM 9457  C C    . GLY A 1 7  ? -23.028 -12.790 -12.289 1.00 0.00 ? 7  GLY A C    10 
ATOM 9458  O O    . GLY A 1 7  ? -22.876 -11.839 -13.055 1.00 0.00 ? 7  GLY A O    10 
ATOM 9459  H H    . GLY A 1 7  ? -24.856 -14.603 -10.833 1.00 0.00 ? 7  GLY A H    10 
ATOM 9460  H HA2  . GLY A 1 7  ? -24.926 -12.318 -11.412 1.00 0.00 ? 7  GLY A HA2  10 
ATOM 9461  H HA3  . GLY A 1 7  ? -23.541 -12.029 -10.359 1.00 0.00 ? 7  GLY A HA3  10 
ATOM 9462  N N    . GLY A 1 8  ? -22.415 -13.959 -12.439 1.00 0.00 ? 8  GLY A N    10 
ATOM 9463  C CA   . GLY A 1 8  ? -21.498 -14.192 -13.547 1.00 0.00 ? 8  GLY A CA   10 
ATOM 9464  C C    . GLY A 1 8  ? -20.366 -13.170 -13.538 1.00 0.00 ? 8  GLY A C    10 
ATOM 9465  O O    . GLY A 1 8  ? -19.584 -13.099 -12.589 1.00 0.00 ? 8  GLY A O    10 
ATOM 9466  H H    . GLY A 1 8  ? -22.605 -14.664 -11.785 1.00 0.00 ? 8  GLY A H    10 
ATOM 9467  H HA2  . GLY A 1 8  ? -21.083 -15.186 -13.460 1.00 0.00 ? 8  GLY A HA2  10 
ATOM 9468  H HA3  . GLY A 1 8  ? -22.038 -14.113 -14.478 1.00 0.00 ? 8  GLY A HA3  10 
ATOM 9469  N N    . SER A 1 9  ? -20.288 -12.383 -14.608 1.00 0.00 ? 9  SER A N    10 
ATOM 9470  C CA   . SER A 1 9  ? -19.254 -11.360 -14.736 1.00 0.00 ? 9  SER A CA   10 
ATOM 9471  C C    . SER A 1 9  ? -19.897 -9.987  -14.958 1.00 0.00 ? 9  SER A C    10 
ATOM 9472  O O    . SER A 1 9  ? -19.975 -9.512  -16.090 1.00 0.00 ? 9  SER A O    10 
ATOM 9473  C CB   . SER A 1 9  ? -18.350 -11.691 -15.925 1.00 0.00 ? 9  SER A CB   10 
ATOM 9474  O OG   . SER A 1 9  ? -17.735 -12.954 -15.710 1.00 0.00 ? 9  SER A OG   10 
ATOM 9475  H H    . SER A 1 9  ? -20.943 -12.491 -15.329 1.00 0.00 ? 9  SER A H    10 
ATOM 9476  H HA   . SER A 1 9  ? -18.657 -11.344 -13.842 1.00 0.00 ? 9  SER A HA   10 
ATOM 9477  H HB2  . SER A 1 9  ? -18.937 -11.731 -16.826 1.00 0.00 ? 9  SER A HB2  10 
ATOM 9478  H HB3  . SER A 1 9  ? -17.594 -10.922 -16.024 1.00 0.00 ? 9  SER A HB3  10 
ATOM 9479  H HG   . SER A 1 9  ? -16.860 -12.928 -16.101 1.00 0.00 ? 9  SER A HG   10 
ATOM 9480  N N    . PRO A 1 10 ? -20.374 -9.355  -13.908 1.00 0.00 ? 10 PRO A N    10 
ATOM 9481  C CA   . PRO A 1 10 ? -21.042 -8.022  -14.012 1.00 0.00 ? 10 PRO A CA   10 
ATOM 9482  C C    . PRO A 1 10 ? -20.057 -6.878  -14.246 1.00 0.00 ? 10 PRO A C    10 
ATOM 9483  O O    . PRO A 1 10 ? -18.862 -7.008  -13.985 1.00 0.00 ? 10 PRO A O    10 
ATOM 9484  C CB   . PRO A 1 10 ? -21.759 -7.880  -12.670 1.00 0.00 ? 10 PRO A CB   10 
ATOM 9485  C CG   . PRO A 1 10 ? -20.940 -8.672  -11.710 1.00 0.00 ? 10 PRO A CG   10 
ATOM 9486  C CD   . PRO A 1 10 ? -20.328 -9.825  -12.508 1.00 0.00 ? 10 PRO A CD   10 
ATOM 9487  H HA   . PRO A 1 10 ? -21.775 -8.041  -14.802 1.00 0.00 ? 10 PRO A HA   10 
ATOM 9488  H HB2  . PRO A 1 10 ? -21.791 -6.841  -12.372 1.00 0.00 ? 10 PRO A HB2  10 
ATOM 9489  H HB3  . PRO A 1 10 ? -22.756 -8.289  -12.729 1.00 0.00 ? 10 PRO A HB3  10 
ATOM 9490  H HG2  . PRO A 1 10 ? -20.160 -8.051  -11.291 1.00 0.00 ? 10 PRO A HG2  10 
ATOM 9491  H HG3  . PRO A 1 10 ? -21.565 -9.066  -10.925 1.00 0.00 ? 10 PRO A HG3  10 
ATOM 9492  H HD2  . PRO A 1 10 ? -19.308 -9.987  -12.185 1.00 0.00 ? 10 PRO A HD2  10 
ATOM 9493  H HD3  . PRO A 1 10 ? -20.914 -10.723 -12.392 1.00 0.00 ? 10 PRO A HD3  10 
ATOM 9494  N N    . LYS A 1 11 ? -20.582 -5.758  -14.733 1.00 0.00 ? 11 LYS A N    10 
ATOM 9495  C CA   . LYS A 1 11 ? -19.750 -4.588  -14.993 1.00 0.00 ? 11 LYS A CA   10 
ATOM 9496  C C    . LYS A 1 11 ? -19.765 -3.643  -13.795 1.00 0.00 ? 11 LYS A C    10 
ATOM 9497  O O    . LYS A 1 11 ? -18.842 -2.851  -13.605 1.00 0.00 ? 11 LYS A O    10 
ATOM 9498  C CB   . LYS A 1 11 ? -20.258 -3.852  -16.234 1.00 0.00 ? 11 LYS A CB   10 
ATOM 9499  C CG   . LYS A 1 11 ? -20.103 -4.753  -17.461 1.00 0.00 ? 11 LYS A CG   10 
ATOM 9500  C CD   . LYS A 1 11 ? -20.606 -4.016  -18.704 1.00 0.00 ? 11 LYS A CD   10 
ATOM 9501  C CE   . LYS A 1 11 ? -20.491 -4.932  -19.922 1.00 0.00 ? 11 LYS A CE   10 
ATOM 9502  N NZ   . LYS A 1 11 ? -19.058 -5.269  -20.158 1.00 0.00 ? 11 LYS A NZ   10 
ATOM 9503  H H    . LYS A 1 11 ? -21.546 -5.726  -14.900 1.00 0.00 ? 11 LYS A H    10 
ATOM 9504  H HA   . LYS A 1 11 ? -18.735 -4.912  -15.172 1.00 0.00 ? 11 LYS A HA   10 
ATOM 9505  H HB2  . LYS A 1 11 ? -21.299 -3.597  -16.101 1.00 0.00 ? 11 LYS A HB2  10 
ATOM 9506  H HB3  . LYS A 1 11 ? -19.682 -2.950  -16.379 1.00 0.00 ? 11 LYS A HB3  10 
ATOM 9507  H HG2  . LYS A 1 11 ? -19.063 -5.011  -17.590 1.00 0.00 ? 11 LYS A HG2  10 
ATOM 9508  H HG3  . LYS A 1 11 ? -20.683 -5.654  -17.321 1.00 0.00 ? 11 LYS A HG3  10 
ATOM 9509  H HD2  . LYS A 1 11 ? -21.639 -3.731  -18.560 1.00 0.00 ? 11 LYS A HD2  10 
ATOM 9510  H HD3  . LYS A 1 11 ? -20.009 -3.130  -18.864 1.00 0.00 ? 11 LYS A HD3  10 
ATOM 9511  H HE2  . LYS A 1 11 ? -21.049 -5.839  -19.744 1.00 0.00 ? 11 LYS A HE2  10 
ATOM 9512  H HE3  . LYS A 1 11 ? -20.890 -4.429  -20.790 1.00 0.00 ? 11 LYS A HE3  10 
ATOM 9513  H HZ1  . LYS A 1 11 ? -18.637 -5.629  -19.278 1.00 0.00 ? 11 LYS A HZ1  10 
ATOM 9514  H HZ2  . LYS A 1 11 ? -18.548 -4.417  -20.465 1.00 0.00 ? 11 LYS A HZ2  10 
ATOM 9515  H HZ3  . LYS A 1 11 ? -18.990 -5.999  -20.895 1.00 0.00 ? 11 LYS A HZ3  10 
ATOM 9516  N N    . GLY A 1 12 ? -20.815 -3.742  -12.985 1.00 0.00 ? 12 GLY A N    10 
ATOM 9517  C CA   . GLY A 1 12 ? -20.937 -2.900  -11.799 1.00 0.00 ? 12 GLY A CA   10 
ATOM 9518  C C    . GLY A 1 12 ? -21.287 -1.465  -12.178 1.00 0.00 ? 12 GLY A C    10 
ATOM 9519  O O    . GLY A 1 12 ? -21.256 -0.567  -11.336 1.00 0.00 ? 12 GLY A O    10 
ATOM 9520  H H    . GLY A 1 12 ? -21.514 -4.399  -13.185 1.00 0.00 ? 12 GLY A H    10 
ATOM 9521  H HA2  . GLY A 1 12 ? -21.711 -3.299  -11.160 1.00 0.00 ? 12 GLY A HA2  10 
ATOM 9522  H HA3  . GLY A 1 12 ? -19.999 -2.903  -11.263 1.00 0.00 ? 12 GLY A HA3  10 
ATOM 9523  N N    . ASP A 1 13 ? -21.611 -1.253  -13.448 1.00 0.00 ? 13 ASP A N    10 
ATOM 9524  C CA   . ASP A 1 13 ? -21.954 0.082   -13.925 1.00 0.00 ? 13 ASP A CA   10 
ATOM 9525  C C    . ASP A 1 13 ? -23.072 0.024   -14.961 1.00 0.00 ? 13 ASP A C    10 
ATOM 9526  O O    . ASP A 1 13 ? -23.113 0.838   -15.884 1.00 0.00 ? 13 ASP A O    10 
ATOM 9527  C CB   . ASP A 1 13 ? -20.723 0.748   -14.540 1.00 0.00 ? 13 ASP A CB   10 
ATOM 9528  C CG   . ASP A 1 13 ? -20.278 -0.021  -15.780 1.00 0.00 ? 13 ASP A CG   10 
ATOM 9529  O OD1  . ASP A 1 13 ? -20.950 -0.977  -16.132 1.00 0.00 ? 13 ASP A OD1  10 
ATOM 9530  O OD2  . ASP A 1 13 ? -19.275 0.358   -16.361 1.00 0.00 ? 13 ASP A OD2  10 
ATOM 9531  H H    . ASP A 1 13 ? -21.614 -2.006  -14.076 1.00 0.00 ? 13 ASP A H    10 
ATOM 9532  H HA   . ASP A 1 13 ? -22.286 0.677   -13.087 1.00 0.00 ? 13 ASP A HA   10 
ATOM 9533  H HB2  . ASP A 1 13 ? -20.965 1.765   -14.816 1.00 0.00 ? 13 ASP A HB2  10 
ATOM 9534  H HB3  . ASP A 1 13 ? -19.921 0.754   -13.817 1.00 0.00 ? 13 ASP A HB3  10 
ATOM 9535  N N    . VAL A 1 14 ? -23.976 -0.938  -14.809 1.00 0.00 ? 14 VAL A N    10 
ATOM 9536  C CA   . VAL A 1 14 ? -25.082 -1.076  -15.751 1.00 0.00 ? 14 VAL A CA   10 
ATOM 9537  C C    . VAL A 1 14 ? -26.372 -1.443  -15.021 1.00 0.00 ? 14 VAL A C    10 
ATOM 9538  O O    . VAL A 1 14 ? -26.374 -2.279  -14.120 1.00 0.00 ? 14 VAL A O    10 
ATOM 9539  C CB   . VAL A 1 14 ? -24.748 -2.154  -16.785 1.00 0.00 ? 14 VAL A CB   10 
ATOM 9540  C CG1  . VAL A 1 14 ? -24.697 -3.520  -16.101 1.00 0.00 ? 14 VAL A CG1  10 
ATOM 9541  C CG2  . VAL A 1 14 ? -25.817 -2.169  -17.882 1.00 0.00 ? 14 VAL A CG2  10 
ATOM 9542  H H    . VAL A 1 14 ? -23.903 -1.558  -14.054 1.00 0.00 ? 14 VAL A H    10 
ATOM 9543  H HA   . VAL A 1 14 ? -25.226 -0.136  -16.263 1.00 0.00 ? 14 VAL A HA   10 
ATOM 9544  H HB   . VAL A 1 14 ? -23.784 -1.938  -17.224 1.00 0.00 ? 14 VAL A HB   10 
ATOM 9545  H HG11 . VAL A 1 14 ? -24.502 -3.389  -15.047 1.00 0.00 ? 14 VAL A HG11 10 
ATOM 9546  H HG12 . VAL A 1 14 ? -23.907 -4.113  -16.540 1.00 0.00 ? 14 VAL A HG12 10 
ATOM 9547  H HG13 . VAL A 1 14 ? -25.642 -4.025  -16.233 1.00 0.00 ? 14 VAL A HG13 10 
ATOM 9548  H HG21 . VAL A 1 14 ? -26.185 -3.177  -18.010 1.00 0.00 ? 14 VAL A HG21 10 
ATOM 9549  H HG22 . VAL A 1 14 ? -25.385 -1.825  -18.809 1.00 0.00 ? 14 VAL A HG22 10 
ATOM 9550  H HG23 . VAL A 1 14 ? -26.633 -1.520  -17.603 1.00 0.00 ? 14 VAL A HG23 10 
ATOM 9551  N N    . ASP A 1 15 ? -27.469 -0.810  -15.428 1.00 0.00 ? 15 ASP A N    10 
ATOM 9552  C CA   . ASP A 1 15 ? -28.772 -1.068  -14.822 1.00 0.00 ? 15 ASP A CA   10 
ATOM 9553  C C    . ASP A 1 15 ? -29.816 -1.304  -15.914 1.00 0.00 ? 15 ASP A C    10 
ATOM 9554  O O    . ASP A 1 15 ? -30.612 -0.417  -16.221 1.00 0.00 ? 15 ASP A O    10 
ATOM 9555  C CB   . ASP A 1 15 ? -29.192 0.127   -13.966 1.00 0.00 ? 15 ASP A CB   10 
ATOM 9556  C CG   . ASP A 1 15 ? -30.444 -0.218  -13.167 1.00 0.00 ? 15 ASP A CG   10 
ATOM 9557  O OD1  . ASP A 1 15 ? -30.352 -1.064  -12.294 1.00 0.00 ? 15 ASP A OD1  10 
ATOM 9558  O OD2  . ASP A 1 15 ? -31.478 0.369   -13.441 1.00 0.00 ? 15 ASP A OD2  10 
ATOM 9559  H H    . ASP A 1 15 ? -27.405 -0.154  -16.154 1.00 0.00 ? 15 ASP A H    10 
ATOM 9560  H HA   . ASP A 1 15 ? -28.703 -1.940  -14.193 1.00 0.00 ? 15 ASP A HA   10 
ATOM 9561  H HB2  . ASP A 1 15 ? -28.392 0.380   -13.286 1.00 0.00 ? 15 ASP A HB2  10 
ATOM 9562  H HB3  . ASP A 1 15 ? -29.399 0.972   -14.606 1.00 0.00 ? 15 ASP A HB3  10 
ATOM 9563  N N    . PRO A 1 16 ? -29.814 -2.467  -16.518 1.00 0.00 ? 16 PRO A N    10 
ATOM 9564  C CA   . PRO A 1 16 ? -30.767 -2.806  -17.613 1.00 0.00 ? 16 PRO A CA   10 
ATOM 9565  C C    . PRO A 1 16 ? -32.169 -3.136  -17.106 1.00 0.00 ? 16 PRO A C    10 
ATOM 9566  O O    . PRO A 1 16 ? -33.098 -3.293  -17.897 1.00 0.00 ? 16 PRO A O    10 
ATOM 9567  C CB   . PRO A 1 16 ? -30.120 -4.016  -18.282 1.00 0.00 ? 16 PRO A CB   10 
ATOM 9568  C CG   . PRO A 1 16 ? -29.348 -4.690  -17.200 1.00 0.00 ? 16 PRO A CG   10 
ATOM 9569  C CD   . PRO A 1 16 ? -28.908 -3.596  -16.225 1.00 0.00 ? 16 PRO A CD   10 
ATOM 9570  H HA   . PRO A 1 16 ? -30.816 -1.995  -18.323 1.00 0.00 ? 16 PRO A HA   10 
ATOM 9571  H HB2  . PRO A 1 16 ? -30.880 -4.679  -18.675 1.00 0.00 ? 16 PRO A HB2  10 
ATOM 9572  H HB3  . PRO A 1 16 ? -29.453 -3.700  -19.069 1.00 0.00 ? 16 PRO A HB3  10 
ATOM 9573  H HG2  . PRO A 1 16 ? -29.977 -5.411  -16.694 1.00 0.00 ? 16 PRO A HG2  10 
ATOM 9574  H HG3  . PRO A 1 16 ? -28.479 -5.179  -17.612 1.00 0.00 ? 16 PRO A HG3  10 
ATOM 9575  H HD2  . PRO A 1 16 ? -29.036 -3.938  -15.208 1.00 0.00 ? 16 PRO A HD2  10 
ATOM 9576  H HD3  . PRO A 1 16 ? -27.885 -3.311  -16.407 1.00 0.00 ? 16 PRO A HD3  10 
ATOM 9577  N N    . PHE A 1 17 ? -32.318 -3.250  -15.791 1.00 0.00 ? 17 PHE A N    10 
ATOM 9578  C CA   . PHE A 1 17 ? -33.619 -3.572  -15.219 1.00 0.00 ? 17 PHE A CA   10 
ATOM 9579  C C    . PHE A 1 17 ? -34.638 -2.486  -15.552 1.00 0.00 ? 17 PHE A C    10 
ATOM 9580  O O    . PHE A 1 17 ? -35.792 -2.782  -15.864 1.00 0.00 ? 17 PHE A O    10 
ATOM 9581  C CB   . PHE A 1 17 ? -33.502 -3.713  -13.700 1.00 0.00 ? 17 PHE A CB   10 
ATOM 9582  C CG   . PHE A 1 17 ? -32.756 -4.984  -13.368 1.00 0.00 ? 17 PHE A CG   10 
ATOM 9583  C CD1  . PHE A 1 17 ? -33.452 -6.192  -13.240 1.00 0.00 ? 17 PHE A CD1  10 
ATOM 9584  C CD2  . PHE A 1 17 ? -31.368 -4.954  -13.191 1.00 0.00 ? 17 PHE A CD2  10 
ATOM 9585  C CE1  . PHE A 1 17 ? -32.761 -7.370  -12.933 1.00 0.00 ? 17 PHE A CE1  10 
ATOM 9586  C CE2  . PHE A 1 17 ? -30.676 -6.133  -12.882 1.00 0.00 ? 17 PHE A CE2  10 
ATOM 9587  C CZ   . PHE A 1 17 ? -31.372 -7.340  -12.755 1.00 0.00 ? 17 PHE A CZ   10 
ATOM 9588  H H    . PHE A 1 17 ? -31.547 -3.119  -15.199 1.00 0.00 ? 17 PHE A H    10 
ATOM 9589  H HA   . PHE A 1 17 ? -33.959 -4.510  -15.628 1.00 0.00 ? 17 PHE A HA   10 
ATOM 9590  H HB2  . PHE A 1 17 ? -32.966 -2.866  -13.299 1.00 0.00 ? 17 PHE A HB2  10 
ATOM 9591  H HB3  . PHE A 1 17 ? -34.489 -3.755  -13.265 1.00 0.00 ? 17 PHE A HB3  10 
ATOM 9592  H HD1  . PHE A 1 17 ? -34.523 -6.215  -13.378 1.00 0.00 ? 17 PHE A HD1  10 
ATOM 9593  H HD2  . PHE A 1 17 ? -30.830 -4.022  -13.288 1.00 0.00 ? 17 PHE A HD2  10 
ATOM 9594  H HE1  . PHE A 1 17 ? -33.298 -8.301  -12.834 1.00 0.00 ? 17 PHE A HE1  10 
ATOM 9595  H HE2  . PHE A 1 17 ? -29.605 -6.109  -12.744 1.00 0.00 ? 17 PHE A HE2  10 
ATOM 9596  H HZ   . PHE A 1 17 ? -30.839 -8.248  -12.518 1.00 0.00 ? 17 PHE A HZ   10 
ATOM 9597  N N    . TYR A 1 18 ? -34.214 -1.229  -15.470 1.00 0.00 ? 18 TYR A N    10 
ATOM 9598  C CA   . TYR A 1 18 ? -35.120 -0.121  -15.753 1.00 0.00 ? 18 TYR A CA   10 
ATOM 9599  C C    . TYR A 1 18 ? -35.646 -0.211  -17.183 1.00 0.00 ? 18 TYR A C    10 
ATOM 9600  O O    . TYR A 1 18 ? -36.851 -0.108  -17.416 1.00 0.00 ? 18 TYR A O    10 
ATOM 9601  C CB   . TYR A 1 18 ? -34.399 1.213   -15.557 1.00 0.00 ? 18 TYR A CB   10 
ATOM 9602  C CG   . TYR A 1 18 ? -35.322 2.343   -15.949 1.00 0.00 ? 18 TYR A CG   10 
ATOM 9603  C CD1  . TYR A 1 18 ? -36.342 2.745   -15.078 1.00 0.00 ? 18 TYR A CD1  10 
ATOM 9604  C CD2  . TYR A 1 18 ? -35.156 2.987   -17.181 1.00 0.00 ? 18 TYR A CD2  10 
ATOM 9605  C CE1  . TYR A 1 18 ? -37.198 3.792   -15.442 1.00 0.00 ? 18 TYR A CE1  10 
ATOM 9606  C CE2  . TYR A 1 18 ? -36.011 4.033   -17.543 1.00 0.00 ? 18 TYR A CE2  10 
ATOM 9607  C CZ   . TYR A 1 18 ? -37.033 4.436   -16.674 1.00 0.00 ? 18 TYR A CZ   10 
ATOM 9608  O OH   . TYR A 1 18 ? -37.877 5.468   -17.031 1.00 0.00 ? 18 TYR A OH   10 
ATOM 9609  H H    . TYR A 1 18 ? -33.291 -1.057  -15.185 1.00 0.00 ? 18 TYR A H    10 
ATOM 9610  H HA   . TYR A 1 18 ? -35.956 -0.169  -15.071 1.00 0.00 ? 18 TYR A HA   10 
ATOM 9611  H HB2  . TYR A 1 18 ? -34.117 1.320   -14.520 1.00 0.00 ? 18 TYR A HB2  10 
ATOM 9612  H HB3  . TYR A 1 18 ? -33.515 1.239   -16.176 1.00 0.00 ? 18 TYR A HB3  10 
ATOM 9613  H HD1  . TYR A 1 18 ? -36.469 2.248   -14.128 1.00 0.00 ? 18 TYR A HD1  10 
ATOM 9614  H HD2  . TYR A 1 18 ? -34.368 2.676   -17.851 1.00 0.00 ? 18 TYR A HD2  10 
ATOM 9615  H HE1  . TYR A 1 18 ? -37.985 4.102   -14.772 1.00 0.00 ? 18 TYR A HE1  10 
ATOM 9616  H HE2  . TYR A 1 18 ? -35.885 4.531   -18.493 1.00 0.00 ? 18 TYR A HE2  10 
ATOM 9617  H HH   . TYR A 1 18 ? -38.695 5.084   -17.357 1.00 0.00 ? 18 TYR A HH   10 
ATOM 9618  N N    . TYR A 1 19 ? -34.744 -0.406  -18.141 1.00 0.00 ? 19 TYR A N    10 
ATOM 9619  C CA   . TYR A 1 19 ? -35.143 -0.510  -19.542 1.00 0.00 ? 19 TYR A CA   10 
ATOM 9620  C C    . TYR A 1 19 ? -35.902 -1.810  -19.788 1.00 0.00 ? 19 TYR A C    10 
ATOM 9621  O O    . TYR A 1 19 ? -36.829 -1.857  -20.596 1.00 0.00 ? 19 TYR A O    10 
ATOM 9622  C CB   . TYR A 1 19 ? -33.906 -0.458  -20.440 1.00 0.00 ? 19 TYR A CB   10 
ATOM 9623  C CG   . TYR A 1 19 ? -33.327 0.936   -20.420 1.00 0.00 ? 19 TYR A CG   10 
ATOM 9624  C CD1  . TYR A 1 19 ? -33.766 1.888   -21.348 1.00 0.00 ? 19 TYR A CD1  10 
ATOM 9625  C CD2  . TYR A 1 19 ? -32.353 1.277   -19.474 1.00 0.00 ? 19 TYR A CD2  10 
ATOM 9626  C CE1  . TYR A 1 19 ? -33.231 3.182   -21.329 1.00 0.00 ? 19 TYR A CE1  10 
ATOM 9627  C CE2  . TYR A 1 19 ? -31.817 2.569   -19.456 1.00 0.00 ? 19 TYR A CE2  10 
ATOM 9628  C CZ   . TYR A 1 19 ? -32.256 3.523   -20.383 1.00 0.00 ? 19 TYR A CZ   10 
ATOM 9629  O OH   . TYR A 1 19 ? -31.728 4.798   -20.365 1.00 0.00 ? 19 TYR A OH   10 
ATOM 9630  H H    . TYR A 1 19 ? -33.794 -0.467  -17.910 1.00 0.00 ? 19 TYR A H    10 
ATOM 9631  H HA   . TYR A 1 19 ? -35.785 0.322   -19.785 1.00 0.00 ? 19 TYR A HA   10 
ATOM 9632  H HB2  . TYR A 1 19 ? -33.168 -1.160  -20.080 1.00 0.00 ? 19 TYR A HB2  10 
ATOM 9633  H HB3  . TYR A 1 19 ? -34.184 -0.717  -21.451 1.00 0.00 ? 19 TYR A HB3  10 
ATOM 9634  H HD1  . TYR A 1 19 ? -34.518 1.627   -22.077 1.00 0.00 ? 19 TYR A HD1  10 
ATOM 9635  H HD2  . TYR A 1 19 ? -32.014 0.541   -18.759 1.00 0.00 ? 19 TYR A HD2  10 
ATOM 9636  H HE1  . TYR A 1 19 ? -33.568 3.917   -22.045 1.00 0.00 ? 19 TYR A HE1  10 
ATOM 9637  H HE2  . TYR A 1 19 ? -31.066 2.834   -18.727 1.00 0.00 ? 19 TYR A HE2  10 
ATOM 9638  H HH   . TYR A 1 19 ? -31.261 4.937   -21.192 1.00 0.00 ? 19 TYR A HH   10 
ATOM 9639  N N    . ASP A 1 20 ? -35.494 -2.861  -19.088 1.00 0.00 ? 20 ASP A N    10 
ATOM 9640  C CA   . ASP A 1 20 ? -36.133 -4.165  -19.232 1.00 0.00 ? 20 ASP A CA   10 
ATOM 9641  C C    . ASP A 1 20 ? -37.461 -4.205  -18.483 1.00 0.00 ? 20 ASP A C    10 
ATOM 9642  O O    . ASP A 1 20 ? -38.221 -5.164  -18.606 1.00 0.00 ? 20 ASP A O    10 
ATOM 9643  C CB   . ASP A 1 20 ? -35.211 -5.264  -18.703 1.00 0.00 ? 20 ASP A CB   10 
ATOM 9644  C CG   . ASP A 1 20 ? -34.019 -5.439  -19.637 1.00 0.00 ? 20 ASP A CG   10 
ATOM 9645  O OD1  . ASP A 1 20 ? -34.074 -4.924  -20.741 1.00 0.00 ? 20 ASP A OD1  10 
ATOM 9646  O OD2  . ASP A 1 20 ? -33.067 -6.087  -19.233 1.00 0.00 ? 20 ASP A OD2  10 
ATOM 9647  H H    . ASP A 1 20 ? -34.750 -2.759  -18.459 1.00 0.00 ? 20 ASP A H    10 
ATOM 9648  H HA   . ASP A 1 20 ? -36.320 -4.345  -20.280 1.00 0.00 ? 20 ASP A HA   10 
ATOM 9649  H HB2  . ASP A 1 20 ? -34.861 -4.993  -17.719 1.00 0.00 ? 20 ASP A HB2  10 
ATOM 9650  H HB3  . ASP A 1 20 ? -35.759 -6.193  -18.645 1.00 0.00 ? 20 ASP A HB3  10 
ATOM 9651  N N    . TYR A 1 21 ? -37.736 -3.162  -17.704 1.00 0.00 ? 21 TYR A N    10 
ATOM 9652  C CA   . TYR A 1 21 ? -38.977 -3.107  -16.938 1.00 0.00 ? 21 TYR A CA   10 
ATOM 9653  C C    . TYR A 1 21 ? -40.176 -3.111  -17.879 1.00 0.00 ? 21 TYR A C    10 
ATOM 9654  O O    . TYR A 1 21 ? -41.151 -3.825  -17.650 1.00 0.00 ? 21 TYR A O    10 
ATOM 9655  C CB   . TYR A 1 21 ? -39.006 -1.845  -16.076 1.00 0.00 ? 21 TYR A CB   10 
ATOM 9656  C CG   . TYR A 1 21 ? -40.310 -1.786  -15.317 1.00 0.00 ? 21 TYR A CG   10 
ATOM 9657  C CD1  . TYR A 1 21 ? -40.495 -2.585  -14.180 1.00 0.00 ? 21 TYR A CD1  10 
ATOM 9658  C CD2  . TYR A 1 21 ? -41.333 -0.934  -15.747 1.00 0.00 ? 21 TYR A CD2  10 
ATOM 9659  C CE1  . TYR A 1 21 ? -41.704 -2.531  -13.478 1.00 0.00 ? 21 TYR A CE1  10 
ATOM 9660  C CE2  . TYR A 1 21 ? -42.542 -0.879  -15.043 1.00 0.00 ? 21 TYR A CE2  10 
ATOM 9661  C CZ   . TYR A 1 21 ? -42.728 -1.677  -13.908 1.00 0.00 ? 21 TYR A CZ   10 
ATOM 9662  O OH   . TYR A 1 21 ? -43.918 -1.626  -13.213 1.00 0.00 ? 21 TYR A OH   10 
ATOM 9663  H H    . TYR A 1 21 ? -37.094 -2.424  -17.639 1.00 0.00 ? 21 TYR A H    10 
ATOM 9664  H HA   . TYR A 1 21 ? -39.031 -3.971  -16.295 1.00 0.00 ? 21 TYR A HA   10 
ATOM 9665  H HB2  . TYR A 1 21 ? -38.183 -1.866  -15.378 1.00 0.00 ? 21 TYR A HB2  10 
ATOM 9666  H HB3  . TYR A 1 21 ? -38.920 -0.975  -16.709 1.00 0.00 ? 21 TYR A HB3  10 
ATOM 9667  H HD1  . TYR A 1 21 ? -39.705 -3.242  -13.849 1.00 0.00 ? 21 TYR A HD1  10 
ATOM 9668  H HD2  . TYR A 1 21 ? -41.191 -0.317  -16.622 1.00 0.00 ? 21 TYR A HD2  10 
ATOM 9669  H HE1  . TYR A 1 21 ? -41.846 -3.146  -12.601 1.00 0.00 ? 21 TYR A HE1  10 
ATOM 9670  H HE2  . TYR A 1 21 ? -43.332 -0.222  -15.375 1.00 0.00 ? 21 TYR A HE2  10 
ATOM 9671  H HH   . TYR A 1 21 ? -43.989 -0.757  -12.810 1.00 0.00 ? 21 TYR A HH   10 
ATOM 9672  N N    . GLU A 1 22 ? -40.108 -2.306  -18.928 1.00 0.00 ? 22 GLU A N    10 
ATOM 9673  C CA   . GLU A 1 22 ? -41.211 -2.232  -19.878 1.00 0.00 ? 22 GLU A CA   10 
ATOM 9674  C C    . GLU A 1 22 ? -41.462 -3.601  -20.503 1.00 0.00 ? 22 GLU A C    10 
ATOM 9675  O O    . GLU A 1 22 ? -42.610 -4.008  -20.682 1.00 0.00 ? 22 GLU A O    10 
ATOM 9676  C CB   . GLU A 1 22 ? -40.886 -1.218  -20.978 1.00 0.00 ? 22 GLU A CB   10 
ATOM 9677  C CG   . GLU A 1 22 ? -40.922 0.197   -20.397 1.00 0.00 ? 22 GLU A CG   10 
ATOM 9678  C CD   . GLU A 1 22 ? -40.425 1.198   -21.434 1.00 0.00 ? 22 GLU A CD   10 
ATOM 9679  O OE1  . GLU A 1 22 ? -39.867 0.763   -22.428 1.00 0.00 ? 22 GLU A OE1  10 
ATOM 9680  O OE2  . GLU A 1 22 ? -40.610 2.385   -21.219 1.00 0.00 ? 22 GLU A OE2  10 
ATOM 9681  H H    . GLU A 1 22 ? -39.321 -1.735  -19.050 1.00 0.00 ? 22 GLU A H    10 
ATOM 9682  H HA   . GLU A 1 22 ? -42.102 -1.913  -19.359 1.00 0.00 ? 22 GLU A HA   10 
ATOM 9683  H HB2  . GLU A 1 22 ? -39.903 -1.421  -21.375 1.00 0.00 ? 22 GLU A HB2  10 
ATOM 9684  H HB3  . GLU A 1 22 ? -41.618 -1.299  -21.767 1.00 0.00 ? 22 GLU A HB3  10 
ATOM 9685  H HG2  . GLU A 1 22 ? -41.936 0.443   -20.116 1.00 0.00 ? 22 GLU A HG2  10 
ATOM 9686  H HG3  . GLU A 1 22 ? -40.288 0.242   -19.523 1.00 0.00 ? 22 GLU A HG3  10 
ATOM 9687  N N    . THR A 1 23 ? -40.386 -4.313  -20.829 1.00 0.00 ? 23 THR A N    10 
ATOM 9688  C CA   . THR A 1 23 ? -40.518 -5.639  -21.427 1.00 0.00 ? 23 THR A CA   10 
ATOM 9689  C C    . THR A 1 23 ? -41.026 -6.649  -20.398 1.00 0.00 ? 23 THR A C    10 
ATOM 9690  O O    . THR A 1 23 ? -41.830 -7.514  -20.718 1.00 0.00 ? 23 THR A O    10 
ATOM 9691  C CB   . THR A 1 23 ? -39.167 -6.102  -21.974 1.00 0.00 ? 23 THR A CB   10 
ATOM 9692  O OG1  . THR A 1 23 ? -38.216 -6.133  -20.919 1.00 0.00 ? 23 THR A OG1  10 
ATOM 9693  C CG2  . THR A 1 23 ? -38.697 -5.136  -23.062 1.00 0.00 ? 23 THR A CG2  10 
ATOM 9694  H H    . THR A 1 23 ? -39.493 -3.946  -20.664 1.00 0.00 ? 23 THR A H    10 
ATOM 9695  H HA   . THR A 1 23 ? -41.223 -5.585  -22.242 1.00 0.00 ? 23 THR A HA   10 
ATOM 9696  H HB   . THR A 1 23 ? -39.268 -7.090  -22.396 1.00 0.00 ? 23 THR A HB   10 
ATOM 9697  H HG1  . THR A 1 23 ? -37.400 -6.501  -21.266 1.00 0.00 ? 23 THR A HG1  10 
ATOM 9698  H HG21 . THR A 1 23 ? -38.701 -5.641  -24.018 1.00 0.00 ? 23 THR A HG21 10 
ATOM 9699  H HG22 . THR A 1 23 ? -37.696 -4.800  -22.837 1.00 0.00 ? 23 THR A HG22 10 
ATOM 9700  H HG23 . THR A 1 23 ? -39.362 -4.286  -23.101 1.00 0.00 ? 23 THR A HG23 10 
ATOM 9701  N N    . VAL A 1 24 ? -40.539 -6.537  -19.169 1.00 0.00 ? 24 VAL A N    10 
ATOM 9702  C CA   . VAL A 1 24 ? -40.923 -7.461  -18.101 1.00 0.00 ? 24 VAL A CA   10 
ATOM 9703  C C    . VAL A 1 24 ? -42.429 -7.704  -18.078 1.00 0.00 ? 24 VAL A C    10 
ATOM 9704  O O    . VAL A 1 24 ? -42.885 -8.744  -17.610 1.00 0.00 ? 24 VAL A O    10 
ATOM 9705  C CB   . VAL A 1 24 ? -40.463 -6.931  -16.740 1.00 0.00 ? 24 VAL A CB   10 
ATOM 9706  C CG1  . VAL A 1 24 ? -41.165 -7.710  -15.627 1.00 0.00 ? 24 VAL A CG1  10 
ATOM 9707  C CG2  . VAL A 1 24 ? -38.949 -7.120  -16.607 1.00 0.00 ? 24 VAL A CG2  10 
ATOM 9708  H H    . VAL A 1 24 ? -39.870 -5.843  -18.983 1.00 0.00 ? 24 VAL A H    10 
ATOM 9709  H HA   . VAL A 1 24 ? -40.432 -8.407  -18.279 1.00 0.00 ? 24 VAL A HA   10 
ATOM 9710  H HB   . VAL A 1 24 ? -40.709 -5.885  -16.657 1.00 0.00 ? 24 VAL A HB   10 
ATOM 9711  H HG11 . VAL A 1 24 ? -41.235 -8.752  -15.905 1.00 0.00 ? 24 VAL A HG11 10 
ATOM 9712  H HG12 . VAL A 1 24 ? -42.158 -7.310  -15.478 1.00 0.00 ? 24 VAL A HG12 10 
ATOM 9713  H HG13 . VAL A 1 24 ? -40.599 -7.619  -14.712 1.00 0.00 ? 24 VAL A HG13 10 
ATOM 9714  H HG21 . VAL A 1 24 ? -38.514 -7.259  -17.586 1.00 0.00 ? 24 VAL A HG21 10 
ATOM 9715  H HG22 . VAL A 1 24 ? -38.748 -7.989  -15.997 1.00 0.00 ? 24 VAL A HG22 10 
ATOM 9716  H HG23 . VAL A 1 24 ? -38.516 -6.247  -16.142 1.00 0.00 ? 24 VAL A HG23 10 
ATOM 9717  N N    . ARG A 1 25 ? -43.200 -6.765  -18.601 1.00 0.00 ? 25 ARG A N    10 
ATOM 9718  C CA   . ARG A 1 25 ? -44.645 -6.960  -18.641 1.00 0.00 ? 25 ARG A CA   10 
ATOM 9719  C C    . ARG A 1 25 ? -44.995 -8.025  -19.691 1.00 0.00 ? 25 ARG A C    10 
ATOM 9720  O O    . ARG A 1 25 ? -45.684 -9.003  -19.402 1.00 0.00 ? 25 ARG A O    10 
ATOM 9721  C CB   . ARG A 1 25 ? -45.345 -5.643  -18.987 1.00 0.00 ? 25 ARG A CB   10 
ATOM 9722  C CG   . ARG A 1 25 ? -46.863 -5.841  -18.964 1.00 0.00 ? 25 ARG A CG   10 
ATOM 9723  C CD   . ARG A 1 25 ? -47.553 -4.517  -19.290 1.00 0.00 ? 25 ARG A CD   10 
ATOM 9724  N NE   . ARG A 1 25 ? -47.252 -3.529  -18.262 1.00 0.00 ? 25 ARG A NE   10 
ATOM 9725  C CZ   . ARG A 1 25 ? -47.931 -3.497  -17.119 1.00 0.00 ? 25 ARG A CZ   10 
ATOM 9726  N NH1  . ARG A 1 25 ? -48.892 -4.354  -16.908 1.00 0.00 ? 25 ARG A NH1  10 
ATOM 9727  N NH2  . ARG A 1 25 ? -47.638 -2.607  -16.210 1.00 0.00 ? 25 ARG A NH2  10 
ATOM 9728  H H    . ARG A 1 25 ? -42.775 -5.983  -19.011 1.00 0.00 ? 25 ARG A H    10 
ATOM 9729  H HA   . ARG A 1 25 ? -44.984 -7.295  -17.672 1.00 0.00 ? 25 ARG A HA   10 
ATOM 9730  H HB2  . ARG A 1 25 ? -45.069 -4.889  -18.264 1.00 0.00 ? 25 ARG A HB2  10 
ATOM 9731  H HB3  . ARG A 1 25 ? -45.041 -5.321  -19.973 1.00 0.00 ? 25 ARG A HB3  10 
ATOM 9732  H HG2  . ARG A 1 25 ? -47.143 -6.582  -19.698 1.00 0.00 ? 25 ARG A HG2  10 
ATOM 9733  H HG3  . ARG A 1 25 ? -47.169 -6.171  -17.982 1.00 0.00 ? 25 ARG A HG3  10 
ATOM 9734  H HD2  . ARG A 1 25 ? -47.202 -4.155  -20.244 1.00 0.00 ? 25 ARG A HD2  10 
ATOM 9735  H HD3  . ARG A 1 25 ? -48.621 -4.674  -19.338 1.00 0.00 ? 25 ARG A HD3  10 
ATOM 9736  H HE   . ARG A 1 25 ? -46.534 -2.879  -18.412 1.00 0.00 ? 25 ARG A HE   10 
ATOM 9737  H HH11 . ARG A 1 25 ? -49.118 -5.034  -17.604 1.00 0.00 ? 25 ARG A HH11 10 
ATOM 9738  H HH12 . ARG A 1 25 ? -49.403 -4.328  -16.048 1.00 0.00 ? 25 ARG A HH12 10 
ATOM 9739  H HH21 . ARG A 1 25 ? -46.901 -1.951  -16.374 1.00 0.00 ? 25 ARG A HH21 10 
ATOM 9740  H HH22 . ARG A 1 25 ? -48.149 -2.584  -15.351 1.00 0.00 ? 25 ARG A HH22 10 
ATOM 9741  N N    . ASN A 1 26 ? -44.515 -7.802  -20.910 1.00 0.00 ? 26 ASN A N    10 
ATOM 9742  C CA   . ASN A 1 26 ? -44.770 -8.712  -22.029 1.00 0.00 ? 26 ASN A CA   10 
ATOM 9743  C C    . ASN A 1 26 ? -43.667 -9.761  -22.180 1.00 0.00 ? 26 ASN A C    10 
ATOM 9744  O O    . ASN A 1 26 ? -43.732 -10.613 -23.070 1.00 0.00 ? 26 ASN A O    10 
ATOM 9745  C CB   . ASN A 1 26 ? -44.887 -7.911  -23.327 1.00 0.00 ? 26 ASN A CB   10 
ATOM 9746  C CG   . ASN A 1 26 ? -46.040 -6.919  -23.226 1.00 0.00 ? 26 ASN A CG   10 
ATOM 9747  O OD1  . ASN A 1 26 ? -45.833 -5.711  -23.347 1.00 0.00 ? 26 ASN A OD1  10 
ATOM 9748  N ND2  . ASN A 1 26 ? -47.250 -7.356  -23.008 1.00 0.00 ? 26 ASN A ND2  10 
ATOM 9749  H H    . ASN A 1 26 ? -44.002 -6.980  -21.063 1.00 0.00 ? 26 ASN A H    10 
ATOM 9750  H HA   . ASN A 1 26 ? -45.707 -9.218  -21.855 1.00 0.00 ? 26 ASN A HA   10 
ATOM 9751  H HB2  . ASN A 1 26 ? -43.966 -7.375  -23.501 1.00 0.00 ? 26 ASN A HB2  10 
ATOM 9752  H HB3  . ASN A 1 26 ? -45.069 -8.587  -24.150 1.00 0.00 ? 26 ASN A HB3  10 
ATOM 9753  H HD21 . ASN A 1 26 ? -47.413 -8.318  -22.913 1.00 0.00 ? 26 ASN A HD21 10 
ATOM 9754  H HD22 . ASN A 1 26 ? -47.995 -6.724  -22.942 1.00 0.00 ? 26 ASN A HD22 10 
ATOM 9755  N N    . GLY A 1 27 ? -42.649 -9.690  -21.331 1.00 0.00 ? 27 GLY A N    10 
ATOM 9756  C CA   . GLY A 1 27 ? -41.536 -10.632 -21.411 1.00 0.00 ? 27 GLY A CA   10 
ATOM 9757  C C    . GLY A 1 27 ? -41.983 -12.077 -21.194 1.00 0.00 ? 27 GLY A C    10 
ATOM 9758  O O    . GLY A 1 27 ? -41.524 -12.983 -21.889 1.00 0.00 ? 27 GLY A O    10 
ATOM 9759  H H    . GLY A 1 27 ? -42.641 -8.998  -20.638 1.00 0.00 ? 27 GLY A H    10 
ATOM 9760  H HA2  . GLY A 1 27 ? -41.077 -10.551 -22.386 1.00 0.00 ? 27 GLY A HA2  10 
ATOM 9761  H HA3  . GLY A 1 27 ? -40.805 -10.376 -20.658 1.00 0.00 ? 27 GLY A HA3  10 
ATOM 9762  N N    . GLY A 1 28 ? -42.863 -12.292 -20.221 1.00 0.00 ? 28 GLY A N    10 
ATOM 9763  C CA   . GLY A 1 28 ? -43.336 -13.642 -19.927 1.00 0.00 ? 28 GLY A CA   10 
ATOM 9764  C C    . GLY A 1 28 ? -44.069 -14.255 -21.117 1.00 0.00 ? 28 GLY A C    10 
ATOM 9765  O O    . GLY A 1 28 ? -43.878 -15.429 -21.437 1.00 0.00 ? 28 GLY A O    10 
ATOM 9766  H H    . GLY A 1 28 ? -43.188 -11.536 -19.689 1.00 0.00 ? 28 GLY A H    10 
ATOM 9767  H HA2  . GLY A 1 28 ? -42.489 -14.264 -19.675 1.00 0.00 ? 28 GLY A HA2  10 
ATOM 9768  H HA3  . GLY A 1 28 ? -44.008 -13.602 -19.083 1.00 0.00 ? 28 GLY A HA3  10 
ATOM 9769  N N    . LEU A 1 29 ? -44.928 -13.465 -21.748 1.00 0.00 ? 29 LEU A N    10 
ATOM 9770  C CA   . LEU A 1 29 ? -45.706 -13.964 -22.879 1.00 0.00 ? 29 LEU A CA   10 
ATOM 9771  C C    . LEU A 1 29 ? -44.782 -14.442 -23.999 1.00 0.00 ? 29 LEU A C    10 
ATOM 9772  O O    . LEU A 1 29 ? -44.968 -15.531 -24.542 1.00 0.00 ? 29 LEU A O    10 
ATOM 9773  C CB   . LEU A 1 29 ? -46.629 -12.852 -23.397 1.00 0.00 ? 29 LEU A CB   10 
ATOM 9774  C CG   . LEU A 1 29 ? -47.452 -13.348 -24.594 1.00 0.00 ? 29 LEU A CG   10 
ATOM 9775  C CD1  . LEU A 1 29 ? -48.319 -14.535 -24.172 1.00 0.00 ? 29 LEU A CD1  10 
ATOM 9776  C CD2  . LEU A 1 29 ? -48.357 -12.217 -25.087 1.00 0.00 ? 29 LEU A CD2  10 
ATOM 9777  H H    . LEU A 1 29 ? -45.062 -12.554 -21.415 1.00 0.00 ? 29 LEU A H    10 
ATOM 9778  H HA   . LEU A 1 29 ? -46.311 -14.792 -22.546 1.00 0.00 ? 29 LEU A HA   10 
ATOM 9779  H HB2  . LEU A 1 29 ? -47.300 -12.547 -22.607 1.00 0.00 ? 29 LEU A HB2  10 
ATOM 9780  H HB3  . LEU A 1 29 ? -46.032 -12.006 -23.703 1.00 0.00 ? 29 LEU A HB3  10 
ATOM 9781  H HG   . LEU A 1 29 ? -46.791 -13.650 -25.393 1.00 0.00 ? 29 LEU A HG   10 
ATOM 9782  H HD11 . LEU A 1 29 ? -47.753 -15.450 -24.279 1.00 0.00 ? 29 LEU A HD11 10 
ATOM 9783  H HD12 . LEU A 1 29 ? -49.198 -14.582 -24.798 1.00 0.00 ? 29 LEU A HD12 10 
ATOM 9784  H HD13 . LEU A 1 29 ? -48.617 -14.416 -23.141 1.00 0.00 ? 29 LEU A HD13 10 
ATOM 9785  H HD21 . LEU A 1 29 ? -49.021 -11.913 -24.289 1.00 0.00 ? 29 LEU A HD21 10 
ATOM 9786  H HD22 . LEU A 1 29 ? -48.941 -12.561 -25.928 1.00 0.00 ? 29 LEU A HD22 10 
ATOM 9787  H HD23 . LEU A 1 29 ? -47.752 -11.375 -25.388 1.00 0.00 ? 29 LEU A HD23 10 
ATOM 9788  N N    . ILE A 1 30 ? -43.796 -13.625 -24.348 1.00 0.00 ? 30 ILE A N    10 
ATOM 9789  C CA   . ILE A 1 30 ? -42.863 -13.979 -25.413 1.00 0.00 ? 30 ILE A CA   10 
ATOM 9790  C C    . ILE A 1 30 ? -42.075 -15.244 -25.073 1.00 0.00 ? 30 ILE A C    10 
ATOM 9791  O O    . ILE A 1 30 ? -41.905 -16.132 -25.915 1.00 0.00 ? 30 ILE A O    10 
ATOM 9792  C CB   . ILE A 1 30 ? -41.889 -12.823 -25.649 1.00 0.00 ? 30 ILE A CB   10 
ATOM 9793  C CG1  . ILE A 1 30 ? -42.644 -11.638 -26.257 1.00 0.00 ? 30 ILE A CG1  10 
ATOM 9794  C CG2  . ILE A 1 30 ? -40.786 -13.270 -26.610 1.00 0.00 ? 30 ILE A CG2  10 
ATOM 9795  C CD1  . ILE A 1 30 ? -41.755 -10.393 -26.225 1.00 0.00 ? 30 ILE A CD1  10 
ATOM 9796  H H    . ILE A 1 30 ? -43.706 -12.753 -23.903 1.00 0.00 ? 30 ILE A H    10 
ATOM 9797  H HA   . ILE A 1 30 ? -43.420 -14.150 -26.321 1.00 0.00 ? 30 ILE A HA   10 
ATOM 9798  H HB   . ILE A 1 30 ? -41.449 -12.526 -24.708 1.00 0.00 ? 30 ILE A HB   10 
ATOM 9799  H HG12 . ILE A 1 30 ? -42.909 -11.866 -27.279 1.00 0.00 ? 30 ILE A HG12 10 
ATOM 9800  H HG13 . ILE A 1 30 ? -43.541 -11.450 -25.686 1.00 0.00 ? 30 ILE A HG13 10 
ATOM 9801  H HG21 . ILE A 1 30 ? -40.277 -12.403 -27.003 1.00 0.00 ? 30 ILE A HG21 10 
ATOM 9802  H HG22 . ILE A 1 30 ? -41.224 -13.830 -27.423 1.00 0.00 ? 30 ILE A HG22 10 
ATOM 9803  H HG23 . ILE A 1 30 ? -40.079 -13.893 -26.082 1.00 0.00 ? 30 ILE A HG23 10 
ATOM 9804  H HD11 . ILE A 1 30 ? -42.274 -9.567  -26.684 1.00 0.00 ? 30 ILE A HD11 10 
ATOM 9805  H HD12 . ILE A 1 30 ? -40.841 -10.591 -26.768 1.00 0.00 ? 30 ILE A HD12 10 
ATOM 9806  H HD13 . ILE A 1 30 ? -41.517 -10.146 -25.201 1.00 0.00 ? 30 ILE A HD13 10 
ATOM 9807  N N    . PHE A 1 31 ? -41.599 -15.327 -23.835 1.00 0.00 ? 31 PHE A N    10 
ATOM 9808  C CA   . PHE A 1 31 ? -40.831 -16.484 -23.393 1.00 0.00 ? 31 PHE A CA   10 
ATOM 9809  C C    . PHE A 1 31 ? -41.654 -17.763 -23.492 1.00 0.00 ? 31 PHE A C    10 
ATOM 9810  O O    . PHE A 1 31 ? -41.167 -18.790 -23.963 1.00 0.00 ? 31 PHE A O    10 
ATOM 9811  C CB   . PHE A 1 31 ? -40.372 -16.282 -21.947 1.00 0.00 ? 31 PHE A CB   10 
ATOM 9812  C CG   . PHE A 1 31 ? -39.604 -17.498 -21.488 1.00 0.00 ? 31 PHE A CG   10 
ATOM 9813  C CD1  . PHE A 1 31 ? -38.269 -17.669 -21.877 1.00 0.00 ? 31 PHE A CD1  10 
ATOM 9814  C CD2  . PHE A 1 31 ? -40.223 -18.451 -20.674 1.00 0.00 ? 31 PHE A CD2  10 
ATOM 9815  C CE1  . PHE A 1 31 ? -37.554 -18.795 -21.451 1.00 0.00 ? 31 PHE A CE1  10 
ATOM 9816  C CE2  . PHE A 1 31 ? -39.509 -19.579 -20.248 1.00 0.00 ? 31 PHE A CE2  10 
ATOM 9817  C CZ   . PHE A 1 31 ? -38.175 -19.749 -20.637 1.00 0.00 ? 31 PHE A CZ   10 
ATOM 9818  H H    . PHE A 1 31 ? -41.772 -14.608 -23.192 1.00 0.00 ? 31 PHE A H    10 
ATOM 9819  H HA   . PHE A 1 31 ? -39.957 -16.582 -24.021 1.00 0.00 ? 31 PHE A HA   10 
ATOM 9820  H HB2  . PHE A 1 31 ? -39.735 -15.409 -21.891 1.00 0.00 ? 31 PHE A HB2  10 
ATOM 9821  H HB3  . PHE A 1 31 ? -41.233 -16.140 -21.313 1.00 0.00 ? 31 PHE A HB3  10 
ATOM 9822  H HD1  . PHE A 1 31 ? -37.790 -16.931 -22.505 1.00 0.00 ? 31 PHE A HD1  10 
ATOM 9823  H HD2  . PHE A 1 31 ? -41.252 -18.319 -20.374 1.00 0.00 ? 31 PHE A HD2  10 
ATOM 9824  H HE1  . PHE A 1 31 ? -36.526 -18.927 -21.751 1.00 0.00 ? 31 PHE A HE1  10 
ATOM 9825  H HE2  . PHE A 1 31 ? -39.987 -20.314 -19.619 1.00 0.00 ? 31 PHE A HE2  10 
ATOM 9826  H HZ   . PHE A 1 31 ? -37.624 -20.618 -20.308 1.00 0.00 ? 31 PHE A HZ   10 
ATOM 9827  N N    . ALA A 1 32 ? -42.893 -17.705 -23.014 1.00 0.00 ? 32 ALA A N    10 
ATOM 9828  C CA   . ALA A 1 32 ? -43.757 -18.879 -23.021 1.00 0.00 ? 32 ALA A CA   10 
ATOM 9829  C C    . ALA A 1 32 ? -43.962 -19.413 -24.436 1.00 0.00 ? 32 ALA A C    10 
ATOM 9830  O O    . ALA A 1 32 ? -43.945 -20.625 -24.649 1.00 0.00 ? 32 ALA A O    10 
ATOM 9831  C CB   . ALA A 1 32 ? -45.113 -18.528 -22.409 1.00 0.00 ? 32 ALA A CB   10 
ATOM 9832  H H    . ALA A 1 32 ? -43.220 -16.870 -22.621 1.00 0.00 ? 32 ALA A H    10 
ATOM 9833  H HA   . ALA A 1 32 ? -43.299 -19.652 -22.422 1.00 0.00 ? 32 ALA A HA   10 
ATOM 9834  H HB1  . ALA A 1 32 ? -45.664 -19.435 -22.210 1.00 0.00 ? 32 ALA A HB1  10 
ATOM 9835  H HB2  . ALA A 1 32 ? -45.672 -17.911 -23.099 1.00 0.00 ? 32 ALA A HB2  10 
ATOM 9836  H HB3  . ALA A 1 32 ? -44.963 -17.989 -21.486 1.00 0.00 ? 32 ALA A HB3  10 
ATOM 9837  N N    . GLY A 1 33 ? -44.159 -18.523 -25.406 1.00 0.00 ? 33 GLY A N    10 
ATOM 9838  C CA   . GLY A 1 33 ? -44.367 -18.963 -26.782 1.00 0.00 ? 33 GLY A CA   10 
ATOM 9839  C C    . GLY A 1 33 ? -43.161 -19.742 -27.296 1.00 0.00 ? 33 GLY A C    10 
ATOM 9840  O O    . GLY A 1 33 ? -43.311 -20.763 -27.966 1.00 0.00 ? 33 GLY A O    10 
ATOM 9841  H H    . GLY A 1 33 ? -44.180 -17.563 -25.209 1.00 0.00 ? 33 GLY A H    10 
ATOM 9842  H HA2  . GLY A 1 33 ? -45.242 -19.596 -26.822 1.00 0.00 ? 33 GLY A HA2  10 
ATOM 9843  H HA3  . GLY A 1 33 ? -44.525 -18.100 -27.410 1.00 0.00 ? 33 GLY A HA3  10 
ATOM 9844  N N    . LEU A 1 34 ? -41.965 -19.271 -26.955 1.00 0.00 ? 34 LEU A N    10 
ATOM 9845  C CA   . LEU A 1 34 ? -40.744 -19.956 -27.371 1.00 0.00 ? 34 LEU A CA   10 
ATOM 9846  C C    . LEU A 1 34 ? -40.643 -21.309 -26.664 1.00 0.00 ? 34 LEU A C    10 
ATOM 9847  O O    . LEU A 1 34 ? -40.251 -22.317 -27.258 1.00 0.00 ? 34 LEU A O    10 
ATOM 9848  C CB   . LEU A 1 34 ? -39.521 -19.092 -27.030 1.00 0.00 ? 34 LEU A CB   10 
ATOM 9849  C CG   . LEU A 1 34 ? -38.229 -19.792 -27.476 1.00 0.00 ? 34 LEU A CG   10 
ATOM 9850  C CD1  . LEU A 1 34 ? -38.253 -20.013 -28.991 1.00 0.00 ? 34 LEU A CD1  10 
ATOM 9851  C CD2  . LEU A 1 34 ? -37.030 -18.914 -27.116 1.00 0.00 ? 34 LEU A CD2  10 
ATOM 9852  H H    . LEU A 1 34 ? -41.903 -18.470 -26.387 1.00 0.00 ? 34 LEU A H    10 
ATOM 9853  H HA   . LEU A 1 34 ? -40.780 -20.117 -28.437 1.00 0.00 ? 34 LEU A HA   10 
ATOM 9854  H HB2  . LEU A 1 34 ? -39.605 -18.140 -27.537 1.00 0.00 ? 34 LEU A HB2  10 
ATOM 9855  H HB3  . LEU A 1 34 ? -39.486 -18.928 -25.964 1.00 0.00 ? 34 LEU A HB3  10 
ATOM 9856  H HG   . LEU A 1 34 ? -38.141 -20.744 -26.975 1.00 0.00 ? 34 LEU A HG   10 
ATOM 9857  H HD11 . LEU A 1 34 ? -38.699 -20.973 -29.207 1.00 0.00 ? 34 LEU A HD11 10 
ATOM 9858  H HD12 . LEU A 1 34 ? -37.242 -19.992 -29.373 1.00 0.00 ? 34 LEU A HD12 10 
ATOM 9859  H HD13 . LEU A 1 34 ? -38.832 -19.233 -29.462 1.00 0.00 ? 34 LEU A HD13 10 
ATOM 9860  H HD21 . LEU A 1 34 ? -36.176 -19.210 -27.707 1.00 0.00 ? 34 LEU A HD21 10 
ATOM 9861  H HD22 . LEU A 1 34 ? -36.799 -19.031 -26.068 1.00 0.00 ? 34 LEU A HD22 10 
ATOM 9862  H HD23 . LEU A 1 34 ? -37.267 -17.879 -27.319 1.00 0.00 ? 34 LEU A HD23 10 
ATOM 9863  N N    . ALA A 1 35 ? -41.004 -21.305 -25.385 1.00 0.00 ? 35 ALA A N    10 
ATOM 9864  C CA   . ALA A 1 35 ? -40.951 -22.522 -24.585 1.00 0.00 ? 35 ALA A CA   10 
ATOM 9865  C C    . ALA A 1 35 ? -41.856 -23.591 -25.192 1.00 0.00 ? 35 ALA A C    10 
ATOM 9866  O O    . ALA A 1 35 ? -41.463 -24.743 -25.315 1.00 0.00 ? 35 ALA A O    10 
ATOM 9867  C CB   . ALA A 1 35 ? -41.393 -22.227 -23.150 1.00 0.00 ? 35 ALA A CB   10 
ATOM 9868  H H    . ALA A 1 35 ? -41.301 -20.453 -25.003 1.00 0.00 ? 35 ALA A H    10 
ATOM 9869  H HA   . ALA A 1 35 ? -39.935 -22.889 -24.570 1.00 0.00 ? 35 ALA A HA   10 
ATOM 9870  H HB1  . ALA A 1 35 ? -41.255 -23.109 -22.543 1.00 0.00 ? 35 ALA A HB1  10 
ATOM 9871  H HB2  . ALA A 1 35 ? -42.435 -21.946 -23.146 1.00 0.00 ? 35 ALA A HB2  10 
ATOM 9872  H HB3  . ALA A 1 35 ? -40.800 -21.417 -22.752 1.00 0.00 ? 35 ALA A HB3  10 
ATOM 9873  N N    . PHE A 1 36 ? -43.081 -23.199 -25.526 1.00 0.00 ? 36 PHE A N    10 
ATOM 9874  C CA   . PHE A 1 36 ? -44.067 -24.131 -26.081 1.00 0.00 ? 36 PHE A CA   10 
ATOM 9875  C C    . PHE A 1 36 ? -43.583 -24.787 -27.380 1.00 0.00 ? 36 PHE A C    10 
ATOM 9876  O O    . PHE A 1 36 ? -43.716 -26.002 -27.556 1.00 0.00 ? 36 PHE A O    10 
ATOM 9877  C CB   . PHE A 1 36 ? -45.378 -23.391 -26.348 1.00 0.00 ? 36 PHE A CB   10 
ATOM 9878  C CG   . PHE A 1 36 ? -46.373 -24.342 -26.968 1.00 0.00 ? 36 PHE A CG   10 
ATOM 9879  C CD1  . PHE A 1 36 ? -47.061 -25.257 -26.161 1.00 0.00 ? 36 PHE A CD1  10 
ATOM 9880  C CD2  . PHE A 1 36 ? -46.608 -24.313 -28.348 1.00 0.00 ? 36 PHE A CD2  10 
ATOM 9881  C CE1  . PHE A 1 36 ? -47.984 -26.141 -26.733 1.00 0.00 ? 36 PHE A CE1  10 
ATOM 9882  C CE2  . PHE A 1 36 ? -47.531 -25.198 -28.920 1.00 0.00 ? 36 PHE A CE2  10 
ATOM 9883  C CZ   . PHE A 1 36 ? -48.219 -26.111 -28.113 1.00 0.00 ? 36 PHE A CZ   10 
ATOM 9884  H H    . PHE A 1 36 ? -43.344 -22.278 -25.319 1.00 0.00 ? 36 PHE A H    10 
ATOM 9885  H HA   . PHE A 1 36 ? -44.255 -24.905 -25.353 1.00 0.00 ? 36 PHE A HA   10 
ATOM 9886  H HB2  . PHE A 1 36 ? -45.774 -23.011 -25.419 1.00 0.00 ? 36 PHE A HB2  10 
ATOM 9887  H HB3  . PHE A 1 36 ? -45.198 -22.570 -27.027 1.00 0.00 ? 36 PHE A HB3  10 
ATOM 9888  H HD1  . PHE A 1 36 ? -46.880 -25.281 -25.097 1.00 0.00 ? 36 PHE A HD1  10 
ATOM 9889  H HD2  . PHE A 1 36 ? -46.078 -23.607 -28.971 1.00 0.00 ? 36 PHE A HD2  10 
ATOM 9890  H HE1  . PHE A 1 36 ? -48.514 -26.846 -26.111 1.00 0.00 ? 36 PHE A HE1  10 
ATOM 9891  H HE2  . PHE A 1 36 ? -47.712 -25.174 -29.985 1.00 0.00 ? 36 PHE A HE2  10 
ATOM 9892  H HZ   . PHE A 1 36 ? -48.931 -26.793 -28.554 1.00 0.00 ? 36 PHE A HZ   10 
ATOM 9893  N N    . ILE A 1 37 ? -43.048 -23.988 -28.297 1.00 0.00 ? 37 ILE A N    10 
ATOM 9894  C CA   . ILE A 1 37 ? -42.591 -24.523 -29.580 1.00 0.00 ? 37 ILE A CA   10 
ATOM 9895  C C    . ILE A 1 37 ? -41.533 -25.605 -29.375 1.00 0.00 ? 37 ILE A C    10 
ATOM 9896  O O    . ILE A 1 37 ? -41.566 -26.647 -30.035 1.00 0.00 ? 37 ILE A O    10 
ATOM 9897  C CB   . ILE A 1 37 ? -42.012 -23.397 -30.438 1.00 0.00 ? 37 ILE A CB   10 
ATOM 9898  C CG1  . ILE A 1 37 ? -43.138 -22.452 -30.865 1.00 0.00 ? 37 ILE A CG1  10 
ATOM 9899  C CG2  . ILE A 1 37 ? -41.346 -23.991 -31.681 1.00 0.00 ? 37 ILE A CG2  10 
ATOM 9900  C CD1  . ILE A 1 37 ? -42.540 -21.187 -31.483 1.00 0.00 ? 37 ILE A CD1  10 
ATOM 9901  H H    . ILE A 1 37 ? -42.986 -23.024 -28.126 1.00 0.00 ? 37 ILE A H    10 
ATOM 9902  H HA   . ILE A 1 37 ? -43.434 -24.953 -30.098 1.00 0.00 ? 37 ILE A HA   10 
ATOM 9903  H HB   . ILE A 1 37 ? -41.278 -22.849 -29.863 1.00 0.00 ? 37 ILE A HB   10 
ATOM 9904  H HG12 . ILE A 1 37 ? -43.766 -22.947 -31.591 1.00 0.00 ? 37 ILE A HG12 10 
ATOM 9905  H HG13 . ILE A 1 37 ? -43.729 -22.185 -30.001 1.00 0.00 ? 37 ILE A HG13 10 
ATOM 9906  H HG21 . ILE A 1 37 ? -40.397 -24.425 -31.408 1.00 0.00 ? 37 ILE A HG21 10 
ATOM 9907  H HG22 . ILE A 1 37 ? -41.189 -23.213 -32.412 1.00 0.00 ? 37 ILE A HG22 10 
ATOM 9908  H HG23 . ILE A 1 37 ? -41.984 -24.756 -32.100 1.00 0.00 ? 37 ILE A HG23 10 
ATOM 9909  H HD11 . ILE A 1 37 ? -41.495 -21.351 -31.696 1.00 0.00 ? 37 ILE A HD11 10 
ATOM 9910  H HD12 . ILE A 1 37 ? -42.642 -20.365 -30.790 1.00 0.00 ? 37 ILE A HD12 10 
ATOM 9911  H HD13 . ILE A 1 37 ? -43.063 -20.953 -32.398 1.00 0.00 ? 37 ILE A HD13 10 
ATOM 9912  N N    . VAL A 1 38 ? -40.593 -25.355 -28.475 1.00 0.00 ? 38 VAL A N    10 
ATOM 9913  C CA   . VAL A 1 38 ? -39.528 -26.320 -28.216 1.00 0.00 ? 38 VAL A CA   10 
ATOM 9914  C C    . VAL A 1 38 ? -40.110 -27.665 -27.773 1.00 0.00 ? 38 VAL A C    10 
ATOM 9915  O O    . VAL A 1 38 ? -39.628 -28.722 -28.181 1.00 0.00 ? 38 VAL A O    10 
ATOM 9916  C CB   . VAL A 1 38 ? -38.593 -25.785 -27.130 1.00 0.00 ? 38 VAL A CB   10 
ATOM 9917  C CG1  . VAL A 1 38 ? -37.625 -26.888 -26.700 1.00 0.00 ? 38 VAL A CG1  10 
ATOM 9918  C CG2  . VAL A 1 38 ? -37.801 -24.597 -27.682 1.00 0.00 ? 38 VAL A CG2  10 
ATOM 9919  H H    . VAL A 1 38 ? -40.606 -24.497 -27.997 1.00 0.00 ? 38 VAL A H    10 
ATOM 9920  H HA   . VAL A 1 38 ? -38.960 -26.465 -29.122 1.00 0.00 ? 38 VAL A HA   10 
ATOM 9921  H HB   . VAL A 1 38 ? -39.176 -25.468 -26.278 1.00 0.00 ? 38 VAL A HB   10 
ATOM 9922  H HG11 . VAL A 1 38 ? -36.680 -26.446 -26.417 1.00 0.00 ? 38 VAL A HG11 10 
ATOM 9923  H HG12 . VAL A 1 38 ? -37.469 -27.571 -27.523 1.00 0.00 ? 38 VAL A HG12 10 
ATOM 9924  H HG13 . VAL A 1 38 ? -38.038 -27.423 -25.861 1.00 0.00 ? 38 VAL A HG13 10 
ATOM 9925  H HG21 . VAL A 1 38 ? -36.820 -24.930 -27.990 1.00 0.00 ? 38 VAL A HG21 10 
ATOM 9926  H HG22 . VAL A 1 38 ? -37.700 -23.844 -26.915 1.00 0.00 ? 38 VAL A HG22 10 
ATOM 9927  H HG23 . VAL A 1 38 ? -38.323 -24.180 -28.531 1.00 0.00 ? 38 VAL A HG23 10 
ATOM 9928  N N    . GLY A 1 39 ? -41.138 -27.616 -26.934 1.00 0.00 ? 39 GLY A N    10 
ATOM 9929  C CA   . GLY A 1 39 ? -41.781 -28.824 -26.425 1.00 0.00 ? 39 GLY A CA   10 
ATOM 9930  C C    . GLY A 1 39 ? -42.365 -29.668 -27.554 1.00 0.00 ? 39 GLY A C    10 
ATOM 9931  O O    . GLY A 1 39 ? -42.332 -30.897 -27.496 1.00 0.00 ? 39 GLY A O    10 
ATOM 9932  H H    . GLY A 1 39 ? -41.470 -26.753 -26.639 1.00 0.00 ? 39 GLY A H    10 
ATOM 9933  H HA2  . GLY A 1 39 ? -41.053 -29.411 -25.887 1.00 0.00 ? 39 GLY A HA2  10 
ATOM 9934  H HA3  . GLY A 1 39 ? -42.576 -28.542 -25.751 1.00 0.00 ? 39 GLY A HA3  10 
ATOM 9935  N N    . LEU A 1 40 ? -42.899 -29.008 -28.576 1.00 0.00 ? 40 LEU A N    10 
ATOM 9936  C CA   . LEU A 1 40 ? -43.485 -29.733 -29.701 1.00 0.00 ? 40 LEU A CA   10 
ATOM 9937  C C    . LEU A 1 40 ? -42.427 -30.635 -30.339 1.00 0.00 ? 40 LEU A C    10 
ATOM 9938  O O    . LEU A 1 40 ? -42.691 -31.796 -30.652 1.00 0.00 ? 40 LEU A O    10 
ATOM 9939  C CB   . LEU A 1 40 ? -44.023 -28.738 -30.738 1.00 0.00 ? 40 LEU A CB   10 
ATOM 9940  C CG   . LEU A 1 40 ? -44.634 -29.488 -31.932 1.00 0.00 ? 40 LEU A CG   10 
ATOM 9941  C CD1  . LEU A 1 40 ? -45.797 -30.361 -31.457 1.00 0.00 ? 40 LEU A CD1  10 
ATOM 9942  C CD2  . LEU A 1 40 ? -45.155 -28.471 -32.951 1.00 0.00 ? 40 LEU A CD2  10 
ATOM 9943  H H    . LEU A 1 40 ? -42.891 -28.025 -28.567 1.00 0.00 ? 40 LEU A H    10 
ATOM 9944  H HA   . LEU A 1 40 ? -44.297 -30.344 -29.340 1.00 0.00 ? 40 LEU A HA   10 
ATOM 9945  H HB2  . LEU A 1 40 ? -44.781 -28.120 -30.280 1.00 0.00 ? 40 LEU A HB2  10 
ATOM 9946  H HB3  . LEU A 1 40 ? -43.216 -28.114 -31.088 1.00 0.00 ? 40 LEU A HB3  10 
ATOM 9947  H HG   . LEU A 1 40 ? -43.883 -30.108 -32.397 1.00 0.00 ? 40 LEU A HG   10 
ATOM 9948  H HD11 . LEU A 1 40 ? -45.422 -31.331 -31.166 1.00 0.00 ? 40 LEU A HD11 10 
ATOM 9949  H HD12 . LEU A 1 40 ? -46.511 -30.477 -32.258 1.00 0.00 ? 40 LEU A HD12 10 
ATOM 9950  H HD13 . LEU A 1 40 ? -46.279 -29.893 -30.611 1.00 0.00 ? 40 LEU A HD13 10 
ATOM 9951  H HD21 . LEU A 1 40 ? -44.872 -27.474 -32.642 1.00 0.00 ? 40 LEU A HD21 10 
ATOM 9952  H HD22 . LEU A 1 40 ? -46.231 -28.537 -33.010 1.00 0.00 ? 40 LEU A HD22 10 
ATOM 9953  H HD23 . LEU A 1 40 ? -44.727 -28.681 -33.920 1.00 0.00 ? 40 LEU A HD23 10 
ATOM 9954  N N    . LEU A 1 41 ? -41.242 -30.077 -30.551 1.00 0.00 ? 41 LEU A N    10 
ATOM 9955  C CA   . LEU A 1 41 ? -40.149 -30.815 -31.185 1.00 0.00 ? 41 LEU A CA   10 
ATOM 9956  C C    . LEU A 1 41 ? -39.812 -32.086 -30.405 1.00 0.00 ? 41 LEU A C    10 
ATOM 9957  O O    . LEU A 1 41 ? -39.470 -33.107 -30.997 1.00 0.00 ? 41 LEU A O    10 
ATOM 9958  C CB   . LEU A 1 41 ? -38.904 -29.927 -31.267 1.00 0.00 ? 41 LEU A CB   10 
ATOM 9959  C CG   . LEU A 1 41 ? -39.136 -28.796 -32.275 1.00 0.00 ? 41 LEU A CG   10 
ATOM 9960  C CD1  . LEU A 1 41 ? -37.976 -27.803 -32.201 1.00 0.00 ? 41 LEU A CD1  10 
ATOM 9961  C CD2  . LEU A 1 41 ? -39.230 -29.360 -33.700 1.00 0.00 ? 41 LEU A CD2  10 
ATOM 9962  H H    . LEU A 1 41 ? -41.124 -29.135 -30.332 1.00 0.00 ? 41 LEU A H    10 
ATOM 9963  H HA   . LEU A 1 41 ? -40.447 -31.089 -32.184 1.00 0.00 ? 41 LEU A HA   10 
ATOM 9964  H HB2  . LEU A 1 41 ? -38.706 -29.503 -30.293 1.00 0.00 ? 41 LEU A HB2  10 
ATOM 9965  H HB3  . LEU A 1 41 ? -38.055 -30.520 -31.575 1.00 0.00 ? 41 LEU A HB3  10 
ATOM 9966  H HG   . LEU A 1 41 ? -40.056 -28.284 -32.029 1.00 0.00 ? 41 LEU A HG   10 
ATOM 9967  H HD11 . LEU A 1 41 ? -37.976 -27.320 -31.234 1.00 0.00 ? 41 LEU A HD11 10 
ATOM 9968  H HD12 . LEU A 1 41 ? -38.088 -27.059 -32.975 1.00 0.00 ? 41 LEU A HD12 10 
ATOM 9969  H HD13 . LEU A 1 41 ? -37.042 -28.328 -32.339 1.00 0.00 ? 41 LEU A HD13 10 
ATOM 9970  H HD21 . LEU A 1 41 ? -38.658 -28.735 -34.369 1.00 0.00 ? 41 LEU A HD21 10 
ATOM 9971  H HD22 . LEU A 1 41 ? -40.262 -29.369 -34.013 1.00 0.00 ? 41 LEU A HD22 10 
ATOM 9972  H HD23 . LEU A 1 41 ? -38.839 -30.365 -33.725 1.00 0.00 ? 41 LEU A HD23 10 
ATOM 9973  N N    . ILE A 1 42 ? -39.908 -32.021 -29.084 1.00 0.00 ? 42 ILE A N    10 
ATOM 9974  C CA   . ILE A 1 42 ? -39.605 -33.185 -28.250 1.00 0.00 ? 42 ILE A CA   10 
ATOM 9975  C C    . ILE A 1 42 ? -40.530 -34.353 -28.603 1.00 0.00 ? 42 ILE A C    10 
ATOM 9976  O O    . ILE A 1 42 ? -40.092 -35.505 -28.706 1.00 0.00 ? 42 ILE A O    10 
ATOM 9977  C CB   . ILE A 1 42 ? -39.760 -32.836 -26.769 1.00 0.00 ? 42 ILE A CB   10 
ATOM 9978  C CG1  . ILE A 1 42 ? -38.643 -31.869 -26.358 1.00 0.00 ? 42 ILE A CG1  10 
ATOM 9979  C CG2  . ILE A 1 42 ? -39.666 -34.115 -25.932 1.00 0.00 ? 42 ILE A CG2  10 
ATOM 9980  C CD1  . ILE A 1 42 ? -38.918 -31.317 -24.955 1.00 0.00 ? 42 ILE A CD1  10 
ATOM 9981  H H    . ILE A 1 42 ? -40.184 -31.180 -28.673 1.00 0.00 ? 42 ILE A H    10 
ATOM 9982  H HA   . ILE A 1 42 ? -38.584 -33.485 -28.431 1.00 0.00 ? 42 ILE A HA   10 
ATOM 9983  H HB   . ILE A 1 42 ? -40.721 -32.371 -26.609 1.00 0.00 ? 42 ILE A HB   10 
ATOM 9984  H HG12 . ILE A 1 42 ? -37.697 -32.393 -26.358 1.00 0.00 ? 42 ILE A HG12 10 
ATOM 9985  H HG13 . ILE A 1 42 ? -38.600 -31.051 -27.061 1.00 0.00 ? 42 ILE A HG13 10 
ATOM 9986  H HG21 . ILE A 1 42 ? -38.853 -34.725 -26.298 1.00 0.00 ? 42 ILE A HG21 10 
ATOM 9987  H HG22 . ILE A 1 42 ? -40.591 -34.664 -26.009 1.00 0.00 ? 42 ILE A HG22 10 
ATOM 9988  H HG23 . ILE A 1 42 ? -39.485 -33.858 -24.898 1.00 0.00 ? 42 ILE A HG23 10 
ATOM 9989  H HD11 . ILE A 1 42 ? -39.810 -31.775 -24.553 1.00 0.00 ? 42 ILE A HD11 10 
ATOM 9990  H HD12 . ILE A 1 42 ? -39.054 -30.248 -25.009 1.00 0.00 ? 42 ILE A HD12 10 
ATOM 9991  H HD13 . ILE A 1 42 ? -38.080 -31.540 -24.312 1.00 0.00 ? 42 ILE A HD13 10 
ATOM 9992  N N    . LEU A 1 43 ? -41.811 -34.058 -28.782 1.00 0.00 ? 43 LEU A N    10 
ATOM 9993  C CA   . LEU A 1 43 ? -42.779 -35.096 -29.110 1.00 0.00 ? 43 LEU A CA   10 
ATOM 9994  C C    . LEU A 1 43 ? -42.355 -35.827 -30.380 1.00 0.00 ? 43 LEU A C    10 
ATOM 9995  O O    . LEU A 1 43 ? -42.489 -37.044 -30.472 1.00 0.00 ? 43 LEU A O    10 
ATOM 9996  C CB   . LEU A 1 43 ? -44.168 -34.472 -29.303 1.00 0.00 ? 43 LEU A CB   10 
ATOM 9997  C CG   . LEU A 1 43 ? -45.200 -35.557 -29.644 1.00 0.00 ? 43 LEU A CG   10 
ATOM 9998  C CD1  . LEU A 1 43 ? -45.287 -36.570 -28.501 1.00 0.00 ? 43 LEU A CD1  10 
ATOM 9999  C CD2  . LEU A 1 43 ? -46.569 -34.902 -29.840 1.00 0.00 ? 43 LEU A CD2  10 
ATOM 10000 H H    . LEU A 1 43 ? -42.111 -33.137 -28.677 1.00 0.00 ? 43 LEU A H    10 
ATOM 10001 H HA   . LEU A 1 43 ? -42.821 -35.803 -28.296 1.00 0.00 ? 43 LEU A HA   10 
ATOM 10002 H HB2  . LEU A 1 43 ? -44.464 -33.971 -28.393 1.00 0.00 ? 43 LEU A HB2  10 
ATOM 10003 H HB3  . LEU A 1 43 ? -44.128 -33.755 -30.108 1.00 0.00 ? 43 LEU A HB3  10 
ATOM 10004 H HG   . LEU A 1 43 ? -44.912 -36.064 -30.553 1.00 0.00 ? 43 LEU A HG   10 
ATOM 10005 H HD11 . LEU A 1 43 ? -44.555 -37.349 -28.654 1.00 0.00 ? 43 LEU A HD11 10 
ATOM 10006 H HD12 . LEU A 1 43 ? -46.276 -37.004 -28.479 1.00 0.00 ? 43 LEU A HD12 10 
ATOM 10007 H HD13 . LEU A 1 43 ? -45.092 -36.073 -27.562 1.00 0.00 ? 43 LEU A HD13 10 
ATOM 10008 H HD21 . LEU A 1 43 ? -46.845 -34.366 -28.945 1.00 0.00 ? 43 LEU A HD21 10 
ATOM 10009 H HD22 . LEU A 1 43 ? -47.307 -35.665 -30.046 1.00 0.00 ? 43 LEU A HD22 10 
ATOM 10010 H HD23 . LEU A 1 43 ? -46.523 -34.214 -30.672 1.00 0.00 ? 43 LEU A HD23 10 
ATOM 10011 N N    . LEU A 1 44 ? -41.868 -35.077 -31.362 1.00 0.00 ? 44 LEU A N    10 
ATOM 10012 C CA   . LEU A 1 44 ? -41.450 -35.662 -32.634 1.00 0.00 ? 44 LEU A CA   10 
ATOM 10013 C C    . LEU A 1 44 ? -40.325 -36.682 -32.444 1.00 0.00 ? 44 LEU A C    10 
ATOM 10014 O O    . LEU A 1 44 ? -40.264 -37.691 -33.160 1.00 0.00 ? 44 LEU A O    10 
ATOM 10015 C CB   . LEU A 1 44 ? -40.978 -34.559 -33.585 1.00 0.00 ? 44 LEU A CB   10 
ATOM 10016 C CG   . LEU A 1 44 ? -42.171 -33.692 -34.012 1.00 0.00 ? 44 LEU A CG   10 
ATOM 10017 C CD1  . LEU A 1 44 ? -41.668 -32.488 -34.810 1.00 0.00 ? 44 LEU A CD1  10 
ATOM 10018 C CD2  . LEU A 1 44 ? -43.137 -34.506 -34.884 1.00 0.00 ? 44 LEU A CD2  10 
ATOM 10019 H H    . LEU A 1 44 ? -41.814 -34.111 -31.249 1.00 0.00 ? 44 LEU A H    10 
ATOM 10020 H HA   . LEU A 1 44 ? -42.294 -36.164 -33.077 1.00 0.00 ? 44 LEU A HA   10 
ATOM 10021 H HB2  . LEU A 1 44 ? -40.251 -33.941 -33.077 1.00 0.00 ? 44 LEU A HB2  10 
ATOM 10022 H HB3  . LEU A 1 44 ? -40.522 -35.002 -34.457 1.00 0.00 ? 44 LEU A HB3  10 
ATOM 10023 H HG   . LEU A 1 44 ? -42.689 -33.344 -33.131 1.00 0.00 ? 44 LEU A HG   10 
ATOM 10024 H HD11 . LEU A 1 44 ? -41.347 -32.813 -35.788 1.00 0.00 ? 44 LEU A HD11 10 
ATOM 10025 H HD12 . LEU A 1 44 ? -40.840 -32.030 -34.292 1.00 0.00 ? 44 LEU A HD12 10 
ATOM 10026 H HD13 . LEU A 1 44 ? -42.468 -31.768 -34.915 1.00 0.00 ? 44 LEU A HD13 10 
ATOM 10027 H HD21 . LEU A 1 44 ? -43.905 -34.938 -34.261 1.00 0.00 ? 44 LEU A HD21 10 
ATOM 10028 H HD22 . LEU A 1 44 ? -42.601 -35.294 -35.390 1.00 0.00 ? 44 LEU A HD22 10 
ATOM 10029 H HD23 . LEU A 1 44 ? -43.593 -33.855 -35.616 1.00 0.00 ? 44 LEU A HD23 10 
ATOM 10030 N N    . SER A 1 45 ? -39.439 -36.446 -31.481 1.00 0.00 ? 45 SER A N    10 
ATOM 10031 C CA   . SER A 1 45 ? -38.354 -37.387 -31.255 1.00 0.00 ? 45 SER A CA   10 
ATOM 10032 C C    . SER A 1 45 ? -38.955 -38.751 -30.963 1.00 0.00 ? 45 SER A C    10 
ATOM 10033 O O    . SER A 1 45 ? -38.451 -39.777 -31.420 1.00 0.00 ? 45 SER A O    10 
ATOM 10034 C CB   . SER A 1 45 ? -37.485 -36.942 -30.078 1.00 0.00 ? 45 SER A CB   10 
ATOM 10035 O OG   . SER A 1 45 ? -38.262 -36.955 -28.887 1.00 0.00 ? 45 SER A OG   10 
ATOM 10036 H H    . SER A 1 45 ? -39.522 -35.657 -30.913 1.00 0.00 ? 45 SER A H    10 
ATOM 10037 H HA   . SER A 1 45 ? -37.744 -37.448 -32.144 1.00 0.00 ? 45 SER A HA   10 
ATOM 10038 H HB2  . SER A 1 45 ? -36.654 -37.616 -29.965 1.00 0.00 ? 45 SER A HB2  10 
ATOM 10039 H HB3  . SER A 1 45 ? -37.114 -35.942 -30.266 1.00 0.00 ? 45 SER A HB3  10 
ATOM 10040 H HG   . SER A 1 45 ? -38.971 -37.594 -29.003 1.00 0.00 ? 45 SER A HG   10 
ATOM 10041 N N    . ARG A 1 46 ? -40.055 -38.749 -30.218 1.00 0.00 ? 46 ARG A N    10 
ATOM 10042 C CA   . ARG A 1 46 ? -40.748 -39.988 -29.888 1.00 0.00 ? 46 ARG A CA   10 
ATOM 10043 C C    . ARG A 1 46 ? -41.274 -40.661 -31.155 1.00 0.00 ? 46 ARG A C    10 
ATOM 10044 O O    . ARG A 1 46 ? -41.325 -41.889 -31.237 1.00 0.00 ? 46 ARG A O    10 
ATOM 10045 C CB   . ARG A 1 46 ? -41.910 -39.725 -28.920 1.00 0.00 ? 46 ARG A CB   10 
ATOM 10046 C CG   . ARG A 1 46 ? -42.528 -41.060 -28.470 1.00 0.00 ? 46 ARG A CG   10 
ATOM 10047 C CD   . ARG A 1 46 ? -43.821 -41.326 -29.248 1.00 0.00 ? 46 ARG A CD   10 
ATOM 10048 N NE   . ARG A 1 46 ? -44.183 -42.740 -29.159 1.00 0.00 ? 46 ARG A NE   10 
ATOM 10049 C CZ   . ARG A 1 46 ? -45.291 -43.202 -29.729 1.00 0.00 ? 46 ARG A CZ   10 
ATOM 10050 N NH1  . ARG A 1 46 ? -46.079 -42.388 -30.376 1.00 0.00 ? 46 ARG A NH1  10 
ATOM 10051 N NH2  . ARG A 1 46 ? -45.592 -44.469 -29.639 1.00 0.00 ? 46 ARG A NH2  10 
ATOM 10052 H H    . ARG A 1 46 ? -40.418 -37.903 -29.886 1.00 0.00 ? 46 ARG A H    10 
ATOM 10053 H HA   . ARG A 1 46 ? -40.042 -40.653 -29.412 1.00 0.00 ? 46 ARG A HA   10 
ATOM 10054 H HB2  . ARG A 1 46 ? -41.543 -39.190 -28.057 1.00 0.00 ? 46 ARG A HB2  10 
ATOM 10055 H HB3  . ARG A 1 46 ? -42.663 -39.132 -29.415 1.00 0.00 ? 46 ARG A HB3  10 
ATOM 10056 H HG2  . ARG A 1 46 ? -41.831 -41.864 -28.647 1.00 0.00 ? 46 ARG A HG2  10 
ATOM 10057 H HG3  . ARG A 1 46 ? -42.754 -41.009 -27.415 1.00 0.00 ? 46 ARG A HG3  10 
ATOM 10058 H HD2  . ARG A 1 46 ? -44.617 -40.731 -28.830 1.00 0.00 ? 46 ARG A HD2  10 
ATOM 10059 H HD3  . ARG A 1 46 ? -43.679 -41.055 -30.283 1.00 0.00 ? 46 ARG A HD3  10 
ATOM 10060 H HE   . ARG A 1 46 ? -43.597 -43.358 -28.673 1.00 0.00 ? 46 ARG A HE   10 
ATOM 10061 H HH11 . ARG A 1 46 ? -45.848 -41.417 -30.445 1.00 0.00 ? 46 ARG A HH11 10 
ATOM 10062 H HH12 . ARG A 1 46 ? -46.913 -42.736 -30.805 1.00 0.00 ? 46 ARG A HH12 10 
ATOM 10063 H HH21 . ARG A 1 46 ? -44.987 -45.092 -29.142 1.00 0.00 ? 46 ARG A HH21 10 
ATOM 10064 H HH22 . ARG A 1 46 ? -46.425 -44.815 -30.067 1.00 0.00 ? 46 ARG A HH22 10 
ATOM 10065 N N    . ARG A 1 47 ? -41.704 -39.853 -32.126 1.00 0.00 ? 47 ARG A N    10 
ATOM 10066 C CA   . ARG A 1 47 ? -42.270 -40.388 -33.360 1.00 0.00 ? 47 ARG A CA   10 
ATOM 10067 C C    . ARG A 1 47 ? -41.320 -41.376 -34.017 1.00 0.00 ? 47 ARG A C    10 
ATOM 10068 O O    . ARG A 1 47 ? -41.758 -42.308 -34.692 1.00 0.00 ? 47 ARG A O    10 
ATOM 10069 C CB   . ARG A 1 47 ? -42.581 -39.255 -34.350 1.00 0.00 ? 47 ARG A CB   10 
ATOM 10070 C CG   . ARG A 1 47 ? -43.319 -39.817 -35.578 1.00 0.00 ? 47 ARG A CG   10 
ATOM 10071 C CD   . ARG A 1 47 ? -42.345 -39.958 -36.752 1.00 0.00 ? 47 ARG A CD   10 
ATOM 10072 N NE   . ARG A 1 47 ? -42.959 -40.733 -37.827 1.00 0.00 ? 47 ARG A NE   10 
ATOM 10073 C CZ   . ARG A 1 47 ? -42.297 -40.998 -38.949 1.00 0.00 ? 47 ARG A CZ   10 
ATOM 10074 N NH1  . ARG A 1 47 ? -41.076 -40.563 -39.103 1.00 0.00 ? 47 ARG A NH1  10 
ATOM 10075 N NH2  . ARG A 1 47 ? -42.866 -41.691 -39.895 1.00 0.00 ? 47 ARG A NH2  10 
ATOM 10076 H H    . ARG A 1 47 ? -41.673 -38.886 -32.006 1.00 0.00 ? 47 ARG A H    10 
ATOM 10077 H HA   . ARG A 1 47 ? -43.186 -40.891 -33.118 1.00 0.00 ? 47 ARG A HA   10 
ATOM 10078 H HB2  . ARG A 1 47 ? -43.202 -38.516 -33.864 1.00 0.00 ? 47 ARG A HB2  10 
ATOM 10079 H HB3  . ARG A 1 47 ? -41.660 -38.795 -34.671 1.00 0.00 ? 47 ARG A HB3  10 
ATOM 10080 H HG2  . ARG A 1 47 ? -43.737 -40.785 -35.342 1.00 0.00 ? 47 ARG A HG2  10 
ATOM 10081 H HG3  . ARG A 1 47 ? -44.116 -39.142 -35.855 1.00 0.00 ? 47 ARG A HG3  10 
ATOM 10082 H HD2  . ARG A 1 47 ? -42.092 -38.977 -37.125 1.00 0.00 ? 47 ARG A HD2  10 
ATOM 10083 H HD3  . ARG A 1 47 ? -41.446 -40.454 -36.421 1.00 0.00 ? 47 ARG A HD3  10 
ATOM 10084 H HE   . ARG A 1 47 ? -43.875 -41.064 -37.720 1.00 0.00 ? 47 ARG A HE   10 
ATOM 10085 H HH11 . ARG A 1 47 ? -40.640 -40.030 -38.378 1.00 0.00 ? 47 ARG A HH11 10 
ATOM 10086 H HH12 . ARG A 1 47 ? -40.577 -40.760 -39.947 1.00 0.00 ? 47 ARG A HH12 10 
ATOM 10087 H HH21 . ARG A 1 47 ? -43.802 -42.024 -39.778 1.00 0.00 ? 47 ARG A HH21 10 
ATOM 10088 H HH22 . ARG A 1 47 ? -42.368 -41.889 -40.739 1.00 0.00 ? 47 ARG A HH22 10 
ATOM 10089 N N    . PHE A 1 48 ? -40.023 -41.194 -33.811 1.00 0.00 ? 48 PHE A N    10 
ATOM 10090 C CA   . PHE A 1 48 ? -39.056 -42.119 -34.394 1.00 0.00 ? 48 PHE A CA   10 
ATOM 10091 C C    . PHE A 1 48 ? -39.273 -43.527 -33.838 1.00 0.00 ? 48 PHE A C    10 
ATOM 10092 O O    . PHE A 1 48 ? -39.174 -44.516 -34.563 1.00 0.00 ? 48 PHE A O    10 
ATOM 10093 C CB   . PHE A 1 48 ? -37.631 -41.653 -34.087 1.00 0.00 ? 48 PHE A CB   10 
ATOM 10094 C CG   . PHE A 1 48 ? -37.274 -40.495 -34.989 1.00 0.00 ? 48 PHE A CG   10 
ATOM 10095 C CD1  . PHE A 1 48 ? -37.691 -39.201 -34.663 1.00 0.00 ? 48 PHE A CD1  10 
ATOM 10096 C CD2  . PHE A 1 48 ? -36.523 -40.719 -36.149 1.00 0.00 ? 48 PHE A CD2  10 
ATOM 10097 C CE1  . PHE A 1 48 ? -37.356 -38.127 -35.496 1.00 0.00 ? 48 PHE A CE1  10 
ATOM 10098 C CE2  . PHE A 1 48 ? -36.189 -39.646 -36.983 1.00 0.00 ? 48 PHE A CE2  10 
ATOM 10099 C CZ   . PHE A 1 48 ? -36.605 -38.350 -36.657 1.00 0.00 ? 48 PHE A CZ   10 
ATOM 10100 H H    . PHE A 1 48 ? -39.715 -40.456 -33.244 1.00 0.00 ? 48 PHE A H    10 
ATOM 10101 H HA   . PHE A 1 48 ? -39.192 -42.139 -35.465 1.00 0.00 ? 48 PHE A HA   10 
ATOM 10102 H HB2  . PHE A 1 48 ? -37.570 -41.339 -33.055 1.00 0.00 ? 48 PHE A HB2  10 
ATOM 10103 H HB3  . PHE A 1 48 ? -36.942 -42.467 -34.258 1.00 0.00 ? 48 PHE A HB3  10 
ATOM 10104 H HD1  . PHE A 1 48 ? -38.272 -39.031 -33.769 1.00 0.00 ? 48 PHE A HD1  10 
ATOM 10105 H HD2  . PHE A 1 48 ? -36.201 -41.718 -36.400 1.00 0.00 ? 48 PHE A HD2  10 
ATOM 10106 H HE1  . PHE A 1 48 ? -37.677 -37.127 -35.245 1.00 0.00 ? 48 PHE A HE1  10 
ATOM 10107 H HE2  . PHE A 1 48 ? -35.611 -39.817 -37.878 1.00 0.00 ? 48 PHE A HE2  10 
ATOM 10108 H HZ   . PHE A 1 48 ? -36.347 -37.521 -37.301 1.00 0.00 ? 48 PHE A HZ   10 
ATOM 10109 N N    . ARG A 1 49 ? -39.565 -43.602 -32.541 1.00 0.00 ? 49 ARG A N    10 
ATOM 10110 C CA   . ARG A 1 49 ? -39.796 -44.876 -31.857 1.00 0.00 ? 49 ARG A CA   10 
ATOM 10111 C C    . ARG A 1 49 ? -41.270 -45.288 -31.933 1.00 0.00 ? 49 ARG A C    10 
ATOM 10112 O O    . ARG A 1 49 ? -41.639 -46.391 -31.532 1.00 0.00 ? 49 ARG A O    10 
ATOM 10113 C CB   . ARG A 1 49 ? -39.369 -44.751 -30.390 1.00 0.00 ? 49 ARG A CB   10 
ATOM 10114 C CG   . ARG A 1 49 ? -37.913 -45.203 -30.232 1.00 0.00 ? 49 ARG A CG   10 
ATOM 10115 C CD   . ARG A 1 49 ? -37.000 -44.304 -31.068 1.00 0.00 ? 49 ARG A CD   10 
ATOM 10116 N NE   . ARG A 1 49 ? -35.604 -44.575 -30.751 1.00 0.00 ? 49 ARG A NE   10 
ATOM 10117 C CZ   . ARG A 1 49 ? -34.620 -44.029 -31.460 1.00 0.00 ? 49 ARG A CZ   10 
ATOM 10118 N NH1  . ARG A 1 49 ? -34.900 -43.238 -32.460 1.00 0.00 ? 49 ARG A NH1  10 
ATOM 10119 N NH2  . ARG A 1 49 ? -33.378 -44.283 -31.155 1.00 0.00 ? 49 ARG A NH2  10 
ATOM 10120 H H    . ARG A 1 49 ? -39.624 -42.783 -32.007 1.00 0.00 ? 49 ARG A H    10 
ATOM 10121 H HA   . ARG A 1 49 ? -39.199 -45.638 -32.330 1.00 0.00 ? 49 ARG A HA   10 
ATOM 10122 H HB2  . ARG A 1 49 ? -39.460 -43.720 -30.078 1.00 0.00 ? 49 ARG A HB2  10 
ATOM 10123 H HB3  . ARG A 1 49 ? -40.006 -45.368 -29.774 1.00 0.00 ? 49 ARG A HB3  10 
ATOM 10124 H HG2  . ARG A 1 49 ? -37.628 -45.135 -29.192 1.00 0.00 ? 49 ARG A HG2  10 
ATOM 10125 H HG3  . ARG A 1 49 ? -37.810 -46.225 -30.565 1.00 0.00 ? 49 ARG A HG3  10 
ATOM 10126 H HD2  . ARG A 1 49 ? -37.172 -44.495 -32.116 1.00 0.00 ? 49 ARG A HD2  10 
ATOM 10127 H HD3  . ARG A 1 49 ? -37.226 -43.269 -30.854 1.00 0.00 ? 49 ARG A HD3  10 
ATOM 10128 H HE   . ARG A 1 49 ? -35.385 -45.168 -30.002 1.00 0.00 ? 49 ARG A HE   10 
ATOM 10129 H HH11 . ARG A 1 49 ? -35.853 -43.044 -32.693 1.00 0.00 ? 49 ARG A HH11 10 
ATOM 10130 H HH12 . ARG A 1 49 ? -34.160 -42.827 -32.994 1.00 0.00 ? 49 ARG A HH12 10 
ATOM 10131 H HH21 . ARG A 1 49 ? -33.165 -44.889 -30.388 1.00 0.00 ? 49 ARG A HH21 10 
ATOM 10132 H HH22 . ARG A 1 49 ? -32.638 -43.872 -31.689 1.00 0.00 ? 49 ARG A HH22 10 
ATOM 10133 N N    . SER A 1 50 ? -42.098 -44.392 -32.455 1.00 0.00 ? 50 SER A N    10 
ATOM 10134 C CA   . SER A 1 50 ? -43.530 -44.670 -32.587 1.00 0.00 ? 50 SER A CA   10 
ATOM 10135 C C    . SER A 1 50 ? -43.805 -45.510 -33.828 1.00 0.00 ? 50 SER A C    10 
ATOM 10136 O O    . SER A 1 50 ? -42.957 -46.289 -34.264 1.00 0.00 ? 50 SER A O    10 
ATOM 10137 C CB   . SER A 1 50 ? -44.326 -43.373 -32.673 1.00 0.00 ? 50 SER A CB   10 
ATOM 10138 O OG   . SER A 1 50 ? -44.168 -42.812 -33.970 1.00 0.00 ? 50 SER A OG   10 
ATOM 10139 H H    . SER A 1 50 ? -41.715 -43.555 -32.790 1.00 0.00 ? 50 SER A H    10 
ATOM 10140 H HA   . SER A 1 50 ? -43.859 -45.219 -31.717 1.00 0.00 ? 50 SER A HA   10 
ATOM 10141 H HB2  . SER A 1 50 ? -45.371 -43.577 -32.501 1.00 0.00 ? 50 SER A HB2  10 
ATOM 10142 H HB3  . SER A 1 50 ? -43.970 -42.685 -31.922 1.00 0.00 ? 50 SER A HB3  10 
ATOM 10143 H HG   . SER A 1 50 ? -44.534 -43.431 -34.607 1.00 0.00 ? 50 SER A HG   10 
ATOM 10144 N N    . GLY A 1 51 ? -44.996 -45.342 -34.396 1.00 0.00 ? 51 GLY A N    10 
ATOM 10145 C CA   . GLY A 1 51 ? -45.375 -46.086 -35.590 1.00 0.00 ? 51 GLY A CA   10 
ATOM 10146 C C    . GLY A 1 51 ? -45.914 -47.468 -35.238 1.00 0.00 ? 51 GLY A C    10 
ATOM 10147 O O    . GLY A 1 51 ? -46.202 -48.272 -36.125 1.00 0.00 ? 51 GLY A O    10 
ATOM 10148 H H    . GLY A 1 51 ? -45.627 -44.700 -34.009 1.00 0.00 ? 51 GLY A H    10 
ATOM 10149 H HA2  . GLY A 1 51 ? -46.137 -45.534 -36.123 1.00 0.00 ? 51 GLY A HA2  10 
ATOM 10150 H HA3  . GLY A 1 51 ? -44.509 -46.198 -36.228 1.00 0.00 ? 51 GLY A HA3  10 
ATOM 10151 N N    . GLY A 1 52 ? -46.045 -47.743 -33.942 1.00 0.00 ? 52 GLY A N    10 
ATOM 10152 C CA   . GLY A 1 52 ? -46.547 -49.038 -33.488 1.00 0.00 ? 52 GLY A CA   10 
ATOM 10153 C C    . GLY A 1 52 ? -45.452 -49.821 -32.776 1.00 0.00 ? 52 GLY A C    10 
ATOM 10154 O O    . GLY A 1 52 ? -44.443 -49.251 -32.360 1.00 0.00 ? 52 GLY A O    10 
ATOM 10155 H H    . GLY A 1 52 ? -45.798 -47.069 -33.273 1.00 0.00 ? 52 GLY A H    10 
ATOM 10156 H HA2  . GLY A 1 52 ? -47.373 -48.879 -32.809 1.00 0.00 ? 52 GLY A HA2  10 
ATOM 10157 H HA3  . GLY A 1 52 ? -46.892 -49.606 -34.338 1.00 0.00 ? 52 GLY A HA3  10 
ATOM 10158 N N    . ASN A 1 53 ? -45.655 -51.128 -32.636 1.00 0.00 ? 53 ASN A N    10 
ATOM 10159 C CA   . ASN A 1 53 ? -44.672 -51.977 -31.972 1.00 0.00 ? 53 ASN A CA   10 
ATOM 10160 C C    . ASN A 1 53 ? -44.397 -51.481 -30.556 1.00 0.00 ? 53 ASN A C    10 
ATOM 10161 O O    . ASN A 1 53 ? -43.445 -50.736 -30.326 1.00 0.00 ? 53 ASN A O    10 
ATOM 10162 C CB   . ASN A 1 53 ? -43.368 -51.998 -32.774 1.00 0.00 ? 53 ASN A CB   10 
ATOM 10163 C CG   . ASN A 1 53 ? -43.628 -52.532 -34.178 1.00 0.00 ? 53 ASN A CG   10 
ATOM 10164 O OD1  . ASN A 1 53 ? -44.344 -53.521 -34.342 1.00 0.00 ? 53 ASN A OD1  10 
ATOM 10165 N ND2  . ASN A 1 53 ? -43.089 -51.935 -35.204 1.00 0.00 ? 53 ASN A ND2  10 
ATOM 10166 H H    . ASN A 1 53 ? -46.479 -51.528 -32.986 1.00 0.00 ? 53 ASN A H    10 
ATOM 10167 H HA   . ASN A 1 53 ? -45.061 -52.982 -31.918 1.00 0.00 ? 53 ASN A HA   10 
ATOM 10168 H HB2  . ASN A 1 53 ? -42.968 -50.997 -32.840 1.00 0.00 ? 53 ASN A HB2  10 
ATOM 10169 H HB3  . ASN A 1 53 ? -42.652 -52.635 -32.277 1.00 0.00 ? 53 ASN A HB3  10 
ATOM 10170 H HD21 . ASN A 1 53 ? -42.521 -51.148 -35.071 1.00 0.00 ? 53 ASN A HD21 10 
ATOM 10171 H HD22 . ASN A 1 53 ? -43.253 -52.273 -36.109 1.00 0.00 ? 53 ASN A HD22 10 
ATOM 10172 N N    . LYS A 1 54 ? -45.238 -51.895 -29.610 1.00 0.00 ? 54 LYS A N    10 
ATOM 10173 C CA   . LYS A 1 54 ? -45.072 -51.486 -28.218 1.00 0.00 ? 54 LYS A CA   10 
ATOM 10174 C C    . LYS A 1 54 ? -43.837 -52.149 -27.615 1.00 0.00 ? 54 LYS A C    10 
ATOM 10175 O O    . LYS A 1 54 ? -43.929 -52.899 -26.643 1.00 0.00 ? 54 LYS A O    10 
ATOM 10176 C CB   . LYS A 1 54 ? -46.309 -51.874 -27.405 1.00 0.00 ? 54 LYS A CB   10 
ATOM 10177 C CG   . LYS A 1 54 ? -47.513 -51.059 -27.882 1.00 0.00 ? 54 LYS A CG   10 
ATOM 10178 C CD   . LYS A 1 54 ? -48.747 -51.449 -27.064 1.00 0.00 ? 54 LYS A CD   10 
ATOM 10179 C CE   . LYS A 1 54 ? -49.952 -50.635 -27.538 1.00 0.00 ? 54 LYS A CE   10 
ATOM 10180 N NZ   . LYS A 1 54 ? -51.155 -51.021 -26.744 1.00 0.00 ? 54 LYS A NZ   10 
ATOM 10181 H H    . LYS A 1 54 ? -45.978 -52.490 -29.854 1.00 0.00 ? 54 LYS A H    10 
ATOM 10182 H HA   . LYS A 1 54 ? -44.949 -50.413 -28.180 1.00 0.00 ? 54 LYS A HA   10 
ATOM 10183 H HB2  . LYS A 1 54 ? -46.510 -52.927 -27.538 1.00 0.00 ? 54 LYS A HB2  10 
ATOM 10184 H HB3  . LYS A 1 54 ? -46.130 -51.669 -26.359 1.00 0.00 ? 54 LYS A HB3  10 
ATOM 10185 H HG2  . LYS A 1 54 ? -47.310 -50.006 -27.751 1.00 0.00 ? 54 LYS A HG2  10 
ATOM 10186 H HG3  . LYS A 1 54 ? -47.697 -51.264 -28.925 1.00 0.00 ? 54 LYS A HG3  10 
ATOM 10187 H HD2  . LYS A 1 54 ? -48.948 -52.502 -27.196 1.00 0.00 ? 54 LYS A HD2  10 
ATOM 10188 H HD3  . LYS A 1 54 ? -48.565 -51.245 -26.020 1.00 0.00 ? 54 LYS A HD3  10 
ATOM 10189 H HE2  . LYS A 1 54 ? -49.753 -49.583 -27.398 1.00 0.00 ? 54 LYS A HE2  10 
ATOM 10190 H HE3  . LYS A 1 54 ? -50.132 -50.834 -28.584 1.00 0.00 ? 54 LYS A HE3  10 
ATOM 10191 H HZ1  . LYS A 1 54 ? -52.009 -50.653 -27.209 1.00 0.00 ? 54 LYS A HZ1  10 
ATOM 10192 H HZ2  . LYS A 1 54 ? -51.081 -50.622 -25.787 1.00 0.00 ? 54 LYS A HZ2  10 
ATOM 10193 H HZ3  . LYS A 1 54 ? -51.214 -52.058 -26.685 1.00 0.00 ? 54 LYS A HZ3  10 
ATOM 10194 N N    . LYS A 1 55 ? -42.683 -51.863 -28.206 1.00 0.00 ? 55 LYS A N    10 
ATOM 10195 C CA   . LYS A 1 55 ? -41.419 -52.423 -27.745 1.00 0.00 ? 55 LYS A CA   10 
ATOM 10196 C C    . LYS A 1 55 ? -40.592 -51.337 -27.068 1.00 0.00 ? 55 LYS A C    10 
ATOM 10197 O O    . LYS A 1 55 ? -39.382 -51.477 -26.889 1.00 0.00 ? 55 LYS A O    10 
ATOM 10198 C CB   . LYS A 1 55 ? -40.644 -52.992 -28.931 1.00 0.00 ? 55 LYS A CB   10 
ATOM 10199 C CG   . LYS A 1 55 ? -41.468 -54.102 -29.586 1.00 0.00 ? 55 LYS A CG   10 
ATOM 10200 C CD   . LYS A 1 55 ? -40.705 -54.664 -30.785 1.00 0.00 ? 55 LYS A CD   10 
ATOM 10201 C CE   . LYS A 1 55 ? -41.538 -55.765 -31.446 1.00 0.00 ? 55 LYS A CE   10 
ATOM 10202 N NZ   . LYS A 1 55 ? -42.803 -55.177 -31.972 1.00 0.00 ? 55 LYS A NZ   10 
ATOM 10203 H H    . LYS A 1 55 ? -42.680 -51.259 -28.976 1.00 0.00 ? 55 LYS A H    10 
ATOM 10204 H HA   . LYS A 1 55 ? -41.615 -53.213 -27.037 1.00 0.00 ? 55 LYS A HA   10 
ATOM 10205 H HB2  . LYS A 1 55 ? -40.458 -52.210 -29.651 1.00 0.00 ? 55 LYS A HB2  10 
ATOM 10206 H HB3  . LYS A 1 55 ? -39.705 -53.400 -28.589 1.00 0.00 ? 55 LYS A HB3  10 
ATOM 10207 H HG2  . LYS A 1 55 ? -41.644 -54.889 -28.868 1.00 0.00 ? 55 LYS A HG2  10 
ATOM 10208 H HG3  . LYS A 1 55 ? -42.412 -53.699 -29.918 1.00 0.00 ? 55 LYS A HG3  10 
ATOM 10209 H HD2  . LYS A 1 55 ? -40.519 -53.874 -31.497 1.00 0.00 ? 55 LYS A HD2  10 
ATOM 10210 H HD3  . LYS A 1 55 ? -39.764 -55.079 -30.453 1.00 0.00 ? 55 LYS A HD3  10 
ATOM 10211 H HE2  . LYS A 1 55 ? -40.977 -56.200 -32.260 1.00 0.00 ? 55 LYS A HE2  10 
ATOM 10212 H HE3  . LYS A 1 55 ? -41.768 -56.528 -30.719 1.00 0.00 ? 55 LYS A HE3  10 
ATOM 10213 H HZ1  . LYS A 1 55 ? -42.731 -55.065 -33.002 1.00 0.00 ? 55 LYS A HZ1  10 
ATOM 10214 H HZ2  . LYS A 1 55 ? -42.965 -54.249 -31.532 1.00 0.00 ? 55 LYS A HZ2  10 
ATOM 10215 H HZ3  . LYS A 1 55 ? -43.597 -55.810 -31.749 1.00 0.00 ? 55 LYS A HZ3  10 
ATOM 10216 N N    . ARG A 1 56 ? -41.262 -50.251 -26.701 1.00 0.00 ? 56 ARG A N    10 
ATOM 10217 C CA   . ARG A 1 56 ? -40.594 -49.134 -26.048 1.00 0.00 ? 56 ARG A CA   10 
ATOM 10218 C C    . ARG A 1 56 ? -40.870 -49.181 -24.549 1.00 0.00 ? 56 ARG A C    10 
ATOM 10219 O O    . ARG A 1 56 ? -40.495 -48.276 -23.804 1.00 0.00 ? 56 ARG A O    10 
ATOM 10220 C CB   . ARG A 1 56 ? -41.109 -47.809 -26.626 1.00 0.00 ? 56 ARG A CB   10 
ATOM 10221 C CG   . ARG A 1 56 ? -41.066 -47.834 -28.165 1.00 0.00 ? 56 ARG A CG   10 
ATOM 10222 C CD   . ARG A 1 56 ? -39.620 -47.804 -28.676 1.00 0.00 ? 56 ARG A CD   10 
ATOM 10223 N NE   . ARG A 1 56 ? -39.609 -47.744 -30.135 1.00 0.00 ? 56 ARG A NE   10 
ATOM 10224 C CZ   . ARG A 1 56 ? -39.661 -48.848 -30.873 1.00 0.00 ? 56 ARG A CZ   10 
ATOM 10225 N NH1  . ARG A 1 56 ? -39.736 -50.016 -30.296 1.00 0.00 ? 56 ARG A NH1  10 
ATOM 10226 N NH2  . ARG A 1 56 ? -39.641 -48.764 -32.174 1.00 0.00 ? 56 ARG A NH2  10 
ATOM 10227 H H    . ARG A 1 56 ? -42.228 -50.212 -26.860 1.00 0.00 ? 56 ARG A H    10 
ATOM 10228 H HA   . ARG A 1 56 ? -39.533 -49.206 -26.205 1.00 0.00 ? 56 ARG A HA   10 
ATOM 10229 H HB2  . ARG A 1 56 ? -42.128 -47.650 -26.301 1.00 0.00 ? 56 ARG A HB2  10 
ATOM 10230 H HB3  . ARG A 1 56 ? -40.492 -46.999 -26.266 1.00 0.00 ? 56 ARG A HB3  10 
ATOM 10231 H HG2  . ARG A 1 56 ? -41.550 -48.731 -28.523 1.00 0.00 ? 56 ARG A HG2  10 
ATOM 10232 H HG3  . ARG A 1 56 ? -41.593 -46.974 -28.547 1.00 0.00 ? 56 ARG A HG3  10 
ATOM 10233 H HD2  . ARG A 1 56 ? -39.116 -46.938 -28.279 1.00 0.00 ? 56 ARG A HD2  10 
ATOM 10234 H HD3  . ARG A 1 56 ? -39.103 -48.696 -28.357 1.00 0.00 ? 56 ARG A HD3  10 
ATOM 10235 H HE   . ARG A 1 56 ? -39.555 -46.873 -30.580 1.00 0.00 ? 56 ARG A HE   10 
ATOM 10236 H HH11 . ARG A 1 56 ? -39.752 -50.082 -29.298 1.00 0.00 ? 56 ARG A HH11 10 
ATOM 10237 H HH12 . ARG A 1 56 ? -39.776 -50.846 -30.853 1.00 0.00 ? 56 ARG A HH12 10 
ATOM 10238 H HH21 . ARG A 1 56 ? -39.587 -47.868 -32.617 1.00 0.00 ? 56 ARG A HH21 10 
ATOM 10239 H HH22 . ARG A 1 56 ? -39.683 -49.594 -32.730 1.00 0.00 ? 56 ARG A HH22 10 
ATOM 10240 N N    . ARG A 1 57 ? -41.536 -50.249 -24.123 1.00 0.00 ? 57 ARG A N    10 
ATOM 10241 C CA   . ARG A 1 57 ? -41.873 -50.419 -22.714 1.00 0.00 ? 57 ARG A CA   10 
ATOM 10242 C C    . ARG A 1 57 ? -41.648 -51.863 -22.274 1.00 0.00 ? 57 ARG A C    10 
ATOM 10243 O O    . ARG A 1 57 ? -41.595 -52.776 -23.097 1.00 0.00 ? 57 ARG A O    10 
ATOM 10244 C CB   . ARG A 1 57 ? -43.332 -50.021 -22.475 1.00 0.00 ? 57 ARG A CB   10 
ATOM 10245 C CG   . ARG A 1 57 ? -44.256 -50.888 -23.336 1.00 0.00 ? 57 ARG A CG   10 
ATOM 10246 C CD   . ARG A 1 57 ? -45.712 -50.516 -23.050 1.00 0.00 ? 57 ARG A CD   10 
ATOM 10247 N NE   . ARG A 1 57 ? -46.068 -50.883 -21.684 1.00 0.00 ? 57 ARG A NE   10 
ATOM 10248 C CZ   . ARG A 1 57 ? -47.252 -50.560 -21.173 1.00 0.00 ? 57 ARG A CZ   10 
ATOM 10249 N NH1  . ARG A 1 57 ? -48.118 -49.902 -21.896 1.00 0.00 ? 57 ARG A NH1  10 
ATOM 10250 N NH2  . ARG A 1 57 ? -47.548 -50.901 -19.949 1.00 0.00 ? 57 ARG A NH2  10 
ATOM 10251 H H    . ARG A 1 57 ? -41.811 -50.924 -24.776 1.00 0.00 ? 57 ARG A H    10 
ATOM 10252 H HA   . ARG A 1 57 ? -41.237 -49.775 -22.126 1.00 0.00 ? 57 ARG A HA   10 
ATOM 10253 H HB2  . ARG A 1 57 ? -43.575 -50.162 -21.432 1.00 0.00 ? 57 ARG A HB2  10 
ATOM 10254 H HB3  . ARG A 1 57 ? -43.468 -48.983 -22.738 1.00 0.00 ? 57 ARG A HB3  10 
ATOM 10255 H HG2  . ARG A 1 57 ? -44.038 -50.719 -24.381 1.00 0.00 ? 57 ARG A HG2  10 
ATOM 10256 H HG3  . ARG A 1 57 ? -44.102 -51.929 -23.100 1.00 0.00 ? 57 ARG A HG3  10 
ATOM 10257 H HD2  . ARG A 1 57 ? -45.841 -49.452 -23.178 1.00 0.00 ? 57 ARG A HD2  10 
ATOM 10258 H HD3  . ARG A 1 57 ? -46.357 -51.038 -23.744 1.00 0.00 ? 57 ARG A HD3  10 
ATOM 10259 H HE   . ARG A 1 57 ? -45.424 -51.376 -21.135 1.00 0.00 ? 57 ARG A HE   10 
ATOM 10260 H HH11 . ARG A 1 57 ? -47.890 -49.642 -22.834 1.00 0.00 ? 57 ARG A HH11 10 
ATOM 10261 H HH12 . ARG A 1 57 ? -49.008 -49.659 -21.511 1.00 0.00 ? 57 ARG A HH12 10 
ATOM 10262 H HH21 . ARG A 1 57 ? -46.884 -51.404 -19.395 1.00 0.00 ? 57 ARG A HH21 10 
ATOM 10263 H HH22 . ARG A 1 57 ? -48.439 -50.658 -19.564 1.00 0.00 ? 57 ARG A HH22 10 
ATOM 10264 N N    . GLN A 1 58 ? -41.507 -52.053 -20.966 1.00 0.00 ? 58 GLN A N    10 
ATOM 10265 C CA   . GLN A 1 58 ? -41.278 -53.383 -20.414 1.00 0.00 ? 58 GLN A CA   10 
ATOM 10266 C C    . GLN A 1 58 ? -42.539 -54.235 -20.504 1.00 0.00 ? 58 GLN A C    10 
ATOM 10267 O O    . GLN A 1 58 ? -43.647 -53.745 -20.291 1.00 0.00 ? 58 GLN A O    10 
ATOM 10268 C CB   . GLN A 1 58 ? -40.845 -53.265 -18.950 1.00 0.00 ? 58 GLN A CB   10 
ATOM 10269 C CG   . GLN A 1 58 ? -39.520 -52.502 -18.869 1.00 0.00 ? 58 GLN A CG   10 
ATOM 10270 C CD   . GLN A 1 58 ? -39.758 -51.017 -19.120 1.00 0.00 ? 58 GLN A CD   10 
ATOM 10271 O OE1  . GLN A 1 58 ? -40.688 -50.434 -18.563 1.00 0.00 ? 58 GLN A OE1  10 
ATOM 10272 N NE2  . GLN A 1 58 ? -38.968 -50.367 -19.930 1.00 0.00 ? 58 GLN A NE2  10 
ATOM 10273 H H    . GLN A 1 58 ? -41.553 -51.280 -20.365 1.00 0.00 ? 58 GLN A H    10 
ATOM 10274 H HA   . GLN A 1 58 ? -40.487 -53.862 -20.971 1.00 0.00 ? 58 GLN A HA   10 
ATOM 10275 H HB2  . GLN A 1 58 ? -41.602 -52.733 -18.393 1.00 0.00 ? 58 GLN A HB2  10 
ATOM 10276 H HB3  . GLN A 1 58 ? -40.715 -54.251 -18.533 1.00 0.00 ? 58 GLN A HB3  10 
ATOM 10277 H HG2  . GLN A 1 58 ? -39.091 -52.635 -17.887 1.00 0.00 ? 58 GLN A HG2  10 
ATOM 10278 H HG3  . GLN A 1 58 ? -38.840 -52.885 -19.614 1.00 0.00 ? 58 GLN A HG3  10 
ATOM 10279 H HE21 . GLN A 1 58 ? -38.230 -50.835 -20.373 1.00 0.00 ? 58 GLN A HE21 10 
ATOM 10280 H HE22 . GLN A 1 58 ? -39.115 -49.412 -20.097 1.00 0.00 ? 58 GLN A HE22 10 
ATOM 10281 N N    . ILE A 1 59 ? -42.354 -55.517 -20.815 1.00 0.00 ? 59 ILE A N    10 
ATOM 10282 C CA   . ILE A 1 59 ? -43.477 -56.444 -20.929 1.00 0.00 ? 59 ILE A CA   10 
ATOM 10283 C C    . ILE A 1 59 ? -43.242 -57.681 -20.065 1.00 0.00 ? 59 ILE A C    10 
ATOM 10284 O O    . ILE A 1 59 ? -44.070 -58.590 -20.024 1.00 0.00 ? 59 ILE A O    10 
ATOM 10285 C CB   . ILE A 1 59 ? -43.670 -56.854 -22.393 1.00 0.00 ? 59 ILE A CB   10 
ATOM 10286 C CG1  . ILE A 1 59 ? -42.383 -57.490 -22.933 1.00 0.00 ? 59 ILE A CG1  10 
ATOM 10287 C CG2  . ILE A 1 59 ? -44.011 -55.618 -23.226 1.00 0.00 ? 59 ILE A CG2  10 
ATOM 10288 C CD1  . ILE A 1 59 ? -42.648 -58.067 -24.326 1.00 0.00 ? 59 ILE A CD1  10 
ATOM 10289 H H    . ILE A 1 59 ? -41.445 -55.847 -20.966 1.00 0.00 ? 59 ILE A H    10 
ATOM 10290 H HA   . ILE A 1 59 ? -44.373 -55.949 -20.588 1.00 0.00 ? 59 ILE A HA   10 
ATOM 10291 H HB   . ILE A 1 59 ? -44.480 -57.565 -22.461 1.00 0.00 ? 59 ILE A HB   10 
ATOM 10292 H HG12 . ILE A 1 59 ? -41.610 -56.737 -22.996 1.00 0.00 ? 59 ILE A HG12 10 
ATOM 10293 H HG13 . ILE A 1 59 ? -42.061 -58.282 -22.275 1.00 0.00 ? 59 ILE A HG13 10 
ATOM 10294 H HG21 . ILE A 1 59 ? -43.140 -54.987 -23.308 1.00 0.00 ? 59 ILE A HG21 10 
ATOM 10295 H HG22 . ILE A 1 59 ? -44.809 -55.069 -22.746 1.00 0.00 ? 59 ILE A HG22 10 
ATOM 10296 H HG23 . ILE A 1 59 ? -44.329 -55.924 -24.212 1.00 0.00 ? 59 ILE A HG23 10 
ATOM 10297 H HD11 . ILE A 1 59 ? -41.908 -57.693 -25.017 1.00 0.00 ? 59 ILE A HD11 10 
ATOM 10298 H HD12 . ILE A 1 59 ? -43.633 -57.772 -24.656 1.00 0.00 ? 59 ILE A HD12 10 
ATOM 10299 H HD13 . ILE A 1 59 ? -42.590 -59.146 -24.284 1.00 0.00 ? 59 ILE A HD13 10 
ATOM 10300 N N    . ASN A 1 60 ? -42.107 -57.704 -19.372 1.00 0.00 ? 60 ASN A N    10 
ATOM 10301 C CA   . ASN A 1 60 ? -41.774 -58.829 -18.506 1.00 0.00 ? 60 ASN A CA   10 
ATOM 10302 C C    . ASN A 1 60 ? -40.716 -58.430 -17.482 1.00 0.00 ? 60 ASN A C    10 
ATOM 10303 O O    . ASN A 1 60 ? -39.997 -57.450 -17.670 1.00 0.00 ? 60 ASN A O    10 
ATOM 10304 C CB   . ASN A 1 60 ? -41.261 -60.001 -19.347 1.00 0.00 ? 60 ASN A CB   10 
ATOM 10305 C CG   . ASN A 1 60 ? -39.951 -59.621 -20.030 1.00 0.00 ? 60 ASN A CG   10 
ATOM 10306 O OD1  . ASN A 1 60 ? -39.361 -58.589 -19.715 1.00 0.00 ? 60 ASN A OD1  10 
ATOM 10307 N ND2  . ASN A 1 60 ? -39.458 -60.401 -20.953 1.00 0.00 ? 60 ASN A ND2  10 
ATOM 10308 H H    . ASN A 1 60 ? -41.491 -56.944 -19.435 1.00 0.00 ? 60 ASN A H    10 
ATOM 10309 H HA   . ASN A 1 60 ? -42.665 -59.144 -17.982 1.00 0.00 ? 60 ASN A HA   10 
ATOM 10310 H HB2  . ASN A 1 60 ? -41.096 -60.855 -18.708 1.00 0.00 ? 60 ASN A HB2  10 
ATOM 10311 H HB3  . ASN A 1 60 ? -41.996 -60.251 -20.097 1.00 0.00 ? 60 ASN A HB3  10 
ATOM 10312 H HD21 . ASN A 1 60 ? -39.928 -61.223 -21.202 1.00 0.00 ? 60 ASN A HD21 10 
ATOM 10313 H HD22 . ASN A 1 60 ? -38.616 -60.165 -21.396 1.00 0.00 ? 60 ASN A HD22 10 
ATOM 10314 N N    . GLU A 1 61 ? -40.624 -59.197 -16.400 1.00 0.00 ? 61 GLU A N    10 
ATOM 10315 C CA   . GLU A 1 61 ? -39.647 -58.914 -15.354 1.00 0.00 ? 61 GLU A CA   10 
ATOM 10316 C C    . GLU A 1 61 ? -38.283 -59.485 -15.729 1.00 0.00 ? 61 GLU A C    10 
ATOM 10317 O O    . GLU A 1 61 ? -37.269 -59.152 -15.115 1.00 0.00 ? 61 GLU A O    10 
ATOM 10318 C CB   . GLU A 1 61 ? -40.110 -59.519 -14.028 1.00 0.00 ? 61 GLU A CB   10 
ATOM 10319 C CG   . GLU A 1 61 ? -41.454 -58.910 -13.628 1.00 0.00 ? 61 GLU A CG   10 
ATOM 10320 C CD   . GLU A 1 61 ? -41.282 -57.426 -13.320 1.00 0.00 ? 61 GLU A CD   10 
ATOM 10321 O OE1  . GLU A 1 61 ? -40.163 -57.020 -13.055 1.00 0.00 ? 61 GLU A OE1  10 
ATOM 10322 O OE2  . GLU A 1 61 ? -42.274 -56.716 -13.355 1.00 0.00 ? 61 GLU A OE2  10 
ATOM 10323 H H    . GLU A 1 61 ? -41.225 -59.966 -16.302 1.00 0.00 ? 61 GLU A H    10 
ATOM 10324 H HA   . GLU A 1 61 ? -39.559 -57.844 -15.238 1.00 0.00 ? 61 GLU A HA   10 
ATOM 10325 H HB2  . GLU A 1 61 ? -40.217 -60.590 -14.139 1.00 0.00 ? 61 GLU A HB2  10 
ATOM 10326 H HB3  . GLU A 1 61 ? -39.378 -59.309 -13.262 1.00 0.00 ? 61 GLU A HB3  10 
ATOM 10327 H HG2  . GLU A 1 61 ? -42.157 -59.030 -14.439 1.00 0.00 ? 61 GLU A HG2  10 
ATOM 10328 H HG3  . GLU A 1 61 ? -41.829 -59.414 -12.749 1.00 0.00 ? 61 GLU A HG3  10 
ATOM 10329 N N    . ASP A 1 62 ? -38.266 -60.347 -16.741 1.00 0.00 ? 62 ASP A N    10 
ATOM 10330 C CA   . ASP A 1 62 ? -37.020 -60.960 -17.193 1.00 0.00 ? 62 ASP A CA   10 
ATOM 10331 C C    . ASP A 1 62 ? -36.050 -59.894 -17.695 1.00 0.00 ? 62 ASP A C    10 
ATOM 10332 O O    . ASP A 1 62 ? -34.854 -59.946 -17.409 1.00 0.00 ? 62 ASP A O    10 
ATOM 10333 C CB   . ASP A 1 62 ? -37.307 -61.960 -18.314 1.00 0.00 ? 62 ASP A CB   10 
ATOM 10334 C CG   . ASP A 1 62 ? -36.021 -62.672 -18.718 1.00 0.00 ? 62 ASP A CG   10 
ATOM 10335 O OD1  . ASP A 1 62 ? -35.500 -63.417 -17.904 1.00 0.00 ? 62 ASP A OD1  10 
ATOM 10336 O OD2  . ASP A 1 62 ? -35.576 -62.463 -19.835 1.00 0.00 ? 62 ASP A OD2  10 
ATOM 10337 H H    . ASP A 1 62 ? -39.105 -60.573 -17.194 1.00 0.00 ? 62 ASP A H    10 
ATOM 10338 H HA   . ASP A 1 62 ? -36.567 -61.483 -16.366 1.00 0.00 ? 62 ASP A HA   10 
ATOM 10339 H HB2  . ASP A 1 62 ? -38.027 -62.687 -17.969 1.00 0.00 ? 62 ASP A HB2  10 
ATOM 10340 H HB3  . ASP A 1 62 ? -37.709 -61.436 -19.169 1.00 0.00 ? 62 ASP A HB3  10 
ATOM 10341 N N    . GLU A 1 63 ? -36.579 -58.934 -18.448 1.00 0.00 ? 63 GLU A N    10 
ATOM 10342 C CA   . GLU A 1 63 ? -35.757 -57.856 -18.992 1.00 0.00 ? 63 GLU A CA   10 
ATOM 10343 C C    . GLU A 1 63 ? -36.403 -56.500 -18.716 1.00 0.00 ? 63 GLU A C    10 
ATOM 10344 O O    . GLU A 1 63 ? -37.038 -55.917 -19.595 1.00 0.00 ? 63 GLU A O    10 
ATOM 10345 C CB   . GLU A 1 63 ? -35.595 -58.042 -20.502 1.00 0.00 ? 63 GLU A CB   10 
ATOM 10346 C CG   . GLU A 1 63 ? -34.582 -57.028 -21.035 1.00 0.00 ? 63 GLU A CG   10 
ATOM 10347 C CD   . GLU A 1 63 ? -34.376 -57.233 -22.532 1.00 0.00 ? 63 GLU A CD   10 
ATOM 10348 O OE1  . GLU A 1 63 ? -34.957 -58.162 -23.068 1.00 0.00 ? 63 GLU A OE1  10 
ATOM 10349 O OE2  . GLU A 1 63 ? -33.640 -56.456 -23.121 1.00 0.00 ? 63 GLU A OE2  10 
ATOM 10350 H H    . GLU A 1 63 ? -37.540 -58.951 -18.640 1.00 0.00 ? 63 GLU A H    10 
ATOM 10351 H HA   . GLU A 1 63 ? -34.782 -57.888 -18.534 1.00 0.00 ? 63 GLU A HA   10 
ATOM 10352 H HB2  . GLU A 1 63 ? -35.244 -59.045 -20.706 1.00 0.00 ? 63 GLU A HB2  10 
ATOM 10353 H HB3  . GLU A 1 63 ? -36.546 -57.888 -20.990 1.00 0.00 ? 63 GLU A HB3  10 
ATOM 10354 H HG2  . GLU A 1 63 ? -34.949 -56.028 -20.857 1.00 0.00 ? 63 GLU A HG2  10 
ATOM 10355 H HG3  . GLU A 1 63 ? -33.639 -57.160 -20.524 1.00 0.00 ? 63 GLU A HG3  10 
ATOM 10356 N N    . PRO A 1 64 ? -36.253 -55.991 -17.520 1.00 0.00 ? 64 PRO A N    10 
ATOM 10357 C CA   . PRO A 1 64 ? -36.834 -54.680 -17.128 1.00 0.00 ? 64 PRO A CA   10 
ATOM 10358 C C    . PRO A 1 64 ? -35.955 -53.508 -17.557 1.00 0.00 ? 64 PRO A C    10 
ATOM 10359 O O    . PRO A 1 64 ? -36.325 -52.831 -18.500 1.00 0.00 ? 64 PRO A O    10 
ATOM 10360 C CB   . PRO A 1 64 ? -36.917 -54.775 -15.606 1.00 0.00 ? 64 PRO A CB   10 
ATOM 10361 C CG   . PRO A 1 64 ? -35.823 -55.711 -15.200 1.00 0.00 ? 64 PRO A CG   10 
ATOM 10362 C CD   . PRO A 1 64 ? -35.517 -56.609 -16.407 1.00 0.00 ? 64 PRO A CD   10 
ATOM 10363 O OXT  . PRO A 1 64 ? -34.924 -53.307 -16.935 1.00 0.00 ? 64 PRO A OXT  10 
ATOM 10364 H HA   . PRO A 1 64 ? -37.825 -54.573 -17.536 1.00 0.00 ? 64 PRO A HA   10 
ATOM 10365 H HB2  . PRO A 1 64 ? -36.762 -53.801 -15.162 1.00 0.00 ? 64 PRO A HB2  10 
ATOM 10366 H HB3  . PRO A 1 64 ? -37.874 -55.176 -15.308 1.00 0.00 ? 64 PRO A HB3  10 
ATOM 10367 H HG2  . PRO A 1 64 ? -34.941 -55.148 -14.924 1.00 0.00 ? 64 PRO A HG2  10 
ATOM 10368 H HG3  . PRO A 1 64 ? -36.146 -56.319 -14.370 1.00 0.00 ? 64 PRO A HG3  10 
ATOM 10369 H HD2  . PRO A 1 64 ? -34.455 -56.615 -16.608 1.00 0.00 ? 64 PRO A HD2  10 
ATOM 10370 H HD3  . PRO A 1 64 ? -35.876 -57.612 -16.232 1.00 0.00 ? 64 PRO A HD3  10 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  LEU 1  1  1  LEU LEU A . n 
A 1 2  ASP 2  2  2  ASP ASP A . n 
A 1 3  ARG 3  3  3  ARG ARG A . n 
A 1 4  TRP 4  4  4  TRP TRP A . n 
A 1 5  TYR 5  5  5  TYR TYR A . n 
A 1 6  LEU 6  6  6  LEU LEU A . n 
A 1 7  GLY 7  7  7  GLY GLY A . n 
A 1 8  GLY 8  8  8  GLY GLY A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 PRO 10 10 10 PRO PRO A . n 
A 1 11 LYS 11 11 11 LYS LYS A . n 
A 1 12 GLY 12 12 12 GLY GLY A . n 
A 1 13 ASP 13 13 13 ASP ASP A . n 
A 1 14 VAL 14 14 14 VAL VAL A . n 
A 1 15 ASP 15 15 15 ASP ASP A . n 
A 1 16 PRO 16 16 16 PRO PRO A . n 
A 1 17 PHE 17 17 17 PHE PHE A . n 
A 1 18 TYR 18 18 18 TYR TYR A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 ASP 20 20 20 ASP ASP A . n 
A 1 21 TYR 21 21 21 TYR TYR A . n 
A 1 22 GLU 22 22 22 GLU GLU A . n 
A 1 23 THR 23 23 23 THR THR A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 ARG 25 25 25 ARG ARG A . n 
A 1 26 ASN 26 26 26 ASN ASN A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 GLY 28 28 28 GLY GLY A . n 
A 1 29 LEU 29 29 29 LEU LEU A . n 
A 1 30 ILE 30 30 30 ILE ILE A . n 
A 1 31 PHE 31 31 31 PHE PHE A . n 
A 1 32 ALA 32 32 32 ALA ALA A . n 
A 1 33 GLY 33 33 33 GLY GLY A . n 
A 1 34 LEU 34 34 34 LEU LEU A . n 
A 1 35 ALA 35 35 35 ALA ALA A . n 
A 1 36 PHE 36 36 36 PHE PHE A . n 
A 1 37 ILE 37 37 37 ILE ILE A . n 
A 1 38 VAL 38 38 38 VAL VAL A . n 
A 1 39 GLY 39 39 39 GLY GLY A . n 
A 1 40 LEU 40 40 40 LEU LEU A . n 
A 1 41 LEU 41 41 41 LEU LEU A . n 
A 1 42 ILE 42 42 42 ILE ILE A . n 
A 1 43 LEU 43 43 43 LEU LEU A . n 
A 1 44 LEU 44 44 44 LEU LEU A . n 
A 1 45 SER 45 45 45 SER SER A . n 
A 1 46 ARG 46 46 46 ARG ARG A . n 
A 1 47 ARG 47 47 47 ARG ARG A . n 
A 1 48 PHE 48 48 48 PHE PHE A . n 
A 1 49 ARG 49 49 49 ARG ARG A . n 
A 1 50 SER 50 50 50 SER SER A . n 
A 1 51 GLY 51 51 51 GLY GLY A . n 
A 1 52 GLY 52 52 52 GLY GLY A . n 
A 1 53 ASN 53 53 53 ASN ASN A . n 
A 1 54 LYS 54 54 54 LYS LYS A . n 
A 1 55 LYS 55 55 55 LYS LYS A . n 
A 1 56 ARG 56 56 56 ARG ARG A . n 
A 1 57 ARG 57 57 57 ARG ARG A . n 
A 1 58 GLN 58 58 58 GLN GLN A . n 
A 1 59 ILE 59 59 59 ILE ILE A . n 
A 1 60 ASN 60 60 60 ASN ASN A . n 
A 1 61 GLU 61 61 61 GLU GLU A . n 
A 1 62 ASP 62 62 62 ASP ASP A . n 
A 1 63 GLU 63 63 63 GLU GLU A . n 
A 1 64 PRO 64 64 64 PRO PRO A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-05-14 
2 'Structure model' 1 1 2014-05-21 
3 'Structure model' 1 2 2014-12-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
_pdbx_nmr_exptl_sample.component             H2O-1 
_pdbx_nmr_exptl_sample.concentration         0.2 
_pdbx_nmr_exptl_sample.concentration_range   ? 
_pdbx_nmr_exptl_sample.concentration_units   mM 
_pdbx_nmr_exptl_sample.isotopic_labeling     '[U-99% 13C; U-99% 15N]' 
_pdbx_nmr_exptl_sample.solution_id           1 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    8 
_pdbx_validate_close_contact.auth_atom_id_1   HH22 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    47 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   H 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   LYS 
_pdbx_validate_close_contact.auth_seq_id_2    54 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.27 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  PRO A 10 ? ? -58.57  -172.26 
2  1  ASP A 13 ? ? -85.88  -74.17  
3  1  PRO A 16 ? ? -83.90  32.14   
4  1  LYS A 54 ? ? 42.20   80.10   
5  1  ARG A 57 ? ? 38.17   54.36   
6  2  LEU A 6  ? ? -116.90 -134.61 
7  2  ASN A 53 ? ? 69.97   -147.84 
8  3  PRO A 10 ? ? -67.96  -84.24  
9  3  PRO A 16 ? ? -84.12  31.67   
10 3  SER A 50 ? ? 76.27   175.86  
11 4  PRO A 10 ? ? -63.96  -153.36 
12 5  LEU A 6  ? ? -34.27  143.55  
13 5  PRO A 10 ? ? -68.62  -85.02  
14 5  ASP A 13 ? ? -160.24 51.50   
15 5  VAL A 24 ? ? -38.27  -23.73  
16 5  SER A 50 ? ? 85.72   40.55   
17 5  ARG A 57 ? ? 35.02   -130.35 
18 5  ILE A 59 ? ? -130.92 -32.04  
19 6  LEU A 6  ? ? -47.50  159.88  
20 6  ARG A 57 ? ? 90.29   -138.76 
21 6  GLU A 61 ? ? 37.35   -122.18 
22 6  ASP A 62 ? ? 42.64   -128.97 
23 7  ARG A 3  ? ? 60.83   65.27   
24 7  PRO A 16 ? ? -83.27  34.88   
25 7  LYS A 54 ? ? -141.23 58.67   
26 8  ARG A 3  ? ? 39.91   -146.67 
27 8  ASN A 53 ? ? -45.66  88.38   
28 8  LYS A 54 ? ? 44.86   98.32   
29 8  ARG A 57 ? ? 55.69   -150.62 
30 9  ARG A 3  ? ? 62.71   171.29  
31 9  ASP A 15 ? ? -162.74 58.56   
32 9  PHE A 17 ? ? -57.48  -1.10   
33 9  SER A 50 ? ? 35.10   -113.16 
34 10 ARG A 3  ? ? -164.67 69.81   
35 10 LEU A 6  ? ? -38.48  143.67  
36 10 ASP A 13 ? ? -142.83 32.76   
37 10 SER A 50 ? ? -81.18  -150.93 
38 10 ASN A 53 ? ? 57.27   84.59   
39 10 LYS A 54 ? ? -69.94  60.52   
#