data_2N0A
# 
_entry.id   2N0A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
RCSB104259   RCSB  
2N0A         PDB   
25518        BMRB  
D_1000104259 WWPDB 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          25518 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2N0A 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-04 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tuttle, M.D.'     1  
'Comellas, G.'     2  
'Nieuwkoop, A.J.'  3  
'Covell, D.J.'     4  
'Berthold, D.A.'   5  
'Kloepper, K.D.'   6  
'Courtney, J.M.'   7  
'Kim, J.K.'        8  
'Schwieters, C.D.' 9  
'Lee, V.M.'        10 
'George, J.M.'     11 
'Rienstra, C.M.'   12 
# 
_citation.id                        primary 
_citation.title                     'Solid-state NMR structure of a pathogenic fibril of full-length human alpha-synuclein.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            23 
_citation.page_first                409 
_citation.page_last                 415 
_citation.year                      2016 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   27018801 
_citation.pdbx_database_id_DOI      10.1038/nsmb.3194 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tuttle, M.D.'     1  
primary 'Comellas, G.'     2  
primary 'Nieuwkoop, A.J.'  3  
primary 'Covell, D.J.'     4  
primary 'Berthold, D.A.'   5  
primary 'Kloepper, K.D.'   6  
primary 'Courtney, J.M.'   7  
primary 'Kim, J.K.'        8  
primary 'Barclay, A.M.'    9  
primary 'Kendall, A.'      10 
primary 'Wan, W.'          11 
primary 'Stubbs, G.'       12 
primary 'Schwieters, C.D.' 13 
primary 'Lee, V.M.'        14 
primary 'George, J.M.'     15 
primary 'Rienstra, C.M.'   16 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Alpha-synuclein 
_entity.formula_weight             14476.108 
_entity.pdbx_number_of_molecules   10 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, NACP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK
TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK
TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   VAL n 
1 4   PHE n 
1 5   MET n 
1 6   LYS n 
1 7   GLY n 
1 8   LEU n 
1 9   SER n 
1 10  LYS n 
1 11  ALA n 
1 12  LYS n 
1 13  GLU n 
1 14  GLY n 
1 15  VAL n 
1 16  VAL n 
1 17  ALA n 
1 18  ALA n 
1 19  ALA n 
1 20  GLU n 
1 21  LYS n 
1 22  THR n 
1 23  LYS n 
1 24  GLN n 
1 25  GLY n 
1 26  VAL n 
1 27  ALA n 
1 28  GLU n 
1 29  ALA n 
1 30  ALA n 
1 31  GLY n 
1 32  LYS n 
1 33  THR n 
1 34  LYS n 
1 35  GLU n 
1 36  GLY n 
1 37  VAL n 
1 38  LEU n 
1 39  TYR n 
1 40  VAL n 
1 41  GLY n 
1 42  SER n 
1 43  LYS n 
1 44  THR n 
1 45  LYS n 
1 46  GLU n 
1 47  GLY n 
1 48  VAL n 
1 49  VAL n 
1 50  HIS n 
1 51  GLY n 
1 52  VAL n 
1 53  ALA n 
1 54  THR n 
1 55  VAL n 
1 56  ALA n 
1 57  GLU n 
1 58  LYS n 
1 59  THR n 
1 60  LYS n 
1 61  GLU n 
1 62  GLN n 
1 63  VAL n 
1 64  THR n 
1 65  ASN n 
1 66  VAL n 
1 67  GLY n 
1 68  GLY n 
1 69  ALA n 
1 70  VAL n 
1 71  VAL n 
1 72  THR n 
1 73  GLY n 
1 74  VAL n 
1 75  THR n 
1 76  ALA n 
1 77  VAL n 
1 78  ALA n 
1 79  GLN n 
1 80  LYS n 
1 81  THR n 
1 82  VAL n 
1 83  GLU n 
1 84  GLY n 
1 85  ALA n 
1 86  GLY n 
1 87  SER n 
1 88  ILE n 
1 89  ALA n 
1 90  ALA n 
1 91  ALA n 
1 92  THR n 
1 93  GLY n 
1 94  PHE n 
1 95  VAL n 
1 96  LYS n 
1 97  LYS n 
1 98  ASP n 
1 99  GLN n 
1 100 LEU n 
1 101 GLY n 
1 102 LYS n 
1 103 ASN n 
1 104 GLU n 
1 105 GLU n 
1 106 GLY n 
1 107 ALA n 
1 108 PRO n 
1 109 GLN n 
1 110 GLU n 
1 111 GLY n 
1 112 ILE n 
1 113 LEU n 
1 114 GLU n 
1 115 ASP n 
1 116 MET n 
1 117 PRO n 
1 118 VAL n 
1 119 ASP n 
1 120 PRO n 
1 121 ASP n 
1 122 ASN n 
1 123 GLU n 
1 124 ALA n 
1 125 TYR n 
1 126 GLU n 
1 127 MET n 
1 128 PRO n 
1 129 SER n 
1 130 GLU n 
1 131 GLU n 
1 132 GLY n 
1 133 TYR n 
1 134 GLN n 
1 135 ASP n 
1 136 TYR n 
1 137 GLU n 
1 138 PRO n 
1 139 GLU n 
1 140 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SNCA, NACP, PARK1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a-AS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SYUA_HUMAN 
_struct_ref.pdbx_db_accession          P37840 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK
TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2N0A A 1 ? 140 ? P37840 1 ? 140 ? 1 140 
2  1 2N0A B 1 ? 140 ? P37840 1 ? 140 ? 1 140 
3  1 2N0A C 1 ? 140 ? P37840 1 ? 140 ? 1 140 
4  1 2N0A D 1 ? 140 ? P37840 1 ? 140 ? 1 140 
5  1 2N0A E 1 ? 140 ? P37840 1 ? 140 ? 1 140 
6  1 2N0A F 1 ? 140 ? P37840 1 ? 140 ? 1 140 
7  1 2N0A G 1 ? 140 ? P37840 1 ? 140 ? 1 140 
8  1 2N0A H 1 ? 140 ? P37840 1 ? 140 ? 1 140 
9  1 2N0A I 1 ? 140 ? P37840 1 ? 140 ? 1 140 
10 1 2N0A J 1 ? 140 ? P37840 1 ? 140 ? 1 140 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  7 'Cross Polarization C1D' 
1 2  1 '3D NCACX'               
1 3  1 '3D NCOCX'               
1 4  1 '3D CANCO'               
1 5  1 '2D CC DARR'             
1 6  2 '2D CC DARR'             
1 7  2 '3D NCOCX'               
1 8  2 '2D NC TEDOR'            
1 9  2 '2D CC DARR'             
1 10 2 '2D CC DARR'             
1 11 2 '3D NCOCX'               
1 12 3 '2D CC DARR'             
1 13 3 '3D NCACX'               
1 14 3 '2D CC DARR'             
1 15 3 '2D NC TEDOR'            
1 16 3 '2D CC DARR'             
1 17 3 '3D NCACX'               
1 18 4 '2D NC TEDOR'            
1 19 5 '2D NC TEDOR'            
1 20 6 '2D CC DARR'             
1 21 6 '2D ChhC'                
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'66% [U-100% 13C; U-100% 15N] alpha-synuclein, 34% H2O, Rehydrated Fibril'                                                        
1 'Rehydrated Fibril' 
'66% [U-100% 13C 1,3-Glycerol; U-100% 15N] alpha-synuclein, 34% H2O, Rehydrated Fibril'                                           
2 'Rehydrated Fibril' 
'66% [U-100% 13C 2-Glycerol; U-100% 15N] alpha-synuclein, 34% H2O, Rehydrated Fibril'                                             
3 'Rehydrated Fibril' 
'66% [U-25% 13C; U-25% 15N] alpha-synuclein, 34% H2O, Rehydrated Fibril'                                                          
4 'Rehydrated Fibril' 
'66% [U-25% 13C 1,3-Glycerol; natural abundance N][natural abundance C13, U-50% N15] alpha-synuclein, 34% H2O, Rehydrated Fibril' 
5 'Rehydrated Fibril' 
'66% [U-25% 13C 2-Glycerol; natural abundance N][natural abundance C13, U-50% N15] alpha-synuclein, 34% H2O, Rehydrated Fibril'   
6 'Rehydrated Fibril' 
'90% Adamantane, 10% KBr, Dry'                                                                                                    
7 Dry                 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
750 Agilent VNMRS        1 'Agilent VNMRS'        
600 Agilent InfinityPlus 2 'Agilent InfinityPlus' 
500 Agilent VNMRS        3 'Agilent VNMRS'        
# 
_pdbx_nmr_refine.entry_id           2N0A 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    0.0 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            256 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2N0A 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   0.0 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    0.0 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.0 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     Degrees 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2N0A 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Schwieters, Kuszewski, Tjandra and Clore' 'geometry optimization' X-PLOR_NIH 1 2.33.4 
'Schwieters, Kuszewski, Tjandra and Clore' refinement              X-PLOR_NIH 2 2.33.4 
'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution'    X-PLOR_NIH 3 2.33.4 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'Atomic-resolution structure of alpha-synuclein fibrils' 
_exptl.entry_id                   2N0A 
_exptl.method                     'SOLID-STATE NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2N0A 
_struct.title                     'Atomic-resolution structure of alpha-synuclein fibrils' 
_struct.pdbx_descriptor           Alpha-synuclein 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2N0A 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            
;Protein Fibril, Amyloid, Parkinson's Disease, STRUCTURAL PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 16  ? GLU A 20  ? VAL A 16  GLU A 20  5 ? 5 
HELX_P HELX_P2 2 GLY C 111 ? ASP C 115 ? GLY C 111 ASP C 115 5 ? 5 
HELX_P HELX_P3 3 ASN G 122 ? GLU G 126 ? ASN G 122 GLU G 126 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 10 ? 
C ? 10 ? 
D ? 10 ? 
E ? 10 ? 
F ? 3  ? 
G ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? parallel 
A 2 3  ? parallel 
A 3 4  ? parallel 
A 4 5  ? parallel 
A 5 6  ? parallel 
A 6 7  ? parallel 
A 7 8  ? parallel 
A 8 9  ? parallel 
A 9 10 ? parallel 
B 1 2  ? parallel 
B 2 3  ? parallel 
B 3 4  ? parallel 
B 4 5  ? parallel 
B 5 6  ? parallel 
B 6 7  ? parallel 
B 7 8  ? parallel 
B 8 9  ? parallel 
B 9 10 ? parallel 
C 1 2  ? parallel 
C 2 3  ? parallel 
C 3 4  ? parallel 
C 4 5  ? parallel 
C 5 6  ? parallel 
C 6 7  ? parallel 
C 7 8  ? parallel 
C 8 9  ? parallel 
C 9 10 ? parallel 
D 1 2  ? parallel 
D 2 3  ? parallel 
D 3 4  ? parallel 
D 4 5  ? parallel 
D 5 6  ? parallel 
D 6 7  ? parallel 
D 7 8  ? parallel 
D 8 9  ? parallel 
D 9 10 ? parallel 
E 1 2  ? parallel 
E 2 3  ? parallel 
E 3 4  ? parallel 
E 4 5  ? parallel 
E 5 6  ? parallel 
E 6 7  ? parallel 
E 7 8  ? parallel 
E 8 9  ? parallel 
E 9 10 ? parallel 
F 1 2  ? parallel 
F 2 3  ? parallel 
G 1 2  ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 38 ? VAL A 55 ? LEU A 38 VAL A 55 
A 2  LEU B 38 ? VAL B 55 ? LEU B 38 VAL B 55 
A 3  LEU C 38 ? VAL C 55 ? LEU C 38 VAL C 55 
A 4  LEU D 38 ? VAL D 55 ? LEU D 38 VAL D 55 
A 5  LEU E 38 ? VAL E 55 ? LEU E 38 VAL E 55 
A 6  LEU F 38 ? VAL F 55 ? LEU F 38 VAL F 55 
A 7  LEU G 38 ? VAL G 55 ? LEU G 38 VAL G 55 
A 8  LEU H 38 ? VAL H 55 ? LEU H 38 VAL H 55 
A 9  LEU I 38 ? VAL I 55 ? LEU I 38 VAL I 55 
A 10 LEU J 38 ? VAL J 55 ? LEU J 38 VAL J 55 
B 1  GLU A 61 ? VAL A 66 ? GLU A 61 VAL A 66 
B 2  GLU B 61 ? VAL B 66 ? GLU B 61 VAL B 66 
B 3  GLU C 61 ? VAL C 66 ? GLU C 61 VAL C 66 
B 4  GLU D 61 ? VAL D 66 ? GLU D 61 VAL D 66 
B 5  GLU E 61 ? VAL E 66 ? GLU E 61 VAL E 66 
B 6  GLU F 61 ? VAL F 66 ? GLU F 61 VAL F 66 
B 7  GLU G 61 ? VAL G 66 ? GLU G 61 VAL G 66 
B 8  GLU H 61 ? VAL H 66 ? GLU H 61 VAL H 66 
B 9  GLU I 61 ? VAL I 66 ? GLU I 61 VAL I 66 
B 10 GLU J 61 ? VAL J 66 ? GLU J 61 VAL J 66 
C 1  VAL A 70 ? ALA A 78 ? VAL A 70 ALA A 78 
C 2  VAL B 70 ? ALA B 78 ? VAL B 70 ALA B 78 
C 3  VAL C 70 ? ALA C 78 ? VAL C 70 ALA C 78 
C 4  VAL D 70 ? ALA D 78 ? VAL D 70 ALA D 78 
C 5  VAL E 70 ? ALA E 78 ? VAL E 70 ALA E 78 
C 6  VAL F 70 ? ALA F 78 ? VAL F 70 ALA F 78 
C 7  VAL G 70 ? ALA G 78 ? VAL G 70 ALA G 78 
C 8  VAL H 70 ? ALA H 78 ? VAL H 70 ALA H 78 
C 9  VAL I 70 ? ALA I 78 ? VAL I 70 ALA I 78 
C 10 VAL J 70 ? ALA J 78 ? VAL J 70 ALA J 78 
D 1  THR A 81 ? GLU A 83 ? THR A 81 GLU A 83 
D 2  THR B 81 ? GLU B 83 ? THR B 81 GLU B 83 
D 3  THR C 81 ? GLU C 83 ? THR C 81 GLU C 83 
D 4  THR D 81 ? GLU D 83 ? THR D 81 GLU D 83 
D 5  THR E 81 ? GLU E 83 ? THR E 81 GLU E 83 
D 6  THR F 81 ? GLU F 83 ? THR F 81 GLU F 83 
D 7  THR G 81 ? GLU G 83 ? THR G 81 GLU G 83 
D 8  THR H 81 ? GLU H 83 ? THR H 81 GLU H 83 
D 9  THR I 81 ? GLU I 83 ? THR I 81 GLU I 83 
D 10 THR J 81 ? GLU J 83 ? THR J 81 GLU J 83 
E 1  ILE A 88 ? LYS A 97 ? ILE A 88 LYS A 97 
E 2  ILE B 88 ? LYS B 97 ? ILE B 88 LYS B 97 
E 3  ILE C 88 ? LYS C 97 ? ILE C 88 LYS C 97 
E 4  ILE D 88 ? LYS D 97 ? ILE D 88 LYS D 97 
E 5  ILE E 88 ? LYS E 97 ? ILE E 88 LYS E 97 
E 6  ILE F 88 ? LYS F 97 ? ILE F 88 LYS F 97 
E 7  ILE G 88 ? LYS G 97 ? ILE G 88 LYS G 97 
E 8  ILE H 88 ? ASP H 98 ? ILE H 88 ASP H 98 
E 9  ILE I 88 ? ASP I 98 ? ILE I 88 ASP I 98 
E 10 ILE J 88 ? LYS J 97 ? ILE J 88 LYS J 97 
F 1  GLU F 28 ? ALA F 30 ? GLU F 28 ALA F 30 
F 2  GLU G 28 ? ALA G 30 ? GLU G 28 ALA G 30 
F 3  ALA H 29 ? ALA H 30 ? ALA H 29 ALA H 30 
G 1  ALA I 29 ? ALA I 30 ? ALA I 29 ALA I 30 
G 2  ALA J 29 ? ALA J 30 ? ALA J 29 ALA J 30 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  N LYS A 43 ? N LYS A 43 O THR B 44 ? O THR B 44 
A 2 3  N LYS B 43 ? N LYS B 43 O THR C 44 ? O THR C 44 
A 3 4  N THR C 54 ? N THR C 54 O VAL D 55 ? O VAL D 55 
A 4 5  N THR D 54 ? N THR D 54 O VAL E 55 ? O VAL E 55 
A 5 6  N THR E 54 ? N THR E 54 O VAL F 55 ? O VAL F 55 
A 6 7  N THR F 54 ? N THR F 54 O VAL G 55 ? O VAL G 55 
A 7 8  N THR G 54 ? N THR G 54 O VAL H 55 ? O VAL H 55 
A 8 9  N THR H 54 ? N THR H 54 O VAL I 55 ? O VAL I 55 
A 9 10 N THR I 54 ? N THR I 54 O VAL J 55 ? O VAL J 55 
B 1 2  N ASN A 65 ? N ASN A 65 O THR B 64 ? O THR B 64 
B 2 3  N ASN B 65 ? N ASN B 65 O THR C 64 ? O THR C 64 
B 3 4  N ASN C 65 ? N ASN C 65 O THR D 64 ? O THR D 64 
B 4 5  N ASN D 65 ? N ASN D 65 O THR E 64 ? O THR E 64 
B 5 6  N ASN E 65 ? N ASN E 65 O THR F 64 ? O THR F 64 
B 6 7  N ASN F 65 ? N ASN F 65 O THR G 64 ? O THR G 64 
B 7 8  N ASN G 65 ? N ASN G 65 O THR H 64 ? O THR H 64 
B 8 9  N ASN H 65 ? N ASN H 65 O THR I 64 ? O THR I 64 
B 9 10 N ASN I 65 ? N ASN I 65 O THR J 64 ? O THR J 64 
C 1 2  N THR A 75 ? N THR A 75 O ALA B 76 ? O ALA B 76 
C 2 3  N THR B 75 ? N THR B 75 O ALA C 76 ? O ALA C 76 
C 3 4  N THR C 75 ? N THR C 75 O ALA D 76 ? O ALA D 76 
C 4 5  N THR D 75 ? N THR D 75 O ALA E 76 ? O ALA E 76 
C 5 6  N THR E 75 ? N THR E 75 O VAL F 74 ? O VAL F 74 
C 6 7  N THR F 75 ? N THR F 75 O VAL G 74 ? O VAL G 74 
C 7 8  N THR G 75 ? N THR G 75 O ALA H 76 ? O ALA H 76 
C 8 9  N THR H 75 ? N THR H 75 O VAL I 74 ? O VAL I 74 
C 9 10 N THR I 75 ? N THR I 75 O VAL J 74 ? O VAL J 74 
D 1 2  N VAL A 82 ? N VAL A 82 O THR B 81 ? O THR B 81 
D 2 3  N VAL B 82 ? N VAL B 82 O THR C 81 ? O THR C 81 
D 3 4  N VAL C 82 ? N VAL C 82 O THR D 81 ? O THR D 81 
D 4 5  N VAL D 82 ? N VAL D 82 O THR E 81 ? O THR E 81 
D 5 6  N VAL E 82 ? N VAL E 82 O THR F 81 ? O THR F 81 
D 6 7  N VAL F 82 ? N VAL F 82 O THR G 81 ? O THR G 81 
D 7 8  N VAL G 82 ? N VAL G 82 O THR H 81 ? O THR H 81 
D 8 9  N VAL H 82 ? N VAL H 82 O THR I 81 ? O THR I 81 
D 9 10 N VAL I 82 ? N VAL I 82 O THR J 81 ? O THR J 81 
E 1 2  N GLY A 93 ? N GLY A 93 O PHE B 94 ? O PHE B 94 
E 2 3  N GLY B 93 ? N GLY B 93 O PHE C 94 ? O PHE C 94 
E 3 4  N GLY C 93 ? N GLY C 93 O PHE D 94 ? O PHE D 94 
E 4 5  N GLY D 93 ? N GLY D 93 O PHE E 94 ? O PHE E 94 
E 5 6  N GLY E 93 ? N GLY E 93 O PHE F 94 ? O PHE F 94 
E 6 7  N GLY F 93 ? N GLY F 93 O PHE G 94 ? O PHE G 94 
E 7 8  N GLY G 93 ? N GLY G 93 O PHE H 94 ? O PHE H 94 
E 8 9  N GLY H 93 ? N GLY H 93 O PHE I 94 ? O PHE I 94 
E 9 10 N GLY I 93 ? N GLY I 93 O PHE J 94 ? O PHE J 94 
F 1 2  N ALA F 29 ? N ALA F 29 O GLU G 28 ? O GLU G 28 
F 2 3  N ALA G 29 ? N ALA G 29 O ALA H 30 ? O ALA H 30 
G 1 2  N ALA I 29 ? N ALA I 29 O ALA J 30 ? O ALA J 30 
# 
_atom_sites.entry_id                    2N0A 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 70.657  77.776  -11.084 1.00 0.00 ? 1   MET A N    1 
ATOM 2     C CA   . MET A 1 1   ? 70.858  77.901  -12.555 1.00 0.00 ? 1   MET A CA   1 
ATOM 3     C C    . MET A 1 1   ? 69.526  78.226  -13.223 1.00 0.00 ? 1   MET A C    1 
ATOM 4     O O    . MET A 1 1   ? 68.514  77.578  -12.960 1.00 0.00 ? 1   MET A O    1 
ATOM 5     C CB   . MET A 1 1   ? 71.411  76.585  -13.110 1.00 0.00 ? 1   MET A CB   1 
ATOM 6     C CG   . MET A 1 1   ? 72.561  76.096  -12.226 1.00 0.00 ? 1   MET A CG   1 
ATOM 7     S SD   . MET A 1 1   ? 73.875  77.340  -12.200 1.00 0.00 ? 1   MET A SD   1 
ATOM 8     C CE   . MET A 1 1   ? 74.977  76.481  -11.052 1.00 0.00 ? 1   MET A CE   1 
ATOM 9     H H1   . MET A 1 1   ? 69.874  78.393  -10.787 1.00 0.00 ? 1   MET A H1   1 
ATOM 10    H H2   . MET A 1 1   ? 71.529  78.058  -10.590 1.00 0.00 ? 1   MET A H2   1 
ATOM 11    H H3   . MET A 1 1   ? 70.427  76.791  -10.848 1.00 0.00 ? 1   MET A H3   1 
ATOM 12    H HA   . MET A 1 1   ? 71.560  78.697  -12.754 1.00 0.00 ? 1   MET A HA   1 
ATOM 13    H HB2  . MET A 1 1   ? 70.625  75.843  -13.123 1.00 0.00 ? 1   MET A HB2  1 
ATOM 14    H HB3  . MET A 1 1   ? 71.774  76.743  -14.113 1.00 0.00 ? 1   MET A HB3  1 
ATOM 15    H HG2  . MET A 1 1   ? 72.199  75.932  -11.222 1.00 0.00 ? 1   MET A HG2  1 
ATOM 16    H HG3  . MET A 1 1   ? 72.950  75.170  -12.624 1.00 0.00 ? 1   MET A HG3  1 
ATOM 17    H HE1  . MET A 1 1   ? 74.668  76.685  -10.035 1.00 0.00 ? 1   MET A HE1  1 
ATOM 18    H HE2  . MET A 1 1   ? 75.988  76.826  -11.195 1.00 0.00 ? 1   MET A HE2  1 
ATOM 19    H HE3  . MET A 1 1   ? 74.933  75.416  -11.241 1.00 0.00 ? 1   MET A HE3  1 
ATOM 20    N N    . ASP A 1 2   ? 69.536  79.232  -14.091 1.00 0.00 ? 2   ASP A N    1 
ATOM 21    C CA   . ASP A 1 2   ? 68.322  79.633  -14.793 1.00 0.00 ? 2   ASP A CA   1 
ATOM 22    C C    . ASP A 1 2   ? 67.189  79.884  -13.805 1.00 0.00 ? 2   ASP A C    1 
ATOM 23    O O    . ASP A 1 2   ? 66.041  79.515  -14.055 1.00 0.00 ? 2   ASP A O    1 
ATOM 24    C CB   . ASP A 1 2   ? 67.908  78.546  -15.785 1.00 0.00 ? 2   ASP A CB   1 
ATOM 25    C CG   . ASP A 1 2   ? 68.912  78.475  -16.931 1.00 0.00 ? 2   ASP A CG   1 
ATOM 26    O OD1  . ASP A 1 2   ? 69.690  79.405  -17.068 1.00 0.00 ? 2   ASP A OD1  1 
ATOM 27    O OD2  . ASP A 1 2   ? 68.886  77.495  -17.656 1.00 0.00 ? 2   ASP A OD2  1 
ATOM 28    H H    . ASP A 1 2   ? 70.372  79.713  -14.263 1.00 0.00 ? 2   ASP A H    1 
ATOM 29    H HA   . ASP A 1 2   ? 68.519  80.544  -15.339 1.00 0.00 ? 2   ASP A HA   1 
ATOM 30    H HB2  . ASP A 1 2   ? 67.876  77.592  -15.277 1.00 0.00 ? 2   ASP A HB2  1 
ATOM 31    H HB3  . ASP A 1 2   ? 66.929  78.774  -16.180 1.00 0.00 ? 2   ASP A HB3  1 
ATOM 32    N N    . VAL A 1 3   ? 67.518  80.513  -12.682 1.00 0.00 ? 3   VAL A N    1 
ATOM 33    C CA   . VAL A 1 3   ? 66.518  80.808  -11.664 1.00 0.00 ? 3   VAL A CA   1 
ATOM 34    C C    . VAL A 1 3   ? 65.328  81.533  -12.279 1.00 0.00 ? 3   VAL A C    1 
ATOM 35    O O    . VAL A 1 3   ? 65.479  82.302  -13.228 1.00 0.00 ? 3   VAL A O    1 
ATOM 36    C CB   . VAL A 1 3   ? 67.130  81.676  -10.564 1.00 0.00 ? 3   VAL A CB   1 
ATOM 37    C CG1  . VAL A 1 3   ? 67.604  83.001  -11.164 1.00 0.00 ? 3   VAL A CG1  1 
ATOM 38    C CG2  . VAL A 1 3   ? 66.076  81.954  -9.490  1.00 0.00 ? 3   VAL A CG2  1 
ATOM 39    H H    . VAL A 1 3   ? 68.448  80.784  -12.537 1.00 0.00 ? 3   VAL A H    1 
ATOM 40    H HA   . VAL A 1 3   ? 66.177  79.883  -11.227 1.00 0.00 ? 3   VAL A HA   1 
ATOM 41    H HB   . VAL A 1 3   ? 67.970  81.160  -10.123 1.00 0.00 ? 3   VAL A HB   1 
ATOM 42    H HG11 . VAL A 1 3   ? 66.748  83.592  -11.456 1.00 0.00 ? 3   VAL A HG11 1 
ATOM 43    H HG12 . VAL A 1 3   ? 68.218  82.805  -12.030 1.00 0.00 ? 3   VAL A HG12 1 
ATOM 44    H HG13 . VAL A 1 3   ? 68.181  83.544  -10.430 1.00 0.00 ? 3   VAL A HG13 1 
ATOM 45    H HG21 . VAL A 1 3   ? 65.354  82.665  -9.869  1.00 0.00 ? 3   VAL A HG21 1 
ATOM 46    H HG22 . VAL A 1 3   ? 66.554  82.361  -8.612  1.00 0.00 ? 3   VAL A HG22 1 
ATOM 47    H HG23 . VAL A 1 3   ? 65.572  81.035  -9.233  1.00 0.00 ? 3   VAL A HG23 1 
ATOM 48    N N    . PHE A 1 4   ? 64.141  81.281  -11.731 1.00 0.00 ? 4   PHE A N    1 
ATOM 49    C CA   . PHE A 1 4   ? 62.921  81.915  -12.232 1.00 0.00 ? 4   PHE A CA   1 
ATOM 50    C C    . PHE A 1 4   ? 61.886  82.029  -11.117 1.00 0.00 ? 4   PHE A C    1 
ATOM 51    O O    . PHE A 1 4   ? 60.860  82.689  -11.277 1.00 0.00 ? 4   PHE A O    1 
ATOM 52    C CB   . PHE A 1 4   ? 62.347  81.097  -13.391 1.00 0.00 ? 4   PHE A CB   1 
ATOM 53    C CG   . PHE A 1 4   ? 61.078  81.750  -13.893 1.00 0.00 ? 4   PHE A CG   1 
ATOM 54    C CD1  . PHE A 1 4   ? 61.152  82.902  -14.688 1.00 0.00 ? 4   PHE A CD1  1 
ATOM 55    C CD2  . PHE A 1 4   ? 59.828  81.206  -13.567 1.00 0.00 ? 4   PHE A CD2  1 
ATOM 56    C CE1  . PHE A 1 4   ? 59.980  83.508  -15.154 1.00 0.00 ? 4   PHE A CE1  1 
ATOM 57    C CE2  . PHE A 1 4   ? 58.656  81.813  -14.035 1.00 0.00 ? 4   PHE A CE2  1 
ATOM 58    C CZ   . PHE A 1 4   ? 58.732  82.964  -14.828 1.00 0.00 ? 4   PHE A CZ   1 
ATOM 59    H H    . PHE A 1 4   ? 64.083  80.659  -10.977 1.00 0.00 ? 4   PHE A H    1 
ATOM 60    H HA   . PHE A 1 4   ? 63.156  82.908  -12.590 1.00 0.00 ? 4   PHE A HA   1 
ATOM 61    H HB2  . PHE A 1 4   ? 63.070  81.053  -14.191 1.00 0.00 ? 4   PHE A HB2  1 
ATOM 62    H HB3  . PHE A 1 4   ? 62.126  80.095  -13.049 1.00 0.00 ? 4   PHE A HB3  1 
ATOM 63    H HD1  . PHE A 1 4   ? 62.115  83.322  -14.939 1.00 0.00 ? 4   PHE A HD1  1 
ATOM 64    H HD2  . PHE A 1 4   ? 59.769  80.318  -12.956 1.00 0.00 ? 4   PHE A HD2  1 
ATOM 65    H HE1  . PHE A 1 4   ? 60.038  84.397  -15.767 1.00 0.00 ? 4   PHE A HE1  1 
ATOM 66    H HE2  . PHE A 1 4   ? 57.693  81.393  -13.783 1.00 0.00 ? 4   PHE A HE2  1 
ATOM 67    H HZ   . PHE A 1 4   ? 57.827  83.432  -15.189 1.00 0.00 ? 4   PHE A HZ   1 
ATOM 68    N N    . MET A 1 5   ? 62.163  81.383  -9.986  1.00 0.00 ? 5   MET A N    1 
ATOM 69    C CA   . MET A 1 5   ? 61.246  81.421  -8.849  1.00 0.00 ? 5   MET A CA   1 
ATOM 70    C C    . MET A 1 5   ? 61.441  82.708  -8.046  1.00 0.00 ? 5   MET A C    1 
ATOM 71    O O    . MET A 1 5   ? 62.564  83.072  -7.702  1.00 0.00 ? 5   MET A O    1 
ATOM 72    C CB   . MET A 1 5   ? 61.480  80.207  -7.944  1.00 0.00 ? 5   MET A CB   1 
ATOM 73    C CG   . MET A 1 5   ? 60.421  80.187  -6.841  1.00 0.00 ? 5   MET A CG   1 
ATOM 74    S SD   . MET A 1 5   ? 60.604  78.684  -5.848  1.00 0.00 ? 5   MET A SD   1 
ATOM 75    C CE   . MET A 1 5   ? 59.210  78.982  -4.733  1.00 0.00 ? 5   MET A CE   1 
ATOM 76    H H    . MET A 1 5   ? 62.997  80.872  -9.915  1.00 0.00 ? 5   MET A H    1 
ATOM 77    H HA   . MET A 1 5   ? 60.229  81.389  -9.216  1.00 0.00 ? 5   MET A HA   1 
ATOM 78    H HB2  . MET A 1 5   ? 61.406  79.302  -8.532  1.00 0.00 ? 5   MET A HB2  1 
ATOM 79    H HB3  . MET A 1 5   ? 62.461  80.270  -7.500  1.00 0.00 ? 5   MET A HB3  1 
ATOM 80    H HG2  . MET A 1 5   ? 60.548  81.051  -6.206  1.00 0.00 ? 5   MET A HG2  1 
ATOM 81    H HG3  . MET A 1 5   ? 59.437  80.207  -7.285  1.00 0.00 ? 5   MET A HG3  1 
ATOM 82    H HE1  . MET A 1 5   ? 59.318  78.366  -3.850  1.00 0.00 ? 5   MET A HE1  1 
ATOM 83    H HE2  . MET A 1 5   ? 58.288  78.732  -5.232  1.00 0.00 ? 5   MET A HE2  1 
ATOM 84    H HE3  . MET A 1 5   ? 59.193  80.026  -4.451  1.00 0.00 ? 5   MET A HE3  1 
ATOM 85    N N    . LYS A 1 6   ? 60.331  83.395  -7.753  1.00 0.00 ? 6   LYS A N    1 
ATOM 86    C CA   . LYS A 1 6   ? 60.370  84.652  -6.987  1.00 0.00 ? 6   LYS A CA   1 
ATOM 87    C C    . LYS A 1 6   ? 59.993  84.408  -5.528  1.00 0.00 ? 6   LYS A C    1 
ATOM 88    O O    . LYS A 1 6   ? 59.046  83.680  -5.237  1.00 0.00 ? 6   LYS A O    1 
ATOM 89    C CB   . LYS A 1 6   ? 59.380  85.656  -7.601  1.00 0.00 ? 6   LYS A CB   1 
ATOM 90    C CG   . LYS A 1 6   ? 59.764  85.966  -9.071  1.00 0.00 ? 6   LYS A CG   1 
ATOM 91    C CD   . LYS A 1 6   ? 60.807  87.108  -9.134  1.00 0.00 ? 6   LYS A CD   1 
ATOM 92    C CE   . LYS A 1 6   ? 60.104  88.476  -9.091  1.00 0.00 ? 6   LYS A CE   1 
ATOM 93    N NZ   . LYS A 1 6   ? 61.127  89.557  -9.112  1.00 0.00 ? 6   LYS A NZ   1 
ATOM 94    H H    . LYS A 1 6   ? 59.465  83.052  -8.058  1.00 0.00 ? 6   LYS A H    1 
ATOM 95    H HA   . LYS A 1 6   ? 61.365  85.074  -7.028  1.00 0.00 ? 6   LYS A HA   1 
ATOM 96    H HB2  . LYS A 1 6   ? 58.385  85.230  -7.574  1.00 0.00 ? 6   LYS A HB2  1 
ATOM 97    H HB3  . LYS A 1 6   ? 59.391  86.564  -7.023  1.00 0.00 ? 6   LYS A HB3  1 
ATOM 98    H HG2  . LYS A 1 6   ? 60.179  85.078  -9.531  1.00 0.00 ? 6   LYS A HG2  1 
ATOM 99    H HG3  . LYS A 1 6   ? 58.876  86.261  -9.616  1.00 0.00 ? 6   LYS A HG3  1 
ATOM 100   H HD2  . LYS A 1 6   ? 61.482  87.029  -8.296  1.00 0.00 ? 6   LYS A HD2  1 
ATOM 101   H HD3  . LYS A 1 6   ? 61.369  87.028  -10.053 1.00 0.00 ? 6   LYS A HD3  1 
ATOM 102   H HE2  . LYS A 1 6   ? 59.461  88.574  -9.952  1.00 0.00 ? 6   LYS A HE2  1 
ATOM 103   H HE3  . LYS A 1 6   ? 59.514  88.557  -8.192  1.00 0.00 ? 6   LYS A HE3  1 
ATOM 104   H HZ1  . LYS A 1 6   ? 61.588  89.579  -10.042 1.00 0.00 ? 6   LYS A HZ1  1 
ATOM 105   H HZ2  . LYS A 1 6   ? 61.839  89.374  -8.375  1.00 0.00 ? 6   LYS A HZ2  1 
ATOM 106   H HZ3  . LYS A 1 6   ? 60.669  90.473  -8.932  1.00 0.00 ? 6   LYS A HZ3  1 
ATOM 107   N N    . GLY A 1 7   ? 60.736  85.028  -4.615  1.00 0.00 ? 7   GLY A N    1 
ATOM 108   C CA   . GLY A 1 7   ? 60.462  84.873  -3.189  1.00 0.00 ? 7   GLY A CA   1 
ATOM 109   C C    . GLY A 1 7   ? 59.303  85.768  -2.761  1.00 0.00 ? 7   GLY A C    1 
ATOM 110   O O    . GLY A 1 7   ? 59.162  86.890  -3.248  1.00 0.00 ? 7   GLY A O    1 
ATOM 111   H H    . GLY A 1 7   ? 61.477  85.601  -4.904  1.00 0.00 ? 7   GLY A H    1 
ATOM 112   H HA2  . GLY A 1 7   ? 60.211  83.842  -2.985  1.00 0.00 ? 7   GLY A HA2  1 
ATOM 113   H HA3  . GLY A 1 7   ? 61.342  85.143  -2.626  1.00 0.00 ? 7   GLY A HA3  1 
ATOM 114   N N    . LEU A 1 8   ? 58.472  85.267  -1.842  1.00 0.00 ? 8   LEU A N    1 
ATOM 115   C CA   . LEU A 1 8   ? 57.320  86.034  -1.348  1.00 0.00 ? 8   LEU A CA   1 
ATOM 116   C C    . LEU A 1 8   ? 57.712  86.811  -0.092  1.00 0.00 ? 8   LEU A C    1 
ATOM 117   O O    . LEU A 1 8   ? 57.909  86.229  0.974   1.00 0.00 ? 8   LEU A O    1 
ATOM 118   C CB   . LEU A 1 8   ? 56.155  85.072  -1.032  1.00 0.00 ? 8   LEU A CB   1 
ATOM 119   C CG   . LEU A 1 8   ? 55.401  84.725  -2.323  1.00 0.00 ? 8   LEU A CG   1 
ATOM 120   C CD1  . LEU A 1 8   ? 56.384  84.173  -3.358  1.00 0.00 ? 8   LEU A CD1  1 
ATOM 121   C CD2  . LEU A 1 8   ? 54.336  83.668  -2.024  1.00 0.00 ? 8   LEU A CD2  1 
ATOM 122   H H    . LEU A 1 8   ? 58.636  84.367  -1.489  1.00 0.00 ? 8   LEU A H    1 
ATOM 123   H HA   . LEU A 1 8   ? 57.002  86.739  -2.107  1.00 0.00 ? 8   LEU A HA   1 
ATOM 124   H HB2  . LEU A 1 8   ? 56.547  84.167  -0.592  1.00 0.00 ? 8   LEU A HB2  1 
ATOM 125   H HB3  . LEU A 1 8   ? 55.470  85.542  -0.338  1.00 0.00 ? 8   LEU A HB3  1 
ATOM 126   H HG   . LEU A 1 8   ? 54.929  85.614  -2.714  1.00 0.00 ? 8   LEU A HG   1 
ATOM 127   H HD11 . LEU A 1 8   ? 55.836  83.716  -4.168  1.00 0.00 ? 8   LEU A HD11 1 
ATOM 128   H HD12 . LEU A 1 8   ? 57.021  83.436  -2.892  1.00 0.00 ? 8   LEU A HD12 1 
ATOM 129   H HD13 . LEU A 1 8   ? 56.991  84.980  -3.745  1.00 0.00 ? 8   LEU A HD13 1 
ATOM 130   H HD21 . LEU A 1 8   ? 53.795  83.436  -2.930  1.00 0.00 ? 8   LEU A HD21 1 
ATOM 131   H HD22 . LEU A 1 8   ? 53.649  84.049  -1.283  1.00 0.00 ? 8   LEU A HD22 1 
ATOM 132   H HD23 . LEU A 1 8   ? 54.811  82.774  -1.649  1.00 0.00 ? 8   LEU A HD23 1 
ATOM 133   N N    . SER A 1 9   ? 57.830  88.129  -0.236  1.00 0.00 ? 9   SER A N    1 
ATOM 134   C CA   . SER A 1 9   ? 58.207  88.992  0.882   1.00 0.00 ? 9   SER A CA   1 
ATOM 135   C C    . SER A 1 9   ? 59.602  88.630  1.401   1.00 0.00 ? 9   SER A C    1 
ATOM 136   O O    . SER A 1 9   ? 60.141  89.307  2.277   1.00 0.00 ? 9   SER A O    1 
ATOM 137   C CB   . SER A 1 9   ? 57.185  88.860  2.015   1.00 0.00 ? 9   SER A CB   1 
ATOM 138   O OG   . SER A 1 9   ? 55.871  88.962  1.477   1.00 0.00 ? 9   SER A OG   1 
ATOM 139   H H    . SER A 1 9   ? 57.666  88.531  -1.115  1.00 0.00 ? 9   SER A H    1 
ATOM 140   H HA   . SER A 1 9   ? 58.218  90.017  0.543   1.00 0.00 ? 9   SER A HA   1 
ATOM 141   H HB2  . SER A 1 9   ? 57.297  87.906  2.498   1.00 0.00 ? 9   SER A HB2  1 
ATOM 142   H HB3  . SER A 1 9   ? 57.350  89.648  2.740   1.00 0.00 ? 9   SER A HB3  1 
ATOM 143   H HG   . SER A 1 9   ? 55.392  89.618  1.989   1.00 0.00 ? 9   SER A HG   1 
ATOM 144   N N    . LYS A 1 10  ? 60.183  87.560  0.853   1.00 0.00 ? 10  LYS A N    1 
ATOM 145   C CA   . LYS A 1 10  ? 61.513  87.126  1.267   1.00 0.00 ? 10  LYS A CA   1 
ATOM 146   C C    . LYS A 1 10  ? 62.581  88.080  0.738   1.00 0.00 ? 10  LYS A C    1 
ATOM 147   O O    . LYS A 1 10  ? 63.517  88.437  1.453   1.00 0.00 ? 10  LYS A O    1 
ATOM 148   C CB   . LYS A 1 10  ? 61.778  85.706  0.754   1.00 0.00 ? 10  LYS A CB   1 
ATOM 149   C CG   . LYS A 1 10  ? 63.146  85.223  1.248   1.00 0.00 ? 10  LYS A CG   1 
ATOM 150   C CD   . LYS A 1 10  ? 63.361  83.773  0.810   1.00 0.00 ? 10  LYS A CD   1 
ATOM 151   C CE   . LYS A 1 10  ? 64.752  83.307  1.247   1.00 0.00 ? 10  LYS A CE   1 
ATOM 152   N NZ   . LYS A 1 10  ? 64.852  83.366  2.733   1.00 0.00 ? 10  LYS A NZ   1 
ATOM 153   H H    . LYS A 1 10  ? 59.715  87.063  0.158   1.00 0.00 ? 10  LYS A H    1 
ATOM 154   H HA   . LYS A 1 10  ? 61.557  87.118  2.346   1.00 0.00 ? 10  LYS A HA   1 
ATOM 155   H HB2  . LYS A 1 10  ? 61.008  85.042  1.121   1.00 0.00 ? 10  LYS A HB2  1 
ATOM 156   H HB3  . LYS A 1 10  ? 61.767  85.707  -0.326  1.00 0.00 ? 10  LYS A HB3  1 
ATOM 157   H HG2  . LYS A 1 10  ? 63.922  85.845  0.827   1.00 0.00 ? 10  LYS A HG2  1 
ATOM 158   H HG3  . LYS A 1 10  ? 63.180  85.281  2.325   1.00 0.00 ? 10  LYS A HG3  1 
ATOM 159   H HD2  . LYS A 1 10  ? 62.610  83.144  1.268   1.00 0.00 ? 10  LYS A HD2  1 
ATOM 160   H HD3  . LYS A 1 10  ? 63.282  83.705  -0.264  1.00 0.00 ? 10  LYS A HD3  1 
ATOM 161   H HE2  . LYS A 1 10  ? 64.912  82.292  0.915   1.00 0.00 ? 10  LYS A HE2  1 
ATOM 162   H HE3  . LYS A 1 10  ? 65.501  83.952  0.809   1.00 0.00 ? 10  LYS A HE3  1 
ATOM 163   H HZ1  . LYS A 1 10  ? 65.445  84.174  3.009   1.00 0.00 ? 10  LYS A HZ1  1 
ATOM 164   H HZ2  . LYS A 1 10  ? 65.279  82.484  3.086   1.00 0.00 ? 10  LYS A HZ2  1 
ATOM 165   H HZ3  . LYS A 1 10  ? 63.903  83.480  3.141   1.00 0.00 ? 10  LYS A HZ3  1 
ATOM 166   N N    . ALA A 1 11  ? 62.433  88.485  -0.522  1.00 0.00 ? 11  ALA A N    1 
ATOM 167   C CA   . ALA A 1 11  ? 63.392  89.396  -1.142  1.00 0.00 ? 11  ALA A CA   1 
ATOM 168   C C    . ALA A 1 11  ? 63.363  90.756  -0.456  1.00 0.00 ? 11  ALA A C    1 
ATOM 169   O O    . ALA A 1 11  ? 62.314  91.212  -0.002  1.00 0.00 ? 11  ALA A O    1 
ATOM 170   C CB   . ALA A 1 11  ? 63.071  89.564  -2.629  1.00 0.00 ? 11  ALA A CB   1 
ATOM 171   H H    . ALA A 1 11  ? 61.668  88.165  -1.043  1.00 0.00 ? 11  ALA A H    1 
ATOM 172   H HA   . ALA A 1 11  ? 64.383  88.977  -1.046  1.00 0.00 ? 11  ALA A HA   1 
ATOM 173   H HB1  . ALA A 1 11  ? 62.848  88.599  -3.061  1.00 0.00 ? 11  ALA A HB1  1 
ATOM 174   H HB2  . ALA A 1 11  ? 63.922  89.995  -3.135  1.00 0.00 ? 11  ALA A HB2  1 
ATOM 175   H HB3  . ALA A 1 11  ? 62.217  90.215  -2.742  1.00 0.00 ? 11  ALA A HB3  1 
ATOM 176   N N    . LYS A 1 12  ? 64.528  91.400  -0.379  1.00 0.00 ? 12  LYS A N    1 
ATOM 177   C CA   . LYS A 1 12  ? 64.635  92.714  0.259   1.00 0.00 ? 12  LYS A CA   1 
ATOM 178   C C    . LYS A 1 12  ? 65.774  93.519  -0.362  1.00 0.00 ? 12  LYS A C    1 
ATOM 179   O O    . LYS A 1 12  ? 66.830  92.972  -0.682  1.00 0.00 ? 12  LYS A O    1 
ATOM 180   C CB   . LYS A 1 12  ? 64.888  92.540  1.758   1.00 0.00 ? 12  LYS A CB   1 
ATOM 181   C CG   . LYS A 1 12  ? 64.926  93.915  2.434   1.00 0.00 ? 12  LYS A CG   1 
ATOM 182   C CD   . LYS A 1 12  ? 64.833  93.758  3.958   1.00 0.00 ? 12  LYS A CD   1 
ATOM 183   C CE   . LYS A 1 12  ? 66.107  93.102  4.500   1.00 0.00 ? 12  LYS A CE   1 
ATOM 184   N NZ   . LYS A 1 12  ? 66.109  93.182  5.987   1.00 0.00 ? 12  LYS A NZ   1 
ATOM 185   H H    . LYS A 1 12  ? 65.330  90.984  -0.757  1.00 0.00 ? 12  LYS A H    1 
ATOM 186   H HA   . LYS A 1 12  ? 63.710  93.257  0.122   1.00 0.00 ? 12  LYS A HA   1 
ATOM 187   H HB2  . LYS A 1 12  ? 64.097  91.944  2.190   1.00 0.00 ? 12  LYS A HB2  1 
ATOM 188   H HB3  . LYS A 1 12  ? 65.833  92.044  1.901   1.00 0.00 ? 12  LYS A HB3  1 
ATOM 189   H HG2  . LYS A 1 12  ? 65.851  94.412  2.180   1.00 0.00 ? 12  LYS A HG2  1 
ATOM 190   H HG3  . LYS A 1 12  ? 64.093  94.508  2.084   1.00 0.00 ? 12  LYS A HG3  1 
ATOM 191   H HD2  . LYS A 1 12  ? 64.711  94.732  4.410   1.00 0.00 ? 12  LYS A HD2  1 
ATOM 192   H HD3  . LYS A 1 12  ? 63.981  93.140  4.203   1.00 0.00 ? 12  LYS A HD3  1 
ATOM 193   H HE2  . LYS A 1 12  ? 66.135  92.066  4.202   1.00 0.00 ? 12  LYS A HE2  1 
ATOM 194   H HE3  . LYS A 1 12  ? 66.971  93.616  4.109   1.00 0.00 ? 12  LYS A HE3  1 
ATOM 195   H HZ1  . LYS A 1 12  ? 65.219  92.793  6.357   1.00 0.00 ? 12  LYS A HZ1  1 
ATOM 196   H HZ2  . LYS A 1 12  ? 66.202  94.178  6.281   1.00 0.00 ? 12  LYS A HZ2  1 
ATOM 197   H HZ3  . LYS A 1 12  ? 66.908  92.634  6.363   1.00 0.00 ? 12  LYS A HZ3  1 
ATOM 198   N N    . GLU A 1 13  ? 65.553  94.819  -0.532  1.00 0.00 ? 13  GLU A N    1 
ATOM 199   C CA   . GLU A 1 13  ? 66.571  95.685  -1.119  1.00 0.00 ? 13  GLU A CA   1 
ATOM 200   C C    . GLU A 1 13  ? 67.784  95.779  -0.201  1.00 0.00 ? 13  GLU A C    1 
ATOM 201   O O    . GLU A 1 13  ? 67.647  95.948  1.011   1.00 0.00 ? 13  GLU A O    1 
ATOM 202   C CB   . GLU A 1 13  ? 65.996  97.084  -1.349  1.00 0.00 ? 13  GLU A CB   1 
ATOM 203   C CG   . GLU A 1 13  ? 64.799  96.996  -2.297  1.00 0.00 ? 13  GLU A CG   1 
ATOM 204   C CD   . GLU A 1 13  ? 65.266  96.563  -3.682  1.00 0.00 ? 13  GLU A CD   1 
ATOM 205   O OE1  . GLU A 1 13  ? 66.445  96.706  -3.961  1.00 0.00 ? 13  GLU A OE1  1 
ATOM 206   O OE2  . GLU A 1 13  ? 64.436  96.095  -4.445  1.00 0.00 ? 13  GLU A OE2  1 
ATOM 207   H H    . GLU A 1 13  ? 64.693  95.201  -0.260  1.00 0.00 ? 13  GLU A H    1 
ATOM 208   H HA   . GLU A 1 13  ? 66.879  95.272  -2.069  1.00 0.00 ? 13  GLU A HA   1 
ATOM 209   H HB2  . GLU A 1 13  ? 65.678  97.501  -0.404  1.00 0.00 ? 13  GLU A HB2  1 
ATOM 210   H HB3  . GLU A 1 13  ? 66.753  97.717  -1.786  1.00 0.00 ? 13  GLU A HB3  1 
ATOM 211   H HG2  . GLU A 1 13  ? 64.092  96.275  -1.915  1.00 0.00 ? 13  GLU A HG2  1 
ATOM 212   H HG3  . GLU A 1 13  ? 64.325  97.964  -2.366  1.00 0.00 ? 13  GLU A HG3  1 
ATOM 213   N N    . GLY A 1 14  ? 68.974  95.675  -0.785  1.00 0.00 ? 14  GLY A N    1 
ATOM 214   C CA   . GLY A 1 14  ? 70.203  95.753  -0.008  1.00 0.00 ? 14  GLY A CA   1 
ATOM 215   C C    . GLY A 1 14  ? 70.546  97.201  0.320   1.00 0.00 ? 14  GLY A C    1 
ATOM 216   O O    . GLY A 1 14  ? 70.025  98.128  -0.299  1.00 0.00 ? 14  GLY A O    1 
ATOM 217   H H    . GLY A 1 14  ? 69.024  95.543  -1.755  1.00 0.00 ? 14  GLY A H    1 
ATOM 218   H HA2  . GLY A 1 14  ? 70.077  95.199  0.913   1.00 0.00 ? 14  GLY A HA2  1 
ATOM 219   H HA3  . GLY A 1 14  ? 71.012  95.319  -0.575  1.00 0.00 ? 14  GLY A HA3  1 
ATOM 220   N N    . VAL A 1 15  ? 71.430  97.389  1.299   1.00 0.00 ? 15  VAL A N    1 
ATOM 221   C CA   . VAL A 1 15  ? 71.847  98.732  1.709   1.00 0.00 ? 15  VAL A CA   1 
ATOM 222   C C    . VAL A 1 15  ? 73.073  99.178  0.916   1.00 0.00 ? 15  VAL A C    1 
ATOM 223   O O    . VAL A 1 15  ? 73.465  100.344 0.966   1.00 0.00 ? 15  VAL A O    1 
ATOM 224   C CB   . VAL A 1 15  ? 72.176  98.740  3.204   1.00 0.00 ? 15  VAL A CB   1 
ATOM 225   C CG1  . VAL A 1 15  ? 70.895  98.513  4.008   1.00 0.00 ? 15  VAL A CG1  1 
ATOM 226   C CG2  . VAL A 1 15  ? 73.173  97.622  3.511   1.00 0.00 ? 15  VAL A CG2  1 
ATOM 227   H H    . VAL A 1 15  ? 71.812  96.610  1.755   1.00 0.00 ? 15  VAL A H    1 
ATOM 228   H HA   . VAL A 1 15  ? 71.041  99.429  1.529   1.00 0.00 ? 15  VAL A HA   1 
ATOM 229   H HB   . VAL A 1 15  ? 72.605  99.694  3.473   1.00 0.00 ? 15  VAL A HB   1 
ATOM 230   H HG11 . VAL A 1 15  ? 70.228  99.352  3.869   1.00 0.00 ? 15  VAL A HG11 1 
ATOM 231   H HG12 . VAL A 1 15  ? 71.140  98.418  5.056   1.00 0.00 ? 15  VAL A HG12 1 
ATOM 232   H HG13 . VAL A 1 15  ? 70.411  97.609  3.668   1.00 0.00 ? 15  VAL A HG13 1 
ATOM 233   H HG21 . VAL A 1 15  ? 72.705  96.664  3.338   1.00 0.00 ? 15  VAL A HG21 1 
ATOM 234   H HG22 . VAL A 1 15  ? 73.482  97.689  4.544   1.00 0.00 ? 15  VAL A HG22 1 
ATOM 235   H HG23 . VAL A 1 15  ? 74.035  97.722  2.869   1.00 0.00 ? 15  VAL A HG23 1 
ATOM 236   N N    . VAL A 1 16  ? 73.677  98.241  0.187   1.00 0.00 ? 16  VAL A N    1 
ATOM 237   C CA   . VAL A 1 16  ? 74.860  98.554  -0.608  1.00 0.00 ? 16  VAL A CA   1 
ATOM 238   C C    . VAL A 1 16  ? 74.485  99.395  -1.825  1.00 0.00 ? 16  VAL A C    1 
ATOM 239   O O    . VAL A 1 16  ? 74.870  100.557 -1.931  1.00 0.00 ? 16  VAL A O    1 
ATOM 240   C CB   . VAL A 1 16  ? 75.533  97.260  -1.068  1.00 0.00 ? 16  VAL A CB   1 
ATOM 241   C CG1  . VAL A 1 16  ? 76.716  97.589  -1.983  1.00 0.00 ? 16  VAL A CG1  1 
ATOM 242   C CG2  . VAL A 1 16  ? 76.033  96.485  0.153   1.00 0.00 ? 16  VAL A CG2  1 
ATOM 243   H H    . VAL A 1 16  ? 73.324  97.327  0.186   1.00 0.00 ? 16  VAL A H    1 
ATOM 244   H HA   . VAL A 1 16  ? 75.556  99.111  0.000   1.00 0.00 ? 16  VAL A HA   1 
ATOM 245   H HB   . VAL A 1 16  ? 74.818  96.657  -1.610  1.00 0.00 ? 16  VAL A HB   1 
ATOM 246   H HG11 . VAL A 1 16  ? 77.302  98.382  -1.541  1.00 0.00 ? 16  VAL A HG11 1 
ATOM 247   H HG12 . VAL A 1 16  ? 76.348  97.908  -2.946  1.00 0.00 ? 16  VAL A HG12 1 
ATOM 248   H HG13 . VAL A 1 16  ? 77.332  96.711  -2.104  1.00 0.00 ? 16  VAL A HG13 1 
ATOM 249   H HG21 . VAL A 1 16  ? 76.877  97.001  0.586   1.00 0.00 ? 16  VAL A HG21 1 
ATOM 250   H HG22 . VAL A 1 16  ? 76.334  95.493  -0.149  1.00 0.00 ? 16  VAL A HG22 1 
ATOM 251   H HG23 . VAL A 1 16  ? 75.240  96.415  0.883   1.00 0.00 ? 16  VAL A HG23 1 
ATOM 252   N N    . ALA A 1 17  ? 73.722  98.804  -2.738  1.00 0.00 ? 17  ALA A N    1 
ATOM 253   C CA   . ALA A 1 17  ? 73.296  99.515  -3.939  1.00 0.00 ? 17  ALA A CA   1 
ATOM 254   C C    . ALA A 1 17  ? 72.433  100.717 -3.570  1.00 0.00 ? 17  ALA A C    1 
ATOM 255   O O    . ALA A 1 17  ? 72.543  101.783 -4.174  1.00 0.00 ? 17  ALA A O    1 
ATOM 256   C CB   . ALA A 1 17  ? 72.507  98.575  -4.852  1.00 0.00 ? 17  ALA A CB   1 
ATOM 257   H H    . ALA A 1 17  ? 73.437  97.877  -2.600  1.00 0.00 ? 17  ALA A H    1 
ATOM 258   H HA   . ALA A 1 17  ? 74.171  99.861  -4.468  1.00 0.00 ? 17  ALA A HA   1 
ATOM 259   H HB1  . ALA A 1 17  ? 72.124  99.132  -5.695  1.00 0.00 ? 17  ALA A HB1  1 
ATOM 260   H HB2  . ALA A 1 17  ? 71.685  98.145  -4.300  1.00 0.00 ? 17  ALA A HB2  1 
ATOM 261   H HB3  . ALA A 1 17  ? 73.155  97.787  -5.205  1.00 0.00 ? 17  ALA A HB3  1 
ATOM 262   N N    . ALA A 1 18  ? 71.571  100.530 -2.575  1.00 0.00 ? 18  ALA A N    1 
ATOM 263   C CA   . ALA A 1 18  ? 70.682  101.596 -2.126  1.00 0.00 ? 18  ALA A CA   1 
ATOM 264   C C    . ALA A 1 18  ? 71.481  102.777 -1.587  1.00 0.00 ? 18  ALA A C    1 
ATOM 265   O O    . ALA A 1 18  ? 70.970  103.892 -1.491  1.00 0.00 ? 18  ALA A O    1 
ATOM 266   C CB   . ALA A 1 18  ? 69.745  101.073 -1.036  1.00 0.00 ? 18  ALA A CB   1 
ATOM 267   H H    . ALA A 1 18  ? 71.530  99.655  -2.135  1.00 0.00 ? 18  ALA A H    1 
ATOM 268   H HA   . ALA A 1 18  ? 70.088  101.930 -2.962  1.00 0.00 ? 18  ALA A HA   1 
ATOM 269   H HB1  . ALA A 1 18  ? 68.962  101.794 -0.857  1.00 0.00 ? 18  ALA A HB1  1 
ATOM 270   H HB2  . ALA A 1 18  ? 70.305  100.917 -0.126  1.00 0.00 ? 18  ALA A HB2  1 
ATOM 271   H HB3  . ALA A 1 18  ? 69.308  100.138 -1.355  1.00 0.00 ? 18  ALA A HB3  1 
ATOM 272   N N    . ALA A 1 19  ? 72.735  102.530 -1.234  1.00 0.00 ? 19  ALA A N    1 
ATOM 273   C CA   . ALA A 1 19  ? 73.584  103.586 -0.705  1.00 0.00 ? 19  ALA A CA   1 
ATOM 274   C C    . ALA A 1 19  ? 73.725  104.714 -1.723  1.00 0.00 ? 19  ALA A C    1 
ATOM 275   O O    . ALA A 1 19  ? 73.729  105.890 -1.361  1.00 0.00 ? 19  ALA A O    1 
ATOM 276   C CB   . ALA A 1 19  ? 74.966  103.023 -0.367  1.00 0.00 ? 19  ALA A CB   1 
ATOM 277   H H    . ALA A 1 19  ? 73.094  101.625 -1.329  1.00 0.00 ? 19  ALA A H    1 
ATOM 278   H HA   . ALA A 1 19  ? 73.137  103.978 0.195   1.00 0.00 ? 19  ALA A HA   1 
ATOM 279   H HB1  . ALA A 1 19  ? 75.490  103.717 0.274   1.00 0.00 ? 19  ALA A HB1  1 
ATOM 280   H HB2  . ALA A 1 19  ? 75.529  102.878 -1.276  1.00 0.00 ? 19  ALA A HB2  1 
ATOM 281   H HB3  . ALA A 1 19  ? 74.855  102.077 0.143   1.00 0.00 ? 19  ALA A HB3  1 
ATOM 282   N N    . GLU A 1 20  ? 73.841  104.348 -3.003  1.00 0.00 ? 20  GLU A N    1 
ATOM 283   C CA   . GLU A 1 20  ? 73.983  105.341 -4.078  1.00 0.00 ? 20  GLU A CA   1 
ATOM 284   C C    . GLU A 1 20  ? 72.631  105.629 -4.735  1.00 0.00 ? 20  GLU A C    1 
ATOM 285   O O    . GLU A 1 20  ? 71.971  104.722 -5.240  1.00 0.00 ? 20  GLU A O    1 
ATOM 286   C CB   . GLU A 1 20  ? 74.958  104.818 -5.138  1.00 0.00 ? 20  GLU A CB   1 
ATOM 287   C CG   . GLU A 1 20  ? 76.364  104.723 -4.542  1.00 0.00 ? 20  GLU A CG   1 
ATOM 288   C CD   . GLU A 1 20  ? 77.330  104.153 -5.576  1.00 0.00 ? 20  GLU A CD   1 
ATOM 289   O OE1  . GLU A 1 20  ? 76.868  103.742 -6.628  1.00 0.00 ? 20  GLU A OE1  1 
ATOM 290   O OE2  . GLU A 1 20  ? 78.519  104.139 -5.303  1.00 0.00 ? 20  GLU A OE2  1 
ATOM 291   H H    . GLU A 1 20  ? 73.829  103.395 -3.231  1.00 0.00 ? 20  GLU A H    1 
ATOM 292   H HA   . GLU A 1 20  ? 74.377  106.263 -3.670  1.00 0.00 ? 20  GLU A HA   1 
ATOM 293   H HB2  . GLU A 1 20  ? 74.639  103.839 -5.468  1.00 0.00 ? 20  GLU A HB2  1 
ATOM 294   H HB3  . GLU A 1 20  ? 74.971  105.493 -5.980  1.00 0.00 ? 20  GLU A HB3  1 
ATOM 295   H HG2  . GLU A 1 20  ? 76.695  105.707 -4.246  1.00 0.00 ? 20  GLU A HG2  1 
ATOM 296   H HG3  . GLU A 1 20  ? 76.344  104.075 -3.678  1.00 0.00 ? 20  GLU A HG3  1 
ATOM 297   N N    . LYS A 1 21  ? 72.235  106.905 -4.732  1.00 0.00 ? 21  LYS A N    1 
ATOM 298   C CA   . LYS A 1 21  ? 70.963  107.326 -5.342  1.00 0.00 ? 21  LYS A CA   1 
ATOM 299   C C    . LYS A 1 21  ? 71.093  108.710 -5.971  1.00 0.00 ? 21  LYS A C    1 
ATOM 300   O O    . LYS A 1 21  ? 71.933  109.513 -5.564  1.00 0.00 ? 21  LYS A O    1 
ATOM 301   C CB   . LYS A 1 21  ? 69.843  107.346 -4.298  1.00 0.00 ? 21  LYS A CB   1 
ATOM 302   C CG   . LYS A 1 21  ? 69.465  105.915 -3.919  1.00 0.00 ? 21  LYS A CG   1 
ATOM 303   C CD   . LYS A 1 21  ? 68.316  105.944 -2.910  1.00 0.00 ? 21  LYS A CD   1 
ATOM 304   C CE   . LYS A 1 21  ? 67.886  104.514 -2.584  1.00 0.00 ? 21  LYS A CE   1 
ATOM 305   N NZ   . LYS A 1 21  ? 66.762  104.544 -1.605  1.00 0.00 ? 21  LYS A NZ   1 
ATOM 306   H H    . LYS A 1 21  ? 72.812  107.582 -4.321  1.00 0.00 ? 21  LYS A H    1 
ATOM 307   H HA   . LYS A 1 21  ? 70.694  106.622 -6.121  1.00 0.00 ? 21  LYS A HA   1 
ATOM 308   H HB2  . LYS A 1 21  ? 70.183  107.874 -3.419  1.00 0.00 ? 21  LYS A HB2  1 
ATOM 309   H HB3  . LYS A 1 21  ? 68.978  107.848 -4.707  1.00 0.00 ? 21  LYS A HB3  1 
ATOM 310   H HG2  . LYS A 1 21  ? 69.156  105.378 -4.805  1.00 0.00 ? 21  LYS A HG2  1 
ATOM 311   H HG3  . LYS A 1 21  ? 70.318  105.421 -3.477  1.00 0.00 ? 21  LYS A HG3  1 
ATOM 312   H HD2  . LYS A 1 21  ? 68.646  106.437 -2.006  1.00 0.00 ? 21  LYS A HD2  1 
ATOM 313   H HD3  . LYS A 1 21  ? 67.481  106.483 -3.331  1.00 0.00 ? 21  LYS A HD3  1 
ATOM 314   H HE2  . LYS A 1 21  ? 67.562  104.021 -3.488  1.00 0.00 ? 21  LYS A HE2  1 
ATOM 315   H HE3  . LYS A 1 21  ? 68.718  103.975 -2.159  1.00 0.00 ? 21  LYS A HE3  1 
ATOM 316   H HZ1  . LYS A 1 21  ? 66.701  105.488 -1.175  1.00 0.00 ? 21  LYS A HZ1  1 
ATOM 317   H HZ2  . LYS A 1 21  ? 66.930  103.835 -0.862  1.00 0.00 ? 21  LYS A HZ2  1 
ATOM 318   H HZ3  . LYS A 1 21  ? 65.871  104.330 -2.094  1.00 0.00 ? 21  LYS A HZ3  1 
ATOM 319   N N    . THR A 1 22  ? 70.250  108.982 -6.963  1.00 0.00 ? 22  THR A N    1 
ATOM 320   C CA   . THR A 1 22  ? 70.268  110.274 -7.644  1.00 0.00 ? 22  THR A CA   1 
ATOM 321   C C    . THR A 1 22  ? 69.854  111.389 -6.687  1.00 0.00 ? 22  THR A C    1 
ATOM 322   O O    . THR A 1 22  ? 68.956  111.212 -5.863  1.00 0.00 ? 22  THR A O    1 
ATOM 323   C CB   . THR A 1 22  ? 69.317  110.241 -8.842  1.00 0.00 ? 22  THR A CB   1 
ATOM 324   O OG1  . THR A 1 22  ? 69.267  111.530 -9.441  1.00 0.00 ? 22  THR A OG1  1 
ATOM 325   C CG2  . THR A 1 22  ? 67.919  109.836 -8.376  1.00 0.00 ? 22  THR A CG2  1 
ATOM 326   H H    . THR A 1 22  ? 69.599  108.303 -7.241  1.00 0.00 ? 22  THR A H    1 
ATOM 327   H HA   . THR A 1 22  ? 71.269  110.469 -7.997  1.00 0.00 ? 22  THR A HA   1 
ATOM 328   H HB   . THR A 1 22  ? 69.673  109.524 -9.565  1.00 0.00 ? 22  THR A HB   1 
ATOM 329   H HG1  . THR A 1 22  ? 68.804  112.118 -8.840  1.00 0.00 ? 22  THR A HG1  1 
ATOM 330   H HG21 . THR A 1 22  ? 67.561  110.548 -7.647  1.00 0.00 ? 22  THR A HG21 1 
ATOM 331   H HG22 . THR A 1 22  ? 67.960  108.853 -7.929  1.00 0.00 ? 22  THR A HG22 1 
ATOM 332   H HG23 . THR A 1 22  ? 67.248  109.818 -9.222  1.00 0.00 ? 22  THR A HG23 1 
ATOM 333   N N    . LYS A 1 23  ? 70.521  112.542 -6.797  1.00 0.00 ? 23  LYS A N    1 
ATOM 334   C CA   . LYS A 1 23  ? 70.225  113.692 -5.932  1.00 0.00 ? 23  LYS A CA   1 
ATOM 335   C C    . LYS A 1 23  ? 69.241  114.642 -6.609  1.00 0.00 ? 23  LYS A C    1 
ATOM 336   O O    . LYS A 1 23  ? 69.619  115.725 -7.059  1.00 0.00 ? 23  LYS A O    1 
ATOM 337   C CB   . LYS A 1 23  ? 71.520  114.442 -5.618  1.00 0.00 ? 23  LYS A CB   1 
ATOM 338   C CG   . LYS A 1 23  ? 72.459  113.524 -4.834  1.00 0.00 ? 23  LYS A CG   1 
ATOM 339   C CD   . LYS A 1 23  ? 73.749  114.275 -4.499  1.00 0.00 ? 23  LYS A CD   1 
ATOM 340   C CE   . LYS A 1 23  ? 74.709  113.335 -3.769  1.00 0.00 ? 23  LYS A CE   1 
ATOM 341   N NZ   . LYS A 1 23  ? 74.091  112.893 -2.487  1.00 0.00 ? 23  LYS A NZ   1 
ATOM 342   H H    . LYS A 1 23  ? 71.229  112.619 -7.470  1.00 0.00 ? 23  LYS A H    1 
ATOM 343   H HA   . LYS A 1 23  ? 69.793  113.344 -5.003  1.00 0.00 ? 23  LYS A HA   1 
ATOM 344   H HB2  . LYS A 1 23  ? 71.995  114.743 -6.541  1.00 0.00 ? 23  LYS A HB2  1 
ATOM 345   H HB3  . LYS A 1 23  ? 71.297  115.316 -5.025  1.00 0.00 ? 23  LYS A HB3  1 
ATOM 346   H HG2  . LYS A 1 23  ? 71.975  113.212 -3.919  1.00 0.00 ? 23  LYS A HG2  1 
ATOM 347   H HG3  . LYS A 1 23  ? 72.695  112.656 -5.432  1.00 0.00 ? 23  LYS A HG3  1 
ATOM 348   H HD2  . LYS A 1 23  ? 74.210  114.625 -5.412  1.00 0.00 ? 23  LYS A HD2  1 
ATOM 349   H HD3  . LYS A 1 23  ? 73.521  115.117 -3.864  1.00 0.00 ? 23  LYS A HD3  1 
ATOM 350   H HE2  . LYS A 1 23  ? 74.909  112.473 -4.389  1.00 0.00 ? 23  LYS A HE2  1 
ATOM 351   H HE3  . LYS A 1 23  ? 75.634  113.853 -3.564  1.00 0.00 ? 23  LYS A HE3  1 
ATOM 352   H HZ1  . LYS A 1 23  ? 73.708  111.934 -2.599  1.00 0.00 ? 23  LYS A HZ1  1 
ATOM 353   H HZ2  . LYS A 1 23  ? 73.323  113.547 -2.230  1.00 0.00 ? 23  LYS A HZ2  1 
ATOM 354   H HZ3  . LYS A 1 23  ? 74.811  112.891 -1.738  1.00 0.00 ? 23  LYS A HZ3  1 
ATOM 355   N N    . GLN A 1 24  ? 67.978  114.233 -6.675  1.00 0.00 ? 24  GLN A N    1 
ATOM 356   C CA   . GLN A 1 24  ? 66.948  115.059 -7.298  1.00 0.00 ? 24  GLN A CA   1 
ATOM 357   C C    . GLN A 1 24  ? 65.559  114.611 -6.851  1.00 0.00 ? 24  GLN A C    1 
ATOM 358   O O    . GLN A 1 24  ? 65.292  113.415 -6.731  1.00 0.00 ? 24  GLN A O    1 
ATOM 359   C CB   . GLN A 1 24  ? 67.061  114.963 -8.825  1.00 0.00 ? 24  GLN A CB   1 
ATOM 360   C CG   . GLN A 1 24  ? 66.297  116.116 -9.489  1.00 0.00 ? 24  GLN A CG   1 
ATOM 361   C CD   . GLN A 1 24  ? 64.797  115.929 -9.294  1.00 0.00 ? 24  GLN A CD   1 
ATOM 362   O OE1  . GLN A 1 24  ? 64.090  116.878 -8.951  1.00 0.00 ? 24  GLN A OE1  1 
ATOM 363   N NE2  . GLN A 1 24  ? 64.264  114.755 -9.493  1.00 0.00 ? 24  GLN A NE2  1 
ATOM 364   H H    . GLN A 1 24  ? 67.734  113.362 -6.299  1.00 0.00 ? 24  GLN A H    1 
ATOM 365   H HA   . GLN A 1 24  ? 67.098  116.084 -6.998  1.00 0.00 ? 24  GLN A HA   1 
ATOM 366   H HB2  . GLN A 1 24  ? 68.102  115.012 -9.110  1.00 0.00 ? 24  GLN A HB2  1 
ATOM 367   H HB3  . GLN A 1 24  ? 66.644  114.023 -9.155  1.00 0.00 ? 24  GLN A HB3  1 
ATOM 368   H HG2  . GLN A 1 24  ? 66.602  117.055 -9.050  1.00 0.00 ? 24  GLN A HG2  1 
ATOM 369   H HG3  . GLN A 1 24  ? 66.519  116.129 -10.544 1.00 0.00 ? 24  GLN A HG3  1 
ATOM 370   H HE21 . GLN A 1 24  ? 64.829  114.001 -9.766  1.00 0.00 ? 24  GLN A HE21 1 
ATOM 371   H HE22 . GLN A 1 24  ? 63.301  114.626 -9.372  1.00 0.00 ? 24  GLN A HE22 1 
ATOM 372   N N    . GLY A 1 25  ? 64.676  115.575 -6.607  1.00 0.00 ? 25  GLY A N    1 
ATOM 373   C CA   . GLY A 1 25  ? 63.318  115.260 -6.176  1.00 0.00 ? 25  GLY A CA   1 
ATOM 374   C C    . GLY A 1 25  ? 63.289  114.877 -4.700  1.00 0.00 ? 25  GLY A C    1 
ATOM 375   O O    . GLY A 1 25  ? 62.314  114.299 -4.218  1.00 0.00 ? 25  GLY A O    1 
ATOM 376   H H    . GLY A 1 25  ? 64.941  116.513 -6.719  1.00 0.00 ? 25  GLY A H    1 
ATOM 377   H HA2  . GLY A 1 25  ? 62.686  116.124 -6.332  1.00 0.00 ? 25  GLY A HA2  1 
ATOM 378   H HA3  . GLY A 1 25  ? 62.943  114.435 -6.761  1.00 0.00 ? 25  GLY A HA3  1 
ATOM 379   N N    . VAL A 1 26  ? 64.362  115.202 -3.989  1.00 0.00 ? 26  VAL A N    1 
ATOM 380   C CA   . VAL A 1 26  ? 64.449  114.885 -2.567  1.00 0.00 ? 26  VAL A CA   1 
ATOM 381   C C    . VAL A 1 26  ? 63.277  115.502 -1.811  1.00 0.00 ? 26  VAL A C    1 
ATOM 382   O O    . VAL A 1 26  ? 62.509  116.285 -2.367  1.00 0.00 ? 26  VAL A O    1 
ATOM 383   C CB   . VAL A 1 26  ? 65.763  115.416 -1.994  1.00 0.00 ? 26  VAL A CB   1 
ATOM 384   C CG1  . VAL A 1 26  ? 66.942  114.781 -2.735  1.00 0.00 ? 26  VAL A CG1  1 
ATOM 385   C CG2  . VAL A 1 26  ? 65.811  116.935 -2.165  1.00 0.00 ? 26  VAL A CG2  1 
ATOM 386   H H    . VAL A 1 26  ? 65.110  115.661 -4.427  1.00 0.00 ? 26  VAL A H    1 
ATOM 387   H HA   . VAL A 1 26  ? 64.422  113.813 -2.444  1.00 0.00 ? 26  VAL A HA   1 
ATOM 388   H HB   . VAL A 1 26  ? 65.823  115.169 -0.944  1.00 0.00 ? 26  VAL A HB   1 
ATOM 389   H HG11 . VAL A 1 26  ? 67.869  115.130 -2.302  1.00 0.00 ? 26  VAL A HG11 1 
ATOM 390   H HG12 . VAL A 1 26  ? 66.904  115.059 -3.777  1.00 0.00 ? 26  VAL A HG12 1 
ATOM 391   H HG13 . VAL A 1 26  ? 66.886  113.706 -2.646  1.00 0.00 ? 26  VAL A HG13 1 
ATOM 392   H HG21 . VAL A 1 26  ? 65.110  117.396 -1.487  1.00 0.00 ? 26  VAL A HG21 1 
ATOM 393   H HG22 . VAL A 1 26  ? 65.550  117.191 -3.182  1.00 0.00 ? 26  VAL A HG22 1 
ATOM 394   H HG23 . VAL A 1 26  ? 66.808  117.291 -1.950  1.00 0.00 ? 26  VAL A HG23 1 
ATOM 395   N N    . ALA A 1 27  ? 63.143  115.137 -0.539  1.00 0.00 ? 27  ALA A N    1 
ATOM 396   C CA   . ALA A 1 27  ? 62.056  115.655 0.285   1.00 0.00 ? 27  ALA A CA   1 
ATOM 397   C C    . ALA A 1 27  ? 62.156  117.173 0.429   1.00 0.00 ? 27  ALA A C    1 
ATOM 398   O O    . ALA A 1 27  ? 63.248  117.724 0.568   1.00 0.00 ? 27  ALA A O    1 
ATOM 399   C CB   . ALA A 1 27  ? 62.100  115.005 1.669   1.00 0.00 ? 27  ALA A CB   1 
ATOM 400   H H    . ALA A 1 27  ? 63.783  114.506 -0.150  1.00 0.00 ? 27  ALA A H    1 
ATOM 401   H HA   . ALA A 1 27  ? 61.115  115.409 -0.182  1.00 0.00 ? 27  ALA A HA   1 
ATOM 402   H HB1  . ALA A 1 27  ? 61.218  115.284 2.226   1.00 0.00 ? 27  ALA A HB1  1 
ATOM 403   H HB2  . ALA A 1 27  ? 62.981  115.341 2.197   1.00 0.00 ? 27  ALA A HB2  1 
ATOM 404   H HB3  . ALA A 1 27  ? 62.133  113.931 1.562   1.00 0.00 ? 27  ALA A HB3  1 
ATOM 405   N N    . GLU A 1 28  ? 61.003  117.839 0.396   1.00 0.00 ? 28  GLU A N    1 
ATOM 406   C CA   . GLU A 1 28  ? 60.956  119.295 0.524   1.00 0.00 ? 28  GLU A CA   1 
ATOM 407   C C    . GLU A 1 28  ? 60.995  119.710 1.994   1.00 0.00 ? 28  GLU A C    1 
ATOM 408   O O    . GLU A 1 28  ? 60.680  118.916 2.879   1.00 0.00 ? 28  GLU A O    1 
ATOM 409   C CB   . GLU A 1 28  ? 59.681  119.834 -0.127  1.00 0.00 ? 28  GLU A CB   1 
ATOM 410   C CG   . GLU A 1 28  ? 59.656  119.445 -1.607  1.00 0.00 ? 28  GLU A CG   1 
ATOM 411   C CD   . GLU A 1 28  ? 60.753  120.187 -2.361  1.00 0.00 ? 28  GLU A CD   1 
ATOM 412   O OE1  . GLU A 1 28  ? 61.267  121.154 -1.822  1.00 0.00 ? 28  GLU A OE1  1 
ATOM 413   O OE2  . GLU A 1 28  ? 61.062  119.781 -3.469  1.00 0.00 ? 28  GLU A OE2  1 
ATOM 414   H H    . GLU A 1 28  ? 60.167  117.342 0.283   1.00 0.00 ? 28  GLU A H    1 
ATOM 415   H HA   . GLU A 1 28  ? 61.810  119.722 0.018   1.00 0.00 ? 28  GLU A HA   1 
ATOM 416   H HB2  . GLU A 1 28  ? 58.818  119.413 0.371   1.00 0.00 ? 28  GLU A HB2  1 
ATOM 417   H HB3  . GLU A 1 28  ? 59.657  120.909 -0.040  1.00 0.00 ? 28  GLU A HB3  1 
ATOM 418   H HG2  . GLU A 1 28  ? 59.815  118.380 -1.699  1.00 0.00 ? 28  GLU A HG2  1 
ATOM 419   H HG3  . GLU A 1 28  ? 58.696  119.701 -2.028  1.00 0.00 ? 28  GLU A HG3  1 
ATOM 420   N N    . ALA A 1 29  ? 61.382  120.960 2.240   1.00 0.00 ? 29  ALA A N    1 
ATOM 421   C CA   . ALA A 1 29  ? 61.463  121.486 3.603   1.00 0.00 ? 29  ALA A CA   1 
ATOM 422   C C    . ALA A 1 29  ? 62.680  120.913 4.334   1.00 0.00 ? 29  ALA A C    1 
ATOM 423   O O    . ALA A 1 29  ? 63.257  121.567 5.208   1.00 0.00 ? 29  ALA A O    1 
ATOM 424   C CB   . ALA A 1 29  ? 60.173  121.157 4.378   1.00 0.00 ? 29  ALA A CB   1 
ATOM 425   H H    . ALA A 1 29  ? 61.620  121.542 1.488   1.00 0.00 ? 29  ALA A H    1 
ATOM 426   H HA   . ALA A 1 29  ? 61.569  122.560 3.549   1.00 0.00 ? 29  ALA A HA   1 
ATOM 427   H HB1  . ALA A 1 29  ? 60.245  120.170 4.813   1.00 0.00 ? 29  ALA A HB1  1 
ATOM 428   H HB2  . ALA A 1 29  ? 59.330  121.187 3.703   1.00 0.00 ? 29  ALA A HB2  1 
ATOM 429   H HB3  . ALA A 1 29  ? 60.026  121.885 5.165   1.00 0.00 ? 29  ALA A HB3  1 
ATOM 430   N N    . ALA A 1 30  ? 63.070  119.687 3.964   1.00 0.00 ? 30  ALA A N    1 
ATOM 431   C CA   . ALA A 1 30  ? 64.229  119.020 4.581   1.00 0.00 ? 30  ALA A CA   1 
ATOM 432   C C    . ALA A 1 30  ? 65.165  118.487 3.504   1.00 0.00 ? 30  ALA A C    1 
ATOM 433   O O    . ALA A 1 30  ? 64.729  117.814 2.568   1.00 0.00 ? 30  ALA A O    1 
ATOM 434   C CB   . ALA A 1 30  ? 63.755  117.859 5.458   1.00 0.00 ? 30  ALA A CB   1 
ATOM 435   H H    . ALA A 1 30  ? 62.571  119.220 3.261   1.00 0.00 ? 30  ALA A H    1 
ATOM 436   H HA   . ALA A 1 30  ? 64.775  119.724 5.198   1.00 0.00 ? 30  ALA A HA   1 
ATOM 437   H HB1  . ALA A 1 30  ? 62.923  118.183 6.065   1.00 0.00 ? 30  ALA A HB1  1 
ATOM 438   H HB2  . ALA A 1 30  ? 64.564  117.537 6.097   1.00 0.00 ? 30  ALA A HB2  1 
ATOM 439   H HB3  . ALA A 1 30  ? 63.444  117.035 4.830   1.00 0.00 ? 30  ALA A HB3  1 
ATOM 440   N N    . GLY A 1 31  ? 66.455  118.783 3.641   1.00 0.00 ? 31  GLY A N    1 
ATOM 441   C CA   . GLY A 1 31  ? 67.434  118.313 2.665   1.00 0.00 ? 31  GLY A CA   1 
ATOM 442   C C    . GLY A 1 31  ? 67.203  118.953 1.298   1.00 0.00 ? 31  GLY A C    1 
ATOM 443   O O    . GLY A 1 31  ? 66.915  118.259 0.322   1.00 0.00 ? 31  GLY A O    1 
ATOM 444   H H    . GLY A 1 31  ? 66.753  119.323 4.411   1.00 0.00 ? 31  GLY A H    1 
ATOM 445   H HA2  . GLY A 1 31  ? 68.426  118.561 3.010   1.00 0.00 ? 31  GLY A HA2  1 
ATOM 446   H HA3  . GLY A 1 31  ? 67.350  117.241 2.568   1.00 0.00 ? 31  GLY A HA3  1 
ATOM 447   N N    . LYS A 1 32  ? 67.334  120.276 1.228   1.00 0.00 ? 32  LYS A N    1 
ATOM 448   C CA   . LYS A 1 32  ? 67.138  120.976 -0.041  1.00 0.00 ? 32  LYS A CA   1 
ATOM 449   C C    . LYS A 1 32  ? 68.200  120.559 -1.051  1.00 0.00 ? 32  LYS A C    1 
ATOM 450   O O    . LYS A 1 32  ? 69.268  120.070 -0.682  1.00 0.00 ? 32  LYS A O    1 
ATOM 451   C CB   . LYS A 1 32  ? 67.164  122.494 0.140   1.00 0.00 ? 32  LYS A CB   1 
ATOM 452   C CG   . LYS A 1 32  ? 65.909  122.958 0.884   1.00 0.00 ? 32  LYS A CG   1 
ATOM 453   C CD   . LYS A 1 32  ? 65.859  124.491 0.883   1.00 0.00 ? 32  LYS A CD   1 
ATOM 454   C CE   . LYS A 1 32  ? 64.613  124.967 1.628   1.00 0.00 ? 32  LYS A CE   1 
ATOM 455   N NZ   . LYS A 1 32  ? 64.548  126.455 1.582   1.00 0.00 ? 32  LYS A NZ   1 
ATOM 456   H H    . LYS A 1 32  ? 67.573  120.788 2.036   1.00 0.00 ? 32  LYS A H    1 
ATOM 457   H HA   . LYS A 1 32  ? 66.171  120.696 -0.433  1.00 0.00 ? 32  LYS A HA   1 
ATOM 458   H HB2  . LYS A 1 32  ? 68.035  122.768 0.707   1.00 0.00 ? 32  LYS A HB2  1 
ATOM 459   H HB3  . LYS A 1 32  ? 67.200  122.968 -0.829  1.00 0.00 ? 32  LYS A HB3  1 
ATOM 460   H HG2  . LYS A 1 32  ? 65.031  122.568 0.392   1.00 0.00 ? 32  LYS A HG2  1 
ATOM 461   H HG3  . LYS A 1 32  ? 65.942  122.603 1.903   1.00 0.00 ? 32  LYS A HG3  1 
ATOM 462   H HD2  . LYS A 1 32  ? 66.739  124.882 1.367   1.00 0.00 ? 32  LYS A HD2  1 
ATOM 463   H HD3  . LYS A 1 32  ? 65.822  124.847 -0.135  1.00 0.00 ? 32  LYS A HD3  1 
ATOM 464   H HE2  . LYS A 1 32  ? 63.732  124.552 1.162   1.00 0.00 ? 32  LYS A HE2  1 
ATOM 465   H HE3  . LYS A 1 32  ? 64.662  124.641 2.657   1.00 0.00 ? 32  LYS A HE3  1 
ATOM 466   H HZ1  . LYS A 1 32  ? 65.494  126.850 1.747   1.00 0.00 ? 32  LYS A HZ1  1 
ATOM 467   H HZ2  . LYS A 1 32  ? 63.894  126.798 2.317   1.00 0.00 ? 32  LYS A HZ2  1 
ATOM 468   H HZ3  . LYS A 1 32  ? 64.208  126.758 0.647   1.00 0.00 ? 32  LYS A HZ3  1 
ATOM 469   N N    . THR A 1 33  ? 67.882  120.727 -2.330  1.00 0.00 ? 33  THR A N    1 
ATOM 470   C CA   . THR A 1 33  ? 68.796  120.337 -3.397  1.00 0.00 ? 33  THR A CA   1 
ATOM 471   C C    . THR A 1 33  ? 70.064  121.185 -3.366  1.00 0.00 ? 33  THR A C    1 
ATOM 472   O O    . THR A 1 33  ? 70.079  122.326 -3.824  1.00 0.00 ? 33  THR A O    1 
ATOM 473   C CB   . THR A 1 33  ? 68.095  120.516 -4.750  1.00 0.00 ? 33  THR A CB   1 
ATOM 474   O OG1  . THR A 1 33  ? 69.068  120.611 -5.780  1.00 0.00 ? 33  THR A OG1  1 
ATOM 475   C CG2  . THR A 1 33  ? 67.241  121.793 -4.728  1.00 0.00 ? 33  THR A CG2  1 
ATOM 476   H H    . THR A 1 33  ? 67.007  121.101 -2.561  1.00 0.00 ? 33  THR A H    1 
ATOM 477   H HA   . THR A 1 33  ? 69.062  119.299 -3.274  1.00 0.00 ? 33  THR A HA   1 
ATOM 478   H HB   . THR A 1 33  ? 67.455  119.668 -4.938  1.00 0.00 ? 33  THR A HB   1 
ATOM 479   H HG1  . THR A 1 33  ? 69.784  121.165 -5.461  1.00 0.00 ? 33  THR A HG1  1 
ATOM 480   H HG21 . THR A 1 33  ? 67.009  122.088 -5.740  1.00 0.00 ? 33  THR A HG21 1 
ATOM 481   H HG22 . THR A 1 33  ? 67.785  122.588 -4.239  1.00 0.00 ? 33  THR A HG22 1 
ATOM 482   H HG23 . THR A 1 33  ? 66.324  121.604 -4.190  1.00 0.00 ? 33  THR A HG23 1 
ATOM 483   N N    . LYS A 1 34  ? 71.132  120.604 -2.820  1.00 0.00 ? 34  LYS A N    1 
ATOM 484   C CA   . LYS A 1 34  ? 72.410  121.298 -2.719  1.00 0.00 ? 34  LYS A CA   1 
ATOM 485   C C    . LYS A 1 34  ? 72.873  121.760 -4.093  1.00 0.00 ? 34  LYS A C    1 
ATOM 486   O O    . LYS A 1 34  ? 72.709  121.051 -5.086  1.00 0.00 ? 34  LYS A O    1 
ATOM 487   C CB   . LYS A 1 34  ? 73.463  120.369 -2.112  1.00 0.00 ? 34  LYS A CB   1 
ATOM 488   C CG   . LYS A 1 34  ? 73.076  120.033 -0.666  1.00 0.00 ? 34  LYS A CG   1 
ATOM 489   C CD   . LYS A 1 34  ? 74.243  119.334 0.049   1.00 0.00 ? 34  LYS A CD   1 
ATOM 490   C CE   . LYS A 1 34  ? 74.441  117.923 -0.515  1.00 0.00 ? 34  LYS A CE   1 
ATOM 491   N NZ   . LYS A 1 34  ? 75.399  117.175 0.350   1.00 0.00 ? 34  LYS A NZ   1 
ATOM 492   H H    . LYS A 1 34  ? 71.056  119.689 -2.476  1.00 0.00 ? 34  LYS A H    1 
ATOM 493   H HA   . LYS A 1 34  ? 72.296  122.155 -2.078  1.00 0.00 ? 34  LYS A HA   1 
ATOM 494   H HB2  . LYS A 1 34  ? 73.510  119.464 -2.696  1.00 0.00 ? 34  LYS A HB2  1 
ATOM 495   H HB3  . LYS A 1 34  ? 74.426  120.858 -2.122  1.00 0.00 ? 34  LYS A HB3  1 
ATOM 496   H HG2  . LYS A 1 34  ? 72.829  120.944 -0.140  1.00 0.00 ? 34  LYS A HG2  1 
ATOM 497   H HG3  . LYS A 1 34  ? 72.217  119.379 -0.669  1.00 0.00 ? 34  LYS A HG3  1 
ATOM 498   H HD2  . LYS A 1 34  ? 75.146  119.908 -0.095  1.00 0.00 ? 34  LYS A HD2  1 
ATOM 499   H HD3  . LYS A 1 34  ? 74.025  119.268 1.105   1.00 0.00 ? 34  LYS A HD3  1 
ATOM 500   H HE2  . LYS A 1 34  ? 73.494  117.406 -0.537  1.00 0.00 ? 34  LYS A HE2  1 
ATOM 501   H HE3  . LYS A 1 34  ? 74.841  117.986 -1.513  1.00 0.00 ? 34  LYS A HE3  1 
ATOM 502   H HZ1  . LYS A 1 34  ? 75.124  116.175 0.387   1.00 0.00 ? 34  LYS A HZ1  1 
ATOM 503   H HZ2  . LYS A 1 34  ? 75.384  117.576 1.311   1.00 0.00 ? 34  LYS A HZ2  1 
ATOM 504   H HZ3  . LYS A 1 34  ? 76.357  117.254 -0.045  1.00 0.00 ? 34  LYS A HZ3  1 
ATOM 505   N N    . GLU A 1 35  ? 73.457  122.959 -4.143  1.00 0.00 ? 35  GLU A N    1 
ATOM 506   C CA   . GLU A 1 35  ? 73.951  123.527 -5.403  1.00 0.00 ? 35  GLU A CA   1 
ATOM 507   C C    . GLU A 1 35  ? 75.474  123.497 -5.422  1.00 0.00 ? 35  GLU A C    1 
ATOM 508   O O    . GLU A 1 35  ? 76.125  124.104 -4.570  1.00 0.00 ? 35  GLU A O    1 
ATOM 509   C CB   . GLU A 1 35  ? 73.479  124.977 -5.528  1.00 0.00 ? 35  GLU A CB   1 
ATOM 510   C CG   . GLU A 1 35  ? 73.761  125.496 -6.940  1.00 0.00 ? 35  GLU A CG   1 
ATOM 511   C CD   . GLU A 1 35  ? 72.844  124.803 -7.942  1.00 0.00 ? 35  GLU A CD   1 
ATOM 512   O OE1  . GLU A 1 35  ? 71.782  124.363 -7.536  1.00 0.00 ? 35  GLU A OE1  1 
ATOM 513   O OE2  . GLU A 1 35  ? 73.215  124.727 -9.101  1.00 0.00 ? 35  GLU A OE2  1 
ATOM 514   H H    . GLU A 1 35  ? 73.559  123.474 -3.317  1.00 0.00 ? 35  GLU A H    1 
ATOM 515   H HA   . GLU A 1 35  ? 73.573  122.960 -6.244  1.00 0.00 ? 35  GLU A HA   1 
ATOM 516   H HB2  . GLU A 1 35  ? 72.418  125.027 -5.330  1.00 0.00 ? 35  GLU A HB2  1 
ATOM 517   H HB3  . GLU A 1 35  ? 74.006  125.585 -4.812  1.00 0.00 ? 35  GLU A HB3  1 
ATOM 518   H HG2  . GLU A 1 35  ? 73.584  126.562 -6.970  1.00 0.00 ? 35  GLU A HG2  1 
ATOM 519   H HG3  . GLU A 1 35  ? 74.789  125.295 -7.196  1.00 0.00 ? 35  GLU A HG3  1 
ATOM 520   N N    . GLY A 1 36  ? 76.040  122.793 -6.393  1.00 0.00 ? 36  GLY A N    1 
ATOM 521   C CA   . GLY A 1 36  ? 77.489  122.705 -6.497  1.00 0.00 ? 36  GLY A CA   1 
ATOM 522   C C    . GLY A 1 36  ? 78.083  124.072 -6.793  1.00 0.00 ? 36  GLY A C    1 
ATOM 523   O O    . GLY A 1 36  ? 78.027  124.974 -5.958  1.00 0.00 ? 36  GLY A O    1 
ATOM 524   H H    . GLY A 1 36  ? 75.478  122.330 -7.050  1.00 0.00 ? 36  GLY A H    1 
ATOM 525   H HA2  . GLY A 1 36  ? 77.889  122.337 -5.561  1.00 0.00 ? 36  GLY A HA2  1 
ATOM 526   H HA3  . GLY A 1 36  ? 77.752  122.023 -7.291  1.00 0.00 ? 36  GLY A HA3  1 
ATOM 527   N N    . VAL A 1 37  ? 78.653  124.224 -7.991  1.00 0.00 ? 37  VAL A N    1 
ATOM 528   C CA   . VAL A 1 37  ? 79.264  125.499 -8.402  1.00 0.00 ? 37  VAL A CA   1 
ATOM 529   C C    . VAL A 1 37  ? 78.747  125.900 -9.781  1.00 0.00 ? 37  VAL A C    1 
ATOM 530   O O    . VAL A 1 37  ? 78.442  125.038 -10.606 1.00 0.00 ? 37  VAL A O    1 
ATOM 531   C CB   . VAL A 1 37  ? 80.786  125.335 -8.448  1.00 0.00 ? 37  VAL A CB   1 
ATOM 532   C CG1  . VAL A 1 37  ? 81.277  124.786 -7.105  1.00 0.00 ? 37  VAL A CG1  1 
ATOM 533   C CG2  . VAL A 1 37  ? 81.167  124.357 -9.563  1.00 0.00 ? 37  VAL A CG2  1 
ATOM 534   H H    . VAL A 1 37  ? 78.664  123.468 -8.614  1.00 0.00 ? 37  VAL A H    1 
ATOM 535   H HA   . VAL A 1 37  ? 79.014  126.278 -7.691  1.00 0.00 ? 37  VAL A HA   1 
ATOM 536   H HB   . VAL A 1 37  ? 81.246  126.297 -8.634  1.00 0.00 ? 37  VAL A HB   1 
ATOM 537   H HG11 . VAL A 1 37  ? 82.357  124.821 -7.074  1.00 0.00 ? 37  VAL A HG11 1 
ATOM 538   H HG12 . VAL A 1 37  ? 80.948  123.762 -6.995  1.00 0.00 ? 37  VAL A HG12 1 
ATOM 539   H HG13 . VAL A 1 37  ? 80.872  125.380 -6.302  1.00 0.00 ? 37  VAL A HG13 1 
ATOM 540   H HG21 . VAL A 1 37  ? 82.209  124.093 -9.467  1.00 0.00 ? 37  VAL A HG21 1 
ATOM 541   H HG22 . VAL A 1 37  ? 80.999  124.820 -10.524 1.00 0.00 ? 37  VAL A HG22 1 
ATOM 542   H HG23 . VAL A 1 37  ? 80.562  123.467 -9.482  1.00 0.00 ? 37  VAL A HG23 1 
ATOM 543   N N    . LEU A 1 38  ? 78.653  127.216 -10.038 1.00 0.00 ? 38  LEU A N    1 
ATOM 544   C CA   . LEU A 1 38  ? 78.164  127.710 -11.348 1.00 0.00 ? 38  LEU A CA   1 
ATOM 545   C C    . LEU A 1 38  ? 79.264  128.508 -12.057 1.00 0.00 ? 38  LEU A C    1 
ATOM 546   O O    . LEU A 1 38  ? 79.873  129.396 -11.459 1.00 0.00 ? 38  LEU A O    1 
ATOM 547   C CB   . LEU A 1 38  ? 76.941  128.625 -11.154 1.00 0.00 ? 38  LEU A CB   1 
ATOM 548   C CG   . LEU A 1 38  ? 75.953  127.998 -10.159 1.00 0.00 ? 38  LEU A CG   1 
ATOM 549   C CD1  . LEU A 1 38  ? 74.742  128.930 -9.972  1.00 0.00 ? 38  LEU A CD1  1 
ATOM 550   C CD2  . LEU A 1 38  ? 75.473  126.640 -10.684 1.00 0.00 ? 38  LEU A CD2  1 
ATOM 551   H H    . LEU A 1 38  ? 78.918  127.866 -9.339  1.00 0.00 ? 38  LEU A H    1 
ATOM 552   H HA   . LEU A 1 38  ? 77.877  126.874 -11.976 1.00 0.00 ? 38  LEU A HA   1 
ATOM 553   H HB2  . LEU A 1 38  ? 77.265  129.583 -10.787 1.00 0.00 ? 38  LEU A HB2  1 
ATOM 554   H HB3  . LEU A 1 38  ? 76.445  128.760 -12.104 1.00 0.00 ? 38  LEU A HB3  1 
ATOM 555   H HG   . LEU A 1 38  ? 76.447  127.862 -9.205  1.00 0.00 ? 38  LEU A HG   1 
ATOM 556   H HD11 . LEU A 1 38  ? 74.239  128.685 -9.049  1.00 0.00 ? 38  LEU A HD11 1 
ATOM 557   H HD12 . LEU A 1 38  ? 74.054  128.806 -10.798 1.00 0.00 ? 38  LEU A HD12 1 
ATOM 558   H HD13 . LEU A 1 38  ? 75.073  129.958 -9.936  1.00 0.00 ? 38  LEU A HD13 1 
ATOM 559   H HD21 . LEU A 1 38  ? 76.259  125.911 -10.568 1.00 0.00 ? 38  LEU A HD21 1 
ATOM 560   H HD22 . LEU A 1 38  ? 75.214  126.729 -11.727 1.00 0.00 ? 38  LEU A HD22 1 
ATOM 561   H HD23 . LEU A 1 38  ? 74.606  126.325 -10.124 1.00 0.00 ? 38  LEU A HD23 1 
ATOM 562   N N    . TYR A 1 39  ? 79.508  128.192 -13.338 1.00 0.00 ? 39  TYR A N    1 
ATOM 563   C CA   . TYR A 1 39  ? 80.536  128.896 -14.139 1.00 0.00 ? 39  TYR A CA   1 
ATOM 564   C C    . TYR A 1 39  ? 79.929  129.439 -15.437 1.00 0.00 ? 39  TYR A C    1 
ATOM 565   O O    . TYR A 1 39  ? 79.475  128.675 -16.288 1.00 0.00 ? 39  TYR A O    1 
ATOM 566   C CB   . TYR A 1 39  ? 81.698  127.934 -14.470 1.00 0.00 ? 39  TYR A CB   1 
ATOM 567   C CG   . TYR A 1 39  ? 82.620  127.806 -13.275 1.00 0.00 ? 39  TYR A CG   1 
ATOM 568   C CD1  . TYR A 1 39  ? 82.294  126.944 -12.223 1.00 0.00 ? 39  TYR A CD1  1 
ATOM 569   C CD2  . TYR A 1 39  ? 83.800  128.559 -13.224 1.00 0.00 ? 39  TYR A CD2  1 
ATOM 570   C CE1  . TYR A 1 39  ? 83.150  126.835 -11.119 1.00 0.00 ? 39  TYR A CE1  1 
ATOM 571   C CE2  . TYR A 1 39  ? 84.654  128.449 -12.122 1.00 0.00 ? 39  TYR A CE2  1 
ATOM 572   C CZ   . TYR A 1 39  ? 84.329  127.588 -11.069 1.00 0.00 ? 39  TYR A CZ   1 
ATOM 573   O OH   . TYR A 1 39  ? 85.171  127.481 -9.981  1.00 0.00 ? 39  TYR A OH   1 
ATOM 574   H H    . TYR A 1 39  ? 78.984  127.479 -13.760 1.00 0.00 ? 39  TYR A H    1 
ATOM 575   H HA   . TYR A 1 39  ? 80.926  129.735 -13.570 1.00 0.00 ? 39  TYR A HA   1 
ATOM 576   H HB2  . TYR A 1 39  ? 81.299  126.962 -14.719 1.00 0.00 ? 39  TYR A HB2  1 
ATOM 577   H HB3  . TYR A 1 39  ? 82.260  128.317 -15.314 1.00 0.00 ? 39  TYR A HB3  1 
ATOM 578   H HD1  . TYR A 1 39  ? 81.384  126.363 -12.261 1.00 0.00 ? 39  TYR A HD1  1 
ATOM 579   H HD2  . TYR A 1 39  ? 84.051  129.224 -14.036 1.00 0.00 ? 39  TYR A HD2  1 
ATOM 580   H HE1  . TYR A 1 39  ? 82.901  126.172 -10.306 1.00 0.00 ? 39  TYR A HE1  1 
ATOM 581   H HE2  . TYR A 1 39  ? 85.564  129.030 -12.084 1.00 0.00 ? 39  TYR A HE2  1 
ATOM 582   H HH   . TYR A 1 39  ? 85.074  128.277 -9.453  1.00 0.00 ? 39  TYR A HH   1 
ATOM 583   N N    . VAL A 1 40  ? 79.934  130.774 -15.579 1.00 0.00 ? 40  VAL A N    1 
ATOM 584   C CA   . VAL A 1 40  ? 79.390  131.432 -16.781 1.00 0.00 ? 40  VAL A CA   1 
ATOM 585   C C    . VAL A 1 40  ? 80.371  132.495 -17.300 1.00 0.00 ? 40  VAL A C    1 
ATOM 586   O O    . VAL A 1 40  ? 80.669  133.464 -16.613 1.00 0.00 ? 40  VAL A O    1 
ATOM 587   C CB   . VAL A 1 40  ? 78.052  132.098 -16.438 1.00 0.00 ? 40  VAL A CB   1 
ATOM 588   C CG1  . VAL A 1 40  ? 77.470  132.765 -17.686 1.00 0.00 ? 40  VAL A CG1  1 
ATOM 589   C CG2  . VAL A 1 40  ? 77.071  131.041 -15.924 1.00 0.00 ? 40  VAL A CG2  1 
ATOM 590   H H    . VAL A 1 40  ? 80.316  131.329 -14.865 1.00 0.00 ? 40  VAL A H    1 
ATOM 591   H HA   . VAL A 1 40  ? 79.225  130.698 -17.559 1.00 0.00 ? 40  VAL A HA   1 
ATOM 592   H HB   . VAL A 1 40  ? 78.208  132.846 -15.674 1.00 0.00 ? 40  VAL A HB   1 
ATOM 593   H HG11 . VAL A 1 40  ? 78.063  133.631 -17.943 1.00 0.00 ? 40  VAL A HG11 1 
ATOM 594   H HG12 . VAL A 1 40  ? 76.452  133.071 -17.489 1.00 0.00 ? 40  VAL A HG12 1 
ATOM 595   H HG13 . VAL A 1 40  ? 77.482  132.064 -18.508 1.00 0.00 ? 40  VAL A HG13 1 
ATOM 596   H HG21 . VAL A 1 40  ? 77.056  130.202 -16.604 1.00 0.00 ? 40  VAL A HG21 1 
ATOM 597   H HG22 . VAL A 1 40  ? 76.081  131.469 -15.860 1.00 0.00 ? 40  VAL A HG22 1 
ATOM 598   H HG23 . VAL A 1 40  ? 77.382  130.706 -14.946 1.00 0.00 ? 40  VAL A HG23 1 
ATOM 599   N N    . GLY A 1 41  ? 80.862  132.319 -18.514 1.00 0.00 ? 41  GLY A N    1 
ATOM 600   C CA   . GLY A 1 41  ? 81.793  133.290 -19.083 1.00 0.00 ? 41  GLY A CA   1 
ATOM 601   C C    . GLY A 1 41  ? 83.123  133.303 -18.318 1.00 0.00 ? 41  GLY A C    1 
ATOM 602   O O    . GLY A 1 41  ? 83.454  134.277 -17.627 1.00 0.00 ? 41  GLY A O    1 
ATOM 603   H H    . GLY A 1 41  ? 80.592  131.532 -19.039 1.00 0.00 ? 41  GLY A H    1 
ATOM 604   H HA2  . GLY A 1 41  ? 81.979  133.033 -20.116 1.00 0.00 ? 41  GLY A HA2  1 
ATOM 605   H HA3  . GLY A 1 41  ? 81.350  134.271 -19.036 1.00 0.00 ? 41  GLY A HA3  1 
ATOM 606   N N    . SER A 1 42  ? 83.883  132.209 -18.446 1.00 0.00 ? 42  SER A N    1 
ATOM 607   C CA   . SER A 1 42  ? 85.186  132.086 -17.775 1.00 0.00 ? 42  SER A CA   1 
ATOM 608   C C    . SER A 1 42  ? 86.220  131.499 -18.730 1.00 0.00 ? 42  SER A C    1 
ATOM 609   O O    . SER A 1 42  ? 85.938  130.533 -19.443 1.00 0.00 ? 42  SER A O    1 
ATOM 610   C CB   . SER A 1 42  ? 85.056  131.173 -16.557 1.00 0.00 ? 42  SER A CB   1 
ATOM 611   O OG   . SER A 1 42  ? 84.126  131.738 -15.643 1.00 0.00 ? 42  SER A OG   1 
ATOM 612   H H    . SER A 1 42  ? 83.563  131.468 -19.007 1.00 0.00 ? 42  SER A H    1 
ATOM 613   H HA   . SER A 1 42  ? 85.525  133.060 -17.449 1.00 0.00 ? 42  SER A HA   1 
ATOM 614   H HB2  . SER A 1 42  ? 84.704  130.204 -16.867 1.00 0.00 ? 42  SER A HB2  1 
ATOM 615   H HB3  . SER A 1 42  ? 86.025  131.067 -16.083 1.00 0.00 ? 42  SER A HB3  1 
ATOM 616   H HG   . SER A 1 42  ? 84.622  132.124 -14.918 1.00 0.00 ? 42  SER A HG   1 
ATOM 617   N N    . LYS A 1 43  ? 87.428  132.074 -18.737 1.00 0.00 ? 43  LYS A N    1 
ATOM 618   C CA   . LYS A 1 43  ? 88.509  131.583 -19.611 1.00 0.00 ? 43  LYS A CA   1 
ATOM 619   C C    . LYS A 1 43  ? 89.686  131.119 -18.761 1.00 0.00 ? 43  LYS A C    1 
ATOM 620   O O    . LYS A 1 43  ? 90.185  131.865 -17.921 1.00 0.00 ? 43  LYS A O    1 
ATOM 621   C CB   . LYS A 1 43  ? 88.978  132.703 -20.547 1.00 0.00 ? 43  LYS A CB   1 
ATOM 622   C CG   . LYS A 1 43  ? 87.773  133.400 -21.204 1.00 0.00 ? 43  LYS A CG   1 
ATOM 623   C CD   . LYS A 1 43  ? 86.972  132.416 -22.068 1.00 0.00 ? 43  LYS A CD   1 
ATOM 624   C CE   . LYS A 1 43  ? 85.936  133.201 -22.879 1.00 0.00 ? 43  LYS A CE   1 
ATOM 625   N NZ   . LYS A 1 43  ? 85.099  132.258 -23.677 1.00 0.00 ? 43  LYS A NZ   1 
ATOM 626   H H    . LYS A 1 43  ? 87.600  132.834 -18.143 1.00 0.00 ? 43  LYS A H    1 
ATOM 627   H HA   . LYS A 1 43  ? 88.163  130.746 -20.206 1.00 0.00 ? 43  LYS A HA   1 
ATOM 628   H HB2  . LYS A 1 43  ? 89.543  133.429 -19.978 1.00 0.00 ? 43  LYS A HB2  1 
ATOM 629   H HB3  . LYS A 1 43  ? 89.610  132.285 -21.317 1.00 0.00 ? 43  LYS A HB3  1 
ATOM 630   H HG2  . LYS A 1 43  ? 87.133  133.796 -20.433 1.00 0.00 ? 43  LYS A HG2  1 
ATOM 631   H HG3  . LYS A 1 43  ? 88.127  134.211 -21.824 1.00 0.00 ? 43  LYS A HG3  1 
ATOM 632   H HD2  . LYS A 1 43  ? 87.639  131.891 -22.736 1.00 0.00 ? 43  LYS A HD2  1 
ATOM 633   H HD3  . LYS A 1 43  ? 86.460  131.709 -21.435 1.00 0.00 ? 43  LYS A HD3  1 
ATOM 634   H HE2  . LYS A 1 43  ? 85.303  133.761 -22.208 1.00 0.00 ? 43  LYS A HE2  1 
ATOM 635   H HE3  . LYS A 1 43  ? 86.444  133.881 -23.546 1.00 0.00 ? 43  LYS A HE3  1 
ATOM 636   H HZ1  . LYS A 1 43  ? 84.293  132.772 -24.085 1.00 0.00 ? 43  LYS A HZ1  1 
ATOM 637   H HZ2  . LYS A 1 43  ? 84.748  131.497 -23.058 1.00 0.00 ? 43  LYS A HZ2  1 
ATOM 638   H HZ3  . LYS A 1 43  ? 85.669  131.848 -24.442 1.00 0.00 ? 43  LYS A HZ3  1 
ATOM 639   N N    . THR A 1 44  ? 90.125  129.876 -18.989 1.00 0.00 ? 44  THR A N    1 
ATOM 640   C CA   . THR A 1 44  ? 91.254  129.299 -18.241 1.00 0.00 ? 44  THR A CA   1 
ATOM 641   C C    . THR A 1 44  ? 92.264  128.677 -19.199 1.00 0.00 ? 44  THR A C    1 
ATOM 642   O O    . THR A 1 44  ? 91.909  127.838 -20.027 1.00 0.00 ? 44  THR A O    1 
ATOM 643   C CB   . THR A 1 44  ? 90.737  128.218 -17.284 1.00 0.00 ? 44  THR A CB   1 
ATOM 644   O OG1  . THR A 1 44  ? 89.796  128.792 -16.388 1.00 0.00 ? 44  THR A OG1  1 
ATOM 645   C CG2  . THR A 1 44  ? 91.905  127.629 -16.491 1.00 0.00 ? 44  THR A CG2  1 
ATOM 646   H H    . THR A 1 44  ? 89.682  129.332 -19.675 1.00 0.00 ? 44  THR A H    1 
ATOM 647   H HA   . THR A 1 44  ? 91.747  130.068 -17.663 1.00 0.00 ? 44  THR A HA   1 
ATOM 648   H HB   . THR A 1 44  ? 90.262  127.433 -17.851 1.00 0.00 ? 44  THR A HB   1 
ATOM 649   H HG1  . THR A 1 44  ? 90.277  129.345 -15.768 1.00 0.00 ? 44  THR A HG1  1 
ATOM 650   H HG21 . THR A 1 44  ? 92.489  128.430 -16.063 1.00 0.00 ? 44  THR A HG21 1 
ATOM 651   H HG22 . THR A 1 44  ? 92.528  127.042 -17.150 1.00 0.00 ? 44  THR A HG22 1 
ATOM 652   H HG23 . THR A 1 44  ? 91.523  127.000 -15.700 1.00 0.00 ? 44  THR A HG23 1 
ATOM 653   N N    . LYS A 1 45  ? 93.531  129.078 -19.072 1.00 0.00 ? 45  LYS A N    1 
ATOM 654   C CA   . LYS A 1 45  ? 94.599  128.539 -19.930 1.00 0.00 ? 45  LYS A CA   1 
ATOM 655   C C    . LYS A 1 45  ? 95.856  128.289 -19.106 1.00 0.00 ? 45  LYS A C    1 
ATOM 656   O O    . LYS A 1 45  ? 96.247  129.122 -18.288 1.00 0.00 ? 45  LYS A O    1 
ATOM 657   C CB   . LYS A 1 45  ? 94.915  129.520 -21.061 1.00 0.00 ? 45  LYS A CB   1 
ATOM 658   C CG   . LYS A 1 45  ? 93.664  129.736 -21.916 1.00 0.00 ? 45  LYS A CG   1 
ATOM 659   C CD   . LYS A 1 45  ? 93.988  130.705 -23.056 1.00 0.00 ? 45  LYS A CD   1 
ATOM 660   C CE   . LYS A 1 45  ? 92.711  131.021 -23.839 1.00 0.00 ? 45  LYS A CE   1 
ATOM 661   N NZ   . LYS A 1 45  ? 92.177  129.770 -24.447 1.00 0.00 ? 45  LYS A NZ   1 
ATOM 662   H H    . LYS A 1 45  ? 93.757  129.742 -18.387 1.00 0.00 ? 45  LYS A H    1 
ATOM 663   H HA   . LYS A 1 45  ? 94.278  127.598 -20.364 1.00 0.00 ? 45  LYS A HA   1 
ATOM 664   H HB2  . LYS A 1 45  ? 95.234  130.463 -20.641 1.00 0.00 ? 45  LYS A HB2  1 
ATOM 665   H HB3  . LYS A 1 45  ? 95.703  129.115 -21.677 1.00 0.00 ? 45  LYS A HB3  1 
ATOM 666   H HG2  . LYS A 1 45  ? 93.341  128.789 -22.326 1.00 0.00 ? 45  LYS A HG2  1 
ATOM 667   H HG3  . LYS A 1 45  ? 92.877  130.152 -21.305 1.00 0.00 ? 45  LYS A HG3  1 
ATOM 668   H HD2  . LYS A 1 45  ? 94.396  131.617 -22.649 1.00 0.00 ? 45  LYS A HD2  1 
ATOM 669   H HD3  . LYS A 1 45  ? 94.709  130.252 -23.720 1.00 0.00 ? 45  LYS A HD3  1 
ATOM 670   H HE2  . LYS A 1 45  ? 91.973  131.439 -23.171 1.00 0.00 ? 45  LYS A HE2  1 
ATOM 671   H HE3  . LYS A 1 45  ? 92.934  131.733 -24.620 1.00 0.00 ? 45  LYS A HE3  1 
ATOM 672   H HZ1  . LYS A 1 45  ? 92.139  129.023 -23.726 1.00 0.00 ? 45  LYS A HZ1  1 
ATOM 673   H HZ2  . LYS A 1 45  ? 92.800  129.470 -25.225 1.00 0.00 ? 45  LYS A HZ2  1 
ATOM 674   H HZ3  . LYS A 1 45  ? 91.221  129.943 -24.814 1.00 0.00 ? 45  LYS A HZ3  1 
ATOM 675   N N    . GLU A 1 46  ? 96.491  127.134 -19.328 1.00 0.00 ? 46  GLU A N    1 
ATOM 676   C CA   . GLU A 1 46  ? 97.715  126.775 -18.596 1.00 0.00 ? 46  GLU A CA   1 
ATOM 677   C C    . GLU A 1 46  ? 98.716  126.086 -19.523 1.00 0.00 ? 46  GLU A C    1 
ATOM 678   O O    . GLU A 1 46  ? 98.459  124.987 -20.014 1.00 0.00 ? 46  GLU A O    1 
ATOM 679   C CB   . GLU A 1 46  ? 97.365  125.830 -17.440 1.00 0.00 ? 46  GLU A CB   1 
ATOM 680   C CG   . GLU A 1 46  ? 96.387  126.525 -16.488 1.00 0.00 ? 46  GLU A CG   1 
ATOM 681   C CD   . GLU A 1 46  ? 96.081  125.617 -15.300 1.00 0.00 ? 46  GLU A CD   1 
ATOM 682   O OE1  . GLU A 1 46  ? 96.573  124.501 -15.290 1.00 0.00 ? 46  GLU A OE1  1 
ATOM 683   O OE2  . GLU A 1 46  ? 95.360  126.054 -14.418 1.00 0.00 ? 46  GLU A OE2  1 
ATOM 684   H H    . GLU A 1 46  ? 96.131  126.510 -19.993 1.00 0.00 ? 46  GLU A H    1 
ATOM 685   H HA   . GLU A 1 46  ? 98.169  127.664 -18.192 1.00 0.00 ? 46  GLU A HA   1 
ATOM 686   H HB2  . GLU A 1 46  ? 96.908  124.933 -17.834 1.00 0.00 ? 46  GLU A HB2  1 
ATOM 687   H HB3  . GLU A 1 46  ? 98.264  125.570 -16.903 1.00 0.00 ? 46  GLU A HB3  1 
ATOM 688   H HG2  . GLU A 1 46  ? 96.825  127.445 -16.134 1.00 0.00 ? 46  GLU A HG2  1 
ATOM 689   H HG3  . GLU A 1 46  ? 95.471  126.743 -17.015 1.00 0.00 ? 46  GLU A HG3  1 
ATOM 690   N N    . GLY A 1 47  ? 99.866  126.725 -19.756 1.00 0.00 ? 47  GLY A N    1 
ATOM 691   C CA   . GLY A 1 47  ? 100.880 126.135 -20.621 1.00 0.00 ? 47  GLY A CA   1 
ATOM 692   C C    . GLY A 1 47  ? 100.450 126.177 -22.083 1.00 0.00 ? 47  GLY A C    1 
ATOM 693   O O    . GLY A 1 47  ? 100.056 125.160 -22.654 1.00 0.00 ? 47  GLY A O    1 
ATOM 694   H H    . GLY A 1 47  ? 100.037 127.602 -19.341 1.00 0.00 ? 47  GLY A H    1 
ATOM 695   H HA2  . GLY A 1 47  ? 101.805 126.683 -20.508 1.00 0.00 ? 47  GLY A HA2  1 
ATOM 696   H HA3  . GLY A 1 47  ? 101.039 125.108 -20.331 1.00 0.00 ? 47  GLY A HA3  1 
ATOM 697   N N    . VAL A 1 48  ? 100.526 127.367 -22.684 1.00 0.00 ? 48  VAL A N    1 
ATOM 698   C CA   . VAL A 1 48  ? 100.144 127.552 -24.094 1.00 0.00 ? 48  VAL A CA   1 
ATOM 699   C C    . VAL A 1 48  ? 101.122 128.489 -24.795 1.00 0.00 ? 48  VAL A C    1 
ATOM 700   O O    . VAL A 1 48  ? 101.523 129.510 -24.241 1.00 0.00 ? 48  VAL A O    1 
ATOM 701   C CB   . VAL A 1 48  ? 98.733  128.129 -24.185 1.00 0.00 ? 48  VAL A CB   1 
ATOM 702   C CG1  . VAL A 1 48  ? 98.371  128.353 -25.655 1.00 0.00 ? 48  VAL A CG1  1 
ATOM 703   C CG2  . VAL A 1 48  ? 97.738  127.145 -23.565 1.00 0.00 ? 48  VAL A CG2  1 
ATOM 704   H H    . VAL A 1 48  ? 100.848 128.139 -22.172 1.00 0.00 ? 48  VAL A H    1 
ATOM 705   H HA   . VAL A 1 48  ? 100.162 126.594 -24.601 1.00 0.00 ? 48  VAL A HA   1 
ATOM 706   H HB   . VAL A 1 48  ? 98.693  129.069 -23.656 1.00 0.00 ? 48  VAL A HB   1 
ATOM 707   H HG11 . VAL A 1 48  ? 98.907  129.212 -26.030 1.00 0.00 ? 48  VAL A HG11 1 
ATOM 708   H HG12 . VAL A 1 48  ? 97.308  128.525 -25.741 1.00 0.00 ? 48  VAL A HG12 1 
ATOM 709   H HG13 . VAL A 1 48  ? 98.642  127.480 -26.230 1.00 0.00 ? 48  VAL A HG13 1 
ATOM 710   H HG21 . VAL A 1 48  ? 97.895  127.099 -22.498 1.00 0.00 ? 48  VAL A HG21 1 
ATOM 711   H HG22 . VAL A 1 48  ? 97.885  126.164 -23.994 1.00 0.00 ? 48  VAL A HG22 1 
ATOM 712   H HG23 . VAL A 1 48  ? 96.731  127.478 -23.767 1.00 0.00 ? 48  VAL A HG23 1 
ATOM 713   N N    . VAL A 1 49  ? 101.503 128.136 -26.029 1.00 0.00 ? 49  VAL A N    1 
ATOM 714   C CA   . VAL A 1 49  ? 102.440 128.955 -26.815 1.00 0.00 ? 49  VAL A CA   1 
ATOM 715   C C    . VAL A 1 49  ? 101.959 129.098 -28.261 1.00 0.00 ? 49  VAL A C    1 
ATOM 716   O O    . VAL A 1 49  ? 101.436 128.154 -28.852 1.00 0.00 ? 49  VAL A O    1 
ATOM 717   C CB   . VAL A 1 49  ? 103.846 128.322 -26.780 1.00 0.00 ? 49  VAL A CB   1 
ATOM 718   C CG1  . VAL A 1 49  ? 103.741 126.826 -27.065 1.00 0.00 ? 49  VAL A CG1  1 
ATOM 719   C CG2  . VAL A 1 49  ? 104.755 128.980 -27.840 1.00 0.00 ? 49  VAL A CG2  1 
ATOM 720   H H    . VAL A 1 49  ? 101.147 127.311 -26.421 1.00 0.00 ? 49  VAL A H    1 
ATOM 721   H HA   . VAL A 1 49  ? 102.499 129.940 -26.381 1.00 0.00 ? 49  VAL A HA   1 
ATOM 722   H HB   . VAL A 1 49  ? 104.277 128.467 -25.798 1.00 0.00 ? 49  VAL A HB   1 
ATOM 723   H HG11 . VAL A 1 49  ? 103.255 126.674 -28.016 1.00 0.00 ? 49  VAL A HG11 1 
ATOM 724   H HG12 . VAL A 1 49  ? 103.163 126.351 -26.285 1.00 0.00 ? 49  VAL A HG12 1 
ATOM 725   H HG13 . VAL A 1 49  ? 104.732 126.395 -27.092 1.00 0.00 ? 49  VAL A HG13 1 
ATOM 726   H HG21 . VAL A 1 49  ? 105.789 128.773 -27.607 1.00 0.00 ? 49  VAL A HG21 1 
ATOM 727   H HG22 . VAL A 1 49  ? 104.593 130.047 -27.844 1.00 0.00 ? 49  VAL A HG22 1 
ATOM 728   H HG23 . VAL A 1 49  ? 104.518 128.583 -28.816 1.00 0.00 ? 49  VAL A HG23 1 
ATOM 729   N N    . HIS A 1 50  ? 102.158 130.293 -28.820 1.00 0.00 ? 50  HIS A N    1 
ATOM 730   C CA   . HIS A 1 50  ? 101.760 130.578 -30.204 1.00 0.00 ? 50  HIS A CA   1 
ATOM 731   C C    . HIS A 1 50  ? 102.770 131.524 -30.852 1.00 0.00 ? 50  HIS A C    1 
ATOM 732   O O    . HIS A 1 50  ? 102.958 132.648 -30.394 1.00 0.00 ? 50  HIS A O    1 
ATOM 733   C CB   . HIS A 1 50  ? 100.376 131.227 -30.229 1.00 0.00 ? 50  HIS A CB   1 
ATOM 734   C CG   . HIS A 1 50  ? 99.952  131.433 -31.657 1.00 0.00 ? 50  HIS A CG   1 
ATOM 735   N ND1  . HIS A 1 50  ? 99.051  130.591 -32.290 1.00 0.00 ? 50  HIS A ND1  1 
ATOM 736   C CD2  . HIS A 1 50  ? 100.309 132.371 -32.590 1.00 0.00 ? 50  HIS A CD2  1 
ATOM 737   C CE1  . HIS A 1 50  ? 98.899  131.038 -33.550 1.00 0.00 ? 50  HIS A CE1  1 
ATOM 738   N NE2  . HIS A 1 50  ? 99.645  132.122 -33.785 1.00 0.00 ? 50  HIS A NE2  1 
ATOM 739   H H    . HIS A 1 50  ? 102.587 131.000 -28.292 1.00 0.00 ? 50  HIS A H    1 
ATOM 740   H HA   . HIS A 1 50  ? 101.728 129.657 -30.769 1.00 0.00 ? 50  HIS A HA   1 
ATOM 741   H HB2  . HIS A 1 50  ? 99.665  130.585 -29.731 1.00 0.00 ? 50  HIS A HB2  1 
ATOM 742   H HB3  . HIS A 1 50  ? 100.415 132.182 -29.725 1.00 0.00 ? 50  HIS A HB3  1 
ATOM 743   H HD1  . HIS A 1 50  ? 98.606  129.815 -31.892 1.00 0.00 ? 50  HIS A HD1  1 
ATOM 744   H HD2  . HIS A 1 50  ? 101.009 133.175 -32.423 1.00 0.00 ? 50  HIS A HD2  1 
ATOM 745   H HE1  . HIS A 1 50  ? 98.251  130.578 -34.282 1.00 0.00 ? 50  HIS A HE1  1 
ATOM 746   N N    . GLY A 1 51  ? 103.423 131.063 -31.925 1.00 0.00 ? 51  GLY A N    1 
ATOM 747   C CA   . GLY A 1 51  ? 104.425 131.887 -32.630 1.00 0.00 ? 51  GLY A CA   1 
ATOM 748   C C    . GLY A 1 51  ? 104.094 132.006 -34.114 1.00 0.00 ? 51  GLY A C    1 
ATOM 749   O O    . GLY A 1 51  ? 103.773 131.016 -34.769 1.00 0.00 ? 51  GLY A O    1 
ATOM 750   H H    . GLY A 1 51  ? 103.236 130.157 -32.247 1.00 0.00 ? 51  GLY A H    1 
ATOM 751   H HA2  . GLY A 1 51  ? 104.462 132.879 -32.197 1.00 0.00 ? 51  GLY A HA2  1 
ATOM 752   H HA3  . GLY A 1 51  ? 105.395 131.424 -32.528 1.00 0.00 ? 51  GLY A HA3  1 
ATOM 753   N N    . VAL A 1 52  ? 104.187 133.234 -34.645 1.00 0.00 ? 52  VAL A N    1 
ATOM 754   C CA   . VAL A 1 52  ? 103.909 133.487 -36.071 1.00 0.00 ? 52  VAL A CA   1 
ATOM 755   C C    . VAL A 1 52  ? 105.059 134.268 -36.698 1.00 0.00 ? 52  VAL A C    1 
ATOM 756   O O    . VAL A 1 52  ? 105.440 135.331 -36.207 1.00 0.00 ? 52  VAL A O    1 
ATOM 757   C CB   . VAL A 1 52  ? 102.610 134.280 -36.222 1.00 0.00 ? 52  VAL A CB   1 
ATOM 758   C CG1  . VAL A 1 52  ? 102.344 134.543 -37.704 1.00 0.00 ? 52  VAL A CG1  1 
ATOM 759   C CG2  . VAL A 1 52  ? 101.452 133.471 -35.637 1.00 0.00 ? 52  VAL A CG2  1 
ATOM 760   H H    . VAL A 1 52  ? 104.456 133.982 -34.071 1.00 0.00 ? 52  VAL A H    1 
ATOM 761   H HA   . VAL A 1 52  ? 103.805 132.545 -36.597 1.00 0.00 ? 52  VAL A HA   1 
ATOM 762   H HB   . VAL A 1 52  ? 102.697 135.221 -35.698 1.00 0.00 ? 52  VAL A HB   1 
ATOM 763   H HG11 . VAL A 1 52  ? 103.055 135.266 -38.076 1.00 0.00 ? 52  VAL A HG11 1 
ATOM 764   H HG12 . VAL A 1 52  ? 101.342 134.927 -37.828 1.00 0.00 ? 52  VAL A HG12 1 
ATOM 765   H HG13 . VAL A 1 52  ? 102.446 133.621 -38.256 1.00 0.00 ? 52  VAL A HG13 1 
ATOM 766   H HG21 . VAL A 1 52  ? 100.573 134.095 -35.568 1.00 0.00 ? 52  VAL A HG21 1 
ATOM 767   H HG22 . VAL A 1 52  ? 101.722 133.119 -34.654 1.00 0.00 ? 52  VAL A HG22 1 
ATOM 768   H HG23 . VAL A 1 52  ? 101.244 132.626 -36.278 1.00 0.00 ? 52  VAL A HG23 1 
ATOM 769   N N    . ALA A 1 53  ? 105.611 133.728 -37.791 1.00 0.00 ? 53  ALA A N    1 
ATOM 770   C CA   . ALA A 1 53  ? 106.732 134.369 -38.497 1.00 0.00 ? 53  ALA A CA   1 
ATOM 771   C C    . ALA A 1 53  ? 106.440 134.460 -39.992 1.00 0.00 ? 53  ALA A C    1 
ATOM 772   O O    . ALA A 1 53  ? 106.114 133.458 -40.630 1.00 0.00 ? 53  ALA A O    1 
ATOM 773   C CB   . ALA A 1 53  ? 108.009 133.552 -38.283 1.00 0.00 ? 53  ALA A CB   1 
ATOM 774   H H    . ALA A 1 53  ? 105.260 132.877 -38.129 1.00 0.00 ? 53  ALA A H    1 
ATOM 775   H HA   . ALA A 1 53  ? 106.888 135.365 -38.110 1.00 0.00 ? 53  ALA A HA   1 
ATOM 776   H HB1  . ALA A 1 53  ? 108.776 133.897 -38.962 1.00 0.00 ? 53  ALA A HB1  1 
ATOM 777   H HB2  . ALA A 1 53  ? 107.805 132.508 -38.474 1.00 0.00 ? 53  ALA A HB2  1 
ATOM 778   H HB3  . ALA A 1 53  ? 108.347 133.673 -37.267 1.00 0.00 ? 53  ALA A HB3  1 
ATOM 779   N N    . THR A 1 54  ? 106.570 135.669 -40.553 1.00 0.00 ? 54  THR A N    1 
ATOM 780   C CA   . THR A 1 54  ? 106.328 135.886 -41.992 1.00 0.00 ? 54  THR A CA   1 
ATOM 781   C C    . THR A 1 54  ? 107.521 136.593 -42.629 1.00 0.00 ? 54  THR A C    1 
ATOM 782   O O    . THR A 1 54  ? 107.947 137.650 -42.164 1.00 0.00 ? 54  THR A O    1 
ATOM 783   C CB   . THR A 1 54  ? 105.067 136.729 -42.191 1.00 0.00 ? 54  THR A CB   1 
ATOM 784   O OG1  . THR A 1 54  ? 103.956 136.059 -41.610 1.00 0.00 ? 54  THR A OG1  1 
ATOM 785   C CG2  . THR A 1 54  ? 104.816 136.931 -43.686 1.00 0.00 ? 54  THR A CG2  1 
ATOM 786   H H    . THR A 1 54  ? 106.840 136.428 -39.996 1.00 0.00 ? 54  THR A H    1 
ATOM 787   H HA   . THR A 1 54  ? 106.188 134.931 -42.489 1.00 0.00 ? 54  THR A HA   1 
ATOM 788   H HB   . THR A 1 54  ? 105.197 137.691 -41.719 1.00 0.00 ? 54  THR A HB   1 
ATOM 789   H HG1  . THR A 1 54  ? 104.120 135.114 -41.659 1.00 0.00 ? 54  THR A HG1  1 
ATOM 790   H HG21 . THR A 1 54  ? 104.863 135.976 -44.191 1.00 0.00 ? 54  THR A HG21 1 
ATOM 791   H HG22 . THR A 1 54  ? 105.569 137.589 -44.092 1.00 0.00 ? 54  THR A HG22 1 
ATOM 792   H HG23 . THR A 1 54  ? 103.839 137.367 -43.832 1.00 0.00 ? 54  THR A HG23 1 
ATOM 793   N N    . VAL A 1 55  ? 108.051 135.997 -43.704 1.00 0.00 ? 55  VAL A N    1 
ATOM 794   C CA   . VAL A 1 55  ? 109.203 136.560 -44.430 1.00 0.00 ? 55  VAL A CA   1 
ATOM 795   C C    . VAL A 1 55  ? 108.888 136.648 -45.922 1.00 0.00 ? 55  VAL A C    1 
ATOM 796   O O    . VAL A 1 55  ? 108.540 135.645 -46.546 1.00 0.00 ? 55  VAL A O    1 
ATOM 797   C CB   . VAL A 1 55  ? 110.423 135.658 -44.227 1.00 0.00 ? 55  VAL A CB   1 
ATOM 798   C CG1  . VAL A 1 55  ? 111.614 136.228 -44.997 1.00 0.00 ? 55  VAL A CG1  1 
ATOM 799   C CG2  . VAL A 1 55  ? 110.764 135.587 -42.737 1.00 0.00 ? 55  VAL A CG2  1 
ATOM 800   H H    . VAL A 1 55  ? 107.657 135.157 -44.020 1.00 0.00 ? 55  VAL A H    1 
ATOM 801   H HA   . VAL A 1 55  ? 109.430 137.550 -44.055 1.00 0.00 ? 55  VAL A HA   1 
ATOM 802   H HB   . VAL A 1 55  ? 110.200 134.666 -44.595 1.00 0.00 ? 55  VAL A HB   1 
ATOM 803   H HG11 . VAL A 1 55  ? 111.461 136.080 -46.056 1.00 0.00 ? 55  VAL A HG11 1 
ATOM 804   H HG12 . VAL A 1 55  ? 112.516 135.721 -44.689 1.00 0.00 ? 55  VAL A HG12 1 
ATOM 805   H HG13 . VAL A 1 55  ? 111.705 137.284 -44.790 1.00 0.00 ? 55  VAL A HG13 1 
ATOM 806   H HG21 . VAL A 1 55  ? 111.523 134.834 -42.578 1.00 0.00 ? 55  VAL A HG21 1 
ATOM 807   H HG22 . VAL A 1 55  ? 109.878 135.328 -42.177 1.00 0.00 ? 55  VAL A HG22 1 
ATOM 808   H HG23 . VAL A 1 55  ? 111.134 136.546 -42.406 1.00 0.00 ? 55  VAL A HG23 1 
ATOM 809   N N    . ALA A 1 56  ? 109.010 137.848 -46.497 1.00 0.00 ? 56  ALA A N    1 
ATOM 810   C CA   . ALA A 1 56  ? 108.727 138.038 -47.929 1.00 0.00 ? 56  ALA A CA   1 
ATOM 811   C C    . ALA A 1 56  ? 109.999 137.879 -48.766 1.00 0.00 ? 56  ALA A C    1 
ATOM 812   O O    . ALA A 1 56  ? 110.191 136.859 -49.427 1.00 0.00 ? 56  ALA A O    1 
ATOM 813   C CB   . ALA A 1 56  ? 108.130 139.429 -48.158 1.00 0.00 ? 56  ALA A CB   1 
ATOM 814   H H    . ALA A 1 56  ? 109.290 138.616 -45.955 1.00 0.00 ? 56  ALA A H    1 
ATOM 815   H HA   . ALA A 1 56  ? 108.005 137.299 -48.252 1.00 0.00 ? 56  ALA A HA   1 
ATOM 816   H HB1  . ALA A 1 56  ? 108.793 140.175 -47.756 1.00 0.00 ? 56  ALA A HB1  1 
ATOM 817   H HB2  . ALA A 1 56  ? 107.173 139.495 -47.661 1.00 0.00 ? 56  ALA A HB2  1 
ATOM 818   H HB3  . ALA A 1 56  ? 107.998 139.596 -49.217 1.00 0.00 ? 56  ALA A HB3  1 
ATOM 819   N N    . GLU A 1 57  ? 110.862 138.892 -48.737 1.00 0.00 ? 57  GLU A N    1 
ATOM 820   C CA   . GLU A 1 57  ? 112.107 138.845 -49.507 1.00 0.00 ? 57  GLU A CA   1 
ATOM 821   C C    . GLU A 1 57  ? 112.943 137.622 -49.092 1.00 0.00 ? 57  GLU A C    1 
ATOM 822   O O    . GLU A 1 57  ? 112.429 136.691 -48.472 1.00 0.00 ? 57  GLU A O    1 
ATOM 823   C CB   . GLU A 1 57  ? 112.909 140.160 -49.279 1.00 0.00 ? 57  GLU A CB   1 
ATOM 824   C CG   . GLU A 1 57  ? 113.628 140.602 -50.567 1.00 0.00 ? 57  GLU A CG   1 
ATOM 825   C CD   . GLU A 1 57  ? 112.627 141.219 -51.542 1.00 0.00 ? 57  GLU A CD   1 
ATOM 826   O OE1  . GLU A 1 57  ? 111.478 141.375 -51.163 1.00 0.00 ? 57  GLU A OE1  1 
ATOM 827   O OE2  . GLU A 1 57  ? 113.027 141.527 -52.653 1.00 0.00 ? 57  GLU A OE2  1 
ATOM 828   H H    . GLU A 1 57  ? 110.658 139.683 -48.197 1.00 0.00 ? 57  GLU A H    1 
ATOM 829   H HA   . GLU A 1 57  ? 111.857 138.755 -50.556 1.00 0.00 ? 57  GLU A HA   1 
ATOM 830   H HB2  . GLU A 1 57  ? 112.229 140.937 -48.975 1.00 0.00 ? 57  GLU A HB2  1 
ATOM 831   H HB3  . GLU A 1 57  ? 113.643 140.011 -48.498 1.00 0.00 ? 57  GLU A HB3  1 
ATOM 832   H HG2  . GLU A 1 57  ? 114.384 141.333 -50.321 1.00 0.00 ? 57  GLU A HG2  1 
ATOM 833   H HG3  . GLU A 1 57  ? 114.095 139.748 -51.029 1.00 0.00 ? 57  GLU A HG3  1 
ATOM 834   N N    . LYS A 1 58  ? 114.235 137.642 -49.440 1.00 0.00 ? 58  LYS A N    1 
ATOM 835   C CA   . LYS A 1 58  ? 115.152 136.538 -49.105 1.00 0.00 ? 58  LYS A CA   1 
ATOM 836   C C    . LYS A 1 58  ? 116.052 136.927 -47.937 1.00 0.00 ? 58  LYS A C    1 
ATOM 837   O O    . LYS A 1 58  ? 116.243 138.105 -47.664 1.00 0.00 ? 58  LYS A O    1 
ATOM 838   C CB   . LYS A 1 58  ? 116.023 136.198 -50.322 1.00 0.00 ? 58  LYS A CB   1 
ATOM 839   C CG   . LYS A 1 58  ? 116.576 137.485 -50.939 1.00 0.00 ? 58  LYS A CG   1 
ATOM 840   C CD   . LYS A 1 58  ? 117.446 137.138 -52.147 1.00 0.00 ? 58  LYS A CD   1 
ATOM 841   C CE   . LYS A 1 58  ? 117.984 138.422 -52.775 1.00 0.00 ? 58  LYS A CE   1 
ATOM 842   N NZ   . LYS A 1 58  ? 118.843 138.082 -53.943 1.00 0.00 ? 58  LYS A NZ   1 
ATOM 843   H H    . LYS A 1 58  ? 114.581 138.413 -49.929 1.00 0.00 ? 58  LYS A H    1 
ATOM 844   H HA   . LYS A 1 58  ? 114.583 135.659 -48.830 1.00 0.00 ? 58  LYS A HA   1 
ATOM 845   H HB2  . LYS A 1 58  ? 116.845 135.566 -50.013 1.00 0.00 ? 58  LYS A HB2  1 
ATOM 846   H HB3  . LYS A 1 58  ? 115.427 135.678 -51.057 1.00 0.00 ? 58  LYS A HB3  1 
ATOM 847   H HG2  . LYS A 1 58  ? 115.757 138.112 -51.257 1.00 0.00 ? 58  LYS A HG2  1 
ATOM 848   H HG3  . LYS A 1 58  ? 117.172 138.010 -50.208 1.00 0.00 ? 58  LYS A HG3  1 
ATOM 849   H HD2  . LYS A 1 58  ? 118.273 136.517 -51.829 1.00 0.00 ? 58  LYS A HD2  1 
ATOM 850   H HD3  . LYS A 1 58  ? 116.855 136.603 -52.876 1.00 0.00 ? 58  LYS A HD3  1 
ATOM 851   H HE2  . LYS A 1 58  ? 117.159 139.036 -53.102 1.00 0.00 ? 58  LYS A HE2  1 
ATOM 852   H HE3  . LYS A 1 58  ? 118.568 138.964 -52.044 1.00 0.00 ? 58  LYS A HE3  1 
ATOM 853   H HZ1  . LYS A 1 58  ? 119.664 138.719 -53.969 1.00 0.00 ? 58  LYS A HZ1  1 
ATOM 854   H HZ2  . LYS A 1 58  ? 118.292 138.188 -54.820 1.00 0.00 ? 58  LYS A HZ2  1 
ATOM 855   H HZ3  . LYS A 1 58  ? 119.173 137.100 -53.857 1.00 0.00 ? 58  LYS A HZ3  1 
ATOM 856   N N    . THR A 1 59  ? 116.604 135.928 -47.252 1.00 0.00 ? 59  THR A N    1 
ATOM 857   C CA   . THR A 1 59  ? 117.491 136.193 -46.120 1.00 0.00 ? 59  THR A CA   1 
ATOM 858   C C    . THR A 1 59  ? 118.899 136.505 -46.619 1.00 0.00 ? 59  THR A C    1 
ATOM 859   O O    . THR A 1 59  ? 119.591 137.354 -46.058 1.00 0.00 ? 59  THR A O    1 
ATOM 860   C CB   . THR A 1 59  ? 117.538 134.976 -45.191 1.00 0.00 ? 59  THR A CB   1 
ATOM 861   O OG1  . THR A 1 59  ? 118.029 133.852 -45.910 1.00 0.00 ? 59  THR A OG1  1 
ATOM 862   C CG2  . THR A 1 59  ? 116.135 134.674 -44.664 1.00 0.00 ? 59  THR A CG2  1 
ATOM 863   H H    . THR A 1 59  ? 116.419 135.003 -47.514 1.00 0.00 ? 59  THR A H    1 
ATOM 864   H HA   . THR A 1 59  ? 117.115 137.042 -45.566 1.00 0.00 ? 59  THR A HA   1 
ATOM 865   H HB   . THR A 1 59  ? 118.193 135.185 -44.360 1.00 0.00 ? 59  THR A HB   1 
ATOM 866   H HG1  . THR A 1 59  ? 117.602 133.067 -45.561 1.00 0.00 ? 59  THR A HG1  1 
ATOM 867   H HG21 . THR A 1 59  ? 116.189 133.877 -43.938 1.00 0.00 ? 59  THR A HG21 1 
ATOM 868   H HG22 . THR A 1 59  ? 115.500 134.372 -45.484 1.00 0.00 ? 59  THR A HG22 1 
ATOM 869   H HG23 . THR A 1 59  ? 115.727 135.559 -44.199 1.00 0.00 ? 59  THR A HG23 1 
ATOM 870   N N    . LYS A 1 60  ? 119.305 135.806 -47.684 1.00 0.00 ? 60  LYS A N    1 
ATOM 871   C CA   . LYS A 1 60  ? 120.630 135.997 -48.276 1.00 0.00 ? 60  LYS A CA   1 
ATOM 872   C C    . LYS A 1 60  ? 121.720 135.398 -47.370 1.00 0.00 ? 60  LYS A C    1 
ATOM 873   O O    . LYS A 1 60  ? 122.519 136.126 -46.791 1.00 0.00 ? 60  LYS A O    1 
ATOM 874   C CB   . LYS A 1 60  ? 120.898 137.499 -48.485 1.00 0.00 ? 60  LYS A CB   1 
ATOM 875   C CG   . LYS A 1 60  ? 121.931 137.712 -49.607 1.00 0.00 ? 60  LYS A CG   1 
ATOM 876   C CD   . LYS A 1 60  ? 122.204 139.211 -49.784 1.00 0.00 ? 60  LYS A CD   1 
ATOM 877   C CE   . LYS A 1 60  ? 123.001 139.435 -51.073 1.00 0.00 ? 60  LYS A CE   1 
ATOM 878   N NZ   . LYS A 1 60  ? 122.140 139.123 -52.251 1.00 0.00 ? 60  LYS A NZ   1 
ATOM 879   H H    . LYS A 1 60  ? 118.698 135.148 -48.080 1.00 0.00 ? 60  LYS A H    1 
ATOM 880   H HA   . LYS A 1 60  ? 120.654 135.498 -49.233 1.00 0.00 ? 60  LYS A HA   1 
ATOM 881   H HB2  . LYS A 1 60  ? 119.977 137.997 -48.747 1.00 0.00 ? 60  LYS A HB2  1 
ATOM 882   H HB3  . LYS A 1 60  ? 121.277 137.913 -47.579 1.00 0.00 ? 60  LYS A HB3  1 
ATOM 883   H HG2  . LYS A 1 60  ? 122.850 137.209 -49.347 1.00 0.00 ? 60  LYS A HG2  1 
ATOM 884   H HG3  . LYS A 1 60  ? 121.547 137.308 -50.529 1.00 0.00 ? 60  LYS A HG3  1 
ATOM 885   H HD2  . LYS A 1 60  ? 121.267 139.747 -49.840 1.00 0.00 ? 60  LYS A HD2  1 
ATOM 886   H HD3  . LYS A 1 60  ? 122.779 139.575 -48.946 1.00 0.00 ? 60  LYS A HD3  1 
ATOM 887   H HE2  . LYS A 1 60  ? 123.322 140.465 -51.124 1.00 0.00 ? 60  LYS A HE2  1 
ATOM 888   H HE3  . LYS A 1 60  ? 123.866 138.787 -51.078 1.00 0.00 ? 60  LYS A HE3  1 
ATOM 889   H HZ1  . LYS A 1 60  ? 122.659 138.504 -52.905 1.00 0.00 ? 60  LYS A HZ1  1 
ATOM 890   H HZ2  . LYS A 1 60  ? 121.885 140.008 -52.738 1.00 0.00 ? 60  LYS A HZ2  1 
ATOM 891   H HZ3  . LYS A 1 60  ? 121.277 138.641 -51.932 1.00 0.00 ? 60  LYS A HZ3  1 
ATOM 892   N N    . GLU A 1 61  ? 121.746 134.072 -47.246 1.00 0.00 ? 61  GLU A N    1 
ATOM 893   C CA   . GLU A 1 61  ? 122.754 133.403 -46.402 1.00 0.00 ? 61  GLU A CA   1 
ATOM 894   C C    . GLU A 1 61  ? 123.899 132.869 -47.261 1.00 0.00 ? 61  GLU A C    1 
ATOM 895   O O    . GLU A 1 61  ? 123.911 131.696 -47.634 1.00 0.00 ? 61  GLU A O    1 
ATOM 896   C CB   . GLU A 1 61  ? 122.099 132.250 -45.636 1.00 0.00 ? 61  GLU A CB   1 
ATOM 897   C CG   . GLU A 1 61  ? 121.196 132.820 -44.540 1.00 0.00 ? 61  GLU A CG   1 
ATOM 898   C CD   . GLU A 1 61  ? 120.350 131.712 -43.920 1.00 0.00 ? 61  GLU A CD   1 
ATOM 899   O OE1  . GLU A 1 61  ? 120.252 130.659 -44.526 1.00 0.00 ? 61  GLU A OE1  1 
ATOM 900   O OE2  . GLU A 1 61  ? 119.812 131.936 -42.847 1.00 0.00 ? 61  GLU A OE2  1 
ATOM 901   H H    . GLU A 1 61  ? 121.085 133.531 -47.726 1.00 0.00 ? 61  GLU A H    1 
ATOM 902   H HA   . GLU A 1 61  ? 123.157 134.110 -45.684 1.00 0.00 ? 61  GLU A HA   1 
ATOM 903   H HB2  . GLU A 1 61  ? 121.510 131.651 -46.317 1.00 0.00 ? 61  GLU A HB2  1 
ATOM 904   H HB3  . GLU A 1 61  ? 122.864 131.634 -45.184 1.00 0.00 ? 61  GLU A HB3  1 
ATOM 905   H HG2  . GLU A 1 61  ? 121.808 133.271 -43.775 1.00 0.00 ? 61  GLU A HG2  1 
ATOM 906   H HG3  . GLU A 1 61  ? 120.544 133.569 -44.966 1.00 0.00 ? 61  GLU A HG3  1 
ATOM 907   N N    . GLN A 1 62  ? 124.863 133.741 -47.574 1.00 0.00 ? 62  GLN A N    1 
ATOM 908   C CA   . GLN A 1 62  ? 126.001 133.338 -48.398 1.00 0.00 ? 62  GLN A CA   1 
ATOM 909   C C    . GLN A 1 62  ? 126.969 132.470 -47.597 1.00 0.00 ? 62  GLN A C    1 
ATOM 910   O O    . GLN A 1 62  ? 126.935 131.243 -47.692 1.00 0.00 ? 62  GLN A O    1 
ATOM 911   C CB   . GLN A 1 62  ? 126.746 134.571 -48.917 1.00 0.00 ? 62  GLN A CB   1 
ATOM 912   C CG   . GLN A 1 62  ? 125.884 135.309 -49.943 1.00 0.00 ? 62  GLN A CG   1 
ATOM 913   C CD   . GLN A 1 62  ? 126.544 136.636 -50.312 1.00 0.00 ? 62  GLN A CD   1 
ATOM 914   O OE1  . GLN A 1 62  ? 127.313 137.187 -49.524 1.00 0.00 ? 62  GLN A OE1  1 
ATOM 915   N NE2  . GLN A 1 62  ? 126.288 137.187 -51.467 1.00 0.00 ? 62  GLN A NE2  1 
ATOM 916   H H    . GLN A 1 62  ? 124.802 134.665 -47.251 1.00 0.00 ? 62  GLN A H    1 
ATOM 917   H HA   . GLN A 1 62  ? 125.638 132.770 -49.242 1.00 0.00 ? 62  GLN A HA   1 
ATOM 918   H HB2  . GLN A 1 62  ? 126.964 135.229 -48.093 1.00 0.00 ? 62  GLN A HB2  1 
ATOM 919   H HB3  . GLN A 1 62  ? 127.668 134.262 -49.382 1.00 0.00 ? 62  GLN A HB3  1 
ATOM 920   H HG2  . GLN A 1 62  ? 125.782 134.700 -50.830 1.00 0.00 ? 62  GLN A HG2  1 
ATOM 921   H HG3  . GLN A 1 62  ? 124.908 135.500 -49.523 1.00 0.00 ? 62  GLN A HG3  1 
ATOM 922   H HE21 . GLN A 1 62  ? 125.675 136.749 -52.094 1.00 0.00 ? 62  GLN A HE21 1 
ATOM 923   H HE22 . GLN A 1 62  ? 126.708 138.038 -51.707 1.00 0.00 ? 62  GLN A HE22 1 
ATOM 924   N N    . VAL A 1 63  ? 127.842 133.114 -46.800 1.00 0.00 ? 63  VAL A N    1 
ATOM 925   C CA   . VAL A 1 63  ? 128.828 132.379 -45.982 1.00 0.00 ? 63  VAL A CA   1 
ATOM 926   C C    . VAL A 1 63  ? 128.609 132.646 -44.493 1.00 0.00 ? 63  VAL A C    1 
ATOM 927   O O    . VAL A 1 63  ? 128.660 133.781 -44.039 1.00 0.00 ? 63  VAL A O    1 
ATOM 928   C CB   . VAL A 1 63  ? 130.248 132.796 -46.377 1.00 0.00 ? 63  VAL A CB   1 
ATOM 929   C CG1  . VAL A 1 63  ? 131.260 132.024 -45.528 1.00 0.00 ? 63  VAL A CG1  1 
ATOM 930   C CG2  . VAL A 1 63  ? 130.482 132.476 -47.858 1.00 0.00 ? 63  VAL A CG2  1 
ATOM 931   H H    . VAL A 1 63  ? 127.824 134.092 -46.764 1.00 0.00 ? 63  VAL A H    1 
ATOM 932   H HA   . VAL A 1 63  ? 128.725 131.312 -46.157 1.00 0.00 ? 63  VAL A HA   1 
ATOM 933   H HB   . VAL A 1 63  ? 130.373 133.856 -46.211 1.00 0.00 ? 63  VAL A HB   1 
ATOM 934   H HG11 . VAL A 1 63  ? 131.002 130.975 -45.528 1.00 0.00 ? 63  VAL A HG11 1 
ATOM 935   H HG12 . VAL A 1 63  ? 131.242 132.399 -44.516 1.00 0.00 ? 63  VAL A HG12 1 
ATOM 936   H HG13 . VAL A 1 63  ? 132.249 132.151 -45.942 1.00 0.00 ? 63  VAL A HG13 1 
ATOM 937   H HG21 . VAL A 1 63  ? 129.672 132.880 -48.446 1.00 0.00 ? 63  VAL A HG21 1 
ATOM 938   H HG22 . VAL A 1 63  ? 130.524 131.405 -47.992 1.00 0.00 ? 63  VAL A HG22 1 
ATOM 939   H HG23 . VAL A 1 63  ? 131.416 132.914 -48.178 1.00 0.00 ? 63  VAL A HG23 1 
ATOM 940   N N    . THR A 1 64  ? 128.367 131.574 -43.735 1.00 0.00 ? 64  THR A N    1 
ATOM 941   C CA   . THR A 1 64  ? 128.140 131.675 -42.284 1.00 0.00 ? 64  THR A CA   1 
ATOM 942   C C    . THR A 1 64  ? 129.127 130.783 -41.535 1.00 0.00 ? 64  THR A C    1 
ATOM 943   O O    . THR A 1 64  ? 129.230 129.589 -41.819 1.00 0.00 ? 64  THR A O    1 
ATOM 944   C CB   . THR A 1 64  ? 126.711 131.229 -41.958 1.00 0.00 ? 64  THR A CB   1 
ATOM 945   O OG1  . THR A 1 64  ? 125.786 132.061 -42.647 1.00 0.00 ? 64  THR A OG1  1 
ATOM 946   C CG2  . THR A 1 64  ? 126.471 131.333 -40.453 1.00 0.00 ? 64  THR A CG2  1 
ATOM 947   H H    . THR A 1 64  ? 128.341 130.690 -44.160 1.00 0.00 ? 64  THR A H    1 
ATOM 948   H HA   . THR A 1 64  ? 128.273 132.699 -41.957 1.00 0.00 ? 64  THR A HA   1 
ATOM 949   H HB   . THR A 1 64  ? 126.574 130.204 -42.269 1.00 0.00 ? 64  THR A HB   1 
ATOM 950   H HG1  . THR A 1 64  ? 125.932 132.965 -42.362 1.00 0.00 ? 64  THR A HG1  1 
ATOM 951   H HG21 . THR A 1 64  ? 126.841 132.283 -40.095 1.00 0.00 ? 64  THR A HG21 1 
ATOM 952   H HG22 . THR A 1 64  ? 126.991 130.531 -39.950 1.00 0.00 ? 64  THR A HG22 1 
ATOM 953   H HG23 . THR A 1 64  ? 125.413 131.260 -40.251 1.00 0.00 ? 64  THR A HG23 1 
ATOM 954   N N    . ASN A 1 65  ? 129.851 131.365 -40.569 1.00 0.00 ? 65  ASN A N    1 
ATOM 955   C CA   . ASN A 1 65  ? 130.832 130.605 -39.774 1.00 0.00 ? 65  ASN A CA   1 
ATOM 956   C C    . ASN A 1 65  ? 130.626 130.863 -38.280 1.00 0.00 ? 65  ASN A C    1 
ATOM 957   O O    . ASN A 1 65  ? 130.793 131.983 -37.804 1.00 0.00 ? 65  ASN A O    1 
ATOM 958   C CB   . ASN A 1 65  ? 132.250 131.010 -40.178 1.00 0.00 ? 65  ASN A CB   1 
ATOM 959   C CG   . ASN A 1 65  ? 132.473 130.717 -41.662 1.00 0.00 ? 65  ASN A CG   1 
ATOM 960   O OD1  . ASN A 1 65  ? 132.074 129.662 -42.153 1.00 0.00 ? 65  ASN A OD1  1 
ATOM 961   N ND2  . ASN A 1 65  ? 133.092 131.594 -42.406 1.00 0.00 ? 65  ASN A ND2  1 
ATOM 962   H H    . ASN A 1 65  ? 129.722 132.318 -40.384 1.00 0.00 ? 65  ASN A H    1 
ATOM 963   H HA   . ASN A 1 65  ? 130.710 129.543 -39.960 1.00 0.00 ? 65  ASN A HA   1 
ATOM 964   H HB2  . ASN A 1 65  ? 132.386 132.064 -39.997 1.00 0.00 ? 65  ASN A HB2  1 
ATOM 965   H HB3  . ASN A 1 65  ? 132.964 130.450 -39.593 1.00 0.00 ? 65  ASN A HB3  1 
ATOM 966   H HD21 . ASN A 1 65  ? 133.409 132.433 -42.013 1.00 0.00 ? 65  ASN A HD21 1 
ATOM 967   H HD22 . ASN A 1 65  ? 133.239 131.412 -43.358 1.00 0.00 ? 65  ASN A HD22 1 
ATOM 968   N N    . VAL A 1 66  ? 130.257 129.807 -37.546 1.00 0.00 ? 66  VAL A N    1 
ATOM 969   C CA   . VAL A 1 66  ? 130.020 129.909 -36.095 1.00 0.00 ? 66  VAL A CA   1 
ATOM 970   C C    . VAL A 1 66  ? 130.726 128.781 -35.348 1.00 0.00 ? 66  VAL A C    1 
ATOM 971   O O    . VAL A 1 66  ? 130.599 127.610 -35.712 1.00 0.00 ? 66  VAL A O    1 
ATOM 972   C CB   . VAL A 1 66  ? 128.524 129.837 -35.813 1.00 0.00 ? 66  VAL A CB   1 
ATOM 973   C CG1  . VAL A 1 66  ? 128.290 129.903 -34.302 1.00 0.00 ? 66  VAL A CG1  1 
ATOM 974   C CG2  . VAL A 1 66  ? 127.826 131.016 -36.497 1.00 0.00 ? 66  VAL A CG2  1 
ATOM 975   H H    . VAL A 1 66  ? 130.139 128.939 -37.987 1.00 0.00 ? 66  VAL A H    1 
ATOM 976   H HA   . VAL A 1 66  ? 130.398 130.856 -35.729 1.00 0.00 ? 66  VAL A HA   1 
ATOM 977   H HB   . VAL A 1 66  ? 128.128 128.907 -36.200 1.00 0.00 ? 66  VAL A HB   1 
ATOM 978   H HG11 . VAL A 1 66  ? 128.865 130.715 -33.884 1.00 0.00 ? 66  VAL A HG11 1 
ATOM 979   H HG12 . VAL A 1 66  ? 128.600 128.972 -33.849 1.00 0.00 ? 66  VAL A HG12 1 
ATOM 980   H HG13 . VAL A 1 66  ? 127.245 130.063 -34.106 1.00 0.00 ? 66  VAL A HG13 1 
ATOM 981   H HG21 . VAL A 1 66  ? 128.072 131.017 -37.548 1.00 0.00 ? 66  VAL A HG21 1 
ATOM 982   H HG22 . VAL A 1 66  ? 128.158 131.940 -36.048 1.00 0.00 ? 66  VAL A HG22 1 
ATOM 983   H HG23 . VAL A 1 66  ? 126.760 130.921 -36.379 1.00 0.00 ? 66  VAL A HG23 1 
ATOM 984   N N    . GLY A 1 67  ? 131.462 129.136 -34.299 1.00 0.00 ? 67  GLY A N    1 
ATOM 985   C CA   . GLY A 1 67  ? 132.175 128.139 -33.506 1.00 0.00 ? 67  GLY A CA   1 
ATOM 986   C C    . GLY A 1 67  ? 131.229 127.417 -32.545 1.00 0.00 ? 67  GLY A C    1 
ATOM 987   O O    . GLY A 1 67  ? 131.100 126.192 -32.591 1.00 0.00 ? 67  GLY A O    1 
ATOM 988   H H    . GLY A 1 67  ? 131.522 130.082 -34.050 1.00 0.00 ? 67  GLY A H    1 
ATOM 989   H HA2  . GLY A 1 67  ? 132.626 127.416 -34.170 1.00 0.00 ? 67  GLY A HA2  1 
ATOM 990   H HA3  . GLY A 1 67  ? 132.949 128.628 -32.935 1.00 0.00 ? 67  GLY A HA3  1 
ATOM 991   N N    . GLY A 1 68  ? 130.571 128.182 -31.672 1.00 0.00 ? 68  GLY A N    1 
ATOM 992   C CA   . GLY A 1 68  ? 129.647 127.597 -30.701 1.00 0.00 ? 68  GLY A CA   1 
ATOM 993   C C    . GLY A 1 68  ? 128.345 127.156 -31.368 1.00 0.00 ? 68  GLY A C    1 
ATOM 994   O O    . GLY A 1 68  ? 128.314 126.153 -32.082 1.00 0.00 ? 68  GLY A O    1 
ATOM 995   H H    . GLY A 1 68  ? 130.717 129.151 -31.674 1.00 0.00 ? 68  GLY A H    1 
ATOM 996   H HA2  . GLY A 1 68  ? 130.116 126.738 -30.241 1.00 0.00 ? 68  GLY A HA2  1 
ATOM 997   H HA3  . GLY A 1 68  ? 129.422 128.326 -29.940 1.00 0.00 ? 68  GLY A HA3  1 
ATOM 998   N N    . ALA A 1 69  ? 127.265 127.905 -31.123 1.00 0.00 ? 69  ALA A N    1 
ATOM 999   C CA   . ALA A 1 69  ? 125.951 127.574 -31.699 1.00 0.00 ? 69  ALA A CA   1 
ATOM 1000  C C    . ALA A 1 69  ? 125.225 128.838 -32.147 1.00 0.00 ? 69  ALA A C    1 
ATOM 1001  O O    . ALA A 1 69  ? 125.468 129.927 -31.625 1.00 0.00 ? 69  ALA A O    1 
ATOM 1002  C CB   . ALA A 1 69  ? 125.098 126.841 -30.663 1.00 0.00 ? 69  ALA A CB   1 
ATOM 1003  H H    . ALA A 1 69  ? 127.349 128.687 -30.540 1.00 0.00 ? 69  ALA A H    1 
ATOM 1004  H HA   . ALA A 1 69  ? 126.081 126.929 -32.560 1.00 0.00 ? 69  ALA A HA   1 
ATOM 1005  H HB1  . ALA A 1 69  ? 124.944 127.478 -29.806 1.00 0.00 ? 69  ALA A HB1  1 
ATOM 1006  H HB2  . ALA A 1 69  ? 125.604 125.938 -30.353 1.00 0.00 ? 69  ALA A HB2  1 
ATOM 1007  H HB3  . ALA A 1 69  ? 124.142 126.586 -31.098 1.00 0.00 ? 69  ALA A HB3  1 
ATOM 1008  N N    . VAL A 1 70  ? 124.324 128.684 -33.126 1.00 0.00 ? 70  VAL A N    1 
ATOM 1009  C CA   . VAL A 1 70  ? 123.554 129.820 -33.655 1.00 0.00 ? 70  VAL A CA   1 
ATOM 1010  C C    . VAL A 1 70  ? 122.103 129.424 -33.919 1.00 0.00 ? 70  VAL A C    1 
ATOM 1011  O O    . VAL A 1 70  ? 121.827 128.408 -34.555 1.00 0.00 ? 70  VAL A O    1 
ATOM 1012  C CB   . VAL A 1 70  ? 124.208 130.327 -34.955 1.00 0.00 ? 70  VAL A CB   1 
ATOM 1013  C CG1  . VAL A 1 70  ? 124.511 129.138 -35.875 1.00 0.00 ? 70  VAL A CG1  1 
ATOM 1014  C CG2  . VAL A 1 70  ? 123.270 131.324 -35.680 1.00 0.00 ? 70  VAL A CG2  1 
ATOM 1015  H H    . VAL A 1 70  ? 124.175 127.790 -33.501 1.00 0.00 ? 70  VAL A H    1 
ATOM 1016  H HA   . VAL A 1 70  ? 123.562 130.618 -32.933 1.00 0.00 ? 70  VAL A HA   1 
ATOM 1017  H HB   . VAL A 1 70  ? 125.131 130.824 -34.708 1.00 0.00 ? 70  VAL A HB   1 
ATOM 1018  H HG11 . VAL A 1 70  ? 125.206 128.471 -35.386 1.00 0.00 ? 70  VAL A HG11 1 
ATOM 1019  H HG12 . VAL A 1 70  ? 124.945 129.496 -36.796 1.00 0.00 ? 70  VAL A HG12 1 
ATOM 1020  H HG13 . VAL A 1 70  ? 123.597 128.608 -36.093 1.00 0.00 ? 70  VAL A HG13 1 
ATOM 1021  H HG21 . VAL A 1 70  ? 122.741 131.922 -34.951 1.00 0.00 ? 70  VAL A HG21 1 
ATOM 1022  H HG22 . VAL A 1 70  ? 122.553 130.780 -36.281 1.00 0.00 ? 70  VAL A HG22 1 
ATOM 1023  H HG23 . VAL A 1 70  ? 123.855 131.969 -36.317 1.00 0.00 ? 70  VAL A HG23 1 
ATOM 1024  N N    . VAL A 1 71  ? 121.176 130.257 -33.434 1.00 0.00 ? 71  VAL A N    1 
ATOM 1025  C CA   . VAL A 1 71  ? 119.736 130.015 -33.624 1.00 0.00 ? 71  VAL A CA   1 
ATOM 1026  C C    . VAL A 1 71  ? 119.076 131.253 -34.223 1.00 0.00 ? 71  VAL A C    1 
ATOM 1027  O O    . VAL A 1 71  ? 119.166 132.345 -33.667 1.00 0.00 ? 71  VAL A O    1 
ATOM 1028  C CB   . VAL A 1 71  ? 119.084 129.684 -32.282 1.00 0.00 ? 71  VAL A CB   1 
ATOM 1029  C CG1  . VAL A 1 71  ? 117.590 129.427 -32.484 1.00 0.00 ? 71  VAL A CG1  1 
ATOM 1030  C CG2  . VAL A 1 71  ? 119.739 128.433 -31.696 1.00 0.00 ? 71  VAL A CG2  1 
ATOM 1031  H H    . VAL A 1 71  ? 121.466 131.060 -32.946 1.00 0.00 ? 71  VAL A H    1 
ATOM 1032  H HA   . VAL A 1 71  ? 119.589 129.180 -34.300 1.00 0.00 ? 71  VAL A HA   1 
ATOM 1033  H HB   . VAL A 1 71  ? 119.216 130.514 -31.602 1.00 0.00 ? 71  VAL A HB   1 
ATOM 1034  H HG11 . VAL A 1 71  ? 117.169 129.019 -31.578 1.00 0.00 ? 71  VAL A HG11 1 
ATOM 1035  H HG12 . VAL A 1 71  ? 117.453 128.724 -33.293 1.00 0.00 ? 71  VAL A HG12 1 
ATOM 1036  H HG13 . VAL A 1 71  ? 117.093 130.355 -32.726 1.00 0.00 ? 71  VAL A HG13 1 
ATOM 1037  H HG21 . VAL A 1 71  ? 120.812 128.525 -31.762 1.00 0.00 ? 71  VAL A HG21 1 
ATOM 1038  H HG22 . VAL A 1 71  ? 119.416 127.565 -32.250 1.00 0.00 ? 71  VAL A HG22 1 
ATOM 1039  H HG23 . VAL A 1 71  ? 119.449 128.328 -30.663 1.00 0.00 ? 71  VAL A HG23 1 
ATOM 1040  N N    . THR A 1 72  ? 118.409 131.081 -35.369 1.00 0.00 ? 72  THR A N    1 
ATOM 1041  C CA   . THR A 1 72  ? 117.734 132.204 -36.045 1.00 0.00 ? 72  THR A CA   1 
ATOM 1042  C C    . THR A 1 72  ? 116.266 131.877 -36.303 1.00 0.00 ? 72  THR A C    1 
ATOM 1043  O O    . THR A 1 72  ? 115.913 130.726 -36.561 1.00 0.00 ? 72  THR A O    1 
ATOM 1044  C CB   . THR A 1 72  ? 118.434 132.489 -37.380 1.00 0.00 ? 72  THR A CB   1 
ATOM 1045  O OG1  . THR A 1 72  ? 118.338 131.345 -38.219 1.00 0.00 ? 72  THR A OG1  1 
ATOM 1046  C CG2  . THR A 1 72  ? 119.910 132.812 -37.128 1.00 0.00 ? 72  THR A CG2  1 
ATOM 1047  H H    . THR A 1 72  ? 118.370 130.187 -35.772 1.00 0.00 ? 72  THR A H    1 
ATOM 1048  H HA   . THR A 1 72  ? 117.789 133.093 -35.430 1.00 0.00 ? 72  THR A HA   1 
ATOM 1049  H HB   . THR A 1 72  ? 117.965 133.331 -37.863 1.00 0.00 ? 72  THR A HB   1 
ATOM 1050  H HG1  . THR A 1 72  ? 118.571 131.611 -39.112 1.00 0.00 ? 72  THR A HG1  1 
ATOM 1051  H HG21 . THR A 1 72  ? 120.445 131.900 -36.907 1.00 0.00 ? 72  THR A HG21 1 
ATOM 1052  H HG22 . THR A 1 72  ? 119.992 133.489 -36.289 1.00 0.00 ? 72  THR A HG22 1 
ATOM 1053  H HG23 . THR A 1 72  ? 120.334 133.275 -38.007 1.00 0.00 ? 72  THR A HG23 1 
ATOM 1054  N N    . GLY A 1 73  ? 115.408 132.905 -36.239 1.00 0.00 ? 73  GLY A N    1 
ATOM 1055  C CA   . GLY A 1 73  ? 113.961 132.725 -36.477 1.00 0.00 ? 73  GLY A CA   1 
ATOM 1056  C C    . GLY A 1 73  ? 113.144 133.103 -35.245 1.00 0.00 ? 73  GLY A C    1 
ATOM 1057  O O    . GLY A 1 73  ? 113.283 134.199 -34.709 1.00 0.00 ? 73  GLY A O    1 
ATOM 1058  H H    . GLY A 1 73  ? 115.752 133.802 -36.031 1.00 0.00 ? 73  GLY A H    1 
ATOM 1059  H HA2  . GLY A 1 73  ? 113.662 133.356 -37.301 1.00 0.00 ? 73  GLY A HA2  1 
ATOM 1060  H HA3  . GLY A 1 73  ? 113.754 131.692 -36.731 1.00 0.00 ? 73  GLY A HA3  1 
ATOM 1061  N N    . VAL A 1 74  ? 112.279 132.185 -34.801 1.00 0.00 ? 74  VAL A N    1 
ATOM 1062  C CA   . VAL A 1 74  ? 111.427 132.433 -33.627 1.00 0.00 ? 74  VAL A CA   1 
ATOM 1063  C C    . VAL A 1 74  ? 111.321 131.182 -32.749 1.00 0.00 ? 74  VAL A C    1 
ATOM 1064  O O    . VAL A 1 74  ? 111.024 130.090 -33.231 1.00 0.00 ? 74  VAL A O    1 
ATOM 1065  C CB   . VAL A 1 74  ? 110.024 132.882 -34.092 1.00 0.00 ? 74  VAL A CB   1 
ATOM 1066  C CG1  . VAL A 1 74  ? 109.516 131.943 -35.192 1.00 0.00 ? 74  VAL A CG1  1 
ATOM 1067  C CG2  . VAL A 1 74  ? 109.035 132.868 -32.902 1.00 0.00 ? 74  VAL A CG2  1 
ATOM 1068  H H    . VAL A 1 74  ? 112.205 131.330 -35.273 1.00 0.00 ? 74  VAL A H    1 
ATOM 1069  H HA   . VAL A 1 74  ? 111.858 133.224 -33.039 1.00 0.00 ? 74  VAL A HA   1 
ATOM 1070  H HB   . VAL A 1 74  ? 110.089 133.885 -34.490 1.00 0.00 ? 74  VAL A HB   1 
ATOM 1071  H HG11 . VAL A 1 74  ? 108.500 132.205 -35.447 1.00 0.00 ? 74  VAL A HG11 1 
ATOM 1072  H HG12 . VAL A 1 74  ? 109.544 130.924 -34.841 1.00 0.00 ? 74  VAL A HG12 1 
ATOM 1073  H HG13 . VAL A 1 74  ? 110.143 132.041 -36.067 1.00 0.00 ? 74  VAL A HG13 1 
ATOM 1074  H HG21 . VAL A 1 74  ? 108.201 133.519 -33.120 1.00 0.00 ? 74  VAL A HG21 1 
ATOM 1075  H HG22 . VAL A 1 74  ? 109.535 133.213 -32.009 1.00 0.00 ? 74  VAL A HG22 1 
ATOM 1076  H HG23 . VAL A 1 74  ? 108.672 131.863 -32.740 1.00 0.00 ? 74  VAL A HG23 1 
ATOM 1077  N N    . THR A 1 75  ? 111.557 131.363 -31.443 1.00 0.00 ? 75  THR A N    1 
ATOM 1078  C CA   . THR A 1 75  ? 111.474 130.258 -30.474 1.00 0.00 ? 75  THR A CA   1 
ATOM 1079  C C    . THR A 1 75  ? 110.618 130.682 -29.293 1.00 0.00 ? 75  THR A C    1 
ATOM 1080  O O    . THR A 1 75  ? 110.854 131.727 -28.694 1.00 0.00 ? 75  THR A O    1 
ATOM 1081  C CB   . THR A 1 75  ? 112.871 129.887 -29.973 1.00 0.00 ? 75  THR A CB   1 
ATOM 1082  O OG1  . THR A 1 75  ? 113.677 129.495 -31.073 1.00 0.00 ? 75  THR A OG1  1 
ATOM 1083  C CG2  . THR A 1 75  ? 112.765 128.732 -28.974 1.00 0.00 ? 75  THR A CG2  1 
ATOM 1084  H H    . THR A 1 75  ? 111.779 132.261 -31.121 1.00 0.00 ? 75  THR A H    1 
ATOM 1085  H HA   . THR A 1 75  ? 111.025 129.389 -30.940 1.00 0.00 ? 75  THR A HA   1 
ATOM 1086  H HB   . THR A 1 75  ? 113.317 130.738 -29.484 1.00 0.00 ? 75  THR A HB   1 
ATOM 1087  H HG1  . THR A 1 75  ? 113.517 130.112 -31.791 1.00 0.00 ? 75  THR A HG1  1 
ATOM 1088  H HG21 . THR A 1 75  ? 113.744 128.308 -28.806 1.00 0.00 ? 75  THR A HG21 1 
ATOM 1089  H HG22 . THR A 1 75  ? 112.108 127.972 -29.371 1.00 0.00 ? 75  THR A HG22 1 
ATOM 1090  H HG23 . THR A 1 75  ? 112.366 129.100 -28.039 1.00 0.00 ? 75  THR A HG23 1 
ATOM 1091  N N    . ALA A 1 76  ? 109.616 129.871 -28.949 1.00 0.00 ? 76  ALA A N    1 
ATOM 1092  C CA   . ALA A 1 76  ? 108.735 130.197 -27.821 1.00 0.00 ? 76  ALA A CA   1 
ATOM 1093  C C    . ALA A 1 76  ? 108.426 128.961 -26.990 1.00 0.00 ? 76  ALA A C    1 
ATOM 1094  O O    . ALA A 1 76  ? 108.188 127.885 -27.534 1.00 0.00 ? 76  ALA A O    1 
ATOM 1095  C CB   . ALA A 1 76  ? 107.435 130.800 -28.338 1.00 0.00 ? 76  ALA A CB   1 
ATOM 1096  H H    . ALA A 1 76  ? 109.468 129.045 -29.455 1.00 0.00 ? 76  ALA A H    1 
ATOM 1097  H HA   . ALA A 1 76  ? 109.216 130.916 -27.194 1.00 0.00 ? 76  ALA A HA   1 
ATOM 1098  H HB1  . ALA A 1 76  ? 107.633 131.771 -28.768 1.00 0.00 ? 76  ALA A HB1  1 
ATOM 1099  H HB2  . ALA A 1 76  ? 106.744 130.904 -27.521 1.00 0.00 ? 76  ALA A HB2  1 
ATOM 1100  H HB3  . ALA A 1 76  ? 107.009 130.153 -29.089 1.00 0.00 ? 76  ALA A HB3  1 
ATOM 1101  N N    . VAL A 1 77  ? 108.424 129.115 -25.657 1.00 0.00 ? 77  VAL A N    1 
ATOM 1102  C CA   . VAL A 1 77  ? 108.131 127.981 -24.765 1.00 0.00 ? 77  VAL A CA   1 
ATOM 1103  C C    . VAL A 1 77  ? 107.264 128.433 -23.585 1.00 0.00 ? 77  VAL A C    1 
ATOM 1104  O O    . VAL A 1 77  ? 107.429 129.536 -23.065 1.00 0.00 ? 77  VAL A O    1 
ATOM 1105  C CB   . VAL A 1 77  ? 109.452 127.369 -24.251 1.00 0.00 ? 77  VAL A CB   1 
ATOM 1106  C CG1  . VAL A 1 77  ? 110.439 127.227 -25.422 1.00 0.00 ? 77  VAL A CG1  1 
ATOM 1107  C CG2  . VAL A 1 77  ? 110.069 128.265 -23.165 1.00 0.00 ? 77  VAL A CG2  1 
ATOM 1108  H H    . VAL A 1 77  ? 108.615 129.997 -25.273 1.00 0.00 ? 77  VAL A H    1 
ATOM 1109  H HA   . VAL A 1 77  ? 107.589 127.221 -25.313 1.00 0.00 ? 77  VAL A HA   1 
ATOM 1110  H HB   . VAL A 1 77  ? 109.251 126.390 -23.836 1.00 0.00 ? 77  VAL A HB   1 
ATOM 1111  H HG11 . VAL A 1 77  ? 111.216 126.526 -25.152 1.00 0.00 ? 77  VAL A HG11 1 
ATOM 1112  H HG12 . VAL A 1 77  ? 110.883 128.189 -25.638 1.00 0.00 ? 77  VAL A HG12 1 
ATOM 1113  H HG13 . VAL A 1 77  ? 109.917 126.867 -26.297 1.00 0.00 ? 77  VAL A HG13 1 
ATOM 1114  H HG21 . VAL A 1 77  ? 109.961 129.292 -23.455 1.00 0.00 ? 77  VAL A HG21 1 
ATOM 1115  H HG22 . VAL A 1 77  ? 111.118 128.031 -23.048 1.00 0.00 ? 77  VAL A HG22 1 
ATOM 1116  H HG23 . VAL A 1 77  ? 109.557 128.101 -22.228 1.00 0.00 ? 77  VAL A HG23 1 
ATOM 1117  N N    . ALA A 1 78  ? 106.349 127.556 -23.160 1.00 0.00 ? 78  ALA A N    1 
ATOM 1118  C CA   . ALA A 1 78  ? 105.455 127.846 -22.027 1.00 0.00 ? 78  ALA A CA   1 
ATOM 1119  C C    . ALA A 1 78  ? 105.727 126.865 -20.892 1.00 0.00 ? 78  ALA A C    1 
ATOM 1120  O O    . ALA A 1 78  ? 105.542 125.658 -21.047 1.00 0.00 ? 78  ALA A O    1 
ATOM 1121  C CB   . ALA A 1 78  ? 103.999 127.714 -22.471 1.00 0.00 ? 78  ALA A CB   1 
ATOM 1122  H H    . ALA A 1 78  ? 106.277 126.689 -23.611 1.00 0.00 ? 78  ALA A H    1 
ATOM 1123  H HA   . ALA A 1 78  ? 105.623 128.855 -21.670 1.00 0.00 ? 78  ALA A HA   1 
ATOM 1124  H HB1  . ALA A 1 78  ? 103.351 128.114 -21.705 1.00 0.00 ? 78  ALA A HB1  1 
ATOM 1125  H HB2  . ALA A 1 78  ? 103.765 126.671 -22.632 1.00 0.00 ? 78  ALA A HB2  1 
ATOM 1126  H HB3  . ALA A 1 78  ? 103.851 128.261 -23.389 1.00 0.00 ? 78  ALA A HB3  1 
ATOM 1127  N N    . GLN A 1 79  ? 106.167 127.390 -19.748 1.00 0.00 ? 79  GLN A N    1 
ATOM 1128  C CA   . GLN A 1 79  ? 106.467 126.557 -18.576 1.00 0.00 ? 79  GLN A CA   1 
ATOM 1129  C C    . GLN A 1 79  ? 105.982 127.262 -17.312 1.00 0.00 ? 79  GLN A C    1 
ATOM 1130  O O    . GLN A 1 79  ? 105.740 128.465 -17.323 1.00 0.00 ? 79  GLN A O    1 
ATOM 1131  C CB   . GLN A 1 79  ? 107.979 126.312 -18.485 1.00 0.00 ? 79  GLN A CB   1 
ATOM 1132  C CG   . GLN A 1 79  ? 108.530 125.975 -19.872 1.00 0.00 ? 79  GLN A CG   1 
ATOM 1133  C CD   . GLN A 1 79  ? 110.017 125.642 -19.778 1.00 0.00 ? 79  GLN A CD   1 
ATOM 1134  O OE1  . GLN A 1 79  ? 110.811 126.464 -19.318 1.00 0.00 ? 79  GLN A OE1  1 
ATOM 1135  N NE2  . GLN A 1 79  ? 110.443 124.479 -20.192 1.00 0.00 ? 79  GLN A NE2  1 
ATOM 1136  H H    . GLN A 1 79  ? 106.296 128.358 -19.686 1.00 0.00 ? 79  GLN A H    1 
ATOM 1137  H HA   . GLN A 1 79  ? 105.959 125.603 -18.664 1.00 0.00 ? 79  GLN A HA   1 
ATOM 1138  H HB2  . GLN A 1 79  ? 108.464 127.194 -18.110 1.00 0.00 ? 79  GLN A HB2  1 
ATOM 1139  H HB3  . GLN A 1 79  ? 108.169 125.487 -17.816 1.00 0.00 ? 79  GLN A HB3  1 
ATOM 1140  H HG2  . GLN A 1 79  ? 107.997 125.127 -20.274 1.00 0.00 ? 79  GLN A HG2  1 
ATOM 1141  H HG3  . GLN A 1 79  ? 108.397 126.825 -20.524 1.00 0.00 ? 79  GLN A HG3  1 
ATOM 1142  H HE21 . GLN A 1 79  ? 109.809 123.828 -20.559 1.00 0.00 ? 79  GLN A HE21 1 
ATOM 1143  H HE22 . GLN A 1 79  ? 111.396 124.258 -20.134 1.00 0.00 ? 79  GLN A HE22 1 
ATOM 1144  N N    . LYS A 1 80  ? 105.839 126.511 -16.215 1.00 0.00 ? 80  LYS A N    1 
ATOM 1145  C CA   . LYS A 1 80  ? 105.383 127.093 -14.938 1.00 0.00 ? 80  LYS A CA   1 
ATOM 1146  C C    . LYS A 1 80  ? 106.495 127.004 -13.901 1.00 0.00 ? 80  LYS A C    1 
ATOM 1147  O O    . LYS A 1 80  ? 106.982 128.021 -13.417 1.00 0.00 ? 80  LYS A O    1 
ATOM 1148  C CB   . LYS A 1 80  ? 104.142 126.351 -14.432 1.00 0.00 ? 80  LYS A CB   1 
ATOM 1149  C CG   . LYS A 1 80  ? 103.479 127.158 -13.309 1.00 0.00 ? 80  LYS A CG   1 
ATOM 1150  C CD   . LYS A 1 80  ? 102.165 126.485 -12.911 1.00 0.00 ? 80  LYS A CD   1 
ATOM 1151  C CE   . LYS A 1 80  ? 101.444 127.333 -11.863 1.00 0.00 ? 80  LYS A CE   1 
ATOM 1152  N NZ   . LYS A 1 80  ? 100.140 126.697 -11.525 1.00 0.00 ? 80  LYS A NZ   1 
ATOM 1153  H H    . LYS A 1 80  ? 106.045 125.554 -16.259 1.00 0.00 ? 80  LYS A H    1 
ATOM 1154  H HA   . LYS A 1 80  ? 105.128 128.139 -15.079 1.00 0.00 ? 80  LYS A HA   1 
ATOM 1155  H HB2  . LYS A 1 80  ? 103.442 126.224 -15.245 1.00 0.00 ? 80  LYS A HB2  1 
ATOM 1156  H HB3  . LYS A 1 80  ? 104.432 125.383 -14.053 1.00 0.00 ? 80  LYS A HB3  1 
ATOM 1157  H HG2  . LYS A 1 80  ? 104.139 127.197 -12.454 1.00 0.00 ? 80  LYS A HG2  1 
ATOM 1158  H HG3  . LYS A 1 80  ? 103.276 128.161 -13.653 1.00 0.00 ? 80  LYS A HG3  1 
ATOM 1159  H HD2  . LYS A 1 80  ? 101.536 126.381 -13.784 1.00 0.00 ? 80  LYS A HD2  1 
ATOM 1160  H HD3  . LYS A 1 80  ? 102.372 125.509 -12.499 1.00 0.00 ? 80  LYS A HD3  1 
ATOM 1161  H HE2  . LYS A 1 80  ? 102.052 127.404 -10.974 1.00 0.00 ? 80  LYS A HE2  1 
ATOM 1162  H HE3  . LYS A 1 80  ? 101.269 128.323 -12.258 1.00 0.00 ? 80  LYS A HE3  1 
ATOM 1163  H HZ1  . LYS A 1 80  ? 99.872  126.034 -12.281 1.00 0.00 ? 80  LYS A HZ1  1 
ATOM 1164  H HZ2  . LYS A 1 80  ? 99.408  127.432 -11.431 1.00 0.00 ? 80  LYS A HZ2  1 
ATOM 1165  H HZ3  . LYS A 1 80  ? 100.228 126.177 -10.629 1.00 0.00 ? 80  LYS A HZ3  1 
ATOM 1166  N N    . THR A 1 81  ? 106.910 125.777 -13.569 1.00 0.00 ? 81  THR A N    1 
ATOM 1167  C CA   . THR A 1 81  ? 107.983 125.571 -12.581 1.00 0.00 ? 81  THR A CA   1 
ATOM 1168  C C    . THR A 1 81  ? 108.976 124.519 -13.073 1.00 0.00 ? 81  THR A C    1 
ATOM 1169  O O    . THR A 1 81  ? 108.595 123.554 -13.733 1.00 0.00 ? 81  THR A O    1 
ATOM 1170  C CB   . THR A 1 81  ? 107.380 125.116 -11.250 1.00 0.00 ? 81  THR A CB   1 
ATOM 1171  O OG1  . THR A 1 81  ? 108.410 124.995 -10.280 1.00 0.00 ? 81  THR A OG1  1 
ATOM 1172  C CG2  . THR A 1 81  ? 106.689 123.763 -11.437 1.00 0.00 ? 81  THR A CG2  1 
ATOM 1173  H H    . THR A 1 81  ? 106.494 124.999 -13.995 1.00 0.00 ? 81  THR A H    1 
ATOM 1174  H HA   . THR A 1 81  ? 108.511 126.496 -12.423 1.00 0.00 ? 81  THR A HA   1 
ATOM 1175  H HB   . THR A 1 81  ? 106.655 125.841 -10.918 1.00 0.00 ? 81  THR A HB   1 
ATOM 1176  H HG1  . THR A 1 81  ? 108.922 124.209 -10.487 1.00 0.00 ? 81  THR A HG1  1 
ATOM 1177  H HG21 . THR A 1 81  ? 106.086 123.788 -12.333 1.00 0.00 ? 81  THR A HG21 1 
ATOM 1178  H HG22 . THR A 1 81  ? 106.058 123.560 -10.585 1.00 0.00 ? 81  THR A HG22 1 
ATOM 1179  H HG23 . THR A 1 81  ? 107.436 122.988 -11.525 1.00 0.00 ? 81  THR A HG23 1 
ATOM 1180  N N    . VAL A 1 82  ? 110.258 124.718 -12.745 1.00 0.00 ? 82  VAL A N    1 
ATOM 1181  C CA   . VAL A 1 82  ? 111.316 123.778 -13.158 1.00 0.00 ? 82  VAL A CA   1 
ATOM 1182  C C    . VAL A 1 82  ? 112.367 123.631 -12.053 1.00 0.00 ? 82  VAL A C    1 
ATOM 1183  O O    . VAL A 1 82  ? 112.690 124.586 -11.357 1.00 0.00 ? 82  VAL A O    1 
ATOM 1184  C CB   . VAL A 1 82  ? 111.971 124.275 -14.463 1.00 0.00 ? 82  VAL A CB   1 
ATOM 1185  C CG1  . VAL A 1 82  ? 112.325 125.759 -14.328 1.00 0.00 ? 82  VAL A CG1  1 
ATOM 1186  C CG2  . VAL A 1 82  ? 113.251 123.463 -14.757 1.00 0.00 ? 82  VAL A CG2  1 
ATOM 1187  H H    . VAL A 1 82  ? 110.500 125.509 -12.218 1.00 0.00 ? 82  VAL A H    1 
ATOM 1188  H HA   . VAL A 1 82  ? 110.877 122.805 -13.341 1.00 0.00 ? 82  VAL A HA   1 
ATOM 1189  H HB   . VAL A 1 82  ? 111.273 124.151 -15.278 1.00 0.00 ? 82  VAL A HB   1 
ATOM 1190  H HG11 . VAL A 1 82  ? 112.762 125.935 -13.361 1.00 0.00 ? 82  VAL A HG11 1 
ATOM 1191  H HG12 . VAL A 1 82  ? 111.429 126.352 -14.429 1.00 0.00 ? 82  VAL A HG12 1 
ATOM 1192  H HG13 . VAL A 1 82  ? 113.029 126.036 -15.099 1.00 0.00 ? 82  VAL A HG13 1 
ATOM 1193  H HG21 . VAL A 1 82  ? 113.081 122.423 -14.518 1.00 0.00 ? 82  VAL A HG21 1 
ATOM 1194  H HG22 . VAL A 1 82  ? 114.069 123.840 -14.159 1.00 0.00 ? 82  VAL A HG22 1 
ATOM 1195  H HG23 . VAL A 1 82  ? 113.500 123.554 -15.804 1.00 0.00 ? 82  VAL A HG23 1 
ATOM 1196  N N    . GLU A 1 83  ? 112.901 122.419 -11.898 1.00 0.00 ? 83  GLU A N    1 
ATOM 1197  C CA   . GLU A 1 83  ? 113.918 122.155 -10.872 1.00 0.00 ? 83  GLU A CA   1 
ATOM 1198  C C    . GLU A 1 83  ? 114.910 121.099 -11.354 1.00 0.00 ? 83  GLU A C    1 
ATOM 1199  O O    . GLU A 1 83  ? 114.535 120.157 -12.052 1.00 0.00 ? 83  GLU A O    1 
ATOM 1200  C CB   . GLU A 1 83  ? 113.242 121.677 -9.582  1.00 0.00 ? 83  GLU A CB   1 
ATOM 1201  C CG   . GLU A 1 83  ? 112.458 120.391 -9.858  1.00 0.00 ? 83  GLU A CG   1 
ATOM 1202  C CD   . GLU A 1 83  ? 111.693 119.968 -8.607  1.00 0.00 ? 83  GLU A CD   1 
ATOM 1203  O OE1  . GLU A 1 83  ? 111.792 120.665 -7.611  1.00 0.00 ? 83  GLU A OE1  1 
ATOM 1204  O OE2  . GLU A 1 83  ? 111.019 118.952 -8.664  1.00 0.00 ? 83  GLU A OE2  1 
ATOM 1205  H H    . GLU A 1 83  ? 112.608 121.687 -12.483 1.00 0.00 ? 83  GLU A H    1 
ATOM 1206  H HA   . GLU A 1 83  ? 114.457 123.064 -10.663 1.00 0.00 ? 83  GLU A HA   1 
ATOM 1207  H HB2  . GLU A 1 83  ? 113.996 121.484 -8.831  1.00 0.00 ? 83  GLU A HB2  1 
ATOM 1208  H HB3  . GLU A 1 83  ? 112.566 122.439 -9.226  1.00 0.00 ? 83  GLU A HB3  1 
ATOM 1209  H HG2  . GLU A 1 83  ? 111.759 120.564 -10.663 1.00 0.00 ? 83  GLU A HG2  1 
ATOM 1210  H HG3  . GLU A 1 83  ? 113.143 119.606 -10.139 1.00 0.00 ? 83  GLU A HG3  1 
ATOM 1211  N N    . GLY A 1 84  ? 116.180 121.259 -10.973 1.00 0.00 ? 84  GLY A N    1 
ATOM 1212  C CA   . GLY A 1 84  ? 117.218 120.306 -11.371 1.00 0.00 ? 84  GLY A CA   1 
ATOM 1213  C C    . GLY A 1 84  ? 118.589 120.971 -11.418 1.00 0.00 ? 84  GLY A C    1 
ATOM 1214  O O    . GLY A 1 84  ? 118.757 122.035 -12.011 1.00 0.00 ? 84  GLY A O    1 
ATOM 1215  H H    . GLY A 1 84  ? 116.421 122.029 -10.415 1.00 0.00 ? 84  GLY A H    1 
ATOM 1216  H HA2  . GLY A 1 84  ? 117.244 119.493 -10.660 1.00 0.00 ? 84  GLY A HA2  1 
ATOM 1217  H HA3  . GLY A 1 84  ? 116.987 119.912 -12.352 1.00 0.00 ? 84  GLY A HA3  1 
ATOM 1218  N N    . ALA A 1 85  ? 119.573 120.329 -10.800 1.00 0.00 ? 85  ALA A N    1 
ATOM 1219  C CA   . ALA A 1 85  ? 120.926 120.867 -10.787 1.00 0.00 ? 85  ALA A CA   1 
ATOM 1220  C C    . ALA A 1 85  ? 121.571 120.716 -12.161 1.00 0.00 ? 85  ALA A C    1 
ATOM 1221  O O    . ALA A 1 85  ? 121.612 119.621 -12.722 1.00 0.00 ? 85  ALA A O    1 
ATOM 1222  C CB   . ALA A 1 85  ? 121.765 120.133 -9.743  1.00 0.00 ? 85  ALA A CB   1 
ATOM 1223  H H    . ALA A 1 85  ? 119.386 119.478 -10.350 1.00 0.00 ? 85  ALA A H    1 
ATOM 1224  H HA   . ALA A 1 85  ? 120.885 121.914 -10.530 1.00 0.00 ? 85  ALA A HA   1 
ATOM 1225  H HB1  . ALA A 1 85  ? 122.775 120.515 -9.758  1.00 0.00 ? 85  ALA A HB1  1 
ATOM 1226  H HB2  . ALA A 1 85  ? 121.777 119.076 -9.967  1.00 0.00 ? 85  ALA A HB2  1 
ATOM 1227  H HB3  . ALA A 1 85  ? 121.337 120.288 -8.763  1.00 0.00 ? 85  ALA A HB3  1 
ATOM 1228  N N    . GLY A 1 86  ? 122.076 121.822 -12.696 1.00 0.00 ? 86  GLY A N    1 
ATOM 1229  C CA   . GLY A 1 86  ? 122.721 121.799 -14.004 1.00 0.00 ? 86  GLY A CA   1 
ATOM 1230  C C    . GLY A 1 86  ? 121.686 121.663 -15.117 1.00 0.00 ? 86  GLY A C    1 
ATOM 1231  O O    . GLY A 1 86  ? 122.035 121.516 -16.288 1.00 0.00 ? 86  GLY A O    1 
ATOM 1232  H H    . GLY A 1 86  ? 122.019 122.665 -12.202 1.00 0.00 ? 86  GLY A H    1 
ATOM 1233  H HA2  . GLY A 1 86  ? 123.274 122.717 -14.142 1.00 0.00 ? 86  GLY A HA2  1 
ATOM 1234  H HA3  . GLY A 1 86  ? 123.401 120.963 -14.051 1.00 0.00 ? 86  GLY A HA3  1 
ATOM 1235  N N    . SER A 1 87  ? 120.410 121.706 -14.739 1.00 0.00 ? 87  SER A N    1 
ATOM 1236  C CA   . SER A 1 87  ? 119.326 121.581 -15.708 1.00 0.00 ? 87  SER A CA   1 
ATOM 1237  C C    . SER A 1 87  ? 119.070 122.911 -16.410 1.00 0.00 ? 87  SER A C    1 
ATOM 1238  O O    . SER A 1 87  ? 119.335 123.982 -15.858 1.00 0.00 ? 87  SER A O    1 
ATOM 1239  C CB   . SER A 1 87  ? 118.051 121.113 -15.007 1.00 0.00 ? 87  SER A CB   1 
ATOM 1240  O OG   . SER A 1 87  ? 116.976 121.114 -15.938 1.00 0.00 ? 87  SER A OG   1 
ATOM 1241  H H    . SER A 1 87  ? 120.193 121.822 -13.791 1.00 0.00 ? 87  SER A H    1 
ATOM 1242  H HA   . SER A 1 87  ? 119.602 120.845 -16.450 1.00 0.00 ? 87  SER A HA   1 
ATOM 1243  H HB2  . SER A 1 87  ? 118.193 120.114 -14.632 1.00 0.00 ? 87  SER A HB2  1 
ATOM 1244  H HB3  . SER A 1 87  ? 117.829 121.777 -14.181 1.00 0.00 ? 87  SER A HB3  1 
ATOM 1245  H HG   . SER A 1 87  ? 116.440 120.336 -15.771 1.00 0.00 ? 87  SER A HG   1 
ATOM 1246  N N    . ILE A 1 88  ? 118.552 122.836 -17.640 1.00 0.00 ? 88  ILE A N    1 
ATOM 1247  C CA   . ILE A 1 88  ? 118.254 124.039 -18.431 1.00 0.00 ? 88  ILE A CA   1 
ATOM 1248  C C    . ILE A 1 88  ? 116.788 124.022 -18.873 1.00 0.00 ? 88  ILE A C    1 
ATOM 1249  O O    . ILE A 1 88  ? 116.305 123.022 -19.404 1.00 0.00 ? 88  ILE A O    1 
ATOM 1250  C CB   . ILE A 1 88  ? 119.198 124.092 -19.660 1.00 0.00 ? 88  ILE A CB   1 
ATOM 1251  C CG1  . ILE A 1 88  ? 118.743 123.075 -20.733 1.00 0.00 ? 88  ILE A CG1  1 
ATOM 1252  C CG2  . ILE A 1 88  ? 120.643 123.758 -19.220 1.00 0.00 ? 88  ILE A CG2  1 
ATOM 1253  C CD1  . ILE A 1 88  ? 119.804 122.980 -21.837 1.00 0.00 ? 88  ILE A CD1  1 
ATOM 1254  H H    . ILE A 1 88  ? 118.364 121.954 -18.025 1.00 0.00 ? 88  ILE A H    1 
ATOM 1255  H HA   . ILE A 1 88  ? 118.418 124.925 -17.828 1.00 0.00 ? 88  ILE A HA   1 
ATOM 1256  H HB   . ILE A 1 88  ? 119.178 125.090 -20.077 1.00 0.00 ? 88  ILE A HB   1 
ATOM 1257  H HG12 . ILE A 1 88  ? 118.606 122.107 -20.278 1.00 0.00 ? 88  ILE A HG12 1 
ATOM 1258  H HG13 . ILE A 1 88  ? 117.812 123.403 -21.170 1.00 0.00 ? 88  ILE A HG13 1 
ATOM 1259  H HG21 . ILE A 1 88  ? 121.340 124.188 -19.925 1.00 0.00 ? 88  ILE A HG21 1 
ATOM 1260  H HG22 . ILE A 1 88  ? 120.779 122.684 -19.194 1.00 0.00 ? 88  ILE A HG22 1 
ATOM 1261  H HG23 . ILE A 1 88  ? 120.834 124.161 -18.236 1.00 0.00 ? 88  ILE A HG23 1 
ATOM 1262  H HD11 . ILE A 1 88  ? 120.637 122.389 -21.483 1.00 0.00 ? 88  ILE A HD11 1 
ATOM 1263  H HD12 . ILE A 1 88  ? 120.149 123.970 -22.093 1.00 0.00 ? 88  ILE A HD12 1 
ATOM 1264  H HD13 . ILE A 1 88  ? 119.375 122.510 -22.709 1.00 0.00 ? 88  ILE A HD13 1 
ATOM 1265  N N    . ALA A 1 89  ? 116.081 125.130 -18.646 1.00 0.00 ? 89  ALA A N    1 
ATOM 1266  C CA   . ALA A 1 89  ? 114.670 125.215 -19.025 1.00 0.00 ? 89  ALA A CA   1 
ATOM 1267  C C    . ALA A 1 89  ? 114.534 125.613 -20.489 1.00 0.00 ? 89  ALA A C    1 
ATOM 1268  O O    . ALA A 1 89  ? 113.975 124.870 -21.296 1.00 0.00 ? 89  ALA A O    1 
ATOM 1269  C CB   . ALA A 1 89  ? 113.954 126.244 -18.150 1.00 0.00 ? 89  ALA A CB   1 
ATOM 1270  H H    . ALA A 1 89  ? 116.513 125.899 -18.215 1.00 0.00 ? 89  ALA A H    1 
ATOM 1271  H HA   . ALA A 1 89  ? 114.203 124.251 -18.879 1.00 0.00 ? 89  ALA A HA   1 
ATOM 1272  H HB1  . ALA A 1 89  ? 112.884 126.117 -18.244 1.00 0.00 ? 89  ALA A HB1  1 
ATOM 1273  H HB2  . ALA A 1 89  ? 114.225 127.238 -18.469 1.00 0.00 ? 89  ALA A HB2  1 
ATOM 1274  H HB3  . ALA A 1 89  ? 114.243 126.106 -17.120 1.00 0.00 ? 89  ALA A HB3  1 
ATOM 1275  N N    . ALA A 1 90  ? 115.056 126.795 -20.827 1.00 0.00 ? 90  ALA A N    1 
ATOM 1276  C CA   . ALA A 1 90  ? 115.001 127.303 -22.204 1.00 0.00 ? 90  ALA A CA   1 
ATOM 1277  C C    . ALA A 1 90  ? 116.363 127.847 -22.614 1.00 0.00 ? 90  ALA A C    1 
ATOM 1278  O O    . ALA A 1 90  ? 116.862 128.806 -22.023 1.00 0.00 ? 90  ALA A O    1 
ATOM 1279  C CB   . ALA A 1 90  ? 113.951 128.416 -22.305 1.00 0.00 ? 90  ALA A CB   1 
ATOM 1280  H H    . ALA A 1 90  ? 115.488 127.340 -20.138 1.00 0.00 ? 90  ALA A H    1 
ATOM 1281  H HA   . ALA A 1 90  ? 114.729 126.503 -22.882 1.00 0.00 ? 90  ALA A HA   1 
ATOM 1282  H HB1  . ALA A 1 90  ? 114.352 129.333 -21.897 1.00 0.00 ? 90  ALA A HB1  1 
ATOM 1283  H HB2  . ALA A 1 90  ? 113.071 128.130 -21.749 1.00 0.00 ? 90  ALA A HB2  1 
ATOM 1284  H HB3  . ALA A 1 90  ? 113.687 128.569 -23.342 1.00 0.00 ? 90  ALA A HB3  1 
ATOM 1285  N N    . ALA A 1 91  ? 116.965 127.233 -23.633 1.00 0.00 ? 91  ALA A N    1 
ATOM 1286  C CA   . ALA A 1 91  ? 118.280 127.669 -24.120 1.00 0.00 ? 91  ALA A CA   1 
ATOM 1287  C C    . ALA A 1 91  ? 118.374 127.511 -25.633 1.00 0.00 ? 91  ALA A C    1 
ATOM 1288  O O    . ALA A 1 91  ? 118.221 126.410 -26.161 1.00 0.00 ? 91  ALA A O    1 
ATOM 1289  C CB   . ALA A 1 91  ? 119.382 126.842 -23.449 1.00 0.00 ? 91  ALA A CB   1 
ATOM 1290  H H    . ALA A 1 91  ? 116.520 126.477 -24.068 1.00 0.00 ? 91  ALA A H    1 
ATOM 1291  H HA   . ALA A 1 91  ? 118.428 128.708 -23.871 1.00 0.00 ? 91  ALA A HA   1 
ATOM 1292  H HB1  . ALA A 1 91  ? 120.328 127.352 -23.554 1.00 0.00 ? 91  ALA A HB1  1 
ATOM 1293  H HB2  . ALA A 1 91  ? 119.443 125.869 -23.919 1.00 0.00 ? 91  ALA A HB2  1 
ATOM 1294  H HB3  . ALA A 1 91  ? 119.151 126.721 -22.403 1.00 0.00 ? 91  ALA A HB3  1 
ATOM 1295  N N    . THR A 1 92  ? 118.641 128.618 -26.329 1.00 0.00 ? 92  THR A N    1 
ATOM 1296  C CA   . THR A 1 92  ? 118.769 128.585 -27.790 1.00 0.00 ? 92  THR A CA   1 
ATOM 1297  C C    . THR A 1 92  ? 120.229 128.399 -28.181 1.00 0.00 ? 92  THR A C    1 
ATOM 1298  O O    . THR A 1 92  ? 121.035 129.323 -28.066 1.00 0.00 ? 92  THR A O    1 
ATOM 1299  C CB   . THR A 1 92  ? 118.238 129.888 -28.392 1.00 0.00 ? 92  THR A CB   1 
ATOM 1300  O OG1  . THR A 1 92  ? 119.213 130.907 -28.246 1.00 0.00 ? 92  THR A OG1  1 
ATOM 1301  C CG2  . THR A 1 92  ? 116.955 130.299 -27.671 1.00 0.00 ? 92  THR A CG2  1 
ATOM 1302  H H    . THR A 1 92  ? 118.761 129.467 -25.853 1.00 0.00 ? 92  THR A H    1 
ATOM 1303  H HA   . THR A 1 92  ? 118.191 127.759 -28.186 1.00 0.00 ? 92  THR A HA   1 
ATOM 1304  H HB   . THR A 1 92  ? 118.024 129.741 -29.440 1.00 0.00 ? 92  THR A HB   1 
ATOM 1305  H HG1  . THR A 1 92  ? 120.037 130.586 -28.619 1.00 0.00 ? 92  THR A HG1  1 
ATOM 1306  H HG21 . THR A 1 92  ? 116.525 131.159 -28.163 1.00 0.00 ? 92  THR A HG21 1 
ATOM 1307  H HG22 . THR A 1 92  ? 117.185 130.548 -26.645 1.00 0.00 ? 92  THR A HG22 1 
ATOM 1308  H HG23 . THR A 1 92  ? 116.251 129.481 -27.695 1.00 0.00 ? 92  THR A HG23 1 
ATOM 1309  N N    . GLY A 1 93  ? 120.561 127.197 -28.642 1.00 0.00 ? 93  GLY A N    1 
ATOM 1310  C CA   . GLY A 1 93  ? 121.930 126.889 -29.044 1.00 0.00 ? 93  GLY A CA   1 
ATOM 1311  C C    . GLY A 1 93  ? 122.784 126.553 -27.826 1.00 0.00 ? 93  GLY A C    1 
ATOM 1312  O O    . GLY A 1 93  ? 123.359 127.439 -27.198 1.00 0.00 ? 93  GLY A O    1 
ATOM 1313  H H    . GLY A 1 93  ? 119.874 126.501 -28.708 1.00 0.00 ? 93  GLY A H    1 
ATOM 1314  H HA2  . GLY A 1 93  ? 121.919 126.044 -29.719 1.00 0.00 ? 93  GLY A HA2  1 
ATOM 1315  H HA3  . GLY A 1 93  ? 122.355 127.742 -29.549 1.00 0.00 ? 93  GLY A HA3  1 
ATOM 1316  N N    . PHE A 1 94  ? 122.860 125.259 -27.493 1.00 0.00 ? 94  PHE A N    1 
ATOM 1317  C CA   . PHE A 1 94  ? 123.646 124.799 -26.335 1.00 0.00 ? 94  PHE A CA   1 
ATOM 1318  C C    . PHE A 1 94  ? 124.757 123.857 -26.793 1.00 0.00 ? 94  PHE A C    1 
ATOM 1319  O O    . PHE A 1 94  ? 124.487 122.808 -27.377 1.00 0.00 ? 94  PHE A O    1 
ATOM 1320  C CB   . PHE A 1 94  ? 122.731 124.055 -25.355 1.00 0.00 ? 94  PHE A CB   1 
ATOM 1321  C CG   . PHE A 1 94  ? 123.433 123.886 -24.027 1.00 0.00 ? 94  PHE A CG   1 
ATOM 1322  C CD1  . PHE A 1 94  ? 124.349 122.843 -23.845 1.00 0.00 ? 94  PHE A CD1  1 
ATOM 1323  C CD2  . PHE A 1 94  ? 123.169 124.778 -22.980 1.00 0.00 ? 94  PHE A CD2  1 
ATOM 1324  C CE1  . PHE A 1 94  ? 125.000 122.692 -22.615 1.00 0.00 ? 94  PHE A CE1  1 
ATOM 1325  C CE2  . PHE A 1 94  ? 123.820 124.626 -21.751 1.00 0.00 ? 94  PHE A CE2  1 
ATOM 1326  C CZ   . PHE A 1 94  ? 124.736 123.583 -21.568 1.00 0.00 ? 94  PHE A CZ   1 
ATOM 1327  H H    . PHE A 1 94  ? 122.375 124.599 -28.031 1.00 0.00 ? 94  PHE A H    1 
ATOM 1328  H HA   . PHE A 1 94  ? 124.090 125.647 -25.827 1.00 0.00 ? 94  PHE A HA   1 
ATOM 1329  H HB2  . PHE A 1 94  ? 121.822 124.621 -25.211 1.00 0.00 ? 94  PHE A HB2  1 
ATOM 1330  H HB3  . PHE A 1 94  ? 122.487 123.083 -25.758 1.00 0.00 ? 94  PHE A HB3  1 
ATOM 1331  H HD1  . PHE A 1 94  ? 124.553 122.156 -24.654 1.00 0.00 ? 94  PHE A HD1  1 
ATOM 1332  H HD2  . PHE A 1 94  ? 122.462 125.581 -23.121 1.00 0.00 ? 94  PHE A HD2  1 
ATOM 1333  H HE1  . PHE A 1 94  ? 125.708 121.888 -22.474 1.00 0.00 ? 94  PHE A HE1  1 
ATOM 1334  H HE2  . PHE A 1 94  ? 123.617 125.314 -20.943 1.00 0.00 ? 94  PHE A HE2  1 
ATOM 1335  H HZ   . PHE A 1 94  ? 125.239 123.466 -20.620 1.00 0.00 ? 94  PHE A HZ   1 
ATOM 1336  N N    . VAL A 1 95  ? 126.010 124.231 -26.520 1.00 0.00 ? 95  VAL A N    1 
ATOM 1337  C CA   . VAL A 1 95  ? 127.161 123.399 -26.908 1.00 0.00 ? 95  VAL A CA   1 
ATOM 1338  C C    . VAL A 1 95  ? 128.249 123.444 -25.828 1.00 0.00 ? 95  VAL A C    1 
ATOM 1339  O O    . VAL A 1 95  ? 128.736 124.509 -25.457 1.00 0.00 ? 95  VAL A O    1 
ATOM 1340  C CB   . VAL A 1 95  ? 127.713 123.882 -28.265 1.00 0.00 ? 95  VAL A CB   1 
ATOM 1341  C CG1  . VAL A 1 95  ? 127.846 125.403 -28.253 1.00 0.00 ? 95  VAL A CG1  1 
ATOM 1342  C CG2  . VAL A 1 95  ? 129.090 123.246 -28.537 1.00 0.00 ? 95  VAL A CG2  1 
ATOM 1343  H H    . VAL A 1 95  ? 126.167 125.077 -26.049 1.00 0.00 ? 95  VAL A H    1 
ATOM 1344  H HA   . VAL A 1 95  ? 126.836 122.370 -27.018 1.00 0.00 ? 95  VAL A HA   1 
ATOM 1345  H HB   . VAL A 1 95  ? 127.026 123.595 -29.049 1.00 0.00 ? 95  VAL A HB   1 
ATOM 1346  H HG11 . VAL A 1 95  ? 128.496 125.700 -27.453 1.00 0.00 ? 95  VAL A HG11 1 
ATOM 1347  H HG12 . VAL A 1 95  ? 126.872 125.849 -28.109 1.00 0.00 ? 95  VAL A HG12 1 
ATOM 1348  H HG13 . VAL A 1 95  ? 128.258 125.734 -29.192 1.00 0.00 ? 95  VAL A HG13 1 
ATOM 1349  H HG21 . VAL A 1 95  ? 129.069 122.206 -28.251 1.00 0.00 ? 95  VAL A HG21 1 
ATOM 1350  H HG22 . VAL A 1 95  ? 129.847 123.761 -27.962 1.00 0.00 ? 95  VAL A HG22 1 
ATOM 1351  H HG23 . VAL A 1 95  ? 129.323 123.325 -29.589 1.00 0.00 ? 95  VAL A HG23 1 
ATOM 1352  N N    . LYS A 1 96  ? 128.627 122.266 -25.328 1.00 0.00 ? 96  LYS A N    1 
ATOM 1353  C CA   . LYS A 1 96  ? 129.662 122.160 -24.288 1.00 0.00 ? 96  LYS A CA   1 
ATOM 1354  C C    . LYS A 1 96  ? 130.786 121.245 -24.759 1.00 0.00 ? 96  LYS A C    1 
ATOM 1355  O O    . LYS A 1 96  ? 130.560 120.070 -25.054 1.00 0.00 ? 96  LYS A O    1 
ATOM 1356  C CB   . LYS A 1 96  ? 129.048 121.591 -23.005 1.00 0.00 ? 96  LYS A CB   1 
ATOM 1357  C CG   . LYS A 1 96  ? 130.104 121.575 -21.896 1.00 0.00 ? 96  LYS A CG   1 
ATOM 1358  C CD   . LYS A 1 96  ? 129.475 121.078 -20.592 1.00 0.00 ? 96  LYS A CD   1 
ATOM 1359  C CE   . LYS A 1 96  ? 130.534 121.077 -19.487 1.00 0.00 ? 96  LYS A CE   1 
ATOM 1360  N NZ   . LYS A 1 96  ? 129.923 120.623 -18.206 1.00 0.00 ? 96  LYS A NZ   1 
ATOM 1361  H H    . LYS A 1 96  ? 128.204 121.447 -25.665 1.00 0.00 ? 96  LYS A H    1 
ATOM 1362  H HA   . LYS A 1 96  ? 130.076 123.139 -24.073 1.00 0.00 ? 96  LYS A HA   1 
ATOM 1363  H HB2  . LYS A 1 96  ? 128.214 122.207 -22.700 1.00 0.00 ? 96  LYS A HB2  1 
ATOM 1364  H HB3  . LYS A 1 96  ? 128.705 120.583 -23.186 1.00 0.00 ? 96  LYS A HB3  1 
ATOM 1365  H HG2  . LYS A 1 96  ? 130.911 120.916 -22.178 1.00 0.00 ? 96  LYS A HG2  1 
ATOM 1366  H HG3  . LYS A 1 96  ? 130.487 122.572 -21.750 1.00 0.00 ? 96  LYS A HG3  1 
ATOM 1367  H HD2  . LYS A 1 96  ? 128.660 121.731 -20.314 1.00 0.00 ? 96  LYS A HD2  1 
ATOM 1368  H HD3  . LYS A 1 96  ? 129.101 120.075 -20.731 1.00 0.00 ? 96  LYS A HD3  1 
ATOM 1369  H HE2  . LYS A 1 96  ? 131.336 120.408 -19.759 1.00 0.00 ? 96  LYS A HE2  1 
ATOM 1370  H HE3  . LYS A 1 96  ? 130.926 122.076 -19.364 1.00 0.00 ? 96  LYS A HE3  1 
ATOM 1371  H HZ1  . LYS A 1 96  ? 129.098 121.216 -17.984 1.00 0.00 ? 96  LYS A HZ1  1 
ATOM 1372  H HZ2  . LYS A 1 96  ? 130.624 120.704 -17.441 1.00 0.00 ? 96  LYS A HZ2  1 
ATOM 1373  H HZ3  . LYS A 1 96  ? 129.619 119.633 -18.296 1.00 0.00 ? 96  LYS A HZ3  1 
ATOM 1374  N N    . LYS A 1 97  ? 132.005 121.789 -24.826 1.00 0.00 ? 97  LYS A N    1 
ATOM 1375  C CA   . LYS A 1 97  ? 133.176 121.012 -25.258 1.00 0.00 ? 97  LYS A CA   1 
ATOM 1376  C C    . LYS A 1 97  ? 134.038 120.653 -24.054 1.00 0.00 ? 97  LYS A C    1 
ATOM 1377  O O    . LYS A 1 97  ? 134.742 121.502 -23.507 1.00 0.00 ? 97  LYS A O    1 
ATOM 1378  C CB   . LYS A 1 97  ? 134.003 121.832 -26.253 1.00 0.00 ? 97  LYS A CB   1 
ATOM 1379  C CG   . LYS A 1 97  ? 133.165 122.111 -27.504 1.00 0.00 ? 97  LYS A CG   1 
ATOM 1380  C CD   . LYS A 1 97  ? 134.003 122.897 -28.516 1.00 0.00 ? 97  LYS A CD   1 
ATOM 1381  C CE   . LYS A 1 97  ? 133.145 123.239 -29.738 1.00 0.00 ? 97  LYS A CE   1 
ATOM 1382  N NZ   . LYS A 1 97  ? 132.692 121.982 -30.398 1.00 0.00 ? 97  LYS A NZ   1 
ATOM 1383  H H    . LYS A 1 97  ? 132.121 122.730 -24.574 1.00 0.00 ? 97  LYS A H    1 
ATOM 1384  H HA   . LYS A 1 97  ? 132.854 120.098 -25.745 1.00 0.00 ? 97  LYS A HA   1 
ATOM 1385  H HB2  . LYS A 1 97  ? 134.292 122.768 -25.795 1.00 0.00 ? 97  LYS A HB2  1 
ATOM 1386  H HB3  . LYS A 1 97  ? 134.887 121.278 -26.530 1.00 0.00 ? 97  LYS A HB3  1 
ATOM 1387  H HG2  . LYS A 1 97  ? 132.852 121.174 -27.942 1.00 0.00 ? 97  LYS A HG2  1 
ATOM 1388  H HG3  . LYS A 1 97  ? 132.296 122.691 -27.232 1.00 0.00 ? 97  LYS A HG3  1 
ATOM 1389  H HD2  . LYS A 1 97  ? 134.359 123.808 -28.060 1.00 0.00 ? 97  LYS A HD2  1 
ATOM 1390  H HD3  . LYS A 1 97  ? 134.845 122.298 -28.829 1.00 0.00 ? 97  LYS A HD3  1 
ATOM 1391  H HE2  . LYS A 1 97  ? 132.283 123.811 -29.424 1.00 0.00 ? 97  LYS A HE2  1 
ATOM 1392  H HE3  . LYS A 1 97  ? 133.728 123.822 -30.435 1.00 0.00 ? 97  LYS A HE3  1 
ATOM 1393  H HZ1  . LYS A 1 97  ? 131.742 121.733 -30.056 1.00 0.00 ? 97  LYS A HZ1  1 
ATOM 1394  H HZ2  . LYS A 1 97  ? 133.357 121.214 -30.172 1.00 0.00 ? 97  LYS A HZ2  1 
ATOM 1395  H HZ3  . LYS A 1 97  ? 132.660 122.123 -31.427 1.00 0.00 ? 97  LYS A HZ3  1 
ATOM 1396  N N    . ASP A 1 98  ? 133.978 119.386 -23.646 1.00 0.00 ? 98  ASP A N    1 
ATOM 1397  C CA   . ASP A 1 98  ? 134.755 118.916 -22.497 1.00 0.00 ? 98  ASP A CA   1 
ATOM 1398  C C    . ASP A 1 98  ? 135.099 117.439 -22.652 1.00 0.00 ? 98  ASP A C    1 
ATOM 1399  O O    . ASP A 1 98  ? 135.002 116.664 -21.701 1.00 0.00 ? 98  ASP A O    1 
ATOM 1400  C CB   . ASP A 1 98  ? 133.952 119.125 -21.211 1.00 0.00 ? 98  ASP A CB   1 
ATOM 1401  C CG   . ASP A 1 98  ? 134.819 118.821 -19.995 1.00 0.00 ? 98  ASP A CG   1 
ATOM 1402  O OD1  . ASP A 1 98  ? 135.887 118.263 -20.178 1.00 0.00 ? 98  ASP A OD1  1 
ATOM 1403  O OD2  . ASP A 1 98  ? 134.399 119.150 -18.897 1.00 0.00 ? 98  ASP A OD2  1 
ATOM 1404  H H    . ASP A 1 98  ? 133.398 118.757 -24.122 1.00 0.00 ? 98  ASP A H    1 
ATOM 1405  H HA   . ASP A 1 98  ? 135.675 119.481 -22.431 1.00 0.00 ? 98  ASP A HA   1 
ATOM 1406  H HB2  . ASP A 1 98  ? 133.613 120.150 -21.164 1.00 0.00 ? 98  ASP A HB2  1 
ATOM 1407  H HB3  . ASP A 1 98  ? 133.096 118.466 -21.214 1.00 0.00 ? 98  ASP A HB3  1 
ATOM 1408  N N    . GLN A 1 99  ? 135.506 117.058 -23.857 1.00 0.00 ? 99  GLN A N    1 
ATOM 1409  C CA   . GLN A 1 99  ? 135.867 115.673 -24.128 1.00 0.00 ? 99  GLN A CA   1 
ATOM 1410  C C    . GLN A 1 99  ? 134.754 114.734 -23.677 1.00 0.00 ? 99  GLN A C    1 
ATOM 1411  O O    . GLN A 1 99  ? 135.013 113.632 -23.195 1.00 0.00 ? 99  GLN A O    1 
ATOM 1412  C CB   . GLN A 1 99  ? 137.163 115.320 -23.397 1.00 0.00 ? 99  GLN A CB   1 
ATOM 1413  C CG   . GLN A 1 99  ? 138.326 116.095 -24.019 1.00 0.00 ? 99  GLN A CG   1 
ATOM 1414  C CD   . GLN A 1 99  ? 139.583 115.918 -23.175 1.00 0.00 ? 99  GLN A CD   1 
ATOM 1415  O OE1  . GLN A 1 99  ? 139.495 115.711 -21.965 1.00 0.00 ? 99  GLN A OE1  1 
ATOM 1416  N NE2  . GLN A 1 99  ? 140.754 115.992 -23.744 1.00 0.00 ? 99  GLN A NE2  1 
ATOM 1417  H H    . GLN A 1 99  ? 135.568 117.720 -24.575 1.00 0.00 ? 99  GLN A H    1 
ATOM 1418  H HA   . GLN A 1 99  ? 136.021 115.552 -25.189 1.00 0.00 ? 99  GLN A HA   1 
ATOM 1419  H HB2  . GLN A 1 99  ? 137.071 115.584 -22.354 1.00 0.00 ? 99  GLN A HB2  1 
ATOM 1420  H HB3  . GLN A 1 99  ? 137.350 114.261 -23.485 1.00 0.00 ? 99  GLN A HB3  1 
ATOM 1421  H HG2  . GLN A 1 99  ? 138.509 115.723 -25.017 1.00 0.00 ? 99  GLN A HG2  1 
ATOM 1422  H HG3  . GLN A 1 99  ? 138.073 117.144 -24.068 1.00 0.00 ? 99  GLN A HG3  1 
ATOM 1423  H HE21 . GLN A 1 99  ? 140.821 116.159 -24.707 1.00 0.00 ? 99  GLN A HE21 1 
ATOM 1424  H HE22 . GLN A 1 99  ? 141.567 115.880 -23.209 1.00 0.00 ? 99  GLN A HE22 1 
ATOM 1425  N N    . LEU A 1 100 ? 133.513 115.179 -23.842 1.00 0.00 ? 100 LEU A N    1 
ATOM 1426  C CA   . LEU A 1 100 ? 132.363 114.371 -23.454 1.00 0.00 ? 100 LEU A CA   1 
ATOM 1427  C C    . LEU A 1 100 ? 132.573 113.786 -22.054 1.00 0.00 ? 100 LEU A C    1 
ATOM 1428  O O    . LEU A 1 100 ? 132.066 112.711 -21.739 1.00 0.00 ? 100 LEU A O    1 
ATOM 1429  C CB   . LEU A 1 100 ? 132.160 113.235 -24.477 1.00 0.00 ? 100 LEU A CB   1 
ATOM 1430  C CG   . LEU A 1 100 ? 131.420 113.767 -25.709 1.00 0.00 ? 100 LEU A CG   1 
ATOM 1431  C CD1  . LEU A 1 100 ? 132.259 114.859 -26.377 1.00 0.00 ? 100 LEU A CD1  1 
ATOM 1432  C CD2  . LEU A 1 100 ? 131.192 112.622 -26.700 1.00 0.00 ? 100 LEU A CD2  1 
ATOM 1433  H H    . LEU A 1 100 ? 133.368 116.065 -24.236 1.00 0.00 ? 100 LEU A H    1 
ATOM 1434  H HA   . LEU A 1 100 ? 131.482 114.999 -23.440 1.00 0.00 ? 100 LEU A HA   1 
ATOM 1435  H HB2  . LEU A 1 100 ? 133.123 112.849 -24.777 1.00 0.00 ? 100 LEU A HB2  1 
ATOM 1436  H HB3  . LEU A 1 100 ? 131.579 112.440 -24.030 1.00 0.00 ? 100 LEU A HB3  1 
ATOM 1437  H HG   . LEU A 1 100 ? 130.467 114.180 -25.407 1.00 0.00 ? 100 LEU A HG   1 
ATOM 1438  H HD11 . LEU A 1 100 ? 132.207 115.763 -25.787 1.00 0.00 ? 100 LEU A HD11 1 
ATOM 1439  H HD12 . LEU A 1 100 ? 131.877 115.053 -27.368 1.00 0.00 ? 100 LEU A HD12 1 
ATOM 1440  H HD13 . LEU A 1 100 ? 133.287 114.532 -26.445 1.00 0.00 ? 100 LEU A HD13 1 
ATOM 1441  H HD21 . LEU A 1 100 ? 132.142 112.186 -26.972 1.00 0.00 ? 100 LEU A HD21 1 
ATOM 1442  H HD22 . LEU A 1 100 ? 130.704 113.003 -27.586 1.00 0.00 ? 100 LEU A HD22 1 
ATOM 1443  H HD23 . LEU A 1 100 ? 130.568 111.868 -26.242 1.00 0.00 ? 100 LEU A HD23 1 
ATOM 1444  N N    . GLY A 1 101 ? 133.323 114.501 -21.221 1.00 0.00 ? 101 GLY A N    1 
ATOM 1445  C CA   . GLY A 1 101 ? 133.590 114.041 -19.862 1.00 0.00 ? 101 GLY A CA   1 
ATOM 1446  C C    . GLY A 1 101 ? 132.345 114.175 -18.988 1.00 0.00 ? 101 GLY A C    1 
ATOM 1447  O O    . GLY A 1 101 ? 131.395 114.866 -19.352 1.00 0.00 ? 101 GLY A O    1 
ATOM 1448  H H    . GLY A 1 101 ? 133.703 115.352 -21.524 1.00 0.00 ? 101 GLY A H    1 
ATOM 1449  H HA2  . GLY A 1 101 ? 133.895 113.004 -19.891 1.00 0.00 ? 101 GLY A HA2  1 
ATOM 1450  H HA3  . GLY A 1 101 ? 134.385 114.634 -19.436 1.00 0.00 ? 101 GLY A HA3  1 
ATOM 1451  N N    . LYS A 1 102 ? 132.358 113.506 -17.829 1.00 0.00 ? 102 LYS A N    1 
ATOM 1452  C CA   . LYS A 1 102 ? 131.219 113.549 -16.893 1.00 0.00 ? 102 LYS A CA   1 
ATOM 1453  C C    . LYS A 1 102 ? 131.565 114.382 -15.662 1.00 0.00 ? 102 LYS A C    1 
ATOM 1454  O O    . LYS A 1 102 ? 132.709 114.390 -15.207 1.00 0.00 ? 102 LYS A O    1 
ATOM 1455  C CB   . LYS A 1 102 ? 130.849 112.129 -16.457 1.00 0.00 ? 102 LYS A CB   1 
ATOM 1456  C CG   . LYS A 1 102 ? 130.334 111.342 -17.664 1.00 0.00 ? 102 LYS A CG   1 
ATOM 1457  C CD   . LYS A 1 102 ? 129.940 109.931 -17.223 1.00 0.00 ? 102 LYS A CD   1 
ATOM 1458  C CE   . LYS A 1 102 ? 129.378 109.159 -18.417 1.00 0.00 ? 102 LYS A CE   1 
ATOM 1459  N NZ   . LYS A 1 102 ? 130.440 108.996 -19.449 1.00 0.00 ? 102 LYS A NZ   1 
ATOM 1460  H H    . LYS A 1 102 ? 133.146 112.971 -17.595 1.00 0.00 ? 102 LYS A H    1 
ATOM 1461  H HA   . LYS A 1 102 ? 130.360 113.994 -17.383 1.00 0.00 ? 102 LYS A HA   1 
ATOM 1462  H HB2  . LYS A 1 102 ? 131.724 111.638 -16.052 1.00 0.00 ? 102 LYS A HB2  1 
ATOM 1463  H HB3  . LYS A 1 102 ? 130.078 112.173 -15.703 1.00 0.00 ? 102 LYS A HB3  1 
ATOM 1464  H HG2  . LYS A 1 102 ? 129.474 111.846 -18.080 1.00 0.00 ? 102 LYS A HG2  1 
ATOM 1465  H HG3  . LYS A 1 102 ? 131.112 111.280 -18.412 1.00 0.00 ? 102 LYS A HG3  1 
ATOM 1466  H HD2  . LYS A 1 102 ? 130.810 109.419 -16.838 1.00 0.00 ? 102 LYS A HD2  1 
ATOM 1467  H HD3  . LYS A 1 102 ? 129.188 109.993 -16.450 1.00 0.00 ? 102 LYS A HD3  1 
ATOM 1468  H HE2  . LYS A 1 102 ? 129.042 108.185 -18.091 1.00 0.00 ? 102 LYS A HE2  1 
ATOM 1469  H HE3  . LYS A 1 102 ? 128.545 109.703 -18.839 1.00 0.00 ? 102 LYS A HE3  1 
ATOM 1470  H HZ1  . LYS A 1 102 ? 130.817 109.930 -19.708 1.00 0.00 ? 102 LYS A HZ1  1 
ATOM 1471  H HZ2  . LYS A 1 102 ? 130.037 108.538 -20.293 1.00 0.00 ? 102 LYS A HZ2  1 
ATOM 1472  H HZ3  . LYS A 1 102 ? 131.207 108.408 -19.068 1.00 0.00 ? 102 LYS A HZ3  1 
ATOM 1473  N N    . ASN A 1 103 ? 130.563 115.086 -15.128 1.00 0.00 ? 103 ASN A N    1 
ATOM 1474  C CA   . ASN A 1 103 ? 130.758 115.932 -13.944 1.00 0.00 ? 103 ASN A CA   1 
ATOM 1475  C C    . ASN A 1 103 ? 130.374 115.176 -12.674 1.00 0.00 ? 103 ASN A C    1 
ATOM 1476  O O    . ASN A 1 103 ? 130.339 115.751 -11.585 1.00 0.00 ? 103 ASN A O    1 
ATOM 1477  C CB   . ASN A 1 103 ? 129.903 117.196 -14.063 1.00 0.00 ? 103 ASN A CB   1 
ATOM 1478  C CG   . ASN A 1 103 ? 130.463 118.100 -15.157 1.00 0.00 ? 103 ASN A CG   1 
ATOM 1479  O OD1  . ASN A 1 103 ? 131.627 117.968 -15.535 1.00 0.00 ? 103 ASN A OD1  1 
ATOM 1480  N ND2  . ASN A 1 103 ? 129.701 119.015 -15.689 1.00 0.00 ? 103 ASN A ND2  1 
ATOM 1481  H H    . ASN A 1 103 ? 129.674 115.039 -15.539 1.00 0.00 ? 103 ASN A H    1 
ATOM 1482  H HA   . ASN A 1 103 ? 131.798 116.225 -13.876 1.00 0.00 ? 103 ASN A HA   1 
ATOM 1483  H HB2  . ASN A 1 103 ? 128.888 116.921 -14.311 1.00 0.00 ? 103 ASN A HB2  1 
ATOM 1484  H HB3  . ASN A 1 103 ? 129.913 117.727 -13.123 1.00 0.00 ? 103 ASN A HB3  1 
ATOM 1485  H HD21 . ASN A 1 103 ? 128.775 119.119 -15.386 1.00 0.00 ? 103 ASN A HD21 1 
ATOM 1486  H HD22 . ASN A 1 103 ? 130.055 119.599 -16.392 1.00 0.00 ? 103 ASN A HD22 1 
ATOM 1487  N N    . GLU A 1 104 ? 130.095 113.886 -12.821 1.00 0.00 ? 104 GLU A N    1 
ATOM 1488  C CA   . GLU A 1 104 ? 129.723 113.058 -11.678 1.00 0.00 ? 104 GLU A CA   1 
ATOM 1489  C C    . GLU A 1 104 ? 128.515 113.645 -10.949 1.00 0.00 ? 104 GLU A C    1 
ATOM 1490  O O    . GLU A 1 104 ? 128.653 114.552 -10.128 1.00 0.00 ? 104 GLU A O    1 
ATOM 1491  C CB   . GLU A 1 104 ? 130.907 112.946 -10.716 1.00 0.00 ? 104 GLU A CB   1 
ATOM 1492  C CG   . GLU A 1 104 ? 130.616 111.872 -9.666  1.00 0.00 ? 104 GLU A CG   1 
ATOM 1493  C CD   . GLU A 1 104 ? 131.842 111.661 -8.783  1.00 0.00 ? 104 GLU A CD   1 
ATOM 1494  O OE1  . GLU A 1 104 ? 132.263 112.615 -8.151  1.00 0.00 ? 104 GLU A OE1  1 
ATOM 1495  O OE2  . GLU A 1 104 ? 132.342 110.549 -8.755  1.00 0.00 ? 104 GLU A OE2  1 
ATOM 1496  H H    . GLU A 1 104 ? 130.144 113.481 -13.713 1.00 0.00 ? 104 GLU A H    1 
ATOM 1497  H HA   . GLU A 1 104 ? 129.470 112.070 -12.031 1.00 0.00 ? 104 GLU A HA   1 
ATOM 1498  H HB2  . GLU A 1 104 ? 131.796 112.677 -11.270 1.00 0.00 ? 104 GLU A HB2  1 
ATOM 1499  H HB3  . GLU A 1 104 ? 131.064 113.895 -10.224 1.00 0.00 ? 104 GLU A HB3  1 
ATOM 1500  H HG2  . GLU A 1 104 ? 129.783 112.187 -9.055  1.00 0.00 ? 104 GLU A HG2  1 
ATOM 1501  H HG3  . GLU A 1 104 ? 130.368 110.946 -10.161 1.00 0.00 ? 104 GLU A HG3  1 
ATOM 1502  N N    . GLU A 1 105 ? 127.333 113.117 -11.257 1.00 0.00 ? 105 GLU A N    1 
ATOM 1503  C CA   . GLU A 1 105 ? 126.098 113.588 -10.631 1.00 0.00 ? 105 GLU A CA   1 
ATOM 1504  C C    . GLU A 1 105 ? 125.910 112.948 -9.258  1.00 0.00 ? 105 GLU A C    1 
ATOM 1505  O O    . GLU A 1 105 ? 126.502 111.910 -8.958  1.00 0.00 ? 105 GLU A O    1 
ATOM 1506  C CB   . GLU A 1 105 ? 124.900 113.251 -11.522 1.00 0.00 ? 105 GLU A CB   1 
ATOM 1507  C CG   . GLU A 1 105 ? 125.080 113.910 -12.890 1.00 0.00 ? 105 GLU A CG   1 
ATOM 1508  C CD   . GLU A 1 105 ? 125.004 115.427 -12.753 1.00 0.00 ? 105 GLU A CD   1 
ATOM 1509  O OE1  . GLU A 1 105 ? 124.502 115.886 -11.741 1.00 0.00 ? 105 GLU A OE1  1 
ATOM 1510  O OE2  . GLU A 1 105 ? 125.447 116.107 -13.665 1.00 0.00 ? 105 GLU A OE2  1 
ATOM 1511  H H    . GLU A 1 105 ? 127.289 112.396 -11.920 1.00 0.00 ? 105 GLU A H    1 
ATOM 1512  H HA   . GLU A 1 105 ? 126.151 114.660 -10.513 1.00 0.00 ? 105 GLU A HA   1 
ATOM 1513  H HB2  . GLU A 1 105 ? 124.833 112.179 -11.643 1.00 0.00 ? 105 GLU A HB2  1 
ATOM 1514  H HB3  . GLU A 1 105 ? 123.996 113.618 -11.063 1.00 0.00 ? 105 GLU A HB3  1 
ATOM 1515  H HG2  . GLU A 1 105 ? 126.042 113.634 -13.297 1.00 0.00 ? 105 GLU A HG2  1 
ATOM 1516  H HG3  . GLU A 1 105 ? 124.300 113.572 -13.556 1.00 0.00 ? 105 GLU A HG3  1 
ATOM 1517  N N    . GLY A 1 106 ? 125.078 113.577 -8.426  1.00 0.00 ? 106 GLY A N    1 
ATOM 1518  C CA   . GLY A 1 106 ? 124.807 113.068 -7.077  1.00 0.00 ? 106 GLY A CA   1 
ATOM 1519  C C    . GLY A 1 106 ? 125.750 113.700 -6.061  1.00 0.00 ? 106 GLY A C    1 
ATOM 1520  O O    . GLY A 1 106 ? 126.821 114.194 -6.414  1.00 0.00 ? 106 GLY A O    1 
ATOM 1521  H H    . GLY A 1 106 ? 124.636 114.398 -8.724  1.00 0.00 ? 106 GLY A H    1 
ATOM 1522  H HA2  . GLY A 1 106 ? 123.787 113.307 -6.809  1.00 0.00 ? 106 GLY A HA2  1 
ATOM 1523  H HA3  . GLY A 1 106 ? 124.935 111.994 -7.059  1.00 0.00 ? 106 GLY A HA3  1 
ATOM 1524  N N    . ALA A 1 107 ? 125.345 113.679 -4.795  1.00 0.00 ? 107 ALA A N    1 
ATOM 1525  C CA   . ALA A 1 107 ? 126.160 114.252 -3.727  1.00 0.00 ? 107 ALA A CA   1 
ATOM 1526  C C    . ALA A 1 107 ? 127.357 113.332 -3.432  1.00 0.00 ? 107 ALA A C    1 
ATOM 1527  O O    . ALA A 1 107 ? 127.318 112.140 -3.737  1.00 0.00 ? 107 ALA A O    1 
ATOM 1528  C CB   . ALA A 1 107 ? 125.280 114.444 -2.461  1.00 0.00 ? 107 ALA A CB   1 
ATOM 1529  H H    . ALA A 1 107 ? 124.481 113.269 -4.575  1.00 0.00 ? 107 ALA A H    1 
ATOM 1530  H HA   . ALA A 1 107 ? 126.530 115.214 -4.054  1.00 0.00 ? 107 ALA A HA   1 
ATOM 1531  H HB1  . ALA A 1 107 ? 124.447 113.758 -2.499  1.00 0.00 ? 107 ALA A HB1  1 
ATOM 1532  H HB2  . ALA A 1 107 ? 124.901 115.459 -2.430  1.00 0.00 ? 107 ALA A HB2  1 
ATOM 1533  H HB3  . ALA A 1 107 ? 125.858 114.256 -1.566  1.00 0.00 ? 107 ALA A HB3  1 
ATOM 1534  N N    . PRO A 1 108 ? 128.413 113.860 -2.854  1.00 0.00 ? 108 PRO A N    1 
ATOM 1535  C CA   . PRO A 1 108 ? 129.634 113.054 -2.527  1.00 0.00 ? 108 PRO A CA   1 
ATOM 1536  C C    . PRO A 1 108 ? 129.360 112.033 -1.418  1.00 0.00 ? 108 PRO A C    1 
ATOM 1537  O O    . PRO A 1 108 ? 128.533 112.264 -0.537  1.00 0.00 ? 108 PRO A O    1 
ATOM 1538  C CB   . PRO A 1 108 ? 130.655 114.121 -2.079  1.00 0.00 ? 108 PRO A CB   1 
ATOM 1539  C CG   . PRO A 1 108 ? 129.817 115.248 -1.564  1.00 0.00 ? 108 PRO A CG   1 
ATOM 1540  C CD   . PRO A 1 108 ? 128.570 115.273 -2.450  1.00 0.00 ? 108 PRO A CD   1 
ATOM 1541  H HA   . PRO A 1 108 ? 129.997 112.553 -3.408  1.00 0.00 ? 108 PRO A HA   1 
ATOM 1542  H HB2  . PRO A 1 108 ? 131.301 113.733 -1.296  1.00 0.00 ? 108 PRO A HB2  1 
ATOM 1543  H HB3  . PRO A 1 108 ? 131.246 114.456 -2.920  1.00 0.00 ? 108 PRO A HB3  1 
ATOM 1544  H HG2  . PRO A 1 108 ? 129.540 115.064 -0.530  1.00 0.00 ? 108 PRO A HG2  1 
ATOM 1545  H HG3  . PRO A 1 108 ? 130.345 116.185 -1.648  1.00 0.00 ? 108 PRO A HG3  1 
ATOM 1546  H HD2  . PRO A 1 108 ? 127.713 115.615 -1.890  1.00 0.00 ? 108 PRO A HD2  1 
ATOM 1547  H HD3  . PRO A 1 108 ? 128.731 115.891 -3.319  1.00 0.00 ? 108 PRO A HD3  1 
ATOM 1548  N N    . GLN A 1 109 ? 130.058 110.901 -1.479  1.00 0.00 ? 109 GLN A N    1 
ATOM 1549  C CA   . GLN A 1 109 ? 129.882 109.844 -0.485  1.00 0.00 ? 109 GLN A CA   1 
ATOM 1550  C C    . GLN A 1 109 ? 130.687 110.145 0.773   1.00 0.00 ? 109 GLN A C    1 
ATOM 1551  O O    . GLN A 1 109 ? 131.639 110.926 0.741   1.00 0.00 ? 109 GLN A O    1 
ATOM 1552  C CB   . GLN A 1 109 ? 130.328 108.501 -1.067  1.00 0.00 ? 109 GLN A CB   1 
ATOM 1553  C CG   . GLN A 1 109 ? 129.488 108.180 -2.304  1.00 0.00 ? 109 GLN A CG   1 
ATOM 1554  C CD   . GLN A 1 109 ? 129.919 106.842 -2.894  1.00 0.00 ? 109 GLN A CD   1 
ATOM 1555  O OE1  . GLN A 1 109 ? 129.749 105.800 -2.261  1.00 0.00 ? 109 GLN A OE1  1 
ATOM 1556  N NE2  . GLN A 1 109 ? 130.474 106.808 -4.074  1.00 0.00 ? 109 GLN A NE2  1 
ATOM 1557  H H    . GLN A 1 109 ? 130.699 110.771 -2.209  1.00 0.00 ? 109 GLN A H    1 
ATOM 1558  H HA   . GLN A 1 109 ? 128.837 109.777 -0.222  1.00 0.00 ? 109 GLN A HA   1 
ATOM 1559  H HB2  . GLN A 1 109 ? 131.372 108.558 -1.343  1.00 0.00 ? 109 GLN A HB2  1 
ATOM 1560  H HB3  . GLN A 1 109 ? 130.190 107.725 -0.330  1.00 0.00 ? 109 GLN A HB3  1 
ATOM 1561  H HG2  . GLN A 1 109 ? 128.446 108.130 -2.026  1.00 0.00 ? 109 GLN A HG2  1 
ATOM 1562  H HG3  . GLN A 1 109 ? 129.626 108.957 -3.042  1.00 0.00 ? 109 GLN A HG3  1 
ATOM 1563  H HE21 . GLN A 1 109 ? 130.612 107.639 -4.575  1.00 0.00 ? 109 GLN A HE21 1 
ATOM 1564  H HE22 . GLN A 1 109 ? 130.754 105.952 -4.461  1.00 0.00 ? 109 GLN A HE22 1 
ATOM 1565  N N    . GLU A 1 110 ? 130.297 109.520 1.881   1.00 0.00 ? 110 GLU A N    1 
ATOM 1566  C CA   . GLU A 1 110 ? 130.988 109.727 3.147   1.00 0.00 ? 110 GLU A CA   1 
ATOM 1567  C C    . GLU A 1 110 ? 132.446 109.296 3.031   1.00 0.00 ? 110 GLU A C    1 
ATOM 1568  O O    . GLU A 1 110 ? 132.798 108.487 2.173   1.00 0.00 ? 110 GLU A O    1 
ATOM 1569  C CB   . GLU A 1 110 ? 130.302 108.928 4.259   1.00 0.00 ? 110 GLU A CB   1 
ATOM 1570  C CG   . GLU A 1 110 ? 128.938 109.548 4.567   1.00 0.00 ? 110 GLU A CG   1 
ATOM 1571  C CD   . GLU A 1 110 ? 128.168 108.661 5.540   1.00 0.00 ? 110 GLU A CD   1 
ATOM 1572  O OE1  . GLU A 1 110 ? 128.587 107.533 5.740   1.00 0.00 ? 110 GLU A OE1  1 
ATOM 1573  O OE2  . GLU A 1 110 ? 127.173 109.124 6.072   1.00 0.00 ? 110 GLU A OE2  1 
ATOM 1574  H H    . GLU A 1 110 ? 129.531 108.910 1.844   1.00 0.00 ? 110 GLU A H    1 
ATOM 1575  H HA   . GLU A 1 110 ? 130.952 110.776 3.400   1.00 0.00 ? 110 GLU A HA   1 
ATOM 1576  H HB2  . GLU A 1 110 ? 130.169 107.905 3.938   1.00 0.00 ? 110 GLU A HB2  1 
ATOM 1577  H HB3  . GLU A 1 110 ? 130.914 108.950 5.148   1.00 0.00 ? 110 GLU A HB3  1 
ATOM 1578  H HG2  . GLU A 1 110 ? 129.081 110.525 5.007   1.00 0.00 ? 110 GLU A HG2  1 
ATOM 1579  H HG3  . GLU A 1 110 ? 128.375 109.647 3.651   1.00 0.00 ? 110 GLU A HG3  1 
ATOM 1580  N N    . GLY A 1 111 ? 133.291 109.849 3.893   1.00 0.00 ? 111 GLY A N    1 
ATOM 1581  C CA   . GLY A 1 111 ? 134.711 109.523 3.870   1.00 0.00 ? 111 GLY A CA   1 
ATOM 1582  C C    . GLY A 1 111 ? 134.944 108.063 4.244   1.00 0.00 ? 111 GLY A C    1 
ATOM 1583  O O    . GLY A 1 111 ? 134.095 107.428 4.869   1.00 0.00 ? 111 GLY A O    1 
ATOM 1584  H H    . GLY A 1 111 ? 132.956 110.494 4.551   1.00 0.00 ? 111 GLY A H    1 
ATOM 1585  H HA2  . GLY A 1 111 ? 135.099 109.702 2.877   1.00 0.00 ? 111 GLY A HA2  1 
ATOM 1586  H HA3  . GLY A 1 111 ? 135.231 110.154 4.574   1.00 0.00 ? 111 GLY A HA3  1 
ATOM 1587  N N    . ILE A 1 112 ? 136.098 107.536 3.850   1.00 0.00 ? 112 ILE A N    1 
ATOM 1588  C CA   . ILE A 1 112 ? 136.434 106.146 4.141   1.00 0.00 ? 112 ILE A CA   1 
ATOM 1589  C C    . ILE A 1 112 ? 136.873 105.991 5.595   1.00 0.00 ? 112 ILE A C    1 
ATOM 1590  O O    . ILE A 1 112 ? 137.783 106.679 6.056   1.00 0.00 ? 112 ILE A O    1 
ATOM 1591  C CB   . ILE A 1 112 ? 137.557 105.679 3.217   1.00 0.00 ? 112 ILE A CB   1 
ATOM 1592  C CG1  . ILE A 1 112 ? 137.100 105.795 1.761   1.00 0.00 ? 112 ILE A CG1  1 
ATOM 1593  C CG2  . ILE A 1 112 ? 137.897 104.221 3.524   1.00 0.00 ? 112 ILE A CG2  1 
ATOM 1594  C CD1  . ILE A 1 112 ? 138.297 105.588 0.831   1.00 0.00 ? 112 ILE A CD1  1 
ATOM 1595  H H    . ILE A 1 112 ? 136.736 108.090 3.350   1.00 0.00 ? 112 ILE A H    1 
ATOM 1596  H HA   . ILE A 1 112 ? 135.564 105.532 3.970   1.00 0.00 ? 112 ILE A HA   1 
ATOM 1597  H HB   . ILE A 1 112 ? 138.433 106.294 3.372   1.00 0.00 ? 112 ILE A HB   1 
ATOM 1598  H HG12 . ILE A 1 112 ? 136.351 105.043 1.559   1.00 0.00 ? 112 ILE A HG12 1 
ATOM 1599  H HG13 . ILE A 1 112 ? 136.682 106.776 1.592   1.00 0.00 ? 112 ILE A HG13 1 
ATOM 1600  H HG21 . ILE A 1 112 ? 138.375 104.158 4.491   1.00 0.00 ? 112 ILE A HG21 1 
ATOM 1601  H HG22 . ILE A 1 112 ? 138.566 103.839 2.767   1.00 0.00 ? 112 ILE A HG22 1 
ATOM 1602  H HG23 . ILE A 1 112 ? 136.991 103.635 3.533   1.00 0.00 ? 112 ILE A HG23 1 
ATOM 1603  H HD11 . ILE A 1 112 ? 139.043 106.344 1.029   1.00 0.00 ? 112 ILE A HD11 1 
ATOM 1604  H HD12 . ILE A 1 112 ? 137.972 105.665 -0.197  1.00 0.00 ? 112 ILE A HD12 1 
ATOM 1605  H HD13 . ILE A 1 112 ? 138.721 104.609 1.002   1.00 0.00 ? 112 ILE A HD13 1 
ATOM 1606  N N    . LEU A 1 113 ? 136.218 105.075 6.313   1.00 0.00 ? 113 LEU A N    1 
ATOM 1607  C CA   . LEU A 1 113 ? 136.540 104.824 7.722   1.00 0.00 ? 113 LEU A CA   1 
ATOM 1608  C C    . LEU A 1 113 ? 137.503 103.642 7.841   1.00 0.00 ? 113 LEU A C    1 
ATOM 1609  O O    . LEU A 1 113 ? 138.687 103.755 7.526   1.00 0.00 ? 113 LEU A O    1 
ATOM 1610  C CB   . LEU A 1 113 ? 135.247 104.520 8.515   1.00 0.00 ? 113 LEU A CB   1 
ATOM 1611  C CG   . LEU A 1 113 ? 134.311 103.578 7.688   1.00 0.00 ? 113 LEU A CG   1 
ATOM 1612  C CD1  . LEU A 1 113 ? 133.513 102.665 8.633   1.00 0.00 ? 113 LEU A CD1  1 
ATOM 1613  C CD2  . LEU A 1 113 ? 133.322 104.410 6.847   1.00 0.00 ? 113 LEU A CD2  1 
ATOM 1614  H H    . LEU A 1 113 ? 135.503 104.558 5.887   1.00 0.00 ? 113 LEU A H    1 
ATOM 1615  H HA   . LEU A 1 113 ? 137.011 105.701 8.149   1.00 0.00 ? 113 LEU A HA   1 
ATOM 1616  H HB2  . LEU A 1 113 ? 135.514 104.043 9.455   1.00 0.00 ? 113 LEU A HB2  1 
ATOM 1617  H HB3  . LEU A 1 113 ? 134.735 105.448 8.729   1.00 0.00 ? 113 LEU A HB3  1 
ATOM 1618  H HG   . LEU A 1 113 ? 134.908 102.959 7.029   1.00 0.00 ? 113 LEU A HG   1 
ATOM 1619  H HD11 . LEU A 1 113 ? 132.709 102.193 8.085   1.00 0.00 ? 113 LEU A HD11 1 
ATOM 1620  H HD12 . LEU A 1 113 ? 133.101 103.254 9.439   1.00 0.00 ? 113 LEU A HD12 1 
ATOM 1621  H HD13 . LEU A 1 113 ? 134.166 101.907 9.037   1.00 0.00 ? 113 LEU A HD13 1 
ATOM 1622  H HD21 . LEU A 1 113 ? 133.839 105.237 6.390   1.00 0.00 ? 113 LEU A HD21 1 
ATOM 1623  H HD22 . LEU A 1 113 ? 132.535 104.788 7.483   1.00 0.00 ? 113 LEU A HD22 1 
ATOM 1624  H HD23 . LEU A 1 113 ? 132.892 103.785 6.077   1.00 0.00 ? 113 LEU A HD23 1 
ATOM 1625  N N    . GLU A 1 114 ? 136.978 102.505 8.305   1.00 0.00 ? 114 GLU A N    1 
ATOM 1626  C CA   . GLU A 1 114 ? 137.781 101.288 8.480   1.00 0.00 ? 114 GLU A CA   1 
ATOM 1627  C C    . GLU A 1 114 ? 137.462 100.270 7.388   1.00 0.00 ? 114 GLU A C    1 
ATOM 1628  O O    . GLU A 1 114 ? 136.432 100.362 6.720   1.00 0.00 ? 114 GLU A O    1 
ATOM 1629  C CB   . GLU A 1 114 ? 137.485 100.671 9.850   1.00 0.00 ? 114 GLU A CB   1 
ATOM 1630  C CG   . GLU A 1 114 ? 137.785 101.694 10.949  1.00 0.00 ? 114 GLU A CG   1 
ATOM 1631  C CD   . GLU A 1 114 ? 139.272 102.030 10.960  1.00 0.00 ? 114 GLU A CD   1 
ATOM 1632  O OE1  . GLU A 1 114 ? 140.045 101.229 10.461  1.00 0.00 ? 114 GLU A OE1  1 
ATOM 1633  O OE2  . GLU A 1 114 ? 139.617 103.084 11.470  1.00 0.00 ? 114 GLU A OE2  1 
ATOM 1634  H H    . GLU A 1 114 ? 136.027 102.483 8.541   1.00 0.00 ? 114 GLU A H    1 
ATOM 1635  H HA   . GLU A 1 114 ? 138.835 101.533 8.431   1.00 0.00 ? 114 GLU A HA   1 
ATOM 1636  H HB2  . GLU A 1 114 ? 136.443 100.385 9.897   1.00 0.00 ? 114 GLU A HB2  1 
ATOM 1637  H HB3  . GLU A 1 114 ? 138.104 99.799  9.993   1.00 0.00 ? 114 GLU A HB3  1 
ATOM 1638  H HG2  . GLU A 1 114 ? 137.215 102.594 10.768  1.00 0.00 ? 114 GLU A HG2  1 
ATOM 1639  H HG3  . GLU A 1 114 ? 137.506 101.280 11.907  1.00 0.00 ? 114 GLU A HG3  1 
ATOM 1640  N N    . ASP A 1 115 ? 138.354 99.299  7.219   1.00 0.00 ? 115 ASP A N    1 
ATOM 1641  C CA   . ASP A 1 115 ? 138.163 98.261  6.210   1.00 0.00 ? 115 ASP A CA   1 
ATOM 1642  C C    . ASP A 1 115 ? 136.860 97.513  6.460   1.00 0.00 ? 115 ASP A C    1 
ATOM 1643  O O    . ASP A 1 115 ? 136.145 97.155  5.522   1.00 0.00 ? 115 ASP A O    1 
ATOM 1644  C CB   . ASP A 1 115 ? 139.330 97.273  6.247   1.00 0.00 ? 115 ASP A CB   1 
ATOM 1645  C CG   . ASP A 1 115 ? 139.177 96.245  5.129   1.00 0.00 ? 115 ASP A CG   1 
ATOM 1646  O OD1  . ASP A 1 115 ? 139.286 96.631  3.978   1.00 0.00 ? 115 ASP A OD1  1 
ATOM 1647  O OD2  . ASP A 1 115 ? 138.951 95.088  5.442   1.00 0.00 ? 115 ASP A OD2  1 
ATOM 1648  H H    . ASP A 1 115 ? 139.153 99.279  7.785   1.00 0.00 ? 115 ASP A H    1 
ATOM 1649  H HA   . ASP A 1 115 ? 138.123 98.721  5.235   1.00 0.00 ? 115 ASP A HA   1 
ATOM 1650  H HB2  . ASP A 1 115 ? 140.259 97.810  6.117   1.00 0.00 ? 115 ASP A HB2  1 
ATOM 1651  H HB3  . ASP A 1 115 ? 139.340 96.765  7.200   1.00 0.00 ? 115 ASP A HB3  1 
ATOM 1652  N N    . MET A 1 116 ? 136.559 97.282  7.732   1.00 0.00 ? 116 MET A N    1 
ATOM 1653  C CA   . MET A 1 116 ? 135.340 96.578  8.105   1.00 0.00 ? 116 MET A CA   1 
ATOM 1654  C C    . MET A 1 116 ? 135.149 96.607  9.637   1.00 0.00 ? 116 MET A C    1 
ATOM 1655  O O    . MET A 1 116 ? 134.043 96.847  10.120  1.00 0.00 ? 116 MET A O    1 
ATOM 1656  C CB   . MET A 1 116 ? 135.400 95.105  7.568   1.00 0.00 ? 116 MET A CB   1 
ATOM 1657  C CG   . MET A 1 116 ? 134.108 94.733  6.806   1.00 0.00 ? 116 MET A CG   1 
ATOM 1658  S SD   . MET A 1 116 ? 134.235 93.027  6.209   1.00 0.00 ? 116 MET A SD   1 
ATOM 1659  C CE   . MET A 1 116 ? 132.618 92.936  5.400   1.00 0.00 ? 116 MET A CE   1 
ATOM 1660  H H    . MET A 1 116 ? 137.161 97.595  8.427   1.00 0.00 ? 116 MET A H    1 
ATOM 1661  H HA   . MET A 1 116 ? 134.504 97.092  7.650   1.00 0.00 ? 116 MET A HA   1 
ATOM 1662  H HB2  . MET A 1 116 ? 136.240 95.014  6.896   1.00 0.00 ? 116 MET A HB2  1 
ATOM 1663  H HB3  . MET A 1 116 ? 135.537 94.413  8.389   1.00 0.00 ? 116 MET A HB3  1 
ATOM 1664  H HG2  . MET A 1 116 ? 133.258 94.822  7.467   1.00 0.00 ? 116 MET A HG2  1 
ATOM 1665  H HG3  . MET A 1 116 ? 133.980 95.400  5.966   1.00 0.00 ? 116 MET A HG3  1 
ATOM 1666  H HE1  . MET A 1 116 ? 132.348 93.913  5.022   1.00 0.00 ? 116 MET A HE1  1 
ATOM 1667  H HE2  . MET A 1 116 ? 131.876 92.609  6.109   1.00 0.00 ? 116 MET A HE2  1 
ATOM 1668  H HE3  . MET A 1 116 ? 132.666 92.229  4.581   1.00 0.00 ? 116 MET A HE3  1 
ATOM 1669  N N    . PRO A 1 117 ? 136.196 96.366  10.401  1.00 0.00 ? 117 PRO A N    1 
ATOM 1670  C CA   . PRO A 1 117 ? 136.118 96.370  11.899  1.00 0.00 ? 117 PRO A CA   1 
ATOM 1671  C C    . PRO A 1 117 ? 135.616 97.706  12.447  1.00 0.00 ? 117 PRO A C    1 
ATOM 1672  O O    . PRO A 1 117 ? 135.963 98.769  11.932  1.00 0.00 ? 117 PRO A O    1 
ATOM 1673  C CB   . PRO A 1 117 ? 137.575 96.086  12.333  1.00 0.00 ? 117 PRO A CB   1 
ATOM 1674  C CG   . PRO A 1 117 ? 138.181 95.391  11.159  1.00 0.00 ? 117 PRO A CG   1 
ATOM 1675  C CD   . PRO A 1 117 ? 137.565 96.062  9.943   1.00 0.00 ? 117 PRO A CD   1 
ATOM 1676  H HA   . PRO A 1 117 ? 135.480 95.569  12.236  1.00 0.00 ? 117 PRO A HA   1 
ATOM 1677  H HB2  . PRO A 1 117 ? 138.101 97.013  12.536  1.00 0.00 ? 117 PRO A HB2  1 
ATOM 1678  H HB3  . PRO A 1 117 ? 137.599 95.442  13.199  1.00 0.00 ? 117 PRO A HB3  1 
ATOM 1679  H HG2  . PRO A 1 117 ? 139.257 95.517  11.162  1.00 0.00 ? 117 PRO A HG2  1 
ATOM 1680  H HG3  . PRO A 1 117 ? 137.924 94.343  11.166  1.00 0.00 ? 117 PRO A HG3  1 
ATOM 1681  H HD2  . PRO A 1 117 ? 138.109 96.966  9.709   1.00 0.00 ? 117 PRO A HD2  1 
ATOM 1682  H HD3  . PRO A 1 117 ? 137.543 95.393  9.102   1.00 0.00 ? 117 PRO A HD3  1 
ATOM 1683  N N    . VAL A 1 118 ? 134.796 97.640  13.499  1.00 0.00 ? 118 VAL A N    1 
ATOM 1684  C CA   . VAL A 1 118 ? 134.237 98.845  14.129  1.00 0.00 ? 118 VAL A CA   1 
ATOM 1685  C C    . VAL A 1 118 ? 134.477 98.813  15.632  1.00 0.00 ? 118 VAL A C    1 
ATOM 1686  O O    . VAL A 1 118 ? 134.578 97.745  16.233  1.00 0.00 ? 118 VAL A O    1 
ATOM 1687  C CB   . VAL A 1 118 ? 132.734 98.920  13.852  1.00 0.00 ? 118 VAL A CB   1 
ATOM 1688  C CG1  . VAL A 1 118 ? 132.503 99.077  12.349  1.00 0.00 ? 118 VAL A CG1  1 
ATOM 1689  C CG2  . VAL A 1 118 ? 132.062 97.630  14.333  1.00 0.00 ? 118 VAL A CG2  1 
ATOM 1690  H H    . VAL A 1 118 ? 134.559 96.761  13.862  1.00 0.00 ? 118 VAL A H    1 
ATOM 1691  H HA   . VAL A 1 118 ? 134.711 99.730  13.721  1.00 0.00 ? 118 VAL A HA   1 
ATOM 1692  H HB   . VAL A 1 118 ? 132.310 99.768  14.373  1.00 0.00 ? 118 VAL A HB   1 
ATOM 1693  H HG11 . VAL A 1 118 ? 133.103 98.355  11.815  1.00 0.00 ? 118 VAL A HG11 1 
ATOM 1694  H HG12 . VAL A 1 118 ? 132.785 100.074 12.043  1.00 0.00 ? 118 VAL A HG12 1 
ATOM 1695  H HG13 . VAL A 1 118 ? 131.460 98.913  12.125  1.00 0.00 ? 118 VAL A HG13 1 
ATOM 1696  H HG21 . VAL A 1 118 ? 131.001 97.687  14.146  1.00 0.00 ? 118 VAL A HG21 1 
ATOM 1697  H HG22 . VAL A 1 118 ? 132.234 97.505  15.392  1.00 0.00 ? 118 VAL A HG22 1 
ATOM 1698  H HG23 . VAL A 1 118 ? 132.477 96.788  13.799  1.00 0.00 ? 118 VAL A HG23 1 
ATOM 1699  N N    . ASP A 1 119 ? 134.567 100.002 16.237  1.00 0.00 ? 119 ASP A N    1 
ATOM 1700  C CA   . ASP A 1 119 ? 134.798 100.129 17.684  1.00 0.00 ? 119 ASP A CA   1 
ATOM 1701  C C    . ASP A 1 119 ? 133.807 101.114 18.297  1.00 0.00 ? 119 ASP A C    1 
ATOM 1702  O O    . ASP A 1 119 ? 134.165 102.246 18.618  1.00 0.00 ? 119 ASP A O    1 
ATOM 1703  C CB   . ASP A 1 119 ? 136.224 100.620 17.934  1.00 0.00 ? 119 ASP A CB   1 
ATOM 1704  C CG   . ASP A 1 119 ? 137.222 99.629  17.349  1.00 0.00 ? 119 ASP A CG   1 
ATOM 1705  O OD1  . ASP A 1 119 ? 136.806 98.533  17.012  1.00 0.00 ? 119 ASP A OD1  1 
ATOM 1706  O OD2  . ASP A 1 119 ? 138.385 99.979  17.246  1.00 0.00 ? 119 ASP A OD2  1 
ATOM 1707  H H    . ASP A 1 119 ? 134.478 100.815 15.698  1.00 0.00 ? 119 ASP A H    1 
ATOM 1708  H HA   . ASP A 1 119 ? 134.673 99.164  18.163  1.00 0.00 ? 119 ASP A HA   1 
ATOM 1709  H HB2  . ASP A 1 119 ? 136.359 101.585 17.466  1.00 0.00 ? 119 ASP A HB2  1 
ATOM 1710  H HB3  . ASP A 1 119 ? 136.392 100.712 18.997  1.00 0.00 ? 119 ASP A HB3  1 
ATOM 1711  N N    . PRO A 1 120 ? 132.575 100.708 18.461  1.00 0.00 ? 120 PRO A N    1 
ATOM 1712  C CA   . PRO A 1 120 ? 131.509 101.582 19.048  1.00 0.00 ? 120 PRO A CA   1 
ATOM 1713  C C    . PRO A 1 120 ? 131.940 102.192 20.387  1.00 0.00 ? 120 PRO A C    1 
ATOM 1714  O O    . PRO A 1 120 ? 132.534 101.515 21.226  1.00 0.00 ? 120 PRO A O    1 
ATOM 1715  C CB   . PRO A 1 120 ? 130.323 100.614 19.221  1.00 0.00 ? 120 PRO A CB   1 
ATOM 1716  C CG   . PRO A 1 120 ? 130.540 99.570  18.175  1.00 0.00 ? 120 PRO A CG   1 
ATOM 1717  C CD   . PRO A 1 120 ? 132.052 99.377  18.106  1.00 0.00 ? 120 PRO A CD   1 
ATOM 1718  H HA   . PRO A 1 120 ? 131.242 102.360 18.353  1.00 0.00 ? 120 PRO A HA   1 
ATOM 1719  H HB2  . PRO A 1 120 ? 130.336 100.167 20.211  1.00 0.00 ? 120 PRO A HB2  1 
ATOM 1720  H HB3  . PRO A 1 120 ? 129.386 101.123 19.051  1.00 0.00 ? 120 PRO A HB3  1 
ATOM 1721  H HG2  . PRO A 1 120 ? 130.050 98.645  18.459  1.00 0.00 ? 120 PRO A HG2  1 
ATOM 1722  H HG3  . PRO A 1 120 ? 130.171 99.913  17.219  1.00 0.00 ? 120 PRO A HG3  1 
ATOM 1723  H HD2  . PRO A 1 120 ? 132.372 98.632  18.824  1.00 0.00 ? 120 PRO A HD2  1 
ATOM 1724  H HD3  . PRO A 1 120 ? 132.359 99.107  17.111  1.00 0.00 ? 120 PRO A HD3  1 
ATOM 1725  N N    . ASP A 1 121 ? 131.639 103.482 20.572  1.00 0.00 ? 121 ASP A N    1 
ATOM 1726  C CA   . ASP A 1 121 ? 132.002 104.193 21.808  1.00 0.00 ? 121 ASP A CA   1 
ATOM 1727  C C    . ASP A 1 121 ? 130.857 105.094 22.259  1.00 0.00 ? 121 ASP A C    1 
ATOM 1728  O O    . ASP A 1 121 ? 130.657 105.311 23.454  1.00 0.00 ? 121 ASP A O    1 
ATOM 1729  C CB   . ASP A 1 121 ? 133.249 105.046 21.564  1.00 0.00 ? 121 ASP A CB   1 
ATOM 1730  C CG   . ASP A 1 121 ? 133.711 105.683 22.869  1.00 0.00 ? 121 ASP A CG   1 
ATOM 1731  O OD1  . ASP A 1 121 ? 132.992 105.570 23.847  1.00 0.00 ? 121 ASP A OD1  1 
ATOM 1732  O OD2  . ASP A 1 121 ? 134.778 106.274 22.872  1.00 0.00 ? 121 ASP A OD2  1 
ATOM 1733  H H    . ASP A 1 121 ? 131.168 103.967 19.863  1.00 0.00 ? 121 ASP A H    1 
ATOM 1734  H HA   . ASP A 1 121 ? 132.214 103.479 22.593  1.00 0.00 ? 121 ASP A HA   1 
ATOM 1735  H HB2  . ASP A 1 121 ? 134.037 104.422 21.170  1.00 0.00 ? 121 ASP A HB2  1 
ATOM 1736  H HB3  . ASP A 1 121 ? 133.017 105.822 20.851  1.00 0.00 ? 121 ASP A HB3  1 
ATOM 1737  N N    . ASN A 1 122 ? 130.103 105.612 21.300  1.00 0.00 ? 122 ASN A N    1 
ATOM 1738  C CA   . ASN A 1 122 ? 128.981 106.479 21.622  1.00 0.00 ? 122 ASN A CA   1 
ATOM 1739  C C    . ASN A 1 122 ? 127.818 105.650 22.154  1.00 0.00 ? 122 ASN A C    1 
ATOM 1740  O O    . ASN A 1 122 ? 126.821 106.192 22.632  1.00 0.00 ? 122 ASN A O    1 
ATOM 1741  C CB   . ASN A 1 122 ? 128.540 107.249 20.377  1.00 0.00 ? 122 ASN A CB   1 
ATOM 1742  C CG   . ASN A 1 122 ? 128.056 106.276 19.309  1.00 0.00 ? 122 ASN A CG   1 
ATOM 1743  O OD1  . ASN A 1 122 ? 128.689 105.247 19.073  1.00 0.00 ? 122 ASN A OD1  1 
ATOM 1744  N ND2  . ASN A 1 122 ? 126.963 106.539 18.647  1.00 0.00 ? 122 ASN A ND2  1 
ATOM 1745  H H    . ASN A 1 122 ? 130.302 105.405 20.364  1.00 0.00 ? 122 ASN A H    1 
ATOM 1746  H HA   . ASN A 1 122 ? 129.286 107.183 22.381  1.00 0.00 ? 122 ASN A HA   1 
ATOM 1747  H HB2  . ASN A 1 122 ? 127.740 107.925 20.638  1.00 0.00 ? 122 ASN A HB2  1 
ATOM 1748  H HB3  . ASN A 1 122 ? 129.376 107.814 19.993  1.00 0.00 ? 122 ASN A HB3  1 
ATOM 1749  H HD21 . ASN A 1 122 ? 126.459 107.358 18.838  1.00 0.00 ? 122 ASN A HD21 1 
ATOM 1750  H HD22 . ASN A 1 122 ? 126.645 105.919 17.957  1.00 0.00 ? 122 ASN A HD22 1 
ATOM 1751  N N    . GLU A 1 123 ? 127.957 104.324 22.068  1.00 0.00 ? 123 GLU A N    1 
ATOM 1752  C CA   . GLU A 1 123 ? 126.917 103.408 22.545  1.00 0.00 ? 123 GLU A CA   1 
ATOM 1753  C C    . GLU A 1 123 ? 127.160 103.029 24.002  1.00 0.00 ? 123 GLU A C    1 
ATOM 1754  O O    . GLU A 1 123 ? 126.359 102.316 24.607  1.00 0.00 ? 123 GLU A O    1 
ATOM 1755  C CB   . GLU A 1 123 ? 126.905 102.140 21.688  1.00 0.00 ? 123 GLU A CB   1 
ATOM 1756  C CG   . GLU A 1 123 ? 126.623 102.510 20.231  1.00 0.00 ? 123 GLU A CG   1 
ATOM 1757  C CD   . GLU A 1 123 ? 125.213 103.075 20.099  1.00 0.00 ? 123 GLU A CD   1 
ATOM 1758  O OE1  . GLU A 1 123 ? 124.411 102.825 20.983  1.00 0.00 ? 123 GLU A OE1  1 
ATOM 1759  O OE2  . GLU A 1 123 ? 124.956 103.749 19.116  1.00 0.00 ? 123 GLU A OE2  1 
ATOM 1760  H H    . GLU A 1 123 ? 128.777 103.955 21.678  1.00 0.00 ? 123 GLU A H    1 
ATOM 1761  H HA   . GLU A 1 123 ? 125.951 103.889 22.466  1.00 0.00 ? 123 GLU A HA   1 
ATOM 1762  H HB2  . GLU A 1 123 ? 127.865 101.650 21.757  1.00 0.00 ? 123 GLU A HB2  1 
ATOM 1763  H HB3  . GLU A 1 123 ? 126.133 101.474 22.043  1.00 0.00 ? 123 GLU A HB3  1 
ATOM 1764  H HG2  . GLU A 1 123 ? 127.339 103.250 19.904  1.00 0.00 ? 123 GLU A HG2  1 
ATOM 1765  H HG3  . GLU A 1 123 ? 126.713 101.629 19.614  1.00 0.00 ? 123 GLU A HG3  1 
ATOM 1766  N N    . ALA A 1 124 ? 128.268 103.506 24.562  1.00 0.00 ? 124 ALA A N    1 
ATOM 1767  C CA   . ALA A 1 124 ? 128.595 103.201 25.948  1.00 0.00 ? 124 ALA A CA   1 
ATOM 1768  C C    . ALA A 1 124 ? 127.450 103.617 26.864  1.00 0.00 ? 124 ALA A C    1 
ATOM 1769  O O    . ALA A 1 124 ? 126.844 104.672 26.678  1.00 0.00 ? 124 ALA A O    1 
ATOM 1770  C CB   . ALA A 1 124 ? 129.871 103.938 26.356  1.00 0.00 ? 124 ALA A CB   1 
ATOM 1771  H H    . ALA A 1 124 ? 128.875 104.065 24.036  1.00 0.00 ? 124 ALA A H    1 
ATOM 1772  H HA   . ALA A 1 124 ? 128.756 102.139 26.046  1.00 0.00 ? 124 ALA A HA   1 
ATOM 1773  H HB1  . ALA A 1 124 ? 130.180 103.606 27.336  1.00 0.00 ? 124 ALA A HB1  1 
ATOM 1774  H HB2  . ALA A 1 124 ? 129.681 105.001 26.378  1.00 0.00 ? 124 ALA A HB2  1 
ATOM 1775  H HB3  . ALA A 1 124 ? 130.652 103.726 25.641  1.00 0.00 ? 124 ALA A HB3  1 
ATOM 1776  N N    . TYR A 1 125 ? 127.153 102.778 27.852  1.00 0.00 ? 125 TYR A N    1 
ATOM 1777  C CA   . TYR A 1 125 ? 126.073 103.063 28.791  1.00 0.00 ? 125 TYR A CA   1 
ATOM 1778  C C    . TYR A 1 125 ? 126.279 102.289 30.089  1.00 0.00 ? 125 TYR A C    1 
ATOM 1779  O O    . TYR A 1 125 ? 127.229 101.518 30.216  1.00 0.00 ? 125 TYR A O    1 
ATOM 1780  C CB   . TYR A 1 125 ? 124.723 102.682 28.167  1.00 0.00 ? 125 TYR A CB   1 
ATOM 1781  C CG   . TYR A 1 125 ? 123.596 103.333 28.947  1.00 0.00 ? 125 TYR A CG   1 
ATOM 1782  C CD1  . TYR A 1 125 ? 123.445 104.726 28.923  1.00 0.00 ? 125 TYR A CD1  1 
ATOM 1783  C CD2  . TYR A 1 125 ? 122.701 102.547 29.689  1.00 0.00 ? 125 TYR A CD2  1 
ATOM 1784  C CE1  . TYR A 1 125 ? 122.406 105.331 29.638  1.00 0.00 ? 125 TYR A CE1  1 
ATOM 1785  C CE2  . TYR A 1 125 ? 121.663 103.154 30.404  1.00 0.00 ? 125 TYR A CE2  1 
ATOM 1786  C CZ   . TYR A 1 125 ? 121.515 104.546 30.379  1.00 0.00 ? 125 TYR A CZ   1 
ATOM 1787  O OH   . TYR A 1 125 ? 120.491 105.144 31.085  1.00 0.00 ? 125 TYR A OH   1 
ATOM 1788  H H    . TYR A 1 125 ? 127.668 101.948 27.948  1.00 0.00 ? 125 TYR A H    1 
ATOM 1789  H HA   . TYR A 1 125 ? 126.071 104.121 29.014  1.00 0.00 ? 125 TYR A HA   1 
ATOM 1790  H HB2  . TYR A 1 125 ? 124.694 103.024 27.143  1.00 0.00 ? 125 TYR A HB2  1 
ATOM 1791  H HB3  . TYR A 1 125 ? 124.607 101.608 28.191  1.00 0.00 ? 125 TYR A HB3  1 
ATOM 1792  H HD1  . TYR A 1 125 ? 124.133 105.332 28.352  1.00 0.00 ? 125 TYR A HD1  1 
ATOM 1793  H HD2  . TYR A 1 125 ? 122.815 101.473 29.710  1.00 0.00 ? 125 TYR A HD2  1 
ATOM 1794  H HE1  . TYR A 1 125 ? 122.291 106.405 29.618  1.00 0.00 ? 125 TYR A HE1  1 
ATOM 1795  H HE2  . TYR A 1 125 ? 120.975 102.549 30.976  1.00 0.00 ? 125 TYR A HE2  1 
ATOM 1796  H HH   . TYR A 1 125 ? 120.527 104.823 31.989  1.00 0.00 ? 125 TYR A HH   1 
ATOM 1797  N N    . GLU A 1 126 ? 125.389 102.505 31.048  1.00 0.00 ? 126 GLU A N    1 
ATOM 1798  C CA   . GLU A 1 126 ? 125.485 101.828 32.337  1.00 0.00 ? 126 GLU A CA   1 
ATOM 1799  C C    . GLU A 1 126 ? 125.394 100.314 32.152  1.00 0.00 ? 126 GLU A C    1 
ATOM 1800  O O    . GLU A 1 126 ? 126.116 99.557  32.799  1.00 0.00 ? 126 GLU A O    1 
ATOM 1801  C CB   . GLU A 1 126 ? 124.357 102.310 33.259  1.00 0.00 ? 126 GLU A CB   1 
ATOM 1802  C CG   . GLU A 1 126 ? 124.513 101.696 34.659  1.00 0.00 ? 126 GLU A CG   1 
ATOM 1803  C CD   . GLU A 1 126 ? 125.794 102.204 35.312  1.00 0.00 ? 126 GLU A CD   1 
ATOM 1804  O OE1  . GLU A 1 126 ? 126.289 103.232 34.878  1.00 0.00 ? 126 GLU A OE1  1 
ATOM 1805  O OE2  . GLU A 1 126 ? 126.262 101.558 36.234  1.00 0.00 ? 126 GLU A OE2  1 
ATOM 1806  H H    . GLU A 1 126 ? 124.655 103.135 30.891  1.00 0.00 ? 126 GLU A H    1 
ATOM 1807  H HA   . GLU A 1 126 ? 126.434 102.070 32.788  1.00 0.00 ? 126 GLU A HA   1 
ATOM 1808  H HB2  . GLU A 1 126 ? 124.393 103.387 33.335  1.00 0.00 ? 126 GLU A HB2  1 
ATOM 1809  H HB3  . GLU A 1 126 ? 123.405 102.014 32.844  1.00 0.00 ? 126 GLU A HB3  1 
ATOM 1810  H HG2  . GLU A 1 126 ? 123.667 101.979 35.266  1.00 0.00 ? 126 GLU A HG2  1 
ATOM 1811  H HG3  . GLU A 1 126 ? 124.551 100.621 34.583  1.00 0.00 ? 126 GLU A HG3  1 
ATOM 1812  N N    . MET A 1 127 ? 124.494 99.876  31.264  1.00 0.00 ? 127 MET A N    1 
ATOM 1813  C CA   . MET A 1 127 ? 124.301 98.438  30.994  1.00 0.00 ? 127 MET A CA   1 
ATOM 1814  C C    . MET A 1 127 ? 124.339 98.157  29.490  1.00 0.00 ? 127 MET A C    1 
ATOM 1815  O O    . MET A 1 127 ? 123.298 97.965  28.861  1.00 0.00 ? 127 MET A O    1 
ATOM 1816  C CB   . MET A 1 127 ? 122.950 97.982  31.557  1.00 0.00 ? 127 MET A CB   1 
ATOM 1817  C CG   . MET A 1 127 ? 122.920 98.217  33.074  1.00 0.00 ? 127 MET A CG   1 
ATOM 1818  S SD   . MET A 1 127 ? 121.385 97.548  33.772  1.00 0.00 ? 127 MET A SD   1 
ATOM 1819  C CE   . MET A 1 127 ? 120.309 98.968  33.432  1.00 0.00 ? 127 MET A CE   1 
ATOM 1820  H H    . MET A 1 127 ? 123.946 100.528 30.782  1.00 0.00 ? 127 MET A H    1 
ATOM 1821  H HA   . MET A 1 127 ? 125.087 97.865  31.475  1.00 0.00 ? 127 MET A HA   1 
ATOM 1822  H HB2  . MET A 1 127 ? 122.159 98.541  31.084  1.00 0.00 ? 127 MET A HB2  1 
ATOM 1823  H HB3  . MET A 1 127 ? 122.814 96.929  31.357  1.00 0.00 ? 127 MET A HB3  1 
ATOM 1824  H HG2  . MET A 1 127 ? 123.766 97.725  33.530  1.00 0.00 ? 127 MET A HG2  1 
ATOM 1825  H HG3  . MET A 1 127 ? 122.972 99.278  33.272  1.00 0.00 ? 127 MET A HG3  1 
ATOM 1826  H HE1  . MET A 1 127 ? 120.263 99.599  34.310  1.00 0.00 ? 127 MET A HE1  1 
ATOM 1827  H HE2  . MET A 1 127 ? 119.319 98.620  33.191  1.00 0.00 ? 127 MET A HE2  1 
ATOM 1828  H HE3  . MET A 1 127 ? 120.702 99.530  32.599  1.00 0.00 ? 127 MET A HE3  1 
ATOM 1829  N N    . PRO A 1 128 ? 125.513 98.129  28.909  1.00 0.00 ? 128 PRO A N    1 
ATOM 1830  C CA   . PRO A 1 128 ? 125.688 97.864  27.442  1.00 0.00 ? 128 PRO A CA   1 
ATOM 1831  C C    . PRO A 1 128 ? 125.014 96.557  27.005  1.00 0.00 ? 128 PRO A C    1 
ATOM 1832  O O    . PRO A 1 128 ? 125.114 95.537  27.688  1.00 0.00 ? 128 PRO A O    1 
ATOM 1833  C CB   . PRO A 1 128 ? 127.222 97.784  27.280  1.00 0.00 ? 128 PRO A CB   1 
ATOM 1834  C CG   . PRO A 1 128 ? 127.758 98.602  28.410  1.00 0.00 ? 128 PRO A CG   1 
ATOM 1835  C CD   . PRO A 1 128 ? 126.808 98.351  29.577  1.00 0.00 ? 128 PRO A CD   1 
ATOM 1836  H HA   . PRO A 1 128 ? 125.306 98.690  26.866  1.00 0.00 ? 128 PRO A HA   1 
ATOM 1837  H HB2  . PRO A 1 128 ? 127.563 96.756  27.363  1.00 0.00 ? 128 PRO A HB2  1 
ATOM 1838  H HB3  . PRO A 1 128 ? 127.529 98.208  26.335  1.00 0.00 ? 128 PRO A HB3  1 
ATOM 1839  H HG2  . PRO A 1 128 ? 128.763 98.282  28.663  1.00 0.00 ? 128 PRO A HG2  1 
ATOM 1840  H HG3  . PRO A 1 128 ? 127.751 99.651  28.153  1.00 0.00 ? 128 PRO A HG3  1 
ATOM 1841  H HD2  . PRO A 1 128 ? 127.111 97.471  30.130  1.00 0.00 ? 128 PRO A HD2  1 
ATOM 1842  H HD3  . PRO A 1 128 ? 126.754 99.211  30.221  1.00 0.00 ? 128 PRO A HD3  1 
ATOM 1843  N N    . SER A 1 129 ? 124.331 96.599  25.861  1.00 0.00 ? 129 SER A N    1 
ATOM 1844  C CA   . SER A 1 129 ? 123.645 95.415  25.337  1.00 0.00 ? 129 SER A CA   1 
ATOM 1845  C C    . SER A 1 129 ? 124.600 94.567  24.506  1.00 0.00 ? 129 SER A C    1 
ATOM 1846  O O    . SER A 1 129 ? 125.316 95.083  23.648  1.00 0.00 ? 129 SER A O    1 
ATOM 1847  C CB   . SER A 1 129 ? 122.462 95.841  24.469  1.00 0.00 ? 129 SER A CB   1 
ATOM 1848  O OG   . SER A 1 129 ? 121.855 94.686  23.904  1.00 0.00 ? 129 SER A OG   1 
ATOM 1849  H H    . SER A 1 129 ? 124.287 97.440  25.359  1.00 0.00 ? 129 SER A H    1 
ATOM 1850  H HA   . SER A 1 129 ? 123.275 94.823  26.162  1.00 0.00 ? 129 SER A HA   1 
ATOM 1851  H HB2  . SER A 1 129 ? 121.740 96.363  25.071  1.00 0.00 ? 129 SER A HB2  1 
ATOM 1852  H HB3  . SER A 1 129 ? 122.812 96.498  23.681  1.00 0.00 ? 129 SER A HB3  1 
ATOM 1853  H HG   . SER A 1 129 ? 122.301 94.491  23.077  1.00 0.00 ? 129 SER A HG   1 
ATOM 1854  N N    . GLU A 1 130 ? 124.608 93.263  24.764  1.00 0.00 ? 130 GLU A N    1 
ATOM 1855  C CA   . GLU A 1 130 ? 125.481 92.356  24.028  1.00 0.00 ? 130 GLU A CA   1 
ATOM 1856  C C    . GLU A 1 130 ? 124.901 92.065  22.646  1.00 0.00 ? 130 GLU A C    1 
ATOM 1857  O O    . GLU A 1 130 ? 123.684 91.974  22.480  1.00 0.00 ? 130 GLU A O    1 
ATOM 1858  C CB   . GLU A 1 130 ? 125.648 91.041  24.796  1.00 0.00 ? 130 GLU A CB   1 
ATOM 1859  C CG   . GLU A 1 130 ? 126.249 91.323  26.175  1.00 0.00 ? 130 GLU A CG   1 
ATOM 1860  C CD   . GLU A 1 130 ? 126.483 90.012  26.920  1.00 0.00 ? 130 GLU A CD   1 
ATOM 1861  O OE1  . GLU A 1 130 ? 126.333 88.969  26.304  1.00 0.00 ? 130 GLU A OE1  1 
ATOM 1862  O OE2  . GLU A 1 130 ? 126.814 90.071  28.092  1.00 0.00 ? 130 GLU A OE2  1 
ATOM 1863  H H    . GLU A 1 130 ? 124.015 92.905  25.459  1.00 0.00 ? 130 GLU A H    1 
ATOM 1864  H HA   . GLU A 1 130 ? 126.449 92.819  23.912  1.00 0.00 ? 130 GLU A HA   1 
ATOM 1865  H HB2  . GLU A 1 130 ? 124.684 90.567  24.912  1.00 0.00 ? 130 GLU A HB2  1 
ATOM 1866  H HB3  . GLU A 1 130 ? 126.307 90.385  24.247  1.00 0.00 ? 130 GLU A HB3  1 
ATOM 1867  H HG2  . GLU A 1 130 ? 127.188 91.842  26.057  1.00 0.00 ? 130 GLU A HG2  1 
ATOM 1868  H HG3  . GLU A 1 130 ? 125.567 91.938  26.742  1.00 0.00 ? 130 GLU A HG3  1 
ATOM 1869  N N    . GLU A 1 131 ? 125.782 91.917  21.658  1.00 0.00 ? 131 GLU A N    1 
ATOM 1870  C CA   . GLU A 1 131 ? 125.353 91.628  20.287  1.00 0.00 ? 131 GLU A CA   1 
ATOM 1871  C C    . GLU A 1 131 ? 125.193 90.119  20.101  1.00 0.00 ? 131 GLU A C    1 
ATOM 1872  O O    . GLU A 1 131 ? 126.067 89.344  20.490  1.00 0.00 ? 131 GLU A O    1 
ATOM 1873  C CB   . GLU A 1 131 ? 126.395 92.176  19.295  1.00 0.00 ? 131 GLU A CB   1 
ATOM 1874  C CG   . GLU A 1 131 ? 125.841 92.155  17.858  1.00 0.00 ? 131 GLU A CG   1 
ATOM 1875  C CD   . GLU A 1 131 ? 125.944 90.752  17.267  1.00 0.00 ? 131 GLU A CD   1 
ATOM 1876  O OE1  . GLU A 1 131 ? 126.887 90.056  17.603  1.00 0.00 ? 131 GLU A OE1  1 
ATOM 1877  O OE2  . GLU A 1 131 ? 125.083 90.400  16.474  1.00 0.00 ? 131 GLU A OE2  1 
ATOM 1878  H H    . GLU A 1 131 ? 126.739 91.998  21.853  1.00 0.00 ? 131 GLU A H    1 
ATOM 1879  H HA   . GLU A 1 131 ? 124.401 92.108  20.105  1.00 0.00 ? 131 GLU A HA   1 
ATOM 1880  H HB2  . GLU A 1 131 ? 126.640 93.193  19.566  1.00 0.00 ? 131 GLU A HB2  1 
ATOM 1881  H HB3  . GLU A 1 131 ? 127.287 91.571  19.346  1.00 0.00 ? 131 GLU A HB3  1 
ATOM 1882  H HG2  . GLU A 1 131 ? 124.808 92.467  17.860  1.00 0.00 ? 131 GLU A HG2  1 
ATOM 1883  H HG3  . GLU A 1 131 ? 126.415 92.836  17.249  1.00 0.00 ? 131 GLU A HG3  1 
ATOM 1884  N N    . GLY A 1 132 ? 124.072 89.704  19.518  1.00 0.00 ? 132 GLY A N    1 
ATOM 1885  C CA   . GLY A 1 132 ? 123.820 88.280  19.309  1.00 0.00 ? 132 GLY A CA   1 
ATOM 1886  C C    . GLY A 1 132 ? 124.959 87.632  18.532  1.00 0.00 ? 132 GLY A C    1 
ATOM 1887  O O    . GLY A 1 132 ? 125.456 88.190  17.556  1.00 0.00 ? 132 GLY A O    1 
ATOM 1888  H H    . GLY A 1 132 ? 123.402 90.360  19.233  1.00 0.00 ? 132 GLY A H    1 
ATOM 1889  H HA2  . GLY A 1 132 ? 123.723 87.793  20.270  1.00 0.00 ? 132 GLY A HA2  1 
ATOM 1890  H HA3  . GLY A 1 132 ? 122.902 88.159  18.754  1.00 0.00 ? 132 GLY A HA3  1 
ATOM 1891  N N    . TYR A 1 133 ? 125.368 86.448  18.974  1.00 0.00 ? 133 TYR A N    1 
ATOM 1892  C CA   . TYR A 1 133 ? 126.454 85.731  18.316  1.00 0.00 ? 133 TYR A CA   1 
ATOM 1893  C C    . TYR A 1 133 ? 125.952 85.039  17.056  1.00 0.00 ? 133 TYR A C    1 
ATOM 1894  O O    . TYR A 1 133 ? 126.728 84.432  16.320  1.00 0.00 ? 133 TYR A O    1 
ATOM 1895  C CB   . TYR A 1 133 ? 127.045 84.688  19.268  1.00 0.00 ? 133 TYR A CB   1 
ATOM 1896  C CG   . TYR A 1 133 ? 127.643 85.382  20.469  1.00 0.00 ? 133 TYR A CG   1 
ATOM 1897  C CD1  . TYR A 1 133 ? 128.901 85.990  20.371  1.00 0.00 ? 133 TYR A CD1  1 
ATOM 1898  C CD2  . TYR A 1 133 ? 126.942 85.417  21.682  1.00 0.00 ? 133 TYR A CD2  1 
ATOM 1899  C CE1  . TYR A 1 133 ? 129.457 86.632  21.484  1.00 0.00 ? 133 TYR A CE1  1 
ATOM 1900  C CE2  . TYR A 1 133 ? 127.498 86.059  22.794  1.00 0.00 ? 133 TYR A CE2  1 
ATOM 1901  C CZ   . TYR A 1 133 ? 128.756 86.667  22.695  1.00 0.00 ? 133 TYR A CZ   1 
ATOM 1902  O OH   . TYR A 1 133 ? 129.304 87.300  23.792  1.00 0.00 ? 133 TYR A OH   1 
ATOM 1903  H H    . TYR A 1 133 ? 124.934 86.050  19.757  1.00 0.00 ? 133 TYR A H    1 
ATOM 1904  H HA   . TYR A 1 133 ? 127.227 86.433  18.046  1.00 0.00 ? 133 TYR A HA   1 
ATOM 1905  H HB2  . TYR A 1 133 ? 126.264 84.013  19.591  1.00 0.00 ? 133 TYR A HB2  1 
ATOM 1906  H HB3  . TYR A 1 133 ? 127.814 84.129  18.756  1.00 0.00 ? 133 TYR A HB3  1 
ATOM 1907  H HD1  . TYR A 1 133 ? 129.441 85.964  19.437  1.00 0.00 ? 133 TYR A HD1  1 
ATOM 1908  H HD2  . TYR A 1 133 ? 125.972 84.948  21.758  1.00 0.00 ? 133 TYR A HD2  1 
ATOM 1909  H HE1  . TYR A 1 133 ? 130.427 87.101  21.407  1.00 0.00 ? 133 TYR A HE1  1 
ATOM 1910  H HE2  . TYR A 1 133 ? 126.958 86.086  23.730  1.00 0.00 ? 133 TYR A HE2  1 
ATOM 1911  H HH   . TYR A 1 133 ? 128.816 87.020  24.570  1.00 0.00 ? 133 TYR A HH   1 
ATOM 1912  N N    . GLN A 1 134 ? 124.648 85.127  16.816  1.00 0.00 ? 134 GLN A N    1 
ATOM 1913  C CA   . GLN A 1 134 ? 124.064 84.493  15.643  1.00 0.00 ? 134 GLN A CA   1 
ATOM 1914  C C    . GLN A 1 134 ? 124.666 85.079  14.367  1.00 0.00 ? 134 GLN A C    1 
ATOM 1915  O O    . GLN A 1 134 ? 125.108 84.342  13.490  1.00 0.00 ? 134 GLN A O    1 
ATOM 1916  C CB   . GLN A 1 134 ? 122.546 84.718  15.636  1.00 0.00 ? 134 GLN A CB   1 
ATOM 1917  C CG   . GLN A 1 134 ? 121.910 84.069  16.872  1.00 0.00 ? 134 GLN A CG   1 
ATOM 1918  C CD   . GLN A 1 134 ? 122.126 82.559  16.854  1.00 0.00 ? 134 GLN A CD   1 
ATOM 1919  O OE1  . GLN A 1 134 ? 121.675 81.877  15.932  1.00 0.00 ? 134 GLN A OE1  1 
ATOM 1920  N NE2  . GLN A 1 134 ? 122.798 81.994  17.819  1.00 0.00 ? 134 GLN A NE2  1 
ATOM 1921  H H    . GLN A 1 134 ? 124.073 85.617  17.439  1.00 0.00 ? 134 GLN A H    1 
ATOM 1922  H HA   . GLN A 1 134 ? 124.266 83.434  15.673  1.00 0.00 ? 134 GLN A HA   1 
ATOM 1923  H HB2  . GLN A 1 134 ? 122.342 85.780  15.644  1.00 0.00 ? 134 GLN A HB2  1 
ATOM 1924  H HB3  . GLN A 1 134 ? 122.123 84.279  14.744  1.00 0.00 ? 134 GLN A HB3  1 
ATOM 1925  H HG2  . GLN A 1 134 ? 122.360 84.482  17.763  1.00 0.00 ? 134 GLN A HG2  1 
ATOM 1926  H HG3  . GLN A 1 134 ? 120.850 84.276  16.878  1.00 0.00 ? 134 GLN A HG3  1 
ATOM 1927  H HE21 . GLN A 1 134 ? 123.159 82.540  18.548  1.00 0.00 ? 134 GLN A HE21 1 
ATOM 1928  H HE22 . GLN A 1 134 ? 122.941 81.024  17.814  1.00 0.00 ? 134 GLN A HE22 1 
ATOM 1929  N N    . ASP A 1 135 ? 124.690 86.408  14.282  1.00 0.00 ? 135 ASP A N    1 
ATOM 1930  C CA   . ASP A 1 135 ? 125.251 87.087  13.112  1.00 0.00 ? 135 ASP A CA   1 
ATOM 1931  C C    . ASP A 1 135 ? 124.720 86.466  11.818  1.00 0.00 ? 135 ASP A C    1 
ATOM 1932  O O    . ASP A 1 135 ? 125.392 86.495  10.789  1.00 0.00 ? 135 ASP A O    1 
ATOM 1933  C CB   . ASP A 1 135 ? 126.779 86.994  13.135  1.00 0.00 ? 135 ASP A CB   1 
ATOM 1934  C CG   . ASP A 1 135 ? 127.338 87.856  14.263  1.00 0.00 ? 135 ASP A CG   1 
ATOM 1935  O OD1  . ASP A 1 135 ? 126.594 88.671  14.783  1.00 0.00 ? 135 ASP A OD1  1 
ATOM 1936  O OD2  . ASP A 1 135 ? 128.501 87.687  14.590  1.00 0.00 ? 135 ASP A OD2  1 
ATOM 1937  H H    . ASP A 1 135 ? 124.330 86.942  15.019  1.00 0.00 ? 135 ASP A H    1 
ATOM 1938  H HA   . ASP A 1 135 ? 124.965 88.128  13.142  1.00 0.00 ? 135 ASP A HA   1 
ATOM 1939  H HB2  . ASP A 1 135 ? 127.072 85.966  13.291  1.00 0.00 ? 135 ASP A HB2  1 
ATOM 1940  H HB3  . ASP A 1 135 ? 127.174 87.341  12.192  1.00 0.00 ? 135 ASP A HB3  1 
ATOM 1941  N N    . TYR A 1 136 ? 123.516 85.903  11.884  1.00 0.00 ? 136 TYR A N    1 
ATOM 1942  C CA   . TYR A 1 136 ? 122.907 85.265  10.715  1.00 0.00 ? 136 TYR A CA   1 
ATOM 1943  C C    . TYR A 1 136 ? 123.804 84.151  10.176  1.00 0.00 ? 136 TYR A C    1 
ATOM 1944  O O    . TYR A 1 136 ? 123.766 83.833  8.986   1.00 0.00 ? 136 TYR A O    1 
ATOM 1945  C CB   . TYR A 1 136 ? 122.638 86.294  9.609   1.00 0.00 ? 136 TYR A CB   1 
ATOM 1946  C CG   . TYR A 1 136 ? 121.541 87.236  10.046  1.00 0.00 ? 136 TYR A CG   1 
ATOM 1947  C CD1  . TYR A 1 136 ? 120.199 86.867  9.891   1.00 0.00 ? 136 TYR A CD1  1 
ATOM 1948  C CD2  . TYR A 1 136 ? 121.866 88.477  10.604  1.00 0.00 ? 136 TYR A CD2  1 
ATOM 1949  C CE1  . TYR A 1 136 ? 119.182 87.741  10.296  1.00 0.00 ? 136 TYR A CE1  1 
ATOM 1950  C CE2  . TYR A 1 136 ? 120.849 89.351  11.009  1.00 0.00 ? 136 TYR A CE2  1 
ATOM 1951  C CZ   . TYR A 1 136 ? 119.507 88.983  10.855  1.00 0.00 ? 136 TYR A CZ   1 
ATOM 1952  O OH   . TYR A 1 136 ? 118.504 89.845  11.254  1.00 0.00 ? 136 TYR A OH   1 
ATOM 1953  H H    . TYR A 1 136 ? 123.031 85.907  12.734  1.00 0.00 ? 136 TYR A H    1 
ATOM 1954  H HA   . TYR A 1 136 ? 121.964 84.830  11.015  1.00 0.00 ? 136 TYR A HA   1 
ATOM 1955  H HB2  . TYR A 1 136 ? 123.537 86.857  9.411   1.00 0.00 ? 136 TYR A HB2  1 
ATOM 1956  H HB3  . TYR A 1 136 ? 122.331 85.781  8.709   1.00 0.00 ? 136 TYR A HB3  1 
ATOM 1957  H HD1  . TYR A 1 136 ? 119.948 85.909  9.460   1.00 0.00 ? 136 TYR A HD1  1 
ATOM 1958  H HD2  . TYR A 1 136 ? 122.901 88.762  10.724  1.00 0.00 ? 136 TYR A HD2  1 
ATOM 1959  H HE1  . TYR A 1 136 ? 118.147 87.457  10.177  1.00 0.00 ? 136 TYR A HE1  1 
ATOM 1960  H HE2  . TYR A 1 136 ? 121.100 90.309  11.440  1.00 0.00 ? 136 TYR A HE2  1 
ATOM 1961  H HH   . TYR A 1 136 ? 117.706 89.615  10.772  1.00 0.00 ? 136 TYR A HH   1 
ATOM 1962  N N    . GLU A 1 137 ? 124.603 83.553  11.059  1.00 0.00 ? 137 GLU A N    1 
ATOM 1963  C CA   . GLU A 1 137 ? 125.493 82.467  10.658  1.00 0.00 ? 137 GLU A CA   1 
ATOM 1964  C C    . GLU A 1 137 ? 126.231 82.827  9.371   1.00 0.00 ? 137 GLU A C    1 
ATOM 1965  O O    . GLU A 1 137 ? 125.875 82.353  8.293   1.00 0.00 ? 137 GLU A O    1 
ATOM 1966  C CB   . GLU A 1 137 ? 124.686 81.185  10.449  1.00 0.00 ? 137 GLU A CB   1 
ATOM 1967  C CG   . GLU A 1 137 ? 123.982 80.811  11.756  1.00 0.00 ? 137 GLU A CG   1 
ATOM 1968  C CD   . GLU A 1 137 ? 123.189 79.522  11.574  1.00 0.00 ? 137 GLU A CD   1 
ATOM 1969  O OE1  . GLU A 1 137 ? 123.253 78.957  10.495  1.00 0.00 ? 137 GLU A OE1  1 
ATOM 1970  O OE2  . GLU A 1 137 ? 122.533 79.115  12.519  1.00 0.00 ? 137 GLU A OE2  1 
ATOM 1971  H H    . GLU A 1 137 ? 124.586 83.842  11.991  1.00 0.00 ? 137 GLU A H    1 
ATOM 1972  H HA   . GLU A 1 137 ? 126.210 82.296  11.442  1.00 0.00 ? 137 GLU A HA   1 
ATOM 1973  H HB2  . GLU A 1 137 ? 123.949 81.345  9.675   1.00 0.00 ? 137 GLU A HB2  1 
ATOM 1974  H HB3  . GLU A 1 137 ? 125.348 80.384  10.158  1.00 0.00 ? 137 GLU A HB3  1 
ATOM 1975  H HG2  . GLU A 1 137 ? 124.720 80.673  12.533  1.00 0.00 ? 137 GLU A HG2  1 
ATOM 1976  H HG3  . GLU A 1 137 ? 123.308 81.607  12.039  1.00 0.00 ? 137 GLU A HG3  1 
ATOM 1977  N N    . PRO A 1 138 ? 127.228 83.677  9.453   1.00 0.00 ? 138 PRO A N    1 
ATOM 1978  C CA   . PRO A 1 138 ? 127.995 84.123  8.257   1.00 0.00 ? 138 PRO A CA   1 
ATOM 1979  C C    . PRO A 1 138 ? 129.046 83.098  7.827   1.00 0.00 ? 138 PRO A C    1 
ATOM 1980  O O    . PRO A 1 138 ? 129.637 82.411  8.661   1.00 0.00 ? 138 PRO A O    1 
ATOM 1981  C CB   . PRO A 1 138 ? 128.631 85.437  8.729   1.00 0.00 ? 138 PRO A CB   1 
ATOM 1982  C CG   . PRO A 1 138 ? 128.868 85.236  10.200  1.00 0.00 ? 138 PRO A CG   1 
ATOM 1983  C CD   . PRO A 1 138 ? 127.751 84.290  10.695  1.00 0.00 ? 138 PRO A CD   1 
ATOM 1984  H HA   . PRO A 1 138 ? 127.321 84.324  7.440   1.00 0.00 ? 138 PRO A HA   1 
ATOM 1985  H HB2  . PRO A 1 138 ? 129.565 85.616  8.208   1.00 0.00 ? 138 PRO A HB2  1 
ATOM 1986  H HB3  . PRO A 1 138 ? 127.949 86.262  8.573   1.00 0.00 ? 138 PRO A HB3  1 
ATOM 1987  H HG2  . PRO A 1 138 ? 129.845 84.785  10.359  1.00 0.00 ? 138 PRO A HG2  1 
ATOM 1988  H HG3  . PRO A 1 138 ? 128.809 86.181  10.725  1.00 0.00 ? 138 PRO A HG3  1 
ATOM 1989  H HD2  . PRO A 1 138 ? 128.165 83.533  11.351  1.00 0.00 ? 138 PRO A HD2  1 
ATOM 1990  H HD3  . PRO A 1 138 ? 126.973 84.838  11.197  1.00 0.00 ? 138 PRO A HD3  1 
ATOM 1991  N N    . GLU A 1 139 ? 129.264 83.000  6.520   1.00 0.00 ? 139 GLU A N    1 
ATOM 1992  C CA   . GLU A 1 139 ? 130.237 82.056  5.981   1.00 0.00 ? 139 GLU A CA   1 
ATOM 1993  C C    . GLU A 1 139 ? 131.643 82.400  6.462   1.00 0.00 ? 139 GLU A C    1 
ATOM 1994  O O    . GLU A 1 139 ? 132.437 81.511  6.773   1.00 0.00 ? 139 GLU A O    1 
ATOM 1995  C CB   . GLU A 1 139 ? 130.199 82.087  4.454   1.00 0.00 ? 139 GLU A CB   1 
ATOM 1996  C CG   . GLU A 1 139 ? 128.855 81.543  3.964   1.00 0.00 ? 139 GLU A CG   1 
ATOM 1997  C CD   . GLU A 1 139 ? 128.763 80.047  4.241   1.00 0.00 ? 139 GLU A CD   1 
ATOM 1998  O OE1  . GLU A 1 139 ? 129.790 79.453  4.525   1.00 0.00 ? 139 GLU A OE1  1 
ATOM 1999  O OE2  . GLU A 1 139 ? 127.668 79.516  4.164   1.00 0.00 ? 139 GLU A OE2  1 
ATOM 2000  H H    . GLU A 1 139 ? 128.758 83.571  5.905   1.00 0.00 ? 139 GLU A H    1 
ATOM 2001  H HA   . GLU A 1 139 ? 129.985 81.062  6.317   1.00 0.00 ? 139 GLU A HA   1 
ATOM 2002  H HB2  . GLU A 1 139 ? 130.323 83.104  4.111   1.00 0.00 ? 139 GLU A HB2  1 
ATOM 2003  H HB3  . GLU A 1 139 ? 130.995 81.474  4.062   1.00 0.00 ? 139 GLU A HB3  1 
ATOM 2004  H HG2  . GLU A 1 139 ? 128.053 82.054  4.480   1.00 0.00 ? 139 GLU A HG2  1 
ATOM 2005  H HG3  . GLU A 1 139 ? 128.765 81.716  2.903   1.00 0.00 ? 139 GLU A HG3  1 
ATOM 2006  N N    . ALA A 1 140 ? 131.946 83.693  6.516   1.00 0.00 ? 140 ALA A N    1 
ATOM 2007  C CA   . ALA A 1 140 ? 133.261 84.142  6.958   1.00 0.00 ? 140 ALA A CA   1 
ATOM 2008  C C    . ALA A 1 140 ? 134.362 83.362  6.245   1.00 0.00 ? 140 ALA A C    1 
ATOM 2009  O O    . ALA A 1 140 ? 134.996 82.545  6.892   1.00 0.00 ? 140 ALA A O    1 
ATOM 2010  C CB   . ALA A 1 140 ? 133.395 83.950  8.470   1.00 0.00 ? 140 ALA A CB   1 
ATOM 2011  O OXT  . ALA A 1 140 ? 134.554 83.592  5.062   1.00 0.00 ? 140 ALA A OXT  1 
ATOM 2012  H H    . ALA A 1 140 ? 131.274 84.356  6.254   1.00 0.00 ? 140 ALA A H    1 
ATOM 2013  H HA   . ALA A 1 140 ? 133.369 85.192  6.729   1.00 0.00 ? 140 ALA A HA   1 
ATOM 2014  H HB1  . ALA A 1 140 ? 132.616 84.505  8.973   1.00 0.00 ? 140 ALA A HB1  1 
ATOM 2015  H HB2  . ALA A 1 140 ? 134.360 84.310  8.796   1.00 0.00 ? 140 ALA A HB2  1 
ATOM 2016  H HB3  . ALA A 1 140 ? 133.302 82.901  8.710   1.00 0.00 ? 140 ALA A HB3  1 
ATOM 2017  N N    . MET B 1 1   ? 58.131  134.020 -22.808 1.00 0.00 ? 1   MET B N    1 
ATOM 2018  C CA   . MET B 1 1   ? 57.201  132.923 -22.419 1.00 0.00 ? 1   MET B CA   1 
ATOM 2019  C C    . MET B 1 1   ? 57.881  132.045 -21.367 1.00 0.00 ? 1   MET B C    1 
ATOM 2020  O O    . MET B 1 1   ? 57.281  131.107 -20.843 1.00 0.00 ? 1   MET B O    1 
ATOM 2021  C CB   . MET B 1 1   ? 56.855  132.089 -23.670 1.00 0.00 ? 1   MET B CB   1 
ATOM 2022  C CG   . MET B 1 1   ? 55.731  132.772 -24.459 1.00 0.00 ? 1   MET B CG   1 
ATOM 2023  S SD   . MET B 1 1   ? 56.295  134.401 -25.017 1.00 0.00 ? 1   MET B SD   1 
ATOM 2024  C CE   . MET B 1 1   ? 55.028  134.664 -26.282 1.00 0.00 ? 1   MET B CE   1 
ATOM 2025  H H1   . MET B 1 1   ? 58.208  134.059 -23.844 1.00 0.00 ? 1   MET B H1   1 
ATOM 2026  H H2   . MET B 1 1   ? 59.069  133.843 -22.396 1.00 0.00 ? 1   MET B H2   1 
ATOM 2027  H H3   . MET B 1 1   ? 57.764  134.927 -22.457 1.00 0.00 ? 1   MET B H3   1 
ATOM 2028  H HA   . MET B 1 1   ? 56.298  133.347 -22.001 1.00 0.00 ? 1   MET B HA   1 
ATOM 2029  H HB2  . MET B 1 1   ? 57.731  132.003 -24.295 1.00 0.00 ? 1   MET B HB2  1 
ATOM 2030  H HB3  . MET B 1 1   ? 56.530  131.102 -23.371 1.00 0.00 ? 1   MET B HB3  1 
ATOM 2031  H HG2  . MET B 1 1   ? 55.473  132.168 -25.316 1.00 0.00 ? 1   MET B HG2  1 
ATOM 2032  H HG3  . MET B 1 1   ? 54.864  132.889 -23.826 1.00 0.00 ? 1   MET B HG3  1 
ATOM 2033  H HE1  . MET B 1 1   ? 55.308  134.137 -27.184 1.00 0.00 ? 1   MET B HE1  1 
ATOM 2034  H HE2  . MET B 1 1   ? 54.946  135.717 -26.494 1.00 0.00 ? 1   MET B HE2  1 
ATOM 2035  H HE3  . MET B 1 1   ? 54.078  134.295 -25.922 1.00 0.00 ? 1   MET B HE3  1 
ATOM 2036  N N    . ASP B 1 2   ? 59.137  132.361 -21.064 1.00 0.00 ? 2   ASP B N    1 
ATOM 2037  C CA   . ASP B 1 2   ? 59.894  131.603 -20.075 1.00 0.00 ? 2   ASP B CA   1 
ATOM 2038  C C    . ASP B 1 2   ? 59.521  132.045 -18.665 1.00 0.00 ? 2   ASP B C    1 
ATOM 2039  O O    . ASP B 1 2   ? 59.797  133.175 -18.265 1.00 0.00 ? 2   ASP B O    1 
ATOM 2040  C CB   . ASP B 1 2   ? 61.393  131.814 -20.293 1.00 0.00 ? 2   ASP B CB   1 
ATOM 2041  C CG   . ASP B 1 2   ? 62.190  130.984 -19.293 1.00 0.00 ? 2   ASP B CG   1 
ATOM 2042  O OD1  . ASP B 1 2   ? 62.159  129.770 -19.405 1.00 0.00 ? 2   ASP B OD1  1 
ATOM 2043  O OD2  . ASP B 1 2   ? 62.819  131.575 -18.431 1.00 0.00 ? 2   ASP B OD2  1 
ATOM 2044  H H    . ASP B 1 2   ? 59.563  133.120 -21.513 1.00 0.00 ? 2   ASP B H    1 
ATOM 2045  H HA   . ASP B 1 2   ? 59.670  130.553 -20.186 1.00 0.00 ? 2   ASP B HA   1 
ATOM 2046  H HB2  . ASP B 1 2   ? 61.655  131.514 -21.298 1.00 0.00 ? 2   ASP B HB2  1 
ATOM 2047  H HB3  . ASP B 1 2   ? 61.631  132.859 -20.159 1.00 0.00 ? 2   ASP B HB3  1 
ATOM 2048  N N    . VAL B 1 3   ? 58.887  131.149 -17.917 1.00 0.00 ? 3   VAL B N    1 
ATOM 2049  C CA   . VAL B 1 3   ? 58.479  131.467 -16.555 1.00 0.00 ? 3   VAL B CA   1 
ATOM 2050  C C    . VAL B 1 3   ? 59.689  131.438 -15.628 1.00 0.00 ? 3   VAL B C    1 
ATOM 2051  O O    . VAL B 1 3   ? 60.337  130.403 -15.469 1.00 0.00 ? 3   VAL B O    1 
ATOM 2052  C CB   . VAL B 1 3   ? 57.438  130.454 -16.078 1.00 0.00 ? 3   VAL B CB   1 
ATOM 2053  C CG1  . VAL B 1 3   ? 57.010  130.789 -14.649 1.00 0.00 ? 3   VAL B CG1  1 
ATOM 2054  C CG2  . VAL B 1 3   ? 56.218  130.504 -17.002 1.00 0.00 ? 3   VAL B CG2  1 
ATOM 2055  H H    . VAL B 1 3   ? 58.688  130.264 -18.287 1.00 0.00 ? 3   VAL B H    1 
ATOM 2056  H HA   . VAL B 1 3   ? 58.044  132.455 -16.538 1.00 0.00 ? 3   VAL B HA   1 
ATOM 2057  H HB   . VAL B 1 3   ? 57.867  129.463 -16.101 1.00 0.00 ? 3   VAL B HB   1 
ATOM 2058  H HG11 . VAL B 1 3   ? 56.749  131.834 -14.587 1.00 0.00 ? 3   VAL B HG11 1 
ATOM 2059  H HG12 . VAL B 1 3   ? 57.824  130.580 -13.971 1.00 0.00 ? 3   VAL B HG12 1 
ATOM 2060  H HG13 . VAL B 1 3   ? 56.154  130.187 -14.379 1.00 0.00 ? 3   VAL B HG13 1 
ATOM 2061  H HG21 . VAL B 1 3   ? 55.397  129.973 -16.544 1.00 0.00 ? 3   VAL B HG21 1 
ATOM 2062  H HG22 . VAL B 1 3   ? 56.463  130.042 -17.946 1.00 0.00 ? 3   VAL B HG22 1 
ATOM 2063  H HG23 . VAL B 1 3   ? 55.934  131.533 -17.168 1.00 0.00 ? 3   VAL B HG23 1 
ATOM 2064  N N    . PHE B 1 4   ? 59.993  132.582 -15.025 1.00 0.00 ? 4   PHE B N    1 
ATOM 2065  C CA   . PHE B 1 4   ? 61.135  132.677 -14.122 1.00 0.00 ? 4   PHE B CA   1 
ATOM 2066  C C    . PHE B 1 4   ? 60.871  131.897 -12.839 1.00 0.00 ? 4   PHE B C    1 
ATOM 2067  O O    . PHE B 1 4   ? 61.753  131.212 -12.322 1.00 0.00 ? 4   PHE B O    1 
ATOM 2068  C CB   . PHE B 1 4   ? 61.403  134.143 -13.780 1.00 0.00 ? 4   PHE B CB   1 
ATOM 2069  C CG   . PHE B 1 4   ? 61.699  134.906 -15.052 1.00 0.00 ? 4   PHE B CG   1 
ATOM 2070  C CD1  . PHE B 1 4   ? 62.944  134.771 -15.675 1.00 0.00 ? 4   PHE B CD1  1 
ATOM 2071  C CD2  . PHE B 1 4   ? 60.724  135.746 -15.608 1.00 0.00 ? 4   PHE B CD2  1 
ATOM 2072  C CE1  . PHE B 1 4   ? 63.216  135.475 -16.855 1.00 0.00 ? 4   PHE B CE1  1 
ATOM 2073  C CE2  . PHE B 1 4   ? 60.997  136.450 -16.787 1.00 0.00 ? 4   PHE B CE2  1 
ATOM 2074  C CZ   . PHE B 1 4   ? 62.242  136.315 -17.411 1.00 0.00 ? 4   PHE B CZ   1 
ATOM 2075  H H    . PHE B 1 4   ? 59.446  133.377 -15.194 1.00 0.00 ? 4   PHE B H    1 
ATOM 2076  H HA   . PHE B 1 4   ? 62.006  132.268 -14.611 1.00 0.00 ? 4   PHE B HA   1 
ATOM 2077  H HB2  . PHE B 1 4   ? 60.534  134.565 -13.295 1.00 0.00 ? 4   PHE B HB2  1 
ATOM 2078  H HB3  . PHE B 1 4   ? 62.253  134.209 -13.117 1.00 0.00 ? 4   PHE B HB3  1 
ATOM 2079  H HD1  . PHE B 1 4   ? 63.694  134.124 -15.248 1.00 0.00 ? 4   PHE B HD1  1 
ATOM 2080  H HD2  . PHE B 1 4   ? 59.763  135.853 -15.126 1.00 0.00 ? 4   PHE B HD2  1 
ATOM 2081  H HE1  . PHE B 1 4   ? 64.176  135.371 -17.336 1.00 0.00 ? 4   PHE B HE1  1 
ATOM 2082  H HE2  . PHE B 1 4   ? 60.245  137.099 -17.215 1.00 0.00 ? 4   PHE B HE2  1 
ATOM 2083  H HZ   . PHE B 1 4   ? 62.452  136.856 -18.321 1.00 0.00 ? 4   PHE B HZ   1 
ATOM 2084  N N    . MET B 1 5   ? 59.649  132.011 -12.334 1.00 0.00 ? 5   MET B N    1 
ATOM 2085  C CA   . MET B 1 5   ? 59.266  131.319 -11.108 1.00 0.00 ? 5   MET B CA   1 
ATOM 2086  C C    . MET B 1 5   ? 57.745  131.237 -11.001 1.00 0.00 ? 5   MET B C    1 
ATOM 2087  O O    . MET B 1 5   ? 57.032  132.034 -11.610 1.00 0.00 ? 5   MET B O    1 
ATOM 2088  C CB   . MET B 1 5   ? 59.829  132.066 -9.898  1.00 0.00 ? 5   MET B CB   1 
ATOM 2089  C CG   . MET B 1 5   ? 59.208  133.466 -9.833  1.00 0.00 ? 5   MET B CG   1 
ATOM 2090  S SD   . MET B 1 5   ? 60.095  134.473 -8.613  1.00 0.00 ? 5   MET B SD   1 
ATOM 2091  C CE   . MET B 1 5   ? 61.442  135.031 -9.692  1.00 0.00 ? 5   MET B CE   1 
ATOM 2092  H H    . MET B 1 5   ? 58.991  132.573 -12.792 1.00 0.00 ? 5   MET B H    1 
ATOM 2093  H HA   . MET B 1 5   ? 59.674  130.319 -11.125 1.00 0.00 ? 5   MET B HA   1 
ATOM 2094  H HB2  . MET B 1 5   ? 59.587  131.522 -8.995  1.00 0.00 ? 5   MET B HB2  1 
ATOM 2095  H HB3  . MET B 1 5   ? 60.899  132.151 -9.992  1.00 0.00 ? 5   MET B HB3  1 
ATOM 2096  H HG2  . MET B 1 5   ? 59.276  133.935 -10.803 1.00 0.00 ? 5   MET B HG2  1 
ATOM 2097  H HG3  . MET B 1 5   ? 58.170  133.386 -9.545  1.00 0.00 ? 5   MET B HG3  1 
ATOM 2098  H HE1  . MET B 1 5   ? 61.195  136.001 -10.102 1.00 0.00 ? 5   MET B HE1  1 
ATOM 2099  H HE2  . MET B 1 5   ? 61.579  134.329 -10.496 1.00 0.00 ? 5   MET B HE2  1 
ATOM 2100  H HE3  . MET B 1 5   ? 62.356  135.100 -9.117  1.00 0.00 ? 5   MET B HE3  1 
ATOM 2101  N N    . LYS B 1 6   ? 57.250  130.270 -10.220 1.00 0.00 ? 6   LYS B N    1 
ATOM 2102  C CA   . LYS B 1 6   ? 55.798  130.094 -10.039 1.00 0.00 ? 6   LYS B CA   1 
ATOM 2103  C C    . LYS B 1 6   ? 55.346  130.701 -8.711  1.00 0.00 ? 6   LYS B C    1 
ATOM 2104  O O    . LYS B 1 6   ? 55.801  130.286 -7.644  1.00 0.00 ? 6   LYS B O    1 
ATOM 2105  C CB   . LYS B 1 6   ? 55.447  128.596 -10.054 1.00 0.00 ? 6   LYS B CB   1 
ATOM 2106  C CG   . LYS B 1 6   ? 53.918  128.408 -10.243 1.00 0.00 ? 6   LYS B CG   1 
ATOM 2107  C CD   . LYS B 1 6   ? 53.555  128.399 -11.751 1.00 0.00 ? 6   LYS B CD   1 
ATOM 2108  C CE   . LYS B 1 6   ? 53.720  126.984 -12.327 1.00 0.00 ? 6   LYS B CE   1 
ATOM 2109  N NZ   . LYS B 1 6   ? 52.538  126.154 -11.948 1.00 0.00 ? 6   LYS B NZ   1 
ATOM 2110  H H    . LYS B 1 6   ? 57.867  129.665 -9.759  1.00 0.00 ? 6   LYS B H    1 
ATOM 2111  H HA   . LYS B 1 6   ? 55.268  130.584 -10.846 1.00 0.00 ? 6   LYS B HA   1 
ATOM 2112  H HB2  . LYS B 1 6   ? 55.977  128.112 -10.862 1.00 0.00 ? 6   LYS B HB2  1 
ATOM 2113  H HB3  . LYS B 1 6   ? 55.746  128.152 -9.116  1.00 0.00 ? 6   LYS B HB3  1 
ATOM 2114  H HG2  . LYS B 1 6   ? 53.614  127.473 -9.792  1.00 0.00 ? 6   LYS B HG2  1 
ATOM 2115  H HG3  . LYS B 1 6   ? 53.389  129.219 -9.756  1.00 0.00 ? 6   LYS B HG3  1 
ATOM 2116  H HD2  . LYS B 1 6   ? 52.530  128.715 -11.875 1.00 0.00 ? 6   LYS B HD2  1 
ATOM 2117  H HD3  . LYS B 1 6   ? 54.204  129.077 -12.285 1.00 0.00 ? 6   LYS B HD3  1 
ATOM 2118  H HE2  . LYS B 1 6   ? 53.791  127.039 -13.403 1.00 0.00 ? 6   LYS B HE2  1 
ATOM 2119  H HE3  . LYS B 1 6   ? 54.617  126.533 -11.931 1.00 0.00 ? 6   LYS B HE3  1 
ATOM 2120  H HZ1  . LYS B 1 6   ? 52.010  125.893 -12.803 1.00 0.00 ? 6   LYS B HZ1  1 
ATOM 2121  H HZ2  . LYS B 1 6   ? 51.922  126.701 -11.312 1.00 0.00 ? 6   LYS B HZ2  1 
ATOM 2122  H HZ3  . LYS B 1 6   ? 52.860  125.291 -11.466 1.00 0.00 ? 6   LYS B HZ3  1 
ATOM 2123  N N    . GLY B 1 7   ? 54.443  131.676 -8.778  1.00 0.00 ? 7   GLY B N    1 
ATOM 2124  C CA   . GLY B 1 7   ? 53.936  132.317 -7.569  1.00 0.00 ? 7   GLY B CA   1 
ATOM 2125  C C    . GLY B 1 7   ? 52.902  131.431 -6.886  1.00 0.00 ? 7   GLY B C    1 
ATOM 2126  O O    . GLY B 1 7   ? 52.252  130.610 -7.534  1.00 0.00 ? 7   GLY B O    1 
ATOM 2127  H H    . GLY B 1 7   ? 54.108  131.965 -9.653  1.00 0.00 ? 7   GLY B H    1 
ATOM 2128  H HA2  . GLY B 1 7   ? 54.759  132.493 -6.889  1.00 0.00 ? 7   GLY B HA2  1 
ATOM 2129  H HA3  . GLY B 1 7   ? 53.479  133.258 -7.827  1.00 0.00 ? 7   GLY B HA3  1 
ATOM 2130  N N    . LEU B 1 8   ? 52.749  131.598 -5.569  1.00 0.00 ? 8   LEU B N    1 
ATOM 2131  C CA   . LEU B 1 8   ? 51.780  130.802 -4.794  1.00 0.00 ? 8   LEU B CA   1 
ATOM 2132  C C    . LEU B 1 8   ? 50.573  131.660 -4.410  1.00 0.00 ? 8   LEU B C    1 
ATOM 2133  O O    . LEU B 1 8   ? 50.710  132.663 -3.711  1.00 0.00 ? 8   LEU B O    1 
ATOM 2134  C CB   . LEU B 1 8   ? 52.463  130.257 -3.527  1.00 0.00 ? 8   LEU B CB   1 
ATOM 2135  C CG   . LEU B 1 8   ? 51.466  129.453 -2.666  1.00 0.00 ? 8   LEU B CG   1 
ATOM 2136  C CD1  . LEU B 1 8   ? 50.897  128.267 -3.473  1.00 0.00 ? 8   LEU B CD1  1 
ATOM 2137  C CD2  . LEU B 1 8   ? 52.201  128.926 -1.426  1.00 0.00 ? 8   LEU B CD2  1 
ATOM 2138  H H    . LEU B 1 8   ? 53.294  132.268 -5.105  1.00 0.00 ? 8   LEU B H    1 
ATOM 2139  H HA   . LEU B 1 8   ? 51.439  129.967 -5.392  1.00 0.00 ? 8   LEU B HA   1 
ATOM 2140  H HB2  . LEU B 1 8   ? 53.283  129.616 -3.813  1.00 0.00 ? 8   LEU B HB2  1 
ATOM 2141  H HB3  . LEU B 1 8   ? 52.845  131.084 -2.946  1.00 0.00 ? 8   LEU B HB3  1 
ATOM 2142  H HG   . LEU B 1 8   ? 50.656  130.094 -2.353  1.00 0.00 ? 8   LEU B HG   1 
ATOM 2143  H HD11 . LEU B 1 8   ? 50.530  127.505 -2.796  1.00 0.00 ? 8   LEU B HD11 1 
ATOM 2144  H HD12 . LEU B 1 8   ? 51.671  127.846 -4.098  1.00 0.00 ? 8   LEU B HD12 1 
ATOM 2145  H HD13 . LEU B 1 8   ? 50.082  128.612 -4.092  1.00 0.00 ? 8   LEU B HD13 1 
ATOM 2146  H HD21 . LEU B 1 8   ? 53.069  128.360 -1.733  1.00 0.00 ? 8   LEU B HD21 1 
ATOM 2147  H HD22 . LEU B 1 8   ? 51.538  128.288 -0.860  1.00 0.00 ? 8   LEU B HD22 1 
ATOM 2148  H HD23 . LEU B 1 8   ? 52.511  129.758 -0.811  1.00 0.00 ? 8   LEU B HD23 1 
ATOM 2149  N N    . SER B 1 9   ? 49.390  131.251 -4.867  1.00 0.00 ? 9   SER B N    1 
ATOM 2150  C CA   . SER B 1 9   ? 48.158  131.984 -4.562  1.00 0.00 ? 9   SER B CA   1 
ATOM 2151  C C    . SER B 1 9   ? 48.380  133.495 -4.654  1.00 0.00 ? 9   SER B C    1 
ATOM 2152  O O    . SER B 1 9   ? 48.163  134.219 -3.683  1.00 0.00 ? 9   SER B O    1 
ATOM 2153  C CB   . SER B 1 9   ? 47.676  131.629 -3.155  1.00 0.00 ? 9   SER B CB   1 
ATOM 2154  O OG   . SER B 1 9   ? 46.370  132.158 -2.959  1.00 0.00 ? 9   SER B OG   1 
ATOM 2155  H H    . SER B 1 9   ? 49.342  130.440 -5.416  1.00 0.00 ? 9   SER B H    1 
ATOM 2156  H HA   . SER B 1 9   ? 47.397  131.699 -5.272  1.00 0.00 ? 9   SER B HA   1 
ATOM 2157  H HB2  . SER B 1 9   ? 47.644  130.559 -3.041  1.00 0.00 ? 9   SER B HB2  1 
ATOM 2158  H HB3  . SER B 1 9   ? 48.358  132.047 -2.424  1.00 0.00 ? 9   SER B HB3  1 
ATOM 2159  H HG   . SER B 1 9   ? 45.849  131.960 -3.740  1.00 0.00 ? 9   SER B HG   1 
ATOM 2160  N N    . LYS B 1 10  ? 48.813  133.962 -5.821  1.00 0.00 ? 10  LYS B N    1 
ATOM 2161  C CA   . LYS B 1 10  ? 49.059  135.390 -6.014  1.00 0.00 ? 10  LYS B CA   1 
ATOM 2162  C C    . LYS B 1 10  ? 47.775  136.190 -5.796  1.00 0.00 ? 10  LYS B C    1 
ATOM 2163  O O    . LYS B 1 10  ? 47.789  137.239 -5.153  1.00 0.00 ? 10  LYS B O    1 
ATOM 2164  C CB   . LYS B 1 10  ? 49.601  135.645 -7.425  1.00 0.00 ? 10  LYS B CB   1 
ATOM 2165  C CG   . LYS B 1 10  ? 49.915  137.134 -7.594  1.00 0.00 ? 10  LYS B CG   1 
ATOM 2166  C CD   . LYS B 1 10  ? 50.569  137.366 -8.958  1.00 0.00 ? 10  LYS B CD   1 
ATOM 2167  C CE   . LYS B 1 10  ? 50.887  138.851 -9.127  1.00 0.00 ? 10  LYS B CE   1 
ATOM 2168  N NZ   . LYS B 1 10  ? 51.581  139.066 -10.428 1.00 0.00 ? 10  LYS B NZ   1 
ATOM 2169  H H    . LYS B 1 10  ? 48.971  133.341 -6.563  1.00 0.00 ? 10  LYS B H    1 
ATOM 2170  H HA   . LYS B 1 10  ? 49.796  135.715 -5.295  1.00 0.00 ? 10  LYS B HA   1 
ATOM 2171  H HB2  . LYS B 1 10  ? 50.502  135.067 -7.573  1.00 0.00 ? 10  LYS B HB2  1 
ATOM 2172  H HB3  . LYS B 1 10  ? 48.860  135.352 -8.152  1.00 0.00 ? 10  LYS B HB3  1 
ATOM 2173  H HG2  . LYS B 1 10  ? 49.000  137.706 -7.532  1.00 0.00 ? 10  LYS B HG2  1 
ATOM 2174  H HG3  . LYS B 1 10  ? 50.592  137.451 -6.815  1.00 0.00 ? 10  LYS B HG3  1 
ATOM 2175  H HD2  . LYS B 1 10  ? 51.482  136.792 -9.021  1.00 0.00 ? 10  LYS B HD2  1 
ATOM 2176  H HD3  . LYS B 1 10  ? 49.892  137.053 -9.739  1.00 0.00 ? 10  LYS B HD3  1 
ATOM 2177  H HE2  . LYS B 1 10  ? 49.968  139.420 -9.113  1.00 0.00 ? 10  LYS B HE2  1 
ATOM 2178  H HE3  . LYS B 1 10  ? 51.525  139.178 -8.319  1.00 0.00 ? 10  LYS B HE3  1 
ATOM 2179  H HZ1  . LYS B 1 10  ? 52.504  139.512 -10.258 1.00 0.00 ? 10  LYS B HZ1  1 
ATOM 2180  H HZ2  . LYS B 1 10  ? 51.002  139.683 -11.033 1.00 0.00 ? 10  LYS B HZ2  1 
ATOM 2181  H HZ3  . LYS B 1 10  ? 51.723  138.151 -10.899 1.00 0.00 ? 10  LYS B HZ3  1 
ATOM 2182  N N    . ALA B 1 11  ? 46.668  135.682 -6.332  1.00 0.00 ? 11  ALA B N    1 
ATOM 2183  C CA   . ALA B 1 11  ? 45.380  136.356 -6.183  1.00 0.00 ? 11  ALA B CA   1 
ATOM 2184  C C    . ALA B 1 11  ? 44.957  136.379 -4.716  1.00 0.00 ? 11  ALA B C    1 
ATOM 2185  O O    . ALA B 1 11  ? 45.291  135.474 -3.952  1.00 0.00 ? 11  ALA B O    1 
ATOM 2186  C CB   . ALA B 1 11  ? 44.312  135.638 -7.013  1.00 0.00 ? 11  ALA B CB   1 
ATOM 2187  H H    . ALA B 1 11  ? 46.716  134.841 -6.831  1.00 0.00 ? 11  ALA B H    1 
ATOM 2188  H HA   . ALA B 1 11  ? 45.472  137.372 -6.538  1.00 0.00 ? 11  ALA B HA   1 
ATOM 2189  H HB1  . ALA B 1 11  ? 43.393  136.204 -6.987  1.00 0.00 ? 11  ALA B HB1  1 
ATOM 2190  H HB2  . ALA B 1 11  ? 44.140  134.653 -6.604  1.00 0.00 ? 11  ALA B HB2  1 
ATOM 2191  H HB3  . ALA B 1 11  ? 44.650  135.548 -8.035  1.00 0.00 ? 11  ALA B HB3  1 
ATOM 2192  N N    . LYS B 1 12  ? 44.223  137.418 -4.328  1.00 0.00 ? 12  LYS B N    1 
ATOM 2193  C CA   . LYS B 1 12  ? 43.766  137.543 -2.946  1.00 0.00 ? 12  LYS B CA   1 
ATOM 2194  C C    . LYS B 1 12  ? 42.830  136.383 -2.594  1.00 0.00 ? 12  LYS B C    1 
ATOM 2195  O O    . LYS B 1 12  ? 41.985  135.989 -3.397  1.00 0.00 ? 12  LYS B O    1 
ATOM 2196  C CB   . LYS B 1 12  ? 43.026  138.882 -2.753  1.00 0.00 ? 12  LYS B CB   1 
ATOM 2197  C CG   . LYS B 1 12  ? 44.038  140.026 -2.601  1.00 0.00 ? 12  LYS B CG   1 
ATOM 2198  C CD   . LYS B 1 12  ? 45.035  139.998 -3.766  1.00 0.00 ? 12  LYS B CD   1 
ATOM 2199  C CE   . LYS B 1 12  ? 45.756  141.348 -3.858  1.00 0.00 ? 12  LYS B CE   1 
ATOM 2200  N NZ   . LYS B 1 12  ? 46.409  141.653 -2.554  1.00 0.00 ? 12  LYS B NZ   1 
ATOM 2201  H H    . LYS B 1 12  ? 43.986  138.110 -4.979  1.00 0.00 ? 12  LYS B H    1 
ATOM 2202  H HA   . LYS B 1 12  ? 44.622  137.513 -2.287  1.00 0.00 ? 12  LYS B HA   1 
ATOM 2203  H HB2  . LYS B 1 12  ? 42.400  139.071 -3.613  1.00 0.00 ? 12  LYS B HB2  1 
ATOM 2204  H HB3  . LYS B 1 12  ? 42.411  138.834 -1.866  1.00 0.00 ? 12  LYS B HB3  1 
ATOM 2205  H HG2  . LYS B 1 12  ? 43.511  140.970 -2.597  1.00 0.00 ? 12  LYS B HG2  1 
ATOM 2206  H HG3  . LYS B 1 12  ? 44.573  139.911 -1.670  1.00 0.00 ? 12  LYS B HG3  1 
ATOM 2207  H HD2  . LYS B 1 12  ? 45.759  139.214 -3.601  1.00 0.00 ? 12  LYS B HD2  1 
ATOM 2208  H HD3  . LYS B 1 12  ? 44.507  139.813 -4.689  1.00 0.00 ? 12  LYS B HD3  1 
ATOM 2209  H HE2  . LYS B 1 12  ? 46.505  141.303 -4.635  1.00 0.00 ? 12  LYS B HE2  1 
ATOM 2210  H HE3  . LYS B 1 12  ? 45.040  142.122 -4.093  1.00 0.00 ? 12  LYS B HE3  1 
ATOM 2211  H HZ1  . LYS B 1 12  ? 47.411  141.380 -2.595  1.00 0.00 ? 12  LYS B HZ1  1 
ATOM 2212  H HZ2  . LYS B 1 12  ? 45.934  141.121 -1.796  1.00 0.00 ? 12  LYS B HZ2  1 
ATOM 2213  H HZ3  . LYS B 1 12  ? 46.338  142.671 -2.360  1.00 0.00 ? 12  LYS B HZ3  1 
ATOM 2214  N N    . GLU B 1 13  ? 42.989  135.845 -1.382  1.00 0.00 ? 13  GLU B N    1 
ATOM 2215  C CA   . GLU B 1 13  ? 42.154  134.729 -0.919  1.00 0.00 ? 13  GLU B CA   1 
ATOM 2216  C C    . GLU B 1 13  ? 40.951  135.251 -0.139  1.00 0.00 ? 13  GLU B C    1 
ATOM 2217  O O    . GLU B 1 13  ? 41.080  136.158 0.685   1.00 0.00 ? 13  GLU B O    1 
ATOM 2218  C CB   . GLU B 1 13  ? 42.980  133.800 -0.024  1.00 0.00 ? 13  GLU B CB   1 
ATOM 2219  C CG   . GLU B 1 13  ? 44.026  133.073 -0.871  1.00 0.00 ? 13  GLU B CG   1 
ATOM 2220  C CD   . GLU B 1 13  ? 44.948  132.254 0.026   1.00 0.00 ? 13  GLU B CD   1 
ATOM 2221  O OE1  . GLU B 1 13  ? 44.885  132.435 1.231   1.00 0.00 ? 13  GLU B OE1  1 
ATOM 2222  O OE2  . GLU B 1 13  ? 45.704  131.455 -0.505  1.00 0.00 ? 13  GLU B OE2  1 
ATOM 2223  H H    . GLU B 1 13  ? 43.678  136.204 -0.787  1.00 0.00 ? 13  GLU B H    1 
ATOM 2224  H HA   . GLU B 1 13  ? 41.799  134.164 -1.772  1.00 0.00 ? 13  GLU B HA   1 
ATOM 2225  H HB2  . GLU B 1 13  ? 43.474  134.383 0.739   1.00 0.00 ? 13  GLU B HB2  1 
ATOM 2226  H HB3  . GLU B 1 13  ? 42.329  133.075 0.441   1.00 0.00 ? 13  GLU B HB3  1 
ATOM 2227  H HG2  . GLU B 1 13  ? 43.529  132.415 -1.569  1.00 0.00 ? 13  GLU B HG2  1 
ATOM 2228  H HG3  . GLU B 1 13  ? 44.612  133.798 -1.417  1.00 0.00 ? 13  GLU B HG3  1 
ATOM 2229  N N    . GLY B 1 14  ? 39.783  134.673 -0.400  1.00 0.00 ? 14  GLY B N    1 
ATOM 2230  C CA   . GLY B 1 14  ? 38.565  135.090 0.286   1.00 0.00 ? 14  GLY B CA   1 
ATOM 2231  C C    . GLY B 1 14  ? 38.686  134.870 1.790   1.00 0.00 ? 14  GLY B C    1 
ATOM 2232  O O    . GLY B 1 14  ? 38.235  135.693 2.586   1.00 0.00 ? 14  GLY B O    1 
ATOM 2233  H H    . GLY B 1 14  ? 39.739  133.955 -1.066  1.00 0.00 ? 14  GLY B H    1 
ATOM 2234  H HA2  . GLY B 1 14  ? 38.390  136.139 0.092   1.00 0.00 ? 14  GLY B HA2  1 
ATOM 2235  H HA3  . GLY B 1 14  ? 37.731  134.516 -0.088  1.00 0.00 ? 14  GLY B HA3  1 
ATOM 2236  N N    . VAL B 1 15  ? 39.298  133.747 2.172   1.00 0.00 ? 15  VAL B N    1 
ATOM 2237  C CA   . VAL B 1 15  ? 39.483  133.402 3.592   1.00 0.00 ? 15  VAL B CA   1 
ATOM 2238  C C    . VAL B 1 15  ? 40.924  132.971 3.847   1.00 0.00 ? 15  VAL B C    1 
ATOM 2239  O O    . VAL B 1 15  ? 41.700  132.790 2.910   1.00 0.00 ? 15  VAL B O    1 
ATOM 2240  C CB   . VAL B 1 15  ? 38.541  132.262 3.975   1.00 0.00 ? 15  VAL B CB   1 
ATOM 2241  C CG1  . VAL B 1 15  ? 37.096  132.668 3.681   1.00 0.00 ? 15  VAL B CG1  1 
ATOM 2242  C CG2  . VAL B 1 15  ? 38.898  131.014 3.166   1.00 0.00 ? 15  VAL B CG2  1 
ATOM 2243  H H    . VAL B 1 15  ? 39.632  133.132 1.487   1.00 0.00 ? 15  VAL B H    1 
ATOM 2244  H HA   . VAL B 1 15  ? 39.261  134.263 4.212   1.00 0.00 ? 15  VAL B HA   1 
ATOM 2245  H HB   . VAL B 1 15  ? 38.645  132.051 5.031   1.00 0.00 ? 15  VAL B HB   1 
ATOM 2246  H HG11 . VAL B 1 15  ? 36.428  131.885 4.007   1.00 0.00 ? 15  VAL B HG11 1 
ATOM 2247  H HG12 . VAL B 1 15  ? 36.975  132.824 2.618   1.00 0.00 ? 15  VAL B HG12 1 
ATOM 2248  H HG13 . VAL B 1 15  ? 36.863  133.582 4.207   1.00 0.00 ? 15  VAL B HG13 1 
ATOM 2249  H HG21 . VAL B 1 15  ? 39.812  130.587 3.552   1.00 0.00 ? 15  VAL B HG21 1 
ATOM 2250  H HG22 . VAL B 1 15  ? 39.037  131.284 2.129   1.00 0.00 ? 15  VAL B HG22 1 
ATOM 2251  H HG23 . VAL B 1 15  ? 38.100  130.292 3.248   1.00 0.00 ? 15  VAL B HG23 1 
ATOM 2252  N N    . VAL B 1 16  ? 41.277  132.810 5.126   1.00 0.00 ? 16  VAL B N    1 
ATOM 2253  C CA   . VAL B 1 16  ? 42.640  132.399 5.512   1.00 0.00 ? 16  VAL B CA   1 
ATOM 2254  C C    . VAL B 1 16  ? 42.592  131.131 6.361   1.00 0.00 ? 16  VAL B C    1 
ATOM 2255  O O    . VAL B 1 16  ? 41.578  130.832 6.991   1.00 0.00 ? 16  VAL B O    1 
ATOM 2256  C CB   . VAL B 1 16  ? 43.304  133.517 6.315   1.00 0.00 ? 16  VAL B CB   1 
ATOM 2257  C CG1  . VAL B 1 16  ? 43.372  134.788 5.465   1.00 0.00 ? 16  VAL B CG1  1 
ATOM 2258  C CG2  . VAL B 1 16  ? 42.482  133.790 7.577   1.00 0.00 ? 16  VAL B CG2  1 
ATOM 2259  H H    . VAL B 1 16  ? 40.613  132.972 5.827   1.00 0.00 ? 16  VAL B H    1 
ATOM 2260  H HA   . VAL B 1 16  ? 43.234  132.206 4.625   1.00 0.00 ? 16  VAL B HA   1 
ATOM 2261  H HB   . VAL B 1 16  ? 44.304  133.216 6.593   1.00 0.00 ? 16  VAL B HB   1 
ATOM 2262  H HG11 . VAL B 1 16  ? 43.934  134.589 4.564   1.00 0.00 ? 16  VAL B HG11 1 
ATOM 2263  H HG12 . VAL B 1 16  ? 43.858  135.571 6.027   1.00 0.00 ? 16  VAL B HG12 1 
ATOM 2264  H HG13 . VAL B 1 16  ? 42.371  135.100 5.204   1.00 0.00 ? 16  VAL B HG13 1 
ATOM 2265  H HG21 . VAL B 1 16  ? 42.806  134.718 8.024   1.00 0.00 ? 16  VAL B HG21 1 
ATOM 2266  H HG22 . VAL B 1 16  ? 42.624  132.983 8.281   1.00 0.00 ? 16  VAL B HG22 1 
ATOM 2267  H HG23 . VAL B 1 16  ? 41.436  133.861 7.318   1.00 0.00 ? 16  VAL B HG23 1 
ATOM 2268  N N    . ALA B 1 17  ? 43.697  130.388 6.370   1.00 0.00 ? 17  ALA B N    1 
ATOM 2269  C CA   . ALA B 1 17  ? 43.770  129.151 7.142   1.00 0.00 ? 17  ALA B CA   1 
ATOM 2270  C C    . ALA B 1 17  ? 43.608  129.435 8.631   1.00 0.00 ? 17  ALA B C    1 
ATOM 2271  O O    . ALA B 1 17  ? 44.120  130.433 9.141   1.00 0.00 ? 17  ALA B O    1 
ATOM 2272  C CB   . ALA B 1 17  ? 45.113  128.459 6.897   1.00 0.00 ? 17  ALA B CB   1 
ATOM 2273  H H    . ALA B 1 17  ? 44.474  130.676 5.846   1.00 0.00 ? 17  ALA B H    1 
ATOM 2274  H HA   . ALA B 1 17  ? 42.977  128.492 6.824   1.00 0.00 ? 17  ALA B HA   1 
ATOM 2275  H HB1  . ALA B 1 17  ? 45.917  129.154 7.090   1.00 0.00 ? 17  ALA B HB1  1 
ATOM 2276  H HB2  . ALA B 1 17  ? 45.165  128.123 5.872   1.00 0.00 ? 17  ALA B HB2  1 
ATOM 2277  H HB3  . ALA B 1 17  ? 45.206  127.610 7.560   1.00 0.00 ? 17  ALA B HB3  1 
ATOM 2278  N N    . ALA B 1 18  ? 42.896  128.551 9.324   1.00 0.00 ? 18  ALA B N    1 
ATOM 2279  C CA   . ALA B 1 18  ? 42.676  128.716 10.757  1.00 0.00 ? 18  ALA B CA   1 
ATOM 2280  C C    . ALA B 1 18  ? 43.891  128.230 11.542  1.00 0.00 ? 18  ALA B C    1 
ATOM 2281  O O    . ALA B 1 18  ? 44.278  127.064 11.448  1.00 0.00 ? 18  ALA B O    1 
ATOM 2282  C CB   . ALA B 1 18  ? 41.438  127.927 11.189  1.00 0.00 ? 18  ALA B CB   1 
ATOM 2283  H H    . ALA B 1 18  ? 42.515  127.774 8.865   1.00 0.00 ? 18  ALA B H    1 
ATOM 2284  H HA   . ALA B 1 18  ? 42.515  129.762 10.972  1.00 0.00 ? 18  ALA B HA   1 
ATOM 2285  H HB1  . ALA B 1 18  ? 41.630  126.870 11.082  1.00 0.00 ? 18  ALA B HB1  1 
ATOM 2286  H HB2  . ALA B 1 18  ? 40.599  128.206 10.569  1.00 0.00 ? 18  ALA B HB2  1 
ATOM 2287  H HB3  . ALA B 1 18  ? 41.213  128.149 12.222  1.00 0.00 ? 18  ALA B HB3  1 
ATOM 2288  N N    . ALA B 1 19  ? 44.483  129.132 12.318  1.00 0.00 ? 19  ALA B N    1 
ATOM 2289  C CA   . ALA B 1 19  ? 45.652  128.791 13.121  1.00 0.00 ? 19  ALA B CA   1 
ATOM 2290  C C    . ALA B 1 19  ? 45.292  127.751 14.175  1.00 0.00 ? 19  ALA B C    1 
ATOM 2291  O O    . ALA B 1 19  ? 46.164  127.069 14.713  1.00 0.00 ? 19  ALA B O    1 
ATOM 2292  C CB   . ALA B 1 19  ? 46.202  130.046 13.801  1.00 0.00 ? 19  ALA B CB   1 
ATOM 2293  H H    . ALA B 1 19  ? 44.126  130.043 12.353  1.00 0.00 ? 19  ALA B H    1 
ATOM 2294  H HA   . ALA B 1 19  ? 46.414  128.385 12.473  1.00 0.00 ? 19  ALA B HA   1 
ATOM 2295  H HB1  . ALA B 1 19  ? 46.235  130.856 13.088  1.00 0.00 ? 19  ALA B HB1  1 
ATOM 2296  H HB2  . ALA B 1 19  ? 47.198  129.850 14.169  1.00 0.00 ? 19  ALA B HB2  1 
ATOM 2297  H HB3  . ALA B 1 19  ? 45.561  130.319 14.626  1.00 0.00 ? 19  ALA B HB3  1 
ATOM 2298  N N    . GLU B 1 20  ? 44.002  127.637 14.465  1.00 0.00 ? 20  GLU B N    1 
ATOM 2299  C CA   . GLU B 1 20  ? 43.533  126.681 15.458  1.00 0.00 ? 20  GLU B CA   1 
ATOM 2300  C C    . GLU B 1 20  ? 43.922  125.262 15.058  1.00 0.00 ? 20  GLU B C    1 
ATOM 2301  O O    . GLU B 1 20  ? 44.273  124.444 15.908  1.00 0.00 ? 20  GLU B O    1 
ATOM 2302  C CB   . GLU B 1 20  ? 42.008  126.774 15.595  1.00 0.00 ? 20  GLU B CB   1 
ATOM 2303  C CG   . GLU B 1 20  ? 41.532  125.935 16.792  1.00 0.00 ? 20  GLU B CG   1 
ATOM 2304  C CD   . GLU B 1 20  ? 41.529  124.450 16.435  1.00 0.00 ? 20  GLU B CD   1 
ATOM 2305  O OE1  . GLU B 1 20  ? 41.351  124.138 15.269  1.00 0.00 ? 20  GLU B OE1  1 
ATOM 2306  O OE2  . GLU B 1 20  ? 41.708  123.646 17.335  1.00 0.00 ? 20  GLU B OE2  1 
ATOM 2307  H H    . GLU B 1 20  ? 43.354  128.209 14.003  1.00 0.00 ? 20  GLU B H    1 
ATOM 2308  H HA   . GLU B 1 20  ? 43.987  126.916 16.408  1.00 0.00 ? 20  GLU B HA   1 
ATOM 2309  H HB2  . GLU B 1 20  ? 41.727  127.806 15.746  1.00 0.00 ? 20  GLU B HB2  1 
ATOM 2310  H HB3  . GLU B 1 20  ? 41.544  126.407 14.693  1.00 0.00 ? 20  GLU B HB3  1 
ATOM 2311  H HG2  . GLU B 1 20  ? 42.188  126.098 17.633  1.00 0.00 ? 20  GLU B HG2  1 
ATOM 2312  H HG3  . GLU B 1 20  ? 40.530  126.236 17.059  1.00 0.00 ? 20  GLU B HG3  1 
ATOM 2313  N N    . LYS B 1 21  ? 43.855  124.972 13.763  1.00 0.00 ? 21  LYS B N    1 
ATOM 2314  C CA   . LYS B 1 21  ? 44.201  123.643 13.273  1.00 0.00 ? 21  LYS B CA   1 
ATOM 2315  C C    . LYS B 1 21  ? 45.641  123.297 13.642  1.00 0.00 ? 21  LYS B C    1 
ATOM 2316  O O    . LYS B 1 21  ? 46.552  124.103 13.456  1.00 0.00 ? 21  LYS B O    1 
ATOM 2317  C CB   . LYS B 1 21  ? 44.034  123.586 11.752  1.00 0.00 ? 21  LYS B CB   1 
ATOM 2318  C CG   . LYS B 1 21  ? 42.544  123.575 11.399  1.00 0.00 ? 21  LYS B CG   1 
ATOM 2319  C CD   . LYS B 1 21  ? 42.350  123.885 9.907   1.00 0.00 ? 21  LYS B CD   1 
ATOM 2320  C CE   . LYS B 1 21  ? 43.111  122.867 9.054   1.00 0.00 ? 21  LYS B CE   1 
ATOM 2321  N NZ   . LYS B 1 21  ? 42.827  121.491 9.549   1.00 0.00 ? 21  LYS B NZ   1 
ATOM 2322  H H    . LYS B 1 21  ? 43.568  125.663 13.126  1.00 0.00 ? 21  LYS B H    1 
ATOM 2323  H HA   . LYS B 1 21  ? 43.540  122.918 13.724  1.00 0.00 ? 21  LYS B HA   1 
ATOM 2324  H HB2  . LYS B 1 21  ? 44.507  124.449 11.304  1.00 0.00 ? 21  LYS B HB2  1 
ATOM 2325  H HB3  . LYS B 1 21  ? 44.496  122.685 11.378  1.00 0.00 ? 21  LYS B HB3  1 
ATOM 2326  H HG2  . LYS B 1 21  ? 42.130  122.602 11.620  1.00 0.00 ? 21  LYS B HG2  1 
ATOM 2327  H HG3  . LYS B 1 21  ? 42.031  124.323 11.988  1.00 0.00 ? 21  LYS B HG3  1 
ATOM 2328  H HD2  . LYS B 1 21  ? 41.298  123.838 9.666   1.00 0.00 ? 21  LYS B HD2  1 
ATOM 2329  H HD3  . LYS B 1 21  ? 42.721  124.877 9.696   1.00 0.00 ? 21  LYS B HD3  1 
ATOM 2330  H HE2  . LYS B 1 21  ? 42.789  122.950 8.027   1.00 0.00 ? 21  LYS B HE2  1 
ATOM 2331  H HE3  . LYS B 1 21  ? 44.170  123.062 9.112   1.00 0.00 ? 21  LYS B HE3  1 
ATOM 2332  H HZ1  . LYS B 1 21  ? 42.894  120.817 8.761   1.00 0.00 ? 21  LYS B HZ1  1 
ATOM 2333  H HZ2  . LYS B 1 21  ? 41.867  121.460 9.954   1.00 0.00 ? 21  LYS B HZ2  1 
ATOM 2334  H HZ3  . LYS B 1 21  ? 43.520  121.236 10.281  1.00 0.00 ? 21  LYS B HZ3  1 
ATOM 2335  N N    . THR B 1 22  ? 45.837  122.087 14.166  1.00 0.00 ? 22  THR B N    1 
ATOM 2336  C CA   . THR B 1 22  ? 47.170  121.631 14.561  1.00 0.00 ? 22  THR B CA   1 
ATOM 2337  C C    . THR B 1 22  ? 47.903  121.008 13.377  1.00 0.00 ? 22  THR B C    1 
ATOM 2338  O O    . THR B 1 22  ? 49.130  121.068 13.293  1.00 0.00 ? 22  THR B O    1 
ATOM 2339  C CB   . THR B 1 22  ? 47.054  120.603 15.689  1.00 0.00 ? 22  THR B CB   1 
ATOM 2340  O OG1  . THR B 1 22  ? 48.284  119.904 15.820  1.00 0.00 ? 22  THR B OG1  1 
ATOM 2341  C CG2  . THR B 1 22  ? 45.930  119.614 15.374  1.00 0.00 ? 22  THR B CG2  1 
ATOM 2342  H H    . THR B 1 22  ? 45.071  121.489 14.288  1.00 0.00 ? 22  THR B H    1 
ATOM 2343  H HA   . THR B 1 22  ? 47.742  122.475 14.921  1.00 0.00 ? 22  THR B HA   1 
ATOM 2344  H HB   . THR B 1 22  ? 46.829  121.111 16.615  1.00 0.00 ? 22  THR B HB   1 
ATOM 2345  H HG1  . THR B 1 22  ? 48.432  119.736 16.753  1.00 0.00 ? 22  THR B HG1  1 
ATOM 2346  H HG21 . THR B 1 22  ? 46.026  118.746 16.009  1.00 0.00 ? 22  THR B HG21 1 
ATOM 2347  H HG22 . THR B 1 22  ? 45.996  119.312 14.341  1.00 0.00 ? 22  THR B HG22 1 
ATOM 2348  H HG23 . THR B 1 22  ? 44.975  120.086 15.551  1.00 0.00 ? 22  THR B HG23 1 
ATOM 2349  N N    . LYS B 1 23  ? 47.145  120.410 12.463  1.00 0.00 ? 23  LYS B N    1 
ATOM 2350  C CA   . LYS B 1 23  ? 47.738  119.781 11.290  1.00 0.00 ? 23  LYS B CA   1 
ATOM 2351  C C    . LYS B 1 23  ? 48.323  120.836 10.357  1.00 0.00 ? 23  LYS B C    1 
ATOM 2352  O O    . LYS B 1 23  ? 47.738  121.903 10.168  1.00 0.00 ? 23  LYS B O    1 
ATOM 2353  C CB   . LYS B 1 23  ? 46.683  118.963 10.544  1.00 0.00 ? 23  LYS B CB   1 
ATOM 2354  C CG   . LYS B 1 23  ? 46.267  117.764 11.399  1.00 0.00 ? 23  LYS B CG   1 
ATOM 2355  C CD   . LYS B 1 23  ? 45.206  116.949 10.658  1.00 0.00 ? 23  LYS B CD   1 
ATOM 2356  C CE   . LYS B 1 23  ? 44.799  115.746 11.510  1.00 0.00 ? 23  LYS B CE   1 
ATOM 2357  N NZ   . LYS B 1 23  ? 43.758  114.958 10.793  1.00 0.00 ? 23  LYS B NZ   1 
ATOM 2358  H H    . LYS B 1 23  ? 46.172  120.392 12.580  1.00 0.00 ? 23  LYS B H    1 
ATOM 2359  H HA   . LYS B 1 23  ? 48.530  119.120 11.610  1.00 0.00 ? 23  LYS B HA   1 
ATOM 2360  H HB2  . LYS B 1 23  ? 45.820  119.583 10.348  1.00 0.00 ? 23  LYS B HB2  1 
ATOM 2361  H HB3  . LYS B 1 23  ? 47.093  118.611 9.610   1.00 0.00 ? 23  LYS B HB3  1 
ATOM 2362  H HG2  . LYS B 1 23  ? 47.130  117.142 11.591  1.00 0.00 ? 23  LYS B HG2  1 
ATOM 2363  H HG3  . LYS B 1 23  ? 45.859  118.113 12.334  1.00 0.00 ? 23  LYS B HG3  1 
ATOM 2364  H HD2  . LYS B 1 23  ? 44.340  117.570 10.473  1.00 0.00 ? 23  LYS B HD2  1 
ATOM 2365  H HD3  . LYS B 1 23  ? 45.608  116.603 9.718   1.00 0.00 ? 23  LYS B HD3  1 
ATOM 2366  H HE2  . LYS B 1 23  ? 45.663  115.123 11.689  1.00 0.00 ? 23  LYS B HE2  1 
ATOM 2367  H HE3  . LYS B 1 23  ? 44.402  116.091 12.454  1.00 0.00 ? 23  LYS B HE3  1 
ATOM 2368  H HZ1  . LYS B 1 23  ? 42.935  115.563 10.601  1.00 0.00 ? 23  LYS B HZ1  1 
ATOM 2369  H HZ2  . LYS B 1 23  ? 43.466  114.152 11.383  1.00 0.00 ? 23  LYS B HZ2  1 
ATOM 2370  H HZ3  . LYS B 1 23  ? 44.146  114.608 9.894   1.00 0.00 ? 23  LYS B HZ3  1 
ATOM 2371  N N    . GLN B 1 24  ? 49.479  120.530 9.779   1.00 0.00 ? 24  GLN B N    1 
ATOM 2372  C CA   . GLN B 1 24  ? 50.136  121.460 8.869   1.00 0.00 ? 24  GLN B CA   1 
ATOM 2373  C C    . GLN B 1 24  ? 50.275  122.833 9.517   1.00 0.00 ? 24  GLN B C    1 
ATOM 2374  O O    . GLN B 1 24  ? 50.043  123.859 8.877   1.00 0.00 ? 24  GLN B O    1 
ATOM 2375  C CB   . GLN B 1 24  ? 49.328  121.586 7.575   1.00 0.00 ? 24  GLN B CB   1 
ATOM 2376  C CG   . GLN B 1 24  ? 49.386  120.265 6.806   1.00 0.00 ? 24  GLN B CG   1 
ATOM 2377  C CD   . GLN B 1 24  ? 48.423  120.309 5.625   1.00 0.00 ? 24  GLN B CD   1 
ATOM 2378  O OE1  . GLN B 1 24  ? 47.419  121.021 5.667   1.00 0.00 ? 24  GLN B OE1  1 
ATOM 2379  N NE2  . GLN B 1 24  ? 48.667  119.584 4.568   1.00 0.00 ? 24  GLN B NE2  1 
ATOM 2380  H H    . GLN B 1 24  ? 49.898  119.666 9.970   1.00 0.00 ? 24  GLN B H    1 
ATOM 2381  H HA   . GLN B 1 24  ? 51.118  121.083 8.631   1.00 0.00 ? 24  GLN B HA   1 
ATOM 2382  H HB2  . GLN B 1 24  ? 48.300  121.820 7.815   1.00 0.00 ? 24  GLN B HB2  1 
ATOM 2383  H HB3  . GLN B 1 24  ? 49.745  122.373 6.967   1.00 0.00 ? 24  GLN B HB3  1 
ATOM 2384  H HG2  . GLN B 1 24  ? 50.391  120.106 6.444   1.00 0.00 ? 24  GLN B HG2  1 
ATOM 2385  H HG3  . GLN B 1 24  ? 49.108  119.455 7.464   1.00 0.00 ? 24  GLN B HG3  1 
ATOM 2386  H HE21 . GLN B 1 24  ? 49.465  119.016 4.537   1.00 0.00 ? 24  GLN B HE21 1 
ATOM 2387  H HE22 . GLN B 1 24  ? 48.053  119.607 3.805   1.00 0.00 ? 24  GLN B HE22 1 
ATOM 2388  N N    . GLY B 1 25  ? 50.652  122.846 10.792  1.00 0.00 ? 25  GLY B N    1 
ATOM 2389  C CA   . GLY B 1 25  ? 50.815  124.103 11.513  1.00 0.00 ? 25  GLY B CA   1 
ATOM 2390  C C    . GLY B 1 25  ? 51.957  124.923 10.924  1.00 0.00 ? 25  GLY B C    1 
ATOM 2391  O O    . GLY B 1 25  ? 51.729  125.867 10.169  1.00 0.00 ? 25  GLY B O    1 
ATOM 2392  H H    . GLY B 1 25  ? 50.822  121.999 11.254  1.00 0.00 ? 25  GLY B H    1 
ATOM 2393  H HA2  . GLY B 1 25  ? 49.898  124.671 11.446  1.00 0.00 ? 25  GLY B HA2  1 
ATOM 2394  H HA3  . GLY B 1 25  ? 51.030  123.893 12.549  1.00 0.00 ? 25  GLY B HA3  1 
ATOM 2395  N N    . VAL B 1 26  ? 53.193  124.553 11.273  1.00 0.00 ? 26  VAL B N    1 
ATOM 2396  C CA   . VAL B 1 26  ? 54.382  125.259 10.773  1.00 0.00 ? 26  VAL B CA   1 
ATOM 2397  C C    . VAL B 1 26  ? 55.487  124.266 10.426  1.00 0.00 ? 26  VAL B C    1 
ATOM 2398  O O    . VAL B 1 26  ? 55.489  123.133 10.906  1.00 0.00 ? 26  VAL B O    1 
ATOM 2399  C CB   . VAL B 1 26  ? 54.892  126.236 11.833  1.00 0.00 ? 26  VAL B CB   1 
ATOM 2400  C CG1  . VAL B 1 26  ? 53.807  127.268 12.146  1.00 0.00 ? 26  VAL B CG1  1 
ATOM 2401  C CG2  . VAL B 1 26  ? 55.242  125.465 13.108  1.00 0.00 ? 26  VAL B CG2  1 
ATOM 2402  H H    . VAL B 1 26  ? 53.309  123.790 11.877  1.00 0.00 ? 26  VAL B H    1 
ATOM 2403  H HA   . VAL B 1 26  ? 54.125  125.818 9.880   1.00 0.00 ? 26  VAL B HA   1 
ATOM 2404  H HB   . VAL B 1 26  ? 55.772  126.741 11.462  1.00 0.00 ? 26  VAL B HB   1 
ATOM 2405  H HG11 . VAL B 1 26  ? 54.182  127.975 12.870  1.00 0.00 ? 26  VAL B HG11 1 
ATOM 2406  H HG12 . VAL B 1 26  ? 52.938  126.767 12.547  1.00 0.00 ? 26  VAL B HG12 1 
ATOM 2407  H HG13 . VAL B 1 26  ? 53.535  127.789 11.240  1.00 0.00 ? 26  VAL B HG13 1 
ATOM 2408  H HG21 . VAL B 1 26  ? 54.417  124.823 13.379  1.00 0.00 ? 26  VAL B HG21 1 
ATOM 2409  H HG22 . VAL B 1 26  ? 55.435  126.162 13.908  1.00 0.00 ? 26  VAL B HG22 1 
ATOM 2410  H HG23 . VAL B 1 26  ? 56.124  124.864 12.934  1.00 0.00 ? 26  VAL B HG23 1 
ATOM 2411  N N    . ALA B 1 27  ? 56.434  124.705 9.593   1.00 0.00 ? 27  ALA B N    1 
ATOM 2412  C CA   . ALA B 1 27  ? 57.558  123.852 9.187   1.00 0.00 ? 27  ALA B CA   1 
ATOM 2413  C C    . ALA B 1 27  ? 58.824  124.689 9.020   1.00 0.00 ? 27  ALA B C    1 
ATOM 2414  O O    . ALA B 1 27  ? 58.878  125.591 8.183   1.00 0.00 ? 27  ALA B O    1 
ATOM 2415  C CB   . ALA B 1 27  ? 57.231  123.148 7.867   1.00 0.00 ? 27  ALA B CB   1 
ATOM 2416  H H    . ALA B 1 27  ? 56.380  125.621 9.249   1.00 0.00 ? 27  ALA B H    1 
ATOM 2417  H HA   . ALA B 1 27  ? 57.736  123.102 9.947   1.00 0.00 ? 27  ALA B HA   1 
ATOM 2418  H HB1  . ALA B 1 27  ? 58.098  122.600 7.528   1.00 0.00 ? 27  ALA B HB1  1 
ATOM 2419  H HB2  . ALA B 1 27  ? 56.955  123.882 7.125   1.00 0.00 ? 27  ALA B HB2  1 
ATOM 2420  H HB3  . ALA B 1 27  ? 56.410  122.463 8.020   1.00 0.00 ? 27  ALA B HB3  1 
ATOM 2421  N N    . GLU B 1 28  ? 59.844  124.381 9.824   1.00 0.00 ? 28  GLU B N    1 
ATOM 2422  C CA   . GLU B 1 28  ? 61.118  125.109 9.763   1.00 0.00 ? 28  GLU B CA   1 
ATOM 2423  C C    . GLU B 1 28  ? 62.068  124.439 8.779   1.00 0.00 ? 28  GLU B C    1 
ATOM 2424  O O    . GLU B 1 28  ? 62.175  123.213 8.743   1.00 0.00 ? 28  GLU B O    1 
ATOM 2425  C CB   . GLU B 1 28  ? 61.764  125.143 11.152  1.00 0.00 ? 28  GLU B CB   1 
ATOM 2426  C CG   . GLU B 1 28  ? 60.933  126.026 12.086  1.00 0.00 ? 28  GLU B CG   1 
ATOM 2427  C CD   . GLU B 1 28  ? 59.614  125.336 12.418  1.00 0.00 ? 28  GLU B CD   1 
ATOM 2428  O OE1  . GLU B 1 28  ? 59.580  124.117 12.379  1.00 0.00 ? 28  GLU B OE1  1 
ATOM 2429  O OE2  . GLU B 1 28  ? 58.656  126.037 12.700  1.00 0.00 ? 28  GLU B OE2  1 
ATOM 2430  H H    . GLU B 1 28  ? 59.740  123.652 10.468  1.00 0.00 ? 28  GLU B H    1 
ATOM 2431  H HA   . GLU B 1 28  ? 60.936  126.124 9.438   1.00 0.00 ? 28  GLU B HA   1 
ATOM 2432  H HB2  . GLU B 1 28  ? 61.811  124.140 11.551  1.00 0.00 ? 28  GLU B HB2  1 
ATOM 2433  H HB3  . GLU B 1 28  ? 62.763  125.546 11.075  1.00 0.00 ? 28  GLU B HB3  1 
ATOM 2434  H HG2  . GLU B 1 28  ? 61.484  126.198 12.999  1.00 0.00 ? 28  GLU B HG2  1 
ATOM 2435  H HG3  . GLU B 1 28  ? 60.731  126.971 11.605  1.00 0.00 ? 28  GLU B HG3  1 
ATOM 2436  N N    . ALA B 1 29  ? 62.758  125.249 7.984   1.00 0.00 ? 29  ALA B N    1 
ATOM 2437  C CA   . ALA B 1 29  ? 63.697  124.718 7.005   1.00 0.00 ? 29  ALA B CA   1 
ATOM 2438  C C    . ALA B 1 29  ? 64.944  124.168 7.695   1.00 0.00 ? 29  ALA B C    1 
ATOM 2439  O O    . ALA B 1 29  ? 65.538  124.832 8.549   1.00 0.00 ? 29  ALA B O    1 
ATOM 2440  C CB   . ALA B 1 29  ? 64.103  125.816 6.021   1.00 0.00 ? 29  ALA B CB   1 
ATOM 2441  H H    . ALA B 1 29  ? 62.633  126.217 8.058   1.00 0.00 ? 29  ALA B H    1 
ATOM 2442  H HA   . ALA B 1 29  ? 63.219  123.919 6.458   1.00 0.00 ? 29  ALA B HA   1 
ATOM 2443  H HB1  . ALA B 1 29  ? 64.945  125.480 5.434   1.00 0.00 ? 29  ALA B HB1  1 
ATOM 2444  H HB2  . ALA B 1 29  ? 64.378  126.706 6.568   1.00 0.00 ? 29  ALA B HB2  1 
ATOM 2445  H HB3  . ALA B 1 29  ? 63.273  126.038 5.366   1.00 0.00 ? 29  ALA B HB3  1 
ATOM 2446  N N    . ALA B 1 30  ? 65.338  122.948 7.313   1.00 0.00 ? 30  ALA B N    1 
ATOM 2447  C CA   . ALA B 1 30  ? 66.525  122.297 7.890   1.00 0.00 ? 30  ALA B CA   1 
ATOM 2448  C C    . ALA B 1 30  ? 67.439  121.783 6.781   1.00 0.00 ? 30  ALA B C    1 
ATOM 2449  O O    . ALA B 1 30  ? 66.987  121.106 5.850   1.00 0.00 ? 30  ALA B O    1 
ATOM 2450  C CB   . ALA B 1 30  ? 66.096  121.123 8.773   1.00 0.00 ? 30  ALA B CB   1 
ATOM 2451  H H    . ALA B 1 30  ? 64.820  122.472 6.627   1.00 0.00 ? 30  ALA B H    1 
ATOM 2452  H HA   . ALA B 1 30  ? 67.077  123.007 8.497   1.00 0.00 ? 30  ALA B HA   1 
ATOM 2453  H HB1  . ALA B 1 30  ? 65.279  121.430 9.407   1.00 0.00 ? 30  ALA B HB1  1 
ATOM 2454  H HB2  . ALA B 1 30  ? 66.929  120.810 9.386   1.00 0.00 ? 30  ALA B HB2  1 
ATOM 2455  H HB3  . ALA B 1 30  ? 65.780  120.301 8.149   1.00 0.00 ? 30  ALA B HB3  1 
ATOM 2456  N N    . GLY B 1 31  ? 68.729  122.100 6.887   1.00 0.00 ? 31  GLY B N    1 
ATOM 2457  C CA   . GLY B 1 31  ? 69.688  121.653 5.884   1.00 0.00 ? 31  GLY B CA   1 
ATOM 2458  C C    . GLY B 1 31  ? 69.411  122.301 4.529   1.00 0.00 ? 31  GLY B C    1 
ATOM 2459  O O    . GLY B 1 31  ? 69.096  121.611 3.554   1.00 0.00 ? 31  GLY B O    1 
ATOM 2460  H H    . GLY B 1 31  ? 69.039  122.640 7.656   1.00 0.00 ? 31  GLY B H    1 
ATOM 2461  H HA2  . GLY B 1 31  ? 70.685  121.913 6.205   1.00 0.00 ? 31  GLY B HA2  1 
ATOM 2462  H HA3  . GLY B 1 31  ? 69.616  120.581 5.780   1.00 0.00 ? 31  GLY B HA3  1 
ATOM 2463  N N    . LYS B 1 32  ? 69.529  123.627 4.470   1.00 0.00 ? 32  LYS B N    1 
ATOM 2464  C CA   . LYS B 1 32  ? 69.290  124.338 3.218   1.00 0.00 ? 32  LYS B CA   1 
ATOM 2465  C C    . LYS B 1 32  ? 70.331  123.948 2.176   1.00 0.00 ? 32  LYS B C    1 
ATOM 2466  O O    . LYS B 1 32  ? 71.414  123.467 2.511   1.00 0.00 ? 32  LYS B O    1 
ATOM 2467  C CB   . LYS B 1 32  ? 69.299  125.855 3.413   1.00 0.00 ? 32  LYS B CB   1 
ATOM 2468  C CG   . LYS B 1 32  ? 68.057  126.296 4.193   1.00 0.00 ? 32  LYS B CG   1 
ATOM 2469  C CD   . LYS B 1 32  ? 67.985  127.827 4.205   1.00 0.00 ? 32  LYS B CD   1 
ATOM 2470  C CE   . LYS B 1 32  ? 66.752  128.279 4.987   1.00 0.00 ? 32  LYS B CE   1 
ATOM 2471  N NZ   . LYS B 1 32  ? 66.665  129.767 4.956   1.00 0.00 ? 32  LYS B NZ   1 
ATOM 2472  H H    . LYS B 1 32  ? 69.786  124.131 5.276   1.00 0.00 ? 32  LYS B H    1 
ATOM 2473  H HA   . LYS B 1 32  ? 68.321  124.046 2.850   1.00 0.00 ? 32  LYS B HA   1 
ATOM 2474  H HB2  . LYS B 1 32  ? 70.181  126.136 3.959   1.00 0.00 ? 32  LYS B HB2  1 
ATOM 2475  H HB3  . LYS B 1 32  ? 69.303  126.338 2.448   1.00 0.00 ? 32  LYS B HB3  1 
ATOM 2476  H HG2  . LYS B 1 32  ? 67.171  125.895 3.720   1.00 0.00 ? 32  LYS B HG2  1 
ATOM 2477  H HG3  . LYS B 1 32  ? 68.120  125.932 5.207   1.00 0.00 ? 32  LYS B HG3  1 
ATOM 2478  H HD2  . LYS B 1 32  ? 68.872  128.228 4.667   1.00 0.00 ? 32  LYS B HD2  1 
ATOM 2479  H HD3  . LYS B 1 32  ? 67.915  128.189 3.191   1.00 0.00 ? 32  LYS B HD3  1 
ATOM 2480  H HE2  . LYS B 1 32  ? 65.866  127.856 4.539   1.00 0.00 ? 32  LYS B HE2  1 
ATOM 2481  H HE3  . LYS B 1 32  ? 66.834  127.946 6.012   1.00 0.00 ? 32  LYS B HE3  1 
ATOM 2482  H HZ1  . LYS B 1 32  ? 67.611  130.174 5.099   1.00 0.00 ? 32  LYS B HZ1  1 
ATOM 2483  H HZ2  . LYS B 1 32  ? 66.028  130.093 5.712   1.00 0.00 ? 32  LYS B HZ2  1 
ATOM 2484  H HZ3  . LYS B 1 32  ? 66.295  130.074 4.034   1.00 0.00 ? 32  LYS B HZ3  1 
ATOM 2485  N N    . THR B 1 33  ? 69.978  124.127 0.910   1.00 0.00 ? 33  THR B N    1 
ATOM 2486  C CA   . THR B 1 33  ? 70.865  123.761 -0.185  1.00 0.00 ? 33  THR B CA   1 
ATOM 2487  C C    . THR B 1 33  ? 72.120  124.623 -0.180  1.00 0.00 ? 33  THR B C    1 
ATOM 2488  O O    . THR B 1 33  ? 72.108  125.768 -0.627  1.00 0.00 ? 33  THR B O    1 
ATOM 2489  C CB   . THR B 1 33  ? 70.121  123.945 -1.513  1.00 0.00 ? 33  THR B CB   1 
ATOM 2490  O OG1  . THR B 1 33  ? 71.059  124.072 -2.572  1.00 0.00 ? 33  THR B OG1  1 
ATOM 2491  C CG2  . THR B 1 33  ? 69.251  125.206 -1.453  1.00 0.00 ? 33  THR B CG2  1 
ATOM 2492  H H    . THR B 1 33  ? 69.091  124.492 0.707   1.00 0.00 ? 33  THR B H    1 
ATOM 2493  H HA   . THR B 1 33  ? 71.147  122.724 -0.081  1.00 0.00 ? 33  THR B HA   1 
ATOM 2494  H HB   . THR B 1 33  ? 69.487  123.091 -1.689  1.00 0.00 ? 33  THR B HB   1 
ATOM 2495  H HG1  . THR B 1 33  ? 71.789  124.611 -2.259  1.00 0.00 ? 33  THR B HG1  1 
ATOM 2496  H HG21 . THR B 1 33  ? 68.984  125.505 -2.457  1.00 0.00 ? 33  THR B HG21 1 
ATOM 2497  H HG22 . THR B 1 33  ? 69.798  126.003 -0.976  1.00 0.00 ? 33  THR B HG22 1 
ATOM 2498  H HG23 . THR B 1 33  ? 68.354  124.999 -0.891  1.00 0.00 ? 33  THR B HG23 1 
ATOM 2499  N N    . LYS B 1 34  ? 73.208  124.049 0.330   1.00 0.00 ? 34  LYS B N    1 
ATOM 2500  C CA   . LYS B 1 34  ? 74.478  124.758 0.403   1.00 0.00 ? 34  LYS B CA   1 
ATOM 2501  C C    . LYS B 1 34  ? 74.897  125.237 -0.978  1.00 0.00 ? 34  LYS B C    1 
ATOM 2502  O O    . LYS B 1 34  ? 74.710  124.535 -1.971  1.00 0.00 ? 34  LYS B O    1 
ATOM 2503  C CB   . LYS B 1 34  ? 75.560  123.838 0.973   1.00 0.00 ? 34  LYS B CB   1 
ATOM 2504  C CG   . LYS B 1 34  ? 75.217  123.485 2.426   1.00 0.00 ? 34  LYS B CG   1 
ATOM 2505  C CD   . LYS B 1 34  ? 76.412  122.794 3.103   1.00 0.00 ? 34  LYS B CD   1 
ATOM 2506  C CE   . LYS B 1 34  ? 76.614  121.391 2.520   1.00 0.00 ? 34  LYS B CE   1 
ATOM 2507  N NZ   . LYS B 1 34  ? 77.604  120.650 3.352   1.00 0.00 ? 34  LYS B NZ   1 
ATOM 2508  H H    . LYS B 1 34  ? 73.153  123.130 0.668   1.00 0.00 ? 34  LYS B H    1 
ATOM 2509  H HA   . LYS B 1 34  ? 74.370  125.609 1.055   1.00 0.00 ? 34  LYS B HA   1 
ATOM 2510  H HB2  . LYS B 1 34  ? 75.603  122.939 0.380   1.00 0.00 ? 34  LYS B HB2  1 
ATOM 2511  H HB3  . LYS B 1 34  ? 76.515  124.340 0.941   1.00 0.00 ? 34  LYS B HB3  1 
ATOM 2512  H HG2  . LYS B 1 34  ? 74.973  124.388 2.966   1.00 0.00 ? 34  LYS B HG2  1 
ATOM 2513  H HG3  . LYS B 1 34  ? 74.367  122.819 2.440   1.00 0.00 ? 34  LYS B HG3  1 
ATOM 2514  H HD2  . LYS B 1 34  ? 77.303  123.382 2.940   1.00 0.00 ? 34  LYS B HD2  1 
ATOM 2515  H HD3  . LYS B 1 34  ? 76.224  122.716 4.163   1.00 0.00 ? 34  LYS B HD3  1 
ATOM 2516  H HE2  . LYS B 1 34  ? 75.674  120.862 2.519   1.00 0.00 ? 34  LYS B HE2  1 
ATOM 2517  H HE3  . LYS B 1 34  ? 76.986  121.469 1.512   1.00 0.00 ? 34  LYS B HE3  1 
ATOM 2518  H HZ1  . LYS B 1 34  ? 77.343  119.644 3.388   1.00 0.00 ? 34  LYS B HZ1  1 
ATOM 2519  H HZ2  . LYS B 1 34  ? 77.612  121.041 4.316   1.00 0.00 ? 34  LYS B HZ2  1 
ATOM 2520  H HZ3  . LYS B 1 34  ? 78.551  120.744 2.931   1.00 0.00 ? 34  LYS B HZ3  1 
ATOM 2521  N N    . GLU B 1 35  ? 75.465  126.443 -1.034  1.00 0.00 ? 35  GLU B N    1 
ATOM 2522  C CA   . GLU B 1 35  ? 75.918  127.030 -2.302  1.00 0.00 ? 35  GLU B CA   1 
ATOM 2523  C C    . GLU B 1 35  ? 77.439  127.020 -2.361  1.00 0.00 ? 35  GLU B C    1 
ATOM 2524  O O    . GLU B 1 35  ? 78.103  127.632 -1.523  1.00 0.00 ? 35  GLU B O    1 
ATOM 2525  C CB   . GLU B 1 35  ? 75.421  128.473 -2.401  1.00 0.00 ? 35  GLU B CB   1 
ATOM 2526  C CG   . GLU B 1 35  ? 75.658  129.011 -3.814  1.00 0.00 ? 35  GLU B CG   1 
ATOM 2527  C CD   . GLU B 1 35  ? 74.725  128.314 -4.798  1.00 0.00 ? 35  GLU B CD   1 
ATOM 2528  O OE1  . GLU B 1 35  ? 73.675  127.865 -4.370  1.00 0.00 ? 35  GLU B OE1  1 
ATOM 2529  O OE2  . GLU B 1 35  ? 75.067  128.248 -5.966  1.00 0.00 ? 35  GLU B OE2  1 
ATOM 2530  H H    . GLU B 1 35  ? 75.585  126.953 -0.206  1.00 0.00 ? 35  GLU B H    1 
ATOM 2531  H HA   . GLU B 1 35  ? 75.525  126.463 -3.138  1.00 0.00 ? 35  GLU B HA   1 
ATOM 2532  H HB2  . GLU B 1 35  ? 74.365  128.506 -2.174  1.00 0.00 ? 35  GLU B HB2  1 
ATOM 2533  H HB3  . GLU B 1 35  ? 75.958  129.083 -1.692  1.00 0.00 ? 35  GLU B HB3  1 
ATOM 2534  H HG2  . GLU B 1 35  ? 75.466  130.074 -3.830  1.00 0.00 ? 35  GLU B HG2  1 
ATOM 2535  H HG3  . GLU B 1 35  ? 76.683  128.825 -4.100  1.00 0.00 ? 35  GLU B HG3  1 
ATOM 2536  N N    . GLY B 1 36  ? 77.989  126.332 -3.353  1.00 0.00 ? 36  GLY B N    1 
ATOM 2537  C CA   . GLY B 1 36  ? 79.436  126.265 -3.494  1.00 0.00 ? 36  GLY B CA   1 
ATOM 2538  C C    . GLY B 1 36  ? 80.003  127.642 -3.798  1.00 0.00 ? 36  GLY B C    1 
ATOM 2539  O O    . GLY B 1 36  ? 79.955  128.539 -2.956  1.00 0.00 ? 36  GLY B O    1 
ATOM 2540  H H    . GLY B 1 36  ? 77.418  125.864 -3.999  1.00 0.00 ? 36  GLY B H    1 
ATOM 2541  H HA2  . GLY B 1 36  ? 79.865  125.898 -2.572  1.00 0.00 ? 36  GLY B HA2  1 
ATOM 2542  H HA3  . GLY B 1 36  ? 79.687  125.592 -4.297  1.00 0.00 ? 36  GLY B HA3  1 
ATOM 2543  N N    . VAL B 1 37  ? 80.538  127.810 -5.010  1.00 0.00 ? 37  VAL B N    1 
ATOM 2544  C CA   . VAL B 1 37  ? 81.119  129.097 -5.428  1.00 0.00 ? 37  VAL B CA   1 
ATOM 2545  C C    . VAL B 1 37  ? 80.558  129.500 -6.791  1.00 0.00 ? 37  VAL B C    1 
ATOM 2546  O O    . VAL B 1 37  ? 80.236  128.636 -7.622  1.00 0.00 ? 37  VAL B O    1 
ATOM 2547  C CB   . VAL B 1 37  ? 82.642  128.959 -5.513  1.00 0.00 ? 37  VAL B CB   1 
ATOM 2548  C CG1  . VAL B 1 37  ? 83.177  128.405 -4.189  1.00 0.00 ? 37  VAL B CG1  1 
ATOM 2549  C CG2  . VAL B 1 37  ? 83.009  127.998 -6.647  1.00 0.00 ? 37  VAL B CG2  1 
ATOM 2550  H H    . VAL B 1 37  ? 80.545  127.059 -5.637  1.00 0.00 ? 37  VAL B H    1 
ATOM 2551  H HA   . VAL B 1 37  ? 80.875  129.868 -4.705  1.00 0.00 ? 37  VAL B HA   1 
ATOM 2552  H HB   . VAL B 1 37  ? 83.082  129.928 -5.702  1.00 0.00 ? 37  VAL B HB   1 
ATOM 2553  H HG11 . VAL B 1 37  ? 84.256  128.454 -4.186  1.00 0.00 ? 37  VAL B HG11 1 
ATOM 2554  H HG12 . VAL B 1 37  ? 82.864  127.377 -4.077  1.00 0.00 ? 37  VAL B HG12 1 
ATOM 2555  H HG13 . VAL B 1 37  ? 82.785  128.988 -3.370  1.00 0.00 ? 37  VAL B HG13 1 
ATOM 2556  H HG21 . VAL B 1 37  ? 84.058  127.747 -6.580  1.00 0.00 ? 37  VAL B HG21 1 
ATOM 2557  H HG22 . VAL B 1 37  ? 82.812  128.467 -7.598  1.00 0.00 ? 37  VAL B HG22 1 
ATOM 2558  H HG23 . VAL B 1 37  ? 82.422  127.102 -6.560  1.00 0.00 ? 37  VAL B HG23 1 
ATOM 2559  N N    . LEU B 1 38  ? 80.442  130.818 -7.032  1.00 0.00 ? 38  LEU B N    1 
ATOM 2560  C CA   . LEU B 1 38  ? 79.910  131.318 -8.323  1.00 0.00 ? 38  LEU B CA   1 
ATOM 2561  C C    . LEU B 1 38  ? 80.981  132.137 -9.052  1.00 0.00 ? 38  LEU B C    1 
ATOM 2562  O O    . LEU B 1 38  ? 81.589  133.031 -8.464  1.00 0.00 ? 38  LEU B O    1 
ATOM 2563  C CB   . LEU B 1 38  ? 78.681  132.216 -8.084  1.00 0.00 ? 38  LEU B CB   1 
ATOM 2564  C CG   . LEU B 1 38  ? 77.731  131.568 -7.063  1.00 0.00 ? 38  LEU B CG   1 
ATOM 2565  C CD1  . LEU B 1 38  ? 76.511  132.482 -6.838  1.00 0.00 ? 38  LEU B CD1  1 
ATOM 2566  C CD2  . LEU B 1 38  ? 77.254  130.210 -7.583  1.00 0.00 ? 38  LEU B CD2  1 
ATOM 2567  H H    . LEU B 1 38  ? 80.718  131.464 -6.336  1.00 0.00 ? 38  LEU B H    1 
ATOM 2568  H HA   . LEU B 1 38  ? 79.616  130.484 -8.951  1.00 0.00 ? 38  LEU B HA   1 
ATOM 2569  H HB2  . LEU B 1 38  ? 79.003  133.175 -7.717  1.00 0.00 ? 38  LEU B HB2  1 
ATOM 2570  H HB3  . LEU B 1 38  ? 78.155  132.352 -9.019  1.00 0.00 ? 38  LEU B HB3  1 
ATOM 2571  H HG   . LEU B 1 38  ? 78.252  131.434 -6.126  1.00 0.00 ? 38  LEU B HG   1 
ATOM 2572  H HD11 . LEU B 1 38  ? 76.035  132.221 -5.905  1.00 0.00 ? 38  LEU B HD11 1 
ATOM 2573  H HD12 . LEU B 1 38  ? 75.805  132.355 -7.649  1.00 0.00 ? 38  LEU B HD12 1 
ATOM 2574  H HD13 . LEU B 1 38  ? 76.830  133.513 -6.802  1.00 0.00 ? 38  LEU B HD13 1 
ATOM 2575  H HD21 . LEU B 1 38  ? 78.050  129.489 -7.500  1.00 0.00 ? 38  LEU B HD21 1 
ATOM 2576  H HD22 . LEU B 1 38  ? 76.964  130.306 -8.612  1.00 0.00 ? 38  LEU B HD22 1 
ATOM 2577  H HD23 . LEU B 1 38  ? 76.408  129.878 -7.003  1.00 0.00 ? 38  LEU B HD23 1 
ATOM 2578  N N    . TYR B 1 39  ? 81.196  131.834 -10.342 1.00 0.00 ? 39  TYR B N    1 
ATOM 2579  C CA   . TYR B 1 39  ? 82.190  132.560 -11.162 1.00 0.00 ? 39  TYR B CA   1 
ATOM 2580  C C    . TYR B 1 39  ? 81.539  133.104 -12.436 1.00 0.00 ? 39  TYR B C    1 
ATOM 2581  O O    . TYR B 1 39  ? 81.073  132.338 -13.281 1.00 0.00 ? 39  TYR B O    1 
ATOM 2582  C CB   . TYR B 1 39  ? 83.357  131.619 -11.535 1.00 0.00 ? 39  TYR B CB   1 
ATOM 2583  C CG   . TYR B 1 39  ? 84.312  131.495 -10.365 1.00 0.00 ? 39  TYR B CG   1 
ATOM 2584  C CD1  . TYR B 1 39  ? 84.027  130.619 -9.312  1.00 0.00 ? 39  TYR B CD1  1 
ATOM 2585  C CD2  . TYR B 1 39  ? 85.483  132.263 -10.339 1.00 0.00 ? 39  TYR B CD2  1 
ATOM 2586  C CE1  . TYR B 1 39  ? 84.914  130.514 -8.233  1.00 0.00 ? 39  TYR B CE1  1 
ATOM 2587  C CE2  . TYR B 1 39  ? 86.368  132.157 -9.262  1.00 0.00 ? 39  TYR B CE2  1 
ATOM 2588  C CZ   . TYR B 1 39  ? 86.084  131.282 -8.209  1.00 0.00 ? 39  TYR B CZ   1 
ATOM 2589  O OH   . TYR B 1 39  ? 86.955  131.178 -7.145  1.00 0.00 ? 39  TYR B OH   1 
ATOM 2590  H H    . TYR B 1 39  ? 80.671  131.117 -10.756 1.00 0.00 ? 39  TYR B H    1 
ATOM 2591  H HA   . TYR B 1 39  ? 82.583  133.400 -10.598 1.00 0.00 ? 39  TYR B HA   1 
ATOM 2592  H HB2  . TYR B 1 39  ? 82.965  130.643 -11.781 1.00 0.00 ? 39  TYR B HB2  1 
ATOM 2593  H HB3  . TYR B 1 39  ? 83.889  132.017 -12.389 1.00 0.00 ? 39  TYR B HB3  1 
ATOM 2594  H HD1  . TYR B 1 39  ? 83.125  130.026 -9.331  1.00 0.00 ? 39  TYR B HD1  1 
ATOM 2595  H HD2  . TYR B 1 39  ? 85.702  132.939 -11.153 1.00 0.00 ? 39  TYR B HD2  1 
ATOM 2596  H HE1  . TYR B 1 39  ? 84.697  129.841 -7.420  1.00 0.00 ? 39  TYR B HE1  1 
ATOM 2597  H HE2  . TYR B 1 39  ? 87.271  132.750 -9.245  1.00 0.00 ? 39  TYR B HE2  1 
ATOM 2598  H HH   . TYR B 1 39  ? 86.863  131.969 -6.608  1.00 0.00 ? 39  TYR B HH   1 
ATOM 2599  N N    . VAL B 1 40  ? 81.521  134.441 -12.568 1.00 0.00 ? 40  VAL B N    1 
ATOM 2600  C CA   . VAL B 1 40  ? 80.933  135.099 -13.747 1.00 0.00 ? 40  VAL B CA   1 
ATOM 2601  C C    . VAL B 1 40  ? 81.881  136.167 -14.295 1.00 0.00 ? 40  VAL B C    1 
ATOM 2602  O O    . VAL B 1 40  ? 82.194  137.137 -13.613 1.00 0.00 ? 40  VAL B O    1 
ATOM 2603  C CB   . VAL B 1 40  ? 79.600  135.748 -13.364 1.00 0.00 ? 40  VAL B CB   1 
ATOM 2604  C CG1  . VAL B 1 40  ? 78.978  136.417 -14.592 1.00 0.00 ? 40  VAL B CG1  1 
ATOM 2605  C CG2  . VAL B 1 40  ? 78.646  134.675 -12.833 1.00 0.00 ? 40  VAL B CG2  1 
ATOM 2606  H H    . VAL B 1 40  ? 81.915  134.995 -11.862 1.00 0.00 ? 40  VAL B H    1 
ATOM 2607  H HA   . VAL B 1 40  ? 80.753  134.370 -14.514 1.00 0.00 ? 40  VAL B HA   1 
ATOM 2608  H HB   . VAL B 1 40  ? 79.770  136.491 -12.598 1.00 0.00 ? 40  VAL B HB   1 
ATOM 2609  H HG11 . VAL B 1 40  ? 79.552  137.293 -14.855 1.00 0.00 ? 40  VAL B HG11 1 
ATOM 2610  H HG12 . VAL B 1 40  ? 77.962  136.707 -14.366 1.00 0.00 ? 40  VAL B HG12 1 
ATOM 2611  H HG13 . VAL B 1 40  ? 78.978  135.723 -15.419 1.00 0.00 ? 40  VAL B HG13 1 
ATOM 2612  H HG21 . VAL B 1 40  ? 78.624  133.840 -13.519 1.00 0.00 ? 40  VAL B HG21 1 
ATOM 2613  H HG22 . VAL B 1 40  ? 77.653  135.090 -12.741 1.00 0.00 ? 40  VAL B HG22 1 
ATOM 2614  H HG23 . VAL B 1 40  ? 78.986  134.337 -11.866 1.00 0.00 ? 40  VAL B HG23 1 
ATOM 2615  N N    . GLY B 1 41  ? 82.336  136.000 -15.529 1.00 0.00 ? 41  GLY B N    1 
ATOM 2616  C CA   . GLY B 1 41  ? 83.241  136.989 -16.118 1.00 0.00 ? 41  GLY B CA   1 
ATOM 2617  C C    . GLY B 1 41  ? 84.588  137.012 -15.390 1.00 0.00 ? 41  GLY B C    1 
ATOM 2618  O O    . GLY B 1 41  ? 84.923  137.984 -14.690 1.00 0.00 ? 41  GLY B O    1 
ATOM 2619  H H    . GLY B 1 41  ? 82.062  135.210 -16.054 1.00 0.00 ? 41  GLY B H    1 
ATOM 2620  H HA2  . GLY B 1 41  ? 83.403  136.744 -17.157 1.00 0.00 ? 41  GLY B HA2  1 
ATOM 2621  H HA3  . GLY B 1 41  ? 82.789  137.966 -16.051 1.00 0.00 ? 41  GLY B HA3  1 
ATOM 2622  N N    . SER B 1 42  ? 85.360  135.934 -15.554 1.00 0.00 ? 42  SER B N    1 
ATOM 2623  C CA   . SER B 1 42  ? 86.686  135.826 -14.915 1.00 0.00 ? 42  SER B CA   1 
ATOM 2624  C C    . SER B 1 42  ? 87.705  135.260 -15.899 1.00 0.00 ? 42  SER B C    1 
ATOM 2625  O O    . SER B 1 42  ? 87.422  134.297 -16.611 1.00 0.00 ? 42  SER B O    1 
ATOM 2626  C CB   . SER B 1 42  ? 86.605  134.910 -13.692 1.00 0.00 ? 42  SER B CB   1 
ATOM 2627  O OG   . SER B 1 42  ? 85.695  135.462 -12.749 1.00 0.00 ? 42  SER B OG   1 
ATOM 2628  H H    . SER B 1 42  ? 85.033  135.191 -16.123 1.00 0.00 ? 42  SER B H    1 
ATOM 2629  H HA   . SER B 1 42  ? 87.020  136.806 -14.595 1.00 0.00 ? 42  SER B HA   1 
ATOM 2630  H HB2  . SER B 1 42  ? 86.259  133.938 -13.992 1.00 0.00 ? 42  SER B HB2  1 
ATOM 2631  H HB3  . SER B 1 42  ? 87.589  134.819 -13.247 1.00 0.00 ? 42  SER B HB3  1 
ATOM 2632  H HG   . SER B 1 42  ? 86.207  135.848 -12.035 1.00 0.00 ? 42  SER B HG   1 
ATOM 2633  N N    . LYS B 1 43  ? 88.904  135.857 -15.930 1.00 0.00 ? 43  LYS B N    1 
ATOM 2634  C CA   . LYS B 1 43  ? 89.971  135.391 -16.834 1.00 0.00 ? 43  LYS B CA   1 
ATOM 2635  C C    . LYS B 1 43  ? 91.175  134.935 -16.017 1.00 0.00 ? 43  LYS B C    1 
ATOM 2636  O O    . LYS B 1 43  ? 91.684  135.681 -15.181 1.00 0.00 ? 43  LYS B O    1 
ATOM 2637  C CB   . LYS B 1 43  ? 90.403  136.533 -17.764 1.00 0.00 ? 43  LYS B CB   1 
ATOM 2638  C CG   . LYS B 1 43  ? 89.174  137.224 -18.381 1.00 0.00 ? 43  LYS B CG   1 
ATOM 2639  C CD   . LYS B 1 43  ? 88.360  136.239 -19.232 1.00 0.00 ? 43  LYS B CD   1 
ATOM 2640  C CE   . LYS B 1 43  ? 87.294  137.018 -20.009 1.00 0.00 ? 43  LYS B CE   1 
ATOM 2641  N NZ   . LYS B 1 43  ? 86.449  136.073 -20.792 1.00 0.00 ? 43  LYS B NZ   1 
ATOM 2642  H H    . LYS B 1 43  ? 89.077  136.617 -15.335 1.00 0.00 ? 43  LYS B H    1 
ATOM 2643  H HA   . LYS B 1 43  ? 89.624  134.559 -17.432 1.00 0.00 ? 43  LYS B HA   1 
ATOM 2644  H HB2  . LYS B 1 43  ? 90.972  137.258 -17.198 1.00 0.00 ? 43  LYS B HB2  1 
ATOM 2645  H HB3  . LYS B 1 43  ? 91.021  136.135 -18.555 1.00 0.00 ? 43  LYS B HB3  1 
ATOM 2646  H HG2  . LYS B 1 43  ? 88.550  137.607 -17.589 1.00 0.00 ? 43  LYS B HG2  1 
ATOM 2647  H HG3  . LYS B 1 43  ? 89.502  138.044 -19.003 1.00 0.00 ? 43  LYS B HG3  1 
ATOM 2648  H HD2  . LYS B 1 43  ? 89.016  135.729 -19.923 1.00 0.00 ? 43  LYS B HD2  1 
ATOM 2649  H HD3  . LYS B 1 43  ? 87.875  135.520 -18.592 1.00 0.00 ? 43  LYS B HD3  1 
ATOM 2650  H HE2  . LYS B 1 43  ? 86.672  137.563 -19.315 1.00 0.00 ? 43  LYS B HE2  1 
ATOM 2651  H HE3  . LYS B 1 43  ? 87.775  137.712 -20.680 1.00 0.00 ? 43  LYS B HE3  1 
ATOM 2652  H HZ1  . LYS B 1 43  ? 85.626  136.580 -21.174 1.00 0.00 ? 43  LYS B HZ1  1 
ATOM 2653  H HZ2  . LYS B 1 43  ? 86.125  135.302 -20.172 1.00 0.00 ? 43  LYS B HZ2  1 
ATOM 2654  H HZ3  . LYS B 1 43  ? 87.004  135.679 -21.576 1.00 0.00 ? 43  LYS B HZ3  1 
ATOM 2655  N N    . THR B 1 44  ? 91.630  133.701 -16.269 1.00 0.00 ? 44  THR B N    1 
ATOM 2656  C CA   . THR B 1 44  ? 92.786  133.137 -15.554 1.00 0.00 ? 44  THR B CA   1 
ATOM 2657  C C    . THR B 1 44  ? 93.780  132.536 -16.543 1.00 0.00 ? 44  THR B C    1 
ATOM 2658  O O    . THR B 1 44  ? 93.418  131.697 -17.367 1.00 0.00 ? 44  THR B O    1 
ATOM 2659  C CB   . THR B 1 44  ? 92.311  132.045 -14.590 1.00 0.00 ? 44  THR B CB   1 
ATOM 2660  O OG1  . THR B 1 44  ? 91.387  132.603 -13.665 1.00 0.00 ? 44  THR B OG1  1 
ATOM 2661  C CG2  . THR B 1 44  ? 93.509  131.471 -13.832 1.00 0.00 ? 44  THR B CG2  1 
ATOM 2662  H H    . THR B 1 44  ? 91.181  133.157 -16.950 1.00 0.00 ? 44  THR B H    1 
ATOM 2663  H HA   . THR B 1 44  ? 93.283  133.913 -14.986 1.00 0.00 ? 44  THR B HA   1 
ATOM 2664  H HB   . THR B 1 44  ? 91.831  131.256 -15.147 1.00 0.00 ? 44  THR B HB   1 
ATOM 2665  H HG1  . THR B 1 44  ? 91.878  133.156 -13.053 1.00 0.00 ? 44  THR B HG1  1 
ATOM 2666  H HG21 . THR B 1 44  ? 94.091  132.278 -13.412 1.00 0.00 ? 44  THR B HG21 1 
ATOM 2667  H HG22 . THR B 1 44  ? 94.124  130.899 -14.512 1.00 0.00 ? 44  THR B HG22 1 
ATOM 2668  H HG23 . THR B 1 44  ? 93.158  130.828 -13.038 1.00 0.00 ? 44  THR B HG23 1 
ATOM 2669  N N    . LYS B 1 45  ? 95.042  132.958 -16.448 1.00 0.00 ? 45  LYS B N    1 
ATOM 2670  C CA   . LYS B 1 45  ? 96.095  132.441 -17.336 1.00 0.00 ? 45  LYS B CA   1 
ATOM 2671  C C    . LYS B 1 45  ? 97.377  132.202 -16.548 1.00 0.00 ? 45  LYS B C    1 
ATOM 2672  O O    . LYS B 1 45  ? 97.778  133.037 -15.735 1.00 0.00 ? 45  LYS B O    1 
ATOM 2673  C CB   . LYS B 1 45  ? 96.368  133.440 -18.464 1.00 0.00 ? 45  LYS B CB   1 
ATOM 2674  C CG   . LYS B 1 45  ? 95.093  133.649 -19.284 1.00 0.00 ? 45  LYS B CG   1 
ATOM 2675  C CD   . LYS B 1 45  ? 95.372  134.635 -20.421 1.00 0.00 ? 45  LYS B CD   1 
ATOM 2676  C CE   . LYS B 1 45  ? 94.070  134.941 -21.166 1.00 0.00 ? 45  LYS B CE   1 
ATOM 2677  N NZ   . LYS B 1 45  ? 93.537  133.688 -21.770 1.00 0.00 ? 45  LYS B NZ   1 
ATOM 2678  H H    . LYS B 1 45  ? 95.275  133.622 -15.764 1.00 0.00 ? 45  LYS B H    1 
ATOM 2679  H HA   . LYS B 1 45  ? 95.777  131.501 -17.773 1.00 0.00 ? 45  LYS B HA   1 
ATOM 2680  H HB2  . LYS B 1 45  ? 96.684  134.382 -18.041 1.00 0.00 ? 45  LYS B HB2  1 
ATOM 2681  H HB3  . LYS B 1 45  ? 97.146  133.054 -19.106 1.00 0.00 ? 45  LYS B HB3  1 
ATOM 2682  H HG2  . LYS B 1 45  ? 94.771  132.703 -19.696 1.00 0.00 ? 45  LYS B HG2  1 
ATOM 2683  H HG3  . LYS B 1 45  ? 94.316  134.048 -18.647 1.00 0.00 ? 45  LYS B HG3  1 
ATOM 2684  H HD2  . LYS B 1 45  ? 95.779  135.548 -20.014 1.00 0.00 ? 45  LYS B HD2  1 
ATOM 2685  H HD3  . LYS B 1 45  ? 96.082  134.199 -21.107 1.00 0.00 ? 45  LYS B HD3  1 
ATOM 2686  H HE2  . LYS B 1 45  ? 93.346  135.344 -20.474 1.00 0.00 ? 45  LYS B HE2  1 
ATOM 2687  H HE3  . LYS B 1 45  ? 94.264  135.662 -21.947 1.00 0.00 ? 45  LYS B HE3  1 
ATOM 2688  H HZ1  . LYS B 1 45  ? 93.531  132.934 -21.055 1.00 0.00 ? 45  LYS B HZ1  1 
ATOM 2689  H HZ2  . LYS B 1 45  ? 94.141  133.405 -22.569 1.00 0.00 ? 45  LYS B HZ2  1 
ATOM 2690  H HZ3  . LYS B 1 45  ? 92.568  133.851 -22.108 1.00 0.00 ? 45  LYS B HZ3  1 
ATOM 2691  N N    . GLU B 1 46  ? 98.022  131.058 -16.795 1.00 0.00 ? 46  GLU B N    1 
ATOM 2692  C CA   . GLU B 1 46  ? 99.270  130.714 -16.098 1.00 0.00 ? 46  GLU B CA   1 
ATOM 2693  C C    . GLU B 1 46  ? 100.256 130.048 -17.057 1.00 0.00 ? 46  GLU B C    1 
ATOM 2694  O O    . GLU B 1 46  ? 99.998  128.955 -17.554 1.00 0.00 ? 46  GLU B O    1 
ATOM 2695  C CB   . GLU B 1 46  ? 98.967  129.758 -14.940 1.00 0.00 ? 46  GLU B CB   1 
ATOM 2696  C CG   . GLU B 1 46  ? 98.006  130.430 -13.957 1.00 0.00 ? 46  GLU B CG   1 
ATOM 2697  C CD   . GLU B 1 46  ? 97.743  129.510 -12.770 1.00 0.00 ? 46  GLU B CD   1 
ATOM 2698  O OE1  . GLU B 1 46  ? 98.249  128.399 -12.783 1.00 0.00 ? 46  GLU B OE1  1 
ATOM 2699  O OE2  . GLU B 1 46  ? 97.040  129.929 -11.865 1.00 0.00 ? 46  GLU B OE2  1 
ATOM 2700  H H    . GLU B 1 46  ? 97.654  130.434 -17.455 1.00 0.00 ? 46  GLU B H    1 
ATOM 2701  H HA   . GLU B 1 46  ? 99.722  131.607 -15.701 1.00 0.00 ? 46  GLU B HA   1 
ATOM 2702  H HB2  . GLU B 1 46  ? 98.514  128.857 -15.326 1.00 0.00 ? 46  GLU B HB2  1 
ATOM 2703  H HB3  . GLU B 1 46  ? 99.885  129.508 -14.429 1.00 0.00 ? 46  GLU B HB3  1 
ATOM 2704  H HG2  . GLU B 1 46  ? 98.439  131.354 -13.607 1.00 0.00 ? 46  GLU B HG2  1 
ATOM 2705  H HG3  . GLU B 1 46  ? 97.072  130.641 -14.457 1.00 0.00 ? 46  GLU B HG3  1 
ATOM 2706  N N    . GLY B 1 47  ? 101.389 130.703 -17.313 1.00 0.00 ? 47  GLY B N    1 
ATOM 2707  C CA   . GLY B 1 47  ? 102.386 130.135 -18.211 1.00 0.00 ? 47  GLY B CA   1 
ATOM 2708  C C    . GLY B 1 47  ? 101.907 130.180 -19.657 1.00 0.00 ? 47  GLY B C    1 
ATOM 2709  O O    . GLY B 1 47  ? 101.488 129.160 -20.216 1.00 0.00 ? 47  GLY B O    1 
ATOM 2710  H H    . GLY B 1 47  ? 101.559 131.575 -16.892 1.00 0.00 ? 47  GLY B H    1 
ATOM 2711  H HA2  . GLY B 1 47  ? 103.304 130.697 -18.122 1.00 0.00 ? 47  GLY B HA2  1 
ATOM 2712  H HA3  . GLY B 1 47  ? 102.569 129.108 -17.932 1.00 0.00 ? 47  GLY B HA3  1 
ATOM 2713  N N    . VAL B 1 48  ? 101.967 131.375 -20.255 1.00 0.00 ? 48  VAL B N    1 
ATOM 2714  C CA   . VAL B 1 48  ? 101.542 131.570 -21.651 1.00 0.00 ? 48  VAL B CA   1 
ATOM 2715  C C    . VAL B 1 48  ? 102.486 132.527 -22.370 1.00 0.00 ? 48  VAL B C    1 
ATOM 2716  O O    . VAL B 1 48  ? 102.889 133.549 -21.815 1.00 0.00 ? 48  VAL B O    1 
ATOM 2717  C CB   . VAL B 1 48  ? 100.123 132.129 -21.698 1.00 0.00 ? 48  VAL B CB   1 
ATOM 2718  C CG1  . VAL B 1 48  ? 99.717  132.364 -23.154 1.00 0.00 ? 48  VAL B CG1  1 
ATOM 2719  C CG2  . VAL B 1 48  ? 99.156  131.129 -21.059 1.00 0.00 ? 48  VAL B CG2  1 
ATOM 2720  H H    . VAL B 1 48  ? 102.307 132.145 -19.746 1.00 0.00 ? 48  VAL B H    1 
ATOM 2721  H HA   . VAL B 1 48  ? 101.557 130.618 -22.166 1.00 0.00 ? 48  VAL B HA   1 
ATOM 2722  H HB   . VAL B 1 48  ? 100.087 133.065 -21.157 1.00 0.00 ? 48  VAL B HB   1 
ATOM 2723  H HG11 . VAL B 1 48  ? 100.231 133.233 -23.537 1.00 0.00 ? 48  VAL B HG11 1 
ATOM 2724  H HG12 . VAL B 1 48  ? 98.650  132.524 -23.210 1.00 0.00 ? 48  VAL B HG12 1 
ATOM 2725  H HG13 . VAL B 1 48  ? 99.982  131.500 -23.746 1.00 0.00 ? 48  VAL B HG13 1 
ATOM 2726  H HG21 . VAL B 1 48  ? 99.344  131.075 -19.997 1.00 0.00 ? 48  VAL B HG21 1 
ATOM 2727  H HG22 . VAL B 1 48  ? 99.304  130.154 -21.501 1.00 0.00 ? 48  VAL B HG22 1 
ATOM 2728  H HG23 . VAL B 1 48  ? 98.140  131.452 -21.229 1.00 0.00 ? 48  VAL B HG23 1 
ATOM 2729  N N    . VAL B 1 49  ? 102.838 132.194 -23.616 1.00 0.00 ? 49  VAL B N    1 
ATOM 2730  C CA   . VAL B 1 49  ? 103.742 133.038 -24.416 1.00 0.00 ? 49  VAL B CA   1 
ATOM 2731  C C    . VAL B 1 49  ? 103.223 133.192 -25.848 1.00 0.00 ? 49  VAL B C    1 
ATOM 2732  O O    . VAL B 1 49  ? 102.697 132.254 -26.439 1.00 0.00 ? 49  VAL B O    1 
ATOM 2733  C CB   . VAL B 1 49  ? 105.159 132.429 -24.422 1.00 0.00 ? 49  VAL B CB   1 
ATOM 2734  C CG1  . VAL B 1 49  ? 105.070 130.935 -24.716 1.00 0.00 ? 49  VAL B CG1  1 
ATOM 2735  C CG2  . VAL B 1 49  ? 106.029 133.111 -25.500 1.00 0.00 ? 49  VAL B CG2  1 
ATOM 2736  H H    . VAL B 1 49  ? 102.483 131.368 -24.008 1.00 0.00 ? 49  VAL B H    1 
ATOM 2737  H HA   . VAL B 1 49  ? 103.796 134.019 -23.972 1.00 0.00 ? 49  VAL B HA   1 
ATOM 2738  H HB   . VAL B 1 49  ? 105.612 132.571 -23.452 1.00 0.00 ? 49  VAL B HB   1 
ATOM 2739  H HG11 . VAL B 1 49  ? 104.553 130.787 -25.645 1.00 0.00 ? 49  VAL B HG11 1 
ATOM 2740  H HG12 . VAL B 1 49  ? 104.530 130.442 -23.922 1.00 0.00 ? 49  VAL B HG12 1 
ATOM 2741  H HG13 . VAL B 1 49  ? 106.065 130.520 -24.787 1.00 0.00 ? 49  VAL B HG13 1 
ATOM 2742  H HG21 . VAL B 1 49  ? 107.071 132.910 -25.304 1.00 0.00 ? 49  VAL B HG21 1 
ATOM 2743  H HG22 . VAL B 1 49  ? 105.854 134.174 -25.484 1.00 0.00 ? 49  VAL B HG22 1 
ATOM 2744  H HG23 . VAL B 1 49  ? 105.764 132.727 -26.472 1.00 0.00 ? 49  VAL B HG23 1 
ATOM 2745  N N    . HIS B 1 50  ? 103.391 134.394 -26.400 1.00 0.00 ? 50  HIS B N    1 
ATOM 2746  C CA   . HIS B 1 50  ? 102.953 134.683 -27.770 1.00 0.00 ? 50  HIS B CA   1 
ATOM 2747  C C    . HIS B 1 50  ? 103.932 135.645 -28.439 1.00 0.00 ? 50  HIS B C    1 
ATOM 2748  O O    . HIS B 1 50  ? 104.122 136.766 -27.975 1.00 0.00 ? 50  HIS B O    1 
ATOM 2749  C CB   . HIS B 1 50  ? 101.560 135.313 -27.754 1.00 0.00 ? 50  HIS B CB   1 
ATOM 2750  C CG   . HIS B 1 50  ? 101.094 135.523 -29.167 1.00 0.00 ? 50  HIS B CG   1 
ATOM 2751  N ND1  . HIS B 1 50  ? 100.186 134.676 -29.783 1.00 0.00 ? 50  HIS B ND1  1 
ATOM 2752  C CD2  . HIS B 1 50  ? 101.413 136.474 -30.101 1.00 0.00 ? 50  HIS B CD2  1 
ATOM 2753  C CE1  . HIS B 1 50  ? 99.993  135.132 -31.034 1.00 0.00 ? 50  HIS B CE1  1 
ATOM 2754  N NE2  . HIS B 1 50  ? 100.717 136.227 -31.279 1.00 0.00 ? 50  HIS B NE2  1 
ATOM 2755  H H    . HIS B 1 50  ? 103.825 135.101 -25.878 1.00 0.00 ? 50  HIS B H    1 
ATOM 2756  H HA   . HIS B 1 50  ? 102.917 133.766 -28.340 1.00 0.00 ? 50  HIS B HA   1 
ATOM 2757  H HB2  . HIS B 1 50  ? 100.872 134.655 -27.242 1.00 0.00 ? 50  HIS B HB2  1 
ATOM 2758  H HB3  . HIS B 1 50  ? 101.600 136.263 -27.243 1.00 0.00 ? 50  HIS B HB3  1 
ATOM 2759  H HD1  . HIS B 1 50  ? 99.764  133.889 -29.380 1.00 0.00 ? 50  HIS B HD1  1 
ATOM 2760  H HD2  . HIS B 1 50  ? 102.105 137.287 -29.948 1.00 0.00 ? 50  HIS B HD2  1 
ATOM 2761  H HE1  . HIS B 1 50  ? 99.331  134.670 -31.751 1.00 0.00 ? 50  HIS B HE1  1 
ATOM 2762  N N    . GLY B 1 51  ? 104.558 135.201 -29.534 1.00 0.00 ? 51  GLY B N    1 
ATOM 2763  C CA   . GLY B 1 51  ? 105.530 136.042 -30.261 1.00 0.00 ? 51  GLY B CA   1 
ATOM 2764  C C    . GLY B 1 51  ? 105.156 136.171 -31.735 1.00 0.00 ? 51  GLY B C    1 
ATOM 2765  O O    . GLY B 1 51  ? 104.828 135.185 -32.390 1.00 0.00 ? 51  GLY B O    1 
ATOM 2766  H H    . GLY B 1 51  ? 104.369 134.295 -29.861 1.00 0.00 ? 51  GLY B H    1 
ATOM 2767  H HA2  . GLY B 1 51  ? 105.567 137.031 -29.820 1.00 0.00 ? 51  GLY B HA2  1 
ATOM 2768  H HA3  . GLY B 1 51  ? 106.508 135.590 -30.189 1.00 0.00 ? 51  GLY B HA3  1 
ATOM 2769  N N    . VAL B 1 52  ? 105.222 137.401 -32.258 1.00 0.00 ? 52  VAL B N    1 
ATOM 2770  C CA   . VAL B 1 52  ? 104.902 137.662 -33.673 1.00 0.00 ? 52  VAL B CA   1 
ATOM 2771  C C    . VAL B 1 52  ? 106.024 138.460 -34.326 1.00 0.00 ? 52  VAL B C    1 
ATOM 2772  O O    . VAL B 1 52  ? 106.404 139.525 -33.838 1.00 0.00 ? 52  VAL B O    1 
ATOM 2773  C CB   . VAL B 1 52  ? 103.589 138.440 -33.782 1.00 0.00 ? 52  VAL B CB   1 
ATOM 2774  C CG1  . VAL B 1 52  ? 103.279 138.712 -35.253 1.00 0.00 ? 52  VAL B CG1  1 
ATOM 2775  C CG2  . VAL B 1 52  ? 102.459 137.612 -33.171 1.00 0.00 ? 52  VAL B CG2  1 
ATOM 2776  H H    . VAL B 1 52  ? 105.500 138.148 -31.686 1.00 0.00 ? 52  VAL B H    1 
ATOM 2777  H HA   . VAL B 1 52  ? 104.794 136.722 -34.203 1.00 0.00 ? 52  VAL B HA   1 
ATOM 2778  H HB   . VAL B 1 52  ? 103.679 139.378 -33.252 1.00 0.00 ? 52  VAL B HB   1 
ATOM 2779  H HG11 . VAL B 1 52  ? 103.970 139.449 -35.637 1.00 0.00 ? 52  VAL B HG11 1 
ATOM 2780  H HG12 . VAL B 1 52  ? 102.269 139.083 -35.346 1.00 0.00 ? 52  VAL B HG12 1 
ATOM 2781  H HG13 . VAL B 1 52  ? 103.380 137.797 -35.817 1.00 0.00 ? 52  VAL B HG13 1 
ATOM 2782  H HG21 . VAL B 1 52  ? 101.574 138.224 -33.076 1.00 0.00 ? 52  VAL B HG21 1 
ATOM 2783  H HG22 . VAL B 1 52  ? 102.758 137.257 -32.198 1.00 0.00 ? 52  VAL B HG22 1 
ATOM 2784  H HG23 . VAL B 1 52  ? 102.244 136.768 -33.812 1.00 0.00 ? 52  VAL B HG23 1 
ATOM 2785  N N    . ALA B 1 53  ? 106.553 137.936 -35.439 1.00 0.00 ? 53  ALA B N    1 
ATOM 2786  C CA   . ALA B 1 53  ? 107.646 138.599 -36.169 1.00 0.00 ? 53  ALA B CA   1 
ATOM 2787  C C    . ALA B 1 53  ? 107.313 138.698 -37.657 1.00 0.00 ? 53  ALA B C    1 
ATOM 2788  O O    . ALA B 1 53  ? 106.987 137.700 -38.296 1.00 0.00 ? 53  ALA B O    1 
ATOM 2789  C CB   . ALA B 1 53  ? 108.939 137.799 -35.995 1.00 0.00 ? 53  ALA B CB   1 
ATOM 2790  H H    . ALA B 1 53  ? 106.205 137.083 -35.775 1.00 0.00 ? 53  ALA B H    1 
ATOM 2791  H HA   . ALA B 1 53  ? 107.797 139.595 -35.778 1.00 0.00 ? 53  ALA B HA   1 
ATOM 2792  H HB1  . ALA B 1 53  ? 109.684 138.161 -36.690 1.00 0.00 ? 53  ALA B HB1  1 
ATOM 2793  H HB2  . ALA B 1 53  ? 108.746 136.754 -36.187 1.00 0.00 ? 53  ALA B HB2  1 
ATOM 2794  H HB3  . ALA B 1 53  ? 109.302 137.919 -34.986 1.00 0.00 ? 53  ALA B HB3  1 
ATOM 2795  N N    . THR B 1 54  ? 107.410 139.913 -38.210 1.00 0.00 ? 54  THR B N    1 
ATOM 2796  C CA   . THR B 1 54  ? 107.126 140.137 -39.639 1.00 0.00 ? 54  THR B CA   1 
ATOM 2797  C C    . THR B 1 54  ? 108.292 140.864 -40.304 1.00 0.00 ? 54  THR B C    1 
ATOM 2798  O O    . THR B 1 54  ? 108.718 141.923 -39.839 1.00 0.00 ? 54  THR B O    1 
ATOM 2799  C CB   . THR B 1 54  ? 105.850 140.970 -39.794 1.00 0.00 ? 54  THR B CB   1 
ATOM 2800  O OG1  . THR B 1 54  ? 104.763 140.283 -39.189 1.00 0.00 ? 54  THR B OG1  1 
ATOM 2801  C CG2  . THR B 1 54  ? 105.556 141.182 -41.279 1.00 0.00 ? 54  THR B CG2  1 
ATOM 2802  H H    . THR B 1 54  ? 107.682 140.672 -37.652 1.00 0.00 ? 54  THR B H    1 
ATOM 2803  H HA   . THR B 1 54  ? 106.982 139.185 -40.140 1.00 0.00 ? 54  THR B HA   1 
ATOM 2804  H HB   . THR B 1 54  ? 105.984 141.929 -39.317 1.00 0.00 ? 54  THR B HB   1 
ATOM 2805  H HG1  . THR B 1 54  ? 104.939 139.340 -39.245 1.00 0.00 ? 54  THR B HG1  1 
ATOM 2806  H HG21 . THR B 1 54  ? 105.602 140.233 -41.794 1.00 0.00 ? 54  THR B HG21 1 
ATOM 2807  H HG22 . THR B 1 54  ? 106.288 141.855 -41.699 1.00 0.00 ? 54  THR B HG22 1 
ATOM 2808  H HG23 . THR B 1 54  ? 104.570 141.607 -41.395 1.00 0.00 ? 54  THR B HG23 1 
ATOM 2809  N N    . VAL B 1 55  ? 108.802 140.284 -41.398 1.00 0.00 ? 55  VAL B N    1 
ATOM 2810  C CA   . VAL B 1 55  ? 109.927 140.870 -42.146 1.00 0.00 ? 55  VAL B CA   1 
ATOM 2811  C C    . VAL B 1 55  ? 109.574 140.968 -43.629 1.00 0.00 ? 55  VAL B C    1 
ATOM 2812  O O    . VAL B 1 55  ? 109.228 139.965 -44.255 1.00 0.00 ? 55  VAL B O    1 
ATOM 2813  C CB   . VAL B 1 55  ? 111.165 139.989 -41.981 1.00 0.00 ? 55  VAL B CB   1 
ATOM 2814  C CG1  . VAL B 1 55  ? 112.327 140.583 -42.776 1.00 0.00 ? 55  VAL B CG1  1 
ATOM 2815  C CG2  . VAL B 1 55  ? 111.546 139.913 -40.501 1.00 0.00 ? 55  VAL B CG2  1 
ATOM 2816  H H    . VAL B 1 55  ? 108.413 139.443 -41.713 1.00 0.00 ? 55  VAL B H    1 
ATOM 2817  H HA   . VAL B 1 55  ? 110.147 141.862 -41.769 1.00 0.00 ? 55  VAL B HA   1 
ATOM 2818  H HB   . VAL B 1 55  ? 110.950 138.995 -42.350 1.00 0.00 ? 55  VAL B HB   1 
ATOM 2819  H HG11 . VAL B 1 55  ? 112.148 140.444 -43.832 1.00 0.00 ? 55  VAL B HG11 1 
ATOM 2820  H HG12 . VAL B 1 55  ? 113.245 140.088 -42.498 1.00 0.00 ? 55  VAL B HG12 1 
ATOM 2821  H HG13 . VAL B 1 55  ? 112.406 141.638 -42.561 1.00 0.00 ? 55  VAL B HG13 1 
ATOM 2822  H HG21 . VAL B 1 55  ? 112.320 139.171 -40.366 1.00 0.00 ? 55  VAL B HG21 1 
ATOM 2823  H HG22 . VAL B 1 55  ? 110.678 139.636 -39.920 1.00 0.00 ? 55  VAL B HG22 1 
ATOM 2824  H HG23 . VAL B 1 55  ? 111.908 140.875 -40.172 1.00 0.00 ? 55  VAL B HG23 1 
ATOM 2825  N N    . ALA B 1 56  ? 109.660 142.178 -44.191 1.00 0.00 ? 56  ALA B N    1 
ATOM 2826  C CA   . ALA B 1 56  ? 109.340 142.382 -45.612 1.00 0.00 ? 56  ALA B CA   1 
ATOM 2827  C C    . ALA B 1 56  ? 110.593 142.250 -46.479 1.00 0.00 ? 56  ALA B C    1 
ATOM 2828  O O    . ALA B 1 56  ? 110.789 141.237 -47.145 1.00 0.00 ? 56  ALA B O    1 
ATOM 2829  C CB   . ALA B 1 56  ? 108.720 143.767 -45.810 1.00 0.00 ? 56  ALA B CB   1 
ATOM 2830  H H    . ALA B 1 56  ? 109.942 142.943 -43.646 1.00 0.00 ? 56  ALA B H    1 
ATOM 2831  H HA   . ALA B 1 56  ? 108.621 141.636 -45.927 1.00 0.00 ? 56  ALA B HA   1 
ATOM 2832  H HB1  . ALA B 1 56  ? 109.386 144.519 -45.424 1.00 0.00 ? 56  ALA B HB1  1 
ATOM 2833  H HB2  . ALA B 1 56  ? 107.776 143.817 -45.285 1.00 0.00 ? 56  ALA B HB2  1 
ATOM 2834  H HB3  . ALA B 1 56  ? 108.553 143.940 -46.864 1.00 0.00 ? 56  ALA B HB3  1 
ATOM 2835  N N    . GLU B 1 57  ? 111.436 143.278 -46.470 1.00 0.00 ? 57  GLU B N    1 
ATOM 2836  C CA   . GLU B 1 57  ? 112.663 143.256 -47.270 1.00 0.00 ? 57  GLU B CA   1 
ATOM 2837  C C    . GLU B 1 57  ? 113.528 142.043 -46.885 1.00 0.00 ? 57  GLU B C    1 
ATOM 2838  O O    . GLU B 1 57  ? 113.045 141.101 -46.256 1.00 0.00 ? 57  GLU B O    1 
ATOM 2839  C CB   . GLU B 1 57  ? 113.453 144.579 -47.052 1.00 0.00 ? 57  GLU B CB   1 
ATOM 2840  C CG   . GLU B 1 57  ? 114.130 145.041 -48.356 1.00 0.00 ? 57  GLU B CG   1 
ATOM 2841  C CD   . GLU B 1 57  ? 113.095 145.651 -49.300 1.00 0.00 ? 57  GLU B CD   1 
ATOM 2842  O OE1  . GLU B 1 57  ? 111.955 145.790 -48.888 1.00 0.00 ? 57  GLU B OE1  1 
ATOM 2843  O OE2  . GLU B 1 57  ? 113.461 145.972 -50.418 1.00 0.00 ? 57  GLU B OE2  1 
ATOM 2844  H H    . GLU B 1 57  ? 111.232 144.065 -45.923 1.00 0.00 ? 57  GLU B H    1 
ATOM 2845  H HA   . GLU B 1 57  ? 112.389 143.171 -48.312 1.00 0.00 ? 57  GLU B HA   1 
ATOM 2846  H HB2  . GLU B 1 57  ? 112.770 145.343 -46.725 1.00 0.00 ? 57  GLU B HB2  1 
ATOM 2847  H HB3  . GLU B 1 57  ? 114.209 144.435 -46.294 1.00 0.00 ? 57  GLU B HB3  1 
ATOM 2848  H HG2  . GLU B 1 57  ? 114.882 145.781 -48.124 1.00 0.00 ? 57  GLU B HG2  1 
ATOM 2849  H HG3  . GLU B 1 57  ? 114.596 144.198 -48.838 1.00 0.00 ? 57  GLU B HG3  1 
ATOM 2850  N N    . LYS B 1 58  ? 114.809 142.082 -47.271 1.00 0.00 ? 58  LYS B N    1 
ATOM 2851  C CA   . LYS B 1 58  ? 115.752 140.989 -46.972 1.00 0.00 ? 58  LYS B CA   1 
ATOM 2852  C C    . LYS B 1 58  ? 116.674 141.380 -45.824 1.00 0.00 ? 58  LYS B C    1 
ATOM 2853  O O    . LYS B 1 58  ? 116.858 142.557 -45.546 1.00 0.00 ? 58  LYS B O    1 
ATOM 2854  C CB   . LYS B 1 58  ? 116.598 140.674 -48.216 1.00 0.00 ? 58  LYS B CB   1 
ATOM 2855  C CG   . LYS B 1 58  ? 117.108 141.973 -48.840 1.00 0.00 ? 58  LYS B CG   1 
ATOM 2856  C CD   . LYS B 1 58  ? 117.950 141.644 -50.072 1.00 0.00 ? 58  LYS B CD   1 
ATOM 2857  C CE   . LYS B 1 58  ? 118.453 142.941 -50.704 1.00 0.00 ? 58  LYS B CE   1 
ATOM 2858  N NZ   . LYS B 1 58  ? 119.286 142.620 -51.896 1.00 0.00 ? 58  LYS B NZ   1 
ATOM 2859  H H    . LYS B 1 58  ? 115.131 142.860 -47.768 1.00 0.00 ? 58  LYS B H    1 
ATOM 2860  H HA   . LYS B 1 58  ? 115.202 140.099 -46.693 1.00 0.00 ? 58  LYS B HA   1 
ATOM 2861  H HB2  . LYS B 1 58  ? 117.445 140.064 -47.934 1.00 0.00 ? 58  LYS B HB2  1 
ATOM 2862  H HB3  . LYS B 1 58  ? 115.995 140.144 -48.937 1.00 0.00 ? 58  LYS B HB3  1 
ATOM 2863  H HG2  . LYS B 1 58  ? 116.271 142.587 -49.131 1.00 0.00 ? 58  LYS B HG2  1 
ATOM 2864  H HG3  . LYS B 1 58  ? 117.715 142.504 -48.123 1.00 0.00 ? 58  LYS B HG3  1 
ATOM 2865  H HD2  . LYS B 1 58  ? 118.793 141.034 -49.779 1.00 0.00 ? 58  LYS B HD2  1 
ATOM 2866  H HD3  . LYS B 1 58  ? 117.348 141.107 -50.788 1.00 0.00 ? 58  LYS B HD3  1 
ATOM 2867  H HE2  . LYS B 1 58  ? 117.610 143.544 -51.005 1.00 0.00 ? 58  LYS B HE2  1 
ATOM 2868  H HE3  . LYS B 1 58  ? 119.048 143.484 -49.985 1.00 0.00 ? 58  LYS B HE3  1 
ATOM 2869  H HZ1  . LYS B 1 58  ? 120.095 143.269 -51.939 1.00 0.00 ? 58  LYS B HZ1  1 
ATOM 2870  H HZ2  . LYS B 1 58  ? 118.710 142.724 -52.758 1.00 0.00 ? 58  LYS B HZ2  1 
ATOM 2871  H HZ3  . LYS B 1 58  ? 119.631 141.642 -51.826 1.00 0.00 ? 58  LYS B HZ3  1 
ATOM 2872  N N    . THR B 1 59  ? 117.257 140.382 -45.163 1.00 0.00 ? 59  THR B N    1 
ATOM 2873  C CA   . THR B 1 59  ? 118.170 140.648 -44.054 1.00 0.00 ? 59  THR B CA   1 
ATOM 2874  C C    . THR B 1 59  ? 119.559 140.989 -44.588 1.00 0.00 ? 59  THR B C    1 
ATOM 2875  O O    . THR B 1 59  ? 120.254 141.845 -44.036 1.00 0.00 ? 59  THR B O    1 
ATOM 2876  C CB   . THR B 1 59  ? 118.262 139.423 -43.140 1.00 0.00 ? 59  THR B CB   1 
ATOM 2877  O OG1  . THR B 1 59  ? 118.749 138.313 -43.883 1.00 0.00 ? 59  THR B OG1  1 
ATOM 2878  C CG2  . THR B 1 59  ? 116.878 139.095 -42.577 1.00 0.00 ? 59  THR B CG2  1 
ATOM 2879  H H    . THR B 1 59  ? 117.079 139.456 -45.430 1.00 0.00 ? 59  THR B H    1 
ATOM 2880  H HA   . THR B 1 59  ? 117.798 141.485 -43.481 1.00 0.00 ? 59  THR B HA   1 
ATOM 2881  H HB   . THR B 1 59  ? 118.936 139.634 -42.323 1.00 0.00 ? 59  THR B HB   1 
ATOM 2882  H HG1  . THR B 1 59  ? 118.339 137.519 -43.532 1.00 0.00 ? 59  THR B HG1  1 
ATOM 2883  H HG21 . THR B 1 59  ? 116.963 138.293 -41.859 1.00 0.00 ? 59  THR B HG21 1 
ATOM 2884  H HG22 . THR B 1 59  ? 116.227 138.791 -43.382 1.00 0.00 ? 59  THR B HG22 1 
ATOM 2885  H HG23 . THR B 1 59  ? 116.470 139.970 -42.094 1.00 0.00 ? 59  THR B HG23 1 
ATOM 2886  N N    . LYS B 1 60  ? 119.948 140.311 -45.669 1.00 0.00 ? 60  LYS B N    1 
ATOM 2887  C CA   . LYS B 1 60  ? 121.252 140.534 -46.290 1.00 0.00 ? 60  LYS B CA   1 
ATOM 2888  C C    . LYS B 1 60  ? 122.376 139.929 -45.423 1.00 0.00 ? 60  LYS B C    1 
ATOM 2889  O O    . LYS B 1 60  ? 123.177 140.657 -44.851 1.00 0.00 ? 60  LYS B O    1 
ATOM 2890  C CB   . LYS B 1 60  ? 121.500 142.037 -46.483 1.00 0.00 ? 60  LYS B CB   1 
ATOM 2891  C CG   . LYS B 1 60  ? 122.499 142.271 -47.635 1.00 0.00 ? 60  LYS B CG   1 
ATOM 2892  C CD   . LYS B 1 60  ? 122.747 143.772 -47.815 1.00 0.00 ? 60  LYS B CD   1 
ATOM 2893  C CE   . LYS B 1 60  ? 123.503 144.011 -49.124 1.00 0.00 ? 60  LYS B CE   1 
ATOM 2894  N NZ   . LYS B 1 60  ? 122.613 143.694 -50.279 1.00 0.00 ? 60  LYS B NZ   1 
ATOM 2895  H H    . LYS B 1 60  ? 119.345 139.641 -46.058 1.00 0.00 ? 60  LYS B H    1 
ATOM 2896  H HA   . LYS B 1 60  ? 121.254 140.068 -47.249 1.00 0.00 ? 60  LYS B HA   1 
ATOM 2897  H HB2  . LYS B 1 60  ? 120.567 142.528 -46.712 1.00 0.00 ? 60  LYS B HB2  1 
ATOM 2898  H HB3  . LYS B 1 60  ? 121.901 142.441 -45.583 1.00 0.00 ? 60  LYS B HB3  1 
ATOM 2899  H HG2  . LYS B 1 60  ? 123.433 141.779 -47.406 1.00 0.00 ? 60  LYS B HG2  1 
ATOM 2900  H HG3  . LYS B 1 60  ? 122.095 141.864 -48.549 1.00 0.00 ? 60  LYS B HG3  1 
ATOM 2901  H HD2  . LYS B 1 60  ? 121.801 144.294 -47.841 1.00 0.00 ? 60  LYS B HD2  1 
ATOM 2902  H HD3  . LYS B 1 60  ? 123.339 144.139 -46.991 1.00 0.00 ? 60  LYS B HD3  1 
ATOM 2903  H HE2  . LYS B 1 60  ? 123.808 145.046 -49.179 1.00 0.00 ? 60  LYS B HE2  1 
ATOM 2904  H HE3  . LYS B 1 60  ? 124.376 143.376 -49.156 1.00 0.00 ? 60  LYS B HE3  1 
ATOM 2905  H HZ1  . LYS B 1 60  ? 123.122 143.087 -50.951 1.00 0.00 ? 60  LYS B HZ1  1 
ATOM 2906  H HZ2  . LYS B 1 60  ? 122.332 144.577 -50.752 1.00 0.00 ? 60  LYS B HZ2  1 
ATOM 2907  H HZ3  . LYS B 1 60  ? 121.766 143.197 -49.939 1.00 0.00 ? 60  LYS B HZ3  1 
ATOM 2908  N N    . GLU B 1 61  ? 122.425 138.597 -45.318 1.00 0.00 ? 61  GLU B N    1 
ATOM 2909  C CA   . GLU B 1 61  ? 123.464 137.932 -44.504 1.00 0.00 ? 61  GLU B CA   1 
ATOM 2910  C C    . GLU B 1 61  ? 124.595 137.420 -45.395 1.00 0.00 ? 61  GLU B C    1 
ATOM 2911  O O    . GLU B 1 61  ? 124.619 136.249 -45.773 1.00 0.00 ? 61  GLU B O    1 
ATOM 2912  C CB   . GLU B 1 61  ? 122.843 136.763 -43.731 1.00 0.00 ? 61  GLU B CB   1 
ATOM 2913  C CG   . GLU B 1 61  ? 121.962 137.313 -42.606 1.00 0.00 ? 61  GLU B CG   1 
ATOM 2914  C CD   . GLU B 1 61  ? 121.148 136.190 -41.972 1.00 0.00 ? 61  GLU B CD   1 
ATOM 2915  O OE1  . GLU B 1 61  ? 121.045 135.142 -42.582 1.00 0.00 ? 61  GLU B OE1  1 
ATOM 2916  O OE2  . GLU B 1 61  ? 120.637 136.398 -40.882 1.00 0.00 ? 61  GLU B OE2  1 
ATOM 2917  H H    . GLU B 1 61  ? 121.760 138.051 -45.786 1.00 0.00 ? 61  GLU B H    1 
ATOM 2918  H HA   . GLU B 1 61  ? 123.875 138.638 -43.792 1.00 0.00 ? 61  GLU B HA   1 
ATOM 2919  H HB2  . GLU B 1 61  ? 122.243 136.164 -44.401 1.00 0.00 ? 61  GLU B HB2  1 
ATOM 2920  H HB3  . GLU B 1 61  ? 123.627 136.153 -43.305 1.00 0.00 ? 61  GLU B HB3  1 
ATOM 2921  H HG2  . GLU B 1 61  ? 122.588 137.765 -41.855 1.00 0.00 ? 61  GLU B HG2  1 
ATOM 2922  H HG3  . GLU B 1 61  ? 121.290 138.057 -43.008 1.00 0.00 ? 61  GLU B HG3  1 
ATOM 2923  N N    . GLN B 1 62  ? 125.533 138.309 -45.730 1.00 0.00 ? 62  GLN B N    1 
ATOM 2924  C CA   . GLN B 1 62  ? 126.654 137.926 -46.584 1.00 0.00 ? 62  GLN B CA   1 
ATOM 2925  C C    . GLN B 1 62  ? 127.653 137.060 -45.820 1.00 0.00 ? 62  GLN B C    1 
ATOM 2926  O O    . GLN B 1 62  ? 127.629 135.835 -45.925 1.00 0.00 ? 62  GLN B O    1 
ATOM 2927  C CB   . GLN B 1 62  ? 127.368 139.173 -47.113 1.00 0.00 ? 62  GLN B CB   1 
ATOM 2928  C CG   . GLN B 1 62  ? 126.470 139.908 -48.110 1.00 0.00 ? 62  GLN B CG   1 
ATOM 2929  C CD   . GLN B 1 62  ? 127.102 141.248 -48.483 1.00 0.00 ? 62  GLN B CD   1 
ATOM 2930  O OE1  . GLN B 1 62  ? 127.884 141.802 -47.711 1.00 0.00 ? 62  GLN B OE1  1 
ATOM 2931  N NE2  . GLN B 1 62  ? 126.807 141.804 -49.626 1.00 0.00 ? 62  GLN B NE2  1 
ATOM 2932  H H    . GLN B 1 62  ? 125.466 139.230 -45.402 1.00 0.00 ? 62  GLN B H    1 
ATOM 2933  H HA   . GLN B 1 62  ? 126.274 137.364 -47.422 1.00 0.00 ? 62  GLN B HA   1 
ATOM 2934  H HB2  . GLN B 1 62  ? 127.600 139.827 -46.290 1.00 0.00 ? 62  GLN B HB2  1 
ATOM 2935  H HB3  . GLN B 1 62  ? 128.282 138.880 -47.606 1.00 0.00 ? 62  GLN B HB3  1 
ATOM 2936  H HG2  . GLN B 1 62  ? 126.351 139.306 -48.999 1.00 0.00 ? 62  GLN B HG2  1 
ATOM 2937  H HG3  . GLN B 1 62  ? 125.503 140.083 -47.662 1.00 0.00 ? 62  GLN B HG3  1 
ATOM 2938  H HE21 . GLN B 1 62  ? 126.184 141.365 -50.239 1.00 0.00 ? 62  GLN B HE21 1 
ATOM 2939  H HE22 . GLN B 1 62  ? 127.211 142.664 -49.870 1.00 0.00 ? 62  GLN B HE22 1 
ATOM 2940  N N    . VAL B 1 63  ? 128.540 137.705 -45.045 1.00 0.00 ? 63  VAL B N    1 
ATOM 2941  C CA   . VAL B 1 63  ? 129.558 136.973 -44.263 1.00 0.00 ? 63  VAL B CA   1 
ATOM 2942  C C    . VAL B 1 63  ? 129.374 137.219 -42.766 1.00 0.00 ? 63  VAL B C    1 
ATOM 2943  O O    . VAL B 1 63  ? 129.425 138.351 -42.300 1.00 0.00 ? 63  VAL B O    1 
ATOM 2944  C CB   . VAL B 1 63  ? 130.960 137.420 -44.687 1.00 0.00 ? 63  VAL B CB   1 
ATOM 2945  C CG1  . VAL B 1 63  ? 132.005 136.657 -43.871 1.00 0.00 ? 63  VAL B CG1  1 
ATOM 2946  C CG2  . VAL B 1 63  ? 131.162 137.120 -46.175 1.00 0.00 ? 63  VAL B CG2  1 
ATOM 2947  H H    . VAL B 1 63  ? 128.516 138.682 -44.999 1.00 0.00 ? 63  VAL B H    1 
ATOM 2948  H HA   . VAL B 1 63  ? 129.469 135.915 -44.450 1.00 0.00 ? 63  VAL B HA   1 
ATOM 2949  H HB   . VAL B 1 63  ? 131.070 138.481 -44.512 1.00 0.00 ? 63  VAL B HB   1 
ATOM 2950  H HG11 . VAL B 1 63  ? 131.762 135.604 -43.872 1.00 0.00 ? 63  VAL B HG11 1 
ATOM 2951  H HG12 . VAL B 1 63  ? 132.009 137.024 -42.857 1.00 0.00 ? 63  VAL B HG12 1 
ATOM 2952  H HG13 . VAL B 1 63  ? 132.981 136.800 -44.311 1.00 0.00 ? 63  VAL B HG13 1 
ATOM 2953  H HG21 . VAL B 1 63  ? 130.332 137.519 -46.739 1.00 0.00 ? 63  VAL B HG21 1 
ATOM 2954  H HG22 . VAL B 1 63  ? 131.215 136.050 -46.322 1.00 0.00 ? 63  VAL B HG22 1 
ATOM 2955  H HG23 . VAL B 1 63  ? 132.081 137.574 -46.514 1.00 0.00 ? 63  VAL B HG23 1 
ATOM 2956  N N    . THR B 1 64  ? 129.164 136.135 -42.014 1.00 0.00 ? 64  THR B N    1 
ATOM 2957  C CA   . THR B 1 64  ? 128.976 136.223 -40.554 1.00 0.00 ? 64  THR B CA   1 
ATOM 2958  C C    . THR B 1 64  ? 129.991 135.336 -39.839 1.00 0.00 ? 64  THR B C    1 
ATOM 2959  O O    . THR B 1 64  ? 130.101 134.149 -40.138 1.00 0.00 ? 64  THR B O    1 
ATOM 2960  C CB   . THR B 1 64  ? 127.561 135.764 -40.190 1.00 0.00 ? 64  THR B CB   1 
ATOM 2961  O OG1  . THR B 1 64  ? 126.610 136.593 -40.846 1.00 0.00 ? 64  THR B OG1  1 
ATOM 2962  C CG2  . THR B 1 64  ? 127.364 135.858 -38.677 1.00 0.00 ? 64  THR B CG2  1 
ATOM 2963  H H    . THR B 1 64  ? 129.137 135.256 -42.444 1.00 0.00 ? 64  THR B H    1 
ATOM 2964  H HA   . THR B 1 64  ? 129.108 137.247 -40.222 1.00 0.00 ? 64  THR B HA   1 
ATOM 2965  H HB   . THR B 1 64  ? 127.423 134.740 -40.503 1.00 0.00 ? 64  THR B HB   1 
ATOM 2966  H HG1  . THR B 1 64  ? 126.750 137.495 -40.552 1.00 0.00 ? 64  THR B HG1  1 
ATOM 2967  H HG21 . THR B 1 64  ? 127.731 136.810 -38.325 1.00 0.00 ? 64  THR B HG21 1 
ATOM 2968  H HG22 . THR B 1 64  ? 127.909 135.060 -38.194 1.00 0.00 ? 64  THR B HG22 1 
ATOM 2969  H HG23 . THR B 1 64  ? 126.314 135.769 -38.445 1.00 0.00 ? 64  THR B HG23 1 
ATOM 2970  N N    . ASN B 1 65  ? 130.735 135.921 -38.890 1.00 0.00 ? 65  ASN B N    1 
ATOM 2971  C CA   . ASN B 1 65  ? 131.749 135.171 -38.127 1.00 0.00 ? 65  ASN B CA   1 
ATOM 2972  C C    . ASN B 1 65  ? 131.579 135.411 -36.626 1.00 0.00 ? 65  ASN B C    1 
ATOM 2973  O O    . ASN B 1 65  ? 131.742 136.532 -36.144 1.00 0.00 ? 65  ASN B O    1 
ATOM 2974  C CB   . ASN B 1 65  ? 133.151 135.608 -38.563 1.00 0.00 ? 65  ASN B CB   1 
ATOM 2975  C CG   . ASN B 1 65  ? 133.341 135.336 -40.053 1.00 0.00 ? 65  ASN B CG   1 
ATOM 2976  O OD1  . ASN B 1 65  ? 132.944 134.281 -40.548 1.00 0.00 ? 65  ASN B OD1  1 
ATOM 2977  N ND2  . ASN B 1 65  ? 133.926 136.229 -40.802 1.00 0.00 ? 65  ASN B ND2  1 
ATOM 2978  H H    . ASN B 1 65  ? 130.601 136.872 -38.694 1.00 0.00 ? 65  ASN B H    1 
ATOM 2979  H HA   . ASN B 1 65  ? 131.642 134.111 -38.320 1.00 0.00 ? 65  ASN B HA   1 
ATOM 2980  H HB2  . ASN B 1 65  ? 133.272 136.663 -38.372 1.00 0.00 ? 65  ASN B HB2  1 
ATOM 2981  H HB3  . ASN B 1 65  ? 133.889 135.055 -38.002 1.00 0.00 ? 65  ASN B HB3  1 
ATOM 2982  H HD21 . ASN B 1 65  ? 134.240 137.069 -40.409 1.00 0.00 ? 65  ASN B HD21 1 
ATOM 2983  H HD22 . ASN B 1 65  ? 134.051 136.060 -41.760 1.00 0.00 ? 65  ASN B HD22 1 
ATOM 2984  N N    . VAL B 1 66  ? 131.245 134.344 -35.891 1.00 0.00 ? 66  VAL B N    1 
ATOM 2985  C CA   . VAL B 1 66  ? 131.047 134.434 -34.432 1.00 0.00 ? 66  VAL B CA   1 
ATOM 2986  C C    . VAL B 1 66  ? 131.787 133.310 -33.713 1.00 0.00 ? 66  VAL B C    1 
ATOM 2987  O O    . VAL B 1 66  ? 131.666 132.142 -34.081 1.00 0.00 ? 66  VAL B O    1 
ATOM 2988  C CB   . VAL B 1 66  ? 129.559 134.347 -34.108 1.00 0.00 ? 66  VAL B CB   1 
ATOM 2989  C CG1  . VAL B 1 66  ? 129.368 134.399 -32.589 1.00 0.00 ? 66  VAL B CG1  1 
ATOM 2990  C CG2  . VAL B 1 66  ? 128.832 135.526 -34.759 1.00 0.00 ? 66  VAL B CG2  1 
ATOM 2991  H H    . VAL B 1 66  ? 131.128 133.477 -36.335 1.00 0.00 ? 66  VAL B H    1 
ATOM 2992  H HA   . VAL B 1 66  ? 131.425 135.383 -34.071 1.00 0.00 ? 66  VAL B HA   1 
ATOM 2993  H HB   . VAL B 1 66  ? 129.160 133.418 -34.489 1.00 0.00 ? 66  VAL B HB   1 
ATOM 2994  H HG11 . VAL B 1 66  ? 129.944 135.216 -32.182 1.00 0.00 ? 66  VAL B HG11 1 
ATOM 2995  H HG12 . VAL B 1 66  ? 129.705 133.470 -32.152 1.00 0.00 ? 66  VAL B HG12 1 
ATOM 2996  H HG13 . VAL B 1 66  ? 128.327 134.543 -32.362 1.00 0.00 ? 66  VAL B HG13 1 
ATOM 2997  H HG21 . VAL B 1 66  ? 129.046 135.539 -35.818 1.00 0.00 ? 66  VAL B HG21 1 
ATOM 2998  H HG22 . VAL B 1 66  ? 129.168 136.449 -34.312 1.00 0.00 ? 66  VAL B HG22 1 
ATOM 2999  H HG23 . VAL B 1 66  ? 127.770 135.421 -34.610 1.00 0.00 ? 66  VAL B HG23 1 
ATOM 3000  N N    . GLY B 1 67  ? 132.546 133.670 -32.681 1.00 0.00 ? 67  GLY B N    1 
ATOM 3001  C CA   . GLY B 1 67  ? 133.293 132.679 -31.914 1.00 0.00 ? 67  GLY B CA   1 
ATOM 3002  C C    . GLY B 1 67  ? 132.382 131.933 -30.938 1.00 0.00 ? 67  GLY B C    1 
ATOM 3003  O O    . GLY B 1 67  ? 132.266 130.708 -30.997 1.00 0.00 ? 67  GLY B O    1 
ATOM 3004  H H    . GLY B 1 67  ? 132.600 134.616 -32.429 1.00 0.00 ? 67  GLY B H    1 
ATOM 3005  H HA2  . GLY B 1 67  ? 133.741 131.969 -32.595 1.00 0.00 ? 67  GLY B HA2  1 
ATOM 3006  H HA3  . GLY B 1 67  ? 134.073 133.177 -31.358 1.00 0.00 ? 67  GLY B HA3  1 
ATOM 3007  N N    . GLY B 1 68  ? 131.741 132.680 -30.039 1.00 0.00 ? 68  GLY B N    1 
ATOM 3008  C CA   . GLY B 1 68  ? 130.849 132.074 -29.050 1.00 0.00 ? 68  GLY B CA   1 
ATOM 3009  C C    . GLY B 1 68  ? 129.537 131.621 -29.687 1.00 0.00 ? 68  GLY B C    1 
ATOM 3010  O O    . GLY B 1 68  ? 129.502 130.628 -30.410 1.00 0.00 ? 68  GLY B O    1 
ATOM 3011  H H    . GLY B 1 68  ? 131.873 133.651 -30.034 1.00 0.00 ? 68  GLY B H    1 
ATOM 3012  H HA2  . GLY B 1 68  ? 131.341 131.219 -28.610 1.00 0.00 ? 68  GLY B HA2  1 
ATOM 3013  H HA3  . GLY B 1 68  ? 130.635 132.795 -28.277 1.00 0.00 ? 68  GLY B HA3  1 
ATOM 3014  N N    . ALA B 1 69  ? 128.453 132.353 -29.405 1.00 0.00 ? 69  ALA B N    1 
ATOM 3015  C CA   . ALA B 1 69  ? 127.128 132.011 -29.948 1.00 0.00 ? 69  ALA B CA   1 
ATOM 3016  C C    . ALA B 1 69  ? 126.375 133.268 -30.366 1.00 0.00 ? 69  ALA B C    1 
ATOM 3017  O O    . ALA B 1 69  ? 126.620 134.359 -29.843 1.00 0.00 ? 69  ALA B O    1 
ATOM 3018  C CB   . ALA B 1 69  ? 126.314 131.261 -28.893 1.00 0.00 ? 69  ALA B CB   1 
ATOM 3019  H H    . ALA B 1 69  ? 128.543 133.131 -28.816 1.00 0.00 ? 69  ALA B H    1 
ATOM 3020  H HA   . ALA B 1 69  ? 127.245 131.374 -30.815 1.00 0.00 ? 69  ALA B HA   1 
ATOM 3021  H HB1  . ALA B 1 69  ? 126.178 131.891 -28.027 1.00 0.00 ? 69  ALA B HB1  1 
ATOM 3022  H HB2  . ALA B 1 69  ? 126.840 130.362 -28.605 1.00 0.00 ? 69  ALA B HB2  1 
ATOM 3023  H HB3  . ALA B 1 69  ? 125.349 130.998 -29.302 1.00 0.00 ? 69  ALA B HB3  1 
ATOM 3024  N N    . VAL B 1 70  ? 125.450 133.110 -31.321 1.00 0.00 ? 70  VAL B N    1 
ATOM 3025  C CA   . VAL B 1 70  ? 124.651 134.245 -31.818 1.00 0.00 ? 70  VAL B CA   1 
ATOM 3026  C C    . VAL B 1 70  ? 123.196 133.838 -32.048 1.00 0.00 ? 70  VAL B C    1 
ATOM 3027  O O    . VAL B 1 70  ? 122.911 132.828 -32.686 1.00 0.00 ? 70  VAL B O    1 
ATOM 3028  C CB   . VAL B 1 70  ? 125.266 134.778 -33.125 1.00 0.00 ? 70  VAL B CB   1 
ATOM 3029  C CG1  . VAL B 1 70  ? 125.561 133.603 -34.065 1.00 0.00 ? 70  VAL B CG1  1 
ATOM 3030  C CG2  . VAL B 1 70  ? 124.296 135.767 -33.817 1.00 0.00 ? 70  VAL B CG2  1 
ATOM 3031  H H    . VAL B 1 70  ? 125.300 132.219 -31.700 1.00 0.00 ? 70  VAL B H    1 
ATOM 3032  H HA   . VAL B 1 70  ? 124.669 135.035 -31.086 1.00 0.00 ? 70  VAL B HA   1 
ATOM 3033  H HB   . VAL B 1 70  ? 126.188 135.284 -32.897 1.00 0.00 ? 70  VAL B HB   1 
ATOM 3034  H HG11 . VAL B 1 70  ? 126.276 132.940 -33.601 1.00 0.00 ? 70  VAL B HG11 1 
ATOM 3035  H HG12 . VAL B 1 70  ? 125.966 133.977 -34.994 1.00 0.00 ? 70  VAL B HG12 1 
ATOM 3036  H HG13 . VAL B 1 70  ? 124.649 133.068 -34.263 1.00 0.00 ? 70  VAL B HG13 1 
ATOM 3037  H HG21 . VAL B 1 70  ? 123.779 136.351 -33.068 1.00 0.00 ? 70  VAL B HG21 1 
ATOM 3038  H HG22 . VAL B 1 70  ? 123.572 135.221 -34.405 1.00 0.00 ? 70  VAL B HG22 1 
ATOM 3039  H HG23 . VAL B 1 70  ? 124.857 136.428 -34.463 1.00 0.00 ? 70  VAL B HG23 1 
ATOM 3040  N N    . VAL B 1 71  ? 122.276 134.651 -31.527 1.00 0.00 ? 71  VAL B N    1 
ATOM 3041  C CA   . VAL B 1 71  ? 120.834 134.391 -31.681 1.00 0.00 ? 71  VAL B CA   1 
ATOM 3042  C C    . VAL B 1 71  ? 120.141 135.623 -32.252 1.00 0.00 ? 71  VAL B C    1 
ATOM 3043  O O    . VAL B 1 71  ? 120.231 136.713 -31.688 1.00 0.00 ? 71  VAL B O    1 
ATOM 3044  C CB   . VAL B 1 71  ? 120.223 134.041 -30.324 1.00 0.00 ? 71  VAL B CB   1 
ATOM 3045  C CG1  . VAL B 1 71  ? 118.728 133.763 -30.489 1.00 0.00 ? 71  VAL B CG1  1 
ATOM 3046  C CG2  . VAL B 1 71  ? 120.913 132.797 -29.767 1.00 0.00 ? 71  VAL B CG2  1 
ATOM 3047  H H    . VAL B 1 71  ? 122.569 135.452 -31.034 1.00 0.00 ? 71  VAL B H    1 
ATOM 3048  H HA   . VAL B 1 71  ? 120.679 133.561 -32.358 1.00 0.00 ? 71  VAL B HA   1 
ATOM 3049  H HB   . VAL B 1 71  ? 120.363 134.868 -29.643 1.00 0.00 ? 71  VAL B HB   1 
ATOM 3050  H HG11 . VAL B 1 71  ? 118.337 133.341 -29.575 1.00 0.00 ? 71  VAL B HG11 1 
ATOM 3051  H HG12 . VAL B 1 71  ? 118.579 133.065 -31.300 1.00 0.00 ? 71  VAL B HG12 1 
ATOM 3052  H HG13 . VAL B 1 71  ? 118.211 134.686 -30.710 1.00 0.00 ? 71  VAL B HG13 1 
ATOM 3053  H HG21 . VAL B 1 71  ? 121.983 132.902 -29.867 1.00 0.00 ? 71  VAL B HG21 1 
ATOM 3054  H HG22 . VAL B 1 71  ? 120.583 131.926 -30.313 1.00 0.00 ? 71  VAL B HG22 1 
ATOM 3055  H HG23 . VAL B 1 71  ? 120.660 132.686 -28.727 1.00 0.00 ? 71  VAL B HG23 1 
ATOM 3056  N N    . THR B 1 72  ? 119.446 135.450 -33.380 1.00 0.00 ? 72  THR B N    1 
ATOM 3057  C CA   . THR B 1 72  ? 118.737 136.571 -34.028 1.00 0.00 ? 72  THR B CA   1 
ATOM 3058  C C    . THR B 1 72  ? 117.267 136.226 -34.251 1.00 0.00 ? 72  THR B C    1 
ATOM 3059  O O    . THR B 1 72  ? 116.920 135.074 -34.518 1.00 0.00 ? 72  THR B O    1 
ATOM 3060  C CB   . THR B 1 72  ? 119.398 136.880 -35.378 1.00 0.00 ? 72  THR B CB   1 
ATOM 3061  O OG1  . THR B 1 72  ? 119.296 135.743 -36.225 1.00 0.00 ? 72  THR B OG1  1 
ATOM 3062  C CG2  . THR B 1 72  ? 120.875 137.221 -35.160 1.00 0.00 ? 72  THR B CG2  1 
ATOM 3063  H H    . THR B 1 72  ? 119.410 134.558 -33.788 1.00 0.00 ? 72  THR B H    1 
ATOM 3064  H HA   . THR B 1 72  ? 118.796 137.455 -33.405 1.00 0.00 ? 72  THR B HA   1 
ATOM 3065  H HB   . THR B 1 72  ? 118.904 137.719 -35.839 1.00 0.00 ? 72  THR B HB   1 
ATOM 3066  H HG1  . THR B 1 72  ? 119.505 136.020 -37.121 1.00 0.00 ? 72  THR B HG1  1 
ATOM 3067  H HG21 . THR B 1 72  ? 121.430 136.315 -34.963 1.00 0.00 ? 72  THR B HG21 1 
ATOM 3068  H HG22 . THR B 1 72  ? 120.970 137.891 -34.318 1.00 0.00 ? 72  THR B HG22 1 
ATOM 3069  H HG23 . THR B 1 72  ? 121.270 137.699 -36.045 1.00 0.00 ? 72  THR B HG23 1 
ATOM 3070  N N    . GLY B 1 73  ? 116.399 137.242 -34.153 1.00 0.00 ? 73  GLY B N    1 
ATOM 3071  C CA   . GLY B 1 73  ? 114.950 137.047 -34.355 1.00 0.00 ? 73  GLY B CA   1 
ATOM 3072  C C    . GLY B 1 73  ? 114.161 137.402 -33.097 1.00 0.00 ? 73  GLY B C    1 
ATOM 3073  O O    . GLY B 1 73  ? 114.296 138.496 -32.556 1.00 0.00 ? 73  GLY B O    1 
ATOM 3074  H H    . GLY B 1 73  ? 116.736 138.141 -33.945 1.00 0.00 ? 73  GLY B H    1 
ATOM 3075  H HA2  . GLY B 1 73  ? 114.621 137.682 -35.165 1.00 0.00 ? 73  GLY B HA2  1 
ATOM 3076  H HA3  . GLY B 1 73  ? 114.749 136.017 -34.614 1.00 0.00 ? 73  GLY B HA3  1 
ATOM 3077  N N    . VAL B 1 74  ? 113.320 136.468 -32.637 1.00 0.00 ? 74  VAL B N    1 
ATOM 3078  C CA   . VAL B 1 74  ? 112.498 136.697 -31.437 1.00 0.00 ? 74  VAL B CA   1 
ATOM 3079  C C    . VAL B 1 74  ? 112.432 135.439 -30.561 1.00 0.00 ? 74  VAL B C    1 
ATOM 3080  O O    . VAL B 1 74  ? 112.134 134.349 -31.035 1.00 0.00 ? 74  VAL B O    1 
ATOM 3081  C CB   . VAL B 1 74  ? 111.077 137.132 -31.861 1.00 0.00 ? 74  VAL B CB   1 
ATOM 3082  C CG1  . VAL B 1 74  ? 110.556 136.198 -32.954 1.00 0.00 ? 74  VAL B CG1  1 
ATOM 3083  C CG2  . VAL B 1 74  ? 110.120 137.093 -30.646 1.00 0.00 ? 74  VAL B CG2  1 
ATOM 3084  H H    . VAL B 1 74  ? 113.248 135.614 -33.113 1.00 0.00 ? 74  VAL B H    1 
ATOM 3085  H HA   . VAL B 1 74  ? 112.935 137.489 -30.855 1.00 0.00 ? 74  VAL B HA   1 
ATOM 3086  H HB   . VAL B 1 74  ? 111.119 138.139 -32.252 1.00 0.00 ? 74  VAL B HB   1 
ATOM 3087  H HG11 . VAL B 1 74  ? 109.526 136.441 -33.176 1.00 0.00 ? 74  VAL B HG11 1 
ATOM 3088  H HG12 . VAL B 1 74  ? 110.618 135.181 -32.617 1.00 0.00 ? 74  VAL B HG12 1 
ATOM 3089  H HG13 . VAL B 1 74  ? 111.152 136.318 -33.846 1.00 0.00 ? 74  VAL B HG13 1 
ATOM 3090  H HG21 . VAL B 1 74  ? 109.271 137.733 -30.837 1.00 0.00 ? 74  VAL B HG21 1 
ATOM 3091  H HG22 . VAL B 1 74  ? 110.638 137.440 -29.764 1.00 0.00 ? 74  VAL B HG22 1 
ATOM 3092  H HG23 . VAL B 1 74  ? 109.779 136.082 -30.483 1.00 0.00 ? 74  VAL B HG23 1 
ATOM 3093  N N    . THR B 1 75  ? 112.702 135.613 -29.265 1.00 0.00 ? 75  THR B N    1 
ATOM 3094  C CA   . THR B 1 75  ? 112.659 134.498 -28.303 1.00 0.00 ? 75  THR B CA   1 
ATOM 3095  C C    . THR B 1 75  ? 111.829 134.897 -27.096 1.00 0.00 ? 75  THR B C    1 
ATOM 3096  O O    . THR B 1 75  ? 112.063 135.942 -26.496 1.00 0.00 ? 75  THR B O    1 
ATOM 3097  C CB   . THR B 1 75  ? 114.073 134.139 -27.844 1.00 0.00 ? 75  THR B CB   1 
ATOM 3098  O OG1  . THR B 1 75  ? 114.853 133.769 -28.971 1.00 0.00 ? 75  THR B OG1  1 
ATOM 3099  C CG2  . THR B 1 75  ? 114.008 132.972 -26.856 1.00 0.00 ? 75  THR B CG2  1 
ATOM 3100  H H    . THR B 1 75  ? 112.924 136.511 -28.941 1.00 0.00 ? 75  THR B H    1 
ATOM 3101  H HA   . THR B 1 75  ? 112.210 133.630 -28.765 1.00 0.00 ? 75  THR B HA   1 
ATOM 3102  H HB   . THR B 1 75  ? 114.522 134.991 -27.360 1.00 0.00 ? 75  THR B HB   1 
ATOM 3103  H HG1  . THR B 1 75  ? 114.661 134.388 -29.679 1.00 0.00 ? 75  THR B HG1  1 
ATOM 3104  H HG21 . THR B 1 75  ? 114.996 132.558 -26.720 1.00 0.00 ? 75  THR B HG21 1 
ATOM 3105  H HG22 . THR B 1 75  ? 113.347 132.209 -27.242 1.00 0.00 ? 75  THR B HG22 1 
ATOM 3106  H HG23 . THR B 1 75  ? 113.633 133.326 -25.906 1.00 0.00 ? 75  THR B HG23 1 
ATOM 3107  N N    . ALA B 1 76  ? 110.848 134.069 -26.731 1.00 0.00 ? 76  ALA B N    1 
ATOM 3108  C CA   . ALA B 1 76  ? 109.991 134.377 -25.576 1.00 0.00 ? 76  ALA B CA   1 
ATOM 3109  C C    . ALA B 1 76  ? 109.724 133.134 -24.739 1.00 0.00 ? 76  ALA B C    1 
ATOM 3110  O O    . ALA B 1 76  ? 109.486 132.067 -25.268 1.00 0.00 ? 76  ALA B O    1 
ATOM 3111  C CB   . ALA B 1 76  ? 108.669 134.965 -26.054 1.00 0.00 ? 76  ALA B CB   1 
ATOM 3112  H H    . ALA B 1 76  ? 110.696 133.244 -27.239 1.00 0.00 ? 76  ALA B H    1 
ATOM 3113  H HA   . ALA B 1 76  ? 110.480 135.101 -24.958 1.00 0.00 ? 76  ALA B HA   1 
ATOM 3114  H HB1  . ALA B 1 76  ? 108.843 135.940 -26.484 1.00 0.00 ? 76  ALA B HB1  1 
ATOM 3115  H HB2  . ALA B 1 76  ? 108.000 135.055 -25.217 1.00 0.00 ? 76  ALA B HB2  1 
ATOM 3116  H HB3  . ALA B 1 76  ? 108.233 134.315 -26.797 1.00 0.00 ? 76  ALA B HB3  1 
ATOM 3117  N N    . VAL B 1 77  ? 109.757 133.277 -23.411 1.00 0.00 ? 77  VAL B N    1 
ATOM 3118  C CA   . VAL B 1 77  ? 109.505 132.129 -22.524 1.00 0.00 ? 77  VAL B CA   1 
ATOM 3119  C C    . VAL B 1 77  ? 108.663 132.554 -21.319 1.00 0.00 ? 77  VAL B C    1 
ATOM 3120  O O    . VAL B 1 77  ? 108.829 133.653 -20.789 1.00 0.00 ? 77  VAL B O    1 
ATOM 3121  C CB   . VAL B 1 77  ? 110.850 131.533 -22.052 1.00 0.00 ? 77  VAL B CB   1 
ATOM 3122  C CG1  . VAL B 1 77  ? 111.811 131.417 -23.251 1.00 0.00 ? 77  VAL B CG1  1 
ATOM 3123  C CG2  . VAL B 1 77  ? 111.480 132.430 -20.977 1.00 0.00 ? 77  VAL B CG2  1 
ATOM 3124  H H    . VAL B 1 77  ? 109.948 134.157 -23.023 1.00 0.00 ? 77  VAL B H    1 
ATOM 3125  H HA   . VAL B 1 77  ? 108.959 131.366 -23.065 1.00 0.00 ? 77  VAL B HA   1 
ATOM 3126  H HB   . VAL B 1 77  ? 110.675 130.550 -21.638 1.00 0.00 ? 77  VAL B HB   1 
ATOM 3127  H HG11 . VAL B 1 77  ? 112.598 130.717 -23.013 1.00 0.00 ? 77  VAL B HG11 1 
ATOM 3128  H HG12 . VAL B 1 77  ? 112.243 132.385 -23.462 1.00 0.00 ? 77  VAL B HG12 1 
ATOM 3129  H HG13 . VAL B 1 77  ? 111.274 131.071 -24.119 1.00 0.00 ? 77  VAL B HG13 1 
ATOM 3130  H HG21 . VAL B 1 77  ? 111.353 133.456 -21.256 1.00 0.00 ? 77  VAL B HG21 1 
ATOM 3131  H HG22 . VAL B 1 77  ? 112.534 132.208 -20.887 1.00 0.00 ? 77  VAL B HG22 1 
ATOM 3132  H HG23 . VAL B 1 77  ? 110.995 132.252 -20.028 1.00 0.00 ? 77  VAL B HG23 1 
ATOM 3133  N N    . ALA B 1 78  ? 107.768 131.663 -20.884 1.00 0.00 ? 78  ALA B N    1 
ATOM 3134  C CA   . ALA B 1 78  ? 106.902 131.930 -19.726 1.00 0.00 ? 78  ALA B CA   1 
ATOM 3135  C C    . ALA B 1 78  ? 107.221 130.943 -18.610 1.00 0.00 ? 78  ALA B C    1 
ATOM 3136  O O    . ALA B 1 78  ? 107.061 129.740 -18.781 1.00 0.00 ? 78  ALA B O    1 
ATOM 3137  C CB   . ALA B 1 78  ? 105.435 131.777 -20.131 1.00 0.00 ? 78  ALA B CB   1 
ATOM 3138  H H    . ALA B 1 78  ? 107.694 130.801 -21.344 1.00 0.00 ? 78  ALA B H    1 
ATOM 3139  H HA   . ALA B 1 78  ? 107.063 132.937 -19.363 1.00 0.00 ? 78  ALA B HA   1 
ATOM 3140  H HB1  . ALA B 1 78  ? 104.803 132.161 -19.344 1.00 0.00 ? 78  ALA B HB1  1 
ATOM 3141  H HB2  . ALA B 1 78  ? 105.213 130.733 -20.294 1.00 0.00 ? 78  ALA B HB2  1 
ATOM 3142  H HB3  . ALA B 1 78  ? 105.255 132.330 -21.040 1.00 0.00 ? 78  ALA B HB3  1 
ATOM 3143  N N    . GLN B 1 79  ? 107.679 131.464 -17.470 1.00 0.00 ? 79  GLN B N    1 
ATOM 3144  C CA   . GLN B 1 79  ? 108.025 130.624 -16.315 1.00 0.00 ? 79  GLN B CA   1 
ATOM 3145  C C    . GLN B 1 79  ? 107.565 131.309 -15.030 1.00 0.00 ? 79  GLN B C    1 
ATOM 3146  O O    . GLN B 1 79  ? 107.309 132.509 -15.024 1.00 0.00 ? 79  GLN B O    1 
ATOM 3147  C CB   . GLN B 1 79  ? 109.543 130.403 -16.267 1.00 0.00 ? 79  GLN B CB   1 
ATOM 3148  C CG   . GLN B 1 79  ? 110.063 130.092 -17.671 1.00 0.00 ? 79  GLN B CG   1 
ATOM 3149  C CD   . GLN B 1 79  ? 111.552 129.773 -17.619 1.00 0.00 ? 79  GLN B CD   1 
ATOM 3150  O OE1  . GLN B 1 79  ? 112.349 130.598 -17.173 1.00 0.00 ? 79  GLN B OE1  1 
ATOM 3151  N NE2  . GLN B 1 79  ? 111.978 128.616 -18.051 1.00 0.00 ? 79  GLN B NE2  1 
ATOM 3152  H H    . GLN B 1 79  ? 107.788 132.433 -17.400 1.00 0.00 ? 79  GLN B H    1 
ATOM 3153  H HA   . GLN B 1 79  ? 107.531 129.665 -16.397 1.00 0.00 ? 79  GLN B HA   1 
ATOM 3154  H HB2  . GLN B 1 79  ? 110.024 131.289 -15.894 1.00 0.00 ? 79  GLN B HB2  1 
ATOM 3155  H HB3  . GLN B 1 79  ? 109.764 129.573 -15.613 1.00 0.00 ? 79  GLN B HB3  1 
ATOM 3156  H HG2  . GLN B 1 79  ? 109.530 129.248 -18.071 1.00 0.00 ? 79  GLN B HG2  1 
ATOM 3157  H HG3  . GLN B 1 79  ? 109.904 130.948 -18.308 1.00 0.00 ? 79  GLN B HG3  1 
ATOM 3158  H HE21 . GLN B 1 79  ? 111.343 127.960 -18.406 1.00 0.00 ? 79  GLN B HE21 1 
ATOM 3159  H HE22 . GLN B 1 79  ? 112.933 128.406 -18.020 1.00 0.00 ? 79  GLN B HE22 1 
ATOM 3160  N N    . LYS B 1 80  ? 107.458 130.545 -13.936 1.00 0.00 ? 80  LYS B N    1 
ATOM 3161  C CA   . LYS B 1 80  ? 107.030 131.112 -12.641 1.00 0.00 ? 80  LYS B CA   1 
ATOM 3162  C C    . LYS B 1 80  ? 108.171 131.029 -11.636 1.00 0.00 ? 80  LYS B C    1 
ATOM 3163  O O    . LYS B 1 80  ? 108.657 132.048 -11.155 1.00 0.00 ? 80  LYS B O    1 
ATOM 3164  C CB   . LYS B 1 80  ? 105.812 130.350 -12.106 1.00 0.00 ? 80  LYS B CB   1 
ATOM 3165  C CG   . LYS B 1 80  ? 105.168 131.140 -10.962 1.00 0.00 ? 80  LYS B CG   1 
ATOM 3166  C CD   . LYS B 1 80  ? 103.875 130.443 -10.535 1.00 0.00 ? 80  LYS B CD   1 
ATOM 3167  C CE   . LYS B 1 80  ? 103.171 131.273 -9.461  1.00 0.00 ? 80  LYS B CE   1 
ATOM 3168  N NZ   . LYS B 1 80  ? 101.886 130.612 -9.094  1.00 0.00 ? 80  LYS B NZ   1 
ATOM 3169  H H    . LYS B 1 80  ? 107.674 129.592 -13.994 1.00 0.00 ? 80  LYS B H    1 
ATOM 3170  H HA   . LYS B 1 80  ? 106.758 132.155 -12.767 1.00 0.00 ? 80  LYS B HA   1 
ATOM 3171  H HB2  . LYS B 1 80  ? 105.093 130.216 -12.900 1.00 0.00 ? 80  LYS B HB2  1 
ATOM 3172  H HB3  . LYS B 1 80  ? 106.125 129.387 -11.736 1.00 0.00 ? 80  LYS B HB3  1 
ATOM 3173  H HG2  . LYS B 1 80  ? 105.851 131.183 -10.124 1.00 0.00 ? 80  LYS B HG2  1 
ATOM 3174  H HG3  . LYS B 1 80  ? 104.940 132.142 -11.295 1.00 0.00 ? 80  LYS B HG3  1 
ATOM 3175  H HD2  . LYS B 1 80  ? 103.225 130.336 -11.391 1.00 0.00 ? 80  LYS B HD2  1 
ATOM 3176  H HD3  . LYS B 1 80  ? 104.109 129.468 -10.136 1.00 0.00 ? 80  LYS B HD3  1 
ATOM 3177  H HE2  . LYS B 1 80  ? 103.802 131.342 -8.588  1.00 0.00 ? 80  LYS B HE2  1 
ATOM 3178  H HE3  . LYS B 1 80  ? 102.971 132.262 -9.843  1.00 0.00 ? 80  LYS B HE3  1 
ATOM 3179  H HZ1  . LYS B 1 80  ? 101.607 129.954 -9.848  1.00 0.00 ? 80  LYS B HZ1  1 
ATOM 3180  H HZ2  . LYS B 1 80  ? 101.146 131.336 -8.972  1.00 0.00 ? 80  LYS B HZ2  1 
ATOM 3181  H HZ3  . LYS B 1 80  ? 102.006 130.086 -8.206  1.00 0.00 ? 80  LYS B HZ3  1 
ATOM 3182  N N    . THR B 1 81  ? 108.612 129.804 -11.328 1.00 0.00 ? 81  THR B N    1 
ATOM 3183  C CA   . THR B 1 81  ? 109.715 129.605 -10.371 1.00 0.00 ? 81  THR B CA   1 
ATOM 3184  C C    . THR B 1 81  ? 110.712 128.575 -10.897 1.00 0.00 ? 81  THR B C    1 
ATOM 3185  O O    . THR B 1 81  ? 110.338 127.610 -11.550 1.00 0.00 ? 81  THR B O    1 
ATOM 3186  C CB   . THR B 1 81  ? 109.153 129.129 -9.028  1.00 0.00 ? 81  THR B CB   1 
ATOM 3187  O OG1  . THR B 1 81  ? 110.211 129.015 -8.087  1.00 0.00 ? 81  THR B OG1  1 
ATOM 3188  C CG2  . THR B 1 81  ? 108.476 127.770 -9.208  1.00 0.00 ? 81  THR B CG2  1 
ATOM 3189  H H    . THR B 1 81  ? 108.194 129.023 -11.750 1.00 0.00 ? 81  THR B H    1 
ATOM 3190  H HA   . THR B 1 81  ? 110.232 130.537 -10.218 1.00 0.00 ? 81  THR B HA   1 
ATOM 3191  H HB   . THR B 1 81  ? 108.428 129.843 -8.670  1.00 0.00 ? 81  THR B HB   1 
ATOM 3192  H HG1  . THR B 1 81  ? 110.726 128.236 -8.312  1.00 0.00 ? 81  THR B HG1  1 
ATOM 3193  H HG21 . THR B 1 81  ? 107.849 127.794 -10.087 1.00 0.00 ? 81  THR B HG21 1 
ATOM 3194  H HG22 . THR B 1 81  ? 107.872 127.550 -8.341  1.00 0.00 ? 81  THR B HG22 1 
ATOM 3195  H HG23 . THR B 1 81  ? 109.230 127.005 -9.325  1.00 0.00 ? 81  THR B HG23 1 
ATOM 3196  N N    . VAL B 1 82  ? 111.998 128.789 -10.601 1.00 0.00 ? 82  VAL B N    1 
ATOM 3197  C CA   . VAL B 1 82  ? 113.056 127.869 -11.050 1.00 0.00 ? 82  VAL B CA   1 
ATOM 3198  C C    . VAL B 1 82  ? 114.137 127.723 -9.977  1.00 0.00 ? 82  VAL B C    1 
ATOM 3199  O O    . VAL B 1 82  ? 114.468 128.675 -9.281  1.00 0.00 ? 82  VAL B O    1 
ATOM 3200  C CB   . VAL B 1 82  ? 113.670 128.385 -12.368 1.00 0.00 ? 82  VAL B CB   1 
ATOM 3201  C CG1  . VAL B 1 82  ? 114.005 129.872 -12.229 1.00 0.00 ? 82  VAL B CG1  1 
ATOM 3202  C CG2  . VAL B 1 82  ? 114.955 127.594 -12.704 1.00 0.00 ? 82  VAL B CG2  1 
ATOM 3203  H H    . VAL B 1 82  ? 112.242 129.580 -10.073 1.00 0.00 ? 82  VAL B H    1 
ATOM 3204  H HA   . VAL B 1 82  ? 112.625 126.900 -11.231 1.00 0.00 ? 82  VAL B HA   1 
ATOM 3205  H HB   . VAL B 1 82  ? 112.952 128.260 -13.167 1.00 0.00 ? 82  VAL B HB   1 
ATOM 3206  H HG11 . VAL B 1 82  ? 114.467 130.046 -11.274 1.00 0.00 ? 82  VAL B HG11 1 
ATOM 3207  H HG12 . VAL B 1 82  ? 113.099 130.454 -12.301 1.00 0.00 ? 82  VAL B HG12 1 
ATOM 3208  H HG13 . VAL B 1 82  ? 114.684 130.166 -13.018 1.00 0.00 ? 82  VAL B HG13 1 
ATOM 3209  H HG21 . VAL B 1 82  ? 114.814 126.552 -12.459 1.00 0.00 ? 82  VAL B HG21 1 
ATOM 3210  H HG22 . VAL B 1 82  ? 115.784 127.985 -12.130 1.00 0.00 ? 82  VAL B HG22 1 
ATOM 3211  H HG23 . VAL B 1 82  ? 115.171 127.690 -13.757 1.00 0.00 ? 82  VAL B HG23 1 
ATOM 3212  N N    . GLU B 1 83  ? 114.688 126.513 -9.849  1.00 0.00 ? 83  GLU B N    1 
ATOM 3213  C CA   . GLU B 1 83  ? 115.737 126.253 -8.853  1.00 0.00 ? 83  GLU B CA   1 
ATOM 3214  C C    . GLU B 1 83  ? 116.730 125.215 -9.369  1.00 0.00 ? 83  GLU B C    1 
ATOM 3215  O O    . GLU B 1 83  ? 116.354 124.276 -10.063 1.00 0.00 ? 83  GLU B O    1 
ATOM 3216  C CB   . GLU B 1 83  ? 115.103 125.756 -7.549  1.00 0.00 ? 83  GLU B CB   1 
ATOM 3217  C CG   . GLU B 1 83  ? 114.328 124.463 -7.814  1.00 0.00 ? 83  GLU B CG   1 
ATOM 3218  C CD   . GLU B 1 83  ? 113.604 124.020 -6.547  1.00 0.00 ? 83  GLU B CD   1 
ATOM 3219  O OE1  . GLU B 1 83  ? 113.720 124.710 -5.548  1.00 0.00 ? 83  GLU B OE1  1 
ATOM 3220  O OE2  . GLU B 1 83  ? 112.941 122.996 -6.595  1.00 0.00 ? 83  GLU B OE2  1 
ATOM 3221  H H    . GLU B 1 83  ? 114.386 125.784 -10.432 1.00 0.00 ? 83  GLU B H    1 
ATOM 3222  H HA   . GLU B 1 83  ? 116.269 127.168 -8.650  1.00 0.00 ? 83  GLU B HA   1 
ATOM 3223  H HB2  . GLU B 1 83  ? 115.879 125.569 -6.821  1.00 0.00 ? 83  GLU B HB2  1 
ATOM 3224  H HB3  . GLU B 1 83  ? 114.426 126.507 -7.168  1.00 0.00 ? 83  GLU B HB3  1 
ATOM 3225  H HG2  . GLU B 1 83  ? 113.606 124.634 -8.599  1.00 0.00 ? 83  GLU B HG2  1 
ATOM 3226  H HG3  . GLU B 1 83  ? 115.016 123.689 -8.121  1.00 0.00 ? 83  GLU B HG3  1 
ATOM 3227  N N    . GLY B 1 84  ? 118.007 125.389 -9.020  1.00 0.00 ? 84  GLY B N    1 
ATOM 3228  C CA   . GLY B 1 84  ? 119.046 124.452 -9.455  1.00 0.00 ? 84  GLY B CA   1 
ATOM 3229  C C    . GLY B 1 84  ? 120.405 125.137 -9.533  1.00 0.00 ? 84  GLY B C    1 
ATOM 3230  O O    . GLY B 1 84  ? 120.542 126.209 -10.121 1.00 0.00 ? 84  GLY B O    1 
ATOM 3231  H H    . GLY B 1 84  ? 118.253 126.156 -8.462  1.00 0.00 ? 84  GLY B H    1 
ATOM 3232  H HA2  . GLY B 1 84  ? 119.103 123.635 -8.751  1.00 0.00 ? 84  GLY B HA2  1 
ATOM 3233  H HA3  . GLY B 1 84  ? 118.795 124.063 -10.431 1.00 0.00 ? 84  GLY B HA3  1 
ATOM 3234  N N    . ALA B 1 85  ? 121.415 124.505 -8.945  1.00 0.00 ? 85  ALA B N    1 
ATOM 3235  C CA   . ALA B 1 85  ? 122.759 125.063 -8.965  1.00 0.00 ? 85  ALA B CA   1 
ATOM 3236  C C    . ALA B 1 85  ? 123.368 124.935 -10.358 1.00 0.00 ? 85  ALA B C    1 
ATOM 3237  O O    . ALA B 1 85  ? 123.402 123.847 -10.934 1.00 0.00 ? 85  ALA B O    1 
ATOM 3238  C CB   . ALA B 1 85  ? 123.639 124.334 -7.950  1.00 0.00 ? 85  ALA B CB   1 
ATOM 3239  H H    . ALA B 1 85  ? 121.254 123.649 -8.497  1.00 0.00 ? 85  ALA B H    1 
ATOM 3240  H HA   . ALA B 1 85  ? 122.710 126.108 -8.698  1.00 0.00 ? 85  ALA B HA   1 
ATOM 3241  H HB1  . ALA B 1 85  ? 124.642 124.731 -7.991  1.00 0.00 ? 85  ALA B HB1  1 
ATOM 3242  H HB2  . ALA B 1 85  ? 123.659 123.280 -8.184  1.00 0.00 ? 85  ALA B HB2  1 
ATOM 3243  H HB3  . ALA B 1 85  ? 123.236 124.475 -6.959  1.00 0.00 ? 85  ALA B HB3  1 
ATOM 3244  N N    . GLY B 1 86  ? 123.847 126.051 -10.895 1.00 0.00 ? 86  GLY B N    1 
ATOM 3245  C CA   . GLY B 1 86  ? 124.457 126.049 -12.220 1.00 0.00 ? 86  GLY B CA   1 
ATOM 3246  C C    . GLY B 1 86  ? 123.394 125.907 -13.306 1.00 0.00 ? 86  GLY B C    1 
ATOM 3247  O O    . GLY B 1 86  ? 123.713 125.776 -14.487 1.00 0.00 ? 86  GLY B O    1 
ATOM 3248  H H    . GLY B 1 86  ? 123.796 126.889 -10.389 1.00 0.00 ? 86  GLY B H    1 
ATOM 3249  H HA2  . GLY B 1 86  ? 124.993 126.976 -12.365 1.00 0.00 ? 86  GLY B HA2  1 
ATOM 3250  H HA3  . GLY B 1 86  ? 125.147 125.224 -12.293 1.00 0.00 ? 86  GLY B HA3  1 
ATOM 3251  N N    . SER B 1 87  ? 122.128 125.930 -12.894 1.00 0.00 ? 87  SER B N    1 
ATOM 3252  C CA   . SER B 1 87  ? 121.020 125.798 -13.835 1.00 0.00 ? 87  SER B CA   1 
ATOM 3253  C C    . SER B 1 87  ? 120.729 127.129 -14.519 1.00 0.00 ? 87  SER B C    1 
ATOM 3254  O O    . SER B 1 87  ? 120.997 128.202 -13.966 1.00 0.00 ? 87  SER B O    1 
ATOM 3255  C CB   . SER B 1 87  ? 119.772 125.308 -13.104 1.00 0.00 ? 87  SER B CB   1 
ATOM 3256  O OG   . SER B 1 87  ? 118.671 125.301 -14.005 1.00 0.00 ? 87  SER B OG   1 
ATOM 3257  H H    . SER B 1 87  ? 121.936 126.035 -11.939 1.00 0.00 ? 87  SER B H    1 
ATOM 3258  H HA   . SER B 1 87  ? 121.286 125.073 -14.589 1.00 0.00 ? 87  SER B HA   1 
ATOM 3259  H HB2  . SER B 1 87  ? 119.936 124.308 -12.741 1.00 0.00 ? 87  SER B HB2  1 
ATOM 3260  H HB3  . SER B 1 87  ? 119.563 125.962 -12.268 1.00 0.00 ? 87  SER B HB3  1 
ATOM 3261  H HG   . SER B 1 87  ? 118.148 124.515 -13.829 1.00 0.00 ? 87  SER B HG   1 
ATOM 3262  N N    . ILE B 1 88  ? 120.176 127.056 -15.734 1.00 0.00 ? 88  ILE B N    1 
ATOM 3263  C CA   . ILE B 1 88  ? 119.843 128.266 -16.506 1.00 0.00 ? 88  ILE B CA   1 
ATOM 3264  C C    . ILE B 1 88  ? 118.367 128.233 -16.908 1.00 0.00 ? 88  ILE B C    1 
ATOM 3265  O O    . ILE B 1 88  ? 117.884 127.229 -17.433 1.00 0.00 ? 88  ILE B O    1 
ATOM 3266  C CB   . ILE B 1 88  ? 120.754 128.347 -17.759 1.00 0.00 ? 88  ILE B CB   1 
ATOM 3267  C CG1  . ILE B 1 88  ? 120.283 127.338 -18.830 1.00 0.00 ? 88  ILE B CG1  1 
ATOM 3268  C CG2  . ILE B 1 88  ? 122.213 128.027 -17.363 1.00 0.00 ? 88  ILE B CG2  1 
ATOM 3269  C CD1  . ILE B 1 88  ? 121.316 127.260 -19.960 1.00 0.00 ? 88  ILE B CD1  1 
ATOM 3270  H H    . ILE B 1 88  ? 119.986 126.173 -16.121 1.00 0.00 ? 88  ILE B H    1 
ATOM 3271  H HA   . ILE B 1 88  ? 120.010 129.148 -15.897 1.00 0.00 ? 88  ILE B HA   1 
ATOM 3272  H HB   . ILE B 1 88  ? 120.708 129.348 -18.165 1.00 0.00 ? 88  ILE B HB   1 
ATOM 3273  H HG12 . ILE B 1 88  ? 120.167 126.371 -18.380 1.00 0.00 ? 88  ILE B HG12 1 
ATOM 3274  H HG13 . ILE B 1 88  ? 119.337 127.658 -19.239 1.00 0.00 ? 88  ILE B HG13 1 
ATOM 3275  H HG21 . ILE B 1 88  ? 122.884 128.471 -18.082 1.00 0.00 ? 88  ILE B HG21 1 
ATOM 3276  H HG22 . ILE B 1 88  ? 122.362 126.955 -17.347 1.00 0.00 ? 88  ILE B HG22 1 
ATOM 3277  H HG23 . ILE B 1 88  ? 122.425 128.426 -16.382 1.00 0.00 ? 88  ILE B HG23 1 
ATOM 3278  H HD11 . ILE B 1 88  ? 122.167 126.681 -19.629 1.00 0.00 ? 88  ILE B HD11 1 
ATOM 3279  H HD12 . ILE B 1 88  ? 121.640 128.257 -20.221 1.00 0.00 ? 88  ILE B HD12 1 
ATOM 3280  H HD13 . ILE B 1 88  ? 120.874 126.788 -20.822 1.00 0.00 ? 88  ILE B HD13 1 
ATOM 3281  N N    . ALA B 1 89  ? 117.652 129.329 -16.653 1.00 0.00 ? 89  ALA B N    1 
ATOM 3282  C CA   . ALA B 1 89  ? 116.231 129.398 -16.994 1.00 0.00 ? 89  ALA B CA   1 
ATOM 3283  C C    . ALA B 1 89  ? 116.053 129.805 -18.449 1.00 0.00 ? 89  ALA B C    1 
ATOM 3284  O O    . ALA B 1 89  ? 115.491 129.059 -19.248 1.00 0.00 ? 89  ALA B O    1 
ATOM 3285  C CB   . ALA B 1 89  ? 115.524 130.411 -16.091 1.00 0.00 ? 89  ALA B CB   1 
ATOM 3286  H H    . ALA B 1 89  ? 118.085 130.099 -16.228 1.00 0.00 ? 89  ALA B H    1 
ATOM 3287  H HA   . ALA B 1 89  ? 115.781 128.427 -16.843 1.00 0.00 ? 89  ALA B HA   1 
ATOM 3288  H HB1  . ALA B 1 89  ? 114.454 130.267 -16.156 1.00 0.00 ? 89  ALA B HB1  1 
ATOM 3289  H HB2  . ALA B 1 89  ? 115.772 131.411 -16.409 1.00 0.00 ? 89  ALA B HB2  1 
ATOM 3290  H HB3  . ALA B 1 89  ? 115.845 130.269 -15.070 1.00 0.00 ? 89  ALA B HB3  1 
ATOM 3291  N N    . ALA B 1 90  ? 116.545 130.999 -18.789 1.00 0.00 ? 90  ALA B N    1 
ATOM 3292  C CA   . ALA B 1 90  ? 116.447 131.517 -20.160 1.00 0.00 ? 90  ALA B CA   1 
ATOM 3293  C C    . ALA B 1 90  ? 117.789 132.084 -20.601 1.00 0.00 ? 90  ALA B C    1 
ATOM 3294  O O    . ALA B 1 90  ? 118.290 133.044 -20.017 1.00 0.00 ? 90  ALA B O    1 
ATOM 3295  C CB   . ALA B 1 90  ? 115.379 132.616 -20.223 1.00 0.00 ? 90  ALA B CB   1 
ATOM 3296  H H    . ALA B 1 90  ? 116.983 131.546 -18.106 1.00 0.00 ? 90  ALA B H    1 
ATOM 3297  H HA   . ALA B 1 90  ? 116.166 130.719 -20.837 1.00 0.00 ? 90  ALA B HA   1 
ATOM 3298  H HB1  . ALA B 1 90  ? 115.779 133.537 -19.821 1.00 0.00 ? 90  ALA B HB1  1 
ATOM 3299  H HB2  . ALA B 1 90  ? 114.520 132.316 -19.643 1.00 0.00 ? 90  ALA B HB2  1 
ATOM 3300  H HB3  . ALA B 1 90  ? 115.082 132.771 -21.251 1.00 0.00 ? 90  ALA B HB3  1 
ATOM 3301  N N    . ALA B 1 91  ? 118.372 131.485 -21.643 1.00 0.00 ? 91  ALA B N    1 
ATOM 3302  C CA   . ALA B 1 91  ? 119.668 131.943 -22.160 1.00 0.00 ? 91  ALA B CA   1 
ATOM 3303  C C    . ALA B 1 91  ? 119.726 131.802 -23.678 1.00 0.00 ? 91  ALA B C    1 
ATOM 3304  O O    . ALA B 1 91  ? 119.580 130.708 -24.215 1.00 0.00 ? 91  ALA B O    1 
ATOM 3305  C CB   . ALA B 1 91  ? 120.799 131.127 -21.528 1.00 0.00 ? 91  ALA B CB   1 
ATOM 3306  H H    . ALA B 1 91  ? 117.926 130.725 -22.070 1.00 0.00 ? 91  ALA B H    1 
ATOM 3307  H HA   . ALA B 1 91  ? 119.809 132.983 -21.905 1.00 0.00 ? 91  ALA B HA   1 
ATOM 3308  H HB1  . ALA B 1 91  ? 121.735 131.651 -21.652 1.00 0.00 ? 91  ALA B HB1  1 
ATOM 3309  H HB2  . ALA B 1 91  ? 120.861 130.160 -22.005 1.00 0.00 ? 91  ALA B HB2  1 
ATOM 3310  H HB3  . ALA B 1 91  ? 120.599 130.995 -20.476 1.00 0.00 ? 91  ALA B HB3  1 
ATOM 3311  N N    . THR B 1 92  ? 119.956 132.918 -24.369 1.00 0.00 ? 92  THR B N    1 
ATOM 3312  C CA   . THR B 1 92  ? 120.045 132.898 -25.833 1.00 0.00 ? 92  THR B CA   1 
ATOM 3313  C C    . THR B 1 92  ? 121.497 132.734 -26.266 1.00 0.00 ? 92  THR B C    1 
ATOM 3314  O O    . THR B 1 92  ? 122.294 133.666 -26.165 1.00 0.00 ? 92  THR B O    1 
ATOM 3315  C CB   . THR B 1 92  ? 119.481 134.198 -26.411 1.00 0.00 ? 92  THR B CB   1 
ATOM 3316  O OG1  . THR B 1 92  ? 120.445 135.230 -26.282 1.00 0.00 ? 92  THR B OG1  1 
ATOM 3317  C CG2  . THR B 1 92  ? 118.212 134.585 -25.652 1.00 0.00 ? 92  THR B CG2  1 
ATOM 3318  H H    . THR B 1 92  ? 120.076 133.765 -23.889 1.00 0.00 ? 92  THR B H    1 
ATOM 3319  H HA   . THR B 1 92  ? 119.468 132.069 -26.220 1.00 0.00 ? 92  THR B HA   1 
ATOM 3320  H HB   . THR B 1 92  ? 119.241 134.056 -27.453 1.00 0.00 ? 92  THR B HB   1 
ATOM 3321  H HG1  . THR B 1 92  ? 121.264 134.924 -26.679 1.00 0.00 ? 92  THR B HG1  1 
ATOM 3322  H HG21 . THR B 1 92  ? 117.757 135.443 -26.124 1.00 0.00 ? 92  THR B HG21 1 
ATOM 3323  H HG22 . THR B 1 92  ? 118.465 134.827 -24.630 1.00 0.00 ? 92  THR B HG22 1 
ATOM 3324  H HG23 . THR B 1 92  ? 117.518 133.758 -25.666 1.00 0.00 ? 92  THR B HG23 1 
ATOM 3325  N N    . GLY B 1 93  ? 121.833 131.538 -26.746 1.00 0.00 ? 93  GLY B N    1 
ATOM 3326  C CA   . GLY B 1 93  ? 123.193 131.253 -27.188 1.00 0.00 ? 93  GLY B CA   1 
ATOM 3327  C C    . GLY B 1 93  ? 124.086 130.917 -25.997 1.00 0.00 ? 93  GLY B C    1 
ATOM 3328  O O    . GLY B 1 93  ? 124.665 131.806 -25.377 1.00 0.00 ? 93  GLY B O    1 
ATOM 3329  H H    . GLY B 1 93  ? 121.154 130.833 -26.800 1.00 0.00 ? 93  GLY B H    1 
ATOM 3330  H HA2  . GLY B 1 93  ? 123.176 130.413 -27.870 1.00 0.00 ? 93  GLY B HA2  1 
ATOM 3331  H HA3  . GLY B 1 93  ? 123.593 132.116 -27.696 1.00 0.00 ? 93  GLY B HA3  1 
ATOM 3332  N N    . PHE B 1 94  ? 124.187 129.621 -25.676 1.00 0.00 ? 94  PHE B N    1 
ATOM 3333  C CA   . PHE B 1 94  ? 125.010 129.163 -24.545 1.00 0.00 ? 94  PHE B CA   1 
ATOM 3334  C C    . PHE B 1 94  ? 126.121 128.240 -25.041 1.00 0.00 ? 94  PHE B C    1 
ATOM 3335  O O    . PHE B 1 94  ? 125.852 127.191 -25.625 1.00 0.00 ? 94  PHE B O    1 
ATOM 3336  C CB   . PHE B 1 94  ? 124.132 128.401 -23.546 1.00 0.00 ? 94  PHE B CB   1 
ATOM 3337  C CG   . PHE B 1 94  ? 124.871 128.230 -22.239 1.00 0.00 ? 94  PHE B CG   1 
ATOM 3338  C CD1  . PHE B 1 94  ? 125.807 127.199 -22.091 1.00 0.00 ? 94  PHE B CD1  1 
ATOM 3339  C CD2  . PHE B 1 94  ? 124.624 129.110 -21.177 1.00 0.00 ? 94  PHE B CD2  1 
ATOM 3340  C CE1  . PHE B 1 94  ? 126.494 127.046 -20.881 1.00 0.00 ? 94  PHE B CE1  1 
ATOM 3341  C CE2  . PHE B 1 94  ? 125.311 128.957 -19.967 1.00 0.00 ? 94  PHE B CE2  1 
ATOM 3342  C CZ   . PHE B 1 94  ? 126.245 127.925 -19.819 1.00 0.00 ? 94  PHE B CZ   1 
ATOM 3343  H H    . PHE B 1 94  ? 123.697 128.958 -26.206 1.00 0.00 ? 94  PHE B H    1 
ATOM 3344  H HA   . PHE B 1 94  ? 125.457 130.014 -24.042 1.00 0.00 ? 94  PHE B HA   1 
ATOM 3345  H HB2  . PHE B 1 94  ? 123.220 128.954 -23.373 1.00 0.00 ? 94  PHE B HB2  1 
ATOM 3346  H HB3  . PHE B 1 94  ? 123.889 127.429 -23.949 1.00 0.00 ? 94  PHE B HB3  1 
ATOM 3347  H HD1  . PHE B 1 94  ? 125.998 126.522 -22.911 1.00 0.00 ? 94  PHE B HD1  1 
ATOM 3348  H HD2  . PHE B 1 94  ? 123.903 129.904 -21.292 1.00 0.00 ? 94  PHE B HD2  1 
ATOM 3349  H HE1  . PHE B 1 94  ? 127.215 126.252 -20.767 1.00 0.00 ? 94  PHE B HE1  1 
ATOM 3350  H HE2  . PHE B 1 94  ? 125.121 129.635 -19.149 1.00 0.00 ? 94  PHE B HE2  1 
ATOM 3351  H HZ   . PHE B 1 94  ? 126.776 127.807 -18.885 1.00 0.00 ? 94  PHE B HZ   1 
ATOM 3352  N N    . VAL B 1 95  ? 127.375 128.630 -24.799 1.00 0.00 ? 95  VAL B N    1 
ATOM 3353  C CA   . VAL B 1 95  ? 128.526 127.817 -25.226 1.00 0.00 ? 95  VAL B CA   1 
ATOM 3354  C C    . VAL B 1 95  ? 129.641 127.865 -24.175 1.00 0.00 ? 95  VAL B C    1 
ATOM 3355  O O    . VAL B 1 95  ? 130.125 128.933 -23.807 1.00 0.00 ? 95  VAL B O    1 
ATOM 3356  C CB   . VAL B 1 95  ? 129.039 128.323 -26.590 1.00 0.00 ? 95  VAL B CB   1 
ATOM 3357  C CG1  . VAL B 1 95  ? 129.147 129.847 -26.566 1.00 0.00 ? 95  VAL B CG1  1 
ATOM 3358  C CG2  . VAL B 1 95  ? 130.421 127.714 -26.903 1.00 0.00 ? 95  VAL B CG2  1 
ATOM 3359  H H    . VAL B 1 95  ? 127.533 129.474 -24.325 1.00 0.00 ? 95  VAL B H    1 
ATOM 3360  H HA   . VAL B 1 95  ? 128.212 126.789 -25.339 1.00 0.00 ? 95  VAL B HA   1 
ATOM 3361  H HB   . VAL B 1 95  ? 128.337 128.034 -27.361 1.00 0.00 ? 95  VAL B HB   1 
ATOM 3362  H HG11 . VAL B 1 95  ? 129.814 130.147 -25.782 1.00 0.00 ? 95  VAL B HG11 1 
ATOM 3363  H HG12 . VAL B 1 95  ? 128.172 130.277 -26.393 1.00 0.00 ? 95  VAL B HG12 1 
ATOM 3364  H HG13 . VAL B 1 95  ? 129.528 130.193 -27.513 1.00 0.00 ? 95  VAL B HG13 1 
ATOM 3365  H HG21 . VAL B 1 95  ? 130.431 126.675 -26.615 1.00 0.00 ? 95  VAL B HG21 1 
ATOM 3366  H HG22 . VAL B 1 95  ? 131.184 128.244 -26.350 1.00 0.00 ? 95  VAL B HG22 1 
ATOM 3367  H HG23 . VAL B 1 95  ? 130.622 127.797 -27.962 1.00 0.00 ? 95  VAL B HG23 1 
ATOM 3368  N N    . LYS B 1 96  ? 130.046 126.686 -23.696 1.00 0.00 ? 96  LYS B N    1 
ATOM 3369  C CA   . LYS B 1 96  ? 131.112 126.585 -22.685 1.00 0.00 ? 96  LYS B CA   1 
ATOM 3370  C C    . LYS B 1 96  ? 132.234 125.686 -23.196 1.00 0.00 ? 96  LYS B C    1 
ATOM 3371  O O    . LYS B 1 96  ? 132.011 124.510 -23.490 1.00 0.00 ? 96  LYS B O    1 
ATOM 3372  C CB   . LYS B 1 96  ? 130.541 126.003 -21.388 1.00 0.00 ? 96  LYS B CB   1 
ATOM 3373  C CG   . LYS B 1 96  ? 131.626 125.992 -20.310 1.00 0.00 ? 96  LYS B CG   1 
ATOM 3374  C CD   . LYS B 1 96  ? 131.039 125.478 -18.993 1.00 0.00 ? 96  LYS B CD   1 
ATOM 3375  C CE   . LYS B 1 96  ? 132.129 125.482 -17.917 1.00 0.00 ? 96  LYS B CE   1 
ATOM 3376  N NZ   . LYS B 1 96  ? 131.559 125.009 -16.622 1.00 0.00 ? 96  LYS B NZ   1 
ATOM 3377  H H    . LYS B 1 96  ? 129.624 125.866 -24.029 1.00 0.00 ? 96  LYS B H    1 
ATOM 3378  H HA   . LYS B 1 96  ? 131.521 127.568 -22.475 1.00 0.00 ? 96  LYS B HA   1 
ATOM 3379  H HB2  . LYS B 1 96  ? 129.707 126.607 -21.057 1.00 0.00 ? 96  LYS B HB2  1 
ATOM 3380  H HB3  . LYS B 1 96  ? 130.204 124.993 -21.566 1.00 0.00 ? 96  LYS B HB3  1 
ATOM 3381  H HG2  . LYS B 1 96  ? 132.435 125.346 -20.619 1.00 0.00 ? 96  LYS B HG2  1 
ATOM 3382  H HG3  . LYS B 1 96  ? 132.001 126.994 -20.166 1.00 0.00 ? 96  LYS B HG3  1 
ATOM 3383  H HD2  . LYS B 1 96  ? 130.224 126.119 -18.686 1.00 0.00 ? 96  LYS B HD2  1 
ATOM 3384  H HD3  . LYS B 1 96  ? 130.675 124.471 -19.129 1.00 0.00 ? 96  LYS B HD3  1 
ATOM 3385  H HE2  . LYS B 1 96  ? 132.932 124.826 -18.216 1.00 0.00 ? 96  LYS B HE2  1 
ATOM 3386  H HE3  . LYS B 1 96  ? 132.509 126.485 -17.796 1.00 0.00 ? 96  LYS B HE3  1 
ATOM 3387  H HZ1  . LYS B 1 96  ? 130.733 125.589 -16.373 1.00 0.00 ? 96  LYS B HZ1  1 
ATOM 3388  H HZ2  . LYS B 1 96  ? 132.280 125.093 -15.876 1.00 0.00 ? 96  LYS B HZ2  1 
ATOM 3389  H HZ3  . LYS B 1 96  ? 131.267 124.015 -16.713 1.00 0.00 ? 96  LYS B HZ3  1 
ATOM 3390  N N    . LYS B 1 97  ? 133.446 126.245 -23.301 1.00 0.00 ? 97  LYS B N    1 
ATOM 3391  C CA   . LYS B 1 97  ? 134.611 125.483 -23.782 1.00 0.00 ? 97  LYS B CA   1 
ATOM 3392  C C    . LYS B 1 97  ? 135.550 125.156 -22.631 1.00 0.00 ? 97  LYS B C    1 
ATOM 3393  O O    . LYS B 1 97  ? 136.167 126.049 -22.052 1.00 0.00 ? 97  LYS B O    1 
ATOM 3394  C CB   . LYS B 1 97  ? 135.369 126.297 -24.831 1.00 0.00 ? 97  LYS B CB   1 
ATOM 3395  C CG   . LYS B 1 97  ? 134.493 126.479 -26.070 1.00 0.00 ? 97  LYS B CG   1 
ATOM 3396  C CD   . LYS B 1 97  ? 135.271 127.263 -27.129 1.00 0.00 ? 97  LYS B CD   1 
ATOM 3397  C CE   . LYS B 1 97  ? 134.409 127.434 -28.382 1.00 0.00 ? 97  LYS B CE   1 
ATOM 3398  N NZ   . LYS B 1 97  ? 135.176 128.197 -29.408 1.00 0.00 ? 97  LYS B NZ   1 
ATOM 3399  H H    . LYS B 1 97  ? 133.561 127.187 -23.051 1.00 0.00 ? 97  LYS B H    1 
ATOM 3400  H HA   . LYS B 1 97  ? 134.281 124.556 -24.237 1.00 0.00 ? 97  LYS B HA   1 
ATOM 3401  H HB2  . LYS B 1 97  ? 135.620 127.265 -24.421 1.00 0.00 ? 97  LYS B HB2  1 
ATOM 3402  H HB3  . LYS B 1 97  ? 136.275 125.777 -25.106 1.00 0.00 ? 97  LYS B HB3  1 
ATOM 3403  H HG2  . LYS B 1 97  ? 134.220 125.511 -26.462 1.00 0.00 ? 97  LYS B HG2  1 
ATOM 3404  H HG3  . LYS B 1 97  ? 133.601 127.025 -25.803 1.00 0.00 ? 97  LYS B HG3  1 
ATOM 3405  H HD2  . LYS B 1 97  ? 135.533 128.235 -26.736 1.00 0.00 ? 97  LYS B HD2  1 
ATOM 3406  H HD3  . LYS B 1 97  ? 136.171 126.725 -27.386 1.00 0.00 ? 97  LYS B HD3  1 
ATOM 3407  H HE2  . LYS B 1 97  ? 134.147 126.463 -28.775 1.00 0.00 ? 97  LYS B HE2  1 
ATOM 3408  H HE3  . LYS B 1 97  ? 133.509 127.975 -28.129 1.00 0.00 ? 97  LYS B HE3  1 
ATOM 3409  H HZ1  . LYS B 1 97  ? 134.520 128.772 -29.975 1.00 0.00 ? 97  LYS B HZ1  1 
ATOM 3410  H HZ2  . LYS B 1 97  ? 135.680 127.531 -30.029 1.00 0.00 ? 97  LYS B HZ2  1 
ATOM 3411  H HZ3  . LYS B 1 97  ? 135.861 128.820 -28.937 1.00 0.00 ? 97  LYS B HZ3  1 
ATOM 3412  N N    . ASP B 1 98  ? 135.661 123.866 -22.311 1.00 0.00 ? 98  ASP B N    1 
ATOM 3413  C CA   . ASP B 1 98  ? 136.539 123.410 -21.227 1.00 0.00 ? 98  ASP B CA   1 
ATOM 3414  C C    . ASP B 1 98  ? 137.875 122.934 -21.788 1.00 0.00 ? 98  ASP B C    1 
ATOM 3415  O O    . ASP B 1 98  ? 138.937 123.312 -21.295 1.00 0.00 ? 98  ASP B O    1 
ATOM 3416  C CB   . ASP B 1 98  ? 135.870 122.262 -20.468 1.00 0.00 ? 98  ASP B CB   1 
ATOM 3417  C CG   . ASP B 1 98  ? 136.596 122.007 -19.149 1.00 0.00 ? 98  ASP B CG   1 
ATOM 3418  O OD1  . ASP B 1 98  ? 137.243 122.919 -18.662 1.00 0.00 ? 98  ASP B OD1  1 
ATOM 3419  O OD2  . ASP B 1 98  ? 136.491 120.901 -18.644 1.00 0.00 ? 98  ASP B OD2  1 
ATOM 3420  H H    . ASP B 1 98  ? 135.148 123.203 -22.818 1.00 0.00 ? 98  ASP B H    1 
ATOM 3421  H HA   . ASP B 1 98  ? 136.717 124.226 -20.538 1.00 0.00 ? 98  ASP B HA   1 
ATOM 3422  H HB2  . ASP B 1 98  ? 134.840 122.519 -20.266 1.00 0.00 ? 98  ASP B HB2  1 
ATOM 3423  H HB3  . ASP B 1 98  ? 135.903 121.370 -21.070 1.00 0.00 ? 98  ASP B HB3  1 
ATOM 3424  N N    . GLN B 1 99  ? 137.811 122.095 -22.820 1.00 0.00 ? 99  GLN B N    1 
ATOM 3425  C CA   . GLN B 1 99  ? 139.023 121.570 -23.437 1.00 0.00 ? 99  GLN B CA   1 
ATOM 3426  C C    . GLN B 1 99  ? 139.971 121.029 -22.376 1.00 0.00 ? 99  GLN B C    1 
ATOM 3427  O O    . GLN B 1 99  ? 141.133 121.428 -22.308 1.00 0.00 ? 99  GLN B O    1 
ATOM 3428  C CB   . GLN B 1 99  ? 139.724 122.666 -24.240 1.00 0.00 ? 99  GLN B CB   1 
ATOM 3429  C CG   . GLN B 1 99  ? 138.879 123.029 -25.463 1.00 0.00 ? 99  GLN B CG   1 
ATOM 3430  C CD   . GLN B 1 99  ? 139.565 124.134 -26.261 1.00 0.00 ? 99  GLN B CD   1 
ATOM 3431  O OE1  . GLN B 1 99  ? 140.793 124.229 -26.259 1.00 0.00 ? 99  GLN B OE1  1 
ATOM 3432  N NE2  . GLN B 1 99  ? 138.845 124.980 -26.949 1.00 0.00 ? 99  GLN B NE2  1 
ATOM 3433  H H    . GLN B 1 99  ? 136.937 121.824 -23.169 1.00 0.00 ? 99  GLN B H    1 
ATOM 3434  H HA   . GLN B 1 99  ? 138.754 120.767 -24.107 1.00 0.00 ? 99  GLN B HA   1 
ATOM 3435  H HB2  . GLN B 1 99  ? 139.852 123.540 -23.619 1.00 0.00 ? 99  GLN B HB2  1 
ATOM 3436  H HB3  . GLN B 1 99  ? 140.690 122.310 -24.565 1.00 0.00 ? 99  GLN B HB3  1 
ATOM 3437  H HG2  . GLN B 1 99  ? 138.760 122.154 -26.089 1.00 0.00 ? 99  GLN B HG2  1 
ATOM 3438  H HG3  . GLN B 1 99  ? 137.908 123.371 -25.140 1.00 0.00 ? 99  GLN B HG3  1 
ATOM 3439  H HE21 . GLN B 1 99  ? 137.869 124.902 -26.953 1.00 0.00 ? 99  GLN B HE21 1 
ATOM 3440  H HE22 . GLN B 1 99  ? 139.283 125.691 -27.461 1.00 0.00 ? 99  GLN B HE22 1 
ATOM 3441  N N    . LEU B 1 100 ? 139.468 120.125 -21.545 1.00 0.00 ? 100 LEU B N    1 
ATOM 3442  C CA   . LEU B 1 100 ? 140.285 119.547 -20.491 1.00 0.00 ? 100 LEU B CA   1 
ATOM 3443  C C    . LEU B 1 100 ? 141.525 118.881 -21.099 1.00 0.00 ? 100 LEU B C    1 
ATOM 3444  O O    . LEU B 1 100 ? 141.411 117.975 -21.923 1.00 0.00 ? 100 LEU B O    1 
ATOM 3445  C CB   . LEU B 1 100 ? 139.444 118.514 -19.693 1.00 0.00 ? 100 LEU B CB   1 
ATOM 3446  C CG   . LEU B 1 100 ? 139.935 118.406 -18.231 1.00 0.00 ? 100 LEU B CG   1 
ATOM 3447  C CD1  . LEU B 1 100 ? 141.435 118.086 -18.212 1.00 0.00 ? 100 LEU B CD1  1 
ATOM 3448  C CD2  . LEU B 1 100 ? 139.658 119.729 -17.458 1.00 0.00 ? 100 LEU B CD2  1 
ATOM 3449  H H    . LEU B 1 100 ? 138.533 119.845 -21.642 1.00 0.00 ? 100 LEU B H    1 
ATOM 3450  H HA   . LEU B 1 100 ? 140.601 120.335 -19.832 1.00 0.00 ? 100 LEU B HA   1 
ATOM 3451  H HB2  . LEU B 1 100 ? 138.409 118.819 -19.698 1.00 0.00 ? 100 LEU B HB2  1 
ATOM 3452  H HB3  . LEU B 1 100 ? 139.523 117.540 -20.162 1.00 0.00 ? 100 LEU B HB3  1 
ATOM 3453  H HG   . LEU B 1 100 ? 139.403 117.598 -17.748 1.00 0.00 ? 100 LEU B HG   1 
ATOM 3454  H HD11 . LEU B 1 100 ? 141.708 117.703 -17.239 1.00 0.00 ? 100 LEU B HD11 1 
ATOM 3455  H HD12 . LEU B 1 100 ? 141.998 118.983 -18.417 1.00 0.00 ? 100 LEU B HD12 1 
ATOM 3456  H HD13 . LEU B 1 100 ? 141.656 117.342 -18.965 1.00 0.00 ? 100 LEU B HD13 1 
ATOM 3457  H HD21 . LEU B 1 100 ? 140.507 120.396 -17.534 1.00 0.00 ? 100 LEU B HD21 1 
ATOM 3458  H HD22 . LEU B 1 100 ? 139.485 119.501 -16.418 1.00 0.00 ? 100 LEU B HD22 1 
ATOM 3459  H HD23 . LEU B 1 100 ? 138.780 120.216 -17.864 1.00 0.00 ? 100 LEU B HD23 1 
ATOM 3460  N N    . GLY B 1 101 ? 142.708 119.342 -20.690 1.00 0.00 ? 101 GLY B N    1 
ATOM 3461  C CA   . GLY B 1 101 ? 143.960 118.787 -21.208 1.00 0.00 ? 101 GLY B CA   1 
ATOM 3462  C C    . GLY B 1 101 ? 144.364 119.469 -22.516 1.00 0.00 ? 101 GLY B C    1 
ATOM 3463  O O    . GLY B 1 101 ? 143.923 120.580 -22.808 1.00 0.00 ? 101 GLY B O    1 
ATOM 3464  H H    . GLY B 1 101 ? 142.740 120.070 -20.034 1.00 0.00 ? 101 GLY B H    1 
ATOM 3465  H HA2  . GLY B 1 101 ? 144.741 118.933 -20.475 1.00 0.00 ? 101 GLY B HA2  1 
ATOM 3466  H HA3  . GLY B 1 101 ? 143.837 117.728 -21.386 1.00 0.00 ? 101 GLY B HA3  1 
ATOM 3467  N N    . LYS B 1 102 ? 145.213 118.795 -23.299 1.00 0.00 ? 102 LYS B N    1 
ATOM 3468  C CA   . LYS B 1 102 ? 145.685 119.343 -24.580 1.00 0.00 ? 102 LYS B CA   1 
ATOM 3469  C C    . LYS B 1 102 ? 145.930 118.223 -25.591 1.00 0.00 ? 102 LYS B C    1 
ATOM 3470  O O    . LYS B 1 102 ? 146.026 117.052 -25.224 1.00 0.00 ? 102 LYS B O    1 
ATOM 3471  C CB   . LYS B 1 102 ? 146.983 120.132 -24.362 1.00 0.00 ? 102 LYS B CB   1 
ATOM 3472  C CG   . LYS B 1 102 ? 148.072 119.196 -23.826 1.00 0.00 ? 102 LYS B CG   1 
ATOM 3473  C CD   . LYS B 1 102 ? 149.337 119.999 -23.521 1.00 0.00 ? 102 LYS B CD   1 
ATOM 3474  C CE   . LYS B 1 102 ? 150.410 119.059 -22.970 1.00 0.00 ? 102 LYS B CE   1 
ATOM 3475  N NZ   . LYS B 1 102 ? 150.773 118.055 -24.012 1.00 0.00 ? 102 LYS B NZ   1 
ATOM 3476  H H    . LYS B 1 102 ? 145.533 117.916 -23.009 1.00 0.00 ? 102 LYS B H    1 
ATOM 3477  H HA   . LYS B 1 102 ? 144.935 120.014 -24.980 1.00 0.00 ? 102 LYS B HA   1 
ATOM 3478  H HB2  . LYS B 1 102 ? 147.306 120.558 -25.302 1.00 0.00 ? 102 LYS B HB2  1 
ATOM 3479  H HB3  . LYS B 1 102 ? 146.809 120.924 -23.650 1.00 0.00 ? 102 LYS B HB3  1 
ATOM 3480  H HG2  . LYS B 1 102 ? 147.722 118.720 -22.922 1.00 0.00 ? 102 LYS B HG2  1 
ATOM 3481  H HG3  . LYS B 1 102 ? 148.300 118.444 -24.563 1.00 0.00 ? 102 LYS B HG3  1 
ATOM 3482  H HD2  . LYS B 1 102 ? 149.695 120.465 -24.428 1.00 0.00 ? 102 LYS B HD2  1 
ATOM 3483  H HD3  . LYS B 1 102 ? 149.115 120.758 -22.787 1.00 0.00 ? 102 LYS B HD3  1 
ATOM 3484  H HE2  . LYS B 1 102 ? 151.285 119.630 -22.701 1.00 0.00 ? 102 LYS B HE2  1 
ATOM 3485  H HE3  . LYS B 1 102 ? 150.029 118.550 -22.098 1.00 0.00 ? 102 LYS B HE3  1 
ATOM 3486  H HZ1  . LYS B 1 102 ? 151.793 118.106 -24.203 1.00 0.00 ? 102 LYS B HZ1  1 
ATOM 3487  H HZ2  . LYS B 1 102 ? 150.245 118.257 -24.887 1.00 0.00 ? 102 LYS B HZ2  1 
ATOM 3488  H HZ3  . LYS B 1 102 ? 150.533 117.102 -23.674 1.00 0.00 ? 102 LYS B HZ3  1 
ATOM 3489  N N    . ASN B 1 103 ? 146.032 118.593 -26.865 1.00 0.00 ? 103 ASN B N    1 
ATOM 3490  C CA   . ASN B 1 103 ? 146.266 117.614 -27.926 1.00 0.00 ? 103 ASN B CA   1 
ATOM 3491  C C    . ASN B 1 103 ? 147.618 116.925 -27.750 1.00 0.00 ? 103 ASN B C    1 
ATOM 3492  O O    . ASN B 1 103 ? 148.598 117.550 -27.344 1.00 0.00 ? 103 ASN B O    1 
ATOM 3493  C CB   . ASN B 1 103 ? 146.224 118.303 -29.290 1.00 0.00 ? 103 ASN B CB   1 
ATOM 3494  C CG   . ASN B 1 103 ? 146.138 117.256 -30.396 1.00 0.00 ? 103 ASN B CG   1 
ATOM 3495  O OD1  . ASN B 1 103 ? 145.483 116.228 -30.229 1.00 0.00 ? 103 ASN B OD1  1 
ATOM 3496  N ND2  . ASN B 1 103 ? 146.766 117.458 -31.521 1.00 0.00 ? 103 ASN B ND2  1 
ATOM 3497  H H    . ASN B 1 103 ? 145.947 119.541 -27.098 1.00 0.00 ? 103 ASN B H    1 
ATOM 3498  H HA   . ASN B 1 103 ? 145.488 116.869 -27.891 1.00 0.00 ? 103 ASN B HA   1 
ATOM 3499  H HB2  . ASN B 1 103 ? 145.361 118.950 -29.340 1.00 0.00 ? 103 ASN B HB2  1 
ATOM 3500  H HB3  . ASN B 1 103 ? 147.122 118.889 -29.423 1.00 0.00 ? 103 ASN B HB3  1 
ATOM 3501  H HD21 . ASN B 1 103 ? 147.289 118.277 -31.650 1.00 0.00 ? 103 ASN B HD21 1 
ATOM 3502  H HD22 . ASN B 1 103 ? 146.715 116.790 -32.237 1.00 0.00 ? 103 ASN B HD22 1 
ATOM 3503  N N    . GLU B 1 104 ? 147.658 115.631 -28.065 1.00 0.00 ? 104 GLU B N    1 
ATOM 3504  C CA   . GLU B 1 104 ? 148.892 114.859 -27.945 1.00 0.00 ? 104 GLU B CA   1 
ATOM 3505  C C    . GLU B 1 104 ? 149.413 114.903 -26.514 1.00 0.00 ? 104 GLU B C    1 
ATOM 3506  O O    . GLU B 1 104 ? 150.418 115.552 -26.228 1.00 0.00 ? 104 GLU B O    1 
ATOM 3507  C CB   . GLU B 1 104 ? 149.954 115.417 -28.897 1.00 0.00 ? 104 GLU B CB   1 
ATOM 3508  C CG   . GLU B 1 104 ? 151.168 114.484 -28.917 1.00 0.00 ? 104 GLU B CG   1 
ATOM 3509  C CD   . GLU B 1 104 ? 152.223 115.018 -29.881 1.00 0.00 ? 104 GLU B CD   1 
ATOM 3510  O OE1  . GLU B 1 104 ? 151.991 116.065 -30.462 1.00 0.00 ? 104 GLU B OE1  1 
ATOM 3511  O OE2  . GLU B 1 104 ? 153.248 114.372 -30.022 1.00 0.00 ? 104 GLU B OE2  1 
ATOM 3512  H H    . GLU B 1 104 ? 146.846 115.189 -28.386 1.00 0.00 ? 104 GLU B H    1 
ATOM 3513  H HA   . GLU B 1 104 ? 148.690 113.832 -28.212 1.00 0.00 ? 104 GLU B HA   1 
ATOM 3514  H HB2  . GLU B 1 104 ? 149.540 115.490 -29.893 1.00 0.00 ? 104 GLU B HB2  1 
ATOM 3515  H HB3  . GLU B 1 104 ? 150.260 116.396 -28.561 1.00 0.00 ? 104 GLU B HB3  1 
ATOM 3516  H HG2  . GLU B 1 104 ? 151.589 114.420 -27.925 1.00 0.00 ? 104 GLU B HG2  1 
ATOM 3517  H HG3  . GLU B 1 104 ? 150.859 113.500 -29.237 1.00 0.00 ? 104 GLU B HG3  1 
ATOM 3518  N N    . GLU B 1 105 ? 148.720 114.212 -25.616 1.00 0.00 ? 105 GLU B N    1 
ATOM 3519  C CA   . GLU B 1 105 ? 149.124 114.185 -24.219 1.00 0.00 ? 105 GLU B CA   1 
ATOM 3520  C C    . GLU B 1 105 ? 150.502 113.539 -24.087 1.00 0.00 ? 105 GLU B C    1 
ATOM 3521  O O    . GLU B 1 105 ? 151.350 114.012 -23.330 1.00 0.00 ? 105 GLU B O    1 
ATOM 3522  C CB   . GLU B 1 105 ? 148.093 113.405 -23.390 1.00 0.00 ? 105 GLU B CB   1 
ATOM 3523  C CG   . GLU B 1 105 ? 148.427 113.513 -21.897 1.00 0.00 ? 105 GLU B CG   1 
ATOM 3524  C CD   . GLU B 1 105 ? 148.258 114.955 -21.428 1.00 0.00 ? 105 GLU B CD   1 
ATOM 3525  O OE1  . GLU B 1 105 ? 147.574 115.701 -22.108 1.00 0.00 ? 105 GLU B OE1  1 
ATOM 3526  O OE2  . GLU B 1 105 ? 148.815 115.292 -20.396 1.00 0.00 ? 105 GLU B OE2  1 
ATOM 3527  H H    . GLU B 1 105 ? 147.924 113.714 -25.897 1.00 0.00 ? 105 GLU B H    1 
ATOM 3528  H HA   . GLU B 1 105 ? 149.177 115.197 -23.851 1.00 0.00 ? 105 GLU B HA   1 
ATOM 3529  H HB2  . GLU B 1 105 ? 147.109 113.814 -23.566 1.00 0.00 ? 105 GLU B HB2  1 
ATOM 3530  H HB3  . GLU B 1 105 ? 148.107 112.367 -23.684 1.00 0.00 ? 105 GLU B HB3  1 
ATOM 3531  H HG2  . GLU B 1 105 ? 147.760 112.875 -21.336 1.00 0.00 ? 105 GLU B HG2  1 
ATOM 3532  H HG3  . GLU B 1 105 ? 149.446 113.199 -21.730 1.00 0.00 ? 105 GLU B HG3  1 
ATOM 3533  N N    . GLY B 1 106 ? 150.724 112.460 -24.837 1.00 0.00 ? 106 GLY B N    1 
ATOM 3534  C CA   . GLY B 1 106 ? 152.007 111.767 -24.797 1.00 0.00 ? 106 GLY B CA   1 
ATOM 3535  C C    . GLY B 1 106 ? 153.123 112.672 -25.306 1.00 0.00 ? 106 GLY B C    1 
ATOM 3536  O O    . GLY B 1 106 ? 152.913 113.489 -26.202 1.00 0.00 ? 106 GLY B O    1 
ATOM 3537  H H    . GLY B 1 106 ? 150.015 112.130 -25.427 1.00 0.00 ? 106 GLY B H    1 
ATOM 3538  H HA2  . GLY B 1 106 ? 152.221 111.473 -23.780 1.00 0.00 ? 106 GLY B HA2  1 
ATOM 3539  H HA3  . GLY B 1 106 ? 151.957 110.886 -25.419 1.00 0.00 ? 106 GLY B HA3  1 
ATOM 3540  N N    . ALA B 1 107 ? 154.308 112.525 -24.723 1.00 0.00 ? 107 ALA B N    1 
ATOM 3541  C CA   . ALA B 1 107 ? 155.449 113.341 -25.122 1.00 0.00 ? 107 ALA B CA   1 
ATOM 3542  C C    . ALA B 1 107 ? 155.973 112.892 -26.501 1.00 0.00 ? 107 ALA B C    1 
ATOM 3543  O O    . ALA B 1 107 ? 155.798 111.734 -26.876 1.00 0.00 ? 107 ALA B O    1 
ATOM 3544  C CB   . ALA B 1 107 ? 156.566 113.224 -24.060 1.00 0.00 ? 107 ALA B CB   1 
ATOM 3545  H H    . ALA B 1 107 ? 154.415 111.859 -24.012 1.00 0.00 ? 107 ALA B H    1 
ATOM 3546  H HA   . ALA B 1 107 ? 155.126 114.361 -25.175 1.00 0.00 ? 107 ALA B HA   1 
ATOM 3547  H HB1  . ALA B 1 107 ? 156.119 113.071 -23.087 1.00 0.00 ? 107 ALA B HB1  1 
ATOM 3548  H HB2  . ALA B 1 107 ? 157.152 114.132 -24.043 1.00 0.00 ? 107 ALA B HB2  1 
ATOM 3549  H HB3  . ALA B 1 107 ? 157.209 112.385 -24.292 1.00 0.00 ? 107 ALA B HB3  1 
ATOM 3550  N N    . PRO B 1 108 ? 156.627 113.764 -27.254 1.00 0.00 ? 108 PRO B N    1 
ATOM 3551  C CA   . PRO B 1 108 ? 157.180 113.386 -28.593 1.00 0.00 ? 108 PRO B CA   1 
ATOM 3552  C C    . PRO B 1 108 ? 157.912 112.040 -28.551 1.00 0.00 ? 108 PRO B C    1 
ATOM 3553  O O    . PRO B 1 108 ? 158.664 111.763 -27.615 1.00 0.00 ? 108 PRO B O    1 
ATOM 3554  C CB   . PRO B 1 108 ? 158.166 114.528 -28.895 1.00 0.00 ? 108 PRO B CB   1 
ATOM 3555  C CG   . PRO B 1 108 ? 157.583 115.723 -28.211 1.00 0.00 ? 108 PRO B CG   1 
ATOM 3556  C CD   . PRO B 1 108 ? 156.897 115.192 -26.938 1.00 0.00 ? 108 PRO B CD   1 
ATOM 3557  H HA   . PRO B 1 108 ? 156.402 113.372 -29.335 1.00 0.00 ? 108 PRO B HA   1 
ATOM 3558  H HB2  . PRO B 1 108 ? 159.150 114.301 -28.489 1.00 0.00 ? 108 PRO B HB2  1 
ATOM 3559  H HB3  . PRO B 1 108 ? 158.231 114.701 -29.959 1.00 0.00 ? 108 PRO B HB3  1 
ATOM 3560  H HG2  . PRO B 1 108 ? 158.370 116.426 -27.951 1.00 0.00 ? 108 PRO B HG2  1 
ATOM 3561  H HG3  . PRO B 1 108 ? 156.853 116.201 -28.851 1.00 0.00 ? 108 PRO B HG3  1 
ATOM 3562  H HD2  . PRO B 1 108 ? 157.556 115.281 -26.080 1.00 0.00 ? 108 PRO B HD2  1 
ATOM 3563  H HD3  . PRO B 1 108 ? 155.973 115.723 -26.768 1.00 0.00 ? 108 PRO B HD3  1 
ATOM 3564  N N    . GLN B 1 109 ? 157.691 111.208 -29.577 1.00 0.00 ? 109 GLN B N    1 
ATOM 3565  C CA   . GLN B 1 109 ? 158.341 109.887 -29.656 1.00 0.00 ? 109 GLN B CA   1 
ATOM 3566  C C    . GLN B 1 109 ? 158.862 109.648 -31.069 1.00 0.00 ? 109 GLN B C    1 
ATOM 3567  O O    . GLN B 1 109 ? 158.128 109.789 -32.047 1.00 0.00 ? 109 GLN B O    1 
ATOM 3568  C CB   . GLN B 1 109 ? 157.339 108.781 -29.287 1.00 0.00 ? 109 GLN B CB   1 
ATOM 3569  C CG   . GLN B 1 109 ? 158.068 107.435 -29.130 1.00 0.00 ? 109 GLN B CG   1 
ATOM 3570  C CD   . GLN B 1 109 ? 159.026 107.484 -27.941 1.00 0.00 ? 109 GLN B CD   1 
ATOM 3571  O OE1  . GLN B 1 109 ? 158.609 107.763 -26.818 1.00 0.00 ? 109 GLN B OE1  1 
ATOM 3572  N NE2  . GLN B 1 109 ? 160.295 107.233 -28.125 1.00 0.00 ? 109 GLN B NE2  1 
ATOM 3573  H H    . GLN B 1 109 ? 157.086 111.485 -30.296 1.00 0.00 ? 109 GLN B H    1 
ATOM 3574  H HA   . GLN B 1 109 ? 159.176 109.853 -28.970 1.00 0.00 ? 109 GLN B HA   1 
ATOM 3575  H HB2  . GLN B 1 109 ? 156.851 109.035 -28.358 1.00 0.00 ? 109 GLN B HB2  1 
ATOM 3576  H HB3  . GLN B 1 109 ? 156.599 108.695 -30.068 1.00 0.00 ? 109 GLN B HB3  1 
ATOM 3577  H HG2  . GLN B 1 109 ? 157.341 106.652 -28.969 1.00 0.00 ? 109 GLN B HG2  1 
ATOM 3578  H HG3  . GLN B 1 109 ? 158.626 107.225 -30.027 1.00 0.00 ? 109 GLN B HG3  1 
ATOM 3579  H HE21 . GLN B 1 109 ? 160.628 107.015 -29.021 1.00 0.00 ? 109 GLN B HE21 1 
ATOM 3580  H HE22 . GLN B 1 109 ? 160.915 107.262 -27.365 1.00 0.00 ? 109 GLN B HE22 1 
ATOM 3581  N N    . GLU B 1 110 ? 160.134 109.286 -31.163 1.00 0.00 ? 110 GLU B N    1 
ATOM 3582  C CA   . GLU B 1 110 ? 160.761 109.027 -32.454 1.00 0.00 ? 110 GLU B CA   1 
ATOM 3583  C C    . GLU B 1 110 ? 160.345 107.666 -32.999 1.00 0.00 ? 110 GLU B C    1 
ATOM 3584  O O    . GLU B 1 110 ? 161.004 107.115 -33.882 1.00 0.00 ? 110 GLU B O    1 
ATOM 3585  C CB   . GLU B 1 110 ? 162.290 109.091 -32.316 1.00 0.00 ? 110 GLU B CB   1 
ATOM 3586  C CG   . GLU B 1 110 ? 162.766 108.148 -31.184 1.00 0.00 ? 110 GLU B CG   1 
ATOM 3587  C CD   . GLU B 1 110 ? 162.713 108.867 -29.832 1.00 0.00 ? 110 GLU B CD   1 
ATOM 3588  O OE1  . GLU B 1 110 ? 162.049 109.887 -29.751 1.00 0.00 ? 110 GLU B OE1  1 
ATOM 3589  O OE2  . GLU B 1 110 ? 163.335 108.382 -28.901 1.00 0.00 ? 110 GLU B OE2  1 
ATOM 3590  H H    . GLU B 1 110 ? 160.664 109.191 -30.347 1.00 0.00 ? 110 GLU B H    1 
ATOM 3591  H HA   . GLU B 1 110 ? 160.446 109.790 -33.150 1.00 0.00 ? 110 GLU B HA   1 
ATOM 3592  H HB2  . GLU B 1 110 ? 162.742 108.784 -33.250 1.00 0.00 ? 110 GLU B HB2  1 
ATOM 3593  H HB3  . GLU B 1 110 ? 162.589 110.106 -32.094 1.00 0.00 ? 110 GLU B HB3  1 
ATOM 3594  H HG2  . GLU B 1 110 ? 162.136 107.271 -31.147 1.00 0.00 ? 110 GLU B HG2  1 
ATOM 3595  H HG3  . GLU B 1 110 ? 163.785 107.845 -31.379 1.00 0.00 ? 110 GLU B HG3  1 
ATOM 3596  N N    . GLY B 1 111 ? 159.252 107.127 -32.471 1.00 0.00 ? 111 GLY B N    1 
ATOM 3597  C CA   . GLY B 1 111 ? 158.768 105.829 -32.920 1.00 0.00 ? 111 GLY B CA   1 
ATOM 3598  C C    . GLY B 1 111 ? 159.781 104.737 -32.596 1.00 0.00 ? 111 GLY B C    1 
ATOM 3599  O O    . GLY B 1 111 ? 160.226 104.010 -33.483 1.00 0.00 ? 111 GLY B O    1 
ATOM 3600  H H    . GLY B 1 111 ? 158.765 107.610 -31.774 1.00 0.00 ? 111 GLY B H    1 
ATOM 3601  H HA2  . GLY B 1 111 ? 157.833 105.608 -32.424 1.00 0.00 ? 111 GLY B HA2  1 
ATOM 3602  H HA3  . GLY B 1 111 ? 158.608 105.857 -33.987 1.00 0.00 ? 111 GLY B HA3  1 
ATOM 3603  N N    . ILE B 1 112 ? 160.151 104.635 -31.321 1.00 0.00 ? 112 ILE B N    1 
ATOM 3604  C CA   . ILE B 1 112 ? 161.126 103.635 -30.897 1.00 0.00 ? 112 ILE B CA   1 
ATOM 3605  C C    . ILE B 1 112 ? 160.823 102.282 -31.528 1.00 0.00 ? 112 ILE B C    1 
ATOM 3606  O O    . ILE B 1 112 ? 161.733 101.557 -31.925 1.00 0.00 ? 112 ILE B O    1 
ATOM 3607  C CB   . ILE B 1 112 ? 161.110 103.501 -29.374 1.00 0.00 ? 112 ILE B CB   1 
ATOM 3608  C CG1  . ILE B 1 112 ? 162.253 102.579 -28.937 1.00 0.00 ? 112 ILE B CG1  1 
ATOM 3609  C CG2  . ILE B 1 112 ? 159.771 102.909 -28.922 1.00 0.00 ? 112 ILE B CG2  1 
ATOM 3610  C CD1  . ILE B 1 112 ? 162.399 102.625 -27.415 1.00 0.00 ? 112 ILE B CD1  1 
ATOM 3611  H H    . ILE B 1 112 ? 159.768 105.249 -30.659 1.00 0.00 ? 112 ILE B H    1 
ATOM 3612  H HA   . ILE B 1 112 ? 162.110 103.952 -31.207 1.00 0.00 ? 112 ILE B HA   1 
ATOM 3613  H HB   . ILE B 1 112 ? 161.241 104.476 -28.927 1.00 0.00 ? 112 ILE B HB   1 
ATOM 3614  H HG12 . ILE B 1 112 ? 162.037 101.566 -29.249 1.00 0.00 ? 112 ILE B HG12 1 
ATOM 3615  H HG13 . ILE B 1 112 ? 163.175 102.907 -29.395 1.00 0.00 ? 112 ILE B HG13 1 
ATOM 3616  H HG21 . ILE B 1 112 ? 159.670 103.020 -27.853 1.00 0.00 ? 112 ILE B HG21 1 
ATOM 3617  H HG22 . ILE B 1 112 ? 159.734 101.862 -29.181 1.00 0.00 ? 112 ILE B HG22 1 
ATOM 3618  H HG23 . ILE B 1 112 ? 158.963 103.431 -29.416 1.00 0.00 ? 112 ILE B HG23 1 
ATOM 3619  H HD11 . ILE B 1 112 ? 163.184 101.948 -27.108 1.00 0.00 ? 112 ILE B HD11 1 
ATOM 3620  H HD12 . ILE B 1 112 ? 161.468 102.328 -26.955 1.00 0.00 ? 112 ILE B HD12 1 
ATOM 3621  H HD13 . ILE B 1 112 ? 162.649 103.630 -27.107 1.00 0.00 ? 112 ILE B HD13 1 
ATOM 3622  N N    . LEU B 1 113 ? 159.534 101.949 -31.632 1.00 0.00 ? 113 LEU B N    1 
ATOM 3623  C CA   . LEU B 1 113 ? 159.110 100.675 -32.236 1.00 0.00 ? 113 LEU B CA   1 
ATOM 3624  C C    . LEU B 1 113 ? 158.301 100.960 -33.499 1.00 0.00 ? 113 LEU B C    1 
ATOM 3625  O O    . LEU B 1 113 ? 157.208 101.521 -33.430 1.00 0.00 ? 113 LEU B O    1 
ATOM 3626  C CB   . LEU B 1 113 ? 158.250 99.894  -31.234 1.00 0.00 ? 113 LEU B CB   1 
ATOM 3627  C CG   . LEU B 1 113 ? 157.903 98.502  -31.795 1.00 0.00 ? 113 LEU B CG   1 
ATOM 3628  C CD1  . LEU B 1 113 ? 159.188 97.646  -31.952 1.00 0.00 ? 113 LEU B CD1  1 
ATOM 3629  C CD2  . LEU B 1 113 ? 156.922 97.809  -30.834 1.00 0.00 ? 113 LEU B CD2  1 
ATOM 3630  H H    . LEU B 1 113 ? 158.852 102.574 -31.305 1.00 0.00 ? 113 LEU B H    1 
ATOM 3631  H HA   . LEU B 1 113 ? 159.977 100.081 -32.498 1.00 0.00 ? 113 LEU B HA   1 
ATOM 3632  H HB2  . LEU B 1 113 ? 158.794 99.781  -30.310 1.00 0.00 ? 113 LEU B HB2  1 
ATOM 3633  H HB3  . LEU B 1 113 ? 157.338 100.437 -31.047 1.00 0.00 ? 113 LEU B HB3  1 
ATOM 3634  H HG   . LEU B 1 113 ? 157.436 98.613  -32.763 1.00 0.00 ? 113 LEU B HG   1 
ATOM 3635  H HD11 . LEU B 1 113 ? 158.946 96.594  -31.859 1.00 0.00 ? 113 LEU B HD11 1 
ATOM 3636  H HD12 . LEU B 1 113 ? 159.906 97.913  -31.189 1.00 0.00 ? 113 LEU B HD12 1 
ATOM 3637  H HD13 . LEU B 1 113 ? 159.620 97.823  -32.926 1.00 0.00 ? 113 LEU B HD13 1 
ATOM 3638  H HD21 . LEU B 1 113 ? 157.249 97.954  -29.814 1.00 0.00 ? 113 LEU B HD21 1 
ATOM 3639  H HD22 . LEU B 1 113 ? 156.888 96.753  -31.054 1.00 0.00 ? 113 LEU B HD22 1 
ATOM 3640  H HD23 . LEU B 1 113 ? 155.936 98.235  -30.959 1.00 0.00 ? 113 LEU B HD23 1 
ATOM 3641  N N    . GLU B 1 114 ? 158.846 100.582 -34.651 1.00 0.00 ? 114 GLU B N    1 
ATOM 3642  C CA   . GLU B 1 114 ? 158.161 100.818 -35.918 1.00 0.00 ? 114 GLU B CA   1 
ATOM 3643  C C    . GLU B 1 114 ? 156.854 100.038 -35.982 1.00 0.00 ? 114 GLU B C    1 
ATOM 3644  O O    . GLU B 1 114 ? 155.843 100.543 -36.472 1.00 0.00 ? 114 GLU B O    1 
ATOM 3645  C CB   . GLU B 1 114 ? 159.062 100.410 -37.084 1.00 0.00 ? 114 GLU B CB   1 
ATOM 3646  C CG   . GLU B 1 114 ? 160.256 101.360 -37.157 1.00 0.00 ? 114 GLU B CG   1 
ATOM 3647  C CD   . GLU B 1 114 ? 159.799 102.740 -37.618 1.00 0.00 ? 114 GLU B CD   1 
ATOM 3648  O OE1  . GLU B 1 114 ? 158.688 102.840 -38.113 1.00 0.00 ? 114 GLU B OE1  1 
ATOM 3649  O OE2  . GLU B 1 114 ? 160.565 103.678 -37.469 1.00 0.00 ? 114 GLU B OE2  1 
ATOM 3650  H H    . GLU B 1 114 ? 159.724 100.145 -34.650 1.00 0.00 ? 114 GLU B H    1 
ATOM 3651  H HA   . GLU B 1 114 ? 157.940 101.871 -36.003 1.00 0.00 ? 114 GLU B HA   1 
ATOM 3652  H HB2  . GLU B 1 114 ? 159.411 99.398  -36.933 1.00 0.00 ? 114 GLU B HB2  1 
ATOM 3653  H HB3  . GLU B 1 114 ? 158.503 100.465 -38.007 1.00 0.00 ? 114 GLU B HB3  1 
ATOM 3654  H HG2  . GLU B 1 114 ? 160.708 101.441 -36.178 1.00 0.00 ? 114 GLU B HG2  1 
ATOM 3655  H HG3  . GLU B 1 114 ? 160.982 100.972 -37.855 1.00 0.00 ? 114 GLU B HG3  1 
ATOM 3656  N N    . ASP B 1 115 ? 156.877 98.805  -35.485 1.00 0.00 ? 115 ASP B N    1 
ATOM 3657  C CA   . ASP B 1 115 ? 155.684 97.965  -35.494 1.00 0.00 ? 115 ASP B CA   1 
ATOM 3658  C C    . ASP B 1 115 ? 154.785 98.292  -34.304 1.00 0.00 ? 115 ASP B C    1 
ATOM 3659  O O    . ASP B 1 115 ? 155.194 98.986  -33.375 1.00 0.00 ? 115 ASP B O    1 
ATOM 3660  C CB   . ASP B 1 115 ? 156.093 96.494  -35.436 1.00 0.00 ? 115 ASP B CB   1 
ATOM 3661  C CG   . ASP B 1 115 ? 156.769 96.196  -34.101 1.00 0.00 ? 115 ASP B CG   1 
ATOM 3662  O OD1  . ASP B 1 115 ? 156.057 95.995  -33.132 1.00 0.00 ? 115 ASP B OD1  1 
ATOM 3663  O OD2  . ASP B 1 115 ? 157.989 96.175  -34.069 1.00 0.00 ? 115 ASP B OD2  1 
ATOM 3664  H H    . ASP B 1 115 ? 157.711 98.454  -35.108 1.00 0.00 ? 115 ASP B H    1 
ATOM 3665  H HA   . ASP B 1 115 ? 155.133 98.137  -36.407 1.00 0.00 ? 115 ASP B HA   1 
ATOM 3666  H HB2  . ASP B 1 115 ? 155.216 95.872  -35.541 1.00 0.00 ? 115 ASP B HB2  1 
ATOM 3667  H HB3  . ASP B 1 115 ? 156.783 96.282  -36.240 1.00 0.00 ? 115 ASP B HB3  1 
ATOM 3668  N N    . MET B 1 116 ? 153.560 97.780  -34.341 1.00 0.00 ? 116 MET B N    1 
ATOM 3669  C CA   . MET B 1 116 ? 152.608 98.013  -33.262 1.00 0.00 ? 116 MET B CA   1 
ATOM 3670  C C    . MET B 1 116 ? 151.468 96.998  -33.332 1.00 0.00 ? 116 MET B C    1 
ATOM 3671  O O    . MET B 1 116 ? 150.351 97.339  -33.720 1.00 0.00 ? 116 MET B O    1 
ATOM 3672  C CB   . MET B 1 116 ? 152.035 99.431  -33.363 1.00 0.00 ? 116 MET B CB   1 
ATOM 3673  C CG   . MET B 1 116 ? 151.269 99.762  -32.074 1.00 0.00 ? 116 MET B CG   1 
ATOM 3674  S SD   . MET B 1 116 ? 150.632 101.459 -32.151 1.00 0.00 ? 116 MET B SD   1 
ATOM 3675  C CE   . MET B 1 116 ? 152.120 102.312 -31.561 1.00 0.00 ? 116 MET B CE   1 
ATOM 3676  H H    . MET B 1 116 ? 153.292 97.230  -35.107 1.00 0.00 ? 116 MET B H    1 
ATOM 3677  H HA   . MET B 1 116 ? 153.116 97.914  -32.318 1.00 0.00 ? 116 MET B HA   1 
ATOM 3678  H HB2  . MET B 1 116 ? 152.842 100.133 -33.501 1.00 0.00 ? 116 MET B HB2  1 
ATOM 3679  H HB3  . MET B 1 116 ? 151.361 99.487  -34.203 1.00 0.00 ? 116 MET B HB3  1 
ATOM 3680  H HG2  . MET B 1 116 ? 150.444 99.075  -31.962 1.00 0.00 ? 116 MET B HG2  1 
ATOM 3681  H HG3  . MET B 1 116 ? 151.933 99.665  -31.227 1.00 0.00 ? 116 MET B HG3  1 
ATOM 3682  H HE1  . MET B 1 116 ? 152.072 102.411 -30.484 1.00 0.00 ? 116 MET B HE1  1 
ATOM 3683  H HE2  . MET B 1 116 ? 152.174 103.291 -32.006 1.00 0.00 ? 116 MET B HE2  1 
ATOM 3684  H HE3  . MET B 1 116 ? 152.997 101.746 -31.835 1.00 0.00 ? 116 MET B HE3  1 
ATOM 3685  N N    . PRO B 1 117 ? 151.723 95.760  -32.975 1.00 0.00 ? 117 PRO B N    1 
ATOM 3686  C CA   . PRO B 1 117 ? 150.685 94.691  -33.017 1.00 0.00 ? 117 PRO B CA   1 
ATOM 3687  C C    . PRO B 1 117 ? 149.730 94.767  -31.821 1.00 0.00 ? 117 PRO B C    1 
ATOM 3688  O O    . PRO B 1 117 ? 149.931 94.097  -30.808 1.00 0.00 ? 117 PRO B O    1 
ATOM 3689  C CB   . PRO B 1 117 ? 151.513 93.399  -33.007 1.00 0.00 ? 117 PRO B CB   1 
ATOM 3690  C CG   . PRO B 1 117 ? 152.743 93.745  -32.222 1.00 0.00 ? 117 PRO B CG   1 
ATOM 3691  C CD   . PRO B 1 117 ? 153.023 95.238  -32.496 1.00 0.00 ? 117 PRO B CD   1 
ATOM 3692  H HA   . PRO B 1 117 ? 150.126 94.754  -33.937 1.00 0.00 ? 117 PRO B HA   1 
ATOM 3693  H HB2  . PRO B 1 117 ? 150.962 92.595  -32.529 1.00 0.00 ? 117 PRO B HB2  1 
ATOM 3694  H HB3  . PRO B 1 117 ? 151.784 93.118  -34.016 1.00 0.00 ? 117 PRO B HB3  1 
ATOM 3695  H HG2  . PRO B 1 117 ? 152.563 93.583  -31.162 1.00 0.00 ? 117 PRO B HG2  1 
ATOM 3696  H HG3  . PRO B 1 117 ? 153.584 93.147  -32.551 1.00 0.00 ? 117 PRO B HG3  1 
ATOM 3697  H HD2  . PRO B 1 117 ? 153.329 95.735  -31.584 1.00 0.00 ? 117 PRO B HD2  1 
ATOM 3698  H HD3  . PRO B 1 117 ? 153.776 95.353  -33.263 1.00 0.00 ? 117 PRO B HD3  1 
ATOM 3699  N N    . VAL B 1 118 ? 148.692 95.599  -31.954 1.00 0.00 ? 118 VAL B N    1 
ATOM 3700  C CA   . VAL B 1 118 ? 147.692 95.778  -30.891 1.00 0.00 ? 118 VAL B CA   1 
ATOM 3701  C C    . VAL B 1 118 ? 146.292 95.871  -31.498 1.00 0.00 ? 118 VAL B C    1 
ATOM 3702  O O    . VAL B 1 118 ? 146.119 96.392  -32.600 1.00 0.00 ? 118 VAL B O    1 
ATOM 3703  C CB   . VAL B 1 118 ? 147.984 97.059  -30.108 1.00 0.00 ? 118 VAL B CB   1 
ATOM 3704  C CG1  . VAL B 1 118 ? 147.814 98.268  -31.030 1.00 0.00 ? 118 VAL B CG1  1 
ATOM 3705  C CG2  . VAL B 1 118 ? 147.006 97.176  -28.936 1.00 0.00 ? 118 VAL B CG2  1 
ATOM 3706  H H    . VAL B 1 118 ? 148.593 96.103  -32.788 1.00 0.00 ? 118 VAL B H    1 
ATOM 3707  H HA   . VAL B 1 118 ? 147.724 94.935  -30.212 1.00 0.00 ? 118 VAL B HA   1 
ATOM 3708  H HB   . VAL B 1 118 ? 148.997 97.031  -29.734 1.00 0.00 ? 118 VAL B HB   1 
ATOM 3709  H HG11 . VAL B 1 118 ? 148.240 99.142  -30.562 1.00 0.00 ? 118 VAL B HG11 1 
ATOM 3710  H HG12 . VAL B 1 118 ? 146.762 98.435  -31.214 1.00 0.00 ? 118 VAL B HG12 1 
ATOM 3711  H HG13 . VAL B 1 118 ? 148.317 98.079  -31.966 1.00 0.00 ? 118 VAL B HG13 1 
ATOM 3712  H HG21 . VAL B 1 118 ? 147.057 96.280  -28.334 1.00 0.00 ? 118 VAL B HG21 1 
ATOM 3713  H HG22 . VAL B 1 118 ? 146.002 97.296  -29.316 1.00 0.00 ? 118 VAL B HG22 1 
ATOM 3714  H HG23 . VAL B 1 118 ? 147.267 98.032  -28.332 1.00 0.00 ? 118 VAL B HG23 1 
ATOM 3715  N N    . ASP B 1 119 ? 145.297 95.364  -30.776 1.00 0.00 ? 119 ASP B N    1 
ATOM 3716  C CA   . ASP B 1 119 ? 143.919 95.400  -31.261 1.00 0.00 ? 119 ASP B CA   1 
ATOM 3717  C C    . ASP B 1 119 ? 143.831 94.813  -32.667 1.00 0.00 ? 119 ASP B C    1 
ATOM 3718  O O    . ASP B 1 119 ? 143.620 95.537  -33.640 1.00 0.00 ? 119 ASP B O    1 
ATOM 3719  C CB   . ASP B 1 119 ? 143.401 96.840  -31.275 1.00 0.00 ? 119 ASP B CB   1 
ATOM 3720  C CG   . ASP B 1 119 ? 141.879 96.850  -31.393 1.00 0.00 ? 119 ASP B CG   1 
ATOM 3721  O OD1  . ASP B 1 119 ? 141.320 95.805  -31.684 1.00 0.00 ? 119 ASP B OD1  1 
ATOM 3722  O OD2  . ASP B 1 119 ? 141.296 97.902  -31.190 1.00 0.00 ? 119 ASP B OD2  1 
ATOM 3723  H H    . ASP B 1 119 ? 145.491 94.962  -29.904 1.00 0.00 ? 119 ASP B H    1 
ATOM 3724  H HA   . ASP B 1 119 ? 143.301 94.813  -30.597 1.00 0.00 ? 119 ASP B HA   1 
ATOM 3725  H HB2  . ASP B 1 119 ? 143.693 97.334  -30.360 1.00 0.00 ? 119 ASP B HB2  1 
ATOM 3726  H HB3  . ASP B 1 119 ? 143.828 97.366  -32.117 1.00 0.00 ? 119 ASP B HB3  1 
ATOM 3727  N N    . PRO B 1 120 ? 143.992 93.522  -32.785 1.00 0.00 ? 120 PRO B N    1 
ATOM 3728  C CA   . PRO B 1 120 ? 143.933 92.814  -34.103 1.00 0.00 ? 120 PRO B CA   1 
ATOM 3729  C C    . PRO B 1 120 ? 142.633 93.106  -34.857 1.00 0.00 ? 120 PRO B C    1 
ATOM 3730  O O    . PRO B 1 120 ? 141.570 93.242  -34.253 1.00 0.00 ? 120 PRO B O    1 
ATOM 3731  C CB   . PRO B 1 120 ? 144.039 91.325  -33.709 1.00 0.00 ? 120 PRO B CB   1 
ATOM 3732  C CG   . PRO B 1 120 ? 144.751 91.337  -32.396 1.00 0.00 ? 120 PRO B CG   1 
ATOM 3733  C CD   . PRO B 1 120 ? 144.250 92.585  -31.679 1.00 0.00 ? 120 PRO B CD   1 
ATOM 3734  H HA   . PRO B 1 120 ? 144.782 93.088  -34.708 1.00 0.00 ? 120 PRO B HA   1 
ATOM 3735  H HB2  . PRO B 1 120 ? 143.051 90.888  -33.600 1.00 0.00 ? 120 PRO B HB2  1 
ATOM 3736  H HB3  . PRO B 1 120 ? 144.614 90.776  -34.441 1.00 0.00 ? 120 PRO B HB3  1 
ATOM 3737  H HG2  . PRO B 1 120 ? 144.507 90.448  -31.827 1.00 0.00 ? 120 PRO B HG2  1 
ATOM 3738  H HG3  . PRO B 1 120 ? 145.818 91.407  -32.547 1.00 0.00 ? 120 PRO B HG3  1 
ATOM 3739  H HD2  . PRO B 1 120 ? 143.340 92.370  -31.133 1.00 0.00 ? 120 PRO B HD2  1 
ATOM 3740  H HD3  . PRO B 1 120 ? 145.007 92.982  -31.021 1.00 0.00 ? 120 PRO B HD3  1 
ATOM 3741  N N    . ASP B 1 121 ? 142.733 93.202  -36.182 1.00 0.00 ? 121 ASP B N    1 
ATOM 3742  C CA   . ASP B 1 121 ? 141.568 93.483  -37.022 1.00 0.00 ? 121 ASP B CA   1 
ATOM 3743  C C    . ASP B 1 121 ? 141.742 92.846  -38.395 1.00 0.00 ? 121 ASP B C    1 
ATOM 3744  O O    . ASP B 1 121 ? 142.865 92.624  -38.847 1.00 0.00 ? 121 ASP B O    1 
ATOM 3745  C CB   . ASP B 1 121 ? 141.390 94.998  -37.177 1.00 0.00 ? 121 ASP B CB   1 
ATOM 3746  C CG   . ASP B 1 121 ? 139.993 95.313  -37.701 1.00 0.00 ? 121 ASP B CG   1 
ATOM 3747  O OD1  . ASP B 1 121 ? 139.208 94.390  -37.836 1.00 0.00 ? 121 ASP B OD1  1 
ATOM 3748  O OD2  . ASP B 1 121 ? 139.728 96.476  -37.962 1.00 0.00 ? 121 ASP B OD2  1 
ATOM 3749  H H    . ASP B 1 121 ? 143.610 93.086  -36.604 1.00 0.00 ? 121 ASP B H    1 
ATOM 3750  H HA   . ASP B 1 121 ? 140.682 93.071  -36.556 1.00 0.00 ? 121 ASP B HA   1 
ATOM 3751  H HB2  . ASP B 1 121 ? 141.528 95.473  -36.217 1.00 0.00 ? 121 ASP B HB2  1 
ATOM 3752  H HB3  . ASP B 1 121 ? 142.125 95.375  -37.871 1.00 0.00 ? 121 ASP B HB3  1 
ATOM 3753  N N    . ASN B 1 122 ? 140.628 92.550  -39.052 1.00 0.00 ? 122 ASN B N    1 
ATOM 3754  C CA   . ASN B 1 122 ? 140.681 91.934  -40.370 1.00 0.00 ? 122 ASN B CA   1 
ATOM 3755  C C    . ASN B 1 122 ? 141.255 92.908  -41.394 1.00 0.00 ? 122 ASN B C    1 
ATOM 3756  O O    . ASN B 1 122 ? 140.810 94.050  -41.495 1.00 0.00 ? 122 ASN B O    1 
ATOM 3757  C CB   . ASN B 1 122 ? 139.277 91.506  -40.801 1.00 0.00 ? 122 ASN B CB   1 
ATOM 3758  C CG   . ASN B 1 122 ? 138.810 90.330  -39.950 1.00 0.00 ? 122 ASN B CG   1 
ATOM 3759  O OD1  . ASN B 1 122 ? 139.631 89.626  -39.361 1.00 0.00 ? 122 ASN B OD1  1 
ATOM 3760  N ND2  . ASN B 1 122 ? 137.535 90.073  -39.847 1.00 0.00 ? 122 ASN B ND2  1 
ATOM 3761  H H    . ASN B 1 122 ? 139.759 92.745  -38.644 1.00 0.00 ? 122 ASN B H    1 
ATOM 3762  H HA   . ASN B 1 122 ? 141.312 91.060  -40.324 1.00 0.00 ? 122 ASN B HA   1 
ATOM 3763  H HB2  . ASN B 1 122 ? 138.594 92.334  -40.675 1.00 0.00 ? 122 ASN B HB2  1 
ATOM 3764  H HB3  . ASN B 1 122 ? 139.294 91.209  -41.839 1.00 0.00 ? 122 ASN B HB3  1 
ATOM 3765  H HD21 . ASN B 1 122 ? 136.883 90.635  -40.316 1.00 0.00 ? 122 ASN B HD21 1 
ATOM 3766  H HD22 . ASN B 1 122 ? 137.229 89.320  -39.301 1.00 0.00 ? 122 ASN B HD22 1 
ATOM 3767  N N    . GLU B 1 123 ? 142.245 92.441  -42.157 1.00 0.00 ? 123 GLU B N    1 
ATOM 3768  C CA   . GLU B 1 123 ? 142.880 93.272  -43.183 1.00 0.00 ? 123 GLU B CA   1 
ATOM 3769  C C    . GLU B 1 123 ? 142.143 93.124  -44.509 1.00 0.00 ? 123 GLU B C    1 
ATOM 3770  O O    . GLU B 1 123 ? 142.496 93.753  -45.506 1.00 0.00 ? 123 GLU B O    1 
ATOM 3771  C CB   . GLU B 1 123 ? 144.343 92.859  -43.362 1.00 0.00 ? 123 GLU B CB   1 
ATOM 3772  C CG   . GLU B 1 123 ? 145.108 93.118  -42.062 1.00 0.00 ? 123 GLU B CG   1 
ATOM 3773  C CD   . GLU B 1 123 ? 145.253 94.619  -41.836 1.00 0.00 ? 123 GLU B CD   1 
ATOM 3774  O OE1  . GLU B 1 123 ? 145.009 95.364  -42.770 1.00 0.00 ? 123 GLU B OE1  1 
ATOM 3775  O OE2  . GLU B 1 123 ? 145.606 95.001  -40.733 1.00 0.00 ? 123 GLU B OE2  1 
ATOM 3776  H H    . GLU B 1 123 ? 142.552 91.519  -42.030 1.00 0.00 ? 123 GLU B H    1 
ATOM 3777  H HA   . GLU B 1 123 ? 142.845 94.308  -42.877 1.00 0.00 ? 123 GLU B HA   1 
ATOM 3778  H HB2  . GLU B 1 123 ? 144.393 91.808  -43.607 1.00 0.00 ? 123 GLU B HB2  1 
ATOM 3779  H HB3  . GLU B 1 123 ? 144.785 93.437  -44.159 1.00 0.00 ? 123 GLU B HB3  1 
ATOM 3780  H HG2  . GLU B 1 123 ? 144.568 92.679  -41.234 1.00 0.00 ? 123 GLU B HG2  1 
ATOM 3781  H HG3  . GLU B 1 123 ? 146.088 92.670  -42.129 1.00 0.00 ? 123 GLU B HG3  1 
ATOM 3782  N N    . ALA B 1 124 ? 141.113 92.290  -44.511 1.00 0.00 ? 124 ALA B N    1 
ATOM 3783  C CA   . ALA B 1 124 ? 140.330 92.071  -45.717 1.00 0.00 ? 124 ALA B CA   1 
ATOM 3784  C C    . ALA B 1 124 ? 139.643 93.365  -46.140 1.00 0.00 ? 124 ALA B C    1 
ATOM 3785  O O    . ALA B 1 124 ? 139.257 94.175  -45.299 1.00 0.00 ? 124 ALA B O    1 
ATOM 3786  C CB   . ALA B 1 124 ? 139.283 90.984  -45.469 1.00 0.00 ? 124 ALA B CB   1 
ATOM 3787  H H    . ALA B 1 124 ? 140.874 91.817  -43.687 1.00 0.00 ? 124 ALA B H    1 
ATOM 3788  H HA   . ALA B 1 124 ? 140.988 91.748  -46.508 1.00 0.00 ? 124 ALA B HA   1 
ATOM 3789  H HB1  . ALA B 1 124 ? 138.494 91.380  -44.846 1.00 0.00 ? 124 ALA B HB1  1 
ATOM 3790  H HB2  . ALA B 1 124 ? 139.747 90.145  -44.974 1.00 0.00 ? 124 ALA B HB2  1 
ATOM 3791  H HB3  . ALA B 1 124 ? 138.869 90.661  -46.412 1.00 0.00 ? 124 ALA B HB3  1 
ATOM 3792  N N    . TYR B 1 125 ? 139.504 93.551  -47.449 1.00 0.00 ? 125 TYR B N    1 
ATOM 3793  C CA   . TYR B 1 125 ? 138.868 94.751  -47.986 1.00 0.00 ? 125 TYR B CA   1 
ATOM 3794  C C    . TYR B 1 125 ? 139.722 95.990  -47.703 1.00 0.00 ? 125 TYR B C    1 
ATOM 3795  O O    . TYR B 1 125 ? 139.316 97.113  -48.001 1.00 0.00 ? 125 TYR B O    1 
ATOM 3796  C CB   . TYR B 1 125 ? 137.466 94.929  -47.375 1.00 0.00 ? 125 TYR B CB   1 
ATOM 3797  C CG   . TYR B 1 125 ? 136.631 95.849  -48.248 1.00 0.00 ? 125 TYR B CG   1 
ATOM 3798  C CD1  . TYR B 1 125 ? 136.105 95.378  -49.457 1.00 0.00 ? 125 TYR B CD1  1 
ATOM 3799  C CD2  . TYR B 1 125 ? 136.384 97.168  -47.844 1.00 0.00 ? 125 TYR B CD2  1 
ATOM 3800  C CE1  . TYR B 1 125 ? 135.334 96.224  -50.262 1.00 0.00 ? 125 TYR B CE1  1 
ATOM 3801  C CE2  . TYR B 1 125 ? 135.614 98.015  -48.651 1.00 0.00 ? 125 TYR B CE2  1 
ATOM 3802  C CZ   . TYR B 1 125 ? 135.088 97.543  -49.859 1.00 0.00 ? 125 TYR B CZ   1 
ATOM 3803  O OH   . TYR B 1 125 ? 134.329 98.378  -50.652 1.00 0.00 ? 125 TYR B OH   1 
ATOM 3804  H H    . TYR B 1 125 ? 139.839 92.868  -48.067 1.00 0.00 ? 125 TYR B H    1 
ATOM 3805  H HA   . TYR B 1 125 ? 138.770 94.635  -49.057 1.00 0.00 ? 125 TYR B HA   1 
ATOM 3806  H HB2  . TYR B 1 125 ? 136.981 93.967  -47.303 1.00 0.00 ? 125 TYR B HB2  1 
ATOM 3807  H HB3  . TYR B 1 125 ? 137.555 95.358  -46.388 1.00 0.00 ? 125 TYR B HB3  1 
ATOM 3808  H HD1  . TYR B 1 125 ? 136.294 94.360  -49.767 1.00 0.00 ? 125 TYR B HD1  1 
ATOM 3809  H HD2  . TYR B 1 125 ? 136.789 97.533  -46.913 1.00 0.00 ? 125 TYR B HD2  1 
ATOM 3810  H HE1  . TYR B 1 125 ? 134.928 95.861  -51.195 1.00 0.00 ? 125 TYR B HE1  1 
ATOM 3811  H HE2  . TYR B 1 125 ? 135.425 99.031  -48.340 1.00 0.00 ? 125 TYR B HE2  1 
ATOM 3812  H HH   . TYR B 1 125 ? 134.336 98.027  -51.545 1.00 0.00 ? 125 TYR B HH   1 
ATOM 3813  N N    . GLU B 1 126 ? 140.916 95.777  -47.127 1.00 0.00 ? 126 GLU B N    1 
ATOM 3814  C CA   . GLU B 1 126 ? 141.835 96.885  -46.807 1.00 0.00 ? 126 GLU B CA   1 
ATOM 3815  C C    . GLU B 1 126 ? 143.243 96.574  -47.312 1.00 0.00 ? 126 GLU B C    1 
ATOM 3816  O O    . GLU B 1 126 ? 143.751 95.468  -47.124 1.00 0.00 ? 126 GLU B O    1 
ATOM 3817  C CB   . GLU B 1 126 ? 141.878 97.104  -45.293 1.00 0.00 ? 126 GLU B CB   1 
ATOM 3818  C CG   . GLU B 1 126 ? 140.475 97.433  -44.782 1.00 0.00 ? 126 GLU B CG   1 
ATOM 3819  C CD   . GLU B 1 126 ? 140.029 98.788  -45.321 1.00 0.00 ? 126 GLU B CD   1 
ATOM 3820  O OE1  . GLU B 1 126 ? 140.888 99.549  -45.735 1.00 0.00 ? 126 GLU B OE1  1 
ATOM 3821  O OE2  . GLU B 1 126 ? 138.836 99.043  -45.311 1.00 0.00 ? 126 GLU B OE2  1 
ATOM 3822  H H    . GLU B 1 126 ? 141.187 94.861  -46.916 1.00 0.00 ? 126 GLU B H    1 
ATOM 3823  H HA   . GLU B 1 126 ? 141.489 97.796  -47.282 1.00 0.00 ? 126 GLU B HA   1 
ATOM 3824  H HB2  . GLU B 1 126 ? 142.236 96.206  -44.809 1.00 0.00 ? 126 GLU B HB2  1 
ATOM 3825  H HB3  . GLU B 1 126 ? 142.542 97.925  -45.067 1.00 0.00 ? 126 GLU B HB3  1 
ATOM 3826  H HG2  . GLU B 1 126 ? 139.784 96.670  -45.112 1.00 0.00 ? 126 GLU B HG2  1 
ATOM 3827  H HG3  . GLU B 1 126 ? 140.484 97.464  -43.703 1.00 0.00 ? 126 GLU B HG3  1 
ATOM 3828  N N    . MET B 1 127 ? 143.871 97.563  -47.947 1.00 0.00 ? 127 MET B N    1 
ATOM 3829  C CA   . MET B 1 127 ? 145.228 97.397  -48.472 1.00 0.00 ? 127 MET B CA   1 
ATOM 3830  C C    . MET B 1 127 ? 145.930 98.751  -48.557 1.00 0.00 ? 127 MET B C    1 
ATOM 3831  O O    . MET B 1 127 ? 146.348 99.175  -49.635 1.00 0.00 ? 127 MET B O    1 
ATOM 3832  C CB   . MET B 1 127 ? 145.170 96.767  -49.868 1.00 0.00 ? 127 MET B CB   1 
ATOM 3833  C CG   . MET B 1 127 ? 146.561 96.264  -50.265 1.00 0.00 ? 127 MET B CG   1 
ATOM 3834  S SD   . MET B 1 127 ? 146.469 95.433  -51.876 1.00 0.00 ? 127 MET B SD   1 
ATOM 3835  C CE   . MET B 1 127 ? 146.177 96.901  -52.900 1.00 0.00 ? 127 MET B CE   1 
ATOM 3836  H H    . MET B 1 127 ? 143.417 98.423  -48.060 1.00 0.00 ? 127 MET B H    1 
ATOM 3837  H HA   . MET B 1 127 ? 145.789 96.746  -47.818 1.00 0.00 ? 127 MET B HA   1 
ATOM 3838  H HB2  . MET B 1 127 ? 144.475 95.938  -49.862 1.00 0.00 ? 127 MET B HB2  1 
ATOM 3839  H HB3  . MET B 1 127 ? 144.840 97.507  -50.581 1.00 0.00 ? 127 MET B HB3  1 
ATOM 3840  H HG2  . MET B 1 127 ? 147.243 97.098  -50.325 1.00 0.00 ? 127 MET B HG2  1 
ATOM 3841  H HG3  . MET B 1 127 ? 146.915 95.565  -49.521 1.00 0.00 ? 127 MET B HG3  1 
ATOM 3842  H HE1  . MET B 1 127 ? 145.125 97.152  -52.880 1.00 0.00 ? 127 MET B HE1  1 
ATOM 3843  H HE2  . MET B 1 127 ? 146.473 96.696  -53.916 1.00 0.00 ? 127 MET B HE2  1 
ATOM 3844  H HE3  . MET B 1 127 ? 146.759 97.730  -52.520 1.00 0.00 ? 127 MET B HE3  1 
ATOM 3845  N N    . PRO B 1 128 ? 146.058 99.436  -47.448 1.00 0.00 ? 128 PRO B N    1 
ATOM 3846  C CA   . PRO B 1 128 ? 146.721 100.778 -47.400 1.00 0.00 ? 128 PRO B CA   1 
ATOM 3847  C C    . PRO B 1 128 ? 148.234 100.681 -47.614 1.00 0.00 ? 128 PRO B C    1 
ATOM 3848  O O    . PRO B 1 128 ? 148.877 101.651 -48.017 1.00 0.00 ? 128 PRO B O    1 
ATOM 3849  C CB   . PRO B 1 128 ? 146.371 101.292 -45.989 1.00 0.00 ? 128 PRO B CB   1 
ATOM 3850  C CG   . PRO B 1 128 ? 146.198 100.053 -45.170 1.00 0.00 ? 128 PRO B CG   1 
ATOM 3851  C CD   . PRO B 1 128 ? 145.591 99.009  -46.114 1.00 0.00 ? 128 PRO B CD   1 
ATOM 3852  H HA   . PRO B 1 128 ? 146.287 101.430 -48.140 1.00 0.00 ? 128 PRO B HA   1 
ATOM 3853  H HB2  . PRO B 1 128 ? 147.174 101.907 -45.595 1.00 0.00 ? 128 PRO B HB2  1 
ATOM 3854  H HB3  . PRO B 1 128 ? 145.446 101.853 -46.011 1.00 0.00 ? 128 PRO B HB3  1 
ATOM 3855  H HG2  . PRO B 1 128 ? 147.162 99.713  -44.803 1.00 0.00 ? 128 PRO B HG2  1 
ATOM 3856  H HG3  . PRO B 1 128 ? 145.526 100.234 -44.343 1.00 0.00 ? 128 PRO B HG3  1 
ATOM 3857  H HD2  . PRO B 1 128 ? 145.959 98.021  -45.873 1.00 0.00 ? 128 PRO B HD2  1 
ATOM 3858  H HD3  . PRO B 1 128 ? 144.512 99.036  -46.073 1.00 0.00 ? 128 PRO B HD3  1 
ATOM 3859  N N    . SER B 1 129 ? 148.794 99.503  -47.345 1.00 0.00 ? 129 SER B N    1 
ATOM 3860  C CA   . SER B 1 129 ? 150.230 99.287  -47.514 1.00 0.00 ? 129 SER B CA   1 
ATOM 3861  C C    . SER B 1 129 ? 150.527 97.804  -47.704 1.00 0.00 ? 129 SER B C    1 
ATOM 3862  O O    . SER B 1 129 ? 149.701 96.951  -47.381 1.00 0.00 ? 129 SER B O    1 
ATOM 3863  C CB   . SER B 1 129 ? 150.988 99.805  -46.293 1.00 0.00 ? 129 SER B CB   1 
ATOM 3864  O OG   . SER B 1 129 ? 150.655 99.012  -45.160 1.00 0.00 ? 129 SER B OG   1 
ATOM 3865  H H    . SER B 1 129 ? 148.232 98.765  -47.030 1.00 0.00 ? 129 SER B H    1 
ATOM 3866  H HA   . SER B 1 129 ? 150.568 99.825  -48.389 1.00 0.00 ? 129 SER B HA   1 
ATOM 3867  H HB2  . SER B 1 129 ? 152.047 99.742  -46.471 1.00 0.00 ? 129 SER B HB2  1 
ATOM 3868  H HB3  . SER B 1 129 ? 150.716 100.839 -46.114 1.00 0.00 ? 129 SER B HB3  1 
ATOM 3869  H HG   . SER B 1 129 ? 150.359 98.154  -45.474 1.00 0.00 ? 129 SER B HG   1 
ATOM 3870  N N    . GLU B 1 130 ? 151.712 97.503  -48.224 1.00 0.00 ? 130 GLU B N    1 
ATOM 3871  C CA   . GLU B 1 130 ? 152.104 96.117  -48.447 1.00 0.00 ? 130 GLU B CA   1 
ATOM 3872  C C    . GLU B 1 130 ? 152.558 95.485  -47.134 1.00 0.00 ? 130 GLU B C    1 
ATOM 3873  O O    . GLU B 1 130 ? 153.495 95.964  -46.496 1.00 0.00 ? 130 GLU B O    1 
ATOM 3874  C CB   . GLU B 1 130 ? 153.245 96.056  -49.470 1.00 0.00 ? 130 GLU B CB   1 
ATOM 3875  C CG   . GLU B 1 130 ? 153.507 94.600  -49.872 1.00 0.00 ? 130 GLU B CG   1 
ATOM 3876  C CD   . GLU B 1 130 ? 152.325 94.058  -50.671 1.00 0.00 ? 130 GLU B CD   1 
ATOM 3877  O OE1  . GLU B 1 130 ? 151.559 94.862  -51.176 1.00 0.00 ? 130 GLU B OE1  1 
ATOM 3878  O OE2  . GLU B 1 130 ? 152.205 92.848  -50.766 1.00 0.00 ? 130 GLU B OE2  1 
ATOM 3879  H H    . GLU B 1 130 ? 152.332 98.223  -48.460 1.00 0.00 ? 130 GLU B H    1 
ATOM 3880  H HA   . GLU B 1 130 ? 151.258 95.567  -48.830 1.00 0.00 ? 130 GLU B HA   1 
ATOM 3881  H HB2  . GLU B 1 130 ? 152.973 96.627  -50.345 1.00 0.00 ? 130 GLU B HB2  1 
ATOM 3882  H HB3  . GLU B 1 130 ? 154.141 96.471  -49.033 1.00 0.00 ? 130 GLU B HB3  1 
ATOM 3883  H HG2  . GLU B 1 130 ? 154.401 94.551  -50.477 1.00 0.00 ? 130 GLU B HG2  1 
ATOM 3884  H HG3  . GLU B 1 130 ? 153.642 94.001  -48.984 1.00 0.00 ? 130 GLU B HG3  1 
ATOM 3885  N N    . GLU B 1 131 ? 151.888 94.398  -46.737 1.00 0.00 ? 131 GLU B N    1 
ATOM 3886  C CA   . GLU B 1 131 ? 152.226 93.689  -45.493 1.00 0.00 ? 131 GLU B CA   1 
ATOM 3887  C C    . GLU B 1 131 ? 152.305 92.188  -45.746 1.00 0.00 ? 131 GLU B C    1 
ATOM 3888  O O    . GLU B 1 131 ? 151.427 91.610  -46.387 1.00 0.00 ? 131 GLU B O    1 
ATOM 3889  C CB   . GLU B 1 131 ? 151.160 93.970  -44.428 1.00 0.00 ? 131 GLU B CB   1 
ATOM 3890  C CG   . GLU B 1 131 ? 151.081 95.476  -44.167 1.00 0.00 ? 131 GLU B CG   1 
ATOM 3891  C CD   . GLU B 1 131 ? 152.384 95.970  -43.546 1.00 0.00 ? 131 GLU B CD   1 
ATOM 3892  O OE1  . GLU B 1 131 ? 153.106 95.150  -43.002 1.00 0.00 ? 131 GLU B OE1  1 
ATOM 3893  O OE2  . GLU B 1 131 ? 152.640 97.161  -43.623 1.00 0.00 ? 131 GLU B OE2  1 
ATOM 3894  H H    . GLU B 1 131 ? 151.152 94.064  -47.292 1.00 0.00 ? 131 GLU B H    1 
ATOM 3895  H HA   . GLU B 1 131 ? 153.186 94.030  -45.123 1.00 0.00 ? 131 GLU B HA   1 
ATOM 3896  H HB2  . GLU B 1 131 ? 150.201 93.614  -44.777 1.00 0.00 ? 131 GLU B HB2  1 
ATOM 3897  H HB3  . GLU B 1 131 ? 151.423 93.462  -43.513 1.00 0.00 ? 131 GLU B HB3  1 
ATOM 3898  H HG2  . GLU B 1 131 ? 150.910 95.993  -45.101 1.00 0.00 ? 131 GLU B HG2  1 
ATOM 3899  H HG3  . GLU B 1 131 ? 150.265 95.680  -43.491 1.00 0.00 ? 131 GLU B HG3  1 
ATOM 3900  N N    . GLY B 1 132 ? 153.362 91.562  -45.240 1.00 0.00 ? 132 GLY B N    1 
ATOM 3901  C CA   . GLY B 1 132 ? 153.549 90.126  -45.418 1.00 0.00 ? 132 GLY B CA   1 
ATOM 3902  C C    . GLY B 1 132 ? 155.008 89.743  -45.212 1.00 0.00 ? 132 GLY B C    1 
ATOM 3903  O O    . GLY B 1 132 ? 155.832 90.579  -44.841 1.00 0.00 ? 132 GLY B O    1 
ATOM 3904  H H    . GLY B 1 132 ? 154.029 92.075  -44.738 1.00 0.00 ? 132 GLY B H    1 
ATOM 3905  H HA2  . GLY B 1 132 ? 152.937 89.598  -44.700 1.00 0.00 ? 132 GLY B HA2  1 
ATOM 3906  H HA3  . GLY B 1 132 ? 153.247 89.848  -46.417 1.00 0.00 ? 132 GLY B HA3  1 
ATOM 3907  N N    . TYR B 1 133 ? 155.326 88.474  -45.456 1.00 0.00 ? 133 TYR B N    1 
ATOM 3908  C CA   . TYR B 1 133 ? 156.696 87.989  -45.294 1.00 0.00 ? 133 TYR B CA   1 
ATOM 3909  C C    . TYR B 1 133 ? 157.501 88.233  -46.566 1.00 0.00 ? 133 TYR B C    1 
ATOM 3910  O O    . TYR B 1 133 ? 157.006 88.022  -47.674 1.00 0.00 ? 133 TYR B O    1 
ATOM 3911  C CB   . TYR B 1 133 ? 156.683 86.492  -44.979 1.00 0.00 ? 133 TYR B CB   1 
ATOM 3912  C CG   . TYR B 1 133 ? 155.939 86.259  -43.684 1.00 0.00 ? 133 TYR B CG   1 
ATOM 3913  C CD1  . TYR B 1 133 ? 156.541 86.587  -42.463 1.00 0.00 ? 133 TYR B CD1  1 
ATOM 3914  C CD2  . TYR B 1 133 ? 154.647 85.716  -43.703 1.00 0.00 ? 133 TYR B CD2  1 
ATOM 3915  C CE1  . TYR B 1 133 ? 155.854 86.372  -41.263 1.00 0.00 ? 133 TYR B CE1  1 
ATOM 3916  C CE2  . TYR B 1 133 ? 153.960 85.500  -42.503 1.00 0.00 ? 133 TYR B CE2  1 
ATOM 3917  C CZ   . TYR B 1 133 ? 154.563 85.829  -41.282 1.00 0.00 ? 133 TYR B CZ   1 
ATOM 3918  O OH   . TYR B 1 133 ? 153.885 85.617  -40.099 1.00 0.00 ? 133 TYR B OH   1 
ATOM 3919  H H    . TYR B 1 133 ? 154.627 87.851  -45.749 1.00 0.00 ? 133 TYR B H    1 
ATOM 3920  H HA   . TYR B 1 133 ? 157.166 88.513  -44.474 1.00 0.00 ? 133 TYR B HA   1 
ATOM 3921  H HB2  . TYR B 1 133 ? 156.192 85.960  -45.783 1.00 0.00 ? 133 TYR B HB2  1 
ATOM 3922  H HB3  . TYR B 1 133 ? 157.698 86.137  -44.879 1.00 0.00 ? 133 TYR B HB3  1 
ATOM 3923  H HD1  . TYR B 1 133 ? 157.536 87.006  -42.447 1.00 0.00 ? 133 TYR B HD1  1 
ATOM 3924  H HD2  . TYR B 1 133 ? 154.181 85.462  -44.644 1.00 0.00 ? 133 TYR B HD2  1 
ATOM 3925  H HE1  . TYR B 1 133 ? 156.319 86.625  -40.322 1.00 0.00 ? 133 TYR B HE1  1 
ATOM 3926  H HE2  . TYR B 1 133 ? 152.965 85.082  -42.518 1.00 0.00 ? 133 TYR B HE2  1 
ATOM 3927  H HH   . TYR B 1 133 ? 153.086 86.147  -40.116 1.00 0.00 ? 133 TYR B HH   1 
ATOM 3928  N N    . GLN B 1 134 ? 158.743 88.675  -46.401 1.00 0.00 ? 134 GLN B N    1 
ATOM 3929  C CA   . GLN B 1 134 ? 159.606 88.941  -47.546 1.00 0.00 ? 134 GLN B CA   1 
ATOM 3930  C C    . GLN B 1 134 ? 159.946 87.645  -48.275 1.00 0.00 ? 134 GLN B C    1 
ATOM 3931  O O    . GLN B 1 134 ? 160.262 87.656  -49.464 1.00 0.00 ? 134 GLN B O    1 
ATOM 3932  C CB   . GLN B 1 134 ? 160.895 89.629  -47.084 1.00 0.00 ? 134 GLN B CB   1 
ATOM 3933  C CG   . GLN B 1 134 ? 161.663 88.707  -46.131 1.00 0.00 ? 134 GLN B CG   1 
ATOM 3934  C CD   . GLN B 1 134 ? 162.888 89.432  -45.582 1.00 0.00 ? 134 GLN B CD   1 
ATOM 3935  O OE1  . GLN B 1 134 ? 163.753 89.858  -46.347 1.00 0.00 ? 134 GLN B OE1  1 
ATOM 3936  N NE2  . GLN B 1 134 ? 163.013 89.600  -44.293 1.00 0.00 ? 134 GLN B NE2  1 
ATOM 3937  H H    . GLN B 1 134 ? 159.085 88.824  -45.494 1.00 0.00 ? 134 GLN B H    1 
ATOM 3938  H HA   . GLN B 1 134 ? 159.088 89.599  -48.227 1.00 0.00 ? 134 GLN B HA   1 
ATOM 3939  H HB2  . GLN B 1 134 ? 161.511 89.849  -47.944 1.00 0.00 ? 134 GLN B HB2  1 
ATOM 3940  H HB3  . GLN B 1 134 ? 160.651 90.546  -46.573 1.00 0.00 ? 134 GLN B HB3  1 
ATOM 3941  H HG2  . GLN B 1 134 ? 161.020 88.420  -45.314 1.00 0.00 ? 134 GLN B HG2  1 
ATOM 3942  H HG3  . GLN B 1 134 ? 161.983 87.824  -46.663 1.00 0.00 ? 134 GLN B HG3  1 
ATOM 3943  H HE21 . GLN B 1 134 ? 162.322 89.260  -43.687 1.00 0.00 ? 134 GLN B HE21 1 
ATOM 3944  H HE22 . GLN B 1 134 ? 163.796 90.065  -43.934 1.00 0.00 ? 134 GLN B HE22 1 
ATOM 3945  N N    . ASP B 1 135 ? 159.880 86.532  -47.553 1.00 0.00 ? 135 ASP B N    1 
ATOM 3946  C CA   . ASP B 1 135 ? 160.186 85.233  -48.142 1.00 0.00 ? 135 ASP B CA   1 
ATOM 3947  C C    . ASP B 1 135 ? 159.221 84.921  -49.282 1.00 0.00 ? 135 ASP B C    1 
ATOM 3948  O O    . ASP B 1 135 ? 158.022 85.181  -49.183 1.00 0.00 ? 135 ASP B O    1 
ATOM 3949  C CB   . ASP B 1 135 ? 160.087 84.142  -47.072 1.00 0.00 ? 135 ASP B CB   1 
ATOM 3950  C CG   . ASP B 1 135 ? 161.251 84.267  -46.095 1.00 0.00 ? 135 ASP B CG   1 
ATOM 3951  O OD1  . ASP B 1 135 ? 162.186 84.987  -46.407 1.00 0.00 ? 135 ASP B OD1  1 
ATOM 3952  O OD2  . ASP B 1 135 ? 161.190 83.642  -45.049 1.00 0.00 ? 135 ASP B OD2  1 
ATOM 3953  H H    . ASP B 1 135 ? 159.623 86.584  -46.608 1.00 0.00 ? 135 ASP B H    1 
ATOM 3954  H HA   . ASP B 1 135 ? 161.192 85.252  -48.528 1.00 0.00 ? 135 ASP B HA   1 
ATOM 3955  H HB2  . ASP B 1 135 ? 159.155 84.250  -46.536 1.00 0.00 ? 135 ASP B HB2  1 
ATOM 3956  H HB3  . ASP B 1 135 ? 160.120 83.173  -47.545 1.00 0.00 ? 135 ASP B HB3  1 
ATOM 3957  N N    . TYR B 1 136 ? 159.757 84.357  -50.371 1.00 0.00 ? 136 TYR B N    1 
ATOM 3958  C CA   . TYR B 1 136 ? 158.941 84.004  -51.544 1.00 0.00 ? 136 TYR B CA   1 
ATOM 3959  C C    . TYR B 1 136 ? 158.725 82.497  -51.610 1.00 0.00 ? 136 TYR B C    1 
ATOM 3960  O O    . TYR B 1 136 ? 157.890 82.013  -52.375 1.00 0.00 ? 136 TYR B O    1 
ATOM 3961  C CB   . TYR B 1 136 ? 159.645 84.466  -52.821 1.00 0.00 ? 136 TYR B CB   1 
ATOM 3962  C CG   . TYR B 1 136 ? 159.798 85.966  -52.797 1.00 0.00 ? 136 TYR B CG   1 
ATOM 3963  C CD1  . TYR B 1 136 ? 158.776 86.783  -53.293 1.00 0.00 ? 136 TYR B CD1  1 
ATOM 3964  C CD2  . TYR B 1 136 ? 160.965 86.542  -52.281 1.00 0.00 ? 136 TYR B CD2  1 
ATOM 3965  C CE1  . TYR B 1 136 ? 158.919 88.175  -53.272 1.00 0.00 ? 136 TYR B CE1  1 
ATOM 3966  C CE2  . TYR B 1 136 ? 161.109 87.933  -52.259 1.00 0.00 ? 136 TYR B CE2  1 
ATOM 3967  C CZ   . TYR B 1 136 ? 160.086 88.750  -52.755 1.00 0.00 ? 136 TYR B CZ   1 
ATOM 3968  O OH   . TYR B 1 136 ? 160.228 90.122  -52.735 1.00 0.00 ? 136 TYR B OH   1 
ATOM 3969  H H    . TYR B 1 136 ? 160.720 84.176  -50.389 1.00 0.00 ? 136 TYR B H    1 
ATOM 3970  H HA   . TYR B 1 136 ? 157.976 84.495  -51.482 1.00 0.00 ? 136 TYR B HA   1 
ATOM 3971  H HB2  . TYR B 1 136 ? 160.620 84.006  -52.880 1.00 0.00 ? 136 TYR B HB2  1 
ATOM 3972  H HB3  . TYR B 1 136 ? 159.058 84.179  -53.680 1.00 0.00 ? 136 TYR B HB3  1 
ATOM 3973  H HD1  . TYR B 1 136 ? 157.876 86.339  -53.692 1.00 0.00 ? 136 TYR B HD1  1 
ATOM 3974  H HD2  . TYR B 1 136 ? 161.754 85.911  -51.898 1.00 0.00 ? 136 TYR B HD2  1 
ATOM 3975  H HE1  . TYR B 1 136 ? 158.130 88.805  -53.655 1.00 0.00 ? 136 TYR B HE1  1 
ATOM 3976  H HE2  . TYR B 1 136 ? 162.009 88.377  -51.860 1.00 0.00 ? 136 TYR B HE2  1 
ATOM 3977  H HH   . TYR B 1 136 ? 160.256 90.405  -51.818 1.00 0.00 ? 136 TYR B HH   1 
ATOM 3978  N N    . GLU B 1 137 ? 159.481 81.759  -50.803 1.00 0.00 ? 137 GLU B N    1 
ATOM 3979  C CA   . GLU B 1 137 ? 159.361 80.304  -50.779 1.00 0.00 ? 137 GLU B CA   1 
ATOM 3980  C C    . GLU B 1 137 ? 159.291 79.742  -52.200 1.00 0.00 ? 137 GLU B C    1 
ATOM 3981  O O    . GLU B 1 137 ? 158.242 79.270  -52.639 1.00 0.00 ? 137 GLU B O    1 
ATOM 3982  C CB   . GLU B 1 137 ? 158.106 79.902  -50.006 1.00 0.00 ? 137 GLU B CB   1 
ATOM 3983  C CG   . GLU B 1 137 ? 158.159 78.408  -49.682 1.00 0.00 ? 137 GLU B CG   1 
ATOM 3984  C CD   . GLU B 1 137 ? 159.214 78.143  -48.613 1.00 0.00 ? 137 GLU B CD   1 
ATOM 3985  O OE1  . GLU B 1 137 ? 159.636 79.095  -47.976 1.00 0.00 ? 137 GLU B OE1  1 
ATOM 3986  O OE2  . GLU B 1 137 ? 159.585 76.993  -48.446 1.00 0.00 ? 137 GLU B OE2  1 
ATOM 3987  H H    . GLU B 1 137 ? 160.130 82.198  -50.215 1.00 0.00 ? 137 GLU B H    1 
ATOM 3988  H HA   . GLU B 1 137 ? 160.225 79.890  -50.281 1.00 0.00 ? 137 GLU B HA   1 
ATOM 3989  H HB2  . GLU B 1 137 ? 158.052 80.469  -49.087 1.00 0.00 ? 137 GLU B HB2  1 
ATOM 3990  H HB3  . GLU B 1 137 ? 157.232 80.107  -50.607 1.00 0.00 ? 137 GLU B HB3  1 
ATOM 3991  H HG2  . GLU B 1 137 ? 157.194 78.085  -49.321 1.00 0.00 ? 137 GLU B HG2  1 
ATOM 3992  H HG3  . GLU B 1 137 ? 158.411 77.857  -50.576 1.00 0.00 ? 137 GLU B HG3  1 
ATOM 3993  N N    . PRO B 1 138 ? 160.383 79.791  -52.921 1.00 0.00 ? 138 PRO B N    1 
ATOM 3994  C CA   . PRO B 1 138 ? 160.453 79.281  -54.331 1.00 0.00 ? 138 PRO B CA   1 
ATOM 3995  C C    . PRO B 1 138 ? 160.051 77.805  -54.433 1.00 0.00 ? 138 PRO B C    1 
ATOM 3996  O O    . PRO B 1 138 ? 160.351 77.008  -53.545 1.00 0.00 ? 138 PRO B O    1 
ATOM 3997  C CB   . PRO B 1 138 ? 161.936 79.492  -54.714 1.00 0.00 ? 138 PRO B CB   1 
ATOM 3998  C CG   . PRO B 1 138 ? 162.411 80.574  -53.796 1.00 0.00 ? 138 PRO B CG   1 
ATOM 3999  C CD   . PRO B 1 138 ? 161.678 80.338  -52.482 1.00 0.00 ? 138 PRO B CD   1 
ATOM 4000  H HA   . PRO B 1 138 ? 159.826 79.880  -54.972 1.00 0.00 ? 138 PRO B HA   1 
ATOM 4001  H HB2  . PRO B 1 138 ? 162.506 78.581  -54.552 1.00 0.00 ? 138 PRO B HB2  1 
ATOM 4002  H HB3  . PRO B 1 138 ? 162.024 79.811  -55.743 1.00 0.00 ? 138 PRO B HB3  1 
ATOM 4003  H HG2  . PRO B 1 138 ? 163.483 80.501  -53.652 1.00 0.00 ? 138 PRO B HG2  1 
ATOM 4004  H HG3  . PRO B 1 138 ? 162.150 81.544  -54.190 1.00 0.00 ? 138 PRO B HG3  1 
ATOM 4005  H HD2  . PRO B 1 138 ? 162.213 79.621  -51.872 1.00 0.00 ? 138 PRO B HD2  1 
ATOM 4006  H HD3  . PRO B 1 138 ? 161.534 81.265  -51.951 1.00 0.00 ? 138 PRO B HD3  1 
ATOM 4007  N N    . GLU B 1 139 ? 159.373 77.456  -55.522 1.00 0.00 ? 139 GLU B N    1 
ATOM 4008  C CA   . GLU B 1 139 ? 158.938 76.080  -55.729 1.00 0.00 ? 139 GLU B CA   1 
ATOM 4009  C C    . GLU B 1 139 ? 160.145 75.152  -55.845 1.00 0.00 ? 139 GLU B C    1 
ATOM 4010  O O    . GLU B 1 139 ? 160.132 74.034  -55.329 1.00 0.00 ? 139 GLU B O    1 
ATOM 4011  C CB   . GLU B 1 139 ? 158.096 75.984  -57.004 1.00 0.00 ? 139 GLU B CB   1 
ATOM 4012  C CG   . GLU B 1 139 ? 156.798 76.776  -56.824 1.00 0.00 ? 139 GLU B CG   1 
ATOM 4013  C CD   . GLU B 1 139 ? 155.910 76.102  -55.784 1.00 0.00 ? 139 GLU B CD   1 
ATOM 4014  O OE1  . GLU B 1 139 ? 156.128 74.931  -55.518 1.00 0.00 ? 139 GLU B OE1  1 
ATOM 4015  O OE2  . GLU B 1 139 ? 155.026 76.766  -55.269 1.00 0.00 ? 139 GLU B OE2  1 
ATOM 4016  H H    . GLU B 1 139 ? 159.163 78.134  -56.196 1.00 0.00 ? 139 GLU B H    1 
ATOM 4017  H HA   . GLU B 1 139 ? 158.338 75.771  -54.888 1.00 0.00 ? 139 GLU B HA   1 
ATOM 4018  H HB2  . GLU B 1 139 ? 158.655 76.390  -57.835 1.00 0.00 ? 139 GLU B HB2  1 
ATOM 4019  H HB3  . GLU B 1 139 ? 157.859 74.951  -57.201 1.00 0.00 ? 139 GLU B HB3  1 
ATOM 4020  H HG2  . GLU B 1 139 ? 157.033 77.779  -56.498 1.00 0.00 ? 139 GLU B HG2  1 
ATOM 4021  H HG3  . GLU B 1 139 ? 156.273 76.820  -57.766 1.00 0.00 ? 139 GLU B HG3  1 
ATOM 4022  N N    . ALA B 1 140 ? 161.185 75.625  -56.523 1.00 0.00 ? 140 ALA B N    1 
ATOM 4023  C CA   . ALA B 1 140 ? 162.397 74.832  -56.701 1.00 0.00 ? 140 ALA B CA   1 
ATOM 4024  C C    . ALA B 1 140 ? 163.548 75.716  -57.171 1.00 0.00 ? 140 ALA B C    1 
ATOM 4025  O O    . ALA B 1 140 ? 163.659 76.825  -56.675 1.00 0.00 ? 140 ALA B O    1 
ATOM 4026  C CB   . ALA B 1 140 ? 162.152 73.722  -57.724 1.00 0.00 ? 140 ALA B CB   1 
ATOM 4027  O OXT  . ALA B 1 140 ? 164.302 75.270  -58.020 1.00 0.00 ? 140 ALA B OXT  1 
ATOM 4028  H H    . ALA B 1 140 ? 161.137 76.524  -56.910 1.00 0.00 ? 140 ALA B H    1 
ATOM 4029  H HA   . ALA B 1 140 ? 162.663 74.383  -55.757 1.00 0.00 ? 140 ALA B HA   1 
ATOM 4030  H HB1  . ALA B 1 140 ? 161.303 73.130  -57.418 1.00 0.00 ? 140 ALA B HB1  1 
ATOM 4031  H HB2  . ALA B 1 140 ? 163.027 73.091  -57.786 1.00 0.00 ? 140 ALA B HB2  1 
ATOM 4032  H HB3  . ALA B 1 140 ? 161.956 74.160  -58.692 1.00 0.00 ? 140 ALA B HB3  1 
ATOM 4033  N N    . MET C 1 1   ? 99.911  160.115 -14.102 1.00 0.00 ? 1   MET C N    1 
ATOM 4034  C CA   . MET C 1 1   ? 98.787  160.627 -13.268 1.00 0.00 ? 1   MET C CA   1 
ATOM 4035  C C    . MET C 1 1   ? 98.535  162.093 -13.605 1.00 0.00 ? 1   MET C C    1 
ATOM 4036  O O    . MET C 1 1   ? 97.449  162.457 -14.056 1.00 0.00 ? 1   MET C O    1 
ATOM 4037  C CB   . MET C 1 1   ? 99.145  160.482 -11.783 1.00 0.00 ? 1   MET C CB   1 
ATOM 4038  C CG   . MET C 1 1   ? 99.795  159.117 -11.544 1.00 0.00 ? 1   MET C CG   1 
ATOM 4039  S SD   . MET C 1 1   ? 98.671  157.810 -12.093 1.00 0.00 ? 1   MET C SD   1 
ATOM 4040  C CE   . MET C 1 1   ? 99.862  156.448 -12.035 1.00 0.00 ? 1   MET C CE   1 
ATOM 4041  H H1   . MET C 1 1   ? 99.794  160.441 -15.080 1.00 0.00 ? 1   MET C H1   1 
ATOM 4042  H H2   . MET C 1 1   ? 99.911  159.074 -14.080 1.00 0.00 ? 1   MET C H2   1 
ATOM 4043  H H3   . MET C 1 1   ? 100.812 160.470 -13.726 1.00 0.00 ? 1   MET C H3   1 
ATOM 4044  H HA   . MET C 1 1   ? 97.896  160.054 -13.478 1.00 0.00 ? 1   MET C HA   1 
ATOM 4045  H HB2  . MET C 1 1   ? 99.836  161.265 -11.501 1.00 0.00 ? 1   MET C HB2  1 
ATOM 4046  H HB3  . MET C 1 1   ? 98.248  160.561 -11.188 1.00 0.00 ? 1   MET C HB3  1 
ATOM 4047  H HG2  . MET C 1 1   ? 100.720 159.054 -12.098 1.00 0.00 ? 1   MET C HG2  1 
ATOM 4048  H HG3  . MET C 1 1   ? 100.000 158.996 -10.490 1.00 0.00 ? 1   MET C HG3  1 
ATOM 4049  H HE1  . MET C 1 1   ? 99.338  155.508 -12.149 1.00 0.00 ? 1   MET C HE1  1 
ATOM 4050  H HE2  . MET C 1 1   ? 100.376 156.458 -11.088 1.00 0.00 ? 1   MET C HE2  1 
ATOM 4051  H HE3  . MET C 1 1   ? 100.580 156.566 -12.834 1.00 0.00 ? 1   MET C HE3  1 
ATOM 4052  N N    . ASP C 1 2   ? 99.546  162.928 -13.388 1.00 0.00 ? 2   ASP C N    1 
ATOM 4053  C CA   . ASP C 1 2   ? 99.421  164.351 -13.677 1.00 0.00 ? 2   ASP C CA   1 
ATOM 4054  C C    . ASP C 1 2   ? 98.202  164.935 -12.970 1.00 0.00 ? 2   ASP C C    1 
ATOM 4055  O O    . ASP C 1 2   ? 97.471  165.745 -13.541 1.00 0.00 ? 2   ASP C O    1 
ATOM 4056  C CB   . ASP C 1 2   ? 99.288  164.567 -15.185 1.00 0.00 ? 2   ASP C CB   1 
ATOM 4057  C CG   . ASP C 1 2   ? 100.592 164.195 -15.882 1.00 0.00 ? 2   ASP C CG   1 
ATOM 4058  O OD1  . ASP C 1 2   ? 101.600 164.108 -15.202 1.00 0.00 ? 2   ASP C OD1  1 
ATOM 4059  O OD2  . ASP C 1 2   ? 100.562 164.000 -17.086 1.00 0.00 ? 2   ASP C OD2  1 
ATOM 4060  H H    . ASP C 1 2   ? 100.389 162.581 -13.029 1.00 0.00 ? 2   ASP C H    1 
ATOM 4061  H HA   . ASP C 1 2   ? 100.307 164.860 -13.328 1.00 0.00 ? 2   ASP C HA   1 
ATOM 4062  H HB2  . ASP C 1 2   ? 98.488  163.948 -15.565 1.00 0.00 ? 2   ASP C HB2  1 
ATOM 4063  H HB3  . ASP C 1 2   ? 99.062  165.605 -15.380 1.00 0.00 ? 2   ASP C HB3  1 
ATOM 4064  N N    . VAL C 1 3   ? 97.985  164.515 -11.727 1.00 0.00 ? 3   VAL C N    1 
ATOM 4065  C CA   . VAL C 1 3   ? 96.846  165.002 -10.955 1.00 0.00 ? 3   VAL C CA   1 
ATOM 4066  C C    . VAL C 1 3   ? 95.546  164.743 -11.709 1.00 0.00 ? 3   VAL C C    1 
ATOM 4067  O O    . VAL C 1 3   ? 95.555  164.493 -12.914 1.00 0.00 ? 3   VAL C O    1 
ATOM 4068  C CB   . VAL C 1 3   ? 96.997  166.503 -10.690 1.00 0.00 ? 3   VAL C CB   1 
ATOM 4069  C CG1  . VAL C 1 3   ? 95.844  166.990 -9.805  1.00 0.00 ? 3   VAL C CG1  1 
ATOM 4070  C CG2  . VAL C 1 3   ? 98.330  166.759 -9.982  1.00 0.00 ? 3   VAL C CG2  1 
ATOM 4071  H H    . VAL C 1 3   ? 98.598  163.866 -11.323 1.00 0.00 ? 3   VAL C H    1 
ATOM 4072  H HA   . VAL C 1 3   ? 96.814  164.482 -10.010 1.00 0.00 ? 3   VAL C HA   1 
ATOM 4073  H HB   . VAL C 1 3   ? 96.978  167.037 -11.629 1.00 0.00 ? 3   VAL C HB   1 
ATOM 4074  H HG11 . VAL C 1 3   ? 96.092  167.956 -9.389  1.00 0.00 ? 3   VAL C HG11 1 
ATOM 4075  H HG12 . VAL C 1 3   ? 95.681  166.284 -9.004  1.00 0.00 ? 3   VAL C HG12 1 
ATOM 4076  H HG13 . VAL C 1 3   ? 94.946  167.075 -10.399 1.00 0.00 ? 3   VAL C HG13 1 
ATOM 4077  H HG21 . VAL C 1 3   ? 99.141  166.401 -10.600 1.00 0.00 ? 3   VAL C HG21 1 
ATOM 4078  H HG22 . VAL C 1 3   ? 98.342  166.238 -9.036  1.00 0.00 ? 3   VAL C HG22 1 
ATOM 4079  H HG23 . VAL C 1 3   ? 98.448  167.819 -9.810  1.00 0.00 ? 3   VAL C HG23 1 
ATOM 4080  N N    . PHE C 1 4   ? 94.423  164.801 -10.986 1.00 0.00 ? 4   PHE C N    1 
ATOM 4081  C CA   . PHE C 1 4   ? 93.101  164.569 -11.587 1.00 0.00 ? 4   PHE C CA   1 
ATOM 4082  C C    . PHE C 1 4   ? 92.318  165.878 -11.661 1.00 0.00 ? 4   PHE C C    1 
ATOM 4083  O O    . PHE C 1 4   ? 92.478  166.757 -10.811 1.00 0.00 ? 4   PHE C O    1 
ATOM 4084  C CB   . PHE C 1 4   ? 92.323  163.555 -10.747 1.00 0.00 ? 4   PHE C CB   1 
ATOM 4085  C CG   . PHE C 1 4   ? 93.110  162.264 -10.668 1.00 0.00 ? 4   PHE C CG   1 
ATOM 4086  C CD1  . PHE C 1 4   ? 93.262  161.467 -11.809 1.00 0.00 ? 4   PHE C CD1  1 
ATOM 4087  C CD2  . PHE C 1 4   ? 93.691  161.868 -9.455  1.00 0.00 ? 4   PHE C CD2  1 
ATOM 4088  C CE1  . PHE C 1 4   ? 93.995  160.274 -11.738 1.00 0.00 ? 4   PHE C CE1  1 
ATOM 4089  C CE2  . PHE C 1 4   ? 94.423  160.677 -9.385  1.00 0.00 ? 4   PHE C CE2  1 
ATOM 4090  C CZ   . PHE C 1 4   ? 94.574  159.880 -10.525 1.00 0.00 ? 4   PHE C CZ   1 
ATOM 4091  H H    . PHE C 1 4   ? 94.482  165.002 -10.029 1.00 0.00 ? 4   PHE C H    1 
ATOM 4092  H HA   . PHE C 1 4   ? 93.216  164.173 -12.591 1.00 0.00 ? 4   PHE C HA   1 
ATOM 4093  H HB2  . PHE C 1 4   ? 92.170  163.954 -9.754  1.00 0.00 ? 4   PHE C HB2  1 
ATOM 4094  H HB3  . PHE C 1 4   ? 91.366  163.364 -11.210 1.00 0.00 ? 4   PHE C HB3  1 
ATOM 4095  H HD1  . PHE C 1 4   ? 92.817  161.771 -12.744 1.00 0.00 ? 4   PHE C HD1  1 
ATOM 4096  H HD2  . PHE C 1 4   ? 93.573  162.481 -8.574  1.00 0.00 ? 4   PHE C HD2  1 
ATOM 4097  H HE1  . PHE C 1 4   ? 94.113  159.660 -12.618 1.00 0.00 ? 4   PHE C HE1  1 
ATOM 4098  H HE2  . PHE C 1 4   ? 94.870  160.373 -8.450  1.00 0.00 ? 4   PHE C HE2  1 
ATOM 4099  H HZ   . PHE C 1 4   ? 95.140  158.962 -10.471 1.00 0.00 ? 4   PHE C HZ   1 
ATOM 4100  N N    . MET C 1 5   ? 91.479  166.000 -12.683 1.00 0.00 ? 5   MET C N    1 
ATOM 4101  C CA   . MET C 1 5   ? 90.681  167.209 -12.870 1.00 0.00 ? 5   MET C CA   1 
ATOM 4102  C C    . MET C 1 5   ? 89.683  167.364 -11.731 1.00 0.00 ? 5   MET C C    1 
ATOM 4103  O O    . MET C 1 5   ? 89.009  168.387 -11.617 1.00 0.00 ? 5   MET C O    1 
ATOM 4104  C CB   . MET C 1 5   ? 89.937  167.142 -14.206 1.00 0.00 ? 5   MET C CB   1 
ATOM 4105  C CG   . MET C 1 5   ? 90.927  167.359 -15.353 1.00 0.00 ? 5   MET C CG   1 
ATOM 4106  S SD   . MET C 1 5   ? 92.129  166.001 -15.379 1.00 0.00 ? 5   MET C SD   1 
ATOM 4107  C CE   . MET C 1 5   ? 90.983  164.663 -15.803 1.00 0.00 ? 5   MET C CE   1 
ATOM 4108  H H    . MET C 1 5   ? 91.398  165.267 -13.328 1.00 0.00 ? 5   MET C H    1 
ATOM 4109  H HA   . MET C 1 5   ? 91.339  168.064 -12.877 1.00 0.00 ? 5   MET C HA   1 
ATOM 4110  H HB2  . MET C 1 5   ? 89.467  166.174 -14.310 1.00 0.00 ? 5   MET C HB2  1 
ATOM 4111  H HB3  . MET C 1 5   ? 89.182  167.913 -14.236 1.00 0.00 ? 5   MET C HB3  1 
ATOM 4112  H HG2  . MET C 1 5   ? 90.393  167.388 -16.291 1.00 0.00 ? 5   MET C HG2  1 
ATOM 4113  H HG3  . MET C 1 5   ? 91.445  168.295 -15.208 1.00 0.00 ? 5   MET C HG3  1 
ATOM 4114  H HE1  . MET C 1 5   ? 90.609  164.208 -14.894 1.00 0.00 ? 5   MET C HE1  1 
ATOM 4115  H HE2  . MET C 1 5   ? 91.497  163.919 -16.388 1.00 0.00 ? 5   MET C HE2  1 
ATOM 4116  H HE3  . MET C 1 5   ? 90.158  165.062 -16.377 1.00 0.00 ? 5   MET C HE3  1 
ATOM 4117  N N    . LYS C 1 6   ? 89.599  166.344 -10.891 1.00 0.00 ? 6   LYS C N    1 
ATOM 4118  C CA   . LYS C 1 6   ? 88.684  166.371 -9.759  1.00 0.00 ? 6   LYS C CA   1 
ATOM 4119  C C    . LYS C 1 6   ? 89.012  167.548 -8.842  1.00 0.00 ? 6   LYS C C    1 
ATOM 4120  O O    . LYS C 1 6   ? 88.114  168.187 -8.291  1.00 0.00 ? 6   LYS C O    1 
ATOM 4121  C CB   . LYS C 1 6   ? 88.794  165.063 -8.972  1.00 0.00 ? 6   LYS C CB   1 
ATOM 4122  C CG   . LYS C 1 6   ? 88.221  163.914 -9.806  1.00 0.00 ? 6   LYS C CG   1 
ATOM 4123  C CD   . LYS C 1 6   ? 88.302  162.609 -9.009  1.00 0.00 ? 6   LYS C CD   1 
ATOM 4124  C CE   . LYS C 1 6   ? 87.688  161.473 -9.829  1.00 0.00 ? 6   LYS C CE   1 
ATOM 4125  N NZ   . LYS C 1 6   ? 88.492  161.263 -11.066 1.00 0.00 ? 6   LYS C NZ   1 
ATOM 4126  H H    . LYS C 1 6   ? 90.164  165.555 -11.033 1.00 0.00 ? 6   LYS C H    1 
ATOM 4127  H HA   . LYS C 1 6   ? 87.673  166.478 -10.124 1.00 0.00 ? 6   LYS C HA   1 
ATOM 4128  H HB2  . LYS C 1 6   ? 89.832  164.863 -8.749  1.00 0.00 ? 6   LYS C HB2  1 
ATOM 4129  H HB3  . LYS C 1 6   ? 88.237  165.148 -8.051  1.00 0.00 ? 6   LYS C HB3  1 
ATOM 4130  H HG2  . LYS C 1 6   ? 87.189  164.124 -10.049 1.00 0.00 ? 6   LYS C HG2  1 
ATOM 4131  H HG3  . LYS C 1 6   ? 88.791  163.812 -10.717 1.00 0.00 ? 6   LYS C HG3  1 
ATOM 4132  H HD2  . LYS C 1 6   ? 89.337  162.381 -8.794  1.00 0.00 ? 6   LYS C HD2  1 
ATOM 4133  H HD3  . LYS C 1 6   ? 87.758  162.717 -8.084  1.00 0.00 ? 6   LYS C HD3  1 
ATOM 4134  H HE2  . LYS C 1 6   ? 87.684  160.566 -9.244  1.00 0.00 ? 6   LYS C HE2  1 
ATOM 4135  H HE3  . LYS C 1 6   ? 86.675  161.732 -10.100 1.00 0.00 ? 6   LYS C HE3  1 
ATOM 4136  H HZ1  . LYS C 1 6   ? 88.432  160.266 -11.355 1.00 0.00 ? 6   LYS C HZ1  1 
ATOM 4137  H HZ2  . LYS C 1 6   ? 89.486  161.511 -10.878 1.00 0.00 ? 6   LYS C HZ2  1 
ATOM 4138  H HZ3  . LYS C 1 6   ? 88.123  161.865 -11.828 1.00 0.00 ? 6   LYS C HZ3  1 
ATOM 4139  N N    . GLY C 1 7   ? 90.312  167.830 -8.680  1.00 0.00 ? 7   GLY C N    1 
ATOM 4140  C CA   . GLY C 1 7   ? 90.767  168.940 -7.821  1.00 0.00 ? 7   GLY C CA   1 
ATOM 4141  C C    . GLY C 1 7   ? 91.541  168.407 -6.619  1.00 0.00 ? 7   GLY C C    1 
ATOM 4142  O O    . GLY C 1 7   ? 91.726  167.199 -6.476  1.00 0.00 ? 7   GLY C O    1 
ATOM 4143  H H    . GLY C 1 7   ? 90.980  167.283 -9.150  1.00 0.00 ? 7   GLY C H    1 
ATOM 4144  H HA2  . GLY C 1 7   ? 91.413  169.586 -8.398  1.00 0.00 ? 7   GLY C HA2  1 
ATOM 4145  H HA3  . GLY C 1 7   ? 89.919  169.512 -7.469  1.00 0.00 ? 7   GLY C HA3  1 
ATOM 4146  N N    . LEU C 1 8   ? 91.996  169.316 -5.757  1.00 0.00 ? 8   LEU C N    1 
ATOM 4147  C CA   . LEU C 1 8   ? 92.757  168.921 -4.568  1.00 0.00 ? 8   LEU C CA   1 
ATOM 4148  C C    . LEU C 1 8   ? 91.812  168.546 -3.428  1.00 0.00 ? 8   LEU C C    1 
ATOM 4149  O O    . LEU C 1 8   ? 90.974  169.347 -3.014  1.00 0.00 ? 8   LEU C O    1 
ATOM 4150  C CB   . LEU C 1 8   ? 93.678  170.076 -4.131  1.00 0.00 ? 8   LEU C CB   1 
ATOM 4151  C CG   . LEU C 1 8   ? 94.490  169.688 -2.877  1.00 0.00 ? 8   LEU C CG   1 
ATOM 4152  C CD1  . LEU C 1 8   ? 95.363  168.449 -3.163  1.00 0.00 ? 8   LEU C CD1  1 
ATOM 4153  C CD2  . LEU C 1 8   ? 95.388  170.871 -2.484  1.00 0.00 ? 8   LEU C CD2  1 
ATOM 4154  H H    . LEU C 1 8   ? 91.823  170.266 -5.922  1.00 0.00 ? 8   LEU C H    1 
ATOM 4155  H HA   . LEU C 1 8   ? 93.366  168.065 -4.815  1.00 0.00 ? 8   LEU C HA   1 
ATOM 4156  H HB2  . LEU C 1 8   ? 94.358  170.313 -4.936  1.00 0.00 ? 8   LEU C HB2  1 
ATOM 4157  H HB3  . LEU C 1 8   ? 93.075  170.945 -3.909  1.00 0.00 ? 8   LEU C HB3  1 
ATOM 4158  H HG   . LEU C 1 8   ? 93.815  169.469 -2.062  1.00 0.00 ? 8   LEU C HG   1 
ATOM 4159  H HD11 . LEU C 1 8   ? 96.194  168.417 -2.470  1.00 0.00 ? 8   LEU C HD11 1 
ATOM 4160  H HD12 . LEU C 1 8   ? 95.743  168.495 -4.174  1.00 0.00 ? 8   LEU C HD12 1 
ATOM 4161  H HD13 . LEU C 1 8   ? 94.769  167.553 -3.043  1.00 0.00 ? 8   LEU C HD13 1 
ATOM 4162  H HD21 . LEU C 1 8   ? 96.208  170.949 -3.182  1.00 0.00 ? 8   LEU C HD21 1 
ATOM 4163  H HD22 . LEU C 1 8   ? 95.778  170.712 -1.489  1.00 0.00 ? 8   LEU C HD22 1 
ATOM 4164  H HD23 . LEU C 1 8   ? 94.811  171.784 -2.502  1.00 0.00 ? 8   LEU C HD23 1 
ATOM 4165  N N    . SER C 1 9   ? 91.961  167.319 -2.919  1.00 0.00 ? 9   SER C N    1 
ATOM 4166  C CA   . SER C 1 9   ? 91.123  166.826 -1.815  1.00 0.00 ? 9   SER C CA   1 
ATOM 4167  C C    . SER C 1 9   ? 91.917  166.832 -0.510  1.00 0.00 ? 9   SER C C    1 
ATOM 4168  O O    . SER C 1 9   ? 93.080  166.430 -0.481  1.00 0.00 ? 9   SER C O    1 
ATOM 4169  C CB   . SER C 1 9   ? 90.654  165.404 -2.124  1.00 0.00 ? 9   SER C CB   1 
ATOM 4170  O OG   . SER C 1 9   ? 89.841  165.423 -3.290  1.00 0.00 ? 9   SER C OG   1 
ATOM 4171  H H    . SER C 1 9   ? 92.650  166.731 -3.293  1.00 0.00 ? 9   SER C H    1 
ATOM 4172  H HA   . SER C 1 9   ? 90.254  167.462 -1.701  1.00 0.00 ? 9   SER C HA   1 
ATOM 4173  H HB2  . SER C 1 9   ? 91.508  164.772 -2.297  1.00 0.00 ? 9   SER C HB2  1 
ATOM 4174  H HB3  . SER C 1 9   ? 90.090  165.020 -1.282  1.00 0.00 ? 9   SER C HB3  1 
ATOM 4175  H HG   . SER C 1 9   ? 90.343  165.837 -3.996  1.00 0.00 ? 9   SER C HG   1 
ATOM 4176  N N    . LYS C 1 10  ? 91.280  167.294 0.571   1.00 0.00 ? 10  LYS C N    1 
ATOM 4177  C CA   . LYS C 1 10  ? 91.936  167.356 1.890   1.00 0.00 ? 10  LYS C CA   1 
ATOM 4178  C C    . LYS C 1 10  ? 91.005  166.826 2.973   1.00 0.00 ? 10  LYS C C    1 
ATOM 4179  O O    . LYS C 1 10  ? 91.409  166.643 4.121   1.00 0.00 ? 10  LYS C O    1 
ATOM 4180  C CB   . LYS C 1 10  ? 92.315  168.806 2.214   1.00 0.00 ? 10  LYS C CB   1 
ATOM 4181  C CG   . LYS C 1 10  ? 91.119  169.728 1.925   1.00 0.00 ? 10  LYS C CG   1 
ATOM 4182  C CD   . LYS C 1 10  ? 91.316  171.087 2.619   1.00 0.00 ? 10  LYS C CD   1 
ATOM 4183  C CE   . LYS C 1 10  ? 92.473  171.851 1.970   1.00 0.00 ? 10  LYS C CE   1 
ATOM 4184  N NZ   . LYS C 1 10  ? 92.537  173.225 2.543   1.00 0.00 ? 10  LYS C NZ   1 
ATOM 4185  H H    . LYS C 1 10  ? 90.353  167.601 0.485   1.00 0.00 ? 10  LYS C H    1 
ATOM 4186  H HA   . LYS C 1 10  ? 92.837  166.754 1.881   1.00 0.00 ? 10  LYS C HA   1 
ATOM 4187  H HB2  . LYS C 1 10  ? 92.591  168.881 3.257   1.00 0.00 ? 10  LYS C HB2  1 
ATOM 4188  H HB3  . LYS C 1 10  ? 93.150  169.099 1.598   1.00 0.00 ? 10  LYS C HB3  1 
ATOM 4189  H HG2  . LYS C 1 10  ? 91.035  169.881 0.859   1.00 0.00 ? 10  LYS C HG2  1 
ATOM 4190  H HG3  . LYS C 1 10  ? 90.214  169.270 2.294   1.00 0.00 ? 10  LYS C HG3  1 
ATOM 4191  H HD2  . LYS C 1 10  ? 90.409  171.668 2.528   1.00 0.00 ? 10  LYS C HD2  1 
ATOM 4192  H HD3  . LYS C 1 10  ? 91.535  170.929 3.664   1.00 0.00 ? 10  LYS C HD3  1 
ATOM 4193  H HE2  . LYS C 1 10  ? 93.402  171.339 2.167   1.00 0.00 ? 10  LYS C HE2  1 
ATOM 4194  H HE3  . LYS C 1 10  ? 92.313  171.912 0.903   1.00 0.00 ? 10  LYS C HE3  1 
ATOM 4195  H HZ1  . LYS C 1 10  ? 92.759  173.168 3.557   1.00 0.00 ? 10  LYS C HZ1  1 
ATOM 4196  H HZ2  . LYS C 1 10  ? 91.619  173.698 2.413   1.00 0.00 ? 10  LYS C HZ2  1 
ATOM 4197  H HZ3  . LYS C 1 10  ? 93.279  173.769 2.059   1.00 0.00 ? 10  LYS C HZ3  1 
ATOM 4198  N N    . ALA C 1 11  ? 89.755  166.579 2.597   1.00 0.00 ? 11  ALA C N    1 
ATOM 4199  C CA   . ALA C 1 11  ? 88.763  166.067 3.539   1.00 0.00 ? 11  ALA C CA   1 
ATOM 4200  C C    . ALA C 1 11  ? 87.685  165.284 2.799   1.00 0.00 ? 11  ALA C C    1 
ATOM 4201  O O    . ALA C 1 11  ? 87.848  164.094 2.526   1.00 0.00 ? 11  ALA C O    1 
ATOM 4202  C CB   . ALA C 1 11  ? 88.121  167.228 4.301   1.00 0.00 ? 11  ALA C CB   1 
ATOM 4203  H H    . ALA C 1 11  ? 89.493  166.745 1.667   1.00 0.00 ? 11  ALA C H    1 
ATOM 4204  H HA   . ALA C 1 11  ? 89.247  165.409 4.247   1.00 0.00 ? 11  ALA C HA   1 
ATOM 4205  H HB1  . ALA C 1 11  ? 87.710  167.936 3.597   1.00 0.00 ? 11  ALA C HB1  1 
ATOM 4206  H HB2  . ALA C 1 11  ? 88.870  167.717 4.906   1.00 0.00 ? 11  ALA C HB2  1 
ATOM 4207  H HB3  . ALA C 1 11  ? 87.334  166.850 4.935   1.00 0.00 ? 11  ALA C HB3  1 
ATOM 4208  N N    . LYS C 1 12  ? 86.587  165.957 2.472   1.00 0.00 ? 12  LYS C N    1 
ATOM 4209  C CA   . LYS C 1 12  ? 85.493  165.308 1.761   1.00 0.00 ? 12  LYS C CA   1 
ATOM 4210  C C    . LYS C 1 12  ? 85.030  164.073 2.525   1.00 0.00 ? 12  LYS C C    1 
ATOM 4211  O O    . LYS C 1 12  ? 85.229  162.943 2.080   1.00 0.00 ? 12  LYS C O    1 
ATOM 4212  C CB   . LYS C 1 12  ? 85.942  164.899 0.354   1.00 0.00 ? 12  LYS C CB   1 
ATOM 4213  C CG   . LYS C 1 12  ? 86.692  166.056 -0.330  1.00 0.00 ? 12  LYS C CG   1 
ATOM 4214  C CD   . LYS C 1 12  ? 85.816  167.313 -0.379  1.00 0.00 ? 12  LYS C CD   1 
ATOM 4215  C CE   . LYS C 1 12  ? 86.467  168.348 -1.299  1.00 0.00 ? 12  LYS C CE   1 
ATOM 4216  N NZ   . LYS C 1 12  ? 85.670  169.607 -1.275  1.00 0.00 ? 12  LYS C NZ   1 
ATOM 4217  H H    . LYS C 1 12  ? 86.512  166.904 2.713   1.00 0.00 ? 12  LYS C H    1 
ATOM 4218  H HA   . LYS C 1 12  ? 84.664  165.992 1.681   1.00 0.00 ? 12  LYS C HA   1 
ATOM 4219  H HB2  . LYS C 1 12  ? 86.597  164.042 0.426   1.00 0.00 ? 12  LYS C HB2  1 
ATOM 4220  H HB3  . LYS C 1 12  ? 85.077  164.638 -0.235  1.00 0.00 ? 12  LYS C HB3  1 
ATOM 4221  H HG2  . LYS C 1 12  ? 87.594  166.272 0.222   1.00 0.00 ? 12  LYS C HG2  1 
ATOM 4222  H HG3  . LYS C 1 12  ? 86.952  165.764 -1.337  1.00 0.00 ? 12  LYS C HG3  1 
ATOM 4223  H HD2  . LYS C 1 12  ? 84.835  167.059 -0.755  1.00 0.00 ? 12  LYS C HD2  1 
ATOM 4224  H HD3  . LYS C 1 12  ? 85.727  167.733 0.610   1.00 0.00 ? 12  LYS C HD3  1 
ATOM 4225  H HE2  . LYS C 1 12  ? 87.472  168.551 -0.958  1.00 0.00 ? 12  LYS C HE2  1 
ATOM 4226  H HE3  . LYS C 1 12  ? 86.501  167.962 -2.307  1.00 0.00 ? 12  LYS C HE3  1 
ATOM 4227  H HZ1  . LYS C 1 12  ? 85.597  169.952 -0.298  1.00 0.00 ? 12  LYS C HZ1  1 
ATOM 4228  H HZ2  . LYS C 1 12  ? 84.717  169.420 -1.650  1.00 0.00 ? 12  LYS C HZ2  1 
ATOM 4229  H HZ3  . LYS C 1 12  ? 86.139  170.326 -1.860  1.00 0.00 ? 12  LYS C HZ3  1 
ATOM 4230  N N    . GLU C 1 13  ? 84.417  164.298 3.684   1.00 0.00 ? 13  GLU C N    1 
ATOM 4231  C CA   . GLU C 1 13  ? 83.936  163.195 4.506   1.00 0.00 ? 13  GLU C CA   1 
ATOM 4232  C C    . GLU C 1 13  ? 83.167  162.194 3.652   1.00 0.00 ? 13  GLU C C    1 
ATOM 4233  O O    . GLU C 1 13  ? 82.345  162.574 2.818   1.00 0.00 ? 13  GLU C O    1 
ATOM 4234  C CB   . GLU C 1 13  ? 83.027  163.733 5.616   1.00 0.00 ? 13  GLU C CB   1 
ATOM 4235  C CG   . GLU C 1 13  ? 82.612  162.588 6.542   1.00 0.00 ? 13  GLU C CG   1 
ATOM 4236  C CD   . GLU C 1 13  ? 81.759  163.128 7.685   1.00 0.00 ? 13  GLU C CD   1 
ATOM 4237  O OE1  . GLU C 1 13  ? 81.508  164.322 7.697   1.00 0.00 ? 13  GLU C OE1  1 
ATOM 4238  O OE2  . GLU C 1 13  ? 81.372  162.341 8.533   1.00 0.00 ? 13  GLU C OE2  1 
ATOM 4239  H H    . GLU C 1 13  ? 84.290  165.221 3.990   1.00 0.00 ? 13  GLU C H    1 
ATOM 4240  H HA   . GLU C 1 13  ? 84.781  162.699 4.956   1.00 0.00 ? 13  GLU C HA   1 
ATOM 4241  H HB2  . GLU C 1 13  ? 83.559  164.481 6.184   1.00 0.00 ? 13  GLU C HB2  1 
ATOM 4242  H HB3  . GLU C 1 13  ? 82.146  164.175 5.176   1.00 0.00 ? 13  GLU C HB3  1 
ATOM 4243  H HG2  . GLU C 1 13  ? 82.041  161.862 5.983   1.00 0.00 ? 13  GLU C HG2  1 
ATOM 4244  H HG3  . GLU C 1 13  ? 83.494  162.116 6.948   1.00 0.00 ? 13  GLU C HG3  1 
ATOM 4245  N N    . GLY C 1 14  ? 83.447  160.912 3.861   1.00 0.00 ? 14  GLY C N    1 
ATOM 4246  C CA   . GLY C 1 14  ? 82.785  159.861 3.100   1.00 0.00 ? 14  GLY C CA   1 
ATOM 4247  C C    . GLY C 1 14  ? 81.280  159.885 3.332   1.00 0.00 ? 14  GLY C C    1 
ATOM 4248  O O    . GLY C 1 14  ? 80.812  160.232 4.417   1.00 0.00 ? 14  GLY C O    1 
ATOM 4249  H H    . GLY C 1 14  ? 84.116  160.669 4.535   1.00 0.00 ? 14  GLY C H    1 
ATOM 4250  H HA2  . GLY C 1 14  ? 82.984  160.006 2.048   1.00 0.00 ? 14  GLY C HA2  1 
ATOM 4251  H HA3  . GLY C 1 14  ? 83.173  158.902 3.407   1.00 0.00 ? 14  GLY C HA3  1 
ATOM 4252  N N    . VAL C 1 15  ? 80.526  159.512 2.303   1.00 0.00 ? 15  VAL C N    1 
ATOM 4253  C CA   . VAL C 1 15  ? 79.069  159.493 2.397   1.00 0.00 ? 15  VAL C CA   1 
ATOM 4254  C C    . VAL C 1 15  ? 78.596  158.215 3.085   1.00 0.00 ? 15  VAL C C    1 
ATOM 4255  O O    . VAL C 1 15  ? 78.972  157.112 2.689   1.00 0.00 ? 15  VAL C O    1 
ATOM 4256  C CB   . VAL C 1 15  ? 78.461  159.575 0.996   1.00 0.00 ? 15  VAL C CB   1 
ATOM 4257  C CG1  . VAL C 1 15  ? 76.937  159.507 1.095   1.00 0.00 ? 15  VAL C CG1  1 
ATOM 4258  C CG2  . VAL C 1 15  ? 78.870  160.895 0.337   1.00 0.00 ? 15  VAL C CG2  1 
ATOM 4259  H H    . VAL C 1 15  ? 80.956  159.247 1.463   1.00 0.00 ? 15  VAL C H    1 
ATOM 4260  H HA   . VAL C 1 15  ? 78.739  160.346 2.971   1.00 0.00 ? 15  VAL C HA   1 
ATOM 4261  H HB   . VAL C 1 15  ? 78.818  158.747 0.400   1.00 0.00 ? 15  VAL C HB   1 
ATOM 4262  H HG11 . VAL C 1 15  ? 76.636  158.497 1.329   1.00 0.00 ? 15  VAL C HG11 1 
ATOM 4263  H HG12 . VAL C 1 15  ? 76.502  159.804 0.152   1.00 0.00 ? 15  VAL C HG12 1 
ATOM 4264  H HG13 . VAL C 1 15  ? 76.597  160.173 1.873   1.00 0.00 ? 15  VAL C HG13 1 
ATOM 4265  H HG21 . VAL C 1 15  ? 78.374  161.715 0.834   1.00 0.00 ? 15  VAL C HG21 1 
ATOM 4266  H HG22 . VAL C 1 15  ? 78.586  160.881 -0.705  1.00 0.00 ? 15  VAL C HG22 1 
ATOM 4267  H HG23 . VAL C 1 15  ? 79.941  161.020 0.417   1.00 0.00 ? 15  VAL C HG23 1 
ATOM 4268  N N    . VAL C 1 16  ? 77.769  158.372 4.123   1.00 0.00 ? 16  VAL C N    1 
ATOM 4269  C CA   . VAL C 1 16  ? 77.240  157.221 4.878   1.00 0.00 ? 16  VAL C CA   1 
ATOM 4270  C C    . VAL C 1 16  ? 75.742  157.068 4.633   1.00 0.00 ? 16  VAL C C    1 
ATOM 4271  O O    . VAL C 1 16  ? 74.984  158.034 4.729   1.00 0.00 ? 16  VAL C O    1 
ATOM 4272  C CB   . VAL C 1 16  ? 77.494  157.423 6.375   1.00 0.00 ? 16  VAL C CB   1 
ATOM 4273  C CG1  . VAL C 1 16  ? 76.683  158.622 6.878   1.00 0.00 ? 16  VAL C CG1  1 
ATOM 4274  C CG2  . VAL C 1 16  ? 77.074  156.164 7.138   1.00 0.00 ? 16  VAL C CG2  1 
ATOM 4275  H H    . VAL C 1 16  ? 77.507  159.277 4.393   1.00 0.00 ? 16  VAL C H    1 
ATOM 4276  H HA   . VAL C 1 16  ? 77.739  156.313 4.561   1.00 0.00 ? 16  VAL C HA   1 
ATOM 4277  H HB   . VAL C 1 16  ? 78.546  157.610 6.537   1.00 0.00 ? 16  VAL C HB   1 
ATOM 4278  H HG11 . VAL C 1 16  ? 76.773  159.438 6.177   1.00 0.00 ? 16  VAL C HG11 1 
ATOM 4279  H HG12 . VAL C 1 16  ? 77.059  158.932 7.842   1.00 0.00 ? 16  VAL C HG12 1 
ATOM 4280  H HG13 . VAL C 1 16  ? 75.643  158.341 6.971   1.00 0.00 ? 16  VAL C HG13 1 
ATOM 4281  H HG21 . VAL C 1 16  ? 77.631  155.316 6.769   1.00 0.00 ? 16  VAL C HG21 1 
ATOM 4282  H HG22 . VAL C 1 16  ? 76.018  155.991 6.996   1.00 0.00 ? 16  VAL C HG22 1 
ATOM 4283  H HG23 . VAL C 1 16  ? 77.279  156.296 8.191   1.00 0.00 ? 16  VAL C HG23 1 
ATOM 4284  N N    . ALA C 1 17  ? 75.322  155.844 4.308   1.00 0.00 ? 17  ALA C N    1 
ATOM 4285  C CA   . ALA C 1 17  ? 73.908  155.561 4.042   1.00 0.00 ? 17  ALA C CA   1 
ATOM 4286  C C    . ALA C 1 17  ? 73.193  155.135 5.321   1.00 0.00 ? 17  ALA C C    1 
ATOM 4287  O O    . ALA C 1 17  ? 73.763  154.438 6.160   1.00 0.00 ? 17  ALA C O    1 
ATOM 4288  C CB   . ALA C 1 17  ? 73.790  154.448 3.000   1.00 0.00 ? 17  ALA C CB   1 
ATOM 4289  H H    . ALA C 1 17  ? 75.975  155.117 4.244   1.00 0.00 ? 17  ALA C H    1 
ATOM 4290  H HA   . ALA C 1 17  ? 73.430  156.451 3.653   1.00 0.00 ? 17  ALA C HA   1 
ATOM 4291  H HB1  . ALA C 1 17  ? 72.750  154.195 2.859   1.00 0.00 ? 17  ALA C HB1  1 
ATOM 4292  H HB2  . ALA C 1 17  ? 74.330  153.577 3.342   1.00 0.00 ? 17  ALA C HB2  1 
ATOM 4293  H HB3  . ALA C 1 17  ? 74.210  154.786 2.065   1.00 0.00 ? 17  ALA C HB3  1 
ATOM 4294  N N    . ALA C 1 18  ? 71.938  155.555 5.460   1.00 0.00 ? 18  ALA C N    1 
ATOM 4295  C CA   . ALA C 1 18  ? 71.153  155.208 6.640   1.00 0.00 ? 18  ALA C CA   1 
ATOM 4296  C C    . ALA C 1 18  ? 70.813  153.721 6.642   1.00 0.00 ? 18  ALA C C    1 
ATOM 4297  O O    . ALA C 1 18  ? 70.527  153.138 5.596   1.00 0.00 ? 18  ALA C O    1 
ATOM 4298  C CB   . ALA C 1 18  ? 69.859  156.024 6.668   1.00 0.00 ? 18  ALA C CB   1 
ATOM 4299  H H    . ALA C 1 18  ? 71.535  156.106 4.758   1.00 0.00 ? 18  ALA C H    1 
ATOM 4300  H HA   . ALA C 1 18  ? 71.728  155.438 7.525   1.00 0.00 ? 18  ALA C HA   1 
ATOM 4301  H HB1  . ALA C 1 18  ? 69.259  155.719 7.513   1.00 0.00 ? 18  ALA C HB1  1 
ATOM 4302  H HB2  . ALA C 1 18  ? 69.307  155.855 5.755   1.00 0.00 ? 18  ALA C HB2  1 
ATOM 4303  H HB3  . ALA C 1 18  ? 70.097  157.074 6.756   1.00 0.00 ? 18  ALA C HB3  1 
ATOM 4304  N N    . ALA C 1 19  ? 70.842  153.116 7.824   1.00 0.00 ? 19  ALA C N    1 
ATOM 4305  C CA   . ALA C 1 19  ? 70.530  151.698 7.955   1.00 0.00 ? 19  ALA C CA   1 
ATOM 4306  C C    . ALA C 1 19  ? 69.061  151.441 7.630   1.00 0.00 ? 19  ALA C C    1 
ATOM 4307  O O    . ALA C 1 19  ? 68.679  150.325 7.277   1.00 0.00 ? 19  ALA C O    1 
ATOM 4308  C CB   . ALA C 1 19  ? 70.831  151.224 9.379   1.00 0.00 ? 19  ALA C CB   1 
ATOM 4309  H H    . ALA C 1 19  ? 71.072  153.633 8.623   1.00 0.00 ? 19  ALA C H    1 
ATOM 4310  H HA   . ALA C 1 19  ? 71.145  151.138 7.265   1.00 0.00 ? 19  ALA C HA   1 
ATOM 4311  H HB1  . ALA C 1 19  ? 70.384  151.907 10.087  1.00 0.00 ? 19  ALA C HB1  1 
ATOM 4312  H HB2  . ALA C 1 19  ? 71.899  151.196 9.531   1.00 0.00 ? 19  ALA C HB2  1 
ATOM 4313  H HB3  . ALA C 1 19  ? 70.420  150.236 9.525   1.00 0.00 ? 19  ALA C HB3  1 
ATOM 4314  N N    . GLU C 1 20  ? 68.242  152.481 7.760   1.00 0.00 ? 20  GLU C N    1 
ATOM 4315  C CA   . GLU C 1 20  ? 66.813  152.360 7.488   1.00 0.00 ? 20  GLU C CA   1 
ATOM 4316  C C    . GLU C 1 20  ? 66.201  151.251 8.341   1.00 0.00 ? 20  GLU C C    1 
ATOM 4317  O O    . GLU C 1 20  ? 66.033  151.409 9.549   1.00 0.00 ? 20  GLU C O    1 
ATOM 4318  C CB   . GLU C 1 20  ? 66.576  152.062 6.003   1.00 0.00 ? 20  GLU C CB   1 
ATOM 4319  C CG   . GLU C 1 20  ? 67.032  153.252 5.157   1.00 0.00 ? 20  GLU C CG   1 
ATOM 4320  C CD   . GLU C 1 20  ? 66.805  152.954 3.679   1.00 0.00 ? 20  GLU C CD   1 
ATOM 4321  O OE1  . GLU C 1 20  ? 66.080  152.016 3.390   1.00 0.00 ? 20  GLU C OE1  1 
ATOM 4322  O OE2  . GLU C 1 20  ? 67.354  153.672 2.859   1.00 0.00 ? 20  GLU C OE2  1 
ATOM 4323  H H    . GLU C 1 20  ? 68.604  153.344 8.051   1.00 0.00 ? 20  GLU C H    1 
ATOM 4324  H HA   . GLU C 1 20  ? 66.332  153.294 7.735   1.00 0.00 ? 20  GLU C HA   1 
ATOM 4325  H HB2  . GLU C 1 20  ? 67.137  151.183 5.719   1.00 0.00 ? 20  GLU C HB2  1 
ATOM 4326  H HB3  . GLU C 1 20  ? 65.525  151.887 5.835   1.00 0.00 ? 20  GLU C HB3  1 
ATOM 4327  H HG2  . GLU C 1 20  ? 66.465  154.129 5.438   1.00 0.00 ? 20  GLU C HG2  1 
ATOM 4328  H HG3  . GLU C 1 20  ? 68.082  153.434 5.329   1.00 0.00 ? 20  GLU C HG3  1 
ATOM 4329  N N    . LYS C 1 21  ? 65.867  150.125 7.701   1.00 0.00 ? 21  LYS C N    1 
ATOM 4330  C CA   . LYS C 1 21  ? 65.267  148.980 8.406   1.00 0.00 ? 21  LYS C CA   1 
ATOM 4331  C C    . LYS C 1 21  ? 65.944  147.676 7.987   1.00 0.00 ? 21  LYS C C    1 
ATOM 4332  O O    . LYS C 1 21  ? 66.391  147.535 6.849   1.00 0.00 ? 21  LYS C O    1 
ATOM 4333  C CB   . LYS C 1 21  ? 63.772  148.905 8.087   1.00 0.00 ? 21  LYS C CB   1 
ATOM 4334  C CG   . LYS C 1 21  ? 63.074  150.160 8.615   1.00 0.00 ? 21  LYS C CG   1 
ATOM 4335  C CD   . LYS C 1 21  ? 61.579  150.088 8.295   1.00 0.00 ? 21  LYS C CD   1 
ATOM 4336  C CE   . LYS C 1 21  ? 60.884  151.344 8.825   1.00 0.00 ? 21  LYS C CE   1 
ATOM 4337  N NZ   . LYS C 1 21  ? 59.431  151.284 8.495   1.00 0.00 ? 21  LYS C NZ   1 
ATOM 4338  H H    . LYS C 1 21  ? 66.025  150.059 6.737   1.00 0.00 ? 21  LYS C H    1 
ATOM 4339  H HA   . LYS C 1 21  ? 65.388  149.105 9.476   1.00 0.00 ? 21  LYS C HA   1 
ATOM 4340  H HB2  . LYS C 1 21  ? 63.635  148.839 7.017   1.00 0.00 ? 21  LYS C HB2  1 
ATOM 4341  H HB3  . LYS C 1 21  ? 63.346  148.032 8.560   1.00 0.00 ? 21  LYS C HB3  1 
ATOM 4342  H HG2  . LYS C 1 21  ? 63.212  150.225 9.685   1.00 0.00 ? 21  LYS C HG2  1 
ATOM 4343  H HG3  . LYS C 1 21  ? 63.499  151.033 8.143   1.00 0.00 ? 21  LYS C HG3  1 
ATOM 4344  H HD2  . LYS C 1 21  ? 61.443  150.023 7.225   1.00 0.00 ? 21  LYS C HD2  1 
ATOM 4345  H HD3  . LYS C 1 21  ? 61.152  149.216 8.767   1.00 0.00 ? 21  LYS C HD3  1 
ATOM 4346  H HE2  . LYS C 1 21  ? 61.008  151.399 9.896   1.00 0.00 ? 21  LYS C HE2  1 
ATOM 4347  H HE3  . LYS C 1 21  ? 61.321  152.218 8.367   1.00 0.00 ? 21  LYS C HE3  1 
ATOM 4348  H HZ1  . LYS C 1 21  ? 59.002  150.462 8.967   1.00 0.00 ? 21  LYS C HZ1  1 
ATOM 4349  H HZ2  . LYS C 1 21  ? 59.313  151.196 7.465   1.00 0.00 ? 21  LYS C HZ2  1 
ATOM 4350  H HZ3  . LYS C 1 21  ? 58.965  152.153 8.826   1.00 0.00 ? 21  LYS C HZ3  1 
ATOM 4351  N N    . THR C 1 22  ? 66.009  146.723 8.917   1.00 0.00 ? 22  THR C N    1 
ATOM 4352  C CA   . THR C 1 22  ? 66.628  145.423 8.644   1.00 0.00 ? 22  THR C CA   1 
ATOM 4353  C C    . THR C 1 22  ? 65.595  144.451 8.083   1.00 0.00 ? 22  THR C C    1 
ATOM 4354  O O    . THR C 1 22  ? 64.502  144.309 8.630   1.00 0.00 ? 22  THR C O    1 
ATOM 4355  C CB   . THR C 1 22  ? 67.223  144.846 9.932   1.00 0.00 ? 22  THR C CB   1 
ATOM 4356  O OG1  . THR C 1 22  ? 68.248  145.708 10.406  1.00 0.00 ? 22  THR C OG1  1 
ATOM 4357  C CG2  . THR C 1 22  ? 67.806  143.460 9.650   1.00 0.00 ? 22  THR C CG2  1 
ATOM 4358  H H    . THR C 1 22  ? 65.631  146.895 9.805   1.00 0.00 ? 22  THR C H    1 
ATOM 4359  H HA   . THR C 1 22  ? 67.421  145.549 7.920   1.00 0.00 ? 22  THR C HA   1 
ATOM 4360  H HB   . THR C 1 22  ? 66.450  144.760 10.678  1.00 0.00 ? 22  THR C HB   1 
ATOM 4361  H HG1  . THR C 1 22  ? 68.045  145.938 11.316  1.00 0.00 ? 22  THR C HG1  1 
ATOM 4362  H HG21 . THR C 1 22  ? 68.426  143.155 10.480  1.00 0.00 ? 22  THR C HG21 1 
ATOM 4363  H HG22 . THR C 1 22  ? 68.401  143.496 8.749   1.00 0.00 ? 22  THR C HG22 1 
ATOM 4364  H HG23 . THR C 1 22  ? 67.001  142.751 9.522   1.00 0.00 ? 22  THR C HG23 1 
ATOM 4365  N N    . LYS C 1 23  ? 65.946  143.787 6.986   1.00 0.00 ? 23  LYS C N    1 
ATOM 4366  C CA   . LYS C 1 23  ? 65.033  142.837 6.361   1.00 0.00 ? 23  LYS C CA   1 
ATOM 4367  C C    . LYS C 1 23  ? 64.810  141.636 7.277   1.00 0.00 ? 23  LYS C C    1 
ATOM 4368  O O    . LYS C 1 23  ? 65.550  140.655 7.219   1.00 0.00 ? 23  LYS C O    1 
ATOM 4369  C CB   . LYS C 1 23  ? 65.613  142.363 5.027   1.00 0.00 ? 23  LYS C CB   1 
ATOM 4370  C CG   . LYS C 1 23  ? 64.573  141.528 4.279   1.00 0.00 ? 23  LYS C CG   1 
ATOM 4371  C CD   . LYS C 1 23  ? 65.144  141.098 2.926   1.00 0.00 ? 23  LYS C CD   1 
ATOM 4372  C CE   . LYS C 1 23  ? 64.096  140.289 2.162   1.00 0.00 ? 23  LYS C CE   1 
ATOM 4373  N NZ   . LYS C 1 23  ? 64.650  139.884 0.840   1.00 0.00 ? 23  LYS C NZ   1 
ATOM 4374  H H    . LYS C 1 23  ? 66.828  143.941 6.590   1.00 0.00 ? 23  LYS C H    1 
ATOM 4375  H HA   . LYS C 1 23  ? 64.087  143.322 6.179   1.00 0.00 ? 23  LYS C HA   1 
ATOM 4376  H HB2  . LYS C 1 23  ? 65.886  143.220 4.428   1.00 0.00 ? 23  LYS C HB2  1 
ATOM 4377  H HB3  . LYS C 1 23  ? 66.491  141.760 5.210   1.00 0.00 ? 23  LYS C HB3  1 
ATOM 4378  H HG2  . LYS C 1 23  ? 64.327  140.652 4.862   1.00 0.00 ? 23  LYS C HG2  1 
ATOM 4379  H HG3  . LYS C 1 23  ? 63.684  142.118 4.120   1.00 0.00 ? 23  LYS C HG3  1 
ATOM 4380  H HD2  . LYS C 1 23  ? 65.412  141.974 2.354   1.00 0.00 ? 23  LYS C HD2  1 
ATOM 4381  H HD3  . LYS C 1 23  ? 66.021  140.488 3.084   1.00 0.00 ? 23  LYS C HD3  1 
ATOM 4382  H HE2  . LYS C 1 23  ? 63.837  139.407 2.729   1.00 0.00 ? 23  LYS C HE2  1 
ATOM 4383  H HE3  . LYS C 1 23  ? 63.213  140.893 2.012   1.00 0.00 ? 23  LYS C HE3  1 
ATOM 4384  H HZ1  . LYS C 1 23  ? 64.138  139.051 0.489   1.00 0.00 ? 23  LYS C HZ1  1 
ATOM 4385  H HZ2  . LYS C 1 23  ? 65.660  139.653 0.943   1.00 0.00 ? 23  LYS C HZ2  1 
ATOM 4386  H HZ3  . LYS C 1 23  ? 64.540  140.665 0.163   1.00 0.00 ? 23  LYS C HZ3  1 
ATOM 4387  N N    . GLN C 1 24  ? 63.782  141.726 8.119   1.00 0.00 ? 24  GLN C N    1 
ATOM 4388  C CA   . GLN C 1 24  ? 63.461  140.645 9.050   1.00 0.00 ? 24  GLN C CA   1 
ATOM 4389  C C    . GLN C 1 24  ? 64.641  140.382 9.985   1.00 0.00 ? 24  GLN C C    1 
ATOM 4390  O O    . GLN C 1 24  ? 64.612  140.752 11.159  1.00 0.00 ? 24  GLN C O    1 
ATOM 4391  C CB   . GLN C 1 24  ? 63.124  139.365 8.275   1.00 0.00 ? 24  GLN C CB   1 
ATOM 4392  C CG   . GLN C 1 24  ? 62.446  138.348 9.204   1.00 0.00 ? 24  GLN C CG   1 
ATOM 4393  C CD   . GLN C 1 24  ? 61.065  138.850 9.620   1.00 0.00 ? 24  GLN C CD   1 
ATOM 4394  O OE1  . GLN C 1 24  ? 60.264  139.239 8.769   1.00 0.00 ? 24  GLN C OE1  1 
ATOM 4395  N NE2  . GLN C 1 24  ? 60.736  138.862 10.882  1.00 0.00 ? 24  GLN C NE2  1 
ATOM 4396  H H    . GLN C 1 24  ? 63.230  142.535 8.116   1.00 0.00 ? 24  GLN C H    1 
ATOM 4397  H HA   . GLN C 1 24  ? 62.606  140.936 9.640   1.00 0.00 ? 24  GLN C HA   1 
ATOM 4398  H HB2  . GLN C 1 24  ? 62.458  139.605 7.459   1.00 0.00 ? 24  GLN C HB2  1 
ATOM 4399  H HB3  . GLN C 1 24  ? 64.033  138.936 7.880   1.00 0.00 ? 24  GLN C HB3  1 
ATOM 4400  H HG2  . GLN C 1 24  ? 62.343  137.405 8.687   1.00 0.00 ? 24  GLN C HG2  1 
ATOM 4401  H HG3  . GLN C 1 24  ? 63.054  138.208 10.084  1.00 0.00 ? 24  GLN C HG3  1 
ATOM 4402  H HE21 . GLN C 1 24  ? 61.374  138.550 11.557  1.00 0.00 ? 24  GLN C HE21 1 
ATOM 4403  H HE22 . GLN C 1 24  ? 59.850  139.183 11.154  1.00 0.00 ? 24  GLN C HE22 1 
ATOM 4404  N N    . GLY C 1 25  ? 65.680  139.743 9.450   1.00 0.00 ? 25  GLY C N    1 
ATOM 4405  C CA   . GLY C 1 25  ? 66.877  139.431 10.231  1.00 0.00 ? 25  GLY C CA   1 
ATOM 4406  C C    . GLY C 1 25  ? 66.753  138.068 10.899  1.00 0.00 ? 25  GLY C C    1 
ATOM 4407  O O    . GLY C 1 25  ? 67.722  137.547 11.450  1.00 0.00 ? 25  GLY C O    1 
ATOM 4408  H H    . GLY C 1 25  ? 65.643  139.478 8.508   1.00 0.00 ? 25  GLY C H    1 
ATOM 4409  H HA2  . GLY C 1 25  ? 67.735  139.426 9.574   1.00 0.00 ? 25  GLY C HA2  1 
ATOM 4410  H HA3  . GLY C 1 25  ? 67.020  140.186 10.993  1.00 0.00 ? 25  GLY C HA3  1 
ATOM 4411  N N    . VAL C 1 26  ? 65.549  137.489 10.845  1.00 0.00 ? 26  VAL C N    1 
ATOM 4412  C CA   . VAL C 1 26  ? 65.298  136.172 11.450  1.00 0.00 ? 26  VAL C CA   1 
ATOM 4413  C C    . VAL C 1 26  ? 64.464  135.305 10.506  1.00 0.00 ? 26  VAL C C    1 
ATOM 4414  O O    . VAL C 1 26  ? 63.273  135.551 10.316  1.00 0.00 ? 26  VAL C O    1 
ATOM 4415  C CB   . VAL C 1 26  ? 64.550  136.357 12.774  1.00 0.00 ? 26  VAL C CB   1 
ATOM 4416  C CG1  . VAL C 1 26  ? 64.483  135.026 13.525  1.00 0.00 ? 26  VAL C CG1  1 
ATOM 4417  C CG2  . VAL C 1 26  ? 65.283  137.391 13.632  1.00 0.00 ? 26  VAL C CG2  1 
ATOM 4418  H H    . VAL C 1 26  ? 64.817  137.953 10.391  1.00 0.00 ? 26  VAL C H    1 
ATOM 4419  H HA   . VAL C 1 26  ? 66.239  135.671 11.646  1.00 0.00 ? 26  VAL C HA   1 
ATOM 4420  H HB   . VAL C 1 26  ? 63.547  136.703 12.571  1.00 0.00 ? 26  VAL C HB   1 
ATOM 4421  H HG11 . VAL C 1 26  ? 64.130  134.252 12.862  1.00 0.00 ? 26  VAL C HG11 1 
ATOM 4422  H HG12 . VAL C 1 26  ? 63.805  135.120 14.360  1.00 0.00 ? 26  VAL C HG12 1 
ATOM 4423  H HG13 . VAL C 1 26  ? 65.466  134.769 13.889  1.00 0.00 ? 26  VAL C HG13 1 
ATOM 4424  H HG21 . VAL C 1 26  ? 66.325  137.118 13.713  1.00 0.00 ? 26  VAL C HG21 1 
ATOM 4425  H HG22 . VAL C 1 26  ? 64.841  137.419 14.616  1.00 0.00 ? 26  VAL C HG22 1 
ATOM 4426  H HG23 . VAL C 1 26  ? 65.201  138.364 13.172  1.00 0.00 ? 26  VAL C HG23 1 
ATOM 4427  N N    . ALA C 1 27  ? 65.095  134.284 9.919   1.00 0.00 ? 27  ALA C N    1 
ATOM 4428  C CA   . ALA C 1 27  ? 64.399  133.375 8.997   1.00 0.00 ? 27  ALA C CA   1 
ATOM 4429  C C    . ALA C 1 27  ? 63.899  132.136 9.737   1.00 0.00 ? 27  ALA C C    1 
ATOM 4430  O O    . ALA C 1 27  ? 63.138  131.338 9.188   1.00 0.00 ? 27  ALA C O    1 
ATOM 4431  C CB   . ALA C 1 27  ? 65.346  132.948 7.878   1.00 0.00 ? 27  ALA C CB   1 
ATOM 4432  H H    . ALA C 1 27  ? 66.044  134.135 10.113  1.00 0.00 ? 27  ALA C H    1 
ATOM 4433  H HA   . ALA C 1 27  ? 63.552  133.886 8.556   1.00 0.00 ? 27  ALA C HA   1 
ATOM 4434  H HB1  . ALA C 1 27  ? 66.269  132.599 8.308   1.00 0.00 ? 27  ALA C HB1  1 
ATOM 4435  H HB2  . ALA C 1 27  ? 65.546  133.791 7.233   1.00 0.00 ? 27  ALA C HB2  1 
ATOM 4436  H HB3  . ALA C 1 27  ? 64.893  132.154 7.304   1.00 0.00 ? 27  ALA C HB3  1 
ATOM 4437  N N    . GLU C 1 28  ? 64.337  131.981 10.983  1.00 0.00 ? 28  GLU C N    1 
ATOM 4438  C CA   . GLU C 1 28  ? 63.932  130.833 11.792  1.00 0.00 ? 28  GLU C CA   1 
ATOM 4439  C C    . GLU C 1 28  ? 64.272  129.525 11.080  1.00 0.00 ? 28  GLU C C    1 
ATOM 4440  O O    . GLU C 1 28  ? 63.381  128.797 10.642  1.00 0.00 ? 28  GLU C O    1 
ATOM 4441  C CB   . GLU C 1 28  ? 62.429  130.887 12.077  1.00 0.00 ? 28  GLU C CB   1 
ATOM 4442  C CG   . GLU C 1 28  ? 62.096  132.187 12.811  1.00 0.00 ? 28  GLU C CG   1 
ATOM 4443  C CD   . GLU C 1 28  ? 60.633  132.184 13.246  1.00 0.00 ? 28  GLU C CD   1 
ATOM 4444  O OE1  . GLU C 1 28  ? 59.934  131.247 12.899  1.00 0.00 ? 28  GLU C OE1  1 
ATOM 4445  O OE2  . GLU C 1 28  ? 60.236  133.119 13.922  1.00 0.00 ? 28  GLU C OE2  1 
ATOM 4446  H H    . GLU C 1 28  ? 64.943  132.648 11.365  1.00 0.00 ? 28  GLU C H    1 
ATOM 4447  H HA   . GLU C 1 28  ? 64.463  130.867 12.730  1.00 0.00 ? 28  GLU C HA   1 
ATOM 4448  H HB2  . GLU C 1 28  ? 61.882  130.848 11.145  1.00 0.00 ? 28  GLU C HB2  1 
ATOM 4449  H HB3  . GLU C 1 28  ? 62.150  130.046 12.694  1.00 0.00 ? 28  GLU C HB3  1 
ATOM 4450  H HG2  . GLU C 1 28  ? 62.730  132.282 13.680  1.00 0.00 ? 28  GLU C HG2  1 
ATOM 4451  H HG3  . GLU C 1 28  ? 62.268  133.022 12.151  1.00 0.00 ? 28  GLU C HG3  1 
ATOM 4452  N N    . ALA C 1 29  ? 65.572  129.235 10.962  1.00 0.00 ? 29  ALA C N    1 
ATOM 4453  C CA   . ALA C 1 29  ? 66.031  128.011 10.291  1.00 0.00 ? 29  ALA C CA   1 
ATOM 4454  C C    . ALA C 1 29  ? 67.310  127.483 10.938  1.00 0.00 ? 29  ALA C C    1 
ATOM 4455  O O    . ALA C 1 29  ? 67.973  128.191 11.702  1.00 0.00 ? 29  ALA C O    1 
ATOM 4456  C CB   . ALA C 1 29  ? 66.290  128.296 8.812   1.00 0.00 ? 29  ALA C CB   1 
ATOM 4457  H H    . ALA C 1 29  ? 66.234  129.858 11.328  1.00 0.00 ? 29  ALA C H    1 
ATOM 4458  H HA   . ALA C 1 29  ? 65.264  127.250 10.370  1.00 0.00 ? 29  ALA C HA   1 
ATOM 4459  H HB1  . ALA C 1 29  ? 66.415  127.364 8.282   1.00 0.00 ? 29  ALA C HB1  1 
ATOM 4460  H HB2  . ALA C 1 29  ? 67.186  128.890 8.712   1.00 0.00 ? 29  ALA C HB2  1 
ATOM 4461  H HB3  . ALA C 1 29  ? 65.451  128.835 8.398   1.00 0.00 ? 29  ALA C HB3  1 
ATOM 4462  N N    . ALA C 1 30  ? 67.656  126.225 10.618  1.00 0.00 ? 30  ALA C N    1 
ATOM 4463  C CA   . ALA C 1 30  ? 68.868  125.585 11.162  1.00 0.00 ? 30  ALA C CA   1 
ATOM 4464  C C    . ALA C 1 30  ? 69.758  125.091 10.026  1.00 0.00 ? 30  ALA C C    1 
ATOM 4465  O O    . ALA C 1 30  ? 69.289  124.413 9.100   1.00 0.00 ? 30  ALA C O    1 
ATOM 4466  C CB   . ALA C 1 30  ? 68.481  124.398 12.049  1.00 0.00 ? 30  ALA C CB   1 
ATOM 4467  H H    . ALA C 1 30  ? 67.088  125.720 9.997   1.00 0.00 ? 30  ALA C H    1 
ATOM 4468  H HA   . ALA C 1 30  ? 69.426  126.299 11.759  1.00 0.00 ? 30  ALA C HA   1 
ATOM 4469  H HB1  . ALA C 1 30  ? 67.680  124.687 12.710  1.00 0.00 ? 30  ALA C HB1  1 
ATOM 4470  H HB2  . ALA C 1 30  ? 69.337  124.090 12.633  1.00 0.00 ? 30  ALA C HB2  1 
ATOM 4471  H HB3  . ALA C 1 30  ? 68.156  123.576 11.429  1.00 0.00 ? 30  ALA C HB3  1 
ATOM 4472  N N    . GLY C 1 31  ? 71.043  125.426 10.101  1.00 0.00 ? 31  GLY C N    1 
ATOM 4473  C CA   . GLY C 1 31  ? 71.982  125.000 9.070   1.00 0.00 ? 31  GLY C CA   1 
ATOM 4474  C C    . GLY C 1 31  ? 71.662  125.658 7.732   1.00 0.00 ? 31  GLY C C    1 
ATOM 4475  O O    . GLY C 1 31  ? 71.330  124.975 6.757   1.00 0.00 ? 31  GLY C O    1 
ATOM 4476  H H    . GLY C 1 31  ? 71.366  125.967 10.865  1.00 0.00 ? 31  GLY C H    1 
ATOM 4477  H HA2  . GLY C 1 31  ? 72.985  125.272 9.370   1.00 0.00 ? 31  GLY C HA2  1 
ATOM 4478  H HA3  . GLY C 1 31  ? 71.923  123.929 8.958   1.00 0.00 ? 31  GLY C HA3  1 
ATOM 4479  N N    . LYS C 1 32  ? 71.762  126.986 7.682   1.00 0.00 ? 32  LYS C N    1 
ATOM 4480  C CA   . LYS C 1 32  ? 71.480  127.708 6.447   1.00 0.00 ? 32  LYS C CA   1 
ATOM 4481  C C    . LYS C 1 32  ? 72.498  127.341 5.374   1.00 0.00 ? 32  LYS C C    1 
ATOM 4482  O O    . LYS C 1 32  ? 73.595  126.872 5.675   1.00 0.00 ? 32  LYS C O    1 
ATOM 4483  C CB   . LYS C 1 32  ? 71.474  129.224 6.656   1.00 0.00 ? 32  LYS C CB   1 
ATOM 4484  C CG   . LYS C 1 32  ? 70.247  129.640 7.472   1.00 0.00 ? 32  LYS C CG   1 
ATOM 4485  C CD   . LYS C 1 32  ? 70.155  131.171 7.498   1.00 0.00 ? 32  LYS C CD   1 
ATOM 4486  C CE   . LYS C 1 32  ? 68.939  131.598 8.316   1.00 0.00 ? 32  LYS C CE   1 
ATOM 4487  N NZ   . LYS C 1 32  ? 68.828  133.086 8.300   1.00 0.00 ? 32  LYS C NZ   1 
ATOM 4488  H H    . LYS C 1 32  ? 72.031  127.484 8.486   1.00 0.00 ? 32  LYS C H    1 
ATOM 4489  H HA   . LYS C 1 32  ? 70.506  127.406 6.101   1.00 0.00 ? 32  LYS C HA   1 
ATOM 4490  H HB2  . LYS C 1 32  ? 72.366  129.511 7.183   1.00 0.00 ? 32  LYS C HB2  1 
ATOM 4491  H HB3  . LYS C 1 32  ? 71.447  129.715 5.696   1.00 0.00 ? 32  LYS C HB3  1 
ATOM 4492  H HG2  . LYS C 1 32  ? 69.355  129.231 7.019   1.00 0.00 ? 32  LYS C HG2  1 
ATOM 4493  H HG3  . LYS C 1 32  ? 70.342  129.270 8.482   1.00 0.00 ? 32  LYS C HG3  1 
ATOM 4494  H HD2  . LYS C 1 32  ? 71.047  131.582 7.939   1.00 0.00 ? 32  LYS C HD2  1 
ATOM 4495  H HD3  . LYS C 1 32  ? 70.052  131.539 6.489   1.00 0.00 ? 32  LYS C HD3  1 
ATOM 4496  H HE2  . LYS C 1 32  ? 68.049  131.164 7.888   1.00 0.00 ? 32  LYS C HE2  1 
ATOM 4497  H HE3  . LYS C 1 32  ? 69.051  131.256 9.335   1.00 0.00 ? 32  LYS C HE3  1 
ATOM 4498  H HZ1  . LYS C 1 32  ? 69.772  133.505 8.420   1.00 0.00 ? 32  LYS C HZ1  1 
ATOM 4499  H HZ2  . LYS C 1 32  ? 68.209  133.396 9.077   1.00 0.00 ? 32  LYS C HZ2  1 
ATOM 4500  H HZ3  . LYS C 1 32  ? 68.427  133.394 7.392   1.00 0.00 ? 32  LYS C HZ3  1 
ATOM 4501  N N    . THR C 1 33  ? 72.108  127.529 4.121   1.00 0.00 ? 33  THR C N    1 
ATOM 4502  C CA   . THR C 1 33  ? 72.970  127.185 3.000   1.00 0.00 ? 33  THR C CA   1 
ATOM 4503  C C    . THR C 1 33  ? 74.213  128.064 2.978   1.00 0.00 ? 33  THR C C    1 
ATOM 4504  O O    . THR C 1 33  ? 74.173  129.212 2.542   1.00 0.00 ? 33  THR C O    1 
ATOM 4505  C CB   . THR C 1 33  ? 72.187  127.371 1.695   1.00 0.00 ? 33  THR C CB   1 
ATOM 4506  O OG1  . THR C 1 33  ? 73.095  127.522 0.612   1.00 0.00 ? 33  THR C OG1  1 
ATOM 4507  C CG2  . THR C 1 33  ? 71.301  128.619 1.793   1.00 0.00 ? 33  THR C CG2  1 
ATOM 4508  H H    . THR C 1 33  ? 71.212  127.883 3.945   1.00 0.00 ? 33  THR C H    1 
ATOM 4509  H HA   . THR C 1 33  ? 73.269  126.151 3.085   1.00 0.00 ? 33  THR C HA   1 
ATOM 4510  H HB   . THR C 1 33  ? 71.562  126.510 1.527   1.00 0.00 ? 33  THR C HB   1 
ATOM 4511  H HG1  . THR C 1 33  ? 73.830  128.059 0.914   1.00 0.00 ? 33  THR C HG1  1 
ATOM 4512  H HG21 . THR C 1 33  ? 71.002  128.924 0.800   1.00 0.00 ? 33  THR C HG21 1 
ATOM 4513  H HG22 . THR C 1 33  ? 71.849  129.420 2.264   1.00 0.00 ? 33  THR C HG22 1 
ATOM 4514  H HG23 . THR C 1 33  ? 70.423  128.393 2.378   1.00 0.00 ? 33  THR C HG23 1 
ATOM 4515  N N    . LYS C 1 34  ? 75.322  127.499 3.455   1.00 0.00 ? 34  LYS C N    1 
ATOM 4516  C CA   . LYS C 1 34  ? 76.583  128.225 3.499   1.00 0.00 ? 34  LYS C CA   1 
ATOM 4517  C C    . LYS C 1 34  ? 76.956  128.720 2.111   1.00 0.00 ? 34  LYS C C    1 
ATOM 4518  O O    . LYS C 1 34  ? 76.748  128.025 1.118   1.00 0.00 ? 34  LYS C O    1 
ATOM 4519  C CB   . LYS C 1 34  ? 77.692  127.316 4.032   1.00 0.00 ? 34  LYS C CB   1 
ATOM 4520  C CG   . LYS C 1 34  ? 77.391  126.943 5.489   1.00 0.00 ? 34  LYS C CG   1 
ATOM 4521  C CD   . LYS C 1 34  ? 78.614  126.263 6.126   1.00 0.00 ? 34  LYS C CD   1 
ATOM 4522  C CE   . LYS C 1 34  ? 78.820  124.869 5.526   1.00 0.00 ? 34  LYS C CE   1 
ATOM 4523  N NZ   . LYS C 1 34  ? 79.843  124.133 6.323   1.00 0.00 ? 34  LYS C NZ   1 
ATOM 4524  H H    . LYS C 1 34  ? 75.287  126.578 3.785   1.00 0.00 ? 34  LYS C H    1 
ATOM 4525  H HA   . LYS C 1 34  ? 76.480  129.070 4.160   1.00 0.00 ? 34  LYS C HA   1 
ATOM 4526  H HB2  . LYS C 1 34  ? 77.731  126.422 3.428   1.00 0.00 ? 34  LYS C HB2  1 
ATOM 4527  H HB3  . LYS C 1 34  ? 78.639  127.830 3.980   1.00 0.00 ? 34  LYS C HB3  1 
ATOM 4528  H HG2  . LYS C 1 34  ? 77.149  127.837 6.045   1.00 0.00 ? 34  LYS C HG2  1 
ATOM 4529  H HG3  . LYS C 1 34  ? 76.552  126.266 5.519   1.00 0.00 ? 34  LYS C HG3  1 
ATOM 4530  H HD2  . LYS C 1 34  ? 79.493  126.865 5.945   1.00 0.00 ? 34  LYS C HD2  1 
ATOM 4531  H HD3  . LYS C 1 34  ? 78.456  126.173 7.192   1.00 0.00 ? 34  LYS C HD3  1 
ATOM 4532  H HE2  . LYS C 1 34  ? 77.888  124.325 5.545   1.00 0.00 ? 34  LYS C HE2  1 
ATOM 4533  H HE3  . LYS C 1 34  ? 79.164  124.960 4.508   1.00 0.00 ? 34  LYS C HE3  1 
ATOM 4534  H HZ1  . LYS C 1 34  ? 79.596  123.124 6.359   1.00 0.00 ? 34  LYS C HZ1  1 
ATOM 4535  H HZ2  . LYS C 1 34  ? 79.873  124.519 7.289   1.00 0.00 ? 34  LYS C HZ2  1 
ATOM 4536  H HZ3  . LYS C 1 34  ? 80.776  124.243 5.877   1.00 0.00 ? 34  LYS C HZ3  1 
ATOM 4537  N N    . GLU C 1 35  ? 77.508  129.934 2.050   1.00 0.00 ? 35  GLU C N    1 
ATOM 4538  C CA   . GLU C 1 35  ? 77.917  130.537 0.776   1.00 0.00 ? 35  GLU C CA   1 
ATOM 4539  C C    . GLU C 1 35  ? 79.437  130.550 0.675   1.00 0.00 ? 35  GLU C C    1 
ATOM 4540  O O    . GLU C 1 35  ? 80.114  131.167 1.499   1.00 0.00 ? 35  GLU C O    1 
ATOM 4541  C CB   . GLU C 1 35  ? 77.398  131.974 0.704   1.00 0.00 ? 35  GLU C CB   1 
ATOM 4542  C CG   . GLU C 1 35  ? 77.590  132.527 -0.709  1.00 0.00 ? 35  GLU C CG   1 
ATOM 4543  C CD   . GLU C 1 35  ? 76.642  131.825 -1.676  1.00 0.00 ? 35  GLU C CD   1 
ATOM 4544  O OE1  . GLU C 1 35  ? 75.610  131.358 -1.226  1.00 0.00 ? 35  GLU C OE1  1 
ATOM 4545  O OE2  . GLU C 1 35  ? 76.957  131.773 -2.853  1.00 0.00 ? 35  GLU C OE2  1 
ATOM 4546  H H    . GLU C 1 35  ? 77.645  130.437 2.879   1.00 0.00 ? 35  GLU C H    1 
ATOM 4547  H HA   . GLU C 1 35  ? 77.510  129.972 -0.054  1.00 0.00 ? 35  GLU C HA   1 
ATOM 4548  H HB2  . GLU C 1 35  ? 76.348  131.989 0.958   1.00 0.00 ? 35  GLU C HB2  1 
ATOM 4549  H HB3  . GLU C 1 35  ? 77.945  132.585 1.404   1.00 0.00 ? 35  GLU C HB3  1 
ATOM 4550  H HG2  . GLU C 1 35  ? 77.381  133.587 -0.710  1.00 0.00 ? 35  GLU C HG2  1 
ATOM 4551  H HG3  . GLU C 1 35  ? 78.609  132.363 -1.024  1.00 0.00 ? 35  GLU C HG3  1 
ATOM 4552  N N    . GLY C 1 36  ? 79.972  129.875 -0.336  1.00 0.00 ? 36  GLY C N    1 
ATOM 4553  C CA   . GLY C 1 36  ? 81.413  129.830 -0.515  1.00 0.00 ? 36  GLY C CA   1 
ATOM 4554  C C    . GLY C 1 36  ? 81.953  131.218 -0.824  1.00 0.00 ? 36  GLY C C    1 
ATOM 4555  O O    . GLY C 1 36  ? 81.914  132.108 0.025   1.00 0.00 ? 36  GLY C O    1 
ATOM 4556  H H    . GLY C 1 36  ? 79.390  129.403 -0.967  1.00 0.00 ? 36  GLY C H    1 
ATOM 4557  H HA2  . GLY C 1 36  ? 81.873  129.462 0.392   1.00 0.00 ? 36  GLY C HA2  1 
ATOM 4558  H HA3  . GLY C 1 36  ? 81.651  129.167 -1.330  1.00 0.00 ? 36  GLY C HA3  1 
ATOM 4559  N N    . VAL C 1 37  ? 82.454  131.403 -2.048  1.00 0.00 ? 37  VAL C N    1 
ATOM 4560  C CA   . VAL C 1 37  ? 83.005  132.700 -2.472  1.00 0.00 ? 37  VAL C CA   1 
ATOM 4561  C C    . VAL C 1 37  ? 82.402  133.107 -3.819  1.00 0.00 ? 37  VAL C C    1 
ATOM 4562  O O    . VAL C 1 37  ? 82.069  132.246 -4.645  1.00 0.00 ? 37  VAL C O    1 
ATOM 4563  C CB   . VAL C 1 37  ? 84.528  132.585 -2.598  1.00 0.00 ? 37  VAL C CB   1 
ATOM 4564  C CG1  . VAL C 1 37  ? 85.105  132.029 -1.293  1.00 0.00 ? 37  VAL C CG1  1 
ATOM 4565  C CG2  . VAL C 1 37  ? 84.879  131.640 -3.749  1.00 0.00 ? 37  VAL C CG2  1 
ATOM 4566  H H    . VAL C 1 37  ? 82.454  130.656 -2.682  1.00 0.00 ? 37  VAL C H    1 
ATOM 4567  H HA   . VAL C 1 37  ? 82.770  133.463 -1.737  1.00 0.00 ? 37  VAL C HA   1 
ATOM 4568  H HB   . VAL C 1 37  ? 84.948  133.563 -2.790  1.00 0.00 ? 37  VAL C HB   1 
ATOM 4569  H HG11 . VAL C 1 37  ? 86.182  132.092 -1.319  1.00 0.00 ? 37  VAL C HG11 1 
ATOM 4570  H HG12 . VAL C 1 37  ? 84.808  130.995 -1.182  1.00 0.00 ? 37  VAL C HG12 1 
ATOM 4571  H HG13 . VAL C 1 37  ? 84.728  132.600 -0.461  1.00 0.00 ? 37  VAL C HG13 1 
ATOM 4572  H HG21 . VAL C 1 37  ? 85.931  131.404 -3.712  1.00 0.00 ? 37  VAL C HG21 1 
ATOM 4573  H HG22 . VAL C 1 37  ? 84.649  132.113 -4.692  1.00 0.00 ? 37  VAL C HG22 1 
ATOM 4574  H HG23 . VAL C 1 37  ? 84.306  130.734 -3.655  1.00 0.00 ? 37  VAL C HG23 1 
ATOM 4575  N N    . LEU C 1 38  ? 82.260  134.424 -4.045  1.00 0.00 ? 38  LEU C N    1 
ATOM 4576  C CA   . LEU C 1 38  ? 81.687  134.928 -5.312  1.00 0.00 ? 38  LEU C CA   1 
ATOM 4577  C C    . LEU C 1 38  ? 82.726  135.767 -6.063  1.00 0.00 ? 38  LEU C C    1 
ATOM 4578  O O    . LEU C 1 38  ? 83.336  136.668 -5.485  1.00 0.00 ? 38  LEU C O    1 
ATOM 4579  C CB   . LEU C 1 38  ? 80.454  135.808 -5.031  1.00 0.00 ? 38  LEU C CB   1 
ATOM 4580  C CG   . LEU C 1 38  ? 79.541  135.140 -3.989  1.00 0.00 ? 38  LEU C CG   1 
ATOM 4581  C CD1  . LEU C 1 38  ? 78.315  136.035 -3.725  1.00 0.00 ? 38  LEU C CD1  1 
ATOM 4582  C CD2  . LEU C 1 38  ? 79.070  133.778 -4.506  1.00 0.00 ? 38  LEU C CD2  1 
ATOM 4583  H H    . LEU C 1 38  ? 82.547  135.068 -3.347  1.00 0.00 ? 38  LEU C H    1 
ATOM 4584  H HA   . LEU C 1 38  ? 81.387  134.095 -5.940  1.00 0.00 ? 38  LEU C HA   1 
ATOM 4585  H HB2  . LEU C 1 38  ? 80.774  136.768 -4.666  1.00 0.00 ? 38  LEU C HB2  1 
ATOM 4586  H HB3  . LEU C 1 38  ? 79.899  135.945 -5.949  1.00 0.00 ? 38  LEU C HB3  1 
ATOM 4587  H HG   . LEU C 1 38  ? 80.090  135.007 -3.068  1.00 0.00 ? 38  LEU C HG   1 
ATOM 4588  H HD11 . LEU C 1 38  ? 77.868  135.760 -2.782  1.00 0.00 ? 38  LEU C HD11 1 
ATOM 4589  H HD12 . LEU C 1 38  ? 77.590  135.905 -4.518  1.00 0.00 ? 38  LEU C HD12 1 
ATOM 4590  H HD13 . LEU C 1 38  ? 78.621  137.071 -3.687  1.00 0.00 ? 38  LEU C HD13 1 
ATOM 4591  H HD21 . LEU C 1 38  ? 79.877  133.069 -4.449  1.00 0.00 ? 38  LEU C HD21 1 
ATOM 4592  H HD22 . LEU C 1 38  ? 78.751  133.878 -5.525  1.00 0.00 ? 38  LEU C HD22 1 
ATOM 4593  H HD23 . LEU C 1 38  ? 78.245  133.432 -3.906  1.00 0.00 ? 38  LEU C HD23 1 
ATOM 4594  N N    . TYR C 1 39  ? 82.911  135.477 -7.361  1.00 0.00 ? 39  TYR C N    1 
ATOM 4595  C CA   . TYR C 1 39  ? 83.874  136.224 -8.201  1.00 0.00 ? 39  TYR C CA   1 
ATOM 4596  C C    . TYR C 1 39  ? 83.180  136.765 -9.452  1.00 0.00 ? 39  TYR C C    1 
ATOM 4597  O O    . TYR C 1 39  ? 82.702  135.997 -10.289 1.00 0.00 ? 39  TYR C O    1 
ATOM 4598  C CB   . TYR C 1 39  ? 85.044  135.303 -8.614  1.00 0.00 ? 39  TYR C CB   1 
ATOM 4599  C CG   . TYR C 1 39  ? 86.032  135.184 -7.472  1.00 0.00 ? 39  TYR C CG   1 
ATOM 4600  C CD1  . TYR C 1 39  ? 85.788  134.296 -6.419  1.00 0.00 ? 39  TYR C CD1  1 
ATOM 4601  C CD2  . TYR C 1 39  ? 87.193  135.969 -7.471  1.00 0.00 ? 39  TYR C CD2  1 
ATOM 4602  C CE1  . TYR C 1 39  ? 86.705  134.195 -5.364  1.00 0.00 ? 39  TYR C CE1  1 
ATOM 4603  C CE2  . TYR C 1 39  ? 88.108  135.866 -6.419  1.00 0.00 ? 39  TYR C CE2  1 
ATOM 4604  C CZ   . TYR C 1 39  ? 87.865  134.980 -5.366  1.00 0.00 ? 39  TYR C CZ   1 
ATOM 4605  O OH   . TYR C 1 39  ? 88.766  134.879 -4.326  1.00 0.00 ? 39  TYR C OH   1 
ATOM 4606  H H    . TYR C 1 39  ? 82.386  134.755 -7.767  1.00 0.00 ? 39  TYR C H    1 
ATOM 4607  H HA   . TYR C 1 39  ? 84.268  137.066 -7.641  1.00 0.00 ? 39  TYR C HA   1 
ATOM 4608  H HB2  . TYR C 1 39  ? 84.660  134.324 -8.858  1.00 0.00 ? 39  TYR C HB2  1 
ATOM 4609  H HB3  . TYR C 1 39  ? 85.548  135.717 -9.478  1.00 0.00 ? 39  TYR C HB3  1 
ATOM 4610  H HD1  . TYR C 1 39  ? 84.894  133.691 -6.417  1.00 0.00 ? 39  TYR C HD1  1 
ATOM 4611  H HD2  . TYR C 1 39  ? 87.380  136.653 -8.285  1.00 0.00 ? 39  TYR C HD2  1 
ATOM 4612  H HE1  . TYR C 1 39  ? 86.520  133.513 -4.551  1.00 0.00 ? 39  TYR C HE1  1 
ATOM 4613  H HE2  . TYR C 1 39  ? 89.002  136.471 -6.421  1.00 0.00 ? 39  TYR C HE2  1 
ATOM 4614  H HH   . TYR C 1 39  ? 88.679  135.665 -3.782  1.00 0.00 ? 39  TYR C HH   1 
ATOM 4615  N N    . VAL C 1 40  ? 83.139  138.102 -9.575  1.00 0.00 ? 40  VAL C N    1 
ATOM 4616  C CA   . VAL C 1 40  ? 82.509  138.757 -10.734 1.00 0.00 ? 40  VAL C CA   1 
ATOM 4617  C C    . VAL C 1 40  ? 83.429  139.838 -11.303 1.00 0.00 ? 40  VAL C C    1 
ATOM 4618  O O    . VAL C 1 40  ? 83.752  140.804 -10.623 1.00 0.00 ? 40  VAL C O    1 
ATOM 4619  C CB   . VAL C 1 40  ? 81.182  139.392 -10.306 1.00 0.00 ? 40  VAL C CB   1 
ATOM 4620  C CG1  . VAL C 1 40  ? 80.519  140.064 -11.511 1.00 0.00 ? 40  VAL C CG1  1 
ATOM 4621  C CG2  . VAL C 1 40  ? 80.254  138.306 -9.756  1.00 0.00 ? 40  VAL C CG2  1 
ATOM 4622  H H    . VAL C 1 40  ? 83.545  138.658 -8.876  1.00 0.00 ? 40  VAL C H    1 
ATOM 4623  H HA   . VAL C 1 40  ? 82.313  138.031 -11.498 1.00 0.00 ? 40  VAL C HA   1 
ATOM 4624  H HB   . VAL C 1 40  ? 81.367  140.131 -9.540  1.00 0.00 ? 40  VAL C HB   1 
ATOM 4625  H HG11 . VAL C 1 40  ? 81.073  140.950 -11.781 1.00 0.00 ? 40  VAL C HG11 1 
ATOM 4626  H HG12 . VAL C 1 40  ? 79.505  140.338 -11.255 1.00 0.00 ? 40  VAL C HG12 1 
ATOM 4627  H HG13 . VAL C 1 40  ? 80.506  139.378 -12.344 1.00 0.00 ? 40  VAL C HG13 1 
ATOM 4628  H HG21 . VAL C 1 40  ? 80.222  137.475 -10.446 1.00 0.00 ? 40  VAL C HG21 1 
ATOM 4629  H HG22 . VAL C 1 40  ? 79.260  138.710 -9.634  1.00 0.00 ? 40  VAL C HG22 1 
ATOM 4630  H HG23 . VAL C 1 40  ? 80.625  137.966 -8.800  1.00 0.00 ? 40  VAL C HG23 1 
ATOM 4631  N N    . GLY C 1 41  ? 83.846  139.687 -12.553 1.00 0.00 ? 41  GLY C N    1 
ATOM 4632  C CA   . GLY C 1 41  ? 84.720  140.689 -13.161 1.00 0.00 ? 41  GLY C CA   1 
ATOM 4633  C C    . GLY C 1 41  ? 86.085  140.723 -12.469 1.00 0.00 ? 41  GLY C C    1 
ATOM 4634  O O    . GLY C 1 41  ? 86.423  141.693 -11.766 1.00 0.00 ? 41  GLY C O    1 
ATOM 4635  H H    . GLY C 1 41  ? 83.565  138.901 -13.077 1.00 0.00 ? 41  GLY C H    1 
ATOM 4636  H HA2  . GLY C 1 41  ? 84.857  140.451 -14.206 1.00 0.00 ? 41  GLY C HA2  1 
ATOM 4637  H HA3  . GLY C 1 41  ? 84.259  141.659 -13.075 1.00 0.00 ? 41  GLY C HA3  1 
ATOM 4638  N N    . SER C 1 42  ? 86.869  139.659 -12.667 1.00 0.00 ? 42  SER C N    1 
ATOM 4639  C CA   . SER C 1 42  ? 88.213  139.566 -12.063 1.00 0.00 ? 42  SER C CA   1 
ATOM 4640  C C    . SER C 1 42  ? 89.215  139.022 -13.075 1.00 0.00 ? 42  SER C C    1 
ATOM 4641  O O    . SER C 1 42  ? 88.929  138.061 -13.788 1.00 0.00 ? 42  SER C O    1 
ATOM 4642  C CB   . SER C 1 42  ? 88.180  138.646 -10.841 1.00 0.00 ? 42  SER C CB   1 
ATOM 4643  O OG   . SER C 1 42  ? 87.290  139.182 -9.870  1.00 0.00 ? 42  SER C OG   1 
ATOM 4644  H H    . SER C 1 42  ? 86.539  138.917 -13.236 1.00 0.00 ? 42  SER C H    1 
ATOM 4645  H HA   . SER C 1 42  ? 88.540  140.551 -11.747 1.00 0.00 ? 42  SER C HA   1 
ATOM 4646  H HB2  . SER C 1 42  ? 87.838  137.670 -11.133 1.00 0.00 ? 42  SER C HB2  1 
ATOM 4647  H HB3  . SER C 1 42  ? 89.178  138.566 -10.425 1.00 0.00 ? 42  SER C HB3  1 
ATOM 4648  H HG   . SER C 1 42  ? 87.817  139.570 -9.167  1.00 0.00 ? 42  SER C HG   1 
ATOM 4649  N N    . LYS C 1 43  ? 90.403  139.638 -13.132 1.00 0.00 ? 43  LYS C N    1 
ATOM 4650  C CA   . LYS C 1 43  ? 91.456  139.199 -14.065 1.00 0.00 ? 43  LYS C CA   1 
ATOM 4651  C C    . LYS C 1 43  ? 92.685  138.751 -13.283 1.00 0.00 ? 43  LYS C C    1 
ATOM 4652  O O    . LYS C 1 43  ? 93.203  139.496 -12.450 1.00 0.00 ? 43  LYS C O    1 
ATOM 4653  C CB   . LYS C 1 43  ? 91.849  140.360 -14.990 1.00 0.00 ? 43  LYS C CB   1 
ATOM 4654  C CG   . LYS C 1 43  ? 90.598  141.043 -15.566 1.00 0.00 ? 43  LYS C CG   1 
ATOM 4655  C CD   . LYS C 1 43  ? 89.773  140.057 -16.404 1.00 0.00 ? 43  LYS C CD   1 
ATOM 4656  C CE   . LYS C 1 43  ? 88.676  140.829 -17.143 1.00 0.00 ? 43  LYS C CE   1 
ATOM 4657  N NZ   . LYS C 1 43  ? 87.823  139.881 -17.914 1.00 0.00 ? 43  LYS C NZ   1 
ATOM 4658  H H    . LYS C 1 43  ? 90.578  140.397 -12.535 1.00 0.00 ? 43  LYS C H    1 
ATOM 4659  H HA   . LYS C 1 43  ? 91.107  138.370 -14.665 1.00 0.00 ? 43  LYS C HA   1 
ATOM 4660  H HB2  . LYS C 1 43  ? 92.424  141.084 -14.428 1.00 0.00 ? 43  LYS C HB2  1 
ATOM 4661  H HB3  . LYS C 1 43  ? 92.453  139.980 -15.801 1.00 0.00 ? 43  LYS C HB3  1 
ATOM 4662  H HG2  . LYS C 1 43  ? 89.990  141.413 -14.754 1.00 0.00 ? 43  LYS C HG2  1 
ATOM 4663  H HG3  . LYS C 1 43  ? 90.899  141.872 -16.189 1.00 0.00 ? 43  LYS C HG3  1 
ATOM 4664  H HD2  . LYS C 1 43  ? 90.415  139.560 -17.117 1.00 0.00 ? 43  LYS C HD2  1 
ATOM 4665  H HD3  . LYS C 1 43  ? 89.313  139.326 -15.758 1.00 0.00 ? 43  LYS C HD3  1 
ATOM 4666  H HE2  . LYS C 1 43  ? 88.066  141.360 -16.427 1.00 0.00 ? 43  LYS C HE2  1 
ATOM 4667  H HE3  . LYS C 1 43  ? 89.130  141.537 -17.821 1.00 0.00 ? 43  LYS C HE3  1 
ATOM 4668  H HZ1  . LYS C 1 43  ? 86.984  140.380 -18.269 1.00 0.00 ? 43  LYS C HZ1  1 
ATOM 4669  H HZ2  . LYS C 1 43  ? 87.526  139.099 -17.295 1.00 0.00 ? 43  LYS C HZ2  1 
ATOM 4670  H HZ3  . LYS C 1 43  ? 88.363  139.502 -18.717 1.00 0.00 ? 43  LYS C HZ3  1 
ATOM 4671  N N    . THR C 1 44  ? 93.154  137.527 -13.559 1.00 0.00 ? 44  THR C N    1 
ATOM 4672  C CA   . THR C 1 44  ? 94.337  136.977 -12.879 1.00 0.00 ? 44  THR C CA   1 
ATOM 4673  C C    . THR C 1 44  ? 95.313  136.397 -13.897 1.00 0.00 ? 44  THR C C    1 
ATOM 4674  O O    . THR C 1 44  ? 94.943  135.559 -14.717 1.00 0.00 ? 44  THR C O    1 
ATOM 4675  C CB   . THR C 1 44  ? 93.905  135.874 -11.907 1.00 0.00 ? 44  THR C CB   1 
ATOM 4676  O OG1  . THR C 1 44  ? 92.998  136.414 -10.955 1.00 0.00 ? 44  THR C OG1  1 
ATOM 4677  C CG2  . THR C 1 44  ? 95.130  135.313 -11.185 1.00 0.00 ? 44  THR C CG2  1 
ATOM 4678  H H    . THR C 1 44  ? 92.699  136.984 -14.236 1.00 0.00 ? 44  THR C H    1 
ATOM 4679  H HA   . THR C 1 44  ? 94.838  137.756 -12.319 1.00 0.00 ? 44  THR C HA   1 
ATOM 4680  H HB   . THR C 1 44  ? 93.421  135.080 -12.455 1.00 0.00 ? 44  THR C HB   1 
ATOM 4681  H HG1  . THR C 1 44  ? 93.498  136.969 -10.353 1.00 0.00 ? 44  THR C HG1  1 
ATOM 4682  H HG21 . THR C 1 44  ? 95.709  136.127 -10.772 1.00 0.00 ? 44  THR C HG21 1 
ATOM 4683  H HG22 . THR C 1 44  ? 95.738  134.758 -11.885 1.00 0.00 ? 44  THR C HG22 1 
ATOM 4684  H HG23 . THR C 1 44  ? 94.811  134.659 -10.387 1.00 0.00 ? 44  THR C HG23 1 
ATOM 4685  N N    . LYS C 1 45  ? 96.572  136.837 -13.831 1.00 0.00 ? 45  LYS C N    1 
ATOM 4686  C CA   . LYS C 1 45  ? 97.608  136.345 -14.751 1.00 0.00 ? 45  LYS C CA   1 
ATOM 4687  C C    . LYS C 1 45  ? 98.913  136.118 -13.998 1.00 0.00 ? 45  LYS C C    1 
ATOM 4688  O O    . LYS C 1 45  ? 99.324  136.953 -13.191 1.00 0.00 ? 45  LYS C O    1 
ATOM 4689  C CB   . LYS C 1 45  ? 97.838  137.360 -15.874 1.00 0.00 ? 45  LYS C CB   1 
ATOM 4690  C CG   . LYS C 1 45  ? 96.538  137.560 -16.657 1.00 0.00 ? 45  LYS C CG   1 
ATOM 4691  C CD   . LYS C 1 45  ? 96.774  138.561 -17.792 1.00 0.00 ? 45  LYS C CD   1 
ATOM 4692  C CE   . LYS C 1 45  ? 95.449  138.857 -18.499 1.00 0.00 ? 45  LYS C CE   1 
ATOM 4693  N NZ   . LYS C 1 45  ? 94.916  137.602 -19.098 1.00 0.00 ? 45  LYS C NZ   1 
ATOM 4694  H H    . LYS C 1 45  ? 96.812  137.500 -13.149 1.00 0.00 ? 45  LYS C H    1 
ATOM 4695  H HA   . LYS C 1 45  ? 97.293  135.405 -15.190 1.00 0.00 ? 45  LYS C HA   1 
ATOM 4696  H HB2  . LYS C 1 45  ? 98.153  138.302 -15.449 1.00 0.00 ? 45  LYS C HB2  1 
ATOM 4697  H HB3  . LYS C 1 45  ? 98.603  136.991 -16.540 1.00 0.00 ? 45  LYS C HB3  1 
ATOM 4698  H HG2  . LYS C 1 45  ? 96.218  136.614 -17.071 1.00 0.00 ? 45  LYS C HG2  1 
ATOM 4699  H HG3  . LYS C 1 45  ? 95.775  137.942 -15.997 1.00 0.00 ? 45  LYS C HG3  1 
ATOM 4700  H HD2  . LYS C 1 45  ? 97.179  139.476 -17.385 1.00 0.00 ? 45  LYS C HD2  1 
ATOM 4701  H HD3  . LYS C 1 45  ? 97.473  138.142 -18.501 1.00 0.00 ? 45  LYS C HD3  1 
ATOM 4702  H HE2  . LYS C 1 45  ? 94.739  139.245 -17.785 1.00 0.00 ? 45  LYS C HE2  1 
ATOM 4703  H HE3  . LYS C 1 45  ? 95.612  139.586 -19.279 1.00 0.00 ? 45  LYS C HE3  1 
ATOM 4704  H HZ1  . LYS C 1 45  ? 94.939  136.842 -18.390 1.00 0.00 ? 45  LYS C HZ1  1 
ATOM 4705  H HZ2  . LYS C 1 45  ? 95.500  137.334 -19.916 1.00 0.00 ? 45  LYS C HZ2  1 
ATOM 4706  H HZ3  . LYS C 1 45  ? 93.936  137.755 -19.407 1.00 0.00 ? 45  LYS C HZ3  1 
ATOM 4707  N N    . GLU C 1 46  ? 99.567  134.986 -14.270 1.00 0.00 ? 46  GLU C N    1 
ATOM 4708  C CA   . GLU C 1 46  ? 100.839 134.654 -13.610 1.00 0.00 ? 46  GLU C CA   1 
ATOM 4709  C C    . GLU C 1 46  ? 101.806 134.010 -14.601 1.00 0.00 ? 46  GLU C C    1 
ATOM 4710  O O    . GLU C 1 46  ? 101.550 132.921 -15.103 1.00 0.00 ? 46  GLU C O    1 
ATOM 4711  C CB   . GLU C 1 46  ? 100.581 133.686 -12.451 1.00 0.00 ? 46  GLU C CB   1 
ATOM 4712  C CG   . GLU C 1 46  ? 99.638  134.338 -11.437 1.00 0.00 ? 46  GLU C CG   1 
ATOM 4713  C CD   . GLU C 1 46  ? 99.418  133.404 -10.251 1.00 0.00 ? 46  GLU C CD   1 
ATOM 4714  O OE1  . GLU C 1 46  ? 99.937  132.301 -10.288 1.00 0.00 ? 46  GLU C OE1  1 
ATOM 4715  O OE2  . GLU C 1 46  ? 98.735  133.806 -9.324  1.00 0.00 ? 46  GLU C OE2  1 
ATOM 4716  H H    . GLU C 1 46  ? 99.191  134.361 -14.925 1.00 0.00 ? 46  GLU C H    1 
ATOM 4717  H HA   . GLU C 1 46  ? 101.288 135.551 -13.218 1.00 0.00 ? 46  GLU C HA   1 
ATOM 4718  H HB2  . GLU C 1 46  ? 100.131 132.781 -12.831 1.00 0.00 ? 46  GLU C HB2  1 
ATOM 4719  H HB3  . GLU C 1 46  ? 101.515 133.447 -11.967 1.00 0.00 ? 46  GLU C HB3  1 
ATOM 4720  H HG2  . GLU C 1 46  ? 100.070 135.264 -11.089 1.00 0.00 ? 46  GLU C HG2  1 
ATOM 4721  H HG3  . GLU C 1 46  ? 98.689  134.541 -11.911 1.00 0.00 ? 46  GLU C HG3  1 
ATOM 4722  N N    . GLY C 1 47  ? 102.925 134.681 -14.878 1.00 0.00 ? 47  GLY C N    1 
ATOM 4723  C CA   . GLY C 1 47  ? 103.903 134.135 -15.809 1.00 0.00 ? 47  GLY C CA   1 
ATOM 4724  C C    . GLY C 1 47  ? 103.383 134.186 -17.239 1.00 0.00 ? 47  GLY C C    1 
ATOM 4725  O O    . GLY C 1 47  ? 102.954 133.167 -17.796 1.00 0.00 ? 47  GLY C O    1 
ATOM 4726  H H    . GLY C 1 47  ? 103.096 135.553 -14.452 1.00 0.00 ? 47  GLY C H    1 
ATOM 4727  H HA2  . GLY C 1 47  ? 104.816 134.709 -15.740 1.00 0.00 ? 47  GLY C HA2  1 
ATOM 4728  H HA3  . GLY C 1 47  ? 104.107 133.108 -15.545 1.00 0.00 ? 47  GLY C HA3  1 
ATOM 4729  N N    . VAL C 1 48  ? 103.417 135.386 -17.830 1.00 0.00 ? 48  VAL C N    1 
ATOM 4730  C CA   . VAL C 1 48  ? 102.950 135.588 -19.210 1.00 0.00 ? 48  VAL C CA   1 
ATOM 4731  C C    . VAL C 1 48  ? 103.862 136.566 -19.945 1.00 0.00 ? 48  VAL C C    1 
ATOM 4732  O O    . VAL C 1 48  ? 104.264 137.588 -19.391 1.00 0.00 ? 48  VAL C O    1 
ATOM 4733  C CB   . VAL C 1 48  ? 101.524 136.130 -19.214 1.00 0.00 ? 48  VAL C CB   1 
ATOM 4734  C CG1  . VAL C 1 48  ? 101.075 136.372 -20.657 1.00 0.00 ? 48  VAL C CG1  1 
ATOM 4735  C CG2  . VAL C 1 48  ? 100.589 135.112 -18.558 1.00 0.00 ? 48  VAL C CG2  1 
ATOM 4736  H H    . VAL C 1 48  ? 103.766 136.154 -17.326 1.00 0.00 ? 48  VAL C H    1 
ATOM 4737  H HA   . VAL C 1 48  ? 102.964 134.643 -19.736 1.00 0.00 ? 48  VAL C HA   1 
ATOM 4738  H HB   . VAL C 1 48  ? 101.490 137.061 -18.664 1.00 0.00 ? 48  VAL C HB   1 
ATOM 4739  H HG11 . VAL C 1 48  ? 101.569 137.250 -21.045 1.00 0.00 ? 48  VAL C HG11 1 
ATOM 4740  H HG12 . VAL C 1 48  ? 100.005 136.520 -20.681 1.00 0.00 ? 48  VAL C HG12 1 
ATOM 4741  H HG13 . VAL C 1 48  ? 101.334 135.516 -21.263 1.00 0.00 ? 48  VAL C HG13 1 
ATOM 4742  H HG21 . VAL C 1 48  ? 100.807 135.050 -17.502 1.00 0.00 ? 48  VAL C HG21 1 
ATOM 4743  H HG22 . VAL C 1 48  ? 100.735 134.144 -19.014 1.00 0.00 ? 48  VAL C HG22 1 
ATOM 4744  H HG23 . VAL C 1 48  ? 99.564  135.424 -18.696 1.00 0.00 ? 48  VAL C HG23 1 
ATOM 4745  N N    . VAL C 1 49  ? 104.184 136.252 -21.205 1.00 0.00 ? 49  VAL C N    1 
ATOM 4746  C CA   . VAL C 1 49  ? 105.054 137.119 -22.018 1.00 0.00 ? 49  VAL C CA   1 
ATOM 4747  C C    . VAL C 1 49  ? 104.495 137.279 -23.435 1.00 0.00 ? 49  VAL C C    1 
ATOM 4748  O O    . VAL C 1 49  ? 103.964 136.341 -24.018 1.00 0.00 ? 49  VAL C O    1 
ATOM 4749  C CB   . VAL C 1 49  ? 106.479 136.532 -22.066 1.00 0.00 ? 49  VAL C CB   1 
ATOM 4750  C CG1  . VAL C 1 49  ? 106.405 135.040 -22.373 1.00 0.00 ? 49  VAL C CG1  1 
ATOM 4751  C CG2  . VAL C 1 49  ? 107.309 137.236 -23.161 1.00 0.00 ? 49  VAL C CG2  1 
ATOM 4752  H H    . VAL C 1 49  ? 103.831 135.425 -21.596 1.00 0.00 ? 49  VAL C H    1 
ATOM 4753  H HA   . VAL C 1 49  ? 105.105 138.096 -21.564 1.00 0.00 ? 49  VAL C HA   1 
ATOM 4754  H HB   . VAL C 1 49  ? 106.955 136.673 -21.107 1.00 0.00 ? 49  VAL C HB   1 
ATOM 4755  H HG11 . VAL C 1 49  ? 105.854 134.893 -23.281 1.00 0.00 ? 49  VAL C HG11 1 
ATOM 4756  H HG12 . VAL C 1 49  ? 105.906 134.531 -21.562 1.00 0.00 ? 49  VAL C HG12 1 
ATOM 4757  H HG13 . VAL C 1 49  ? 107.404 134.645 -22.487 1.00 0.00 ? 49  VAL C HG13 1 
ATOM 4758  H HG21 . VAL C 1 49  ? 108.359 137.047 -22.997 1.00 0.00 ? 49  VAL C HG21 1 
ATOM 4759  H HG22 . VAL C 1 49  ? 107.123 138.297 -23.128 1.00 0.00 ? 49  VAL C HG22 1 
ATOM 4760  H HG23 . VAL C 1 49  ? 107.021 136.860 -24.129 1.00 0.00 ? 49  VAL C HG23 1 
ATOM 4761  N N    . HIS C 1 50  ? 104.633 138.488 -23.981 1.00 0.00 ? 50  HIS C N    1 
ATOM 4762  C CA   . HIS C 1 50  ? 104.155 138.782 -25.335 1.00 0.00 ? 50  HIS C CA   1 
ATOM 4763  C C    . HIS C 1 50  ? 105.103 139.761 -26.022 1.00 0.00 ? 50  HIS C C    1 
ATOM 4764  O O    . HIS C 1 50  ? 105.297 140.879 -25.553 1.00 0.00 ? 50  HIS C O    1 
ATOM 4765  C CB   . HIS C 1 50  ? 102.756 139.393 -25.276 1.00 0.00 ? 50  HIS C CB   1 
ATOM 4766  C CG   . HIS C 1 50  ? 102.248 139.609 -26.674 1.00 0.00 ? 50  HIS C CG   1 
ATOM 4767  N ND1  . HIS C 1 50  ? 101.334 138.755 -27.271 1.00 0.00 ? 50  HIS C ND1  1 
ATOM 4768  C CD2  . HIS C 1 50  ? 102.529 140.571 -27.609 1.00 0.00 ? 50  HIS C CD2  1 
ATOM 4769  C CE1  . HIS C 1 50  ? 101.099 139.219 -28.513 1.00 0.00 ? 50  HIS C CE1  1 
ATOM 4770  N NE2  . HIS C 1 50  ? 101.802 140.324 -28.770 1.00 0.00 ? 50  HIS C NE2  1 
ATOM 4771  H H    . HIS C 1 50  ? 105.073 139.196 -23.464 1.00 0.00 ? 50  HIS C H    1 
ATOM 4772  H HA   . HIS C 1 50  ? 104.116 137.870 -25.911 1.00 0.00 ? 50  HIS C HA   1 
ATOM 4773  H HB2  . HIS C 1 50  ? 102.091 138.723 -24.750 1.00 0.00 ? 50  HIS C HB2  1 
ATOM 4774  H HB3  . HIS C 1 50  ? 102.796 140.341 -24.758 1.00 0.00 ? 50  HIS C HB3  1 
ATOM 4775  H HD1  . HIS C 1 50  ? 100.932 137.960 -26.863 1.00 0.00 ? 50  HIS C HD1  1 
ATOM 4776  H HD2  . HIS C 1 50  ? 103.216 141.392 -27.468 1.00 0.00 ? 50  HIS C HD2  1 
ATOM 4777  H HE1  . HIS C 1 50  ? 100.424 138.753 -29.215 1.00 0.00 ? 50  HIS C HE1  1 
ATOM 4778  N N    . GLY C 1 51  ? 105.701 139.335 -27.140 1.00 0.00 ? 51  GLY C N    1 
ATOM 4779  C CA   . GLY C 1 51  ? 106.643 140.192 -27.887 1.00 0.00 ? 51  GLY C CA   1 
ATOM 4780  C C    . GLY C 1 51  ? 106.226 140.328 -29.348 1.00 0.00 ? 51  GLY C C    1 
ATOM 4781  O O    . GLY C 1 51  ? 105.887 139.345 -30.001 1.00 0.00 ? 51  GLY C O    1 
ATOM 4782  H H    . GLY C 1 51  ? 105.512 138.430 -27.470 1.00 0.00 ? 51  GLY C H    1 
ATOM 4783  H HA2  . GLY C 1 51  ? 106.681 141.178 -27.440 1.00 0.00 ? 51  GLY C HA2  1 
ATOM 4784  H HA3  . GLY C 1 51  ? 107.627 139.752 -27.846 1.00 0.00 ? 51  GLY C HA3  1 
ATOM 4785  N N    . VAL C 1 52  ? 106.266 141.562 -29.864 1.00 0.00 ? 52  VAL C N    1 
ATOM 4786  C CA   . VAL C 1 52  ? 105.903 141.830 -31.268 1.00 0.00 ? 52  VAL C CA   1 
ATOM 4787  C C    . VAL C 1 52  ? 106.996 142.647 -31.946 1.00 0.00 ? 52  VAL C C    1 
ATOM 4788  O O    . VAL C 1 52  ? 107.377 143.713 -31.459 1.00 0.00 ? 52  VAL C O    1 
ATOM 4789  C CB   . VAL C 1 52  ? 104.579 142.592 -31.333 1.00 0.00 ? 52  VAL C CB   1 
ATOM 4790  C CG1  . VAL C 1 52  ? 104.225 142.873 -32.794 1.00 0.00 ? 52  VAL C CG1  1 
ATOM 4791  C CG2  . VAL C 1 52  ? 103.475 141.745 -30.700 1.00 0.00 ? 52  VAL C CG2  1 
ATOM 4792  H H    . VAL C 1 52  ? 106.554 142.308 -29.296 1.00 0.00 ? 52  VAL C H    1 
ATOM 4793  H HA   . VAL C 1 52  ? 105.792 140.892 -31.803 1.00 0.00 ? 52  VAL C HA   1 
ATOM 4794  H HB   . VAL C 1 52  ? 104.673 143.527 -30.799 1.00 0.00 ? 52  VAL C HB   1 
ATOM 4795  H HG11 . VAL C 1 52  ? 104.894 143.623 -33.189 1.00 0.00 ? 52  VAL C HG11 1 
ATOM 4796  H HG12 . VAL C 1 52  ? 103.207 143.230 -32.856 1.00 0.00 ? 52  VAL C HG12 1 
ATOM 4797  H HG13 . VAL C 1 52  ? 104.323 141.964 -33.368 1.00 0.00 ? 52  VAL C HG13 1 
ATOM 4798  H HG21 . VAL C 1 52  ? 102.585 142.345 -30.576 1.00 0.00 ? 52  VAL C HG21 1 
ATOM 4799  H HG22 . VAL C 1 52  ? 103.805 141.389 -29.736 1.00 0.00 ? 52  VAL C HG22 1 
ATOM 4800  H HG23 . VAL C 1 52  ? 103.255 140.903 -31.338 1.00 0.00 ? 52  VAL C HG23 1 
ATOM 4801  N N    . ALA C 1 53  ? 107.502 142.138 -33.076 1.00 0.00 ? 53  ALA C N    1 
ATOM 4802  C CA   . ALA C 1 53  ? 108.565 142.821 -33.832 1.00 0.00 ? 53  ALA C CA   1 
ATOM 4803  C C    . ALA C 1 53  ? 108.191 142.927 -35.308 1.00 0.00 ? 53  ALA C C    1 
ATOM 4804  O O    . ALA C 1 53  ? 107.861 141.930 -35.947 1.00 0.00 ? 53  ALA C O    1 
ATOM 4805  C CB   . ALA C 1 53  ? 109.874 142.038 -33.698 1.00 0.00 ? 53  ALA C CB   1 
ATOM 4806  H H    . ALA C 1 53  ? 107.155 141.284 -33.410 1.00 0.00 ? 53  ALA C H    1 
ATOM 4807  H HA   . ALA C 1 53  ? 108.714 143.816 -33.436 1.00 0.00 ? 53  ALA C HA   1 
ATOM 4808  H HB1  . ALA C 1 53  ? 110.594 142.413 -34.411 1.00 0.00 ? 53  ALA C HB1  1 
ATOM 4809  H HB2  . ALA C 1 53  ? 109.689 140.991 -33.892 1.00 0.00 ? 53  ALA C HB2  1 
ATOM 4810  H HB3  . ALA C 1 53  ? 110.263 142.154 -32.697 1.00 0.00 ? 53  ALA C HB3  1 
ATOM 4811  N N    . THR C 1 54  ? 108.255 144.147 -35.853 1.00 0.00 ? 54  THR C N    1 
ATOM 4812  C CA   . THR C 1 54  ? 107.930 144.380 -37.273 1.00 0.00 ? 54  THR C CA   1 
ATOM 4813  C C    . THR C 1 54  ? 109.069 145.126 -37.961 1.00 0.00 ? 54  THR C C    1 
ATOM 4814  O O    . THR C 1 54  ? 109.492 146.186 -37.500 1.00 0.00 ? 54  THR C O    1 
ATOM 4815  C CB   . THR C 1 54  ? 106.641 145.199 -37.384 1.00 0.00 ? 54  THR C CB   1 
ATOM 4816  O OG1  . THR C 1 54  ? 105.579 144.496 -36.755 1.00 0.00 ? 54  THR C OG1  1 
ATOM 4817  C CG2  . THR C 1 54  ? 106.303 145.421 -38.859 1.00 0.00 ? 54  THR C CG2  1 
ATOM 4818  H H    . THR C 1 54  ? 108.533 144.906 -35.297 1.00 0.00 ? 54  THR C H    1 
ATOM 4819  H HA   . THR C 1 54  ? 107.783 143.431 -37.777 1.00 0.00 ? 54  THR C HA   1 
ATOM 4820  H HB   . THR C 1 54  ? 106.778 146.155 -36.902 1.00 0.00 ? 54  THR C HB   1 
ATOM 4821  H HG1  . THR C 1 54  ? 105.768 143.556 -36.815 1.00 0.00 ? 54  THR C HG1  1 
ATOM 4822  H HG21 . THR C 1 54  ? 106.347 144.479 -39.383 1.00 0.00 ? 54  THR C HG21 1 
ATOM 4823  H HG22 . THR C 1 54  ? 107.015 146.108 -39.292 1.00 0.00 ? 54  THR C HG22 1 
ATOM 4824  H HG23 . THR C 1 54  ? 105.308 145.833 -38.941 1.00 0.00 ? 54  THR C HG23 1 
ATOM 4825  N N    . VAL C 1 55  ? 109.557 144.563 -39.074 1.00 0.00 ? 55  VAL C N    1 
ATOM 4826  C CA   . VAL C 1 55  ? 110.653 145.171 -39.846 1.00 0.00 ? 55  VAL C CA   1 
ATOM 4827  C C    . VAL C 1 55  ? 110.259 145.279 -41.316 1.00 0.00 ? 55  VAL C C    1 
ATOM 4828  O O    . VAL C 1 55  ? 109.911 144.278 -41.945 1.00 0.00 ? 55  VAL C O    1 
ATOM 4829  C CB   . VAL C 1 55  ? 111.908 144.306 -39.720 1.00 0.00 ? 55  VAL C CB   1 
ATOM 4830  C CG1  . VAL C 1 55  ? 113.039 144.926 -40.540 1.00 0.00 ? 55  VAL C CG1  1 
ATOM 4831  C CG2  . VAL C 1 55  ? 112.328 144.226 -38.251 1.00 0.00 ? 55  VAL C CG2  1 
ATOM 4832  H H    . VAL C 1 55  ? 109.171 143.719 -39.387 1.00 0.00 ? 55  VAL C H    1 
ATOM 4833  H HA   . VAL C 1 55  ? 110.869 146.162 -39.464 1.00 0.00 ? 55  VAL C HA   1 
ATOM 4834  H HB   . VAL C 1 55  ? 111.699 143.313 -40.092 1.00 0.00 ? 55  VAL C HB   1 
ATOM 4835  H HG11 . VAL C 1 55  ? 112.834 144.794 -41.593 1.00 0.00 ? 55  VAL C HG11 1 
ATOM 4836  H HG12 . VAL C 1 55  ? 113.972 144.441 -40.291 1.00 0.00 ? 55  VAL C HG12 1 
ATOM 4837  H HG13 . VAL C 1 55  ? 113.111 145.980 -40.317 1.00 0.00 ? 55  VAL C HG13 1 
ATOM 4838  H HG21 . VAL C 1 55  ? 113.116 143.494 -38.142 1.00 0.00 ? 55  VAL C HG21 1 
ATOM 4839  H HG22 . VAL C 1 55  ? 111.480 143.933 -37.649 1.00 0.00 ? 55  VAL C HG22 1 
ATOM 4840  H HG23 . VAL C 1 55  ? 112.686 145.192 -37.925 1.00 0.00 ? 55  VAL C HG23 1 
ATOM 4841  N N    . ALA C 1 56  ? 110.316 146.496 -41.867 1.00 0.00 ? 56  ALA C N    1 
ATOM 4842  C CA   . ALA C 1 56  ? 109.957 146.713 -43.275 1.00 0.00 ? 56  ALA C CA   1 
ATOM 4843  C C    . ALA C 1 56  ? 111.189 146.607 -44.174 1.00 0.00 ? 56  ALA C C    1 
ATOM 4844  O O    . ALA C 1 56  ? 111.386 145.600 -44.848 1.00 0.00 ? 56  ALA C O    1 
ATOM 4845  C CB   . ALA C 1 56  ? 109.315 148.093 -43.442 1.00 0.00 ? 56  ALA C CB   1 
ATOM 4846  H H    . ALA C 1 56  ? 110.603 147.259 -41.321 1.00 0.00 ? 56  ALA C H    1 
ATOM 4847  H HA   . ALA C 1 56  ? 109.239 145.963 -43.580 1.00 0.00 ? 56  ALA C HA   1 
ATOM 4848  H HB1  . ALA C 1 56  ? 109.985 148.849 -43.071 1.00 0.00 ? 56  ALA C HB1  1 
ATOM 4849  H HB2  . ALA C 1 56  ? 108.389 148.128 -42.886 1.00 0.00 ? 56  ALA C HB2  1 
ATOM 4850  H HB3  . ALA C 1 56  ? 109.113 148.272 -44.488 1.00 0.00 ? 56  ALA C HB3  1 
ATOM 4851  N N    . GLU C 1 57  ? 112.014 147.650 -44.181 1.00 0.00 ? 57  GLU C N    1 
ATOM 4852  C CA   . GLU C 1 57  ? 113.220 147.653 -45.014 1.00 0.00 ? 57  GLU C CA   1 
ATOM 4853  C C    . GLU C 1 57  ? 114.112 146.449 -44.661 1.00 0.00 ? 57  GLU C C    1 
ATOM 4854  O O    . GLU C 1 57  ? 113.662 145.496 -44.025 1.00 0.00 ? 57  GLU C O    1 
ATOM 4855  C CB   . GLU C 1 57  ? 113.996 148.985 -44.807 1.00 0.00 ? 57  GLU C CB   1 
ATOM 4856  C CG   . GLU C 1 57  ? 114.632 149.466 -46.125 1.00 0.00 ? 57  GLU C CG   1 
ATOM 4857  C CD   . GLU C 1 57  ? 113.563 150.067 -47.035 1.00 0.00 ? 57  GLU C CD   1 
ATOM 4858  O OE1  . GLU C 1 57  ? 112.433 150.189 -46.591 1.00 0.00 ? 57  GLU C OE1  1 
ATOM 4859  O OE2  . GLU C 1 57  ? 113.892 150.401 -48.162 1.00 0.00 ? 57  GLU C OE2  1 
ATOM 4860  H H    . GLU C 1 57  ? 111.810 148.431 -43.627 1.00 0.00 ? 57  GLU C H    1 
ATOM 4861  H HA   . GLU C 1 57  ? 112.921 147.571 -46.048 1.00 0.00 ? 57  GLU C HA   1 
ATOM 4862  H HB2  . GLU C 1 57  ? 113.312 149.735 -44.455 1.00 0.00 ? 57  GLU C HB2  1 
ATOM 4863  H HB3  . GLU C 1 57  ? 114.774 148.845 -44.070 1.00 0.00 ? 57  GLU C HB3  1 
ATOM 4864  H HG2  . GLU C 1 57  ? 115.379 150.215 -45.908 1.00 0.00 ? 57  GLU C HG2  1 
ATOM 4865  H HG3  . GLU C 1 57  ? 115.096 148.633 -46.625 1.00 0.00 ? 57  GLU C HG3  1 
ATOM 4866  N N    . LYS C 1 58  ? 115.382 146.509 -45.085 1.00 0.00 ? 58  LYS C N    1 
ATOM 4867  C CA   . LYS C 1 58  ? 116.347 145.426 -44.820 1.00 0.00 ? 58  LYS C CA   1 
ATOM 4868  C C    . LYS C 1 58  ? 117.296 145.820 -43.694 1.00 0.00 ? 58  LYS C C    1 
ATOM 4869  O O    . LYS C 1 58  ? 117.472 146.999 -43.411 1.00 0.00 ? 58  LYS C O    1 
ATOM 4870  C CB   . LYS C 1 58  ? 117.165 145.135 -46.089 1.00 0.00 ? 58  LYS C CB   1 
ATOM 4871  C CG   . LYS C 1 58  ? 117.636 146.445 -46.718 1.00 0.00 ? 58  LYS C CG   1 
ATOM 4872  C CD   . LYS C 1 58  ? 118.450 146.137 -47.973 1.00 0.00 ? 58  LYS C CD   1 
ATOM 4873  C CE   . LYS C 1 58  ? 118.918 147.445 -48.609 1.00 0.00 ? 58  LYS C CE   1 
ATOM 4874  N NZ   . LYS C 1 58  ? 119.723 147.145 -49.826 1.00 0.00 ? 58  LYS C NZ   1 
ATOM 4875  H H    . LYS C 1 58  ? 115.677 147.293 -45.585 1.00 0.00 ? 58  LYS C H    1 
ATOM 4876  H HA   . LYS C 1 58  ? 115.818 144.526 -44.534 1.00 0.00 ? 58  LYS C HA   1 
ATOM 4877  H HB2  . LYS C 1 58  ? 118.030 144.537 -45.834 1.00 0.00 ? 58  LYS C HB2  1 
ATOM 4878  H HB3  . LYS C 1 58  ? 116.552 144.599 -46.796 1.00 0.00 ? 58  LYS C HB3  1 
ATOM 4879  H HG2  . LYS C 1 58  ? 116.781 147.046 -46.983 1.00 0.00 ? 58  LYS C HG2  1 
ATOM 4880  H HG3  . LYS C 1 58  ? 118.253 146.982 -46.013 1.00 0.00 ? 58  LYS C HG3  1 
ATOM 4881  H HD2  . LYS C 1 58  ? 119.309 145.537 -47.707 1.00 0.00 ? 58  LYS C HD2  1 
ATOM 4882  H HD3  . LYS C 1 58  ? 117.837 145.595 -48.677 1.00 0.00 ? 58  LYS C HD3  1 
ATOM 4883  H HE2  . LYS C 1 58  ? 118.058 148.038 -48.882 1.00 0.00 ? 58  LYS C HE2  1 
ATOM 4884  H HE3  . LYS C 1 58  ? 119.523 147.993 -47.902 1.00 0.00 ? 58  LYS C HE3  1 
ATOM 4885  H HZ1  . LYS C 1 58  ? 120.520 147.807 -49.886 1.00 0.00 ? 58  LYS C HZ1  1 
ATOM 4886  H HZ2  . LYS C 1 58  ? 119.122 147.245 -50.671 1.00 0.00 ? 58  LYS C HZ2  1 
ATOM 4887  H HZ3  . LYS C 1 58  ? 120.086 146.173 -49.772 1.00 0.00 ? 58  LYS C HZ3  1 
ATOM 4888  N N    . THR C 1 59  ? 117.908 144.825 -43.057 1.00 0.00 ? 59  THR C N    1 
ATOM 4889  C CA   . THR C 1 59  ? 118.846 145.094 -41.970 1.00 0.00 ? 59  THR C CA   1 
ATOM 4890  C C    . THR C 1 59  ? 120.214 145.464 -42.536 1.00 0.00 ? 59  THR C C    1 
ATOM 4891  O O    . THR C 1 59  ? 120.912 146.321 -41.994 1.00 0.00 ? 59  THR C O    1 
ATOM 4892  C CB   . THR C 1 59  ? 118.980 143.860 -41.070 1.00 0.00 ? 59  THR C CB   1 
ATOM 4893  O OG1  . THR C 1 59  ? 119.462 142.765 -41.838 1.00 0.00 ? 59  THR C OG1  1 
ATOM 4894  C CG2  . THR C 1 59  ? 117.618 143.509 -40.474 1.00 0.00 ? 59  THR C CG2  1 
ATOM 4895  H H    . THR C 1 59  ? 117.733 143.899 -43.326 1.00 0.00 ? 59  THR C H    1 
ATOM 4896  H HA   . THR C 1 59  ? 118.476 145.920 -41.378 1.00 0.00 ? 59  THR C HA   1 
ATOM 4897  H HB   . THR C 1 59  ? 119.674 144.073 -40.272 1.00 0.00 ? 59  THR C HB   1 
ATOM 4898  H HG1  . THR C 1 59  ? 119.071 141.962 -41.486 1.00 0.00 ? 59  THR C HG1  1 
ATOM 4899  H HG21 . THR C 1 59  ? 117.734 142.704 -39.764 1.00 0.00 ? 59  THR C HG21 1 
ATOM 4900  H HG22 . THR C 1 59  ? 116.948 143.200 -41.263 1.00 0.00 ? 59  THR C HG22 1 
ATOM 4901  H HG23 . THR C 1 59  ? 117.209 144.374 -39.973 1.00 0.00 ? 59  THR C HG23 1 
ATOM 4902  N N    . LYS C 1 60  ? 120.587 144.803 -43.634 1.00 0.00 ? 60  LYS C N    1 
ATOM 4903  C CA   . LYS C 1 60  ? 121.871 145.051 -44.284 1.00 0.00 ? 60  LYS C CA   1 
ATOM 4904  C C    . LYS C 1 60  ? 123.024 144.448 -43.454 1.00 0.00 ? 60  LYS C C    1 
ATOM 4905  O O    . LYS C 1 60  ? 123.832 145.180 -42.893 1.00 0.00 ? 60  LYS C O    1 
ATOM 4906  C CB   . LYS C 1 60  ? 122.096 146.559 -44.464 1.00 0.00 ? 60  LYS C CB   1 
ATOM 4907  C CG   . LYS C 1 60  ? 123.061 146.817 -45.642 1.00 0.00 ? 60  LYS C CG   1 
ATOM 4908  C CD   . LYS C 1 60  ? 123.281 148.320 -45.821 1.00 0.00 ? 60  LYS C CD   1 
ATOM 4909  C CE   . LYS C 1 60  ? 123.997 148.576 -47.149 1.00 0.00 ? 60  LYS C CE   1 
ATOM 4910  N NZ   . LYS C 1 60  ? 123.080 148.252 -48.281 1.00 0.00 ? 60  LYS C NZ   1 
ATOM 4911  H H    . LYS C 1 60  ? 119.984 144.127 -44.014 1.00 0.00 ? 60  LYS C H    1 
ATOM 4912  H HA   . LYS C 1 60  ? 121.853 144.598 -45.249 1.00 0.00 ? 60  LYS C HA   1 
ATOM 4913  H HB2  . LYS C 1 60  ? 121.151 147.042 -44.662 1.00 0.00 ? 60  LYS C HB2  1 
ATOM 4914  H HB3  . LYS C 1 60  ? 122.518 146.957 -43.571 1.00 0.00 ? 60  LYS C HB3  1 
ATOM 4915  H HG2  . LYS C 1 60  ? 124.008 146.337 -45.440 1.00 0.00 ? 60  LYS C HG2  1 
ATOM 4916  H HG3  . LYS C 1 60  ? 122.638 146.407 -46.547 1.00 0.00 ? 60  LYS C HG3  1 
ATOM 4917  H HD2  . LYS C 1 60  ? 122.328 148.829 -45.817 1.00 0.00 ? 60  LYS C HD2  1 
ATOM 4918  H HD3  . LYS C 1 60  ? 123.892 148.693 -45.012 1.00 0.00 ? 60  LYS C HD3  1 
ATOM 4919  H HE2  . LYS C 1 60  ? 124.288 149.615 -47.208 1.00 0.00 ? 60  LYS C HE2  1 
ATOM 4920  H HE3  . LYS C 1 60  ? 124.877 147.953 -47.210 1.00 0.00 ? 60  LYS C HE3  1 
ATOM 4921  H HZ1  . LYS C 1 60  ? 123.577 147.657 -48.972 1.00 0.00 ? 60  LYS C HZ1  1 
ATOM 4922  H HZ2  . LYS C 1 60  ? 122.771 149.135 -48.740 1.00 0.00 ? 60  LYS C HZ2  1 
ATOM 4923  H HZ3  . LYS C 1 60  ? 122.250 147.741 -47.919 1.00 0.00 ? 60  LYS C HZ3  1 
ATOM 4924  N N    . GLU C 1 61  ? 123.092 143.114 -43.367 1.00 0.00 ? 61  GLU C N    1 
ATOM 4925  C CA   . GLU C 1 61  ? 124.161 142.452 -42.587 1.00 0.00 ? 61  GLU C CA   1 
ATOM 4926  C C    . GLU C 1 61  ? 125.275 141.963 -43.510 1.00 0.00 ? 61  GLU C C    1 
ATOM 4927  O O    . GLU C 1 61  ? 125.306 140.795 -43.896 1.00 0.00 ? 61  GLU C O    1 
ATOM 4928  C CB   . GLU C 1 61  ? 123.575 141.270 -41.807 1.00 0.00 ? 61  GLU C CB   1 
ATOM 4929  C CG   . GLU C 1 61  ? 122.717 141.798 -40.655 1.00 0.00 ? 61  GLU C CG   1 
ATOM 4930  C CD   . GLU C 1 61  ? 121.937 140.659 -40.008 1.00 0.00 ? 61  GLU C CD   1 
ATOM 4931  O OE1  . GLU C 1 61  ? 121.832 139.614 -40.623 1.00 0.00 ? 61  GLU C OE1  1 
ATOM 4932  O OE2  . GLU C 1 61  ? 121.452 140.851 -38.904 1.00 0.00 ? 61  GLU C OE2  1 
ATOM 4933  H H    . GLU C 1 61  ? 122.421 142.565 -43.824 1.00 0.00 ? 61  GLU C H    1 
ATOM 4934  H HA   . GLU C 1 61  ? 124.582 143.158 -41.877 1.00 0.00 ? 61  GLU C HA   1 
ATOM 4935  H HB2  . GLU C 1 61  ? 122.966 140.669 -42.467 1.00 0.00 ? 61  GLU C HB2  1 
ATOM 4936  H HB3  . GLU C 1 61  ? 124.378 140.667 -41.409 1.00 0.00 ? 61  GLU C HB3  1 
ATOM 4937  H HG2  . GLU C 1 61  ? 123.358 142.253 -39.917 1.00 0.00 ? 61  GLU C HG2  1 
ATOM 4938  H HG3  . GLU C 1 61  ? 122.025 142.536 -41.033 1.00 0.00 ? 61  GLU C HG3  1 
ATOM 4939  N N    . GLN C 1 62  ? 126.190 142.866 -43.864 1.00 0.00 ? 62  GLN C N    1 
ATOM 4940  C CA   . GLN C 1 62  ? 127.292 142.504 -44.751 1.00 0.00 ? 62  GLN C CA   1 
ATOM 4941  C C    . GLN C 1 62  ? 128.321 141.641 -44.023 1.00 0.00 ? 62  GLN C C    1 
ATOM 4942  O O    . GLN C 1 62  ? 128.304 140.417 -44.136 1.00 0.00 ? 62  GLN C O    1 
ATOM 4943  C CB   . GLN C 1 62  ? 127.976 143.765 -45.288 1.00 0.00 ? 62  GLN C CB   1 
ATOM 4944  C CG   . GLN C 1 62  ? 127.043 144.497 -46.254 1.00 0.00 ? 62  GLN C CG   1 
ATOM 4945  C CD   . GLN C 1 62  ? 127.647 145.847 -46.630 1.00 0.00 ? 62  GLN C CD   1 
ATOM 4946  O OE1  . GLN C 1 62  ? 128.442 146.404 -45.874 1.00 0.00 ? 62  GLN C OE1  1 
ATOM 4947  N NE2  . GLN C 1 62  ? 127.316 146.411 -47.759 1.00 0.00 ? 62  GLN C NE2  1 
ATOM 4948  H H    . GLN C 1 62  ? 126.120 143.786 -43.529 1.00 0.00 ? 62  GLN C H    1 
ATOM 4949  H HA   . GLN C 1 62  ? 126.895 141.945 -45.583 1.00 0.00 ? 62  GLN C HA   1 
ATOM 4950  H HB2  . GLN C 1 62  ? 128.222 144.414 -44.467 1.00 0.00 ? 62  GLN C HB2  1 
ATOM 4951  H HB3  . GLN C 1 62  ? 128.880 143.487 -45.807 1.00 0.00 ? 62  GLN C HB3  1 
ATOM 4952  H HG2  . GLN C 1 62  ? 126.909 143.901 -47.145 1.00 0.00 ? 62  GLN C HG2  1 
ATOM 4953  H HG3  . GLN C 1 62  ? 126.086 144.653 -45.779 1.00 0.00 ? 62  GLN C HG3  1 
ATOM 4954  H HE21 . GLN C 1 62  ? 126.683 145.967 -48.362 1.00 0.00 ? 62  GLN C HE21 1 
ATOM 4955  H HE22 . GLN C 1 62  ? 127.701 147.278 -48.005 1.00 0.00 ? 62  GLN C HE22 1 
ATOM 4956  N N    . VAL C 1 63  ? 129.223 142.287 -43.270 1.00 0.00 ? 63  VAL C N    1 
ATOM 4957  C CA   . VAL C 1 63  ? 130.270 141.561 -42.523 1.00 0.00 ? 63  VAL C CA   1 
ATOM 4958  C C    . VAL C 1 63  ? 130.123 141.788 -41.021 1.00 0.00 ? 63  VAL C C    1 
ATOM 4959  O O    . VAL C 1 63  ? 130.176 142.917 -40.544 1.00 0.00 ? 63  VAL C O    1 
ATOM 4960  C CB   . VAL C 1 63  ? 131.654 142.033 -42.978 1.00 0.00 ? 63  VAL C CB   1 
ATOM 4961  C CG1  . VAL C 1 63  ? 132.730 141.278 -42.197 1.00 0.00 ? 63  VAL C CG1  1 
ATOM 4962  C CG2  . VAL C 1 63  ? 131.822 141.751 -44.474 1.00 0.00 ? 63  VAL C CG2  1 
ATOM 4963  H H    . VAL C 1 63  ? 129.190 143.266 -43.216 1.00 0.00 ? 63  VAL C H    1 
ATOM 4964  H HA   . VAL C 1 63  ? 130.191 140.504 -42.720 1.00 0.00 ? 63  VAL C HA   1 
ATOM 4965  H HB   . VAL C 1 63  ? 131.753 143.093 -42.794 1.00 0.00 ? 63  VAL C HB   1 
ATOM 4966  H HG11 . VAL C 1 63  ? 132.502 140.222 -42.201 1.00 0.00 ? 63  VAL C HG11 1 
ATOM 4967  H HG12 . VAL C 1 63  ? 132.756 141.636 -41.179 1.00 0.00 ? 63  VAL C HG12 1 
ATOM 4968  H HG13 . VAL C 1 63  ? 133.693 141.439 -42.661 1.00 0.00 ? 63  VAL C HG13 1 
ATOM 4969  H HG21 . VAL C 1 63  ? 130.974 142.146 -45.013 1.00 0.00 ? 63  VAL C HG21 1 
ATOM 4970  H HG22 . VAL C 1 63  ? 131.886 140.685 -44.635 1.00 0.00 ? 63  VAL C HG22 1 
ATOM 4971  H HG23 . VAL C 1 63  ? 132.727 142.222 -44.830 1.00 0.00 ? 63  VAL C HG23 1 
ATOM 4972  N N    . THR C 1 64  ? 129.945 140.694 -40.272 1.00 0.00 ? 64  THR C N    1 
ATOM 4973  C CA   . THR C 1 64  ? 129.796 140.768 -38.807 1.00 0.00 ? 64  THR C CA   1 
ATOM 4974  C C    . THR C 1 64  ? 130.842 139.888 -38.129 1.00 0.00 ? 64  THR C C    1 
ATOM 4975  O O    . THR C 1 64  ? 130.958 138.703 -38.441 1.00 0.00 ? 64  THR C O    1 
ATOM 4976  C CB   . THR C 1 64  ? 128.397 140.290 -38.406 1.00 0.00 ? 64  THR C CB   1 
ATOM 4977  O OG1  . THR C 1 64  ? 127.420 141.114 -39.030 1.00 0.00 ? 64  THR C OG1  1 
ATOM 4978  C CG2  . THR C 1 64  ? 128.242 140.374 -36.889 1.00 0.00 ? 64  THR C CG2  1 
ATOM 4979  H H    . THR C 1 64  ? 129.916 139.818 -40.710 1.00 0.00 ? 64  THR C H    1 
ATOM 4980  H HA   . THR C 1 64  ? 129.927 141.790 -38.471 1.00 0.00 ? 64  THR C HA   1 
ATOM 4981  H HB   . THR C 1 64  ? 128.261 139.268 -38.722 1.00 0.00 ? 64  THR C HB   1 
ATOM 4982  H HG1  . THR C 1 64  ? 127.555 142.015 -38.729 1.00 0.00 ? 64  THR C HG1  1 
ATOM 4983  H HG21 . THR C 1 64  ? 128.608 141.329 -36.541 1.00 0.00 ? 64  THR C HG21 1 
ATOM 4984  H HG22 . THR C 1 64  ? 128.809 139.581 -36.425 1.00 0.00 ? 64  THR C HG22 1 
ATOM 4985  H HG23 . THR C 1 64  ? 127.199 140.272 -36.627 1.00 0.00 ? 64  THR C HG23 1 
ATOM 4986  N N    . ASN C 1 65  ? 131.604 140.475 -37.194 1.00 0.00 ? 65  ASN C N    1 
ATOM 4987  C CA   . ASN C 1 65  ? 132.649 139.733 -36.467 1.00 0.00 ? 65  ASN C CA   1 
ATOM 4988  C C    . ASN C 1 65  ? 132.515 139.959 -34.959 1.00 0.00 ? 65  ASN C C    1 
ATOM 4989  O O    . ASN C 1 65  ? 132.676 141.077 -34.473 1.00 0.00 ? 65  ASN C O    1 
ATOM 4990  C CB   . ASN C 1 65  ? 134.031 140.199 -36.934 1.00 0.00 ? 65  ASN C CB   1 
ATOM 4991  C CG   . ASN C 1 65  ? 134.186 139.945 -38.431 1.00 0.00 ? 65  ASN C CG   1 
ATOM 4992  O OD1  . ASN C 1 65  ? 133.794 138.890 -38.927 1.00 0.00 ? 65  ASN C OD1  1 
ATOM 4993  N ND2  . ASN C 1 65  ? 134.739 140.856 -39.186 1.00 0.00 ? 65  ASN C ND2  1 
ATOM 4994  H H    . ASN C 1 65  ? 131.462 141.423 -36.989 1.00 0.00 ? 65  ASN C H    1 
ATOM 4995  H HA   . ASN C 1 65  ? 132.554 138.674 -36.668 1.00 0.00 ? 65  ASN C HA   1 
ATOM 4996  H HB2  . ASN C 1 65  ? 134.140 141.254 -36.735 1.00 0.00 ? 65  ASN C HB2  1 
ATOM 4997  H HB3  . ASN C 1 65  ? 134.793 139.653 -36.398 1.00 0.00 ? 65  ASN C HB3  1 
ATOM 4998  H HD21 . ASN C 1 65  ? 135.051 141.696 -38.792 1.00 0.00 ? 65  ASN C HD21 1 
ATOM 4999  H HD22 . ASN C 1 65  ? 134.843 140.698 -40.149 1.00 0.00 ? 65  ASN C HD22 1 
ATOM 5000  N N    . VAL C 1 66  ? 132.216 138.882 -34.223 1.00 0.00 ? 66  VAL C N    1 
ATOM 5001  C CA   . VAL C 1 66  ? 132.057 138.959 -32.759 1.00 0.00 ? 66  VAL C CA   1 
ATOM 5002  C C    . VAL C 1 66  ? 132.830 137.840 -32.068 1.00 0.00 ? 66  VAL C C    1 
ATOM 5003  O O    . VAL C 1 66  ? 132.714 136.671 -32.442 1.00 0.00 ? 66  VAL C O    1 
ATOM 5004  C CB   . VAL C 1 66  ? 130.580 138.853 -32.392 1.00 0.00 ? 66  VAL C CB   1 
ATOM 5005  C CG1  . VAL C 1 66  ? 130.432 138.890 -30.869 1.00 0.00 ? 66  VAL C CG1  1 
ATOM 5006  C CG2  . VAL C 1 66  ? 129.823 140.031 -33.012 1.00 0.00 ? 66  VAL C CG2  1 
ATOM 5007  H H    . VAL C 1 66  ? 132.099 138.016 -34.670 1.00 0.00 ? 66  VAL C H    1 
ATOM 5008  H HA   . VAL C 1 66  ? 132.434 139.910 -32.401 1.00 0.00 ? 66  VAL C HA   1 
ATOM 5009  H HB   . VAL C 1 66  ? 130.179 137.923 -32.771 1.00 0.00 ? 66  VAL C HB   1 
ATOM 5010  H HG11 . VAL C 1 66  ? 131.008 139.712 -30.470 1.00 0.00 ? 66  VAL C HG11 1 
ATOM 5011  H HG12 . VAL C 1 66  ? 130.791 137.962 -30.448 1.00 0.00 ? 66  VAL C HG12 1 
ATOM 5012  H HG13 . VAL C 1 66  ? 129.395 139.020 -30.610 1.00 0.00 ? 66  VAL C HG13 1 
ATOM 5013  H HG21 . VAL C 1 66  ? 130.004 140.055 -34.076 1.00 0.00 ? 66  VAL C HG21 1 
ATOM 5014  H HG22 . VAL C 1 66  ? 130.166 140.954 -32.569 1.00 0.00 ? 66  VAL C HG22 1 
ATOM 5015  H HG23 . VAL C 1 66  ? 128.767 139.916 -32.831 1.00 0.00 ? 66  VAL C HG23 1 
ATOM 5016  N N    . GLY C 1 67  ? 133.613 138.203 -31.056 1.00 0.00 ? 67  GLY C N    1 
ATOM 5017  C CA   . GLY C 1 67  ? 134.394 137.217 -30.316 1.00 0.00 ? 67  GLY C CA   1 
ATOM 5018  C C    . GLY C 1 67  ? 133.519 136.451 -29.323 1.00 0.00 ? 67  GLY C C    1 
ATOM 5019  O O    . GLY C 1 67  ? 133.419 135.226 -29.391 1.00 0.00 ? 67  GLY C O    1 
ATOM 5020  H H    . GLY C 1 67  ? 133.662 139.148 -30.799 1.00 0.00 ? 67  GLY C H    1 
ATOM 5021  H HA2  . GLY C 1 67  ? 134.835 136.519 -31.014 1.00 0.00 ? 67  GLY C HA2  1 
ATOM 5022  H HA3  . GLY C 1 67  ? 135.180 137.722 -29.775 1.00 0.00 ? 67  GLY C HA3  1 
ATOM 5023  N N    . GLY C 1 68  ? 132.893 137.181 -28.400 1.00 0.00 ? 68  GLY C N    1 
ATOM 5024  C CA   . GLY C 1 68  ? 132.036 136.554 -27.394 1.00 0.00 ? 68  GLY C CA   1 
ATOM 5025  C C    . GLY C 1 68  ? 130.714 136.089 -28.000 1.00 0.00 ? 68  GLY C C    1 
ATOM 5026  O O    . GLY C 1 68  ? 130.672 135.101 -28.731 1.00 0.00 ? 68  GLY C O    1 
ATOM 5027  H H    . GLY C 1 68  ? 133.013 138.154 -28.389 1.00 0.00 ? 68  GLY C H    1 
ATOM 5028  H HA2  . GLY C 1 68  ? 132.551 135.700 -26.976 1.00 0.00 ? 68  GLY C HA2  1 
ATOM 5029  H HA3  . GLY C 1 68  ? 131.833 137.263 -26.608 1.00 0.00 ? 68  GLY C HA3  1 
ATOM 5030  N N    . ALA C 1 69  ? 129.628 136.802 -27.681 1.00 0.00 ? 69  ALA C N    1 
ATOM 5031  C CA   . ALA C 1 69  ? 128.294 136.448 -28.191 1.00 0.00 ? 69  ALA C CA   1 
ATOM 5032  C C    . ALA C 1 69  ? 127.514 137.702 -28.577 1.00 0.00 ? 69  ALA C C    1 
ATOM 5033  O O    . ALA C 1 69  ? 127.760 138.789 -28.051 1.00 0.00 ? 69  ALA C O    1 
ATOM 5034  C CB   . ALA C 1 69  ? 127.518 135.678 -27.120 1.00 0.00 ? 69  ALA C CB   1 
ATOM 5035  H H    . ALA C 1 69  ? 129.723 137.575 -27.086 1.00 0.00 ? 69  ALA C H    1 
ATOM 5036  H HA   . ALA C 1 69  ? 128.394 135.818 -29.066 1.00 0.00 ? 69  ALA C HA   1 
ATOM 5037  H HB1  . ALA C 1 69  ? 127.400 136.300 -26.244 1.00 0.00 ? 69  ALA C HB1  1 
ATOM 5038  H HB2  . ALA C 1 69  ? 128.061 134.784 -26.855 1.00 0.00 ? 69  ALA C HB2  1 
ATOM 5039  H HB3  . ALA C 1 69  ? 126.544 135.409 -27.504 1.00 0.00 ? 69  ALA C HB3  1 
ATOM 5040  N N    . VAL C 1 70  ? 126.563 137.541 -29.507 1.00 0.00 ? 70  VAL C N    1 
ATOM 5041  C CA   . VAL C 1 70  ? 125.739 138.668 -29.971 1.00 0.00 ? 70  VAL C CA   1 
ATOM 5042  C C    . VAL C 1 70  ? 124.283 138.245 -30.166 1.00 0.00 ? 70  VAL C C    1 
ATOM 5043  O O    . VAL C 1 70  ? 123.994 137.235 -30.804 1.00 0.00 ? 70  VAL C O    1 
ATOM 5044  C CB   . VAL C 1 70  ? 126.313 139.224 -31.288 1.00 0.00 ? 70  VAL C CB   1 
ATOM 5045  C CG1  . VAL C 1 70  ? 126.598 138.064 -32.248 1.00 0.00 ? 70  VAL C CG1  1 
ATOM 5046  C CG2  . VAL C 1 70  ? 125.313 140.208 -31.944 1.00 0.00 ? 70  VAL C CG2  1 
ATOM 5047  H H    . VAL C 1 70  ? 126.415 136.647 -29.890 1.00 0.00 ? 70  VAL C H    1 
ATOM 5048  H HA   . VAL C 1 70  ? 125.766 139.450 -29.230 1.00 0.00 ? 70  VAL C HA   1 
ATOM 5049  H HB   . VAL C 1 70  ? 127.234 139.740 -31.077 1.00 0.00 ? 70  VAL C HB   1 
ATOM 5050  H HG11 . VAL C 1 70  ? 127.334 137.405 -31.810 1.00 0.00 ? 70  VAL C HG11 1 
ATOM 5051  H HG12 . VAL C 1 70  ? 126.974 138.452 -33.182 1.00 0.00 ? 70  VAL C HG12 1 
ATOM 5052  H HG13 . VAL C 1 70  ? 125.689 137.519 -32.426 1.00 0.00 ? 70  VAL C HG13 1 
ATOM 5053  H HG21 . VAL C 1 70  ? 124.809 140.777 -31.176 1.00 0.00 ? 70  VAL C HG21 1 
ATOM 5054  H HG22 . VAL C 1 70  ? 124.580 139.658 -32.517 1.00 0.00 ? 70  VAL C HG22 1 
ATOM 5055  H HG23 . VAL C 1 70  ? 125.848 140.881 -32.597 1.00 0.00 ? 70  VAL C HG23 1 
ATOM 5056  N N    . VAL C 1 71  ? 123.366 139.042 -29.615 1.00 0.00 ? 71  VAL C N    1 
ATOM 5057  C CA   . VAL C 1 71  ? 121.925 138.766 -29.732 1.00 0.00 ? 71  VAL C CA   1 
ATOM 5058  C C    . VAL C 1 71  ? 121.201 139.992 -30.272 1.00 0.00 ? 71  VAL C C    1 
ATOM 5059  O O    . VAL C 1 71  ? 121.292 141.078 -29.702 1.00 0.00 ? 71  VAL C O    1 
ATOM 5060  C CB   . VAL C 1 71  ? 121.356 138.395 -28.361 1.00 0.00 ? 71  VAL C CB   1 
ATOM 5061  C CG1  . VAL C 1 71  ? 119.860 138.097 -28.489 1.00 0.00 ? 71  VAL C CG1  1 
ATOM 5062  C CG2  . VAL C 1 71  ? 122.078 137.158 -27.832 1.00 0.00 ? 71  VAL C CG2  1 
ATOM 5063  H H    . VAL C 1 71  ? 123.662 139.842 -29.125 1.00 0.00 ? 71  VAL C H    1 
ATOM 5064  H HA   . VAL C 1 71  ? 121.763 137.938 -30.411 1.00 0.00 ? 71  VAL C HA   1 
ATOM 5065  H HB   . VAL C 1 71  ? 121.501 139.219 -27.677 1.00 0.00 ? 71  VAL C HB   1 
ATOM 5066  H HG11 . VAL C 1 71  ? 119.500 137.661 -27.568 1.00 0.00 ? 71  VAL C HG11 1 
ATOM 5067  H HG12 . VAL C 1 71  ? 119.700 137.402 -29.301 1.00 0.00 ? 71  VAL C HG12 1 
ATOM 5068  H HG13 . VAL C 1 71  ? 119.324 139.013 -28.687 1.00 0.00 ? 71  VAL C HG13 1 
ATOM 5069  H HG21 . VAL C 1 71  ? 123.144 137.277 -27.963 1.00 0.00 ? 71  VAL C HG21 1 
ATOM 5070  H HG22 . VAL C 1 71  ? 121.744 136.286 -28.374 1.00 0.00 ? 71  VAL C HG22 1 
ATOM 5071  H HG23 . VAL C 1 71  ? 121.857 137.036 -26.787 1.00 0.00 ? 71  VAL C HG23 1 
ATOM 5072  N N    . THR C 1 72  ? 120.477 139.820 -31.382 1.00 0.00 ? 72  THR C N    1 
ATOM 5073  C CA   . THR C 1 72  ? 119.736 140.936 -32.000 1.00 0.00 ? 72  THR C CA   1 
ATOM 5074  C C    . THR C 1 72  ? 118.265 140.573 -32.187 1.00 0.00 ? 72  THR C C    1 
ATOM 5075  O O    . THR C 1 72  ? 117.928 139.419 -32.453 1.00 0.00 ? 72  THR C O    1 
ATOM 5076  C CB   . THR C 1 72  ? 120.357 141.265 -33.364 1.00 0.00 ? 72  THR C CB   1 
ATOM 5077  O OG1  . THR C 1 72  ? 120.247 140.135 -34.219 1.00 0.00 ? 72  THR C OG1  1 
ATOM 5078  C CG2  . THR C 1 72  ? 121.834 141.626 -33.183 1.00 0.00 ? 72  THR C CG2  1 
ATOM 5079  H H    . THR C 1 72  ? 120.441 138.930 -31.797 1.00 0.00 ? 72  THR C H    1 
ATOM 5080  H HA   . THR C 1 72  ? 119.800 141.814 -31.372 1.00 0.00 ? 72  THR C HA   1 
ATOM 5081  H HB   . THR C 1 72  ? 119.837 142.101 -33.805 1.00 0.00 ? 72  THR C HB   1 
ATOM 5082  H HG1  . THR C 1 72  ? 120.436 140.421 -35.117 1.00 0.00 ? 72  THR C HG1  1 
ATOM 5083  H HG21 . THR C 1 72  ? 122.406 140.725 -33.012 1.00 0.00 ? 72  THR C HG21 1 
ATOM 5084  H HG22 . THR C 1 72  ? 121.942 142.287 -32.337 1.00 0.00 ? 72  THR C HG22 1 
ATOM 5085  H HG23 . THR C 1 72  ? 122.196 142.119 -34.074 1.00 0.00 ? 72  THR C HG23 1 
ATOM 5086  N N    . GLY C 1 73  ? 117.387 141.577 -32.057 1.00 0.00 ? 73  GLY C N    1 
ATOM 5087  C CA   . GLY C 1 73  ? 115.936 141.363 -32.222 1.00 0.00 ? 73  GLY C CA   1 
ATOM 5088  C C    . GLY C 1 73  ? 115.177 141.697 -30.940 1.00 0.00 ? 73  GLY C C    1 
ATOM 5089  O O    . GLY C 1 73  ? 115.312 142.790 -30.395 1.00 0.00 ? 73  GLY C O    1 
ATOM 5090  H H    . GLY C 1 73  ? 117.719 142.479 -31.848 1.00 0.00 ? 73  GLY C H    1 
ATOM 5091  H HA2  . GLY C 1 73  ? 115.577 142.001 -33.017 1.00 0.00 ? 73  GLY C HA2  1 
ATOM 5092  H HA3  . GLY C 1 73  ? 115.741 140.334 -32.485 1.00 0.00 ? 73  GLY C HA3  1 
ATOM 5093  N N    . VAL C 1 74  ? 114.363 140.747 -30.464 1.00 0.00 ? 74  VAL C N    1 
ATOM 5094  C CA   . VAL C 1 74  ? 113.570 140.956 -29.240 1.00 0.00 ? 74  VAL C CA   1 
ATOM 5095  C C    . VAL C 1 74  ? 113.544 139.690 -28.373 1.00 0.00 ? 74  VAL C C    1 
ATOM 5096  O O    . VAL C 1 74  ? 113.246 138.602 -28.846 1.00 0.00 ? 74  VAL C O    1 
ATOM 5097  C CB   . VAL C 1 74  ? 112.134 141.377 -29.623 1.00 0.00 ? 74  VAL C CB   1 
ATOM 5098  C CG1  . VAL C 1 74  ? 111.594 140.446 -30.710 1.00 0.00 ? 74  VAL C CG1  1 
ATOM 5099  C CG2  . VAL C 1 74  ? 111.209 141.314 -28.383 1.00 0.00 ? 74  VAL C CG2  1 
ATOM 5100  H H    . VAL C 1 74  ? 114.288 139.896 -30.945 1.00 0.00 ? 74  VAL C H    1 
ATOM 5101  H HA   . VAL C 1 74  ? 114.013 141.750 -28.664 1.00 0.00 ? 74  VAL C HA   1 
ATOM 5102  H HB   . VAL C 1 74  ? 112.151 142.387 -30.005 1.00 0.00 ? 74  VAL C HB   1 
ATOM 5103  H HG11 . VAL C 1 74  ? 110.556 140.674 -30.899 1.00 0.00 ? 74  VAL C HG11 1 
ATOM 5104  H HG12 . VAL C 1 74  ? 111.684 139.427 -30.385 1.00 0.00 ? 74  VAL C HG12 1 
ATOM 5105  H HG13 . VAL C 1 74  ? 112.163 140.585 -31.618 1.00 0.00 ? 74  VAL C HG13 1 
ATOM 5106  H HG21 . VAL C 1 74  ? 110.345 141.942 -28.547 1.00 0.00 ? 74  VAL C HG21 1 
ATOM 5107  H HG22 . VAL C 1 74  ? 111.746 141.663 -27.514 1.00 0.00 ? 74  VAL C HG22 1 
ATOM 5108  H HG23 . VAL C 1 74  ? 110.888 140.296 -28.219 1.00 0.00 ? 74  VAL C HG23 1 
ATOM 5109  N N    . THR C 1 75  ? 113.847 139.857 -27.083 1.00 0.00 ? 75  THR C N    1 
ATOM 5110  C CA   . THR C 1 75  ? 113.844 138.734 -26.130 1.00 0.00 ? 75  THR C CA   1 
ATOM 5111  C C    . THR C 1 75  ? 113.041 139.114 -24.897 1.00 0.00 ? 75  THR C C    1 
ATOM 5112  O O    . THR C 1 75  ? 113.278 140.157 -24.296 1.00 0.00 ? 75  THR C O    1 
ATOM 5113  C CB   . THR C 1 75  ? 115.275 138.390 -25.712 1.00 0.00 ? 75  THR C CB   1 
ATOM 5114  O OG1  . THR C 1 75  ? 116.028 138.042 -26.864 1.00 0.00 ? 75  THR C OG1  1 
ATOM 5115  C CG2  . THR C 1 75  ? 115.251 137.212 -24.736 1.00 0.00 ? 75  THR C CG2  1 
ATOM 5116  H H    . THR C 1 75  ? 114.068 140.756 -26.758 1.00 0.00 ? 75  THR C H    1 
ATOM 5117  H HA   . THR C 1 75  ? 113.393 137.865 -26.587 1.00 0.00 ? 75  THR C HA   1 
ATOM 5118  H HB   . THR C 1 75  ? 115.725 139.243 -25.231 1.00 0.00 ? 75  THR C HB   1 
ATOM 5119  H HG1  . THR C 1 75  ? 115.803 138.660 -27.562 1.00 0.00 ? 75  THR C HG1  1 
ATOM 5120  H HG21 . THR C 1 75  ? 116.247 136.807 -24.635 1.00 0.00 ? 75  THR C HG21 1 
ATOM 5121  H HG22 . THR C 1 75  ? 114.587 136.445 -25.110 1.00 0.00 ? 75  THR C HG22 1 
ATOM 5122  H HG23 . THR C 1 75  ? 114.900 137.551 -23.772 1.00 0.00 ? 75  THR C HG23 1 
ATOM 5123  N N    . ALA C 1 76  ? 112.082 138.269 -24.510 1.00 0.00 ? 76  ALA C N    1 
ATOM 5124  C CA   . ALA C 1 76  ? 111.253 138.558 -23.330 1.00 0.00 ? 76  ALA C CA   1 
ATOM 5125  C C    . ALA C 1 76  ? 111.026 137.305 -22.494 1.00 0.00 ? 76  ALA C C    1 
ATOM 5126  O O    . ALA C 1 76  ? 110.786 136.238 -23.024 1.00 0.00 ? 76  ALA C O    1 
ATOM 5127  C CB   . ALA C 1 76  ? 109.909 139.129 -23.769 1.00 0.00 ? 76  ALA C CB   1 
ATOM 5128  H H    . ALA C 1 76  ? 111.926 137.446 -25.021 1.00 0.00 ? 76  ALA C H    1 
ATOM 5129  H HA   . ALA C 1 76  ? 111.748 139.284 -22.721 1.00 0.00 ? 76  ALA C HA   1 
ATOM 5130  H HB1  . ALA C 1 76  ? 110.058 140.109 -24.197 1.00 0.00 ? 76  ALA C HB1  1 
ATOM 5131  H HB2  . ALA C 1 76  ? 109.261 139.205 -22.914 1.00 0.00 ? 76  ALA C HB2  1 
ATOM 5132  H HB3  . ALA C 1 76  ? 109.462 138.477 -24.504 1.00 0.00 ? 76  ALA C HB3  1 
ATOM 5133  N N    . VAL C 1 77  ? 111.095 137.437 -21.168 1.00 0.00 ? 77  VAL C N    1 
ATOM 5134  C CA   . VAL C 1 77  ? 110.883 136.278 -20.286 1.00 0.00 ? 77  VAL C CA   1 
ATOM 5135  C C    . VAL C 1 77  ? 110.067 136.678 -19.055 1.00 0.00 ? 77  VAL C C    1 
ATOM 5136  O O    . VAL C 1 77  ? 110.232 137.773 -18.517 1.00 0.00 ? 77  VAL C O    1 
ATOM 5137  C CB   . VAL C 1 77  ? 112.249 135.697 -19.855 1.00 0.00 ? 77  VAL C CB   1 
ATOM 5138  C CG1  . VAL C 1 77  ? 113.180 135.604 -21.080 1.00 0.00 ? 77  VAL C CG1  1 
ATOM 5139  C CG2  . VAL C 1 77  ? 112.894 136.595 -18.791 1.00 0.00 ? 77  VAL C CG2  1 
ATOM 5140  H H    . VAL C 1 77  ? 111.285 138.316 -20.778 1.00 0.00 ? 77  VAL C H    1 
ATOM 5141  H HA   . VAL C 1 77  ? 110.334 135.512 -20.820 1.00 0.00 ? 77  VAL C HA   1 
ATOM 5142  H HB   . VAL C 1 77  ? 112.099 134.709 -19.445 1.00 0.00 ? 77  VAL C HB   1 
ATOM 5143  H HG11 . VAL C 1 77  ? 113.979 134.910 -20.871 1.00 0.00 ? 77  VAL C HG11 1 
ATOM 5144  H HG12 . VAL C 1 77  ? 113.597 136.578 -21.291 1.00 0.00 ? 77  VAL C HG12 1 
ATOM 5145  H HG13 . VAL C 1 77  ? 112.625 135.264 -21.938 1.00 0.00 ? 77  VAL C HG13 1 
ATOM 5146  H HG21 . VAL C 1 77  ? 112.747 137.622 -19.060 1.00 0.00 ? 77  VAL C HG21 1 
ATOM 5147  H HG22 . VAL C 1 77  ? 113.953 136.386 -18.729 1.00 0.00 ? 77  VAL C HG22 1 
ATOM 5148  H HG23 . VAL C 1 77  ? 112.435 136.405 -17.832 1.00 0.00 ? 77  VAL C HG23 1 
ATOM 5149  N N    . ALA C 1 78  ? 109.194 135.771 -18.610 1.00 0.00 ? 78  ALA C N    1 
ATOM 5150  C CA   . ALA C 1 78  ? 108.353 136.013 -17.428 1.00 0.00 ? 78  ALA C CA   1 
ATOM 5151  C C    . ALA C 1 78  ? 108.718 135.022 -16.331 1.00 0.00 ? 78  ALA C C    1 
ATOM 5152  O O    . ALA C 1 78  ? 108.573 133.818 -16.510 1.00 0.00 ? 78  ALA C O    1 
ATOM 5153  C CB   . ALA C 1 78  ? 106.879 135.841 -17.795 1.00 0.00 ? 78  ALA C CB   1 
ATOM 5154  H H    . ALA C 1 78  ? 109.117 134.914 -19.080 1.00 0.00 ? 78  ALA C H    1 
ATOM 5155  H HA   . ALA C 1 78  ? 108.509 137.021 -17.060 1.00 0.00 ? 78  ALA C HA   1 
ATOM 5156  H HB1  . ALA C 1 78  ? 106.263 136.208 -16.987 1.00 0.00 ? 78  ALA C HB1  1 
ATOM 5157  H HB2  . ALA C 1 78  ? 106.669 134.795 -17.962 1.00 0.00 ? 78  ALA C HB2  1 
ATOM 5158  H HB3  . ALA C 1 78  ? 106.664 136.400 -18.693 1.00 0.00 ? 78  ALA C HB3  1 
ATOM 5159  N N    . GLN C 1 79  ? 109.197 135.539 -15.198 1.00 0.00 ? 79  GLN C N    1 
ATOM 5160  C CA   . GLN C 1 79  ? 109.587 134.694 -14.061 1.00 0.00 ? 79  GLN C CA   1 
ATOM 5161  C C    . GLN C 1 79  ? 109.153 135.361 -12.757 1.00 0.00 ? 79  GLN C C    1 
ATOM 5162  O O    . GLN C 1 79  ? 108.884 136.558 -12.732 1.00 0.00 ? 79  GLN C O    1 
ATOM 5163  C CB   . GLN C 1 79  ? 111.110 134.496 -14.056 1.00 0.00 ? 79  GLN C CB   1 
ATOM 5164  C CG   . GLN C 1 79  ? 111.596 134.206 -15.477 1.00 0.00 ? 79  GLN C CG   1 
ATOM 5165  C CD   . GLN C 1 79  ? 113.090 133.905 -15.467 1.00 0.00 ? 79  GLN C CD   1 
ATOM 5166  O OE1  . GLN C 1 79  ? 113.890 134.736 -15.036 1.00 0.00 ? 79  GLN C OE1  1 
ATOM 5167  N NE2  . GLN C 1 79  ? 113.517 132.757 -15.917 1.00 0.00 ? 79  GLN C NE2  1 
ATOM 5168  H H    . GLN C 1 79  ? 109.292 136.509 -15.121 1.00 0.00 ? 79  GLN C H    1 
ATOM 5169  H HA   . GLN C 1 79  ? 109.107 133.729 -14.138 1.00 0.00 ? 79  GLN C HA   1 
ATOM 5170  H HB2  . GLN C 1 79  ? 111.587 135.387 -13.688 1.00 0.00 ? 79  GLN C HB2  1 
ATOM 5171  H HB3  . GLN C 1 79  ? 111.361 133.663 -13.417 1.00 0.00 ? 79  GLN C HB3  1 
ATOM 5172  H HG2  . GLN C 1 79  ? 111.062 133.361 -15.872 1.00 0.00 ? 79  GLN C HG2  1 
ATOM 5173  H HG3  . GLN C 1 79  ? 111.412 135.068 -16.100 1.00 0.00 ? 79  GLN C HG3  1 
ATOM 5174  H HE21 . GLN C 1 79  ? 112.879 132.096 -16.258 1.00 0.00 ? 79  GLN C HE21 1 
ATOM 5175  H HE22 . GLN C 1 79  ? 114.475 132.556 -15.912 1.00 0.00 ? 79  GLN C HE22 1 
ATOM 5176  N N    . LYS C 1 80  ? 109.083 134.586 -11.667 1.00 0.00 ? 80  LYS C N    1 
ATOM 5177  C CA   . LYS C 1 80  ? 108.683 135.135 -10.355 1.00 0.00 ? 80  LYS C CA   1 
ATOM 5178  C C    . LYS C 1 80  ? 109.852 135.059 -9.382  1.00 0.00 ? 80  LYS C C    1 
ATOM 5179  O O    . LYS C 1 80  ? 110.336 136.080 -8.905  1.00 0.00 ? 80  LYS C O    1 
ATOM 5180  C CB   . LYS C 1 80  ? 107.491 134.352 -9.793  1.00 0.00 ? 80  LYS C CB   1 
ATOM 5181  C CG   . LYS C 1 80  ? 106.865 135.125 -8.627  1.00 0.00 ? 80  LYS C CG   1 
ATOM 5182  C CD   . LYS C 1 80  ? 105.595 134.405 -8.172  1.00 0.00 ? 80  LYS C CD   1 
ATOM 5183  C CE   . LYS C 1 80  ? 104.907 135.215 -7.072  1.00 0.00 ? 80  LYS C CE   1 
ATOM 5184  N NZ   . LYS C 1 80  ? 103.643 134.533 -6.677  1.00 0.00 ? 80  LYS C NZ   1 
ATOM 5185  H H    . LYS C 1 80  ? 109.309 133.636 -11.740 1.00 0.00 ? 80  LYS C H    1 
ATOM 5186  H HA   . LYS C 1 80  ? 108.394 136.175 -10.465 1.00 0.00 ? 80  LYS C HA   1 
ATOM 5187  H HB2  . LYS C 1 80  ? 106.753 134.211 -10.569 1.00 0.00 ? 80  LYS C HB2  1 
ATOM 5188  H HB3  . LYS C 1 80  ? 107.827 133.392 -9.438  1.00 0.00 ? 80  LYS C HB3  1 
ATOM 5189  H HG2  . LYS C 1 80  ? 107.569 135.173 -7.808  1.00 0.00 ? 80  LYS C HG2  1 
ATOM 5190  H HG3  . LYS C 1 80  ? 106.615 136.125 -8.947  1.00 0.00 ? 80  LYS C HG3  1 
ATOM 5191  H HD2  . LYS C 1 80  ? 104.925 134.295 -9.011  1.00 0.00 ? 80  LYS C HD2  1 
ATOM 5192  H HD3  . LYS C 1 80  ? 105.854 133.430 -7.787  1.00 0.00 ? 80  LYS C HD3  1 
ATOM 5193  H HE2  . LYS C 1 80  ? 105.561 135.288 -6.215  1.00 0.00 ? 80  LYS C HE2  1 
ATOM 5194  H HE3  . LYS C 1 80  ? 104.684 136.205 -7.439  1.00 0.00 ? 80  LYS C HE3  1 
ATOM 5195  H HZ1  . LYS C 1 80  ? 103.352 133.879 -7.431  1.00 0.00 ? 80  LYS C HZ1  1 
ATOM 5196  H HZ2  . LYS C 1 80  ? 102.898 135.245 -6.528  1.00 0.00 ? 80  LYS C HZ2  1 
ATOM 5197  H HZ3  . LYS C 1 80  ? 103.795 134.000 -5.798  1.00 0.00 ? 80  LYS C HZ3  1 
ATOM 5198  N N    . THR C 1 81  ? 110.319 133.838 -9.098  1.00 0.00 ? 81  THR C N    1 
ATOM 5199  C CA   . THR C 1 81  ? 111.450 133.647 -8.173  1.00 0.00 ? 81  THR C CA   1 
ATOM 5200  C C    . THR C 1 81  ? 112.448 132.636 -8.733  1.00 0.00 ? 81  THR C C    1 
ATOM 5201  O O    . THR C 1 81  ? 112.070 131.672 -9.386  1.00 0.00 ? 81  THR C O    1 
ATOM 5202  C CB   . THR C 1 81  ? 110.931 133.152 -6.820  1.00 0.00 ? 81  THR C CB   1 
ATOM 5203  O OG1  . THR C 1 81  ? 112.016 133.043 -5.908  1.00 0.00 ? 81  THR C OG1  1 
ATOM 5204  C CG2  . THR C 1 81  ? 110.269 131.784 -6.994  1.00 0.00 ? 81  THR C CG2  1 
ATOM 5205  H H    . THR C 1 81  ? 109.902 133.054 -9.516  1.00 0.00 ? 81  THR C H    1 
ATOM 5206  H HA   . THR C 1 81  ? 111.958 134.585 -8.025  1.00 0.00 ? 81  THR C HA   1 
ATOM 5207  H HB   . THR C 1 81  ? 110.207 133.851 -6.436  1.00 0.00 ? 81  THR C HB   1 
ATOM 5208  H HG1  . THR C 1 81  ? 112.531 132.271 -6.150  1.00 0.00 ? 81  THR C HG1  1 
ATOM 5209  H HG21 . THR C 1 81  ? 109.617 131.807 -7.856  1.00 0.00 ? 81  THR C HG21 1 
ATOM 5210  H HG22 . THR C 1 81  ? 109.691 131.548 -6.113  1.00 0.00 ? 81  THR C HG22 1 
ATOM 5211  H HG23 . THR C 1 81  ? 111.030 131.032 -7.139  1.00 0.00 ? 81  THR C HG23 1 
ATOM 5212  N N    . VAL C 1 82  ? 113.738 132.866 -8.470  1.00 0.00 ? 82  VAL C N    1 
ATOM 5213  C CA   . VAL C 1 82  ? 114.796 131.964 -8.956  1.00 0.00 ? 82  VAL C CA   1 
ATOM 5214  C C    . VAL C 1 82  ? 115.907 131.822 -7.914  1.00 0.00 ? 82  VAL C C    1 
ATOM 5215  O O    . VAL C 1 82  ? 116.246 132.773 -7.218  1.00 0.00 ? 82  VAL C O    1 
ATOM 5216  C CB   . VAL C 1 82  ? 115.369 132.501 -10.285 1.00 0.00 ? 82  VAL C CB   1 
ATOM 5217  C CG1  . VAL C 1 82  ? 115.687 133.991 -10.141 1.00 0.00 ? 82  VAL C CG1  1 
ATOM 5218  C CG2  . VAL C 1 82  ? 116.655 131.731 -10.661 1.00 0.00 ? 82  VAL C CG2  1 
ATOM 5219  H H    . VAL C 1 82  ? 113.986 133.654 -7.941  1.00 0.00 ? 82  VAL C H    1 
ATOM 5220  H HA   . VAL C 1 82  ? 114.374 130.991 -9.135  1.00 0.00 ? 82  VAL C HA   1 
ATOM 5221  H HB   . VAL C 1 82  ? 114.632 132.372 -11.065 1.00 0.00 ? 82  VAL C HB   1 
ATOM 5222  H HG11 . VAL C 1 82  ? 116.174 134.163 -9.198  1.00 0.00 ? 82  VAL C HG11 1 
ATOM 5223  H HG12 . VAL C 1 82  ? 114.770 134.560 -10.181 1.00 0.00 ? 82  VAL C HG12 1 
ATOM 5224  H HG13 . VAL C 1 82  ? 116.338 134.301 -10.946 1.00 0.00 ? 82  VAL C HG13 1 
ATOM 5225  H HG21 . VAL C 1 82  ? 116.536 130.686 -10.420 1.00 0.00 ? 82  VAL C HG21 1 
ATOM 5226  H HG22 . VAL C 1 82  ? 117.495 132.131 -10.111 1.00 0.00 ? 82  VAL C HG22 1 
ATOM 5227  H HG23 . VAL C 1 82  ? 116.838 131.836 -11.721 1.00 0.00 ? 82  VAL C HG23 1 
ATOM 5228  N N    . GLU C 1 83  ? 116.476 130.618 -7.812  1.00 0.00 ? 83  GLU C N    1 
ATOM 5229  C CA   . GLU C 1 83  ? 117.555 130.362 -6.847  1.00 0.00 ? 83  GLU C CA   1 
ATOM 5230  C C    . GLU C 1 83  ? 118.547 129.339 -7.398  1.00 0.00 ? 83  GLU C C    1 
ATOM 5231  O O    . GLU C 1 83  ? 118.163 128.402 -8.090  1.00 0.00 ? 83  GLU C O    1 
ATOM 5232  C CB   . GLU C 1 83  ? 116.962 129.845 -5.532  1.00 0.00 ? 83  GLU C CB   1 
ATOM 5233  C CG   . GLU C 1 83  ? 116.198 128.544 -5.786  1.00 0.00 ? 83  GLU C CG   1 
ATOM 5234  C CD   . GLU C 1 83  ? 115.513 128.080 -4.505  1.00 0.00 ? 83  GLU C CD   1 
ATOM 5235  O OE1  . GLU C 1 83  ? 115.648 128.764 -3.503  1.00 0.00 ? 83  GLU C OE1  1 
ATOM 5236  O OE2  . GLU C 1 83  ? 114.863 127.048 -4.545  1.00 0.00 ? 83  GLU C OE2  1 
ATOM 5237  H H    . GLU C 1 83  ? 116.167 129.890 -8.394  1.00 0.00 ? 83  GLU C H    1 
ATOM 5238  H HA   . GLU C 1 83  ? 118.082 131.280 -6.651  1.00 0.00 ? 83  GLU C HA   1 
ATOM 5239  H HB2  . GLU C 1 83  ? 117.758 129.664 -4.824  1.00 0.00 ? 83  GLU C HB2  1 
ATOM 5240  H HB3  . GLU C 1 83  ? 116.286 130.584 -5.127  1.00 0.00 ? 83  GLU C HB3  1 
ATOM 5241  H HG2  . GLU C 1 83  ? 115.454 128.709 -6.551  1.00 0.00 ? 83  GLU C HG2  1 
ATOM 5242  H HG3  . GLU C 1 83  ? 116.888 127.782 -6.117  1.00 0.00 ? 83  GLU C HG3  1 
ATOM 5243  N N    . GLY C 1 84  ? 119.829 129.528 -7.082  1.00 0.00 ? 84  GLY C N    1 
ATOM 5244  C CA   . GLY C 1 84  ? 120.870 128.608 -7.552  1.00 0.00 ? 84  GLY C CA   1 
ATOM 5245  C C    . GLY C 1 84  ? 122.217 129.313 -7.660  1.00 0.00 ? 84  GLY C C    1 
ATOM 5246  O O    . GLY C 1 84  ? 122.323 130.392 -8.241  1.00 0.00 ? 84  GLY C O    1 
ATOM 5247  H H    . GLY C 1 84  ? 120.079 130.294 -6.524  1.00 0.00 ? 84  GLY C H    1 
ATOM 5248  H HA2  . GLY C 1 84  ? 120.956 127.786 -6.857  1.00 0.00 ? 84  GLY C HA2  1 
ATOM 5249  H HA3  . GLY C 1 84  ? 120.599 128.224 -8.525  1.00 0.00 ? 84  GLY C HA3  1 
ATOM 5250  N N    . ALA C 1 85  ? 123.250 128.691 -7.106  1.00 0.00 ? 85  ALA C N    1 
ATOM 5251  C CA   . ALA C 1 85  ? 124.584 129.270 -7.157  1.00 0.00 ? 85  ALA C CA   1 
ATOM 5252  C C    . ALA C 1 85  ? 125.156 129.161 -8.567  1.00 0.00 ? 85  ALA C C    1 
ATOM 5253  O O    . ALA C 1 85  ? 125.187 128.080 -9.154  1.00 0.00 ? 85  ALA C O    1 
ATOM 5254  C CB   . ALA C 1 85  ? 125.502 128.544 -6.173  1.00 0.00 ? 85  ALA C CB   1 
ATOM 5255  H H    . ALA C 1 85  ? 123.114 127.828 -6.661  1.00 0.00 ? 85  ALA C H    1 
ATOM 5256  H HA   . ALA C 1 85  ? 124.528 130.310 -6.879  1.00 0.00 ? 85  ALA C HA   1 
ATOM 5257  H HB1  . ALA C 1 85  ? 126.498 128.957 -6.238  1.00 0.00 ? 85  ALA C HB1  1 
ATOM 5258  H HB2  . ALA C 1 85  ? 125.531 127.492 -6.416  1.00 0.00 ? 85  ALA C HB2  1 
ATOM 5259  H HB3  . ALA C 1 85  ? 125.125 128.671 -5.169  1.00 0.00 ? 85  ALA C HB3  1 
ATOM 5260  N N    . GLY C 1 86  ? 125.609 130.288 -9.105  1.00 0.00 ? 86  GLY C N    1 
ATOM 5261  C CA   . GLY C 1 86  ? 126.181 130.306 -10.447 1.00 0.00 ? 86  GLY C CA   1 
ATOM 5262  C C    . GLY C 1 86  ? 125.092 130.159 -11.504 1.00 0.00 ? 86  GLY C C    1 
ATOM 5263  O O    . GLY C 1 86  ? 125.380 130.042 -12.695 1.00 0.00 ? 86  GLY C O    1 
ATOM 5264  H H    . GLY C 1 86  ? 125.562 131.121 -8.589  1.00 0.00 ? 86  GLY C H    1 
ATOM 5265  H HA2  . GLY C 1 86  ? 126.702 131.241 -10.597 1.00 0.00 ? 86  GLY C HA2  1 
ATOM 5266  H HA3  . GLY C 1 86  ? 126.880 129.490 -10.545 1.00 0.00 ? 86  GLY C HA3  1 
ATOM 5267  N N    . SER C 1 87  ? 123.838 130.162 -11.059 1.00 0.00 ? 87  SER C N    1 
ATOM 5268  C CA   . SER C 1 87  ? 122.706 130.024 -11.971 1.00 0.00 ? 87  SER C CA   1 
ATOM 5269  C C    . SER C 1 87  ? 122.380 131.358 -12.635 1.00 0.00 ? 87  SER C C    1 
ATOM 5270  O O    . SER C 1 87  ? 122.651 132.428 -12.080 1.00 0.00 ? 87  SER C O    1 
ATOM 5271  C CB   . SER C 1 87  ? 121.483 129.510 -11.212 1.00 0.00 ? 87  SER C CB   1 
ATOM 5272  O OG   . SER C 1 87  ? 120.360 129.496 -12.085 1.00 0.00 ? 87  SER C OG   1 
ATOM 5273  H H    . SER C 1 87  ? 123.669 130.257 -10.099 1.00 0.00 ? 87  SER C H    1 
ATOM 5274  H HA   . SER C 1 87  ? 122.962 129.309 -12.739 1.00 0.00 ? 87  SER C HA   1 
ATOM 5275  H HB2  . SER C 1 87  ? 121.671 128.509 -10.862 1.00 0.00 ? 87  SER C HB2  1 
ATOM 5276  H HB3  . SER C 1 87  ? 121.288 130.155 -10.365 1.00 0.00 ? 87  SER C HB3  1 
ATOM 5277  H HG   . SER C 1 87  ? 119.851 128.703 -11.899 1.00 0.00 ? 87  SER C HG   1 
ATOM 5278  N N    . ILE C 1 88  ? 121.796 131.288 -13.835 1.00 0.00 ? 88  ILE C N    1 
ATOM 5279  C CA   . ILE C 1 88  ? 121.426 132.499 -14.586 1.00 0.00 ? 88  ILE C CA   1 
ATOM 5280  C C    . ILE C 1 88  ? 119.940 132.448 -14.948 1.00 0.00 ? 88  ILE C C    1 
ATOM 5281  O O    . ILE C 1 88  ? 119.456 131.442 -15.469 1.00 0.00 ? 88  ILE C O    1 
ATOM 5282  C CB   . ILE C 1 88  ? 122.301 132.605 -15.863 1.00 0.00 ? 88  ILE C CB   1 
ATOM 5283  C CG1  . ILE C 1 88  ? 121.815 131.601 -16.930 1.00 0.00 ? 88  ILE C CG1  1 
ATOM 5284  C CG2  . ILE C 1 88  ? 123.774 132.302 -15.508 1.00 0.00 ? 88  ILE C CG2  1 
ATOM 5285  C CD1  . ILE C 1 88  ? 122.820 131.543 -18.086 1.00 0.00 ? 88  ILE C CD1  1 
ATOM 5286  H H    . ILE C 1 88  ? 121.605 130.404 -14.225 1.00 0.00 ? 88  ILE C H    1 
ATOM 5287  H HA   . ILE C 1 88  ? 121.597 133.376 -13.974 1.00 0.00 ? 88  ILE C HA   1 
ATOM 5288  H HB   . ILE C 1 88  ? 122.231 133.610 -16.257 1.00 0.00 ? 88  ILE C HB   1 
ATOM 5289  H HG12 . ILE C 1 88  ? 121.721 130.629 -16.486 1.00 0.00 ? 88  ILE C HG12 1 
ATOM 5290  H HG13 . ILE C 1 88  ? 120.856 131.915 -17.313 1.00 0.00 ? 88  ILE C HG13 1 
ATOM 5291  H HG21 . ILE C 1 88  ? 124.420 132.759 -16.242 1.00 0.00 ? 88  ILE C HG21 1 
ATOM 5292  H HG22 . ILE C 1 88  ? 123.938 131.232 -15.505 1.00 0.00 ? 88  ILE C HG22 1 
ATOM 5293  H HG23 . ILE C 1 88  ? 124.007 132.697 -14.530 1.00 0.00 ? 88  ILE C HG23 1 
ATOM 5294  H HD11 . ILE C 1 88  ? 123.688 130.975 -17.780 1.00 0.00 ? 88  ILE C HD11 1 
ATOM 5295  H HD12 . ILE C 1 88  ? 123.122 132.545 -18.352 1.00 0.00 ? 88  ILE C HD12 1 
ATOM 5296  H HD13 . ILE C 1 88  ? 122.363 131.067 -18.939 1.00 0.00 ? 88  ILE C HD13 1 
ATOM 5297  N N    . ALA C 1 89  ? 119.219 133.533 -14.665 1.00 0.00 ? 89  ALA C N    1 
ATOM 5298  C CA   . ALA C 1 89  ? 117.788 133.586 -14.967 1.00 0.00 ? 89  ALA C CA   1 
ATOM 5299  C C    . ALA C 1 89  ? 117.568 134.002 -16.414 1.00 0.00 ? 89  ALA C C    1 
ATOM 5300  O O    . ALA C 1 89  ? 116.998 133.253 -17.205 1.00 0.00 ? 89  ALA C O    1 
ATOM 5301  C CB   . ALA C 1 89  ? 117.093 134.581 -14.037 1.00 0.00 ? 89  ALA C CB   1 
ATOM 5302  H H    . ALA C 1 89  ? 119.652 134.306 -14.246 1.00 0.00 ? 89  ALA C H    1 
ATOM 5303  H HA   . ALA C 1 89  ? 117.354 132.607 -14.814 1.00 0.00 ? 89  ALA C HA   1 
ATOM 5304  H HB1  . ALA C 1 89  ? 116.024 134.422 -14.073 1.00 0.00 ? 89  ALA C HB1  1 
ATOM 5305  H HB2  . ALA C 1 89  ? 117.317 135.587 -14.356 1.00 0.00 ? 89  ALA C HB2  1 
ATOM 5306  H HB3  . ALA C 1 89  ? 117.445 134.437 -13.027 1.00 0.00 ? 89  ALA C HB3  1 
ATOM 5307  N N    . ALA C 1 90  ? 118.031 135.207 -16.756 1.00 0.00 ? 90  ALA C N    1 
ATOM 5308  C CA   . ALA C 1 90  ? 117.890 135.735 -18.119 1.00 0.00 ? 90  ALA C CA   1 
ATOM 5309  C C    . ALA C 1 90  ? 119.212 136.323 -18.591 1.00 0.00 ? 90  ALA C C    1 
ATOM 5310  O O    . ALA C 1 90  ? 119.716 137.285 -18.013 1.00 0.00 ? 90  ALA C O    1 
ATOM 5311  C CB   . ALA C 1 90  ? 116.806 136.820 -18.144 1.00 0.00 ? 90  ALA C CB   1 
ATOM 5312  H H    . ALA C 1 90  ? 118.478 135.754 -16.079 1.00 0.00 ? 90  ALA C H    1 
ATOM 5313  H HA   . ALA C 1 90  ? 117.603 134.938 -18.795 1.00 0.00 ? 90  ALA C HA   1 
ATOM 5314  H HB1  . ALA C 1 90  ? 117.206 137.744 -17.749 1.00 0.00 ? 90  ALA C HB1  1 
ATOM 5315  H HB2  . ALA C 1 90  ? 115.970 136.504 -17.540 1.00 0.00 ? 90  ALA C HB2  1 
ATOM 5316  H HB3  . ALA C 1 90  ? 116.477 136.976 -19.162 1.00 0.00 ? 90  ALA C HB3  1 
ATOM 5317  N N    . ALA C 1 91  ? 119.776 135.741 -19.653 1.00 0.00 ? 91  ALA C N    1 
ATOM 5318  C CA   . ALA C 1 91  ? 121.052 136.221 -20.201 1.00 0.00 ? 91  ALA C CA   1 
ATOM 5319  C C    . ALA C 1 91  ? 121.070 136.094 -21.720 1.00 0.00 ? 91  ALA C C    1 
ATOM 5320  O O    . ALA C 1 91  ? 120.925 135.002 -22.264 1.00 0.00 ? 91  ALA C O    1 
ATOM 5321  C CB   . ALA C 1 91  ? 122.210 135.414 -19.606 1.00 0.00 ? 91  ALA C CB   1 
ATOM 5322  H H    . ALA C 1 91  ? 119.329 134.976 -20.075 1.00 0.00 ? 91  ALA C H    1 
ATOM 5323  H HA   . ALA C 1 91  ? 121.185 137.259 -19.940 1.00 0.00 ? 91  ALA C HA   1 
ATOM 5324  H HB1  . ALA C 1 91  ? 123.136 135.951 -19.754 1.00 0.00 ? 91  ALA C HB1  1 
ATOM 5325  H HB2  . ALA C 1 91  ? 122.271 134.451 -20.095 1.00 0.00 ? 91  ALA C HB2  1 
ATOM 5326  H HB3  . ALA C 1 91  ? 122.042 135.271 -18.551 1.00 0.00 ? 91  ALA C HB3  1 
ATOM 5327  N N    . THR C 1 92  ? 121.266 137.217 -22.409 1.00 0.00 ? 92  THR C N    1 
ATOM 5328  C CA   . THR C 1 92  ? 121.316 137.211 -23.875 1.00 0.00 ? 92  THR C CA   1 
ATOM 5329  C C    . THR C 1 92  ? 122.758 137.069 -24.349 1.00 0.00 ? 92  THR C C    1 
ATOM 5330  O O    . THR C 1 92  ? 123.546 138.011 -24.261 1.00 0.00 ? 92  THR C O    1 
ATOM 5331  C CB   . THR C 1 92  ? 120.720 138.509 -24.426 1.00 0.00 ? 92  THR C CB   1 
ATOM 5332  O OG1  . THR C 1 92  ? 121.672 139.553 -24.313 1.00 0.00 ? 92  THR C OG1  1 
ATOM 5333  C CG2  . THR C 1 92  ? 119.465 138.870 -23.632 1.00 0.00 ? 92  THR C CG2  1 
ATOM 5334  H H    . THR C 1 92  ? 121.388 138.062 -21.924 1.00 0.00 ? 92  THR C H    1 
ATOM 5335  H HA   . THR C 1 92  ? 120.739 136.377 -24.253 1.00 0.00 ? 92  THR C HA   1 
ATOM 5336  H HB   . THR C 1 92  ? 120.456 138.372 -25.463 1.00 0.00 ? 92  THR C HB   1 
ATOM 5337  H HG1  . THR C 1 92  ? 122.486 139.260 -24.729 1.00 0.00 ? 92  THR C HG1  1 
ATOM 5338  H HG21 . THR C 1 92  ? 118.987 139.728 -24.083 1.00 0.00 ? 92  THR C HG21 1 
ATOM 5339  H HG22 . THR C 1 92  ? 119.740 139.105 -22.614 1.00 0.00 ? 92  THR C HG22 1 
ATOM 5340  H HG23 . THR C 1 92  ? 118.782 138.034 -23.636 1.00 0.00 ? 92  THR C HG23 1 
ATOM 5341  N N    . GLY C 1 93  ? 123.096 135.881 -24.848 1.00 0.00 ? 93  GLY C N    1 
ATOM 5342  C CA   . GLY C 1 93  ? 124.447 135.617 -25.329 1.00 0.00 ? 93  GLY C CA   1 
ATOM 5343  C C    . GLY C 1 93  ? 125.375 135.283 -24.166 1.00 0.00 ? 93  GLY C C    1 
ATOM 5344  O O    . GLY C 1 93  ? 125.961 136.175 -23.553 1.00 0.00 ? 93  GLY C O    1 
ATOM 5345  H H    . GLY C 1 93  ? 122.424 135.169 -24.890 1.00 0.00 ? 93  GLY C H    1 
ATOM 5346  H HA2  . GLY C 1 93  ? 124.422 134.784 -26.018 1.00 0.00 ? 93  GLY C HA2  1 
ATOM 5347  H HA3  . GLY C 1 93  ? 124.822 136.490 -25.840 1.00 0.00 ? 93  GLY C HA3  1 
ATOM 5348  N N    . PHE C 1 94  ? 125.503 133.986 -23.859 1.00 0.00 ? 94  PHE C N    1 
ATOM 5349  C CA   . PHE C 1 94  ? 126.364 133.531 -22.754 1.00 0.00 ? 94  PHE C CA   1 
ATOM 5350  C C    . PHE C 1 94  ? 127.472 132.626 -23.288 1.00 0.00 ? 94  PHE C C    1 
ATOM 5351  O O    . PHE C 1 94  ? 127.201 131.580 -23.874 1.00 0.00 ? 94  PHE C O    1 
ATOM 5352  C CB   . PHE C 1 94  ? 125.521 132.748 -21.738 1.00 0.00 ? 94  PHE C CB   1 
ATOM 5353  C CG   . PHE C 1 94  ? 126.299 132.578 -20.454 1.00 0.00 ? 94  PHE C CG   1 
ATOM 5354  C CD1  . PHE C 1 94  ? 127.252 131.559 -20.340 1.00 0.00 ? 94  PHE C CD1  1 
ATOM 5355  C CD2  . PHE C 1 94  ? 126.069 133.445 -19.378 1.00 0.00 ? 94  PHE C CD2  1 
ATOM 5356  C CE1  . PHE C 1 94  ? 127.974 131.406 -19.150 1.00 0.00 ? 94  PHE C CE1  1 
ATOM 5357  C CE2  . PHE C 1 94  ? 126.790 133.291 -18.188 1.00 0.00 ? 94  PHE C CE2  1 
ATOM 5358  C CZ   . PHE C 1 94  ? 127.743 132.272 -18.074 1.00 0.00 ? 94  PHE C CZ   1 
ATOM 5359  H H    . PHE C 1 94  ? 125.009 133.322 -24.382 1.00 0.00 ? 94  PHE C H    1 
ATOM 5360  H HA   . PHE C 1 94  ? 126.812 134.382 -22.258 1.00 0.00 ? 94  PHE C HA   1 
ATOM 5361  H HB2  . PHE C 1 94  ? 124.608 133.288 -21.536 1.00 0.00 ? 94  PHE C HB2  1 
ATOM 5362  H HB3  . PHE C 1 94  ? 125.282 131.776 -22.143 1.00 0.00 ? 94  PHE C HB3  1 
ATOM 5363  H HD1  . PHE C 1 94  ? 127.430 130.891 -21.170 1.00 0.00 ? 94  PHE C HD1  1 
ATOM 5364  H HD2  . PHE C 1 94  ? 125.334 134.231 -19.466 1.00 0.00 ? 94  PHE C HD2  1 
ATOM 5365  H HE1  . PHE C 1 94  ? 128.710 130.620 -19.062 1.00 0.00 ? 94  PHE C HE1  1 
ATOM 5366  H HE2  . PHE C 1 94  ? 126.613 133.960 -17.358 1.00 0.00 ? 94  PHE C HE2  1 
ATOM 5367  H HZ   . PHE C 1 94  ? 128.300 132.153 -17.156 1.00 0.00 ? 94  PHE C HZ   1 
ATOM 5368  N N    . VAL C 1 95  ? 128.726 133.031 -23.077 1.00 0.00 ? 95  VAL C N    1 
ATOM 5369  C CA   . VAL C 1 95  ? 129.877 132.238 -23.543 1.00 0.00 ? 95  VAL C CA   1 
ATOM 5370  C C    . VAL C 1 95  ? 131.017 132.291 -22.521 1.00 0.00 ? 95  VAL C C    1 
ATOM 5371  O O    . VAL C 1 95  ? 131.497 133.362 -22.156 1.00 0.00 ? 95  VAL C O    1 
ATOM 5372  C CB   . VAL C 1 95  ? 130.347 132.767 -24.915 1.00 0.00 ? 95  VAL C CB   1 
ATOM 5373  C CG1  . VAL C 1 95  ? 130.436 134.292 -24.877 1.00 0.00 ? 95  VAL C CG1  1 
ATOM 5374  C CG2  . VAL C 1 95  ? 131.731 132.179 -25.269 1.00 0.00 ? 95  VAL C CG2  1 
ATOM 5375  H H    . VAL C 1 95  ? 128.886 133.873 -22.601 1.00 0.00 ? 95  VAL C H    1 
ATOM 5376  H HA   . VAL C 1 95  ? 129.573 131.207 -23.659 1.00 0.00 ? 95  VAL C HA   1 
ATOM 5377  H HB   . VAL C 1 95  ? 129.631 132.476 -25.671 1.00 0.00 ? 95  VAL C HB   1 
ATOM 5378  H HG11 . VAL C 1 95  ? 131.120 134.593 -24.107 1.00 0.00 ? 95  VAL C HG11 1 
ATOM 5379  H HG12 . VAL C 1 95  ? 129.459 134.706 -24.674 1.00 0.00 ? 95  VAL C HG12 1 
ATOM 5380  H HG13 . VAL C 1 95  ? 130.786 134.653 -25.830 1.00 0.00 ? 95  VAL C HG13 1 
ATOM 5381  H HG21 . VAL C 1 95  ? 131.764 131.140 -24.985 1.00 0.00 ? 95  VAL C HG21 1 
ATOM 5382  H HG22 . VAL C 1 95  ? 132.501 132.719 -24.737 1.00 0.00 ? 95  VAL C HG22 1 
ATOM 5383  H HG23 . VAL C 1 95  ? 131.900 132.269 -26.332 1.00 0.00 ? 95  VAL C HG23 1 
ATOM 5384  N N    . LYS C 1 96  ? 131.451 131.113 -22.065 1.00 0.00 ? 96  LYS C N    1 
ATOM 5385  C CA   . LYS C 1 96  ? 132.543 131.017 -21.083 1.00 0.00 ? 96  LYS C CA   1 
ATOM 5386  C C    . LYS C 1 96  ? 133.663 130.135 -21.625 1.00 0.00 ? 96  LYS C C    1 
ATOM 5387  O O    . LYS C 1 96  ? 133.449 128.960 -21.926 1.00 0.00 ? 96  LYS C O    1 
ATOM 5388  C CB   . LYS C 1 96  ? 132.014 130.417 -19.775 1.00 0.00 ? 96  LYS C CB   1 
ATOM 5389  C CG   . LYS C 1 96  ? 133.129 130.413 -18.725 1.00 0.00 ? 96  LYS C CG   1 
ATOM 5390  C CD   . LYS C 1 96  ? 132.585 129.880 -17.397 1.00 0.00 ? 96  LYS C CD   1 
ATOM 5391  C CE   . LYS C 1 96  ? 133.703 129.891 -16.351 1.00 0.00 ? 96  LYS C CE   1 
ATOM 5392  N NZ   . LYS C 1 96  ? 133.175 129.399 -15.045 1.00 0.00 ? 96  LYS C NZ   1 
ATOM 5393  H H    . LYS C 1 96  ? 131.029 130.289 -22.394 1.00 0.00 ? 96  LYS C H    1 
ATOM 5394  H HA   . LYS C 1 96  ? 132.944 132.003 -20.875 1.00 0.00 ? 96  LYS C HA   1 
ATOM 5395  H HB2  . LYS C 1 96  ? 131.182 131.008 -19.417 1.00 0.00 ? 96  LYS C HB2  1 
ATOM 5396  H HB3  . LYS C 1 96  ? 131.685 129.404 -19.951 1.00 0.00 ? 96  LYS C HB3  1 
ATOM 5397  H HG2  . LYS C 1 96  ? 133.937 129.780 -19.060 1.00 0.00 ? 96  LYS C HG2  1 
ATOM 5398  H HG3  . LYS C 1 96  ? 133.493 131.418 -18.583 1.00 0.00 ? 96  LYS C HG3  1 
ATOM 5399  H HD2  . LYS C 1 96  ? 131.771 130.508 -17.063 1.00 0.00 ? 96  LYS C HD2  1 
ATOM 5400  H HD3  . LYS C 1 96  ? 132.230 128.870 -17.532 1.00 0.00 ? 96  LYS C HD3  1 
ATOM 5401  H HE2  . LYS C 1 96  ? 134.506 129.247 -16.678 1.00 0.00 ? 96  LYS C HE2  1 
ATOM 5402  H HE3  . LYS C 1 96  ? 134.075 130.898 -16.232 1.00 0.00 ? 96  LYS C HE3  1 
ATOM 5403  H HZ1  . LYS C 1 96  ? 132.348 129.965 -14.770 1.00 0.00 ? 96  LYS C HZ1  1 
ATOM 5404  H HZ2  . LYS C 1 96  ? 133.914 129.489 -14.317 1.00 0.00 ? 96  LYS C HZ2  1 
ATOM 5405  H HZ3  . LYS C 1 96  ? 132.896 128.402 -15.136 1.00 0.00 ? 96  LYS C HZ3  1 
ATOM 5406  N N    . LYS C 1 97  ? 134.868 130.704 -21.738 1.00 0.00 ? 97  LYS C N    1 
ATOM 5407  C CA   . LYS C 1 97  ? 136.032 129.953 -22.234 1.00 0.00 ? 97  LYS C CA   1 
ATOM 5408  C C    . LYS C 1 97  ? 136.919 129.522 -21.075 1.00 0.00 ? 97  LYS C C    1 
ATOM 5409  O O    . LYS C 1 97  ? 137.420 130.356 -20.320 1.00 0.00 ? 97  LYS C O    1 
ATOM 5410  C CB   . LYS C 1 97  ? 136.843 130.816 -23.202 1.00 0.00 ? 97  LYS C CB   1 
ATOM 5411  C CG   . LYS C 1 97  ? 136.060 130.996 -24.503 1.00 0.00 ? 97  LYS C CG   1 
ATOM 5412  C CD   . LYS C 1 97  ? 136.881 131.837 -25.481 1.00 0.00 ? 97  LYS C CD   1 
ATOM 5413  C CE   . LYS C 1 97  ? 136.114 131.985 -26.797 1.00 0.00 ? 97  LYS C CE   1 
ATOM 5414  N NZ   . LYS C 1 97  ? 136.917 132.799 -27.750 1.00 0.00 ? 97  LYS C NZ   1 
ATOM 5415  H H    . LYS C 1 97  ? 134.981 131.642 -21.474 1.00 0.00 ? 97  LYS C H    1 
ATOM 5416  H HA   . LYS C 1 97  ? 135.695 129.067 -22.763 1.00 0.00 ? 97  LYS C HA   1 
ATOM 5417  H HB2  . LYS C 1 97  ? 137.026 131.783 -22.755 1.00 0.00 ? 97  LYS C HB2  1 
ATOM 5418  H HB3  . LYS C 1 97  ? 137.784 130.333 -23.416 1.00 0.00 ? 97  LYS C HB3  1 
ATOM 5419  H HG2  . LYS C 1 97  ? 135.861 130.027 -24.939 1.00 0.00 ? 97  LYS C HG2  1 
ATOM 5420  H HG3  . LYS C 1 97  ? 135.127 131.497 -24.295 1.00 0.00 ? 97  LYS C HG3  1 
ATOM 5421  H HD2  . LYS C 1 97  ? 137.057 132.814 -25.056 1.00 0.00 ? 97  LYS C HD2  1 
ATOM 5422  H HD3  . LYS C 1 97  ? 137.825 131.350 -25.671 1.00 0.00 ? 97  LYS C HD3  1 
ATOM 5423  H HE2  . LYS C 1 97  ? 135.934 131.007 -27.221 1.00 0.00 ? 97  LYS C HE2  1 
ATOM 5424  H HE3  . LYS C 1 97  ? 135.170 132.475 -26.611 1.00 0.00 ? 97  LYS C HE3  1 
ATOM 5425  H HZ1  . LYS C 1 97  ? 136.958 133.783 -27.418 1.00 0.00 ? 97  LYS C HZ1  1 
ATOM 5426  H HZ2  . LYS C 1 97  ? 136.475 132.768 -28.692 1.00 0.00 ? 97  LYS C HZ2  1 
ATOM 5427  H HZ3  . LYS C 1 97  ? 137.882 132.415 -27.808 1.00 0.00 ? 97  LYS C HZ3  1 
ATOM 5428  N N    . ASP C 1 98  ? 137.110 128.213 -20.946 1.00 0.00 ? 98  ASP C N    1 
ATOM 5429  C CA   . ASP C 1 98  ? 137.938 127.668 -19.879 1.00 0.00 ? 98  ASP C CA   1 
ATOM 5430  C C    . ASP C 1 98  ? 137.485 128.196 -18.521 1.00 0.00 ? 98  ASP C C    1 
ATOM 5431  O O    . ASP C 1 98  ? 136.590 129.037 -18.436 1.00 0.00 ? 98  ASP C O    1 
ATOM 5432  C CB   . ASP C 1 98  ? 139.403 128.039 -20.116 1.00 0.00 ? 98  ASP C CB   1 
ATOM 5433  C CG   . ASP C 1 98  ? 139.856 127.525 -21.479 1.00 0.00 ? 98  ASP C CG   1 
ATOM 5434  O OD1  . ASP C 1 98  ? 139.610 126.365 -21.765 1.00 0.00 ? 98  ASP C OD1  1 
ATOM 5435  O OD2  . ASP C 1 98  ? 140.444 128.300 -22.217 1.00 0.00 ? 98  ASP C OD2  1 
ATOM 5436  H H    . ASP C 1 98  ? 136.686 127.602 -21.581 1.00 0.00 ? 98  ASP C H    1 
ATOM 5437  H HA   . ASP C 1 98  ? 137.847 126.594 -19.884 1.00 0.00 ? 98  ASP C HA   1 
ATOM 5438  H HB2  . ASP C 1 98  ? 139.510 129.114 -20.083 1.00 0.00 ? 98  ASP C HB2  1 
ATOM 5439  H HB3  . ASP C 1 98  ? 140.013 127.593 -19.346 1.00 0.00 ? 98  ASP C HB3  1 
ATOM 5440  N N    . GLN C 1 99  ? 138.113 127.692 -17.458 1.00 0.00 ? 99  GLN C N    1 
ATOM 5441  C CA   . GLN C 1 99  ? 137.776 128.110 -16.095 1.00 0.00 ? 99  GLN C CA   1 
ATOM 5442  C C    . GLN C 1 99  ? 139.005 128.023 -15.195 1.00 0.00 ? 99  GLN C C    1 
ATOM 5443  O O    . GLN C 1 99  ? 139.781 127.070 -15.279 1.00 0.00 ? 99  GLN C O    1 
ATOM 5444  C CB   . GLN C 1 99  ? 136.663 127.220 -15.538 1.00 0.00 ? 99  GLN C CB   1 
ATOM 5445  C CG   . GLN C 1 99  ? 136.243 127.729 -14.157 1.00 0.00 ? 99  GLN C CG   1 
ATOM 5446  C CD   . GLN C 1 99  ? 135.039 126.940 -13.652 1.00 0.00 ? 99  GLN C CD   1 
ATOM 5447  O OE1  . GLN C 1 99  ? 134.044 126.799 -14.363 1.00 0.00 ? 99  GLN C OE1  1 
ATOM 5448  N NE2  . GLN C 1 99  ? 135.070 126.414 -12.457 1.00 0.00 ? 99  GLN C NE2  1 
ATOM 5449  H H    . GLN C 1 99  ? 138.817 127.024 -17.592 1.00 0.00 ? 99  GLN C H    1 
ATOM 5450  H HA   . GLN C 1 99  ? 137.428 129.136 -16.111 1.00 0.00 ? 99  GLN C HA   1 
ATOM 5451  H HB2  . GLN C 1 99  ? 135.813 127.246 -16.206 1.00 0.00 ? 99  GLN C HB2  1 
ATOM 5452  H HB3  . GLN C 1 99  ? 137.023 126.206 -15.451 1.00 0.00 ? 99  GLN C HB3  1 
ATOM 5453  H HG2  . GLN C 1 99  ? 137.064 127.609 -13.467 1.00 0.00 ? 99  GLN C HG2  1 
ATOM 5454  H HG3  . GLN C 1 99  ? 135.981 128.774 -14.225 1.00 0.00 ? 99  GLN C HG3  1 
ATOM 5455  H HE21 . GLN C 1 99  ? 135.863 126.527 -11.893 1.00 0.00 ? 99  GLN C HE21 1 
ATOM 5456  H HE22 . GLN C 1 99  ? 134.299 125.908 -12.124 1.00 0.00 ? 99  GLN C HE22 1 
ATOM 5457  N N    . LEU C 1 100 ? 139.181 129.025 -14.340 1.00 0.00 ? 100 LEU C N    1 
ATOM 5458  C CA   . LEU C 1 100 ? 140.324 129.056 -13.434 1.00 0.00 ? 100 LEU C CA   1 
ATOM 5459  C C    . LEU C 1 100 ? 140.292 127.852 -12.498 1.00 0.00 ? 100 LEU C C    1 
ATOM 5460  O O    . LEU C 1 100 ? 141.311 127.197 -12.279 1.00 0.00 ? 100 LEU C O    1 
ATOM 5461  C CB   . LEU C 1 100 ? 140.300 130.360 -12.621 1.00 0.00 ? 100 LEU C CB   1 
ATOM 5462  C CG   . LEU C 1 100 ? 141.489 130.423 -11.641 1.00 0.00 ? 100 LEU C CG   1 
ATOM 5463  C CD1  . LEU C 1 100 ? 142.824 130.362 -12.412 1.00 0.00 ? 100 LEU C CD1  1 
ATOM 5464  C CD2  . LEU C 1 100 ? 141.407 131.741 -10.858 1.00 0.00 ? 100 LEU C CD2  1 
ATOM 5465  H H    . LEU C 1 100 ? 138.532 129.758 -14.321 1.00 0.00 ? 100 LEU C H    1 
ATOM 5466  H HA   . LEU C 1 100 ? 141.229 129.024 -14.019 1.00 0.00 ? 100 LEU C HA   1 
ATOM 5467  H HB2  . LEU C 1 100 ? 140.351 131.201 -13.298 1.00 0.00 ? 100 LEU C HB2  1 
ATOM 5468  H HB3  . LEU C 1 100 ? 139.377 130.412 -12.062 1.00 0.00 ? 100 LEU C HB3  1 
ATOM 5469  H HG   . LEU C 1 100 ? 141.434 129.595 -10.952 1.00 0.00 ? 100 LEU C HG   1 
ATOM 5470  H HD11 . LEU C 1 100 ? 142.739 130.920 -13.333 1.00 0.00 ? 100 LEU C HD11 1 
ATOM 5471  H HD12 . LEU C 1 100 ? 143.064 129.334 -12.634 1.00 0.00 ? 100 LEU C HD12 1 
ATOM 5472  H HD13 . LEU C 1 100 ? 143.614 130.786 -11.807 1.00 0.00 ? 100 LEU C HD13 1 
ATOM 5473  H HD21 . LEU C 1 100 ? 140.514 131.742 -10.249 1.00 0.00 ? 100 LEU C HD21 1 
ATOM 5474  H HD22 . LEU C 1 100 ? 141.370 132.570 -11.550 1.00 0.00 ? 100 LEU C HD22 1 
ATOM 5475  H HD23 . LEU C 1 100 ? 142.275 131.839 -10.225 1.00 0.00 ? 100 LEU C HD23 1 
ATOM 5476  N N    . GLY C 1 101 ? 139.116 127.568 -11.950 1.00 0.00 ? 101 GLY C N    1 
ATOM 5477  C CA   . GLY C 1 101 ? 138.962 126.441 -11.038 1.00 0.00 ? 101 GLY C CA   1 
ATOM 5478  C C    . GLY C 1 101 ? 139.271 125.125 -11.743 1.00 0.00 ? 101 GLY C C    1 
ATOM 5479  O O    . GLY C 1 101 ? 138.994 124.963 -12.931 1.00 0.00 ? 101 GLY C O    1 
ATOM 5480  H H    . GLY C 1 101 ? 138.339 128.125 -12.163 1.00 0.00 ? 101 GLY C H    1 
ATOM 5481  H HA2  . GLY C 1 101 ? 139.636 126.566 -10.202 1.00 0.00 ? 101 GLY C HA2  1 
ATOM 5482  H HA3  . GLY C 1 101 ? 137.945 126.416 -10.676 1.00 0.00 ? 101 GLY C HA3  1 
ATOM 5483  N N    . LYS C 1 102 ? 139.848 124.185 -10.997 1.00 0.00 ? 102 LYS C N    1 
ATOM 5484  C CA   . LYS C 1 102 ? 140.196 122.878 -11.550 1.00 0.00 ? 102 LYS C CA   1 
ATOM 5485  C C    . LYS C 1 102 ? 140.264 121.833 -10.432 1.00 0.00 ? 102 LYS C C    1 
ATOM 5486  O O    . LYS C 1 102 ? 139.241 121.468 -9.852  1.00 0.00 ? 102 LYS C O    1 
ATOM 5487  C CB   . LYS C 1 102 ? 141.544 122.959 -12.282 1.00 0.00 ? 102 LYS C CB   1 
ATOM 5488  C CG   . LYS C 1 102 ? 142.522 123.823 -11.477 1.00 0.00 ? 102 LYS C CG   1 
ATOM 5489  C CD   . LYS C 1 102 ? 143.907 123.757 -12.121 1.00 0.00 ? 102 LYS C CD   1 
ATOM 5490  C CE   . LYS C 1 102 ? 144.894 124.589 -11.300 1.00 0.00 ? 102 LYS C CE   1 
ATOM 5491  N NZ   . LYS C 1 102 ? 146.255 124.472 -11.894 1.00 0.00 ? 102 LYS C NZ   1 
ATOM 5492  H H    . LYS C 1 102 ? 140.043 124.375 -10.057 1.00 0.00 ? 102 LYS C H    1 
ATOM 5493  H HA   . LYS C 1 102 ? 139.434 122.580 -12.257 1.00 0.00 ? 102 LYS C HA   1 
ATOM 5494  H HB2  . LYS C 1 102 ? 141.953 121.967 -12.406 1.00 0.00 ? 102 LYS C HB2  1 
ATOM 5495  H HB3  . LYS C 1 102 ? 141.395 123.407 -13.254 1.00 0.00 ? 102 LYS C HB3  1 
ATOM 5496  H HG2  . LYS C 1 102 ? 142.175 124.846 -11.472 1.00 0.00 ? 102 LYS C HG2  1 
ATOM 5497  H HG3  . LYS C 1 102 ? 142.580 123.459 -10.464 1.00 0.00 ? 102 LYS C HG3  1 
ATOM 5498  H HD2  . LYS C 1 102 ? 144.241 122.730 -12.152 1.00 0.00 ? 102 LYS C HD2  1 
ATOM 5499  H HD3  . LYS C 1 102 ? 143.857 124.150 -13.125 1.00 0.00 ? 102 LYS C HD3  1 
ATOM 5500  H HE2  . LYS C 1 102 ? 144.585 125.624 -11.309 1.00 0.00 ? 102 LYS C HE2  1 
ATOM 5501  H HE3  . LYS C 1 102 ? 144.911 124.227 -10.284 1.00 0.00 ? 102 LYS C HE3  1 
ATOM 5502  H HZ1  . LYS C 1 102 ? 146.372 125.185 -12.640 1.00 0.00 ? 102 LYS C HZ1  1 
ATOM 5503  H HZ2  . LYS C 1 102 ? 146.375 123.520 -12.300 1.00 0.00 ? 102 LYS C HZ2  1 
ATOM 5504  H HZ3  . LYS C 1 102 ? 146.969 124.626 -11.154 1.00 0.00 ? 102 LYS C HZ3  1 
ATOM 5505  N N    . ASN C 1 103 ? 141.470 121.360 -10.132 1.00 0.00 ? 103 ASN C N    1 
ATOM 5506  C CA   . ASN C 1 103 ? 141.650 120.365 -9.080  1.00 0.00 ? 103 ASN C CA   1 
ATOM 5507  C C    . ASN C 1 103 ? 140.795 119.133 -9.355  1.00 0.00 ? 103 ASN C C    1 
ATOM 5508  O O    . ASN C 1 103 ? 139.898 118.803 -8.581  1.00 0.00 ? 103 ASN C O    1 
ATOM 5509  C CB   . ASN C 1 103 ? 141.270 120.960 -7.721  1.00 0.00 ? 103 ASN C CB   1 
ATOM 5510  C CG   . ASN C 1 103 ? 141.821 120.087 -6.596  1.00 0.00 ? 103 ASN C CG   1 
ATOM 5511  O OD1  . ASN C 1 103 ? 142.918 119.541 -6.714  1.00 0.00 ? 103 ASN C OD1  1 
ATOM 5512  N ND2  . ASN C 1 103 ? 141.121 119.921 -5.507  1.00 0.00 ? 103 ASN C ND2  1 
ATOM 5513  H H    . ASN C 1 103 ? 142.252 121.687 -10.624 1.00 0.00 ? 103 ASN C H    1 
ATOM 5514  H HA   . ASN C 1 103 ? 142.688 120.071 -9.054  1.00 0.00 ? 103 ASN C HA   1 
ATOM 5515  H HB2  . ASN C 1 103 ? 141.684 121.955 -7.639  1.00 0.00 ? 103 ASN C HB2  1 
ATOM 5516  H HB3  . ASN C 1 103 ? 140.195 121.012 -7.639  1.00 0.00 ? 103 ASN C HB3  1 
ATOM 5517  H HD21 . ASN C 1 103 ? 140.248 120.356 -5.415  1.00 0.00 ? 103 ASN C HD21 1 
ATOM 5518  H HD22 . ASN C 1 103 ? 141.469 119.362 -4.781  1.00 0.00 ? 103 ASN C HD22 1 
ATOM 5519  N N    . GLU C 1 104 ? 141.078 118.460 -10.468 1.00 0.00 ? 104 GLU C N    1 
ATOM 5520  C CA   . GLU C 1 104 ? 140.325 117.267 -10.843 1.00 0.00 ? 104 GLU C CA   1 
ATOM 5521  C C    . GLU C 1 104 ? 140.134 116.356 -9.630  1.00 0.00 ? 104 GLU C C    1 
ATOM 5522  O O    . GLU C 1 104 ? 141.012 116.253 -8.773  1.00 0.00 ? 104 GLU C O    1 
ATOM 5523  C CB   . GLU C 1 104 ? 141.065 116.508 -11.950 1.00 0.00 ? 104 GLU C CB   1 
ATOM 5524  C CG   . GLU C 1 104 ? 140.144 115.442 -12.551 1.00 0.00 ? 104 GLU C CG   1 
ATOM 5525  C CD   . GLU C 1 104 ? 140.876 114.685 -13.652 1.00 0.00 ? 104 GLU C CD   1 
ATOM 5526  O OE1  . GLU C 1 104 ? 141.973 115.093 -13.997 1.00 0.00 ? 104 GLU C OE1  1 
ATOM 5527  O OE2  . GLU C 1 104 ? 140.333 113.702 -14.131 1.00 0.00 ? 104 GLU C OE2  1 
ATOM 5528  H H    . GLU C 1 104 ? 141.803 118.775 -11.048 1.00 0.00 ? 104 GLU C H    1 
ATOM 5529  H HA   . GLU C 1 104 ? 139.355 117.566 -11.213 1.00 0.00 ? 104 GLU C HA   1 
ATOM 5530  H HB2  . GLU C 1 104 ? 141.365 117.202 -12.721 1.00 0.00 ? 104 GLU C HB2  1 
ATOM 5531  H HB3  . GLU C 1 104 ? 141.940 116.032 -11.534 1.00 0.00 ? 104 GLU C HB3  1 
ATOM 5532  H HG2  . GLU C 1 104 ? 139.839 114.753 -11.782 1.00 0.00 ? 104 GLU C HG2  1 
ATOM 5533  H HG3  . GLU C 1 104 ? 139.270 115.920 -12.969 1.00 0.00 ? 104 GLU C HG3  1 
ATOM 5534  N N    . GLU C 1 105 ? 138.972 115.719 -9.556  1.00 0.00 ? 105 GLU C N    1 
ATOM 5535  C CA   . GLU C 1 105 ? 138.656 114.838 -8.434  1.00 0.00 ? 105 GLU C CA   1 
ATOM 5536  C C    . GLU C 1 105 ? 139.334 113.479 -8.595  1.00 0.00 ? 105 GLU C C    1 
ATOM 5537  O O    . GLU C 1 105 ? 139.093 112.559 -7.813  1.00 0.00 ? 105 GLU C O    1 
ATOM 5538  C CB   . GLU C 1 105 ? 137.140 114.644 -8.350  1.00 0.00 ? 105 GLU C CB   1 
ATOM 5539  C CG   . GLU C 1 105 ? 136.458 115.999 -8.112  1.00 0.00 ? 105 GLU C CG   1 
ATOM 5540  C CD   . GLU C 1 105 ? 136.390 116.797 -9.413  1.00 0.00 ? 105 GLU C CD   1 
ATOM 5541  O OE1  . GLU C 1 105 ? 136.661 116.225 -10.457 1.00 0.00 ? 105 GLU C OE1  1 
ATOM 5542  O OE2  . GLU C 1 105 ? 136.071 117.972 -9.346  1.00 0.00 ? 105 GLU C OE2  1 
ATOM 5543  H H    . GLU C 1 105 ? 138.307 115.854 -10.262 1.00 0.00 ? 105 GLU C H    1 
ATOM 5544  H HA   . GLU C 1 105 ? 138.999 115.296 -7.519  1.00 0.00 ? 105 GLU C HA   1 
ATOM 5545  H HB2  . GLU C 1 105 ? 136.780 114.210 -9.272  1.00 0.00 ? 105 GLU C HB2  1 
ATOM 5546  H HB3  . GLU C 1 105 ? 136.911 113.981 -7.530  1.00 0.00 ? 105 GLU C HB3  1 
ATOM 5547  H HG2  . GLU C 1 105 ? 135.456 115.832 -7.744  1.00 0.00 ? 105 GLU C HG2  1 
ATOM 5548  H HG3  . GLU C 1 105 ? 137.017 116.561 -7.377  1.00 0.00 ? 105 GLU C HG3  1 
ATOM 5549  N N    . GLY C 1 106 ? 140.175 113.359 -9.617  1.00 0.00 ? 106 GLY C N    1 
ATOM 5550  C CA   . GLY C 1 106 ? 140.880 112.105 -9.885  1.00 0.00 ? 106 GLY C CA   1 
ATOM 5551  C C    . GLY C 1 106 ? 140.051 111.211 -10.800 1.00 0.00 ? 106 GLY C C    1 
ATOM 5552  O O    . GLY C 1 106 ? 138.875 111.478 -11.044 1.00 0.00 ? 106 GLY C O    1 
ATOM 5553  H H    . GLY C 1 106 ? 140.323 114.124 -10.204 1.00 0.00 ? 106 GLY C H    1 
ATOM 5554  H HA2  . GLY C 1 106 ? 141.824 112.327 -10.361 1.00 0.00 ? 106 GLY C HA2  1 
ATOM 5555  H HA3  . GLY C 1 106 ? 141.065 111.585 -8.954  1.00 0.00 ? 106 GLY C HA3  1 
ATOM 5556  N N    . ALA C 1 107 ? 140.670 110.151 -11.305 1.00 0.00 ? 107 ALA C N    1 
ATOM 5557  C CA   . ALA C 1 107 ? 139.977 109.223 -12.195 1.00 0.00 ? 107 ALA C CA   1 
ATOM 5558  C C    . ALA C 1 107 ? 138.976 108.373 -11.390 1.00 0.00 ? 107 ALA C C    1 
ATOM 5559  O O    . ALA C 1 107 ? 139.154 108.176 -10.188 1.00 0.00 ? 107 ALA C O    1 
ATOM 5560  C CB   . ALA C 1 107 ? 141.013 108.319 -12.897 1.00 0.00 ? 107 ALA C CB   1 
ATOM 5561  H H    . ALA C 1 107 ? 141.610 109.988 -11.076 1.00 0.00 ? 107 ALA C H    1 
ATOM 5562  H HA   . ALA C 1 107 ? 139.442 109.793 -12.940 1.00 0.00 ? 107 ALA C HA   1 
ATOM 5563  H HB1  . ALA C 1 107 ? 141.840 108.134 -12.226 1.00 0.00 ? 107 ALA C HB1  1 
ATOM 5564  H HB2  . ALA C 1 107 ? 141.381 108.813 -13.785 1.00 0.00 ? 107 ALA C HB2  1 
ATOM 5565  H HB3  . ALA C 1 107 ? 140.560 107.379 -13.174 1.00 0.00 ? 107 ALA C HB3  1 
ATOM 5566  N N    . PRO C 1 108 ? 137.934 107.868 -12.022 1.00 0.00 ? 108 PRO C N    1 
ATOM 5567  C CA   . PRO C 1 108 ? 136.908 107.026 -11.326 1.00 0.00 ? 108 PRO C CA   1 
ATOM 5568  C C    . PRO C 1 108 ? 137.479 105.663 -10.920 1.00 0.00 ? 108 PRO C C    1 
ATOM 5569  O O    . PRO C 1 108 ? 138.370 105.133 -11.582 1.00 0.00 ? 108 PRO C O    1 
ATOM 5570  C CB   . PRO C 1 108 ? 135.791 106.885 -12.381 1.00 0.00 ? 108 PRO C CB   1 
ATOM 5571  C CG   . PRO C 1 108 ? 136.498 107.019 -13.692 1.00 0.00 ? 108 PRO C CG   1 
ATOM 5572  C CD   . PRO C 1 108 ? 137.613 108.039 -13.456 1.00 0.00 ? 108 PRO C CD   1 
ATOM 5573  H HA   . PRO C 1 108 ? 136.527 107.542 -10.460 1.00 0.00 ? 108 PRO C HA   1 
ATOM 5574  H HB2  . PRO C 1 108 ? 135.306 105.917 -12.302 1.00 0.00 ? 108 PRO C HB2  1 
ATOM 5575  H HB3  . PRO C 1 108 ? 135.065 107.678 -12.271 1.00 0.00 ? 108 PRO C HB3  1 
ATOM 5576  H HG2  . PRO C 1 108 ? 136.918 106.062 -13.987 1.00 0.00 ? 108 PRO C HG2  1 
ATOM 5577  H HG3  . PRO C 1 108 ? 135.822 107.382 -14.452 1.00 0.00 ? 108 PRO C HG3  1 
ATOM 5578  H HD2  . PRO C 1 108 ? 138.467 107.814 -14.077 1.00 0.00 ? 108 PRO C HD2  1 
ATOM 5579  H HD3  . PRO C 1 108 ? 137.260 109.042 -13.640 1.00 0.00 ? 108 PRO C HD3  1 
ATOM 5580  N N    . GLN C 1 109 ? 136.962 105.105 -9.821  1.00 0.00 ? 109 GLN C N    1 
ATOM 5581  C CA   . GLN C 1 109 ? 137.434 103.804 -9.330  1.00 0.00 ? 109 GLN C CA   1 
ATOM 5582  C C    . GLN C 1 109 ? 136.603 102.671 -9.929  1.00 0.00 ? 109 GLN C C    1 
ATOM 5583  O O    . GLN C 1 109 ? 135.511 102.366 -9.450  1.00 0.00 ? 109 GLN C O    1 
ATOM 5584  C CB   . GLN C 1 109 ? 137.337 103.766 -7.800  1.00 0.00 ? 109 GLN C CB   1 
ATOM 5585  C CG   . GLN C 1 109 ? 138.016 102.504 -7.268  1.00 0.00 ? 109 GLN C CG   1 
ATOM 5586  C CD   . GLN C 1 109 ? 138.020 102.520 -5.741  1.00 0.00 ? 109 GLN C CD   1 
ATOM 5587  O OE1  . GLN C 1 109 ? 138.082 103.589 -5.133  1.00 0.00 ? 109 GLN C OE1  1 
ATOM 5588  N NE2  . GLN C 1 109 ? 137.958 101.396 -5.081  1.00 0.00 ? 109 GLN C NE2  1 
ATOM 5589  H H    . GLN C 1 109 ? 136.257 105.575 -9.329  1.00 0.00 ? 109 GLN C H    1 
ATOM 5590  H HA   . GLN C 1 109 ? 138.468 103.666 -9.614  1.00 0.00 ? 109 GLN C HA   1 
ATOM 5591  H HB2  . GLN C 1 109 ? 137.825 104.638 -7.389  1.00 0.00 ? 109 GLN C HB2  1 
ATOM 5592  H HB3  . GLN C 1 109 ? 136.298 103.765 -7.506  1.00 0.00 ? 109 GLN C HB3  1 
ATOM 5593  H HG2  . GLN C 1 109 ? 137.477 101.634 -7.616  1.00 0.00 ? 109 GLN C HG2  1 
ATOM 5594  H HG3  . GLN C 1 109 ? 139.033 102.464 -7.627  1.00 0.00 ? 109 GLN C HG3  1 
ATOM 5595  H HE21 . GLN C 1 109 ? 137.909 100.546 -5.566  1.00 0.00 ? 109 GLN C HE21 1 
ATOM 5596  H HE22 . GLN C 1 109 ? 137.961 101.401 -4.101  1.00 0.00 ? 109 GLN C HE22 1 
ATOM 5597  N N    . GLU C 1 110 ? 137.140 102.049 -10.987 1.00 0.00 ? 110 GLU C N    1 
ATOM 5598  C CA   . GLU C 1 110 ? 136.459 100.935 -11.671 1.00 0.00 ? 110 GLU C CA   1 
ATOM 5599  C C    . GLU C 1 110 ? 137.448 99.817  -11.985 1.00 0.00 ? 110 GLU C C    1 
ATOM 5600  O O    . GLU C 1 110 ? 137.073 98.649  -12.078 1.00 0.00 ? 110 GLU C O    1 
ATOM 5601  C CB   . GLU C 1 110 ? 135.828 101.431 -12.978 1.00 0.00 ? 110 GLU C CB   1 
ATOM 5602  C CG   . GLU C 1 110 ? 134.810 102.529 -12.676 1.00 0.00 ? 110 GLU C CG   1 
ATOM 5603  C CD   . GLU C 1 110 ? 133.631 101.944 -11.905 1.00 0.00 ? 110 GLU C CD   1 
ATOM 5604  O OE1  . GLU C 1 110 ? 133.451 100.738 -11.963 1.00 0.00 ? 110 GLU C OE1  1 
ATOM 5605  O OE2  . GLU C 1 110 ? 132.924 102.710 -11.271 1.00 0.00 ? 110 GLU C OE2  1 
ATOM 5606  H H    . GLU C 1 110 ? 138.015 102.341 -11.315 1.00 0.00 ? 110 GLU C H    1 
ATOM 5607  H HA   . GLU C 1 110 ? 135.677 100.540 -11.034 1.00 0.00 ? 110 GLU C HA   1 
ATOM 5608  H HB2  . GLU C 1 110 ? 136.602 101.824 -13.622 1.00 0.00 ? 110 GLU C HB2  1 
ATOM 5609  H HB3  . GLU C 1 110 ? 135.333 100.608 -13.474 1.00 0.00 ? 110 GLU C HB3  1 
ATOM 5610  H HG2  . GLU C 1 110 ? 135.279 103.301 -12.086 1.00 0.00 ? 110 GLU C HG2  1 
ATOM 5611  H HG3  . GLU C 1 110 ? 134.455 102.952 -13.604 1.00 0.00 ? 110 GLU C HG3  1 
ATOM 5612  N N    . GLY C 1 111 ? 138.719 100.189 -12.148 1.00 0.00 ? 111 GLY C N    1 
ATOM 5613  C CA   . GLY C 1 111 ? 139.776 99.217  -12.453 1.00 0.00 ? 111 GLY C CA   1 
ATOM 5614  C C    . GLY C 1 111 ? 140.027 99.129  -13.957 1.00 0.00 ? 111 GLY C C    1 
ATOM 5615  O O    . GLY C 1 111 ? 139.092 99.095  -14.758 1.00 0.00 ? 111 GLY C O    1 
ATOM 5616  H H    . GLY C 1 111 ? 138.954 101.136 -12.062 1.00 0.00 ? 111 GLY C H    1 
ATOM 5617  H HA2  . GLY C 1 111 ? 140.687 99.524  -11.961 1.00 0.00 ? 111 GLY C HA2  1 
ATOM 5618  H HA3  . GLY C 1 111 ? 139.490 98.240  -12.085 1.00 0.00 ? 111 GLY C HA3  1 
ATOM 5619  N N    . ILE C 1 112 ? 141.300 99.080  -14.332 1.00 0.00 ? 112 ILE C N    1 
ATOM 5620  C CA   . ILE C 1 112 ? 141.675 98.987  -15.738 1.00 0.00 ? 112 ILE C CA   1 
ATOM 5621  C C    . ILE C 1 112 ? 141.346 97.607  -16.292 1.00 0.00 ? 112 ILE C C    1 
ATOM 5622  O O    . ILE C 1 112 ? 141.469 97.360  -17.488 1.00 0.00 ? 112 ILE C O    1 
ATOM 5623  C CB   . ILE C 1 112 ? 143.172 99.264  -15.892 1.00 0.00 ? 112 ILE C CB   1 
ATOM 5624  C CG1  . ILE C 1 112 ? 143.965 98.318  -14.980 1.00 0.00 ? 112 ILE C CG1  1 
ATOM 5625  C CG2  . ILE C 1 112 ? 143.465 100.713 -15.502 1.00 0.00 ? 112 ILE C CG2  1 
ATOM 5626  C CD1  . ILE C 1 112 ? 145.460 98.468  -15.264 1.00 0.00 ? 112 ILE C CD1  1 
ATOM 5627  H H    . ILE C 1 112 ? 142.002 99.103  -13.649 1.00 0.00 ? 112 ILE C H    1 
ATOM 5628  H HA   . ILE C 1 112 ? 141.126 99.728  -16.297 1.00 0.00 ? 112 ILE C HA   1 
ATOM 5629  H HB   . ILE C 1 112 ? 143.462 99.103  -16.921 1.00 0.00 ? 112 ILE C HB   1 
ATOM 5630  H HG12 . ILE C 1 112 ? 143.768 98.566  -13.948 1.00 0.00 ? 112 ILE C HG12 1 
ATOM 5631  H HG13 . ILE C 1 112 ? 143.669 97.298  -15.169 1.00 0.00 ? 112 ILE C HG13 1 
ATOM 5632  H HG21 . ILE C 1 112 ? 144.516 100.916 -15.636 1.00 0.00 ? 112 ILE C HG21 1 
ATOM 5633  H HG22 . ILE C 1 112 ? 143.197 100.868 -14.468 1.00 0.00 ? 112 ILE C HG22 1 
ATOM 5634  H HG23 . ILE C 1 112 ? 142.887 101.378 -16.128 1.00 0.00 ? 112 ILE C HG23 1 
ATOM 5635  H HD11 . ILE C 1 112 ? 145.800 99.429  -14.906 1.00 0.00 ? 112 ILE C HD11 1 
ATOM 5636  H HD12 . ILE C 1 112 ? 145.634 98.399  -16.328 1.00 0.00 ? 112 ILE C HD12 1 
ATOM 5637  H HD13 . ILE C 1 112 ? 146.003 97.683  -14.759 1.00 0.00 ? 112 ILE C HD13 1 
ATOM 5638  N N    . LEU C 1 113 ? 140.924 96.712  -15.413 1.00 0.00 ? 113 LEU C N    1 
ATOM 5639  C CA   . LEU C 1 113 ? 140.578 95.361  -15.825 1.00 0.00 ? 113 LEU C CA   1 
ATOM 5640  C C    . LEU C 1 113 ? 139.348 95.389  -16.727 1.00 0.00 ? 113 LEU C C    1 
ATOM 5641  O O    . LEU C 1 113 ? 139.105 94.457  -17.491 1.00 0.00 ? 113 LEU C O    1 
ATOM 5642  C CB   . LEU C 1 113 ? 140.299 94.495  -14.593 1.00 0.00 ? 113 LEU C CB   1 
ATOM 5643  C CG   . LEU C 1 113 ? 141.566 94.384  -13.725 1.00 0.00 ? 113 LEU C CG   1 
ATOM 5644  C CD1  . LEU C 1 113 ? 141.214 93.663  -12.418 1.00 0.00 ? 113 LEU C CD1  1 
ATOM 5645  C CD2  . LEU C 1 113 ? 142.669 93.595  -14.476 1.00 0.00 ? 113 LEU C CD2  1 
ATOM 5646  H H    . LEU C 1 113 ? 140.842 96.963  -14.470 1.00 0.00 ? 113 LEU C H    1 
ATOM 5647  H HA   . LEU C 1 113 ? 141.401 94.939  -16.376 1.00 0.00 ? 113 LEU C HA   1 
ATOM 5648  H HB2  . LEU C 1 113 ? 139.507 94.946  -14.014 1.00 0.00 ? 113 LEU C HB2  1 
ATOM 5649  H HB3  . LEU C 1 113 ? 139.994 93.510  -14.909 1.00 0.00 ? 113 LEU C HB3  1 
ATOM 5650  H HG   . LEU C 1 113 ? 141.928 95.379  -13.495 1.00 0.00 ? 113 LEU C HG   1 
ATOM 5651  H HD11 . LEU C 1 113 ? 140.582 94.299  -11.814 1.00 0.00 ? 113 LEU C HD11 1 
ATOM 5652  H HD12 . LEU C 1 113 ? 142.120 93.437  -11.875 1.00 0.00 ? 113 LEU C HD12 1 
ATOM 5653  H HD13 . LEU C 1 113 ? 140.692 92.746  -12.643 1.00 0.00 ? 113 LEU C HD13 1 
ATOM 5654  H HD21 . LEU C 1 113 ? 143.224 94.271  -15.110 1.00 0.00 ? 113 LEU C HD21 1 
ATOM 5655  H HD22 . LEU C 1 113 ? 142.220 92.822  -15.081 1.00 0.00 ? 113 LEU C HD22 1 
ATOM 5656  H HD23 . LEU C 1 113 ? 143.348 93.143  -13.764 1.00 0.00 ? 113 LEU C HD23 1 
ATOM 5657  N N    . GLU C 1 114 ? 138.575 96.468  -16.632 1.00 0.00 ? 114 GLU C N    1 
ATOM 5658  C CA   . GLU C 1 114 ? 137.372 96.606  -17.444 1.00 0.00 ? 114 GLU C CA   1 
ATOM 5659  C C    . GLU C 1 114 ? 137.713 96.552  -18.932 1.00 0.00 ? 114 GLU C C    1 
ATOM 5660  O O    . GLU C 1 114 ? 136.858 96.242  -19.762 1.00 0.00 ? 114 GLU C O    1 
ATOM 5661  C CB   . GLU C 1 114 ? 136.675 97.933  -17.122 1.00 0.00 ? 114 GLU C CB   1 
ATOM 5662  C CG   . GLU C 1 114 ? 137.572 99.105  -17.543 1.00 0.00 ? 114 GLU C CG   1 
ATOM 5663  C CD   . GLU C 1 114 ? 136.984 100.420 -17.038 1.00 0.00 ? 114 GLU C CD   1 
ATOM 5664  O OE1  . GLU C 1 114 ? 135.955 100.375 -16.385 1.00 0.00 ? 114 GLU C OE1  1 
ATOM 5665  O OE2  . GLU C 1 114 ? 137.574 101.452 -17.311 1.00 0.00 ? 114 GLU C OE2  1 
ATOM 5666  H H    . GLU C 1 114 ? 138.818 97.182  -16.005 1.00 0.00 ? 114 GLU C H    1 
ATOM 5667  H HA   . GLU C 1 114 ? 136.698 95.796  -17.211 1.00 0.00 ? 114 GLU C HA   1 
ATOM 5668  H HB2  . GLU C 1 114 ? 135.739 97.986  -17.658 1.00 0.00 ? 114 GLU C HB2  1 
ATOM 5669  H HB3  . GLU C 1 114 ? 136.486 97.991  -16.061 1.00 0.00 ? 114 GLU C HB3  1 
ATOM 5670  H HG2  . GLU C 1 114 ? 138.558 98.969  -17.125 1.00 0.00 ? 114 GLU C HG2  1 
ATOM 5671  H HG3  . GLU C 1 114 ? 137.638 99.137  -18.620 1.00 0.00 ? 114 GLU C HG3  1 
ATOM 5672  N N    . ASP C 1 115 ? 138.966 96.853  -19.264 1.00 0.00 ? 115 ASP C N    1 
ATOM 5673  C CA   . ASP C 1 115 ? 139.401 96.831  -20.656 1.00 0.00 ? 115 ASP C CA   1 
ATOM 5674  C C    . ASP C 1 115 ? 139.588 95.394  -21.139 1.00 0.00 ? 115 ASP C C    1 
ATOM 5675  O O    . ASP C 1 115 ? 139.725 94.472  -20.335 1.00 0.00 ? 115 ASP C O    1 
ATOM 5676  C CB   . ASP C 1 115 ? 140.720 97.593  -20.799 1.00 0.00 ? 115 ASP C CB   1 
ATOM 5677  C CG   . ASP C 1 115 ? 141.826 96.870  -20.034 1.00 0.00 ? 115 ASP C CG   1 
ATOM 5678  O OD1  . ASP C 1 115 ? 141.537 95.843  -19.443 1.00 0.00 ? 115 ASP C OD1  1 
ATOM 5679  O OD2  . ASP C 1 115 ? 142.945 97.354  -20.052 1.00 0.00 ? 115 ASP C OD2  1 
ATOM 5680  H H    . ASP C 1 115 ? 139.608 97.093  -18.563 1.00 0.00 ? 115 ASP C H    1 
ATOM 5681  H HA   . ASP C 1 115 ? 138.652 97.312  -21.267 1.00 0.00 ? 115 ASP C HA   1 
ATOM 5682  H HB2  . ASP C 1 115 ? 140.987 97.653  -21.844 1.00 0.00 ? 115 ASP C HB2  1 
ATOM 5683  H HB3  . ASP C 1 115 ? 140.604 98.589  -20.401 1.00 0.00 ? 115 ASP C HB3  1 
ATOM 5684  N N    . MET C 1 116 ? 139.595 95.215  -22.462 1.00 0.00 ? 116 MET C N    1 
ATOM 5685  C CA   . MET C 1 116 ? 139.770 93.886  -23.066 1.00 0.00 ? 116 MET C CA   1 
ATOM 5686  C C    . MET C 1 116 ? 140.775 93.951  -24.216 1.00 0.00 ? 116 MET C C    1 
ATOM 5687  O O    . MET C 1 116 ? 140.415 93.739  -25.374 1.00 0.00 ? 116 MET C O    1 
ATOM 5688  C CB   . MET C 1 116 ? 138.423 93.384  -23.589 1.00 0.00 ? 116 MET C CB   1 
ATOM 5689  C CG   . MET C 1 116 ? 137.448 93.268  -22.416 1.00 0.00 ? 116 MET C CG   1 
ATOM 5690  S SD   . MET C 1 116 ? 135.841 92.690  -23.014 1.00 0.00 ? 116 MET C SD   1 
ATOM 5691  C CE   . MET C 1 116 ? 135.014 92.636  -21.404 1.00 0.00 ? 116 MET C CE   1 
ATOM 5692  H H    . MET C 1 116 ? 139.484 95.992  -23.048 1.00 0.00 ? 116 MET C H    1 
ATOM 5693  H HA   . MET C 1 116 ? 140.130 93.188  -22.324 1.00 0.00 ? 116 MET C HA   1 
ATOM 5694  H HB2  . MET C 1 116 ? 138.033 94.084  -24.315 1.00 0.00 ? 116 MET C HB2  1 
ATOM 5695  H HB3  . MET C 1 116 ? 138.549 92.415  -24.048 1.00 0.00 ? 116 MET C HB3  1 
ATOM 5696  H HG2  . MET C 1 116 ? 137.838 92.565  -21.696 1.00 0.00 ? 116 MET C HG2  1 
ATOM 5697  H HG3  . MET C 1 116 ? 137.331 94.234  -21.950 1.00 0.00 ? 116 MET C HG3  1 
ATOM 5698  H HE1  . MET C 1 116 ? 133.943 92.643  -21.551 1.00 0.00 ? 116 MET C HE1  1 
ATOM 5699  H HE2  . MET C 1 116 ? 135.302 93.497  -20.824 1.00 0.00 ? 116 MET C HE2  1 
ATOM 5700  H HE3  . MET C 1 116 ? 135.307 91.736  -20.880 1.00 0.00 ? 116 MET C HE3  1 
ATOM 5701  N N    . PRO C 1 117 ? 142.020 94.243  -23.924 1.00 0.00 ? 117 PRO C N    1 
ATOM 5702  C CA   . PRO C 1 117 ? 143.087 94.339  -24.965 1.00 0.00 ? 117 PRO C CA   1 
ATOM 5703  C C    . PRO C 1 117 ? 143.493 92.963  -25.501 1.00 0.00 ? 117 PRO C C    1 
ATOM 5704  O O    . PRO C 1 117 ? 144.213 92.862  -26.494 1.00 0.00 ? 117 PRO C O    1 
ATOM 5705  C CB   . PRO C 1 117 ? 144.245 95.035  -24.227 1.00 0.00 ? 117 PRO C CB   1 
ATOM 5706  C CG   . PRO C 1 117 ? 144.070 94.641  -22.793 1.00 0.00 ? 117 PRO C CG   1 
ATOM 5707  C CD   . PRO C 1 117 ? 142.554 94.516  -22.570 1.00 0.00 ? 117 PRO C CD   1 
ATOM 5708  H HA   . PRO C 1 117 ? 142.752 94.963  -25.778 1.00 0.00 ? 117 PRO C HA   1 
ATOM 5709  H HB2  . PRO C 1 117 ? 145.203 94.692  -24.607 1.00 0.00 ? 117 PRO C HB2  1 
ATOM 5710  H HB3  . PRO C 1 117 ? 144.166 96.110  -24.328 1.00 0.00 ? 117 PRO C HB3  1 
ATOM 5711  H HG2  . PRO C 1 117 ? 144.559 93.689  -22.607 1.00 0.00 ? 117 PRO C HG2  1 
ATOM 5712  H HG3  . PRO C 1 117 ? 144.476 95.401  -22.138 1.00 0.00 ? 117 PRO C HG3  1 
ATOM 5713  H HD2  . PRO C 1 117 ? 142.341 93.697  -21.896 1.00 0.00 ? 117 PRO C HD2  1 
ATOM 5714  H HD3  . PRO C 1 117 ? 142.145 95.438  -22.189 1.00 0.00 ? 117 PRO C HD3  1 
ATOM 5715  N N    . VAL C 1 118 ? 143.020 91.904  -24.834 1.00 0.00 ? 118 VAL C N    1 
ATOM 5716  C CA   . VAL C 1 118 ? 143.333 90.523  -25.243 1.00 0.00 ? 118 VAL C CA   1 
ATOM 5717  C C    . VAL C 1 118 ? 142.058 89.680  -25.310 1.00 0.00 ? 118 VAL C C    1 
ATOM 5718  O O    . VAL C 1 118 ? 141.100 89.928  -24.578 1.00 0.00 ? 118 VAL C O    1 
ATOM 5719  C CB   . VAL C 1 118 ? 144.305 89.898  -24.238 1.00 0.00 ? 118 VAL C CB   1 
ATOM 5720  C CG1  . VAL C 1 118 ? 145.649 90.629  -24.300 1.00 0.00 ? 118 VAL C CG1  1 
ATOM 5721  C CG2  . VAL C 1 118 ? 143.726 90.025  -22.824 1.00 0.00 ? 118 VAL C CG2  1 
ATOM 5722  H H    . VAL C 1 118 ? 142.450 92.051  -24.051 1.00 0.00 ? 118 VAL C H    1 
ATOM 5723  H HA   . VAL C 1 118 ? 143.798 90.526  -26.222 1.00 0.00 ? 118 VAL C HA   1 
ATOM 5724  H HB   . VAL C 1 118 ? 144.450 88.854  -24.478 1.00 0.00 ? 118 VAL C HB   1 
ATOM 5725  H HG11 . VAL C 1 118 ? 145.495 91.684  -24.125 1.00 0.00 ? 118 VAL C HG11 1 
ATOM 5726  H HG12 . VAL C 1 118 ? 146.091 90.487  -25.276 1.00 0.00 ? 118 VAL C HG12 1 
ATOM 5727  H HG13 . VAL C 1 118 ? 146.310 90.232  -23.544 1.00 0.00 ? 118 VAL C HG13 1 
ATOM 5728  H HG21 . VAL C 1 118 ? 142.747 89.572  -22.794 1.00 0.00 ? 118 VAL C HG21 1 
ATOM 5729  H HG22 . VAL C 1 118 ? 143.649 91.069  -22.561 1.00 0.00 ? 118 VAL C HG22 1 
ATOM 5730  H HG23 . VAL C 1 118 ? 144.377 89.524  -22.124 1.00 0.00 ? 118 VAL C HG23 1 
ATOM 5731  N N    . ASP C 1 119 ? 142.060 88.679  -26.191 1.00 0.00 ? 119 ASP C N    1 
ATOM 5732  C CA   . ASP C 1 119 ? 140.900 87.799  -26.345 1.00 0.00 ? 119 ASP C CA   1 
ATOM 5733  C C    . ASP C 1 119 ? 139.601 88.601  -26.329 1.00 0.00 ? 119 ASP C C    1 
ATOM 5734  O O    . ASP C 1 119 ? 138.836 88.541  -25.366 1.00 0.00 ? 119 ASP C O    1 
ATOM 5735  C CB   . ASP C 1 119 ? 140.873 86.764  -25.216 1.00 0.00 ? 119 ASP C CB   1 
ATOM 5736  C CG   . ASP C 1 119 ? 139.895 85.643  -25.557 1.00 0.00 ? 119 ASP C CG   1 
ATOM 5737  O OD1  . ASP C 1 119 ? 140.148 84.934  -26.517 1.00 0.00 ? 119 ASP C OD1  1 
ATOM 5738  O OD2  . ASP C 1 119 ? 138.908 85.508  -24.852 1.00 0.00 ? 119 ASP C OD2  1 
ATOM 5739  H H    . ASP C 1 119 ? 142.854 88.529  -26.744 1.00 0.00 ? 119 ASP C H    1 
ATOM 5740  H HA   . ASP C 1 119 ? 140.979 87.281  -27.288 1.00 0.00 ? 119 ASP C HA   1 
ATOM 5741  H HB2  . ASP C 1 119 ? 141.862 86.350  -25.086 1.00 0.00 ? 119 ASP C HB2  1 
ATOM 5742  H HB3  . ASP C 1 119 ? 140.561 87.243  -24.300 1.00 0.00 ? 119 ASP C HB3  1 
ATOM 5743  N N    . PRO C 1 120 ? 139.340 89.344  -27.372 1.00 0.00 ? 120 PRO C N    1 
ATOM 5744  C CA   . PRO C 1 120 ? 138.100 90.177  -27.480 1.00 0.00 ? 120 PRO C CA   1 
ATOM 5745  C C    . PRO C 1 120 ? 136.838 89.357  -27.203 1.00 0.00 ? 120 PRO C C    1 
ATOM 5746  O O    . PRO C 1 120 ? 135.908 89.830  -26.549 1.00 0.00 ? 120 PRO C O    1 
ATOM 5747  C CB   . PRO C 1 120 ? 138.142 90.669  -28.938 1.00 0.00 ? 120 PRO C CB   1 
ATOM 5748  C CG   . PRO C 1 120 ? 139.595 90.697  -29.272 1.00 0.00 ? 120 PRO C CG   1 
ATOM 5749  C CD   . PRO C 1 120 ? 140.192 89.482  -28.566 1.00 0.00 ? 120 PRO C CD   1 
ATOM 5750  H HA   . PRO C 1 120 ? 138.154 91.018  -26.811 1.00 0.00 ? 120 PRO C HA   1 
ATOM 5751  H HB2  . PRO C 1 120 ? 137.617 89.978  -29.590 1.00 0.00 ? 120 PRO C HB2  1 
ATOM 5752  H HB3  . PRO C 1 120 ? 137.722 91.660  -29.020 1.00 0.00 ? 120 PRO C HB3  1 
ATOM 5753  H HG2  . PRO C 1 120 ? 139.737 90.622  -30.345 1.00 0.00 ? 120 PRO C HG2  1 
ATOM 5754  H HG3  . PRO C 1 120 ? 140.051 91.599  -28.894 1.00 0.00 ? 120 PRO C HG3  1 
ATOM 5755  H HD2  . PRO C 1 120 ? 140.118 88.604  -29.197 1.00 0.00 ? 120 PRO C HD2  1 
ATOM 5756  H HD3  . PRO C 1 120 ? 141.214 89.666  -28.279 1.00 0.00 ? 120 PRO C HD3  1 
ATOM 5757  N N    . ASP C 1 121 ? 136.825 88.127  -27.698 1.00 0.00 ? 121 ASP C N    1 
ATOM 5758  C CA   . ASP C 1 121 ? 135.685 87.244  -27.495 1.00 0.00 ? 121 ASP C CA   1 
ATOM 5759  C C    . ASP C 1 121 ? 135.566 86.861  -26.021 1.00 0.00 ? 121 ASP C C    1 
ATOM 5760  O O    . ASP C 1 121 ? 136.572 86.634  -25.348 1.00 0.00 ? 121 ASP C O    1 
ATOM 5761  C CB   . ASP C 1 121 ? 135.852 85.982  -28.342 1.00 0.00 ? 121 ASP C CB   1 
ATOM 5762  C CG   . ASP C 1 121 ? 135.667 86.318  -29.818 1.00 0.00 ? 121 ASP C CG   1 
ATOM 5763  O OD1  . ASP C 1 121 ? 135.162 87.391  -30.103 1.00 0.00 ? 121 ASP C OD1  1 
ATOM 5764  O OD2  . ASP C 1 121 ? 136.039 85.498  -30.642 1.00 0.00 ? 121 ASP C OD2  1 
ATOM 5765  H H    . ASP C 1 121 ? 137.598 87.804  -28.205 1.00 0.00 ? 121 ASP C H    1 
ATOM 5766  H HA   . ASP C 1 121 ? 134.785 87.755  -27.800 1.00 0.00 ? 121 ASP C HA   1 
ATOM 5767  H HB2  . ASP C 1 121 ? 136.841 85.576  -28.186 1.00 0.00 ? 121 ASP C HB2  1 
ATOM 5768  H HB3  . ASP C 1 121 ? 135.114 85.251  -28.046 1.00 0.00 ? 121 ASP C HB3  1 
ATOM 5769  N N    . ASN C 1 122 ? 134.334 86.784  -25.527 1.00 0.00 ? 122 ASN C N    1 
ATOM 5770  C CA   . ASN C 1 122 ? 134.098 86.418  -24.129 1.00 0.00 ? 122 ASN C CA   1 
ATOM 5771  C C    . ASN C 1 122 ? 132.705 85.824  -23.965 1.00 0.00 ? 122 ASN C C    1 
ATOM 5772  O O    . ASN C 1 122 ? 131.840 85.996  -24.823 1.00 0.00 ? 122 ASN C O    1 
ATOM 5773  C CB   . ASN C 1 122 ? 134.244 87.650  -23.233 1.00 0.00 ? 122 ASN C CB   1 
ATOM 5774  C CG   . ASN C 1 122 ? 133.130 88.646  -23.531 1.00 0.00 ? 122 ASN C CG   1 
ATOM 5775  O OD1  . ASN C 1 122 ? 132.345 88.444  -24.457 1.00 0.00 ? 122 ASN C OD1  1 
ATOM 5776  N ND2  . ASN C 1 122 ? 133.012 89.719  -22.796 1.00 0.00 ? 122 ASN C ND2  1 
ATOM 5777  H H    . ASN C 1 122 ? 133.570 86.970  -26.109 1.00 0.00 ? 122 ASN C H    1 
ATOM 5778  H HA   . ASN C 1 122 ? 134.829 85.680  -23.828 1.00 0.00 ? 122 ASN C HA   1 
ATOM 5779  H HB2  . ASN C 1 122 ? 134.190 87.348  -22.197 1.00 0.00 ? 122 ASN C HB2  1 
ATOM 5780  H HB3  . ASN C 1 122 ? 135.200 88.117  -23.419 1.00 0.00 ? 122 ASN C HB3  1 
ATOM 5781  H HD21 . ASN C 1 122 ? 133.637 89.878  -22.058 1.00 0.00 ? 122 ASN C HD21 1 
ATOM 5782  H HD22 . ASN C 1 122 ? 132.299 90.364  -22.981 1.00 0.00 ? 122 ASN C HD22 1 
ATOM 5783  N N    . GLU C 1 123 ? 132.496 85.113  -22.860 1.00 0.00 ? 123 GLU C N    1 
ATOM 5784  C CA   . GLU C 1 123 ? 131.202 84.488  -22.596 1.00 0.00 ? 123 GLU C CA   1 
ATOM 5785  C C    . GLU C 1 123 ? 130.723 83.710  -23.828 1.00 0.00 ? 123 GLU C C    1 
ATOM 5786  O O    . GLU C 1 123 ? 129.572 83.280  -23.889 1.00 0.00 ? 123 GLU C O    1 
ATOM 5787  C CB   . GLU C 1 123 ? 130.164 85.564  -22.219 1.00 0.00 ? 123 GLU C CB   1 
ATOM 5788  C CG   . GLU C 1 123 ? 130.354 85.990  -20.755 1.00 0.00 ? 123 GLU C CG   1 
ATOM 5789  C CD   . GLU C 1 123 ? 131.695 86.694  -20.585 1.00 0.00 ? 123 GLU C CD   1 
ATOM 5790  O OE1  . GLU C 1 123 ? 131.990 87.564  -21.387 1.00 0.00 ? 123 GLU C OE1  1 
ATOM 5791  O OE2  . GLU C 1 123 ? 132.403 86.357  -19.651 1.00 0.00 ? 123 GLU C OE2  1 
ATOM 5792  H H    . GLU C 1 123 ? 133.224 85.004  -22.213 1.00 0.00 ? 123 GLU C H    1 
ATOM 5793  H HA   . GLU C 1 123 ? 131.310 83.798  -21.772 1.00 0.00 ? 123 GLU C HA   1 
ATOM 5794  H HB2  . GLU C 1 123 ? 130.292 86.425  -22.861 1.00 0.00 ? 123 GLU C HB2  1 
ATOM 5795  H HB3  . GLU C 1 123 ? 129.166 85.169  -22.346 1.00 0.00 ? 123 GLU C HB3  1 
ATOM 5796  H HG2  . GLU C 1 123 ? 129.559 86.667  -20.475 1.00 0.00 ? 123 GLU C HG2  1 
ATOM 5797  H HG3  . GLU C 1 123 ? 130.322 85.120  -20.118 1.00 0.00 ? 123 GLU C HG3  1 
ATOM 5798  N N    . ALA C 1 124 ? 131.613 83.536  -24.803 1.00 0.00 ? 124 ALA C N    1 
ATOM 5799  C CA   . ALA C 1 124 ? 131.266 82.811  -26.022 1.00 0.00 ? 124 ALA C CA   1 
ATOM 5800  C C    . ALA C 1 124 ? 130.911 81.362  -25.706 1.00 0.00 ? 124 ALA C C    1 
ATOM 5801  O O    . ALA C 1 124 ? 129.943 80.819  -26.239 1.00 0.00 ? 124 ALA C O    1 
ATOM 5802  C CB   . ALA C 1 124 ? 132.441 82.847  -27.000 1.00 0.00 ? 124 ALA C CB   1 
ATOM 5803  H H    . ALA C 1 124 ? 132.516 83.899  -24.702 1.00 0.00 ? 124 ALA C H    1 
ATOM 5804  H HA   . ALA C 1 124 ? 130.414 83.288  -26.484 1.00 0.00 ? 124 ALA C HA   1 
ATOM 5805  H HB1  . ALA C 1 124 ? 132.232 82.197  -27.837 1.00 0.00 ? 124 ALA C HB1  1 
ATOM 5806  H HB2  . ALA C 1 124 ? 133.336 82.511  -26.498 1.00 0.00 ? 124 ALA C HB2  1 
ATOM 5807  H HB3  . ALA C 1 124 ? 132.585 83.856  -27.355 1.00 0.00 ? 124 ALA C HB3  1 
ATOM 5808  N N    . TYR C 1 125 ? 131.701 80.742  -24.833 1.00 0.00 ? 125 TYR C N    1 
ATOM 5809  C CA   . TYR C 1 125 ? 131.465 79.353  -24.447 1.00 0.00 ? 125 TYR C CA   1 
ATOM 5810  C C    . TYR C 1 125 ? 130.391 79.270  -23.366 1.00 0.00 ? 125 TYR C C    1 
ATOM 5811  O O    . TYR C 1 125 ? 129.716 78.250  -23.226 1.00 0.00 ? 125 TYR C O    1 
ATOM 5812  C CB   . TYR C 1 125 ? 132.763 78.725  -23.933 1.00 0.00 ? 125 TYR C CB   1 
ATOM 5813  C CG   . TYR C 1 125 ? 133.737 78.574  -25.079 1.00 0.00 ? 125 TYR C CG   1 
ATOM 5814  C CD1  . TYR C 1 125 ? 133.710 77.421  -25.873 1.00 0.00 ? 125 TYR C CD1  1 
ATOM 5815  C CD2  . TYR C 1 125 ? 134.666 79.587  -25.346 1.00 0.00 ? 125 TYR C CD2  1 
ATOM 5816  C CE1  . TYR C 1 125 ? 134.612 77.281  -26.934 1.00 0.00 ? 125 TYR C CE1  1 
ATOM 5817  C CE2  . TYR C 1 125 ? 135.568 79.447  -26.407 1.00 0.00 ? 125 TYR C CE2  1 
ATOM 5818  C CZ   . TYR C 1 125 ? 135.541 78.294  -27.201 1.00 0.00 ? 125 TYR C CZ   1 
ATOM 5819  O OH   . TYR C 1 125 ? 136.431 78.155  -28.248 1.00 0.00 ? 125 TYR C OH   1 
ATOM 5820  H H    . TYR C 1 125 ? 132.457 81.228  -24.441 1.00 0.00 ? 125 TYR C H    1 
ATOM 5821  H HA   . TYR C 1 125 ? 131.132 78.799  -25.313 1.00 0.00 ? 125 TYR C HA   1 
ATOM 5822  H HB2  . TYR C 1 125 ? 133.194 79.360  -23.174 1.00 0.00 ? 125 TYR C HB2  1 
ATOM 5823  H HB3  . TYR C 1 125 ? 132.551 77.753  -23.512 1.00 0.00 ? 125 TYR C HB3  1 
ATOM 5824  H HD1  . TYR C 1 125 ? 132.994 76.639  -25.666 1.00 0.00 ? 125 TYR C HD1  1 
ATOM 5825  H HD2  . TYR C 1 125 ? 134.686 80.476  -24.734 1.00 0.00 ? 125 TYR C HD2  1 
ATOM 5826  H HE1  . TYR C 1 125 ? 134.593 76.392  -27.546 1.00 0.00 ? 125 TYR C HE1  1 
ATOM 5827  H HE2  . TYR C 1 125 ? 136.285 80.227  -26.614 1.00 0.00 ? 125 TYR C HE2  1 
ATOM 5828  H HH   . TYR C 1 125 ? 136.030 78.543  -29.030 1.00 0.00 ? 125 TYR C HH   1 
ATOM 5829  N N    . GLU C 1 126 ? 130.243 80.347  -22.601 1.00 0.00 ? 126 GLU C N    1 
ATOM 5830  C CA   . GLU C 1 126 ? 129.251 80.381  -21.532 1.00 0.00 ? 126 GLU C CA   1 
ATOM 5831  C C    . GLU C 1 126 ? 127.850 80.583  -22.101 1.00 0.00 ? 126 GLU C C    1 
ATOM 5832  O O    . GLU C 1 126 ? 127.596 81.541  -22.832 1.00 0.00 ? 126 GLU C O    1 
ATOM 5833  C CB   . GLU C 1 126 ? 129.580 81.516  -20.556 1.00 0.00 ? 126 GLU C CB   1 
ATOM 5834  C CG   . GLU C 1 126 ? 128.588 81.500  -19.388 1.00 0.00 ? 126 GLU C CG   1 
ATOM 5835  C CD   . GLU C 1 126 ? 128.967 82.572  -18.371 1.00 0.00 ? 126 GLU C CD   1 
ATOM 5836  O OE1  . GLU C 1 126 ? 129.960 83.245  -18.591 1.00 0.00 ? 126 GLU C OE1  1 
ATOM 5837  O OE2  . GLU C 1 126 ? 128.257 82.705  -17.387 1.00 0.00 ? 126 GLU C OE2  1 
ATOM 5838  H H    . GLU C 1 126 ? 130.812 81.130  -22.756 1.00 0.00 ? 126 GLU C H    1 
ATOM 5839  H HA   . GLU C 1 126 ? 129.281 79.444  -20.997 1.00 0.00 ? 126 GLU C HA   1 
ATOM 5840  H HB2  . GLU C 1 126 ? 130.584 81.384  -20.177 1.00 0.00 ? 126 GLU C HB2  1 
ATOM 5841  H HB3  . GLU C 1 126 ? 129.511 82.463  -21.069 1.00 0.00 ? 126 GLU C HB3  1 
ATOM 5842  H HG2  . GLU C 1 126 ? 127.593 81.695  -19.759 1.00 0.00 ? 126 GLU C HG2  1 
ATOM 5843  H HG3  . GLU C 1 126 ? 128.611 80.532  -18.911 1.00 0.00 ? 126 GLU C HG3  1 
ATOM 5844  N N    . MET C 1 127 ? 126.943 79.675  -21.752 1.00 0.00 ? 127 MET C N    1 
ATOM 5845  C CA   . MET C 1 127 ? 125.565 79.759  -22.224 1.00 0.00 ? 127 MET C CA   1 
ATOM 5846  C C    . MET C 1 127 ? 124.703 78.692  -21.550 1.00 0.00 ? 127 MET C C    1 
ATOM 5847  O O    . MET C 1 127 ? 124.006 77.930  -22.221 1.00 0.00 ? 127 MET C O    1 
ATOM 5848  C CB   . MET C 1 127 ? 125.521 79.579  -23.747 1.00 0.00 ? 127 MET C CB   1 
ATOM 5849  C CG   . MET C 1 127 ? 126.450 78.436  -24.155 1.00 0.00 ? 127 MET C CG   1 
ATOM 5850  S SD   . MET C 1 127 ? 126.233 78.082  -25.919 1.00 0.00 ? 127 MET C SD   1 
ATOM 5851  C CE   . MET C 1 127 ? 126.933 79.623  -26.565 1.00 0.00 ? 127 MET C CE   1 
ATOM 5852  H H    . MET C 1 127 ? 127.205 78.937  -21.163 1.00 0.00 ? 127 MET C H    1 
ATOM 5853  H HA   . MET C 1 127 ? 125.172 80.733  -21.977 1.00 0.00 ? 127 MET C HA   1 
ATOM 5854  H HB2  . MET C 1 127 ? 124.510 79.352  -24.057 1.00 0.00 ? 127 MET C HB2  1 
ATOM 5855  H HB3  . MET C 1 127 ? 125.846 80.491  -24.225 1.00 0.00 ? 127 MET C HB3  1 
ATOM 5856  H HG2  . MET C 1 127 ? 127.474 78.718  -23.965 1.00 0.00 ? 127 MET C HG2  1 
ATOM 5857  H HG3  . MET C 1 127 ? 126.209 77.554  -23.580 1.00 0.00 ? 127 MET C HG3  1 
ATOM 5858  H HE1  . MET C 1 127 ? 127.753 79.941  -25.936 1.00 0.00 ? 127 MET C HE1  1 
ATOM 5859  H HE2  . MET C 1 127 ? 126.173 80.388  -26.575 1.00 0.00 ? 127 MET C HE2  1 
ATOM 5860  H HE3  . MET C 1 127 ? 127.287 79.460  -27.575 1.00 0.00 ? 127 MET C HE3  1 
ATOM 5861  N N    . PRO C 1 128 ? 124.741 78.623  -20.242 1.00 0.00 ? 128 PRO C N    1 
ATOM 5862  C CA   . PRO C 1 128 ? 123.945 77.620  -19.464 1.00 0.00 ? 128 PRO C CA   1 
ATOM 5863  C C    . PRO C 1 128 ? 122.438 77.897  -19.533 1.00 0.00 ? 128 PRO C C    1 
ATOM 5864  O O    . PRO C 1 128 ? 121.628 76.970  -19.575 1.00 0.00 ? 128 PRO C O    1 
ATOM 5865  C CB   . PRO C 1 128 ? 124.485 77.783  -18.027 1.00 0.00 ? 128 PRO C CB   1 
ATOM 5866  C CG   . PRO C 1 128 ? 124.977 79.195  -17.970 1.00 0.00 ? 128 PRO C CG   1 
ATOM 5867  C CD   . PRO C 1 128 ? 125.540 79.492  -19.360 1.00 0.00 ? 128 PRO C CD   1 
ATOM 5868  H HA   . PRO C 1 128 ? 124.154 76.624  -19.818 1.00 0.00 ? 128 PRO C HA   1 
ATOM 5869  H HB2  . PRO C 1 128 ? 123.698 77.621  -17.297 1.00 0.00 ? 128 PRO C HB2  1 
ATOM 5870  H HB3  . PRO C 1 128 ? 125.305 77.099  -17.852 1.00 0.00 ? 128 PRO C HB3  1 
ATOM 5871  H HG2  . PRO C 1 128 ? 124.155 79.866  -17.746 1.00 0.00 ? 128 PRO C HG2  1 
ATOM 5872  H HG3  . PRO C 1 128 ? 125.757 79.297  -17.229 1.00 0.00 ? 128 PRO C HG3  1 
ATOM 5873  H HD2  . PRO C 1 128 ? 125.400 80.536  -19.616 1.00 0.00 ? 128 PRO C HD2  1 
ATOM 5874  H HD3  . PRO C 1 128 ? 126.582 79.221  -19.415 1.00 0.00 ? 128 PRO C HD3  1 
ATOM 5875  N N    . SER C 1 129 ? 122.076 79.176  -19.546 1.00 0.00 ? 129 SER C N    1 
ATOM 5876  C CA   . SER C 1 129 ? 120.670 79.565  -19.610 1.00 0.00 ? 129 SER C CA   1 
ATOM 5877  C C    . SER C 1 129 ? 120.539 81.035  -19.995 1.00 0.00 ? 129 SER C C    1 
ATOM 5878  O O    . SER C 1 129 ? 121.527 81.766  -20.034 1.00 0.00 ? 129 SER C O    1 
ATOM 5879  C CB   . SER C 1 129 ? 119.994 79.327  -18.260 1.00 0.00 ? 129 SER C CB   1 
ATOM 5880  O OG   . SER C 1 129 ? 120.523 80.234  -17.301 1.00 0.00 ? 129 SER C OG   1 
ATOM 5881  H H    . SER C 1 129 ? 122.766 79.872  -19.511 1.00 0.00 ? 129 SER C H    1 
ATOM 5882  H HA   . SER C 1 129 ? 120.176 78.963  -20.357 1.00 0.00 ? 129 SER C HA   1 
ATOM 5883  H HB2  . SER C 1 129 ? 118.935 79.487  -18.353 1.00 0.00 ? 129 SER C HB2  1 
ATOM 5884  H HB3  . SER C 1 129 ? 120.175 78.306  -17.942 1.00 0.00 ? 129 SER C HB3  1 
ATOM 5885  H HG   . SER C 1 129 ? 120.337 79.883  -16.427 1.00 0.00 ? 129 SER C HG   1 
ATOM 5886  N N    . GLU C 1 130 ? 119.304 81.464  -20.278 1.00 0.00 ? 130 GLU C N    1 
ATOM 5887  C CA   . GLU C 1 130 ? 119.037 82.860  -20.661 1.00 0.00 ? 130 GLU C CA   1 
ATOM 5888  C C    . GLU C 1 130 ? 117.811 83.399  -19.917 1.00 0.00 ? 130 GLU C C    1 
ATOM 5889  O O    . GLU C 1 130 ? 117.075 84.238  -20.439 1.00 0.00 ? 130 GLU C O    1 
ATOM 5890  C CB   . GLU C 1 130 ? 118.810 82.949  -22.177 1.00 0.00 ? 130 GLU C CB   1 
ATOM 5891  C CG   . GLU C 1 130 ? 117.944 81.775  -22.637 1.00 0.00 ? 130 GLU C CG   1 
ATOM 5892  C CD   . GLU C 1 130 ? 117.642 81.902  -24.127 1.00 0.00 ? 130 GLU C CD   1 
ATOM 5893  O OE1  . GLU C 1 130 ? 118.499 82.390  -24.845 1.00 0.00 ? 130 GLU C OE1  1 
ATOM 5894  O OE2  . GLU C 1 130 ? 116.558 81.511  -24.527 1.00 0.00 ? 130 GLU C OE2  1 
ATOM 5895  H H    . GLU C 1 130 ? 118.557 80.833  -20.226 1.00 0.00 ? 130 GLU C H    1 
ATOM 5896  H HA   . GLU C 1 130 ? 119.891 83.477  -20.404 1.00 0.00 ? 130 GLU C HA   1 
ATOM 5897  H HB2  . GLU C 1 130 ? 118.316 83.880  -22.419 1.00 0.00 ? 130 GLU C HB2  1 
ATOM 5898  H HB3  . GLU C 1 130 ? 119.763 82.907  -22.684 1.00 0.00 ? 130 GLU C HB3  1 
ATOM 5899  H HG2  . GLU C 1 130 ? 118.470 80.849  -22.456 1.00 0.00 ? 130 GLU C HG2  1 
ATOM 5900  H HG3  . GLU C 1 130 ? 117.019 81.774  -22.085 1.00 0.00 ? 130 GLU C HG3  1 
ATOM 5901  N N    . GLU C 1 131 ? 117.607 82.918  -18.691 1.00 0.00 ? 131 GLU C N    1 
ATOM 5902  C CA   . GLU C 1 131 ? 116.476 83.364  -17.876 1.00 0.00 ? 131 GLU C CA   1 
ATOM 5903  C C    . GLU C 1 131 ? 115.173 83.300  -18.666 1.00 0.00 ? 131 GLU C C    1 
ATOM 5904  O O    . GLU C 1 131 ? 114.532 84.323  -18.911 1.00 0.00 ? 131 GLU C O    1 
ATOM 5905  C CB   . GLU C 1 131 ? 116.714 84.796  -17.385 1.00 0.00 ? 131 GLU C CB   1 
ATOM 5906  C CG   . GLU C 1 131 ? 117.905 84.823  -16.415 1.00 0.00 ? 131 GLU C CG   1 
ATOM 5907  C CD   . GLU C 1 131 ? 119.216 84.685  -17.185 1.00 0.00 ? 131 GLU C CD   1 
ATOM 5908  O OE1  . GLU C 1 131 ? 119.222 84.976  -18.370 1.00 0.00 ? 131 GLU C OE1  1 
ATOM 5909  O OE2  . GLU C 1 131 ? 120.198 84.297  -16.574 1.00 0.00 ? 131 GLU C OE2  1 
ATOM 5910  H H    . GLU C 1 131 ? 118.231 82.257  -18.325 1.00 0.00 ? 131 GLU C H    1 
ATOM 5911  H HA   . GLU C 1 131 ? 116.388 82.713  -17.019 1.00 0.00 ? 131 GLU C HA   1 
ATOM 5912  H HB2  . GLU C 1 131 ? 116.920 85.437  -18.229 1.00 0.00 ? 131 GLU C HB2  1 
ATOM 5913  H HB3  . GLU C 1 131 ? 115.831 85.151  -16.874 1.00 0.00 ? 131 GLU C HB3  1 
ATOM 5914  H HG2  . GLU C 1 131 ? 117.905 85.760  -15.878 1.00 0.00 ? 131 GLU C HG2  1 
ATOM 5915  H HG3  . GLU C 1 131 ? 117.817 84.009  -15.711 1.00 0.00 ? 131 GLU C HG3  1 
ATOM 5916  N N    . GLY C 1 132 ? 114.788 82.089  -19.064 1.00 0.00 ? 132 GLY C N    1 
ATOM 5917  C CA   . GLY C 1 132 ? 113.556 81.887  -19.831 1.00 0.00 ? 132 GLY C CA   1 
ATOM 5918  C C    . GLY C 1 132 ? 113.843 81.939  -21.325 1.00 0.00 ? 132 GLY C C    1 
ATOM 5919  O O    . GLY C 1 132 ? 114.824 82.541  -21.755 1.00 0.00 ? 132 GLY C O    1 
ATOM 5920  H H    . GLY C 1 132 ? 115.342 81.314  -18.837 1.00 0.00 ? 132 GLY C H    1 
ATOM 5921  H HA2  . GLY C 1 132 ? 113.140 80.920  -19.582 1.00 0.00 ? 132 GLY C HA2  1 
ATOM 5922  H HA3  . GLY C 1 132 ? 112.839 82.658  -19.580 1.00 0.00 ? 132 GLY C HA3  1 
ATOM 5923  N N    . TYR C 1 133 ? 112.978 81.303  -22.117 1.00 0.00 ? 133 TYR C N    1 
ATOM 5924  C CA   . TYR C 1 133 ? 113.148 81.277  -23.576 1.00 0.00 ? 133 TYR C CA   1 
ATOM 5925  C C    . TYR C 1 133 ? 112.277 82.338  -24.236 1.00 0.00 ? 133 TYR C C    1 
ATOM 5926  O O    . TYR C 1 133 ? 111.126 82.541  -23.849 1.00 0.00 ? 133 TYR C O    1 
ATOM 5927  C CB   . TYR C 1 133 ? 112.764 79.899  -24.116 1.00 0.00 ? 133 TYR C CB   1 
ATOM 5928  C CG   . TYR C 1 133 ? 113.796 78.887  -23.682 1.00 0.00 ? 133 TYR C CG   1 
ATOM 5929  C CD1  . TYR C 1 133 ? 113.651 78.218  -22.460 1.00 0.00 ? 133 TYR C CD1  1 
ATOM 5930  C CD2  . TYR C 1 133 ? 114.898 78.618  -24.501 1.00 0.00 ? 133 TYR C CD2  1 
ATOM 5931  C CE1  . TYR C 1 133 ? 114.610 77.280  -22.059 1.00 0.00 ? 133 TYR C CE1  1 
ATOM 5932  C CE2  . TYR C 1 133 ? 115.856 77.680  -24.099 1.00 0.00 ? 133 TYR C CE2  1 
ATOM 5933  C CZ   . TYR C 1 133 ? 115.712 77.012  -22.878 1.00 0.00 ? 133 TYR C CZ   1 
ATOM 5934  O OH   . TYR C 1 133 ? 116.657 76.088  -22.482 1.00 0.00 ? 133 TYR C OH   1 
ATOM 5935  H H    . TYR C 1 133 ? 112.214 80.840  -21.716 1.00 0.00 ? 133 TYR C H    1 
ATOM 5936  H HA   . TYR C 1 133 ? 114.184 81.470  -23.827 1.00 0.00 ? 133 TYR C HA   1 
ATOM 5937  H HB2  . TYR C 1 133 ? 111.796 79.617  -23.728 1.00 0.00 ? 133 TYR C HB2  1 
ATOM 5938  H HB3  . TYR C 1 133 ? 112.724 79.932  -25.194 1.00 0.00 ? 133 TYR C HB3  1 
ATOM 5939  H HD1  . TYR C 1 133 ? 112.800 78.425  -21.828 1.00 0.00 ? 133 TYR C HD1  1 
ATOM 5940  H HD2  . TYR C 1 133 ? 115.009 79.134  -25.443 1.00 0.00 ? 133 TYR C HD2  1 
ATOM 5941  H HE1  . TYR C 1 133 ? 114.498 76.765  -21.116 1.00 0.00 ? 133 TYR C HE1  1 
ATOM 5942  H HE2  . TYR C 1 133 ? 116.707 77.473  -24.732 1.00 0.00 ? 133 TYR C HE2  1 
ATOM 5943  H HH   . TYR C 1 133 ? 116.529 75.914  -21.546 1.00 0.00 ? 133 TYR C HH   1 
ATOM 5944  N N    . GLN C 1 134 ? 112.835 83.011  -25.242 1.00 0.00 ? 134 GLN C N    1 
ATOM 5945  C CA   . GLN C 1 134 ? 112.102 84.055  -25.961 1.00 0.00 ? 134 GLN C CA   1 
ATOM 5946  C C    . GLN C 1 134 ? 112.605 84.168  -27.397 1.00 0.00 ? 134 GLN C C    1 
ATOM 5947  O O    . GLN C 1 134 ? 113.798 84.019  -27.662 1.00 0.00 ? 134 GLN C O    1 
ATOM 5948  C CB   . GLN C 1 134 ? 112.278 85.400  -25.246 1.00 0.00 ? 134 GLN C CB   1 
ATOM 5949  C CG   . GLN C 1 134 ? 113.772 85.760  -25.165 1.00 0.00 ? 134 GLN C CG   1 
ATOM 5950  C CD   . GLN C 1 134 ? 114.248 86.347  -26.492 1.00 0.00 ? 134 GLN C CD   1 
ATOM 5951  O OE1  . GLN C 1 134 ? 113.475 86.995  -27.198 1.00 0.00 ? 134 GLN C OE1  1 
ATOM 5952  N NE2  . GLN C 1 134 ? 115.481 86.156  -26.875 1.00 0.00 ? 134 GLN C NE2  1 
ATOM 5953  H H    . GLN C 1 134 ? 113.755 82.803  -25.506 1.00 0.00 ? 134 GLN C H    1 
ATOM 5954  H HA   . GLN C 1 134 ? 111.051 83.805  -25.979 1.00 0.00 ? 134 GLN C HA   1 
ATOM 5955  H HB2  . GLN C 1 134 ? 111.749 86.169  -25.791 1.00 0.00 ? 134 GLN C HB2  1 
ATOM 5956  H HB3  . GLN C 1 134 ? 111.875 85.330  -24.247 1.00 0.00 ? 134 GLN C HB3  1 
ATOM 5957  H HG2  . GLN C 1 134 ? 113.921 86.488  -24.380 1.00 0.00 ? 134 GLN C HG2  1 
ATOM 5958  H HG3  . GLN C 1 134 ? 114.347 84.872  -24.940 1.00 0.00 ? 134 GLN C HG3  1 
ATOM 5959  H HE21 . GLN C 1 134 ? 116.094 85.639  -26.312 1.00 0.00 ? 134 GLN C HE21 1 
ATOM 5960  H HE22 . GLN C 1 134 ? 115.793 86.530  -27.726 1.00 0.00 ? 134 GLN C HE22 1 
ATOM 5961  N N    . ASP C 1 135 ? 111.683 84.434  -28.318 1.00 0.00 ? 135 ASP C N    1 
ATOM 5962  C CA   . ASP C 1 135 ? 112.033 84.570  -29.729 1.00 0.00 ? 135 ASP C CA   1 
ATOM 5963  C C    . ASP C 1 135 ? 112.553 85.972  -30.022 1.00 0.00 ? 135 ASP C C    1 
ATOM 5964  O O    . ASP C 1 135 ? 112.237 86.924  -29.308 1.00 0.00 ? 135 ASP C O    1 
ATOM 5965  C CB   . ASP C 1 135 ? 110.808 84.292  -30.601 1.00 0.00 ? 135 ASP C CB   1 
ATOM 5966  C CG   . ASP C 1 135 ? 110.471 82.805  -30.567 1.00 0.00 ? 135 ASP C CG   1 
ATOM 5967  O OD1  . ASP C 1 135 ? 111.300 82.040  -30.102 1.00 0.00 ? 135 ASP C OD1  1 
ATOM 5968  O OD2  . ASP C 1 135 ? 109.388 82.454  -31.005 1.00 0.00 ? 135 ASP C OD2  1 
ATOM 5969  H H    . ASP C 1 135 ? 110.750 84.544  -28.043 1.00 0.00 ? 135 ASP C H    1 
ATOM 5970  H HA   . ASP C 1 135 ? 112.804 83.853  -29.974 1.00 0.00 ? 135 ASP C HA   1 
ATOM 5971  H HB2  . ASP C 1 135 ? 109.968 84.860  -30.230 1.00 0.00 ? 135 ASP C HB2  1 
ATOM 5972  H HB3  . ASP C 1 135 ? 111.018 84.586  -31.618 1.00 0.00 ? 135 ASP C HB3  1 
ATOM 5973  N N    . TYR C 1 136 ? 113.351 86.093  -31.081 1.00 0.00 ? 136 TYR C N    1 
ATOM 5974  C CA   . TYR C 1 136 ? 113.911 87.388  -31.471 1.00 0.00 ? 136 TYR C CA   1 
ATOM 5975  C C    . TYR C 1 136 ? 114.165 87.430  -32.974 1.00 0.00 ? 136 TYR C C    1 
ATOM 5976  O O    . TYR C 1 136 ? 114.463 86.409  -33.594 1.00 0.00 ? 136 TYR C O    1 
ATOM 5977  C CB   . TYR C 1 136 ? 115.220 87.632  -30.722 1.00 0.00 ? 136 TYR C CB   1 
ATOM 5978  C CG   . TYR C 1 136 ? 116.162 86.477  -30.967 1.00 0.00 ? 136 TYR C CG   1 
ATOM 5979  C CD1  . TYR C 1 136 ? 116.999 86.479  -32.088 1.00 0.00 ? 136 TYR C CD1  1 
ATOM 5980  C CD2  . TYR C 1 136 ? 116.195 85.403  -30.069 1.00 0.00 ? 136 TYR C CD2  1 
ATOM 5981  C CE1  . TYR C 1 136 ? 117.870 85.405  -32.312 1.00 0.00 ? 136 TYR C CE1  1 
ATOM 5982  C CE2  . TYR C 1 136 ? 117.066 84.330  -30.294 1.00 0.00 ? 136 TYR C CE2  1 
ATOM 5983  C CZ   . TYR C 1 136 ? 117.902 84.331  -31.415 1.00 0.00 ? 136 TYR C CZ   1 
ATOM 5984  O OH   . TYR C 1 136 ? 118.761 83.273  -31.635 1.00 0.00 ? 136 TYR C OH   1 
ATOM 5985  H H    . TYR C 1 136 ? 113.564 85.299  -31.613 1.00 0.00 ? 136 TYR C H    1 
ATOM 5986  H HA   . TYR C 1 136 ? 113.211 88.172  -31.216 1.00 0.00 ? 136 TYR C HA   1 
ATOM 5987  H HB2  . TYR C 1 136 ? 115.673 88.547  -31.074 1.00 0.00 ? 136 TYR C HB2  1 
ATOM 5988  H HB3  . TYR C 1 136 ? 115.021 87.713  -29.663 1.00 0.00 ? 136 TYR C HB3  1 
ATOM 5989  H HD1  . TYR C 1 136 ? 116.973 87.307  -32.781 1.00 0.00 ? 136 TYR C HD1  1 
ATOM 5990  H HD2  . TYR C 1 136 ? 115.549 85.402  -29.204 1.00 0.00 ? 136 TYR C HD2  1 
ATOM 5991  H HE1  . TYR C 1 136 ? 118.516 85.405  -33.178 1.00 0.00 ? 136 TYR C HE1  1 
ATOM 5992  H HE2  . TYR C 1 136 ? 117.090 83.502  -29.601 1.00 0.00 ? 136 TYR C HE2  1 
ATOM 5993  H HH   . TYR C 1 136 ? 119.441 83.565  -32.246 1.00 0.00 ? 136 TYR C HH   1 
ATOM 5994  N N    . GLU C 1 137 ? 114.046 88.620  -33.551 1.00 0.00 ? 137 GLU C N    1 
ATOM 5995  C CA   . GLU C 1 137 ? 114.264 88.791  -34.982 1.00 0.00 ? 137 GLU C CA   1 
ATOM 5996  C C    . GLU C 1 137 ? 114.415 90.274  -35.323 1.00 0.00 ? 137 GLU C C    1 
ATOM 5997  O O    . GLU C 1 137 ? 113.485 90.897  -35.836 1.00 0.00 ? 137 GLU C O    1 
ATOM 5998  C CB   . GLU C 1 137 ? 113.088 88.203  -35.762 1.00 0.00 ? 137 GLU C CB   1 
ATOM 5999  C CG   . GLU C 1 137 ? 113.457 88.101  -37.244 1.00 0.00 ? 137 GLU C CG   1 
ATOM 6000  C CD   . GLU C 1 137 ? 114.485 86.993  -37.452 1.00 0.00 ? 137 GLU C CD   1 
ATOM 6001  O OE1  . GLU C 1 137 ? 114.675 86.209  -36.537 1.00 0.00 ? 137 GLU C OE1  1 
ATOM 6002  O OE2  . GLU C 1 137 ? 115.066 86.945  -38.524 1.00 0.00 ? 137 GLU C OE2  1 
ATOM 6003  H H    . GLU C 1 137 ? 113.807 89.398  -33.005 1.00 0.00 ? 137 GLU C H    1 
ATOM 6004  H HA   . GLU C 1 137 ? 115.165 88.270  -35.265 1.00 0.00 ? 137 GLU C HA   1 
ATOM 6005  H HB2  . GLU C 1 137 ? 112.858 87.219  -35.379 1.00 0.00 ? 137 GLU C HB2  1 
ATOM 6006  H HB3  . GLU C 1 137 ? 112.226 88.843  -35.652 1.00 0.00 ? 137 GLU C HB3  1 
ATOM 6007  H HG2  . GLU C 1 137 ? 112.569 87.880  -37.820 1.00 0.00 ? 137 GLU C HG2  1 
ATOM 6008  H HG3  . GLU C 1 137 ? 113.873 89.041  -37.575 1.00 0.00 ? 137 GLU C HG3  1 
ATOM 6009  N N    . PRO C 1 138 ? 115.560 90.842  -35.051 1.00 0.00 ? 138 PRO C N    1 
ATOM 6010  C CA   . PRO C 1 138 ? 115.834 92.288  -35.336 1.00 0.00 ? 138 PRO C CA   1 
ATOM 6011  C C    . PRO C 1 138 ? 115.569 92.643  -36.801 1.00 0.00 ? 138 PRO C C    1 
ATOM 6012  O O    . PRO C 1 138 ? 115.780 91.825  -37.697 1.00 0.00 ? 138 PRO C O    1 
ATOM 6013  C CB   . PRO C 1 138 ? 117.327 92.440  -34.977 1.00 0.00 ? 138 PRO C CB   1 
ATOM 6014  C CG   . PRO C 1 138 ? 117.580 91.359  -33.978 1.00 0.00 ? 138 PRO C CG   1 
ATOM 6015  C CD   . PRO C 1 138 ? 116.721 90.183  -34.432 1.00 0.00 ? 138 PRO C CD   1 
ATOM 6016  H HA   . PRO C 1 138 ? 115.241 92.913  -34.690 1.00 0.00 ? 138 PRO C HA   1 
ATOM 6017  H HB2  . PRO C 1 138 ? 117.949 92.295  -35.856 1.00 0.00 ? 138 PRO C HB2  1 
ATOM 6018  H HB3  . PRO C 1 138 ? 117.517 93.407  -34.536 1.00 0.00 ? 138 PRO C HB3  1 
ATOM 6019  H HG2  . PRO C 1 138 ? 118.630 91.087  -33.975 1.00 0.00 ? 138 PRO C HG2  1 
ATOM 6020  H HG3  . PRO C 1 138 ? 117.271 91.677  -32.993 1.00 0.00 ? 138 PRO C HG3  1 
ATOM 6021  H HD2  . PRO C 1 138 ? 117.256 89.581  -35.156 1.00 0.00 ? 138 PRO C HD2  1 
ATOM 6022  H HD3  . PRO C 1 138 ? 116.410 89.585  -33.590 1.00 0.00 ? 138 PRO C HD3  1 
ATOM 6023  N N    . GLU C 1 139 ? 115.099 93.864  -37.034 1.00 0.00 ? 139 GLU C N    1 
ATOM 6024  C CA   . GLU C 1 139 ? 114.801 94.309  -38.390 1.00 0.00 ? 139 GLU C CA   1 
ATOM 6025  C C    . GLU C 1 139 ? 116.051 94.216  -39.261 1.00 0.00 ? 139 GLU C C    1 
ATOM 6026  O O    . GLU C 1 139 ? 117.159 94.497  -38.805 1.00 0.00 ? 139 GLU C O    1 
ATOM 6027  C CB   . GLU C 1 139 ? 114.300 95.756  -38.367 1.00 0.00 ? 139 GLU C CB   1 
ATOM 6028  C CG   . GLU C 1 139 ? 113.043 95.852  -37.499 1.00 0.00 ? 139 GLU C CG   1 
ATOM 6029  C CD   . GLU C 1 139 ? 111.902 95.070  -38.140 1.00 0.00 ? 139 GLU C CD   1 
ATOM 6030  O OE1  . GLU C 1 139 ? 111.977 94.820  -39.332 1.00 0.00 ? 139 GLU C OE1  1 
ATOM 6031  O OE2  . GLU C 1 139 ? 110.968 94.734  -37.430 1.00 0.00 ? 139 GLU C OE2  1 
ATOM 6032  H H    . GLU C 1 139 ? 114.944 94.473  -36.282 1.00 0.00 ? 139 GLU C H    1 
ATOM 6033  H HA   . GLU C 1 139 ? 114.032 93.678  -38.807 1.00 0.00 ? 139 GLU C HA   1 
ATOM 6034  H HB2  . GLU C 1 139 ? 115.069 96.396  -37.959 1.00 0.00 ? 139 GLU C HB2  1 
ATOM 6035  H HB3  . GLU C 1 139 ? 114.066 96.070  -39.372 1.00 0.00 ? 139 GLU C HB3  1 
ATOM 6036  H HG2  . GLU C 1 139 ? 113.250 95.445  -36.520 1.00 0.00 ? 139 GLU C HG2  1 
ATOM 6037  H HG3  . GLU C 1 139 ? 112.754 96.889  -37.402 1.00 0.00 ? 139 GLU C HG3  1 
ATOM 6038  N N    . ALA C 1 140 ? 115.864 93.816  -40.520 1.00 0.00 ? 140 ALA C N    1 
ATOM 6039  C CA   . ALA C 1 140 ? 116.986 93.682  -41.451 1.00 0.00 ? 140 ALA C CA   1 
ATOM 6040  C C    . ALA C 1 140 ? 116.510 93.849  -42.892 1.00 0.00 ? 140 ALA C C    1 
ATOM 6041  O O    . ALA C 1 140 ? 115.349 94.169  -43.079 1.00 0.00 ? 140 ALA C O    1 
ATOM 6042  C CB   . ALA C 1 140 ? 117.636 92.306  -41.286 1.00 0.00 ? 140 ALA C CB   1 
ATOM 6043  O OXT  . ALA C 1 140 ? 117.317 93.653  -43.788 1.00 0.00 ? 140 ALA C OXT  1 
ATOM 6044  H H    . ALA C 1 140 ? 114.958 93.602  -40.826 1.00 0.00 ? 140 ALA C H    1 
ATOM 6045  H HA   . ALA C 1 140 ? 117.722 94.444  -41.235 1.00 0.00 ? 140 ALA C HA   1 
ATOM 6046  H HB1  . ALA C 1 140 ? 118.535 92.258  -41.884 1.00 0.00 ? 140 ALA C HB1  1 
ATOM 6047  H HB2  . ALA C 1 140 ? 116.946 91.541  -41.611 1.00 0.00 ? 140 ALA C HB2  1 
ATOM 6048  H HB3  . ALA C 1 140 ? 117.886 92.148  -40.248 1.00 0.00 ? 140 ALA C HB3  1 
ATOM 6049  N N    . MET D 1 1   ? 41.095  160.868 -1.000  1.00 0.00 ? 1   MET D N    1 
ATOM 6050  C CA   . MET D 1 1   ? 40.337  162.011 -0.419  1.00 0.00 ? 1   MET D CA   1 
ATOM 6051  C C    . MET D 1 1   ? 39.032  161.490 0.188   1.00 0.00 ? 1   MET D C    1 
ATOM 6052  O O    . MET D 1 1   ? 38.076  162.243 0.373   1.00 0.00 ? 1   MET D O    1 
ATOM 6053  C CB   . MET D 1 1   ? 40.041  163.034 -1.533  1.00 0.00 ? 1   MET D CB   1 
ATOM 6054  C CG   . MET D 1 1   ? 39.760  164.416 -0.922  1.00 0.00 ? 1   MET D CG   1 
ATOM 6055  S SD   . MET D 1 1   ? 41.312  165.164 -0.359  1.00 0.00 ? 1   MET D SD   1 
ATOM 6056  C CE   . MET D 1 1   ? 41.801  165.916 -1.936  1.00 0.00 ? 1   MET D CE   1 
ATOM 6057  H H1   . MET D 1 1   ? 40.936  160.832 -2.026  1.00 0.00 ? 1   MET D H1   1 
ATOM 6058  H H2   . MET D 1 1   ? 40.767  159.979 -0.566  1.00 0.00 ? 1   MET D H2   1 
ATOM 6059  H H3   . MET D 1 1   ? 42.109  160.992 -0.812  1.00 0.00 ? 1   MET D H3   1 
ATOM 6060  H HA   . MET D 1 1   ? 40.932  162.477 0.353   1.00 0.00 ? 1   MET D HA   1 
ATOM 6061  H HB2  . MET D 1 1   ? 40.896  163.100 -2.189  1.00 0.00 ? 1   MET D HB2  1 
ATOM 6062  H HB3  . MET D 1 1   ? 39.181  162.714 -2.101  1.00 0.00 ? 1   MET D HB3  1 
ATOM 6063  H HG2  . MET D 1 1   ? 39.305  165.052 -1.666  1.00 0.00 ? 1   MET D HG2  1 
ATOM 6064  H HG3  . MET D 1 1   ? 39.089  164.310 -0.084  1.00 0.00 ? 1   MET D HG3  1 
ATOM 6065  H HE1  . MET D 1 1   ? 41.914  165.146 -2.685  1.00 0.00 ? 1   MET D HE1  1 
ATOM 6066  H HE2  . MET D 1 1   ? 42.739  166.433 -1.813  1.00 0.00 ? 1   MET D HE2  1 
ATOM 6067  H HE3  . MET D 1 1   ? 41.043  166.622 -2.248  1.00 0.00 ? 1   MET D HE3  1 
ATOM 6068  N N    . ASP D 1 2   ? 39.000  160.195 0.494   1.00 0.00 ? 2   ASP D N    1 
ATOM 6069  C CA   . ASP D 1 2   ? 37.806  159.583 1.077   1.00 0.00 ? 2   ASP D CA   1 
ATOM 6070  C C    . ASP D 1 2   ? 37.722  159.874 2.576   1.00 0.00 ? 2   ASP D C    1 
ATOM 6071  O O    . ASP D 1 2   ? 36.699  159.613 3.209   1.00 0.00 ? 2   ASP D O    1 
ATOM 6072  C CB   . ASP D 1 2   ? 37.832  158.069 0.851   1.00 0.00 ? 2   ASP D CB   1 
ATOM 6073  C CG   . ASP D 1 2   ? 37.613  157.757 -0.626  1.00 0.00 ? 2   ASP D CG   1 
ATOM 6074  O OD1  . ASP D 1 2   ? 37.205  158.652 -1.348  1.00 0.00 ? 2   ASP D OD1  1 
ATOM 6075  O OD2  . ASP D 1 2   ? 37.856  156.626 -1.015  1.00 0.00 ? 2   ASP D OD2  1 
ATOM 6076  H H    . ASP D 1 2   ? 39.790  159.641 0.323   1.00 0.00 ? 2   ASP D H    1 
ATOM 6077  H HA   . ASP D 1 2   ? 36.933  159.992 0.592   1.00 0.00 ? 2   ASP D HA   1 
ATOM 6078  H HB2  . ASP D 1 2   ? 38.788  157.677 1.162   1.00 0.00 ? 2   ASP D HB2  1 
ATOM 6079  H HB3  . ASP D 1 2   ? 37.048  157.608 1.432   1.00 0.00 ? 2   ASP D HB3  1 
ATOM 6080  N N    . VAL D 1 3   ? 38.809  160.410 3.142   1.00 0.00 ? 3   VAL D N    1 
ATOM 6081  C CA   . VAL D 1 3   ? 38.855  160.730 4.578   1.00 0.00 ? 3   VAL D CA   1 
ATOM 6082  C C    . VAL D 1 3   ? 39.622  162.037 4.810   1.00 0.00 ? 3   VAL D C    1 
ATOM 6083  O O    . VAL D 1 3   ? 39.718  162.519 5.938   1.00 0.00 ? 3   VAL D O    1 
ATOM 6084  C CB   . VAL D 1 3   ? 39.538  159.583 5.342   1.00 0.00 ? 3   VAL D CB   1 
ATOM 6085  C CG1  . VAL D 1 3   ? 39.169  159.644 6.829   1.00 0.00 ? 3   VAL D CG1  1 
ATOM 6086  C CG2  . VAL D 1 3   ? 39.077  158.243 4.760   1.00 0.00 ? 3   VAL D CG2  1 
ATOM 6087  H H    . VAL D 1 3   ? 39.595  160.592 2.587   1.00 0.00 ? 3   VAL D H    1 
ATOM 6088  H HA   . VAL D 1 3   ? 37.844  160.852 4.952   1.00 0.00 ? 3   VAL D HA   1 
ATOM 6089  H HB   . VAL D 1 3   ? 40.610  159.669 5.236   1.00 0.00 ? 3   VAL D HB   1 
ATOM 6090  H HG11 . VAL D 1 3   ? 39.537  160.567 7.253   1.00 0.00 ? 3   VAL D HG11 1 
ATOM 6091  H HG12 . VAL D 1 3   ? 39.615  158.808 7.345   1.00 0.00 ? 3   VAL D HG12 1 
ATOM 6092  H HG13 . VAL D 1 3   ? 38.094  159.601 6.935   1.00 0.00 ? 3   VAL D HG13 1 
ATOM 6093  H HG21 . VAL D 1 3   ? 39.406  157.439 5.403   1.00 0.00 ? 3   VAL D HG21 1 
ATOM 6094  H HG22 . VAL D 1 3   ? 39.501  158.112 3.776   1.00 0.00 ? 3   VAL D HG22 1 
ATOM 6095  H HG23 . VAL D 1 3   ? 37.999  158.231 4.694   1.00 0.00 ? 3   VAL D HG23 1 
ATOM 6096  N N    . PHE D 1 4   ? 40.168  162.596 3.729   1.00 0.00 ? 4   PHE D N    1 
ATOM 6097  C CA   . PHE D 1 4   ? 40.929  163.845 3.811   1.00 0.00 ? 4   PHE D CA   1 
ATOM 6098  C C    . PHE D 1 4   ? 42.193  163.652 4.651   1.00 0.00 ? 4   PHE D C    1 
ATOM 6099  O O    . PHE D 1 4   ? 42.207  163.947 5.846   1.00 0.00 ? 4   PHE D O    1 
ATOM 6100  C CB   . PHE D 1 4   ? 40.062  164.956 4.424   1.00 0.00 ? 4   PHE D CB   1 
ATOM 6101  C CG   . PHE D 1 4   ? 40.684  166.311 4.145   1.00 0.00 ? 4   PHE D CG   1 
ATOM 6102  C CD1  . PHE D 1 4   ? 40.468  166.941 2.911   1.00 0.00 ? 4   PHE D CD1  1 
ATOM 6103  C CD2  . PHE D 1 4   ? 41.471  166.935 5.120   1.00 0.00 ? 4   PHE D CD2  1 
ATOM 6104  C CE1  . PHE D 1 4   ? 41.040  168.195 2.655   1.00 0.00 ? 4   PHE D CE1  1 
ATOM 6105  C CE2  . PHE D 1 4   ? 42.042  168.188 4.863   1.00 0.00 ? 4   PHE D CE2  1 
ATOM 6106  C CZ   . PHE D 1 4   ? 41.827  168.818 3.632   1.00 0.00 ? 4   PHE D CZ   1 
ATOM 6107  H H    . PHE D 1 4   ? 40.057  162.161 2.858   1.00 0.00 ? 4   PHE D H    1 
ATOM 6108  H HA   . PHE D 1 4   ? 41.217  164.140 2.812   1.00 0.00 ? 4   PHE D HA   1 
ATOM 6109  H HB2  . PHE D 1 4   ? 39.073  164.920 3.992   1.00 0.00 ? 4   PHE D HB2  1 
ATOM 6110  H HB3  . PHE D 1 4   ? 39.993  164.811 5.492   1.00 0.00 ? 4   PHE D HB3  1 
ATOM 6111  H HD1  . PHE D 1 4   ? 39.860  166.462 2.158   1.00 0.00 ? 4   PHE D HD1  1 
ATOM 6112  H HD2  . PHE D 1 4   ? 41.638  166.451 6.070   1.00 0.00 ? 4   PHE D HD2  1 
ATOM 6113  H HE1  . PHE D 1 4   ? 40.874  168.681 1.705   1.00 0.00 ? 4   PHE D HE1  1 
ATOM 6114  H HE2  . PHE D 1 4   ? 42.650  168.669 5.615   1.00 0.00 ? 4   PHE D HE2  1 
ATOM 6115  H HZ   . PHE D 1 4   ? 42.267  169.784 3.434   1.00 0.00 ? 4   PHE D HZ   1 
ATOM 6116  N N    . MET D 1 5   ? 43.253  163.155 4.012   1.00 0.00 ? 5   MET D N    1 
ATOM 6117  C CA   . MET D 1 5   ? 44.521  162.927 4.705   1.00 0.00 ? 5   MET D CA   1 
ATOM 6118  C C    . MET D 1 5   ? 44.360  161.840 5.772   1.00 0.00 ? 5   MET D C    1 
ATOM 6119  O O    . MET D 1 5   ? 43.264  161.621 6.287   1.00 0.00 ? 5   MET D O    1 
ATOM 6120  C CB   . MET D 1 5   ? 45.004  164.236 5.356   1.00 0.00 ? 5   MET D CB   1 
ATOM 6121  C CG   . MET D 1 5   ? 46.519  164.172 5.609   1.00 0.00 ? 5   MET D CG   1 
ATOM 6122  S SD   . MET D 1 5   ? 47.411  164.375 4.045   1.00 0.00 ? 5   MET D SD   1 
ATOM 6123  C CE   . MET D 1 5   ? 47.410  166.187 3.999   1.00 0.00 ? 5   MET D CE   1 
ATOM 6124  H H    . MET D 1 5   ? 43.182  162.941 3.058   1.00 0.00 ? 5   MET D H    1 
ATOM 6125  H HA   . MET D 1 5   ? 45.255  162.601 3.982   1.00 0.00 ? 5   MET D HA   1 
ATOM 6126  H HB2  . MET D 1 5   ? 44.785  165.061 4.695   1.00 0.00 ? 5   MET D HB2  1 
ATOM 6127  H HB3  . MET D 1 5   ? 44.491  164.385 6.294   1.00 0.00 ? 5   MET D HB3  1 
ATOM 6128  H HG2  . MET D 1 5   ? 46.803  164.960 6.290   1.00 0.00 ? 5   MET D HG2  1 
ATOM 6129  H HG3  . MET D 1 5   ? 46.769  163.215 6.044   1.00 0.00 ? 5   MET D HG3  1 
ATOM 6130  H HE1  . MET D 1 5   ? 47.344  166.520 2.972   1.00 0.00 ? 5   MET D HE1  1 
ATOM 6131  H HE2  . MET D 1 5   ? 48.321  166.560 4.435   1.00 0.00 ? 5   MET D HE2  1 
ATOM 6132  H HE3  . MET D 1 5   ? 46.566  166.564 4.560   1.00 0.00 ? 5   MET D HE3  1 
ATOM 6133  N N    . LYS D 1 6   ? 45.459  161.158 6.094   1.00 0.00 ? 6   LYS D N    1 
ATOM 6134  C CA   . LYS D 1 6   ? 45.423  160.093 7.094   1.00 0.00 ? 6   LYS D CA   1 
ATOM 6135  C C    . LYS D 1 6   ? 44.333  159.078 6.759   1.00 0.00 ? 6   LYS D C    1 
ATOM 6136  O O    . LYS D 1 6   ? 43.559  158.676 7.627   1.00 0.00 ? 6   LYS D O    1 
ATOM 6137  C CB   . LYS D 1 6   ? 45.169  160.676 8.487   1.00 0.00 ? 6   LYS D CB   1 
ATOM 6138  C CG   . LYS D 1 6   ? 46.357  161.544 8.902   1.00 0.00 ? 6   LYS D CG   1 
ATOM 6139  C CD   . LYS D 1 6   ? 46.116  162.105 10.307  1.00 0.00 ? 6   LYS D CD   1 
ATOM 6140  C CE   . LYS D 1 6   ? 47.321  162.944 10.737  1.00 0.00 ? 6   LYS D CE   1 
ATOM 6141  N NZ   . LYS D 1 6   ? 47.460  164.117 9.827   1.00 0.00 ? 6   LYS D NZ   1 
ATOM 6142  H H    . LYS D 1 6   ? 46.306  161.373 5.648   1.00 0.00 ? 6   LYS D H    1 
ATOM 6143  H HA   . LYS D 1 6   ? 46.377  159.589 7.098   1.00 0.00 ? 6   LYS D HA   1 
ATOM 6144  H HB2  . LYS D 1 6   ? 44.271  161.276 8.468   1.00 0.00 ? 6   LYS D HB2  1 
ATOM 6145  H HB3  . LYS D 1 6   ? 45.049  159.871 9.198   1.00 0.00 ? 6   LYS D HB3  1 
ATOM 6146  H HG2  . LYS D 1 6   ? 47.257  160.947 8.901   1.00 0.00 ? 6   LYS D HG2  1 
ATOM 6147  H HG3  . LYS D 1 6   ? 46.466  162.360 8.206   1.00 0.00 ? 6   LYS D HG3  1 
ATOM 6148  H HD2  . LYS D 1 6   ? 45.229  162.722 10.300  1.00 0.00 ? 6   LYS D HD2  1 
ATOM 6149  H HD3  . LYS D 1 6   ? 45.983  161.289 11.001  1.00 0.00 ? 6   LYS D HD3  1 
ATOM 6150  H HE2  . LYS D 1 6   ? 47.176  163.289 11.749  1.00 0.00 ? 6   LYS D HE2  1 
ATOM 6151  H HE3  . LYS D 1 6   ? 48.216  162.341 10.686  1.00 0.00 ? 6   LYS D HE3  1 
ATOM 6152  H HZ1  . LYS D 1 6   ? 46.940  163.937 8.946   1.00 0.00 ? 6   LYS D HZ1  1 
ATOM 6153  H HZ2  . LYS D 1 6   ? 48.467  164.269 9.611   1.00 0.00 ? 6   LYS D HZ2  1 
ATOM 6154  H HZ3  . LYS D 1 6   ? 47.072  164.963 10.289  1.00 0.00 ? 6   LYS D HZ3  1 
ATOM 6155  N N    . GLY D 1 7   ? 44.282  158.669 5.493   1.00 0.00 ? 7   GLY D N    1 
ATOM 6156  C CA   . GLY D 1 7   ? 43.282  157.697 5.046   1.00 0.00 ? 7   GLY D CA   1 
ATOM 6157  C C    . GLY D 1 7   ? 43.791  156.909 3.845   1.00 0.00 ? 7   GLY D C    1 
ATOM 6158  O O    . GLY D 1 7   ? 44.954  156.507 3.803   1.00 0.00 ? 7   GLY D O    1 
ATOM 6159  H H    . GLY D 1 7   ? 44.926  159.025 4.847   1.00 0.00 ? 7   GLY D H    1 
ATOM 6160  H HA2  . GLY D 1 7   ? 43.060  157.010 5.853   1.00 0.00 ? 7   GLY D HA2  1 
ATOM 6161  H HA3  . GLY D 1 7   ? 42.381  158.219 4.767   1.00 0.00 ? 7   GLY D HA3  1 
ATOM 6162  N N    . LEU D 1 8   ? 42.909  156.685 2.877   1.00 0.00 ? 8   LEU D N    1 
ATOM 6163  C CA   . LEU D 1 8   ? 43.271  155.934 1.676   1.00 0.00 ? 8   LEU D CA   1 
ATOM 6164  C C    . LEU D 1 8   ? 43.801  154.551 2.074   1.00 0.00 ? 8   LEU D C    1 
ATOM 6165  O O    . LEU D 1 8   ? 43.042  153.699 2.537   1.00 0.00 ? 8   LEU D O    1 
ATOM 6166  C CB   . LEU D 1 8   ? 44.344  156.697 0.869   1.00 0.00 ? 8   LEU D CB   1 
ATOM 6167  C CG   . LEU D 1 8   ? 43.696  157.829 0.046   1.00 0.00 ? 8   LEU D CG   1 
ATOM 6168  C CD1  . LEU D 1 8   ? 42.827  157.260 -1.107  1.00 0.00 ? 8   LEU D CD1  1 
ATOM 6169  C CD2  . LEU D 1 8   ? 42.836  158.698 0.978   1.00 0.00 ? 8   LEU D CD2  1 
ATOM 6170  H H    . LEU D 1 8   ? 41.995  157.026 2.972   1.00 0.00 ? 8   LEU D H    1 
ATOM 6171  H HA   . LEU D 1 8   ? 42.392  155.807 1.066   1.00 0.00 ? 8   LEU D HA   1 
ATOM 6172  H HB2  . LEU D 1 8   ? 45.066  157.125 1.549   1.00 0.00 ? 8   LEU D HB2  1 
ATOM 6173  H HB3  . LEU D 1 8   ? 44.849  156.019 0.200   1.00 0.00 ? 8   LEU D HB3  1 
ATOM 6174  H HG   . LEU D 1 8   ? 44.480  158.440 -0.380  1.00 0.00 ? 8   LEU D HG   1 
ATOM 6175  H HD11 . LEU D 1 8   ? 42.823  157.964 -1.926  1.00 0.00 ? 8   LEU D HD11 1 
ATOM 6176  H HD12 . LEU D 1 8   ? 41.811  157.106 -0.769  1.00 0.00 ? 8   LEU D HD12 1 
ATOM 6177  H HD13 . LEU D 1 8   ? 43.236  156.321 -1.448  1.00 0.00 ? 8   LEU D HD13 1 
ATOM 6178  H HD21 . LEU D 1 8   ? 42.602  159.632 0.486   1.00 0.00 ? 8   LEU D HD21 1 
ATOM 6179  H HD22 . LEU D 1 8   ? 43.381  158.900 1.889   1.00 0.00 ? 8   LEU D HD22 1 
ATOM 6180  H HD23 . LEU D 1 8   ? 41.921  158.177 1.214   1.00 0.00 ? 8   LEU D HD23 1 
ATOM 6181  N N    . SER D 1 9   ? 45.105  154.338 1.895   1.00 0.00 ? 9   SER D N    1 
ATOM 6182  C CA   . SER D 1 9   ? 45.723  153.053 2.242   1.00 0.00 ? 9   SER D CA   1 
ATOM 6183  C C    . SER D 1 9   ? 46.146  153.033 3.710   1.00 0.00 ? 9   SER D C    1 
ATOM 6184  O O    . SER D 1 9   ? 46.526  151.991 4.240   1.00 0.00 ? 9   SER D O    1 
ATOM 6185  C CB   . SER D 1 9   ? 46.949  152.808 1.362   1.00 0.00 ? 9   SER D CB   1 
ATOM 6186  O OG   . SER D 1 9   ? 46.537  152.674 0.007   1.00 0.00 ? 9   SER D OG   1 
ATOM 6187  H H    . SER D 1 9   ? 45.662  155.053 1.524   1.00 0.00 ? 9   SER D H    1 
ATOM 6188  H HA   . SER D 1 9   ? 45.011  152.258 2.073   1.00 0.00 ? 9   SER D HA   1 
ATOM 6189  H HB2  . SER D 1 9   ? 47.627  153.639 1.444   1.00 0.00 ? 9   SER D HB2  1 
ATOM 6190  H HB3  . SER D 1 9   ? 47.450  151.904 1.689   1.00 0.00 ? 9   SER D HB3  1 
ATOM 6191  H HG   . SER D 1 9   ? 47.324  152.668 -0.543  1.00 0.00 ? 9   SER D HG   1 
ATOM 6192  N N    . LYS D 1 10  ? 46.080  154.193 4.362   1.00 0.00 ? 10  LYS D N    1 
ATOM 6193  C CA   . LYS D 1 10  ? 46.461  154.297 5.769   1.00 0.00 ? 10  LYS D CA   1 
ATOM 6194  C C    . LYS D 1 10  ? 45.284  153.900 6.658   1.00 0.00 ? 10  LYS D C    1 
ATOM 6195  O O    . LYS D 1 10  ? 44.197  154.467 6.554   1.00 0.00 ? 10  LYS D O    1 
ATOM 6196  C CB   . LYS D 1 10  ? 46.884  155.745 6.084   1.00 0.00 ? 10  LYS D CB   1 
ATOM 6197  C CG   . LYS D 1 10  ? 47.641  155.814 7.435   1.00 0.00 ? 10  LYS D CG   1 
ATOM 6198  C CD   . LYS D 1 10  ? 49.137  155.512 7.225   1.00 0.00 ? 10  LYS D CD   1 
ATOM 6199  C CE   . LYS D 1 10  ? 49.881  155.616 8.564   1.00 0.00 ? 10  LYS D CE   1 
ATOM 6200  N NZ   . LYS D 1 10  ? 49.967  157.046 8.982   1.00 0.00 ? 10  LYS D NZ   1 
ATOM 6201  H H    . LYS D 1 10  ? 45.770  154.991 3.891   1.00 0.00 ? 10  LYS D H    1 
ATOM 6202  H HA   . LYS D 1 10  ? 47.289  153.636 5.965   1.00 0.00 ? 10  LYS D HA   1 
ATOM 6203  H HB2  . LYS D 1 10  ? 47.521  156.108 5.290   1.00 0.00 ? 10  LYS D HB2  1 
ATOM 6204  H HB3  . LYS D 1 10  ? 46.000  156.365 6.140   1.00 0.00 ? 10  LYS D HB3  1 
ATOM 6205  H HG2  . LYS D 1 10  ? 47.535  156.806 7.851   1.00 0.00 ? 10  LYS D HG2  1 
ATOM 6206  H HG3  . LYS D 1 10  ? 47.224  155.094 8.122   1.00 0.00 ? 10  LYS D HG3  1 
ATOM 6207  H HD2  . LYS D 1 10  ? 49.255  154.516 6.830   1.00 0.00 ? 10  LYS D HD2  1 
ATOM 6208  H HD3  . LYS D 1 10  ? 49.554  156.226 6.531   1.00 0.00 ? 10  LYS D HD3  1 
ATOM 6209  H HE2  . LYS D 1 10  ? 49.348  155.053 9.316   1.00 0.00 ? 10  LYS D HE2  1 
ATOM 6210  H HE3  . LYS D 1 10  ? 50.878  155.213 8.452   1.00 0.00 ? 10  LYS D HE3  1 
ATOM 6211  H HZ1  . LYS D 1 10  ? 49.429  157.183 9.860   1.00 0.00 ? 10  LYS D HZ1  1 
ATOM 6212  H HZ2  . LYS D 1 10  ? 49.570  157.650 8.232   1.00 0.00 ? 10  LYS D HZ2  1 
ATOM 6213  H HZ3  . LYS D 1 10  ? 50.962  157.301 9.144   1.00 0.00 ? 10  LYS D HZ3  1 
ATOM 6214  N N    . ALA D 1 11  ? 45.509  152.916 7.534   1.00 0.00 ? 11  ALA D N    1 
ATOM 6215  C CA   . ALA D 1 11  ? 44.461  152.436 8.448   1.00 0.00 ? 11  ALA D CA   1 
ATOM 6216  C C    . ALA D 1 11  ? 45.019  152.308 9.859   1.00 0.00 ? 11  ALA D C    1 
ATOM 6217  O O    . ALA D 1 11  ? 44.769  153.157 10.715  1.00 0.00 ? 11  ALA D O    1 
ATOM 6218  C CB   . ALA D 1 11  ? 43.944  151.074 7.975   1.00 0.00 ? 11  ALA D CB   1 
ATOM 6219  H H    . ALA D 1 11  ? 46.396  152.502 7.568   1.00 0.00 ? 11  ALA D H    1 
ATOM 6220  H HA   . ALA D 1 11  ? 43.635  153.137 8.463   1.00 0.00 ? 11  ALA D HA   1 
ATOM 6221  H HB1  . ALA D 1 11  ? 43.093  150.782 8.574   1.00 0.00 ? 11  ALA D HB1  1 
ATOM 6222  H HB2  . ALA D 1 11  ? 44.725  150.337 8.076   1.00 0.00 ? 11  ALA D HB2  1 
ATOM 6223  H HB3  . ALA D 1 11  ? 43.648  151.143 6.939   1.00 0.00 ? 11  ALA D HB3  1 
ATOM 6224  N N    . LYS D 1 12  ? 45.781  151.247 10.093  1.00 0.00 ? 12  LYS D N    1 
ATOM 6225  C CA   . LYS D 1 12  ? 46.376  151.025 11.402  1.00 0.00 ? 12  LYS D CA   1 
ATOM 6226  C C    . LYS D 1 12  ? 47.392  149.886 11.342  1.00 0.00 ? 12  LYS D C    1 
ATOM 6227  O O    . LYS D 1 12  ? 47.185  148.896 10.640  1.00 0.00 ? 12  LYS D O    1 
ATOM 6228  C CB   . LYS D 1 12  ? 45.279  150.685 12.411  1.00 0.00 ? 12  LYS D CB   1 
ATOM 6229  C CG   . LYS D 1 12  ? 44.429  149.527 11.869  1.00 0.00 ? 12  LYS D CG   1 
ATOM 6230  C CD   . LYS D 1 12  ? 43.337  149.142 12.889  1.00 0.00 ? 12  LYS D CD   1 
ATOM 6231  C CE   . LYS D 1 12  ? 42.136  150.091 12.768  1.00 0.00 ? 12  LYS D CE   1 
ATOM 6232  N NZ   . LYS D 1 12  ? 41.054  149.639 13.686  1.00 0.00 ? 12  LYS D NZ   1 
ATOM 6233  H H    . LYS D 1 12  ? 45.950  150.607 9.372   1.00 0.00 ? 12  LYS D H    1 
ATOM 6234  H HA   . LYS D 1 12  ? 46.875  151.927 11.719  1.00 0.00 ? 12  LYS D HA   1 
ATOM 6235  H HB2  . LYS D 1 12  ? 45.730  150.397 13.349  1.00 0.00 ? 12  LYS D HB2  1 
ATOM 6236  H HB3  . LYS D 1 12  ? 44.656  151.550 12.562  1.00 0.00 ? 12  LYS D HB3  1 
ATOM 6237  H HG2  . LYS D 1 12  ? 43.965  149.829 10.940  1.00 0.00 ? 12  LYS D HG2  1 
ATOM 6238  H HG3  . LYS D 1 12  ? 45.063  148.673 11.690  1.00 0.00 ? 12  LYS D HG3  1 
ATOM 6239  H HD2  . LYS D 1 12  ? 43.012  148.130 12.697  1.00 0.00 ? 12  LYS D HD2  1 
ATOM 6240  H HD3  . LYS D 1 12  ? 43.740  149.203 13.890  1.00 0.00 ? 12  LYS D HD3  1 
ATOM 6241  H HE2  . LYS D 1 12  ? 42.433  151.092 13.035  1.00 0.00 ? 12  LYS D HE2  1 
ATOM 6242  H HE3  . LYS D 1 12  ? 41.773  150.083 11.752  1.00 0.00 ? 12  LYS D HE3  1 
ATOM 6243  H HZ1  . LYS D 1 12  ? 40.144  149.656 13.184  1.00 0.00 ? 12  LYS D HZ1  1 
ATOM 6244  H HZ2  . LYS D 1 12  ? 41.009  150.277 14.508  1.00 0.00 ? 12  LYS D HZ2  1 
ATOM 6245  H HZ3  . LYS D 1 12  ? 41.254  148.671 14.007  1.00 0.00 ? 12  LYS D HZ3  1 
ATOM 6246  N N    . GLU D 1 13  ? 48.489  150.031 12.091  1.00 0.00 ? 13  GLU D N    1 
ATOM 6247  C CA   . GLU D 1 13  ? 49.539  149.003 12.129  1.00 0.00 ? 13  GLU D CA   1 
ATOM 6248  C C    . GLU D 1 13  ? 50.107  148.876 13.542  1.00 0.00 ? 13  GLU D C    1 
ATOM 6249  O O    . GLU D 1 13  ? 50.374  149.877 14.205  1.00 0.00 ? 13  GLU D O    1 
ATOM 6250  C CB   . GLU D 1 13  ? 50.668  149.358 11.152  1.00 0.00 ? 13  GLU D CB   1 
ATOM 6251  C CG   . GLU D 1 13  ? 50.152  149.261 9.713   1.00 0.00 ? 13  GLU D CG   1 
ATOM 6252  C CD   . GLU D 1 13  ? 51.265  149.626 8.733   1.00 0.00 ? 13  GLU D CD   1 
ATOM 6253  O OE1  . GLU D 1 13  ? 52.308  150.067 9.188   1.00 0.00 ? 13  GLU D OE1  1 
ATOM 6254  O OE2  . GLU D 1 13  ? 51.058  149.457 7.542   1.00 0.00 ? 13  GLU D OE2  1 
ATOM 6255  H H    . GLU D 1 13  ? 48.594  150.841 12.633  1.00 0.00 ? 13  GLU D H    1 
ATOM 6256  H HA   . GLU D 1 13  ? 49.119  148.046 11.841  1.00 0.00 ? 13  GLU D HA   1 
ATOM 6257  H HB2  . GLU D 1 13  ? 51.006  150.366 11.346  1.00 0.00 ? 13  GLU D HB2  1 
ATOM 6258  H HB3  . GLU D 1 13  ? 51.488  148.670 11.285  1.00 0.00 ? 13  GLU D HB3  1 
ATOM 6259  H HG2  . GLU D 1 13  ? 49.822  148.250 9.519   1.00 0.00 ? 13  GLU D HG2  1 
ATOM 6260  H HG3  . GLU D 1 13  ? 49.324  149.941 9.581   1.00 0.00 ? 13  GLU D HG3  1 
ATOM 6261  N N    . GLY D 1 14  ? 50.290  147.639 13.993  1.00 0.00 ? 14  GLY D N    1 
ATOM 6262  C CA   . GLY D 1 14  ? 50.828  147.391 15.327  1.00 0.00 ? 14  GLY D CA   1 
ATOM 6263  C C    . GLY D 1 14  ? 49.971  148.060 16.397  1.00 0.00 ? 14  GLY D C    1 
ATOM 6264  O O    . GLY D 1 14  ? 48.743  148.018 16.338  1.00 0.00 ? 14  GLY D O    1 
ATOM 6265  H H    . GLY D 1 14  ? 50.061  146.879 13.418  1.00 0.00 ? 14  GLY D H    1 
ATOM 6266  H HA2  . GLY D 1 14  ? 50.852  146.326 15.507  1.00 0.00 ? 14  GLY D HA2  1 
ATOM 6267  H HA3  . GLY D 1 14  ? 51.831  147.783 15.384  1.00 0.00 ? 14  GLY D HA3  1 
ATOM 6268  N N    . VAL D 1 15  ? 50.632  148.684 17.371  1.00 0.00 ? 15  VAL D N    1 
ATOM 6269  C CA   . VAL D 1 15  ? 49.929  149.369 18.455  1.00 0.00 ? 15  VAL D CA   1 
ATOM 6270  C C    . VAL D 1 15  ? 48.725  148.557 18.933  1.00 0.00 ? 15  VAL D C    1 
ATOM 6271  O O    . VAL D 1 15  ? 47.646  148.627 18.345  1.00 0.00 ? 15  VAL D O    1 
ATOM 6272  C CB   . VAL D 1 15  ? 49.456  150.743 17.980  1.00 0.00 ? 15  VAL D CB   1 
ATOM 6273  C CG1  . VAL D 1 15  ? 48.847  151.511 19.154  1.00 0.00 ? 15  VAL D CG1  1 
ATOM 6274  C CG2  . VAL D 1 15  ? 50.647  151.526 17.423  1.00 0.00 ? 15  VAL D CG2  1 
ATOM 6275  H H    . VAL D 1 15  ? 51.612  148.685 17.360  1.00 0.00 ? 15  VAL D H    1 
ATOM 6276  H HA   . VAL D 1 15  ? 50.609  149.505 19.282  1.00 0.00 ? 15  VAL D HA   1 
ATOM 6277  H HB   . VAL D 1 15  ? 48.711  150.619 17.207  1.00 0.00 ? 15  VAL D HB   1 
ATOM 6278  H HG11 . VAL D 1 15  ? 49.551  151.534 19.973  1.00 0.00 ? 15  VAL D HG11 1 
ATOM 6279  H HG12 . VAL D 1 15  ? 47.939  151.019 19.473  1.00 0.00 ? 15  VAL D HG12 1 
ATOM 6280  H HG13 . VAL D 1 15  ? 48.620  152.521 18.845  1.00 0.00 ? 15  VAL D HG13 1 
ATOM 6281  H HG21 . VAL D 1 15  ? 51.061  150.998 16.578  1.00 0.00 ? 15  VAL D HG21 1 
ATOM 6282  H HG22 . VAL D 1 15  ? 51.401  151.628 18.189  1.00 0.00 ? 15  VAL D HG22 1 
ATOM 6283  H HG23 . VAL D 1 15  ? 50.318  152.506 17.109  1.00 0.00 ? 15  VAL D HG23 1 
ATOM 6284  N N    . VAL D 1 16  ? 48.916  147.788 20.012  1.00 0.00 ? 16  VAL D N    1 
ATOM 6285  C CA   . VAL D 1 16  ? 47.836  146.961 20.577  1.00 0.00 ? 16  VAL D CA   1 
ATOM 6286  C C    . VAL D 1 16  ? 47.708  147.202 22.080  1.00 0.00 ? 16  VAL D C    1 
ATOM 6287  O O    . VAL D 1 16  ? 48.701  147.446 22.766  1.00 0.00 ? 16  VAL D O    1 
ATOM 6288  C CB   . VAL D 1 16  ? 48.136  145.482 20.322  1.00 0.00 ? 16  VAL D CB   1 
ATOM 6289  C CG1  . VAL D 1 16  ? 48.160  145.217 18.815  1.00 0.00 ? 16  VAL D CG1  1 
ATOM 6290  C CG2  . VAL D 1 16  ? 49.501  145.130 20.919  1.00 0.00 ? 16  VAL D CG2  1 
ATOM 6291  H H    . VAL D 1 16  ? 49.798  147.778 20.440  1.00 0.00 ? 16  VAL D H    1 
ATOM 6292  H HA   . VAL D 1 16  ? 46.892  147.211 20.103  1.00 0.00 ? 16  VAL D HA   1 
ATOM 6293  H HB   . VAL D 1 16  ? 47.371  144.873 20.783  1.00 0.00 ? 16  VAL D HB   1 
ATOM 6294  H HG11 . VAL D 1 16  ? 48.407  144.182 18.634  1.00 0.00 ? 16  VAL D HG11 1 
ATOM 6295  H HG12 . VAL D 1 16  ? 48.900  145.851 18.349  1.00 0.00 ? 16  VAL D HG12 1 
ATOM 6296  H HG13 . VAL D 1 16  ? 47.188  145.432 18.396  1.00 0.00 ? 16  VAL D HG13 1 
ATOM 6297  H HG21 . VAL D 1 16  ? 49.766  144.120 20.645  1.00 0.00 ? 16  VAL D HG21 1 
ATOM 6298  H HG22 . VAL D 1 16  ? 49.454  145.210 21.995  1.00 0.00 ? 16  VAL D HG22 1 
ATOM 6299  H HG23 . VAL D 1 16  ? 50.247  145.814 20.540  1.00 0.00 ? 16  VAL D HG23 1 
ATOM 6300  N N    . ALA D 1 17  ? 46.478  147.130 22.584  1.00 0.00 ? 17  ALA D N    1 
ATOM 6301  C CA   . ALA D 1 17  ? 46.229  147.342 24.007  1.00 0.00 ? 17  ALA D CA   1 
ATOM 6302  C C    . ALA D 1 17  ? 46.915  146.269 24.845  1.00 0.00 ? 17  ALA D C    1 
ATOM 6303  O O    . ALA D 1 17  ? 47.480  146.556 25.900  1.00 0.00 ? 17  ALA D O    1 
ATOM 6304  C CB   . ALA D 1 17  ? 44.725  147.322 24.284  1.00 0.00 ? 17  ALA D CB   1 
ATOM 6305  H H    . ALA D 1 17  ? 45.725  146.931 21.988  1.00 0.00 ? 17  ALA D H    1 
ATOM 6306  H HA   . ALA D 1 17  ? 46.619  148.308 24.290  1.00 0.00 ? 17  ALA D HA   1 
ATOM 6307  H HB1  . ALA D 1 17  ? 44.266  148.195 23.846  1.00 0.00 ? 17  ALA D HB1  1 
ATOM 6308  H HB2  . ALA D 1 17  ? 44.555  147.322 25.350  1.00 0.00 ? 17  ALA D HB2  1 
ATOM 6309  H HB3  . ALA D 1 17  ? 44.292  146.432 23.851  1.00 0.00 ? 17  ALA D HB3  1 
ATOM 6310  N N    . ALA D 1 18  ? 46.857  145.029 24.369  1.00 0.00 ? 18  ALA D N    1 
ATOM 6311  C CA   . ALA D 1 18  ? 47.472  143.917 25.083  1.00 0.00 ? 18  ALA D CA   1 
ATOM 6312  C C    . ALA D 1 18  ? 47.334  142.625 24.282  1.00 0.00 ? 18  ALA D C    1 
ATOM 6313  O O    . ALA D 1 18  ? 48.037  141.649 24.536  1.00 0.00 ? 18  ALA D O    1 
ATOM 6314  C CB   . ALA D 1 18  ? 46.807  143.743 26.450  1.00 0.00 ? 18  ALA D CB   1 
ATOM 6315  H H    . ALA D 1 18  ? 46.390  144.860 23.525  1.00 0.00 ? 18  ALA D H    1 
ATOM 6316  H HA   . ALA D 1 18  ? 48.520  144.130 25.230  1.00 0.00 ? 18  ALA D HA   1 
ATOM 6317  H HB1  . ALA D 1 18  ? 45.733  143.760 26.333  1.00 0.00 ? 18  ALA D HB1  1 
ATOM 6318  H HB2  . ALA D 1 18  ? 47.109  144.548 27.103  1.00 0.00 ? 18  ALA D HB2  1 
ATOM 6319  H HB3  . ALA D 1 18  ? 47.106  142.799 26.881  1.00 0.00 ? 18  ALA D HB3  1 
ATOM 6320  N N    . ALA D 1 19  ? 46.421  142.628 23.318  1.00 0.00 ? 19  ALA D N    1 
ATOM 6321  C CA   . ALA D 1 19  ? 46.199  141.450 22.487  1.00 0.00 ? 19  ALA D CA   1 
ATOM 6322  C C    . ALA D 1 19  ? 47.454  141.113 21.688  1.00 0.00 ? 19  ALA D C    1 
ATOM 6323  O O    . ALA D 1 19  ? 48.152  142.004 21.206  1.00 0.00 ? 19  ALA D O    1 
ATOM 6324  C CB   . ALA D 1 19  ? 45.031  141.698 21.531  1.00 0.00 ? 19  ALA D CB   1 
ATOM 6325  H H    . ALA D 1 19  ? 45.886  143.435 23.162  1.00 0.00 ? 19  ALA D H    1 
ATOM 6326  H HA   . ALA D 1 19  ? 45.954  140.613 23.125  1.00 0.00 ? 19  ALA D HA   1 
ATOM 6327  H HB1  . ALA D 1 19  ? 44.108  141.731 22.091  1.00 0.00 ? 19  ALA D HB1  1 
ATOM 6328  H HB2  . ALA D 1 19  ? 44.983  140.899 20.806  1.00 0.00 ? 19  ALA D HB2  1 
ATOM 6329  H HB3  . ALA D 1 19  ? 45.177  142.638 21.021  1.00 0.00 ? 19  ALA D HB3  1 
ATOM 6330  N N    . GLU D 1 20  ? 47.734  139.820 21.556  1.00 0.00 ? 20  GLU D N    1 
ATOM 6331  C CA   . GLU D 1 20  ? 48.910  139.375 20.815  1.00 0.00 ? 20  GLU D CA   1 
ATOM 6332  C C    . GLU D 1 20  ? 50.184  139.926 21.458  1.00 0.00 ? 20  GLU D C    1 
ATOM 6333  O O    . GLU D 1 20  ? 51.122  140.320 20.766  1.00 0.00 ? 20  GLU D O    1 
ATOM 6334  C CB   . GLU D 1 20  ? 48.813  139.842 19.352  1.00 0.00 ? 20  GLU D CB   1 
ATOM 6335  C CG   . GLU D 1 20  ? 49.736  138.995 18.465  1.00 0.00 ? 20  GLU D CG   1 
ATOM 6336  C CD   . GLU D 1 20  ? 49.575  139.404 17.005  1.00 0.00 ? 20  GLU D CD   1 
ATOM 6337  O OE1  . GLU D 1 20  ? 49.882  140.544 16.693  1.00 0.00 ? 20  GLU D OE1  1 
ATOM 6338  O OE2  . GLU D 1 20  ? 49.146  138.574 16.221  1.00 0.00 ? 20  GLU D OE2  1 
ATOM 6339  H H    . GLU D 1 20  ? 47.142  139.155 21.963  1.00 0.00 ? 20  GLU D H    1 
ATOM 6340  H HA   . GLU D 1 20  ? 48.946  138.295 20.837  1.00 0.00 ? 20  GLU D HA   1 
ATOM 6341  H HB2  . GLU D 1 20  ? 47.793  139.735 19.012  1.00 0.00 ? 20  GLU D HB2  1 
ATOM 6342  H HB3  . GLU D 1 20  ? 49.105  140.879 19.284  1.00 0.00 ? 20  GLU D HB3  1 
ATOM 6343  H HG2  . GLU D 1 20  ? 50.762  139.143 18.768  1.00 0.00 ? 20  GLU D HG2  1 
ATOM 6344  H HG3  . GLU D 1 20  ? 49.478  137.952 18.573  1.00 0.00 ? 20  GLU D HG3  1 
ATOM 6345  N N    . LYS D 1 21  ? 50.208  139.949 22.787  1.00 0.00 ? 21  LYS D N    1 
ATOM 6346  C CA   . LYS D 1 21  ? 51.370  140.451 23.513  1.00 0.00 ? 21  LYS D CA   1 
ATOM 6347  C C    . LYS D 1 21  ? 52.600  139.596 23.220  1.00 0.00 ? 21  LYS D C    1 
ATOM 6348  O O    . LYS D 1 21  ? 53.733  140.069 23.310  1.00 0.00 ? 21  LYS D O    1 
ATOM 6349  C CB   . LYS D 1 21  ? 51.082  140.453 25.021  1.00 0.00 ? 21  LYS D CB   1 
ATOM 6350  C CG   . LYS D 1 21  ? 50.829  139.019 25.507  1.00 0.00 ? 21  LYS D CG   1 
ATOM 6351  C CD   . LYS D 1 21  ? 50.488  139.037 26.998  1.00 0.00 ? 21  LYS D CD   1 
ATOM 6352  C CE   . LYS D 1 21  ? 50.225  137.607 27.477  1.00 0.00 ? 21  LYS D CE   1 
ATOM 6353  N NZ   . LYS D 1 21  ? 49.907  137.620 28.933  1.00 0.00 ? 21  LYS D NZ   1 
ATOM 6354  H H    . LYS D 1 21  ? 49.431  139.622 23.288  1.00 0.00 ? 21  LYS D H    1 
ATOM 6355  H HA   . LYS D 1 21  ? 51.567  141.464 23.198  1.00 0.00 ? 21  LYS D HA   1 
ATOM 6356  H HB2  . LYS D 1 21  ? 51.930  140.866 25.547  1.00 0.00 ? 21  LYS D HB2  1 
ATOM 6357  H HB3  . LYS D 1 21  ? 50.210  141.055 25.218  1.00 0.00 ? 21  LYS D HB3  1 
ATOM 6358  H HG2  . LYS D 1 21  ? 50.006  138.591 24.954  1.00 0.00 ? 21  LYS D HG2  1 
ATOM 6359  H HG3  . LYS D 1 21  ? 51.714  138.422 25.354  1.00 0.00 ? 21  LYS D HG3  1 
ATOM 6360  H HD2  . LYS D 1 21  ? 51.315  139.458 27.552  1.00 0.00 ? 21  LYS D HD2  1 
ATOM 6361  H HD3  . LYS D 1 21  ? 49.604  139.636 27.158  1.00 0.00 ? 21  LYS D HD3  1 
ATOM 6362  H HE2  . LYS D 1 21  ? 49.391  137.193 26.931  1.00 0.00 ? 21  LYS D HE2  1 
ATOM 6363  H HE3  . LYS D 1 21  ? 51.103  137.003 27.305  1.00 0.00 ? 21  LYS D HE3  1 
ATOM 6364  H HZ1  . LYS D 1 21  ? 49.943  136.650 29.304  1.00 0.00 ? 21  LYS D HZ1  1 
ATOM 6365  H HZ2  . LYS D 1 21  ? 48.953  138.012 29.076  1.00 0.00 ? 21  LYS D HZ2  1 
ATOM 6366  H HZ3  . LYS D 1 21  ? 50.603  138.206 29.435  1.00 0.00 ? 21  LYS D HZ3  1 
ATOM 6367  N N    . THR D 1 22  ? 52.365  138.332 22.867  1.00 0.00 ? 22  THR D N    1 
ATOM 6368  C CA   . THR D 1 22  ? 53.457  137.408 22.558  1.00 0.00 ? 22  THR D CA   1 
ATOM 6369  C C    . THR D 1 22  ? 53.825  137.498 21.083  1.00 0.00 ? 22  THR D C    1 
ATOM 6370  O O    . THR D 1 22  ? 52.974  137.332 20.210  1.00 0.00 ? 22  THR D O    1 
ATOM 6371  C CB   . THR D 1 22  ? 53.032  135.974 22.889  1.00 0.00 ? 22  THR D CB   1 
ATOM 6372  O OG1  . THR D 1 22  ? 52.755  135.871 24.280  1.00 0.00 ? 22  THR D OG1  1 
ATOM 6373  C CG2  . THR D 1 22  ? 54.155  135.006 22.516  1.00 0.00 ? 22  THR D CG2  1 
ATOM 6374  H H    . THR D 1 22  ? 51.440  138.015 22.813  1.00 0.00 ? 22  THR D H    1 
ATOM 6375  H HA   . THR D 1 22  ? 54.323  137.661 23.155  1.00 0.00 ? 22  THR D HA   1 
ATOM 6376  H HB   . THR D 1 22  ? 52.146  135.723 22.327  1.00 0.00 ? 22  THR D HB   1 
ATOM 6377  H HG1  . THR D 1 22  ? 51.833  135.622 24.382  1.00 0.00 ? 22  THR D HG1  1 
ATOM 6378  H HG21 . THR D 1 22  ? 53.958  134.039 22.954  1.00 0.00 ? 22  THR D HG21 1 
ATOM 6379  H HG22 . THR D 1 22  ? 55.095  135.385 22.889  1.00 0.00 ? 22  THR D HG22 1 
ATOM 6380  H HG23 . THR D 1 22  ? 54.206  134.911 21.441  1.00 0.00 ? 22  THR D HG23 1 
ATOM 6381  N N    . LYS D 1 23  ? 55.099  137.762 20.810  1.00 0.00 ? 23  LYS D N    1 
ATOM 6382  C CA   . LYS D 1 23  ? 55.570  137.873 19.434  1.00 0.00 ? 23  LYS D CA   1 
ATOM 6383  C C    . LYS D 1 23  ? 55.836  136.488 18.854  1.00 0.00 ? 23  LYS D C    1 
ATOM 6384  O O    . LYS D 1 23  ? 56.576  135.694 19.433  1.00 0.00 ? 23  LYS D O    1 
ATOM 6385  C CB   . LYS D 1 23  ? 56.861  138.710 19.381  1.00 0.00 ? 23  LYS D CB   1 
ATOM 6386  C CG   . LYS D 1 23  ? 56.587  140.166 19.860  1.00 0.00 ? 23  LYS D CG   1 
ATOM 6387  C CD   . LYS D 1 23  ? 56.795  140.281 21.381  1.00 0.00 ? 23  LYS D CD   1 
ATOM 6388  C CE   . LYS D 1 23  ? 56.575  141.730 21.820  1.00 0.00 ? 23  LYS D CE   1 
ATOM 6389  N NZ   . LYS D 1 23  ? 55.150  142.102 21.603  1.00 0.00 ? 23  LYS D NZ   1 
ATOM 6390  H H    . LYS D 1 23  ? 55.734  137.886 21.546  1.00 0.00 ? 23  LYS D H    1 
ATOM 6391  H HA   . LYS D 1 23  ? 54.814  138.363 18.838  1.00 0.00 ? 23  LYS D HA   1 
ATOM 6392  H HB2  . LYS D 1 23  ? 57.610  138.251 20.012  1.00 0.00 ? 23  LYS D HB2  1 
ATOM 6393  H HB3  . LYS D 1 23  ? 57.224  138.732 18.363  1.00 0.00 ? 23  LYS D HB3  1 
ATOM 6394  H HG2  . LYS D 1 23  ? 57.270  140.840 19.360  1.00 0.00 ? 23  LYS D HG2  1 
ATOM 6395  H HG3  . LYS D 1 23  ? 55.572  140.447 19.617  1.00 0.00 ? 23  LYS D HG3  1 
ATOM 6396  H HD2  . LYS D 1 23  ? 56.093  139.644 21.892  1.00 0.00 ? 23  LYS D HD2  1 
ATOM 6397  H HD3  . LYS D 1 23  ? 57.801  139.982 21.631  1.00 0.00 ? 23  LYS D HD3  1 
ATOM 6398  H HE2  . LYS D 1 23  ? 56.817  141.828 22.869  1.00 0.00 ? 23  LYS D HE2  1 
ATOM 6399  H HE3  . LYS D 1 23  ? 57.211  142.383 21.242  1.00 0.00 ? 23  LYS D HE3  1 
ATOM 6400  H HZ1  . LYS D 1 23  ? 54.536  141.460 22.144  1.00 0.00 ? 23  LYS D HZ1  1 
ATOM 6401  H HZ2  . LYS D 1 23  ? 54.923  142.029 20.590  1.00 0.00 ? 23  LYS D HZ2  1 
ATOM 6402  H HZ3  . LYS D 1 23  ? 54.992  143.079 21.924  1.00 0.00 ? 23  LYS D HZ3  1 
ATOM 6403  N N    . GLN D 1 24  ? 55.228  136.207 17.704  1.00 0.00 ? 24  GLN D N    1 
ATOM 6404  C CA   . GLN D 1 24  ? 55.405  134.913 17.045  1.00 0.00 ? 24  GLN D CA   1 
ATOM 6405  C C    . GLN D 1 24  ? 55.353  133.773 18.066  1.00 0.00 ? 24  GLN D C    1 
ATOM 6406  O O    . GLN D 1 24  ? 54.279  133.262 18.387  1.00 0.00 ? 24  GLN D O    1 
ATOM 6407  C CB   . GLN D 1 24  ? 56.754  134.885 16.310  1.00 0.00 ? 24  GLN D CB   1 
ATOM 6408  C CG   . GLN D 1 24  ? 56.658  135.705 15.020  1.00 0.00 ? 24  GLN D CG   1 
ATOM 6409  C CD   . GLN D 1 24  ? 56.429  137.174 15.358  1.00 0.00 ? 24  GLN D CD   1 
ATOM 6410  O OE1  . GLN D 1 24  ? 55.441  137.766 14.924  1.00 0.00 ? 24  GLN D OE1  1 
ATOM 6411  N NE2  . GLN D 1 24  ? 57.290  137.802 16.114  1.00 0.00 ? 24  GLN D NE2  1 
ATOM 6412  H H    . GLN D 1 24  ? 54.651  136.882 17.289  1.00 0.00 ? 24  GLN D H    1 
ATOM 6413  H HA   . GLN D 1 24  ? 54.610  134.773 16.328  1.00 0.00 ? 24  GLN D HA   1 
ATOM 6414  H HB2  . GLN D 1 24  ? 57.519  135.305 16.948  1.00 0.00 ? 24  GLN D HB2  1 
ATOM 6415  H HB3  . GLN D 1 24  ? 57.012  133.864 16.065  1.00 0.00 ? 24  GLN D HB3  1 
ATOM 6416  H HG2  . GLN D 1 24  ? 57.579  135.604 14.463  1.00 0.00 ? 24  GLN D HG2  1 
ATOM 6417  H HG3  . GLN D 1 24  ? 55.836  135.343 14.421  1.00 0.00 ? 24  GLN D HG3  1 
ATOM 6418  H HE21 . GLN D 1 24  ? 58.074  137.328 16.459  1.00 0.00 ? 24  GLN D HE21 1 
ATOM 6419  H HE22 . GLN D 1 24  ? 57.149  138.746 16.337  1.00 0.00 ? 24  GLN D HE22 1 
ATOM 6420  N N    . GLY D 1 25  ? 56.521  133.381 18.566  1.00 0.00 ? 25  GLY D N    1 
ATOM 6421  C CA   . GLY D 1 25  ? 56.604  132.302 19.546  1.00 0.00 ? 25  GLY D CA   1 
ATOM 6422  C C    . GLY D 1 25  ? 58.058  131.973 19.865  1.00 0.00 ? 25  GLY D C    1 
ATOM 6423  O O    . GLY D 1 25  ? 58.538  132.240 20.967  1.00 0.00 ? 25  GLY D O    1 
ATOM 6424  H H    . GLY D 1 25  ? 57.344  133.825 18.270  1.00 0.00 ? 25  GLY D H    1 
ATOM 6425  H HA2  . GLY D 1 25  ? 56.098  132.606 20.452  1.00 0.00 ? 25  GLY D HA2  1 
ATOM 6426  H HA3  . GLY D 1 25  ? 56.123  131.422 19.147  1.00 0.00 ? 25  GLY D HA3  1 
ATOM 6427  N N    . VAL D 1 26  ? 58.757  131.391 18.890  1.00 0.00 ? 26  VAL D N    1 
ATOM 6428  C CA   . VAL D 1 26  ? 60.166  131.025 19.068  1.00 0.00 ? 26  VAL D CA   1 
ATOM 6429  C C    . VAL D 1 26  ? 60.905  131.084 17.733  1.00 0.00 ? 26  VAL D C    1 
ATOM 6430  O O    . VAL D 1 26  ? 60.334  130.787 16.684  1.00 0.00 ? 26  VAL D O    1 
ATOM 6431  C CB   . VAL D 1 26  ? 60.268  129.611 19.643  1.00 0.00 ? 26  VAL D CB   1 
ATOM 6432  C CG1  . VAL D 1 26  ? 59.708  128.608 18.634  1.00 0.00 ? 26  VAL D CG1  1 
ATOM 6433  C CG2  . VAL D 1 26  ? 61.736  129.283 19.928  1.00 0.00 ? 26  VAL D CG2  1 
ATOM 6434  H H    . VAL D 1 26  ? 58.319  131.204 18.034  1.00 0.00 ? 26  VAL D H    1 
ATOM 6435  H HA   . VAL D 1 26  ? 60.632  131.717 19.757  1.00 0.00 ? 26  VAL D HA   1 
ATOM 6436  H HB   . VAL D 1 26  ? 59.700  129.554 20.561  1.00 0.00 ? 26  VAL D HB   1 
ATOM 6437  H HG11 . VAL D 1 26  ? 58.767  128.971 18.249  1.00 0.00 ? 26  VAL D HG11 1 
ATOM 6438  H HG12 . VAL D 1 26  ? 59.554  127.655 19.119  1.00 0.00 ? 26  VAL D HG12 1 
ATOM 6439  H HG13 . VAL D 1 26  ? 60.408  128.488 17.819  1.00 0.00 ? 26  VAL D HG13 1 
ATOM 6440  H HG21 . VAL D 1 26  ? 62.152  130.036 20.581  1.00 0.00 ? 26  VAL D HG21 1 
ATOM 6441  H HG22 . VAL D 1 26  ? 62.288  129.267 19.000  1.00 0.00 ? 26  VAL D HG22 1 
ATOM 6442  H HG23 . VAL D 1 26  ? 61.803  128.315 20.404  1.00 0.00 ? 26  VAL D HG23 1 
ATOM 6443  N N    . ALA D 1 27  ? 62.185  131.471 17.781  1.00 0.00 ? 27  ALA D N    1 
ATOM 6444  C CA   . ALA D 1 27  ? 63.015  131.567 16.566  1.00 0.00 ? 27  ALA D CA   1 
ATOM 6445  C C    . ALA D 1 27  ? 64.300  130.765 16.736  1.00 0.00 ? 27  ALA D C    1 
ATOM 6446  O O    . ALA D 1 27  ? 64.976  130.871 17.760  1.00 0.00 ? 27  ALA D O    1 
ATOM 6447  C CB   . ALA D 1 27  ? 63.365  133.032 16.291  1.00 0.00 ? 27  ALA D CB   1 
ATOM 6448  H H    . ALA D 1 27  ? 62.584  131.692 18.649  1.00 0.00 ? 27  ALA D H    1 
ATOM 6449  H HA   . ALA D 1 27  ? 62.469  131.173 15.718  1.00 0.00 ? 27  ALA D HA   1 
ATOM 6450  H HB1  . ALA D 1 27  ? 64.090  133.085 15.492  1.00 0.00 ? 27  ALA D HB1  1 
ATOM 6451  H HB2  . ALA D 1 27  ? 63.780  133.477 17.183  1.00 0.00 ? 27  ALA D HB2  1 
ATOM 6452  H HB3  . ALA D 1 27  ? 62.473  133.568 16.004  1.00 0.00 ? 27  ALA D HB3  1 
ATOM 6453  N N    . GLU D 1 28  ? 64.633  129.961 15.728  1.00 0.00 ? 28  GLU D N    1 
ATOM 6454  C CA   . GLU D 1 28  ? 65.842  129.144 15.786  1.00 0.00 ? 28  GLU D CA   1 
ATOM 6455  C C    . GLU D 1 28  ? 67.074  129.982 15.444  1.00 0.00 ? 28  GLU D C    1 
ATOM 6456  O O    . GLU D 1 28  ? 67.921  130.236 16.301  1.00 0.00 ? 28  GLU D O    1 
ATOM 6457  C CB   . GLU D 1 28  ? 65.729  127.978 14.798  1.00 0.00 ? 28  GLU D CB   1 
ATOM 6458  C CG   . GLU D 1 28  ? 66.861  126.979 15.049  1.00 0.00 ? 28  GLU D CG   1 
ATOM 6459  C CD   . GLU D 1 28  ? 66.644  126.267 16.380  1.00 0.00 ? 28  GLU D CD   1 
ATOM 6460  O OE1  . GLU D 1 28  ? 65.536  126.325 16.887  1.00 0.00 ? 28  GLU D OE1  1 
ATOM 6461  O OE2  . GLU D 1 28  ? 67.589  125.673 16.873  1.00 0.00 ? 28  GLU D OE2  1 
ATOM 6462  H H    . GLU D 1 28  ? 64.057  129.915 14.938  1.00 0.00 ? 28  GLU D H    1 
ATOM 6463  H HA   . GLU D 1 28  ? 65.952  128.747 16.783  1.00 0.00 ? 28  GLU D HA   1 
ATOM 6464  H HB2  . GLU D 1 28  ? 64.776  127.486 14.932  1.00 0.00 ? 28  GLU D HB2  1 
ATOM 6465  H HB3  . GLU D 1 28  ? 65.802  128.354 13.790  1.00 0.00 ? 28  GLU D HB3  1 
ATOM 6466  H HG2  . GLU D 1 28  ? 66.877  126.251 14.253  1.00 0.00 ? 28  GLU D HG2  1 
ATOM 6467  H HG3  . GLU D 1 28  ? 67.804  127.503 15.074  1.00 0.00 ? 28  GLU D HG3  1 
ATOM 6468  N N    . ALA D 1 29  ? 67.161  130.414 14.185  1.00 0.00 ? 29  ALA D N    1 
ATOM 6469  C CA   . ALA D 1 29  ? 68.290  131.231 13.736  1.00 0.00 ? 29  ALA D CA   1 
ATOM 6470  C C    . ALA D 1 29  ? 69.608  130.711 14.318  1.00 0.00 ? 29  ALA D C    1 
ATOM 6471  O O    . ALA D 1 29  ? 70.252  131.390 15.121  1.00 0.00 ? 29  ALA D O    1 
ATOM 6472  C CB   . ALA D 1 29  ? 68.080  132.686 14.158  1.00 0.00 ? 29  ALA D CB   1 
ATOM 6473  H H    . ALA D 1 29  ? 66.453  130.183 13.549  1.00 0.00 ? 29  ALA D H    1 
ATOM 6474  H HA   . ALA D 1 29  ? 68.344  131.185 12.658  1.00 0.00 ? 29  ALA D HA   1 
ATOM 6475  H HB1  . ALA D 1 29  ? 68.781  133.318 13.635  1.00 0.00 ? 29  ALA D HB1  1 
ATOM 6476  H HB2  . ALA D 1 29  ? 68.235  132.779 15.222  1.00 0.00 ? 29  ALA D HB2  1 
ATOM 6477  H HB3  . ALA D 1 29  ? 67.072  132.989 13.914  1.00 0.00 ? 29  ALA D HB3  1 
ATOM 6478  N N    . ALA D 1 30  ? 70.001  129.494 13.911  1.00 0.00 ? 30  ALA D N    1 
ATOM 6479  C CA   . ALA D 1 30  ? 71.247  128.874 14.402  1.00 0.00 ? 30  ALA D CA   1 
ATOM 6480  C C    . ALA D 1 30  ? 72.114  128.403 13.236  1.00 0.00 ? 30  ALA D C    1 
ATOM 6481  O O    . ALA D 1 30  ? 71.630  127.726 12.316  1.00 0.00 ? 30  ALA D O    1 
ATOM 6482  C CB   . ALA D 1 30  ? 70.910  127.676 15.292  1.00 0.00 ? 30  ALA D CB   1 
ATOM 6483  H H    . ALA D 1 30  ? 69.441  128.999 13.272  1.00 0.00 ? 30  ALA D H    1 
ATOM 6484  H HA   . ALA D 1 30  ? 71.810  129.594 14.986  1.00 0.00 ? 30  ALA D HA   1 
ATOM 6485  H HB1  . ALA D 1 30  ? 70.126  127.951 15.983  1.00 0.00 ? 30  ALA D HB1  1 
ATOM 6486  H HB2  . ALA D 1 30  ? 71.789  127.377 15.843  1.00 0.00 ? 30  ALA D HB2  1 
ATOM 6487  H HB3  . ALA D 1 30  ? 70.573  126.854 14.677  1.00 0.00 ? 30  ALA D HB3  1 
ATOM 6488  N N    . GLY D 1 31  ? 73.396  128.757 13.281  1.00 0.00 ? 31  GLY D N    1 
ATOM 6489  C CA   . GLY D 1 31  ? 74.316  128.355 12.222  1.00 0.00 ? 31  GLY D CA   1 
ATOM 6490  C C    . GLY D 1 31  ? 73.952  129.021 10.899  1.00 0.00 ? 31  GLY D C    1 
ATOM 6491  O O    . GLY D 1 31  ? 73.607  128.344 9.928   1.00 0.00 ? 31  GLY D O    1 
ATOM 6492  H H    . GLY D 1 31  ? 73.731  129.294 14.039  1.00 0.00 ? 31  GLY D H    1 
ATOM 6493  H HA2  . GLY D 1 31  ? 75.321  128.638 12.498  1.00 0.00 ? 31  GLY D HA2  1 
ATOM 6494  H HA3  . GLY D 1 31  ? 74.268  127.284 12.101  1.00 0.00 ? 31  GLY D HA3  1 
ATOM 6495  N N    . LYS D 1 32  ? 74.032  130.351 10.861  1.00 0.00 ? 32  LYS D N    1 
ATOM 6496  C CA   . LYS D 1 32  ? 73.709  131.080 9.642   1.00 0.00 ? 32  LYS D CA   1 
ATOM 6497  C C    . LYS D 1 32  ? 74.703  130.738 8.539   1.00 0.00 ? 32  LYS D C    1 
ATOM 6498  O O    . LYS D 1 32  ? 75.814  130.280 8.807   1.00 0.00 ? 32  LYS D O    1 
ATOM 6499  C CB   . LYS D 1 32  ? 73.688  132.593 9.866   1.00 0.00 ? 32  LYS D CB   1 
ATOM 6500  C CG   . LYS D 1 32  ? 72.477  132.988 10.717  1.00 0.00 ? 32  LYS D CG   1 
ATOM 6501  C CD   . LYS D 1 32  ? 72.361  134.517 10.756  1.00 0.00 ? 32  LYS D CD   1 
ATOM 6502  C CE   . LYS D 1 32  ? 71.162  134.923 11.612  1.00 0.00 ? 32  LYS D CE   1 
ATOM 6503  N NZ   . LYS D 1 32  ? 71.034  136.408 11.611  1.00 0.00 ? 32  LYS D NZ   1 
ATOM 6504  H H    . LYS D 1 32  ? 74.315  130.845 11.663  1.00 0.00 ? 32  LYS D H    1 
ATOM 6505  H HA   . LYS D 1 32  ? 72.730  130.769 9.318   1.00 0.00 ? 32  LYS D HA   1 
ATOM 6506  H HB2  . LYS D 1 32  ? 74.590  132.889 10.371  1.00 0.00 ? 32  LYS D HB2  1 
ATOM 6507  H HB3  . LYS D 1 32  ? 73.630  133.094 8.912   1.00 0.00 ? 32  LYS D HB3  1 
ATOM 6508  H HG2  . LYS D 1 32  ? 71.579  132.568 10.286  1.00 0.00 ? 32  LYS D HG2  1 
ATOM 6509  H HG3  . LYS D 1 32  ? 72.606  132.614 11.722  1.00 0.00 ? 32  LYS D HG3  1 
ATOM 6510  H HD2  . LYS D 1 32  ? 73.261  134.938 11.173  1.00 0.00 ? 32  LYS D HD2  1 
ATOM 6511  H HD3  . LYS D 1 32  ? 72.224  134.891 9.753   1.00 0.00 ? 32  LYS D HD3  1 
ATOM 6512  H HE2  . LYS D 1 32  ? 70.265  134.482 11.206  1.00 0.00 ? 32  LYS D HE2  1 
ATOM 6513  H HE3  . LYS D 1 32  ? 71.309  134.576 12.624  1.00 0.00 ? 32  LYS D HE3  1 
ATOM 6514  H HZ1  . LYS D 1 32  ? 71.975  136.838 11.707  1.00 0.00 ? 32  LYS D HZ1  1 
ATOM 6515  H HZ2  . LYS D 1 32  ? 70.433  136.705 12.407  1.00 0.00 ? 32  LYS D HZ2  1 
ATOM 6516  H HZ3  . LYS D 1 32  ? 70.605  136.718 10.716  1.00 0.00 ? 32  LYS D HZ3  1 
ATOM 6517  N N    . THR D 1 33  ? 74.278  130.931 7.299   1.00 0.00 ? 33  THR D N    1 
ATOM 6518  C CA   . THR D 1 33  ? 75.114  130.610 6.152   1.00 0.00 ? 33  THR D CA   1 
ATOM 6519  C C    . THR D 1 33  ? 76.343  131.506 6.106   1.00 0.00 ? 33  THR D C    1 
ATOM 6520  O O    . THR D 1 33  ? 76.275  132.658 5.681   1.00 0.00 ? 33  THR D O    1 
ATOM 6521  C CB   . THR D 1 33  ? 74.294  130.798 4.872   1.00 0.00 ? 33  THR D CB   1 
ATOM 6522  O OG1  . THR D 1 33  ? 75.170  130.973 3.767   1.00 0.00 ? 33  THR D OG1  1 
ATOM 6523  C CG2  . THR D 1 33  ? 73.392  132.031 5.007   1.00 0.00 ? 33  THR D CG2  1 
ATOM 6524  H H    . THR D 1 33  ? 73.373  131.275 7.150   1.00 0.00 ? 33  THR D H    1 
ATOM 6525  H HA   . THR D 1 33  ? 75.429  129.580 6.220   1.00 0.00 ? 33  THR D HA   1 
ATOM 6526  H HB   . THR D 1 33  ? 73.676  129.930 4.712   1.00 0.00 ? 33  THR D HB   1 
ATOM 6527  H HG1  . THR D 1 33  ? 75.910  131.510 4.058   1.00 0.00 ? 33  THR D HG1  1 
ATOM 6528  H HG21 . THR D 1 33  ? 73.061  132.341 4.027   1.00 0.00 ? 33  THR D HG21 1 
ATOM 6529  H HG22 . THR D 1 33  ? 73.942  132.836 5.471   1.00 0.00 ? 33  THR D HG22 1 
ATOM 6530  H HG23 . THR D 1 33  ? 72.535  131.786 5.615   1.00 0.00 ? 33  THR D HG23 1 
ATOM 6531  N N    . LYS D 1 34  ? 77.471  130.954 6.547   1.00 0.00 ? 34  LYS D N    1 
ATOM 6532  C CA   . LYS D 1 34  ? 78.722  131.696 6.563   1.00 0.00 ? 34  LYS D CA   1 
ATOM 6533  C C    . LYS D 1 34  ? 79.052  132.207 5.170   1.00 0.00 ? 34  LYS D C    1 
ATOM 6534  O O    . LYS D 1 34  ? 78.824  131.519 4.177   1.00 0.00 ? 34  LYS D O    1 
ATOM 6535  C CB   . LYS D 1 34  ? 79.858  130.797 7.057   1.00 0.00 ? 34  LYS D CB   1 
ATOM 6536  C CG   . LYS D 1 34  ? 79.602  130.406 8.518   1.00 0.00 ? 34  LYS D CG   1 
ATOM 6537  C CD   . LYS D 1 34  ? 80.850  129.737 9.117   1.00 0.00 ? 34  LYS D CD   1 
ATOM 6538  C CE   . LYS D 1 34  ? 81.060  128.351 8.496   1.00 0.00 ? 34  LYS D CE   1 
ATOM 6539  N NZ   . LYS D 1 34  ? 82.114  127.623 9.260   1.00 0.00 ? 34  LYS D NZ   1 
ATOM 6540  H H    . LYS D 1 34  ? 77.459  130.029 6.870   1.00 0.00 ? 34  LYS D H    1 
ATOM 6541  H HA   . LYS D 1 34  ? 78.627  132.535 7.235   1.00 0.00 ? 34  LYS D HA   1 
ATOM 6542  H HB2  . LYS D 1 34  ? 79.894  129.910 6.445   1.00 0.00 ? 34  LYS D HB2  1 
ATOM 6543  H HB3  . LYS D 1 34  ? 80.796  131.326 6.985   1.00 0.00 ? 34  LYS D HB3  1 
ATOM 6544  H HG2  . LYS D 1 34  ? 79.362  131.291 9.088   1.00 0.00 ? 34  LYS D HG2  1 
ATOM 6545  H HG3  . LYS D 1 34  ? 78.773  129.715 8.563   1.00 0.00 ? 34  LYS D HG3  1 
ATOM 6546  H HD2  . LYS D 1 34  ? 81.715  130.353 8.918   1.00 0.00 ? 34  LYS D HD2  1 
ATOM 6547  H HD3  . LYS D 1 34  ? 80.722  129.634 10.184  1.00 0.00 ? 34  LYS D HD3  1 
ATOM 6548  H HE2  . LYS D 1 34  ? 80.136  127.794 8.535   1.00 0.00 ? 34  LYS D HE2  1 
ATOM 6549  H HE3  . LYS D 1 34  ? 81.375  128.458 7.471   1.00 0.00 ? 34  LYS D HE3  1 
ATOM 6550  H HZ1  . LYS D 1 34  ? 81.881  126.611 9.294   1.00 0.00 ? 34  LYS D HZ1  1 
ATOM 6551  H HZ2  . LYS D 1 34  ? 82.166  128.002 10.228  1.00 0.00 ? 34  LYS D HZ2  1 
ATOM 6552  H HZ3  . LYS D 1 34  ? 83.032  127.749 8.789   1.00 0.00 ? 34  LYS D HZ3  1 
ATOM 6553  N N    . GLU D 1 35  ? 79.587  133.428 5.105   1.00 0.00 ? 35  GLU D N    1 
ATOM 6554  C CA   . GLU D 1 35  ? 79.954  134.047 3.825   1.00 0.00 ? 35  GLU D CA   1 
ATOM 6555  C C    . GLU D 1 35  ? 81.470  134.083 3.684   1.00 0.00 ? 35  GLU D C    1 
ATOM 6556  O O    . GLU D 1 35  ? 82.159  134.702 4.494   1.00 0.00 ? 35  GLU D O    1 
ATOM 6557  C CB   . GLU D 1 35  ? 79.412  135.477 3.781   1.00 0.00 ? 35  GLU D CB   1 
ATOM 6558  C CG   . GLU D 1 35  ? 79.559  136.046 2.367   1.00 0.00 ? 35  GLU D CG   1 
ATOM 6559  C CD   . GLU D 1 35  ? 78.597  135.337 1.419   1.00 0.00 ? 35  GLU D CD   1 
ATOM 6560  O OE1  . GLU D 1 35  ? 77.583  134.853 1.891   1.00 0.00 ? 35  GLU D OE1  1 
ATOM 6561  O OE2  . GLU D 1 35  ? 78.883  135.298 0.235   1.00 0.00 ? 35  GLU D OE2  1 
ATOM 6562  H H    . GLU D 1 35  ? 79.742  133.926 5.935   1.00 0.00 ? 35  GLU D H    1 
ATOM 6563  H HA   . GLU D 1 35  ? 79.532  133.484 3.002   1.00 0.00 ? 35  GLU D HA   1 
ATOM 6564  H HB2  . GLU D 1 35  ? 78.368  135.475 4.061   1.00 0.00 ? 35  GLU D HB2  1 
ATOM 6565  H HB3  . GLU D 1 35  ? 79.968  136.089 4.471   1.00 0.00 ? 35  GLU D HB3  1 
ATOM 6566  H HG2  . GLU D 1 35  ? 79.334  137.102 2.382   1.00 0.00 ? 35  GLU D HG2  1 
ATOM 6567  H HG3  . GLU D 1 35  ? 80.572  135.899 2.025   1.00 0.00 ? 35  GLU D HG3  1 
ATOM 6568  N N    . GLY D 1 36  ? 81.987  133.423 2.655   1.00 0.00 ? 36  GLY D N    1 
ATOM 6569  C CA   . GLY D 1 36  ? 83.423  133.400 2.436   1.00 0.00 ? 36  GLY D CA   1 
ATOM 6570  C C    . GLY D 1 36  ? 83.935  134.797 2.123   1.00 0.00 ? 36  GLY D C    1 
ATOM 6571  O O    . GLY D 1 36  ? 83.905  135.680 2.980   1.00 0.00 ? 36  GLY D O    1 
ATOM 6572  H H    . GLY D 1 36  ? 81.394  132.947 2.035   1.00 0.00 ? 36  GLY D H    1 
ATOM 6573  H HA2  . GLY D 1 36  ? 83.911  133.033 3.329   1.00 0.00 ? 36  GLY D HA2  1 
ATOM 6574  H HA3  . GLY D 1 36  ? 83.649  132.745 1.611   1.00 0.00 ? 36  GLY D HA3  1 
ATOM 6575  N N    . VAL D 1 37  ? 84.403  134.997 0.887   1.00 0.00 ? 37  VAL D N    1 
ATOM 6576  C CA   . VAL D 1 37  ? 84.924  136.306 0.460   1.00 0.00 ? 37  VAL D CA   1 
ATOM 6577  C C    . VAL D 1 37  ? 84.279  136.714 -0.866  1.00 0.00 ? 37  VAL D C    1 
ATOM 6578  O O    . VAL D 1 37  ? 83.935  135.855 -1.690  1.00 0.00 ? 37  VAL D O    1 
ATOM 6579  C CB   . VAL D 1 37  ? 86.443  136.213 0.291   1.00 0.00 ? 37  VAL D CB   1 
ATOM 6580  C CG1  . VAL D 1 37  ? 87.062  135.654 1.577   1.00 0.00 ? 37  VAL D CG1  1 
ATOM 6581  C CG2  . VAL D 1 37  ? 86.777  135.283 -0.876  1.00 0.00 ? 37  VAL D CG2  1 
ATOM 6582  H H    . VAL D 1 37  ? 84.396  134.255 0.249   1.00 0.00 ? 37  VAL D H    1 
ATOM 6583  H HA   . VAL D 1 37  ? 84.698  137.059 1.207   1.00 0.00 ? 37  VAL D HA   1 
ATOM 6584  H HB   . VAL D 1 37  ? 86.845  137.198 0.098   1.00 0.00 ? 37  VAL D HB   1 
ATOM 6585  H HG11 . VAL D 1 37  ? 88.138  135.733 1.523   1.00 0.00 ? 37  VAL D HG11 1 
ATOM 6586  H HG12 . VAL D 1 37  ? 86.783  134.616 1.688   1.00 0.00 ? 37  VAL D HG12 1 
ATOM 6587  H HG13 . VAL D 1 37  ? 86.700  136.215 2.424   1.00 0.00 ? 37  VAL D HG13 1 
ATOM 6588  H HG21 . VAL D 1 37  ? 87.834  135.062 -0.869  1.00 0.00 ? 37  VAL D HG21 1 
ATOM 6589  H HG22 . VAL D 1 37  ? 86.516  135.760 -1.807  1.00 0.00 ? 37  VAL D HG22 1 
ATOM 6590  H HG23 . VAL D 1 37  ? 86.221  134.368 -0.775  1.00 0.00 ? 37  VAL D HG23 1 
ATOM 6591  N N    . LEU D 1 38  ? 84.112  138.030 -1.076  1.00 0.00 ? 38  LEU D N    1 
ATOM 6592  C CA   . LEU D 1 38  ? 83.497  138.537 -2.324  1.00 0.00 ? 38  LEU D CA   1 
ATOM 6593  C C    . LEU D 1 38  ? 84.504  139.396 -3.097  1.00 0.00 ? 38  LEU D C    1 
ATOM 6594  O O    . LEU D 1 38  ? 85.116  140.301 -2.528  1.00 0.00 ? 38  LEU D O    1 
ATOM 6595  C CB   . LEU D 1 38  ? 82.260  139.400 -2.000  1.00 0.00 ? 38  LEU D CB   1 
ATOM 6596  C CG   . LEU D 1 38  ? 81.387  138.713 -0.938  1.00 0.00 ? 38  LEU D CG   1 
ATOM 6597  C CD1  . LEU D 1 38  ? 80.157  139.588 -0.634  1.00 0.00 ? 38  LEU D CD1  1 
ATOM 6598  C CD2  . LEU D 1 38  ? 80.921  137.348 -1.451  1.00 0.00 ? 38  LEU D CD2  1 
ATOM 6599  H H    . LEU D 1 38  ? 84.407  138.674 -0.383  1.00 0.00 ? 38  LEU D H    1 
ATOM 6600  H HA   . LEU D 1 38  ? 83.191  137.707 -2.950  1.00 0.00 ? 38  LEU D HA   1 
ATOM 6601  H HB2  . LEU D 1 38  ? 82.578  140.362 -1.636  1.00 0.00 ? 38  LEU D HB2  1 
ATOM 6602  H HB3  . LEU D 1 38  ? 81.679  139.536 -2.900  1.00 0.00 ? 38  LEU D HB3  1 
ATOM 6603  H HG   . LEU D 1 38  ? 81.964  138.582 -0.033  1.00 0.00 ? 38  LEU D HG   1 
ATOM 6604  H HD11 . LEU D 1 38  ? 79.738  139.300 0.317   1.00 0.00 ? 38  LEU D HD11 1 
ATOM 6605  H HD12 . LEU D 1 38  ? 79.413  139.454 -1.409  1.00 0.00 ? 38  LEU D HD12 1 
ATOM 6606  H HD13 . LEU D 1 38  ? 80.449  140.627 -0.597  1.00 0.00 ? 38  LEU D HD13 1 
ATOM 6607  H HD21 . LEU D 1 38  ? 81.739  136.649 -1.420  1.00 0.00 ? 38  LEU D HD21 1 
ATOM 6608  H HD22 . LEU D 1 38  ? 80.574  137.448 -2.460  1.00 0.00 ? 38  LEU D HD22 1 
ATOM 6609  H HD23 . LEU D 1 38  ? 80.117  136.987 -0.831  1.00 0.00 ? 38  LEU D HD23 1 
ATOM 6610  N N    . TYR D 1 39  ? 84.659  139.117 -4.400  1.00 0.00 ? 39  TYR D N    1 
ATOM 6611  C CA   . TYR D 1 39  ? 85.587  139.884 -5.261  1.00 0.00 ? 39  TYR D CA   1 
ATOM 6612  C C    . TYR D 1 39  ? 84.853  140.422 -6.489  1.00 0.00 ? 39  TYR D C    1 
ATOM 6613  O O    . TYR D 1 39  ? 84.364  139.652 -7.316  1.00 0.00 ? 39  TYR D O    1 
ATOM 6614  C CB   . TYR D 1 39  ? 86.760  138.985 -5.711  1.00 0.00 ? 39  TYR D CB   1 
ATOM 6615  C CG   . TYR D 1 39  ? 87.780  138.871 -4.597  1.00 0.00 ? 39  TYR D CG   1 
ATOM 6616  C CD1  . TYR D 1 39  ? 87.577  137.973 -3.544  1.00 0.00 ? 39  TYR D CD1  1 
ATOM 6617  C CD2  . TYR D 1 39  ? 88.929  139.672 -4.622  1.00 0.00 ? 39  TYR D CD2  1 
ATOM 6618  C CE1  . TYR D 1 39  ? 88.524  137.877 -2.516  1.00 0.00 ? 39  TYR D CE1  1 
ATOM 6619  C CE2  . TYR D 1 39  ? 89.875  139.574 -3.596  1.00 0.00 ? 39  TYR D CE2  1 
ATOM 6620  C CZ   . TYR D 1 39  ? 89.671  138.677 -2.543  1.00 0.00 ? 39  TYR D CZ   1 
ATOM 6621  O OH   . TYR D 1 39  ? 90.602  138.582 -1.529  1.00 0.00 ? 39  TYR D OH   1 
ATOM 6622  H H    . TYR D 1 39  ? 84.134  138.390 -4.798  1.00 0.00 ? 39  TYR D H    1 
ATOM 6623  H HA   . TYR D 1 39  ? 85.984  140.728 -4.706  1.00 0.00 ? 39  TYR D HA   1 
ATOM 6624  H HB2  . TYR D 1 39  ? 86.385  138.001 -5.953  1.00 0.00 ? 39  TYR D HB2  1 
ATOM 6625  H HB3  . TYR D 1 39  ? 87.234  139.412 -6.586  1.00 0.00 ? 39  TYR D HB3  1 
ATOM 6626  H HD1  . TYR D 1 39  ? 86.692  137.355 -3.524  1.00 0.00 ? 39  TYR D HD1  1 
ATOM 6627  H HD2  . TYR D 1 39  ? 89.086  140.364 -5.436  1.00 0.00 ? 39  TYR D HD2  1 
ATOM 6628  H HE1  . TYR D 1 39  ? 88.369  137.186 -1.704  1.00 0.00 ? 39  TYR D HE1  1 
ATOM 6629  H HE2  . TYR D 1 39  ? 90.760  140.193 -3.617  1.00 0.00 ? 39  TYR D HE2  1 
ATOM 6630  H HH   . TYR D 1 39  ? 90.521  139.363 -0.978  1.00 0.00 ? 39  TYR D HH   1 
ATOM 6631  N N    . VAL D 1 40  ? 84.789  141.758 -6.602  1.00 0.00 ? 40  VAL D N    1 
ATOM 6632  C CA   . VAL D 1 40  ? 84.119  142.412 -7.739  1.00 0.00 ? 40  VAL D CA   1 
ATOM 6633  C C    . VAL D 1 40  ? 85.011  143.508 -8.327  1.00 0.00 ? 40  VAL D C    1 
ATOM 6634  O O    . VAL D 1 40  ? 85.344  144.467 -7.647  1.00 0.00 ? 40  VAL D O    1 
ATOM 6635  C CB   . VAL D 1 40  ? 82.800  143.031 -7.268  1.00 0.00 ? 40  VAL D CB   1 
ATOM 6636  C CG1  . VAL D 1 40  ? 82.096  143.704 -8.448  1.00 0.00 ? 40  VAL D CG1  1 
ATOM 6637  C CG2  . VAL D 1 40  ? 81.898  141.933 -6.698  1.00 0.00 ? 40  VAL D CG2  1 
ATOM 6638  H H    . VAL D 1 40  ? 85.204  142.316 -5.911  1.00 0.00 ? 40  VAL D H    1 
ATOM 6639  H HA   . VAL D 1 40  ? 83.908  141.687 -8.501  1.00 0.00 ? 40  VAL D HA   1 
ATOM 6640  H HB   . VAL D 1 40  ? 83.000  143.766 -6.502  1.00 0.00 ? 40  VAL D HB   1 
ATOM 6641  H HG11 . VAL D 1 40  ? 82.632  144.599 -8.726  1.00 0.00 ? 40  VAL D HG11 1 
ATOM 6642  H HG12 . VAL D 1 40  ? 81.086  143.966 -8.163  1.00 0.00 ? 40  VAL D HG12 1 
ATOM 6643  H HG13 . VAL D 1 40  ? 82.067  143.026 -9.287  1.00 0.00 ? 40  VAL D HG13 1 
ATOM 6644  H HG21 . VAL D 1 40  ? 81.855  141.106 -7.394  1.00 0.00 ? 40  VAL D HG21 1 
ATOM 6645  H HG22 . VAL D 1 40  ? 80.904  142.326 -6.545  1.00 0.00 ? 40  VAL D HG22 1 
ATOM 6646  H HG23 . VAL D 1 40  ? 82.300  141.590 -5.757  1.00 0.00 ? 40  VAL D HG23 1 
ATOM 6647  N N    . GLY D 1 41  ? 85.390  143.373 -9.592  1.00 0.00 ? 41  GLY D N    1 
ATOM 6648  C CA   . GLY D 1 41  ? 86.233  144.386 -10.216 1.00 0.00 ? 41  GLY D CA   1 
ATOM 6649  C C    . GLY D 1 41  ? 87.616  144.433 -9.559  1.00 0.00 ? 41  GLY D C    1 
ATOM 6650  O O    . GLY D 1 41  ? 87.956  145.401 -8.854  1.00 0.00 ? 41  GLY D O    1 
ATOM 6651  H H    . GLY D 1 41  ? 85.101  142.589 -10.115 1.00 0.00 ? 41  GLY D H    1 
ATOM 6652  H HA2  . GLY D 1 41  ? 86.346  144.158 -11.265 1.00 0.00 ? 41  GLY D HA2  1 
ATOM 6653  H HA3  . GLY D 1 41  ? 85.762  145.351 -10.111 1.00 0.00 ? 41  GLY D HA3  1 
ATOM 6654  N N    . SER D 1 42  ? 88.409  143.383 -9.789  1.00 0.00 ? 42  SER D N    1 
ATOM 6655  C CA   . SER D 1 42  ? 89.769  143.305 -9.221  1.00 0.00 ? 42  SER D CA   1 
ATOM 6656  C C    . SER D 1 42  ? 90.753  142.783 -10.263 1.00 0.00 ? 42  SER D C    1 
ATOM 6657  O O    . SER D 1 42  ? 90.463  141.823 -10.975 1.00 0.00 ? 42  SER D O    1 
ATOM 6658  C CB   . SER D 1 42  ? 89.782  142.377 -8.005  1.00 0.00 ? 42  SER D CB   1 
ATOM 6659  O OG   . SER D 1 42  ? 88.913  142.897 -7.006  1.00 0.00 ? 42  SER D OG   1 
ATOM 6660  H H    . SER D 1 42  ? 88.075  142.643 -10.359 1.00 0.00 ? 42  SER D H    1 
ATOM 6661  H HA   . SER D 1 42  ? 90.091  144.292 -8.907  1.00 0.00 ? 42  SER D HA   1 
ATOM 6662  H HB2  . SER D 1 42  ? 89.443  141.398 -8.293  1.00 0.00 ? 42  SER D HB2  1 
ATOM 6663  H HB3  . SER D 1 42  ? 90.792  142.307 -7.617  1.00 0.00 ? 42  SER D HB3  1 
ATOM 6664  H HG   . SER D 1 42  ? 89.454  143.289 -6.316  1.00 0.00 ? 42  SER D HG   1 
ATOM 6665  N N    . LYS D 1 43  ? 91.930  143.419 -10.344 1.00 0.00 ? 43  LYS D N    1 
ATOM 6666  C CA   . LYS D 1 43  ? 92.966  143.006 -11.307 1.00 0.00 ? 43  LYS D CA   1 
ATOM 6667  C C    . LYS D 1 43  ? 94.221  142.566 -10.558 1.00 0.00 ? 43  LYS D C    1 
ATOM 6668  O O    . LYS D 1 43  ? 94.747  143.310 -9.730  1.00 0.00 ? 43  LYS D O    1 
ATOM 6669  C CB   . LYS D 1 43  ? 93.322  144.184 -12.225 1.00 0.00 ? 43  LYS D CB   1 
ATOM 6670  C CG   . LYS D 1 43  ? 92.047  144.857 -12.761 1.00 0.00 ? 43  LYS D CG   1 
ATOM 6671  C CD   . LYS D 1 43  ? 91.211  143.869 -13.584 1.00 0.00 ? 43  LYS D CD   1 
ATOM 6672  C CE   . LYS D 1 43  ? 90.086  144.635 -14.288 1.00 0.00 ? 43  LYS D CE   1 
ATOM 6673  N NZ   . LYS D 1 43  ? 89.226  143.682 -15.045 1.00 0.00 ? 43  LYS D NZ   1 
ATOM 6674  H H    . LYS D 1 43  ? 92.107  144.176 -9.746  1.00 0.00 ? 43  LYS D H    1 
ATOM 6675  H HA   . LYS D 1 43  ? 92.615  142.179 -11.908 1.00 0.00 ? 43  LYS D HA   1 
ATOM 6676  H HB2  . LYS D 1 43  ? 93.899  144.908 -11.668 1.00 0.00 ? 43  LYS D HB2  1 
ATOM 6677  H HB3  . LYS D 1 43  ? 93.909  143.822 -13.056 1.00 0.00 ? 43  LYS D HB3  1 
ATOM 6678  H HG2  . LYS D 1 43  ? 91.458  145.214 -11.929 1.00 0.00 ? 43  LYS D HG2  1 
ATOM 6679  H HG3  . LYS D 1 43  ? 92.322  145.695 -13.385 1.00 0.00 ? 43  LYS D HG3  1 
ATOM 6680  H HD2  . LYS D 1 43  ? 91.838  143.386 -14.319 1.00 0.00 ? 43  LYS D HD2  1 
ATOM 6681  H HD3  . LYS D 1 43  ? 90.777  143.128 -12.933 1.00 0.00 ? 43  LYS D HD3  1 
ATOM 6682  H HE2  . LYS D 1 43  ? 89.488  145.151 -13.552 1.00 0.00 ? 43  LYS D HE2  1 
ATOM 6683  H HE3  . LYS D 1 43  ? 90.515  145.354 -14.971 1.00 0.00 ? 43  LYS D HE3  1 
ATOM 6684  H HZ1  . LYS D 1 43  ? 88.371  144.173 -15.374 1.00 0.00 ? 43  LYS D HZ1  1 
ATOM 6685  H HZ2  . LYS D 1 43  ? 88.956  142.891 -14.425 1.00 0.00 ? 43  LYS D HZ2  1 
ATOM 6686  H HZ3  . LYS D 1 43  ? 89.750  143.317 -15.865 1.00 0.00 ? 43  LYS D HZ3  1 
ATOM 6687  N N    . THR D 1 44  ? 94.702  141.353 -10.861 1.00 0.00 ? 44  THR D N    1 
ATOM 6688  C CA   . THR D 1 44  ? 95.910  140.815 -10.213 1.00 0.00 ? 44  THR D CA   1 
ATOM 6689  C C    . THR D 1 44  ? 96.867  140.258 -11.262 1.00 0.00 ? 44  THR D C    1 
ATOM 6690  O O    . THR D 1 44  ? 96.487  139.420 -12.078 1.00 0.00 ? 44  THR D O    1 
ATOM 6691  C CB   . THR D 1 44  ? 95.519  139.700 -9.237  1.00 0.00 ? 44  THR D CB   1 
ATOM 6692  O OG1  . THR D 1 44  ? 94.631  140.223 -8.259  1.00 0.00 ? 44  THR D OG1  1 
ATOM 6693  C CG2  . THR D 1 44  ? 96.773  139.155 -8.552  1.00 0.00 ? 44  THR D CG2  1 
ATOM 6694  H H    . THR D 1 44  ? 94.240  140.810 -11.532 1.00 0.00 ? 44  THR D H    1 
ATOM 6695  H HA   . THR D 1 44  ? 96.414  141.599 -9.664  1.00 0.00 ? 44  THR D HA   1 
ATOM 6696  H HB   . THR D 1 44  ? 95.034  138.903 -9.777  1.00 0.00 ? 44  THR D HB   1 
ATOM 6697  H HG1  . THR D 1 44  ? 95.139  140.783 -7.667  1.00 0.00 ? 44  THR D HG1  1 
ATOM 6698  H HG21 . THR D 1 44  ? 97.349  139.975 -8.148  1.00 0.00 ? 44  THR D HG21 1 
ATOM 6699  H HG22 . THR D 1 44  ? 97.371  138.614 -9.270  1.00 0.00 ? 44  THR D HG22 1 
ATOM 6700  H HG23 . THR D 1 44  ? 96.484  138.490 -7.751  1.00 0.00 ? 44  THR D HG23 1 
ATOM 6701  N N    . LYS D 1 45  ? 98.120  140.717 -11.226 1.00 0.00 ? 45  LYS D N    1 
ATOM 6702  C CA   . LYS D 1 45  ? 99.140  140.248 -12.176 1.00 0.00 ? 45  LYS D CA   1 
ATOM 6703  C C    . LYS D 1 45  ? 100.467 140.035 -11.458 1.00 0.00 ? 45  LYS D C    1 
ATOM 6704  O O    . LYS D 1 45  ? 100.889 140.872 -10.658 1.00 0.00 ? 45  LYS D O    1 
ATOM 6705  C CB   . LYS D 1 45  ? 99.326  141.277 -13.293 1.00 0.00 ? 45  LYS D CB   1 
ATOM 6706  C CG   . LYS D 1 45  ? 98.004  141.468 -14.040 1.00 0.00 ? 45  LYS D CG   1 
ATOM 6707  C CD   . LYS D 1 45  ? 98.196  142.484 -15.170 1.00 0.00 ? 45  LYS D CD   1 
ATOM 6708  C CE   . LYS D 1 45  ? 96.849  142.769 -15.838 1.00 0.00 ? 45  LYS D CE   1 
ATOM 6709  N NZ   . LYS D 1 45  ? 96.315  141.513 -16.433 1.00 0.00 ? 45  LYS D NZ   1 
ATOM 6710  H H    . LYS D 1 45  ? 98.367  141.379 -10.545 1.00 0.00 ? 45  LYS D H    1 
ATOM 6711  H HA   . LYS D 1 45  ? 98.827  139.308 -12.615 1.00 0.00 ? 45  LYS D HA   1 
ATOM 6712  H HB2  . LYS D 1 45  ? 99.641  142.219 -12.867 1.00 0.00 ? 45  LYS D HB2  1 
ATOM 6713  H HB3  . LYS D 1 45  ? 100.079 140.925 -13.984 1.00 0.00 ? 45  LYS D HB3  1 
ATOM 6714  H HG2  . LYS D 1 45  ? 97.685  140.523 -14.454 1.00 0.00 ? 45  LYS D HG2  1 
ATOM 6715  H HG3  . LYS D 1 45  ? 97.254  141.834 -13.355 1.00 0.00 ? 45  LYS D HG3  1 
ATOM 6716  H HD2  . LYS D 1 45  ? 98.600  143.400 -14.765 1.00 0.00 ? 45  LYS D HD2  1 
ATOM 6717  H HD3  . LYS D 1 45  ? 98.880  142.082 -15.901 1.00 0.00 ? 45  LYS D HD3  1 
ATOM 6718  H HE2  . LYS D 1 45  ? 96.153  143.143 -15.102 1.00 0.00 ? 45  LYS D HE2  1 
ATOM 6719  H HE3  . LYS D 1 45  ? 96.982  143.507 -16.615 1.00 0.00 ? 45  LYS D HE3  1 
ATOM 6720  H HZ1  . LYS D 1 45  ? 96.366  140.747 -15.732 1.00 0.00 ? 45  LYS D HZ1  1 
ATOM 6721  H HZ2  . LYS D 1 45  ? 96.881  141.258 -17.269 1.00 0.00 ? 45  LYS D HZ2  1 
ATOM 6722  H HZ3  . LYS D 1 45  ? 95.325  141.656 -16.715 1.00 0.00 ? 45  LYS D HZ3  1 
ATOM 6723  N N    . GLU D 1 46  ? 101.129 138.913 -11.754 1.00 0.00 ? 46  GLU D N    1 
ATOM 6724  C CA   . GLU D 1 46  ? 102.422 138.596 -11.131 1.00 0.00 ? 46  GLU D CA   1 
ATOM 6725  C C    . GLU D 1 46  ? 103.371 137.973 -12.154 1.00 0.00 ? 46  GLU D C    1 
ATOM 6726  O O    . GLU D 1 46  ? 103.114 136.886 -12.661 1.00 0.00 ? 46  GLU D O    1 
ATOM 6727  C CB   . GLU D 1 46  ? 102.211 137.615 -9.973  1.00 0.00 ? 46  GLU D CB   1 
ATOM 6728  C CG   . GLU D 1 46  ? 101.285 138.245 -8.929  1.00 0.00 ? 46  GLU D CG   1 
ATOM 6729  C CD   . GLU D 1 46  ? 101.110 137.299 -7.746  1.00 0.00 ? 46  GLU D CD   1 
ATOM 6730  O OE1  . GLU D 1 46  ? 101.641 136.201 -7.808  1.00 0.00 ? 46  GLU D OE1  1 
ATOM 6731  O OE2  . GLU D 1 46  ? 100.449 137.685 -6.797  1.00 0.00 ? 46  GLU D OE2  1 
ATOM 6732  H H    . GLU D 1 46  ? 100.744 138.287 -12.403 1.00 0.00 ? 46  GLU D H    1 
ATOM 6733  H HA   . GLU D 1 46  ? 102.868 139.496 -10.746 1.00 0.00 ? 46  GLU D HA   1 
ATOM 6734  H HB2  . GLU D 1 46  ? 101.764 136.706 -10.348 1.00 0.00 ? 46  GLU D HB2  1 
ATOM 6735  H HB3  . GLU D 1 46  ? 103.161 137.388 -9.517  1.00 0.00 ? 46  GLU D HB3  1 
ATOM 6736  H HG2  . GLU D 1 46  ? 101.712 139.175 -8.585  1.00 0.00 ? 46  GLU D HG2  1 
ATOM 6737  H HG3  . GLU D 1 46  ? 100.321 138.438 -9.376  1.00 0.00 ? 46  GLU D HG3  1 
ATOM 6738  N N    . GLY D 1 47  ? 104.473 138.660 -12.452 1.00 0.00 ? 47  GLY D N    1 
ATOM 6739  C CA   . GLY D 1 47  ? 105.432 138.135 -13.414 1.00 0.00 ? 47  GLY D CA   1 
ATOM 6740  C C    . GLY D 1 47  ? 104.873 138.193 -14.829 1.00 0.00 ? 47  GLY D C    1 
ATOM 6741  O O    . GLY D 1 47  ? 104.436 137.174 -15.381 1.00 0.00 ? 47  GLY D O    1 
ATOM 6742  H H    . GLY D 1 47  ? 104.645 139.528 -12.021 1.00 0.00 ? 47  GLY D H    1 
ATOM 6743  H HA2  . GLY D 1 47  ? 106.339 138.721 -13.365 1.00 0.00 ? 47  GLY D HA2  1 
ATOM 6744  H HA3  . GLY D 1 47  ? 105.658 137.109 -13.166 1.00 0.00 ? 47  GLY D HA3  1 
ATOM 6745  N N    . VAL D 1 48  ? 104.880 139.399 -15.410 1.00 0.00 ? 48  VAL D N    1 
ATOM 6746  C CA   . VAL D 1 48  ? 104.373 139.608 -16.775 1.00 0.00 ? 48  VAL D CA   1 
ATOM 6747  C C    . VAL D 1 48  ? 105.251 140.605 -17.525 1.00 0.00 ? 48  VAL D C    1 
ATOM 6748  O O    . VAL D 1 48  ? 105.654 141.626 -16.971 1.00 0.00 ? 48  VAL D O    1 
ATOM 6749  C CB   . VAL D 1 48  ? 102.940 140.129 -16.735 1.00 0.00 ? 48  VAL D CB   1 
ATOM 6750  C CG1  . VAL D 1 48  ? 102.450 140.379 -18.164 1.00 0.00 ? 48  VAL D CG1  1 
ATOM 6751  C CG2  . VAL D 1 48  ? 102.037 139.093 -16.065 1.00 0.00 ? 48  VAL D CG2  1 
ATOM 6752  H H    . VAL D 1 48  ? 105.236 140.165 -14.911 1.00 0.00 ? 48  VAL D H    1 
ATOM 6753  H HA   . VAL D 1 48  ? 104.385 138.669 -17.311 1.00 0.00 ? 48  VAL D HA   1 
ATOM 6754  H HB   . VAL D 1 48  ? 102.909 141.055 -16.177 1.00 0.00 ? 48  VAL D HB   1 
ATOM 6755  H HG11 . VAL D 1 48  ? 102.924 141.266 -18.558 1.00 0.00 ? 48  VAL D HG11 1 
ATOM 6756  H HG12 . VAL D 1 48  ? 101.379 140.515 -18.159 1.00 0.00 ? 48  VAL D HG12 1 
ATOM 6757  H HG13 . VAL D 1 48  ? 102.703 139.531 -18.784 1.00 0.00 ? 48  VAL D HG13 1 
ATOM 6758  H HG21 . VAL D 1 48  ? 102.286 139.022 -15.017 1.00 0.00 ? 48  VAL D HG21 1 
ATOM 6759  H HG22 . VAL D 1 48  ? 102.181 138.132 -16.536 1.00 0.00 ? 48  VAL D HG22 1 
ATOM 6760  H HG23 . VAL D 1 48  ? 101.005 139.394 -16.170 1.00 0.00 ? 48  VAL D HG23 1 
ATOM 6761  N N    . VAL D 1 49  ? 105.544 140.309 -18.795 1.00 0.00 ? 49  VAL D N    1 
ATOM 6762  C CA   . VAL D 1 49  ? 106.379 141.198 -19.621 1.00 0.00 ? 49  VAL D CA   1 
ATOM 6763  C C    . VAL D 1 49  ? 105.781 141.362 -21.020 1.00 0.00 ? 49  VAL D C    1 
ATOM 6764  O O    . VAL D 1 49  ? 105.245 140.422 -21.598 1.00 0.00 ? 49  VAL D O    1 
ATOM 6765  C CB   . VAL D 1 49  ? 107.811 140.633 -19.713 1.00 0.00 ? 49  VAL D CB   1 
ATOM 6766  C CG1  . VAL D 1 49  ? 107.751 139.144 -20.031 1.00 0.00 ? 49  VAL D CG1  1 
ATOM 6767  C CG2  . VAL D 1 49  ? 108.601 141.361 -20.822 1.00 0.00 ? 49  VAL D CG2  1 
ATOM 6768  H H    . VAL D 1 49  ? 105.191 139.482 -19.186 1.00 0.00 ? 49  VAL D H    1 
ATOM 6769  H HA   . VAL D 1 49  ? 106.426 142.171 -19.160 1.00 0.00 ? 49  VAL D HA   1 
ATOM 6770  H HB   . VAL D 1 49  ? 108.311 140.772 -18.766 1.00 0.00 ? 49  VAL D HB   1 
ATOM 6771  H HG11 . VAL D 1 49  ? 107.166 138.996 -20.918 1.00 0.00 ? 49  VAL D HG11 1 
ATOM 6772  H HG12 . VAL D 1 49  ? 107.294 138.618 -19.207 1.00 0.00 ? 49  VAL D HG12 1 
ATOM 6773  H HG13 . VAL D 1 49  ? 108.750 138.768 -20.190 1.00 0.00 ? 49  VAL D HG13 1 
ATOM 6774  H HG21 . VAL D 1 49  ? 109.657 141.182 -20.691 1.00 0.00 ? 49  VAL D HG21 1 
ATOM 6775  H HG22 . VAL D 1 49  ? 108.402 142.418 -20.772 1.00 0.00 ? 49  VAL D HG22 1 
ATOM 6776  H HG23 . VAL D 1 49  ? 108.290 140.991 -21.786 1.00 0.00 ? 49  VAL D HG23 1 
ATOM 6777  N N    . HIS D 1 50  ? 105.890 142.577 -21.560 1.00 0.00 ? 50  HIS D N    1 
ATOM 6778  C CA   . HIS D 1 50  ? 105.371 142.877 -22.899 1.00 0.00 ? 50  HIS D CA   1 
ATOM 6779  C C    . HIS D 1 50  ? 106.289 143.874 -23.603 1.00 0.00 ? 50  HIS D C    1 
ATOM 6780  O O    . HIS D 1 50  ? 106.483 144.991 -23.130 1.00 0.00 ? 50  HIS D O    1 
ATOM 6781  C CB   . HIS D 1 50  ? 103.967 143.470 -22.797 1.00 0.00 ? 50  HIS D CB   1 
ATOM 6782  C CG   . HIS D 1 50  ? 103.419 143.690 -24.180 1.00 0.00 ? 50  HIS D CG   1 
ATOM 6783  N ND1  . HIS D 1 50  ? 102.499 142.828 -24.757 1.00 0.00 ? 50  HIS D ND1  1 
ATOM 6784  C CD2  . HIS D 1 50  ? 103.661 144.662 -25.115 1.00 0.00 ? 50  HIS D CD2  1 
ATOM 6785  C CE1  . HIS D 1 50  ? 102.225 143.297 -25.989 1.00 0.00 ? 50  HIS D CE1  1 
ATOM 6786  N NE2  . HIS D 1 50  ? 102.907 144.413 -26.257 1.00 0.00 ? 50  HIS D NE2  1 
ATOM 6787  H H    . HIS D 1 50  ? 106.335 143.287 -21.051 1.00 0.00 ? 50  HIS D H    1 
ATOM 6788  H HA   . HIS D 1 50  ? 105.328 141.969 -23.481 1.00 0.00 ? 50  HIS D HA   1 
ATOM 6789  H HB2  . HIS D 1 50  ? 103.325 142.788 -22.259 1.00 0.00 ? 50  HIS D HB2  1 
ATOM 6790  H HB3  . HIS D 1 50  ? 104.010 144.415 -22.274 1.00 0.00 ? 50  HIS D HB3  1 
ATOM 6791  H HD1  . HIS D 1 50  ? 102.119 142.025 -24.345 1.00 0.00 ? 50  HIS D HD1  1 
ATOM 6792  H HD2  . HIS D 1 50  ? 104.341 145.490 -24.987 1.00 0.00 ? 50  HIS D HD2  1 
ATOM 6793  H HE1  . HIS D 1 50  ? 101.536 142.827 -26.676 1.00 0.00 ? 50  HIS D HE1  1 
ATOM 6794  N N    . GLY D 1 51  ? 106.858 143.465 -24.742 1.00 0.00 ? 51  GLY D N    1 
ATOM 6795  C CA   . GLY D 1 51  ? 107.768 144.339 -25.508 1.00 0.00 ? 51  GLY D CA   1 
ATOM 6796  C C    . GLY D 1 51  ? 107.309 144.481 -26.956 1.00 0.00 ? 51  GLY D C    1 
ATOM 6797  O O    . GLY D 1 51  ? 106.961 143.499 -27.607 1.00 0.00 ? 51  GLY D O    1 
ATOM 6798  H H    . GLY D 1 51  ? 106.668 142.562 -25.074 1.00 0.00 ? 51  GLY D H    1 
ATOM 6799  H HA2  . GLY D 1 51  ? 107.808 145.321 -25.054 1.00 0.00 ? 51  GLY D HA2  1 
ATOM 6800  H HA3  . GLY D 1 51  ? 108.758 143.909 -25.498 1.00 0.00 ? 51  GLY D HA3  1 
ATOM 6801  N N    . VAL D 1 52  ? 107.323 145.718 -27.464 1.00 0.00 ? 52  VAL D N    1 
ATOM 6802  C CA   . VAL D 1 52  ? 106.918 145.992 -28.856 1.00 0.00 ? 52  VAL D CA   1 
ATOM 6803  C C    . VAL D 1 52  ? 107.981 146.827 -29.557 1.00 0.00 ? 52  VAL D C    1 
ATOM 6804  O O    . VAL D 1 52  ? 108.362 147.894 -29.073 1.00 0.00 ? 52  VAL D O    1 
ATOM 6805  C CB   . VAL D 1 52  ? 105.582 146.738 -28.878 1.00 0.00 ? 52  VAL D CB   1 
ATOM 6806  C CG1  . VAL D 1 52  ? 105.185 147.025 -30.327 1.00 0.00 ? 52  VAL D CG1  1 
ATOM 6807  C CG2  . VAL D 1 52  ? 104.507 145.872 -28.221 1.00 0.00 ? 52  VAL D CG2  1 
ATOM 6808  H H    . VAL D 1 52  ? 107.619 146.464 -26.899 1.00 0.00 ? 52  VAL D H    1 
ATOM 6809  H HA   . VAL D 1 52  ? 106.803 145.057 -29.394 1.00 0.00 ? 52  VAL D HA   1 
ATOM 6810  H HB   . VAL D 1 52  ? 105.680 147.670 -28.339 1.00 0.00 ? 52  VAL D HB   1 
ATOM 6811  H HG11 . VAL D 1 52  ? 105.831 147.789 -30.733 1.00 0.00 ? 52  VAL D HG11 1 
ATOM 6812  H HG12 . VAL D 1 52  ? 104.160 147.368 -30.357 1.00 0.00 ? 52  VAL D HG12 1 
ATOM 6813  H HG13 . VAL D 1 52  ? 105.281 146.123 -30.911 1.00 0.00 ? 52  VAL D HG13 1 
ATOM 6814  H HG21 . VAL D 1 52  ? 103.613 146.459 -28.071 1.00 0.00 ? 52  VAL D HG21 1 
ATOM 6815  H HG22 . VAL D 1 52  ? 104.867 145.514 -27.270 1.00 0.00 ? 52  VAL D HG22 1 
ATOM 6816  H HG23 . VAL D 1 52  ? 104.283 145.031 -28.861 1.00 0.00 ? 52  VAL D HG23 1 
ATOM 6817  N N    . ALA D 1 53  ? 108.462 146.333 -30.705 1.00 0.00 ? 53  ALA D N    1 
ATOM 6818  C CA   . ALA D 1 53  ? 109.495 147.035 -31.484 1.00 0.00 ? 53  ALA D CA   1 
ATOM 6819  C C    . ALA D 1 53  ? 109.080 147.149 -32.948 1.00 0.00 ? 53  ALA D C    1 
ATOM 6820  O O    . ALA D 1 53  ? 108.745 146.154 -33.586 1.00 0.00 ? 53  ALA D O    1 
ATOM 6821  C CB   . ALA D 1 53  ? 110.817 146.269 -31.392 1.00 0.00 ? 53  ALA D CB   1 
ATOM 6822  H H    . ALA D 1 53  ? 108.116 145.477 -31.036 1.00 0.00 ? 53  ALA D H    1 
ATOM 6823  H HA   . ALA D 1 53  ? 109.642 148.029 -31.084 1.00 0.00 ? 53  ALA D HA   1 
ATOM 6824  H HB1  . ALA D 1 53  ? 111.512 146.660 -32.120 1.00 0.00 ? 53  ALA D HB1  1 
ATOM 6825  H HB2  . ALA D 1 53  ? 110.641 145.222 -31.587 1.00 0.00 ? 53  ALA D HB2  1 
ATOM 6826  H HB3  . ALA D 1 53  ? 111.233 146.385 -30.400 1.00 0.00 ? 53  ALA D HB3  1 
ATOM 6827  N N    . THR D 1 54  ? 109.113 148.374 -33.484 1.00 0.00 ? 54  THR D N    1 
ATOM 6828  C CA   . THR D 1 54  ? 108.746 148.613 -34.893 1.00 0.00 ? 54  THR D CA   1 
ATOM 6829  C C    . THR D 1 54  ? 109.857 149.380 -35.605 1.00 0.00 ? 54  THR D C    1 
ATOM 6830  O O    . THR D 1 54  ? 110.279 150.442 -35.147 1.00 0.00 ? 54  THR D O    1 
ATOM 6831  C CB   . THR D 1 54  ? 107.446 149.418 -34.962 1.00 0.00 ? 54  THR D CB   1 
ATOM 6832  O OG1  . THR D 1 54  ? 106.409 148.697 -34.309 1.00 0.00 ? 54  THR D OG1  1 
ATOM 6833  C CG2  . THR D 1 54  ? 107.064 149.650 -36.424 1.00 0.00 ? 54  THR D CG2  1 
ATOM 6834  H H    . THR D 1 54  ? 109.396 149.131 -32.929 1.00 0.00 ? 54  THR D H    1 
ATOM 6835  H HA   . THR D 1 54  ? 108.597 147.668 -35.401 1.00 0.00 ? 54  THR D HA   1 
ATOM 6836  H HB   . THR D 1 54  ? 107.584 150.372 -34.475 1.00 0.00 ? 54  THR D HB   1 
ATOM 6837  H HG1  . THR D 1 54  ? 106.615 147.761 -34.372 1.00 0.00 ? 54  THR D HG1  1 
ATOM 6838  H HG21 . THR D 1 54  ? 107.108 148.714 -36.960 1.00 0.00 ? 54  THR D HG21 1 
ATOM 6839  H HG22 . THR D 1 54  ? 107.754 150.352 -36.868 1.00 0.00 ? 54  THR D HG22 1 
ATOM 6840  H HG23 . THR D 1 54  ? 106.062 150.049 -36.476 1.00 0.00 ? 54  THR D HG23 1 
ATOM 6841  N N    . VAL D 1 55  ? 110.322 148.832 -36.735 1.00 0.00 ? 55  VAL D N    1 
ATOM 6842  C CA   . VAL D 1 55  ? 111.389 149.463 -37.529 1.00 0.00 ? 55  VAL D CA   1 
ATOM 6843  C C    . VAL D 1 55  ? 110.956 149.581 -38.988 1.00 0.00 ? 55  VAL D C    1 
ATOM 6844  O O    . VAL D 1 55  ? 110.603 148.582 -39.618 1.00 0.00 ? 55  VAL D O    1 
ATOM 6845  C CB   . VAL D 1 55  ? 112.659 148.616 -37.445 1.00 0.00 ? 55  VAL D CB   1 
ATOM 6846  C CG1  . VAL D 1 55  ? 113.760 149.258 -38.289 1.00 0.00 ? 55  VAL D CG1  1 
ATOM 6847  C CG2  . VAL D 1 55  ? 113.120 148.529 -35.988 1.00 0.00 ? 55  VAL D CG2  1 
ATOM 6848  H H    . VAL D 1 55  ? 109.940 147.986 -37.046 1.00 0.00 ? 55  VAL D H    1 
ATOM 6849  H HA   . VAL D 1 55  ? 111.602 150.454 -37.143 1.00 0.00 ? 55  VAL D HA   1 
ATOM 6850  H HB   . VAL D 1 55  ? 112.454 147.622 -37.819 1.00 0.00 ? 55  VAL D HB   1 
ATOM 6851  H HG11 . VAL D 1 55  ? 113.529 149.134 -39.336 1.00 0.00 ? 55  VAL D HG11 1 
ATOM 6852  H HG12 . VAL D 1 55  ? 114.705 148.784 -38.070 1.00 0.00 ? 55  VAL D HG12 1 
ATOM 6853  H HG13 . VAL D 1 55  ? 113.823 150.310 -38.056 1.00 0.00 ? 55  VAL D HG13 1 
ATOM 6854  H HG21 . VAL D 1 55  ? 113.918 147.807 -35.905 1.00 0.00 ? 55  VAL D HG21 1 
ATOM 6855  H HG22 . VAL D 1 55  ? 112.291 148.223 -35.366 1.00 0.00 ? 55  VAL D HG22 1 
ATOM 6856  H HG23 . VAL D 1 55  ? 113.474 149.496 -35.663 1.00 0.00 ? 55  VAL D HG23 1 
ATOM 6857  N N    . ALA D 1 56  ? 110.982 150.805 -39.524 1.00 0.00 ? 56  ALA D N    1 
ATOM 6858  C CA   . ALA D 1 56  ? 110.583 151.034 -40.919 1.00 0.00 ? 56  ALA D CA   1 
ATOM 6859  C C    . ALA D 1 56  ? 111.793 150.952 -41.851 1.00 0.00 ? 56  ALA D C    1 
ATOM 6860  O O    . ALA D 1 56  ? 111.987 149.952 -42.535 1.00 0.00 ? 56  ALA D O    1 
ATOM 6861  C CB   . ALA D 1 56  ? 109.921 152.407 -41.053 1.00 0.00 ? 56  ALA D CB   1 
ATOM 6862  H H    . ALA D 1 56  ? 111.271 151.565 -38.976 1.00 0.00 ? 56  ALA D H    1 
ATOM 6863  H HA   . ALA D 1 56  ? 109.866 150.278 -41.214 1.00 0.00 ? 56  ALA D HA   1 
ATOM 6864  H HB1  . ALA D 1 56  ? 110.595 153.168 -40.697 1.00 0.00 ? 56  ALA D HB1  1 
ATOM 6865  H HB2  . ALA D 1 56  ? 109.013 152.428 -40.468 1.00 0.00 ? 56  ALA D HB2  1 
ATOM 6866  H HB3  . ALA D 1 56  ? 109.684 152.593 -42.091 1.00 0.00 ? 56  ALA D HB3  1 
ATOM 6867  N N    . GLU D 1 57  ? 112.601 152.009 -41.873 1.00 0.00 ? 57  GLU D N    1 
ATOM 6868  C CA   . GLU D 1 57  ? 113.785 152.035 -42.736 1.00 0.00 ? 57  GLU D CA   1 
ATOM 6869  C C    . GLU D 1 57  ? 114.704 150.843 -42.415 1.00 0.00 ? 57  GLU D C    1 
ATOM 6870  O O    . GLU D 1 57  ? 114.285 149.882 -41.771 1.00 0.00 ? 57  GLU D O    1 
ATOM 6871  C CB   . GLU D 1 57  ? 114.547 153.377 -42.539 1.00 0.00 ? 57  GLU D CB   1 
ATOM 6872  C CG   . GLU D 1 57  ? 115.140 153.879 -43.870 1.00 0.00 ? 57  GLU D CG   1 
ATOM 6873  C CD   . GLU D 1 57  ? 114.039 154.472 -44.745 1.00 0.00 ? 57  GLU D CD   1 
ATOM 6874  O OE1  . GLU D 1 57  ? 112.919 154.575 -44.271 1.00 0.00 ? 57  GLU D OE1  1 
ATOM 6875  O OE2  . GLU D 1 57  ? 114.332 154.819 -45.879 1.00 0.00 ? 57  GLU D OE2  1 
ATOM 6876  H H    . GLU D 1 57  ? 112.400 152.783 -41.308 1.00 0.00 ? 57  GLU D H    1 
ATOM 6877  H HA   . GLU D 1 57  ? 113.460 151.957 -43.763 1.00 0.00 ? 57  GLU D HA   1 
ATOM 6878  H HB2  . GLU D 1 57  ? 113.861 154.114 -42.163 1.00 0.00 ? 57  GLU D HB2  1 
ATOM 6879  H HB3  . GLU D 1 57  ? 115.346 153.244 -41.825 1.00 0.00 ? 57  GLU D HB3  1 
ATOM 6880  H HG2  . GLU D 1 57  ? 115.883 154.637 -43.667 1.00 0.00 ? 57  GLU D HG2  1 
ATOM 6881  H HG3  . GLU D 1 57  ? 115.602 153.057 -44.390 1.00 0.00 ? 57  GLU D HG3  1 
ATOM 6882  N N    . LYS D 1 58  ? 115.959 150.922 -42.877 1.00 0.00 ? 58  LYS D N    1 
ATOM 6883  C CA   . LYS D 1 58  ? 116.947 149.853 -42.647 1.00 0.00 ? 58  LYS D CA   1 
ATOM 6884  C C    . LYS D 1 58  ? 117.919 150.252 -41.542 1.00 0.00 ? 58  LYS D C    1 
ATOM 6885  O O    . LYS D 1 58  ? 118.086 151.431 -41.254 1.00 0.00 ? 58  LYS D O    1 
ATOM 6886  C CB   . LYS D 1 58  ? 117.735 149.583 -43.939 1.00 0.00 ? 58  LYS D CB   1 
ATOM 6887  C CG   . LYS D 1 58  ? 118.169 150.906 -44.570 1.00 0.00 ? 58  LYS D CG   1 
ATOM 6888  C CD   . LYS D 1 58  ? 118.955 150.619 -45.850 1.00 0.00 ? 58  LYS D CD   1 
ATOM 6889  C CE   . LYS D 1 58  ? 119.385 151.937 -46.488 1.00 0.00 ? 58  LYS D CE   1 
ATOM 6890  N NZ   . LYS D 1 58  ? 120.161 151.659 -47.728 1.00 0.00 ? 58  LYS D NZ   1 
ATOM 6891  H H    . LYS D 1 58  ? 116.228 151.714 -43.381 1.00 0.00 ? 58  LYS D H    1 
ATOM 6892  H HA   . LYS D 1 58  ? 116.439 148.943 -42.354 1.00 0.00 ? 58  LYS D HA   1 
ATOM 6893  H HB2  . LYS D 1 58  ? 118.615 148.996 -43.711 1.00 0.00 ? 58  LYS D HB2  1 
ATOM 6894  H HB3  . LYS D 1 58  ? 117.111 149.043 -44.634 1.00 0.00 ? 58  LYS D HB3  1 
ATOM 6895  H HG2  . LYS D 1 58  ? 117.299 151.495 -44.807 1.00 0.00 ? 58  LYS D HG2  1 
ATOM 6896  H HG3  . LYS D 1 58  ? 118.797 151.447 -43.878 1.00 0.00 ? 58  LYS D HG3  1 
ATOM 6897  H HD2  . LYS D 1 58  ? 119.829 150.030 -45.611 1.00 0.00 ? 58  LYS D HD2  1 
ATOM 6898  H HD3  . LYS D 1 58  ? 118.330 150.074 -46.541 1.00 0.00 ? 58  LYS D HD3  1 
ATOM 6899  H HE2  . LYS D 1 58  ? 118.510 152.520 -46.734 1.00 0.00 ? 58  LYS D HE2  1 
ATOM 6900  H HE3  . LYS D 1 58  ? 120.002 152.489 -45.793 1.00 0.00 ? 58  LYS D HE3  1 
ATOM 6901  H HZ1  . LYS D 1 58  ? 120.946 152.336 -47.805 1.00 0.00 ? 58  LYS D HZ1  1 
ATOM 6902  H HZ2  . LYS D 1 58  ? 119.536 151.755 -48.556 1.00 0.00 ? 58  LYS D HZ2  1 
ATOM 6903  H HZ3  . LYS D 1 58  ? 120.542 150.693 -47.690 1.00 0.00 ? 58  LYS D HZ3  1 
ATOM 6904  N N    . THR D 1 59  ? 118.562 149.260 -40.929 1.00 0.00 ? 59  THR D N    1 
ATOM 6905  C CA   . THR D 1 59  ? 119.525 149.533 -39.864 1.00 0.00 ? 59  THR D CA   1 
ATOM 6906  C C    . THR D 1 59  ? 120.874 149.928 -40.462 1.00 0.00 ? 59  THR D C    1 
ATOM 6907  O O    . THR D 1 59  ? 121.575 150.790 -39.928 1.00 0.00 ? 59  THR D O    1 
ATOM 6908  C CB   . THR D 1 59  ? 119.700 148.293 -38.981 1.00 0.00 ? 59  THR D CB   1 
ATOM 6909  O OG1  . THR D 1 59  ? 120.175 147.212 -39.772 1.00 0.00 ? 59  THR D OG1  1 
ATOM 6910  C CG2  . THR D 1 59  ? 118.358 147.917 -38.352 1.00 0.00 ? 59  THR D CG2  1 
ATOM 6911  H H    . THR D 1 59  ? 118.393 148.335 -41.201 1.00 0.00 ? 59  THR D H    1 
ATOM 6912  H HA   . THR D 1 59  ? 119.159 150.348 -39.255 1.00 0.00 ? 59  THR D HA   1 
ATOM 6913  H HB   . THR D 1 59  ? 120.410 148.507 -38.199 1.00 0.00 ? 59  THR D HB   1 
ATOM 6914  H HG1  . THR D 1 59  ? 119.806 146.400 -39.418 1.00 0.00 ? 59  THR D HG1  1 
ATOM 6915  H HG21 . THR D 1 59  ? 118.504 147.108 -37.652 1.00 0.00 ? 59  THR D HG21 1 
ATOM 6916  H HG22 . THR D 1 59  ? 117.673 147.602 -39.127 1.00 0.00 ? 59  THR D HG22 1 
ATOM 6917  H HG23 . THR D 1 59  ? 117.949 148.772 -37.836 1.00 0.00 ? 59  THR D HG23 1 
ATOM 6918  N N    . LYS D 1 60  ? 121.226 149.283 -41.577 1.00 0.00 ? 60  LYS D N    1 
ATOM 6919  C CA   . LYS D 1 60  ? 122.489 149.556 -42.257 1.00 0.00 ? 60  LYS D CA   1 
ATOM 6920  C C    . LYS D 1 60  ? 123.671 148.958 -41.463 1.00 0.00 ? 60  LYS D C    1 
ATOM 6921  O O    . LYS D 1 60  ? 124.487 149.696 -40.920 1.00 0.00 ? 60  LYS D O    1 
ATOM 6922  C CB   . LYS D 1 60  ? 122.691 151.070 -42.425 1.00 0.00 ? 60  LYS D CB   1 
ATOM 6923  C CG   . LYS D 1 60  ? 123.620 151.351 -43.626 1.00 0.00 ? 60  LYS D CG   1 
ATOM 6924  C CD   . LYS D 1 60  ? 123.813 152.860 -43.801 1.00 0.00 ? 60  LYS D CD   1 
ATOM 6925  C CE   . LYS D 1 60  ? 124.488 153.133 -45.148 1.00 0.00 ? 60  LYS D CE   1 
ATOM 6926  N NZ   . LYS D 1 60  ? 123.544 152.801 -46.254 1.00 0.00 ? 60  LYS D NZ   1 
ATOM 6927  H H    . LYS D 1 60  ? 120.623 148.604 -41.949 1.00 0.00 ? 60  LYS D H    1 
ATOM 6928  H HA   . LYS D 1 60  ? 122.452 149.115 -43.227 1.00 0.00 ? 60  LYS D HA   1 
ATOM 6929  H HB2  . LYS D 1 60  ? 121.736 151.545 -42.592 1.00 0.00 ? 60  LYS D HB2  1 
ATOM 6930  H HB3  . LYS D 1 60  ? 123.133 151.463 -41.540 1.00 0.00 ? 60  LYS D HB3  1 
ATOM 6931  H HG2  . LYS D 1 60  ? 124.579 150.886 -43.452 1.00 0.00 ? 60  LYS D HG2  1 
ATOM 6932  H HG3  . LYS D 1 60  ? 123.181 150.941 -44.523 1.00 0.00 ? 60  LYS D HG3  1 
ATOM 6933  H HD2  . LYS D 1 60  ? 122.853 153.355 -43.769 1.00 0.00 ? 60  LYS D HD2  1 
ATOM 6934  H HD3  . LYS D 1 60  ? 124.441 153.237 -43.008 1.00 0.00 ? 60  LYS D HD3  1 
ATOM 6935  H HE2  . LYS D 1 60  ? 124.763 154.175 -45.209 1.00 0.00 ? 60  LYS D HE2  1 
ATOM 6936  H HE3  . LYS D 1 60  ? 125.374 152.521 -45.236 1.00 0.00 ? 60  LYS D HE3  1 
ATOM 6937  H HZ1  . LYS D 1 60  ? 124.031 152.217 -46.963 1.00 0.00 ? 60  LYS D HZ1  1 
ATOM 6938  H HZ2  . LYS D 1 60  ? 123.209 153.681 -46.699 1.00 0.00 ? 60  LYS D HZ2  1 
ATOM 6939  H HZ3  . LYS D 1 60  ? 122.733 152.275 -45.874 1.00 0.00 ? 60  LYS D HZ3  1 
ATOM 6940  N N    . GLU D 1 61  ? 123.755 147.624 -41.391 1.00 0.00 ? 61  GLU D N    1 
ATOM 6941  C CA   . GLU D 1 61  ? 124.854 146.968 -40.647 1.00 0.00 ? 61  GLU D CA   1 
ATOM 6942  C C    . GLU D 1 61  ? 125.948 146.500 -41.604 1.00 0.00 ? 61  GLU D C    1 
ATOM 6943  O O    . GLU D 1 61  ? 125.983 145.335 -42.000 1.00 0.00 ? 61  GLU D O    1 
ATOM 6944  C CB   . GLU D 1 61  ? 124.303 145.771 -39.863 1.00 0.00 ? 61  GLU D CB   1 
ATOM 6945  C CG   . GLU D 1 61  ? 123.470 146.279 -38.683 1.00 0.00 ? 61  GLU D CG   1 
ATOM 6946  C CD   . GLU D 1 61  ? 122.724 145.123 -38.025 1.00 0.00 ? 61  GLU D CD   1 
ATOM 6947  O OE1  . GLU D 1 61  ? 122.620 144.082 -38.644 1.00 0.00 ? 61  GLU D OE1  1 
ATOM 6948  O OE2  . GLU D 1 61  ? 122.264 145.301 -36.909 1.00 0.00 ? 61  GLU D OE2  1 
ATOM 6949  H H    . GLU D 1 61  ? 123.078 147.074 -41.838 1.00 0.00 ? 61  GLU D H    1 
ATOM 6950  H HA   . GLU D 1 61  ? 125.286 147.672 -39.943 1.00 0.00 ? 61  GLU D HA   1 
ATOM 6951  H HB2  . GLU D 1 61  ? 123.684 145.170 -40.512 1.00 0.00 ? 61  GLU D HB2  1 
ATOM 6952  H HB3  . GLU D 1 61  ? 125.124 145.174 -39.492 1.00 0.00 ? 61  GLU D HB3  1 
ATOM 6953  H HG2  . GLU D 1 61  ? 124.126 146.737 -37.960 1.00 0.00 ? 61  GLU D HG2  1 
ATOM 6954  H HG3  . GLU D 1 61  ? 122.758 147.010 -39.035 1.00 0.00 ? 61  GLU D HG3  1 
ATOM 6955  N N    . GLN D 1 62  ? 126.841 147.417 -41.976 1.00 0.00 ? 62  GLN D N    1 
ATOM 6956  C CA   . GLN D 1 62  ? 127.922 147.075 -42.896 1.00 0.00 ? 62  GLN D CA   1 
ATOM 6957  C C    . GLN D 1 62  ? 128.980 146.217 -42.203 1.00 0.00 ? 62  GLN D C    1 
ATOM 6958  O O    . GLN D 1 62  ? 128.972 144.993 -42.325 1.00 0.00 ? 62  GLN D O    1 
ATOM 6959  C CB   . GLN D 1 62  ? 128.579 148.348 -43.437 1.00 0.00 ? 62  GLN D CB   1 
ATOM 6960  C CG   . GLN D 1 62  ? 127.611 149.078 -44.373 1.00 0.00 ? 62  GLN D CG   1 
ATOM 6961  C CD   . GLN D 1 62  ? 128.188 150.440 -44.751 1.00 0.00 ? 62  GLN D CD   1 
ATOM 6962  O OE1  . GLN D 1 62  ? 128.995 151.001 -44.010 1.00 0.00 ? 62  GLN D OE1  1 
ATOM 6963  N NE2  . GLN D 1 62  ? 127.820 151.010 -45.866 1.00 0.00 ? 62  GLN D NE2  1 
ATOM 6964  H H    . GLN D 1 62  ? 126.769 148.332 -41.633 1.00 0.00 ? 62  GLN D H    1 
ATOM 6965  H HA   . GLN D 1 62  ? 127.509 146.520 -43.722 1.00 0.00 ? 62  GLN D HA   1 
ATOM 6966  H HB2  . GLN D 1 62  ? 128.837 148.994 -42.616 1.00 0.00 ? 62  GLN D HB2  1 
ATOM 6967  H HB3  . GLN D 1 62  ? 129.471 148.086 -43.983 1.00 0.00 ? 62  GLN D HB3  1 
ATOM 6968  H HG2  . GLN D 1 62  ? 127.462 148.490 -45.266 1.00 0.00 ? 62  GLN D HG2  1 
ATOM 6969  H HG3  . GLN D 1 62  ? 126.665 149.218 -43.872 1.00 0.00 ? 62  GLN D HG3  1 
ATOM 6970  H HE21 . GLN D 1 62  ? 127.177 150.564 -46.456 1.00 0.00 ? 62  GLN D HE21 1 
ATOM 6971  H HE22 . GLN D 1 62  ? 128.188 151.885 -46.114 1.00 0.00 ? 62  GLN D HE22 1 
ATOM 6972  N N    . VAL D 1 63  ? 129.897 146.865 -41.472 1.00 0.00 ? 63  VAL D N    1 
ATOM 6973  C CA   . VAL D 1 63  ? 130.972 146.144 -40.762 1.00 0.00 ? 63  VAL D CA   1 
ATOM 6974  C C    . VAL D 1 63  ? 130.862 146.353 -39.253 1.00 0.00 ? 63  VAL D C    1 
ATOM 6975  O O    . VAL D 1 63  ? 130.916 147.477 -38.766 1.00 0.00 ? 63  VAL D O    1 
ATOM 6976  C CB   . VAL D 1 63  ? 132.337 146.640 -41.247 1.00 0.00 ? 63  VAL D CB   1 
ATOM 6977  C CG1  . VAL D 1 63  ? 133.444 145.892 -40.502 1.00 0.00 ? 63  VAL D CG1  1 
ATOM 6978  C CG2  . VAL D 1 63  ? 132.471 146.376 -42.750 1.00 0.00 ? 63  VAL D CG2  1 
ATOM 6979  H H    . VAL D 1 63  ? 129.856 147.842 -41.409 1.00 0.00 ? 63  VAL D H    1 
ATOM 6980  H HA   . VAL D 1 63  ? 130.901 145.088 -40.969 1.00 0.00 ? 63  VAL D HA   1 
ATOM 6981  H HB   . VAL D 1 63  ? 132.426 147.700 -41.055 1.00 0.00 ? 63  VAL D HB   1 
ATOM 6982  H HG11 . VAL D 1 63  ? 133.229 144.834 -40.508 1.00 0.00 ? 63  VAL D HG11 1 
ATOM 6983  H HG12 . VAL D 1 63  ? 133.493 146.243 -39.482 1.00 0.00 ? 63  VAL D HG12 1 
ATOM 6984  H HG13 . VAL D 1 63  ? 134.391 146.069 -40.990 1.00 0.00 ? 63  VAL D HG13 1 
ATOM 6985  H HG21 . VAL D 1 63  ? 131.606 146.768 -43.263 1.00 0.00 ? 63  VAL D HG21 1 
ATOM 6986  H HG22 . VAL D 1 63  ? 132.542 145.312 -42.923 1.00 0.00 ? 63  VAL D HG22 1 
ATOM 6987  H HG23 . VAL D 1 63  ? 133.362 146.861 -43.123 1.00 0.00 ? 63  VAL D HG23 1 
ATOM 6988  N N    . THR D 1 64  ? 130.716 145.250 -38.511 1.00 0.00 ? 64  THR D N    1 
ATOM 6989  C CA   . THR D 1 64  ? 130.608 145.309 -37.042 1.00 0.00 ? 64  THR D CA   1 
ATOM 6990  C C    . THR D 1 64  ? 131.682 144.436 -36.400 1.00 0.00 ? 64  THR D C    1 
ATOM 6991  O O    . THR D 1 64  ? 131.805 143.257 -36.726 1.00 0.00 ? 64  THR D O    1 
ATOM 6992  C CB   . THR D 1 64  ? 129.226 144.814 -36.606 1.00 0.00 ? 64  THR D CB   1 
ATOM 6993  O OG1  . THR D 1 64  ? 128.223 145.631 -37.196 1.00 0.00 ? 64  THR D OG1  1 
ATOM 6994  C CG2  . THR D 1 64  ? 129.113 144.886 -35.083 1.00 0.00 ? 64  THR D CG2  1 
ATOM 6995  H H    . THR D 1 64  ? 130.685 144.378 -38.956 1.00 0.00 ? 64  THR D H    1 
ATOM 6996  H HA   . THR D 1 64  ? 130.736 146.331 -36.701 1.00 0.00 ? 64  THR D HA   1 
ATOM 6997  H HB   . THR D 1 64  ? 129.092 143.792 -36.924 1.00 0.00 ? 64  THR D HB   1 
ATOM 6998  H HG1  . THR D 1 64  ? 128.356 146.532 -36.891 1.00 0.00 ? 64  THR D HG1  1 
ATOM 6999  H HG21 . THR D 1 64  ? 129.475 145.844 -34.740 1.00 0.00 ? 64  THR D HG21 1 
ATOM 7000  H HG22 . THR D 1 64  ? 129.704 144.098 -34.641 1.00 0.00 ? 64  THR D HG22 1 
ATOM 7001  H HG23 . THR D 1 64  ? 128.080 144.767 -34.792 1.00 0.00 ? 64  THR D HG23 1 
ATOM 7002  N N    . ASN D 1 65  ? 132.461 145.026 -35.483 1.00 0.00 ? 65  ASN D N    1 
ATOM 7003  C CA   . ASN D 1 65  ? 133.536 144.294 -34.789 1.00 0.00 ? 65  ASN D CA   1 
ATOM 7004  C C    . ASN D 1 65  ? 133.439 144.505 -33.277 1.00 0.00 ? 65  ASN D C    1 
ATOM 7005  O O    . ASN D 1 65  ? 133.599 145.620 -32.784 1.00 0.00 ? 65  ASN D O    1 
ATOM 7006  C CB   . ASN D 1 65  ? 134.897 144.787 -35.288 1.00 0.00 ? 65  ASN D CB   1 
ATOM 7007  C CG   . ASN D 1 65  ? 135.019 144.550 -36.791 1.00 0.00 ? 65  ASN D CG   1 
ATOM 7008  O OD1  . ASN D 1 65  ? 134.630 143.493 -37.287 1.00 0.00 ? 65  ASN D OD1  1 
ATOM 7009  N ND2  . ASN D 1 65  ? 135.538 145.477 -37.551 1.00 0.00 ? 65  ASN D ND2  1 
ATOM 7010  H H    . ASN D 1 65  ? 132.312 145.970 -35.266 1.00 0.00 ? 65  ASN D H    1 
ATOM 7011  H HA   . ASN D 1 65  ? 133.453 143.235 -34.997 1.00 0.00 ? 65  ASN D HA   1 
ATOM 7012  H HB2  . ASN D 1 65  ? 134.994 145.842 -35.081 1.00 0.00 ? 65  ASN D HB2  1 
ATOM 7013  H HB3  . ASN D 1 65  ? 135.683 144.249 -34.777 1.00 0.00 ? 65  ASN D HB3  1 
ATOM 7014  H HD21 . ASN D 1 65  ? 135.846 146.319 -37.154 1.00 0.00 ? 65  ASN D HD21 1 
ATOM 7015  H HD22 . ASN D 1 65  ? 135.619 145.331 -38.516 1.00 0.00 ? 65  ASN D HD22 1 
ATOM 7016  N N    . VAL D 1 66  ? 133.174 143.418 -32.541 1.00 0.00 ? 66  VAL D N    1 
ATOM 7017  C CA   . VAL D 1 66  ? 133.055 143.483 -31.072 1.00 0.00 ? 66  VAL D CA   1 
ATOM 7018  C C    . VAL D 1 66  ? 133.860 142.369 -30.412 1.00 0.00 ? 66  VAL D C    1 
ATOM 7019  O O    . VAL D 1 66  ? 133.747 141.202 -30.788 1.00 0.00 ? 66  VAL D O    1 
ATOM 7020  C CB   . VAL D 1 66  ? 131.590 143.359 -30.664 1.00 0.00 ? 66  VAL D CB   1 
ATOM 7021  C CG1  . VAL D 1 66  ? 131.485 143.382 -29.136 1.00 0.00 ? 66  VAL D CG1  1 
ATOM 7022  C CG2  . VAL D 1 66  ? 130.804 144.535 -31.252 1.00 0.00 ? 66  VAL D CG2  1 
ATOM 7023  H H    . VAL D 1 66  ? 133.056 142.554 -32.991 1.00 0.00 ? 66  VAL D H    1 
ATOM 7024  H HA   . VAL D 1 66  ? 133.431 144.436 -30.718 1.00 0.00 ? 66  VAL D HA   1 
ATOM 7025  H HB   . VAL D 1 66  ? 131.187 142.429 -31.040 1.00 0.00 ? 66  VAL D HB   1 
ATOM 7026  H HG11 . VAL D 1 66  ? 132.064 144.208 -28.748 1.00 0.00 ? 66  VAL D HG11 1 
ATOM 7027  H HG12 . VAL D 1 66  ? 131.867 142.456 -28.735 1.00 0.00 ? 66  VAL D HG12 1 
ATOM 7028  H HG13 . VAL D 1 66  ? 130.456 143.499 -28.848 1.00 0.00 ? 66  VAL D HG13 1 
ATOM 7029  H HG21 . VAL D 1 66  ? 130.951 144.566 -32.321 1.00 0.00 ? 66  VAL D HG21 1 
ATOM 7030  H HG22 . VAL D 1 66  ? 131.153 145.458 -30.813 1.00 0.00 ? 66  VAL D HG22 1 
ATOM 7031  H HG23 . VAL D 1 66  ? 129.756 144.410 -31.038 1.00 0.00 ? 66  VAL D HG23 1 
ATOM 7032  N N    . GLY D 1 67  ? 134.667 142.736 -29.419 1.00 0.00 ? 67  GLY D N    1 
ATOM 7033  C CA   . GLY D 1 67  ? 135.481 141.756 -28.708 1.00 0.00 ? 67  GLY D CA   1 
ATOM 7034  C C    . GLY D 1 67  ? 134.642 140.969 -27.699 1.00 0.00 ? 67  GLY D C    1 
ATOM 7035  O O    . GLY D 1 67  ? 134.554 139.742 -27.776 1.00 0.00 ? 67  GLY D O    1 
ATOM 7036  H H    . GLY D 1 67  ? 134.712 143.680 -29.157 1.00 0.00 ? 67  GLY D H    1 
ATOM 7037  H HA2  . GLY D 1 67  ? 135.914 141.071 -29.423 1.00 0.00 ? 67  GLY D HA2  1 
ATOM 7038  H HA3  . GLY D 1 67  ? 136.273 142.268 -28.182 1.00 0.00 ? 67  GLY D HA3  1 
ATOM 7039  N N    . GLY D 1 68  ? 134.032 141.681 -26.752 1.00 0.00 ? 68  GLY D N    1 
ATOM 7040  C CA   . GLY D 1 68  ? 133.211 141.033 -25.731 1.00 0.00 ? 68  GLY D CA   1 
ATOM 7041  C C    . GLY D 1 68  ? 131.878 140.558 -26.304 1.00 0.00 ? 68  GLY D C    1 
ATOM 7042  O O    . GLY D 1 68  ? 131.830 139.577 -27.044 1.00 0.00 ? 68  GLY D O    1 
ATOM 7043  H H    . GLY D 1 68  ? 134.140 142.657 -26.735 1.00 0.00 ? 68  GLY D H    1 
ATOM 7044  H HA2  . GLY D 1 68  ? 133.748 140.184 -25.335 1.00 0.00 ? 68  GLY D HA2  1 
ATOM 7045  H HA3  . GLY D 1 68  ? 133.020 141.733 -24.932 1.00 0.00 ? 68  GLY D HA3  1 
ATOM 7046  N N    . ALA D 1 69  ? 130.793 141.253 -25.949 1.00 0.00 ? 69  ALA D N    1 
ATOM 7047  C CA   . ALA D 1 69  ? 129.450 140.886 -26.426 1.00 0.00 ? 69  ALA D CA   1 
ATOM 7048  C C    . ALA D 1 69  ? 128.645 142.131 -26.780 1.00 0.00 ? 69  ALA D C    1 
ATOM 7049  O O    . ALA D 1 69  ? 128.892 143.218 -26.252 1.00 0.00 ? 69  ALA D O    1 
ATOM 7050  C CB   . ALA D 1 69  ? 128.713 140.099 -25.340 1.00 0.00 ? 69  ALA D CB   1 
ATOM 7051  H H    . ALA D 1 69  ? 130.894 142.023 -25.349 1.00 0.00 ? 69  ALA D H    1 
ATOM 7052  H HA   . ALA D 1 69  ? 129.534 140.266 -27.308 1.00 0.00 ? 69  ALA D HA   1 
ATOM 7053  H HB1  . ALA D 1 69  ? 128.614 140.711 -24.457 1.00 0.00 ? 69  ALA D HB1  1 
ATOM 7054  H HB2  . ALA D 1 69  ? 129.274 139.208 -25.099 1.00 0.00 ? 69  ALA D HB2  1 
ATOM 7055  H HB3  . ALA D 1 69  ? 127.732 139.822 -25.699 1.00 0.00 ? 69  ALA D HB3  1 
ATOM 7056  N N    . VAL D 1 70  ? 127.671 141.966 -27.684 1.00 0.00 ? 70  VAL D N    1 
ATOM 7057  C CA   . VAL D 1 70  ? 126.820 143.090 -28.114 1.00 0.00 ? 70  VAL D CA   1 
ATOM 7058  C C    . VAL D 1 70  ? 125.366 142.650 -28.275 1.00 0.00 ? 70  VAL D C    1 
ATOM 7059  O O    . VAL D 1 70  ? 125.073 141.644 -28.914 1.00 0.00 ? 70  VAL D O    1 
ATOM 7060  C CB   . VAL D 1 70  ? 127.353 143.667 -29.440 1.00 0.00 ? 70  VAL D CB   1 
ATOM 7061  C CG1  . VAL D 1 70  ? 127.627 142.523 -30.420 1.00 0.00 ? 70  VAL D CG1  1 
ATOM 7062  C CG2  . VAL D 1 70  ? 126.324 144.645 -30.058 1.00 0.00 ? 70  VAL D CG2  1 
ATOM 7063  H H    . VAL D 1 70  ? 127.521 141.075 -28.071 1.00 0.00 ? 70  VAL D H    1 
ATOM 7064  H HA   . VAL D 1 70  ? 126.856 143.866 -27.367 1.00 0.00 ? 70  VAL D HA   1 
ATOM 7065  H HB   . VAL D 1 70  ? 128.272 144.193 -29.248 1.00 0.00 ? 70  VAL D HB   1 
ATOM 7066  H HG11 . VAL D 1 70  ? 128.384 141.870 -30.009 1.00 0.00 ? 70  VAL D HG11 1 
ATOM 7067  H HG12 . VAL D 1 70  ? 127.972 142.927 -31.360 1.00 0.00 ? 70  VAL D HG12 1 
ATOM 7068  H HG13 . VAL D 1 70  ? 126.721 141.967 -30.580 1.00 0.00 ? 70  VAL D HG13 1 
ATOM 7069  H HG21 . VAL D 1 70  ? 125.834 145.201 -29.272 1.00 0.00 ? 70  VAL D HG21 1 
ATOM 7070  H HG22 . VAL D 1 70  ? 125.581 144.092 -30.618 1.00 0.00 ? 70  VAL D HG22 1 
ATOM 7071  H HG23 . VAL D 1 70  ? 126.833 145.332 -30.720 1.00 0.00 ? 70  VAL D HG23 1 
ATOM 7072  N N    . VAL D 1 71  ? 124.452 143.430 -27.692 1.00 0.00 ? 71  VAL D N    1 
ATOM 7073  C CA   . VAL D 1 71  ? 123.013 143.137 -27.773 1.00 0.00 ? 71  VAL D CA   1 
ATOM 7074  C C    . VAL D 1 71  ? 122.257 144.358 -28.282 1.00 0.00 ? 71  VAL D C    1 
ATOM 7075  O O    . VAL D 1 71  ? 122.350 145.441 -27.704 1.00 0.00 ? 71  VAL D O    1 
ATOM 7076  C CB   . VAL D 1 71  ? 122.485 142.747 -26.391 1.00 0.00 ? 71  VAL D CB   1 
ATOM 7077  C CG1  . VAL D 1 71  ? 120.991 142.427 -26.482 1.00 0.00 ? 71  VAL D CG1  1 
ATOM 7078  C CG2  . VAL D 1 71  ? 123.240 141.515 -25.891 1.00 0.00 ? 71  VAL D CG2  1 
ATOM 7079  H H    . VAL D 1 71  ? 124.751 144.228 -27.204 1.00 0.00 ? 71  VAL D H    1 
ATOM 7080  H HA   . VAL D 1 71  ? 122.843 142.314 -28.455 1.00 0.00 ? 71  VAL D HA   1 
ATOM 7081  H HB   . VAL D 1 71  ? 122.636 143.568 -25.704 1.00 0.00 ? 71  VAL D HB   1 
ATOM 7082  H HG11 . VAL D 1 71  ? 120.662 141.982 -25.555 1.00 0.00 ? 71  VAL D HG11 1 
ATOM 7083  H HG12 . VAL D 1 71  ? 120.821 141.735 -27.293 1.00 0.00 ? 71  VAL D HG12 1 
ATOM 7084  H HG13 . VAL D 1 71  ? 120.438 143.337 -26.662 1.00 0.00 ? 71  VAL D HG13 1 
ATOM 7085  H HG21 . VAL D 1 71  ? 124.299 141.652 -26.052 1.00 0.00 ? 71  VAL D HG21 1 
ATOM 7086  H HG22 . VAL D 1 71  ? 122.902 140.644 -26.431 1.00 0.00 ? 71  VAL D HG22 1 
ATOM 7087  H HG23 . VAL D 1 71  ? 123.049 141.383 -24.841 1.00 0.00 ? 71  VAL D HG23 1 
ATOM 7088  N N    . THR D 1 72  ? 121.506 144.185 -29.374 1.00 0.00 ? 72  THR D N    1 
ATOM 7089  C CA   . THR D 1 72  ? 120.735 145.296 -29.962 1.00 0.00 ? 72  THR D CA   1 
ATOM 7090  C C    . THR D 1 72  ? 119.264 144.915 -30.114 1.00 0.00 ? 72  THR D C    1 
ATOM 7091  O O    . THR D 1 72  ? 118.934 143.760 -30.382 1.00 0.00 ? 72  THR D O    1 
ATOM 7092  C CB   . THR D 1 72  ? 121.313 145.647 -31.339 1.00 0.00 ? 72  THR D CB   1 
ATOM 7093  O OG1  . THR D 1 72  ? 121.195 144.524 -32.203 1.00 0.00 ? 72  THR D OG1  1 
ATOM 7094  C CG2  . THR D 1 72  ? 122.790 146.026 -31.196 1.00 0.00 ? 72  THR D CG2  1 
ATOM 7095  H H    . THR D 1 72  ? 121.472 143.300 -29.795 1.00 0.00 ? 72  THR D H    1 
ATOM 7096  H HA   . THR D 1 72  ? 120.803 146.170 -29.328 1.00 0.00 ? 72  THR D HA   1 
ATOM 7097  H HB   . THR D 1 72  ? 120.772 146.480 -31.756 1.00 0.00 ? 72  THR D HB   1 
ATOM 7098  H HG1  . THR D 1 72  ? 121.364 144.820 -33.101 1.00 0.00 ? 72  THR D HG1  1 
ATOM 7099  H HG21 . THR D 1 72  ? 123.380 145.132 -31.051 1.00 0.00 ? 72  THR D HG21 1 
ATOM 7100  H HG22 . THR D 1 72  ? 122.914 146.679 -30.344 1.00 0.00 ? 72  THR D HG22 1 
ATOM 7101  H HG23 . THR D 1 72  ? 123.121 146.535 -32.090 1.00 0.00 ? 72  THR D HG23 1 
ATOM 7102  N N    . GLY D 1 73  ? 118.377 145.906 -29.950 1.00 0.00 ? 73  GLY D N    1 
ATOM 7103  C CA   . GLY D 1 73  ? 116.925 145.676 -30.079 1.00 0.00 ? 73  GLY D CA   1 
ATOM 7104  C C    . GLY D 1 73  ? 116.197 145.989 -28.774 1.00 0.00 ? 73  GLY D C    1 
ATOM 7105  O O    . GLY D 1 73  ? 116.334 147.078 -28.222 1.00 0.00 ? 73  GLY D O    1 
ATOM 7106  H H    . GLY D 1 73  ? 118.702 146.812 -29.744 1.00 0.00 ? 73  GLY D H    1 
ATOM 7107  H HA2  . GLY D 1 73  ? 116.537 146.317 -30.857 1.00 0.00 ? 73  GLY D HA2  1 
ATOM 7108  H HA3  . GLY D 1 73  ? 116.736 144.646 -30.347 1.00 0.00 ? 73  GLY D HA3  1 
ATOM 7109  N N    . VAL D 1 74  ? 115.409 145.024 -28.285 1.00 0.00 ? 74  VAL D N    1 
ATOM 7110  C CA   . VAL D 1 74  ? 114.647 145.212 -27.037 1.00 0.00 ? 74  VAL D CA   1 
ATOM 7111  C C    . VAL D 1 74  ? 114.661 143.940 -26.179 1.00 0.00 ? 74  VAL D C    1 
ATOM 7112  O O    . VAL D 1 74  ? 114.363 142.850 -26.653 1.00 0.00 ? 74  VAL D O    1 
ATOM 7113  C CB   . VAL D 1 74  ? 113.196 145.618 -27.377 1.00 0.00 ? 74  VAL D CB   1 
ATOM 7114  C CG1  . VAL D 1 74  ? 112.639 144.690 -28.458 1.00 0.00 ? 74  VAL D CG1  1 
ATOM 7115  C CG2  . VAL D 1 74  ? 112.306 145.532 -26.114 1.00 0.00 ? 74  VAL D CG2  1 
ATOM 7116  H H    . VAL D 1 74  ? 115.331 144.176 -28.770 1.00 0.00 ? 74  VAL D H    1 
ATOM 7117  H HA   . VAL D 1 74  ? 115.096 146.008 -26.465 1.00 0.00 ? 74  VAL D HA   1 
ATOM 7118  H HB   . VAL D 1 74  ? 113.190 146.632 -27.750 1.00 0.00 ? 74  VAL D HB   1 
ATOM 7119  H HG11 . VAL D 1 74  ? 111.592 144.903 -28.613 1.00 0.00 ? 74  VAL D HG11 1 
ATOM 7120  H HG12 . VAL D 1 74  ? 112.753 143.669 -28.145 1.00 0.00 ? 74  VAL D HG12 1 
ATOM 7121  H HG13 . VAL D 1 74  ? 113.179 144.846 -29.380 1.00 0.00 ? 74  VAL D HG13 1 
ATOM 7122  H HG21 . VAL D 1 74  ? 111.430 146.147 -26.250 1.00 0.00 ? 74  VAL D HG21 1 
ATOM 7123  H HG22 . VAL D 1 74  ? 112.859 145.882 -25.256 1.00 0.00 ? 74  VAL D HG22 1 
ATOM 7124  H HG23 . VAL D 1 74  ? 112.004 144.507 -25.950 1.00 0.00 ? 74  VAL D HG23 1 
ATOM 7125  N N    . THR D 1 75  ? 114.997 144.099 -24.896 1.00 0.00 ? 75  THR D N    1 
ATOM 7126  C CA   . THR D 1 75  ? 115.033 142.969 -23.952 1.00 0.00 ? 75  THR D CA   1 
ATOM 7127  C C    . THR D 1 75  ? 114.259 143.328 -22.695 1.00 0.00 ? 75  THR D C    1 
ATOM 7128  O O    . THR D 1 75  ? 114.499 144.370 -22.092 1.00 0.00 ? 75  THR D O    1 
ATOM 7129  C CB   . THR D 1 75  ? 116.480 142.639 -23.578 1.00 0.00 ? 75  THR D CB   1 
ATOM 7130  O OG1  . THR D 1 75  ? 117.205 142.312 -24.753 1.00 0.00 ? 75  THR D OG1  1 
ATOM 7131  C CG2  . THR D 1 75  ? 116.497 141.450 -22.613 1.00 0.00 ? 75  THR D CG2  1 
ATOM 7132  H H    . THR D 1 75  ? 115.214 144.999 -24.570 1.00 0.00 ? 75  THR D H    1 
ATOM 7133  H HA   . THR D 1 75  ? 114.581 142.098 -24.405 1.00 0.00 ? 75  THR D HA   1 
ATOM 7134  H HB   . THR D 1 75  ? 116.933 143.492 -23.100 1.00 0.00 ? 75  THR D HB   1 
ATOM 7135  H HG1  . THR D 1 75  ? 116.950 142.930 -25.441 1.00 0.00 ? 75  THR D HG1  1 
ATOM 7136  H HG21 . THR D 1 75  ? 117.501 141.056 -22.546 1.00 0.00 ? 75  THR D HG21 1 
ATOM 7137  H HG22 . THR D 1 75  ? 115.833 140.681 -22.977 1.00 0.00 ? 75  THR D HG22 1 
ATOM 7138  H HG23 . THR D 1 75  ? 116.172 141.775 -21.635 1.00 0.00 ? 75  THR D HG23 1 
ATOM 7139  N N    . ALA D 1 76  ? 113.323 142.468 -22.288 1.00 0.00 ? 76  ALA D N    1 
ATOM 7140  C CA   . ALA D 1 76  ? 112.523 142.736 -21.084 1.00 0.00 ? 76  ALA D CA   1 
ATOM 7141  C C    . ALA D 1 76  ? 112.335 141.475 -20.253 1.00 0.00 ? 76  ALA D C    1 
ATOM 7142  O O    . ALA D 1 76  ? 112.097 140.409 -20.786 1.00 0.00 ? 76  ALA D O    1 
ATOM 7143  C CB   . ALA D 1 76  ? 111.159 143.292 -21.481 1.00 0.00 ? 76  ALA D CB   1 
ATOM 7144  H H    . ALA D 1 76  ? 113.165 141.646 -22.802 1.00 0.00 ? 76  ALA D H    1 
ATOM 7145  H HA   . ALA D 1 76  ? 113.024 143.466 -20.482 1.00 0.00 ? 76  ALA D HA   1 
ATOM 7146  H HB1  . ALA D 1 76  ? 111.281 144.278 -21.905 1.00 0.00 ? 76  ALA D HB1  1 
ATOM 7147  H HB2  . ALA D 1 76  ? 110.533 143.351 -20.609 1.00 0.00 ? 76  ALA D HB2  1 
ATOM 7148  H HB3  . ALA D 1 76  ? 110.702 142.640 -22.211 1.00 0.00 ? 76  ALA D HB3  1 
ATOM 7149  N N    . VAL D 1 77  ? 112.438 141.596 -18.928 1.00 0.00 ? 77  VAL D N    1 
ATOM 7150  C CA   . VAL D 1 77  ? 112.266 140.427 -18.051 1.00 0.00 ? 77  VAL D CA   1 
ATOM 7151  C C    . VAL D 1 77  ? 111.477 140.803 -16.796 1.00 0.00 ? 77  VAL D C    1 
ATOM 7152  O O    . VAL D 1 77  ? 111.643 141.893 -16.248 1.00 0.00 ? 77  VAL D O    1 
ATOM 7153  C CB   . VAL D 1 77  ? 113.652 139.862 -17.662 1.00 0.00 ? 77  VAL D CB   1 
ATOM 7154  C CG1  . VAL D 1 77  ? 114.553 139.792 -18.911 1.00 0.00 ? 77  VAL D CG1  1 
ATOM 7155  C CG2  . VAL D 1 77  ? 114.313 140.761 -16.607 1.00 0.00 ? 77  VAL D CG2  1 
ATOM 7156  H H    . VAL D 1 77  ? 112.626 142.474 -18.535 1.00 0.00 ? 77  VAL D H    1 
ATOM 7157  H HA   . VAL D 1 77  ? 111.715 139.657 -18.577 1.00 0.00 ? 77  VAL D HA   1 
ATOM 7158  H HB   . VAL D 1 77  ? 113.528 138.868 -17.256 1.00 0.00 ? 77  VAL D HB   1 
ATOM 7159  H HG11 . VAL D 1 77  ? 115.364 139.104 -18.729 1.00 0.00 ? 77  VAL D HG11 1 
ATOM 7160  H HG12 . VAL D 1 77  ? 114.954 140.773 -19.123 1.00 0.00 ? 77  VAL D HG12 1 
ATOM 7161  H HG13 . VAL D 1 77  ? 113.979 139.454 -19.758 1.00 0.00 ? 77  VAL D HG13 1 
ATOM 7162  H HG21 . VAL D 1 77  ? 114.146 141.786 -16.865 1.00 0.00 ? 77  VAL D HG21 1 
ATOM 7163  H HG22 . VAL D 1 77  ? 115.374 140.565 -16.573 1.00 0.00 ? 77  VAL D HG22 1 
ATOM 7164  H HG23 . VAL D 1 77  ? 113.879 140.557 -15.639 1.00 0.00 ? 77  VAL D HG23 1 
ATOM 7165  N N    . ALA D 1 78  ? 110.627 139.879 -16.340 1.00 0.00 ? 78  ALA D N    1 
ATOM 7166  C CA   . ALA D 1 78  ? 109.814 140.097 -15.134 1.00 0.00 ? 78  ALA D CA   1 
ATOM 7167  C C    . ALA D 1 78  ? 110.222 139.101 -14.056 1.00 0.00 ? 78  ALA D C    1 
ATOM 7168  O O    . ALA D 1 78  ? 110.090 137.897 -14.242 1.00 0.00 ? 78  ALA D O    1 
ATOM 7169  C CB   . ALA D 1 78  ? 108.333 139.906 -15.464 1.00 0.00 ? 78  ALA D CB   1 
ATOM 7170  H H    . ALA D 1 78  ? 110.550 139.026 -16.818 1.00 0.00 ? 78  ALA D H    1 
ATOM 7171  H HA   . ALA D 1 78  ? 109.964 141.104 -14.760 1.00 0.00 ? 78  ALA D HA   1 
ATOM 7172  H HB1  . ALA D 1 78  ? 107.732 140.252 -14.635 1.00 0.00 ? 78  ALA D HB1  1 
ATOM 7173  H HB2  . ALA D 1 78  ? 108.136 138.858 -15.639 1.00 0.00 ? 78  ALA D HB2  1 
ATOM 7174  H HB3  . ALA D 1 78  ? 108.085 140.472 -16.350 1.00 0.00 ? 78  ALA D HB3  1 
ATOM 7175  N N    . GLN D 1 79  ? 110.723 139.616 -12.931 1.00 0.00 ? 79  GLN D N    1 
ATOM 7176  C CA   . GLN D 1 79  ? 111.158 138.766 -11.814 1.00 0.00 ? 79  GLN D CA   1 
ATOM 7177  C C    . GLN D 1 79  ? 110.749 139.415 -10.492 1.00 0.00 ? 79  GLN D C    1 
ATOM 7178  O O    . GLN D 1 79  ? 110.466 140.608 -10.448 1.00 0.00 ? 79  GLN D O    1 
ATOM 7179  C CB   . GLN D 1 79  ? 112.683 138.591 -11.852 1.00 0.00 ? 79  GLN D CB   1 
ATOM 7180  C CG   . GLN D 1 79  ? 113.134 138.322 -13.288 1.00 0.00 ? 79  GLN D CG   1 
ATOM 7181  C CD   . GLN D 1 79  ? 114.632 138.038 -13.322 1.00 0.00 ? 79  GLN D CD   1 
ATOM 7182  O OE1  . GLN D 1 79  ? 115.433 138.875 -12.906 1.00 0.00 ? 79  GLN D OE1  1 
ATOM 7183  N NE2  . GLN D 1 79  ? 115.060 136.899 -13.791 1.00 0.00 ? 79  GLN D NE2  1 
ATOM 7184  H H    . GLN D 1 79  ? 110.807 140.586 -12.847 1.00 0.00 ? 79  GLN D H    1 
ATOM 7185  H HA   . GLN D 1 79  ? 110.690 137.795 -11.887 1.00 0.00 ? 79  GLN D HA   1 
ATOM 7186  H HB2  . GLN D 1 79  ? 113.157 139.484 -11.488 1.00 0.00 ? 79  GLN D HB2  1 
ATOM 7187  H HB3  . GLN D 1 79  ? 112.964 137.756 -11.229 1.00 0.00 ? 79  GLN D HB3  1 
ATOM 7188  H HG2  . GLN D 1 79  ? 112.600 137.475 -13.680 1.00 0.00 ? 79  GLN D HG2  1 
ATOM 7189  H HG3  . GLN D 1 79  ? 112.924 139.188 -13.897 1.00 0.00 ? 79  GLN D HG3  1 
ATOM 7190  H HE21 . GLN D 1 79  ? 114.420 136.232 -14.120 1.00 0.00 ? 79  GLN D HE21 1 
ATOM 7191  H HE22 . GLN D 1 79  ? 116.020 136.710 -13.815 1.00 0.00 ? 79  GLN D HE22 1 
ATOM 7192  N N    . LYS D 1 80  ? 110.717 138.629 -9.408  1.00 0.00 ? 80  LYS D N    1 
ATOM 7193  C CA   . LYS D 1 80  ? 110.344 139.162 -8.081  1.00 0.00 ? 80  LYS D CA   1 
ATOM 7194  C C    . LYS D 1 80  ? 111.540 139.095 -7.140  1.00 0.00 ? 80  LYS D C    1 
ATOM 7195  O O    . LYS D 1 80  ? 112.020 140.118 -6.664  1.00 0.00 ? 80  LYS D O    1 
ATOM 7196  C CB   . LYS D 1 80  ? 109.179 138.357 -7.493  1.00 0.00 ? 80  LYS D CB   1 
ATOM 7197  C CG   . LYS D 1 80  ? 108.574 139.114 -6.305  1.00 0.00 ? 80  LYS D CG   1 
ATOM 7198  C CD   . LYS D 1 80  ? 107.327 138.372 -5.821  1.00 0.00 ? 80  LYS D CD   1 
ATOM 7199  C CE   . LYS D 1 80  ? 106.658 139.163 -4.697  1.00 0.00 ? 80  LYS D CE   1 
ATOM 7200  N NZ   . LYS D 1 80  ? 105.414 138.459 -4.274  1.00 0.00 ? 80  LYS D NZ   1 
ATOM 7201  H H    . LYS D 1 80  ? 110.952 137.683 -9.495  1.00 0.00 ? 80  LYS D H    1 
ATOM 7202  H HA   . LYS D 1 80  ? 110.038 140.198 -8.174  1.00 0.00 ? 80  LYS D HA   1 
ATOM 7203  H HB2  . LYS D 1 80  ? 108.423 138.212 -8.251  1.00 0.00 ? 80  LYS D HB2  1 
ATOM 7204  H HB3  . LYS D 1 80  ? 109.539 137.400 -7.155  1.00 0.00 ? 80  LYS D HB3  1 
ATOM 7205  H HG2  . LYS D 1 80  ? 109.298 139.166 -5.505  1.00 0.00 ? 80  LYS D HG2  1 
ATOM 7206  H HG3  . LYS D 1 80  ? 108.299 140.112 -6.612  1.00 0.00 ? 80  LYS D HG3  1 
ATOM 7207  H HD2  . LYS D 1 80  ? 106.635 138.258 -6.643  1.00 0.00 ? 80  LYS D HD2  1 
ATOM 7208  H HD3  . LYS D 1 80  ? 107.610 137.397 -5.452  1.00 0.00 ? 80  LYS D HD3  1 
ATOM 7209  H HE2  . LYS D 1 80  ? 107.332 139.239 -3.858  1.00 0.00 ? 80  LYS D HE2  1 
ATOM 7210  H HE3  . LYS D 1 80  ? 106.408 140.152 -5.051  1.00 0.00 ? 80  LYS D HE3  1 
ATOM 7211  H HZ1  . LYS D 1 80  ? 105.111 137.809 -5.026  1.00 0.00 ? 80  LYS D HZ1  1 
ATOM 7212  H HZ2  . LYS D 1 80  ? 104.664 139.157 -4.094  1.00 0.00 ? 80  LYS D HZ2  1 
ATOM 7213  H HZ3  . LYS D 1 80  ? 105.600 137.918 -3.406  1.00 0.00 ? 80  LYS D HZ3  1 
ATOM 7214  N N    . THR D 1 81  ? 112.034 137.878 -6.881  1.00 0.00 ? 81  THR D N    1 
ATOM 7215  C CA   . THR D 1 81  ? 113.192 137.695 -5.989  1.00 0.00 ? 81  THR D CA   1 
ATOM 7216  C C    . THR D 1 81  ? 114.189 136.704 -6.585  1.00 0.00 ? 81  THR D C    1 
ATOM 7217  O O    . THR D 1 81  ? 113.806 135.740 -7.236  1.00 0.00 ? 81  THR D O    1 
ATOM 7218  C CB   . THR D 1 81  ? 112.716 137.180 -4.627  1.00 0.00 ? 81  THR D CB   1 
ATOM 7219  O OG1  . THR D 1 81  ? 113.827 137.079 -3.746  1.00 0.00 ? 81  THR D OG1  1 
ATOM 7220  C CG2  . THR D 1 81  ? 112.068 135.806 -4.797  1.00 0.00 ? 81  THR D CG2  1 
ATOM 7221  H H    . THR D 1 81  ? 111.617 137.092 -7.297  1.00 0.00 ? 81  THR D H    1 
ATOM 7222  H HA   . THR D 1 81  ? 113.689 138.639 -5.846  1.00 0.00 ? 81  THR D HA   1 
ATOM 7223  H HB   . THR D 1 81  ? 111.993 137.867 -4.217  1.00 0.00 ? 81  THR D HB   1 
ATOM 7224  H HG1  . THR D 1 81  ? 114.341 136.311 -4.003  1.00 0.00 ? 81  THR D HG1  1 
ATOM 7225  H HG21 . THR D 1 81  ? 111.394 135.827 -5.640  1.00 0.00 ? 81  THR D HG21 1 
ATOM 7226  H HG22 . THR D 1 81  ? 111.517 135.554 -3.902  1.00 0.00 ? 81  THR D HG22 1 
ATOM 7227  H HG23 . THR D 1 81  ? 112.835 135.064 -4.967  1.00 0.00 ? 81  THR D HG23 1 
ATOM 7228  N N    . VAL D 1 82  ? 115.482 136.948 -6.352  1.00 0.00 ? 82  VAL D N    1 
ATOM 7229  C CA   . VAL D 1 82  ? 116.539 136.065 -6.874  1.00 0.00 ? 82  VAL D CA   1 
ATOM 7230  C C    . VAL D 1 82  ? 117.679 135.928 -5.863  1.00 0.00 ? 82  VAL D C    1 
ATOM 7231  O O    . VAL D 1 82  ? 118.024 136.876 -5.169  1.00 0.00 ? 82  VAL D O    1 
ATOM 7232  C CB   . VAL D 1 82  ? 117.069 136.621 -8.212  1.00 0.00 ? 82  VAL D CB   1 
ATOM 7233  C CG1  . VAL D 1 82  ? 117.372 138.115 -8.063  1.00 0.00 ? 82  VAL D CG1  1 
ATOM 7234  C CG2  . VAL D 1 82  ? 118.355 135.872 -8.632  1.00 0.00 ? 82  VAL D CG2  1 
ATOM 7235  H H    . VAL D 1 82  ? 115.732 137.735 -5.823  1.00 0.00 ? 82  VAL D H    1 
ATOM 7236  H HA   . VAL D 1 82  ? 116.124 135.088 -7.050  1.00 0.00 ? 82  VAL D HA   1 
ATOM 7237  H HB   . VAL D 1 82  ? 116.314 136.490 -8.974  1.00 0.00 ? 82  VAL D HB   1 
ATOM 7238  H HG11 . VAL D 1 82  ? 117.882 138.284 -7.131  1.00 0.00 ? 82  VAL D HG11 1 
ATOM 7239  H HG12 . VAL D 1 82  ? 116.448 138.672 -8.072  1.00 0.00 ? 82  VAL D HG12 1 
ATOM 7240  H HG13 . VAL D 1 82  ? 117.998 138.442 -8.881  1.00 0.00 ? 82  VAL D HG13 1 
ATOM 7241  H HG21 . VAL D 1 82  ? 118.257 134.824 -8.394  1.00 0.00 ? 82  VAL D HG21 1 
ATOM 7242  H HG22 . VAL D 1 82  ? 119.205 136.280 -8.101  1.00 0.00 ? 82  VAL D HG22 1 
ATOM 7243  H HG23 . VAL D 1 82  ? 118.506 135.987 -9.695  1.00 0.00 ? 82  VAL D HG23 1 
ATOM 7244  N N    . GLU D 1 83  ? 118.264 134.729 -5.788  1.00 0.00 ? 83  GLU D N    1 
ATOM 7245  C CA   . GLU D 1 83  ? 119.372 134.478 -4.855  1.00 0.00 ? 83  GLU D CA   1 
ATOM 7246  C C    . GLU D 1 83  ? 120.361 133.474 -5.441  1.00 0.00 ? 83  GLU D C    1 
ATOM 7247  O O    . GLU D 1 83  ? 119.974 132.536 -6.131  1.00 0.00 ? 83  GLU D O    1 
ATOM 7248  C CB   . GLU D 1 83  ? 118.820 133.942 -3.528  1.00 0.00 ? 83  GLU D CB   1 
ATOM 7249  C CG   . GLU D 1 83  ? 118.068 132.632 -3.774  1.00 0.00 ? 83  GLU D CG   1 
ATOM 7250  C CD   . GLU D 1 83  ? 117.422 132.149 -2.480  1.00 0.00 ? 83  GLU D CD   1 
ATOM 7251  O OE1  . GLU D 1 83  ? 117.575 132.827 -1.477  1.00 0.00 ? 83  GLU D OE1  1 
ATOM 7252  O OE2  . GLU D 1 83  ? 116.786 131.110 -2.512  1.00 0.00 ? 83  GLU D OE2  1 
ATOM 7253  H H    . GLU D 1 83  ? 117.948 134.003 -6.368  1.00 0.00 ? 83  GLU D H    1 
ATOM 7254  H HA   . GLU D 1 83  ? 119.891 135.401 -4.663  1.00 0.00 ? 83  GLU D HA   1 
ATOM 7255  H HB2  . GLU D 1 83  ? 119.638 133.765 -2.844  1.00 0.00 ? 83  GLU D HB2  1 
ATOM 7256  H HB3  . GLU D 1 83  ? 118.144 134.667 -3.101  1.00 0.00 ? 83  GLU D HB3  1 
ATOM 7257  H HG2  . GLU D 1 83  ? 117.301 132.795 -4.519  1.00 0.00 ? 83  GLU D HG2  1 
ATOM 7258  H HG3  . GLU D 1 83  ? 118.759 131.884 -4.130  1.00 0.00 ? 83  GLU D HG3  1 
ATOM 7259  N N    . GLY D 1 84  ? 121.648 133.675 -5.156  1.00 0.00 ? 84  GLY D N    1 
ATOM 7260  C CA   . GLY D 1 84  ? 122.689 132.775 -5.660  1.00 0.00 ? 84  GLY D CA   1 
ATOM 7261  C C    . GLY D 1 84  ? 124.023 133.499 -5.798  1.00 0.00 ? 84  GLY D C    1 
ATOM 7262  O O    . GLY D 1 84  ? 124.099 134.584 -6.373  1.00 0.00 ? 84  GLY D O    1 
ATOM 7263  H H    . GLY D 1 84  ? 121.902 134.441 -4.598  1.00 0.00 ? 84  GLY D H    1 
ATOM 7264  H HA2  . GLY D 1 84  ? 122.804 131.949 -4.975  1.00 0.00 ? 84  GLY D HA2  1 
ATOM 7265  H HA3  . GLY D 1 84  ? 122.397 132.395 -6.630  1.00 0.00 ? 84  GLY D HA3  1 
ATOM 7266  N N    . ALA D 1 85  ? 125.079 132.887 -5.278  1.00 0.00 ? 85  ALA D N    1 
ATOM 7267  C CA   . ALA D 1 85  ? 126.403 133.484 -5.360  1.00 0.00 ? 85  ALA D CA   1 
ATOM 7268  C C    . ALA D 1 85  ? 126.938 133.396 -6.786  1.00 0.00 ? 85  ALA D C    1 
ATOM 7269  O O    . ALA D 1 85  ? 126.964 132.322 -7.384  1.00 0.00 ? 85  ALA D O    1 
ATOM 7270  C CB   . ALA D 1 85  ? 127.358 132.765 -4.407  1.00 0.00 ? 85  ALA D CB   1 
ATOM 7271  H H    . ALA D 1 85  ? 124.966 132.019 -4.837  1.00 0.00 ? 85  ALA D H    1 
ATOM 7272  H HA   . ALA D 1 85  ? 126.339 134.522 -5.071  1.00 0.00 ? 85  ALA D HA   1 
ATOM 7273  H HB1  . ALA D 1 85  ? 128.345 133.193 -4.495  1.00 0.00 ? 85  ALA D HB1  1 
ATOM 7274  H HB2  . ALA D 1 85  ? 127.397 131.716 -4.661  1.00 0.00 ? 85  ALA D HB2  1 
ATOM 7275  H HB3  . ALA D 1 85  ? 127.006 132.877 -3.392  1.00 0.00 ? 85  ALA D HB3  1 
ATOM 7276  N N    . GLY D 1 86  ? 127.363 134.533 -7.325  1.00 0.00 ? 86  GLY D N    1 
ATOM 7277  C CA   . GLY D 1 86  ? 127.897 134.572 -8.682  1.00 0.00 ? 86  GLY D CA   1 
ATOM 7278  C C    . GLY D 1 86  ? 126.782 134.419 -9.711  1.00 0.00 ? 86  GLY D C    1 
ATOM 7279  O O    . GLY D 1 86  ? 127.040 134.316 -10.910 1.00 0.00 ? 86  GLY D O    1 
ATOM 7280  H H    . GLY D 1 86  ? 127.320 135.360 -6.801  1.00 0.00 ? 86  GLY D H    1 
ATOM 7281  H HA2  . GLY D 1 86  ? 128.401 135.514 -8.838  1.00 0.00 ? 86  GLY D HA2  1 
ATOM 7282  H HA3  . GLY D 1 86  ? 128.605 133.766 -8.806  1.00 0.00 ? 86  GLY D HA3  1 
ATOM 7283  N N    . SER D 1 87  ? 125.540 134.401 -9.232  1.00 0.00 ? 87  SER D N    1 
ATOM 7284  C CA   . SER D 1 87  ? 124.387 134.256 -10.115 1.00 0.00 ? 87  SER D CA   1 
ATOM 7285  C C    . SER D 1 87  ? 124.026 135.591 -10.757 1.00 0.00 ? 87  SER D C    1 
ATOM 7286  O O    . SER D 1 87  ? 124.296 136.659 -10.199 1.00 0.00 ? 87  SER D O    1 
ATOM 7287  C CB   . SER D 1 87  ? 123.192 133.721 -9.329  1.00 0.00 ? 87  SER D CB   1 
ATOM 7288  O OG   . SER D 1 87  ? 122.046 133.698 -10.172 1.00 0.00 ? 87  SER D OG   1 
ATOM 7289  H H    . SER D 1 87  ? 125.397 134.486 -8.267  1.00 0.00 ? 87  SER D H    1 
ATOM 7290  H HA   . SER D 1 87  ? 124.630 133.551 -10.895 1.00 0.00 ? 87  SER D HA   1 
ATOM 7291  H HB2  . SER D 1 87  ? 123.402 132.720 -8.992  1.00 0.00 ? 87  SER D HB2  1 
ATOM 7292  H HB3  . SER D 1 87  ? 123.011 134.355 -8.471  1.00 0.00 ? 87  SER D HB3  1 
ATOM 7293  H HG   . SER D 1 87  ? 121.552 132.898 -9.978  1.00 0.00 ? 87  SER D HG   1 
ATOM 7294  N N    . ILE D 1 88  ? 123.412 135.524 -11.943 1.00 0.00 ? 88  ILE D N    1 
ATOM 7295  C CA   . ILE D 1 88  ? 123.005 136.738 -12.671 1.00 0.00 ? 88  ILE D CA   1 
ATOM 7296  C C    . ILE D 1 88  ? 121.512 136.669 -12.994 1.00 0.00 ? 88  ILE D C    1 
ATOM 7297  O O    . ILE D 1 88  ? 121.028 135.662 -13.511 1.00 0.00 ? 88  ILE D O    1 
ATOM 7298  C CB   . ILE D 1 88  ? 123.845 136.869 -13.970 1.00 0.00 ? 88  ILE D CB   1 
ATOM 7299  C CG1  . ILE D 1 88  ? 123.342 135.869 -15.035 1.00 0.00 ? 88  ILE D CG1  1 
ATOM 7300  C CG2  . ILE D 1 88  ? 125.330 136.581 -13.658 1.00 0.00 ? 88  ILE D CG2  1 
ATOM 7301  C CD1  . ILE D 1 88  ? 124.319 135.831 -16.216 1.00 0.00 ? 88  ILE D CD1  1 
ATOM 7302  H H    . ILE D 1 88  ? 123.222 134.641 -12.335 1.00 0.00 ? 88  ILE D H    1 
ATOM 7303  H HA   . ILE D 1 88  ? 123.181 137.613 -12.055 1.00 0.00 ? 88  ILE D HA   1 
ATOM 7304  H HB   . ILE D 1 88  ? 123.751 137.876 -14.352 1.00 0.00 ? 88  ILE D HB   1 
ATOM 7305  H HG12 . ILE D 1 88  ? 123.269 134.892 -14.596 1.00 0.00 ? 88  ILE D HG12 1 
ATOM 7306  H HG13 . ILE D 1 88  ? 122.371 136.177 -15.390 1.00 0.00 ? 88  ILE D HG13 1 
ATOM 7307  H HG21 . ILE D 1 88  ? 125.950 137.052 -14.407 1.00 0.00 ? 88  ILE D HG21 1 
ATOM 7308  H HG22 . ILE D 1 88  ? 125.507 135.515 -13.667 1.00 0.00 ? 88  ILE D HG22 1 
ATOM 7309  H HG23 . ILE D 1 88  ? 125.585 136.973 -12.685 1.00 0.00 ? 88  ILE D HG23 1 
ATOM 7310  H HD11 . ILE D 1 88  ? 125.201 135.274 -15.935 1.00 0.00 ? 88  ILE D HD11 1 
ATOM 7311  H HD12 . ILE D 1 88  ? 124.599 136.838 -16.485 1.00 0.00 ? 88  ILE D HD12 1 
ATOM 7312  H HD13 . ILE D 1 88  ? 123.846 135.352 -17.060 1.00 0.00 ? 88  ILE D HD13 1 
ATOM 7313  N N    . ALA D 1 89  ? 120.784 137.742 -12.684 1.00 0.00 ? 89  ALA D N    1 
ATOM 7314  C CA   . ALA D 1 89  ? 119.346 137.777 -12.946 1.00 0.00 ? 89  ALA D CA   1 
ATOM 7315  C C    . ALA D 1 89  ? 119.081 138.204 -14.383 1.00 0.00 ? 89  ALA D C    1 
ATOM 7316  O O    . ALA D 1 89  ? 118.501 137.454 -15.164 1.00 0.00 ? 89  ALA D O    1 
ATOM 7317  C CB   . ALA D 1 89  ? 118.662 138.755 -11.989 1.00 0.00 ? 89  ALA D CB   1 
ATOM 7318  H H    . ALA D 1 89  ? 121.218 138.517 -12.269 1.00 0.00 ? 89  ALA D H    1 
ATOM 7319  H HA   . ALA D 1 89  ? 118.929 136.792 -12.790 1.00 0.00 ? 89  ALA D HA   1 
ATOM 7320  H HB1  . ALA D 1 89  ? 117.596 138.580 -11.996 1.00 0.00 ? 89  ALA D HB1  1 
ATOM 7321  H HB2  . ALA D 1 89  ? 118.861 139.767 -12.305 1.00 0.00 ? 89  ALA D HB2  1 
ATOM 7322  H HB3  . ALA D 1 89  ? 119.045 138.609 -10.991 1.00 0.00 ? 89  ALA D HB3  1 
ATOM 7323  N N    . ALA D 1 90  ? 119.518 139.417 -14.727 1.00 0.00 ? 90  ALA D N    1 
ATOM 7324  C CA   . ALA D 1 90  ? 119.334 139.955 -16.081 1.00 0.00 ? 90  ALA D CA   1 
ATOM 7325  C C    . ALA D 1 90  ? 120.636 140.565 -16.583 1.00 0.00 ? 90  ALA D C    1 
ATOM 7326  O O    . ALA D 1 90  ? 121.142 141.530 -16.011 1.00 0.00 ? 90  ALA D O    1 
ATOM 7327  C CB   . ALA D 1 90  ? 118.236 141.026 -16.068 1.00 0.00 ? 90  ALA D CB   1 
ATOM 7328  H H    . ALA D 1 90  ? 119.977 139.966 -14.057 1.00 0.00 ? 90  ALA D H    1 
ATOM 7329  H HA   . ALA D 1 90  ? 119.039 139.160 -16.756 1.00 0.00 ? 90  ALA D HA   1 
ATOM 7330  H HB1  . ALA D 1 90  ? 118.635 141.952 -15.679 1.00 0.00 ? 90  ALA D HB1  1 
ATOM 7331  H HB2  . ALA D 1 90  ? 117.422 140.695 -15.441 1.00 0.00 ? 90  ALA D HB2  1 
ATOM 7332  H HB3  . ALA D 1 90  ? 117.875 141.183 -17.074 1.00 0.00 ? 90  ALA D HB3  1 
ATOM 7333  N N    . ALA D 1 91  ? 121.179 139.998 -17.665 1.00 0.00 ? 91  ALA D N    1 
ATOM 7334  C CA   . ALA D 1 91  ? 122.433 140.501 -18.243 1.00 0.00 ? 91  ALA D CA   1 
ATOM 7335  C C    . ALA D 1 91  ? 122.412 140.387 -19.764 1.00 0.00 ? 91  ALA D C    1 
ATOM 7336  O O    . ALA D 1 91  ? 122.265 139.298 -20.313 1.00 0.00 ? 91  ALA D O    1 
ATOM 7337  C CB   . ALA D 1 91  ? 123.618 139.705 -17.688 1.00 0.00 ? 91  ALA D CB   1 
ATOM 7338  H H    . ALA D 1 91  ? 120.730 139.232 -18.081 1.00 0.00 ? 91  ALA D H    1 
ATOM 7339  H HA   . ALA D 1 91  ? 122.559 141.538 -17.978 1.00 0.00 ? 91  ALA D HA   1 
ATOM 7340  H HB1  . ALA D 1 91  ? 124.531 140.255 -17.858 1.00 0.00 ? 91  ALA D HB1  1 
ATOM 7341  H HB2  . ALA D 1 91  ? 123.677 138.746 -18.184 1.00 0.00 ? 91  ALA D HB2  1 
ATOM 7342  H HB3  . ALA D 1 91  ? 123.482 139.551 -16.628 1.00 0.00 ? 91  ALA D HB3  1 
ATOM 7343  N N    . THR D 1 92  ? 122.575 141.518 -20.447 1.00 0.00 ? 92  THR D N    1 
ATOM 7344  C CA   . THR D 1 92  ? 122.584 141.525 -21.914 1.00 0.00 ? 92  THR D CA   1 
ATOM 7345  C C    . THR D 1 92  ? 124.015 141.405 -22.427 1.00 0.00 ? 92  THR D C    1 
ATOM 7346  O O    . THR D 1 92  ? 124.793 142.356 -22.354 1.00 0.00 ? 92  THR D O    1 
ATOM 7347  C CB   . THR D 1 92  ? 121.957 142.820 -22.437 1.00 0.00 ? 92  THR D CB   1 
ATOM 7348  O OG1  . THR D 1 92  ? 122.899 143.876 -22.336 1.00 0.00 ? 92  THR D OG1  1 
ATOM 7349  C CG2  . THR D 1 92  ? 120.718 143.156 -21.609 1.00 0.00 ? 92  THR D CG2  1 
ATOM 7350  H H    . THR D 1 92  ? 122.699 142.361 -19.959 1.00 0.00 ? 92  THR D H    1 
ATOM 7351  H HA   . THR D 1 92  ? 122.008 140.688 -22.283 1.00 0.00 ? 92  THR D HA   1 
ATOM 7352  H HB   . THR D 1 92  ? 121.669 142.690 -23.468 1.00 0.00 ? 92  THR D HB   1 
ATOM 7353  H HG1  . THR D 1 92  ? 123.707 143.596 -22.772 1.00 0.00 ? 92  THR D HG1  1 
ATOM 7354  H HG21 . THR D 1 92  ? 120.218 144.010 -22.041 1.00 0.00 ? 92  THR D HG21 1 
ATOM 7355  H HG22 . THR D 1 92  ? 121.015 143.387 -20.596 1.00 0.00 ? 92  THR D HG22 1 
ATOM 7356  H HG23 . THR D 1 92  ? 120.047 142.311 -21.604 1.00 0.00 ? 92  THR D HG23 1 
ATOM 7357  N N    . GLY D 1 93  ? 124.354 140.225 -22.946 1.00 0.00 ? 93  GLY D N    1 
ATOM 7358  C CA   . GLY D 1 93  ? 125.695 139.982 -23.465 1.00 0.00 ? 93  GLY D CA   1 
ATOM 7359  C C    . GLY D 1 93  ? 126.658 139.650 -22.330 1.00 0.00 ? 93  GLY D C    1 
ATOM 7360  O O    . GLY D 1 93  ? 127.247 140.545 -21.725 1.00 0.00 ? 93  GLY D O    1 
ATOM 7361  H H    . GLY D 1 93  ? 123.690 139.505 -22.975 1.00 0.00 ? 93  GLY D H    1 
ATOM 7362  H HA2  . GLY D 1 93  ? 125.661 139.154 -24.160 1.00 0.00 ? 93  GLY D HA2  1 
ATOM 7363  H HA3  . GLY D 1 93  ? 126.044 140.863 -23.979 1.00 0.00 ? 93  GLY D HA3  1 
ATOM 7364  N N    . PHE D 1 94  ? 126.812 138.354 -22.040 1.00 0.00 ? 94  PHE D N    1 
ATOM 7365  C CA   . PHE D 1 94  ? 127.709 137.901 -20.962 1.00 0.00 ? 94  PHE D CA   1 
ATOM 7366  C C    . PHE D 1 94  ? 128.814 137.017 -21.534 1.00 0.00 ? 94  PHE D C    1 
ATOM 7367  O O    . PHE D 1 94  ? 128.541 135.971 -22.122 1.00 0.00 ? 94  PHE D O    1 
ATOM 7368  C CB   . PHE D 1 94  ? 126.905 137.099 -19.930 1.00 0.00 ? 94  PHE D CB   1 
ATOM 7369  C CG   . PHE D 1 94  ? 127.720 136.929 -18.669 1.00 0.00 ? 94  PHE D CG   1 
ATOM 7370  C CD1  . PHE D 1 94  ? 128.688 135.923 -18.589 1.00 0.00 ? 94  PHE D CD1  1 
ATOM 7371  C CD2  . PHE D 1 94  ? 127.506 137.784 -17.580 1.00 0.00 ? 94  PHE D CD2  1 
ATOM 7372  C CE1  . PHE D 1 94  ? 129.444 135.770 -17.421 1.00 0.00 ? 94  PHE D CE1  1 
ATOM 7373  C CE2  . PHE D 1 94  ? 128.261 137.632 -16.411 1.00 0.00 ? 94  PHE D CE2  1 
ATOM 7374  C CZ   . PHE D 1 94  ? 129.230 136.625 -16.331 1.00 0.00 ? 94  PHE D CZ   1 
ATOM 7375  H H    . PHE D 1 94  ? 126.313 137.687 -22.555 1.00 0.00 ? 94  PHE D H    1 
ATOM 7376  H HA   . PHE D 1 94  ? 128.159 138.755 -20.471 1.00 0.00 ? 94  PHE D HA   1 
ATOM 7377  H HB2  . PHE D 1 94  ? 125.990 137.625 -19.699 1.00 0.00 ? 94  PHE D HB2  1 
ATOM 7378  H HB3  . PHE D 1 94  ? 126.667 136.128 -20.336 1.00 0.00 ? 94  PHE D HB3  1 
ATOM 7379  H HD1  . PHE D 1 94  ? 128.853 135.264 -19.429 1.00 0.00 ? 94  PHE D HD1  1 
ATOM 7380  H HD2  . PHE D 1 94  ? 126.758 138.561 -17.642 1.00 0.00 ? 94  PHE D HD2  1 
ATOM 7381  H HE1  . PHE D 1 94  ? 130.193 134.994 -17.359 1.00 0.00 ? 94  PHE D HE1  1 
ATOM 7382  H HE2  . PHE D 1 94  ? 128.097 138.292 -15.572 1.00 0.00 ? 94  PHE D HE2  1 
ATOM 7383  H HZ   . PHE D 1 94  ? 129.813 136.507 -15.430 1.00 0.00 ? 94  PHE D HZ   1 
ATOM 7384  N N    . VAL D 1 95  ? 130.068 137.436 -21.354 1.00 0.00 ? 95  VAL D N    1 
ATOM 7385  C CA   . VAL D 1 95  ? 131.215 136.665 -21.857 1.00 0.00 ? 95  VAL D CA   1 
ATOM 7386  C C    . VAL D 1 95  ? 132.380 136.722 -20.864 1.00 0.00 ? 95  VAL D C    1 
ATOM 7387  O O    . VAL D 1 95  ? 132.857 137.795 -20.501 1.00 0.00 ? 95  VAL D O    1 
ATOM 7388  C CB   . VAL D 1 95  ? 131.644 137.213 -23.236 1.00 0.00 ? 95  VAL D CB   1 
ATOM 7389  C CG1  . VAL D 1 95  ? 131.713 138.739 -23.184 1.00 0.00 ? 95  VAL D CG1  1 
ATOM 7390  C CG2  . VAL D 1 95  ? 133.025 136.648 -23.630 1.00 0.00 ? 95  VAL D CG2  1 
ATOM 7391  H H    . VAL D 1 95  ? 130.228 138.277 -20.873 1.00 0.00 ? 95  VAL D H    1 
ATOM 7392  H HA   . VAL D 1 95  ? 130.922 135.630 -21.977 1.00 0.00 ? 95  VAL D HA   1 
ATOM 7393  H HB   . VAL D 1 95  ? 130.912 136.921 -23.975 1.00 0.00 ? 95  VAL D HB   1 
ATOM 7394  H HG11 . VAL D 1 95  ? 132.415 139.041 -22.430 1.00 0.00 ? 95  VAL D HG11 1 
ATOM 7395  H HG12 . VAL D 1 95  ? 130.737 139.138 -22.948 1.00 0.00 ? 95  VAL D HG12 1 
ATOM 7396  H HG13 . VAL D 1 95  ? 132.032 139.115 -24.142 1.00 0.00 ? 95  VAL D HG13 1 
ATOM 7397  H HG21 . VAL D 1 95  ? 133.080 135.606 -23.355 1.00 0.00 ? 95  VAL D HG21 1 
ATOM 7398  H HG22 . VAL D 1 95  ? 133.802 137.194 -23.116 1.00 0.00 ? 95  VAL D HG22 1 
ATOM 7399  H HG23 . VAL D 1 95  ? 133.163 136.746 -24.698 1.00 0.00 ? 95  VAL D HG23 1 
ATOM 7400  N N    . LYS D 1 96  ? 132.840 135.543 -20.431 1.00 0.00 ? 96  LYS D N    1 
ATOM 7401  C CA   . LYS D 1 96  ? 133.958 135.452 -19.478 1.00 0.00 ? 96  LYS D CA   1 
ATOM 7402  C C    . LYS D 1 96  ? 135.079 134.599 -20.057 1.00 0.00 ? 96  LYS D C    1 
ATOM 7403  O O    . LYS D 1 96  ? 134.881 133.423 -20.374 1.00 0.00 ? 96  LYS D O    1 
ATOM 7404  C CB   . LYS D 1 96  ? 133.472 134.836 -18.161 1.00 0.00 ? 96  LYS D CB   1 
ATOM 7405  C CG   . LYS D 1 96  ? 134.616 134.839 -17.142 1.00 0.00 ? 96  LYS D CG   1 
ATOM 7406  C CD   . LYS D 1 96  ? 134.116 134.289 -15.804 1.00 0.00 ? 96  LYS D CD   1 
ATOM 7407  C CE   . LYS D 1 96  ? 135.262 134.306 -14.789 1.00 0.00 ? 96  LYS D CE   1 
ATOM 7408  N NZ   . LYS D 1 96  ? 134.776 133.797 -13.473 1.00 0.00 ? 96  LYS D NZ   1 
ATOM 7409  H H    . LYS D 1 96  ? 132.421 134.718 -20.758 1.00 0.00 ? 96  LYS D H    1 
ATOM 7410  H HA   . LYS D 1 96  ? 134.350 136.443 -19.272 1.00 0.00 ? 96  LYS D HA   1 
ATOM 7411  H HB2  . LYS D 1 96  ? 132.645 135.414 -17.777 1.00 0.00 ? 96  LYS D HB2  1 
ATOM 7412  H HB3  . LYS D 1 96  ? 133.153 133.821 -18.338 1.00 0.00 ? 96  LYS D HB3  1 
ATOM 7413  H HG2  . LYS D 1 96  ? 135.424 134.219 -17.505 1.00 0.00 ? 96  LYS D HG2  1 
ATOM 7414  H HG3  . LYS D 1 96  ? 134.972 135.848 -17.003 1.00 0.00 ? 96  LYS D HG3  1 
ATOM 7415  H HD2  . LYS D 1 96  ? 133.303 134.904 -15.444 1.00 0.00 ? 96  LYS D HD2  1 
ATOM 7416  H HD3  . LYS D 1 96  ? 133.770 133.277 -15.938 1.00 0.00 ? 96  LYS D HD3  1 
ATOM 7417  H HE2  . LYS D 1 96  ? 136.064 133.676 -15.143 1.00 0.00 ? 96  LYS D HE2  1 
ATOM 7418  H HE3  . LYS D 1 96  ? 135.625 135.316 -14.673 1.00 0.00 ? 96  LYS D HE3  1 
ATOM 7419  H HZ1  . LYS D 1 96  ? 133.948 134.350 -13.172 1.00 0.00 ? 96  LYS D HZ1  1 
ATOM 7420  H HZ2  . LYS D 1 96  ? 135.533 133.893 -12.765 1.00 0.00 ? 96  LYS D HZ2  1 
ATOM 7421  H HZ3  . LYS D 1 96  ? 134.509 132.798 -13.564 1.00 0.00 ? 96  LYS D HZ3  1 
ATOM 7422  N N    . LYS D 1 97  ? 136.266 135.209 -20.184 1.00 0.00 ? 97  LYS D N    1 
ATOM 7423  C CA   . LYS D 1 97  ? 137.446 134.518 -20.719 1.00 0.00 ? 97  LYS D CA   1 
ATOM 7424  C C    . LYS D 1 97  ? 138.419 134.192 -19.591 1.00 0.00 ? 97  LYS D C    1 
ATOM 7425  O O    . LYS D 1 97  ? 139.280 135.004 -19.244 1.00 0.00 ? 97  LYS D O    1 
ATOM 7426  C CB   . LYS D 1 97  ? 138.148 135.409 -21.749 1.00 0.00 ? 97  LYS D CB   1 
ATOM 7427  C CG   . LYS D 1 97  ? 137.273 135.531 -23.001 1.00 0.00 ? 97  LYS D CG   1 
ATOM 7428  C CD   . LYS D 1 97  ? 137.838 136.603 -23.949 1.00 0.00 ? 97  LYS D CD   1 
ATOM 7429  C CE   . LYS D 1 97  ? 139.155 136.119 -24.570 1.00 0.00 ? 97  LYS D CE   1 
ATOM 7430  N NZ   . LYS D 1 97  ? 139.539 137.025 -25.689 1.00 0.00 ? 97  LYS D NZ   1 
ATOM 7431  H H    . LYS D 1 97  ? 136.350 136.146 -19.906 1.00 0.00 ? 97  LYS D H    1 
ATOM 7432  H HA   . LYS D 1 97  ? 137.146 133.596 -21.202 1.00 0.00 ? 97  LYS D HA   1 
ATOM 7433  H HB2  . LYS D 1 97  ? 138.316 136.389 -21.326 1.00 0.00 ? 97  LYS D HB2  1 
ATOM 7434  H HB3  . LYS D 1 97  ? 139.094 134.964 -22.013 1.00 0.00 ? 97  LYS D HB3  1 
ATOM 7435  H HG2  . LYS D 1 97  ? 137.245 134.580 -23.513 1.00 0.00 ? 97  LYS D HG2  1 
ATOM 7436  H HG3  . LYS D 1 97  ? 136.269 135.809 -22.710 1.00 0.00 ? 97  LYS D HG3  1 
ATOM 7437  H HD2  . LYS D 1 97  ? 137.123 136.797 -24.735 1.00 0.00 ? 97  LYS D HD2  1 
ATOM 7438  H HD3  . LYS D 1 97  ? 138.017 137.511 -23.395 1.00 0.00 ? 97  LYS D HD3  1 
ATOM 7439  H HE2  . LYS D 1 97  ? 139.933 136.132 -23.824 1.00 0.00 ? 97  LYS D HE2  1 
ATOM 7440  H HE3  . LYS D 1 97  ? 139.030 135.114 -24.946 1.00 0.00 ? 97  LYS D HE3  1 
ATOM 7441  H HZ1  . LYS D 1 97  ? 140.398 136.663 -26.148 1.00 0.00 ? 97  LYS D HZ1  1 
ATOM 7442  H HZ2  . LYS D 1 97  ? 139.720 137.980 -25.315 1.00 0.00 ? 97  LYS D HZ2  1 
ATOM 7443  H HZ3  . LYS D 1 97  ? 138.768 137.064 -26.384 1.00 0.00 ? 97  LYS D HZ3  1 
ATOM 7444  N N    . ASP D 1 98  ? 138.275 132.996 -19.024 1.00 0.00 ? 98  ASP D N    1 
ATOM 7445  C CA   . ASP D 1 98  ? 139.145 132.559 -17.939 1.00 0.00 ? 98  ASP D CA   1 
ATOM 7446  C C    . ASP D 1 98  ? 140.470 132.045 -18.495 1.00 0.00 ? 98  ASP D C    1 
ATOM 7447  O O    . ASP D 1 98  ? 141.531 132.271 -17.914 1.00 0.00 ? 98  ASP D O    1 
ATOM 7448  C CB   . ASP D 1 98  ? 138.458 131.452 -17.133 1.00 0.00 ? 98  ASP D CB   1 
ATOM 7449  C CG   . ASP D 1 98  ? 139.151 131.274 -15.786 1.00 0.00 ? 98  ASP D CG   1 
ATOM 7450  O OD1  . ASP D 1 98  ? 140.347 131.040 -15.785 1.00 0.00 ? 98  ASP D OD1  1 
ATOM 7451  O OD2  . ASP D 1 98  ? 138.473 131.375 -14.776 1.00 0.00 ? 98  ASP D OD2  1 
ATOM 7452  H H    . ASP D 1 98  ? 137.574 132.393 -19.347 1.00 0.00 ? 98  ASP D H    1 
ATOM 7453  H HA   . ASP D 1 98  ? 139.342 133.397 -17.285 1.00 0.00 ? 98  ASP D HA   1 
ATOM 7454  H HB2  . ASP D 1 98  ? 137.423 131.719 -16.971 1.00 0.00 ? 98  ASP D HB2  1 
ATOM 7455  H HB3  . ASP D 1 98  ? 138.506 130.524 -17.684 1.00 0.00 ? 98  ASP D HB3  1 
ATOM 7456  N N    . GLN D 1 99  ? 140.393 131.346 -19.625 1.00 0.00 ? 99  GLN D N    1 
ATOM 7457  C CA   . GLN D 1 99  ? 141.585 130.791 -20.263 1.00 0.00 ? 99  GLN D CA   1 
ATOM 7458  C C    . GLN D 1 99  ? 142.305 129.841 -19.310 1.00 0.00 ? 99  GLN D C    1 
ATOM 7459  O O    . GLN D 1 99  ? 141.745 129.421 -18.296 1.00 0.00 ? 99  GLN D O    1 
ATOM 7460  C CB   . GLN D 1 99  ? 142.537 131.921 -20.677 1.00 0.00 ? 99  GLN D CB   1 
ATOM 7461  C CG   . GLN D 1 99  ? 141.780 132.963 -21.507 1.00 0.00 ? 99  GLN D CG   1 
ATOM 7462  C CD   . GLN D 1 99  ? 141.141 132.305 -22.726 1.00 0.00 ? 99  GLN D CD   1 
ATOM 7463  O OE1  . GLN D 1 99  ? 141.831 131.664 -23.519 1.00 0.00 ? 99  GLN D OE1  1 
ATOM 7464  N NE2  . GLN D 1 99  ? 139.857 132.423 -22.922 1.00 0.00 ? 99  GLN D NE2  1 
ATOM 7465  H H    . GLN D 1 99  ? 139.516 131.195 -20.038 1.00 0.00 ? 99  GLN D H    1 
ATOM 7466  H HA   . GLN D 1 99  ? 141.289 130.243 -21.143 1.00 0.00 ? 99  GLN D HA   1 
ATOM 7467  H HB2  . GLN D 1 99  ? 142.944 132.391 -19.793 1.00 0.00 ? 99  GLN D HB2  1 
ATOM 7468  H HB3  . GLN D 1 99  ? 143.342 131.512 -21.268 1.00 0.00 ? 99  GLN D HB3  1 
ATOM 7469  H HG2  . GLN D 1 99  ? 141.009 133.412 -20.899 1.00 0.00 ? 99  GLN D HG2  1 
ATOM 7470  H HG3  . GLN D 1 99  ? 142.468 133.728 -21.835 1.00 0.00 ? 99  GLN D HG3  1 
ATOM 7471  H HE21 . GLN D 1 99  ? 139.310 132.932 -22.287 1.00 0.00 ? 99  GLN D HE21 1 
ATOM 7472  H HE22 . GLN D 1 99  ? 139.440 132.003 -23.702 1.00 0.00 ? 99  GLN D HE22 1 
ATOM 7473  N N    . LEU D 1 100 ? 143.550 129.505 -19.640 1.00 0.00 ? 100 LEU D N    1 
ATOM 7474  C CA   . LEU D 1 100 ? 144.341 128.603 -18.806 1.00 0.00 ? 100 LEU D CA   1 
ATOM 7475  C C    . LEU D 1 100 ? 145.832 128.780 -19.077 1.00 0.00 ? 100 LEU D C    1 
ATOM 7476  O O    . LEU D 1 100 ? 146.231 129.624 -19.881 1.00 0.00 ? 100 LEU D O    1 
ATOM 7477  C CB   . LEU D 1 100 ? 143.928 127.141 -19.052 1.00 0.00 ? 100 LEU D CB   1 
ATOM 7478  C CG   . LEU D 1 100 ? 144.434 126.646 -20.418 1.00 0.00 ? 100 LEU D CG   1 
ATOM 7479  C CD1  . LEU D 1 100 ? 143.850 125.257 -20.690 1.00 0.00 ? 100 LEU D CD1  1 
ATOM 7480  C CD2  . LEU D 1 100 ? 143.991 127.613 -21.529 1.00 0.00 ? 100 LEU D CD2  1 
ATOM 7481  H H    . LEU D 1 100 ? 143.944 129.871 -20.459 1.00 0.00 ? 100 LEU D H    1 
ATOM 7482  H HA   . LEU D 1 100 ? 144.152 128.840 -17.768 1.00 0.00 ? 100 LEU D HA   1 
ATOM 7483  H HB2  . LEU D 1 100 ? 144.348 126.520 -18.275 1.00 0.00 ? 100 LEU D HB2  1 
ATOM 7484  H HB3  . LEU D 1 100 ? 142.852 127.066 -19.024 1.00 0.00 ? 100 LEU D HB3  1 
ATOM 7485  H HG   . LEU D 1 100 ? 145.513 126.578 -20.404 1.00 0.00 ? 100 LEU D HG   1 
ATOM 7486  H HD11 . LEU D 1 100 ? 142.772 125.318 -20.720 1.00 0.00 ? 100 LEU D HD11 1 
ATOM 7487  H HD12 . LEU D 1 100 ? 144.150 124.580 -19.902 1.00 0.00 ? 100 LEU D HD12 1 
ATOM 7488  H HD13 . LEU D 1 100 ? 144.216 124.891 -21.637 1.00 0.00 ? 100 LEU D HD13 1 
ATOM 7489  H HD21 . LEU D 1 100 ? 144.631 128.483 -21.525 1.00 0.00 ? 100 LEU D HD21 1 
ATOM 7490  H HD22 . LEU D 1 100 ? 142.970 127.916 -21.356 1.00 0.00 ? 100 LEU D HD22 1 
ATOM 7491  H HD23 . LEU D 1 100 ? 144.063 127.121 -22.490 1.00 0.00 ? 100 LEU D HD23 1 
ATOM 7492  N N    . GLY D 1 101 ? 146.651 127.978 -18.396 1.00 0.00 ? 101 GLY D N    1 
ATOM 7493  C CA   . GLY D 1 101 ? 148.105 128.044 -18.561 1.00 0.00 ? 101 GLY D CA   1 
ATOM 7494  C C    . GLY D 1 101 ? 148.723 129.020 -17.563 1.00 0.00 ? 101 GLY D C    1 
ATOM 7495  O O    . GLY D 1 101 ? 148.522 130.231 -17.660 1.00 0.00 ? 101 GLY D O    1 
ATOM 7496  H H    . GLY D 1 101 ? 146.270 127.328 -17.770 1.00 0.00 ? 101 GLY D H    1 
ATOM 7497  H HA2  . GLY D 1 101 ? 148.524 127.061 -18.399 1.00 0.00 ? 101 GLY D HA2  1 
ATOM 7498  H HA3  . GLY D 1 101 ? 148.342 128.369 -19.565 1.00 0.00 ? 101 GLY D HA3  1 
ATOM 7499  N N    . LYS D 1 102 ? 149.487 128.482 -16.605 1.00 0.00 ? 102 LYS D N    1 
ATOM 7500  C CA   . LYS D 1 102 ? 150.152 129.308 -15.580 1.00 0.00 ? 102 LYS D CA   1 
ATOM 7501  C C    . LYS D 1 102 ? 151.661 129.123 -15.650 1.00 0.00 ? 102 LYS D C    1 
ATOM 7502  O O    . LYS D 1 102 ? 152.190 128.096 -15.228 1.00 0.00 ? 102 LYS D O    1 
ATOM 7503  C CB   . LYS D 1 102 ? 149.660 128.904 -14.189 1.00 0.00 ? 102 LYS D CB   1 
ATOM 7504  C CG   . LYS D 1 102 ? 148.195 129.307 -14.032 1.00 0.00 ? 102 LYS D CG   1 
ATOM 7505  C CD   . LYS D 1 102 ? 147.697 128.891 -12.646 1.00 0.00 ? 102 LYS D CD   1 
ATOM 7506  C CE   . LYS D 1 102 ? 146.231 129.296 -12.486 1.00 0.00 ? 102 LYS D CE   1 
ATOM 7507  N NZ   . LYS D 1 102 ? 146.115 130.783 -12.530 1.00 0.00 ? 102 LYS D NZ   1 
ATOM 7508  H H    . LYS D 1 102 ? 149.613 127.511 -16.587 1.00 0.00 ? 102 LYS D H    1 
ATOM 7509  H HA   . LYS D 1 102 ? 149.920 130.355 -15.741 1.00 0.00 ? 102 LYS D HA   1 
ATOM 7510  H HB2  . LYS D 1 102 ? 149.755 127.834 -14.070 1.00 0.00 ? 102 LYS D HB2  1 
ATOM 7511  H HB3  . LYS D 1 102 ? 150.252 129.405 -13.437 1.00 0.00 ? 102 LYS D HB3  1 
ATOM 7512  H HG2  . LYS D 1 102 ? 148.105 130.377 -14.144 1.00 0.00 ? 102 LYS D HG2  1 
ATOM 7513  H HG3  . LYS D 1 102 ? 147.603 128.814 -14.788 1.00 0.00 ? 102 LYS D HG3  1 
ATOM 7514  H HD2  . LYS D 1 102 ? 147.790 127.820 -12.538 1.00 0.00 ? 102 LYS D HD2  1 
ATOM 7515  H HD3  . LYS D 1 102 ? 148.290 129.382 -11.888 1.00 0.00 ? 102 LYS D HD3  1 
ATOM 7516  H HE2  . LYS D 1 102 ? 145.651 128.867 -13.290 1.00 0.00 ? 102 LYS D HE2  1 
ATOM 7517  H HE3  . LYS D 1 102 ? 145.858 128.933 -11.539 1.00 0.00 ? 102 LYS D HE3  1 
ATOM 7518  H HZ1  . LYS D 1 102 ? 146.750 131.160 -13.259 1.00 0.00 ? 102 LYS D HZ1  1 
ATOM 7519  H HZ2  . LYS D 1 102 ? 146.376 131.178 -11.603 1.00 0.00 ? 102 LYS D HZ2  1 
ATOM 7520  H HZ3  . LYS D 1 102 ? 145.137 131.047 -12.756 1.00 0.00 ? 102 LYS D HZ3  1 
ATOM 7521  N N    . ASN D 1 103 ? 152.353 130.128 -16.187 1.00 0.00 ? 103 ASN D N    1 
ATOM 7522  C CA   . ASN D 1 103 ? 153.813 130.075 -16.312 1.00 0.00 ? 103 ASN D CA   1 
ATOM 7523  C C    . ASN D 1 103 ? 154.480 130.746 -15.115 1.00 0.00 ? 103 ASN D C    1 
ATOM 7524  O O    . ASN D 1 103 ? 155.689 130.624 -14.917 1.00 0.00 ? 103 ASN D O    1 
ATOM 7525  C CB   . ASN D 1 103 ? 154.243 130.780 -17.600 1.00 0.00 ? 103 ASN D CB   1 
ATOM 7526  C CG   . ASN D 1 103 ? 153.743 129.999 -18.811 1.00 0.00 ? 103 ASN D CG   1 
ATOM 7527  O OD1  . ASN D 1 103 ? 153.699 128.769 -18.782 1.00 0.00 ? 103 ASN D OD1  1 
ATOM 7528  N ND2  . ASN D 1 103 ? 153.360 130.643 -19.880 1.00 0.00 ? 103 ASN D ND2  1 
ATOM 7529  H H    . ASN D 1 103 ? 151.874 130.923 -16.505 1.00 0.00 ? 103 ASN D H    1 
ATOM 7530  H HA   . ASN D 1 103 ? 154.135 129.042 -16.359 1.00 0.00 ? 103 ASN D HA   1 
ATOM 7531  H HB2  . ASN D 1 103 ? 153.828 131.777 -17.619 1.00 0.00 ? 103 ASN D HB2  1 
ATOM 7532  H HB3  . ASN D 1 103 ? 155.321 130.840 -17.634 1.00 0.00 ? 103 ASN D HB3  1 
ATOM 7533  H HD21 . ASN D 1 103 ? 153.395 131.622 -19.901 1.00 0.00 ? 103 ASN D HD21 1 
ATOM 7534  H HD22 . ASN D 1 103 ? 153.039 130.147 -20.662 1.00 0.00 ? 103 ASN D HD22 1 
ATOM 7535  N N    . GLU D 1 104 ? 153.685 131.459 -14.322 1.00 0.00 ? 104 GLU D N    1 
ATOM 7536  C CA   . GLU D 1 104 ? 154.211 132.149 -13.149 1.00 0.00 ? 104 GLU D CA   1 
ATOM 7537  C C    . GLU D 1 104 ? 154.764 131.139 -12.146 1.00 0.00 ? 104 GLU D C    1 
ATOM 7538  O O    . GLU D 1 104 ? 155.842 131.332 -11.584 1.00 0.00 ? 104 GLU D O    1 
ATOM 7539  C CB   . GLU D 1 104 ? 153.096 132.980 -12.497 1.00 0.00 ? 104 GLU D CB   1 
ATOM 7540  C CG   . GLU D 1 104 ? 153.664 133.817 -11.342 1.00 0.00 ? 104 GLU D CG   1 
ATOM 7541  C CD   . GLU D 1 104 ? 154.643 134.854 -11.882 1.00 0.00 ? 104 GLU D CD   1 
ATOM 7542  O OE1  . GLU D 1 104 ? 154.576 135.144 -13.066 1.00 0.00 ? 104 GLU D OE1  1 
ATOM 7543  O OE2  . GLU D 1 104 ? 155.446 135.343 -11.105 1.00 0.00 ? 104 GLU D OE2  1 
ATOM 7544  H H    . GLU D 1 104 ? 152.730 131.525 -14.530 1.00 0.00 ? 104 GLU D H    1 
ATOM 7545  H HA   . GLU D 1 104 ? 155.007 132.808 -13.458 1.00 0.00 ? 104 GLU D HA   1 
ATOM 7546  H HB2  . GLU D 1 104 ? 152.664 133.638 -13.236 1.00 0.00 ? 104 GLU D HB2  1 
ATOM 7547  H HB3  . GLU D 1 104 ? 152.333 132.319 -12.117 1.00 0.00 ? 104 GLU D HB3  1 
ATOM 7548  H HG2  . GLU D 1 104 ? 152.853 134.323 -10.838 1.00 0.00 ? 104 GLU D HG2  1 
ATOM 7549  H HG3  . GLU D 1 104 ? 154.172 133.174 -10.643 1.00 0.00 ? 104 GLU D HG3  1 
ATOM 7550  N N    . GLU D 1 105 ? 154.019 130.058 -11.930 1.00 0.00 ? 105 GLU D N    1 
ATOM 7551  C CA   . GLU D 1 105 ? 154.446 129.020 -10.997 1.00 0.00 ? 105 GLU D CA   1 
ATOM 7552  C C    . GLU D 1 105 ? 155.738 128.372 -11.479 1.00 0.00 ? 105 GLU D C    1 
ATOM 7553  O O    . GLU D 1 105 ? 156.641 128.096 -10.688 1.00 0.00 ? 105 GLU D O    1 
ATOM 7554  C CB   . GLU D 1 105 ? 153.353 127.954 -10.862 1.00 0.00 ? 105 GLU D CB   1 
ATOM 7555  C CG   . GLU D 1 105 ? 153.785 126.894 -9.841  1.00 0.00 ? 105 GLU D CG   1 
ATOM 7556  C CD   . GLU D 1 105 ? 152.655 125.893 -9.619  1.00 0.00 ? 105 GLU D CD   1 
ATOM 7557  O OE1  . GLU D 1 105 ? 151.612 126.063 -10.227 1.00 0.00 ? 105 GLU D OE1  1 
ATOM 7558  O OE2  . GLU D 1 105 ? 152.851 124.972 -8.843  1.00 0.00 ? 105 GLU D OE2  1 
ATOM 7559  H H    . GLU D 1 105 ? 153.170 129.955 -12.410 1.00 0.00 ? 105 GLU D H    1 
ATOM 7560  H HA   . GLU D 1 105 ? 154.618 129.468 -10.030 1.00 0.00 ? 105 GLU D HA   1 
ATOM 7561  H HB2  . GLU D 1 105 ? 152.436 128.420 -10.532 1.00 0.00 ? 105 GLU D HB2  1 
ATOM 7562  H HB3  . GLU D 1 105 ? 153.192 127.482 -11.820 1.00 0.00 ? 105 GLU D HB3  1 
ATOM 7563  H HG2  . GLU D 1 105 ? 154.656 126.373 -10.209 1.00 0.00 ? 105 GLU D HG2  1 
ATOM 7564  H HG3  . GLU D 1 105 ? 154.024 127.376 -8.906  1.00 0.00 ? 105 GLU D HG3  1 
ATOM 7565  N N    . GLY D 1 106 ? 155.816 128.130 -12.783 1.00 0.00 ? 106 GLY D N    1 
ATOM 7566  C CA   . GLY D 1 106 ? 156.999 127.511 -13.366 1.00 0.00 ? 106 GLY D CA   1 
ATOM 7567  C C    . GLY D 1 106 ? 157.191 126.093 -12.835 1.00 0.00 ? 106 GLY D C    1 
ATOM 7568  O O    . GLY D 1 106 ? 156.223 125.372 -12.598 1.00 0.00 ? 106 GLY D O    1 
ATOM 7569  H H    . GLY D 1 106 ? 155.063 128.370 -13.363 1.00 0.00 ? 106 GLY D H    1 
ATOM 7570  H HA2  . GLY D 1 106 ? 156.887 127.477 -14.441 1.00 0.00 ? 106 GLY D HA2  1 
ATOM 7571  H HA3  . GLY D 1 106 ? 157.868 128.102 -13.118 1.00 0.00 ? 106 GLY D HA3  1 
ATOM 7572  N N    . ALA D 1 107 ? 158.449 125.705 -12.652 1.00 0.00 ? 107 ALA D N    1 
ATOM 7573  C CA   . ALA D 1 107 ? 158.769 124.372 -12.147 1.00 0.00 ? 107 ALA D CA   1 
ATOM 7574  C C    . ALA D 1 107 ? 158.394 124.264 -10.657 1.00 0.00 ? 107 ALA D C    1 
ATOM 7575  O O    . ALA D 1 107 ? 158.354 125.273 -9.953  1.00 0.00 ? 107 ALA D O    1 
ATOM 7576  C CB   . ALA D 1 107 ? 160.276 124.107 -12.340 1.00 0.00 ? 107 ALA D CB   1 
ATOM 7577  H H    . ALA D 1 107 ? 159.177 126.327 -12.859 1.00 0.00 ? 107 ALA D H    1 
ATOM 7578  H HA   . ALA D 1 107 ? 158.208 123.643 -12.713 1.00 0.00 ? 107 ALA D HA   1 
ATOM 7579  H HB1  . ALA D 1 107 ? 160.618 123.370 -11.630 1.00 0.00 ? 107 ALA D HB1  1 
ATOM 7580  H HB2  . ALA D 1 107 ? 160.823 125.027 -12.189 1.00 0.00 ? 107 ALA D HB2  1 
ATOM 7581  H HB3  . ALA D 1 107 ? 160.454 123.749 -13.345 1.00 0.00 ? 107 ALA D HB3  1 
ATOM 7582  N N    . PRO D 1 108 ? 158.122 123.070 -10.166 1.00 0.00 ? 108 PRO D N    1 
ATOM 7583  C CA   . PRO D 1 108 ? 157.748 122.857 -8.728  1.00 0.00 ? 108 PRO D CA   1 
ATOM 7584  C C    . PRO D 1 108 ? 158.944 123.069 -7.789  1.00 0.00 ? 108 PRO D C    1 
ATOM 7585  O O    . PRO D 1 108 ? 160.097 122.957 -8.206  1.00 0.00 ? 108 PRO D O    1 
ATOM 7586  C CB   . PRO D 1 108 ? 157.262 121.396 -8.703  1.00 0.00 ? 108 PRO D CB   1 
ATOM 7587  C CG   . PRO D 1 108 ? 158.016 120.738 -9.811  1.00 0.00 ? 108 PRO D CG   1 
ATOM 7588  C CD   . PRO D 1 108 ? 158.132 121.792 -10.914 1.00 0.00 ? 108 PRO D CD   1 
ATOM 7589  H HA   . PRO D 1 108 ? 156.941 123.513 -8.452  1.00 0.00 ? 108 PRO D HA   1 
ATOM 7590  H HB2  . PRO D 1 108 ? 157.491 120.929 -7.750  1.00 0.00 ? 108 PRO D HB2  1 
ATOM 7591  H HB3  . PRO D 1 108 ? 156.201 121.348 -8.900  1.00 0.00 ? 108 PRO D HB3  1 
ATOM 7592  H HG2  . PRO D 1 108 ? 159.002 120.443 -9.466  1.00 0.00 ? 108 PRO D HG2  1 
ATOM 7593  H HG3  . PRO D 1 108 ? 157.477 119.877 -10.180 1.00 0.00 ? 108 PRO D HG3  1 
ATOM 7594  H HD2  . PRO D 1 108 ? 159.055 121.667 -11.461 1.00 0.00 ? 108 PRO D HD2  1 
ATOM 7595  H HD3  . PRO D 1 108 ? 157.283 121.744 -11.580 1.00 0.00 ? 108 PRO D HD3  1 
ATOM 7596  N N    . GLN D 1 109 ? 158.657 123.387 -6.522  1.00 0.00 ? 109 GLN D N    1 
ATOM 7597  C CA   . GLN D 1 109 ? 159.718 123.624 -5.534  1.00 0.00 ? 109 GLN D CA   1 
ATOM 7598  C C    . GLN D 1 109 ? 159.262 123.204 -4.132  1.00 0.00 ? 109 GLN D C    1 
ATOM 7599  O O    . GLN D 1 109 ? 159.796 122.255 -3.557  1.00 0.00 ? 109 GLN D O    1 
ATOM 7600  C CB   . GLN D 1 109 ? 160.087 125.115 -5.530  1.00 0.00 ? 109 GLN D CB   1 
ATOM 7601  C CG   . GLN D 1 109 ? 161.355 125.353 -4.695  1.00 0.00 ? 109 GLN D CG   1 
ATOM 7602  C CD   . GLN D 1 109 ? 162.560 124.674 -5.341  1.00 0.00 ? 109 GLN D CD   1 
ATOM 7603  O OE1  . GLN D 1 109 ? 162.831 124.884 -6.525  1.00 0.00 ? 109 GLN D OE1  1 
ATOM 7604  N NE2  . GLN D 1 109 ? 163.307 123.875 -4.630  1.00 0.00 ? 109 GLN D NE2  1 
ATOM 7605  H H    . GLN D 1 109 ? 157.719 123.470 -6.248  1.00 0.00 ? 109 GLN D H    1 
ATOM 7606  H HA   . GLN D 1 109 ? 160.591 123.046 -5.801  1.00 0.00 ? 109 GLN D HA   1 
ATOM 7607  H HB2  . GLN D 1 109 ? 160.261 125.441 -6.544  1.00 0.00 ? 109 GLN D HB2  1 
ATOM 7608  H HB3  . GLN D 1 109 ? 159.271 125.681 -5.108  1.00 0.00 ? 109 GLN D HB3  1 
ATOM 7609  H HG2  . GLN D 1 109 ? 161.539 126.415 -4.623  1.00 0.00 ? 109 GLN D HG2  1 
ATOM 7610  H HG3  . GLN D 1 109 ? 161.208 124.950 -3.703  1.00 0.00 ? 109 GLN D HG3  1 
ATOM 7611  H HE21 . GLN D 1 109 ? 163.094 123.712 -3.688  1.00 0.00 ? 109 GLN D HE21 1 
ATOM 7612  H HE22 . GLN D 1 109 ? 164.084 123.438 -5.039  1.00 0.00 ? 109 GLN D HE22 1 
ATOM 7613  N N    . GLU D 1 110 ? 158.280 123.927 -3.582  1.00 0.00 ? 110 GLU D N    1 
ATOM 7614  C CA   . GLU D 1 110 ? 157.765 123.632 -2.233  1.00 0.00 ? 110 GLU D CA   1 
ATOM 7615  C C    . GLU D 1 110 ? 156.513 122.748 -2.298  1.00 0.00 ? 110 GLU D C    1 
ATOM 7616  O O    . GLU D 1 110 ? 155.509 123.032 -1.646  1.00 0.00 ? 110 GLU D O    1 
ATOM 7617  C CB   . GLU D 1 110 ? 157.426 124.954 -1.526  1.00 0.00 ? 110 GLU D CB   1 
ATOM 7618  C CG   . GLU D 1 110 ? 157.334 124.736 -0.012  1.00 0.00 ? 110 GLU D CG   1 
ATOM 7619  C CD   . GLU D 1 110 ? 158.722 124.466 0.559   1.00 0.00 ? 110 GLU D CD   1 
ATOM 7620  O OE1  . GLU D 1 110 ? 159.684 124.650 -0.168  1.00 0.00 ? 110 GLU D OE1  1 
ATOM 7621  O OE2  . GLU D 1 110 ? 158.804 124.081 1.713   1.00 0.00 ? 110 GLU D OE2  1 
ATOM 7622  H H    . GLU D 1 110 ? 157.901 124.677 -4.085  1.00 0.00 ? 110 GLU D H    1 
ATOM 7623  H HA   . GLU D 1 110 ? 158.528 123.117 -1.663  1.00 0.00 ? 110 GLU D HA   1 
ATOM 7624  H HB2  . GLU D 1 110 ? 158.199 125.679 -1.735  1.00 0.00 ? 110 GLU D HB2  1 
ATOM 7625  H HB3  . GLU D 1 110 ? 156.480 125.325 -1.891  1.00 0.00 ? 110 GLU D HB3  1 
ATOM 7626  H HG2  . GLU D 1 110 ? 156.922 125.621 0.453   1.00 0.00 ? 110 GLU D HG2  1 
ATOM 7627  H HG3  . GLU D 1 110 ? 156.692 123.893 0.193   1.00 0.00 ? 110 GLU D HG3  1 
ATOM 7628  N N    . GLY D 1 111 ? 156.582 121.680 -3.089  1.00 0.00 ? 111 GLY D N    1 
ATOM 7629  C CA   . GLY D 1 111 ? 155.447 120.765 -3.233  1.00 0.00 ? 111 GLY D CA   1 
ATOM 7630  C C    . GLY D 1 111 ? 155.160 119.999 -1.937  1.00 0.00 ? 111 GLY D C    1 
ATOM 7631  O O    . GLY D 1 111 ? 154.002 119.800 -1.568  1.00 0.00 ? 111 GLY D O    1 
ATOM 7632  H H    . GLY D 1 111 ? 157.407 121.503 -3.587  1.00 0.00 ? 111 GLY D H    1 
ATOM 7633  H HA2  . GLY D 1 111 ? 154.570 121.333 -3.506  1.00 0.00 ? 111 GLY D HA2  1 
ATOM 7634  H HA3  . GLY D 1 111 ? 155.665 120.056 -4.017  1.00 0.00 ? 111 GLY D HA3  1 
ATOM 7635  N N    . ILE D 1 112 ? 156.220 119.556 -1.263  1.00 0.00 ? 112 ILE D N    1 
ATOM 7636  C CA   . ILE D 1 112 ? 156.074 118.792 -0.021  1.00 0.00 ? 112 ILE D CA   1 
ATOM 7637  C C    . ILE D 1 112 ? 154.962 117.751 -0.156  1.00 0.00 ? 112 ILE D C    1 
ATOM 7638  O O    . ILE D 1 112 ? 153.846 117.951 0.323   1.00 0.00 ? 112 ILE D O    1 
ATOM 7639  C CB   . ILE D 1 112 ? 155.765 119.726 1.153   1.00 0.00 ? 112 ILE D CB   1 
ATOM 7640  C CG1  . ILE D 1 112 ? 156.891 120.753 1.294   1.00 0.00 ? 112 ILE D CG1  1 
ATOM 7641  C CG2  . ILE D 1 112 ? 155.666 118.905 2.445   1.00 0.00 ? 112 ILE D CG2  1 
ATOM 7642  C CD1  . ILE D 1 112 ? 156.468 121.839 2.284   1.00 0.00 ? 112 ILE D CD1  1 
ATOM 7643  H H    . ILE D 1 112 ? 157.117 119.732 -1.613  1.00 0.00 ? 112 ILE D H    1 
ATOM 7644  H HA   . ILE D 1 112 ? 157.004 118.279 0.181   1.00 0.00 ? 112 ILE D HA   1 
ATOM 7645  H HB   . ILE D 1 112 ? 154.828 120.235 0.974   1.00 0.00 ? 112 ILE D HB   1 
ATOM 7646  H HG12 . ILE D 1 112 ? 157.783 120.261 1.658   1.00 0.00 ? 112 ILE D HG12 1 
ATOM 7647  H HG13 . ILE D 1 112 ? 157.094 121.202 0.334   1.00 0.00 ? 112 ILE D HG13 1 
ATOM 7648  H HG21 . ILE D 1 112 ? 156.489 118.207 2.491   1.00 0.00 ? 112 ILE D HG21 1 
ATOM 7649  H HG22 . ILE D 1 112 ? 154.734 118.363 2.459   1.00 0.00 ? 112 ILE D HG22 1 
ATOM 7650  H HG23 . ILE D 1 112 ? 155.709 119.565 3.299   1.00 0.00 ? 112 ILE D HG23 1 
ATOM 7651  H HD11 . ILE D 1 112 ? 156.090 121.376 3.184   1.00 0.00 ? 112 ILE D HD11 1 
ATOM 7652  H HD12 . ILE D 1 112 ? 155.693 122.448 1.840   1.00 0.00 ? 112 ILE D HD12 1 
ATOM 7653  H HD13 . ILE D 1 112 ? 157.317 122.456 2.525   1.00 0.00 ? 112 ILE D HD13 1 
ATOM 7654  N N    . LEU D 1 113 ? 155.280 116.640 -0.814  1.00 0.00 ? 113 LEU D N    1 
ATOM 7655  C CA   . LEU D 1 113 ? 154.307 115.567 -1.012  1.00 0.00 ? 113 LEU D CA   1 
ATOM 7656  C C    . LEU D 1 113 ? 154.225 114.697 0.238   1.00 0.00 ? 113 LEU D C    1 
ATOM 7657  O O    . LEU D 1 113 ? 155.215 114.517 0.946   1.00 0.00 ? 113 LEU D O    1 
ATOM 7658  C CB   . LEU D 1 113 ? 154.719 114.702 -2.219  1.00 0.00 ? 113 LEU D CB   1 
ATOM 7659  C CG   . LEU D 1 113 ? 154.330 115.407 -3.524  1.00 0.00 ? 113 LEU D CG   1 
ATOM 7660  C CD1  . LEU D 1 113 ? 155.101 116.725 -3.648  1.00 0.00 ? 113 LEU D CD1  1 
ATOM 7661  C CD2  . LEU D 1 113 ? 154.673 114.502 -4.712  1.00 0.00 ? 113 LEU D CD2  1 
ATOM 7662  H H    . LEU D 1 113 ? 156.185 116.538 -1.176  1.00 0.00 ? 113 LEU D H    1 
ATOM 7663  H HA   . LEU D 1 113 ? 153.335 115.999 -1.202  1.00 0.00 ? 113 LEU D HA   1 
ATOM 7664  H HB2  . LEU D 1 113 ? 155.787 114.547 -2.200  1.00 0.00 ? 113 LEU D HB2  1 
ATOM 7665  H HB3  . LEU D 1 113 ? 154.217 113.745 -2.171  1.00 0.00 ? 113 LEU D HB3  1 
ATOM 7666  H HG   . LEU D 1 113 ? 153.270 115.611 -3.520  1.00 0.00 ? 113 LEU D HG   1 
ATOM 7667  H HD11 . LEU D 1 113 ? 154.666 117.460 -2.988  1.00 0.00 ? 113 LEU D HD11 1 
ATOM 7668  H HD12 . LEU D 1 113 ? 155.048 117.081 -4.666  1.00 0.00 ? 113 LEU D HD12 1 
ATOM 7669  H HD13 . LEU D 1 113 ? 156.136 116.565 -3.376  1.00 0.00 ? 113 LEU D HD13 1 
ATOM 7670  H HD21 . LEU D 1 113 ? 155.746 114.437 -4.817  1.00 0.00 ? 113 LEU D HD21 1 
ATOM 7671  H HD22 . LEU D 1 113 ? 154.246 114.914 -5.613  1.00 0.00 ? 113 LEU D HD22 1 
ATOM 7672  H HD23 . LEU D 1 113 ? 154.268 113.515 -4.540  1.00 0.00 ? 113 LEU D HD23 1 
ATOM 7673  N N    . GLU D 1 114 ? 153.042 114.158 0.505   1.00 0.00 ? 114 GLU D N    1 
ATOM 7674  C CA   . GLU D 1 114 ? 152.859 113.310 1.674   1.00 0.00 ? 114 GLU D CA   1 
ATOM 7675  C C    . GLU D 1 114 ? 153.674 112.028 1.528   1.00 0.00 ? 114 GLU D C    1 
ATOM 7676  O O    . GLU D 1 114 ? 153.423 111.220 0.633   1.00 0.00 ? 114 GLU D O    1 
ATOM 7677  C CB   . GLU D 1 114 ? 151.379 112.956 1.835   1.00 0.00 ? 114 GLU D CB   1 
ATOM 7678  C CG   . GLU D 1 114 ? 150.591 114.210 2.223   1.00 0.00 ? 114 GLU D CG   1 
ATOM 7679  C CD   . GLU D 1 114 ? 149.096 113.904 2.248   1.00 0.00 ? 114 GLU D CD   1 
ATOM 7680  O OE1  . GLU D 1 114 ? 148.722 112.835 1.795   1.00 0.00 ? 114 GLU D OE1  1 
ATOM 7681  O OE2  . GLU D 1 114 ? 148.347 114.744 2.720   1.00 0.00 ? 114 GLU D OE2  1 
ATOM 7682  H H    . GLU D 1 114 ? 152.285 114.331 -0.092  1.00 0.00 ? 114 GLU D H    1 
ATOM 7683  H HA   . GLU D 1 114 ? 153.190 113.842 2.552   1.00 0.00 ? 114 GLU D HA   1 
ATOM 7684  H HB2  . GLU D 1 114 ? 150.999 112.564 0.902   1.00 0.00 ? 114 GLU D HB2  1 
ATOM 7685  H HB3  . GLU D 1 114 ? 151.270 112.212 2.609   1.00 0.00 ? 114 GLU D HB3  1 
ATOM 7686  H HG2  . GLU D 1 114 ? 150.906 114.541 3.202   1.00 0.00 ? 114 GLU D HG2  1 
ATOM 7687  H HG3  . GLU D 1 114 ? 150.784 114.990 1.503   1.00 0.00 ? 114 GLU D HG3  1 
ATOM 7688  N N    . ASP D 1 115 ? 154.650 111.848 2.415   1.00 0.00 ? 115 ASP D N    1 
ATOM 7689  C CA   . ASP D 1 115 ? 155.499 110.658 2.381   1.00 0.00 ? 115 ASP D CA   1 
ATOM 7690  C C    . ASP D 1 115 ? 154.815 109.492 3.096   1.00 0.00 ? 115 ASP D C    1 
ATOM 7691  O O    . ASP D 1 115 ? 153.693 109.629 3.583   1.00 0.00 ? 115 ASP D O    1 
ATOM 7692  C CB   . ASP D 1 115 ? 156.846 110.965 3.047   1.00 0.00 ? 115 ASP D CB   1 
ATOM 7693  C CG   . ASP D 1 115 ? 156.648 111.238 4.535   1.00 0.00 ? 115 ASP D CG   1 
ATOM 7694  O OD1  . ASP D 1 115 ? 155.518 111.166 4.987   1.00 0.00 ? 115 ASP D OD1  1 
ATOM 7695  O OD2  . ASP D 1 115 ? 157.632 111.517 5.201   1.00 0.00 ? 115 ASP D OD2  1 
ATOM 7696  H H    . ASP D 1 115 ? 154.801 112.526 3.106   1.00 0.00 ? 115 ASP D H    1 
ATOM 7697  H HA   . ASP D 1 115 ? 155.678 110.380 1.351   1.00 0.00 ? 115 ASP D HA   1 
ATOM 7698  H HB2  . ASP D 1 115 ? 157.508 110.122 2.922   1.00 0.00 ? 115 ASP D HB2  1 
ATOM 7699  H HB3  . ASP D 1 115 ? 157.284 111.836 2.581   1.00 0.00 ? 115 ASP D HB3  1 
ATOM 7700  N N    . MET D 1 116 ? 155.490 108.343 3.153   1.00 0.00 ? 116 MET D N    1 
ATOM 7701  C CA   . MET D 1 116 ? 154.918 107.168 3.812   1.00 0.00 ? 116 MET D CA   1 
ATOM 7702  C C    . MET D 1 116 ? 154.868 107.374 5.335   1.00 0.00 ? 116 MET D C    1 
ATOM 7703  O O    . MET D 1 116 ? 155.695 108.100 5.882   1.00 0.00 ? 116 MET D O    1 
ATOM 7704  C CB   . MET D 1 116 ? 155.758 105.925 3.499   1.00 0.00 ? 116 MET D CB   1 
ATOM 7705  C CG   . MET D 1 116 ? 155.574 105.534 2.032   1.00 0.00 ? 116 MET D CG   1 
ATOM 7706  S SD   . MET D 1 116 ? 156.438 103.972 1.707   1.00 0.00 ? 116 MET D SD   1 
ATOM 7707  C CE   . MET D 1 116 ? 158.134 104.591 1.862   1.00 0.00 ? 116 MET D CE   1 
ATOM 7708  H H    . MET D 1 116 ? 156.380 108.285 2.747   1.00 0.00 ? 116 MET D H    1 
ATOM 7709  H HA   . MET D 1 116 ? 153.928 107.019 3.431   1.00 0.00 ? 116 MET D HA   1 
ATOM 7710  H HB2  . MET D 1 116 ? 156.800 106.139 3.686   1.00 0.00 ? 116 MET D HB2  1 
ATOM 7711  H HB3  . MET D 1 116 ? 155.443 105.109 4.128   1.00 0.00 ? 116 MET D HB3  1 
ATOM 7712  H HG2  . MET D 1 116 ? 154.519 105.409 1.825   1.00 0.00 ? 116 MET D HG2  1 
ATOM 7713  H HG3  . MET D 1 116 ? 155.974 106.308 1.397   1.00 0.00 ? 116 MET D HG3  1 
ATOM 7714  H HE1  . MET D 1 116 ? 158.805 103.936 1.320   1.00 0.00 ? 116 MET D HE1  1 
ATOM 7715  H HE2  . MET D 1 116 ? 158.418 104.611 2.900   1.00 0.00 ? 116 MET D HE2  1 
ATOM 7716  H HE3  . MET D 1 116 ? 158.194 105.591 1.456   1.00 0.00 ? 116 MET D HE3  1 
ATOM 7717  N N    . PRO D 1 117 ? 153.931 106.752 6.038   1.00 0.00 ? 117 PRO D N    1 
ATOM 7718  C CA   . PRO D 1 117 ? 153.832 106.892 7.525   1.00 0.00 ? 117 PRO D CA   1 
ATOM 7719  C C    . PRO D 1 117 ? 155.203 106.810 8.223   1.00 0.00 ? 117 PRO D C    1 
ATOM 7720  O O    . PRO D 1 117 ? 155.817 105.746 8.278   1.00 0.00 ? 117 PRO D O    1 
ATOM 7721  C CB   . PRO D 1 117 ? 152.949 105.700 7.934   1.00 0.00 ? 117 PRO D CB   1 
ATOM 7722  C CG   . PRO D 1 117 ? 152.054 105.456 6.755   1.00 0.00 ? 117 PRO D CG   1 
ATOM 7723  C CD   . PRO D 1 117 ? 152.859 105.867 5.504   1.00 0.00 ? 117 PRO D CD   1 
ATOM 7724  H HA   . PRO D 1 117 ? 153.338 107.812 7.783   1.00 0.00 ? 117 PRO D HA   1 
ATOM 7725  H HB2  . PRO D 1 117 ? 153.562 104.823 8.131   1.00 0.00 ? 117 PRO D HB2  1 
ATOM 7726  H HB3  . PRO D 1 117 ? 152.360 105.947 8.807   1.00 0.00 ? 117 PRO D HB3  1 
ATOM 7727  H HG2  . PRO D 1 117 ? 151.783 104.403 6.702   1.00 0.00 ? 117 PRO D HG2  1 
ATOM 7728  H HG3  . PRO D 1 117 ? 151.159 106.063 6.832   1.00 0.00 ? 117 PRO D HG3  1 
ATOM 7729  H HD2  . PRO D 1 117 ? 153.284 104.995 5.021   1.00 0.00 ? 117 PRO D HD2  1 
ATOM 7730  H HD3  . PRO D 1 117 ? 152.227 106.413 4.818   1.00 0.00 ? 117 PRO D HD3  1 
ATOM 7731  N N    . VAL D 1 118 ? 155.658 107.942 8.776   1.00 0.00 ? 118 VAL D N    1 
ATOM 7732  C CA   . VAL D 1 118 ? 156.945 108.002 9.499   1.00 0.00 ? 118 VAL D CA   1 
ATOM 7733  C C    . VAL D 1 118 ? 156.789 108.818 10.784  1.00 0.00 ? 118 VAL D C    1 
ATOM 7734  O O    . VAL D 1 118 ? 156.392 109.983 10.745  1.00 0.00 ? 118 VAL D O    1 
ATOM 7735  C CB   . VAL D 1 118 ? 158.032 108.629 8.602   1.00 0.00 ? 118 VAL D CB   1 
ATOM 7736  C CG1  . VAL D 1 118 ? 159.290 108.935 9.431   1.00 0.00 ? 118 VAL D CG1  1 
ATOM 7737  C CG2  . VAL D 1 118 ? 158.401 107.641 7.486   1.00 0.00 ? 118 VAL D CG2  1 
ATOM 7738  H H    . VAL D 1 118 ? 155.113 108.754 8.712   1.00 0.00 ? 118 VAL D H    1 
ATOM 7739  H HA   . VAL D 1 118 ? 157.253 106.997 9.766   1.00 0.00 ? 118 VAL D HA   1 
ATOM 7740  H HB   . VAL D 1 118 ? 157.655 109.543 8.165   1.00 0.00 ? 118 VAL D HB   1 
ATOM 7741  H HG11 . VAL D 1 118 ? 160.127 109.113 8.771   1.00 0.00 ? 118 VAL D HG11 1 
ATOM 7742  H HG12 . VAL D 1 118 ? 159.510 108.098 10.075  1.00 0.00 ? 118 VAL D HG12 1 
ATOM 7743  H HG13 . VAL D 1 118 ? 159.117 109.815 10.034  1.00 0.00 ? 118 VAL D HG13 1 
ATOM 7744  H HG21 . VAL D 1 118 ? 157.506 107.211 7.073   1.00 0.00 ? 118 VAL D HG21 1 
ATOM 7745  H HG22 . VAL D 1 118 ? 159.021 106.854 7.891   1.00 0.00 ? 118 VAL D HG22 1 
ATOM 7746  H HG23 . VAL D 1 118 ? 158.943 108.161 6.710   1.00 0.00 ? 118 VAL D HG23 1 
ATOM 7747  N N    . ASP D 1 119 ? 157.114 108.199 11.919  1.00 0.00 ? 119 ASP D N    1 
ATOM 7748  C CA   . ASP D 1 119 ? 157.013 108.881 13.209  1.00 0.00 ? 119 ASP D CA   1 
ATOM 7749  C C    . ASP D 1 119 ? 155.719 109.691 13.299  1.00 0.00 ? 119 ASP D C    1 
ATOM 7750  O O    . ASP D 1 119 ? 155.752 110.921 13.338  1.00 0.00 ? 119 ASP D O    1 
ATOM 7751  C CB   . ASP D 1 119 ? 158.211 109.813 13.401  1.00 0.00 ? 119 ASP D CB   1 
ATOM 7752  C CG   . ASP D 1 119 ? 159.509 109.015 13.348  1.00 0.00 ? 119 ASP D CG   1 
ATOM 7753  O OD1  . ASP D 1 119 ? 159.441 107.800 13.430  1.00 0.00 ? 119 ASP D OD1  1 
ATOM 7754  O OD2  . ASP D 1 119 ? 160.556 109.632 13.227  1.00 0.00 ? 119 ASP D OD2  1 
ATOM 7755  H H    . ASP D 1 119 ? 157.429 107.272 11.888  1.00 0.00 ? 119 ASP D H    1 
ATOM 7756  H HA   . ASP D 1 119 ? 157.018 108.142 13.997  1.00 0.00 ? 119 ASP D HA   1 
ATOM 7757  H HB2  . ASP D 1 119 ? 158.215 110.557 12.617  1.00 0.00 ? 119 ASP D HB2  1 
ATOM 7758  H HB3  . ASP D 1 119 ? 158.132 110.304 14.359  1.00 0.00 ? 119 ASP D HB3  1 
ATOM 7759  N N    . PRO D 1 120 ? 154.588 109.031 13.320  1.00 0.00 ? 120 PRO D N    1 
ATOM 7760  C CA   . PRO D 1 120 ? 153.257 109.718 13.391  1.00 0.00 ? 120 PRO D CA   1 
ATOM 7761  C C    . PRO D 1 120 ? 153.177 110.710 14.556  1.00 0.00 ? 120 PRO D C    1 
ATOM 7762  O O    . PRO D 1 120 ? 153.503 110.372 15.694  1.00 0.00 ? 120 PRO D O    1 
ATOM 7763  C CB   . PRO D 1 120 ? 152.269 108.548 13.582  1.00 0.00 ? 120 PRO D CB   1 
ATOM 7764  C CG   . PRO D 1 120 ? 152.960 107.372 12.970  1.00 0.00 ? 120 PRO D CG   1 
ATOM 7765  C CD   . PRO D 1 120 ? 154.441 107.564 13.281  1.00 0.00 ? 120 PRO D CD   1 
ATOM 7766  H HA   . PRO D 1 120 ? 153.048 110.218 12.461  1.00 0.00 ? 120 PRO D HA   1 
ATOM 7767  H HB2  . PRO D 1 120 ? 152.086 108.371 14.638  1.00 0.00 ? 120 PRO D HB2  1 
ATOM 7768  H HB3  . PRO D 1 120 ? 151.341 108.744 13.067  1.00 0.00 ? 120 PRO D HB3  1 
ATOM 7769  H HG2  . PRO D 1 120 ? 152.596 106.450 13.411  1.00 0.00 ? 120 PRO D HG2  1 
ATOM 7770  H HG3  . PRO D 1 120 ? 152.809 107.361 11.901  1.00 0.00 ? 120 PRO D HG3  1 
ATOM 7771  H HD2  . PRO D 1 120 ? 154.686 107.125 14.242  1.00 0.00 ? 120 PRO D HD2  1 
ATOM 7772  H HD3  . PRO D 1 120 ? 155.053 107.143 12.503  1.00 0.00 ? 120 PRO D HD3  1 
ATOM 7773  N N    . ASP D 1 121 ? 152.732 111.935 14.262  1.00 0.00 ? 121 ASP D N    1 
ATOM 7774  C CA   . ASP D 1 121 ? 152.601 112.974 15.292  1.00 0.00 ? 121 ASP D CA   1 
ATOM 7775  C C    . ASP D 1 121 ? 151.172 113.016 15.824  1.00 0.00 ? 121 ASP D C    1 
ATOM 7776  O O    . ASP D 1 121 ? 150.887 113.692 16.814  1.00 0.00 ? 121 ASP D O    1 
ATOM 7777  C CB   . ASP D 1 121 ? 152.968 114.338 14.700  1.00 0.00 ? 121 ASP D CB   1 
ATOM 7778  C CG   . ASP D 1 121 ? 151.996 114.705 13.583  1.00 0.00 ? 121 ASP D CG   1 
ATOM 7779  O OD1  . ASP D 1 121 ? 151.063 113.950 13.364  1.00 0.00 ? 121 ASP D OD1  1 
ATOM 7780  O OD2  . ASP D 1 121 ? 152.201 115.735 12.963  1.00 0.00 ? 121 ASP D OD2  1 
ATOM 7781  H H    . ASP D 1 121 ? 152.481 112.144 13.337  1.00 0.00 ? 121 ASP D H    1 
ATOM 7782  H HA   . ASP D 1 121 ? 153.274 112.759 16.112  1.00 0.00 ? 121 ASP D HA   1 
ATOM 7783  H HB2  . ASP D 1 121 ? 152.923 115.089 15.475  1.00 0.00 ? 121 ASP D HB2  1 
ATOM 7784  H HB3  . ASP D 1 121 ? 153.971 114.295 14.300  1.00 0.00 ? 121 ASP D HB3  1 
ATOM 7785  N N    . ASN D 1 122 ? 150.278 112.280 15.162  1.00 0.00 ? 122 ASN D N    1 
ATOM 7786  C CA   . ASN D 1 122 ? 148.871 112.223 15.572  1.00 0.00 ? 122 ASN D CA   1 
ATOM 7787  C C    . ASN D 1 122 ? 148.636 111.044 16.510  1.00 0.00 ? 122 ASN D C    1 
ATOM 7788  O O    . ASN D 1 122 ? 148.057 110.033 16.113  1.00 0.00 ? 122 ASN D O    1 
ATOM 7789  C CB   . ASN D 1 122 ? 147.979 112.071 14.340  1.00 0.00 ? 122 ASN D CB   1 
ATOM 7790  C CG   . ASN D 1 122 ? 146.514 112.230 14.733  1.00 0.00 ? 122 ASN D CG   1 
ATOM 7791  O OD1  . ASN D 1 122 ? 146.149 113.204 15.392  1.00 0.00 ? 122 ASN D OD1  1 
ATOM 7792  N ND2  . ASN D 1 122 ? 145.649 111.323 14.369  1.00 0.00 ? 122 ASN D ND2  1 
ATOM 7793  H H    . ASN D 1 122 ? 150.570 111.760 14.386  1.00 0.00 ? 122 ASN D H    1 
ATOM 7794  H HA   . ASN D 1 122 ? 148.605 113.138 16.084  1.00 0.00 ? 122 ASN D HA   1 
ATOM 7795  H HB2  . ASN D 1 122 ? 148.240 112.827 13.613  1.00 0.00 ? 122 ASN D HB2  1 
ATOM 7796  H HB3  . ASN D 1 122 ? 148.127 111.092 13.907  1.00 0.00 ? 122 ASN D HB3  1 
ATOM 7797  H HD21 . ASN D 1 122 ? 145.944 110.548 13.847  1.00 0.00 ? 122 ASN D HD21 1 
ATOM 7798  H HD22 . ASN D 1 122 ? 144.707 111.418 14.618  1.00 0.00 ? 122 ASN D HD22 1 
ATOM 7799  N N    . GLU D 1 123 ? 149.088 111.175 17.750  1.00 0.00 ? 123 GLU D N    1 
ATOM 7800  C CA   . GLU D 1 123 ? 148.915 110.104 18.723  1.00 0.00 ? 123 GLU D CA   1 
ATOM 7801  C C    . GLU D 1 123 ? 147.431 109.840 18.968  1.00 0.00 ? 123 GLU D C    1 
ATOM 7802  O O    . GLU D 1 123 ? 146.996 108.690 19.021  1.00 0.00 ? 123 GLU D O    1 
ATOM 7803  C CB   . GLU D 1 123 ? 149.604 110.480 20.039  1.00 0.00 ? 123 GLU D CB   1 
ATOM 7804  C CG   . GLU D 1 123 ? 149.453 109.340 21.049  1.00 0.00 ? 123 GLU D CG   1 
ATOM 7805  C CD   . GLU D 1 123 ? 150.245 109.661 22.313  1.00 0.00 ? 123 GLU D CD   1 
ATOM 7806  O OE1  . GLU D 1 123 ? 150.880 110.702 22.339  1.00 0.00 ? 123 GLU D OE1  1 
ATOM 7807  O OE2  . GLU D 1 123 ? 150.206 108.861 23.233  1.00 0.00 ? 123 GLU D OE2  1 
ATOM 7808  H H    . GLU D 1 123 ? 149.544 112.001 18.015  1.00 0.00 ? 123 GLU D H    1 
ATOM 7809  H HA   . GLU D 1 123 ? 149.370 109.204 18.337  1.00 0.00 ? 123 GLU D HA   1 
ATOM 7810  H HB2  . GLU D 1 123 ? 150.654 110.659 19.855  1.00 0.00 ? 123 GLU D HB2  1 
ATOM 7811  H HB3  . GLU D 1 123 ? 149.151 111.374 20.438  1.00 0.00 ? 123 GLU D HB3  1 
ATOM 7812  H HG2  . GLU D 1 123 ? 148.409 109.220 21.303  1.00 0.00 ? 123 GLU D HG2  1 
ATOM 7813  H HG3  . GLU D 1 123 ? 149.826 108.424 20.618  1.00 0.00 ? 123 GLU D HG3  1 
ATOM 7814  N N    . ALA D 1 124 ? 146.657 110.918 19.113  1.00 0.00 ? 124 ALA D N    1 
ATOM 7815  C CA   . ALA D 1 124 ? 145.213 110.807 19.350  1.00 0.00 ? 124 ALA D CA   1 
ATOM 7816  C C    . ALA D 1 124 ? 144.443 110.884 18.034  1.00 0.00 ? 124 ALA D C    1 
ATOM 7817  O O    . ALA D 1 124 ? 144.883 111.531 17.085  1.00 0.00 ? 124 ALA D O    1 
ATOM 7818  C CB   . ALA D 1 124 ? 144.752 111.934 20.275  1.00 0.00 ? 124 ALA D CB   1 
ATOM 7819  H H    . ALA D 1 124 ? 147.063 111.807 19.058  1.00 0.00 ? 124 ALA D H    1 
ATOM 7820  H HA   . ALA D 1 124 ? 144.997 109.859 19.827  1.00 0.00 ? 124 ALA D HA   1 
ATOM 7821  H HB1  . ALA D 1 124 ? 144.872 112.883 19.773  1.00 0.00 ? 124 ALA D HB1  1 
ATOM 7822  H HB2  . ALA D 1 124 ? 145.348 111.927 21.176  1.00 0.00 ? 124 ALA D HB2  1 
ATOM 7823  H HB3  . ALA D 1 124 ? 143.713 111.791 20.530  1.00 0.00 ? 124 ALA D HB3  1 
ATOM 7824  N N    . TYR D 1 125 ? 143.292 110.217 17.984  1.00 0.00 ? 125 TYR D N    1 
ATOM 7825  C CA   . TYR D 1 125 ? 142.473 110.219 16.776  1.00 0.00 ? 125 TYR D CA   1 
ATOM 7826  C C    . TYR D 1 125 ? 142.062 111.643 16.412  1.00 0.00 ? 125 TYR D C    1 
ATOM 7827  O O    . TYR D 1 125 ? 142.205 112.064 15.263  1.00 0.00 ? 125 TYR D O    1 
ATOM 7828  C CB   . TYR D 1 125 ? 141.226 109.359 16.987  1.00 0.00 ? 125 TYR D CB   1 
ATOM 7829  C CG   . TYR D 1 125 ? 140.349 109.425 15.754  1.00 0.00 ? 125 TYR D CG   1 
ATOM 7830  C CD1  . TYR D 1 125 ? 140.717 108.726 14.599  1.00 0.00 ? 125 TYR D CD1  1 
ATOM 7831  C CD2  . TYR D 1 125 ? 139.171 110.184 15.767  1.00 0.00 ? 125 TYR D CD2  1 
ATOM 7832  C CE1  . TYR D 1 125 ? 139.909 108.784 13.457  1.00 0.00 ? 125 TYR D CE1  1 
ATOM 7833  C CE2  . TYR D 1 125 ? 138.363 110.243 14.625  1.00 0.00 ? 125 TYR D CE2  1 
ATOM 7834  C CZ   . TYR D 1 125 ? 138.733 109.544 13.470  1.00 0.00 ? 125 TYR D CZ   1 
ATOM 7835  O OH   . TYR D 1 125 ? 137.938 109.603 12.344  1.00 0.00 ? 125 TYR D OH   1 
ATOM 7836  H H    . TYR D 1 125 ? 142.990 109.718 18.770  1.00 0.00 ? 125 TYR D H    1 
ATOM 7837  H HA   . TYR D 1 125 ? 143.049 109.803 15.963  1.00 0.00 ? 125 TYR D HA   1 
ATOM 7838  H HB2  . TYR D 1 125 ? 141.522 108.334 17.162  1.00 0.00 ? 125 TYR D HB2  1 
ATOM 7839  H HB3  . TYR D 1 125 ? 140.675 109.724 17.842  1.00 0.00 ? 125 TYR D HB3  1 
ATOM 7840  H HD1  . TYR D 1 125 ? 141.625 108.140 14.587  1.00 0.00 ? 125 TYR D HD1  1 
ATOM 7841  H HD2  . TYR D 1 125 ? 138.886 110.724 16.658  1.00 0.00 ? 125 TYR D HD2  1 
ATOM 7842  H HE1  . TYR D 1 125 ? 140.194 108.245 12.566  1.00 0.00 ? 125 TYR D HE1  1 
ATOM 7843  H HE2  . TYR D 1 125 ? 137.456 110.828 14.634  1.00 0.00 ? 125 TYR D HE2  1 
ATOM 7844  H HH   . TYR D 1 125 ? 138.231 110.346 11.812  1.00 0.00 ? 125 TYR D HH   1 
ATOM 7845  N N    . GLU D 1 126 ? 141.560 112.383 17.395  1.00 0.00 ? 126 GLU D N    1 
ATOM 7846  C CA   . GLU D 1 126 ? 141.140 113.760 17.160  1.00 0.00 ? 126 GLU D CA   1 
ATOM 7847  C C    . GLU D 1 126 ? 142.364 114.660 16.970  1.00 0.00 ? 126 GLU D C    1 
ATOM 7848  O O    . GLU D 1 126 ? 143.386 114.478 17.631  1.00 0.00 ? 126 GLU D O    1 
ATOM 7849  C CB   . GLU D 1 126 ? 140.305 114.265 18.344  1.00 0.00 ? 126 GLU D CB   1 
ATOM 7850  C CG   . GLU D 1 126 ? 139.060 113.387 18.508  1.00 0.00 ? 126 GLU D CG   1 
ATOM 7851  C CD   . GLU D 1 126 ? 138.183 113.925 19.635  1.00 0.00 ? 126 GLU D CD   1 
ATOM 7852  O OE1  . GLU D 1 126 ? 138.723 114.224 20.687  1.00 0.00 ? 126 GLU D OE1  1 
ATOM 7853  O OE2  . GLU D 1 126 ? 136.985 114.028 19.429  1.00 0.00 ? 126 GLU D OE2  1 
ATOM 7854  H H    . GLU D 1 126 ? 141.472 111.998 18.292  1.00 0.00 ? 126 GLU D H    1 
ATOM 7855  H HA   . GLU D 1 126 ? 140.537 113.795 16.266  1.00 0.00 ? 126 GLU D HA   1 
ATOM 7856  H HB2  . GLU D 1 126 ? 140.898 114.220 19.246  1.00 0.00 ? 126 GLU D HB2  1 
ATOM 7857  H HB3  . GLU D 1 126 ? 140.002 115.284 18.162  1.00 0.00 ? 126 GLU D HB3  1 
ATOM 7858  H HG2  . GLU D 1 126 ? 138.497 113.388 17.585  1.00 0.00 ? 126 GLU D HG2  1 
ATOM 7859  H HG3  . GLU D 1 126 ? 139.362 112.377 18.742  1.00 0.00 ? 126 GLU D HG3  1 
ATOM 7860  N N    . MET D 1 127 ? 142.252 115.628 16.062  1.00 0.00 ? 127 MET D N    1 
ATOM 7861  C CA   . MET D 1 127 ? 143.360 116.546 15.795  1.00 0.00 ? 127 MET D CA   1 
ATOM 7862  C C    . MET D 1 127 ? 143.562 117.503 16.980  1.00 0.00 ? 127 MET D C    1 
ATOM 7863  O O    . MET D 1 127 ? 142.603 117.832 17.679  1.00 0.00 ? 127 MET D O    1 
ATOM 7864  C CB   . MET D 1 127 ? 143.071 117.353 14.523  1.00 0.00 ? 127 MET D CB   1 
ATOM 7865  C CG   . MET D 1 127 ? 143.171 116.439 13.301  1.00 0.00 ? 127 MET D CG   1 
ATOM 7866  S SD   . MET D 1 127 ? 142.992 117.425 11.789  1.00 0.00 ? 127 MET D SD   1 
ATOM 7867  C CE   . MET D 1 127 ? 141.246 117.873 11.987  1.00 0.00 ? 127 MET D CE   1 
ATOM 7868  H H    . MET D 1 127 ? 141.415 115.726 15.562  1.00 0.00 ? 127 MET D H    1 
ATOM 7869  H HA   . MET D 1 127 ? 144.254 115.963 15.643  1.00 0.00 ? 127 MET D HA   1 
ATOM 7870  H HB2  . MET D 1 127 ? 142.074 117.766 14.582  1.00 0.00 ? 127 MET D HB2  1 
ATOM 7871  H HB3  . MET D 1 127 ? 143.783 118.153 14.429  1.00 0.00 ? 127 MET D HB3  1 
ATOM 7872  H HG2  . MET D 1 127 ? 144.134 115.951 13.298  1.00 0.00 ? 127 MET D HG2  1 
ATOM 7873  H HG3  . MET D 1 127 ? 142.392 115.693 13.341  1.00 0.00 ? 127 MET D HG3  1 
ATOM 7874  H HE1  . MET D 1 127 ? 140.807 118.044 11.013  1.00 0.00 ? 127 MET D HE1  1 
ATOM 7875  H HE2  . MET D 1 127 ? 141.171 118.773 12.574  1.00 0.00 ? 127 MET D HE2  1 
ATOM 7876  H HE3  . MET D 1 127 ? 140.719 117.074 12.490  1.00 0.00 ? 127 MET D HE3  1 
ATOM 7877  N N    . PRO D 1 128 ? 144.779 117.962 17.224  1.00 0.00 ? 128 PRO D N    1 
ATOM 7878  C CA   . PRO D 1 128 ? 145.070 118.903 18.354  1.00 0.00 ? 128 PRO D CA   1 
ATOM 7879  C C    . PRO D 1 128 ? 144.495 120.300 18.095  1.00 0.00 ? 128 PRO D C    1 
ATOM 7880  O O    . PRO D 1 128 ? 144.360 120.722 16.947  1.00 0.00 ? 128 PRO D O    1 
ATOM 7881  C CB   . PRO D 1 128 ? 146.610 118.927 18.407  1.00 0.00 ? 128 PRO D CB   1 
ATOM 7882  C CG   . PRO D 1 128 ? 147.034 118.636 17.004  1.00 0.00 ? 128 PRO D CG   1 
ATOM 7883  C CD   . PRO D 1 128 ? 146.009 117.639 16.463  1.00 0.00 ? 128 PRO D CD   1 
ATOM 7884  H HA   . PRO D 1 128 ? 144.681 118.508 19.278  1.00 0.00 ? 128 PRO D HA   1 
ATOM 7885  H HB2  . PRO D 1 128 ? 146.971 119.900 18.724  1.00 0.00 ? 128 PRO D HB2  1 
ATOM 7886  H HB3  . PRO D 1 128 ? 146.977 118.156 19.069  1.00 0.00 ? 128 PRO D HB3  1 
ATOM 7887  H HG2  . PRO D 1 128 ? 147.020 119.549 16.415  1.00 0.00 ? 128 PRO D HG2  1 
ATOM 7888  H HG3  . PRO D 1 128 ? 148.020 118.196 16.987  1.00 0.00 ? 128 PRO D HG3  1 
ATOM 7889  H HD2  . PRO D 1 128 ? 145.859 117.786 15.402  1.00 0.00 ? 128 PRO D HD2  1 
ATOM 7890  H HD3  . PRO D 1 128 ? 146.317 116.624 16.668  1.00 0.00 ? 128 PRO D HD3  1 
ATOM 7891  N N    . SER D 1 129 ? 144.161 121.008 19.169  1.00 0.00 ? 129 SER D N    1 
ATOM 7892  C CA   . SER D 1 129 ? 143.604 122.350 19.040  1.00 0.00 ? 129 SER D CA   1 
ATOM 7893  C C    . SER D 1 129 ? 144.634 123.303 18.443  1.00 0.00 ? 129 SER D C    1 
ATOM 7894  O O    . SER D 1 129 ? 145.805 123.286 18.825  1.00 0.00 ? 129 SER D O    1 
ATOM 7895  C CB   . SER D 1 129 ? 143.167 122.868 20.411  1.00 0.00 ? 129 SER D CB   1 
ATOM 7896  O OG   . SER D 1 129 ? 142.697 124.204 20.279  1.00 0.00 ? 129 SER D OG   1 
ATOM 7897  H H    . SER D 1 129 ? 144.289 120.623 20.062  1.00 0.00 ? 129 SER D H    1 
ATOM 7898  H HA   . SER D 1 129 ? 142.743 122.313 18.392  1.00 0.00 ? 129 SER D HA   1 
ATOM 7899  H HB2  . SER D 1 129 ? 142.375 122.250 20.795  1.00 0.00 ? 129 SER D HB2  1 
ATOM 7900  H HB3  . SER D 1 129 ? 144.009 122.836 21.092  1.00 0.00 ? 129 SER D HB3  1 
ATOM 7901  H HG   . SER D 1 129 ? 141.792 124.170 19.964  1.00 0.00 ? 129 SER D HG   1 
ATOM 7902  N N    . GLU D 1 130 ? 144.190 124.137 17.505  1.00 0.00 ? 130 GLU D N    1 
ATOM 7903  C CA   . GLU D 1 130 ? 145.084 125.097 16.865  1.00 0.00 ? 130 GLU D CA   1 
ATOM 7904  C C    . GLU D 1 130 ? 145.600 126.109 17.880  1.00 0.00 ? 130 GLU D C    1 
ATOM 7905  O O    . GLU D 1 130 ? 146.768 126.495 17.848  1.00 0.00 ? 130 GLU D O    1 
ATOM 7906  C CB   . GLU D 1 130 ? 144.347 125.829 15.741  1.00 0.00 ? 130 GLU D CB   1 
ATOM 7907  C CG   . GLU D 1 130 ? 144.089 124.859 14.585  1.00 0.00 ? 130 GLU D CG   1 
ATOM 7908  C CD   . GLU D 1 130 ? 143.217 125.526 13.527  1.00 0.00 ? 130 GLU D CD   1 
ATOM 7909  O OE1  . GLU D 1 130 ? 142.690 126.590 13.806  1.00 0.00 ? 130 GLU D OE1  1 
ATOM 7910  O OE2  . GLU D 1 130 ? 143.089 124.963 12.453  1.00 0.00 ? 130 GLU D OE2  1 
ATOM 7911  H H    . GLU D 1 130 ? 143.246 124.107 17.243  1.00 0.00 ? 130 GLU D H    1 
ATOM 7912  H HA   . GLU D 1 130 ? 145.922 124.566 16.442  1.00 0.00 ? 130 GLU D HA   1 
ATOM 7913  H HB2  . GLU D 1 130 ? 143.404 126.205 16.113  1.00 0.00 ? 130 GLU D HB2  1 
ATOM 7914  H HB3  . GLU D 1 130 ? 144.950 126.652 15.390  1.00 0.00 ? 130 GLU D HB3  1 
ATOM 7915  H HG2  . GLU D 1 130 ? 145.032 124.571 14.143  1.00 0.00 ? 130 GLU D HG2  1 
ATOM 7916  H HG3  . GLU D 1 130 ? 143.587 123.981 14.961  1.00 0.00 ? 130 GLU D HG3  1 
ATOM 7917  N N    . GLU D 1 131 ? 144.723 126.536 18.782  1.00 0.00 ? 131 GLU D N    1 
ATOM 7918  C CA   . GLU D 1 131 ? 145.102 127.504 19.803  1.00 0.00 ? 131 GLU D CA   1 
ATOM 7919  C C    . GLU D 1 131 ? 146.172 126.922 20.719  1.00 0.00 ? 131 GLU D C    1 
ATOM 7920  O O    . GLU D 1 131 ? 146.078 125.773 21.150  1.00 0.00 ? 131 GLU D O    1 
ATOM 7921  C CB   . GLU D 1 131 ? 143.876 127.901 20.631  1.00 0.00 ? 131 GLU D CB   1 
ATOM 7922  C CG   . GLU D 1 131 ? 144.260 129.010 21.615  1.00 0.00 ? 131 GLU D CG   1 
ATOM 7923  C CD   . GLU D 1 131 ? 143.032 129.451 22.406  1.00 0.00 ? 131 GLU D CD   1 
ATOM 7924  O OE1  . GLU D 1 131 ? 141.973 128.891 22.178  1.00 0.00 ? 131 GLU D OE1  1 
ATOM 7925  O OE2  . GLU D 1 131 ? 143.171 130.343 23.227  1.00 0.00 ? 131 GLU D OE2  1 
ATOM 7926  H H    . GLU D 1 131 ? 143.804 126.192 18.760  1.00 0.00 ? 131 GLU D H    1 
ATOM 7927  H HA   . GLU D 1 131 ? 145.496 128.386 19.320  1.00 0.00 ? 131 GLU D HA   1 
ATOM 7928  H HB2  . GLU D 1 131 ? 143.097 128.259 19.972  1.00 0.00 ? 131 GLU D HB2  1 
ATOM 7929  H HB3  . GLU D 1 131 ? 143.518 127.044 21.179  1.00 0.00 ? 131 GLU D HB3  1 
ATOM 7930  H HG2  . GLU D 1 131 ? 145.010 128.641 22.299  1.00 0.00 ? 131 GLU D HG2  1 
ATOM 7931  H HG3  . GLU D 1 131 ? 144.655 129.853 21.070  1.00 0.00 ? 131 GLU D HG3  1 
ATOM 7932  N N    . GLY D 1 132 ? 147.193 127.727 21.013  1.00 0.00 ? 132 GLY D N    1 
ATOM 7933  C CA   . GLY D 1 132 ? 148.290 127.294 21.882  1.00 0.00 ? 132 GLY D CA   1 
ATOM 7934  C C    . GLY D 1 132 ? 148.853 128.474 22.662  1.00 0.00 ? 132 GLY D C    1 
ATOM 7935  O O    . GLY D 1 132 ? 148.604 128.614 23.859  1.00 0.00 ? 132 GLY D O    1 
ATOM 7936  H H    . GLY D 1 132 ? 147.211 128.632 20.638  1.00 0.00 ? 132 GLY D H    1 
ATOM 7937  H HA2  . GLY D 1 132 ? 147.929 126.546 22.579  1.00 0.00 ? 132 GLY D HA2  1 
ATOM 7938  H HA3  . GLY D 1 132 ? 149.074 126.864 21.277  1.00 0.00 ? 132 GLY D HA3  1 
ATOM 7939  N N    . TYR D 1 133 ? 149.615 129.325 21.974  1.00 0.00 ? 133 TYR D N    1 
ATOM 7940  C CA   . TYR D 1 133 ? 150.215 130.502 22.611  1.00 0.00 ? 133 TYR D CA   1 
ATOM 7941  C C    . TYR D 1 133 ? 150.328 131.651 21.612  1.00 0.00 ? 133 TYR D C    1 
ATOM 7942  O O    . TYR D 1 133 ? 151.152 131.614 20.699  1.00 0.00 ? 133 TYR D O    1 
ATOM 7943  C CB   . TYR D 1 133 ? 151.606 130.147 23.139  1.00 0.00 ? 133 TYR D CB   1 
ATOM 7944  C CG   . TYR D 1 133 ? 152.215 131.350 23.820  1.00 0.00 ? 133 TYR D CG   1 
ATOM 7945  C CD1  . TYR D 1 133 ? 151.834 131.680 25.125  1.00 0.00 ? 133 TYR D CD1  1 
ATOM 7946  C CD2  . TYR D 1 133 ? 153.162 132.133 23.148  1.00 0.00 ? 133 TYR D CD2  1 
ATOM 7947  C CE1  . TYR D 1 133 ? 152.398 132.792 25.761  1.00 0.00 ? 133 TYR D CE1  1 
ATOM 7948  C CE2  . TYR D 1 133 ? 153.727 133.246 23.784  1.00 0.00 ? 133 TYR D CE2  1 
ATOM 7949  C CZ   . TYR D 1 133 ? 153.345 133.575 25.089  1.00 0.00 ? 133 TYR D CZ   1 
ATOM 7950  O OH   . TYR D 1 133 ? 153.902 134.672 25.716  1.00 0.00 ? 133 TYR D OH   1 
ATOM 7951  H H    . TYR D 1 133 ? 149.777 129.161 21.021  1.00 0.00 ? 133 TYR D H    1 
ATOM 7952  H HA   . TYR D 1 133 ? 149.596 130.820 23.440  1.00 0.00 ? 133 TYR D HA   1 
ATOM 7953  H HB2  . TYR D 1 133 ? 151.525 129.335 23.847  1.00 0.00 ? 133 TYR D HB2  1 
ATOM 7954  H HB3  . TYR D 1 133 ? 152.236 129.842 22.315  1.00 0.00 ? 133 TYR D HB3  1 
ATOM 7955  H HD1  . TYR D 1 133 ? 151.102 131.076 25.643  1.00 0.00 ? 133 TYR D HD1  1 
ATOM 7956  H HD2  . TYR D 1 133 ? 153.457 131.879 22.141  1.00 0.00 ? 133 TYR D HD2  1 
ATOM 7957  H HE1  . TYR D 1 133 ? 152.104 133.046 26.768  1.00 0.00 ? 133 TYR D HE1  1 
ATOM 7958  H HE2  . TYR D 1 133 ? 154.458 133.850 23.266  1.00 0.00 ? 133 TYR D HE2  1 
ATOM 7959  H HH   . TYR D 1 133 ? 153.836 135.420 25.119  1.00 0.00 ? 133 TYR D HH   1 
ATOM 7960  N N    . GLN D 1 134 ? 149.498 132.676 21.796  1.00 0.00 ? 134 GLN D N    1 
ATOM 7961  C CA   . GLN D 1 134 ? 149.521 133.832 20.906  1.00 0.00 ? 134 GLN D CA   1 
ATOM 7962  C C    . GLN D 1 134 ? 148.792 135.012 21.543  1.00 0.00 ? 134 GLN D C    1 
ATOM 7963  O O    . GLN D 1 134 ? 147.800 134.831 22.250  1.00 0.00 ? 134 GLN D O    1 
ATOM 7964  C CB   . GLN D 1 134 ? 148.862 133.477 19.571  1.00 0.00 ? 134 GLN D CB   1 
ATOM 7965  C CG   . GLN D 1 134 ? 147.408 133.066 19.808  1.00 0.00 ? 134 GLN D CG   1 
ATOM 7966  C CD   . GLN D 1 134 ? 146.783 132.580 18.505  1.00 0.00 ? 134 GLN D CD   1 
ATOM 7967  O OE1  . GLN D 1 134 ? 147.497 132.288 17.545  1.00 0.00 ? 134 GLN D OE1  1 
ATOM 7968  N NE2  . GLN D 1 134 ? 145.486 132.474 18.413  1.00 0.00 ? 134 GLN D NE2  1 
ATOM 7969  H H    . GLN D 1 134 ? 148.864 132.654 22.542  1.00 0.00 ? 134 GLN D H    1 
ATOM 7970  H HA   . GLN D 1 134 ? 150.548 134.113 20.724  1.00 0.00 ? 134 GLN D HA   1 
ATOM 7971  H HB2  . GLN D 1 134 ? 148.893 134.334 18.914  1.00 0.00 ? 134 GLN D HB2  1 
ATOM 7972  H HB3  . GLN D 1 134 ? 149.395 132.655 19.115  1.00 0.00 ? 134 GLN D HB3  1 
ATOM 7973  H HG2  . GLN D 1 134 ? 147.374 132.273 20.541  1.00 0.00 ? 134 GLN D HG2  1 
ATOM 7974  H HG3  . GLN D 1 134 ? 146.851 133.917 20.175  1.00 0.00 ? 134 GLN D HG3  1 
ATOM 7975  H HE21 . GLN D 1 134 ? 144.920 132.706 19.179  1.00 0.00 ? 134 GLN D HE21 1 
ATOM 7976  H HE22 . GLN D 1 134 ? 145.078 132.161 17.579  1.00 0.00 ? 134 GLN D HE22 1 
ATOM 7977  N N    . ASP D 1 135 ? 149.285 136.221 21.289  1.00 0.00 ? 135 ASP D N    1 
ATOM 7978  C CA   . ASP D 1 135 ? 148.663 137.419 21.846  1.00 0.00 ? 135 ASP D CA   1 
ATOM 7979  C C    . ASP D 1 135 ? 149.265 138.680 21.236  1.00 0.00 ? 135 ASP D C    1 
ATOM 7980  O O    . ASP D 1 135 ? 149.225 139.752 21.839  1.00 0.00 ? 135 ASP D O    1 
ATOM 7981  C CB   . ASP D 1 135 ? 148.847 137.448 23.362  1.00 0.00 ? 135 ASP D CB   1 
ATOM 7982  C CG   . ASP D 1 135 ? 150.326 137.583 23.706  1.00 0.00 ? 135 ASP D CG   1 
ATOM 7983  O OD1  . ASP D 1 135 ? 151.123 137.664 22.785  1.00 0.00 ? 135 ASP D OD1  1 
ATOM 7984  O OD2  . ASP D 1 135 ? 150.640 137.604 24.883  1.00 0.00 ? 135 ASP D OD2  1 
ATOM 7985  H H    . ASP D 1 135 ? 150.076 136.310 20.717  1.00 0.00 ? 135 ASP D H    1 
ATOM 7986  H HA   . ASP D 1 135 ? 147.607 137.397 21.626  1.00 0.00 ? 135 ASP D HA   1 
ATOM 7987  H HB2  . ASP D 1 135 ? 148.305 138.288 23.771  1.00 0.00 ? 135 ASP D HB2  1 
ATOM 7988  H HB3  . ASP D 1 135 ? 148.464 136.533 23.786  1.00 0.00 ? 135 ASP D HB3  1 
ATOM 7989  N N    . TYR D 1 136 ? 149.827 138.544 20.033  1.00 0.00 ? 136 TYR D N    1 
ATOM 7990  C CA   . TYR D 1 136 ? 150.447 139.680 19.332  1.00 0.00 ? 136 TYR D CA   1 
ATOM 7991  C C    . TYR D 1 136 ? 149.981 139.726 17.878  1.00 0.00 ? 136 TYR D C    1 
ATOM 7992  O O    . TYR D 1 136 ? 150.567 140.424 17.051  1.00 0.00 ? 136 TYR D O    1 
ATOM 7993  C CB   . TYR D 1 136 ? 151.975 139.552 19.381  1.00 0.00 ? 136 TYR D CB   1 
ATOM 7994  C CG   . TYR D 1 136 ? 152.397 138.198 18.859  1.00 0.00 ? 136 TYR D CG   1 
ATOM 7995  C CD1  . TYR D 1 136 ? 152.647 138.022 17.492  1.00 0.00 ? 136 TYR D CD1  1 
ATOM 7996  C CD2  . TYR D 1 136 ? 152.543 137.120 19.741  1.00 0.00 ? 136 TYR D CD2  1 
ATOM 7997  C CE1  . TYR D 1 136 ? 153.042 136.768 17.008  1.00 0.00 ? 136 TYR D CE1  1 
ATOM 7998  C CE2  . TYR D 1 136 ? 152.937 135.866 19.257  1.00 0.00 ? 136 TYR D CE2  1 
ATOM 7999  C CZ   . TYR D 1 136 ? 153.187 135.689 17.891  1.00 0.00 ? 136 TYR D CZ   1 
ATOM 8000  O OH   . TYR D 1 136 ? 153.576 134.453 17.414  1.00 0.00 ? 136 TYR D OH   1 
ATOM 8001  H H    . TYR D 1 136 ? 149.829 137.663 19.606  1.00 0.00 ? 136 TYR D H    1 
ATOM 8002  H HA   . TYR D 1 136 ? 150.161 140.607 19.814  1.00 0.00 ? 136 TYR D HA   1 
ATOM 8003  H HB2  . TYR D 1 136 ? 152.420 140.325 18.771  1.00 0.00 ? 136 TYR D HB2  1 
ATOM 8004  H HB3  . TYR D 1 136 ? 152.313 139.664 20.401  1.00 0.00 ? 136 TYR D HB3  1 
ATOM 8005  H HD1  . TYR D 1 136 ? 152.535 138.852 16.812  1.00 0.00 ? 136 TYR D HD1  1 
ATOM 8006  H HD2  . TYR D 1 136 ? 152.350 137.256 20.796  1.00 0.00 ? 136 TYR D HD2  1 
ATOM 8007  H HE1  . TYR D 1 136 ? 153.235 136.632 15.954  1.00 0.00 ? 136 TYR D HE1  1 
ATOM 8008  H HE2  . TYR D 1 136 ? 153.049 135.035 19.938  1.00 0.00 ? 136 TYR D HE2  1 
ATOM 8009  H HH   . TYR D 1 136 ? 154.312 134.585 16.812  1.00 0.00 ? 136 TYR D HH   1 
ATOM 8010  N N    . GLU D 1 137 ? 148.925 138.972 17.571  1.00 0.00 ? 137 GLU D N    1 
ATOM 8011  C CA   . GLU D 1 137 ? 148.392 138.935 16.209  1.00 0.00 ? 137 GLU D CA   1 
ATOM 8012  C C    . GLU D 1 137 ? 147.545 140.186 15.901  1.00 0.00 ? 137 GLU D C    1 
ATOM 8013  O O    . GLU D 1 137 ? 147.593 140.707 14.788  1.00 0.00 ? 137 GLU D O    1 
ATOM 8014  C CB   . GLU D 1 137 ? 147.544 137.654 15.987  1.00 0.00 ? 137 GLU D CB   1 
ATOM 8015  C CG   . GLU D 1 137 ? 148.090 136.518 16.854  1.00 0.00 ? 137 GLU D CG   1 
ATOM 8016  C CD   . GLU D 1 137 ? 147.314 135.237 16.574  1.00 0.00 ? 137 GLU D CD   1 
ATOM 8017  O OE1  . GLU D 1 137 ? 146.102 135.256 16.726  1.00 0.00 ? 137 GLU D OE1  1 
ATOM 8018  O OE2  . GLU D 1 137 ? 147.940 134.256 16.209  1.00 0.00 ? 137 GLU D OE2  1 
ATOM 8019  H H    . GLU D 1 137 ? 148.499 138.436 18.270  1.00 0.00 ? 137 GLU D H    1 
ATOM 8020  H HA   . GLU D 1 137 ? 149.226 138.914 15.520  1.00 0.00 ? 137 GLU D HA   1 
ATOM 8021  H HB2  . GLU D 1 137 ? 146.514 137.839 16.247  1.00 0.00 ? 137 GLU D HB2  1 
ATOM 8022  H HB3  . GLU D 1 137 ? 147.599 137.360 14.947  1.00 0.00 ? 137 GLU D HB3  1 
ATOM 8023  H HG2  . GLU D 1 137 ? 149.135 136.362 16.630  1.00 0.00 ? 137 GLU D HG2  1 
ATOM 8024  H HG3  . GLU D 1 137 ? 147.979 136.776 17.895  1.00 0.00 ? 137 GLU D HG3  1 
ATOM 8025  N N    . PRO D 1 138 ? 146.765 140.666 16.853  1.00 0.00 ? 138 PRO D N    1 
ATOM 8026  C CA   . PRO D 1 138 ? 145.897 141.860 16.649  1.00 0.00 ? 138 PRO D CA   1 
ATOM 8027  C C    . PRO D 1 138 ? 146.624 143.174 16.959  1.00 0.00 ? 138 PRO D C    1 
ATOM 8028  O O    . PRO D 1 138 ? 146.891 143.972 16.060  1.00 0.00 ? 138 PRO D O    1 
ATOM 8029  C CB   . PRO D 1 138 ? 144.733 141.607 17.621  1.00 0.00 ? 138 PRO D CB   1 
ATOM 8030  C CG   . PRO D 1 138 ? 145.333 140.812 18.765  1.00 0.00 ? 138 PRO D CG   1 
ATOM 8031  C CD   . PRO D 1 138 ? 146.625 140.136 18.223  1.00 0.00 ? 138 PRO D CD   1 
ATOM 8032  H HA   . PRO D 1 138 ? 145.522 141.878 15.637  1.00 0.00 ? 138 PRO D HA   1 
ATOM 8033  H HB2  . PRO D 1 138 ? 144.324 142.550 17.977  1.00 0.00 ? 138 PRO D HB2  1 
ATOM 8034  H HB3  . PRO D 1 138 ? 143.958 141.028 17.133  1.00 0.00 ? 138 PRO D HB3  1 
ATOM 8035  H HG2  . PRO D 1 138 ? 145.576 141.477 19.593  1.00 0.00 ? 138 PRO D HG2  1 
ATOM 8036  H HG3  . PRO D 1 138 ? 144.635 140.052 19.104  1.00 0.00 ? 138 PRO D HG3  1 
ATOM 8037  H HD2  . PRO D 1 138 ? 147.481 140.416 18.826  1.00 0.00 ? 138 PRO D HD2  1 
ATOM 8038  H HD3  . PRO D 1 138 ? 146.517 139.064 18.201  1.00 0.00 ? 138 PRO D HD3  1 
ATOM 8039  N N    . GLU D 1 139 ? 146.936 143.395 18.231  1.00 0.00 ? 139 GLU D N    1 
ATOM 8040  C CA   . GLU D 1 139 ? 147.626 144.617 18.634  1.00 0.00 ? 139 GLU D CA   1 
ATOM 8041  C C    . GLU D 1 139 ? 146.935 145.837 18.037  1.00 0.00 ? 139 GLU D C    1 
ATOM 8042  O O    . GLU D 1 139 ? 147.575 146.852 17.761  1.00 0.00 ? 139 GLU D O    1 
ATOM 8043  C CB   . GLU D 1 139 ? 149.082 144.577 18.165  1.00 0.00 ? 139 GLU D CB   1 
ATOM 8044  C CG   . GLU D 1 139 ? 149.823 143.453 18.889  1.00 0.00 ? 139 GLU D CG   1 
ATOM 8045  C CD   . GLU D 1 139 ? 151.270 143.396 18.414  1.00 0.00 ? 139 GLU D CD   1 
ATOM 8046  O OE1  . GLU D 1 139 ? 151.595 144.111 17.481  1.00 0.00 ? 139 GLU D OE1  1 
ATOM 8047  O OE2  . GLU D 1 139 ? 152.032 142.638 18.990  1.00 0.00 ? 139 GLU D OE2  1 
ATOM 8048  H H    . GLU D 1 139 ? 146.697 142.728 18.911  1.00 0.00 ? 139 GLU D H    1 
ATOM 8049  H HA   . GLU D 1 139 ? 147.607 144.694 19.710  1.00 0.00 ? 139 GLU D HA   1 
ATOM 8050  H HB2  . GLU D 1 139 ? 149.112 144.400 17.098  1.00 0.00 ? 139 GLU D HB2  1 
ATOM 8051  H HB3  . GLU D 1 139 ? 149.558 145.520 18.387  1.00 0.00 ? 139 GLU D HB3  1 
ATOM 8052  H HG2  . GLU D 1 139 ? 149.801 143.637 19.953  1.00 0.00 ? 139 GLU D HG2  1 
ATOM 8053  H HG3  . GLU D 1 139 ? 149.340 142.511 18.677  1.00 0.00 ? 139 GLU D HG3  1 
ATOM 8054  N N    . ALA D 1 140 ? 145.625 145.729 17.840  1.00 0.00 ? 140 ALA D N    1 
ATOM 8055  C CA   . ALA D 1 140 ? 144.851 146.829 17.273  1.00 0.00 ? 140 ALA D CA   1 
ATOM 8056  C C    . ALA D 1 140 ? 145.571 147.428 16.067  1.00 0.00 ? 140 ALA D C    1 
ATOM 8057  O O    . ALA D 1 140 ? 145.278 148.563 15.731  1.00 0.00 ? 140 ALA D O    1 
ATOM 8058  C CB   . ALA D 1 140 ? 144.630 147.913 18.328  1.00 0.00 ? 140 ALA D CB   1 
ATOM 8059  O OXT  . ALA D 1 140 ? 146.405 146.742 15.499  1.00 0.00 ? 140 ALA D OXT  1 
ATOM 8060  H H    . ALA D 1 140 ? 145.171 144.895 18.079  1.00 0.00 ? 140 ALA D H    1 
ATOM 8061  H HA   . ALA D 1 140 ? 143.891 146.452 16.955  1.00 0.00 ? 140 ALA D HA   1 
ATOM 8062  H HB1  . ALA D 1 140 ? 144.262 147.460 19.237  1.00 0.00 ? 140 ALA D HB1  1 
ATOM 8063  H HB2  . ALA D 1 140 ? 143.907 148.627 17.964  1.00 0.00 ? 140 ALA D HB2  1 
ATOM 8064  H HB3  . ALA D 1 140 ? 145.564 148.416 18.529  1.00 0.00 ? 140 ALA D HB3  1 
ATOM 8065  N N    . MET E 1 1   ? 35.178  119.591 44.182  1.00 0.00 ? 1   MET E N    1 
ATOM 8066  C CA   . MET E 1 1   ? 35.203  118.492 43.174  1.00 0.00 ? 1   MET E CA   1 
ATOM 8067  C C    . MET E 1 1   ? 35.356  119.090 41.780  1.00 0.00 ? 1   MET E C    1 
ATOM 8068  O O    . MET E 1 1   ? 34.436  119.719 41.260  1.00 0.00 ? 1   MET E O    1 
ATOM 8069  C CB   . MET E 1 1   ? 33.898  117.697 43.258  1.00 0.00 ? 1   MET E CB   1 
ATOM 8070  C CG   . MET E 1 1   ? 33.593  117.367 44.719  1.00 0.00 ? 1   MET E CG   1 
ATOM 8071  S SD   . MET E 1 1   ? 34.979  116.447 45.437  1.00 0.00 ? 1   MET E SD   1 
ATOM 8072  C CE   . MET E 1 1   ? 34.837  114.960 44.413  1.00 0.00 ? 1   MET E CE   1 
ATOM 8073  H H1   . MET E 1 1   ? 35.592  119.253 45.073  1.00 0.00 ? 1   MET E H1   1 
ATOM 8074  H H2   . MET E 1 1   ? 34.194  119.889 44.346  1.00 0.00 ? 1   MET E H2   1 
ATOM 8075  H H3   . MET E 1 1   ? 35.732  120.397 43.830  1.00 0.00 ? 1   MET E H3   1 
ATOM 8076  H HA   . MET E 1 1   ? 36.037  117.837 43.377  1.00 0.00 ? 1   MET E HA   1 
ATOM 8077  H HB2  . MET E 1 1   ? 33.092  118.285 42.844  1.00 0.00 ? 1   MET E HB2  1 
ATOM 8078  H HB3  . MET E 1 1   ? 34.000  116.780 42.697  1.00 0.00 ? 1   MET E HB3  1 
ATOM 8079  H HG2  . MET E 1 1   ? 33.448  118.285 45.270  1.00 0.00 ? 1   MET E HG2  1 
ATOM 8080  H HG3  . MET E 1 1   ? 32.694  116.770 44.774  1.00 0.00 ? 1   MET E HG3  1 
ATOM 8081  H HE1  . MET E 1 1   ? 35.167  114.100 44.982  1.00 0.00 ? 1   MET E HE1  1 
ATOM 8082  H HE2  . MET E 1 1   ? 35.454  115.064 43.537  1.00 0.00 ? 1   MET E HE2  1 
ATOM 8083  H HE3  . MET E 1 1   ? 33.807  114.825 44.112  1.00 0.00 ? 1   MET E HE3  1 
ATOM 8084  N N    . ASP E 1 2   ? 36.525  118.886 41.177  1.00 0.00 ? 2   ASP E N    1 
ATOM 8085  C CA   . ASP E 1 2   ? 36.787  119.409 39.839  1.00 0.00 ? 2   ASP E CA   1 
ATOM 8086  C C    . ASP E 1 2   ? 36.197  118.482 38.782  1.00 0.00 ? 2   ASP E C    1 
ATOM 8087  O O    . ASP E 1 2   ? 36.701  117.381 38.555  1.00 0.00 ? 2   ASP E O    1 
ATOM 8088  C CB   . ASP E 1 2   ? 38.295  119.545 39.620  1.00 0.00 ? 2   ASP E CB   1 
ATOM 8089  C CG   . ASP E 1 2   ? 38.572  120.148 38.246  1.00 0.00 ? 2   ASP E CG   1 
ATOM 8090  O OD1  . ASP E 1 2   ? 37.631  120.304 37.488  1.00 0.00 ? 2   ASP E OD1  1 
ATOM 8091  O OD2  . ASP E 1 2   ? 39.724  120.444 37.973  1.00 0.00 ? 2   ASP E OD2  1 
ATOM 8092  H H    . ASP E 1 2   ? 37.222  118.374 41.638  1.00 0.00 ? 2   ASP E H    1 
ATOM 8093  H HA   . ASP E 1 2   ? 36.332  120.384 39.743  1.00 0.00 ? 2   ASP E HA   1 
ATOM 8094  H HB2  . ASP E 1 2   ? 38.711  120.187 40.383  1.00 0.00 ? 2   ASP E HB2  1 
ATOM 8095  H HB3  . ASP E 1 2   ? 38.756  118.571 39.681  1.00 0.00 ? 2   ASP E HB3  1 
ATOM 8096  N N    . VAL E 1 3   ? 35.121  118.931 38.144  1.00 0.00 ? 3   VAL E N    1 
ATOM 8097  C CA   . VAL E 1 3   ? 34.464  118.131 37.117  1.00 0.00 ? 3   VAL E CA   1 
ATOM 8098  C C    . VAL E 1 3   ? 35.423  117.858 35.960  1.00 0.00 ? 3   VAL E C    1 
ATOM 8099  O O    . VAL E 1 3   ? 35.521  116.729 35.478  1.00 0.00 ? 3   VAL E O    1 
ATOM 8100  C CB   . VAL E 1 3   ? 33.219  118.870 36.602  1.00 0.00 ? 3   VAL E CB   1 
ATOM 8101  C CG1  . VAL E 1 3   ? 32.635  118.136 35.388  1.00 0.00 ? 3   VAL E CG1  1 
ATOM 8102  C CG2  . VAL E 1 3   ? 32.168  118.928 37.714  1.00 0.00 ? 3   VAL E CG2  1 
ATOM 8103  H H    . VAL E 1 3   ? 34.762  119.814 38.369  1.00 0.00 ? 3   VAL E H    1 
ATOM 8104  H HA   . VAL E 1 3   ? 34.157  117.191 37.549  1.00 0.00 ? 3   VAL E HA   1 
ATOM 8105  H HB   . VAL E 1 3   ? 33.494  119.874 36.314  1.00 0.00 ? 3   VAL E HB   1 
ATOM 8106  H HG11 . VAL E 1 3   ? 33.261  118.313 34.526  1.00 0.00 ? 3   VAL E HG11 1 
ATOM 8107  H HG12 . VAL E 1 3   ? 31.638  118.503 35.191  1.00 0.00 ? 3   VAL E HG12 1 
ATOM 8108  H HG13 . VAL E 1 3   ? 32.595  117.077 35.592  1.00 0.00 ? 3   VAL E HG13 1 
ATOM 8109  H HG21 . VAL E 1 3   ? 32.516  119.575 38.505  1.00 0.00 ? 3   VAL E HG21 1 
ATOM 8110  H HG22 . VAL E 1 3   ? 32.003  117.935 38.108  1.00 0.00 ? 3   VAL E HG22 1 
ATOM 8111  H HG23 . VAL E 1 3   ? 31.242  119.314 37.314  1.00 0.00 ? 3   VAL E HG23 1 
ATOM 8112  N N    . PHE E 1 4   ? 36.129  118.901 35.516  1.00 0.00 ? 4   PHE E N    1 
ATOM 8113  C CA   . PHE E 1 4   ? 37.085  118.772 34.405  1.00 0.00 ? 4   PHE E CA   1 
ATOM 8114  C C    . PHE E 1 4   ? 38.520  118.794 34.926  1.00 0.00 ? 4   PHE E C    1 
ATOM 8115  O O    . PHE E 1 4   ? 38.996  119.814 35.424  1.00 0.00 ? 4   PHE E O    1 
ATOM 8116  C CB   . PHE E 1 4   ? 36.885  119.927 33.422  1.00 0.00 ? 4   PHE E CB   1 
ATOM 8117  C CG   . PHE E 1 4   ? 35.502  119.839 32.824  1.00 0.00 ? 4   PHE E CG   1 
ATOM 8118  C CD1  . PHE E 1 4   ? 35.286  119.078 31.669  1.00 0.00 ? 4   PHE E CD1  1 
ATOM 8119  C CD2  . PHE E 1 4   ? 34.436  120.518 33.425  1.00 0.00 ? 4   PHE E CD2  1 
ATOM 8120  C CE1  . PHE E 1 4   ? 34.002  118.996 31.115  1.00 0.00 ? 4   PHE E CE1  1 
ATOM 8121  C CE2  . PHE E 1 4   ? 33.152  120.435 32.872  1.00 0.00 ? 4   PHE E CE2  1 
ATOM 8122  C CZ   . PHE E 1 4   ? 32.936  119.674 31.717  1.00 0.00 ? 4   PHE E CZ   1 
ATOM 8123  H H    . PHE E 1 4   ? 36.007  119.775 35.940  1.00 0.00 ? 4   PHE E H    1 
ATOM 8124  H HA   . PHE E 1 4   ? 36.918  117.838 33.881  1.00 0.00 ? 4   PHE E HA   1 
ATOM 8125  H HB2  . PHE E 1 4   ? 36.995  120.866 33.943  1.00 0.00 ? 4   PHE E HB2  1 
ATOM 8126  H HB3  . PHE E 1 4   ? 37.622  119.862 32.636  1.00 0.00 ? 4   PHE E HB3  1 
ATOM 8127  H HD1  . PHE E 1 4   ? 36.108  118.555 31.205  1.00 0.00 ? 4   PHE E HD1  1 
ATOM 8128  H HD2  . PHE E 1 4   ? 34.603  121.104 34.316  1.00 0.00 ? 4   PHE E HD2  1 
ATOM 8129  H HE1  . PHE E 1 4   ? 33.835  118.409 30.224  1.00 0.00 ? 4   PHE E HE1  1 
ATOM 8130  H HE2  . PHE E 1 4   ? 32.330  120.958 33.336  1.00 0.00 ? 4   PHE E HE2  1 
ATOM 8131  H HZ   . PHE E 1 4   ? 31.946  119.610 31.290  1.00 0.00 ? 4   PHE E HZ   1 
ATOM 8132  N N    . MET E 1 5   ? 39.204  117.662 34.797  1.00 0.00 ? 5   MET E N    1 
ATOM 8133  C CA   . MET E 1 5   ? 40.586  117.553 35.248  1.00 0.00 ? 5   MET E CA   1 
ATOM 8134  C C    . MET E 1 5   ? 41.492  118.446 34.407  1.00 0.00 ? 5   MET E C    1 
ATOM 8135  O O    . MET E 1 5   ? 42.470  119.004 34.904  1.00 0.00 ? 5   MET E O    1 
ATOM 8136  C CB   . MET E 1 5   ? 41.061  116.101 35.148  1.00 0.00 ? 5   MET E CB   1 
ATOM 8137  C CG   . MET E 1 5   ? 40.338  115.257 36.200  1.00 0.00 ? 5   MET E CG   1 
ATOM 8138  S SD   . MET E 1 5   ? 40.871  113.532 36.062  1.00 0.00 ? 5   MET E SD   1 
ATOM 8139  C CE   . MET E 1 5   ? 39.978  112.904 37.506  1.00 0.00 ? 5   MET E CE   1 
ATOM 8140  H H    . MET E 1 5   ? 38.770  116.884 34.386  1.00 0.00 ? 5   MET E H    1 
ATOM 8141  H HA   . MET E 1 5   ? 40.644  117.868 36.279  1.00 0.00 ? 5   MET E HA   1 
ATOM 8142  H HB2  . MET E 1 5   ? 40.841  115.717 34.162  1.00 0.00 ? 5   MET E HB2  1 
ATOM 8143  H HB3  . MET E 1 5   ? 42.125  116.057 35.324  1.00 0.00 ? 5   MET E HB3  1 
ATOM 8144  H HG2  . MET E 1 5   ? 40.575  115.629 37.185  1.00 0.00 ? 5   MET E HG2  1 
ATOM 8145  H HG3  . MET E 1 5   ? 39.272  115.318 36.039  1.00 0.00 ? 5   MET E HG3  1 
ATOM 8146  H HE1  . MET E 1 5   ? 39.968  111.823 37.480  1.00 0.00 ? 5   MET E HE1  1 
ATOM 8147  H HE2  . MET E 1 5   ? 38.964  113.271 37.490  1.00 0.00 ? 5   MET E HE2  1 
ATOM 8148  H HE3  . MET E 1 5   ? 40.468  113.245 38.408  1.00 0.00 ? 5   MET E HE3  1 
ATOM 8149  N N    . LYS E 1 6   ? 41.161  118.566 33.126  1.00 0.00 ? 6   LYS E N    1 
ATOM 8150  C CA   . LYS E 1 6   ? 41.950  119.380 32.210  1.00 0.00 ? 6   LYS E CA   1 
ATOM 8151  C C    . LYS E 1 6   ? 41.975  120.834 32.674  1.00 0.00 ? 6   LYS E C    1 
ATOM 8152  O O    . LYS E 1 6   ? 42.915  121.572 32.381  1.00 0.00 ? 6   LYS E O    1 
ATOM 8153  C CB   . LYS E 1 6   ? 41.352  119.302 30.806  1.00 0.00 ? 6   LYS E CB   1 
ATOM 8154  C CG   . LYS E 1 6   ? 41.447  117.865 30.293  1.00 0.00 ? 6   LYS E CG   1 
ATOM 8155  C CD   . LYS E 1 6   ? 40.887  117.792 28.871  1.00 0.00 ? 6   LYS E CD   1 
ATOM 8156  C CE   . LYS E 1 6   ? 40.857  116.334 28.408  1.00 0.00 ? 6   LYS E CE   1 
ATOM 8157  N NZ   . LYS E 1 6   ? 42.242  115.781 28.411  1.00 0.00 ? 6   LYS E NZ   1 
ATOM 8158  H H    . LYS E 1 6   ? 40.374  118.089 32.788  1.00 0.00 ? 6   LYS E H    1 
ATOM 8159  H HA   . LYS E 1 6   ? 42.961  119.001 32.182  1.00 0.00 ? 6   LYS E HA   1 
ATOM 8160  H HB2  . LYS E 1 6   ? 40.316  119.606 30.839  1.00 0.00 ? 6   LYS E HB2  1 
ATOM 8161  H HB3  . LYS E 1 6   ? 41.899  119.956 30.144  1.00 0.00 ? 6   LYS E HB3  1 
ATOM 8162  H HG2  . LYS E 1 6   ? 42.481  117.550 30.290  1.00 0.00 ? 6   LYS E HG2  1 
ATOM 8163  H HG3  . LYS E 1 6   ? 40.874  117.215 30.935  1.00 0.00 ? 6   LYS E HG3  1 
ATOM 8164  H HD2  . LYS E 1 6   ? 39.885  118.196 28.857  1.00 0.00 ? 6   LYS E HD2  1 
ATOM 8165  H HD3  . LYS E 1 6   ? 41.516  118.365 28.206  1.00 0.00 ? 6   LYS E HD3  1 
ATOM 8166  H HE2  . LYS E 1 6   ? 40.238  115.756 29.078  1.00 0.00 ? 6   LYS E HE2  1 
ATOM 8167  H HE3  . LYS E 1 6   ? 40.452  116.282 27.409  1.00 0.00 ? 6   LYS E HE3  1 
ATOM 8168  H HZ1  . LYS E 1 6   ? 42.368  115.159 27.589  1.00 0.00 ? 6   LYS E HZ1  1 
ATOM 8169  H HZ2  . LYS E 1 6   ? 42.395  115.238 29.286  1.00 0.00 ? 6   LYS E HZ2  1 
ATOM 8170  H HZ3  . LYS E 1 6   ? 42.927  116.560 28.363  1.00 0.00 ? 6   LYS E HZ3  1 
ATOM 8171  N N    . GLY E 1 7   ? 40.935  121.238 33.399  1.00 0.00 ? 7   GLY E N    1 
ATOM 8172  C CA   . GLY E 1 7   ? 40.850  122.608 33.901  1.00 0.00 ? 7   GLY E CA   1 
ATOM 8173  C C    . GLY E 1 7   ? 40.339  123.558 32.824  1.00 0.00 ? 7   GLY E C    1 
ATOM 8174  O O    . GLY E 1 7   ? 40.463  124.776 32.948  1.00 0.00 ? 7   GLY E O    1 
ATOM 8175  H H    . GLY E 1 7   ? 40.215  120.606 33.603  1.00 0.00 ? 7   GLY E H    1 
ATOM 8176  H HA2  . GLY E 1 7   ? 40.177  122.633 34.745  1.00 0.00 ? 7   GLY E HA2  1 
ATOM 8177  H HA3  . GLY E 1 7   ? 41.830  122.932 34.219  1.00 0.00 ? 7   GLY E HA3  1 
ATOM 8178  N N    . LEU E 1 8   ? 39.764  122.993 31.770  1.00 0.00 ? 8   LEU E N    1 
ATOM 8179  C CA   . LEU E 1 8   ? 39.238  123.803 30.677  1.00 0.00 ? 8   LEU E CA   1 
ATOM 8180  C C    . LEU E 1 8   ? 40.334  124.700 30.113  1.00 0.00 ? 8   LEU E C    1 
ATOM 8181  O O    . LEU E 1 8   ? 40.103  125.874 29.820  1.00 0.00 ? 8   LEU E O    1 
ATOM 8182  C CB   . LEU E 1 8   ? 38.074  124.665 31.173  1.00 0.00 ? 8   LEU E CB   1 
ATOM 8183  C CG   . LEU E 1 8   ? 37.115  123.814 32.014  1.00 0.00 ? 8   LEU E CG   1 
ATOM 8184  C CD1  . LEU E 1 8   ? 35.946  124.683 32.489  1.00 0.00 ? 8   LEU E CD1  1 
ATOM 8185  C CD2  . LEU E 1 8   ? 36.578  122.646 31.172  1.00 0.00 ? 8   LEU E CD2  1 
ATOM 8186  H H    . LEU E 1 8   ? 39.692  122.018 31.724  1.00 0.00 ? 8   LEU E H    1 
ATOM 8187  H HA   . LEU E 1 8   ? 38.883  123.151 29.894  1.00 0.00 ? 8   LEU E HA   1 
ATOM 8188  H HB2  . LEU E 1 8   ? 38.459  125.475 31.776  1.00 0.00 ? 8   LEU E HB2  1 
ATOM 8189  H HB3  . LEU E 1 8   ? 37.541  125.071 30.326  1.00 0.00 ? 8   LEU E HB3  1 
ATOM 8190  H HG   . LEU E 1 8   ? 37.643  123.427 32.874  1.00 0.00 ? 8   LEU E HG   1 
ATOM 8191  H HD11 . LEU E 1 8   ? 35.270  124.085 33.082  1.00 0.00 ? 8   LEU E HD11 1 
ATOM 8192  H HD12 . LEU E 1 8   ? 35.419  125.079 31.631  1.00 0.00 ? 8   LEU E HD12 1 
ATOM 8193  H HD13 . LEU E 1 8   ? 36.324  125.501 33.086  1.00 0.00 ? 8   LEU E HD13 1 
ATOM 8194  H HD21 . LEU E 1 8   ? 36.323  123.000 30.184  1.00 0.00 ? 8   LEU E HD21 1 
ATOM 8195  H HD22 . LEU E 1 8   ? 35.698  122.234 31.645  1.00 0.00 ? 8   LEU E HD22 1 
ATOM 8196  H HD23 . LEU E 1 8   ? 37.335  121.880 31.097  1.00 0.00 ? 8   LEU E HD23 1 
ATOM 8197  N N    . SER E 1 9   ? 41.532  124.136 29.965  1.00 0.00 ? 9   SER E N    1 
ATOM 8198  C CA   . SER E 1 9   ? 42.673  124.884 29.436  1.00 0.00 ? 9   SER E CA   1 
ATOM 8199  C C    . SER E 1 9   ? 42.694  124.815 27.914  1.00 0.00 ? 9   SER E C    1 
ATOM 8200  O O    . SER E 1 9   ? 43.759  124.839 27.296  1.00 0.00 ? 9   SER E O    1 
ATOM 8201  C CB   . SER E 1 9   ? 43.976  124.309 29.996  1.00 0.00 ? 9   SER E CB   1 
ATOM 8202  O OG   . SER E 1 9   ? 44.068  122.931 29.657  1.00 0.00 ? 9   SER E OG   1 
ATOM 8203  H H    . SER E 1 9   ? 41.652  123.197 30.219  1.00 0.00 ? 9   SER E H    1 
ATOM 8204  H HA   . SER E 1 9   ? 42.592  125.919 29.739  1.00 0.00 ? 9   SER E HA   1 
ATOM 8205  H HB2  . SER E 1 9   ? 44.814  124.834 29.571  1.00 0.00 ? 9   SER E HB2  1 
ATOM 8206  H HB3  . SER E 1 9   ? 43.988  124.429 31.072  1.00 0.00 ? 9   SER E HB3  1 
ATOM 8207  H HG   . SER E 1 9   ? 44.079  122.860 28.701  1.00 0.00 ? 9   SER E HG   1 
ATOM 8208  N N    . LYS E 1 10  ? 41.509  124.721 27.317  1.00 0.00 ? 10  LYS E N    1 
ATOM 8209  C CA   . LYS E 1 10  ? 41.394  124.641 25.864  1.00 0.00 ? 10  LYS E CA   1 
ATOM 8210  C C    . LYS E 1 10  ? 41.922  125.919 25.220  1.00 0.00 ? 10  LYS E C    1 
ATOM 8211  O O    . LYS E 1 10  ? 42.160  125.964 24.014  1.00 0.00 ? 10  LYS E O    1 
ATOM 8212  C CB   . LYS E 1 10  ? 39.926  124.440 25.458  1.00 0.00 ? 10  LYS E CB   1 
ATOM 8213  C CG   . LYS E 1 10  ? 39.344  123.176 26.120  1.00 0.00 ? 10  LYS E CG   1 
ATOM 8214  C CD   . LYS E 1 10  ? 39.995  121.911 25.539  1.00 0.00 ? 10  LYS E CD   1 
ATOM 8215  C CE   . LYS E 1 10  ? 39.145  120.685 25.893  1.00 0.00 ? 10  LYS E CE   1 
ATOM 8216  N NZ   . LYS E 1 10  ? 39.117  120.508 27.373  1.00 0.00 ? 10  LYS E NZ   1 
ATOM 8217  H H    . LYS E 1 10  ? 40.696  124.702 27.864  1.00 0.00 ? 10  LYS E H    1 
ATOM 8218  H HA   . LYS E 1 10  ? 41.977  123.810 25.507  1.00 0.00 ? 10  LYS E HA   1 
ATOM 8219  H HB2  . LYS E 1 10  ? 39.353  125.300 25.766  1.00 0.00 ? 10  LYS E HB2  1 
ATOM 8220  H HB3  . LYS E 1 10  ? 39.866  124.339 24.385  1.00 0.00 ? 10  LYS E HB3  1 
ATOM 8221  H HG2  . LYS E 1 10  ? 39.525  123.215 27.184  1.00 0.00 ? 10  LYS E HG2  1 
ATOM 8222  H HG3  . LYS E 1 10  ? 38.278  123.142 25.941  1.00 0.00 ? 10  LYS E HG3  1 
ATOM 8223  H HD2  . LYS E 1 10  ? 40.069  122.001 24.466  1.00 0.00 ? 10  LYS E HD2  1 
ATOM 8224  H HD3  . LYS E 1 10  ? 40.980  121.785 25.960  1.00 0.00 ? 10  LYS E HD3  1 
ATOM 8225  H HE2  . LYS E 1 10  ? 38.138  120.829 25.530  1.00 0.00 ? 10  LYS E HE2  1 
ATOM 8226  H HE3  . LYS E 1 10  ? 39.571  119.806 25.434  1.00 0.00 ? 10  LYS E HE3  1 
ATOM 8227  H HZ1  . LYS E 1 10  ? 39.407  121.393 27.834  1.00 0.00 ? 10  LYS E HZ1  1 
ATOM 8228  H HZ2  . LYS E 1 10  ? 39.771  119.744 27.643  1.00 0.00 ? 10  LYS E HZ2  1 
ATOM 8229  H HZ3  . LYS E 1 10  ? 38.153  120.263 27.675  1.00 0.00 ? 10  LYS E HZ3  1 
ATOM 8230  N N    . ALA E 1 11  ? 42.102  126.956 26.031  1.00 0.00 ? 11  ALA E N    1 
ATOM 8231  C CA   . ALA E 1 11  ? 42.603  128.227 25.523  1.00 0.00 ? 11  ALA E CA   1 
ATOM 8232  C C    . ALA E 1 11  ? 43.980  128.035 24.897  1.00 0.00 ? 11  ALA E C    1 
ATOM 8233  O O    . ALA E 1 11  ? 44.291  128.624 23.861  1.00 0.00 ? 11  ALA E O    1 
ATOM 8234  C CB   . ALA E 1 11  ? 42.694  129.248 26.660  1.00 0.00 ? 11  ALA E CB   1 
ATOM 8235  H H    . ALA E 1 11  ? 41.896  126.864 26.985  1.00 0.00 ? 11  ALA E H    1 
ATOM 8236  H HA   . ALA E 1 11  ? 41.924  128.598 24.771  1.00 0.00 ? 11  ALA E HA   1 
ATOM 8237  H HB1  . ALA E 1 11  ? 43.542  129.015 27.287  1.00 0.00 ? 11  ALA E HB1  1 
ATOM 8238  H HB2  . ALA E 1 11  ? 41.790  129.213 27.249  1.00 0.00 ? 11  ALA E HB2  1 
ATOM 8239  H HB3  . ALA E 1 11  ? 42.815  130.238 26.246  1.00 0.00 ? 11  ALA E HB3  1 
ATOM 8240  N N    . LYS E 1 12  ? 44.799  127.198 25.532  1.00 0.00 ? 12  LYS E N    1 
ATOM 8241  C CA   . LYS E 1 12  ? 46.146  126.915 25.035  1.00 0.00 ? 12  LYS E CA   1 
ATOM 8242  C C    . LYS E 1 12  ? 46.114  125.737 24.064  1.00 0.00 ? 12  LYS E C    1 
ATOM 8243  O O    . LYS E 1 12  ? 45.274  124.846 24.186  1.00 0.00 ? 12  LYS E O    1 
ATOM 8244  C CB   . LYS E 1 12  ? 47.073  126.589 26.209  1.00 0.00 ? 12  LYS E CB   1 
ATOM 8245  C CG   . LYS E 1 12  ? 47.206  127.825 27.109  1.00 0.00 ? 12  LYS E CG   1 
ATOM 8246  C CD   . LYS E 1 12  ? 47.895  127.452 28.433  1.00 0.00 ? 12  LYS E CD   1 
ATOM 8247  C CE   . LYS E 1 12  ? 49.368  127.102 28.187  1.00 0.00 ? 12  LYS E CE   1 
ATOM 8248  N NZ   . LYS E 1 12  ? 50.076  126.995 29.494  1.00 0.00 ? 12  LYS E NZ   1 
ATOM 8249  H H    . LYS E 1 12  ? 44.489  126.753 26.349  1.00 0.00 ? 12  LYS E H    1 
ATOM 8250  H HA   . LYS E 1 12  ? 46.529  127.786 24.518  1.00 0.00 ? 12  LYS E HA   1 
ATOM 8251  H HB2  . LYS E 1 12  ? 46.661  125.767 26.777  1.00 0.00 ? 12  LYS E HB2  1 
ATOM 8252  H HB3  . LYS E 1 12  ? 48.043  126.316 25.827  1.00 0.00 ? 12  LYS E HB3  1 
ATOM 8253  H HG2  . LYS E 1 12  ? 47.793  128.576 26.600  1.00 0.00 ? 12  LYS E HG2  1 
ATOM 8254  H HG3  . LYS E 1 12  ? 46.225  128.221 27.319  1.00 0.00 ? 12  LYS E HG3  1 
ATOM 8255  H HD2  . LYS E 1 12  ? 47.836  128.288 29.113  1.00 0.00 ? 12  LYS E HD2  1 
ATOM 8256  H HD3  . LYS E 1 12  ? 47.395  126.601 28.868  1.00 0.00 ? 12  LYS E HD3  1 
ATOM 8257  H HE2  . LYS E 1 12  ? 49.435  126.157 27.671  1.00 0.00 ? 12  LYS E HE2  1 
ATOM 8258  H HE3  . LYS E 1 12  ? 49.828  127.874 27.589  1.00 0.00 ? 12  LYS E HE3  1 
ATOM 8259  H HZ1  . LYS E 1 12  ? 51.025  126.598 29.343  1.00 0.00 ? 12  LYS E HZ1  1 
ATOM 8260  H HZ2  . LYS E 1 12  ? 49.536  126.373 30.131  1.00 0.00 ? 12  LYS E HZ2  1 
ATOM 8261  H HZ3  . LYS E 1 12  ? 50.161  127.939 29.921  1.00 0.00 ? 12  LYS E HZ3  1 
ATOM 8262  N N    . GLU E 1 13  ? 47.034  125.739 23.099  1.00 0.00 ? 13  GLU E N    1 
ATOM 8263  C CA   . GLU E 1 13  ? 47.105  124.662 22.105  1.00 0.00 ? 13  GLU E CA   1 
ATOM 8264  C C    . GLU E 1 13  ? 48.547  124.433 21.661  1.00 0.00 ? 13  GLU E C    1 
ATOM 8265  O O    . GLU E 1 13  ? 48.802  123.712 20.696  1.00 0.00 ? 13  GLU E O    1 
ATOM 8266  C CB   . GLU E 1 13  ? 46.241  125.013 20.891  1.00 0.00 ? 13  GLU E CB   1 
ATOM 8267  C CG   . GLU E 1 13  ? 46.722  126.332 20.284  1.00 0.00 ? 13  GLU E CG   1 
ATOM 8268  C CD   . GLU E 1 13  ? 45.818  126.734 19.123  1.00 0.00 ? 13  GLU E CD   1 
ATOM 8269  O OE1  . GLU E 1 13  ? 44.888  125.997 18.840  1.00 0.00 ? 13  GLU E OE1  1 
ATOM 8270  O OE2  . GLU E 1 13  ? 46.070  127.773 18.535  1.00 0.00 ? 13  GLU E OE2  1 
ATOM 8271  H H    . GLU E 1 13  ? 47.677  126.476 23.052  1.00 0.00 ? 13  GLU E H    1 
ATOM 8272  H HA   . GLU E 1 13  ? 46.730  123.745 22.543  1.00 0.00 ? 13  GLU E HA   1 
ATOM 8273  H HB2  . GLU E 1 13  ? 46.321  124.227 20.153  1.00 0.00 ? 13  GLU E HB2  1 
ATOM 8274  H HB3  . GLU E 1 13  ? 45.211  125.115 21.198  1.00 0.00 ? 13  GLU E HB3  1 
ATOM 8275  H HG2  . GLU E 1 13  ? 46.700  127.104 21.040  1.00 0.00 ? 13  GLU E HG2  1 
ATOM 8276  H HG3  . GLU E 1 13  ? 47.733  126.213 19.925  1.00 0.00 ? 13  GLU E HG3  1 
ATOM 8277  N N    . GLY E 1 14  ? 49.489  125.051 22.374  1.00 0.00 ? 14  GLY E N    1 
ATOM 8278  C CA   . GLY E 1 14  ? 50.911  124.906 22.048  1.00 0.00 ? 14  GLY E CA   1 
ATOM 8279  C C    . GLY E 1 14  ? 51.773  125.080 23.292  1.00 0.00 ? 14  GLY E C    1 
ATOM 8280  O O    . GLY E 1 14  ? 51.473  125.902 24.158  1.00 0.00 ? 14  GLY E O    1 
ATOM 8281  H H    . GLY E 1 14  ? 49.227  125.611 23.134  1.00 0.00 ? 14  GLY E H    1 
ATOM 8282  H HA2  . GLY E 1 14  ? 51.087  123.922 21.630  1.00 0.00 ? 14  GLY E HA2  1 
ATOM 8283  H HA3  . GLY E 1 14  ? 51.186  125.654 21.321  1.00 0.00 ? 14  GLY E HA3  1 
ATOM 8284  N N    . VAL E 1 15  ? 52.856  124.299 23.373  1.00 0.00 ? 15  VAL E N    1 
ATOM 8285  C CA   . VAL E 1 15  ? 53.781  124.364 24.517  1.00 0.00 ? 15  VAL E CA   1 
ATOM 8286  C C    . VAL E 1 15  ? 55.219  124.505 24.026  1.00 0.00 ? 15  VAL E C    1 
ATOM 8287  O O    . VAL E 1 15  ? 55.699  123.686 23.243  1.00 0.00 ? 15  VAL E O    1 
ATOM 8288  C CB   . VAL E 1 15  ? 53.650  123.089 25.355  1.00 0.00 ? 15  VAL E CB   1 
ATOM 8289  C CG1  . VAL E 1 15  ? 54.621  123.145 26.535  1.00 0.00 ? 15  VAL E CG1  1 
ATOM 8290  C CG2  . VAL E 1 15  ? 52.217  122.975 25.881  1.00 0.00 ? 15  VAL E CG2  1 
ATOM 8291  H H    . VAL E 1 15  ? 53.041  123.668 22.648  1.00 0.00 ? 15  VAL E H    1 
ATOM 8292  H HA   . VAL E 1 15  ? 53.540  125.218 25.139  1.00 0.00 ? 15  VAL E HA   1 
ATOM 8293  H HB   . VAL E 1 15  ? 53.880  122.230 24.741  1.00 0.00 ? 15  VAL E HB   1 
ATOM 8294  H HG11 . VAL E 1 15  ? 55.628  122.985 26.180  1.00 0.00 ? 15  VAL E HG11 1 
ATOM 8295  H HG12 . VAL E 1 15  ? 54.364  122.376 27.248  1.00 0.00 ? 15  VAL E HG12 1 
ATOM 8296  H HG13 . VAL E 1 15  ? 54.556  124.113 27.011  1.00 0.00 ? 15  VAL E HG13 1 
ATOM 8297  H HG21 . VAL E 1 15  ? 51.530  122.953 25.049  1.00 0.00 ? 15  VAL E HG21 1 
ATOM 8298  H HG22 . VAL E 1 15  ? 51.996  123.824 26.511  1.00 0.00 ? 15  VAL E HG22 1 
ATOM 8299  H HG23 . VAL E 1 15  ? 52.116  122.065 26.455  1.00 0.00 ? 15  VAL E HG23 1 
ATOM 8300  N N    . VAL E 1 16  ? 55.908  125.548 24.498  1.00 0.00 ? 16  VAL E N    1 
ATOM 8301  C CA   . VAL E 1 16  ? 57.306  125.796 24.108  1.00 0.00 ? 16  VAL E CA   1 
ATOM 8302  C C    . VAL E 1 16  ? 58.246  125.422 25.248  1.00 0.00 ? 16  VAL E C    1 
ATOM 8303  O O    . VAL E 1 16  ? 59.436  125.185 25.034  1.00 0.00 ? 16  VAL E O    1 
ATOM 8304  C CB   . VAL E 1 16  ? 57.491  127.274 23.759  1.00 0.00 ? 16  VAL E CB   1 
ATOM 8305  C CG1  . VAL E 1 16  ? 56.750  127.589 22.458  1.00 0.00 ? 16  VAL E CG1  1 
ATOM 8306  C CG2  . VAL E 1 16  ? 56.921  128.136 24.889  1.00 0.00 ? 16  VAL E CG2  1 
ATOM 8307  H H    . VAL E 1 16  ? 55.471  126.164 25.123  1.00 0.00 ? 16  VAL E H    1 
ATOM 8308  H HA   . VAL E 1 16  ? 57.555  125.201 23.237  1.00 0.00 ? 16  VAL E HA   1 
ATOM 8309  H HB   . VAL E 1 16  ? 58.543  127.487 23.636  1.00 0.00 ? 16  VAL E HB   1 
ATOM 8310  H HG11 . VAL E 1 16  ? 55.719  127.277 22.546  1.00 0.00 ? 16  VAL E HG11 1 
ATOM 8311  H HG12 . VAL E 1 16  ? 57.218  127.060 21.641  1.00 0.00 ? 16  VAL E HG12 1 
ATOM 8312  H HG13 . VAL E 1 16  ? 56.789  128.652 22.270  1.00 0.00 ? 16  VAL E HG13 1 
ATOM 8313  H HG21 . VAL E 1 16  ? 57.174  129.171 24.715  1.00 0.00 ? 16  VAL E HG21 1 
ATOM 8314  H HG22 . VAL E 1 16  ? 57.340  127.816 25.831  1.00 0.00 ? 16  VAL E HG22 1 
ATOM 8315  H HG23 . VAL E 1 16  ? 55.847  128.027 24.917  1.00 0.00 ? 16  VAL E HG23 1 
ATOM 8316  N N    . ALA E 1 17  ? 57.702  125.367 26.459  1.00 0.00 ? 17  ALA E N    1 
ATOM 8317  C CA   . ALA E 1 17  ? 58.496  125.014 27.630  1.00 0.00 ? 17  ALA E CA   1 
ATOM 8318  C C    . ALA E 1 17  ? 57.590  124.573 28.776  1.00 0.00 ? 17  ALA E C    1 
ATOM 8319  O O    . ALA E 1 17  ? 56.433  124.985 28.857  1.00 0.00 ? 17  ALA E O    1 
ATOM 8320  C CB   . ALA E 1 17  ? 59.339  126.211 28.070  1.00 0.00 ? 17  ALA E CB   1 
ATOM 8321  H H    . ALA E 1 17  ? 56.747  125.564 26.566  1.00 0.00 ? 17  ALA E H    1 
ATOM 8322  H HA   . ALA E 1 17  ? 59.155  124.199 27.372  1.00 0.00 ? 17  ALA E HA   1 
ATOM 8323  H HB1  . ALA E 1 17  ? 59.801  125.995 29.023  1.00 0.00 ? 17  ALA E HB1  1 
ATOM 8324  H HB2  . ALA E 1 17  ? 58.707  127.082 28.167  1.00 0.00 ? 17  ALA E HB2  1 
ATOM 8325  H HB3  . ALA E 1 17  ? 60.106  126.402 27.335  1.00 0.00 ? 17  ALA E HB3  1 
ATOM 8326  N N    . ALA E 1 18  ? 58.124  123.737 29.661  1.00 0.00 ? 18  ALA E N    1 
ATOM 8327  C CA   . ALA E 1 18  ? 57.355  123.249 30.803  1.00 0.00 ? 18  ALA E CA   1 
ATOM 8328  C C    . ALA E 1 18  ? 57.338  124.291 31.917  1.00 0.00 ? 18  ALA E C    1 
ATOM 8329  O O    . ALA E 1 18  ? 57.231  125.488 31.655  1.00 0.00 ? 18  ALA E O    1 
ATOM 8330  C CB   . ALA E 1 18  ? 57.966  121.947 31.326  1.00 0.00 ? 18  ALA E CB   1 
ATOM 8331  H H    . ALA E 1 18  ? 59.053  123.445 29.546  1.00 0.00 ? 18  ALA E H    1 
ATOM 8332  H HA   . ALA E 1 18  ? 56.340  123.055 30.489  1.00 0.00 ? 18  ALA E HA   1 
ATOM 8333  H HB1  . ALA E 1 18  ? 58.863  122.169 31.887  1.00 0.00 ? 18  ALA E HB1  1 
ATOM 8334  H HB2  . ALA E 1 18  ? 58.213  121.306 30.493  1.00 0.00 ? 18  ALA E HB2  1 
ATOM 8335  H HB3  . ALA E 1 18  ? 57.255  121.448 31.967  1.00 0.00 ? 18  ALA E HB3  1 
ATOM 8336  N N    . ALA E 1 19  ? 57.448  123.832 33.160  1.00 0.00 ? 19  ALA E N    1 
ATOM 8337  C CA   . ALA E 1 19  ? 57.446  124.744 34.297  1.00 0.00 ? 19  ALA E CA   1 
ATOM 8338  C C    . ALA E 1 19  ? 58.578  125.754 34.156  1.00 0.00 ? 19  ALA E C    1 
ATOM 8339  O O    . ALA E 1 19  ? 59.697  125.397 33.786  1.00 0.00 ? 19  ALA E O    1 
ATOM 8340  C CB   . ALA E 1 19  ? 57.616  123.960 35.600  1.00 0.00 ? 19  ALA E CB   1 
ATOM 8341  H H    . ALA E 1 19  ? 57.533  122.867 33.315  1.00 0.00 ? 19  ALA E H    1 
ATOM 8342  H HA   . ALA E 1 19  ? 56.504  125.272 34.325  1.00 0.00 ? 19  ALA E HA   1 
ATOM 8343  H HB1  . ALA E 1 19  ? 56.835  123.218 35.678  1.00 0.00 ? 19  ALA E HB1  1 
ATOM 8344  H HB2  . ALA E 1 19  ? 57.553  124.637 36.438  1.00 0.00 ? 19  ALA E HB2  1 
ATOM 8345  H HB3  . ALA E 1 19  ? 58.579  123.471 35.603  1.00 0.00 ? 19  ALA E HB3  1 
ATOM 8346  N N    . GLU E 1 20  ? 58.281  127.019 34.449  1.00 0.00 ? 20  GLU E N    1 
ATOM 8347  C CA   . GLU E 1 20  ? 59.286  128.077 34.345  1.00 0.00 ? 20  GLU E CA   1 
ATOM 8348  C C    . GLU E 1 20  ? 60.118  128.148 35.618  1.00 0.00 ? 20  GLU E C    1 
ATOM 8349  O O    . GLU E 1 20  ? 59.591  128.395 36.703  1.00 0.00 ? 20  GLU E O    1 
ATOM 8350  C CB   . GLU E 1 20  ? 58.597  129.424 34.108  1.00 0.00 ? 20  GLU E CB   1 
ATOM 8351  C CG   . GLU E 1 20  ? 59.652  130.514 33.897  1.00 0.00 ? 20  GLU E CG   1 
ATOM 8352  C CD   . GLU E 1 20  ? 58.972  131.846 33.598  1.00 0.00 ? 20  GLU E CD   1 
ATOM 8353  O OE1  . GLU E 1 20  ? 57.753  131.878 33.595  1.00 0.00 ? 20  GLU E OE1  1 
ATOM 8354  O OE2  . GLU E 1 20  ? 59.680  132.814 33.380  1.00 0.00 ? 20  GLU E OE2  1 
ATOM 8355  H H    . GLU E 1 20  ? 57.372  127.245 34.735  1.00 0.00 ? 20  GLU E H    1 
ATOM 8356  H HA   . GLU E 1 20  ? 59.938  127.869 33.508  1.00 0.00 ? 20  GLU E HA   1 
ATOM 8357  H HB2  . GLU E 1 20  ? 57.967  129.357 33.232  1.00 0.00 ? 20  GLU E HB2  1 
ATOM 8358  H HB3  . GLU E 1 20  ? 57.993  129.674 34.967  1.00 0.00 ? 20  GLU E HB3  1 
ATOM 8359  H HG2  . GLU E 1 20  ? 60.253  130.612 34.788  1.00 0.00 ? 20  GLU E HG2  1 
ATOM 8360  H HG3  . GLU E 1 20  ? 60.286  130.243 33.065  1.00 0.00 ? 20  GLU E HG3  1 
ATOM 8361  N N    . LYS E 1 21  ? 61.422  127.936 35.477  1.00 0.00 ? 21  LYS E N    1 
ATOM 8362  C CA   . LYS E 1 21  ? 62.321  127.984 36.624  1.00 0.00 ? 21  LYS E CA   1 
ATOM 8363  C C    . LYS E 1 21  ? 63.756  128.215 36.160  1.00 0.00 ? 21  LYS E C    1 
ATOM 8364  O O    . LYS E 1 21  ? 64.379  127.332 35.572  1.00 0.00 ? 21  LYS E O    1 
ATOM 8365  C CB   . LYS E 1 21  ? 62.228  126.672 37.409  1.00 0.00 ? 21  LYS E CB   1 
ATOM 8366  C CG   . LYS E 1 21  ? 63.118  126.745 38.652  1.00 0.00 ? 21  LYS E CG   1 
ATOM 8367  C CD   . LYS E 1 21  ? 62.959  125.459 39.467  1.00 0.00 ? 21  LYS E CD   1 
ATOM 8368  C CE   . LYS E 1 21  ? 63.888  125.504 40.681  1.00 0.00 ? 21  LYS E CE   1 
ATOM 8369  N NZ   . LYS E 1 21  ? 63.511  126.655 41.551  1.00 0.00 ? 21  LYS E NZ   1 
ATOM 8370  H H    . LYS E 1 21  ? 61.786  127.747 34.587  1.00 0.00 ? 21  LYS E H    1 
ATOM 8371  H HA   . LYS E 1 21  ? 62.026  128.799 37.269  1.00 0.00 ? 21  LYS E HA   1 
ATOM 8372  H HB2  . LYS E 1 21  ? 61.203  126.506 37.709  1.00 0.00 ? 21  LYS E HB2  1 
ATOM 8373  H HB3  . LYS E 1 21  ? 62.555  125.856 36.784  1.00 0.00 ? 21  LYS E HB3  1 
ATOM 8374  H HG2  . LYS E 1 21  ? 64.149  126.857 38.352  1.00 0.00 ? 21  LYS E HG2  1 
ATOM 8375  H HG3  . LYS E 1 21  ? 62.823  127.590 39.256  1.00 0.00 ? 21  LYS E HG3  1 
ATOM 8376  H HD2  . LYS E 1 21  ? 61.934  125.367 39.799  1.00 0.00 ? 21  LYS E HD2  1 
ATOM 8377  H HD3  . LYS E 1 21  ? 63.216  124.609 38.852  1.00 0.00 ? 21  LYS E HD3  1 
ATOM 8378  H HE2  . LYS E 1 21  ? 63.795  124.585 41.240  1.00 0.00 ? 21  LYS E HE2  1 
ATOM 8379  H HE3  . LYS E 1 21  ? 64.909  125.623 40.349  1.00 0.00 ? 21  LYS E HE3  1 
ATOM 8380  H HZ1  . LYS E 1 21  ? 62.477  126.758 41.561  1.00 0.00 ? 21  LYS E HZ1  1 
ATOM 8381  H HZ2  . LYS E 1 21  ? 63.944  127.526 41.180  1.00 0.00 ? 21  LYS E HZ2  1 
ATOM 8382  H HZ3  . LYS E 1 21  ? 63.849  126.484 42.518  1.00 0.00 ? 21  LYS E HZ3  1 
ATOM 8383  N N    . THR E 1 22  ? 64.273  129.407 36.434  1.00 0.00 ? 22  THR E N    1 
ATOM 8384  C CA   . THR E 1 22  ? 65.637  129.747 36.045  1.00 0.00 ? 22  THR E CA   1 
ATOM 8385  C C    . THR E 1 22  ? 65.917  129.312 34.605  1.00 0.00 ? 22  THR E C    1 
ATOM 8386  O O    . THR E 1 22  ? 67.073  129.155 34.211  1.00 0.00 ? 22  THR E O    1 
ATOM 8387  C CB   . THR E 1 22  ? 66.631  129.070 36.992  1.00 0.00 ? 22  THR E CB   1 
ATOM 8388  O OG1  . THR E 1 22  ? 66.582  127.662 36.803  1.00 0.00 ? 22  THR E OG1  1 
ATOM 8389  C CG2  . THR E 1 22  ? 66.269  129.405 38.440  1.00 0.00 ? 22  THR E CG2  1 
ATOM 8390  H H    . THR E 1 22  ? 63.728  130.071 36.908  1.00 0.00 ? 22  THR E H    1 
ATOM 8391  H HA   . THR E 1 22  ? 65.763  130.816 36.116  1.00 0.00 ? 22  THR E HA   1 
ATOM 8392  H HB   . THR E 1 22  ? 67.628  129.426 36.783  1.00 0.00 ? 22  THR E HB   1 
ATOM 8393  H HG1  . THR E 1 22  ? 66.428  127.253 37.659  1.00 0.00 ? 22  THR E HG1  1 
ATOM 8394  H HG21 . THR E 1 22  ? 66.983  128.945 39.106  1.00 0.00 ? 22  THR E HG21 1 
ATOM 8395  H HG22 . THR E 1 22  ? 65.279  129.034 38.659  1.00 0.00 ? 22  THR E HG22 1 
ATOM 8396  H HG23 . THR E 1 22  ? 66.289  130.477 38.577  1.00 0.00 ? 22  THR E HG23 1 
ATOM 8397  N N    . LYS E 1 23  ? 64.853  129.120 33.823  1.00 0.00 ? 23  LYS E N    1 
ATOM 8398  C CA   . LYS E 1 23  ? 65.002  128.704 32.425  1.00 0.00 ? 23  LYS E CA   1 
ATOM 8399  C C    . LYS E 1 23  ? 65.199  129.918 31.521  1.00 0.00 ? 23  LYS E C    1 
ATOM 8400  O O    . LYS E 1 23  ? 64.238  130.601 31.164  1.00 0.00 ? 23  LYS E O    1 
ATOM 8401  C CB   . LYS E 1 23  ? 63.755  127.933 31.982  1.00 0.00 ? 23  LYS E CB   1 
ATOM 8402  C CG   . LYS E 1 23  ? 64.000  127.305 30.602  1.00 0.00 ? 23  LYS E CG   1 
ATOM 8403  C CD   . LYS E 1 23  ? 62.717  126.622 30.094  1.00 0.00 ? 23  LYS E CD   1 
ATOM 8404  C CE   . LYS E 1 23  ? 62.532  125.257 30.777  1.00 0.00 ? 23  LYS E CE   1 
ATOM 8405  N NZ   . LYS E 1 23  ? 61.384  124.539 30.148  1.00 0.00 ? 23  LYS E NZ   1 
ATOM 8406  H H    . LYS E 1 23  ? 63.955  129.261 34.189  1.00 0.00 ? 23  LYS E H    1 
ATOM 8407  H HA   . LYS E 1 23  ? 65.862  128.056 32.335  1.00 0.00 ? 23  LYS E HA   1 
ATOM 8408  H HB2  . LYS E 1 23  ? 63.546  127.159 32.702  1.00 0.00 ? 23  LYS E HB2  1 
ATOM 8409  H HB3  . LYS E 1 23  ? 62.915  128.608 31.924  1.00 0.00 ? 23  LYS E HB3  1 
ATOM 8410  H HG2  . LYS E 1 23  ? 64.294  128.078 29.906  1.00 0.00 ? 23  LYS E HG2  1 
ATOM 8411  H HG3  . LYS E 1 23  ? 64.789  126.573 30.677  1.00 0.00 ? 23  LYS E HG3  1 
ATOM 8412  H HD2  . LYS E 1 23  ? 61.867  127.250 30.315  1.00 0.00 ? 23  LYS E HD2  1 
ATOM 8413  H HD3  . LYS E 1 23  ? 62.788  126.479 29.026  1.00 0.00 ? 23  LYS E HD3  1 
ATOM 8414  H HE2  . LYS E 1 23  ? 63.428  124.669 30.660  1.00 0.00 ? 23  LYS E HE2  1 
ATOM 8415  H HE3  . LYS E 1 23  ? 62.328  125.399 31.825  1.00 0.00 ? 23  LYS E HE3  1 
ATOM 8416  H HZ1  . LYS E 1 23  ? 61.264  124.865 29.169  1.00 0.00 ? 23  LYS E HZ1  1 
ATOM 8417  H HZ2  . LYS E 1 23  ? 60.516  124.734 30.688  1.00 0.00 ? 23  LYS E HZ2  1 
ATOM 8418  H HZ3  . LYS E 1 23  ? 61.573  123.517 30.150  1.00 0.00 ? 23  LYS E HZ3  1 
ATOM 8419  N N    . GLN E 1 24  ? 66.452  130.182 31.154  1.00 0.00 ? 24  GLN E N    1 
ATOM 8420  C CA   . GLN E 1 24  ? 66.763  131.317 30.291  1.00 0.00 ? 24  GLN E CA   1 
ATOM 8421  C C    . GLN E 1 24  ? 66.157  131.117 28.902  1.00 0.00 ? 24  GLN E C    1 
ATOM 8422  O O    . GLN E 1 24  ? 65.610  132.050 28.313  1.00 0.00 ? 24  GLN E O    1 
ATOM 8423  C CB   . GLN E 1 24  ? 68.285  131.484 30.176  1.00 0.00 ? 24  GLN E CB   1 
ATOM 8424  C CG   . GLN E 1 24  ? 68.621  132.780 29.425  1.00 0.00 ? 24  GLN E CG   1 
ATOM 8425  C CD   . GLN E 1 24  ? 68.162  133.995 30.228  1.00 0.00 ? 24  GLN E CD   1 
ATOM 8426  O OE1  . GLN E 1 24  ? 67.328  134.770 29.761  1.00 0.00 ? 24  GLN E OE1  1 
ATOM 8427  N NE2  . GLN E 1 24  ? 68.659  134.206 31.417  1.00 0.00 ? 24  GLN E NE2  1 
ATOM 8428  H H    . GLN E 1 24  ? 67.176  129.603 31.469  1.00 0.00 ? 24  GLN E H    1 
ATOM 8429  H HA   . GLN E 1 24  ? 66.344  132.209 30.729  1.00 0.00 ? 24  GLN E HA   1 
ATOM 8430  H HB2  . GLN E 1 24  ? 68.716  131.523 31.167  1.00 0.00 ? 24  GLN E HB2  1 
ATOM 8431  H HB3  . GLN E 1 24  ? 68.698  130.644 29.640  1.00 0.00 ? 24  GLN E HB3  1 
ATOM 8432  H HG2  . GLN E 1 24  ? 69.689  132.836 29.272  1.00 0.00 ? 24  GLN E HG2  1 
ATOM 8433  H HG3  . GLN E 1 24  ? 68.123  132.778 28.467  1.00 0.00 ? 24  GLN E HG3  1 
ATOM 8434  H HE21 . GLN E 1 24  ? 69.322  133.586 31.788  1.00 0.00 ? 24  GLN E HE21 1 
ATOM 8435  H HE22 . GLN E 1 24  ? 68.369  134.983 31.938  1.00 0.00 ? 24  GLN E HE22 1 
ATOM 8436  N N    . GLY E 1 25  ? 66.252  129.892 28.386  1.00 0.00 ? 25  GLY E N    1 
ATOM 8437  C CA   . GLY E 1 25  ? 65.701  129.583 27.067  1.00 0.00 ? 25  GLY E CA   1 
ATOM 8438  C C    . GLY E 1 25  ? 66.234  130.545 26.009  1.00 0.00 ? 25  GLY E C    1 
ATOM 8439  O O    . GLY E 1 25  ? 65.479  131.334 25.442  1.00 0.00 ? 25  GLY E O    1 
ATOM 8440  H H    . GLY E 1 25  ? 66.695  129.186 28.901  1.00 0.00 ? 25  GLY E H    1 
ATOM 8441  H HA2  . GLY E 1 25  ? 65.973  128.573 26.799  1.00 0.00 ? 25  GLY E HA2  1 
ATOM 8442  H HA3  . GLY E 1 25  ? 64.626  129.663 27.105  1.00 0.00 ? 25  GLY E HA3  1 
ATOM 8443  N N    . VAL E 1 26  ? 67.539  130.487 25.751  1.00 0.00 ? 26  VAL E N    1 
ATOM 8444  C CA   . VAL E 1 26  ? 68.147  131.375 24.763  1.00 0.00 ? 26  VAL E CA   1 
ATOM 8445  C C    . VAL E 1 26  ? 67.792  130.940 23.336  1.00 0.00 ? 26  VAL E C    1 
ATOM 8446  O O    . VAL E 1 26  ? 66.785  131.379 22.781  1.00 0.00 ? 26  VAL E O    1 
ATOM 8447  C CB   . VAL E 1 26  ? 69.667  131.382 24.937  1.00 0.00 ? 26  VAL E CB   1 
ATOM 8448  C CG1  . VAL E 1 26  ? 70.293  132.314 23.899  1.00 0.00 ? 26  VAL E CG1  1 
ATOM 8449  C CG2  . VAL E 1 26  ? 70.014  131.879 26.342  1.00 0.00 ? 26  VAL E CG2  1 
ATOM 8450  H H    . VAL E 1 26  ? 68.100  129.846 26.236  1.00 0.00 ? 26  VAL E H    1 
ATOM 8451  H HA   . VAL E 1 26  ? 67.777  132.375 24.923  1.00 0.00 ? 26  VAL E HA   1 
ATOM 8452  H HB   . VAL E 1 26  ? 70.051  130.381 24.801  1.00 0.00 ? 26  VAL E HB   1 
ATOM 8453  H HG11 . VAL E 1 26  ? 69.745  133.244 23.875  1.00 0.00 ? 26  VAL E HG11 1 
ATOM 8454  H HG12 . VAL E 1 26  ? 70.253  131.848 22.926  1.00 0.00 ? 26  VAL E HG12 1 
ATOM 8455  H HG13 . VAL E 1 26  ? 71.322  132.509 24.163  1.00 0.00 ? 26  VAL E HG13 1 
ATOM 8456  H HG21 . VAL E 1 26  ? 71.078  132.058 26.409  1.00 0.00 ? 26  VAL E HG21 1 
ATOM 8457  H HG22 . VAL E 1 26  ? 69.729  131.133 27.069  1.00 0.00 ? 26  VAL E HG22 1 
ATOM 8458  H HG23 . VAL E 1 26  ? 69.483  132.798 26.542  1.00 0.00 ? 26  VAL E HG23 1 
ATOM 8459  N N    . ALA E 1 27  ? 68.622  130.077 22.749  1.00 0.00 ? 27  ALA E N    1 
ATOM 8460  C CA   . ALA E 1 27  ? 68.380  129.593 21.385  1.00 0.00 ? 27  ALA E CA   1 
ATOM 8461  C C    . ALA E 1 27  ? 67.890  130.725 20.476  1.00 0.00 ? 27  ALA E C    1 
ATOM 8462  O O    . ALA E 1 27  ? 66.863  130.594 19.811  1.00 0.00 ? 27  ALA E O    1 
ATOM 8463  C CB   . ALA E 1 27  ? 67.338  128.472 21.406  1.00 0.00 ? 27  ALA E CB   1 
ATOM 8464  H H    . ALA E 1 27  ? 69.410  129.758 23.236  1.00 0.00 ? 27  ALA E H    1 
ATOM 8465  H HA   . ALA E 1 27  ? 69.303  129.200 20.986  1.00 0.00 ? 27  ALA E HA   1 
ATOM 8466  H HB1  . ALA E 1 27  ? 67.286  128.009 20.431  1.00 0.00 ? 27  ALA E HB1  1 
ATOM 8467  H HB2  . ALA E 1 27  ? 66.372  128.883 21.660  1.00 0.00 ? 27  ALA E HB2  1 
ATOM 8468  H HB3  . ALA E 1 27  ? 67.618  127.732 22.141  1.00 0.00 ? 27  ALA E HB3  1 
ATOM 8469  N N    . GLU E 1 28  ? 68.633  131.838 20.452  1.00 0.00 ? 28  GLU E N    1 
ATOM 8470  C CA   . GLU E 1 28  ? 68.260  132.995 19.617  1.00 0.00 ? 28  GLU E CA   1 
ATOM 8471  C C    . GLU E 1 28  ? 69.510  133.661 19.030  1.00 0.00 ? 28  GLU E C    1 
ATOM 8472  O O    . GLU E 1 28  ? 70.441  134.004 19.758  1.00 0.00 ? 28  GLU E O    1 
ATOM 8473  C CB   . GLU E 1 28  ? 67.492  134.015 20.471  1.00 0.00 ? 28  GLU E CB   1 
ATOM 8474  C CG   . GLU E 1 28  ? 66.920  135.126 19.580  1.00 0.00 ? 28  GLU E CG   1 
ATOM 8475  C CD   . GLU E 1 28  ? 65.830  134.560 18.676  1.00 0.00 ? 28  GLU E CD   1 
ATOM 8476  O OE1  . GLU E 1 28  ? 65.314  133.502 18.993  1.00 0.00 ? 28  GLU E OE1  1 
ATOM 8477  O OE2  . GLU E 1 28  ? 65.525  135.196 17.680  1.00 0.00 ? 28  GLU E OE2  1 
ATOM 8478  H H    . GLU E 1 28  ? 69.441  131.887 21.004  1.00 0.00 ? 28  GLU E H    1 
ATOM 8479  H HA   . GLU E 1 28  ? 67.625  132.668 18.804  1.00 0.00 ? 28  GLU E HA   1 
ATOM 8480  H HB2  . GLU E 1 28  ? 66.682  133.515 20.983  1.00 0.00 ? 28  GLU E HB2  1 
ATOM 8481  H HB3  . GLU E 1 28  ? 68.161  134.450 21.197  1.00 0.00 ? 28  GLU E HB3  1 
ATOM 8482  H HG2  . GLU E 1 28  ? 66.500  135.902 20.204  1.00 0.00 ? 28  GLU E HG2  1 
ATOM 8483  H HG3  . GLU E 1 28  ? 67.708  135.542 18.972  1.00 0.00 ? 28  GLU E HG3  1 
ATOM 8484  N N    . ALA E 1 29  ? 69.515  133.847 17.709  1.00 0.00 ? 29  ALA E N    1 
ATOM 8485  C CA   . ALA E 1 29  ? 70.648  134.482 17.032  1.00 0.00 ? 29  ALA E CA   1 
ATOM 8486  C C    . ALA E 1 29  ? 71.980  133.972 17.589  1.00 0.00 ? 29  ALA E C    1 
ATOM 8487  O O    . ALA E 1 29  ? 72.620  134.645 18.399  1.00 0.00 ? 29  ALA E O    1 
ATOM 8488  C CB   . ALA E 1 29  ? 70.570  136.003 17.201  1.00 0.00 ? 29  ALA E CB   1 
ATOM 8489  H H    . ALA E 1 29  ? 68.740  133.559 17.181  1.00 0.00 ? 29  ALA E H    1 
ATOM 8490  H HA   . ALA E 1 29  ? 70.599  134.248 15.979  1.00 0.00 ? 29  ALA E HA   1 
ATOM 8491  H HB1  . ALA E 1 29  ? 70.686  136.255 18.244  1.00 0.00 ? 29  ALA E HB1  1 
ATOM 8492  H HB2  . ALA E 1 29  ? 69.611  136.355 16.850  1.00 0.00 ? 29  ALA E HB2  1 
ATOM 8493  H HB3  . ALA E 1 29  ? 71.357  136.470 16.627  1.00 0.00 ? 29  ALA E HB3  1 
ATOM 8494  N N    . ALA E 1 30  ? 72.395  132.773 17.146  1.00 0.00 ? 30  ALA E N    1 
ATOM 8495  C CA   . ALA E 1 30  ? 73.661  132.171 17.603  1.00 0.00 ? 30  ALA E CA   1 
ATOM 8496  C C    . ALA E 1 30  ? 74.504  131.723 16.410  1.00 0.00 ? 30  ALA E C    1 
ATOM 8497  O O    . ALA E 1 30  ? 74.005  131.048 15.499  1.00 0.00 ? 30  ALA E O    1 
ATOM 8498  C CB   . ALA E 1 30  ? 73.367  130.961 18.493  1.00 0.00 ? 30  ALA E CB   1 
ATOM 8499  H H    . ALA E 1 30  ? 71.841  132.287 16.498  1.00 0.00 ? 30  ALA E H    1 
ATOM 8500  H HA   . ALA E 1 30  ? 74.228  132.895 18.177  1.00 0.00 ? 30  ALA E HA   1 
ATOM 8501  H HB1  . ALA E 1 30  ? 72.604  131.220 19.210  1.00 0.00 ? 30  ALA E HB1  1 
ATOM 8502  H HB2  . ALA E 1 30  ? 74.268  130.668 19.014  1.00 0.00 ? 30  ALA E HB2  1 
ATOM 8503  H HB3  . ALA E 1 30  ? 73.022  130.140 17.882  1.00 0.00 ? 30  ALA E HB3  1 
ATOM 8504  N N    . GLY E 1 31  ? 75.782  132.094 16.424  1.00 0.00 ? 31  GLY E N    1 
ATOM 8505  C CA   . GLY E 1 31  ? 76.679  131.716 15.339  1.00 0.00 ? 31  GLY E CA   1 
ATOM 8506  C C    . GLY E 1 31  ? 76.274  132.390 14.033  1.00 0.00 ? 31  GLY E C    1 
ATOM 8507  O O    . GLY E 1 31  ? 75.914  131.718 13.064  1.00 0.00 ? 31  GLY E O    1 
ATOM 8508  H H    . GLY E 1 31  ? 76.128  132.626 17.178  1.00 0.00 ? 31  GLY E H    1 
ATOM 8509  H HA2  . GLY E 1 31  ? 77.686  132.009 15.594  1.00 0.00 ? 31  GLY E HA2  1 
ATOM 8510  H HA3  . GLY E 1 31  ? 76.643  130.646 15.206  1.00 0.00 ? 31  GLY E HA3  1 
ATOM 8511  N N    . LYS E 1 32  ? 76.333  133.721 14.007  1.00 0.00 ? 32  LYS E N    1 
ATOM 8512  C CA   . LYS E 1 32  ? 75.969  134.457 12.803  1.00 0.00 ? 32  LYS E CA   1 
ATOM 8513  C C    . LYS E 1 32  ? 76.939  134.139 11.672  1.00 0.00 ? 32  LYS E C    1 
ATOM 8514  O O    . LYS E 1 32  ? 78.063  133.694 11.907  1.00 0.00 ? 32  LYS E O    1 
ATOM 8515  C CB   . LYS E 1 32  ? 75.936  135.970 13.043  1.00 0.00 ? 32  LYS E CB   1 
ATOM 8516  C CG   . LYS E 1 32  ? 74.741  136.340 13.931  1.00 0.00 ? 32  LYS E CG   1 
ATOM 8517  C CD   . LYS E 1 32  ? 74.603  137.868 13.980  1.00 0.00 ? 32  LYS E CD   1 
ATOM 8518  C CE   . LYS E 1 32  ? 73.423  138.251 14.872  1.00 0.00 ? 32  LYS E CE   1 
ATOM 8519  N NZ   . LYS E 1 32  ? 73.275  139.734 14.885  1.00 0.00 ? 32  LYS E NZ   1 
ATOM 8520  H H    . LYS E 1 32  ? 76.625  134.208 14.804  1.00 0.00 ? 32  LYS E H    1 
ATOM 8521  H HA   . LYS E 1 32  ? 74.987  134.137 12.503  1.00 0.00 ? 32  LYS E HA   1 
ATOM 8522  H HB2  . LYS E 1 32  ? 76.846  136.271 13.529  1.00 0.00 ? 32  LYS E HB2  1 
ATOM 8523  H HB3  . LYS E 1 32  ? 75.847  136.479 12.096  1.00 0.00 ? 32  LYS E HB3  1 
ATOM 8524  H HG2  . LYS E 1 32  ? 73.839  135.908 13.520  1.00 0.00 ? 32  LYS E HG2  1 
ATOM 8525  H HG3  . LYS E 1 32  ? 74.903  135.963 14.928  1.00 0.00 ? 32  LYS E HG3  1 
ATOM 8526  H HD2  . LYS E 1 32  ? 75.506  138.302 14.373  1.00 0.00 ? 32  LYS E HD2  1 
ATOM 8527  H HD3  . LYS E 1 32  ? 74.431  138.243 12.983  1.00 0.00 ? 32  LYS E HD3  1 
ATOM 8528  H HE2  . LYS E 1 32  ? 72.520  137.801 14.487  1.00 0.00 ? 32  LYS E HE2  1 
ATOM 8529  H HE3  . LYS E 1 32  ? 73.602  137.898 15.878  1.00 0.00 ? 32  LYS E HE3  1 
ATOM 8530  H HZ1  . LYS E 1 32  ? 74.212  140.175 14.961  1.00 0.00 ? 32  LYS E HZ1  1 
ATOM 8531  H HZ2  . LYS E 1 32  ? 72.690  140.016 15.698  1.00 0.00 ? 32  LYS E HZ2  1 
ATOM 8532  H HZ3  . LYS E 1 32  ? 72.818  140.045 14.005  1.00 0.00 ? 32  LYS E HZ3  1 
ATOM 8533  N N    . THR E 1 33  ? 76.479  134.338 10.446  1.00 0.00 ? 33  THR E N    1 
ATOM 8534  C CA   . THR E 1 33  ? 77.288  134.039 9.275   1.00 0.00 ? 33  THR E CA   1 
ATOM 8535  C C    . THR E 1 33  ? 78.503  134.952 9.203   1.00 0.00 ? 33  THR E C    1 
ATOM 8536  O O    . THR E 1 33  ? 78.408  136.105 8.789   1.00 0.00 ? 33  THR E O    1 
ATOM 8537  C CB   . THR E 1 33  ? 76.432  134.226 8.019   1.00 0.00 ? 33  THR E CB   1 
ATOM 8538  O OG1  . THR E 1 33  ? 77.277  134.422 6.894   1.00 0.00 ? 33  THR E OG1  1 
ATOM 8539  C CG2  . THR E 1 33  ? 75.518  135.445 8.190   1.00 0.00 ? 33  THR E CG2  1 
ATOM 8540  H H    . THR E 1 33  ? 75.565  134.671 10.325  1.00 0.00 ? 33  THR E H    1 
ATOM 8541  H HA   . THR E 1 33  ? 77.619  133.012 9.325   1.00 0.00 ? 33  THR E HA   1 
ATOM 8542  H HB   . THR E 1 33  ? 75.823  133.351 7.868   1.00 0.00 ? 33  THR E HB   1 
ATOM 8543  H HG1  . THR E 1 33  ? 78.017  134.966 7.171   1.00 0.00 ? 33  THR E HG1  1 
ATOM 8544  H HG21 . THR E 1 33  ? 75.155  135.759 7.222   1.00 0.00 ? 33  THR E HG21 1 
ATOM 8545  H HG22 . THR E 1 33  ? 76.068  136.253 8.646   1.00 0.00 ? 33  THR E HG22 1 
ATOM 8546  H HG23 . THR E 1 33  ? 74.679  135.182 8.817   1.00 0.00 ? 33  THR E HG23 1 
ATOM 8547  N N    . LYS E 1 34  ? 79.650  134.412 9.609   1.00 0.00 ? 34  LYS E N    1 
ATOM 8548  C CA   . LYS E 1 34  ? 80.890  135.171 9.598   1.00 0.00 ? 34  LYS E CA   1 
ATOM 8549  C C    . LYS E 1 34  ? 81.174  135.698 8.200   1.00 0.00 ? 34  LYS E C    1 
ATOM 8550  O O    . LYS E 1 34  ? 80.927  135.014 7.208   1.00 0.00 ? 34  LYS E O    1 
ATOM 8551  C CB   . LYS E 1 34  ? 82.051  134.283 10.053  1.00 0.00 ? 34  LYS E CB   1 
ATOM 8552  C CG   . LYS E 1 34  ? 81.838  133.873 11.515  1.00 0.00 ? 34  LYS E CG   1 
ATOM 8553  C CD   . LYS E 1 34  ? 83.109  133.217 12.075  1.00 0.00 ? 34  LYS E CD   1 
ATOM 8554  C CE   . LYS E 1 34  ? 83.324  131.841 11.436  1.00 0.00 ? 34  LYS E CE   1 
ATOM 8555  N NZ   . LYS E 1 34  ? 84.408  131.121 12.164  1.00 0.00 ? 34  LYS E NZ   1 
ATOM 8556  H H    . LYS E 1 34  ? 79.659  133.484 9.924   1.00 0.00 ? 34  LYS E H    1 
ATOM 8557  H HA   . LYS E 1 34  ? 80.801  136.003 10.279  1.00 0.00 ? 34  LYS E HA   1 
ATOM 8558  H HB2  . LYS E 1 34  ? 82.084  133.403 9.430   1.00 0.00 ? 34  LYS E HB2  1 
ATOM 8559  H HB3  . LYS E 1 34  ? 82.979  134.826 9.962   1.00 0.00 ? 34  LYS E HB3  1 
ATOM 8560  H HG2  . LYS E 1 34  ? 81.599  134.749 12.101  1.00 0.00 ? 34  LYS E HG2  1 
ATOM 8561  H HG3  . LYS E 1 34  ? 81.020  133.171 11.573  1.00 0.00 ? 34  LYS E HG3  1 
ATOM 8562  H HD2  . LYS E 1 34  ? 83.960  133.848 11.861  1.00 0.00 ? 34  LYS E HD2  1 
ATOM 8563  H HD3  . LYS E 1 34  ? 83.010  133.101 13.144  1.00 0.00 ? 34  LYS E HD3  1 
ATOM 8564  H HE2  . LYS E 1 34  ? 82.409  131.270 11.491  1.00 0.00 ? 34  LYS E HE2  1 
ATOM 8565  H HE3  . LYS E 1 34  ? 83.610  131.962 10.403  1.00 0.00 ? 34  LYS E HE3  1 
ATOM 8566  H HZ1  . LYS E 1 34  ? 84.188  130.106 12.198  1.00 0.00 ? 34  LYS E HZ1  1 
ATOM 8567  H HZ2  . LYS E 1 34  ? 84.481  131.493 13.133  1.00 0.00 ? 34  LYS E HZ2  1 
ATOM 8568  H HZ3  . LYS E 1 34  ? 85.310  131.261 11.669  1.00 0.00 ? 34  LYS E HZ3  1 
ATOM 8569  N N    . GLU E 1 35  ? 81.694  136.925 8.131   1.00 0.00 ? 35  GLU E N    1 
ATOM 8570  C CA   . GLU E 1 35  ? 82.017  137.560 6.847   1.00 0.00 ? 35  GLU E CA   1 
ATOM 8571  C C    . GLU E 1 35  ? 83.527  137.617 6.666   1.00 0.00 ? 35  GLU E C    1 
ATOM 8572  O O    . GLU E 1 35  ? 84.231  138.240 7.463   1.00 0.00 ? 35  GLU E O    1 
ATOM 8573  C CB   . GLU E 1 35  ? 81.454  138.982 6.828   1.00 0.00 ? 35  GLU E CB   1 
ATOM 8574  C CG   . GLU E 1 35  ? 81.556  139.564 5.416   1.00 0.00 ? 35  GLU E CG   1 
ATOM 8575  C CD   . GLU E 1 35  ? 80.579  138.849 4.488   1.00 0.00 ? 35  GLU E CD   1 
ATOM 8576  O OE1  . GLU E 1 35  ? 79.584  138.349 4.982   1.00 0.00 ? 35  GLU E OE1  1 
ATOM 8577  O OE2  . GLU E 1 35  ? 80.837  138.823 3.297   1.00 0.00 ? 35  GLU E OE2  1 
ATOM 8578  H H    . GLU E 1 35  ? 81.866  137.418 8.960   1.00 0.00 ? 35  GLU E H    1 
ATOM 8579  H HA   . GLU E 1 35  ? 81.580  136.997 6.031   1.00 0.00 ? 35  GLU E HA   1 
ATOM 8580  H HB2  . GLU E 1 35  ? 80.419  138.962 7.137   1.00 0.00 ? 35  GLU E HB2  1 
ATOM 8581  H HB3  . GLU E 1 35  ? 82.019  139.597 7.510   1.00 0.00 ? 35  GLU E HB3  1 
ATOM 8582  H HG2  . GLU E 1 35  ? 81.315  140.618 5.446   1.00 0.00 ? 35  GLU E HG2  1 
ATOM 8583  H HG3  . GLU E 1 35  ? 82.561  139.435 5.047   1.00 0.00 ? 35  GLU E HG3  1 
ATOM 8584  N N    . GLY E 1 36  ? 84.025  136.973 5.618   1.00 0.00 ? 36  GLY E N    1 
ATOM 8585  C CA   . GLY E 1 36  ? 85.457  136.970 5.361   1.00 0.00 ? 36  GLY E CA   1 
ATOM 8586  C C    . GLY E 1 36  ? 85.941  138.378 5.046   1.00 0.00 ? 36  GLY E C    1 
ATOM 8587  O O    . GLY E 1 36  ? 85.923  139.254 5.911   1.00 0.00 ? 36  GLY E O    1 
ATOM 8588  H H    . GLY E 1 36  ? 83.424  136.492 5.010   1.00 0.00 ? 36  GLY E H    1 
ATOM 8589  H HA2  . GLY E 1 36  ? 85.973  136.603 6.238   1.00 0.00 ? 36  GLY E HA2  1 
ATOM 8590  H HA3  . GLY E 1 36  ? 85.670  136.325 4.524   1.00 0.00 ? 36  GLY E HA3  1 
ATOM 8591  N N    . VAL E 1 37  ? 86.374  138.594 3.801   1.00 0.00 ? 37  VAL E N    1 
ATOM 8592  C CA   . VAL E 1 37  ? 86.865  139.913 3.371   1.00 0.00 ? 37  VAL E CA   1 
ATOM 8593  C C    . VAL E 1 37  ? 86.182  140.323 2.067   1.00 0.00 ? 37  VAL E C    1 
ATOM 8594  O O    . VAL E 1 37  ? 85.828  139.466 1.242   1.00 0.00 ? 37  VAL E O    1 
ATOM 8595  C CB   . VAL E 1 37  ? 88.381  139.844 3.162   1.00 0.00 ? 37  VAL E CB   1 
ATOM 8596  C CG1  . VAL E 1 37  ? 89.041  139.283 4.425   1.00 0.00 ? 37  VAL E CG1  1 
ATOM 8597  C CG2  . VAL E 1 37  ? 88.698  138.927 1.978   1.00 0.00 ? 37  VAL E CG2  1 
ATOM 8598  H H    . VAL E 1 37  ? 86.361  137.856 3.157   1.00 0.00 ? 37  VAL E H    1 
ATOM 8599  H HA   . VAL E 1 37  ? 86.648  140.656 4.129   1.00 0.00 ? 37  VAL E HA   1 
ATOM 8600  H HB   . VAL E 1 37  ? 88.764  140.836 2.965   1.00 0.00 ? 37  VAL E HB   1 
ATOM 8601  H HG11 . VAL E 1 37  ? 90.114  139.378 4.344   1.00 0.00 ? 37  VAL E HG11 1 
ATOM 8602  H HG12 . VAL E 1 37  ? 88.780  138.241 4.534   1.00 0.00 ? 37  VAL E HG12 1 
ATOM 8603  H HG13 . VAL E 1 37  ? 88.694  139.832 5.285   1.00 0.00 ? 37  VAL E HG13 1 
ATOM 8604  H HG21 . VAL E 1 37  ? 89.758  138.721 1.956   1.00 0.00 ? 37  VAL E HG21 1 
ATOM 8605  H HG22 . VAL E 1 37  ? 88.406  139.409 1.058   1.00 0.00 ? 37  VAL E HG22 1 
ATOM 8606  H HG23 . VAL E 1 37  ? 88.157  138.004 2.086   1.00 0.00 ? 37  VAL E HG23 1 
ATOM 8607  N N    . LEU E 1 38  ? 85.990  141.639 1.873   1.00 0.00 ? 38  LEU E N    1 
ATOM 8608  C CA   . LEU E 1 38  ? 85.334  142.147 0.645   1.00 0.00 ? 38  LEU E CA   1 
ATOM 8609  C C    . LEU E 1 38  ? 86.308  143.024 -0.149  1.00 0.00 ? 38  LEU E C    1 
ATOM 8610  O O    . LEU E 1 38  ? 86.922  143.935 0.410   1.00 0.00 ? 38  LEU E O    1 
ATOM 8611  C CB   . LEU E 1 38  ? 84.097  142.991 1.010   1.00 0.00 ? 38  LEU E CB   1 
ATOM 8612  C CG   . LEU E 1 38  ? 83.261  142.285 2.091   1.00 0.00 ? 38  LEU E CG   1 
ATOM 8613  C CD1  . LEU E 1 38  ? 82.028  143.142 2.434   1.00 0.00 ? 38  LEU E CD1  1 
ATOM 8614  C CD2  . LEU E 1 38  ? 82.800  140.917 1.581   1.00 0.00 ? 38  LEU E CD2  1 
ATOM 8615  H H    . LEU E 1 38  ? 86.291  142.278 2.560   1.00 0.00 ? 38  LEU E H    1 
ATOM 8616  H HA   . LEU E 1 38  ? 85.019  141.319 0.021   1.00 0.00 ? 38  LEU E HA   1 
ATOM 8617  H HB2  . LEU E 1 38  ? 84.414  143.954 1.374   1.00 0.00 ? 38  LEU E HB2  1 
ATOM 8618  H HB3  . LEU E 1 38  ? 83.488  143.128 0.129   1.00 0.00 ? 38  LEU E HB3  1 
ATOM 8619  H HG   . LEU E 1 38  ? 83.863  142.156 2.980   1.00 0.00 ? 38  LEU E HG   1 
ATOM 8620  H HD11 . LEU E 1 38  ? 81.640  142.840 3.395   1.00 0.00 ? 38  LEU E HD11 1 
ATOM 8621  H HD12 . LEU E 1 38  ? 81.266  143.002 1.679   1.00 0.00 ? 38  LEU E HD12 1 
ATOM 8622  H HD13 . LEU E 1 38  ? 82.307  144.185 2.470   1.00 0.00 ? 38  LEU E HD13 1 
ATOM 8623  H HD21 . LEU E 1 38  ? 83.628  140.228 1.588   1.00 0.00 ? 38  LEU E HD21 1 
ATOM 8624  H HD22 . LEU E 1 38  ? 82.427  141.020 0.582   1.00 0.00 ? 38  LEU E HD22 1 
ATOM 8625  H HD23 . LEU E 1 38  ? 82.017  140.542 2.219   1.00 0.00 ? 38  LEU E HD23 1 
ATOM 8626  N N    . TYR E 1 39  ? 86.434  142.756 -1.458  1.00 0.00 ? 39  TYR E N    1 
ATOM 8627  C CA   . TYR E 1 39  ? 87.328  143.541 -2.337  1.00 0.00 ? 39  TYR E CA   1 
ATOM 8628  C C    . TYR E 1 39  ? 86.553  144.076 -3.541  1.00 0.00 ? 39  TYR E C    1 
ATOM 8629  O O    . TYR E 1 39  ? 86.052  143.304 -4.360  1.00 0.00 ? 39  TYR E O    1 
ATOM 8630  C CB   . TYR E 1 39  ? 88.501  142.663 -2.825  1.00 0.00 ? 39  TYR E CB   1 
ATOM 8631  C CG   . TYR E 1 39  ? 89.552  142.556 -1.739  1.00 0.00 ? 39  TYR E CG   1 
ATOM 8632  C CD1  . TYR E 1 39  ? 89.389  141.648 -0.688  1.00 0.00 ? 39  TYR E CD1  1 
ATOM 8633  C CD2  . TYR E 1 39  ? 90.688  143.374 -1.789  1.00 0.00 ? 39  TYR E CD2  1 
ATOM 8634  C CE1  . TYR E 1 39  ? 90.364  141.557 0.313   1.00 0.00 ? 39  TYR E CE1  1 
ATOM 8635  C CE2  . TYR E 1 39  ? 91.662  143.282 -0.789  1.00 0.00 ? 39  TYR E CE2  1 
ATOM 8636  C CZ   . TYR E 1 39  ? 91.499  142.374 0.263   1.00 0.00 ? 39  TYR E CZ   1 
ATOM 8637  O OH   . TYR E 1 39  ? 92.458  142.285 1.250   1.00 0.00 ? 39  TYR E OH   1 
ATOM 8638  H H    . TYR E 1 39  ? 85.907  142.024 -1.846  1.00 0.00 ? 39  TYR E H    1 
ATOM 8639  H HA   . TYR E 1 39  ? 87.727  144.388 -1.787  1.00 0.00 ? 39  TYR E HA   1 
ATOM 8640  H HB2  . TYR E 1 39  ? 88.134  141.675 -3.065  1.00 0.00 ? 39  TYR E HB2  1 
ATOM 8641  H HB3  . TYR E 1 39  ? 88.946  143.104 -3.709  1.00 0.00 ? 39  TYR E HB3  1 
ATOM 8642  H HD1  . TYR E 1 39  ? 88.513  141.017 -0.649  1.00 0.00 ? 39  TYR E HD1  1 
ATOM 8643  H HD2  . TYR E 1 39  ? 90.813  144.074 -2.601  1.00 0.00 ? 39  TYR E HD2  1 
ATOM 8644  H HE1  . TYR E 1 39  ? 90.240  140.859 1.125   1.00 0.00 ? 39  TYR E HE1  1 
ATOM 8645  H HE2  . TYR E 1 39  ? 92.538  143.913 -0.829  1.00 0.00 ? 39  TYR E HE2  1 
ATOM 8646  H HH   . TYR E 1 39  ? 92.379  143.060 1.811   1.00 0.00 ? 39  TYR E HH   1 
ATOM 8647  N N    . VAL E 1 40  ? 86.467  145.412 -3.645  1.00 0.00 ? 40  VAL E N    1 
ATOM 8648  C CA   . VAL E 1 40  ? 85.758  146.064 -4.757  1.00 0.00 ? 40  VAL E CA   1 
ATOM 8649  C C    . VAL E 1 40  ? 86.619  147.173 -5.364  1.00 0.00 ? 40  VAL E C    1 
ATOM 8650  O O    . VAL E 1 40  ? 86.963  148.131 -4.686  1.00 0.00 ? 40  VAL E O    1 
ATOM 8651  C CB   . VAL E 1 40  ? 84.446  146.665 -4.246  1.00 0.00 ? 40  VAL E CB   1 
ATOM 8652  C CG1  . VAL E 1 40  ? 83.701  147.341 -5.400  1.00 0.00 ? 40  VAL E CG1  1 
ATOM 8653  C CG2  . VAL E 1 40  ? 83.573  145.554 -3.659  1.00 0.00 ? 40  VAL E CG2  1 
ATOM 8654  H H    . VAL E 1 40  ? 86.894  145.971 -2.961  1.00 0.00 ? 40  VAL E H    1 
ATOM 8655  H HA   . VAL E 1 40  ? 85.534  145.340 -5.519  1.00 0.00 ? 40  VAL E HA   1 
ATOM 8656  H HB   . VAL E 1 40  ? 84.661  147.398 -3.480  1.00 0.00 ? 40  VAL E HB   1 
ATOM 8657  H HG11 . VAL E 1 40  ? 84.223  148.242 -5.686  1.00 0.00 ? 40  VAL E HG11 1 
ATOM 8658  H HG12 . VAL E 1 40  ? 82.699  147.590 -5.083  1.00 0.00 ? 40  VAL E HG12 1 
ATOM 8659  H HG13 . VAL E 1 40  ? 83.656  146.667 -6.242  1.00 0.00 ? 40  VAL E HG13 1 
ATOM 8660  H HG21 . VAL E 1 40  ? 83.517  144.733 -4.358  1.00 0.00 ? 40  VAL E HG21 1 
ATOM 8661  H HG22 . VAL E 1 40  ? 82.580  145.937 -3.473  1.00 0.00 ? 40  VAL E HG22 1 
ATOM 8662  H HG23 . VAL E 1 40  ? 84.005  145.208 -2.732  1.00 0.00 ? 40  VAL E HG23 1 
ATOM 8663  N N    . GLY E 1 41  ? 86.962  147.053 -6.640  1.00 0.00 ? 41  GLY E N    1 
ATOM 8664  C CA   . GLY E 1 41  ? 87.776  148.080 -7.279  1.00 0.00 ? 41  GLY E CA   1 
ATOM 8665  C C    . GLY E 1 41  ? 89.172  148.142 -6.660  1.00 0.00 ? 41  GLY E C    1 
ATOM 8666  O O    . GLY E 1 41  ? 89.518  149.107 -5.953  1.00 0.00 ? 41  GLY E O    1 
ATOM 8667  H H    . GLY E 1 41  ? 86.666  146.271 -7.160  1.00 0.00 ? 41  GLY E H    1 
ATOM 8668  H HA2  . GLY E 1 41  ? 87.863  147.860 -8.334  1.00 0.00 ? 41  GLY E HA2  1 
ATOM 8669  H HA3  . GLY E 1 41  ? 87.294  149.039 -7.156  1.00 0.00 ? 41  GLY E HA3  1 
ATOM 8670  N N    . SER E 1 42  ? 89.974  147.103 -6.920  1.00 0.00 ? 42  SER E N    1 
ATOM 8671  C CA   . SER E 1 42  ? 91.351  147.040 -6.388  1.00 0.00 ? 42  SER E CA   1 
ATOM 8672  C C    . SER E 1 42  ? 92.315  146.540 -7.460  1.00 0.00 ? 42  SER E C    1 
ATOM 8673  O O    . SER E 1 42  ? 92.020  145.582 -8.172  1.00 0.00 ? 42  SER E O    1 
ATOM 8674  C CB   . SER E 1 42  ? 91.407  146.104 -5.181  1.00 0.00 ? 42  SER E CB   1 
ATOM 8675  O OG   . SER E 1 42  ? 90.559  146.606 -4.155  1.00 0.00 ? 42  SER E OG   1 
ATOM 8676  H H    . SER E 1 42  ? 89.636  146.365 -7.488  1.00 0.00 ? 42  SER E H    1 
ATOM 8677  H HA   . SER E 1 42  ? 91.666  148.029 -6.076  1.00 0.00 ? 42  SER E HA   1 
ATOM 8678  H HB2  . SER E 1 42  ? 91.073  145.123 -5.467  1.00 0.00 ? 42  SER E HB2  1 
ATOM 8679  H HB3  . SER E 1 42  ? 92.428  146.044 -4.820  1.00 0.00 ? 42  SER E HB3  1 
ATOM 8680  H HG   . SER E 1 42  ? 91.114  147.006 -3.482  1.00 0.00 ? 42  SER E HG   1 
ATOM 8681  N N    . LYS E 1 43  ? 93.478  147.196 -7.565  1.00 0.00 ? 43  LYS E N    1 
ATOM 8682  C CA   . LYS E 1 43  ? 94.496  146.808 -8.556  1.00 0.00 ? 43  LYS E CA   1 
ATOM 8683  C C    . LYS E 1 43  ? 95.776  146.379 -7.843  1.00 0.00 ? 43  LYS E C    1 
ATOM 8684  O O    . LYS E 1 43  ? 96.311  147.120 -7.020  1.00 0.00 ? 43  LYS E O    1 
ATOM 8685  C CB   . LYS E 1 43  ? 94.814  148.002 -9.468  1.00 0.00 ? 43  LYS E CB   1 
ATOM 8686  C CG   . LYS E 1 43  ? 93.517  148.665 -9.963  1.00 0.00 ? 43  LYS E CG   1 
ATOM 8687  C CD   . LYS E 1 43  ? 92.671  147.674 -10.773 1.00 0.00 ? 43  LYS E CD   1 
ATOM 8688  C CE   . LYS E 1 43  ? 91.521  148.431 -11.440 1.00 0.00 ? 43  LYS E CE   1 
ATOM 8689  N NZ   . LYS E 1 43  ? 90.652  147.473 -12.183 1.00 0.00 ? 43  LYS E NZ   1 
ATOM 8690  H H    . LYS E 1 43  ? 93.658  147.950 -6.965  1.00 0.00 ? 43  LYS E H    1 
ATOM 8691  H HA   . LYS E 1 43  ? 94.142  145.983 -9.160  1.00 0.00 ? 43  LYS E HA   1 
ATOM 8692  H HB2  . LYS E 1 43  ? 95.395  148.727 -8.916  1.00 0.00 ? 43  LYS E HB2  1 
ATOM 8693  H HB3  . LYS E 1 43  ? 95.386  147.659 -10.318 1.00 0.00 ? 43  LYS E HB3  1 
ATOM 8694  H HG2  . LYS E 1 43  ? 92.946  149.008 -9.114  1.00 0.00 ? 43  LYS E HG2  1 
ATOM 8695  H HG3  . LYS E 1 43  ? 93.766  149.510 -10.588 1.00 0.00 ? 43  LYS E HG3  1 
ATOM 8696  H HD2  . LYS E 1 43  ? 93.285  147.204 -11.528 1.00 0.00 ? 43  LYS E HD2  1 
ATOM 8697  H HD3  . LYS E 1 43  ? 92.264  146.923 -10.117 1.00 0.00 ? 43  LYS E HD3  1 
ATOM 8698  H HE2  . LYS E 1 43  ? 90.935  148.935 -10.685 1.00 0.00 ? 43  LYS E HE2  1 
ATOM 8699  H HE3  . LYS E 1 43  ? 91.922  149.161 -12.128 1.00 0.00 ? 43  LYS E HE3  1 
ATOM 8700  H HZ1  . LYS E 1 43  ? 89.781  147.955 -12.482 1.00 0.00 ? 43  LYS E HZ1  1 
ATOM 8701  H HZ2  . LYS E 1 43  ? 90.410  146.673 -11.562 1.00 0.00 ? 43  LYS E HZ2  1 
ATOM 8702  H HZ3  . LYS E 1 43  ? 91.158  147.123 -13.020 1.00 0.00 ? 43  LYS E HZ3  1 
ATOM 8703  N N    . THR E 1 44  ? 96.268  145.176 -8.169  1.00 0.00 ? 44  THR E N    1 
ATOM 8704  C CA   . THR E 1 44  ? 97.500  144.650 -7.558  1.00 0.00 ? 44  THR E CA   1 
ATOM 8705  C C    . THR E 1 44  ? 98.437  144.114 -8.633  1.00 0.00 ? 44  THR E C    1 
ATOM 8706  O O    . THR E 1 44  ? 98.049  143.278 -9.446  1.00 0.00 ? 44  THR E O    1 
ATOM 8707  C CB   . THR E 1 44  ? 97.151  143.524 -6.578  1.00 0.00 ? 44  THR E CB   1 
ATOM 8708  O OG1  . THR E 1 44  ? 96.281  144.028 -5.573  1.00 0.00 ? 44  THR E OG1  1 
ATOM 8709  C CG2  . THR E 1 44  ? 98.429  142.994 -5.928  1.00 0.00 ? 44  THR E CG2  1 
ATOM 8710  H H    . THR E 1 44  ? 95.799  144.632 -8.837  1.00 0.00 ? 44  THR E H    1 
ATOM 8711  H HA   . THR E 1 44  ? 98.007  145.438 -7.015  1.00 0.00 ? 44  THR E HA   1 
ATOM 8712  H HB   . THR E 1 44  ? 96.662  142.723 -7.110  1.00 0.00 ? 44  THR E HB   1 
ATOM 8713  H HG1  . THR E 1 44  ? 96.796  144.593 -4.992  1.00 0.00 ? 44  THR E HG1  1 
ATOM 8714  H HG21 . THR E 1 44  ? 99.002  143.819 -5.535  1.00 0.00 ? 44  THR E HG21 1 
ATOM 8715  H HG22 . THR E 1 44  ? 99.016  142.466 -6.665  1.00 0.00 ? 44  THR E HG22 1 
ATOM 8716  H HG23 . THR E 1 44  ? 98.170  142.320 -5.125  1.00 0.00 ? 44  THR E HG23 1 
ATOM 8717  N N    . LYS E 1 45  ? 99.684  144.594 -8.626  1.00 0.00 ? 45  LYS E N    1 
ATOM 8718  C CA   . LYS E 1 45  ? 100.686 144.147 -9.605  1.00 0.00 ? 45  LYS E CA   1 
ATOM 8719  C C    . LYS E 1 45  ? 102.034 143.949 -8.924  1.00 0.00 ? 45  LYS E C    1 
ATOM 8720  O O    . LYS E 1 45  ? 102.466 144.785 -8.128  1.00 0.00 ? 45  LYS E O    1 
ATOM 8721  C CB   . LYS E 1 45  ? 100.829 145.191 -10.717 1.00 0.00 ? 45  LYS E CB   1 
ATOM 8722  C CG   . LYS E 1 45  ? 99.485  145.373 -11.426 1.00 0.00 ? 45  LYS E CG   1 
ATOM 8723  C CD   . LYS E 1 45  ? 99.634  146.402 -12.549 1.00 0.00 ? 45  LYS E CD   1 
ATOM 8724  C CE   . LYS E 1 45  ? 98.266  146.674 -13.179 1.00 0.00 ? 45  LYS E CE   1 
ATOM 8725  N NZ   . LYS E 1 45  ? 97.733  145.416 -13.772 1.00 0.00 ? 45  LYS E NZ   1 
ATOM 8726  H H    . LYS E 1 45  ? 99.938  145.254 -7.947  1.00 0.00 ? 45  LYS E H    1 
ATOM 8727  H HA   . LYS E 1 45  ? 100.376 143.207 -10.046 1.00 0.00 ? 45  LYS E HA   1 
ATOM 8728  H HB2  . LYS E 1 45  ? 101.144 146.132 -10.290 1.00 0.00 ? 45  LYS E HB2  1 
ATOM 8729  H HB3  . LYS E 1 45  ? 101.567 144.856 -11.431 1.00 0.00 ? 45  LYS E HB3  1 
ATOM 8730  H HG2  . LYS E 1 45  ? 99.167  144.427 -11.841 1.00 0.00 ? 45  LYS E HG2  1 
ATOM 8731  H HG3  . LYS E 1 45  ? 98.749  145.721 -10.717 1.00 0.00 ? 45  LYS E HG3  1 
ATOM 8732  H HD2  . LYS E 1 45  ? 100.035 147.319 -12.146 1.00 0.00 ? 45  LYS E HD2  1 
ATOM 8733  H HD3  . LYS E 1 45  ? 100.304 146.016 -13.302 1.00 0.00 ? 45  LYS E HD3  1 
ATOM 8734  H HE2  . LYS E 1 45  ? 97.585  147.032 -12.421 1.00 0.00 ? 45  LYS E HE2  1 
ATOM 8735  H HE3  . LYS E 1 45  ? 98.368  147.421 -13.952 1.00 0.00 ? 45  LYS E HE3  1 
ATOM 8736  H HZ1  . LYS E 1 45  ? 97.812  144.646 -13.078 1.00 0.00 ? 45  LYS E HZ1  1 
ATOM 8737  H HZ2  . LYS E 1 45  ? 98.280  145.176 -14.624 1.00 0.00 ? 45  LYS E HZ2  1 
ATOM 8738  H HZ3  . LYS E 1 45  ? 96.734  145.549 -14.026 1.00 0.00 ? 45  LYS E HZ3  1 
ATOM 8739  N N    . GLU E 1 46  ? 102.703 142.838 -9.245  1.00 0.00 ? 46  GLU E N    1 
ATOM 8740  C CA   . GLU E 1 46  ? 104.016 142.534 -8.658  1.00 0.00 ? 46  GLU E CA   1 
ATOM 8741  C C    . GLU E 1 46  ? 104.946 141.934 -9.711  1.00 0.00 ? 46  GLU E C    1 
ATOM 8742  O O    . GLU E 1 46  ? 104.690 140.848 -10.222 1.00 0.00 ? 46  GLU E O    1 
ATOM 8743  C CB   . GLU E 1 46  ? 103.851 141.543 -7.502  1.00 0.00 ? 46  GLU E CB   1 
ATOM 8744  C CG   . GLU E 1 46  ? 102.945 142.152 -6.430  1.00 0.00 ? 46  GLU E CG   1 
ATOM 8745  C CD   . GLU E 1 46  ? 102.815 141.193 -5.250  1.00 0.00 ? 46  GLU E CD   1 
ATOM 8746  O OE1  . GLU E 1 46  ? 103.358 140.103 -5.335  1.00 0.00 ? 46  GLU E OE1  1 
ATOM 8747  O OE2  . GLU E 1 46  ? 102.175 141.562 -4.280  1.00 0.00 ? 46  GLU E OE2  1 
ATOM 8748  H H    . GLU E 1 46  ? 102.311 142.211 -9.889  1.00 0.00 ? 46  GLU E H    1 
ATOM 8749  H HA   . GLU E 1 46  ? 104.461 143.440 -8.277  1.00 0.00 ? 46  GLU E HA   1 
ATOM 8750  H HB2  . GLU E 1 46  ? 103.408 140.629 -7.872  1.00 0.00 ? 46  GLU E HB2  1 
ATOM 8751  H HB3  . GLU E 1 46  ? 104.817 141.326 -7.073  1.00 0.00 ? 46  GLU E HB3  1 
ATOM 8752  H HG2  . GLU E 1 46  ? 103.368 143.085 -6.090  1.00 0.00 ? 46  GLU E HG2  1 
ATOM 8753  H HG3  . GLU E 1 46  ? 101.967 142.334 -6.850  1.00 0.00 ? 46  GLU E HG3  1 
ATOM 8754  N N    . GLY E 1 47  ? 106.031 142.637 -10.030 1.00 0.00 ? 47  GLY E N    1 
ATOM 8755  C CA   . GLY E 1 47  ? 106.972 142.133 -11.022 1.00 0.00 ? 47  GLY E CA   1 
ATOM 8756  C C    . GLY E 1 47  ? 106.372 142.199 -12.421 1.00 0.00 ? 47  GLY E C    1 
ATOM 8757  O O    . GLY E 1 47  ? 105.933 141.182 -12.970 1.00 0.00 ? 47  GLY E O    1 
ATOM 8758  H H    . GLY E 1 47  ? 106.202 143.504 -9.597  1.00 0.00 ? 47  GLY E H    1 
ATOM 8759  H HA2  . GLY E 1 47  ? 107.873 142.732 -10.993 1.00 0.00 ? 47  GLY E HA2  1 
ATOM 8760  H HA3  . GLY E 1 47  ? 107.216 141.110 -10.791 1.00 0.00 ? 47  GLY E HA3  1 
ATOM 8761  N N    . VAL E 1 48  ? 106.353 143.409 -12.993 1.00 0.00 ? 48  VAL E N    1 
ATOM 8762  C CA   . VAL E 1 48  ? 105.808 143.624 -14.341 1.00 0.00 ? 48  VAL E CA   1 
ATOM 8763  C C    . VAL E 1 48  ? 106.652 144.641 -15.102 1.00 0.00 ? 48  VAL E C    1 
ATOM 8764  O O    . VAL E 1 48  ? 107.056 145.662 -14.550 1.00 0.00 ? 48  VAL E O    1 
ATOM 8765  C CB   . VAL E 1 48  ? 104.369 144.125 -14.258 1.00 0.00 ? 48  VAL E CB   1 
ATOM 8766  C CG1  . VAL E 1 48  ? 103.839 144.381 -15.670 1.00 0.00 ? 48  VAL E CG1  1 
ATOM 8767  C CG2  . VAL E 1 48  ? 103.498 143.070 -13.574 1.00 0.00 ? 48  VAL E CG2  1 
ATOM 8768  H H    . VAL E 1 48  ? 106.717 144.174 -12.497 1.00 0.00 ? 48  VAL E H    1 
ATOM 8769  H HA   . VAL E 1 48  ? 105.820 142.691 -14.886 1.00 0.00 ? 48  VAL E HA   1 
ATOM 8770  H HB   . VAL E 1 48  ? 104.340 145.044 -13.690 1.00 0.00 ? 48  VAL E HB   1 
ATOM 8771  H HG11 . VAL E 1 48  ? 104.292 145.277 -16.069 1.00 0.00 ? 48  VAL E HG11 1 
ATOM 8772  H HG12 . VAL E 1 48  ? 102.767 144.504 -15.637 1.00 0.00 ? 48  VAL E HG12 1 
ATOM 8773  H HG13 . VAL E 1 48  ? 104.085 143.541 -16.305 1.00 0.00 ? 48  VAL E HG13 1 
ATOM 8774  H HG21 . VAL E 1 48  ? 103.775 142.992 -12.534 1.00 0.00 ? 48  VAL E HG21 1 
ATOM 8775  H HG22 . VAL E 1 48  ? 103.643 142.115 -14.058 1.00 0.00 ? 48  VAL E HG22 1 
ATOM 8776  H HG23 . VAL E 1 48  ? 102.460 143.357 -13.650 1.00 0.00 ? 48  VAL E HG23 1 
ATOM 8777  N N    . VAL E 1 49  ? 106.915 144.362 -16.384 1.00 0.00 ? 49  VAL E N    1 
ATOM 8778  C CA   . VAL E 1 49  ? 107.715 145.271 -17.222 1.00 0.00 ? 49  VAL E CA   1 
ATOM 8779  C C    . VAL E 1 49  ? 107.079 145.440 -18.603 1.00 0.00 ? 49  VAL E C    1 
ATOM 8780  O O    . VAL E 1 49  ? 106.541 144.498 -19.175 1.00 0.00 ? 49  VAL E O    1 
ATOM 8781  C CB   . VAL E 1 49  ? 109.153 144.730 -17.355 1.00 0.00 ? 49  VAL E CB   1 
ATOM 8782  C CG1  . VAL E 1 49  ? 109.107 143.243 -17.687 1.00 0.00 ? 49  VAL E CG1  1 
ATOM 8783  C CG2  . VAL E 1 49  ? 109.902 145.479 -18.476 1.00 0.00 ? 49  VAL E CG2  1 
ATOM 8784  H H    . VAL E 1 49  ? 106.564 143.534 -16.774 1.00 0.00 ? 49  VAL E H    1 
ATOM 8785  H HA   . VAL E 1 49  ? 107.760 146.240 -16.752 1.00 0.00 ? 49  VAL E HA   1 
ATOM 8786  H HB   . VAL E 1 49  ? 109.674 144.867 -16.419 1.00 0.00 ? 49  VAL E HB   1 
ATOM 8787  H HG11 . VAL E 1 49  ? 108.491 143.093 -18.552 1.00 0.00 ? 49  VAL E HG11 1 
ATOM 8788  H HG12 . VAL E 1 49  ? 108.690 142.700 -16.851 1.00 0.00 ? 49  VAL E HG12 1 
ATOM 8789  H HG13 . VAL E 1 49  ? 110.106 142.887 -17.887 1.00 0.00 ? 49  VAL E HG13 1 
ATOM 8790  H HG21 . VAL E 1 49  ? 110.964 145.313 -18.375 1.00 0.00 ? 49  VAL E HG21 1 
ATOM 8791  H HG22 . VAL E 1 49  ? 109.692 146.533 -18.409 1.00 0.00 ? 49  VAL E HG22 1 
ATOM 8792  H HG23 . VAL E 1 49  ? 109.571 145.115 -19.437 1.00 0.00 ? 49  VAL E HG23 1 
ATOM 8793  N N    . HIS E 1 50  ? 107.158 146.661 -19.135 1.00 0.00 ? 50  HIS E N    1 
ATOM 8794  C CA   . HIS E 1 50  ? 106.601 146.964 -20.457 1.00 0.00 ? 50  HIS E CA   1 
ATOM 8795  C C    . HIS E 1 50  ? 107.486 147.978 -21.178 1.00 0.00 ? 50  HIS E C    1 
ATOM 8796  O O    . HIS E 1 50  ? 107.680 149.095 -20.701 1.00 0.00 ? 50  HIS E O    1 
ATOM 8797  C CB   . HIS E 1 50  ? 105.191 147.537 -20.313 1.00 0.00 ? 50  HIS E CB   1 
ATOM 8798  C CG   . HIS E 1 50  ? 104.603 147.759 -21.680 1.00 0.00 ? 50  HIS E CG   1 
ATOM 8799  N ND1  . HIS E 1 50  ? 103.679 146.890 -22.239 1.00 0.00 ? 50  HIS E ND1  1 
ATOM 8800  C CD2  . HIS E 1 50  ? 104.808 148.742 -22.614 1.00 0.00 ? 50  HIS E CD2  1 
ATOM 8801  C CE1  . HIS E 1 50  ? 103.365 147.364 -23.459 1.00 0.00 ? 50  HIS E CE1  1 
ATOM 8802  N NE2  . HIS E 1 50  ? 104.026 148.491 -23.736 1.00 0.00 ? 50  HIS E NE2  1 
ATOM 8803  H H    . HIS E 1 50  ? 107.607 147.372 -18.632 1.00 0.00 ? 50  HIS E H    1 
ATOM 8804  H HA   . HIS E 1 50  ? 106.554 146.059 -21.046 1.00 0.00 ? 50  HIS E HA   1 
ATOM 8805  H HB2  . HIS E 1 50  ? 104.574 146.841 -19.764 1.00 0.00 ? 50  HIS E HB2  1 
ATOM 8806  H HB3  . HIS E 1 50  ? 105.235 148.477 -19.784 1.00 0.00 ? 50  HIS E HB3  1 
ATOM 8807  H HD1  . HIS E 1 50  ? 103.320 146.080 -21.821 1.00 0.00 ? 50  HIS E HD1  1 
ATOM 8808  H HD2  . HIS E 1 50  ? 105.481 149.576 -22.498 1.00 0.00 ? 50  HIS E HD2  1 
ATOM 8809  H HE1  . HIS E 1 50  ? 102.665 146.892 -24.130 1.00 0.00 ? 50  HIS E HE1  1 
ATOM 8810  N N    . GLY E 1 51  ? 108.028 147.586 -22.336 1.00 0.00 ? 51  GLY E N    1 
ATOM 8811  C CA   . GLY E 1 51  ? 108.904 148.478 -23.120 1.00 0.00 ? 51  GLY E CA   1 
ATOM 8812  C C    . GLY E 1 51  ? 108.404 148.625 -24.553 1.00 0.00 ? 51  GLY E C    1 
ATOM 8813  O O    . GLY E 1 51  ? 108.051 147.644 -25.201 1.00 0.00 ? 51  GLY E O    1 
ATOM 8814  H H    . GLY E 1 51  ? 107.839 146.683 -22.671 1.00 0.00 ? 51  GLY E H    1 
ATOM 8815  H HA2  . GLY E 1 51  ? 108.944 149.456 -22.658 1.00 0.00 ? 51  GLY E HA2  1 
ATOM 8816  H HA3  . GLY E 1 51  ? 109.900 148.061 -23.139 1.00 0.00 ? 51  GLY E HA3  1 
ATOM 8817  N N    . VAL E 1 52  ? 108.390 149.866 -25.053 1.00 0.00 ? 52  VAL E N    1 
ATOM 8818  C CA   . VAL E 1 52  ? 107.944 150.143 -26.430 1.00 0.00 ? 52  VAL E CA   1 
ATOM 8819  C C    . VAL E 1 52  ? 108.977 150.997 -27.154 1.00 0.00 ? 52  VAL E C    1 
ATOM 8820  O O    . VAL E 1 52  ? 109.358 152.066 -26.672 1.00 0.00 ? 52  VAL E O    1 
ATOM 8821  C CB   . VAL E 1 52  ? 106.598 150.872 -26.412 1.00 0.00 ? 52  VAL E CB   1 
ATOM 8822  C CG1  . VAL E 1 52  ? 106.158 151.166 -27.846 1.00 0.00 ? 52  VAL E CG1  1 
ATOM 8823  C CG2  . VAL E 1 52  ? 105.553 149.987 -25.733 1.00 0.00 ? 52  VAL E CG2  1 
ATOM 8824  H H    . VAL E 1 52  ? 108.693 150.610 -24.491 1.00 0.00 ? 52  VAL E H    1 
ATOM 8825  H HA   . VAL E 1 52  ? 107.826 149.211 -26.973 1.00 0.00 ? 52  VAL E HA   1 
ATOM 8826  H HB   . VAL E 1 52  ? 106.698 151.801 -25.868 1.00 0.00 ? 52  VAL E HB   1 
ATOM 8827  H HG11 . VAL E 1 52  ? 106.782 151.942 -28.263 1.00 0.00 ? 52  VAL E HG11 1 
ATOM 8828  H HG12 . VAL E 1 52  ? 105.128 151.492 -27.847 1.00 0.00 ? 52  VAL E HG12 1 
ATOM 8829  H HG13 . VAL E 1 52  ? 106.252 150.270 -28.441 1.00 0.00 ? 52  VAL E HG13 1 
ATOM 8830  H HG21 . VAL E 1 52  ? 104.655 150.561 -25.555 1.00 0.00 ? 52  VAL E HG21 1 
ATOM 8831  H HG22 . VAL E 1 52  ? 105.942 149.627 -24.795 1.00 0.00 ? 52  VAL E HG22 1 
ATOM 8832  H HG23 . VAL E 1 52  ? 105.322 149.147 -26.373 1.00 0.00 ? 52  VAL E HG23 1 
ATOM 8833  N N    . ALA E 1 53  ? 109.433 150.517 -28.318 1.00 0.00 ? 53  ALA E N    1 
ATOM 8834  C CA   . ALA E 1 53  ? 110.435 151.239 -29.119 1.00 0.00 ? 53  ALA E CA   1 
ATOM 8835  C C    . ALA E 1 53  ? 109.980 151.358 -30.571 1.00 0.00 ? 53  ALA E C    1 
ATOM 8836  O O    . ALA E 1 53  ? 109.642 150.364 -31.208 1.00 0.00 ? 53  ALA E O    1 
ATOM 8837  C CB   . ALA E 1 53  ? 111.770 150.490 -29.068 1.00 0.00 ? 53  ALA E CB   1 
ATOM 8838  H H    . ALA E 1 53  ? 109.089 149.659 -28.647 1.00 0.00 ? 53  ALA E H    1 
ATOM 8839  H HA   . ALA E 1 53  ? 110.581 152.230 -28.716 1.00 0.00 ? 53  ALA E HA   1 
ATOM 8840  H HB1  . ALA E 1 53  ? 112.440 150.896 -29.811 1.00 0.00 ? 53  ALA E HB1  1 
ATOM 8841  H HB2  . ALA E 1 53  ? 111.603 149.441 -29.270 1.00 0.00 ? 53  ALA E HB2  1 
ATOM 8842  H HB3  . ALA E 1 53  ? 112.207 150.602 -28.088 1.00 0.00 ? 53  ALA E HB3  1 
ATOM 8843  N N    . THR E 1 54  ? 109.983 152.587 -31.098 1.00 0.00 ? 54  THR E N    1 
ATOM 8844  C CA   . THR E 1 54  ? 109.575 152.833 -32.493 1.00 0.00 ? 54  THR E CA   1 
ATOM 8845  C C    . THR E 1 54  ? 110.656 153.619 -33.228 1.00 0.00 ? 54  THR E C    1 
ATOM 8846  O O    . THR E 1 54  ? 111.076 154.683 -32.773 1.00 0.00 ? 54  THR E O    1 
ATOM 8847  C CB   . THR E 1 54  ? 108.263 153.622 -32.520 1.00 0.00 ? 54  THR E CB   1 
ATOM 8848  O OG1  . THR E 1 54  ? 107.254 152.882 -31.848 1.00 0.00 ? 54  THR E OG1  1 
ATOM 8849  C CG2  . THR E 1 54  ? 107.840 153.863 -33.969 1.00 0.00 ? 54  THR E CG2  1 
ATOM 8850  H H    . THR E 1 54  ? 110.270 153.343 -30.544 1.00 0.00 ? 54  THR E H    1 
ATOM 8851  H HA   . THR E 1 54  ? 109.423 151.889 -33.006 1.00 0.00 ? 54  THR E HA   1 
ATOM 8852  H HB   . THR E 1 54  ? 108.403 154.573 -32.028 1.00 0.00 ? 54  THR E HB   1 
ATOM 8853  H HG1  . THR E 1 54  ? 107.475 151.950 -31.911 1.00 0.00 ? 54  THR E HG1  1 
ATOM 8854  H HG21 . THR E 1 54  ? 107.885 152.932 -34.517 1.00 0.00 ? 54  THR E HG21 1 
ATOM 8855  H HG22 . THR E 1 54  ? 108.507 154.579 -34.425 1.00 0.00 ? 54  THR E HG22 1 
ATOM 8856  H HG23 . THR E 1 54  ? 106.830 154.245 -33.992 1.00 0.00 ? 54  THR E HG23 1 
ATOM 8857  N N    . VAL E 1 55  ? 111.099 153.088 -34.375 1.00 0.00 ? 55  VAL E N    1 
ATOM 8858  C CA   . VAL E 1 55  ? 112.137 153.741 -35.191 1.00 0.00 ? 55  VAL E CA   1 
ATOM 8859  C C    . VAL E 1 55  ? 111.664 153.867 -36.636 1.00 0.00 ? 55  VAL E C    1 
ATOM 8860  O O    . VAL E 1 55  ? 111.312 152.870 -37.271 1.00 0.00 ? 55  VAL E O    1 
ATOM 8861  C CB   . VAL E 1 55  ? 113.421 152.910 -35.148 1.00 0.00 ? 55  VAL E CB   1 
ATOM 8862  C CG1  . VAL E 1 55  ? 114.489 153.576 -36.015 1.00 0.00 ? 55  VAL E CG1  1 
ATOM 8863  C CG2  . VAL E 1 55  ? 113.920 152.816 -33.704 1.00 0.00 ? 55  VAL E CG2  1 
ATOM 8864  H H    . VAL E 1 55  ? 110.719 152.239 -34.683 1.00 0.00 ? 55  VAL E H    1 
ATOM 8865  H HA   . VAL E 1 55  ? 112.346 154.729 -34.800 1.00 0.00 ? 55  VAL E HA   1 
ATOM 8866  H HB   . VAL E 1 55  ? 113.219 151.917 -35.526 1.00 0.00 ? 55  VAL E HB   1 
ATOM 8867  H HG11 . VAL E 1 55  ? 114.231 153.459 -37.056 1.00 0.00 ? 55  VAL E HG11 1 
ATOM 8868  H HG12 . VAL E 1 55  ? 115.445 153.111 -35.826 1.00 0.00 ? 55  VAL E HG12 1 
ATOM 8869  H HG13 . VAL E 1 55  ? 114.544 154.627 -35.773 1.00 0.00 ? 55  VAL E HG13 1 
ATOM 8870  H HG21 . VAL E 1 55  ? 114.728 152.102 -33.649 1.00 0.00 ? 55  VAL E HG21 1 
ATOM 8871  H HG22 . VAL E 1 55  ? 113.111 152.497 -33.063 1.00 0.00 ? 55  VAL E HG22 1 
ATOM 8872  H HG23 . VAL E 1 55  ? 114.272 153.786 -33.382 1.00 0.00 ? 55  VAL E HG23 1 
ATOM 8873  N N    . ALA E 1 56  ? 111.658 155.098 -37.158 1.00 0.00 ? 56  ALA E N    1 
ATOM 8874  C CA   . ALA E 1 56  ? 111.220 155.338 -38.539 1.00 0.00 ? 56  ALA E CA   1 
ATOM 8875  C C    . ALA E 1 56  ? 112.406 155.280 -39.502 1.00 0.00 ? 56  ALA E C    1 
ATOM 8876  O O    . ALA E 1 56  ? 112.597 154.287 -40.198 1.00 0.00 ? 56  ALA E O    1 
ATOM 8877  C CB   . ALA E 1 56  ? 110.540 156.704 -38.641 1.00 0.00 ? 56  ALA E CB   1 
ATOM 8878  H H    . ALA E 1 56  ? 111.949 155.856 -36.607 1.00 0.00 ? 56  ALA E H    1 
ATOM 8879  H HA   . ALA E 1 56  ? 110.504 154.577 -38.825 1.00 0.00 ? 56  ALA E HA   1 
ATOM 8880  H HB1  . ALA E 1 56  ? 111.218 157.470 -38.300 1.00 0.00 ? 56  ALA E HB1  1 
ATOM 8881  H HB2  . ALA E 1 56  ? 109.652 156.711 -38.025 1.00 0.00 ? 56  ALA E HB2  1 
ATOM 8882  H HB3  . ALA E 1 56  ? 110.267 156.896 -39.668 1.00 0.00 ? 56  ALA E HB3  1 
ATOM 8883  N N    . GLU E 1 57  ? 113.199 156.350 -39.539 1.00 0.00 ? 57  GLU E N    1 
ATOM 8884  C CA   . GLU E 1 57  ? 114.360 156.400 -40.431 1.00 0.00 ? 57  GLU E CA   1 
ATOM 8885  C C    . GLU E 1 57  ? 115.303 155.220 -40.145 1.00 0.00 ? 57  GLU E C    1 
ATOM 8886  O O    . GLU E 1 57  ? 114.917 154.249 -39.495 1.00 0.00 ? 57  GLU E O    1 
ATOM 8887  C CB   . GLU E 1 57  ? 115.106 157.752 -40.244 1.00 0.00 ? 57  GLU E CB   1 
ATOM 8888  C CG   . GLU E 1 57  ? 115.657 158.272 -41.586 1.00 0.00 ? 57  GLU E CG   1 
ATOM 8889  C CD   . GLU E 1 57  ? 114.523 158.857 -42.427 1.00 0.00 ? 57  GLU E CD   1 
ATOM 8890  O OE1  . GLU E 1 57  ? 113.416 158.939 -41.922 1.00 0.00 ? 57  GLU E OE1  1 
ATOM 8891  O OE2  . GLU E 1 57  ? 114.782 159.218 -43.564 1.00 0.00 ? 57  GLU E OE2  1 
ATOM 8892  H H    . GLU E 1 57  ? 112.999 157.117 -38.963 1.00 0.00 ? 57  GLU E H    1 
ATOM 8893  H HA   . GLU E 1 57  ? 114.009 156.326 -41.450 1.00 0.00 ? 57  GLU E HA   1 
ATOM 8894  H HB2  . GLU E 1 57  ? 114.421 158.476 -39.845 1.00 0.00 ? 57  GLU E HB2  1 
ATOM 8895  H HB3  . GLU E 1 57  ? 115.927 157.625 -39.552 1.00 0.00 ? 57  GLU E HB3  1 
ATOM 8896  H HG2  . GLU E 1 57  ? 116.393 159.039 -41.396 1.00 0.00 ? 57  GLU E HG2  1 
ATOM 8897  H HG3  . GLU E 1 57  ? 116.116 157.460 -42.126 1.00 0.00 ? 57  GLU E HG3  1 
ATOM 8898  N N    . LYS E 1 58  ? 116.544 155.320 -40.640 1.00 0.00 ? 58  LYS E N    1 
ATOM 8899  C CA   . LYS E 1 58  ? 117.555 154.264 -40.443 1.00 0.00 ? 58  LYS E CA   1 
ATOM 8900  C C    . LYS E 1 58  ? 118.549 154.669 -39.361 1.00 0.00 ? 58  LYS E C    1 
ATOM 8901  O O    . LYS E 1 58  ? 118.707 155.848 -39.069 1.00 0.00 ? 58  LYS E O    1 
ATOM 8902  C CB   . LYS E 1 58  ? 118.311 154.016 -41.758 1.00 0.00 ? 58  LYS E CB   1 
ATOM 8903  C CG   . LYS E 1 58  ? 118.709 155.348 -42.390 1.00 0.00 ? 58  LYS E CG   1 
ATOM 8904  C CD   . LYS E 1 58  ? 119.464 155.083 -43.694 1.00 0.00 ? 58  LYS E CD   1 
ATOM 8905  C CE   . LYS E 1 58  ? 119.858 156.413 -44.333 1.00 0.00 ? 58  LYS E CE   1 
ATOM 8906  N NZ   . LYS E 1 58  ? 120.605 156.155 -45.596 1.00 0.00 ? 58  LYS E NZ   1 
ATOM 8907  H H    . LYS E 1 58  ? 116.788 156.119 -41.146 1.00 0.00 ? 58  LYS E H    1 
ATOM 8908  H HA   . LYS E 1 58  ? 117.066 153.345 -40.146 1.00 0.00 ? 58  LYS E HA   1 
ATOM 8909  H HB2  . LYS E 1 58  ? 119.206 153.441 -41.558 1.00 0.00 ? 58  LYS E HB2  1 
ATOM 8910  H HB3  . LYS E 1 58  ? 117.677 153.471 -42.441 1.00 0.00 ? 58  LYS E HB3  1 
ATOM 8911  H HG2  . LYS E 1 58  ? 117.824 155.927 -42.600 1.00 0.00 ? 58  LYS E HG2  1 
ATOM 8912  H HG3  . LYS E 1 58  ? 119.347 155.895 -41.712 1.00 0.00 ? 58  LYS E HG3  1 
ATOM 8913  H HD2  . LYS E 1 58  ? 120.353 154.506 -43.483 1.00 0.00 ? 58  LYS E HD2  1 
ATOM 8914  H HD3  . LYS E 1 58  ? 118.829 154.533 -44.371 1.00 0.00 ? 58  LYS E HD3  1 
ATOM 8915  H HE2  . LYS E 1 58  ? 118.968 156.984 -44.551 1.00 0.00 ? 58  LYS E HE2  1 
ATOM 8916  H HE3  . LYS E 1 58  ? 120.484 156.968 -43.650 1.00 0.00 ? 58  LYS E HE3  1 
ATOM 8917  H HZ1  . LYS E 1 58  ? 121.375 156.845 -45.690 1.00 0.00 ? 58  LYS E HZ1  1 
ATOM 8918  H HZ2  . LYS E 1 58  ? 119.957 156.242 -46.405 1.00 0.00 ? 58  LYS E HZ2  1 
ATOM 8919  H HZ3  . LYS E 1 58  ? 121.004 155.196 -45.573 1.00 0.00 ? 58  LYS E HZ3  1 
ATOM 8920  N N    . THR E 1 59  ? 119.221 153.682 -38.774 1.00 0.00 ? 59  THR E N    1 
ATOM 8921  C CA   . THR E 1 59  ? 120.208 153.960 -37.732 1.00 0.00 ? 59  THR E CA   1 
ATOM 8922  C C    . THR E 1 59  ? 121.537 154.379 -38.360 1.00 0.00 ? 59  THR E C    1 
ATOM 8923  O O    . THR E 1 59  ? 122.240 155.245 -37.835 1.00 0.00 ? 59  THR E O    1 
ATOM 8924  C CB   . THR E 1 59  ? 120.421 152.713 -36.864 1.00 0.00 ? 59  THR E CB   1 
ATOM 8925  O OG1  . THR E 1 59  ? 120.891 151.646 -37.677 1.00 0.00 ? 59  THR E OG1  1 
ATOM 8926  C CG2  . THR E 1 59  ? 119.101 152.312 -36.206 1.00 0.00 ? 59  THR E CG2  1 
ATOM 8927  H H    . THR E 1 59  ? 119.058 152.756 -39.049 1.00 0.00 ? 59  THR E H    1 
ATOM 8928  H HA   . THR E 1 59  ? 119.846 154.763 -37.106 1.00 0.00 ? 59  THR E HA   1 
ATOM 8929  H HB   . THR E 1 59  ? 121.149 152.931 -36.098 1.00 0.00 ? 59  THR E HB   1 
ATOM 8930  H HG1  . THR E 1 59  ? 120.539 150.826 -37.322 1.00 0.00 ? 59  THR E HG1  1 
ATOM 8931  H HG21 . THR E 1 59  ? 119.277 151.501 -35.513 1.00 0.00 ? 59  THR E HG21 1 
ATOM 8932  H HG22 . THR E 1 59  ? 118.402 151.992 -36.965 1.00 0.00 ? 59  THR E HG22 1 
ATOM 8933  H HG23 . THR E 1 59  ? 118.692 153.157 -35.672 1.00 0.00 ? 59  THR E HG23 1 
ATOM 8934  N N    . LYS E 1 60  ? 121.868 153.751 -39.489 1.00 0.00 ? 60  LYS E N    1 
ATOM 8935  C CA   . LYS E 1 60  ? 123.110 154.047 -40.198 1.00 0.00 ? 60  LYS E CA   1 
ATOM 8936  C C    . LYS E 1 60  ? 124.319 153.456 -39.443 1.00 0.00 ? 60  LYS E C    1 
ATOM 8937  O O    . LYS E 1 60  ? 125.141 154.195 -38.915 1.00 0.00 ? 60  LYS E O    1 
ATOM 8938  C CB   . LYS E 1 60  ? 123.288 155.566 -40.356 1.00 0.00 ? 60  LYS E CB   1 
ATOM 8939  C CG   . LYS E 1 60  ? 124.179 155.870 -41.579 1.00 0.00 ? 60  LYS E CG   1 
ATOM 8940  C CD   . LYS E 1 60  ? 124.345 157.382 -41.749 1.00 0.00 ? 60  LYS E CD   1 
ATOM 8941  C CE   . LYS E 1 60  ? 124.979 157.671 -43.113 1.00 0.00 ? 60  LYS E CE   1 
ATOM 8942  N NZ   . LYS E 1 60  ? 124.010 157.333 -44.195 1.00 0.00 ? 60  LYS E NZ   1 
ATOM 8943  H H    . LYS E 1 60  ? 121.264 153.070 -39.852 1.00 0.00 ? 60  LYS E H    1 
ATOM 8944  H HA   . LYS E 1 60  ? 123.051 153.614 -41.170 1.00 0.00 ? 60  LYS E HA   1 
ATOM 8945  H HB2  . LYS E 1 60  ? 122.322 156.028 -40.490 1.00 0.00 ? 60  LYS E HB2  1 
ATOM 8946  H HB3  . LYS E 1 60  ? 123.748 155.954 -39.478 1.00 0.00 ? 60  LYS E HB3  1 
ATOM 8947  H HG2  . LYS E 1 60  ? 125.150 155.417 -41.435 1.00 0.00 ? 60  LYS E HG2  1 
ATOM 8948  H HG3  . LYS E 1 60  ? 123.722 155.459 -42.467 1.00 0.00 ? 60  LYS E HG3  1 
ATOM 8949  H HD2  . LYS E 1 60  ? 123.378 157.863 -41.688 1.00 0.00 ? 60  LYS E HD2  1 
ATOM 8950  H HD3  . LYS E 1 60  ? 124.988 157.763 -40.971 1.00 0.00 ? 60  LYS E HD3  1 
ATOM 8951  H HE2  . LYS E 1 60  ? 125.237 158.718 -43.176 1.00 0.00 ? 60  LYS E HE2  1 
ATOM 8952  H HE3  . LYS E 1 60  ? 125.871 157.073 -43.228 1.00 0.00 ? 60  LYS E HE3  1 
ATOM 8953  H HZ1  . LYS E 1 60  ? 124.486 156.760 -44.921 1.00 0.00 ? 60  LYS E HZ1  1 
ATOM 8954  H HZ2  . LYS E 1 60  ? 123.650 158.209 -44.625 1.00 0.00 ? 60  LYS E HZ2  1 
ATOM 8955  H HZ3  . LYS E 1 60  ? 123.218 156.792 -43.795 1.00 0.00 ? 60  LYS E HZ3  1 
ATOM 8956  N N    . GLU E 1 61  ? 124.418 152.123 -39.386 1.00 0.00 ? 61  GLU E N    1 
ATOM 8957  C CA   . GLU E 1 61  ? 125.543 151.471 -38.676 1.00 0.00 ? 61  GLU E CA   1 
ATOM 8958  C C    . GLU E 1 61  ? 126.618 151.022 -39.666 1.00 0.00 ? 61  GLU E C    1 
ATOM 8959  O O    . GLU E 1 61  ? 126.658 149.860 -40.069 1.00 0.00 ? 61  GLU E O    1 
ATOM 8960  C CB   . GLU E 1 61  ? 125.029 150.259 -37.889 1.00 0.00 ? 61  GLU E CB   1 
ATOM 8961  C CG   . GLU E 1 61  ? 124.222 150.747 -36.684 1.00 0.00 ? 61  GLU E CG   1 
ATOM 8962  C CD   . GLU E 1 61  ? 123.509 149.577 -36.015 1.00 0.00 ? 61  GLU E CD   1 
ATOM 8963  O OE1  . GLU E 1 61  ? 123.407 148.537 -36.638 1.00 0.00 ? 61  GLU E OE1  1 
ATOM 8964  O OE2  . GLU E 1 61  ? 123.074 149.741 -34.887 1.00 0.00 ? 61  GLU E OE2  1 
ATOM 8965  H H    . GLU E 1 61  ? 123.733 151.564 -39.817 1.00 0.00 ? 61  GLU E H    1 
ATOM 8966  H HA   . GLU E 1 61  ? 125.987 152.172 -37.979 1.00 0.00 ? 61  GLU E HA   1 
ATOM 8967  H HB2  . GLU E 1 61  ? 124.400 149.655 -38.527 1.00 0.00 ? 61  GLU E HB2  1 
ATOM 8968  H HB3  . GLU E 1 61  ? 125.867 149.670 -37.545 1.00 0.00 ? 61  GLU E HB3  1 
ATOM 8969  H HG2  . GLU E 1 61  ? 124.891 151.209 -35.974 1.00 0.00 ? 61  GLU E HG2  1 
ATOM 8970  H HG3  . GLU E 1 61  ? 123.490 151.472 -37.011 1.00 0.00 ? 61  GLU E HG3  1 
ATOM 8971  N N    . GLN E 1 62  ? 127.487 151.953 -40.057 1.00 0.00 ? 62  GLN E N    1 
ATOM 8972  C CA   . GLN E 1 62  ? 128.547 151.633 -41.008 1.00 0.00 ? 62  GLN E CA   1 
ATOM 8973  C C    . GLN E 1 62  ? 129.632 150.779 -40.353 1.00 0.00 ? 62  GLN E C    1 
ATOM 8974  O O    . GLN E 1 62  ? 129.633 149.556 -40.485 1.00 0.00 ? 62  GLN E O    1 
ATOM 8975  C CB   . GLN E 1 62  ? 129.175 152.919 -41.553 1.00 0.00 ? 62  GLN E CB   1 
ATOM 8976  C CG   . GLN E 1 62  ? 128.176 153.645 -42.457 1.00 0.00 ? 62  GLN E CG   1 
ATOM 8977  C CD   . GLN E 1 62  ? 128.726 155.017 -42.837 1.00 0.00 ? 62  GLN E CD   1 
ATOM 8978  O OE1  . GLN E 1 62  ? 129.545 155.581 -42.112 1.00 0.00 ? 62  GLN E OE1  1 
ATOM 8979  N NE2  . GLN E 1 62  ? 128.323 155.593 -43.937 1.00 0.00 ? 62  GLN E NE2  1 
ATOM 8980  H H    . GLN E 1 62  ? 127.411 152.866 -39.705 1.00 0.00 ? 62  GLN E H    1 
ATOM 8981  H HA   . GLN E 1 62  ? 128.119 151.081 -41.829 1.00 0.00 ? 62  GLN E HA   1 
ATOM 8982  H HB2  . GLN E 1 62  ? 129.447 153.560 -40.732 1.00 0.00 ? 62  GLN E HB2  1 
ATOM 8983  H HB3  . GLN E 1 62  ? 130.057 152.672 -42.124 1.00 0.00 ? 62  GLN E HB3  1 
ATOM 8984  H HG2  . GLN E 1 62  ? 128.012 153.063 -43.353 1.00 0.00 ? 62  GLN E HG2  1 
ATOM 8985  H HG3  . GLN E 1 62  ? 127.241 153.768 -41.933 1.00 0.00 ? 62  GLN E HG3  1 
ATOM 8986  H HE21 . GLN E 1 62  ? 127.669 155.144 -44.514 1.00 0.00 ? 62  GLN E HE21 1 
ATOM 8987  H HE22 . GLN E 1 62  ? 128.672 156.475 -44.186 1.00 0.00 ? 62  GLN E HE22 1 
ATOM 8988  N N    . VAL E 1 63  ? 130.564 151.431 -39.643 1.00 0.00 ? 63  VAL E N    1 
ATOM 8989  C CA   . VAL E 1 63  ? 131.666 150.715 -38.969 1.00 0.00 ? 63  VAL E CA   1 
ATOM 8990  C C    . VAL E 1 63  ? 131.594 150.908 -37.455 1.00 0.00 ? 63  VAL E C    1 
ATOM 8991  O O    . VAL E 1 63  ? 131.649 152.028 -36.959 1.00 0.00 ? 63  VAL E O    1 
ATOM 8992  C CB   . VAL E 1 63  ? 133.012 151.234 -39.484 1.00 0.00 ? 63  VAL E CB   1 
ATOM 8993  C CG1  . VAL E 1 63  ? 134.147 150.494 -38.775 1.00 0.00 ? 63  VAL E CG1  1 
ATOM 8994  C CG2  . VAL E 1 63  ? 133.111 150.987 -40.992 1.00 0.00 ? 63  VAL E CG2  1 
ATOM 8995  H H    . VAL E 1 63  ? 130.515 152.406 -39.571 1.00 0.00 ? 63  VAL E H    1 
ATOM 8996  H HA   . VAL E 1 63  ? 131.602 149.660 -39.185 1.00 0.00 ? 63  VAL E HA   1 
ATOM 8997  H HB   . VAL E 1 63  ? 133.091 152.293 -39.283 1.00 0.00 ? 63  VAL E HB   1 
ATOM 8998  H HG11 . VAL E 1 63  ? 133.945 149.434 -38.784 1.00 0.00 ? 63  VAL E HG11 1 
ATOM 8999  H HG12 . VAL E 1 63  ? 134.219 150.839 -37.754 1.00 0.00 ? 63  VAL E HG12 1 
ATOM 9000  H HG13 . VAL E 1 63  ? 135.078 150.688 -39.287 1.00 0.00 ? 63  VAL E HG13 1 
ATOM 9001  H HG21 . VAL E 1 63  ? 132.229 151.374 -41.480 1.00 0.00 ? 63  VAL E HG21 1 
ATOM 9002  H HG22 . VAL E 1 63  ? 133.189 149.926 -41.179 1.00 0.00 ? 63  VAL E HG22 1 
ATOM 9003  H HG23 . VAL E 1 63  ? 133.987 151.484 -41.382 1.00 0.00 ? 63  VAL E HG23 1 
ATOM 9004  N N    . THR E 1 64  ? 131.480 149.797 -36.721 1.00 0.00 ? 64  THR E N    1 
ATOM 9005  C CA   . THR E 1 64  ? 131.411 149.840 -35.249 1.00 0.00 ? 64  THR E CA   1 
ATOM 9006  C C    . THR E 1 64  ? 132.513 148.976 -34.644 1.00 0.00 ? 64  THR E C    1 
ATOM 9007  O O    . THR E 1 64  ? 132.644 147.801 -34.984 1.00 0.00 ? 64  THR E O    1 
ATOM 9008  C CB   . THR E 1 64  ? 130.048 149.326 -34.779 1.00 0.00 ? 64  THR E CB   1 
ATOM 9009  O OG1  . THR E 1 64  ? 129.020 150.135 -35.335 1.00 0.00 ? 64  THR E OG1  1 
ATOM 9010  C CG2  . THR E 1 64  ? 129.976 149.387 -33.253 1.00 0.00 ? 64  THR E CG2  1 
ATOM 9011  H H    . THR E 1 64  ? 131.447 148.927 -37.174 1.00 0.00 ? 64  THR E H    1 
ATOM 9012  H HA   . THR E 1 64  ? 131.538 150.860 -34.903 1.00 0.00 ? 64  THR E HA   1 
ATOM 9013  H HB   . THR E 1 64  ? 129.918 148.305 -35.100 1.00 0.00 ? 64  THR E HB   1 
ATOM 9014  H HG1  . THR E 1 64  ? 129.152 151.035 -35.027 1.00 0.00 ? 64  THR E HG1  1 
ATOM 9015  H HG21 . THR E 1 64  ? 130.335 150.347 -32.913 1.00 0.00 ? 64  THR E HG21 1 
ATOM 9016  H HG22 . THR E 1 64  ? 130.590 148.604 -32.833 1.00 0.00 ? 64  THR E HG22 1 
ATOM 9017  H HG23 . THR E 1 64  ? 128.954 149.251 -32.935 1.00 0.00 ? 64  THR E HG23 1 
ATOM 9018  N N    . ASN E 1 65  ? 133.309 149.568 -33.743 1.00 0.00 ? 65  ASN E N    1 
ATOM 9019  C CA   . ASN E 1 65  ? 134.412 148.847 -33.084 1.00 0.00 ? 65  ASN E CA   1 
ATOM 9020  C C    . ASN E 1 65  ? 134.352 149.044 -31.568 1.00 0.00 ? 65  ASN E C    1 
ATOM 9021  O O    . ASN E 1 65  ? 134.513 150.157 -31.070 1.00 0.00 ? 65  ASN E O    1 
ATOM 9022  C CB   . ASN E 1 65  ? 135.751 149.366 -33.613 1.00 0.00 ? 65  ASN E CB   1 
ATOM 9023  C CG   . ASN E 1 65  ? 135.838 149.147 -35.122 1.00 0.00 ? 65  ASN E CG   1 
ATOM 9024  O OD1  . ASN E 1 65  ? 135.453 148.089 -35.619 1.00 0.00 ? 65  ASN E OD1  1 
ATOM 9025  N ND2  . ASN E 1 65  ? 136.323 150.090 -35.884 1.00 0.00 ? 65  ASN E ND2  1 
ATOM 9026  H H    . ASN E 1 65  ? 133.153 150.509 -33.515 1.00 0.00 ? 65  ASN E H    1 
ATOM 9027  H HA   . ASN E 1 65  ? 134.340 147.790 -33.301 1.00 0.00 ? 65  ASN E HA   1 
ATOM 9028  H HB2  . ASN E 1 65  ? 135.836 150.421 -33.399 1.00 0.00 ? 65  ASN E HB2  1 
ATOM 9029  H HB3  . ASN E 1 65  ? 136.558 148.837 -33.130 1.00 0.00 ? 65  ASN E HB3  1 
ATOM 9030  H HD21 . ASN E 1 65  ? 136.628 150.932 -35.488 1.00 0.00 ? 65  ASN E HD21 1 
ATOM 9031  H HD22 . ASN E 1 65  ? 136.381 149.955 -36.854 1.00 0.00 ? 65  ASN E HD22 1 
ATOM 9032  N N    . VAL E 1 66  ? 134.121 147.948 -30.834 1.00 0.00 ? 66  VAL E N    1 
ATOM 9033  C CA   . VAL E 1 66  ? 134.041 148.002 -29.362 1.00 0.00 ? 66  VAL E CA   1 
ATOM 9034  C C    . VAL E 1 66  ? 134.877 146.893 -28.731 1.00 0.00 ? 66  VAL E C    1 
ATOM 9035  O O    . VAL E 1 66  ? 134.769 145.727 -29.113 1.00 0.00 ? 66  VAL E O    1 
ATOM 9036  C CB   . VAL E 1 66  ? 132.590 147.858 -28.913 1.00 0.00 ? 66  VAL E CB   1 
ATOM 9037  C CG1  . VAL E 1 66  ? 132.529 147.868 -27.383 1.00 0.00 ? 66  VAL E CG1  1 
ATOM 9038  C CG2  . VAL E 1 66  ? 131.775 149.030 -29.468 1.00 0.00 ? 66  VAL E CG2  1 
ATOM 9039  H H    . VAL E 1 66  ? 134.002 147.086 -31.287 1.00 0.00 ? 66  VAL E H    1 
ATOM 9040  H HA   . VAL E 1 66  ? 134.417 148.957 -29.011 1.00 0.00 ? 66  VAL E HA   1 
ATOM 9041  H HB   . VAL E 1 66  ? 132.187 146.927 -29.285 1.00 0.00 ? 66  VAL E HB   1 
ATOM 9042  H HG11 . VAL E 1 66  ? 133.109 148.697 -27.005 1.00 0.00 ? 66  VAL E HG11 1 
ATOM 9043  H HG12 . VAL E 1 66  ? 132.931 146.943 -26.999 1.00 0.00 ? 66  VAL E HG12 1 
ATOM 9044  H HG13 . VAL E 1 66  ? 131.507 147.972 -27.064 1.00 0.00 ? 66  VAL E HG13 1 
ATOM 9045  H HG21 . VAL E 1 66  ? 131.887 149.069 -30.542 1.00 0.00 ? 66  VAL E HG21 1 
ATOM 9046  H HG22 . VAL E 1 66  ? 132.131 149.953 -29.036 1.00 0.00 ? 66  VAL E HG22 1 
ATOM 9047  H HG23 . VAL E 1 66  ? 130.735 148.895 -29.221 1.00 0.00 ? 66  VAL E HG23 1 
ATOM 9048  N N    . GLY E 1 67  ? 135.707 147.264 -27.759 1.00 0.00 ? 67  GLY E N    1 
ATOM 9049  C CA   . GLY E 1 67  ? 136.552 146.290 -27.077 1.00 0.00 ? 67  GLY E CA   1 
ATOM 9050  C C    . GLY E 1 67  ? 135.752 145.483 -26.055 1.00 0.00 ? 67  GLY E C    1 
ATOM 9051  O O    . GLY E 1 67  ? 135.677 144.256 -26.140 1.00 0.00 ? 67  GLY E O    1 
ATOM 9052  H H    . GLY E 1 67  ? 135.748 148.206 -27.493 1.00 0.00 ? 67  GLY E H    1 
ATOM 9053  H HA2  . GLY E 1 67  ? 136.976 145.616 -27.808 1.00 0.00 ? 67  GLY E HA2  1 
ATOM 9054  H HA3  . GLY E 1 67  ? 137.350 146.809 -26.568 1.00 0.00 ? 67  GLY E HA3  1 
ATOM 9055  N N    . GLY E 1 68  ? 135.156 146.179 -25.085 1.00 0.00 ? 68  GLY E N    1 
ATOM 9056  C CA   . GLY E 1 68  ? 134.373 145.511 -24.047 1.00 0.00 ? 68  GLY E CA   1 
ATOM 9057  C C    . GLY E 1 68  ? 133.031 145.023 -24.590 1.00 0.00 ? 68  GLY E C    1 
ATOM 9058  O O    . GLY E 1 68  ? 132.976 144.048 -25.338 1.00 0.00 ? 68  GLY E O    1 
ATOM 9059  H H    . GLY E 1 68  ? 135.252 147.156 -25.062 1.00 0.00 ? 68  GLY E H    1 
ATOM 9060  H HA2  . GLY E 1 68  ? 134.932 144.666 -23.674 1.00 0.00 ? 68  GLY E HA2  1 
ATOM 9061  H HA3  . GLY E 1 68  ? 134.195 146.200 -23.236 1.00 0.00 ? 68  GLY E HA3  1 
ATOM 9062  N N    . ALA E 1 69  ? 131.947 145.700 -24.198 1.00 0.00 ? 69  ALA E N    1 
ATOM 9063  C CA   . ALA E 1 69  ? 130.595 145.319 -24.642 1.00 0.00 ? 69  ALA E CA   1 
ATOM 9064  C C    . ALA E 1 69  ? 129.766 146.558 -24.964 1.00 0.00 ? 69  ALA E C    1 
ATOM 9065  O O    . ALA E 1 69  ? 130.016 147.641 -24.433 1.00 0.00 ? 69  ALA E O    1 
ATOM 9066  C CB   . ALA E 1 69  ? 129.899 144.514 -23.544 1.00 0.00 ? 69  ALA E CB   1 
ATOM 9067  H H    . ALA E 1 69  ? 132.053 146.465 -23.593 1.00 0.00 ? 69  ALA E H    1 
ATOM 9068  H HA   . ALA E 1 69  ? 130.664 144.707 -25.532 1.00 0.00 ? 69  ALA E HA   1 
ATOM 9069  H HB1  . ALA E 1 69  ? 129.815 145.119 -22.653 1.00 0.00 ? 69  ALA E HB1  1 
ATOM 9070  H HB2  . ALA E 1 69  ? 130.476 143.629 -23.325 1.00 0.00 ? 69  ALA E HB2  1 
ATOM 9071  H HB3  . ALA E 1 69  ? 128.912 144.228 -23.879 1.00 0.00 ? 69  ALA E HB3  1 
ATOM 9072  N N    . VAL E 1 70  ? 128.769 146.390 -25.843 1.00 0.00 ? 70  VAL E N    1 
ATOM 9073  C CA   . VAL E 1 70  ? 127.894 147.507 -26.239 1.00 0.00 ? 70  VAL E CA   1 
ATOM 9074  C C    . VAL E 1 70  ? 126.442 147.049 -26.366 1.00 0.00 ? 70  VAL E C    1 
ATOM 9075  O O    . VAL E 1 70  ? 126.146 146.046 -27.005 1.00 0.00 ? 70  VAL E O    1 
ATOM 9076  C CB   . VAL E 1 70  ? 128.385 148.104 -27.571 1.00 0.00 ? 70  VAL E CB   1 
ATOM 9077  C CG1  . VAL E 1 70  ? 128.649 146.975 -28.569 1.00 0.00 ? 70  VAL E CG1  1 
ATOM 9078  C CG2  . VAL E 1 70  ? 127.328 149.075 -28.151 1.00 0.00 ? 70  VAL E CG2  1 
ATOM 9079  H H    . VAL E 1 70  ? 128.619 145.501 -26.232 1.00 0.00 ? 70  VAL E H    1 
ATOM 9080  H HA   . VAL E 1 70  ? 127.941 148.272 -25.484 1.00 0.00 ? 70  VAL E HA   1 
ATOM 9081  H HB   . VAL E 1 70  ? 129.302 148.639 -27.395 1.00 0.00 ? 70  VAL E HB   1 
ATOM 9082  H HG11 . VAL E 1 70  ? 129.425 146.328 -28.186 1.00 0.00 ? 70  VAL E HG11 1 
ATOM 9083  H HG12 . VAL E 1 70  ? 128.961 147.393 -29.514 1.00 0.00 ? 70  VAL E HG12 1 
ATOM 9084  H HG13 . VAL E 1 70  ? 127.747 146.407 -28.711 1.00 0.00 ? 70  VAL E HG13 1 
ATOM 9085  H HG21 . VAL E 1 70  ? 126.855 149.618 -27.346 1.00 0.00 ? 70  VAL E HG21 1 
ATOM 9086  H HG22 . VAL E 1 70  ? 126.577 148.518 -28.695 1.00 0.00 ? 70  VAL E HG22 1 
ATOM 9087  H HG23 . VAL E 1 70  ? 127.812 149.772 -28.820 1.00 0.00 ? 70  VAL E HG23 1 
ATOM 9088  N N    . VAL E 1 71  ? 125.535 147.813 -25.752 1.00 0.00 ? 71  VAL E N    1 
ATOM 9089  C CA   . VAL E 1 71  ? 124.096 147.500 -25.798 1.00 0.00 ? 71  VAL E CA   1 
ATOM 9090  C C    . VAL E 1 71  ? 123.313 148.716 -26.275 1.00 0.00 ? 71  VAL E C    1 
ATOM 9091  O O    . VAL E 1 71  ? 123.405 149.795 -25.690 1.00 0.00 ? 71  VAL E O    1 
ATOM 9092  C CB   . VAL E 1 71  ? 123.610 147.092 -24.405 1.00 0.00 ? 71  VAL E CB   1 
ATOM 9093  C CG1  . VAL E 1 71  ? 122.119 146.751 -24.461 1.00 0.00 ? 71  VAL E CG1  1 
ATOM 9094  C CG2  . VAL E 1 71  ? 124.396 145.869 -23.936 1.00 0.00 ? 71  VAL E CG2  1 
ATOM 9095  H H    . VAL E 1 71  ? 125.838 148.612 -25.263 1.00 0.00 ? 71  VAL E H    1 
ATOM 9096  H HA   . VAL E 1 71  ? 123.919 146.681 -26.483 1.00 0.00 ? 71  VAL E HA   1 
ATOM 9097  H HB   . VAL E 1 71  ? 123.768 147.910 -23.716 1.00 0.00 ? 71  VAL E HB   1 
ATOM 9098  H HG11 . VAL E 1 71  ? 121.820 146.296 -23.528 1.00 0.00 ? 71  VAL E HG11 1 
ATOM 9099  H HG12 . VAL E 1 71  ? 121.939 146.062 -25.271 1.00 0.00 ? 71  VAL E HG12 1 
ATOM 9100  H HG13 . VAL E 1 71  ? 121.548 147.653 -24.621 1.00 0.00 ? 71  VAL E HG13 1 
ATOM 9101  H HG21 . VAL E 1 71  ? 125.448 146.020 -24.124 1.00 0.00 ? 71  VAL E HG21 1 
ATOM 9102  H HG22 . VAL E 1 71  ? 124.057 144.996 -24.473 1.00 0.00 ? 71  VAL E HG22 1 
ATOM 9103  H HG23 . VAL E 1 71  ? 124.238 145.726 -22.882 1.00 0.00 ? 71  VAL E HG23 1 
ATOM 9104  N N    . THR E 1 72  ? 122.535 148.543 -27.348 1.00 0.00 ? 72  THR E N    1 
ATOM 9105  C CA   . THR E 1 72  ? 121.733 149.648 -27.907 1.00 0.00 ? 72  THR E CA   1 
ATOM 9106  C C    . THR E 1 72  ? 120.263 149.249 -28.022 1.00 0.00 ? 72  THR E C    1 
ATOM 9107  O O    . THR E 1 72  ? 119.941 148.092 -28.293 1.00 0.00 ? 72  THR E O    1 
ATOM 9108  C CB   . THR E 1 72  ? 122.270 150.019 -29.295 1.00 0.00 ? 72  THR E CB   1 
ATOM 9109  O OG1  . THR E 1 72  ? 122.142 148.903 -30.166 1.00 0.00 ? 72  THR E OG1  1 
ATOM 9110  C CG2  . THR E 1 72  ? 123.744 150.417 -29.188 1.00 0.00 ? 72  THR E CG2  1 
ATOM 9111  H H    . THR E 1 72  ? 122.501 147.659 -27.777 1.00 0.00 ? 72  THR E H    1 
ATOM 9112  H HA   . THR E 1 72  ? 121.806 150.516 -27.265 1.00 0.00 ? 72  THR E HA   1 
ATOM 9113  H HB   . THR E 1 72  ? 121.705 150.849 -29.689 1.00 0.00 ? 72  THR E HB   1 
ATOM 9114  H HG1  . THR E 1 72  ? 122.292 149.208 -31.064 1.00 0.00 ? 72  THR E HG1  1 
ATOM 9115  H HG21 . THR E 1 72  ? 124.349 149.529 -29.069 1.00 0.00 ? 72  THR E HG21 1 
ATOM 9116  H HG22 . THR E 1 72  ? 123.883 151.063 -28.333 1.00 0.00 ? 72  THR E HG22 1 
ATOM 9117  H HG23 . THR E 1 72  ? 124.043 150.939 -30.085 1.00 0.00 ? 72  THR E HG23 1 
ATOM 9118  N N    . GLY E 1 73  ? 119.368 150.227 -27.827 1.00 0.00 ? 73  GLY E N    1 
ATOM 9119  C CA   . GLY E 1 73  ? 117.917 149.980 -27.918 1.00 0.00 ? 73  GLY E CA   1 
ATOM 9120  C C    . GLY E 1 73  ? 117.221 150.272 -26.592 1.00 0.00 ? 73  GLY E C    1 
ATOM 9121  O O    . GLY E 1 73  ? 117.358 151.357 -26.033 1.00 0.00 ? 73  GLY E O    1 
ATOM 9122  H H    . GLY E 1 73  ? 119.691 151.137 -27.620 1.00 0.00 ? 73  GLY E H    1 
ATOM 9123  H HA2  . GLY E 1 73  ? 117.500 150.623 -28.680 1.00 0.00 ? 73  GLY E HA2  1 
ATOM 9124  H HA3  . GLY E 1 73  ? 117.734 148.951 -28.192 1.00 0.00 ? 73  GLY E HA3  1 
ATOM 9125  N N    . VAL E 1 74  ? 116.457 149.292 -26.089 1.00 0.00 ? 74  VAL E N    1 
ATOM 9126  C CA   . VAL E 1 74  ? 115.729 149.460 -24.819 1.00 0.00 ? 74  VAL E CA   1 
ATOM 9127  C C    . VAL E 1 74  ? 115.781 148.180 -23.973 1.00 0.00 ? 74  VAL E C    1 
ATOM 9128  O O    . VAL E 1 74  ? 115.486 147.092 -24.449 1.00 0.00 ? 74  VAL E O    1 
ATOM 9129  C CB   . VAL E 1 74  ? 114.263 149.851 -25.116 1.00 0.00 ? 74  VAL E CB   1 
ATOM 9130  C CG1  . VAL E 1 74  ? 113.690 148.925 -26.191 1.00 0.00 ? 74  VAL E CG1  1 
ATOM 9131  C CG2  . VAL E 1 74  ? 113.409 149.742 -23.832 1.00 0.00 ? 74  VAL E CG2  1 
ATOM 9132  H H    . VAL E 1 74  ? 116.378 148.447 -26.578 1.00 0.00 ? 74  VAL E H    1 
ATOM 9133  H HA   . VAL E 1 74  ? 116.183 150.257 -24.253 1.00 0.00 ? 74  VAL E HA   1 
ATOM 9134  H HB   . VAL E 1 74  ? 114.236 150.867 -25.479 1.00 0.00 ? 74  VAL E HB   1 
ATOM 9135  H HG11 . VAL E 1 74  ? 112.637 149.124 -26.315 1.00 0.00 ? 74  VAL E HG11 1 
ATOM 9136  H HG12 . VAL E 1 74  ? 113.828 147.903 -25.893 1.00 0.00 ? 74  VAL E HG12 1 
ATOM 9137  H HG13 . VAL E 1 74  ? 114.201 149.099 -27.127 1.00 0.00 ? 74  VAL E HG13 1 
ATOM 9138  H HG21 . VAL E 1 74  ? 112.520 150.346 -23.940 1.00 0.00 ? 74  VAL E HG21 1 
ATOM 9139  H HG22 . VAL E 1 74  ? 113.980 150.093 -22.987 1.00 0.00 ? 74  VAL E HG22 1 
ATOM 9140  H HG23 . VAL E 1 74  ? 113.127 148.712 -23.668 1.00 0.00 ? 74  VAL E HG23 1 
ATOM 9141  N N    . THR E 1 75  ? 116.151 148.336 -22.698 1.00 0.00 ? 75  THR E N    1 
ATOM 9142  C CA   . THR E 1 75  ? 116.227 147.198 -21.765 1.00 0.00 ? 75  THR E CA   1 
ATOM 9143  C C    . THR E 1 75  ? 115.483 147.538 -20.484 1.00 0.00 ? 75  THR E C    1 
ATOM 9144  O O    . THR E 1 75  ? 115.725 148.579 -19.879 1.00 0.00 ? 75  THR E O    1 
ATOM 9145  C CB   . THR E 1 75  ? 117.688 146.882 -21.433 1.00 0.00 ? 75  THR E CB   1 
ATOM 9146  O OG1  . THR E 1 75  ? 118.385 146.574 -22.630 1.00 0.00 ? 75  THR E OG1  1 
ATOM 9147  C CG2  . THR E 1 75  ? 117.747 145.686 -20.479 1.00 0.00 ? 75  THR E CG2  1 
ATOM 9148  H H    . THR E 1 75  ? 116.365 149.234 -22.370 1.00 0.00 ? 75  THR E H    1 
ATOM 9149  H HA   . THR E 1 75  ? 115.773 146.325 -22.211 1.00 0.00 ? 75  THR E HA   1 
ATOM 9150  H HB   . THR E 1 75  ? 118.143 147.737 -20.960 1.00 0.00 ? 75  THR E HB   1 
ATOM 9151  H HG1  . THR E 1 75  ? 118.099 147.193 -23.306 1.00 0.00 ? 75  THR E HG1  1 
ATOM 9152  H HG21 . THR E 1 75  ? 118.756 145.304 -20.443 1.00 0.00 ? 75  THR E HG21 1 
ATOM 9153  H HG22 . THR E 1 75  ? 117.081 144.911 -20.831 1.00 0.00 ? 75  THR E HG22 1 
ATOM 9154  H HG23 . THR E 1 75  ? 117.445 145.999 -19.490 1.00 0.00 ? 75  THR E HG23 1 
ATOM 9155  N N    . ALA E 1 76  ? 114.570 146.662 -20.058 1.00 0.00 ? 76  ALA E N    1 
ATOM 9156  C CA   . ALA E 1 76  ? 113.799 146.911 -18.830 1.00 0.00 ? 76  ALA E CA   1 
ATOM 9157  C C    . ALA E 1 76  ? 113.652 145.640 -18.006 1.00 0.00 ? 76  ALA E C    1 
ATOM 9158  O O    . ALA E 1 76  ? 113.415 144.574 -18.542 1.00 0.00 ? 76  ALA E O    1 
ATOM 9159  C CB   . ALA E 1 76  ? 112.418 147.450 -19.186 1.00 0.00 ? 76  ALA E CB   1 
ATOM 9160  H H    . ALA E 1 76  ? 114.408 145.844 -20.573 1.00 0.00 ? 76  ALA E H    1 
ATOM 9161  H HA   . ALA E 1 76  ? 114.307 147.642 -18.236 1.00 0.00 ? 76  ALA E HA   1 
ATOM 9162  H HB1  . ALA E 1 76  ? 112.516 148.442 -19.604 1.00 0.00 ? 76  ALA E HB1  1 
ATOM 9163  H HB2  . ALA E 1 76  ? 111.815 147.492 -18.297 1.00 0.00 ? 76  ALA E HB2  1 
ATOM 9164  H HB3  . ALA E 1 76  ? 111.951 146.800 -19.910 1.00 0.00 ? 76  ALA E HB3  1 
ATOM 9165  N N    . VAL E 1 77  ? 113.786 145.751 -16.682 1.00 0.00 ? 77  VAL E N    1 
ATOM 9166  C CA   . VAL E 1 77  ? 113.654 144.571 -15.813 1.00 0.00 ? 77  VAL E CA   1 
ATOM 9167  C C    . VAL E 1 77  ? 112.893 144.923 -14.534 1.00 0.00 ? 77  VAL E C    1 
ATOM 9168  O O    . VAL E 1 77  ? 113.058 146.010 -13.978 1.00 0.00 ? 77  VAL E O    1 
ATOM 9169  C CB   . VAL E 1 77  ? 115.056 144.022 -15.465 1.00 0.00 ? 77  VAL E CB   1 
ATOM 9170  C CG1  . VAL E 1 77  ? 115.926 143.977 -16.736 1.00 0.00 ? 77  VAL E CG1  1 
ATOM 9171  C CG2  . VAL E 1 77  ? 115.731 144.920 -14.418 1.00 0.00 ? 77  VAL E CG2  1 
ATOM 9172  H H    . VAL E 1 77  ? 113.972 146.629 -16.286 1.00 0.00 ? 77  VAL E H    1 
ATOM 9173  H HA   . VAL E 1 77  ? 113.101 143.799 -16.332 1.00 0.00 ? 77  VAL E HA   1 
ATOM 9174  H HB   . VAL E 1 77  ? 114.956 143.022 -15.065 1.00 0.00 ? 77  VAL E HB   1 
ATOM 9175  H HG11 . VAL E 1 77  ? 116.752 143.298 -16.582 1.00 0.00 ? 77  VAL E HG11 1 
ATOM 9176  H HG12 . VAL E 1 77  ? 116.310 144.965 -16.948 1.00 0.00 ? 77  VAL E HG12 1 
ATOM 9177  H HG13 . VAL E 1 77  ? 115.336 143.639 -17.572 1.00 0.00 ? 77  VAL E HG13 1 
ATOM 9178  H HG21 . VAL E 1 77  ? 115.545 145.946 -14.663 1.00 0.00 ? 77  VAL E HG21 1 
ATOM 9179  H HG22 . VAL E 1 77  ? 116.796 144.737 -14.412 1.00 0.00 ? 77  VAL E HG22 1 
ATOM 9180  H HG23 . VAL E 1 77  ? 115.323 144.704 -13.441 1.00 0.00 ? 77  VAL E HG23 1 
ATOM 9181  N N    . ALA E 1 78  ? 112.066 143.984 -14.067 1.00 0.00 ? 78  ALA E N    1 
ATOM 9182  C CA   . ALA E 1 78  ? 111.281 144.178 -12.838 1.00 0.00 ? 78  ALA E CA   1 
ATOM 9183  C C    . ALA E 1 78  ? 111.732 143.178 -11.782 1.00 0.00 ? 78  ALA E C    1 
ATOM 9184  O O    . ALA E 1 78  ? 111.614 141.974 -11.975 1.00 0.00 ? 78  ALA E O    1 
ATOM 9185  C CB   . ALA E 1 78  ? 109.794 143.968 -13.132 1.00 0.00 ? 78  ALA E CB   1 
ATOM 9186  H H    . ALA E 1 78  ? 111.986 143.134 -14.553 1.00 0.00 ? 78  ALA E H    1 
ATOM 9187  H HA   . ALA E 1 78  ? 111.425 145.182 -12.459 1.00 0.00 ? 78  ALA E HA   1 
ATOM 9188  H HB1  . ALA E 1 78  ? 109.211 144.293 -12.283 1.00 0.00 ? 78  ALA E HB1  1 
ATOM 9189  H HB2  . ALA E 1 78  ? 109.608 142.921 -13.316 1.00 0.00 ? 78  ALA E HB2  1 
ATOM 9190  H HB3  . ALA E 1 78  ? 109.515 144.542 -14.002 1.00 0.00 ? 78  ALA E HB3  1 
ATOM 9191  N N    . GLN E 1 79  ? 112.256 143.690 -10.664 1.00 0.00 ? 79  GLN E N    1 
ATOM 9192  C CA   . GLN E 1 79  ? 112.732 142.837 -9.567  1.00 0.00 ? 79  GLN E CA   1 
ATOM 9193  C C    . GLN E 1 79  ? 112.350 143.469 -8.229  1.00 0.00 ? 79  GLN E C    1 
ATOM 9194  O O    . GLN E 1 79  ? 112.054 144.659 -8.166  1.00 0.00 ? 79  GLN E O    1 
ATOM 9195  C CB   . GLN E 1 79  ? 114.259 142.685 -9.648  1.00 0.00 ? 79  GLN E CB   1 
ATOM 9196  C CG   . GLN E 1 79  ? 114.674 142.436 -11.098 1.00 0.00 ? 79  GLN E CG   1 
ATOM 9197  C CD   . GLN E 1 79  ? 116.174 142.171 -11.174 1.00 0.00 ? 79  GLN E CD   1 
ATOM 9198  O OE1  . GLN E 1 79  ? 116.975 143.015 -10.774 1.00 0.00 ? 79  GLN E OE1  1 
ATOM 9199  N NE2  . GLN E 1 79  ? 116.603 141.041 -11.664 1.00 0.00 ? 79  GLN E NE2  1 
ATOM 9200  H H    . GLN E 1 79  ? 112.327 144.660 -10.574 1.00 0.00 ? 79  GLN E H    1 
ATOM 9201  H HA   . GLN E 1 79  ? 112.276 141.860 -9.636  1.00 0.00 ? 79  GLN E HA   1 
ATOM 9202  H HB2  . GLN E 1 79  ? 114.729 143.582 -9.288  1.00 0.00 ? 79  GLN E HB2  1 
ATOM 9203  H HB3  . GLN E 1 79  ? 114.568 141.848 -9.041  1.00 0.00 ? 79  GLN E HB3  1 
ATOM 9204  H HG2  . GLN E 1 79  ? 114.140 141.586 -11.483 1.00 0.00 ? 79  GLN E HG2  1 
ATOM 9205  H HG3  . GLN E 1 79  ? 114.437 143.305 -11.692 1.00 0.00 ? 79  GLN E HG3  1 
ATOM 9206  H HE21 . GLN E 1 79  ? 115.963 140.369 -11.980 1.00 0.00 ? 79  GLN E HE21 1 
ATOM 9207  H HE22 . GLN E 1 79  ? 117.564 140.863 -11.713 1.00 0.00 ? 79  GLN E HE22 1 
ATOM 9208  N N    . LYS E 1 80  ? 112.354 142.673 -7.152  1.00 0.00 ? 80  LYS E N    1 
ATOM 9209  C CA   . LYS E 1 80  ? 112.009 143.190 -5.811  1.00 0.00 ? 80  LYS E CA   1 
ATOM 9210  C C    . LYS E 1 80  ? 113.230 143.132 -4.902  1.00 0.00 ? 80  LYS E C    1 
ATOM 9211  O O    . LYS E 1 80  ? 113.706 144.158 -4.426  1.00 0.00 ? 80  LYS E O    1 
ATOM 9212  C CB   . LYS E 1 80  ? 110.871 142.366 -5.199  1.00 0.00 ? 80  LYS E CB   1 
ATOM 9213  C CG   . LYS E 1 80  ? 110.287 143.104 -3.989  1.00 0.00 ? 80  LYS E CG   1 
ATOM 9214  C CD   . LYS E 1 80  ? 109.064 142.341 -3.479  1.00 0.00 ? 80  LYS E CD   1 
ATOM 9215  C CE   . LYS E 1 80  ? 108.413 143.113 -2.330  1.00 0.00 ? 80  LYS E CE   1 
ATOM 9216  N NZ   . LYS E 1 80  ? 107.193 142.387 -1.879  1.00 0.00 ? 80  LYS E NZ   1 
ATOM 9217  H H    . LYS E 1 80  ? 112.598 141.730 -7.253  1.00 0.00 ? 80  LYS E H    1 
ATOM 9218  H HA   . LYS E 1 80  ? 111.687 144.223 -5.887  1.00 0.00 ? 80  LYS E HA   1 
ATOM 9219  H HB2  . LYS E 1 80  ? 110.098 142.216 -5.938  1.00 0.00 ? 80  LYS E HB2  1 
ATOM 9220  H HB3  . LYS E 1 80  ? 111.252 141.411 -4.878  1.00 0.00 ? 80  LYS E HB3  1 
ATOM 9221  H HG2  . LYS E 1 80  ? 111.032 143.161 -3.208  1.00 0.00 ? 80  LYS E HG2  1 
ATOM 9222  H HG3  . LYS E 1 80  ? 109.991 144.101 -4.280  1.00 0.00 ? 80  LYS E HG3  1 
ATOM 9223  H HD2  . LYS E 1 80  ? 108.352 142.224 -4.284  1.00 0.00 ? 80  LYS E HD2  1 
ATOM 9224  H HD3  . LYS E 1 80  ? 109.370 141.368 -3.126  1.00 0.00 ? 80  LYS E HD3  1 
ATOM 9225  H HE2  . LYS E 1 80  ? 109.110 143.193 -1.509  1.00 0.00 ? 80  LYS E HE2  1 
ATOM 9226  H HE3  . LYS E 1 80  ? 108.140 144.101 -2.669  1.00 0.00 ? 80  LYS E HE3  1 
ATOM 9227  H HZ1  . LYS E 1 80  ? 106.877 141.741 -2.631  1.00 0.00 ? 80  LYS E HZ1  1 
ATOM 9228  H HZ2  . LYS E 1 80  ? 106.439 143.073 -1.671  1.00 0.00 ? 80  LYS E HZ2  1 
ATOM 9229  H HZ3  . LYS E 1 80  ? 107.411 141.839 -1.024  1.00 0.00 ? 80  LYS E HZ3  1 
ATOM 9230  N N    . THR E 1 81  ? 113.750 141.920 -4.671  1.00 0.00 ? 81  THR E N    1 
ATOM 9231  C CA   . THR E 1 81  ? 114.934 141.746 -3.810  1.00 0.00 ? 81  THR E CA   1 
ATOM 9232  C C    . THR E 1 81  ? 115.928 140.773 -4.441  1.00 0.00 ? 81  THR E C    1 
ATOM 9233  O O    . THR E 1 81  ? 115.542 139.812 -5.092  1.00 0.00 ? 81  THR E O    1 
ATOM 9234  C CB   . THR E 1 81  ? 114.502 141.214 -2.441  1.00 0.00 ? 81  THR E CB   1 
ATOM 9235  O OG1  . THR E 1 81  ? 115.637 141.120 -1.591  1.00 0.00 ? 81  THR E OG1  1 
ATOM 9236  C CG2  . THR E 1 81  ? 113.868 139.832 -2.605  1.00 0.00 ? 81  THR E CG2  1 
ATOM 9237  H H    . THR E 1 81  ? 113.336 141.134 -5.085  1.00 0.00 ? 81  THR E H    1 
ATOM 9238  H HA   . THR E 1 81  ? 115.423 142.696 -3.673  1.00 0.00 ? 81  THR E HA   1 
ATOM 9239  H HB   . THR E 1 81  ? 113.781 141.887 -2.006  1.00 0.00 ? 81  THR E HB   1 
ATOM 9240  H HG1  . THR E 1 81  ? 116.150 140.356 -1.863  1.00 0.00 ? 81  THR E HG1  1 
ATOM 9241  H HG21 . THR E 1 81  ? 113.171 139.852 -3.430  1.00 0.00 ? 81  THR E HG21 1 
ATOM 9242  H HG22 . THR E 1 81  ? 113.344 139.566 -1.699  1.00 0.00 ? 81  THR E HG22 1 
ATOM 9243  H HG23 . THR E 1 81  ? 114.639 139.102 -2.802  1.00 0.00 ? 81  THR E HG23 1 
ATOM 9244  N N    . VAL E 1 82  ? 117.224 141.034 -4.239  1.00 0.00 ? 82  VAL E N    1 
ATOM 9245  C CA   . VAL E 1 82  ? 118.279 140.169 -4.797  1.00 0.00 ? 82  VAL E CA   1 
ATOM 9246  C C    . VAL E 1 82  ? 119.446 140.037 -3.816  1.00 0.00 ? 82  VAL E C    1 
ATOM 9247  O O    . VAL E 1 82  ? 119.797 140.983 -3.121  1.00 0.00 ? 82  VAL E O    1 
ATOM 9248  C CB   . VAL E 1 82  ? 118.768 140.745 -6.142  1.00 0.00 ? 82  VAL E CB   1 
ATOM 9249  C CG1  . VAL E 1 82  ? 119.055 142.240 -5.986  1.00 0.00 ? 82  VAL E CG1  1 
ATOM 9250  C CG2  . VAL E 1 82  ? 120.052 140.016 -6.600  1.00 0.00 ? 82  VAL E CG2  1 
ATOM 9251  H H    . VAL E 1 82  ? 117.478 141.818 -3.708  1.00 0.00 ? 82  VAL E H    1 
ATOM 9252  H HA   . VAL E 1 82  ? 117.872 139.188 -4.972  1.00 0.00 ? 82  VAL E HA   1 
ATOM 9253  H HB   . VAL E 1 82  ? 117.996 140.611 -6.885  1.00 0.00 ? 82  VAL E HB   1 
ATOM 9254  H HG11 . VAL E 1 82  ? 119.587 142.408 -5.066  1.00 0.00 ? 82  VAL E HG11 1 
ATOM 9255  H HG12 . VAL E 1 82  ? 118.124 142.786 -5.967  1.00 0.00 ? 82  VAL E HG12 1 
ATOM 9256  H HG13 . VAL E 1 82  ? 119.655 142.582 -6.818  1.00 0.00 ? 82  VAL E HG13 1 
ATOM 9257  H HG21 . VAL E 1 82  ? 119.975 138.964 -6.368  1.00 0.00 ? 82  VAL E HG21 1 
ATOM 9258  H HG22 . VAL E 1 82  ? 120.910 140.430 -6.088  1.00 0.00 ? 82  VAL E HG22 1 
ATOM 9259  H HG23 . VAL E 1 82  ? 120.175 140.141 -7.666  1.00 0.00 ? 82  VAL E HG23 1 
ATOM 9260  N N    . GLU E 1 83  ? 120.048 138.844 -3.768  1.00 0.00 ? 83  GLU E N    1 
ATOM 9261  C CA   . GLU E 1 83  ? 121.183 138.598 -2.866  1.00 0.00 ? 83  GLU E CA   1 
ATOM 9262  C C    . GLU E 1 83  ? 122.171 137.611 -3.488  1.00 0.00 ? 83  GLU E C    1 
ATOM 9263  O O    . GLU E 1 83  ? 121.780 136.675 -4.175  1.00 0.00 ? 83  GLU E O    1 
ATOM 9264  C CB   . GLU E 1 83  ? 120.673 138.044 -1.531  1.00 0.00 ? 83  GLU E CB   1 
ATOM 9265  C CG   . GLU E 1 83  ? 119.931 136.726 -1.769  1.00 0.00 ? 83  GLU E CG   1 
ATOM 9266  C CD   . GLU E 1 83  ? 119.328 136.223 -0.462  1.00 0.00 ? 83  GLU E CD   1 
ATOM 9267  O OE1  . GLU E 1 83  ? 119.496 136.895 0.543   1.00 0.00 ? 83  GLU E OE1  1 
ATOM 9268  O OE2  . GLU E 1 83  ? 118.705 135.175 -0.486  1.00 0.00 ? 83  GLU E OE2  1 
ATOM 9269  H H    . GLU E 1 83  ? 119.726 138.119 -4.347  1.00 0.00 ? 83  GLU E H    1 
ATOM 9270  H HA   . GLU E 1 83  ? 121.696 139.526 -2.679  1.00 0.00 ? 83  GLU E HA   1 
ATOM 9271  H HB2  . GLU E 1 83  ? 121.510 137.871 -0.870  1.00 0.00 ? 83  GLU E HB2  1 
ATOM 9272  H HB3  . GLU E 1 83  ? 119.999 138.756 -1.079  1.00 0.00 ? 83  GLU E HB3  1 
ATOM 9273  H HG2  . GLU E 1 83  ? 119.145 136.884 -2.491  1.00 0.00 ? 83  GLU E HG2  1 
ATOM 9274  H HG3  . GLU E 1 83  ? 120.624 135.990 -2.148  1.00 0.00 ? 83  GLU E HG3  1 
ATOM 9275  N N    . GLY E 1 84  ? 123.461 137.829 -3.234  1.00 0.00 ? 84  GLY E N    1 
ATOM 9276  C CA   . GLY E 1 84  ? 124.500 136.948 -3.774  1.00 0.00 ? 84  GLY E CA   1 
ATOM 9277  C C    . GLY E 1 84  ? 125.819 137.691 -3.940  1.00 0.00 ? 84  GLY E C    1 
ATOM 9278  O O    . GLY E 1 84  ? 125.865 138.782 -4.507  1.00 0.00 ? 84  GLY E O    1 
ATOM 9279  H H    . GLY E 1 84  ? 123.719 138.592 -2.676  1.00 0.00 ? 84  GLY E H    1 
ATOM 9280  H HA2  . GLY E 1 84  ? 124.643 136.117 -3.099  1.00 0.00 ? 84  GLY E HA2  1 
ATOM 9281  H HA3  . GLY E 1 84  ? 124.188 136.572 -4.738  1.00 0.00 ? 84  GLY E HA3  1 
ATOM 9282  N N    . ALA E 1 85  ? 126.897 137.089 -3.451  1.00 0.00 ? 85  ALA E N    1 
ATOM 9283  C CA   . ALA E 1 85  ? 128.210 137.706 -3.564  1.00 0.00 ? 85  ALA E CA   1 
ATOM 9284  C C    . ALA E 1 85  ? 128.708 137.638 -5.005  1.00 0.00 ? 85  ALA E C    1 
ATOM 9285  O O    . ALA E 1 85  ? 128.732 136.568 -5.613  1.00 0.00 ? 85  ALA E O    1 
ATOM 9286  C CB   . ALA E 1 85  ? 129.200 136.991 -2.643  1.00 0.00 ? 85  ALA E CB   1 
ATOM 9287  H H    . ALA E 1 85  ? 126.807 136.215 -3.016  1.00 0.00 ? 85  ALA E H    1 
ATOM 9288  H HA   . ALA E 1 85  ? 128.139 138.740 -3.265  1.00 0.00 ? 85  ALA E HA   1 
ATOM 9289  H HB1  . ALA E 1 85  ? 130.179 137.436 -2.753  1.00 0.00 ? 85  ALA E HB1  1 
ATOM 9290  H HB2  . ALA E 1 85  ? 129.247 135.945 -2.908  1.00 0.00 ? 85  ALA E HB2  1 
ATOM 9291  H HB3  . ALA E 1 85  ? 128.873 137.089 -1.619  1.00 0.00 ? 85  ALA E HB3  1 
ATOM 9292  N N    . GLY E 1 86  ? 129.104 138.785 -5.545  1.00 0.00 ? 86  GLY E N    1 
ATOM 9293  C CA   . GLY E 1 86  ? 129.601 138.842 -6.914  1.00 0.00 ? 86  GLY E CA   1 
ATOM 9294  C C    . GLY E 1 86  ? 128.461 138.683 -7.915  1.00 0.00 ? 86  GLY E C    1 
ATOM 9295  O O    . GLY E 1 86  ? 128.688 138.591 -9.122  1.00 0.00 ? 86  GLY E O    1 
ATOM 9296  H H    . GLY E 1 86  ? 129.065 139.607 -5.012  1.00 0.00 ? 86  GLY E H    1 
ATOM 9297  H HA2  . GLY E 1 86  ? 130.088 139.792 -7.076  1.00 0.00 ? 86  GLY E HA2  1 
ATOM 9298  H HA3  . GLY E 1 86  ? 130.315 138.047 -7.066  1.00 0.00 ? 86  GLY E HA3  1 
ATOM 9299  N N    . SER E 1 87  ? 127.233 138.646 -7.404  1.00 0.00 ? 87  SER E N    1 
ATOM 9300  C CA   . SER E 1 87  ? 126.059 138.493 -8.257  1.00 0.00 ? 87  SER E CA   1 
ATOM 9301  C C    . SER E 1 87  ? 125.663 139.829 -8.877  1.00 0.00 ? 87  SER E C    1 
ATOM 9302  O O    . SER E 1 87  ? 125.933 140.894 -8.317  1.00 0.00 ? 87  SER E O    1 
ATOM 9303  C CB   . SER E 1 87  ? 124.891 137.934 -7.444  1.00 0.00 ? 87  SER E CB   1 
ATOM 9304  O OG   . SER E 1 87  ? 123.724 137.904 -8.257  1.00 0.00 ? 87  SER E OG   1 
ATOM 9305  H H    . SER E 1 87  ? 127.113 138.722 -6.435  1.00 0.00 ? 87  SER E H    1 
ATOM 9306  H HA   . SER E 1 87  ? 126.291 137.797 -9.051  1.00 0.00 ? 87  SER E HA   1 
ATOM 9307  H HB2  . SER E 1 87  ? 125.123 136.934 -7.122  1.00 0.00 ? 87  SER E HB2  1 
ATOM 9308  H HB3  . SER E 1 87  ? 124.724 138.560 -6.577  1.00 0.00 ? 87  SER E HB3  1 
ATOM 9309  H HG   . SER E 1 87  ? 123.246 137.097 -8.058  1.00 0.00 ? 87  SER E HG   1 
ATOM 9310  N N    . ILE E 1 88  ? 125.018 139.765 -10.047 1.00 0.00 ? 88  ILE E N    1 
ATOM 9311  C CA   . ILE E 1 88  ? 124.576 140.978 -10.754 1.00 0.00 ? 88  ILE E CA   1 
ATOM 9312  C C    . ILE E 1 88  ? 123.077 140.893 -11.038 1.00 0.00 ? 88  ILE E C    1 
ATOM 9313  O O    . ILE E 1 88  ? 122.593 139.884 -11.552 1.00 0.00 ? 88  ILE E O    1 
ATOM 9314  C CB   . ILE E 1 88  ? 125.379 141.134 -12.072 1.00 0.00 ? 88  ILE E CB   1 
ATOM 9315  C CG1  . ILE E 1 88  ? 124.862 140.138 -13.133 1.00 0.00 ? 88  ILE E CG1  1 
ATOM 9316  C CG2  . ILE E 1 88  ? 126.876 140.864 -11.803 1.00 0.00 ? 88  ILE E CG2  1 
ATOM 9317  C CD1  . ILE E 1 88  ? 125.809 140.122 -14.340 1.00 0.00 ? 88  ILE E CD1  1 
ATOM 9318  H H    . ILE E 1 88  ? 124.829 138.883 -10.441 1.00 0.00 ? 88  ILE E H    1 
ATOM 9319  H HA   . ILE E 1 88  ? 124.756 141.851 -10.133 1.00 0.00 ? 88  ILE E HA   1 
ATOM 9320  H HB   . ILE E 1 88  ? 125.263 142.144 -12.441 1.00 0.00 ? 88  ILE E HB   1 
ATOM 9321  H HG12 . ILE E 1 88  ? 124.811 139.157 -12.702 1.00 0.00 ? 88  ILE E HG12 1 
ATOM 9322  H HG13 . ILE E 1 88  ? 123.879 140.437 -13.461 1.00 0.00 ? 88  ILE E HG13 1 
ATOM 9323  H HG21 . ILE E 1 88  ? 127.469 141.348 -12.564 1.00 0.00 ? 88  ILE E HG21 1 
ATOM 9324  H HG22 . ILE E 1 88  ? 127.066 139.799 -11.824 1.00 0.00 ? 88  ILE E HG22 1 
ATOM 9325  H HG23 . ILE E 1 88  ? 127.152 141.252 -10.834 1.00 0.00 ? 88  ILE E HG23 1 
ATOM 9326  H HD11 . ILE E 1 88  ? 126.706 139.575 -14.085 1.00 0.00 ? 88  ILE E HD11 1 
ATOM 9327  H HD12 . ILE E 1 88  ? 126.070 141.135 -14.608 1.00 0.00 ? 88  ILE E HD12 1 
ATOM 9328  H HD13 . ILE E 1 88  ? 125.320 139.642 -15.174 1.00 0.00 ? 88  ILE E HD13 1 
ATOM 9329  N N    . ALA E 1 89  ? 122.343 141.952 -10.697 1.00 0.00 ? 89  ALA E N    1 
ATOM 9330  C CA   . ALA E 1 89  ? 120.898 141.970 -10.922 1.00 0.00 ? 89  ALA E CA   1 
ATOM 9331  C C    . ALA E 1 89  ? 120.590 142.406 -12.348 1.00 0.00 ? 89  ALA E C    1 
ATOM 9332  O O    . ALA E 1 89  ? 119.998 141.656 -13.120 1.00 0.00 ? 89  ALA E O    1 
ATOM 9333  C CB   . ALA E 1 89  ? 120.228 142.930 -9.938  1.00 0.00 ? 89  ALA E CB   1 
ATOM 9334  H H    . ALA E 1 89  ? 122.777 142.730 -10.287 1.00 0.00 ? 89  ALA E H    1 
ATOM 9335  H HA   . ALA E 1 89  ? 120.500 140.977 -10.765 1.00 0.00 ? 89  ALA E HA   1 
ATOM 9336  H HB1  . ALA E 1 89  ? 119.163 142.738 -9.916  1.00 0.00 ? 89  ALA E HB1  1 
ATOM 9337  H HB2  . ALA E 1 89  ? 120.402 143.946 -10.250 1.00 0.00 ? 89  ALA E HB2  1 
ATOM 9338  H HB3  . ALA E 1 89  ? 120.639 142.780 -8.951  1.00 0.00 ? 89  ALA E HB3  1 
ATOM 9339  N N    . ALA E 1 90  ? 121.004 143.627 -12.692 1.00 0.00 ? 90  ALA E N    1 
ATOM 9340  C CA   . ALA E 1 90  ? 120.777 144.173 -14.037 1.00 0.00 ? 90  ALA E CA   1 
ATOM 9341  C C    . ALA E 1 90  ? 122.057 144.804 -14.569 1.00 0.00 ? 90  ALA E C    1 
ATOM 9342  O O    . ALA E 1 90  ? 122.565 145.771 -14.000 1.00 0.00 ? 90  ALA E O    1 
ATOM 9343  C CB   . ALA E 1 90  ? 119.664 145.228 -13.985 1.00 0.00 ? 90  ALA E CB   1 
ATOM 9344  H H    . ALA E 1 90  ? 121.473 144.175 -12.030 1.00 0.00 ? 90  ALA E H    1 
ATOM 9345  H HA   . ALA E 1 90  ? 120.474 143.381 -14.711 1.00 0.00 ? 90  ALA E HA   1 
ATOM 9346  H HB1  . ALA E 1 90  ? 120.062 146.158 -13.601 1.00 0.00 ? 90  ALA E HB1  1 
ATOM 9347  H HB2  . ALA E 1 90  ? 118.874 144.882 -13.337 1.00 0.00 ? 90  ALA E HB2  1 
ATOM 9348  H HB3  . ALA E 1 90  ? 119.272 145.387 -14.980 1.00 0.00 ? 90  ALA E HB3  1 
ATOM 9349  N N    . ALA E 1 91  ? 122.577 144.254 -15.670 1.00 0.00 ? 91  ALA E N    1 
ATOM 9350  C CA   . ALA E 1 91  ? 123.808 144.779 -16.277 1.00 0.00 ? 91  ALA E CA   1 
ATOM 9351  C C    . ALA E 1 91  ? 123.749 144.677 -17.798 1.00 0.00 ? 91  ALA E C    1 
ATOM 9352  O O    . ALA E 1 91  ? 123.601 143.592 -18.353 1.00 0.00 ? 91  ALA E O    1 
ATOM 9353  C CB   . ALA E 1 91  ? 125.020 143.995 -15.761 1.00 0.00 ? 91  ALA E CB   1 
ATOM 9354  H H    . ALA E 1 91  ? 122.127 143.486 -16.081 1.00 0.00 ? 91  ALA E H    1 
ATOM 9355  H HA   . ALA E 1 91  ? 123.928 145.815 -16.005 1.00 0.00 ? 91  ALA E HA   1 
ATOM 9356  H HB1  . ALA E 1 91  ? 125.921 144.559 -15.951 1.00 0.00 ? 91  ALA E HB1  1 
ATOM 9357  H HB2  . ALA E 1 91  ? 125.078 143.042 -16.267 1.00 0.00 ? 91  ALA E HB2  1 
ATOM 9358  H HB3  . ALA E 1 91  ? 124.916 143.831 -14.699 1.00 0.00 ? 91  ALA E HB3  1 
ATOM 9359  N N    . THR E 1 92  ? 123.879 145.816 -18.475 1.00 0.00 ? 92  THR E N    1 
ATOM 9360  C CA   . THR E 1 92  ? 123.848 145.836 -19.942 1.00 0.00 ? 92  THR E CA   1 
ATOM 9361  C C    . THR E 1 92  ? 125.266 145.736 -20.495 1.00 0.00 ? 92  THR E C    1 
ATOM 9362  O O    . THR E 1 92  ? 126.034 146.697 -20.434 1.00 0.00 ? 92  THR E O    1 
ATOM 9363  C CB   . THR E 1 92  ? 123.191 147.126 -20.437 1.00 0.00 ? 92  THR E CB   1 
ATOM 9364  O OG1  . THR E 1 92  ? 124.121 148.194 -20.348 1.00 0.00 ? 92  THR E OG1  1 
ATOM 9365  C CG2  . THR E 1 92  ? 121.969 147.439 -19.576 1.00 0.00 ? 92  THR E CG2  1 
ATOM 9366  H H    . THR E 1 92  ? 124.004 146.657 -17.984 1.00 0.00 ? 92  THR E H    1 
ATOM 9367  H HA   . THR E 1 92  ? 123.272 144.993 -20.303 1.00 0.00 ? 92  THR E HA   1 
ATOM 9368  H HB   . THR E 1 92  ? 122.879 147.003 -21.463 1.00 0.00 ? 92  THR E HB   1 
ATOM 9369  H HG1  . THR E 1 92  ? 124.923 147.928 -20.803 1.00 0.00 ? 92  THR E HG1  1 
ATOM 9370  H HG21 . THR E 1 92  ? 121.443 148.287 -19.990 1.00 0.00 ? 92  THR E HG21 1 
ATOM 9371  H HG22 . THR E 1 92  ? 122.287 147.667 -18.570 1.00 0.00 ? 92  THR E HG22 1 
ATOM 9372  H HG23 . THR E 1 92  ? 121.312 146.582 -19.560 1.00 0.00 ? 92  THR E HG23 1 
ATOM 9373  N N    . GLY E 1 93  ? 125.604 144.566 -21.031 1.00 0.00 ? 93  GLY E N    1 
ATOM 9374  C CA   . GLY E 1 93  ? 126.934 144.343 -21.588 1.00 0.00 ? 93  GLY E CA   1 
ATOM 9375  C C    . GLY E 1 93  ? 127.932 144.015 -20.482 1.00 0.00 ? 93  GLY E C    1 
ATOM 9376  O O    . GLY E 1 93  ? 128.523 144.914 -19.884 1.00 0.00 ? 93  GLY E O    1 
ATOM 9377  H H    . GLY E 1 93  ? 124.949 143.837 -21.049 1.00 0.00 ? 93  GLY E H    1 
ATOM 9378  H HA2  . GLY E 1 93  ? 126.892 143.519 -22.288 1.00 0.00 ? 93  GLY E HA2  1 
ATOM 9379  H HA3  . GLY E 1 93  ? 127.259 145.233 -22.105 1.00 0.00 ? 93  GLY E HA3  1 
ATOM 9380  N N    . PHE E 1 94  ? 128.112 142.719 -20.208 1.00 0.00 ? 94  PHE E N    1 
ATOM 9381  C CA   . PHE E 1 94  ? 129.042 142.270 -19.158 1.00 0.00 ? 94  PHE E CA   1 
ATOM 9382  C C    . PHE E 1 94  ? 130.144 141.405 -19.766 1.00 0.00 ? 94  PHE E C    1 
ATOM 9383  O O    . PHE E 1 94  ? 129.870 140.361 -20.356 1.00 0.00 ? 94  PHE E O    1 
ATOM 9384  C CB   . PHE E 1 94  ? 128.278 141.449 -18.112 1.00 0.00 ? 94  PHE E CB   1 
ATOM 9385  C CG   . PHE E 1 94  ? 129.128 141.281 -16.873 1.00 0.00 ? 94  PHE E CG   1 
ATOM 9386  C CD1  . PHE E 1 94  ? 130.112 140.287 -16.828 1.00 0.00 ? 94  PHE E CD1  1 
ATOM 9387  C CD2  . PHE E 1 94  ? 128.933 142.124 -15.772 1.00 0.00 ? 94  PHE E CD2  1 
ATOM 9388  C CE1  . PHE E 1 94  ? 130.901 140.136 -15.681 1.00 0.00 ? 94  PHE E CE1  1 
ATOM 9389  C CE2  . PHE E 1 94  ? 129.721 141.974 -14.626 1.00 0.00 ? 94  PHE E CE2  1 
ATOM 9390  C CZ   . PHE E 1 94  ? 130.705 140.979 -14.580 1.00 0.00 ? 94  PHE E CZ   1 
ATOM 9391  H H    . PHE E 1 94  ? 127.609 142.049 -20.715 1.00 0.00 ? 94  PHE E H    1 
ATOM 9392  H HA   . PHE E 1 94  ? 129.493 143.126 -18.672 1.00 0.00 ? 94  PHE E HA   1 
ATOM 9393  H HB2  . PHE E 1 94  ? 127.363 141.960 -17.852 1.00 0.00 ? 94  PHE E HB2  1 
ATOM 9394  H HB3  . PHE E 1 94  ? 128.042 140.477 -18.519 1.00 0.00 ? 94  PHE E HB3  1 
ATOM 9395  H HD1  . PHE E 1 94  ? 130.263 139.636 -17.677 1.00 0.00 ? 94  PHE E HD1  1 
ATOM 9396  H HD2  . PHE E 1 94  ? 128.174 142.891 -15.809 1.00 0.00 ? 94  PHE E HD2  1 
ATOM 9397  H HE1  . PHE E 1 94  ? 131.660 139.369 -15.646 1.00 0.00 ? 94  PHE E HE1  1 
ATOM 9398  H HE2  . PHE E 1 94  ? 129.571 142.625 -13.778 1.00 0.00 ? 94  PHE E HE2  1 
ATOM 9399  H HZ   . PHE E 1 94  ? 131.313 140.862 -13.696 1.00 0.00 ? 94  PHE E HZ   1 
ATOM 9400  N N    . VAL E 1 95  ? 131.397 141.842 -19.616 1.00 0.00 ? 95  VAL E N    1 
ATOM 9401  C CA   . VAL E 1 95  ? 132.541 141.090 -20.156 1.00 0.00 ? 95  VAL E CA   1 
ATOM 9402  C C    . VAL E 1 95  ? 133.731 141.153 -19.193 1.00 0.00 ? 95  VAL E C    1 
ATOM 9403  O O    . VAL E 1 95  ? 134.206 142.229 -18.835 1.00 0.00 ? 95  VAL E O    1 
ATOM 9404  C CB   . VAL E 1 95  ? 132.926 141.658 -21.539 1.00 0.00 ? 95  VAL E CB   1 
ATOM 9405  C CG1  . VAL E 1 95  ? 132.976 143.184 -21.474 1.00 0.00 ? 95  VAL E CG1  1 
ATOM 9406  C CG2  . VAL E 1 95  ? 134.304 141.114 -21.975 1.00 0.00 ? 95  VAL E CG2  1 
ATOM 9407  H H    . VAL E 1 95  ? 131.559 142.681 -19.133 1.00 0.00 ? 95  VAL E H    1 
ATOM 9408  H HA   . VAL E 1 95  ? 132.260 140.053 -20.278 1.00 0.00 ? 95  VAL E HA   1 
ATOM 9409  H HB   . VAL E 1 95  ? 132.180 141.362 -22.263 1.00 0.00 ? 95  VAL E HB   1 
ATOM 9410  H HG11 . VAL E 1 95  ? 133.696 143.489 -20.738 1.00 0.00 ? 95  VAL E HG11 1 
ATOM 9411  H HG12 . VAL E 1 95  ? 132.002 143.566 -21.206 1.00 0.00 ? 95  VAL E HG12 1 
ATOM 9412  H HG13 . VAL E 1 95  ? 133.262 143.573 -22.438 1.00 0.00 ? 95  VAL E HG13 1 
ATOM 9413  H HG21 . VAL E 1 95  ? 134.381 140.071 -21.708 1.00 0.00 ? 95  VAL E HG21 1 
ATOM 9414  H HG22 . VAL E 1 95  ? 135.087 141.668 -21.477 1.00 0.00 ? 95  VAL E HG22 1 
ATOM 9415  H HG23 . VAL E 1 95  ? 134.413 141.222 -23.045 1.00 0.00 ? 95  VAL E HG23 1 
ATOM 9416  N N    . LYS E 1 96  ? 134.216 139.977 -18.781 1.00 0.00 ? 96  LYS E N    1 
ATOM 9417  C CA   . LYS E 1 96  ? 135.363 139.889 -17.860 1.00 0.00 ? 96  LYS E CA   1 
ATOM 9418  C C    . LYS E 1 96  ? 136.470 139.041 -18.482 1.00 0.00 ? 96  LYS E C    1 
ATOM 9419  O O    . LYS E 1 96  ? 136.258 137.876 -18.816 1.00 0.00 ? 96  LYS E O    1 
ATOM 9420  C CB   . LYS E 1 96  ? 134.917 139.259 -16.537 1.00 0.00 ? 96  LYS E CB   1 
ATOM 9421  C CG   . LYS E 1 96  ? 136.087 139.267 -15.548 1.00 0.00 ? 96  LYS E CG   1 
ATOM 9422  C CD   . LYS E 1 96  ? 135.629 138.701 -14.201 1.00 0.00 ? 96  LYS E CD   1 
ATOM 9423  C CE   . LYS E 1 96  ? 136.801 138.725 -13.216 1.00 0.00 ? 96  LYS E CE   1 
ATOM 9424  N NZ   . LYS E 1 96  ? 136.357 138.202 -11.893 1.00 0.00 ? 96  LYS E NZ   1 
ATOM 9425  H H    . LYS E 1 96  ? 133.799 139.149 -19.104 1.00 0.00 ? 96  LYS E H    1 
ATOM 9426  H HA   . LYS E 1 96  ? 135.753 140.882 -17.660 1.00 0.00 ? 96  LYS E HA   1 
ATOM 9427  H HB2  . LYS E 1 96  ? 134.093 139.825 -16.127 1.00 0.00 ? 96  LYS E HB2  1 
ATOM 9428  H HB3  . LYS E 1 96  ? 134.604 138.241 -16.711 1.00 0.00 ? 96  LYS E HB3  1 
ATOM 9429  H HG2  . LYS E 1 96  ? 136.891 138.660 -15.937 1.00 0.00 ? 96  LYS E HG2  1 
ATOM 9430  H HG3  . LYS E 1 96  ? 136.434 140.280 -15.411 1.00 0.00 ? 96  LYS E HG3  1 
ATOM 9431  H HD2  . LYS E 1 96  ? 134.819 139.303 -13.814 1.00 0.00 ? 96  LYS E HD2  1 
ATOM 9432  H HD3  . LYS E 1 96  ? 135.293 137.685 -14.333 1.00 0.00 ? 96  LYS E HD3  1 
ATOM 9433  H HE2  . LYS E 1 96  ? 137.602 138.108 -13.596 1.00 0.00 ? 96  LYS E HE2  1 
ATOM 9434  H HE3  . LYS E 1 96  ? 137.154 139.740 -13.102 1.00 0.00 ? 96  LYS E HE3  1 
ATOM 9435  H HZ1  . LYS E 1 96  ? 135.529 138.739 -11.567 1.00 0.00 ? 96  LYS E HZ1  1 
ATOM 9436  H HZ2  . LYS E 1 96  ? 137.131 138.304 -11.203 1.00 0.00 ? 96  LYS E HZ2  1 
ATOM 9437  H HZ3  . LYS E 1 96  ? 136.103 137.198 -11.983 1.00 0.00 ? 96  LYS E HZ3  1 
ATOM 9438  N N    . LYS E 1 97  ? 137.657 139.636 -18.640 1.00 0.00 ? 97  LYS E N    1 
ATOM 9439  C CA   . LYS E 1 97  ? 138.812 138.934 -19.231 1.00 0.00 ? 97  LYS E CA   1 
ATOM 9440  C C    . LYS E 1 97  ? 139.991 138.942 -18.260 1.00 0.00 ? 97  LYS E C    1 
ATOM 9441  O O    . LYS E 1 97  ? 140.379 139.994 -17.757 1.00 0.00 ? 97  LYS E O    1 
ATOM 9442  C CB   . LYS E 1 97  ? 139.207 139.622 -20.542 1.00 0.00 ? 97  LYS E CB   1 
ATOM 9443  C CG   . LYS E 1 97  ? 140.426 138.925 -21.142 1.00 0.00 ? 97  LYS E CG   1 
ATOM 9444  C CD   . LYS E 1 97  ? 140.673 139.461 -22.554 1.00 0.00 ? 97  LYS E CD   1 
ATOM 9445  C CE   . LYS E 1 97  ? 141.945 138.833 -23.122 1.00 0.00 ? 97  LYS E CE   1 
ATOM 9446  N NZ   . LYS E 1 97  ? 143.135 139.435 -22.457 1.00 0.00 ? 97  LYS E NZ   1 
ATOM 9447  H H    . LYS E 1 97  ? 137.762 140.569 -18.356 1.00 0.00 ? 97  LYS E H    1 
ATOM 9448  H HA   . LYS E 1 97  ? 138.546 137.905 -19.445 1.00 0.00 ? 97  LYS E HA   1 
ATOM 9449  H HB2  . LYS E 1 97  ? 138.382 139.566 -21.237 1.00 0.00 ? 97  LYS E HB2  1 
ATOM 9450  H HB3  . LYS E 1 97  ? 139.445 140.657 -20.347 1.00 0.00 ? 97  LYS E HB3  1 
ATOM 9451  H HG2  . LYS E 1 97  ? 141.290 139.119 -20.525 1.00 0.00 ? 97  LYS E HG2  1 
ATOM 9452  H HG3  . LYS E 1 97  ? 140.246 137.862 -21.189 1.00 0.00 ? 97  LYS E HG3  1 
ATOM 9453  H HD2  . LYS E 1 97  ? 139.833 139.210 -23.186 1.00 0.00 ? 97  LYS E HD2  1 
ATOM 9454  H HD3  . LYS E 1 97  ? 140.789 140.533 -22.516 1.00 0.00 ? 97  LYS E HD3  1 
ATOM 9455  H HE2  . LYS E 1 97  ? 141.933 137.768 -22.941 1.00 0.00 ? 97  LYS E HE2  1 
ATOM 9456  H HE3  . LYS E 1 97  ? 141.995 139.016 -24.184 1.00 0.00 ? 97  LYS E HE3  1 
ATOM 9457  H HZ1  . LYS E 1 97  ? 142.941 139.553 -21.443 1.00 0.00 ? 97  LYS E HZ1  1 
ATOM 9458  H HZ2  . LYS E 1 97  ? 143.335 140.364 -22.882 1.00 0.00 ? 97  LYS E HZ2  1 
ATOM 9459  H HZ3  . LYS E 1 97  ? 143.956 138.812 -22.582 1.00 0.00 ? 97  LYS E HZ3  1 
ATOM 9460  N N    . ASP E 1 98  ? 140.552 137.754 -17.985 1.00 0.00 ? 98  ASP E N    1 
ATOM 9461  C CA   . ASP E 1 98  ? 141.688 137.632 -17.046 1.00 0.00 ? 98  ASP E CA   1 
ATOM 9462  C C    . ASP E 1 98  ? 142.849 136.858 -17.669 1.00 0.00 ? 98  ASP E C    1 
ATOM 9463  O O    . ASP E 1 98  ? 142.827 135.627 -17.726 1.00 0.00 ? 98  ASP E O    1 
ATOM 9464  C CB   . ASP E 1 98  ? 141.230 136.908 -15.784 1.00 0.00 ? 98  ASP E CB   1 
ATOM 9465  C CG   . ASP E 1 98  ? 142.382 136.821 -14.793 1.00 0.00 ? 98  ASP E CG   1 
ATOM 9466  O OD1  . ASP E 1 98  ? 143.475 137.230 -15.150 1.00 0.00 ? 98  ASP E OD1  1 
ATOM 9467  O OD2  . ASP E 1 98  ? 142.157 136.352 -13.692 1.00 0.00 ? 98  ASP E OD2  1 
ATOM 9468  H H    . ASP E 1 98  ? 140.194 136.944 -18.410 1.00 0.00 ? 98  ASP E H    1 
ATOM 9469  H HA   . ASP E 1 98  ? 142.041 138.617 -16.768 1.00 0.00 ? 98  ASP E HA   1 
ATOM 9470  H HB2  . ASP E 1 98  ? 140.410 137.450 -15.337 1.00 0.00 ? 98  ASP E HB2  1 
ATOM 9471  H HB3  . ASP E 1 98  ? 140.903 135.910 -16.041 1.00 0.00 ? 98  ASP E HB3  1 
ATOM 9472  N N    . GLN E 1 99  ? 143.862 137.587 -18.125 1.00 0.00 ? 99  GLN E N    1 
ATOM 9473  C CA   . GLN E 1 99  ? 145.033 136.961 -18.734 1.00 0.00 ? 99  GLN E CA   1 
ATOM 9474  C C    . GLN E 1 99  ? 145.911 136.292 -17.675 1.00 0.00 ? 99  GLN E C    1 
ATOM 9475  O O    . GLN E 1 99  ? 146.436 135.200 -17.891 1.00 0.00 ? 99  GLN E O    1 
ATOM 9476  C CB   . GLN E 1 99  ? 145.844 138.011 -19.488 1.00 0.00 ? 99  GLN E CB   1 
ATOM 9477  C CG   . GLN E 1 99  ? 144.978 138.602 -20.600 1.00 0.00 ? 99  GLN E CG   1 
ATOM 9478  C CD   . GLN E 1 99  ? 145.779 139.610 -21.414 1.00 0.00 ? 99  GLN E CD   1 
ATOM 9479  O OE1  . GLN E 1 99  ? 146.748 139.242 -22.078 1.00 0.00 ? 99  GLN E OE1  1 
ATOM 9480  N NE2  . GLN E 1 99  ? 145.433 140.869 -21.403 1.00 0.00 ? 99  GLN E NE2  1 
ATOM 9481  H H    . GLN E 1 99  ? 143.825 138.563 -18.045 1.00 0.00 ? 99  GLN E H    1 
ATOM 9482  H HA   . GLN E 1 99  ? 144.701 136.212 -19.435 1.00 0.00 ? 99  GLN E HA   1 
ATOM 9483  H HB2  . GLN E 1 99  ? 146.146 138.795 -18.806 1.00 0.00 ? 99  GLN E HB2  1 
ATOM 9484  H HB3  . GLN E 1 99  ? 146.719 137.551 -19.922 1.00 0.00 ? 99  GLN E HB3  1 
ATOM 9485  H HG2  . GLN E 1 99  ? 144.638 137.807 -21.245 1.00 0.00 ? 99  GLN E HG2  1 
ATOM 9486  H HG3  . GLN E 1 99  ? 144.125 139.097 -20.160 1.00 0.00 ? 99  GLN E HG3  1 
ATOM 9487  H HE21 . GLN E 1 99  ? 144.663 141.161 -20.872 1.00 0.00 ? 99  GLN E HE21 1 
ATOM 9488  H HE22 . GLN E 1 99  ? 145.943 141.522 -21.925 1.00 0.00 ? 99  GLN E HE22 1 
ATOM 9489  N N    . LEU E 1 100 ? 146.070 136.960 -16.525 1.00 0.00 ? 100 LEU E N    1 
ATOM 9490  C CA   . LEU E 1 100 ? 146.894 136.432 -15.423 1.00 0.00 ? 100 LEU E CA   1 
ATOM 9491  C C    . LEU E 1 100 ? 146.147 136.557 -14.101 1.00 0.00 ? 100 LEU E C    1 
ATOM 9492  O O    . LEU E 1 100 ? 145.690 137.639 -13.733 1.00 0.00 ? 100 LEU E O    1 
ATOM 9493  C CB   . LEU E 1 100 ? 148.226 137.202 -15.360 1.00 0.00 ? 100 LEU E CB   1 
ATOM 9494  C CG   . LEU E 1 100 ? 149.060 136.769 -14.137 1.00 0.00 ? 100 LEU E CG   1 
ATOM 9495  C CD1  . LEU E 1 100 ? 149.303 135.249 -14.170 1.00 0.00 ? 100 LEU E CD1  1 
ATOM 9496  C CD2  . LEU E 1 100 ? 150.408 137.501 -14.182 1.00 0.00 ? 100 LEU E CD2  1 
ATOM 9497  H H    . LEU E 1 100 ? 145.628 137.828 -16.414 1.00 0.00 ? 100 LEU E H    1 
ATOM 9498  H HA   . LEU E 1 100 ? 147.106 135.385 -15.601 1.00 0.00 ? 100 LEU E HA   1 
ATOM 9499  H HB2  . LEU E 1 100 ? 148.790 137.011 -16.259 1.00 0.00 ? 100 LEU E HB2  1 
ATOM 9500  H HB3  . LEU E 1 100 ? 148.019 138.260 -15.289 1.00 0.00 ? 100 LEU E HB3  1 
ATOM 9501  H HG   . LEU E 1 100 ? 148.540 137.032 -13.228 1.00 0.00 ? 100 LEU E HG   1 
ATOM 9502  H HD11 . LEU E 1 100 ? 149.501 134.936 -15.185 1.00 0.00 ? 100 LEU E HD11 1 
ATOM 9503  H HD12 . LEU E 1 100 ? 148.430 134.737 -13.798 1.00 0.00 ? 100 LEU E HD12 1 
ATOM 9504  H HD13 . LEU E 1 100 ? 150.152 135.002 -13.545 1.00 0.00 ? 100 LEU E HD13 1 
ATOM 9505  H HD21 . LEU E 1 100 ? 150.240 138.567 -14.157 1.00 0.00 ? 100 LEU E HD21 1 
ATOM 9506  H HD22 . LEU E 1 100 ? 150.928 137.240 -15.092 1.00 0.00 ? 100 LEU E HD22 1 
ATOM 9507  H HD23 . LEU E 1 100 ? 151.005 137.210 -13.331 1.00 0.00 ? 100 LEU E HD23 1 
ATOM 9508  N N    . GLY E 1 101 ? 146.025 135.442 -13.392 1.00 0.00 ? 101 GLY E N    1 
ATOM 9509  C CA   . GLY E 1 101 ? 145.329 135.434 -12.114 1.00 0.00 ? 101 GLY E CA   1 
ATOM 9510  C C    . GLY E 1 101 ? 145.527 134.104 -11.406 1.00 0.00 ? 101 GLY E C    1 
ATOM 9511  O O    . GLY E 1 101 ? 146.031 133.146 -11.992 1.00 0.00 ? 101 GLY E O    1 
ATOM 9512  H H    . GLY E 1 101 ? 146.408 134.608 -13.737 1.00 0.00 ? 101 GLY E H    1 
ATOM 9513  H HA2  . GLY E 1 101 ? 145.716 136.231 -11.494 1.00 0.00 ? 101 GLY E HA2  1 
ATOM 9514  H HA3  . GLY E 1 101 ? 144.275 135.592 -12.280 1.00 0.00 ? 101 GLY E HA3  1 
ATOM 9515  N N    . LYS E 1 102 ? 145.128 134.048 -10.142 1.00 0.00 ? 102 LYS E N    1 
ATOM 9516  C CA   . LYS E 1 102 ? 145.266 132.826 -9.356  1.00 0.00 ? 102 LYS E CA   1 
ATOM 9517  C C    . LYS E 1 102 ? 144.269 132.811 -8.203  1.00 0.00 ? 102 LYS E C    1 
ATOM 9518  O O    . LYS E 1 102 ? 143.884 133.861 -7.688  1.00 0.00 ? 102 LYS E O    1 
ATOM 9519  C CB   . LYS E 1 102 ? 146.696 132.717 -8.820  1.00 0.00 ? 102 LYS E CB   1 
ATOM 9520  C CG   . LYS E 1 102 ? 147.052 133.998 -8.064  1.00 0.00 ? 102 LYS E CG   1 
ATOM 9521  C CD   . LYS E 1 102 ? 148.475 133.889 -7.509  1.00 0.00 ? 102 LYS E CD   1 
ATOM 9522  C CE   . LYS E 1 102 ? 148.851 135.197 -6.811  1.00 0.00 ? 102 LYS E CE   1 
ATOM 9523  N NZ   . LYS E 1 102 ? 150.222 135.082 -6.239  1.00 0.00 ? 102 LYS E NZ   1 
ATOM 9524  H H    . LYS E 1 102 ? 144.734 134.843 -9.727  1.00 0.00 ? 102 LYS E H    1 
ATOM 9525  H HA   . LYS E 1 102 ? 145.070 131.973 -9.993  1.00 0.00 ? 102 LYS E HA   1 
ATOM 9526  H HB2  . LYS E 1 102 ? 146.768 131.871 -8.152  1.00 0.00 ? 102 LYS E HB2  1 
ATOM 9527  H HB3  . LYS E 1 102 ? 147.381 132.585 -9.644  1.00 0.00 ? 102 LYS E HB3  1 
ATOM 9528  H HG2  . LYS E 1 102 ? 146.995 134.841 -8.739  1.00 0.00 ? 102 LYS E HG2  1 
ATOM 9529  H HG3  . LYS E 1 102 ? 146.361 134.141 -7.250  1.00 0.00 ? 102 LYS E HG3  1 
ATOM 9530  H HD2  . LYS E 1 102 ? 148.521 133.074 -6.800  1.00 0.00 ? 102 LYS E HD2  1 
ATOM 9531  H HD3  . LYS E 1 102 ? 149.165 133.703 -8.317  1.00 0.00 ? 102 LYS E HD3  1 
ATOM 9532  H HE2  . LYS E 1 102 ? 148.827 136.006 -7.526  1.00 0.00 ? 102 LYS E HE2  1 
ATOM 9533  H HE3  . LYS E 1 102 ? 148.145 135.398 -6.017  1.00 0.00 ? 102 LYS E HE3  1 
ATOM 9534  H HZ1  . LYS E 1 102 ? 150.283 134.227 -5.652  1.00 0.00 ? 102 LYS E HZ1  1 
ATOM 9535  H HZ2  . LYS E 1 102 ? 150.426 135.920 -5.655  1.00 0.00 ? 102 LYS E HZ2  1 
ATOM 9536  H HZ3  . LYS E 1 102 ? 150.916 135.020 -7.011  1.00 0.00 ? 102 LYS E HZ3  1 
ATOM 9537  N N    . ASN E 1 103 ? 143.849 131.606 -7.807  1.00 0.00 ? 103 ASN E N    1 
ATOM 9538  C CA   . ASN E 1 103 ? 142.882 131.440 -6.710  1.00 0.00 ? 103 ASN E CA   1 
ATOM 9539  C C    . ASN E 1 103 ? 143.580 130.941 -5.451  1.00 0.00 ? 103 ASN E C    1 
ATOM 9540  O O    . ASN E 1 103 ? 144.461 130.084 -5.517  1.00 0.00 ? 103 ASN E O    1 
ATOM 9541  C CB   . ASN E 1 103 ? 141.802 130.437 -7.119  1.00 0.00 ? 103 ASN E CB   1 
ATOM 9542  C CG   . ASN E 1 103 ? 140.641 130.494 -6.132  1.00 0.00 ? 103 ASN E CG   1 
ATOM 9543  O OD1  . ASN E 1 103 ? 140.276 131.573 -5.665  1.00 0.00 ? 103 ASN E OD1  1 
ATOM 9544  N ND2  . ASN E 1 103 ? 140.040 129.390 -5.782  1.00 0.00 ? 103 ASN E ND2  1 
ATOM 9545  H H    . ASN E 1 103 ? 144.192 130.810 -8.263  1.00 0.00 ? 103 ASN E H    1 
ATOM 9546  H HA   . ASN E 1 103 ? 142.408 132.389 -6.493  1.00 0.00 ? 103 ASN E HA   1 
ATOM 9547  H HB2  . ASN E 1 103 ? 141.445 130.678 -8.109  1.00 0.00 ? 103 ASN E HB2  1 
ATOM 9548  H HB3  . ASN E 1 103 ? 142.221 129.441 -7.121  1.00 0.00 ? 103 ASN E HB3  1 
ATOM 9549  H HD21 . ASN E 1 103 ? 140.335 128.533 -6.152  1.00 0.00 ? 103 ASN E HD21 1 
ATOM 9550  H HD22 . ASN E 1 103 ? 139.293 129.420 -5.148  1.00 0.00 ? 103 ASN E HD22 1 
ATOM 9551  N N    . GLU E 1 104 ? 143.178 131.480 -4.306  1.00 0.00 ? 104 GLU E N    1 
ATOM 9552  C CA   . GLU E 1 104 ? 143.770 131.077 -3.036  1.00 0.00 ? 104 GLU E CA   1 
ATOM 9553  C C    . GLU E 1 104 ? 143.185 129.746 -2.574  1.00 0.00 ? 104 GLU E C    1 
ATOM 9554  O O    . GLU E 1 104 ? 142.738 129.616 -1.435  1.00 0.00 ? 104 GLU E O    1 
ATOM 9555  C CB   . GLU E 1 104 ? 143.507 132.145 -1.975  1.00 0.00 ? 104 GLU E CB   1 
ATOM 9556  C CG   . GLU E 1 104 ? 144.323 133.397 -2.298  1.00 0.00 ? 104 GLU E CG   1 
ATOM 9557  C CD   . GLU E 1 104 ? 143.956 134.520 -1.335  1.00 0.00 ? 104 GLU E CD   1 
ATOM 9558  O OE1  . GLU E 1 104 ? 142.974 134.370 -0.626  1.00 0.00 ? 104 GLU E OE1  1 
ATOM 9559  O OE2  . GLU E 1 104 ? 144.661 135.516 -1.321  1.00 0.00 ? 104 GLU E OE2  1 
ATOM 9560  H H    . GLU E 1 104 ? 142.469 132.157 -4.314  1.00 0.00 ? 104 GLU E H    1 
ATOM 9561  H HA   . GLU E 1 104 ? 144.837 130.968 -3.163  1.00 0.00 ? 104 GLU E HA   1 
ATOM 9562  H HB2  . GLU E 1 104 ? 142.454 132.392 -1.966  1.00 0.00 ? 104 GLU E HB2  1 
ATOM 9563  H HB3  . GLU E 1 104 ? 143.796 131.769 -1.006  1.00 0.00 ? 104 GLU E HB3  1 
ATOM 9564  H HG2  . GLU E 1 104 ? 145.375 133.172 -2.203  1.00 0.00 ? 104 GLU E HG2  1 
ATOM 9565  H HG3  . GLU E 1 104 ? 144.112 133.711 -3.309  1.00 0.00 ? 104 GLU E HG3  1 
ATOM 9566  N N    . GLU E 1 105 ? 143.195 128.763 -3.469  1.00 0.00 ? 105 GLU E N    1 
ATOM 9567  C CA   . GLU E 1 105 ? 142.665 127.441 -3.152  1.00 0.00 ? 105 GLU E CA   1 
ATOM 9568  C C    . GLU E 1 105 ? 141.239 127.540 -2.621  1.00 0.00 ? 105 GLU E C    1 
ATOM 9569  O O    . GLU E 1 105 ? 140.686 126.560 -2.122  1.00 0.00 ? 105 GLU E O    1 
ATOM 9570  C CB   . GLU E 1 105 ? 143.549 126.762 -2.103  1.00 0.00 ? 105 GLU E CB   1 
ATOM 9571  C CG   . GLU E 1 105 ? 144.928 126.480 -2.699  1.00 0.00 ? 105 GLU E CG   1 
ATOM 9572  C CD   . GLU E 1 105 ? 145.829 125.844 -1.646  1.00 0.00 ? 105 GLU E CD   1 
ATOM 9573  O OE1  . GLU E 1 105 ? 145.410 125.769 -0.504  1.00 0.00 ? 105 GLU E OE1  1 
ATOM 9574  O OE2  . GLU E 1 105 ? 146.925 125.441 -1.999  1.00 0.00 ? 105 GLU E OE2  1 
ATOM 9575  H H    . GLU E 1 105 ? 143.566 128.930 -4.361  1.00 0.00 ? 105 GLU E H    1 
ATOM 9576  H HA   . GLU E 1 105 ? 142.666 126.839 -4.048  1.00 0.00 ? 105 GLU E HA   1 
ATOM 9577  H HB2  . GLU E 1 105 ? 143.651 127.411 -1.245  1.00 0.00 ? 105 GLU E HB2  1 
ATOM 9578  H HB3  . GLU E 1 105 ? 143.094 125.832 -1.798  1.00 0.00 ? 105 GLU E HB3  1 
ATOM 9579  H HG2  . GLU E 1 105 ? 144.825 125.807 -3.537  1.00 0.00 ? 105 GLU E HG2  1 
ATOM 9580  H HG3  . GLU E 1 105 ? 145.369 127.407 -3.035  1.00 0.00 ? 105 GLU E HG3  1 
ATOM 9581  N N    . GLY E 1 106 ? 140.647 128.723 -2.731  1.00 0.00 ? 106 GLY E N    1 
ATOM 9582  C CA   . GLY E 1 106 ? 139.283 128.922 -2.257  1.00 0.00 ? 106 GLY E CA   1 
ATOM 9583  C C    . GLY E 1 106 ? 139.209 128.739 -0.744  1.00 0.00 ? 106 GLY E C    1 
ATOM 9584  O O    . GLY E 1 106 ? 138.190 128.302 -0.211  1.00 0.00 ? 106 GLY E O    1 
ATOM 9585  H H    . GLY E 1 106 ? 141.132 129.470 -3.138  1.00 0.00 ? 106 GLY E H    1 
ATOM 9586  H HA2  . GLY E 1 106 ? 138.962 129.924 -2.512  1.00 0.00 ? 106 GLY E HA2  1 
ATOM 9587  H HA3  . GLY E 1 106 ? 138.631 128.206 -2.732  1.00 0.00 ? 106 GLY E HA3  1 
ATOM 9588  N N    . ALA E 1 107 ? 140.299 129.071 -0.062  1.00 0.00 ? 107 ALA E N    1 
ATOM 9589  C CA   . ALA E 1 107 ? 140.358 128.935 1.390   1.00 0.00 ? 107 ALA E CA   1 
ATOM 9590  C C    . ALA E 1 107 ? 139.324 129.863 2.052   1.00 0.00 ? 107 ALA E C    1 
ATOM 9591  O O    . ALA E 1 107 ? 138.950 130.886 1.478   1.00 0.00 ? 107 ALA E O    1 
ATOM 9592  C CB   . ALA E 1 107 ? 141.779 129.282 1.876   1.00 0.00 ? 107 ALA E CB   1 
ATOM 9593  H H    . ALA E 1 107 ? 141.081 129.411 -0.545  1.00 0.00 ? 107 ALA E H    1 
ATOM 9594  H HA   . ALA E 1 107 ? 140.138 127.910 1.647   1.00 0.00 ? 107 ALA E HA   1 
ATOM 9595  H HB1  . ALA E 1 107 ? 142.415 128.412 1.780   1.00 0.00 ? 107 ALA E HB1  1 
ATOM 9596  H HB2  . ALA E 1 107 ? 141.752 129.592 2.910   1.00 0.00 ? 107 ALA E HB2  1 
ATOM 9597  H HB3  . ALA E 1 107 ? 142.179 130.083 1.274   1.00 0.00 ? 107 ALA E HB3  1 
ATOM 9598  N N    . PRO E 1 108 ? 138.847 129.523 3.235   1.00 0.00 ? 108 PRO E N    1 
ATOM 9599  C CA   . PRO E 1 108 ? 137.828 130.352 3.957   1.00 0.00 ? 108 PRO E CA   1 
ATOM 9600  C C    . PRO E 1 108 ? 138.411 131.686 4.436   1.00 0.00 ? 108 PRO E C    1 
ATOM 9601  O O    . PRO E 1 108 ? 139.611 131.800 4.679   1.00 0.00 ? 108 PRO E O    1 
ATOM 9602  C CB   . PRO E 1 108 ? 137.416 129.454 5.142   1.00 0.00 ? 108 PRO E CB   1 
ATOM 9603  C CG   . PRO E 1 108 ? 138.611 128.594 5.392   1.00 0.00 ? 108 PRO E CG   1 
ATOM 9604  C CD   . PRO E 1 108 ? 139.219 128.323 4.016   1.00 0.00 ? 108 PRO E CD   1 
ATOM 9605  H HA   . PRO E 1 108 ? 136.976 130.529 3.323   1.00 0.00 ? 108 PRO E HA   1 
ATOM 9606  H HB2  . PRO E 1 108 ? 137.182 130.052 6.017   1.00 0.00 ? 108 PRO E HB2  1 
ATOM 9607  H HB3  . PRO E 1 108 ? 136.569 128.839 4.872   1.00 0.00 ? 108 PRO E HB3  1 
ATOM 9608  H HG2  . PRO E 1 108 ? 139.323 129.120 6.023   1.00 0.00 ? 108 PRO E HG2  1 
ATOM 9609  H HG3  . PRO E 1 108 ? 138.320 127.662 5.856   1.00 0.00 ? 108 PRO E HG3  1 
ATOM 9610  H HD2  . PRO E 1 108 ? 140.292 128.222 4.089   1.00 0.00 ? 108 PRO E HD2  1 
ATOM 9611  H HD3  . PRO E 1 108 ? 138.784 127.441 3.572   1.00 0.00 ? 108 PRO E HD3  1 
ATOM 9612  N N    . GLN E 1 109 ? 137.548 132.690 4.559   1.00 0.00 ? 109 GLN E N    1 
ATOM 9613  C CA   . GLN E 1 109 ? 137.985 134.009 5.002   1.00 0.00 ? 109 GLN E CA   1 
ATOM 9614  C C    . GLN E 1 109 ? 138.349 133.980 6.481   1.00 0.00 ? 109 GLN E C    1 
ATOM 9615  O O    . GLN E 1 109 ? 137.764 133.226 7.259   1.00 0.00 ? 109 GLN E O    1 
ATOM 9616  C CB   . GLN E 1 109 ? 136.875 135.033 4.763   1.00 0.00 ? 109 GLN E CB   1 
ATOM 9617  C CG   . GLN E 1 109 ? 136.558 135.106 3.267   1.00 0.00 ? 109 GLN E CG   1 
ATOM 9618  C CD   . GLN E 1 109 ? 135.755 133.880 2.846   1.00 0.00 ? 109 GLN E CD   1 
ATOM 9619  O OE1  . GLN E 1 109 ? 134.804 133.497 3.527   1.00 0.00 ? 109 GLN E OE1  1 
ATOM 9620  N NE2  . GLN E 1 109 ? 136.083 133.239 1.759   1.00 0.00 ? 109 GLN E NE2  1 
ATOM 9621  H H    . GLN E 1 109 ? 136.602 132.542 4.347   1.00 0.00 ? 109 GLN E H    1 
ATOM 9622  H HA   . GLN E 1 109 ? 138.855 134.298 4.433   1.00 0.00 ? 109 GLN E HA   1 
ATOM 9623  H HB2  . GLN E 1 109 ? 135.989 134.737 5.306   1.00 0.00 ? 109 GLN E HB2  1 
ATOM 9624  H HB3  . GLN E 1 109 ? 137.200 136.003 5.107   1.00 0.00 ? 109 GLN E HB3  1 
ATOM 9625  H HG2  . GLN E 1 109 ? 135.983 135.998 3.066   1.00 0.00 ? 109 GLN E HG2  1 
ATOM 9626  H HG3  . GLN E 1 109 ? 137.480 135.139 2.705   1.00 0.00 ? 109 GLN E HG3  1 
ATOM 9627  H HE21 . GLN E 1 109 ? 136.842 133.545 1.219   1.00 0.00 ? 109 GLN E HE21 1 
ATOM 9628  H HE22 . GLN E 1 109 ? 135.572 132.451 1.481   1.00 0.00 ? 109 GLN E HE22 1 
ATOM 9629  N N    . GLU E 1 110 ? 139.322 134.803 6.866   1.00 0.00 ? 110 GLU E N    1 
ATOM 9630  C CA   . GLU E 1 110 ? 139.754 134.853 8.258   1.00 0.00 ? 110 GLU E CA   1 
ATOM 9631  C C    . GLU E 1 110 ? 138.608 135.303 9.158   1.00 0.00 ? 110 GLU E C    1 
ATOM 9632  O O    . GLU E 1 110 ? 138.396 134.740 10.233  1.00 0.00 ? 110 GLU E O    1 
ATOM 9633  C CB   . GLU E 1 110 ? 140.937 135.815 8.405   1.00 0.00 ? 110 GLU E CB   1 
ATOM 9634  C CG   . GLU E 1 110 ? 142.164 135.231 7.700   1.00 0.00 ? 110 GLU E CG   1 
ATOM 9635  C CD   . GLU E 1 110 ? 142.674 134.014 8.464   1.00 0.00 ? 110 GLU E CD   1 
ATOM 9636  O OE1  . GLU E 1 110 ? 142.291 133.857 9.612   1.00 0.00 ? 110 GLU E OE1  1 
ATOM 9637  O OE2  . GLU E 1 110 ? 143.441 133.258 7.891   1.00 0.00 ? 110 GLU E OE2  1 
ATOM 9638  H H    . GLU E 1 110 ? 139.757 135.380 6.203   1.00 0.00 ? 110 GLU E H    1 
ATOM 9639  H HA   . GLU E 1 110 ? 140.069 133.866 8.560   1.00 0.00 ? 110 GLU E HA   1 
ATOM 9640  H HB2  . GLU E 1 110 ? 140.685 136.767 7.960   1.00 0.00 ? 110 GLU E HB2  1 
ATOM 9641  H HB3  . GLU E 1 110 ? 141.159 135.954 9.452   1.00 0.00 ? 110 GLU E HB3  1 
ATOM 9642  H HG2  . GLU E 1 110 ? 141.894 134.936 6.696   1.00 0.00 ? 110 GLU E HG2  1 
ATOM 9643  H HG3  . GLU E 1 110 ? 142.943 135.978 7.657   1.00 0.00 ? 110 GLU E HG3  1 
ATOM 9644  N N    . GLY E 1 111 ? 137.863 136.311 8.715   1.00 0.00 ? 111 GLY E N    1 
ATOM 9645  C CA   . GLY E 1 111 ? 136.734 136.808 9.495   1.00 0.00 ? 111 GLY E CA   1 
ATOM 9646  C C    . GLY E 1 111 ? 137.119 136.980 10.962  1.00 0.00 ? 111 GLY E C    1 
ATOM 9647  O O    . GLY E 1 111 ? 136.478 136.416 11.848  1.00 0.00 ? 111 GLY E O    1 
ATOM 9648  H H    . GLY E 1 111 ? 138.069 136.720 7.848   1.00 0.00 ? 111 GLY E H    1 
ATOM 9649  H HA2  . GLY E 1 111 ? 136.418 137.762 9.095   1.00 0.00 ? 111 GLY E HA2  1 
ATOM 9650  H HA3  . GLY E 1 111 ? 135.918 136.106 9.425   1.00 0.00 ? 111 GLY E HA3  1 
ATOM 9651  N N    . ILE E 1 112 ? 138.173 137.750 11.212  1.00 0.00 ? 112 ILE E N    1 
ATOM 9652  C CA   . ILE E 1 112 ? 138.635 137.969 12.580  1.00 0.00 ? 112 ILE E CA   1 
ATOM 9653  C C    . ILE E 1 112 ? 137.532 138.617 13.418  1.00 0.00 ? 112 ILE E C    1 
ATOM 9654  O O    . ILE E 1 112 ? 137.246 138.176 14.531  1.00 0.00 ? 112 ILE E O    1 
ATOM 9655  C CB   . ILE E 1 112 ? 139.870 138.878 12.568  1.00 0.00 ? 112 ILE E CB   1 
ATOM 9656  C CG1  . ILE E 1 112 ? 141.034 138.147 11.894  1.00 0.00 ? 112 ILE E CG1  1 
ATOM 9657  C CG2  . ILE E 1 112 ? 140.265 139.230 14.007  1.00 0.00 ? 112 ILE E CG2  1 
ATOM 9658  C CD1  . ILE E 1 112 ? 142.169 139.138 11.626  1.00 0.00 ? 112 ILE E CD1  1 
ATOM 9659  H H    . ILE E 1 112 ? 138.653 138.167 10.467  1.00 0.00 ? 112 ILE E H    1 
ATOM 9660  H HA   . ILE E 1 112 ? 138.901 137.020 13.018  1.00 0.00 ? 112 ILE E HA   1 
ATOM 9661  H HB   . ILE E 1 112 ? 139.646 139.783 12.024  1.00 0.00 ? 112 ILE E HB   1 
ATOM 9662  H HG12 . ILE E 1 112 ? 141.388 137.359 12.542  1.00 0.00 ? 112 ILE E HG12 1 
ATOM 9663  H HG13 . ILE E 1 112 ? 140.700 137.724 10.959  1.00 0.00 ? 112 ILE E HG13 1 
ATOM 9664  H HG21 . ILE E 1 112 ? 141.253 139.662 14.015  1.00 0.00 ? 112 ILE E HG21 1 
ATOM 9665  H HG22 . ILE E 1 112 ? 140.258 138.335 14.611  1.00 0.00 ? 112 ILE E HG22 1 
ATOM 9666  H HG23 . ILE E 1 112 ? 139.558 139.941 14.410  1.00 0.00 ? 112 ILE E HG23 1 
ATOM 9667  H HD11 . ILE E 1 112 ? 143.048 138.600 11.301  1.00 0.00 ? 112 ILE E HD11 1 
ATOM 9668  H HD12 . ILE E 1 112 ? 142.394 139.682 12.531  1.00 0.00 ? 112 ILE E HD12 1 
ATOM 9669  H HD13 . ILE E 1 112 ? 141.867 139.831 10.855  1.00 0.00 ? 112 ILE E HD13 1 
ATOM 9670  N N    . LEU E 1 113 ? 136.914 139.660 12.874  1.00 0.00 ? 113 LEU E N    1 
ATOM 9671  C CA   . LEU E 1 113 ? 135.841 140.357 13.578  1.00 0.00 ? 113 LEU E CA   1 
ATOM 9672  C C    . LEU E 1 113 ? 136.214 140.591 15.044  1.00 0.00 ? 113 LEU E C    1 
ATOM 9673  O O    . LEU E 1 113 ? 135.469 140.218 15.950  1.00 0.00 ? 113 LEU E O    1 
ATOM 9674  C CB   . LEU E 1 113 ? 134.551 139.538 13.503  1.00 0.00 ? 113 LEU E CB   1 
ATOM 9675  C CG   . LEU E 1 113 ? 134.296 139.101 12.055  1.00 0.00 ? 113 LEU E CG   1 
ATOM 9676  C CD1  . LEU E 1 113 ? 132.995 138.292 11.992  1.00 0.00 ? 113 LEU E CD1  1 
ATOM 9677  C CD2  . LEU E 1 113 ? 134.184 140.337 11.143  1.00 0.00 ? 113 LEU E CD2  1 
ATOM 9678  H H    . LEU E 1 113 ? 137.182 139.966 11.982  1.00 0.00 ? 113 LEU E H    1 
ATOM 9679  H HA   . LEU E 1 113 ? 135.676 141.313 13.107  1.00 0.00 ? 113 LEU E HA   1 
ATOM 9680  H HB2  . LEU E 1 113 ? 134.645 138.665 14.132  1.00 0.00 ? 113 LEU E HB2  1 
ATOM 9681  H HB3  . LEU E 1 113 ? 133.723 140.140 13.846  1.00 0.00 ? 113 LEU E HB3  1 
ATOM 9682  H HG   . LEU E 1 113 ? 135.116 138.481 11.721  1.00 0.00 ? 113 LEU E HG   1 
ATOM 9683  H HD11 . LEU E 1 113 ? 133.120 137.369 12.538  1.00 0.00 ? 113 LEU E HD11 1 
ATOM 9684  H HD12 . LEU E 1 113 ? 132.758 138.072 10.961  1.00 0.00 ? 113 LEU E HD12 1 
ATOM 9685  H HD13 . LEU E 1 113 ? 132.192 138.865 12.432  1.00 0.00 ? 113 LEU E HD13 1 
ATOM 9686  H HD21 . LEU E 1 113 ? 135.173 140.701 10.909  1.00 0.00 ? 113 LEU E HD21 1 
ATOM 9687  H HD22 . LEU E 1 113 ? 133.627 141.113 11.649  1.00 0.00 ? 113 LEU E HD22 1 
ATOM 9688  H HD23 . LEU E 1 113 ? 133.676 140.069 10.226  1.00 0.00 ? 113 LEU E HD23 1 
ATOM 9689  N N    . GLU E 1 114 ? 137.371 141.207 15.268  1.00 0.00 ? 114 GLU E N    1 
ATOM 9690  C CA   . GLU E 1 114 ? 137.832 141.481 16.627  1.00 0.00 ? 114 GLU E CA   1 
ATOM 9691  C C    . GLU E 1 114 ? 136.803 142.320 17.388  1.00 0.00 ? 114 GLU E C    1 
ATOM 9692  O O    . GLU E 1 114 ? 136.254 143.283 16.854  1.00 0.00 ? 114 GLU E O    1 
ATOM 9693  C CB   . GLU E 1 114 ? 139.173 142.220 16.582  1.00 0.00 ? 114 GLU E CB   1 
ATOM 9694  C CG   . GLU E 1 114 ? 138.995 143.575 15.891  1.00 0.00 ? 114 GLU E CG   1 
ATOM 9695  C CD   . GLU E 1 114 ? 140.352 144.242 15.690  1.00 0.00 ? 114 GLU E CD   1 
ATOM 9696  O OE1  . GLU E 1 114 ? 141.341 143.667 16.115  1.00 0.00 ? 114 GLU E OE1  1 
ATOM 9697  O OE2  . GLU E 1 114 ? 140.382 145.317 15.115  1.00 0.00 ? 114 GLU E OE2  1 
ATOM 9698  H H    . GLU E 1 114 ? 137.927 141.481 14.507  1.00 0.00 ? 114 GLU E H    1 
ATOM 9699  H HA   . GLU E 1 114 ? 137.968 140.543 17.145  1.00 0.00 ? 114 GLU E HA   1 
ATOM 9700  H HB2  . GLU E 1 114 ? 139.533 142.374 17.589  1.00 0.00 ? 114 GLU E HB2  1 
ATOM 9701  H HB3  . GLU E 1 114 ? 139.889 141.630 16.031  1.00 0.00 ? 114 GLU E HB3  1 
ATOM 9702  H HG2  . GLU E 1 114 ? 138.522 143.429 14.930  1.00 0.00 ? 114 GLU E HG2  1 
ATOM 9703  H HG3  . GLU E 1 114 ? 138.375 144.211 16.503  1.00 0.00 ? 114 GLU E HG3  1 
ATOM 9704  N N    . ASP E 1 115 ? 136.539 141.937 18.647  1.00 0.00 ? 115 ASP E N    1 
ATOM 9705  C CA   . ASP E 1 115 ? 135.566 142.653 19.494  1.00 0.00 ? 115 ASP E CA   1 
ATOM 9706  C C    . ASP E 1 115 ? 136.231 143.173 20.772  1.00 0.00 ? 115 ASP E C    1 
ATOM 9707  O O    . ASP E 1 115 ? 135.553 143.637 21.690  1.00 0.00 ? 115 ASP E O    1 
ATOM 9708  C CB   . ASP E 1 115 ? 134.414 141.714 19.858  1.00 0.00 ? 115 ASP E CB   1 
ATOM 9709  C CG   . ASP E 1 115 ? 133.561 141.440 18.624  1.00 0.00 ? 115 ASP E CG   1 
ATOM 9710  O OD1  . ASP E 1 115 ? 133.722 142.154 17.648  1.00 0.00 ? 115 ASP E OD1  1 
ATOM 9711  O OD2  . ASP E 1 115 ? 132.760 140.521 18.672  1.00 0.00 ? 115 ASP E OD2  1 
ATOM 9712  H H    . ASP E 1 115 ? 137.005 141.158 19.013  1.00 0.00 ? 115 ASP E H    1 
ATOM 9713  H HA   . ASP E 1 115 ? 135.160 143.499 18.949  1.00 0.00 ? 115 ASP E HA   1 
ATOM 9714  H HB2  . ASP E 1 115 ? 134.816 140.782 20.230  1.00 0.00 ? 115 ASP E HB2  1 
ATOM 9715  H HB3  . ASP E 1 115 ? 133.802 142.172 20.622  1.00 0.00 ? 115 ASP E HB3  1 
ATOM 9716  N N    . MET E 1 116 ? 137.566 143.089 20.824  1.00 0.00 ? 116 MET E N    1 
ATOM 9717  C CA   . MET E 1 116 ? 138.331 143.552 21.996  1.00 0.00 ? 116 MET E CA   1 
ATOM 9718  C C    . MET E 1 116 ? 139.576 144.323 21.554  1.00 0.00 ? 116 MET E C    1 
ATOM 9719  O O    . MET E 1 116 ? 140.694 143.828 21.689  1.00 0.00 ? 116 MET E O    1 
ATOM 9720  C CB   . MET E 1 116 ? 138.765 142.344 22.836  1.00 0.00 ? 116 MET E CB   1 
ATOM 9721  C CG   . MET E 1 116 ? 139.373 142.829 24.159  1.00 0.00 ? 116 MET E CG   1 
ATOM 9722  S SD   . MET E 1 116 ? 139.723 141.411 25.231  1.00 0.00 ? 116 MET E SD   1 
ATOM 9723  C CE   . MET E 1 116 ? 138.074 141.251 25.965  1.00 0.00 ? 116 MET E CE   1 
ATOM 9724  H H    . MET E 1 116 ? 138.048 142.708 20.062  1.00 0.00 ? 116 MET E H    1 
ATOM 9725  H HA   . MET E 1 116 ? 137.714 144.193 22.610  1.00 0.00 ? 116 MET E HA   1 
ATOM 9726  H HB2  . MET E 1 116 ? 137.910 141.721 23.034  1.00 0.00 ? 116 MET E HB2  1 
ATOM 9727  H HB3  . MET E 1 116 ? 139.505 141.777 22.291  1.00 0.00 ? 116 MET E HB3  1 
ATOM 9728  H HG2  . MET E 1 116 ? 140.292 143.360 23.959  1.00 0.00 ? 116 MET E HG2  1 
ATOM 9729  H HG3  . MET E 1 116 ? 138.678 143.491 24.653  1.00 0.00 ? 116 MET E HG3  1 
ATOM 9730  H HE1  . MET E 1 116 ? 137.350 141.048 25.191  1.00 0.00 ? 116 MET E HE1  1 
ATOM 9731  H HE2  . MET E 1 116 ? 137.813 142.168 26.467  1.00 0.00 ? 116 MET E HE2  1 
ATOM 9732  H HE3  . MET E 1 116 ? 138.078 140.441 26.682  1.00 0.00 ? 116 MET E HE3  1 
ATOM 9733  N N    . PRO E 1 117 ? 139.414 145.514 21.025  1.00 0.00 ? 117 PRO E N    1 
ATOM 9734  C CA   . PRO E 1 117 ? 140.570 146.337 20.560  1.00 0.00 ? 117 PRO E CA   1 
ATOM 9735  C C    . PRO E 1 117 ? 141.339 146.961 21.730  1.00 0.00 ? 117 PRO E C    1 
ATOM 9736  O O    . PRO E 1 117 ? 140.766 147.251 22.781  1.00 0.00 ? 117 PRO E O    1 
ATOM 9737  C CB   . PRO E 1 117 ? 139.907 147.401 19.673  1.00 0.00 ? 117 PRO E CB   1 
ATOM 9738  C CG   . PRO E 1 117 ? 138.547 147.590 20.269  1.00 0.00 ? 117 PRO E CG   1 
ATOM 9739  C CD   . PRO E 1 117 ? 138.125 146.213 20.810  1.00 0.00 ? 117 PRO E CD   1 
ATOM 9740  H HA   . PRO E 1 117 ? 141.236 145.733 19.964  1.00 0.00 ? 117 PRO E HA   1 
ATOM 9741  H HB2  . PRO E 1 117 ? 140.473 148.326 19.699  1.00 0.00 ? 117 PRO E HB2  1 
ATOM 9742  H HB3  . PRO E 1 117 ? 139.819 147.042 18.657  1.00 0.00 ? 117 PRO E HB3  1 
ATOM 9743  H HG2  . PRO E 1 117 ? 138.594 148.316 21.076  1.00 0.00 ? 117 PRO E HG2  1 
ATOM 9744  H HG3  . PRO E 1 117 ? 137.845 147.920 19.515  1.00 0.00 ? 117 PRO E HG3  1 
ATOM 9745  H HD2  . PRO E 1 117 ? 137.583 146.325 21.740  1.00 0.00 ? 117 PRO E HD2  1 
ATOM 9746  H HD3  . PRO E 1 117 ? 137.530 145.680 20.083  1.00 0.00 ? 117 PRO E HD3  1 
ATOM 9747  N N    . VAL E 1 118 ? 142.648 147.162 21.534  1.00 0.00 ? 118 VAL E N    1 
ATOM 9748  C CA   . VAL E 1 118 ? 143.516 147.752 22.570  1.00 0.00 ? 118 VAL E CA   1 
ATOM 9749  C C    . VAL E 1 118 ? 144.059 149.101 22.104  1.00 0.00 ? 118 VAL E C    1 
ATOM 9750  O O    . VAL E 1 118 ? 144.772 149.182 21.104  1.00 0.00 ? 118 VAL E O    1 
ATOM 9751  C CB   . VAL E 1 118 ? 144.681 146.796 22.853  1.00 0.00 ? 118 VAL E CB   1 
ATOM 9752  C CG1  . VAL E 1 118 ? 145.623 147.414 23.892  1.00 0.00 ? 118 VAL E CG1  1 
ATOM 9753  C CG2  . VAL E 1 118 ? 144.127 145.471 23.387  1.00 0.00 ? 118 VAL E CG2  1 
ATOM 9754  H H    . VAL E 1 118 ? 143.043 146.906 20.674  1.00 0.00 ? 118 VAL E H    1 
ATOM 9755  H HA   . VAL E 1 118 ? 142.953 147.896 23.484  1.00 0.00 ? 118 VAL E HA   1 
ATOM 9756  H HB   . VAL E 1 118 ? 145.227 146.616 21.938  1.00 0.00 ? 118 VAL E HB   1 
ATOM 9757  H HG11 . VAL E 1 118 ? 145.044 147.856 24.688  1.00 0.00 ? 118 VAL E HG11 1 
ATOM 9758  H HG12 . VAL E 1 118 ? 146.227 148.176 23.421  1.00 0.00 ? 118 VAL E HG12 1 
ATOM 9759  H HG13 . VAL E 1 118 ? 146.267 146.646 24.297  1.00 0.00 ? 118 VAL E HG13 1 
ATOM 9760  H HG21 . VAL E 1 118 ? 144.931 144.891 23.817  1.00 0.00 ? 118 VAL E HG21 1 
ATOM 9761  H HG22 . VAL E 1 118 ? 143.677 144.916 22.577  1.00 0.00 ? 118 VAL E HG22 1 
ATOM 9762  H HG23 . VAL E 1 118 ? 143.383 145.670 24.143  1.00 0.00 ? 118 VAL E HG23 1 
ATOM 9763  N N    . ASP E 1 119 ? 143.709 150.159 22.837  1.00 0.00 ? 119 ASP E N    1 
ATOM 9764  C CA   . ASP E 1 119 ? 144.158 151.510 22.493  1.00 0.00 ? 119 ASP E CA   1 
ATOM 9765  C C    . ASP E 1 119 ? 144.174 152.407 23.731  1.00 0.00 ? 119 ASP E C    1 
ATOM 9766  O O    . ASP E 1 119 ? 143.357 153.321 23.851  1.00 0.00 ? 119 ASP E O    1 
ATOM 9767  C CB   . ASP E 1 119 ? 143.226 152.114 21.442  1.00 0.00 ? 119 ASP E CB   1 
ATOM 9768  C CG   . ASP E 1 119 ? 141.772 151.962 21.882  1.00 0.00 ? 119 ASP E CG   1 
ATOM 9769  O OD1  . ASP E 1 119 ? 141.532 151.219 22.818  1.00 0.00 ? 119 ASP E OD1  1 
ATOM 9770  O OD2  . ASP E 1 119 ? 140.922 152.593 21.275  1.00 0.00 ? 119 ASP E OD2  1 
ATOM 9771  H H    . ASP E 1 119 ? 143.136 150.030 23.623  1.00 0.00 ? 119 ASP E H    1 
ATOM 9772  H HA   . ASP E 1 119 ? 145.154 151.459 22.082  1.00 0.00 ? 119 ASP E HA   1 
ATOM 9773  H HB2  . ASP E 1 119 ? 143.456 153.163 21.321  1.00 0.00 ? 119 ASP E HB2  1 
ATOM 9774  H HB3  . ASP E 1 119 ? 143.369 151.606 20.502  1.00 0.00 ? 119 ASP E HB3  1 
ATOM 9775  N N    . PRO E 1 120 ? 145.073 152.166 24.648  1.00 0.00 ? 120 PRO E N    1 
ATOM 9776  C CA   . PRO E 1 120 ? 145.178 152.971 25.900  1.00 0.00 ? 120 PRO E CA   1 
ATOM 9777  C C    . PRO E 1 120 ? 145.884 154.310 25.662  1.00 0.00 ? 120 PRO E C    1 
ATOM 9778  O O    . PRO E 1 120 ? 145.962 154.787 24.530  1.00 0.00 ? 120 PRO E O    1 
ATOM 9779  C CB   . PRO E 1 120 ? 145.981 152.058 26.833  1.00 0.00 ? 120 PRO E CB   1 
ATOM 9780  C CG   . PRO E 1 120 ? 146.880 151.282 25.917  1.00 0.00 ? 120 PRO E CG   1 
ATOM 9781  C CD   . PRO E 1 120 ? 146.097 151.101 24.600  1.00 0.00 ? 120 PRO E CD   1 
ATOM 9782  H HA   . PRO E 1 120 ? 144.198 153.140 26.314  1.00 0.00 ? 120 PRO E HA   1 
ATOM 9783  H HB2  . PRO E 1 120 ? 146.560 152.645 27.538  1.00 0.00 ? 120 PRO E HB2  1 
ATOM 9784  H HB3  . PRO E 1 120 ? 145.319 151.385 27.360  1.00 0.00 ? 120 PRO E HB3  1 
ATOM 9785  H HG2  . PRO E 1 120 ? 147.797 151.839 25.739  1.00 0.00 ? 120 PRO E HG2  1 
ATOM 9786  H HG3  . PRO E 1 120 ? 147.112 150.315 26.343  1.00 0.00 ? 120 PRO E HG3  1 
ATOM 9787  H HD2  . PRO E 1 120 ? 146.755 151.236 23.750  1.00 0.00 ? 120 PRO E HD2  1 
ATOM 9788  H HD3  . PRO E 1 120 ? 145.622 150.132 24.564  1.00 0.00 ? 120 PRO E HD3  1 
ATOM 9789  N N    . ASP E 1 121 ? 146.386 154.912 26.736  1.00 0.00 ? 121 ASP E N    1 
ATOM 9790  C CA   . ASP E 1 121 ? 147.070 156.196 26.628  1.00 0.00 ? 121 ASP E CA   1 
ATOM 9791  C C    . ASP E 1 121 ? 148.249 156.097 25.664  1.00 0.00 ? 121 ASP E C    1 
ATOM 9792  O O    . ASP E 1 121 ? 148.520 157.028 24.905  1.00 0.00 ? 121 ASP E O    1 
ATOM 9793  C CB   . ASP E 1 121 ? 147.564 156.648 28.005  1.00 0.00 ? 121 ASP E CB   1 
ATOM 9794  C CG   . ASP E 1 121 ? 148.134 158.059 27.914  1.00 0.00 ? 121 ASP E CG   1 
ATOM 9795  O OD1  . ASP E 1 121 ? 148.348 158.520 26.804  1.00 0.00 ? 121 ASP E OD1  1 
ATOM 9796  O OD2  . ASP E 1 121 ? 148.344 158.661 28.954  1.00 0.00 ? 121 ASP E OD2  1 
ATOM 9797  H H    . ASP E 1 121 ? 146.288 154.490 27.616  1.00 0.00 ? 121 ASP E H    1 
ATOM 9798  H HA   . ASP E 1 121 ? 146.373 156.930 26.252  1.00 0.00 ? 121 ASP E HA   1 
ATOM 9799  H HB2  . ASP E 1 121 ? 146.739 156.638 28.703  1.00 0.00 ? 121 ASP E HB2  1 
ATOM 9800  H HB3  . ASP E 1 121 ? 148.333 155.973 28.350  1.00 0.00 ? 121 ASP E HB3  1 
ATOM 9801  N N    . ASN E 1 122 ? 148.947 154.966 25.695  1.00 0.00 ? 122 ASN E N    1 
ATOM 9802  C CA   . ASN E 1 122 ? 150.091 154.766 24.810  1.00 0.00 ? 122 ASN E CA   1 
ATOM 9803  C C    . ASN E 1 122 ? 151.145 155.845 25.037  1.00 0.00 ? 122 ASN E C    1 
ATOM 9804  O O    . ASN E 1 122 ? 151.677 156.418 24.085  1.00 0.00 ? 122 ASN E O    1 
ATOM 9805  C CB   . ASN E 1 122 ? 149.629 154.799 23.352  1.00 0.00 ? 122 ASN E CB   1 
ATOM 9806  C CG   . ASN E 1 122 ? 150.713 154.230 22.444  1.00 0.00 ? 122 ASN E CG   1 
ATOM 9807  O OD1  . ASN E 1 122 ? 151.428 153.307 22.833  1.00 0.00 ? 122 ASN E OD1  1 
ATOM 9808  N ND2  . ASN E 1 122 ? 150.879 154.728 21.250  1.00 0.00 ? 122 ASN E ND2  1 
ATOM 9809  H H    . ASN E 1 122 ? 148.687 154.255 26.316  1.00 0.00 ? 122 ASN E H    1 
ATOM 9810  H HA   . ASN E 1 122 ? 150.527 153.801 25.016  1.00 0.00 ? 122 ASN E HA   1 
ATOM 9811  H HB2  . ASN E 1 122 ? 148.729 154.209 23.249  1.00 0.00 ? 122 ASN E HB2  1 
ATOM 9812  H HB3  . ASN E 1 122 ? 149.421 155.820 23.065  1.00 0.00 ? 122 ASN E HB3  1 
ATOM 9813  H HD21 . ASN E 1 122 ? 150.308 155.464 20.941  1.00 0.00 ? 122 ASN E HD21 1 
ATOM 9814  H HD22 . ASN E 1 122 ? 151.574 154.369 20.661  1.00 0.00 ? 122 ASN E HD22 1 
ATOM 9815  N N    . GLU E 1 123 ? 151.444 156.114 26.303  1.00 0.00 ? 123 GLU E N    1 
ATOM 9816  C CA   . GLU E 1 123 ? 152.439 157.121 26.648  1.00 0.00 ? 123 GLU E CA   1 
ATOM 9817  C C    . GLU E 1 123 ? 153.826 156.662 26.201  1.00 0.00 ? 123 GLU E C    1 
ATOM 9818  O O    . GLU E 1 123 ? 154.168 155.487 26.327  1.00 0.00 ? 123 GLU E O    1 
ATOM 9819  C CB   . GLU E 1 123 ? 152.436 157.360 28.162  1.00 0.00 ? 123 GLU E CB   1 
ATOM 9820  C CG   . GLU E 1 123 ? 153.329 158.558 28.504  1.00 0.00 ? 123 GLU E CG   1 
ATOM 9821  C CD   . GLU E 1 123 ? 152.717 159.841 27.951  1.00 0.00 ? 123 GLU E CD   1 
ATOM 9822  O OE1  . GLU E 1 123 ? 151.532 159.832 27.661  1.00 0.00 ? 123 GLU E OE1  1 
ATOM 9823  O OE2  . GLU E 1 123 ? 153.442 160.814 27.827  1.00 0.00 ? 123 GLU E OE2  1 
ATOM 9824  H H    . GLU E 1 123 ? 150.989 155.622 27.018  1.00 0.00 ? 123 GLU E H    1 
ATOM 9825  H HA   . GLU E 1 123 ? 152.194 158.042 26.143  1.00 0.00 ? 123 GLU E HA   1 
ATOM 9826  H HB2  . GLU E 1 123 ? 151.426 157.560 28.490  1.00 0.00 ? 123 GLU E HB2  1 
ATOM 9827  H HB3  . GLU E 1 123 ? 152.809 156.481 28.663  1.00 0.00 ? 123 GLU E HB3  1 
ATOM 9828  H HG2  . GLU E 1 123 ? 153.422 158.638 29.577  1.00 0.00 ? 123 GLU E HG2  1 
ATOM 9829  H HG3  . GLU E 1 123 ? 154.307 158.413 28.071  1.00 0.00 ? 123 GLU E HG3  1 
ATOM 9830  N N    . ALA E 1 124 ? 154.617 157.592 25.673  1.00 0.00 ? 124 ALA E N    1 
ATOM 9831  C CA   . ALA E 1 124 ? 155.959 157.257 25.209  1.00 0.00 ? 124 ALA E CA   1 
ATOM 9832  C C    . ALA E 1 124 ? 156.781 156.639 26.337  1.00 0.00 ? 124 ALA E C    1 
ATOM 9833  O O    . ALA E 1 124 ? 157.064 157.289 27.342  1.00 0.00 ? 124 ALA E O    1 
ATOM 9834  C CB   . ALA E 1 124 ? 156.662 158.517 24.698  1.00 0.00 ? 124 ALA E CB   1 
ATOM 9835  H H    . ALA E 1 124 ? 154.293 158.513 25.592  1.00 0.00 ? 124 ALA E H    1 
ATOM 9836  H HA   . ALA E 1 124 ? 155.883 156.548 24.399  1.00 0.00 ? 124 ALA E HA   1 
ATOM 9837  H HB1  . ALA E 1 124 ? 157.649 158.260 24.343  1.00 0.00 ? 124 ALA E HB1  1 
ATOM 9838  H HB2  . ALA E 1 124 ? 156.743 159.235 25.501  1.00 0.00 ? 124 ALA E HB2  1 
ATOM 9839  H HB3  . ALA E 1 124 ? 156.088 158.946 23.889  1.00 0.00 ? 124 ALA E HB3  1 
ATOM 9840  N N    . TYR E 1 125 ? 157.163 155.377 26.155  1.00 0.00 ? 125 TYR E N    1 
ATOM 9841  C CA   . TYR E 1 125 ? 157.957 154.674 27.158  1.00 0.00 ? 125 TYR E CA   1 
ATOM 9842  C C    . TYR E 1 125 ? 159.297 155.370 27.369  1.00 0.00 ? 125 TYR E C    1 
ATOM 9843  O O    . TYR E 1 125 ? 159.723 155.585 28.504  1.00 0.00 ? 125 TYR E O    1 
ATOM 9844  C CB   . TYR E 1 125 ? 158.196 153.226 26.724  1.00 0.00 ? 125 TYR E CB   1 
ATOM 9845  C CG   . TYR E 1 125 ? 159.025 152.521 27.774  1.00 0.00 ? 125 TYR E CG   1 
ATOM 9846  C CD1  . TYR E 1 125 ? 158.414 152.040 28.938  1.00 0.00 ? 125 TYR E CD1  1 
ATOM 9847  C CD2  . TYR E 1 125 ? 160.401 152.348 27.582  1.00 0.00 ? 125 TYR E CD2  1 
ATOM 9848  C CE1  . TYR E 1 125 ? 159.180 151.388 29.913  1.00 0.00 ? 125 TYR E CE1  1 
ATOM 9849  C CE2  . TYR E 1 125 ? 161.167 151.696 28.557  1.00 0.00 ? 125 TYR E CE2  1 
ATOM 9850  C CZ   . TYR E 1 125 ? 160.556 151.216 29.722  1.00 0.00 ? 125 TYR E CZ   1 
ATOM 9851  O OH   . TYR E 1 125 ? 161.310 150.573 30.683  1.00 0.00 ? 125 TYR E OH   1 
ATOM 9852  H H    . TYR E 1 125 ? 156.909 154.912 25.331  1.00 0.00 ? 125 TYR E H    1 
ATOM 9853  H HA   . TYR E 1 125 ? 157.414 154.671 28.091  1.00 0.00 ? 125 TYR E HA   1 
ATOM 9854  H HB2  . TYR E 1 125 ? 157.246 152.723 26.614  1.00 0.00 ? 125 TYR E HB2  1 
ATOM 9855  H HB3  . TYR E 1 125 ? 158.722 153.215 25.781  1.00 0.00 ? 125 TYR E HB3  1 
ATOM 9856  H HD1  . TYR E 1 125 ? 157.352 152.173 29.087  1.00 0.00 ? 125 TYR E HD1  1 
ATOM 9857  H HD2  . TYR E 1 125 ? 160.872 152.719 26.685  1.00 0.00 ? 125 TYR E HD2  1 
ATOM 9858  H HE1  . TYR E 1 125 ? 158.709 151.017 30.811  1.00 0.00 ? 125 TYR E HE1  1 
ATOM 9859  H HE2  . TYR E 1 125 ? 162.228 151.564 28.410  1.00 0.00 ? 125 TYR E HE2  1 
ATOM 9860  H HH   . TYR E 1 125 ? 161.633 151.235 31.299  1.00 0.00 ? 125 TYR E HH   1 
ATOM 9861  N N    . GLU E 1 126 ? 159.963 155.711 26.267  1.00 0.00 ? 126 GLU E N    1 
ATOM 9862  C CA   . GLU E 1 126 ? 161.262 156.372 26.346  1.00 0.00 ? 126 GLU E CA   1 
ATOM 9863  C C    . GLU E 1 126 ? 161.180 157.622 27.211  1.00 0.00 ? 126 GLU E C    1 
ATOM 9864  O O    . GLU E 1 126 ? 160.182 158.342 27.191  1.00 0.00 ? 126 GLU E O    1 
ATOM 9865  C CB   . GLU E 1 126 ? 161.743 156.762 24.947  1.00 0.00 ? 126 GLU E CB   1 
ATOM 9866  C CG   . GLU E 1 126 ? 161.973 155.507 24.108  1.00 0.00 ? 126 GLU E CG   1 
ATOM 9867  C CD   . GLU E 1 126 ? 162.487 155.896 22.727  1.00 0.00 ? 126 GLU E CD   1 
ATOM 9868  O OE1  . GLU E 1 126 ? 163.478 156.608 22.665  1.00 0.00 ? 126 GLU E OE1  1 
ATOM 9869  O OE2  . GLU E 1 126 ? 161.884 155.480 21.752  1.00 0.00 ? 126 GLU E OE2  1 
ATOM 9870  H H    . GLU E 1 126 ? 159.577 155.508 25.389  1.00 0.00 ? 126 GLU E H    1 
ATOM 9871  H HA   . GLU E 1 126 ? 161.976 155.690 26.782  1.00 0.00 ? 126 GLU E HA   1 
ATOM 9872  H HB2  . GLU E 1 126 ? 160.997 157.382 24.472  1.00 0.00 ? 126 GLU E HB2  1 
ATOM 9873  H HB3  . GLU E 1 126 ? 162.669 157.313 25.027  1.00 0.00 ? 126 GLU E HB3  1 
ATOM 9874  H HG2  . GLU E 1 126 ? 162.699 154.876 24.598  1.00 0.00 ? 126 GLU E HG2  1 
ATOM 9875  H HG3  . GLU E 1 126 ? 161.042 154.970 24.004  1.00 0.00 ? 126 GLU E HG3  1 
ATOM 9876  N N    . MET E 1 127 ? 162.242 157.870 27.976  1.00 0.00 ? 127 MET E N    1 
ATOM 9877  C CA   . MET E 1 127 ? 162.301 159.036 28.860  1.00 0.00 ? 127 MET E CA   1 
ATOM 9878  C C    . MET E 1 127 ? 163.732 159.561 28.958  1.00 0.00 ? 127 MET E C    1 
ATOM 9879  O O    . MET E 1 127 ? 164.398 159.382 29.977  1.00 0.00 ? 127 MET E O    1 
ATOM 9880  C CB   . MET E 1 127 ? 161.809 158.645 30.254  1.00 0.00 ? 127 MET E CB   1 
ATOM 9881  C CG   . MET E 1 127 ? 161.643 159.898 31.112  1.00 0.00 ? 127 MET E CG   1 
ATOM 9882  S SD   . MET E 1 127 ? 161.005 159.429 32.744  1.00 0.00 ? 127 MET E SD   1 
ATOM 9883  C CE   . MET E 1 127 ? 162.479 158.561 33.349  1.00 0.00 ? 127 MET E CE   1 
ATOM 9884  H H    . MET E 1 127 ? 163.005 157.255 27.947  1.00 0.00 ? 127 MET E H    1 
ATOM 9885  H HA   . MET E 1 127 ? 161.665 159.820 28.471  1.00 0.00 ? 127 MET E HA   1 
ATOM 9886  H HB2  . MET E 1 127 ? 160.860 158.136 30.171  1.00 0.00 ? 127 MET E HB2  1 
ATOM 9887  H HB3  . MET E 1 127 ? 162.530 157.987 30.719  1.00 0.00 ? 127 MET E HB3  1 
ATOM 9888  H HG2  . MET E 1 127 ? 162.596 160.392 31.220  1.00 0.00 ? 127 MET E HG2  1 
ATOM 9889  H HG3  . MET E 1 127 ? 160.944 160.569 30.634  1.00 0.00 ? 127 MET E HG3  1 
ATOM 9890  H HE1  . MET E 1 127 ? 162.429 157.521 33.054  1.00 0.00 ? 127 MET E HE1  1 
ATOM 9891  H HE2  . MET E 1 127 ? 162.517 158.624 34.424  1.00 0.00 ? 127 MET E HE2  1 
ATOM 9892  H HE3  . MET E 1 127 ? 163.366 159.016 32.933  1.00 0.00 ? 127 MET E HE3  1 
ATOM 9893  N N    . PRO E 1 128 ? 164.211 160.200 27.922  1.00 0.00 ? 128 PRO E N    1 
ATOM 9894  C CA   . PRO E 1 128 ? 165.599 160.765 27.893  1.00 0.00 ? 128 PRO E CA   1 
ATOM 9895  C C    . PRO E 1 128 ? 165.857 161.705 29.075  1.00 0.00 ? 128 PRO E C    1 
ATOM 9896  O O    . PRO E 1 128 ? 164.995 162.503 29.442  1.00 0.00 ? 128 PRO E O    1 
ATOM 9897  C CB   . PRO E 1 128 ? 165.643 161.520 26.548  1.00 0.00 ? 128 PRO E CB   1 
ATOM 9898  C CG   . PRO E 1 128 ? 164.621 160.832 25.703  1.00 0.00 ? 128 PRO E CG   1 
ATOM 9899  C CD   . PRO E 1 128 ? 163.495 160.456 26.662  1.00 0.00 ? 128 PRO E CD   1 
ATOM 9900  H HA   . PRO E 1 128 ? 166.324 159.969 27.886  1.00 0.00 ? 128 PRO E HA   1 
ATOM 9901  H HB2  . PRO E 1 128 ? 165.379 162.565 26.686  1.00 0.00 ? 128 PRO E HB2  1 
ATOM 9902  H HB3  . PRO E 1 128 ? 166.619 161.437 26.093  1.00 0.00 ? 128 PRO E HB3  1 
ATOM 9903  H HG2  . PRO E 1 128 ? 164.258 161.502 24.931  1.00 0.00 ? 128 PRO E HG2  1 
ATOM 9904  H HG3  . PRO E 1 128 ? 165.037 159.939 25.261  1.00 0.00 ? 128 PRO E HG3  1 
ATOM 9905  H HD2  . PRO E 1 128 ? 162.800 161.279 26.771  1.00 0.00 ? 128 PRO E HD2  1 
ATOM 9906  H HD3  . PRO E 1 128 ? 162.988 159.564 26.330  1.00 0.00 ? 128 PRO E HD3  1 
ATOM 9907  N N    . SER E 1 129 ? 167.044 161.604 29.663  1.00 0.00 ? 129 SER E N    1 
ATOM 9908  C CA   . SER E 1 129 ? 167.391 162.453 30.795  1.00 0.00 ? 129 SER E CA   1 
ATOM 9909  C C    . SER E 1 129 ? 167.564 163.897 30.341  1.00 0.00 ? 129 SER E C    1 
ATOM 9910  O O    . SER E 1 129 ? 168.088 164.156 29.257  1.00 0.00 ? 129 SER E O    1 
ATOM 9911  C CB   . SER E 1 129 ? 168.685 161.961 31.444  1.00 0.00 ? 129 SER E CB   1 
ATOM 9912  O OG   . SER E 1 129 ? 168.483 160.653 31.965  1.00 0.00 ? 129 SER E OG   1 
ATOM 9913  H H    . SER E 1 129 ? 167.695 160.951 29.331  1.00 0.00 ? 129 SER E H    1 
ATOM 9914  H HA   . SER E 1 129 ? 166.596 162.408 31.524  1.00 0.00 ? 129 SER E HA   1 
ATOM 9915  H HB2  . SER E 1 129 ? 169.471 161.935 30.711  1.00 0.00 ? 129 SER E HB2  1 
ATOM 9916  H HB3  . SER E 1 129 ? 168.965 162.638 32.244  1.00 0.00 ? 129 SER E HB3  1 
ATOM 9917  H HG   . SER E 1 129 ? 168.685 160.023 31.268  1.00 0.00 ? 129 SER E HG   1 
ATOM 9918  N N    . GLU E 1 130 ? 167.118 164.839 31.178  1.00 0.00 ? 130 GLU E N    1 
ATOM 9919  C CA   . GLU E 1 130 ? 167.225 166.271 30.861  1.00 0.00 ? 130 GLU E CA   1 
ATOM 9920  C C    . GLU E 1 130 ? 167.743 167.048 32.066  1.00 0.00 ? 130 GLU E C    1 
ATOM 9921  O O    . GLU E 1 130 ? 167.355 166.782 33.204  1.00 0.00 ? 130 GLU E O    1 
ATOM 9922  C CB   . GLU E 1 130 ? 165.855 166.817 30.451  1.00 0.00 ? 130 GLU E CB   1 
ATOM 9923  C CG   . GLU E 1 130 ? 165.349 166.056 29.223  1.00 0.00 ? 130 GLU E CG   1 
ATOM 9924  C CD   . GLU E 1 130 ? 166.250 166.344 28.026  1.00 0.00 ? 130 GLU E CD   1 
ATOM 9925  O OE1  . GLU E 1 130 ? 166.943 167.347 28.058  1.00 0.00 ? 130 GLU E OE1  1 
ATOM 9926  O OE2  . GLU E 1 130 ? 166.232 165.557 27.095  1.00 0.00 ? 130 GLU E OE2  1 
ATOM 9927  H H    . GLU E 1 130 ? 166.711 164.568 32.026  1.00 0.00 ? 130 GLU E H    1 
ATOM 9928  H HA   . GLU E 1 130 ? 167.916 166.414 30.038  1.00 0.00 ? 130 GLU E HA   1 
ATOM 9929  H HB2  . GLU E 1 130 ? 165.157 166.688 31.268  1.00 0.00 ? 130 GLU E HB2  1 
ATOM 9930  H HB3  . GLU E 1 130 ? 165.939 167.867 30.213  1.00 0.00 ? 130 GLU E HB3  1 
ATOM 9931  H HG2  . GLU E 1 130 ? 165.357 164.996 29.431  1.00 0.00 ? 130 GLU E HG2  1 
ATOM 9932  H HG3  . GLU E 1 130 ? 164.343 166.371 28.997  1.00 0.00 ? 130 GLU E HG3  1 
ATOM 9933  N N    . GLU E 1 131 ? 168.617 168.011 31.804  1.00 0.00 ? 131 GLU E N    1 
ATOM 9934  C CA   . GLU E 1 131 ? 169.184 168.829 32.867  1.00 0.00 ? 131 GLU E CA   1 
ATOM 9935  C C    . GLU E 1 131 ? 168.158 169.838 33.373  1.00 0.00 ? 131 GLU E C    1 
ATOM 9936  O O    . GLU E 1 131 ? 167.308 170.309 32.617  1.00 0.00 ? 131 GLU E O    1 
ATOM 9937  C CB   . GLU E 1 131 ? 170.434 169.560 32.352  1.00 0.00 ? 131 GLU E CB   1 
ATOM 9938  C CG   . GLU E 1 131 ? 170.117 170.298 31.027  1.00 0.00 ? 131 GLU E CG   1 
ATOM 9939  C CD   . GLU E 1 131 ? 170.317 169.362 29.830  1.00 0.00 ? 131 GLU E CD   1 
ATOM 9940  O OE1  . GLU E 1 131 ? 170.318 168.160 30.035  1.00 0.00 ? 131 GLU E OE1  1 
ATOM 9941  O OE2  . GLU E 1 131 ? 170.464 169.866 28.728  1.00 0.00 ? 131 GLU E OE2  1 
ATOM 9942  H H    . GLU E 1 131 ? 168.882 168.177 30.877  1.00 0.00 ? 131 GLU E H    1 
ATOM 9943  H HA   . GLU E 1 131 ? 169.471 168.187 33.685  1.00 0.00 ? 131 GLU E HA   1 
ATOM 9944  H HB2  . GLU E 1 131 ? 170.753 170.278 33.096  1.00 0.00 ? 131 GLU E HB2  1 
ATOM 9945  H HB3  . GLU E 1 131 ? 171.227 168.843 32.189  1.00 0.00 ? 131 GLU E HB3  1 
ATOM 9946  H HG2  . GLU E 1 131 ? 169.095 170.651 31.039  1.00 0.00 ? 131 GLU E HG2  1 
ATOM 9947  H HG3  . GLU E 1 131 ? 170.781 171.145 30.925  1.00 0.00 ? 131 GLU E HG3  1 
ATOM 9948  N N    . GLY E 1 132 ? 168.239 170.159 34.662  1.00 0.00 ? 132 GLY E N    1 
ATOM 9949  C CA   . GLY E 1 132 ? 167.307 171.107 35.269  1.00 0.00 ? 132 GLY E CA   1 
ATOM 9950  C C    . GLY E 1 132 ? 167.224 170.894 36.777  1.00 0.00 ? 132 GLY E C    1 
ATOM 9951  O O    . GLY E 1 132 ? 168.241 170.892 37.471  1.00 0.00 ? 132 GLY E O    1 
ATOM 9952  H H    . GLY E 1 132 ? 168.932 169.746 35.217  1.00 0.00 ? 132 GLY E H    1 
ATOM 9953  H HA2  . GLY E 1 132 ? 167.643 172.114 35.068  1.00 0.00 ? 132 GLY E HA2  1 
ATOM 9954  H HA3  . GLY E 1 132 ? 166.325 170.967 34.841  1.00 0.00 ? 132 GLY E HA3  1 
ATOM 9955  N N    . TYR E 1 133 ? 166.006 170.713 37.275  1.00 0.00 ? 133 TYR E N    1 
ATOM 9956  C CA   . TYR E 1 133 ? 165.793 170.497 38.702  1.00 0.00 ? 133 TYR E CA   1 
ATOM 9957  C C    . TYR E 1 133 ? 166.460 169.200 39.154  1.00 0.00 ? 133 TYR E C    1 
ATOM 9958  O O    . TYR E 1 133 ? 166.994 169.118 40.260  1.00 0.00 ? 133 TYR E O    1 
ATOM 9959  C CB   . TYR E 1 133 ? 164.294 170.434 38.999  1.00 0.00 ? 133 TYR E CB   1 
ATOM 9960  C CG   . TYR E 1 133 ? 163.685 171.800 38.791  1.00 0.00 ? 133 TYR E CG   1 
ATOM 9961  C CD1  . TYR E 1 133 ? 163.645 172.717 39.848  1.00 0.00 ? 133 TYR E CD1  1 
ATOM 9962  C CD2  . TYR E 1 133 ? 163.160 172.151 37.540  1.00 0.00 ? 133 TYR E CD2  1 
ATOM 9963  C CE1  . TYR E 1 133 ? 163.082 173.984 39.654  1.00 0.00 ? 133 TYR E CE1  1 
ATOM 9964  C CE2  . TYR E 1 133 ? 162.597 173.418 37.347  1.00 0.00 ? 133 TYR E CE2  1 
ATOM 9965  C CZ   . TYR E 1 133 ? 162.558 174.335 38.404  1.00 0.00 ? 133 TYR E CZ   1 
ATOM 9966  O OH   . TYR E 1 133 ? 162.004 175.584 38.215  1.00 0.00 ? 133 TYR E OH   1 
ATOM 9967  H H    . TYR E 1 133 ? 165.235 170.723 36.671  1.00 0.00 ? 133 TYR E H    1 
ATOM 9968  H HA   . TYR E 1 133 ? 166.223 171.323 39.250  1.00 0.00 ? 133 TYR E HA   1 
ATOM 9969  H HB2  . TYR E 1 133 ? 163.825 169.725 38.332  1.00 0.00 ? 133 TYR E HB2  1 
ATOM 9970  H HB3  . TYR E 1 133 ? 164.141 170.125 40.022  1.00 0.00 ? 133 TYR E HB3  1 
ATOM 9971  H HD1  . TYR E 1 133 ? 164.049 172.447 40.812  1.00 0.00 ? 133 TYR E HD1  1 
ATOM 9972  H HD2  . TYR E 1 133 ? 163.191 171.443 36.724  1.00 0.00 ? 133 TYR E HD2  1 
ATOM 9973  H HE1  . TYR E 1 133 ? 163.052 174.691 40.470  1.00 0.00 ? 133 TYR E HE1  1 
ATOM 9974  H HE2  . TYR E 1 133 ? 162.193 173.688 36.383  1.00 0.00 ? 133 TYR E HE2  1 
ATOM 9975  H HH   . TYR E 1 133 ? 162.600 176.234 38.594  1.00 0.00 ? 133 TYR E HH   1 
ATOM 9976  N N    . GLN E 1 134 ? 166.422 168.191 38.291  1.00 0.00 ? 134 GLN E N    1 
ATOM 9977  C CA   . GLN E 1 134 ? 167.022 166.899 38.608  1.00 0.00 ? 134 GLN E CA   1 
ATOM 9978  C C    . GLN E 1 134 ? 168.546 167.003 38.629  1.00 0.00 ? 134 GLN E C    1 
ATOM 9979  O O    . GLN E 1 134 ? 169.131 167.845 37.947  1.00 0.00 ? 134 GLN E O    1 
ATOM 9980  C CB   . GLN E 1 134 ? 166.601 165.855 37.566  1.00 0.00 ? 134 GLN E CB   1 
ATOM 9981  C CG   . GLN E 1 134 ? 165.073 165.723 37.536  1.00 0.00 ? 134 GLN E CG   1 
ATOM 9982  C CD   . GLN E 1 134 ? 164.549 165.275 38.897  1.00 0.00 ? 134 GLN E CD   1 
ATOM 9983  O OE1  . GLN E 1 134 ? 164.959 164.234 39.409  1.00 0.00 ? 134 GLN E OE1  1 
ATOM 9984  N NE2  . GLN E 1 134 ? 163.663 166.005 39.516  1.00 0.00 ? 134 GLN E NE2  1 
ATOM 9985  H H    . GLN E 1 134 ? 165.980 168.316 37.426  1.00 0.00 ? 134 GLN E H    1 
ATOM 9986  H HA   . GLN E 1 134 ? 166.682 166.583 39.582  1.00 0.00 ? 134 GLN E HA   1 
ATOM 9987  H HB2  . GLN E 1 134 ? 166.953 166.163 36.592  1.00 0.00 ? 134 GLN E HB2  1 
ATOM 9988  H HB3  . GLN E 1 134 ? 167.037 164.901 37.819  1.00 0.00 ? 134 GLN E HB3  1 
ATOM 9989  H HG2  . GLN E 1 134 ? 164.636 166.677 37.282  1.00 0.00 ? 134 GLN E HG2  1 
ATOM 9990  H HG3  . GLN E 1 134 ? 164.793 164.993 36.790  1.00 0.00 ? 134 GLN E HG3  1 
ATOM 9991  H HE21 . GLN E 1 134 ? 163.338 166.834 39.106  1.00 0.00 ? 134 GLN E HE21 1 
ATOM 9992  H HE22 . GLN E 1 134 ? 163.323 165.726 40.391  1.00 0.00 ? 134 GLN E HE22 1 
ATOM 9993  N N    . ASP E 1 135 ? 169.179 166.138 39.417  1.00 0.00 ? 135 ASP E N    1 
ATOM 9994  C CA   . ASP E 1 135 ? 170.636 166.129 39.528  1.00 0.00 ? 135 ASP E CA   1 
ATOM 9995  C C    . ASP E 1 135 ? 171.150 167.492 39.993  1.00 0.00 ? 135 ASP E C    1 
ATOM 9996  O O    . ASP E 1 135 ? 170.474 168.195 40.745  1.00 0.00 ? 135 ASP E O    1 
ATOM 9997  C CB   . ASP E 1 135 ? 171.262 165.777 38.175  1.00 0.00 ? 135 ASP E CB   1 
ATOM 9998  C CG   . ASP E 1 135 ? 170.689 164.460 37.662  1.00 0.00 ? 135 ASP E CG   1 
ATOM 9999  O OD1  . ASP E 1 135 ? 170.632 163.520 38.437  1.00 0.00 ? 135 ASP E OD1  1 
ATOM 10000 O OD2  . ASP E 1 135 ? 170.316 164.412 36.502  1.00 0.00 ? 135 ASP E OD2  1 
ATOM 10001 H H    . ASP E 1 135 ? 168.656 165.491 39.936  1.00 0.00 ? 135 ASP E H    1 
ATOM 10002 H HA   . ASP E 1 135 ? 170.927 165.381 40.250  1.00 0.00 ? 135 ASP E HA   1 
ATOM 10003 H HB2  . ASP E 1 135 ? 171.050 166.562 37.465  1.00 0.00 ? 135 ASP E HB2  1 
ATOM 10004 H HB3  . ASP E 1 135 ? 172.331 165.676 38.290  1.00 0.00 ? 135 ASP E HB3  1 
ATOM 10005 N N    . TYR E 1 136 ? 172.355 167.857 39.544  1.00 0.00 ? 136 TYR E N    1 
ATOM 10006 C CA   . TYR E 1 136 ? 172.963 169.139 39.921  1.00 0.00 ? 136 TYR E CA   1 
ATOM 10007 C C    . TYR E 1 136 ? 172.701 170.185 38.838  1.00 0.00 ? 136 TYR E C    1 
ATOM 10008 O O    . TYR E 1 136 ? 172.628 169.857 37.653  1.00 0.00 ? 136 TYR E O    1 
ATOM 10009 C CB   . TYR E 1 136 ? 174.472 168.959 40.090  1.00 0.00 ? 136 TYR E CB   1 
ATOM 10010 C CG   . TYR E 1 136 ? 174.746 167.780 40.993  1.00 0.00 ? 136 TYR E CG   1 
ATOM 10011 C CD1  . TYR E 1 136 ? 174.688 167.929 42.382  1.00 0.00 ? 136 TYR E CD1  1 
ATOM 10012 C CD2  . TYR E 1 136 ? 175.062 166.534 40.435  1.00 0.00 ? 136 TYR E CD2  1 
ATOM 10013 C CE1  . TYR E 1 136 ? 174.945 166.833 43.215  1.00 0.00 ? 136 TYR E CE1  1 
ATOM 10014 C CE2  . TYR E 1 136 ? 175.320 165.440 41.266  1.00 0.00 ? 136 TYR E CE2  1 
ATOM 10015 C CZ   . TYR E 1 136 ? 175.263 165.588 42.656  1.00 0.00 ? 136 TYR E CZ   1 
ATOM 10016 O OH   . TYR E 1 136 ? 175.517 164.508 43.477  1.00 0.00 ? 136 TYR E OH   1 
ATOM 10017 H H    . TYR E 1 136 ? 172.847 167.255 38.952  1.00 0.00 ? 136 TYR E H    1 
ATOM 10018 H HA   . TYR E 1 136 ? 172.543 169.483 40.858  1.00 0.00 ? 136 TYR E HA   1 
ATOM 10019 H HB2  . TYR E 1 136 ? 174.927 168.789 39.125  1.00 0.00 ? 136 TYR E HB2  1 
ATOM 10020 H HB3  . TYR E 1 136 ? 174.891 169.848 40.533  1.00 0.00 ? 136 TYR E HB3  1 
ATOM 10021 H HD1  . TYR E 1 136 ? 174.444 168.889 42.813  1.00 0.00 ? 136 TYR E HD1  1 
ATOM 10022 H HD2  . TYR E 1 136 ? 175.106 166.420 39.362  1.00 0.00 ? 136 TYR E HD2  1 
ATOM 10023 H HE1  . TYR E 1 136 ? 174.902 166.948 44.288  1.00 0.00 ? 136 TYR E HE1  1 
ATOM 10024 H HE2  . TYR E 1 136 ? 175.565 164.479 40.835  1.00 0.00 ? 136 TYR E HE2  1 
ATOM 10025 H HH   . TYR E 1 136 ? 176.031 163.870 42.976  1.00 0.00 ? 136 TYR E HH   1 
ATOM 10026 N N    . GLU E 1 137 ? 172.560 171.448 39.251  1.00 0.00 ? 137 GLU E N    1 
ATOM 10027 C CA   . GLU E 1 137 ? 172.302 172.550 38.308  1.00 0.00 ? 137 GLU E CA   1 
ATOM 10028 C C    . GLU E 1 137 ? 173.105 173.791 38.695  1.00 0.00 ? 137 GLU E C    1 
ATOM 10029 O O    . GLU E 1 137 ? 172.534 174.845 38.978  1.00 0.00 ? 137 GLU E O    1 
ATOM 10030 C CB   . GLU E 1 137 ? 170.809 172.888 38.308  1.00 0.00 ? 137 GLU E CB   1 
ATOM 10031 C CG   . GLU E 1 137 ? 170.313 173.009 39.751  1.00 0.00 ? 137 GLU E CG   1 
ATOM 10032 C CD   . GLU E 1 137 ? 168.847 173.426 39.768  1.00 0.00 ? 137 GLU E CD   1 
ATOM 10033 O OE1  . GLU E 1 137 ? 168.337 173.771 38.714  1.00 0.00 ? 137 GLU E OE1  1 
ATOM 10034 O OE2  . GLU E 1 137 ? 168.255 173.395 40.834  1.00 0.00 ? 137 GLU E OE2  1 
ATOM 10035 H H    . GLU E 1 137 ? 172.627 171.646 40.208  1.00 0.00 ? 137 GLU E H    1 
ATOM 10036 H HA   . GLU E 1 137 ? 172.588 172.248 37.307  1.00 0.00 ? 137 GLU E HA   1 
ATOM 10037 H HB2  . GLU E 1 137 ? 170.652 173.825 37.792  1.00 0.00 ? 137 GLU E HB2  1 
ATOM 10038 H HB3  . GLU E 1 137 ? 170.261 172.105 37.806  1.00 0.00 ? 137 GLU E HB3  1 
ATOM 10039 H HG2  . GLU E 1 137 ? 170.420 172.055 40.247  1.00 0.00 ? 137 GLU E HG2  1 
ATOM 10040 H HG3  . GLU E 1 137 ? 170.901 173.749 40.271  1.00 0.00 ? 137 GLU E HG3  1 
ATOM 10041 N N    . PRO E 1 138 ? 174.410 173.686 38.721  1.00 0.00 ? 138 PRO E N    1 
ATOM 10042 C CA   . PRO E 1 138 ? 175.302 174.828 39.092  1.00 0.00 ? 138 PRO E CA   1 
ATOM 10043 C C    . PRO E 1 138 ? 175.358 175.900 37.996  1.00 0.00 ? 138 PRO E C    1 
ATOM 10044 O O    . PRO E 1 138 ? 175.490 177.088 38.287  1.00 0.00 ? 138 PRO E O    1 
ATOM 10045 C CB   . PRO E 1 138 ? 176.669 174.152 39.299  1.00 0.00 ? 138 PRO E CB   1 
ATOM 10046 C CG   . PRO E 1 138 ? 176.637 172.958 38.397  1.00 0.00 ? 138 PRO E CG   1 
ATOM 10047 C CD   . PRO E 1 138 ? 175.182 172.471 38.395  1.00 0.00 ? 138 PRO E CD   1 
ATOM 10048 H HA   . PRO E 1 138 ? 174.972 175.268 40.019  1.00 0.00 ? 138 PRO E HA   1 
ATOM 10049 H HB2  . PRO E 1 138 ? 177.476 174.824 39.022  1.00 0.00 ? 138 PRO E HB2  1 
ATOM 10050 H HB3  . PRO E 1 138 ? 176.782 173.836 40.326  1.00 0.00 ? 138 PRO E HB3  1 
ATOM 10051 H HG2  . PRO E 1 138 ? 176.942 173.242 37.394  1.00 0.00 ? 138 PRO E HG2  1 
ATOM 10052 H HG3  . PRO E 1 138 ? 177.285 172.179 38.775  1.00 0.00 ? 138 PRO E HG3  1 
ATOM 10053 H HD2  . PRO E 1 138 ? 174.911 172.092 37.417  1.00 0.00 ? 138 PRO E HD2  1 
ATOM 10054 H HD3  . PRO E 1 138 ? 175.028 171.720 39.150  1.00 0.00 ? 138 PRO E HD3  1 
ATOM 10055 N N    . GLU E 1 139 ? 175.254 175.469 36.742  1.00 0.00 ? 139 GLU E N    1 
ATOM 10056 C CA   . GLU E 1 139 ? 175.294 176.404 35.621  1.00 0.00 ? 139 GLU E CA   1 
ATOM 10057 C C    . GLU E 1 139 ? 174.090 177.340 35.663  1.00 0.00 ? 139 GLU E C    1 
ATOM 10058 O O    . GLU E 1 139 ? 174.219 178.543 35.444  1.00 0.00 ? 139 GLU E O    1 
ATOM 10059 C CB   . GLU E 1 139 ? 175.308 175.633 34.296  1.00 0.00 ? 139 GLU E CB   1 
ATOM 10060 C CG   . GLU E 1 139 ? 175.402 176.614 33.122  1.00 0.00 ? 139 GLU E CG   1 
ATOM 10061 C CD   . GLU E 1 139 ? 175.529 175.845 31.812  1.00 0.00 ? 139 GLU E CD   1 
ATOM 10062 O OE1  . GLU E 1 139 ? 175.550 174.627 31.863  1.00 0.00 ? 139 GLU E OE1  1 
ATOM 10063 O OE2  . GLU E 1 139 ? 175.604 176.486 30.776  1.00 0.00 ? 139 GLU E OE2  1 
ATOM 10064 H H    . GLU E 1 139 ? 175.149 174.511 36.567  1.00 0.00 ? 139 GLU E H    1 
ATOM 10065 H HA   . GLU E 1 139 ? 176.197 176.993 35.689  1.00 0.00 ? 139 GLU E HA   1 
ATOM 10066 H HB2  . GLU E 1 139 ? 176.160 174.969 34.277  1.00 0.00 ? 139 GLU E HB2  1 
ATOM 10067 H HB3  . GLU E 1 139 ? 174.401 175.056 34.207  1.00 0.00 ? 139 GLU E HB3  1 
ATOM 10068 H HG2  . GLU E 1 139 ? 174.512 177.226 33.093  1.00 0.00 ? 139 GLU E HG2  1 
ATOM 10069 H HG3  . GLU E 1 139 ? 176.267 177.247 33.251  1.00 0.00 ? 139 GLU E HG3  1 
ATOM 10070 N N    . ALA E 1 140 ? 172.916 176.774 35.952  1.00 0.00 ? 140 ALA E N    1 
ATOM 10071 C CA   . ALA E 1 140 ? 171.680 177.559 36.029  1.00 0.00 ? 140 ALA E CA   1 
ATOM 10072 C C    . ALA E 1 140 ? 171.409 177.992 37.466  1.00 0.00 ? 140 ALA E C    1 
ATOM 10073 O O    . ALA E 1 140 ? 170.297 178.414 37.737  1.00 0.00 ? 140 ALA E O    1 
ATOM 10074 C CB   . ALA E 1 140 ? 170.503 176.725 35.519  1.00 0.00 ? 140 ALA E CB   1 
ATOM 10075 O OXT  . ALA E 1 140 ? 172.317 177.892 38.275  1.00 0.00 ? 140 ALA E OXT  1 
ATOM 10076 H H    . ALA E 1 140 ? 172.881 175.809 36.119  1.00 0.00 ? 140 ALA E H    1 
ATOM 10077 H HA   . ALA E 1 140 ? 171.773 178.441 35.408  1.00 0.00 ? 140 ALA E HA   1 
ATOM 10078 H HB1  . ALA E 1 140 ? 170.449 175.801 36.077  1.00 0.00 ? 140 ALA E HB1  1 
ATOM 10079 H HB2  . ALA E 1 140 ? 170.645 176.503 34.472  1.00 0.00 ? 140 ALA E HB2  1 
ATOM 10080 H HB3  . ALA E 1 140 ? 169.585 177.279 35.649  1.00 0.00 ? 140 ALA E HB3  1 
ATOM 10081 N N    . MET F 1 1   ? 52.412  187.781 47.025  1.00 0.00 ? 1   MET F N    1 
ATOM 10082 C CA   . MET F 1 1   ? 53.161  188.375 45.882  1.00 0.00 ? 1   MET F CA   1 
ATOM 10083 C C    . MET F 1 1   ? 52.446  188.040 44.578  1.00 0.00 ? 1   MET F C    1 
ATOM 10084 O O    . MET F 1 1   ? 53.005  187.376 43.705  1.00 0.00 ? 1   MET F O    1 
ATOM 10085 C CB   . MET F 1 1   ? 54.584  187.812 45.858  1.00 0.00 ? 1   MET F CB   1 
ATOM 10086 C CG   . MET F 1 1   ? 55.390  188.414 47.010  1.00 0.00 ? 1   MET F CG   1 
ATOM 10087 S SD   . MET F 1 1   ? 57.058  187.713 47.010  1.00 0.00 ? 1   MET F SD   1 
ATOM 10088 C CE   . MET F 1 1   ? 57.730  188.727 48.349  1.00 0.00 ? 1   MET F CE   1 
ATOM 10089 H H1   . MET F 1 1   ? 52.569  188.356 47.878  1.00 0.00 ? 1   MET F H1   1 
ATOM 10090 H H2   . MET F 1 1   ? 52.748  186.811 47.193  1.00 0.00 ? 1   MET F H2   1 
ATOM 10091 H H3   . MET F 1 1   ? 51.397  187.765 46.804  1.00 0.00 ? 1   MET F H3   1 
ATOM 10092 H HA   . MET F 1 1   ? 53.202  189.448 46.000  1.00 0.00 ? 1   MET F HA   1 
ATOM 10093 H HB2  . MET F 1 1   ? 54.547  186.737 45.965  1.00 0.00 ? 1   MET F HB2  1 
ATOM 10094 H HB3  . MET F 1 1   ? 55.056  188.065 44.921  1.00 0.00 ? 1   MET F HB3  1 
ATOM 10095 H HG2  . MET F 1 1   ? 55.449  189.485 46.887  1.00 0.00 ? 1   MET F HG2  1 
ATOM 10096 H HG3  . MET F 1 1   ? 54.903  188.186 47.948  1.00 0.00 ? 1   MET F HG3  1 
ATOM 10097 H HE1  . MET F 1 1   ? 58.809  188.644 48.357  1.00 0.00 ? 1   MET F HE1  1 
ATOM 10098 H HE2  . MET F 1 1   ? 57.340  188.384 49.293  1.00 0.00 ? 1   MET F HE2  1 
ATOM 10099 H HE3  . MET F 1 1   ? 57.444  189.760 48.197  1.00 0.00 ? 1   MET F HE3  1 
ATOM 10100 N N    . ASP F 1 2   ? 51.209  188.507 44.453  1.00 0.00 ? 2   ASP F N    1 
ATOM 10101 C CA   . ASP F 1 2   ? 50.427  188.257 43.248  1.00 0.00 ? 2   ASP F CA   1 
ATOM 10102 C C    . ASP F 1 2   ? 51.115  188.871 42.033  1.00 0.00 ? 2   ASP F C    1 
ATOM 10103 O O    . ASP F 1 2   ? 51.129  188.283 40.953  1.00 0.00 ? 2   ASP F O    1 
ATOM 10104 C CB   . ASP F 1 2   ? 49.026  188.852 43.402  1.00 0.00 ? 2   ASP F CB   1 
ATOM 10105 C CG   . ASP F 1 2   ? 48.219  188.033 44.402  1.00 0.00 ? 2   ASP F CG   1 
ATOM 10106 O OD1  . ASP F 1 2   ? 48.652  186.940 44.730  1.00 0.00 ? 2   ASP F OD1  1 
ATOM 10107 O OD2  . ASP F 1 2   ? 47.179  188.509 44.827  1.00 0.00 ? 2   ASP F OD2  1 
ATOM 10108 H H    . ASP F 1 2   ? 50.817  189.034 45.180  1.00 0.00 ? 2   ASP F H    1 
ATOM 10109 H HA   . ASP F 1 2   ? 50.340  187.191 43.102  1.00 0.00 ? 2   ASP F HA   1 
ATOM 10110 H HB2  . ASP F 1 2   ? 49.107  189.870 43.756  1.00 0.00 ? 2   ASP F HB2  1 
ATOM 10111 H HB3  . ASP F 1 2   ? 48.525  188.844 42.446  1.00 0.00 ? 2   ASP F HB3  1 
ATOM 10112 N N    . VAL F 1 3   ? 51.681  190.059 42.223  1.00 0.00 ? 3   VAL F N    1 
ATOM 10113 C CA   . VAL F 1 3   ? 52.370  190.751 41.139  1.00 0.00 ? 3   VAL F CA   1 
ATOM 10114 C C    . VAL F 1 3   ? 51.528  190.731 39.866  1.00 0.00 ? 3   VAL F C    1 
ATOM 10115 O O    . VAL F 1 3   ? 50.743  191.647 39.618  1.00 0.00 ? 3   VAL F O    1 
ATOM 10116 C CB   . VAL F 1 3   ? 53.725  190.092 40.874  1.00 0.00 ? 3   VAL F CB   1 
ATOM 10117 C CG1  . VAL F 1 3   ? 54.423  190.807 39.715  1.00 0.00 ? 3   VAL F CG1  1 
ATOM 10118 C CG2  . VAL F 1 3   ? 54.593  190.192 42.130  1.00 0.00 ? 3   VAL F CG2  1 
ATOM 10119 H H    . VAL F 1 3   ? 51.637  190.477 43.108  1.00 0.00 ? 3   VAL F H    1 
ATOM 10120 H HA   . VAL F 1 3   ? 52.536  191.778 41.432  1.00 0.00 ? 3   VAL F HA   1 
ATOM 10121 H HB   . VAL F 1 3   ? 53.576  189.052 40.617  1.00 0.00 ? 3   VAL F HB   1 
ATOM 10122 H HG11 . VAL F 1 3   ? 55.449  190.475 39.654  1.00 0.00 ? 3   VAL F HG11 1 
ATOM 10123 H HG12 . VAL F 1 3   ? 54.400  191.874 39.884  1.00 0.00 ? 3   VAL F HG12 1 
ATOM 10124 H HG13 . VAL F 1 3   ? 53.915  190.577 38.791  1.00 0.00 ? 3   VAL F HG13 1 
ATOM 10125 H HG21 . VAL F 1 3   ? 54.157  189.595 42.918  1.00 0.00 ? 3   VAL F HG21 1 
ATOM 10126 H HG22 . VAL F 1 3   ? 54.649  191.223 42.448  1.00 0.00 ? 3   VAL F HG22 1 
ATOM 10127 H HG23 . VAL F 1 3   ? 55.586  189.829 41.910  1.00 0.00 ? 3   VAL F HG23 1 
ATOM 10128 N N    . PHE F 1 4   ? 51.692  189.676 39.058  1.00 0.00 ? 4   PHE F N    1 
ATOM 10129 C CA   . PHE F 1 4   ? 50.939  189.535 37.800  1.00 0.00 ? 4   PHE F CA   1 
ATOM 10130 C C    . PHE F 1 4   ? 50.002  188.332 37.871  1.00 0.00 ? 4   PHE F C    1 
ATOM 10131 O O    . PHE F 1 4   ? 50.445  187.198 38.048  1.00 0.00 ? 4   PHE F O    1 
ATOM 10132 C CB   . PHE F 1 4   ? 51.910  189.344 36.632  1.00 0.00 ? 4   PHE F CB   1 
ATOM 10133 C CG   . PHE F 1 4   ? 51.132  189.249 35.339  1.00 0.00 ? 4   PHE F CG   1 
ATOM 10134 C CD1  . PHE F 1 4   ? 50.727  190.416 34.680  1.00 0.00 ? 4   PHE F CD1  1 
ATOM 10135 C CD2  . PHE F 1 4   ? 50.814  187.996 34.802  1.00 0.00 ? 4   PHE F CD2  1 
ATOM 10136 C CE1  . PHE F 1 4   ? 50.003  190.330 33.485  1.00 0.00 ? 4   PHE F CE1  1 
ATOM 10137 C CE2  . PHE F 1 4   ? 50.091  187.910 33.606  1.00 0.00 ? 4   PHE F CE2  1 
ATOM 10138 C CZ   . PHE F 1 4   ? 49.686  189.077 32.947  1.00 0.00 ? 4   PHE F CZ   1 
ATOM 10139 H H    . PHE F 1 4   ? 52.330  188.978 39.312  1.00 0.00 ? 4   PHE F H    1 
ATOM 10140 H HA   . PHE F 1 4   ? 50.349  190.426 37.619  1.00 0.00 ? 4   PHE F HA   1 
ATOM 10141 H HB2  . PHE F 1 4   ? 52.587  190.184 36.584  1.00 0.00 ? 4   PHE F HB2  1 
ATOM 10142 H HB3  . PHE F 1 4   ? 52.474  188.435 36.778  1.00 0.00 ? 4   PHE F HB3  1 
ATOM 10143 H HD1  . PHE F 1 4   ? 50.972  191.383 35.095  1.00 0.00 ? 4   PHE F HD1  1 
ATOM 10144 H HD2  . PHE F 1 4   ? 51.127  187.095 35.309  1.00 0.00 ? 4   PHE F HD2  1 
ATOM 10145 H HE1  . PHE F 1 4   ? 49.690  191.230 32.977  1.00 0.00 ? 4   PHE F HE1  1 
ATOM 10146 H HE2  . PHE F 1 4   ? 49.845  186.944 33.191  1.00 0.00 ? 4   PHE F HE2  1 
ATOM 10147 H HZ   . PHE F 1 4   ? 49.127  189.011 32.025  1.00 0.00 ? 4   PHE F HZ   1 
ATOM 10148 N N    . MET F 1 5   ? 48.707  188.587 37.723  1.00 0.00 ? 5   MET F N    1 
ATOM 10149 C CA   . MET F 1 5   ? 47.714  187.517 37.762  1.00 0.00 ? 5   MET F CA   1 
ATOM 10150 C C    . MET F 1 5   ? 47.714  186.745 36.445  1.00 0.00 ? 5   MET F C    1 
ATOM 10151 O O    . MET F 1 5   ? 48.136  187.267 35.416  1.00 0.00 ? 5   MET F O    1 
ATOM 10152 C CB   . MET F 1 5   ? 46.322  188.101 38.014  1.00 0.00 ? 5   MET F CB   1 
ATOM 10153 C CG   . MET F 1 5   ? 46.269  188.716 39.417  1.00 0.00 ? 5   MET F CG   1 
ATOM 10154 S SD   . MET F 1 5   ? 46.344  187.401 40.668  1.00 0.00 ? 5   MET F SD   1 
ATOM 10155 C CE   . MET F 1 5   ? 44.603  186.882 40.621  1.00 0.00 ? 5   MET F CE   1 
ATOM 10156 H H    . MET F 1 5   ? 48.413  189.512 37.579  1.00 0.00 ? 5   MET F H    1 
ATOM 10157 H HA   . MET F 1 5   ? 47.959  186.840 38.568  1.00 0.00 ? 5   MET F HA   1 
ATOM 10158 H HB2  . MET F 1 5   ? 46.116  188.866 37.278  1.00 0.00 ? 5   MET F HB2  1 
ATOM 10159 H HB3  . MET F 1 5   ? 45.586  187.319 37.935  1.00 0.00 ? 5   MET F HB3  1 
ATOM 10160 H HG2  . MET F 1 5   ? 47.109  189.382 39.548  1.00 0.00 ? 5   MET F HG2  1 
ATOM 10161 H HG3  . MET F 1 5   ? 45.350  189.270 39.532  1.00 0.00 ? 5   MET F HG3  1 
ATOM 10162 H HE1  . MET F 1 5   ? 44.098  187.242 41.509  1.00 0.00 ? 5   MET F HE1  1 
ATOM 10163 H HE2  . MET F 1 5   ? 44.548  185.808 40.594  1.00 0.00 ? 5   MET F HE2  1 
ATOM 10164 H HE3  . MET F 1 5   ? 44.121  187.286 39.741  1.00 0.00 ? 5   MET F HE3  1 
ATOM 10165 N N    . LYS F 1 6   ? 47.241  185.500 36.491  1.00 0.00 ? 6   LYS F N    1 
ATOM 10166 C CA   . LYS F 1 6   ? 47.188  184.655 35.294  1.00 0.00 ? 6   LYS F CA   1 
ATOM 10167 C C    . LYS F 1 6   ? 48.596  184.224 34.869  1.00 0.00 ? 6   LYS F C    1 
ATOM 10168 O O    . LYS F 1 6   ? 49.399  183.796 35.697  1.00 0.00 ? 6   LYS F O    1 
ATOM 10169 C CB   . LYS F 1 6   ? 46.496  185.411 34.138  1.00 0.00 ? 6   LYS F CB   1 
ATOM 10170 C CG   . LYS F 1 6   ? 45.928  184.408 33.118  1.00 0.00 ? 6   LYS F CG   1 
ATOM 10171 C CD   . LYS F 1 6   ? 45.665  185.113 31.779  1.00 0.00 ? 6   LYS F CD   1 
ATOM 10172 C CE   . LYS F 1 6   ? 44.801  186.362 32.003  1.00 0.00 ? 6   LYS F CE   1 
ATOM 10173 N NZ   . LYS F 1 6   ? 45.656  187.482 32.490  1.00 0.00 ? 6   LYS F NZ   1 
ATOM 10174 H H    . LYS F 1 6   ? 46.922  185.141 37.345  1.00 0.00 ? 6   LYS F H    1 
ATOM 10175 H HA   . LYS F 1 6   ? 46.613  183.771 35.528  1.00 0.00 ? 6   LYS F HA   1 
ATOM 10176 H HB2  . LYS F 1 6   ? 45.690  186.010 34.536  1.00 0.00 ? 6   LYS F HB2  1 
ATOM 10177 H HB3  . LYS F 1 6   ? 47.209  186.055 33.647  1.00 0.00 ? 6   LYS F HB3  1 
ATOM 10178 H HG2  . LYS F 1 6   ? 46.639  183.607 32.968  1.00 0.00 ? 6   LYS F HG2  1 
ATOM 10179 H HG3  . LYS F 1 6   ? 45.002  184.000 33.495  1.00 0.00 ? 6   LYS F HG3  1 
ATOM 10180 H HD2  . LYS F 1 6   ? 46.607  185.403 31.335  1.00 0.00 ? 6   LYS F HD2  1 
ATOM 10181 H HD3  . LYS F 1 6   ? 45.148  184.438 31.114  1.00 0.00 ? 6   LYS F HD3  1 
ATOM 10182 H HE2  . LYS F 1 6   ? 44.337  186.647 31.071  1.00 0.00 ? 6   LYS F HE2  1 
ATOM 10183 H HE3  . LYS F 1 6   ? 44.035  186.149 32.734  1.00 0.00 ? 6   LYS F HE3  1 
ATOM 10184 H HZ1  . LYS F 1 6   ? 46.658  187.226 32.384  1.00 0.00 ? 6   LYS F HZ1  1 
ATOM 10185 H HZ2  . LYS F 1 6   ? 45.448  187.665 33.494  1.00 0.00 ? 6   LYS F HZ2  1 
ATOM 10186 H HZ3  . LYS F 1 6   ? 45.458  188.337 31.934  1.00 0.00 ? 6   LYS F HZ3  1 
ATOM 10187 N N    . GLY F 1 7   ? 48.885  184.342 33.574  1.00 0.00 ? 7   GLY F N    1 
ATOM 10188 C CA   . GLY F 1 7   ? 50.194  183.962 33.054  1.00 0.00 ? 7   GLY F CA   1 
ATOM 10189 C C    . GLY F 1 7   ? 50.357  182.445 33.025  1.00 0.00 ? 7   GLY F C    1 
ATOM 10190 O O    . GLY F 1 7   ? 51.473  181.932 33.096  1.00 0.00 ? 7   GLY F O    1 
ATOM 10191 H H    . GLY F 1 7   ? 48.206  184.689 32.958  1.00 0.00 ? 7   GLY F H    1 
ATOM 10192 H HA2  . GLY F 1 7   ? 50.304  184.350 32.051  1.00 0.00 ? 7   GLY F HA2  1 
ATOM 10193 H HA3  . GLY F 1 7   ? 50.961  184.386 33.684  1.00 0.00 ? 7   GLY F HA3  1 
ATOM 10194 N N    . LEU F 1 8   ? 49.239  181.732 32.923  1.00 0.00 ? 8   LEU F N    1 
ATOM 10195 C CA   . LEU F 1 8   ? 49.278  180.271 32.888  1.00 0.00 ? 8   LEU F CA   1 
ATOM 10196 C C    . LEU F 1 8   ? 50.034  179.792 31.654  1.00 0.00 ? 8   LEU F C    1 
ATOM 10197 O O    . LEU F 1 8   ? 49.707  180.167 30.528  1.00 0.00 ? 8   LEU F O    1 
ATOM 10198 C CB   . LEU F 1 8   ? 47.845  179.712 32.872  1.00 0.00 ? 8   LEU F CB   1 
ATOM 10199 C CG   . LEU F 1 8   ? 47.855  178.168 32.841  1.00 0.00 ? 8   LEU F CG   1 
ATOM 10200 C CD1  . LEU F 1 8   ? 48.574  177.609 34.087  1.00 0.00 ? 8   LEU F CD1  1 
ATOM 10201 C CD2  . LEU F 1 8   ? 46.403  177.666 32.813  1.00 0.00 ? 8   LEU F CD2  1 
ATOM 10202 H H    . LEU F 1 8   ? 48.375  182.194 32.870  1.00 0.00 ? 8   LEU F H    1 
ATOM 10203 H HA   . LEU F 1 8   ? 49.783  179.918 33.772  1.00 0.00 ? 8   LEU F HA   1 
ATOM 10204 H HB2  . LEU F 1 8   ? 47.323  180.048 33.755  1.00 0.00 ? 8   LEU F HB2  1 
ATOM 10205 H HB3  . LEU F 1 8   ? 47.333  180.081 31.995  1.00 0.00 ? 8   LEU F HB3  1 
ATOM 10206 H HG   . LEU F 1 8   ? 48.366  177.828 31.951  1.00 0.00 ? 8   LEU F HG   1 
ATOM 10207 H HD11 . LEU F 1 8   ? 48.243  176.596 34.277  1.00 0.00 ? 8   LEU F HD11 1 
ATOM 10208 H HD12 . LEU F 1 8   ? 48.351  178.226 34.945  1.00 0.00 ? 8   LEU F HD12 1 
ATOM 10209 H HD13 . LEU F 1 8   ? 49.641  177.605 33.914  1.00 0.00 ? 8   LEU F HD13 1 
ATOM 10210 H HD21 . LEU F 1 8   ? 46.394  176.587 32.875  1.00 0.00 ? 8   LEU F HD21 1 
ATOM 10211 H HD22 . LEU F 1 8   ? 45.932  177.978 31.894  1.00 0.00 ? 8   LEU F HD22 1 
ATOM 10212 H HD23 . LEU F 1 8   ? 45.863  178.080 33.653  1.00 0.00 ? 8   LEU F HD23 1 
ATOM 10213 N N    . SER F 1 9   ? 51.048  178.963 31.873  1.00 0.00 ? 9   SER F N    1 
ATOM 10214 C CA   . SER F 1 9   ? 51.843  178.440 30.773  1.00 0.00 ? 9   SER F CA   1 
ATOM 10215 C C    . SER F 1 9   ? 52.671  177.245 31.234  1.00 0.00 ? 9   SER F C    1 
ATOM 10216 O O    . SER F 1 9   ? 53.806  177.054 30.797  1.00 0.00 ? 9   SER F O    1 
ATOM 10217 C CB   . SER F 1 9   ? 52.757  179.538 30.230  1.00 0.00 ? 9   SER F CB   1 
ATOM 10218 O OG   . SER F 1 9   ? 52.042  180.767 30.199  1.00 0.00 ? 9   SER F OG   1 
ATOM 10219 H H    . SER F 1 9   ? 51.263  178.699 32.792  1.00 0.00 ? 9   SER F H    1 
ATOM 10220 H HA   . SER F 1 9   ? 51.179  178.120 29.983  1.00 0.00 ? 9   SER F HA   1 
ATOM 10221 H HB2  . SER F 1 9   ? 53.618  179.644 30.867  1.00 0.00 ? 9   SER F HB2  1 
ATOM 10222 H HB3  . SER F 1 9   ? 53.079  179.273 29.231  1.00 0.00 ? 9   SER F HB3  1 
ATOM 10223 H HG   . SER F 1 9   ? 52.461  181.370 30.817  1.00 0.00 ? 9   SER F HG   1 
ATOM 10224 N N    . LYS F 1 10  ? 52.085  176.441 32.119  1.00 0.00 ? 10  LYS F N    1 
ATOM 10225 C CA   . LYS F 1 10  ? 52.761  175.257 32.642  1.00 0.00 ? 10  LYS F CA   1 
ATOM 10226 C C    . LYS F 1 10  ? 52.988  174.243 31.533  1.00 0.00 ? 10  LYS F C    1 
ATOM 10227 O O    . LYS F 1 10  ? 53.749  173.289 31.695  1.00 0.00 ? 10  LYS F O    1 
ATOM 10228 C CB   . LYS F 1 10  ? 51.927  174.619 33.755  1.00 0.00 ? 10  LYS F CB   1 
ATOM 10229 C CG   . LYS F 1 10  ? 51.954  175.510 34.998  1.00 0.00 ? 10  LYS F CG   1 
ATOM 10230 C CD   . LYS F 1 10  ? 51.107  174.868 36.099  1.00 0.00 ? 10  LYS F CD   1 
ATOM 10231 C CE   . LYS F 1 10  ? 51.148  175.743 37.353  1.00 0.00 ? 10  LYS F CE   1 
ATOM 10232 N NZ   . LYS F 1 10  ? 50.312  175.121 38.420  1.00 0.00 ? 10  LYS F NZ   1 
ATOM 10233 H H    . LYS F 1 10  ? 51.177  176.646 32.424  1.00 0.00 ? 10  LYS F H    1 
ATOM 10234 H HA   . LYS F 1 10  ? 53.717  175.551 33.048  1.00 0.00 ? 10  LYS F HA   1 
ATOM 10235 H HB2  . LYS F 1 10  ? 50.908  174.504 33.417  1.00 0.00 ? 10  LYS F HB2  1 
ATOM 10236 H HB3  . LYS F 1 10  ? 52.335  173.650 34.000  1.00 0.00 ? 10  LYS F HB3  1 
ATOM 10237 H HG2  . LYS F 1 10  ? 52.974  175.616 35.342  1.00 0.00 ? 10  LYS F HG2  1 
ATOM 10238 H HG3  . LYS F 1 10  ? 51.552  176.482 34.756  1.00 0.00 ? 10  LYS F HG3  1 
ATOM 10239 H HD2  . LYS F 1 10  ? 50.087  174.773 35.759  1.00 0.00 ? 10  LYS F HD2  1 
ATOM 10240 H HD3  . LYS F 1 10  ? 51.501  173.890 36.332  1.00 0.00 ? 10  LYS F HD3  1 
ATOM 10241 H HE2  . LYS F 1 10  ? 52.167  175.829 37.699  1.00 0.00 ? 10  LYS F HE2  1 
ATOM 10242 H HE3  . LYS F 1 10  ? 50.762  176.724 37.120  1.00 0.00 ? 10  LYS F HE3  1 
ATOM 10243 H HZ1  . LYS F 1 10  ? 49.313  175.145 38.136  1.00 0.00 ? 10  LYS F HZ1  1 
ATOM 10244 H HZ2  . LYS F 1 10  ? 50.435  175.652 39.308  1.00 0.00 ? 10  LYS F HZ2  1 
ATOM 10245 H HZ3  . LYS F 1 10  ? 50.607  174.135 38.561  1.00 0.00 ? 10  LYS F HZ3  1 
ATOM 10246 N N    . ALA F 1 11  ? 52.322  174.455 30.408  1.00 0.00 ? 11  ALA F N    1 
ATOM 10247 C CA   . ALA F 1 11  ? 52.456  173.554 29.276  1.00 0.00 ? 11  ALA F CA   1 
ATOM 10248 C C    . ALA F 1 11  ? 53.909  173.493 28.819  1.00 0.00 ? 11  ALA F C    1 
ATOM 10249 O O    . ALA F 1 11  ? 54.399  172.437 28.421  1.00 0.00 ? 11  ALA F O    1 
ATOM 10250 C CB   . ALA F 1 11  ? 51.571  174.025 28.123  1.00 0.00 ? 11  ALA F CB   1 
ATOM 10251 H H    . ALA F 1 11  ? 51.729  175.232 30.339  1.00 0.00 ? 11  ALA F H    1 
ATOM 10252 H HA   . ALA F 1 11  ? 52.141  172.565 29.577  1.00 0.00 ? 11  ALA F HA   1 
ATOM 10253 H HB1  . ALA F 1 11  ? 50.539  174.040 28.443  1.00 0.00 ? 11  ALA F HB1  1 
ATOM 10254 H HB2  . ALA F 1 11  ? 51.679  173.349 27.287  1.00 0.00 ? 11  ALA F HB2  1 
ATOM 10255 H HB3  . ALA F 1 11  ? 51.869  175.018 27.822  1.00 0.00 ? 11  ALA F HB3  1 
ATOM 10256 N N    . LYS F 1 12  ? 54.597  174.633 28.877  1.00 0.00 ? 12  LYS F N    1 
ATOM 10257 C CA   . LYS F 1 12  ? 55.995  174.682 28.462  1.00 0.00 ? 12  LYS F CA   1 
ATOM 10258 C C    . LYS F 1 12  ? 56.842  173.786 29.359  1.00 0.00 ? 12  LYS F C    1 
ATOM 10259 O O    . LYS F 1 12  ? 56.768  173.871 30.585  1.00 0.00 ? 12  LYS F O    1 
ATOM 10260 C CB   . LYS F 1 12  ? 56.524  176.119 28.541  1.00 0.00 ? 12  LYS F CB   1 
ATOM 10261 C CG   . LYS F 1 12  ? 55.732  177.018 27.585  1.00 0.00 ? 12  LYS F CG   1 
ATOM 10262 C CD   . LYS F 1 12  ? 56.440  178.375 27.421  1.00 0.00 ? 12  LYS F CD   1 
ATOM 10263 C CE   . LYS F 1 12  ? 56.407  179.155 28.739  1.00 0.00 ? 12  LYS F CE   1 
ATOM 10264 N NZ   . LYS F 1 12  ? 56.836  180.563 28.493  1.00 0.00 ? 12  LYS F NZ   1 
ATOM 10265 H H    . LYS F 1 12  ? 54.160  175.448 29.205  1.00 0.00 ? 12  LYS F H    1 
ATOM 10266 H HA   . LYS F 1 12  ? 56.073  174.336 27.443  1.00 0.00 ? 12  LYS F HA   1 
ATOM 10267 H HB2  . LYS F 1 12  ? 56.412  176.480 29.552  1.00 0.00 ? 12  LYS F HB2  1 
ATOM 10268 H HB3  . LYS F 1 12  ? 57.568  176.136 28.267  1.00 0.00 ? 12  LYS F HB3  1 
ATOM 10269 H HG2  . LYS F 1 12  ? 55.657  176.535 26.621  1.00 0.00 ? 12  LYS F HG2  1 
ATOM 10270 H HG3  . LYS F 1 12  ? 54.742  177.179 27.984  1.00 0.00 ? 12  LYS F HG3  1 
ATOM 10271 H HD2  . LYS F 1 12  ? 57.466  178.210 27.128  1.00 0.00 ? 12  LYS F HD2  1 
ATOM 10272 H HD3  . LYS F 1 12  ? 55.938  178.948 26.656  1.00 0.00 ? 12  LYS F HD3  1 
ATOM 10273 H HE2  . LYS F 1 12  ? 55.408  179.147 29.140  1.00 0.00 ? 12  LYS F HE2  1 
ATOM 10274 H HE3  . LYS F 1 12  ? 57.083  178.699 29.446  1.00 0.00 ? 12  LYS F HE3  1 
ATOM 10275 H HZ1  . LYS F 1 12  ? 56.435  180.895 27.593  1.00 0.00 ? 12  LYS F HZ1  1 
ATOM 10276 H HZ2  . LYS F 1 12  ? 57.874  180.606 28.448  1.00 0.00 ? 12  LYS F HZ2  1 
ATOM 10277 H HZ3  . LYS F 1 12  ? 56.495  181.169 29.265  1.00 0.00 ? 12  LYS F HZ3  1 
ATOM 10278 N N    . GLU F 1 13  ? 57.653  172.929 28.739  1.00 0.00 ? 13  GLU F N    1 
ATOM 10279 C CA   . GLU F 1 13  ? 58.521  172.017 29.486  1.00 0.00 ? 13  GLU F CA   1 
ATOM 10280 C C    . GLU F 1 13  ? 59.863  172.681 29.778  1.00 0.00 ? 13  GLU F C    1 
ATOM 10281 O O    . GLU F 1 13  ? 60.440  173.339 28.913  1.00 0.00 ? 13  GLU F O    1 
ATOM 10282 C CB   . GLU F 1 13  ? 58.748  170.738 28.677  1.00 0.00 ? 13  GLU F CB   1 
ATOM 10283 C CG   . GLU F 1 13  ? 57.405  170.051 28.417  1.00 0.00 ? 13  GLU F CG   1 
ATOM 10284 C CD   . GLU F 1 13  ? 56.815  169.544 29.729  1.00 0.00 ? 13  GLU F CD   1 
ATOM 10285 O OE1  . GLU F 1 13  ? 57.566  169.407 30.679  1.00 0.00 ? 13  GLU F OE1  1 
ATOM 10286 O OE2  . GLU F 1 13  ? 55.620  169.298 29.761  1.00 0.00 ? 13  GLU F OE2  1 
ATOM 10287 H H    . GLU F 1 13  ? 57.670  172.911 27.759  1.00 0.00 ? 13  GLU F H    1 
ATOM 10288 H HA   . GLU F 1 13  ? 58.047  171.756 30.423  1.00 0.00 ? 13  GLU F HA   1 
ATOM 10289 H HB2  . GLU F 1 13  ? 59.213  170.989 27.733  1.00 0.00 ? 13  GLU F HB2  1 
ATOM 10290 H HB3  . GLU F 1 13  ? 59.391  170.071 29.229  1.00 0.00 ? 13  GLU F HB3  1 
ATOM 10291 H HG2  . GLU F 1 13  ? 56.723  170.756 27.965  1.00 0.00 ? 13  GLU F HG2  1 
ATOM 10292 H HG3  . GLU F 1 13  ? 57.554  169.218 27.746  1.00 0.00 ? 13  GLU F HG3  1 
ATOM 10293 N N    . GLY F 1 14  ? 60.357  172.504 31.008  1.00 0.00 ? 14  GLY F N    1 
ATOM 10294 C CA   . GLY F 1 14  ? 61.645  173.092 31.421  1.00 0.00 ? 14  GLY F CA   1 
ATOM 10295 C C    . GLY F 1 14  ? 62.620  172.011 31.874  1.00 0.00 ? 14  GLY F C    1 
ATOM 10296 O O    . GLY F 1 14  ? 63.751  172.307 32.259  1.00 0.00 ? 14  GLY F O    1 
ATOM 10297 H H    . GLY F 1 14  ? 59.849  171.969 31.653  1.00 0.00 ? 14  GLY F H    1 
ATOM 10298 H HA2  . GLY F 1 14  ? 62.086  173.641 30.596  1.00 0.00 ? 14  GLY F HA2  1 
ATOM 10299 H HA3  . GLY F 1 14  ? 61.472  173.772 32.242  1.00 0.00 ? 14  GLY F HA3  1 
ATOM 10300 N N    . VAL F 1 15  ? 62.174  170.750 31.833  1.00 0.00 ? 15  VAL F N    1 
ATOM 10301 C CA   . VAL F 1 15  ? 63.018  169.616 32.250  1.00 0.00 ? 15  VAL F CA   1 
ATOM 10302 C C    . VAL F 1 15  ? 62.949  168.481 31.231  1.00 0.00 ? 15  VAL F C    1 
ATOM 10303 O O    . VAL F 1 15  ? 61.926  168.283 30.574  1.00 0.00 ? 15  VAL F O    1 
ATOM 10304 C CB   . VAL F 1 15  ? 62.550  169.107 33.616  1.00 0.00 ? 15  VAL F CB   1 
ATOM 10305 C CG1  . VAL F 1 15  ? 62.817  170.176 34.678  1.00 0.00 ? 15  VAL F CG1  1 
ATOM 10306 C CG2  . VAL F 1 15  ? 61.048  168.813 33.564  1.00 0.00 ? 15  VAL F CG2  1 
ATOM 10307 H H    . VAL F 1 15  ? 61.263  170.576 31.521  1.00 0.00 ? 15  VAL F H    1 
ATOM 10308 H HA   . VAL F 1 15  ? 64.049  169.940 32.336  1.00 0.00 ? 15  VAL F HA   1 
ATOM 10309 H HB   . VAL F 1 15  ? 63.089  168.205 33.870  1.00 0.00 ? 15  VAL F HB   1 
ATOM 10310 H HG11 . VAL F 1 15  ? 62.436  171.127 34.334  1.00 0.00 ? 15  VAL F HG11 1 
ATOM 10311 H HG12 . VAL F 1 15  ? 63.880  170.255 34.850  1.00 0.00 ? 15  VAL F HG12 1 
ATOM 10312 H HG13 . VAL F 1 15  ? 62.322  169.901 35.597  1.00 0.00 ? 15  VAL F HG13 1 
ATOM 10313 H HG21 . VAL F 1 15  ? 60.831  168.179 32.718  1.00 0.00 ? 15  VAL F HG21 1 
ATOM 10314 H HG22 . VAL F 1 15  ? 60.503  169.741 33.467  1.00 0.00 ? 15  VAL F HG22 1 
ATOM 10315 H HG23 . VAL F 1 15  ? 60.747  168.314 34.474  1.00 0.00 ? 15  VAL F HG23 1 
ATOM 10316 N N    . VAL F 1 16  ? 64.044  167.733 31.115  1.00 0.00 ? 16  VAL F N    1 
ATOM 10317 C CA   . VAL F 1 16  ? 64.102  166.613 30.182  1.00 0.00 ? 16  VAL F CA   1 
ATOM 10318 C C    . VAL F 1 16  ? 63.386  165.394 30.759  1.00 0.00 ? 16  VAL F C    1 
ATOM 10319 O O    . VAL F 1 16  ? 62.746  164.635 30.032  1.00 0.00 ? 16  VAL F O    1 
ATOM 10320 C CB   . VAL F 1 16  ? 65.560  166.256 29.883  1.00 0.00 ? 16  VAL F CB   1 
ATOM 10321 C CG1  . VAL F 1 16  ? 66.221  165.707 31.149  1.00 0.00 ? 16  VAL F CG1  1 
ATOM 10322 C CG2  . VAL F 1 16  ? 65.611  165.192 28.783  1.00 0.00 ? 16  VAL F CG2  1 
ATOM 10323 H H    . VAL F 1 16  ? 64.825  167.937 31.670  1.00 0.00 ? 16  VAL F H    1 
ATOM 10324 H HA   . VAL F 1 16  ? 63.618  166.899 29.260  1.00 0.00 ? 16  VAL F HA   1 
ATOM 10325 H HB   . VAL F 1 16  ? 66.087  167.141 29.557  1.00 0.00 ? 16  VAL F HB   1 
ATOM 10326 H HG11 . VAL F 1 16  ? 66.000  166.358 31.982  1.00 0.00 ? 16  VAL F HG11 1 
ATOM 10327 H HG12 . VAL F 1 16  ? 67.290  165.659 31.004  1.00 0.00 ? 16  VAL F HG12 1 
ATOM 10328 H HG13 . VAL F 1 16  ? 65.840  164.718 31.355  1.00 0.00 ? 16  VAL F HG13 1 
ATOM 10329 H HG21 . VAL F 1 16  ? 65.184  164.271 29.153  1.00 0.00 ? 16  VAL F HG21 1 
ATOM 10330 H HG22 . VAL F 1 16  ? 66.636  165.023 28.492  1.00 0.00 ? 16  VAL F HG22 1 
ATOM 10331 H HG23 . VAL F 1 16  ? 65.046  165.532 27.927  1.00 0.00 ? 16  VAL F HG23 1 
ATOM 10332 N N    . ALA F 1 17  ? 63.506  165.210 32.072  1.00 0.00 ? 17  ALA F N    1 
ATOM 10333 C CA   . ALA F 1 17  ? 62.871  164.077 32.735  1.00 0.00 ? 17  ALA F CA   1 
ATOM 10334 C C    . ALA F 1 17  ? 63.297  162.766 32.075  1.00 0.00 ? 17  ALA F C    1 
ATOM 10335 O O    . ALA F 1 17  ? 64.404  162.277 32.303  1.00 0.00 ? 17  ALA F O    1 
ATOM 10336 C CB   . ALA F 1 17  ? 61.349  164.215 32.668  1.00 0.00 ? 17  ALA F CB   1 
ATOM 10337 H H    . ALA F 1 17  ? 64.032  165.844 32.601  1.00 0.00 ? 17  ALA F H    1 
ATOM 10338 H HA   . ALA F 1 17  ? 63.174  164.062 33.771  1.00 0.00 ? 17  ALA F HA   1 
ATOM 10339 H HB1  . ALA F 1 17  ? 61.040  164.307 31.637  1.00 0.00 ? 17  ALA F HB1  1 
ATOM 10340 H HB2  . ALA F 1 17  ? 61.043  165.095 33.215  1.00 0.00 ? 17  ALA F HB2  1 
ATOM 10341 H HB3  . ALA F 1 17  ? 60.888  163.342 33.106  1.00 0.00 ? 17  ALA F HB3  1 
ATOM 10342 N N    . ALA F 1 18  ? 62.411  162.205 31.257  1.00 0.00 ? 18  ALA F N    1 
ATOM 10343 C CA   . ALA F 1 18  ? 62.701  160.951 30.564  1.00 0.00 ? 18  ALA F CA   1 
ATOM 10344 C C    . ALA F 1 18  ? 61.846  160.830 29.308  1.00 0.00 ? 18  ALA F C    1 
ATOM 10345 O O    . ALA F 1 18  ? 61.536  159.726 28.860  1.00 0.00 ? 18  ALA F O    1 
ATOM 10346 C CB   . ALA F 1 18  ? 62.423  159.765 31.489  1.00 0.00 ? 18  ALA F CB   1 
ATOM 10347 H H    . ALA F 1 18  ? 61.545  162.642 31.114  1.00 0.00 ? 18  ALA F H    1 
ATOM 10348 H HA   . ALA F 1 18  ? 63.744  160.936 30.280  1.00 0.00 ? 18  ALA F HA   1 
ATOM 10349 H HB1  . ALA F 1 18  ? 61.371  159.733 31.727  1.00 0.00 ? 18  ALA F HB1  1 
ATOM 10350 H HB2  . ALA F 1 18  ? 62.995  159.877 32.398  1.00 0.00 ? 18  ALA F HB2  1 
ATOM 10351 H HB3  . ALA F 1 18  ? 62.709  158.849 30.994  1.00 0.00 ? 18  ALA F HB3  1 
ATOM 10352 N N    . ALA F 1 19  ? 61.466  161.972 28.746  1.00 0.00 ? 19  ALA F N    1 
ATOM 10353 C CA   . ALA F 1 19  ? 60.644  161.983 27.543  1.00 0.00 ? 19  ALA F CA   1 
ATOM 10354 C C    . ALA F 1 19  ? 61.487  161.662 26.313  1.00 0.00 ? 19  ALA F C    1 
ATOM 10355 O O    . ALA F 1 19  ? 61.661  162.502 25.431  1.00 0.00 ? 19  ALA F O    1 
ATOM 10356 C CB   . ALA F 1 19  ? 59.990  163.353 27.369  1.00 0.00 ? 19  ALA F CB   1 
ATOM 10357 H H    . ALA F 1 19  ? 61.742  162.822 29.149  1.00 0.00 ? 19  ALA F H    1 
ATOM 10358 H HA   . ALA F 1 19  ? 59.870  161.237 27.640  1.00 0.00 ? 19  ALA F HA   1 
ATOM 10359 H HB1  . ALA F 1 19  ? 59.556  163.423 26.383  1.00 0.00 ? 19  ALA F HB1  1 
ATOM 10360 H HB2  . ALA F 1 19  ? 60.736  164.125 27.490  1.00 0.00 ? 19  ALA F HB2  1 
ATOM 10361 H HB3  . ALA F 1 19  ? 59.217  163.481 28.113  1.00 0.00 ? 19  ALA F HB3  1 
ATOM 10362 N N    . GLU F 1 20  ? 62.010  160.436 26.260  1.00 0.00 ? 20  GLU F N    1 
ATOM 10363 C CA   . GLU F 1 20  ? 62.837  160.005 25.130  1.00 0.00 ? 20  GLU F CA   1 
ATOM 10364 C C    . GLU F 1 20  ? 62.689  158.503 24.910  1.00 0.00 ? 20  GLU F C    1 
ATOM 10365 O O    . GLU F 1 20  ? 62.894  157.709 25.826  1.00 0.00 ? 20  GLU F O    1 
ATOM 10366 C CB   . GLU F 1 20  ? 64.307  160.337 25.406  1.00 0.00 ? 20  GLU F CB   1 
ATOM 10367 C CG   . GLU F 1 20  ? 65.135  160.121 24.136  1.00 0.00 ? 20  GLU F CG   1 
ATOM 10368 C CD   . GLU F 1 20  ? 64.779  161.178 23.096  1.00 0.00 ? 20  GLU F CD   1 
ATOM 10369 O OE1  . GLU F 1 20  ? 64.168  162.165 23.471  1.00 0.00 ? 20  GLU F OE1  1 
ATOM 10370 O OE2  . GLU F 1 20  ? 65.121  160.985 21.942  1.00 0.00 ? 20  GLU F OE2  1 
ATOM 10371 H H    . GLU F 1 20  ? 61.835  159.808 26.993  1.00 0.00 ? 20  GLU F H    1 
ATOM 10372 H HA   . GLU F 1 20  ? 62.521  160.523 24.234  1.00 0.00 ? 20  GLU F HA   1 
ATOM 10373 H HB2  . GLU F 1 20  ? 64.389  161.367 25.718  1.00 0.00 ? 20  GLU F HB2  1 
ATOM 10374 H HB3  . GLU F 1 20  ? 64.679  159.693 26.188  1.00 0.00 ? 20  GLU F HB3  1 
ATOM 10375 H HG2  . GLU F 1 20  ? 66.186  160.195 24.377  1.00 0.00 ? 20  GLU F HG2  1 
ATOM 10376 H HG3  . GLU F 1 20  ? 64.929  159.141 23.733  1.00 0.00 ? 20  GLU F HG3  1 
ATOM 10377 N N    . LYS F 1 21  ? 62.338  158.120 23.684  1.00 0.00 ? 21  LYS F N    1 
ATOM 10378 C CA   . LYS F 1 21  ? 62.172  156.707 23.344  1.00 0.00 ? 21  LYS F CA   1 
ATOM 10379 C C    . LYS F 1 21  ? 63.513  156.096 22.947  1.00 0.00 ? 21  LYS F C    1 
ATOM 10380 O O    . LYS F 1 21  ? 64.383  156.787 22.419  1.00 0.00 ? 21  LYS F O    1 
ATOM 10381 C CB   . LYS F 1 21  ? 61.170  156.562 22.191  1.00 0.00 ? 21  LYS F CB   1 
ATOM 10382 C CG   . LYS F 1 21  ? 61.689  157.298 20.950  1.00 0.00 ? 21  LYS F CG   1 
ATOM 10383 C CD   . LYS F 1 21  ? 60.661  157.184 19.822  1.00 0.00 ? 21  LYS F CD   1 
ATOM 10384 C CE   . LYS F 1 21  ? 61.173  157.925 18.585  1.00 0.00 ? 21  LYS F CE   1 
ATOM 10385 N NZ   . LYS F 1 21  ? 60.175  157.806 17.483  1.00 0.00 ? 21  LYS F NZ   1 
ATOM 10386 H H    . LYS F 1 21  ? 62.192  158.800 22.992  1.00 0.00 ? 21  LYS F H    1 
ATOM 10387 H HA   . LYS F 1 21  ? 61.788  156.176 24.206  1.00 0.00 ? 21  LYS F HA   1 
ATOM 10388 H HB2  . LYS F 1 21  ? 61.039  155.515 21.959  1.00 0.00 ? 21  LYS F HB2  1 
ATOM 10389 H HB3  . LYS F 1 21  ? 60.222  156.986 22.485  1.00 0.00 ? 21  LYS F HB3  1 
ATOM 10390 H HG2  . LYS F 1 21  ? 61.850  158.340 21.188  1.00 0.00 ? 21  LYS F HG2  1 
ATOM 10391 H HG3  . LYS F 1 21  ? 62.620  156.855 20.628  1.00 0.00 ? 21  LYS F HG3  1 
ATOM 10392 H HD2  . LYS F 1 21  ? 60.506  156.142 19.580  1.00 0.00 ? 21  LYS F HD2  1 
ATOM 10393 H HD3  . LYS F 1 21  ? 59.727  157.624 20.141  1.00 0.00 ? 21  LYS F HD3  1 
ATOM 10394 H HE2  . LYS F 1 21  ? 61.321  158.967 18.825  1.00 0.00 ? 21  LYS F HE2  1 
ATOM 10395 H HE3  . LYS F 1 21  ? 62.111  157.492 18.270  1.00 0.00 ? 21  LYS F HE3  1 
ATOM 10396 H HZ1  . LYS F 1 21  ? 60.260  158.625 16.849  1.00 0.00 ? 21  LYS F HZ1  1 
ATOM 10397 H HZ2  . LYS F 1 21  ? 59.216  157.775 17.886  1.00 0.00 ? 21  LYS F HZ2  1 
ATOM 10398 H HZ3  . LYS F 1 21  ? 60.355  156.934 16.946  1.00 0.00 ? 21  LYS F HZ3  1 
ATOM 10399 N N    . THR F 1 22  ? 63.675  154.795 23.204  1.00 0.00 ? 22  THR F N    1 
ATOM 10400 C CA   . THR F 1 22  ? 64.924  154.089 22.866  1.00 0.00 ? 22  THR F CA   1 
ATOM 10401 C C    . THR F 1 22  ? 64.705  153.183 21.660  1.00 0.00 ? 22  THR F C    1 
ATOM 10402 O O    . THR F 1 22  ? 63.608  152.667 21.451  1.00 0.00 ? 22  THR F O    1 
ATOM 10403 C CB   . THR F 1 22  ? 65.380  153.243 24.060  1.00 0.00 ? 22  THR F CB   1 
ATOM 10404 O OG1  . THR F 1 22  ? 64.407  152.243 24.331  1.00 0.00 ? 22  THR F OG1  1 
ATOM 10405 C CG2  . THR F 1 22  ? 65.548  154.139 25.290  1.00 0.00 ? 22  THR F CG2  1 
ATOM 10406 H H    . THR F 1 22  ? 62.945  154.297 23.626  1.00 0.00 ? 22  THR F H    1 
ATOM 10407 H HA   . THR F 1 22  ? 65.701  154.808 22.630  1.00 0.00 ? 22  THR F HA   1 
ATOM 10408 H HB   . THR F 1 22  ? 66.325  152.775 23.831  1.00 0.00 ? 22  THR F HB   1 
ATOM 10409 H HG1  . THR F 1 22  ? 63.540  152.617 24.155  1.00 0.00 ? 22  THR F HG1  1 
ATOM 10410 H HG21 . THR F 1 22  ? 66.005  153.571 26.088  1.00 0.00 ? 22  THR F HG21 1 
ATOM 10411 H HG22 . THR F 1 22  ? 64.581  154.495 25.611  1.00 0.00 ? 22  THR F HG22 1 
ATOM 10412 H HG23 . THR F 1 22  ? 66.178  154.980 25.041  1.00 0.00 ? 22  THR F HG23 1 
ATOM 10413 N N    . LYS F 1 23  ? 65.757  152.991 20.868  1.00 0.00 ? 23  LYS F N    1 
ATOM 10414 C CA   . LYS F 1 23  ? 65.665  152.142 19.683  1.00 0.00 ? 23  LYS F CA   1 
ATOM 10415 C C    . LYS F 1 23  ? 65.813  150.675 20.066  1.00 0.00 ? 23  LYS F C    1 
ATOM 10416 O O    . LYS F 1 23  ? 66.547  150.338 20.995  1.00 0.00 ? 23  LYS F O    1 
ATOM 10417 C CB   . LYS F 1 23  ? 66.753  152.526 18.679  1.00 0.00 ? 23  LYS F CB   1 
ATOM 10418 C CG   . LYS F 1 23  ? 66.500  153.954 18.184  1.00 0.00 ? 23  LYS F CG   1 
ATOM 10419 C CD   . LYS F 1 23  ? 67.690  154.451 17.349  1.00 0.00 ? 23  LYS F CD   1 
ATOM 10420 C CE   . LYS F 1 23  ? 67.732  153.723 15.999  1.00 0.00 ? 23  LYS F CE   1 
ATOM 10421 N NZ   . LYS F 1 23  ? 68.712  154.399 15.103  1.00 0.00 ? 23  LYS F NZ   1 
ATOM 10422 H H    . LYS F 1 23  ? 66.607  153.428 21.083  1.00 0.00 ? 23  LYS F H    1 
ATOM 10423 H HA   . LYS F 1 23  ? 64.699  152.286 19.219  1.00 0.00 ? 23  LYS F HA   1 
ATOM 10424 H HB2  . LYS F 1 23  ? 67.722  152.471 19.154  1.00 0.00 ? 23  LYS F HB2  1 
ATOM 10425 H HB3  . LYS F 1 23  ? 66.719  151.845 17.844  1.00 0.00 ? 23  LYS F HB3  1 
ATOM 10426 H HG2  . LYS F 1 23  ? 65.605  153.970 17.579  1.00 0.00 ? 23  LYS F HG2  1 
ATOM 10427 H HG3  . LYS F 1 23  ? 66.366  154.607 19.034  1.00 0.00 ? 23  LYS F HG3  1 
ATOM 10428 H HD2  . LYS F 1 23  ? 67.589  155.513 17.180  1.00 0.00 ? 23  LYS F HD2  1 
ATOM 10429 H HD3  . LYS F 1 23  ? 68.606  154.260 17.885  1.00 0.00 ? 23  LYS F HD3  1 
ATOM 10430 H HE2  . LYS F 1 23  ? 68.038  152.700 16.148  1.00 0.00 ? 23  LYS F HE2  1 
ATOM 10431 H HE3  . LYS F 1 23  ? 66.754  153.746 15.545  1.00 0.00 ? 23  LYS F HE3  1 
ATOM 10432 H HZ1  . LYS F 1 23  ? 68.605  155.429 15.186  1.00 0.00 ? 23  LYS F HZ1  1 
ATOM 10433 H HZ2  . LYS F 1 23  ? 68.536  154.109 14.119  1.00 0.00 ? 23  LYS F HZ2  1 
ATOM 10434 H HZ3  . LYS F 1 23  ? 69.677  154.129 15.378  1.00 0.00 ? 23  LYS F HZ3  1 
ATOM 10435 N N    . GLN F 1 24  ? 65.113  149.804 19.348  1.00 0.00 ? 24  GLN F N    1 
ATOM 10436 C CA   . GLN F 1 24  ? 65.182  148.377 19.629  1.00 0.00 ? 24  GLN F CA   1 
ATOM 10437 C C    . GLN F 1 24  ? 66.520  147.811 19.170  1.00 0.00 ? 24  GLN F C    1 
ATOM 10438 O O    . GLN F 1 24  ? 66.953  148.048 18.043  1.00 0.00 ? 24  GLN F O    1 
ATOM 10439 C CB   . GLN F 1 24  ? 64.040  147.646 18.917  1.00 0.00 ? 24  GLN F CB   1 
ATOM 10440 C CG   . GLN F 1 24  ? 62.700  148.090 19.508  1.00 0.00 ? 24  GLN F CG   1 
ATOM 10441 C CD   . GLN F 1 24  ? 62.424  149.545 19.145  1.00 0.00 ? 24  GLN F CD   1 
ATOM 10442 O OE1  . GLN F 1 24  ? 62.303  150.393 20.030  1.00 0.00 ? 24  GLN F OE1  1 
ATOM 10443 N NE2  . GLN F 1 24  ? 62.312  149.887 17.892  1.00 0.00 ? 24  GLN F NE2  1 
ATOM 10444 H H    . GLN F 1 24  ? 64.544  150.127 18.618  1.00 0.00 ? 24  GLN F H    1 
ATOM 10445 H HA   . GLN F 1 24  ? 65.082  148.225 20.694  1.00 0.00 ? 24  GLN F HA   1 
ATOM 10446 H HB2  . GLN F 1 24  ? 64.064  147.879 17.862  1.00 0.00 ? 24  GLN F HB2  1 
ATOM 10447 H HB3  . GLN F 1 24  ? 64.154  146.581 19.053  1.00 0.00 ? 24  GLN F HB3  1 
ATOM 10448 H HG2  . GLN F 1 24  ? 61.910  147.467 19.113  1.00 0.00 ? 24  GLN F HG2  1 
ATOM 10449 H HG3  . GLN F 1 24  ? 62.731  147.989 20.582  1.00 0.00 ? 24  GLN F HG3  1 
ATOM 10450 H HE21 . GLN F 1 24  ? 62.405  149.210 17.189  1.00 0.00 ? 24  GLN F HE21 1 
ATOM 10451 H HE22 . GLN F 1 24  ? 62.134  150.820 17.652  1.00 0.00 ? 24  GLN F HE22 1 
ATOM 10452 N N    . GLY F 1 25  ? 67.174  147.062 20.057  1.00 0.00 ? 25  GLY F N    1 
ATOM 10453 C CA   . GLY F 1 25  ? 68.472  146.461 19.743  1.00 0.00 ? 25  GLY F CA   1 
ATOM 10454 C C    . GLY F 1 25  ? 68.294  145.075 19.142  1.00 0.00 ? 25  GLY F C    1 
ATOM 10455 O O    . GLY F 1 25  ? 67.182  144.670 18.808  1.00 0.00 ? 25  GLY F O    1 
ATOM 10456 H H    . GLY F 1 25  ? 66.778  146.910 20.940  1.00 0.00 ? 25  GLY F H    1 
ATOM 10457 H HA2  . GLY F 1 25  ? 69.002  147.090 19.039  1.00 0.00 ? 25  GLY F HA2  1 
ATOM 10458 H HA3  . GLY F 1 25  ? 69.052  146.379 20.649  1.00 0.00 ? 25  GLY F HA3  1 
ATOM 10459 N N    . VAL F 1 26  ? 69.399  144.347 19.008  1.00 0.00 ? 26  VAL F N    1 
ATOM 10460 C CA   . VAL F 1 26  ? 69.354  143.001 18.447  1.00 0.00 ? 26  VAL F CA   1 
ATOM 10461 C C    . VAL F 1 26  ? 68.928  141.992 19.514  1.00 0.00 ? 26  VAL F C    1 
ATOM 10462 O O    . VAL F 1 26  ? 68.817  140.798 19.241  1.00 0.00 ? 26  VAL F O    1 
ATOM 10463 C CB   . VAL F 1 26  ? 70.727  142.625 17.880  1.00 0.00 ? 26  VAL F CB   1 
ATOM 10464 C CG1  . VAL F 1 26  ? 71.066  143.561 16.718  1.00 0.00 ? 26  VAL F CG1  1 
ATOM 10465 C CG2  . VAL F 1 26  ? 71.795  142.766 18.970  1.00 0.00 ? 26  VAL F CG2  1 
ATOM 10466 H H    . VAL F 1 26  ? 70.259  144.722 19.293  1.00 0.00 ? 26  VAL F H    1 
ATOM 10467 H HA   . VAL F 1 26  ? 68.632  142.981 17.642  1.00 0.00 ? 26  VAL F HA   1 
ATOM 10468 H HB   . VAL F 1 26  ? 70.702  141.604 17.526  1.00 0.00 ? 26  VAL F HB   1 
ATOM 10469 H HG11 . VAL F 1 26  ? 71.017  144.586 17.054  1.00 0.00 ? 26  VAL F HG11 1 
ATOM 10470 H HG12 . VAL F 1 26  ? 70.357  143.411 15.917  1.00 0.00 ? 26  VAL F HG12 1 
ATOM 10471 H HG13 . VAL F 1 26  ? 72.062  143.346 16.361  1.00 0.00 ? 26  VAL F HG13 1 
ATOM 10472 H HG21 . VAL F 1 26  ? 72.761  142.506 18.561  1.00 0.00 ? 26  VAL F HG21 1 
ATOM 10473 H HG22 . VAL F 1 26  ? 71.562  142.106 19.791  1.00 0.00 ? 26  VAL F HG22 1 
ATOM 10474 H HG23 . VAL F 1 26  ? 71.817  143.786 19.323  1.00 0.00 ? 26  VAL F HG23 1 
ATOM 10475 N N    . ALA F 1 27  ? 68.681  142.490 20.727  1.00 0.00 ? 27  ALA F N    1 
ATOM 10476 C CA   . ALA F 1 27  ? 68.255  141.633 21.836  1.00 0.00 ? 27  ALA F CA   1 
ATOM 10477 C C    . ALA F 1 27  ? 69.335  140.603 22.178  1.00 0.00 ? 27  ALA F C    1 
ATOM 10478 O O    . ALA F 1 27  ? 70.476  140.965 22.475  1.00 0.00 ? 27  ALA F O    1 
ATOM 10479 C CB   . ALA F 1 27  ? 66.944  140.921 21.473  1.00 0.00 ? 27  ALA F CB   1 
ATOM 10480 H H    . ALA F 1 27  ? 68.781  143.454 20.878  1.00 0.00 ? 27  ALA F H    1 
ATOM 10481 H HA   . ALA F 1 27  ? 68.082  142.252 22.702  1.00 0.00 ? 27  ALA F HA   1 
ATOM 10482 H HB1  . ALA F 1 27  ? 66.512  140.489 22.364  1.00 0.00 ? 27  ALA F HB1  1 
ATOM 10483 H HB2  . ALA F 1 27  ? 67.140  140.141 20.754  1.00 0.00 ? 27  ALA F HB2  1 
ATOM 10484 H HB3  . ALA F 1 27  ? 66.253  141.636 21.050  1.00 0.00 ? 27  ALA F HB3  1 
ATOM 10485 N N    . GLU F 1 28  ? 68.973  139.319 22.135  1.00 0.00 ? 28  GLU F N    1 
ATOM 10486 C CA   . GLU F 1 28  ? 69.928  138.255 22.444  1.00 0.00 ? 28  GLU F CA   1 
ATOM 10487 C C    . GLU F 1 28  ? 70.794  137.955 21.232  1.00 0.00 ? 28  GLU F C    1 
ATOM 10488 O O    . GLU F 1 28  ? 70.283  137.711 20.139  1.00 0.00 ? 28  GLU F O    1 
ATOM 10489 C CB   . GLU F 1 28  ? 69.187  136.981 22.854  1.00 0.00 ? 28  GLU F CB   1 
ATOM 10490 C CG   . GLU F 1 28  ? 68.349  137.246 24.104  1.00 0.00 ? 28  GLU F CG   1 
ATOM 10491 C CD   . GLU F 1 28  ? 67.647  135.964 24.541  1.00 0.00 ? 28  GLU F CD   1 
ATOM 10492 O OE1  . GLU F 1 28  ? 67.051  135.320 23.693  1.00 0.00 ? 28  GLU F OE1  1 
ATOM 10493 O OE2  . GLU F 1 28  ? 67.717  135.644 25.716  1.00 0.00 ? 28  GLU F OE2  1 
ATOM 10494 H H    . GLU F 1 28  ? 68.054  139.085 21.892  1.00 0.00 ? 28  GLU F H    1 
ATOM 10495 H HA   . GLU F 1 28  ? 70.560  138.570 23.261  1.00 0.00 ? 28  GLU F HA   1 
ATOM 10496 H HB2  . GLU F 1 28  ? 68.540  136.667 22.047  1.00 0.00 ? 28  GLU F HB2  1 
ATOM 10497 H HB3  . GLU F 1 28  ? 69.905  136.200 23.063  1.00 0.00 ? 28  GLU F HB3  1 
ATOM 10498 H HG2  . GLU F 1 28  ? 68.992  137.593 24.900  1.00 0.00 ? 28  GLU F HG2  1 
ATOM 10499 H HG3  . GLU F 1 28  ? 67.610  138.001 23.885  1.00 0.00 ? 28  GLU F HG3  1 
ATOM 10500 N N    . ALA F 1 29  ? 72.107  137.967 21.428  1.00 0.00 ? 29  ALA F N    1 
ATOM 10501 C CA   . ALA F 1 29  ? 73.028  137.687 20.332  1.00 0.00 ? 29  ALA F CA   1 
ATOM 10502 C C    . ALA F 1 29  ? 74.369  137.202 20.865  1.00 0.00 ? 29  ALA F C    1 
ATOM 10503 O O    . ALA F 1 29  ? 74.981  137.844 21.724  1.00 0.00 ? 29  ALA F O    1 
ATOM 10504 C CB   . ALA F 1 29  ? 73.230  138.952 19.499  1.00 0.00 ? 29  ALA F CB   1 
ATOM 10505 H H    . ALA F 1 29  ? 72.463  138.165 22.321  1.00 0.00 ? 29  ALA F H    1 
ATOM 10506 H HA   . ALA F 1 29  ? 72.608  136.918 19.699  1.00 0.00 ? 29  ALA F HA   1 
ATOM 10507 H HB1  . ALA F 1 29  ? 72.269  139.315 19.164  1.00 0.00 ? 29  ALA F HB1  1 
ATOM 10508 H HB2  . ALA F 1 29  ? 73.848  138.726 18.645  1.00 0.00 ? 29  ALA F HB2  1 
ATOM 10509 H HB3  . ALA F 1 29  ? 73.709  139.708 20.103  1.00 0.00 ? 29  ALA F HB3  1 
ATOM 10510 N N    . ALA F 1 30  ? 74.824  136.058 20.343  1.00 0.00 ? 30  ALA F N    1 
ATOM 10511 C CA   . ALA F 1 30  ? 76.107  135.475 20.761  1.00 0.00 ? 30  ALA F CA   1 
ATOM 10512 C C    . ALA F 1 30  ? 76.921  135.050 19.543  1.00 0.00 ? 30  ALA F C    1 
ATOM 10513 O O    . ALA F 1 30  ? 76.410  134.376 18.641  1.00 0.00 ? 30  ALA F O    1 
ATOM 10514 C CB   . ALA F 1 30  ? 75.855  134.257 21.650  1.00 0.00 ? 30  ALA F CB   1 
ATOM 10515 H H    . ALA F 1 30  ? 74.288  135.595 19.662  1.00 0.00 ? 30  ALA F H    1 
ATOM 10516 H HA   . ALA F 1 30  ? 76.677  136.204 21.324  1.00 0.00 ? 30  ALA F HA   1 
ATOM 10517 H HB1  . ALA F 1 30  ? 75.108  134.500 22.392  1.00 0.00 ? 30  ALA F HB1  1 
ATOM 10518 H HB2  . ALA F 1 30  ? 76.773  133.974 22.143  1.00 0.00 ? 30  ALA F HB2  1 
ATOM 10519 H HB3  . ALA F 1 30  ? 75.505  133.434 21.043  1.00 0.00 ? 30  ALA F HB3  1 
ATOM 10520 N N    . GLY F 1 31  ? 78.193  135.441 19.524  1.00 0.00 ? 31  GLY F N    1 
ATOM 10521 C CA   . GLY F 1 31  ? 79.066  135.088 18.415  1.00 0.00 ? 31  GLY F CA   1 
ATOM 10522 C C    . GLY F 1 31  ? 78.623  135.771 17.128  1.00 0.00 ? 31  GLY F C    1 
ATOM 10523 O O    . GLY F 1 31  ? 78.252  135.104 16.162  1.00 0.00 ? 31  GLY F O    1 
ATOM 10524 H H    . GLY F 1 31  ? 78.549  135.972 20.272  1.00 0.00 ? 31  GLY F H    1 
ATOM 10525 H HA2  . GLY F 1 31  ? 80.077  135.393 18.649  1.00 0.00 ? 31  GLY F HA2  1 
ATOM 10526 H HA3  . GLY F 1 31  ? 79.042  134.019 18.273  1.00 0.00 ? 31  GLY F HA3  1 
ATOM 10527 N N    . LYS F 1 32  ? 78.661  137.101 17.116  1.00 0.00 ? 32  LYS F N    1 
ATOM 10528 C CA   . LYS F 1 32  ? 78.259  137.845 15.928  1.00 0.00 ? 32  LYS F CA   1 
ATOM 10529 C C    . LYS F 1 32  ? 79.202  137.550 14.769  1.00 0.00 ? 32  LYS F C    1 
ATOM 10530 O O    . LYS F 1 32  ? 80.337  137.117 14.970  1.00 0.00 ? 32  LYS F O    1 
ATOM 10531 C CB   . LYS F 1 32  ? 78.213  139.355 16.184  1.00 0.00 ? 32  LYS F CB   1 
ATOM 10532 C CG   . LYS F 1 32  ? 77.038  139.702 17.105  1.00 0.00 ? 32  LYS F CG   1 
ATOM 10533 C CD   . LYS F 1 32  ? 76.876  141.227 17.167  1.00 0.00 ? 32  LYS F CD   1 
ATOM 10534 C CE   . LYS F 1 32  ? 75.714  141.587 18.092  1.00 0.00 ? 32  LYS F CE   1 
ATOM 10535 N NZ   . LYS F 1 32  ? 75.545  143.068 18.119  1.00 0.00 ? 32  LYS F NZ   1 
ATOM 10536 H H    . LYS F 1 32  ? 78.966  137.586 17.910  1.00 0.00 ? 32  LYS F H    1 
ATOM 10537 H HA   . LYS F 1 32  ? 77.274  137.516 15.649  1.00 0.00 ? 32  LYS F HA   1 
ATOM 10538 H HB2  . LYS F 1 32  ? 79.131  139.662 16.650  1.00 0.00 ? 32  LYS F HB2  1 
ATOM 10539 H HB3  . LYS F 1 32  ? 78.094  139.872 15.245  1.00 0.00 ? 32  LYS F HB3  1 
ATOM 10540 H HG2  . LYS F 1 32  ? 76.130  139.259 16.717  1.00 0.00 ? 32  LYS F HG2  1 
ATOM 10541 H HG3  . LYS F 1 32  ? 77.231  139.322 18.096  1.00 0.00 ? 32  LYS F HG3  1 
ATOM 10542 H HD2  . LYS F 1 32  ? 77.782  141.673 17.538  1.00 0.00 ? 32  LYS F HD2  1 
ATOM 10543 H HD3  . LYS F 1 32  ? 76.671  141.605 16.177  1.00 0.00 ? 32  LYS F HD3  1 
ATOM 10544 H HE2  . LYS F 1 32  ? 74.808  141.127 17.730  1.00 0.00 ? 32  LYS F HE2  1 
ATOM 10545 H HE3  . LYS F 1 32  ? 75.926  141.232 19.091  1.00 0.00 ? 32  LYS F HE3  1 
ATOM 10546 H HZ1  . LYS F 1 32  ? 76.478  143.523 18.175  1.00 0.00 ? 32  LYS F HZ1  1 
ATOM 10547 H HZ2  . LYS F 1 32  ? 74.978  143.337 18.950  1.00 0.00 ? 32  LYS F HZ2  1 
ATOM 10548 H HZ3  . LYS F 1 32  ? 75.062  143.377 17.253  1.00 0.00 ? 32  LYS F HZ3  1 
ATOM 10549 N N    . THR F 1 33  ? 78.708  137.754 13.557  1.00 0.00 ? 33  THR F N    1 
ATOM 10550 C CA   . THR F 1 33  ? 79.489  137.475 12.363  1.00 0.00 ? 33  THR F CA   1 
ATOM 10551 C C    . THR F 1 33  ? 80.688  138.405 12.265  1.00 0.00 ? 33  THR F C    1 
ATOM 10552 O O    . THR F 1 33  ? 80.567  139.561 11.861  1.00 0.00 ? 33  THR F O    1 
ATOM 10553 C CB   . THR F 1 33  ? 78.599  137.661 11.132  1.00 0.00 ? 33  THR F CB   1 
ATOM 10554 O OG1  . THR F 1 33  ? 79.411  137.876 9.987   1.00 0.00 ? 33  THR F OG1  1 
ATOM 10555 C CG2  . THR F 1 33  ? 77.672  138.867 11.336  1.00 0.00 ? 33  THR F CG2  1 
ATOM 10556 H H    . THR F 1 33  ? 77.787  138.077 13.463  1.00 0.00 ? 33  THR F H    1 
ATOM 10557 H HA   . THR F 1 33  ? 79.835  136.453 12.394  1.00 0.00 ? 33  THR F HA   1 
ATOM 10558 H HB   . THR F 1 33  ? 77.997  136.778 10.990  1.00 0.00 ? 33  THR F HB   1 
ATOM 10559 H HG1  . THR F 1 33  ? 80.150  138.430 10.248  1.00 0.00 ? 33  THR F HG1  1 
ATOM 10560 H HG21 . THR F 1 33  ? 77.281  139.184 10.381  1.00 0.00 ? 33  THR F HG21 1 
ATOM 10561 H HG22 . THR F 1 33  ? 78.223  139.678 11.786  1.00 0.00 ? 33  THR F HG22 1 
ATOM 10562 H HG23 . THR F 1 33  ? 76.855  138.587 11.983  1.00 0.00 ? 33  THR F HG23 1 
ATOM 10563 N N    . LYS F 1 34  ? 81.852  137.880 12.637  1.00 0.00 ? 34  LYS F N    1 
ATOM 10564 C CA   . LYS F 1 34  ? 83.082  138.656 12.598  1.00 0.00 ? 34  LYS F CA   1 
ATOM 10565 C C    . LYS F 1 34  ? 83.322  139.196 11.197  1.00 0.00 ? 34  LYS F C    1 
ATOM 10566 O O    . LYS F 1 34  ? 83.058  138.517 10.207  1.00 0.00 ? 34  LYS F O    1 
ATOM 10567 C CB   . LYS F 1 34  ? 84.266  137.779 13.014  1.00 0.00 ? 34  LYS F CB   1 
ATOM 10568 C CG   . LYS F 1 34  ? 84.096  137.352 14.477  1.00 0.00 ? 34  LYS F CG   1 
ATOM 10569 C CD   . LYS F 1 34  ? 85.390  136.708 14.999  1.00 0.00 ? 34  LYS F CD   1 
ATOM 10570 C CE   . LYS F 1 34  ? 85.607  135.341 14.340  1.00 0.00 ? 34  LYS F CE   1 
ATOM 10571 N NZ   . LYS F 1 34  ? 86.720  134.630 15.032  1.00 0.00 ? 34  LYS F NZ   1 
ATOM 10572 H H    . LYS F 1 34  ? 81.883  136.950 12.944  1.00 0.00 ? 34  LYS F H    1 
ATOM 10573 H HA   . LYS F 1 34  ? 83.000  139.482 13.287  1.00 0.00 ? 34  LYS F HA   1 
ATOM 10574 H HB2  . LYS F 1 34  ? 84.295  136.906 12.382  1.00 0.00 ? 34  LYS F HB2  1 
ATOM 10575 H HB3  . LYS F 1 34  ? 85.184  138.336 12.907  1.00 0.00 ? 34  LYS F HB3  1 
ATOM 10576 H HG2  . LYS F 1 34  ? 83.860  138.218 15.078  1.00 0.00 ? 34  LYS F HG2  1 
ATOM 10577 H HG3  . LYS F 1 34  ? 83.289  136.638 14.550  1.00 0.00 ? 34  LYS F HG3  1 
ATOM 10578 H HD2  . LYS F 1 34  ? 86.226  137.352 14.771  1.00 0.00 ? 34  LYS F HD2  1 
ATOM 10579 H HD3  . LYS F 1 34  ? 85.320  136.580 16.069  1.00 0.00 ? 34  LYS F HD3  1 
ATOM 10580 H HE2  . LYS F 1 34  ? 84.703  134.757 14.412  1.00 0.00 ? 34  LYS F HE2  1 
ATOM 10581 H HE3  . LYS F 1 34  ? 85.866  135.478 13.302  1.00 0.00 ? 34  LYS F HE3  1 
ATOM 10582 H HZ1  . LYS F 1 34  ? 86.514  133.612 15.065  1.00 0.00 ? 34  LYS F HZ1  1 
ATOM 10583 H HZ2  . LYS F 1 34  ? 86.815  134.996 16.003  1.00 0.00 ? 34  LYS F HZ2  1 
ATOM 10584 H HZ3  . LYS F 1 34  ? 87.607  134.785 14.514  1.00 0.00 ? 34  LYS F HZ3  1 
ATOM 10585 N N    . GLU F 1 35  ? 83.823  140.431 11.124  1.00 0.00 ? 35  GLU F N    1 
ATOM 10586 C CA   . GLU F 1 35  ? 84.103  141.079 9.837   1.00 0.00 ? 35  GLU F CA   1 
ATOM 10587 C C    . GLU F 1 35  ? 85.608  141.158 9.617   1.00 0.00 ? 35  GLU F C    1 
ATOM 10588 O O    . GLU F 1 35  ? 86.324  141.784 10.401  1.00 0.00 ? 35  GLU F O    1 
ATOM 10589 C CB   . GLU F 1 35  ? 83.522  142.493 9.845   1.00 0.00 ? 35  GLU F CB   1 
ATOM 10590 C CG   . GLU F 1 35  ? 83.579  143.087 8.436   1.00 0.00 ? 35  GLU F CG   1 
ATOM 10591 C CD   . GLU F 1 35  ? 82.589  142.367 7.527   1.00 0.00 ? 35  GLU F CD   1 
ATOM 10592 O OE1  . GLU F 1 35  ? 81.616  141.847 8.043   1.00 0.00 ? 35  GLU F OE1  1 
ATOM 10593 O OE2  . GLU F 1 35  ? 82.814  142.355 6.329   1.00 0.00 ? 35  GLU F OE2  1 
ATOM 10594 H H    . GLU F 1 35  ? 84.010  140.919 11.953  1.00 0.00 ? 35  GLU F H    1 
ATOM 10595 H HA   . GLU F 1 35  ? 83.654  140.516 9.029   1.00 0.00 ? 35  GLU F HA   1 
ATOM 10596 H HB2  . GLU F 1 35  ? 82.495  142.458 10.180  1.00 0.00 ? 35  GLU F HB2  1 
ATOM 10597 H HB3  . GLU F 1 35  ? 84.096  143.111 10.517  1.00 0.00 ? 35  GLU F HB3  1 
ATOM 10598 H HG2  . GLU F 1 35  ? 83.327  144.138 8.480   1.00 0.00 ? 35  GLU F HG2  1 
ATOM 10599 H HG3  . GLU F 1 35  ? 84.577  142.975 8.040   1.00 0.00 ? 35  GLU F HG3  1 
ATOM 10600 N N    . GLY F 1 36  ? 86.087  140.529 8.551   1.00 0.00 ? 36  GLY F N    1 
ATOM 10601 C CA   . GLY F 1 36  ? 87.511  140.549 8.258   1.00 0.00 ? 36  GLY F CA   1 
ATOM 10602 C C    . GLY F 1 36  ? 87.969  141.965 7.942   1.00 0.00 ? 36  GLY F C    1 
ATOM 10603 O O    . GLY F 1 36  ? 87.959  142.834 8.813   1.00 0.00 ? 36  GLY F O    1 
ATOM 10604 H H    . GLY F 1 36  ? 85.476  140.046 7.955   1.00 0.00 ? 36  GLY F H    1 
ATOM 10605 H HA2  . GLY F 1 36  ? 88.055  140.181 9.116   1.00 0.00 ? 36  GLY F HA2  1 
ATOM 10606 H HA3  . GLY F 1 36  ? 87.711  139.914 7.410   1.00 0.00 ? 36  GLY F HA3  1 
ATOM 10607 N N    . VAL F 1 37  ? 88.367  142.197 6.687   1.00 0.00 ? 37  VAL F N    1 
ATOM 10608 C CA   . VAL F 1 37  ? 88.829  143.525 6.255   1.00 0.00 ? 37  VAL F CA   1 
ATOM 10609 C C    . VAL F 1 37  ? 88.107  143.937 4.974   1.00 0.00 ? 37  VAL F C    1 
ATOM 10610 O O    . VAL F 1 37  ? 87.743  143.083 4.154   1.00 0.00 ? 37  VAL F O    1 
ATOM 10611 C CB   . VAL F 1 37  ? 90.341  143.480 6.005   1.00 0.00 ? 37  VAL F CB   1 
ATOM 10612 C CG1  . VAL F 1 37  ? 91.041  142.921 7.247   1.00 0.00 ? 37  VAL F CG1  1 
ATOM 10613 C CG2  . VAL F 1 37  ? 90.638  142.577 4.808   1.00 0.00 ? 37  VAL F CG2  1 
ATOM 10614 H H    . VAL F 1 37  ? 88.348  141.464 6.037   1.00 0.00 ? 37  VAL F H    1 
ATOM 10615 H HA   . VAL F 1 37  ? 88.622  144.261 7.025   1.00 0.00 ? 37  VAL F HA   1 
ATOM 10616 H HB   . VAL F 1 37  ? 90.704  144.479 5.807   1.00 0.00 ? 37  VAL F HB   1 
ATOM 10617 H HG11 . VAL F 1 37  ? 92.111  143.031 7.139   1.00 0.00 ? 37  VAL F HG11 1 
ATOM 10618 H HG12 . VAL F 1 37  ? 90.797  141.875 7.356   1.00 0.00 ? 37  VAL F HG12 1 
ATOM 10619 H HG13 . VAL F 1 37  ? 90.710  143.459 8.121   1.00 0.00 ? 37  VAL F HG13 1 
ATOM 10620 H HG21 . VAL F 1 37  ? 91.700  142.385 4.756   1.00 0.00 ? 37  VAL F HG21 1 
ATOM 10621 H HG22 . VAL F 1 37  ? 90.315  143.061 3.900   1.00 0.00 ? 37  VAL F HG22 1 
ATOM 10622 H HG23 . VAL F 1 37  ? 90.113  141.646 4.923   1.00 0.00 ? 37  VAL F HG23 1 
ATOM 10623 N N    . LEU F 1 38  ? 87.891  145.251 4.795   1.00 0.00 ? 38  LEU F N    1 
ATOM 10624 C CA   . LEU F 1 38  ? 87.196  145.761 3.591   1.00 0.00 ? 38  LEU F CA   1 
ATOM 10625 C C    . LEU F 1 38  ? 88.137  146.657 2.777   1.00 0.00 ? 38  LEU F C    1 
ATOM 10626 O O    . LEU F 1 38  ? 88.753  147.572 3.324   1.00 0.00 ? 38  LEU F O    1 
ATOM 10627 C CB   . LEU F 1 38  ? 85.959  146.587 3.996   1.00 0.00 ? 38  LEU F CB   1 
ATOM 10628 C CG   . LEU F 1 38  ? 85.163  145.862 5.095   1.00 0.00 ? 38  LEU F CG   1 
ATOM 10629 C CD1  . LEU F 1 38  ? 83.929  146.700 5.476   1.00 0.00 ? 38  LEU F CD1  1 
ATOM 10630 C CD2  . LEU F 1 38  ? 84.707  144.492 4.588   1.00 0.00 ? 38  LEU F CD2  1 
ATOM 10631 H H    . LEU F 1 38  ? 88.200  145.889 5.480   1.00 0.00 ? 38  LEU F H    1 
ATOM 10632 H HA   . LEU F 1 38  ? 86.874  144.933 2.970   1.00 0.00 ? 38  LEU F HA   1 
ATOM 10633 H HB2  . LEU F 1 38  ? 86.275  147.551 4.359   1.00 0.00 ? 38  LEU F HB2  1 
ATOM 10634 H HB3  . LEU F 1 38  ? 85.324  146.723 3.133   1.00 0.00 ? 38  LEU F HB3  1 
ATOM 10635 H HG   . LEU F 1 38  ? 85.791  145.736 5.966   1.00 0.00 ? 38  LEU F HG   1 
ATOM 10636 H HD11 . LEU F 1 38  ? 83.569  146.387 6.445   1.00 0.00 ? 38  LEU F HD11 1 
ATOM 10637 H HD12 . LEU F 1 38  ? 83.148  146.556 4.741   1.00 0.00 ? 38  LEU F HD12 1 
ATOM 10638 H HD13 . LEU F 1 38  ? 84.194  147.746 5.513   1.00 0.00 ? 38  LEU F HD13 1 
ATOM 10639 H HD21 . LEU F 1 38  ? 85.543  143.814 4.570   1.00 0.00 ? 38  LEU F HD21 1 
ATOM 10640 H HD22 . LEU F 1 38  ? 84.307  144.595 3.599   1.00 0.00 ? 38  LEU F HD22 1 
ATOM 10641 H HD23 . LEU F 1 38  ? 83.944  144.103 5.242   1.00 0.00 ? 38  LEU F HD23 1 
ATOM 10642 N N    . TYR F 1 39  ? 88.231  146.398 1.464   1.00 0.00 ? 39  TYR F N    1 
ATOM 10643 C CA   . TYR F 1 39  ? 89.092  147.201 0.566   1.00 0.00 ? 39  TYR F CA   1 
ATOM 10644 C C    . TYR F 1 39  ? 88.278  147.733 -0.614  1.00 0.00 ? 39  TYR F C    1 
ATOM 10645 O O    . TYR F 1 39  ? 87.766  146.959 -1.424  1.00 0.00 ? 39  TYR F O    1 
ATOM 10646 C CB   . TYR F 1 39  ? 90.264  146.343 0.041   1.00 0.00 ? 39  TYR F CB   1 
ATOM 10647 C CG   . TYR F 1 39  ? 91.345  146.244 1.099   1.00 0.00 ? 39  TYR F CG   1 
ATOM 10648 C CD1  . TYR F 1 39  ? 91.221  145.326 2.147   1.00 0.00 ? 39  TYR F CD1  1 
ATOM 10649 C CD2  . TYR F 1 39  ? 92.468  147.079 1.026   1.00 0.00 ? 39  TYR F CD2  1 
ATOM 10650 C CE1  . TYR F 1 39  ? 92.224  145.242 3.122   1.00 0.00 ? 39  TYR F CE1  1 
ATOM 10651 C CE2  . TYR F 1 39  ? 93.467  146.994 2.000   1.00 0.00 ? 39  TYR F CE2  1 
ATOM 10652 C CZ   . TYR F 1 39  ? 93.345  146.076 3.048   1.00 0.00 ? 39  TYR F CZ   1 
ATOM 10653 O OH   . TYR F 1 39  ? 94.331  145.992 4.010   1.00 0.00 ? 39  TYR F OH   1 
ATOM 10654 H H    . TYR F 1 39  ? 87.706  145.661 1.084   1.00 0.00 ? 39  TYR F H    1 
ATOM 10655 H HA   . TYR F 1 39  ? 89.492  148.050 1.111   1.00 0.00 ? 39  TYR F HA   1 
ATOM 10656 H HB2  . TYR F 1 39  ? 89.906  145.353 -0.196  1.00 0.00 ? 39  TYR F HB2  1 
ATOM 10657 H HB3  . TYR F 1 39  ? 90.680  146.797 -0.851  1.00 0.00 ? 39  TYR F HB3  1 
ATOM 10658 H HD1  . TYR F 1 39  ? 90.356  144.683 2.203   1.00 0.00 ? 39  TYR F HD1  1 
ATOM 10659 H HD2  . TYR F 1 39  ? 92.561  147.787 0.216   1.00 0.00 ? 39  TYR F HD2  1 
ATOM 10660 H HE1  . TYR F 1 39  ? 92.132  144.536 3.930   1.00 0.00 ? 39  TYR F HE1  1 
ATOM 10661 H HE2  . TYR F 1 39  ? 94.334  147.637 1.942   1.00 0.00 ? 39  TYR F HE2  1 
ATOM 10662 H HH   . TYR F 1 39  ? 94.254  146.761 4.580   1.00 0.00 ? 39  TYR F HH   1 
ATOM 10663 N N    . VAL F 1 40  ? 88.170  149.067 -0.706  1.00 0.00 ? 40  VAL F N    1 
ATOM 10664 C CA   . VAL F 1 40  ? 87.423  149.717 -1.794  1.00 0.00 ? 40  VAL F CA   1 
ATOM 10665 C C    . VAL F 1 40  ? 88.253  150.838 -2.419  1.00 0.00 ? 40  VAL F C    1 
ATOM 10666 O O    . VAL F 1 40  ? 88.605  151.799 -1.746  1.00 0.00 ? 40  VAL F O    1 
ATOM 10667 C CB   . VAL F 1 40  ? 86.120  150.301 -1.242  1.00 0.00 ? 40  VAL F CB   1 
ATOM 10668 C CG1  . VAL F 1 40  ? 85.336  150.976 -2.370  1.00 0.00 ? 40  VAL F CG1  1 
ATOM 10669 C CG2  . VAL F 1 40  ? 85.275  149.177 -0.639  1.00 0.00 ? 40  VAL F CG2  1 
ATOM 10670 H H    . VAL F 1 40  ? 88.607  149.628 -0.030  1.00 0.00 ? 40  VAL F H    1 
ATOM 10671 H HA   . VAL F 1 40  ? 87.184  148.995 -2.553  1.00 0.00 ? 40  VAL F HA   1 
ATOM 10672 H HB   . VAL F 1 40  ? 86.349  151.030 -0.478  1.00 0.00 ? 40  VAL F HB   1 
ATOM 10673 H HG11 . VAL F 1 40  ? 85.841  151.884 -2.666  1.00 0.00 ? 40  VAL F HG11 1 
ATOM 10674 H HG12 . VAL F 1 40  ? 84.341  151.214 -2.024  1.00 0.00 ? 40  VAL F HG12 1 
ATOM 10675 H HG13 . VAL F 1 40  ? 85.272  150.306 -3.214  1.00 0.00 ? 40  VAL F HG13 1 
ATOM 10676 H HG21 . VAL F 1 40  ? 85.206  148.361 -1.342  1.00 0.00 ? 40  VAL F HG21 1 
ATOM 10677 H HG22 . VAL F 1 40  ? 84.285  149.548 -0.420  1.00 0.00 ? 40  VAL F HG22 1 
ATOM 10678 H HG23 . VAL F 1 40  ? 85.738  148.828 0.273   1.00 0.00 ? 40  VAL F HG23 1 
ATOM 10679 N N    . GLY F 1 41  ? 88.561  150.731 -3.706  1.00 0.00 ? 41  GLY F N    1 
ATOM 10680 C CA   . GLY F 1 41  ? 89.343  151.773 -4.359  1.00 0.00 ? 41  GLY F CA   1 
ATOM 10681 C C    . GLY F 1 41  ? 90.753  151.849 -3.775  1.00 0.00 ? 41  GLY F C    1 
ATOM 10682 O O    . GLY F 1 41  ? 91.106  152.812 -3.071  1.00 0.00 ? 41  GLY F O    1 
ATOM 10683 H H    . GLY F 1 41  ? 88.261  149.949 -4.225  1.00 0.00 ? 41  GLY F H    1 
ATOM 10684 H HA2  . GLY F 1 41  ? 89.406  151.558 -5.417  1.00 0.00 ? 41  GLY F HA2  1 
ATOM 10685 H HA3  . GLY F 1 41  ? 88.854  152.723 -4.218  1.00 0.00 ? 41  GLY F HA3  1 
ATOM 10686 N N    . SER F 1 42  ? 91.563  150.824 -4.067  1.00 0.00 ? 42  SER F N    1 
ATOM 10687 C CA   . SER F 1 42  ? 92.954  150.775 -3.571  1.00 0.00 ? 42  SER F CA   1 
ATOM 10688 C C    . SER F 1 42  ? 93.896  150.299 -4.671  1.00 0.00 ? 42  SER F C    1 
ATOM 10689 O O    . SER F 1 42  ? 93.597  149.341 -5.385  1.00 0.00 ? 42  SER F O    1 
ATOM 10690 C CB   . SER F 1 42  ? 93.054  149.831 -2.372  1.00 0.00 ? 42  SER F CB   1 
ATOM 10691 O OG   . SER F 1 42  ? 92.226  150.315 -1.321  1.00 0.00 ? 42  SER F OG   1 
ATOM 10692 H H    . SER F 1 42  ? 91.220  150.084 -4.631  1.00 0.00 ? 42  SER F H    1 
ATOM 10693 H HA   . SER F 1 42  ? 93.263  151.766 -3.258  1.00 0.00 ? 42  SER F HA   1 
ATOM 10694 H HB2  . SER F 1 42  ? 92.726  148.847 -2.658  1.00 0.00 ? 42  SER F HB2  1 
ATOM 10695 H HB3  . SER F 1 42  ? 94.085  149.783 -2.039  1.00 0.00 ? 42  SER F HB3  1 
ATOM 10696 H HG   . SER F 1 42  ? 92.793  150.725 -0.664  1.00 0.00 ? 42  SER F HG   1 
ATOM 10697 N N    . LYS F 1 43  ? 95.047  150.972 -4.798  1.00 0.00 ? 43  LYS F N    1 
ATOM 10698 C CA   . LYS F 1 43  ? 96.046  150.610 -5.816  1.00 0.00 ? 43  LYS F CA   1 
ATOM 10699 C C    . LYS F 1 43  ? 97.349  150.191 -5.139  1.00 0.00 ? 43  LYS F C    1 
ATOM 10700 O O    . LYS F 1 43  ? 97.894  150.932 -4.321  1.00 0.00 ? 43  LYS F O    1 
ATOM 10701 C CB   . LYS F 1 43  ? 96.326  151.819 -6.721  1.00 0.00 ? 43  LYS F CB   1 
ATOM 10702 C CG   . LYS F 1 43  ? 95.009  152.471 -7.178  1.00 0.00 ? 43  LYS F CG   1 
ATOM 10703 C CD   . LYS F 1 43  ? 94.156  151.477 -7.974  1.00 0.00 ? 43  LYS F CD   1 
ATOM 10704 C CE   . LYS F 1 43  ? 92.978  152.223 -8.604  1.00 0.00 ? 43  LYS F CE   1 
ATOM 10705 N NZ   . LYS F 1 43  ? 92.102  151.259 -9.329  1.00 0.00 ? 43  LYS F NZ   1 
ATOM 10706 H H    . LYS F 1 43  ? 95.231  151.723 -4.196  1.00 0.00 ? 43  LYS F H    1 
ATOM 10707 H HA   . LYS F 1 43  ? 95.691  149.788 -6.422  1.00 0.00 ? 43  LYS F HA   1 
ATOM 10708 H HB2  . LYS F 1 43  ? 96.911  152.546 -6.174  1.00 0.00 ? 43  LYS F HB2  1 
ATOM 10709 H HB3  . LYS F 1 43  ? 96.883  151.495 -7.589  1.00 0.00 ? 43  LYS F HB3  1 
ATOM 10710 H HG2  . LYS F 1 43  ? 94.457  152.802 -6.312  1.00 0.00 ? 43  LYS F HG2  1 
ATOM 10711 H HG3  . LYS F 1 43  ? 95.233  153.325 -7.802  1.00 0.00 ? 43  LYS F HG3  1 
ATOM 10712 H HD2  . LYS F 1 43  ? 94.755  151.021 -8.747  1.00 0.00 ? 43  LYS F HD2  1 
ATOM 10713 H HD3  . LYS F 1 43  ? 93.775  150.715 -7.313  1.00 0.00 ? 43  LYS F HD3  1 
ATOM 10714 H HE2  . LYS F 1 43  ? 92.408  152.714 -7.830  1.00 0.00 ? 43  LYS F HE2  1 
ATOM 10715 H HE3  . LYS F 1 43  ? 93.351  152.963 -9.297  1.00 0.00 ? 43  LYS F HE3  1 
ATOM 10716 H HZ1  . LYS F 1 43  ? 91.218  151.732 -9.602  1.00 0.00 ? 43  LYS F HZ1  1 
ATOM 10717 H HZ2  . LYS F 1 43  ? 91.888  150.452 -8.708  1.00 0.00 ? 43  LYS F HZ2  1 
ATOM 10718 H HZ3  . LYS F 1 43  ? 92.589  150.922 -10.183 1.00 0.00 ? 43  LYS F HZ3  1 
ATOM 10719 N N    . THR F 1 44  ? 97.851  148.999 -5.489  1.00 0.00 ? 44  THR F N    1 
ATOM 10720 C CA   . THR F 1 44  ? 99.104  148.487 -4.912  1.00 0.00 ? 44  THR F CA   1 
ATOM 10721 C C    . THR F 1 44  ? 100.022 147.972 -6.015  1.00 0.00 ? 44  THR F C    1 
ATOM 10722 O O    . THR F 1 44  ? 99.626  147.136 -6.826  1.00 0.00 ? 44  THR F O    1 
ATOM 10723 C CB   . THR F 1 44  ? 98.796  147.350 -3.933  1.00 0.00 ? 44  THR F CB   1 
ATOM 10724 O OG1  . THR F 1 44  ? 97.945  147.834 -2.902  1.00 0.00 ? 44  THR F OG1  1 
ATOM 10725 C CG2  . THR F 1 44  ? 100.098 146.833 -3.318  1.00 0.00 ? 44  THR F CG2  1 
ATOM 10726 H H    . THR F 1 44  ? 97.374  148.456 -6.151  1.00 0.00 ? 44  THR F H    1 
ATOM 10727 H HA   . THR F 1 44  ? 99.614  149.279 -4.377  1.00 0.00 ? 44  THR F HA   1 
ATOM 10728 H HB   . THR F 1 44  ? 98.306  146.545 -4.456  1.00 0.00 ? 44  THR F HB   1 
ATOM 10729 H HG1  . THR F 1 44  ? 98.467  148.403 -2.331  1.00 0.00 ? 44  THR F HG1  1 
ATOM 10730 H HG21 . THR F 1 44  ? 100.669 147.664 -2.933  1.00 0.00 ? 44  THR F HG21 1 
ATOM 10731 H HG22 . THR F 1 44  ? 100.674 146.319 -4.074  1.00 0.00 ? 44  THR F HG22 1 
ATOM 10732 H HG23 . THR F 1 44  ? 99.869  146.150 -2.513  1.00 0.00 ? 44  THR F HG23 1 
ATOM 10733 N N    . LYS F 1 45  ? 101.260 148.470 -6.034  1.00 0.00 ? 45  LYS F N    1 
ATOM 10734 C CA   . LYS F 1 45  ? 102.245 148.047 -7.042  1.00 0.00 ? 45  LYS F CA   1 
ATOM 10735 C C    . LYS F 1 45  ? 103.612 147.861 -6.396  1.00 0.00 ? 45  LYS F C    1 
ATOM 10736 O O    . LYS F 1 45  ? 104.051 148.697 -5.605  1.00 0.00 ? 45  LYS F O    1 
ATOM 10737 C CB   . LYS F 1 45  ? 102.346 149.103 -8.147  1.00 0.00 ? 45  LYS F CB   1 
ATOM 10738 C CG   . LYS F 1 45  ? 100.981 149.275 -8.816  1.00 0.00 ? 45  LYS F CG   1 
ATOM 10739 C CD   . LYS F 1 45  ? 101.086 150.316 -9.934  1.00 0.00 ? 45  LYS F CD   1 
ATOM 10740 C CE   . LYS F 1 45  ? 99.700  150.576 -10.525 1.00 0.00 ? 45  LYS F CE   1 
ATOM 10741 N NZ   . LYS F 1 45  ? 99.167  149.317 -11.116 1.00 0.00 ? 45  LYS F NZ   1 
ATOM 10742 H H    . LYS F 1 45  ? 101.521 149.128 -5.356  1.00 0.00 ? 45  LYS F H    1 
ATOM 10743 H HA   . LYS F 1 45  ? 101.938 147.107 -7.484  1.00 0.00 ? 45  LYS F HA   1 
ATOM 10744 H HB2  . LYS F 1 45  ? 102.659 150.044 -7.718  1.00 0.00 ? 45  LYS F HB2  1 
ATOM 10745 H HB3  . LYS F 1 45  ? 103.068 148.785 -8.883  1.00 0.00 ? 45  LYS F HB3  1 
ATOM 10746 H HG2  . LYS F 1 45  ? 100.663 148.329 -9.233  1.00 0.00 ? 45  LYS F HG2  1 
ATOM 10747 H HG3  . LYS F 1 45  ? 100.260 149.606 -8.085  1.00 0.00 ? 45  LYS F HG3  1 
ATOM 10748 H HD2  . LYS F 1 45  ? 101.486 151.236 -9.532  1.00 0.00 ? 45  LYS F HD2  1 
ATOM 10749 H HD3  . LYS F 1 45  ? 101.742 149.948 -10.709 1.00 0.00 ? 45  LYS F HD3  1 
ATOM 10750 H HE2  . LYS F 1 45  ? 99.034  150.917 -9.746  1.00 0.00 ? 45  LYS F HE2  1 
ATOM 10751 H HE3  . LYS F 1 45  ? 99.771  151.332 -11.294 1.00 0.00 ? 45  LYS F HE3  1 
ATOM 10752 H HZ1  . LYS F 1 45  ? 99.272  148.542 -10.433 1.00 0.00 ? 45  LYS F HZ1  1 
ATOM 10753 H HZ2  . LYS F 1 45  ? 99.698  149.090 -11.983 1.00 0.00 ? 45  LYS F HZ2  1 
ATOM 10754 H HZ3  . LYS F 1 45  ? 98.162  149.440 -11.346 1.00 0.00 ? 45  LYS F HZ3  1 
ATOM 10755 N N    . GLU F 1 46  ? 104.288 146.763 -6.744  1.00 0.00 ? 46  GLU F N    1 
ATOM 10756 C CA   . GLU F 1 46  ? 105.622 146.475 -6.194  1.00 0.00 ? 46  GLU F CA   1 
ATOM 10757 C C    . GLU F 1 46  ? 106.532 145.896 -7.274  1.00 0.00 ? 46  GLU F C    1 
ATOM 10758 O O    . GLU F 1 46  ? 106.277 144.812 -7.790  1.00 0.00 ? 46  GLU F O    1 
ATOM 10759 C CB   . GLU F 1 46  ? 105.500 145.472 -5.041  1.00 0.00 ? 46  GLU F CB   1 
ATOM 10760 C CG   . GLU F 1 46  ? 104.615 146.061 -3.940  1.00 0.00 ? 46  GLU F CG   1 
ATOM 10761 C CD   . GLU F 1 46  ? 104.529 145.092 -2.766  1.00 0.00 ? 46  GLU F CD   1 
ATOM 10762 O OE1  . GLU F 1 46  ? 105.082 144.010 -2.874  1.00 0.00 ? 46  GLU F OE1  1 
ATOM 10763 O OE2  . GLU F 1 46  ? 103.912 145.445 -1.775  1.00 0.00 ? 46  GLU F OE2  1 
ATOM 10764 H H    . GLU F 1 46  ? 103.889 146.137 -7.383  1.00 0.00 ? 46  GLU F H    1 
ATOM 10765 H HA   . GLU F 1 46  ? 106.062 147.384 -5.818  1.00 0.00 ? 46  GLU F HA   1 
ATOM 10766 H HB2  . GLU F 1 46  ? 105.060 144.556 -5.406  1.00 0.00 ? 46  GLU F HB2  1 
ATOM 10767 H HB3  . GLU F 1 46  ? 106.480 145.266 -4.639  1.00 0.00 ? 46  GLU F HB3  1 
ATOM 10768 H HG2  . GLU F 1 46  ? 105.034 146.997 -3.604  1.00 0.00 ? 46  GLU F HG2  1 
ATOM 10769 H HG3  . GLU F 1 46  ? 103.623 146.233 -4.333  1.00 0.00 ? 46  GLU F HG3  1 
ATOM 10770 N N    . GLY F 1 47  ? 107.599 146.618 -7.616  1.00 0.00 ? 47  GLY F N    1 
ATOM 10771 C CA   . GLY F 1 47  ? 108.518 146.135 -8.637  1.00 0.00 ? 47  GLY F CA   1 
ATOM 10772 C C    . GLY F 1 47  ? 107.882 146.204 -10.019 1.00 0.00 ? 47  GLY F C    1 
ATOM 10773 O O    . GLY F 1 47  ? 107.436 145.189 -10.560 1.00 0.00 ? 47  GLY F O    1 
ATOM 10774 H H    . GLY F 1 47  ? 107.770 147.482 -7.179  1.00 0.00 ? 47  GLY F H    1 
ATOM 10775 H HA2  . GLY F 1 47  ? 109.412 146.743 -8.625  1.00 0.00 ? 47  GLY F HA2  1 
ATOM 10776 H HA3  . GLY F 1 47  ? 108.782 145.111 -8.422  1.00 0.00 ? 47  GLY F HA3  1 
ATOM 10777 N N    . VAL F 1 48  ? 107.836 147.418 -10.580 1.00 0.00 ? 48  VAL F N    1 
ATOM 10778 C CA   . VAL F 1 48  ? 107.254 147.639 -11.910 1.00 0.00 ? 48  VAL F CA   1 
ATOM 10779 C C    . VAL F 1 48  ? 108.062 148.675 -12.685 1.00 0.00 ? 48  VAL F C    1 
ATOM 10780 O O    . VAL F 1 48  ? 108.465 149.696 -12.132 1.00 0.00 ? 48  VAL F O    1 
ATOM 10781 C CB   . VAL F 1 48  ? 105.811 148.118 -11.785 1.00 0.00 ? 48  VAL F CB   1 
ATOM 10782 C CG1  . VAL F 1 48  ? 105.240 148.380 -13.181 1.00 0.00 ? 48  VAL F CG1  1 
ATOM 10783 C CG2  . VAL F 1 48  ? 104.972 147.045 -11.088 1.00 0.00 ? 48  VAL F CG2  1 
ATOM 10784 H H    . VAL F 1 48  ? 108.207 148.184 -10.086 1.00 0.00 ? 48  VAL F H    1 
ATOM 10785 H HA   . VAL F 1 48  ? 107.263 146.710 -12.464 1.00 0.00 ? 48  VAL F HA   1 
ATOM 10786 H HB   . VAL F 1 48  ? 105.783 149.032 -11.207 1.00 0.00 ? 48  VAL F HB   1 
ATOM 10787 H HG11 . VAL F 1 48  ? 105.671 149.284 -13.583 1.00 0.00 ? 48  VAL F HG11 1 
ATOM 10788 H HG12 . VAL F 1 48  ? 104.167 148.491 -13.116 1.00 0.00 ? 48  VAL F HG12 1 
ATOM 10789 H HG13 . VAL F 1 48  ? 105.477 147.548 -13.828 1.00 0.00 ? 48  VAL F HG13 1 
ATOM 10790 H HG21 . VAL F 1 48  ? 105.276 146.962 -10.056 1.00 0.00 ? 48  VAL F HG21 1 
ATOM 10791 H HG22 . VAL F 1 48  ? 105.118 146.096 -11.584 1.00 0.00 ? 48  VAL F HG22 1 
ATOM 10792 H HG23 . VAL F 1 48  ? 103.928 147.318 -11.136 1.00 0.00 ? 48  VAL F HG23 1 
ATOM 10793 N N    . VAL F 1 49  ? 108.297 148.412 -13.973 1.00 0.00 ? 49  VAL F N    1 
ATOM 10794 C CA   . VAL F 1 49  ? 109.062 149.341 -14.822 1.00 0.00 ? 49  VAL F CA   1 
ATOM 10795 C C    . VAL F 1 49  ? 108.389 149.513 -16.185 1.00 0.00 ? 49  VAL F C    1 
ATOM 10796 O O    . VAL F 1 49  ? 107.850 148.567 -16.751 1.00 0.00 ? 49  VAL F O    1 
ATOM 10797 C CB   . VAL F 1 49  ? 110.504 148.824 -14.997 1.00 0.00 ? 49  VAL F CB   1 
ATOM 10798 C CG1  . VAL F 1 49  ? 110.471 147.339 -15.340 1.00 0.00 ? 49  VAL F CG1  1 
ATOM 10799 C CG2  . VAL F 1 49  ? 111.213 149.593 -16.130 1.00 0.00 ? 49  VAL F CG2  1 
ATOM 10800 H H    . VAL F 1 49  ? 107.949 147.582 -14.364 1.00 0.00 ? 49  VAL F H    1 
ATOM 10801 H HA   . VAL F 1 49  ? 109.103 150.308 -14.345 1.00 0.00 ? 49  VAL F HA   1 
ATOM 10802 H HB   . VAL F 1 49  ? 111.045 148.960 -14.072 1.00 0.00 ? 49  VAL F HB   1 
ATOM 10803 H HG11 . VAL F 1 49  ? 109.825 147.188 -16.184 1.00 0.00 ? 49  VAL F HG11 1 
ATOM 10804 H HG12 . VAL F 1 49  ? 110.096 146.781 -14.495 1.00 0.00 ? 49  VAL F HG12 1 
ATOM 10805 H HG13 . VAL F 1 49  ? 111.468 147.003 -15.582 1.00 0.00 ? 49  VAL F HG13 1 
ATOM 10806 H HG21 . VAL F 1 49  ? 112.280 149.442 -16.056 1.00 0.00 ? 49  VAL F HG21 1 
ATOM 10807 H HG22 . VAL F 1 49  ? 110.991 150.645 -16.046 1.00 0.00 ? 49  VAL F HG22 1 
ATOM 10808 H HG23 . VAL F 1 49  ? 110.863 149.234 -17.083 1.00 0.00 ? 49  VAL F HG23 1 
ATOM 10809 N N    . HIS F 1 50  ? 108.437 150.740 -16.709 1.00 0.00 ? 50  HIS F N    1 
ATOM 10810 C CA   . HIS F 1 50  ? 107.843 151.046 -18.014 1.00 0.00 ? 50  HIS F CA   1 
ATOM 10811 C C    . HIS F 1 50  ? 108.694 152.078 -18.750 1.00 0.00 ? 50  HIS F C    1 
ATOM 10812 O O    . HIS F 1 50  ? 108.886 153.192 -18.269 1.00 0.00 ? 50  HIS F O    1 
ATOM 10813 C CB   . HIS F 1 50  ? 106.429 151.598 -17.829 1.00 0.00 ? 50  HIS F CB   1 
ATOM 10814 C CG   . HIS F 1 50  ? 105.802 151.823 -19.176 1.00 0.00 ? 50  HIS F CG   1 
ATOM 10815 N ND1  . HIS F 1 50  ? 104.876 150.945 -19.718 1.00 0.00 ? 50  HIS F ND1  1 
ATOM 10816 C CD2  . HIS F 1 50  ? 105.970 152.814 -20.109 1.00 0.00 ? 50  HIS F CD2  1 
ATOM 10817 C CE1  . HIS F 1 50  ? 104.524 151.425 -20.926 1.00 0.00 ? 50  HIS F CE1  1 
ATOM 10818 N NE2  . HIS F 1 50  ? 105.161 152.562 -21.212 1.00 0.00 ? 50  HIS F NE2  1 
ATOM 10819 H H    . HIS F 1 50  ? 108.889 151.453 -16.210 1.00 0.00 ? 50  HIS F H    1 
ATOM 10820 H HA   . HIS F 1 50  ? 107.792 150.146 -18.608 1.00 0.00 ? 50  HIS F HA   1 
ATOM 10821 H HB2  . HIS F 1 50  ? 105.837 150.890 -17.269 1.00 0.00 ? 50  HIS F HB2  1 
ATOM 10822 H HB3  . HIS F 1 50  ? 106.475 152.535 -17.294 1.00 0.00 ? 50  HIS F HB3  1 
ATOM 10823 H HD1  . HIS F 1 50  ? 104.538 150.127 -19.298 1.00 0.00 ? 50  HIS F HD1  1 
ATOM 10824 H HD2  . HIS F 1 50  ? 106.635 153.658 -20.005 1.00 0.00 ? 50  HIS F HD2  1 
ATOM 10825 H HE1  . HIS F 1 50  ? 103.811 150.948 -21.582 1.00 0.00 ? 50  HIS F HE1  1 
ATOM 10826 N N    . GLY F 1 51  ? 109.210 151.702 -19.925 1.00 0.00 ? 51  GLY F N    1 
ATOM 10827 C CA   . GLY F 1 51  ? 110.052 152.612 -20.725 1.00 0.00 ? 51  GLY F CA   1 
ATOM 10828 C C    . GLY F 1 51  ? 109.513 152.762 -22.144 1.00 0.00 ? 51  GLY F C    1 
ATOM 10829 O O    . GLY F 1 51  ? 109.155 151.781 -22.790 1.00 0.00 ? 51  GLY F O    1 
ATOM 10830 H H    . GLY F 1 51  ? 109.025 150.798 -20.261 1.00 0.00 ? 51  GLY F H    1 
ATOM 10831 H HA2  . GLY F 1 51  ? 110.091 153.587 -20.258 1.00 0.00 ? 51  GLY F HA2  1 
ATOM 10832 H HA3  . GLY F 1 51  ? 111.053 152.209 -20.774 1.00 0.00 ? 51  GLY F HA3  1 
ATOM 10833 N N    . VAL F 1 52  ? 109.469 154.005 -22.632 1.00 0.00 ? 52  VAL F N    1 
ATOM 10834 C CA   . VAL F 1 52  ? 108.983 154.286 -23.996 1.00 0.00 ? 52  VAL F CA   1 
ATOM 10835 C C    . VAL F 1 52  ? 109.985 155.159 -24.741 1.00 0.00 ? 52  VAL F C    1 
ATOM 10836 O O    . VAL F 1 52  ? 110.366 156.228 -24.261 1.00 0.00 ? 52  VAL F O    1 
ATOM 10837 C CB   . VAL F 1 52  ? 107.629 154.998 -23.936 1.00 0.00 ? 52  VAL F CB   1 
ATOM 10838 C CG1  . VAL F 1 52  ? 107.147 155.297 -25.356 1.00 0.00 ? 52  VAL F CG1  1 
ATOM 10839 C CG2  . VAL F 1 52  ? 106.612 154.095 -23.237 1.00 0.00 ? 52  VAL F CG2  1 
ATOM 10840 H H    . VAL F 1 52  ? 109.777 154.751 -22.073 1.00 0.00 ? 52  VAL F H    1 
ATOM 10841 H HA   . VAL F 1 52  ? 108.863 153.357 -24.542 1.00 0.00 ? 52  VAL F HA   1 
ATOM 10842 H HB   . VAL F 1 52  ? 107.732 155.924 -23.387 1.00 0.00 ? 52  VAL F HB   1 
ATOM 10843 H HG11 . VAL F 1 52  ? 107.747 156.086 -25.783 1.00 0.00 ? 52  VAL F HG11 1 
ATOM 10844 H HG12 . VAL F 1 52  ? 106.112 155.606 -25.327 1.00 0.00 ? 52  VAL F HG12 1 
ATOM 10845 H HG13 . VAL F 1 52  ? 107.240 154.406 -25.962 1.00 0.00 ? 52  VAL F HG13 1 
ATOM 10846 H HG21 . VAL F 1 52  ? 105.713 154.656 -23.032 1.00 0.00 ? 52  VAL F HG21 1 
ATOM 10847 H HG22 . VAL F 1 52  ? 107.032 153.733 -22.312 1.00 0.00 ? 52  VAL F HG22 1 
ATOM 10848 H HG23 . VAL F 1 52  ? 106.377 153.257 -23.877 1.00 0.00 ? 52  VAL F HG23 1 
ATOM 10849 N N    . ALA F 1 53  ? 110.416 154.692 -25.920 1.00 0.00 ? 53  ALA F N    1 
ATOM 10850 C CA   . ALA F 1 53  ? 111.387 155.433 -26.741 1.00 0.00 ? 53  ALA F CA   1 
ATOM 10851 C C    . ALA F 1 53  ? 110.892 155.557 -28.180 1.00 0.00 ? 53  ALA F C    1 
ATOM 10852 O O    . ALA F 1 53  ? 110.550 154.564 -28.816 1.00 0.00 ? 53  ALA F O    1 
ATOM 10853 C CB   . ALA F 1 53  ? 112.732 154.701 -26.732 1.00 0.00 ? 53  ALA F CB   1 
ATOM 10854 H H    . ALA F 1 53  ? 110.075 153.834 -26.245 1.00 0.00 ? 53  ALA F H    1 
ATOM 10855 H HA   . ALA F 1 53  ? 111.530 156.423 -26.335 1.00 0.00 ? 53  ALA F HA   1 
ATOM 10856 H HB1  . ALA F 1 53  ? 113.379 155.125 -27.486 1.00 0.00 ? 53  ALA F HB1  1 
ATOM 10857 H HB2  . ALA F 1 53  ? 112.574 153.653 -26.940 1.00 0.00 ? 53  ALA F HB2  1 
ATOM 10858 H HB3  . ALA F 1 53  ? 113.193 154.810 -25.761 1.00 0.00 ? 53  ALA F HB3  1 
ATOM 10859 N N    . THR F 1 54  ? 110.865 156.789 -28.698 1.00 0.00 ? 54  THR F N    1 
ATOM 10860 C CA   . THR F 1 54  ? 110.418 157.040 -30.080 1.00 0.00 ? 54  THR F CA   1 
ATOM 10861 C C    . THR F 1 54  ? 111.469 157.847 -30.836 1.00 0.00 ? 54  THR F C    1 
ATOM 10862 O O    . THR F 1 54  ? 111.886 158.913 -30.381 1.00 0.00 ? 54  THR F O    1 
ATOM 10863 C CB   . THR F 1 54  ? 109.097 157.813 -30.065 1.00 0.00 ? 54  THR F CB   1 
ATOM 10864 O OG1  . THR F 1 54  ? 108.115 157.054 -29.372 1.00 0.00 ? 54  THR F OG1  1 
ATOM 10865 C CG2  . THR F 1 54  ? 108.633 158.060 -31.501 1.00 0.00 ? 54  THR F CG2  1 
ATOM 10866 H H    . THR F 1 54  ? 111.158 157.545 -28.145 1.00 0.00 ? 54  THR F H    1 
ATOM 10867 H HA   . THR F 1 54  ? 110.266 156.099 -30.596 1.00 0.00 ? 54  THR F HA   1 
ATOM 10868 H HB   . THR F 1 54  ? 109.237 158.761 -29.569 1.00 0.00 ? 54  THR F HB   1 
ATOM 10869 H HG1  . THR F 1 54  ? 108.354 156.127 -29.439 1.00 0.00 ? 54  THR F HG1  1 
ATOM 10870 H HG21 . THR F 1 54  ? 108.678 157.136 -32.058 1.00 0.00 ? 54  THR F HG21 1 
ATOM 10871 H HG22 . THR F 1 54  ? 109.276 158.793 -31.965 1.00 0.00 ? 54  THR F HG22 1 
ATOM 10872 H HG23 . THR F 1 54  ? 107.617 158.426 -31.493 1.00 0.00 ? 54  THR F HG23 1 
ATOM 10873 N N    . VAL F 1 55  ? 111.890 157.331 -31.998 1.00 0.00 ? 55  VAL F N    1 
ATOM 10874 C CA   . VAL F 1 55  ? 112.898 158.005 -32.833 1.00 0.00 ? 55  VAL F CA   1 
ATOM 10875 C C    . VAL F 1 55  ? 112.389 158.141 -34.266 1.00 0.00 ? 55  VAL F C    1 
ATOM 10876 O O    . VAL F 1 55  ? 112.040 157.145 -34.903 1.00 0.00 ? 55  VAL F O    1 
ATOM 10877 C CB   . VAL F 1 55  ? 114.193 157.192 -32.832 1.00 0.00 ? 55  VAL F CB   1 
ATOM 10878 C CG1  . VAL F 1 55  ? 115.230 157.881 -33.718 1.00 0.00 ? 55  VAL F CG1  1 
ATOM 10879 C CG2  . VAL F 1 55  ? 114.731 157.092 -31.402 1.00 0.00 ? 55  VAL F CG2  1 
ATOM 10880 H H    . VAL F 1 55  ? 111.514 156.479 -32.304 1.00 0.00 ? 55  VAL F H    1 
ATOM 10881 H HA   . VAL F 1 55  ? 113.104 158.993 -32.439 1.00 0.00 ? 55  VAL F HA   1 
ATOM 10882 H HB   . VAL F 1 55  ? 113.996 156.200 -33.214 1.00 0.00 ? 55  VAL F HB   1 
ATOM 10883 H HG11 . VAL F 1 55  ? 114.946 157.771 -34.755 1.00 0.00 ? 55  VAL F HG11 1 
ATOM 10884 H HG12 . VAL F 1 55  ? 116.197 157.429 -33.560 1.00 0.00 ? 55  VAL F HG12 1 
ATOM 10885 H HG13 . VAL F 1 55  ? 115.276 158.930 -33.468 1.00 0.00 ? 55  VAL F HG13 1 
ATOM 10886 H HG21 . VAL F 1 55  ? 115.549 156.387 -31.374 1.00 0.00 ? 55  VAL F HG21 1 
ATOM 10887 H HG22 . VAL F 1 55  ? 113.943 156.757 -30.744 1.00 0.00 ? 55  VAL F HG22 1 
ATOM 10888 H HG23 . VAL F 1 55  ? 115.080 158.063 -31.081 1.00 0.00 ? 55  VAL F HG23 1 
ATOM 10889 N N    . ALA F 1 56  ? 112.347 159.377 -34.771 1.00 0.00 ? 56  ALA F N    1 
ATOM 10890 C CA   . ALA F 1 56  ? 111.873 159.627 -36.137 1.00 0.00 ? 56  ALA F CA   1 
ATOM 10891 C C    . ALA F 1 56  ? 113.034 159.593 -37.131 1.00 0.00 ? 56  ALA F C    1 
ATOM 10892 O O    . ALA F 1 56  ? 113.221 158.607 -37.837 1.00 0.00 ? 56  ALA F O    1 
ATOM 10893 C CB   . ALA F 1 56  ? 111.176 160.987 -36.206 1.00 0.00 ? 56  ALA F CB   1 
ATOM 10894 H H    . ALA F 1 56  ? 112.636 160.133 -34.217 1.00 0.00 ? 56  ALA F H    1 
ATOM 10895 H HA   . ALA F 1 56  ? 111.158 158.861 -36.413 1.00 0.00 ? 56  ALA F HA   1 
ATOM 10896 H HB1  . ALA F 1 56  ? 111.856 161.756 -35.881 1.00 0.00 ? 56  ALA F HB1  1 
ATOM 10897 H HB2  . ALA F 1 56  ? 110.307 160.979 -35.563 1.00 0.00 ? 56  ALA F HB2  1 
ATOM 10898 H HB3  . ALA F 1 56  ? 110.869 161.184 -37.223 1.00 0.00 ? 56  ALA F HB3  1 
ATOM 10899 N N    . GLU F 1 57  ? 113.810 160.676 -37.181 1.00 0.00 ? 57  GLU F N    1 
ATOM 10900 C CA   . GLU F 1 57  ? 114.947 160.751 -38.103 1.00 0.00 ? 57  GLU F CA   1 
ATOM 10901 C C    . GLU F 1 57  ? 115.915 159.582 -37.851 1.00 0.00 ? 57  GLU F C    1 
ATOM 10902 O O    . GLU F 1 57  ? 115.560 158.599 -37.199 1.00 0.00 ? 57  GLU F O    1 
ATOM 10903 C CB   . GLU F 1 57  ? 115.678 162.110 -37.925 1.00 0.00 ? 57  GLU F CB   1 
ATOM 10904 C CG   . GLU F 1 57  ? 116.187 162.649 -39.276 1.00 0.00 ? 57  GLU F CG   1 
ATOM 10905 C CD   . GLU F 1 57  ? 115.024 163.226 -40.083 1.00 0.00 ? 57  GLU F CD   1 
ATOM 10906 O OE1  . GLU F 1 57  ? 113.928 163.286 -39.548 1.00 0.00 ? 57  GLU F OE1  1 
ATOM 10907 O OE2  . GLU F 1 57  ? 115.248 163.600 -41.222 1.00 0.00 ? 57  GLU F OE2  1 
ATOM 10908 H H    . GLU F 1 57  ? 113.614 161.437 -36.595 1.00 0.00 ? 57  GLU F H    1 
ATOM 10909 H HA   . GLU F 1 57  ? 114.571 160.678 -39.113 1.00 0.00 ? 57  GLU F HA   1 
ATOM 10910 H HB2  . GLU F 1 57  ? 114.994 162.821 -37.503 1.00 0.00 ? 57  GLU F HB2  1 
ATOM 10911 H HB3  . GLU F 1 57  ? 116.519 161.991 -37.256 1.00 0.00 ? 57  GLU F HB3  1 
ATOM 10912 H HG2  . GLU F 1 57  ? 116.919 163.424 -39.100 1.00 0.00 ? 57  GLU F HG2  1 
ATOM 10913 H HG3  . GLU F 1 57  ? 116.643 161.849 -39.834 1.00 0.00 ? 57  GLU F HG3  1 
ATOM 10914 N N    . LYS F 1 58  ? 117.141 159.705 -38.376 1.00 0.00 ? 58  LYS F N    1 
ATOM 10915 C CA   . LYS F 1 58  ? 118.172 158.661 -38.214 1.00 0.00 ? 58  LYS F CA   1 
ATOM 10916 C C    . LYS F 1 58  ? 119.188 159.073 -37.155 1.00 0.00 ? 58  LYS F C    1 
ATOM 10917 O O    . LYS F 1 58  ? 119.337 160.251 -36.857 1.00 0.00 ? 58  LYS F O    1 
ATOM 10918 C CB   . LYS F 1 58  ? 118.897 158.434 -39.550 1.00 0.00 ? 58  LYS F CB   1 
ATOM 10919 C CG   . LYS F 1 58  ? 119.259 159.777 -40.183 1.00 0.00 ? 58  LYS F CG   1 
ATOM 10920 C CD   . LYS F 1 58  ? 119.983 159.532 -41.506 1.00 0.00 ? 58  LYS F CD   1 
ATOM 10921 C CE   . LYS F 1 58  ? 120.341 160.871 -42.147 1.00 0.00 ? 58  LYS F CE   1 
ATOM 10922 N NZ   . LYS F 1 58  ? 121.058 160.633 -43.430 1.00 0.00 ? 58  LYS F NZ   1 
ATOM 10923 H H    . LYS F 1 58  ? 117.360 160.510 -38.882 1.00 0.00 ? 58  LYS F H    1 
ATOM 10924 H HA   . LYS F 1 58  ? 117.705 157.733 -37.911 1.00 0.00 ? 58  LYS F HA   1 
ATOM 10925 H HB2  . LYS F 1 58  ? 119.805 157.870 -39.378 1.00 0.00 ? 58  LYS F HB2  1 
ATOM 10926 H HB3  . LYS F 1 58  ? 118.254 157.884 -40.220 1.00 0.00 ? 58  LYS F HB3  1 
ATOM 10927 H HG2  . LYS F 1 58  ? 118.359 160.343 -40.365 1.00 0.00 ? 58  LYS F HG2  1 
ATOM 10928 H HG3  . LYS F 1 58  ? 119.907 160.327 -39.517 1.00 0.00 ? 58  LYS F HG3  1 
ATOM 10929 H HD2  . LYS F 1 58  ? 120.886 158.965 -41.325 1.00 0.00 ? 58  LYS F HD2  1 
ATOM 10930 H HD3  . LYS F 1 58  ? 119.339 158.977 -42.173 1.00 0.00 ? 58  LYS F HD3  1 
ATOM 10931 H HE2  . LYS F 1 58  ? 119.437 161.431 -42.337 1.00 0.00 ? 58  LYS F HE2  1 
ATOM 10932 H HE3  . LYS F 1 58  ? 120.976 161.432 -41.477 1.00 0.00 ? 58  LYS F HE3  1 
ATOM 10933 H HZ1  . LYS F 1 58  ? 121.812 161.338 -43.542 1.00 0.00 ? 58  LYS F HZ1  1 
ATOM 10934 H HZ2  . LYS F 1 58  ? 120.386 160.714 -44.221 1.00 0.00 ? 58  LYS F HZ2  1 
ATOM 10935 H HZ3  . LYS F 1 58  ? 121.475 159.681 -43.424 1.00 0.00 ? 58  LYS F HZ3  1 
ATOM 10936 N N    . THR F 1 59  ? 119.889 158.091 -36.592 1.00 0.00 ? 59  THR F N    1 
ATOM 10937 C CA   . THR F 1 59  ? 120.897 158.374 -35.573 1.00 0.00 ? 59  THR F CA   1 
ATOM 10938 C C    . THR F 1 59  ? 122.204 158.817 -36.230 1.00 0.00 ? 59  THR F C    1 
ATOM 10939 O O    . THR F 1 59  ? 122.912 159.686 -35.715 1.00 0.00 ? 59  THR F O    1 
ATOM 10940 C CB   . THR F 1 59  ? 121.150 157.124 -34.722 1.00 0.00 ? 59  THR F CB   1 
ATOM 10941 O OG1  . THR F 1 59  ? 121.616 156.071 -35.555 1.00 0.00 ? 59  THR F OG1  1 
ATOM 10942 C CG2  . THR F 1 59  ? 119.851 156.697 -34.035 1.00 0.00 ? 59  THR F CG2  1 
ATOM 10943 H H    . THR F 1 59  ? 119.730 157.165 -36.870 1.00 0.00 ? 59  THR F H    1 
ATOM 10944 H HA   . THR F 1 59  ? 120.540 159.166 -34.932 1.00 0.00 ? 59  THR F HA   1 
ATOM 10945 H HB   . THR F 1 59  ? 121.892 157.345 -33.971 1.00 0.00 ? 59  THR F HB   1 
ATOM 10946 H HG1  . THR F 1 59  ? 121.279 155.243 -35.205 1.00 0.00 ? 59  THR F HG1  1 
ATOM 10947 H HG21 . THR F 1 59  ? 120.056 155.885 -33.354 1.00 0.00 ? 59  THR F HG21 1 
ATOM 10948 H HG22 . THR F 1 59  ? 119.141 156.371 -34.781 1.00 0.00 ? 59  THR F HG22 1 
ATOM 10949 H HG23 . THR F 1 59  ? 119.441 157.533 -33.488 1.00 0.00 ? 59  THR F HG23 1 
ATOM 10950 N N    . LYS F 1 60  ? 122.513 158.205 -37.373 1.00 0.00 ? 60  LYS F N    1 
ATOM 10951 C CA   . LYS F 1 60  ? 123.733 158.523 -38.110 1.00 0.00 ? 60  LYS F CA   1 
ATOM 10952 C C    . LYS F 1 60  ? 124.969 157.939 -37.395 1.00 0.00 ? 60  LYS F C    1 
ATOM 10953 O O    . LYS F 1 60  ? 125.798 158.683 -36.880 1.00 0.00 ? 60  LYS F O    1 
ATOM 10954 C CB   . LYS F 1 60  ? 123.889 160.046 -38.257 1.00 0.00 ? 60  LYS F CB   1 
ATOM 10955 C CG   . LYS F 1 60  ? 124.743 160.372 -39.503 1.00 0.00 ? 60  LYS F CG   1 
ATOM 10956 C CD   . LYS F 1 60  ? 124.881 161.889 -39.667 1.00 0.00 ? 60  LYS F CD   1 
ATOM 10957 C CE   . LYS F 1 60  ? 125.474 162.195 -41.046 1.00 0.00 ? 60  LYS F CE   1 
ATOM 10958 N NZ   . LYS F 1 60  ? 124.480 161.847 -42.103 1.00 0.00 ? 60  LYS F NZ   1 
ATOM 10959 H H    . LYS F 1 60  ? 121.911 157.517 -37.728 1.00 0.00 ? 60  LYS F H    1 
ATOM 10960 H HA   . LYS F 1 60  ? 123.656 158.100 -39.085 1.00 0.00 ? 60  LYS F HA   1 
ATOM 10961 H HB2  . LYS F 1 60  ? 122.913 160.499 -38.360 1.00 0.00 ? 60  LYS F HB2  1 
ATOM 10962 H HB3  . LYS F 1 60  ? 124.370 160.432 -37.389 1.00 0.00 ? 60  LYS F HB3  1 
ATOM 10963 H HG2  . LYS F 1 60  ? 125.723 159.934 -39.390 1.00 0.00 ? 60  LYS F HG2  1 
ATOM 10964 H HG3  . LYS F 1 60  ? 124.265 159.961 -40.380 1.00 0.00 ? 60  LYS F HG3  1 
ATOM 10965 H HD2  . LYS F 1 60  ? 123.911 162.354 -39.577 1.00 0.00 ? 60  LYS F HD2  1 
ATOM 10966 H HD3  . LYS F 1 60  ? 125.541 162.273 -38.906 1.00 0.00 ? 60  LYS F HD3  1 
ATOM 10967 H HE2  . LYS F 1 60  ? 125.716 163.245 -41.109 1.00 0.00 ? 60  LYS F HE2  1 
ATOM 10968 H HE3  . LYS F 1 60  ? 126.371 161.609 -41.189 1.00 0.00 ? 60  LYS F HE3  1 
ATOM 10969 H HZ1  . LYS F 1 60  ? 124.945 161.287 -42.846 1.00 0.00 ? 60  LYS F HZ1  1 
ATOM 10970 H HZ2  . LYS F 1 60  ? 124.095 162.721 -42.517 1.00 0.00 ? 60  LYS F HZ2  1 
ATOM 10971 H HZ3  . LYS F 1 60  ? 123.708 161.291 -41.685 1.00 0.00 ? 60  LYS F HZ3  1 
ATOM 10972 N N    . GLU F 1 61  ? 125.084 156.605 -37.352 1.00 0.00 ? 61  GLU F N    1 
ATOM 10973 C CA   . GLU F 1 61  ? 126.235 155.960 -36.678 1.00 0.00 ? 61  GLU F CA   1 
ATOM 10974 C C    . GLU F 1 61  ? 127.287 155.532 -37.699 1.00 0.00 ? 61  GLU F C    1 
ATOM 10975 O O    . GLU F 1 61  ? 127.334 154.373 -38.109 1.00 0.00 ? 61  GLU F O    1 
ATOM 10976 C CB   . GLU F 1 61  ? 125.755 154.736 -35.890 1.00 0.00 ? 61  GLU F CB   1 
ATOM 10977 C CG   . GLU F 1 61  ? 124.975 155.204 -34.658 1.00 0.00 ? 61  GLU F CG   1 
ATOM 10978 C CD   . GLU F 1 61  ? 124.296 154.021 -33.980 1.00 0.00 ? 61  GLU F CD   1 
ATOM 10979 O OE1  . GLU F 1 61  ? 124.192 152.983 -34.607 1.00 0.00 ? 61  GLU F OE1  1 
ATOM 10980 O OE2  . GLU F 1 61  ? 123.886 154.171 -32.841 1.00 0.00 ? 61  GLU F OE2  1 
ATOM 10981 H H    . GLU F 1 61  ? 124.393 156.045 -37.768 1.00 0.00 ? 61  GLU F H    1 
ATOM 10982 H HA   . GLU F 1 61  ? 126.689 156.660 -35.986 1.00 0.00 ? 61  GLU F HA   1 
ATOM 10983 H HB2  . GLU F 1 61  ? 125.117 154.129 -36.514 1.00 0.00 ? 61  GLU F HB2  1 
ATOM 10984 H HB3  . GLU F 1 61  ? 126.609 154.155 -35.571 1.00 0.00 ? 61  GLU F HB3  1 
ATOM 10985 H HG2  . GLU F 1 61  ? 125.656 155.669 -33.963 1.00 0.00 ? 61  GLU F HG2  1 
ATOM 10986 H HG3  . GLU F 1 61  ? 124.226 155.921 -34.961 1.00 0.00 ? 61  GLU F HG3  1 
ATOM 10987 N N    . GLN F 1 62  ? 128.132 156.478 -38.109 1.00 0.00 ? 62  GLN F N    1 
ATOM 10988 C CA   . GLN F 1 62  ? 129.171 156.179 -39.090 1.00 0.00 ? 62  GLN F CA   1 
ATOM 10989 C C    . GLN F 1 62  ? 130.283 155.329 -38.472 1.00 0.00 ? 62  GLN F C    1 
ATOM 10990 O O    . GLN F 1 62  ? 130.290 154.108 -38.614 1.00 0.00 ? 62  GLN F O    1 
ATOM 10991 C CB   . GLN F 1 62  ? 129.771 157.476 -39.638 1.00 0.00 ? 62  GLN F CB   1 
ATOM 10992 C CG   . GLN F 1 62  ? 128.742 158.199 -40.510 1.00 0.00 ? 62  GLN F CG   1 
ATOM 10993 C CD   . GLN F 1 62  ? 129.266 159.580 -40.892 1.00 0.00 ? 62  GLN F CD   1 
ATOM 10994 O OE1  . GLN F 1 62  ? 130.098 160.147 -40.185 1.00 0.00 ? 62  GLN F OE1  1 
ATOM 10995 N NE2  . GLN F 1 62  ? 128.826 160.161 -41.976 1.00 0.00 ? 62  GLN F NE2  1 
ATOM 10996 H H    . GLN F 1 62  ? 128.049 157.388 -37.751 1.00 0.00 ? 62  GLN F H    1 
ATOM 10997 H HA   . GLN F 1 62  ? 128.728 155.631 -39.905 1.00 0.00 ? 62  GLN F HA   1 
ATOM 10998 H HB2  . GLN F 1 62  ? 130.055 158.114 -38.819 1.00 0.00 ? 62  GLN F HB2  1 
ATOM 10999 H HB3  . GLN F 1 62  ? 130.641 157.246 -40.232 1.00 0.00 ? 62  GLN F HB3  1 
ATOM 11000 H HG2  . GLN F 1 62  ? 128.561 157.622 -41.406 1.00 0.00 ? 62  GLN F HG2  1 
ATOM 11001 H HG3  . GLN F 1 62  ? 127.818 158.306 -39.961 1.00 0.00 ? 62  GLN F HG3  1 
ATOM 11002 H HE21 . GLN F 1 62  ? 128.162 159.711 -42.538 1.00 0.00 ? 62  GLN F HE21 1 
ATOM 11003 H HE22 . GLN F 1 62  ? 129.159 161.048 -42.224 1.00 0.00 ? 62  GLN F HE22 1 
ATOM 11004 N N    . VAL F 1 63  ? 131.228 155.985 -37.784 1.00 0.00 ? 63  VAL F N    1 
ATOM 11005 C CA   . VAL F 1 63  ? 132.356 155.275 -37.147 1.00 0.00 ? 63  VAL F CA   1 
ATOM 11006 C C    . VAL F 1 63  ? 132.321 155.452 -35.631 1.00 0.00 ? 63  VAL F C    1 
ATOM 11007 O O    . VAL F 1 63  ? 132.376 156.567 -35.124 1.00 0.00 ? 63  VAL F O    1 
ATOM 11008 C CB   . VAL F 1 63  ? 133.682 155.816 -37.690 1.00 0.00 ? 63  VAL F CB   1 
ATOM 11009 C CG1  . VAL F 1 63  ? 134.844 155.085 -37.017 1.00 0.00 ? 63  VAL F CG1  1 
ATOM 11010 C CG2  . VAL F 1 63  ? 133.747 155.585 -39.203 1.00 0.00 ? 63  VAL F CG2  1 
ATOM 11011 H H    . VAL F 1 63  ? 131.172 156.960 -37.703 1.00 0.00 ? 63  VAL F H    1 
ATOM 11012 H HA   . VAL F 1 63  ? 132.299 154.223 -37.373 1.00 0.00 ? 63  VAL F HA   1 
ATOM 11013 H HB   . VAL F 1 63  ? 133.752 156.874 -37.482 1.00 0.00 ? 63  VAL F HB   1 
ATOM 11014 H HG11 . VAL F 1 63  ? 134.655 154.022 -37.029 1.00 0.00 ? 63  VAL F HG11 1 
ATOM 11015 H HG12 . VAL F 1 63  ? 134.939 155.423 -35.995 1.00 0.00 ? 63  VAL F HG12 1 
ATOM 11016 H HG13 . VAL F 1 63  ? 135.760 155.293 -37.552 1.00 0.00 ? 63  VAL F HG13 1 
ATOM 11017 H HG21 . VAL F 1 63  ? 132.849 155.967 -39.666 1.00 0.00 ? 63  VAL F HG21 1 
ATOM 11018 H HG22 . VAL F 1 63  ? 133.830 154.525 -39.401 1.00 0.00 ? 63  VAL F HG22 1 
ATOM 11019 H HG23 . VAL F 1 63  ? 134.607 156.096 -39.609 1.00 0.00 ? 63  VAL F HG23 1 
ATOM 11020 N N    . THR F 1 64  ? 132.241 154.332 -34.904 1.00 0.00 ? 64  THR F N    1 
ATOM 11021 C CA   . THR F 1 64  ? 132.210 154.363 -33.429 1.00 0.00 ? 64  THR F CA   1 
ATOM 11022 C C    . THR F 1 64  ? 133.338 153.507 -32.861 1.00 0.00 ? 64  THR F C    1 
ATOM 11023 O O    . THR F 1 64  ? 133.475 152.337 -33.215 1.00 0.00 ? 64  THR F O    1 
ATOM 11024 C CB   . THR F 1 64  ? 130.865 153.829 -32.927 1.00 0.00 ? 64  THR F CB   1 
ATOM 11025 O OG1  . THR F 1 64  ? 129.814 154.630 -33.448 1.00 0.00 ? 64  THR F OG1  1 
ATOM 11026 C CG2  . THR F 1 64  ? 130.834 153.878 -31.399 1.00 0.00 ? 64  THR F CG2  1 
ATOM 11027 H H    . THR F 1 64  ? 132.205 153.467 -35.363 1.00 0.00 ? 64  THR F H    1 
ATOM 11028 H HA   . THR F 1 64  ? 132.333 155.381 -33.077 1.00 0.00 ? 64  THR F HA   1 
ATOM 11029 H HB   . THR F 1 64  ? 130.737 152.808 -33.252 1.00 0.00 ? 64  THR F HB   1 
ATOM 11030 H HG1  . THR F 1 64  ? 129.943 155.529 -33.134 1.00 0.00 ? 64  THR F HG1  1 
ATOM 11031 H HG21 . THR F 1 64  ? 131.187 154.842 -31.063 1.00 0.00 ? 64  THR F HG21 1 
ATOM 11032 H HG22 . THR F 1 64  ? 131.471 153.102 -31.002 1.00 0.00 ? 64  THR F HG22 1 
ATOM 11033 H HG23 . THR F 1 64  ? 129.823 153.724 -31.054 1.00 0.00 ? 64  THR F HG23 1 
ATOM 11034 N N    . ASN F 1 65  ? 134.149 154.103 -31.976 1.00 0.00 ? 65  ASN F N    1 
ATOM 11035 C CA   . ASN F 1 65  ? 135.279 153.393 -31.353 1.00 0.00 ? 65  ASN F CA   1 
ATOM 11036 C C    . ASN F 1 65  ? 135.257 153.576 -29.834 1.00 0.00 ? 65  ASN F C    1 
ATOM 11037 O O    . ASN F 1 65  ? 135.416 154.687 -29.331 1.00 0.00 ? 65  ASN F O    1 
ATOM 11038 C CB   . ASN F 1 65  ? 136.597 153.938 -31.911 1.00 0.00 ? 65  ASN F CB   1 
ATOM 11039 C CG   . ASN F 1 65  ? 136.648 153.734 -33.423 1.00 0.00 ? 65  ASN F CG   1 
ATOM 11040 O OD1  . ASN F 1 65  ? 136.266 152.676 -33.921 1.00 0.00 ? 65  ASN F OD1  1 
ATOM 11041 N ND2  . ASN F 1 65  ? 137.097 154.691 -34.188 1.00 0.00 ? 65  ASN F ND2  1 
ATOM 11042 H H    . ASN F 1 65  ? 133.987 155.039 -31.737 1.00 0.00 ? 65  ASN F H    1 
ATOM 11043 H HA   . ASN F 1 65  ? 135.218 152.336 -31.577 1.00 0.00 ? 65  ASN F HA   1 
ATOM 11044 H HB2  . ASN F 1 65  ? 136.669 154.992 -31.689 1.00 0.00 ? 65  ASN F HB2  1 
ATOM 11045 H HB3  . ASN F 1 65  ? 137.423 153.418 -31.453 1.00 0.00 ? 65  ASN F HB3  1 
ATOM 11046 H HD21 . ASN F 1 65  ? 137.401 155.534 -33.792 1.00 0.00 ? 65  ASN F HD21 1 
ATOM 11047 H HD22 . ASN F 1 65  ? 137.134 154.567 -35.160 1.00 0.00 ? 65  ASN F HD22 1 
ATOM 11048 N N    . VAL F 1 66  ? 135.058 152.472 -29.102 1.00 0.00 ? 66  VAL F N    1 
ATOM 11049 C CA   . VAL F 1 66  ? 135.018 152.515 -27.628 1.00 0.00 ? 66  VAL F CA   1 
ATOM 11050 C C    . VAL F 1 66  ? 135.884 151.411 -27.028 1.00 0.00 ? 66  VAL F C    1 
ATOM 11051 O O    . VAL F 1 66  ? 135.778 150.247 -27.414 1.00 0.00 ? 66  VAL F O    1 
ATOM 11052 C CB   . VAL F 1 66  ? 133.582 152.351 -27.140 1.00 0.00 ? 66  VAL F CB   1 
ATOM 11053 C CG1  . VAL F 1 66  ? 133.563 152.350 -25.609 1.00 0.00 ? 66  VAL F CG1  1 
ATOM 11054 C CG2  . VAL F 1 66  ? 132.740 153.519 -27.663 1.00 0.00 ? 66  VAL F CG2  1 
ATOM 11055 H H    . VAL F 1 66  ? 134.939 151.612 -29.558 1.00 0.00 ? 66  VAL F H    1 
ATOM 11056 H HA   . VAL F 1 66  ? 135.393 153.471 -27.281 1.00 0.00 ? 66  VAL F HA   1 
ATOM 11057 H HB   . VAL F 1 66  ? 133.178 151.419 -27.508 1.00 0.00 ? 66  VAL F HB   1 
ATOM 11058 H HG11 . VAL F 1 66  ? 134.143 153.182 -25.240 1.00 0.00 ? 66  VAL F HG11 1 
ATOM 11059 H HG12 . VAL F 1 66  ? 133.986 151.426 -25.243 1.00 0.00 ? 66  VAL F HG12 1 
ATOM 11060 H HG13 . VAL F 1 66  ? 132.548 152.438 -25.261 1.00 0.00 ? 66  VAL F HG13 1 
ATOM 11061 H HG21 . VAL F 1 66  ? 132.816 153.563 -28.740 1.00 0.00 ? 66  VAL F HG21 1 
ATOM 11062 H HG22 . VAL F 1 66  ? 133.103 154.443 -27.238 1.00 0.00 ? 66  VAL F HG22 1 
ATOM 11063 H HG23 . VAL F 1 66  ? 131.709 153.375 -27.383 1.00 0.00 ? 66  VAL F HG23 1 
ATOM 11064 N N    . GLY F 1 67  ? 136.736 151.786 -26.077 1.00 0.00 ? 67  GLY F N    1 
ATOM 11065 C CA   . GLY F 1 67  ? 137.612 150.819 -25.424 1.00 0.00 ? 67  GLY F CA   1 
ATOM 11066 C C    . GLY F 1 67  ? 136.848 149.993 -24.389 1.00 0.00 ? 67  GLY F C    1 
ATOM 11067 O O    . GLY F 1 67  ? 136.789 148.767 -24.483 1.00 0.00 ? 67  GLY F O    1 
ATOM 11068 H H    . GLY F 1 67  ? 136.773 152.728 -25.807 1.00 0.00 ? 67  GLY F H    1 
ATOM 11069 H HA2  . GLY F 1 67  ? 138.027 150.158 -26.171 1.00 0.00 ? 67  GLY F HA2  1 
ATOM 11070 H HA3  . GLY F 1 67  ? 138.415 151.345 -24.931 1.00 0.00 ? 67  GLY F HA3  1 
ATOM 11071 N N    . GLY F 1 68  ? 136.270 150.673 -23.398 1.00 0.00 ? 68  GLY F N    1 
ATOM 11072 C CA   . GLY F 1 68  ? 135.522 149.986 -22.347 1.00 0.00 ? 68  GLY F CA   1 
ATOM 11073 C C    . GLY F 1 68  ? 134.174 149.485 -22.857 1.00 0.00 ? 68  GLY F C    1 
ATOM 11074 O O    . GLY F 1 68  ? 134.111 148.517 -23.613 1.00 0.00 ? 68  GLY F O    1 
ATOM 11075 H H    . GLY F 1 68  ? 136.354 151.650 -23.368 1.00 0.00 ? 68  GLY F H    1 
ATOM 11076 H HA2  . GLY F 1 68  ? 136.102 149.145 -21.996 1.00 0.00 ? 68  GLY F HA2  1 
ATOM 11077 H HA3  . GLY F 1 68  ? 135.357 150.666 -21.526 1.00 0.00 ? 68  GLY F HA3  1 
ATOM 11078 N N    . ALA F 1 69  ? 133.091 150.144 -22.430 1.00 0.00 ? 69  ALA F N    1 
ATOM 11079 C CA   . ALA F 1 69  ? 131.733 149.751 -22.842 1.00 0.00 ? 69  ALA F CA   1 
ATOM 11080 C C    . ALA F 1 69  ? 130.880 150.982 -23.130 1.00 0.00 ? 69  ALA F C    1 
ATOM 11081 O O    . ALA F 1 69  ? 131.131 152.066 -22.596 1.00 0.00 ? 69  ALA F O    1 
ATOM 11082 C CB   . ALA F 1 69  ? 131.075 148.929 -21.732 1.00 0.00 ? 69  ALA F CB   1 
ATOM 11083 H H    . ALA F 1 69  ? 133.205 150.905 -21.822 1.00 0.00 ? 69  ALA F H    1 
ATOM 11084 H HA   . ALA F 1 69  ? 131.785 149.146 -23.738 1.00 0.00 ? 69  ALA F HA   1 
ATOM 11085 H HB1  . ALA F 1 69  ? 131.007 149.525 -20.834 1.00 0.00 ? 69  ALA F HB1  1 
ATOM 11086 H HB2  . ALA F 1 69  ? 131.669 148.049 -21.535 1.00 0.00 ? 69  ALA F HB2  1 
ATOM 11087 H HB3  . ALA F 1 69  ? 130.084 148.632 -22.042 1.00 0.00 ? 69  ALA F HB3  1 
ATOM 11088 N N    . VAL F 1 70  ? 129.861 150.809 -23.982 1.00 0.00 ? 70  VAL F N    1 
ATOM 11089 C CA   . VAL F 1 70  ? 128.963 151.918 -24.344 1.00 0.00 ? 70  VAL F CA   1 
ATOM 11090 C C    . VAL F 1 70  ? 127.514 151.442 -24.438 1.00 0.00 ? 70  VAL F C    1 
ATOM 11091 O O    . VAL F 1 70  ? 127.211 150.438 -25.079 1.00 0.00 ? 70  VAL F O    1 
ATOM 11092 C CB   . VAL F 1 70  ? 129.413 152.535 -25.681 1.00 0.00 ? 70  VAL F CB   1 
ATOM 11093 C CG1  . VAL F 1 70  ? 129.665 151.420 -26.699 1.00 0.00 ? 70  VAL F CG1  1 
ATOM 11094 C CG2  . VAL F 1 70  ? 128.329 153.498 -26.224 1.00 0.00 ? 70  VAL F CG2  1 
ATOM 11095 H H    . VAL F 1 70  ? 129.710 149.921 -24.375 1.00 0.00 ? 70  VAL F H    1 
ATOM 11096 H HA   . VAL F 1 70  ? 129.019 152.677 -23.582 1.00 0.00 ? 70  VAL F HA   1 
ATOM 11097 H HB   . VAL F 1 70  ? 130.326 153.081 -25.523 1.00 0.00 ? 70  VAL F HB   1 
ATOM 11098 H HG11 . VAL F 1 70  ? 130.461 150.782 -26.343 1.00 0.00 ? 70  VAL F HG11 1 
ATOM 11099 H HG12 . VAL F 1 70  ? 129.948 151.853 -27.646 1.00 0.00 ? 70  VAL F HG12 1 
ATOM 11100 H HG13 . VAL F 1 70  ? 128.769 150.841 -26.823 1.00 0.00 ? 70  VAL F HG13 1 
ATOM 11101 H HG21 . VAL F 1 70  ? 127.872 154.030 -25.403 1.00 0.00 ? 70  VAL F HG21 1 
ATOM 11102 H HG22 . VAL F 1 70  ? 127.569 152.936 -26.750 1.00 0.00 ? 70  VAL F HG22 1 
ATOM 11103 H HG23 . VAL F 1 70  ? 128.785 154.206 -26.902 1.00 0.00 ? 70  VAL F HG23 1 
ATOM 11104 N N    . VAL F 1 71  ? 126.613 152.190 -23.796 1.00 0.00 ? 71  VAL F N    1 
ATOM 11105 C CA   . VAL F 1 71  ? 125.178 151.858 -23.807 1.00 0.00 ? 71  VAL F CA   1 
ATOM 11106 C C    . VAL F 1 71  ? 124.367 153.068 -24.254 1.00 0.00 ? 71  VAL F C    1 
ATOM 11107 O O    . VAL F 1 71  ? 124.462 154.142 -23.663 1.00 0.00 ? 71  VAL F O    1 
ATOM 11108 C CB   . VAL F 1 71  ? 124.734 151.432 -22.407 1.00 0.00 ? 71  VAL F CB   1 
ATOM 11109 C CG1  . VAL F 1 71  ? 123.246 151.070 -22.427 1.00 0.00 ? 71  VAL F CG1  1 
ATOM 11110 C CG2  . VAL F 1 71  ? 125.549 150.216 -21.967 1.00 0.00 ? 71  VAL F CG2  1 
ATOM 11111 H H    . VAL F 1 71  ? 126.917 152.987 -23.308 1.00 0.00 ? 71  VAL F H    1 
ATOM 11112 H HA   . VAL F 1 71  ? 124.993 151.042 -24.495 1.00 0.00 ? 71  VAL F HA   1 
ATOM 11113 H HB   . VAL F 1 71  ? 124.896 152.246 -21.714 1.00 0.00 ? 71  VAL F HB   1 
ATOM 11114 H HG11 . VAL F 1 71  ? 122.977 150.605 -21.489 1.00 0.00 ? 71  VAL F HG11 1 
ATOM 11115 H HG12 . VAL F 1 71  ? 123.055 150.383 -23.238 1.00 0.00 ? 71  VAL F HG12 1 
ATOM 11116 H HG13 . VAL F 1 71  ? 122.659 151.965 -22.567 1.00 0.00 ? 71  VAL F HG13 1 
ATOM 11117 H HG21 . VAL F 1 71  ? 126.594 150.383 -22.185 1.00 0.00 ? 71  VAL F HG21 1 
ATOM 11118 H HG22 . VAL F 1 71  ? 125.206 149.341 -22.499 1.00 0.00 ? 71  VAL F HG22 1 
ATOM 11119 H HG23 . VAL F 1 71  ? 125.423 150.065 -20.910 1.00 0.00 ? 71  VAL F HG23 1 
ATOM 11120 N N    . THR F 1 72  ? 123.563 152.892 -25.308 1.00 0.00 ? 72  THR F N    1 
ATOM 11121 C CA   . THR F 1 72  ? 122.732 153.992 -25.835 1.00 0.00 ? 72  THR F CA   1 
ATOM 11122 C C    . THR F 1 72  ? 121.264 153.576 -25.915 1.00 0.00 ? 72  THR F C    1 
ATOM 11123 O O    . THR F 1 72  ? 120.948 152.414 -26.188 1.00 0.00 ? 72  THR F O    1 
ATOM 11124 C CB   . THR F 1 72  ? 123.226 154.384 -27.233 1.00 0.00 ? 72  THR F CB   1 
ATOM 11125 O OG1  . THR F 1 72  ? 123.091 153.274 -28.112 1.00 0.00 ? 72  THR F OG1  1 
ATOM 11126 C CG2  . THR F 1 72  ? 124.698 154.799 -27.160 1.00 0.00 ? 72  THR F CG2  1 
ATOM 11127 H H    . THR F 1 72  ? 123.528 152.013 -25.742 1.00 0.00 ? 72  THR F H    1 
ATOM 11128 H HA   . THR F 1 72  ? 122.810 154.856 -25.188 1.00 0.00 ? 72  THR F HA   1 
ATOM 11129 H HB   . THR F 1 72  ? 122.641 155.209 -27.604 1.00 0.00 ? 72  THR F HB   1 
ATOM 11130 H HG1  . THR F 1 72  ? 123.223 153.589 -29.009 1.00 0.00 ? 72  THR F HG1  1 
ATOM 11131 H HG21 . THR F 1 72  ? 125.317 153.918 -27.065 1.00 0.00 ? 72  THR F HG21 1 
ATOM 11132 H HG22 . THR F 1 72  ? 124.850 155.439 -26.304 1.00 0.00 ? 72  THR F HG22 1 
ATOM 11133 H HG23 . THR F 1 72  ? 124.967 155.331 -28.060 1.00 0.00 ? 72  THR F HG23 1 
ATOM 11134 N N    . GLY F 1 73  ? 120.365 154.540 -25.687 1.00 0.00 ? 73  GLY F N    1 
ATOM 11135 C CA   . GLY F 1 73  ? 118.914 154.275 -25.743 1.00 0.00 ? 73  GLY F CA   1 
ATOM 11136 C C    . GLY F 1 73  ? 118.249 154.546 -24.396 1.00 0.00 ? 73  GLY F C    1 
ATOM 11137 O O    . GLY F 1 73  ? 118.388 155.629 -23.832 1.00 0.00 ? 73  GLY F O    1 
ATOM 11138 H H    . GLY F 1 73  ? 120.679 155.449 -25.481 1.00 0.00 ? 73  GLY F H    1 
ATOM 11139 H HA2  . GLY F 1 73  ? 118.470 154.920 -26.489 1.00 0.00 ? 73  GLY F HA2  1 
ATOM 11140 H HA3  . GLY F 1 73  ? 118.734 153.247 -26.021 1.00 0.00 ? 73  GLY F HA3  1 
ATOM 11141 N N    . VAL F 1 74  ? 117.512 153.553 -23.881 1.00 0.00 ? 74  VAL F N    1 
ATOM 11142 C CA   . VAL F 1 74  ? 116.816 153.702 -22.591 1.00 0.00 ? 74  VAL F CA   1 
ATOM 11143 C C    . VAL F 1 74  ? 116.908 152.416 -21.758 1.00 0.00 ? 74  VAL F C    1 
ATOM 11144 O O    . VAL F 1 74  ? 116.613 151.326 -22.234 1.00 0.00 ? 74  VAL F O    1 
ATOM 11145 C CB   . VAL F 1 74  ? 115.339 154.076 -22.845 1.00 0.00 ? 74  VAL F CB   1 
ATOM 11146 C CG1  . VAL F 1 74  ? 114.750 153.151 -23.913 1.00 0.00 ? 74  VAL F CG1  1 
ATOM 11147 C CG2  . VAL F 1 74  ? 114.521 153.946 -21.541 1.00 0.00 ? 74  VAL F CG2  1 
ATOM 11148 H H    . VAL F 1 74  ? 117.430 152.712 -24.376 1.00 0.00 ? 74  VAL F H    1 
ATOM 11149 H HA   . VAL F 1 74  ? 117.276 154.500 -22.030 1.00 0.00 ? 74  VAL F HA   1 
ATOM 11150 H HB   . VAL F 1 74  ? 115.290 155.095 -23.199 1.00 0.00 ? 74  VAL F HB   1 
ATOM 11151 H HG11 . VAL F 1 74  ? 113.690 153.338 -24.004 1.00 0.00 ? 74  VAL F HG11 1 
ATOM 11152 H HG12 . VAL F 1 74  ? 114.911 152.130 -23.628 1.00 0.00 ? 74  VAL F HG12 1 
ATOM 11153 H HG13 . VAL F 1 74  ? 115.230 153.342 -24.861 1.00 0.00 ? 74  VAL F HG13 1 
ATOM 11154 H HG21 . VAL F 1 74  ? 113.620 154.538 -21.622 1.00 0.00 ? 74  VAL F HG21 1 
ATOM 11155 H HG22 . VAL F 1 74  ? 115.109 154.300 -20.708 1.00 0.00 ? 74  VAL F HG22 1 
ATOM 11156 H HG23 . VAL F 1 74  ? 114.258 152.911 -21.377 1.00 0.00 ? 74  VAL F HG23 1 
ATOM 11157 N N    . THR F 1 75  ? 117.309 152.566 -20.491 1.00 0.00 ? 75  THR F N    1 
ATOM 11158 C CA   . THR F 1 75  ? 117.425 151.423 -19.569 1.00 0.00 ? 75  THR F CA   1 
ATOM 11159 C C    . THR F 1 75  ? 116.712 151.744 -18.264 1.00 0.00 ? 75  THR F C    1 
ATOM 11160 O O    . THR F 1 75  ? 116.957 152.783 -17.659 1.00 0.00 ? 75  THR F O    1 
ATOM 11161 C CB   . THR F 1 75  ? 118.898 151.124 -19.280 1.00 0.00 ? 75  THR F CB   1 
ATOM 11162 O OG1  . THR F 1 75  ? 119.564 150.832 -20.498 1.00 0.00 ? 75  THR F OG1  1 
ATOM 11163 C CG2  . THR F 1 75  ? 118.998 149.920 -18.338 1.00 0.00 ? 75  THR F CG2  1 
ATOM 11164 H H    . THR F 1 75  ? 117.520 153.465 -20.161 1.00 0.00 ? 75  THR F H    1 
ATOM 11165 H HA   . THR F 1 75  ? 116.970 150.549 -20.010 1.00 0.00 ? 75  THR F HA   1 
ATOM 11166 H HB   . THR F 1 75  ? 119.356 151.980 -18.813 1.00 0.00 ? 75  THR F HB   1 
ATOM 11167 H HG1  . THR F 1 75  ? 119.253 151.453 -21.162 1.00 0.00 ? 75  THR F HG1  1 
ATOM 11168 H HG21 . THR F 1 75  ? 120.013 149.550 -18.334 1.00 0.00 ? 75  THR F HG21 1 
ATOM 11169 H HG22 . THR F 1 75  ? 118.332 149.140 -18.676 1.00 0.00 ? 75  THR F HG22 1 
ATOM 11170 H HG23 . THR F 1 75  ? 118.721 150.222 -17.338 1.00 0.00 ? 75  THR F HG23 1 
ATOM 11171 N N    . ALA F 1 76  ? 115.821 150.853 -17.822 1.00 0.00 ? 76  ALA F N    1 
ATOM 11172 C CA   . ALA F 1 76  ? 115.081 151.081 -16.571 1.00 0.00 ? 76  ALA F CA   1 
ATOM 11173 C C    . ALA F 1 76  ? 114.973 149.801 -15.755 1.00 0.00 ? 76  ALA F C    1 
ATOM 11174 O O    . ALA F 1 76  ? 114.739 148.737 -16.295 1.00 0.00 ? 76  ALA F O    1 
ATOM 11175 C CB   . ALA F 1 76  ? 113.685 151.606 -16.885 1.00 0.00 ? 76  ALA F CB   1 
ATOM 11176 H H    . ALA F 1 76  ? 115.655 150.036 -18.338 1.00 0.00 ? 76  ALA F H    1 
ATOM 11177 H HA   . ALA F 1 76  ? 115.596 151.815 -15.986 1.00 0.00 ? 76  ALA F HA   1 
ATOM 11178 H HB1  . ALA F 1 76  ? 113.757 152.602 -17.293 1.00 0.00 ? 76  ALA F HB1  1 
ATOM 11179 H HB2  . ALA F 1 76  ? 113.104 151.631 -15.979 1.00 0.00 ? 76  ALA F HB2  1 
ATOM 11180 H HB3  . ALA F 1 76  ? 113.207 150.956 -17.602 1.00 0.00 ? 76  ALA F HB3  1 
ATOM 11181 N N    . VAL F 1 77  ? 115.138 149.904 -14.434 1.00 0.00 ? 77  VAL F N    1 
ATOM 11182 C CA   . VAL F 1 77  ? 115.044 148.713 -13.573 1.00 0.00 ? 77  VAL F CA   1 
ATOM 11183 C C    . VAL F 1 77  ? 114.310 149.042 -12.273 1.00 0.00 ? 77  VAL F C    1 
ATOM 11184 O O    . VAL F 1 77  ? 114.475 150.126 -11.709 1.00 0.00 ? 77  VAL F O    1 
ATOM 11185 C CB   . VAL F 1 77  ? 116.463 148.181 -13.265 1.00 0.00 ? 77  VAL F CB   1 
ATOM 11186 C CG1  . VAL F 1 77  ? 117.302 148.158 -14.558 1.00 0.00 ? 77  VAL F CG1  1 
ATOM 11187 C CG2  . VAL F 1 77  ? 117.150 149.080 -12.227 1.00 0.00 ? 77  VAL F CG2  1 
ATOM 11188 H H    . VAL F 1 77  ? 115.320 150.779 -14.034 1.00 0.00 ? 77  VAL F H    1 
ATOM 11189 H HA   . VAL F 1 77  ? 114.489 147.938 -14.086 1.00 0.00 ? 77  VAL F HA   1 
ATOM 11190 H HB   . VAL F 1 77  ? 116.386 147.177 -12.872 1.00 0.00 ? 77  VAL F HB   1 
ATOM 11191 H HG11 . VAL F 1 77  ? 118.139 147.489 -14.431 1.00 0.00 ? 77  VAL F HG11 1 
ATOM 11192 H HG12 . VAL F 1 77  ? 117.668 149.153 -14.770 1.00 0.00 ? 77  VAL F HG12 1 
ATOM 11193 H HG13 . VAL F 1 77  ? 116.695 147.821 -15.382 1.00 0.00 ? 77  VAL F HG13 1 
ATOM 11194 H HG21 . VAL F 1 77  ? 116.948 150.105 -12.463 1.00 0.00 ? 77  VAL F HG21 1 
ATOM 11195 H HG22 . VAL F 1 77  ? 118.217 148.910 -12.247 1.00 0.00 ? 77  VAL F HG22 1 
ATOM 11196 H HG23 . VAL F 1 77  ? 116.768 148.854 -11.243 1.00 0.00 ? 77  VAL F HG23 1 
ATOM 11197 N N    . ALA F 1 78  ? 113.509 148.087 -11.793 1.00 0.00 ? 78  ALA F N    1 
ATOM 11198 C CA   . ALA F 1 78  ? 112.754 148.257 -10.543 1.00 0.00 ? 78  ALA F CA   1 
ATOM 11199 C C    . ALA F 1 78  ? 113.247 147.255 -9.508  1.00 0.00 ? 78  ALA F C    1 
ATOM 11200 O O    . ALA F 1 78  ? 113.142 146.051 -9.711  1.00 0.00 ? 78  ALA F O    1 
ATOM 11201 C CB   . ALA F 1 78  ? 111.263 148.030 -10.799 1.00 0.00 ? 78  ALA F CB   1 
ATOM 11202 H H    . ALA F 1 78  ? 113.429 147.241 -12.285 1.00 0.00 ? 78  ALA F H    1 
ATOM 11203 H HA   . ALA F 1 78  ? 112.894 149.261 -10.158 1.00 0.00 ? 78  ALA F HA   1 
ATOM 11204 H HB1  . ALA F 1 78  ? 110.699 148.335 -9.930  1.00 0.00 ? 78  ALA F HB1  1 
ATOM 11205 H HB2  . ALA F 1 78  ? 111.087 146.984 -10.994 1.00 0.00 ? 78  ALA F HB2  1 
ATOM 11206 H HB3  . ALA F 1 78  ? 110.953 148.612 -11.654 1.00 0.00 ? 78  ALA F HB3  1 
ATOM 11207 N N    . GLN F 1 79  ? 113.791 147.765 -8.401  1.00 0.00 ? 79  GLN F N    1 
ATOM 11208 C CA   . GLN F 1 79  ? 114.309 146.911 -7.324  1.00 0.00 ? 79  GLN F CA   1 
ATOM 11209 C C    . GLN F 1 79  ? 113.953 147.527 -5.970  1.00 0.00 ? 79  GLN F C    1 
ATOM 11210 O O    . GLN F 1 79  ? 113.646 148.712 -5.891  1.00 0.00 ? 79  GLN F O    1 
ATOM 11211 C CB   . GLN F 1 79  ? 115.834 146.781 -7.447  1.00 0.00 ? 79  GLN F CB   1 
ATOM 11212 C CG   . GLN F 1 79  ? 116.215 146.550 -8.909  1.00 0.00 ? 79  GLN F CG   1 
ATOM 11213 C CD   . GLN F 1 79  ? 117.715 146.306 -9.026  1.00 0.00 ? 79  GLN F CD   1 
ATOM 11214 O OE1  . GLN F 1 79  ? 118.516 147.158 -8.640  1.00 0.00 ? 79  GLN F OE1  1 
ATOM 11215 N NE2  . GLN F 1 79  ? 118.146 145.185 -9.535  1.00 0.00 ? 79  GLN F NE2  1 
ATOM 11216 H H    . GLN F 1 79  ? 113.850 148.736 -8.303  1.00 0.00 ? 79  GLN F H    1 
ATOM 11217 H HA   . GLN F 1 79  ? 113.865 145.928 -7.389  1.00 0.00 ? 79  GLN F HA   1 
ATOM 11218 H HB2  . GLN F 1 79  ? 116.302 147.683 -7.091  1.00 0.00 ? 79  GLN F HB2  1 
ATOM 11219 H HB3  . GLN F 1 79  ? 116.173 145.945 -6.855  1.00 0.00 ? 79  GLN F HB3  1 
ATOM 11220 H HG2  . GLN F 1 79  ? 115.682 145.697 -9.288  1.00 0.00 ? 79  GLN F HG2  1 
ATOM 11221 H HG3  . GLN F 1 79  ? 115.951 147.421 -9.489  1.00 0.00 ? 79  GLN F HG3  1 
ATOM 11222 H HE21 . GLN F 1 79  ? 117.507 144.507 -9.839  1.00 0.00 ? 79  GLN F HE21 1 
ATOM 11223 H HE22 . GLN F 1 79  ? 119.108 145.021 -9.612  1.00 0.00 ? 79  GLN F HE22 1 
ATOM 11224 N N    . LYS F 1 80  ? 113.996 146.722 -4.901  1.00 0.00 ? 80  LYS F N    1 
ATOM 11225 C CA   . LYS F 1 80  ? 113.678 147.222 -3.547  1.00 0.00 ? 80  LYS F CA   1 
ATOM 11226 C C    . LYS F 1 80  ? 114.923 147.173 -2.670  1.00 0.00 ? 80  LYS F C    1 
ATOM 11227 O O    . LYS F 1 80  ? 115.396 148.201 -2.197  1.00 0.00 ? 80  LYS F O    1 
ATOM 11228 C CB   . LYS F 1 80  ? 112.567 146.378 -2.913  1.00 0.00 ? 80  LYS F CB   1 
ATOM 11229 C CG   . LYS F 1 80  ? 112.004 147.100 -1.684  1.00 0.00 ? 80  LYS F CG   1 
ATOM 11230 C CD   . LYS F 1 80  ? 110.806 146.315 -1.147  1.00 0.00 ? 80  LYS F CD   1 
ATOM 11231 C CE   . LYS F 1 80  ? 110.176 147.068 0.025   1.00 0.00 ? 80  LYS F CE   1 
ATOM 11232 N NZ   . LYS F 1 80  ? 108.979 146.320 0.504   1.00 0.00 ? 80  LYS F NZ   1 
ATOM 11233 H H    . LYS F 1 80  ? 114.247 145.783 -5.017  1.00 0.00 ? 80  LYS F H    1 
ATOM 11234 H HA   . LYS F 1 80  ? 113.341 148.252 -3.606  1.00 0.00 ? 80  LYS F HA   1 
ATOM 11235 H HB2  . LYS F 1 80  ? 111.777 146.224 -3.633  1.00 0.00 ? 80  LYS F HB2  1 
ATOM 11236 H HB3  . LYS F 1 80  ? 112.969 145.426 -2.609  1.00 0.00 ? 80  LYS F HB3  1 
ATOM 11237 H HG2  . LYS F 1 80  ? 112.768 147.163 -0.920  1.00 0.00 ? 80  LYS F HG2  1 
ATOM 11238 H HG3  . LYS F 1 80  ? 111.685 148.094 -1.959  1.00 0.00 ? 80  LYS F HG3  1 
ATOM 11239 H HD2  . LYS F 1 80  ? 110.075 146.195 -1.932  1.00 0.00 ? 80  LYS F HD2  1 
ATOM 11240 H HD3  . LYS F 1 80  ? 111.135 145.344 -0.810  1.00 0.00 ? 80  LYS F HD3  1 
ATOM 11241 H HE2  . LYS F 1 80  ? 110.893 147.153 0.829   1.00 0.00 ? 80  LYS F HE2  1 
ATOM 11242 H HE3  . LYS F 1 80  ? 109.878 148.055 -0.298  1.00 0.00 ? 80  LYS F HE3  1 
ATOM 11243 H HZ1  . LYS F 1 80  ? 108.649 145.678 -0.245  1.00 0.00 ? 80  LYS F HZ1  1 
ATOM 11244 H HZ2  . LYS F 1 80  ? 108.221 146.993 0.742   1.00 0.00 ? 80  LYS F HZ2  1 
ATOM 11245 H HZ3  . LYS F 1 80  ? 109.228 145.767 1.346   1.00 0.00 ? 80  LYS F HZ3  1 
ATOM 11246 N N    . THR F 1 81  ? 115.467 145.969 -2.467  1.00 0.00 ? 81  THR F N    1 
ATOM 11247 C CA   . THR F 1 81  ? 116.676 145.803 -1.639  1.00 0.00 ? 81  THR F CA   1 
ATOM 11248 C C    . THR F 1 81  ? 117.666 144.849 -2.303  1.00 0.00 ? 81  THR F C    1 
ATOM 11249 O O    . THR F 1 81  ? 117.276 143.889 -2.953  1.00 0.00 ? 81  THR F O    1 
ATOM 11250 C CB   . THR F 1 81  ? 116.288 145.255 -0.263  1.00 0.00 ? 81  THR F CB   1 
ATOM 11251 O OG1  . THR F 1 81  ? 117.446 145.170 0.556   1.00 0.00 ? 81  THR F OG1  1 
ATOM 11252 C CG2  . THR F 1 81  ? 115.667 143.866 -0.421  1.00 0.00 ? 81  THR F CG2  1 
ATOM 11253 H H    . THR F 1 81  ? 115.055 145.180 -2.878  1.00 0.00 ? 81  THR F H    1 
ATOM 11254 H HA   . THR F 1 81  ? 117.155 146.760 -1.507  1.00 0.00 ? 81  THR F HA   1 
ATOM 11255 H HB   . THR F 1 81  ? 115.569 145.916 0.197   1.00 0.00 ? 81  THR F HB   1 
ATOM 11256 H HG1  . THR F 1 81  ? 117.957 144.408 0.271   1.00 0.00 ? 81  THR F HG1  1 
ATOM 11257 H HG21 . THR F 1 81  ? 114.948 143.884 -1.227  1.00 0.00 ? 81  THR F HG21 1 
ATOM 11258 H HG22 . THR F 1 81  ? 115.171 143.587 0.496   1.00 0.00 ? 81  THR F HG22 1 
ATOM 11259 H HG23 . THR F 1 81  ? 116.442 143.149 -0.645  1.00 0.00 ? 81  THR F HG23 1 
ATOM 11260 N N    . VAL F 1 82  ? 118.964 145.124 -2.132  1.00 0.00 ? 82  VAL F N    1 
ATOM 11261 C CA   . VAL F 1 82  ? 120.015 144.278 -2.723  1.00 0.00 ? 82  VAL F CA   1 
ATOM 11262 C C    . VAL F 1 82  ? 121.208 144.152 -1.774  1.00 0.00 ? 82  VAL F C    1 
ATOM 11263 O O    . VAL F 1 82  ? 121.565 145.097 -1.079  1.00 0.00 ? 82  VAL F O    1 
ATOM 11264 C CB   . VAL F 1 82  ? 120.463 144.871 -4.076  1.00 0.00 ? 82  VAL F CB   1 
ATOM 11265 C CG1  . VAL F 1 82  ? 120.735 146.369 -3.913  1.00 0.00 ? 82  VAL F CG1  1 
ATOM 11266 C CG2  . VAL F 1 82  ? 121.745 144.164 -4.571  1.00 0.00 ? 82  VAL F CG2  1 
ATOM 11267 H H    . VAL F 1 82  ? 119.220 145.907 -1.600  1.00 0.00 ? 82  VAL F H    1 
ATOM 11268 H HA   . VAL F 1 82  ? 119.616 143.293 -2.897  1.00 0.00 ? 82  VAL F HA   1 
ATOM 11269 H HB   . VAL F 1 82  ? 119.674 144.733 -4.800  1.00 0.00 ? 82  VAL F HB   1 
ATOM 11270 H HG11 . VAL F 1 82  ? 121.289 146.535 -3.006  1.00 0.00 ? 82  VAL F HG11 1 
ATOM 11271 H HG12 . VAL F 1 82  ? 119.797 146.901 -3.863  1.00 0.00 ? 82  VAL F HG12 1 
ATOM 11272 H HG13 . VAL F 1 82  ? 121.306 146.727 -4.758  1.00 0.00 ? 82  VAL F HG13 1 
ATOM 11273 H HG21 . VAL F 1 82  ? 121.688 143.110 -4.345  1.00 0.00 ? 82  VAL F HG21 1 
ATOM 11274 H HG22 . VAL F 1 82  ? 122.610 144.587 -4.078  1.00 0.00 ? 82  VAL F HG22 1 
ATOM 11275 H HG23 . VAL F 1 82  ? 121.839 144.298 -5.639  1.00 0.00 ? 82  VAL F HG23 1 
ATOM 11276 N N    . GLU F 1 83  ? 121.825 142.966 -1.752  1.00 0.00 ? 83  GLU F N    1 
ATOM 11277 C CA   . GLU F 1 83  ? 122.985 142.725 -0.882  1.00 0.00 ? 83  GLU F CA   1 
ATOM 11278 C C    . GLU F 1 83  ? 123.970 141.759 -1.538  1.00 0.00 ? 83  GLU F C    1 
ATOM 11279 O O    . GLU F 1 83  ? 123.574 140.823 -2.223  1.00 0.00 ? 83  GLU F O    1 
ATOM 11280 C CB   . GLU F 1 83  ? 122.517 142.153 0.461   1.00 0.00 ? 83  GLU F CB   1 
ATOM 11281 C CG   . GLU F 1 83  ? 121.787 140.830 0.229   1.00 0.00 ? 83  GLU F CG   1 
ATOM 11282 C CD   . GLU F 1 83  ? 121.224 140.307 1.547   1.00 0.00 ? 83  GLU F CD   1 
ATOM 11283 O OE1  . GLU F 1 83  ? 121.409 140.971 2.553   1.00 0.00 ? 83  GLU F OE1  1 
ATOM 11284 O OE2  . GLU F 1 83  ? 120.616 139.249 1.531   1.00 0.00 ? 83  GLU F OE2  1 
ATOM 11285 H H    . GLU F 1 83  ? 121.499 142.243 -2.330  1.00 0.00 ? 83  GLU F H    1 
ATOM 11286 H HA   . GLU F 1 83  ? 123.491 143.658 -0.699  1.00 0.00 ? 83  GLU F HA   1 
ATOM 11287 H HB2  . GLU F 1 83  ? 123.374 141.985 1.098   1.00 0.00 ? 83  GLU F HB2  1 
ATOM 11288 H HB3  . GLU F 1 83  ? 121.846 142.853 0.936   1.00 0.00 ? 83  GLU F HB3  1 
ATOM 11289 H HG2  . GLU F 1 83  ? 120.978 140.984 -0.470  1.00 0.00 ? 83  GLU F HG2  1 
ATOM 11290 H HG3  . GLU F 1 83  ? 122.477 140.105 -0.176  1.00 0.00 ? 83  GLU F HG3  1 
ATOM 11291 N N    . GLY F 1 84  ? 125.263 141.991 -1.316  1.00 0.00 ? 84  GLY F N    1 
ATOM 11292 C CA   . GLY F 1 84  ? 126.299 141.127 -1.890  1.00 0.00 ? 84  GLY F CA   1 
ATOM 11293 C C    . GLY F 1 84  ? 127.603 141.890 -2.084  1.00 0.00 ? 84  GLY F C    1 
ATOM 11294 O O    . GLY F 1 84  ? 127.619 142.986 -2.641  1.00 0.00 ? 84  GLY F O    1 
ATOM 11295 H H    . GLY F 1 84  ? 125.527 142.753 -0.758  1.00 0.00 ? 84  GLY F H    1 
ATOM 11296 H HA2  . GLY F 1 84  ? 126.472 140.293 -1.226  1.00 0.00 ? 84  GLY F HA2  1 
ATOM 11297 H HA3  . GLY F 1 84  ? 125.967 140.755 -2.849  1.00 0.00 ? 84  GLY F HA3  1 
ATOM 11298 N N    . ALA F 1 85  ? 128.702 141.299 -1.630  1.00 0.00 ? 85  ALA F N    1 
ATOM 11299 C CA   . ALA F 1 85  ? 130.004 141.935 -1.771  1.00 0.00 ? 85  ALA F CA   1 
ATOM 11300 C C    . ALA F 1 85  ? 130.464 141.886 -3.225  1.00 0.00 ? 85  ALA F C    1 
ATOM 11301 O O    . ALA F 1 85  ? 130.484 140.824 -3.843  1.00 0.00 ? 85  ALA F O    1 
ATOM 11302 C CB   . ALA F 1 85  ? 131.027 141.227 -0.883  1.00 0.00 ? 85  ALA F CB   1 
ATOM 11303 H H    . ALA F 1 85  ? 128.636 140.420 -1.201  1.00 0.00 ? 85  ALA F H    1 
ATOM 11304 H HA   . ALA F 1 85  ? 129.926 142.966 -1.460  1.00 0.00 ? 85  ALA F HA   1 
ATOM 11305 H HB1  . ALA F 1 85  ? 131.996 141.686 -1.013  1.00 0.00 ? 85  ALA F HB1  1 
ATOM 11306 H HB2  . ALA F 1 85  ? 131.082 140.184 -1.158  1.00 0.00 ? 85  ALA F HB2  1 
ATOM 11307 H HB3  . ALA F 1 85  ? 130.725 141.310 0.151   1.00 0.00 ? 85  ALA F HB3  1 
ATOM 11308 N N    . GLY F 1 86  ? 130.831 143.043 -3.764  1.00 0.00 ? 86  GLY F N    1 
ATOM 11309 C CA   . GLY F 1 86  ? 131.292 143.118 -5.146  1.00 0.00 ? 86  GLY F CA   1 
ATOM 11310 C C    . GLY F 1 86  ? 130.128 142.954 -6.118  1.00 0.00 ? 86  GLY F C    1 
ATOM 11311 O O    . GLY F 1 86  ? 130.324 142.875 -7.332  1.00 0.00 ? 86  GLY F O    1 
ATOM 11312 H H    . GLY F 1 86  ? 130.796 143.859 -3.223  1.00 0.00 ? 86  GLY F H    1 
ATOM 11313 H HA2  . GLY F 1 86  ? 131.762 144.077 -5.311  1.00 0.00 ? 86  GLY F HA2  1 
ATOM 11314 H HA3  . GLY F 1 86  ? 132.012 142.334 -5.323  1.00 0.00 ? 86  GLY F HA3  1 
ATOM 11315 N N    . SER F 1 87  ? 128.914 142.897 -5.575  1.00 0.00 ? 87  SER F N    1 
ATOM 11316 C CA   . SER F 1 87  ? 127.719 142.737 -6.398  1.00 0.00 ? 87  SER F CA   1 
ATOM 11317 C C    . SER F 1 87  ? 127.291 144.071 -6.996  1.00 0.00 ? 87  SER F C    1 
ATOM 11318 O O    . SER F 1 87  ? 127.563 145.136 -6.434  1.00 0.00 ? 87  SER F O    1 
ATOM 11319 C CB   . SER F 1 87  ? 126.581 142.155 -5.559  1.00 0.00 ? 87  SER F CB   1 
ATOM 11320 O OG   . SER F 1 87  ? 125.395 142.115 -6.343  1.00 0.00 ? 87  SER F OG   1 
ATOM 11321 H H    . SER F 1 87  ? 128.819 142.963 -4.601  1.00 0.00 ? 87  SER F H    1 
ATOM 11322 H HA   . SER F 1 87  ? 127.939 142.050 -7.205  1.00 0.00 ? 87  SER F HA   1 
ATOM 11323 H HB2  . SER F 1 87  ? 126.835 141.155 -5.253  1.00 0.00 ? 87  SER F HB2  1 
ATOM 11324 H HB3  . SER F 1 87  ? 126.429 142.771 -4.684  1.00 0.00 ? 87  SER F HB3  1 
ATOM 11325 H HG   . SER F 1 87  ? 124.931 141.300 -6.136  1.00 0.00 ? 87  SER F HG   1 
ATOM 11326 N N    . ILE F 1 88  ? 126.615 144.010 -8.149  1.00 0.00 ? 88  ILE F N    1 
ATOM 11327 C CA   . ILE F 1 88  ? 126.140 145.223 -8.834  1.00 0.00 ? 88  ILE F CA   1 
ATOM 11328 C C    . ILE F 1 88  ? 124.635 145.119 -9.080  1.00 0.00 ? 88  ILE F C    1 
ATOM 11329 O O    . ILE F 1 88  ? 124.153 144.108 -9.591  1.00 0.00 ? 88  ILE F O    1 
ATOM 11330 C CB   . ILE F 1 88  ? 126.906 145.402 -10.170 1.00 0.00 ? 88  ILE F CB   1 
ATOM 11331 C CG1  . ILE F 1 88  ? 126.375 144.408 -11.227 1.00 0.00 ? 88  ILE F CG1  1 
ATOM 11332 C CG2  . ILE F 1 88  ? 128.413 145.149 -9.942  1.00 0.00 ? 88  ILE F CG2  1 
ATOM 11333 C CD1  . ILE F 1 88  ? 127.290 144.413 -12.458 1.00 0.00 ? 88  ILE F CD1  1 
ATOM 11334 H H    . ILE F 1 88  ? 126.430 143.131 -8.548  1.00 0.00 ? 88  ILE F H    1 
ATOM 11335 H HA   . ILE F 1 88  ? 126.325 146.092 -8.209  1.00 0.00 ? 88  ILE F HA   1 
ATOM 11336 H HB   . ILE F 1 88  ? 126.766 146.413 -10.527 1.00 0.00 ? 88  ILE F HB   1 
ATOM 11337 H HG12 . ILE F 1 88  ? 126.346 143.423 -10.804 1.00 0.00 ? 88  ILE F HG12 1 
ATOM 11338 H HG13 . ILE F 1 88  ? 125.380 144.698 -11.528 1.00 0.00 ? 88  ILE F HG13 1 
ATOM 11339 H HG21 . ILE F 1 88  ? 128.979 145.646 -10.716 1.00 0.00 ? 88  ILE F HG21 1 
ATOM 11340 H HG22 . ILE F 1 88  ? 128.615 144.087 -9.977  1.00 0.00 ? 88  ILE F HG22 1 
ATOM 11341 H HG23 . ILE F 1 88  ? 128.710 145.535 -8.979  1.00 0.00 ? 88  ILE F HG23 1 
ATOM 11342 H HD11 . ILE F 1 88  ? 128.200 143.877 -12.230 1.00 0.00 ? 88  ILE F HD11 1 
ATOM 11343 H HD12 . ILE F 1 88  ? 127.531 145.431 -12.724 1.00 0.00 ? 88  ILE F HD12 1 
ATOM 11344 H HD13 . ILE F 1 88  ? 126.787 143.932 -13.283 1.00 0.00 ? 88  ILE F HD13 1 
ATOM 11345 N N    . ALA F 1 89  ? 123.897 146.165 -8.710  1.00 0.00 ? 89  ALA F N    1 
ATOM 11346 C CA   . ALA F 1 89  ? 122.446 146.165 -8.897  1.00 0.00 ? 89  ALA F CA   1 
ATOM 11347 C C    . ALA F 1 89  ? 122.095 146.608 -10.311 1.00 0.00 ? 89  ALA F C    1 
ATOM 11348 O O    . ALA F 1 89  ? 121.490 145.859 -11.073 1.00 0.00 ? 89  ALA F O    1 
ATOM 11349 C CB   . ALA F 1 89  ? 121.789 147.107 -7.886  1.00 0.00 ? 89  ALA F CB   1 
ATOM 11350 H H    . ALA F 1 89  ? 124.331 146.944 -8.304  1.00 0.00 ? 89  ALA F H    1 
ATOM 11351 H HA   . ALA F 1 89  ? 122.065 145.166 -8.739  1.00 0.00 ? 89  ALA F HA   1 
ATOM 11352 H HB1  . ALA F 1 89  ? 120.730 146.903 -7.839  1.00 0.00 ? 89  ALA F HB1  1 
ATOM 11353 H HB2  . ALA F 1 89  ? 121.945 148.129 -8.193  1.00 0.00 ? 89  ALA F HB2  1 
ATOM 11354 H HB3  . ALA F 1 89  ? 122.230 146.954 -6.913  1.00 0.00 ? 89  ALA F HB3  1 
ATOM 11355 N N    . ALA F 1 90  ? 122.487 147.838 -10.656 1.00 0.00 ? 90  ALA F N    1 
ATOM 11356 C CA   . ALA F 1 90  ? 122.217 148.391 -11.990 1.00 0.00 ? 90  ALA F CA   1 
ATOM 11357 C C    . ALA F 1 90  ? 123.473 149.044 -12.550 1.00 0.00 ? 90  ALA F C    1 
ATOM 11358 O O    . ALA F 1 90  ? 123.983 150.013 -11.987 1.00 0.00 ? 90  ALA F O    1 
ATOM 11359 C CB   . ALA F 1 90  ? 121.093 149.431 -11.899 1.00 0.00 ? 90  ALA F CB   1 
ATOM 11360 H H    . ALA F 1 90  ? 122.968 148.385 -10.003 1.00 0.00 ? 90  ALA F H    1 
ATOM 11361 H HA   . ALA F 1 90  ? 121.907 147.599 -12.662 1.00 0.00 ? 90  ALA F HA   1 
ATOM 11362 H HB1  . ALA F 1 90  ? 121.488 150.363 -11.519 1.00 0.00 ? 90  ALA F HB1  1 
ATOM 11363 H HB2  . ALA F 1 90  ? 120.324 149.070 -11.233 1.00 0.00 ? 90  ALA F HB2  1 
ATOM 11364 H HB3  . ALA F 1 90  ? 120.671 149.592 -12.881 1.00 0.00 ? 90  ALA F HB3  1 
ATOM 11365 N N    . ALA F 1 91  ? 123.972 148.510 -13.669 1.00 0.00 ? 91  ALA F N    1 
ATOM 11366 C CA   . ALA F 1 91  ? 125.179 149.057 -14.304 1.00 0.00 ? 91  ALA F CA   1 
ATOM 11367 C C    . ALA F 1 91  ? 125.081 148.968 -15.824 1.00 0.00 ? 91  ALA F C    1 
ATOM 11368 O O    . ALA F 1 91  ? 124.933 147.885 -16.383 1.00 0.00 ? 91  ALA F O    1 
ATOM 11369 C CB   . ALA F 1 91  ? 126.414 148.286 -13.826 1.00 0.00 ? 91  ALA F CB   1 
ATOM 11370 H H    . ALA F 1 91  ? 123.522 147.739 -14.075 1.00 0.00 ? 91  ALA F H    1 
ATOM 11371 H HA   . ALA F 1 91  ? 125.292 150.093 -14.026 1.00 0.00 ? 91  ALA F HA   1 
ATOM 11372 H HB1  . ALA F 1 91  ? 127.302 148.864 -14.037 1.00 0.00 ? 91  ALA F HB1  1 
ATOM 11373 H HB2  . ALA F 1 91  ? 126.472 147.337 -14.342 1.00 0.00 ? 91  ALA F HB2  1 
ATOM 11374 H HB3  . ALA F 1 91  ? 126.341 148.113 -12.764 1.00 0.00 ? 91  ALA F HB3  1 
ATOM 11375 N N    . THR F 1 92  ? 125.178 150.114 -16.494 1.00 0.00 ? 92  THR F N    1 
ATOM 11376 C CA   . THR F 1 92  ? 125.108 150.143 -17.960 1.00 0.00 ? 92  THR F CA   1 
ATOM 11377 C C    . THR F 1 92  ? 126.512 150.065 -18.551 1.00 0.00 ? 92  THR F C    1 
ATOM 11378 O O    . THR F 1 92  ? 127.270 151.034 -18.502 1.00 0.00 ? 92  THR F O    1 
ATOM 11379 C CB   . THR F 1 92  ? 124.423 151.431 -18.427 1.00 0.00 ? 92  THR F CB   1 
ATOM 11380 O OG1  . THR F 1 92  ? 125.341 152.509 -18.351 1.00 0.00 ? 92  THR F OG1  1 
ATOM 11381 C CG2  . THR F 1 92  ? 123.218 151.719 -17.532 1.00 0.00 ? 92  THR F CG2  1 
ATOM 11382 H H    . THR F 1 92  ? 125.305 150.951 -15.999 1.00 0.00 ? 92  THR F H    1 
ATOM 11383 H HA   . THR F 1 92  ? 124.532 149.297 -18.312 1.00 0.00 ? 92  THR F HA   1 
ATOM 11384 H HB   . THR F 1 92  ? 124.087 151.313 -19.444 1.00 0.00 ? 92  THR F HB   1 
ATOM 11385 H HG1  . THR F 1 92  ? 126.135 152.258 -18.829 1.00 0.00 ? 92  THR F HG1  1 
ATOM 11386 H HG21 . THR F 1 92  ? 122.669 152.560 -17.927 1.00 0.00 ? 92  THR F HG21 1 
ATOM 11387 H HG22 . THR F 1 92  ? 123.559 151.949 -16.533 1.00 0.00 ? 92  THR F HG22 1 
ATOM 11388 H HG23 . THR F 1 92  ? 122.576 150.852 -17.502 1.00 0.00 ? 92  THR F HG23 1 
ATOM 11389 N N    . GLY F 1 93  ? 126.850 148.903 -19.105 1.00 0.00 ? 93  GLY F N    1 
ATOM 11390 C CA   . GLY F 1 93  ? 128.166 148.701 -19.699 1.00 0.00 ? 93  GLY F CA   1 
ATOM 11391 C C    . GLY F 1 93  ? 129.197 148.379 -18.622 1.00 0.00 ? 93  GLY F C    1 
ATOM 11392 O O    . GLY F 1 93  ? 129.791 149.280 -18.032 1.00 0.00 ? 93  GLY F O    1 
ATOM 11393 H H    . GLY F 1 93  ? 126.203 148.168 -19.112 1.00 0.00 ? 93  GLY F H    1 
ATOM 11394 H HA2  . GLY F 1 93  ? 128.117 147.882 -20.403 1.00 0.00 ? 93  GLY F HA2  1 
ATOM 11395 H HA3  . GLY F 1 93  ? 128.467 149.599 -20.217 1.00 0.00 ? 93  GLY F HA3  1 
ATOM 11396 N N    . PHE F 1 94  ? 129.403 147.081 -18.364 1.00 0.00 ? 94  PHE F N    1 
ATOM 11397 C CA   . PHE F 1 94  ? 130.367 146.637 -17.343 1.00 0.00 ? 94  PHE F CA   1 
ATOM 11398 C C    . PHE F 1 94  ? 131.463 145.793 -17.987 1.00 0.00 ? 94  PHE F C    1 
ATOM 11399 O O    . PHE F 1 94  ? 131.188 144.750 -18.578 1.00 0.00 ? 94  PHE F O    1 
ATOM 11400 C CB   . PHE F 1 94  ? 129.642 145.800 -16.283 1.00 0.00 ? 94  PHE F CB   1 
ATOM 11401 C CG   . PHE F 1 94  ? 130.526 145.633 -15.069 1.00 0.00 ? 94  PHE F CG   1 
ATOM 11402 C CD1  . PHE F 1 94  ? 131.523 144.652 -15.057 1.00 0.00 ? 94  PHE F CD1  1 
ATOM 11403 C CD2  . PHE F 1 94  ? 130.350 146.467 -13.957 1.00 0.00 ? 94  PHE F CD2  1 
ATOM 11404 C CE1  . PHE F 1 94  ? 132.345 144.503 -13.932 1.00 0.00 ? 94  PHE F CE1  1 
ATOM 11405 C CE2  . PHE F 1 94  ? 131.169 146.318 -12.833 1.00 0.00 ? 94  PHE F CE2  1 
ATOM 11406 C CZ   . PHE F 1 94  ? 132.167 145.336 -12.820 1.00 0.00 ? 94  PHE F CZ   1 
ATOM 11407 H H    . PHE F 1 94  ? 128.896 146.409 -18.865 1.00 0.00 ? 94  PHE F H    1 
ATOM 11408 H HA   . PHE F 1 94  ? 130.819 147.497 -16.862 1.00 0.00 ? 94  PHE F HA   1 
ATOM 11409 H HB2  . PHE F 1 94  ? 128.727 146.297 -15.996 1.00 0.00 ? 94  PHE F HB2  1 
ATOM 11410 H HB3  . PHE F 1 94  ? 129.408 144.828 -16.692 1.00 0.00 ? 94  PHE F HB3  1 
ATOM 11411 H HD1  . PHE F 1 94  ? 131.661 144.011 -15.915 1.00 0.00 ? 94  PHE F HD1  1 
ATOM 11412 H HD2  . PHE F 1 94  ? 129.580 147.224 -13.967 1.00 0.00 ? 94  PHE F HD2  1 
ATOM 11413 H HE1  . PHE F 1 94  ? 133.115 143.747 -13.923 1.00 0.00 ? 94  PHE F HE1  1 
ATOM 11414 H HE2  . PHE F 1 94  ? 131.034 146.961 -11.976 1.00 0.00 ? 94  PHE F HE2  1 
ATOM 11415 H HZ   . PHE F 1 94  ? 132.801 145.221 -11.954 1.00 0.00 ? 94  PHE F HZ   1 
ATOM 11416 N N    . VAL F 1 95  ? 132.713 146.246 -17.865 1.00 0.00 ? 95  VAL F N    1 
ATOM 11417 C CA   . VAL F 1 95  ? 133.853 145.514 -18.442 1.00 0.00 ? 95  VAL F CA   1 
ATOM 11418 C C    . VAL F 1 95  ? 135.067 145.583 -17.509 1.00 0.00 ? 95  VAL F C    1 
ATOM 11419 O O    . VAL F 1 95  ? 135.537 146.661 -17.152 1.00 0.00 ? 95  VAL F O    1 
ATOM 11420 C CB   . VAL F 1 95  ? 134.196 146.101 -19.829 1.00 0.00 ? 95  VAL F CB   1 
ATOM 11421 C CG1  . VAL F 1 95  ? 134.228 147.628 -19.749 1.00 0.00 ? 95  VAL F CG1  1 
ATOM 11422 C CG2  . VAL F 1 95  ? 135.569 145.580 -20.305 1.00 0.00 ? 95  VAL F CG2  1 
ATOM 11423 H H    . VAL F 1 95  ? 132.876 147.083 -17.380 1.00 0.00 ? 95  VAL F H    1 
ATOM 11424 H HA   . VAL F 1 95  ? 133.582 144.474 -18.568 1.00 0.00 ? 95  VAL F HA   1 
ATOM 11425 H HB   . VAL F 1 95  ? 133.436 145.804 -20.537 1.00 0.00 ? 95  VAL F HB   1 
ATOM 11426 H HG11 . VAL F 1 95  ? 134.963 147.934 -19.028 1.00 0.00 ? 95  VAL F HG11 1 
ATOM 11427 H HG12 . VAL F 1 95  ? 133.257 147.993 -19.451 1.00 0.00 ? 95  VAL F HG12 1 
ATOM 11428 H HG13 . VAL F 1 95  ? 134.482 148.031 -20.715 1.00 0.00 ? 95  VAL F HG13 1 
ATOM 11429 H HG21 . VAL F 1 95  ? 135.666 144.536 -20.050 1.00 0.00 ? 95  VAL F HG21 1 
ATOM 11430 H HG22 . VAL F 1 95  ? 136.358 146.140 -19.822 1.00 0.00 ? 95  VAL F HG22 1 
ATOM 11431 H HG23 . VAL F 1 95  ? 135.649 145.698 -21.376 1.00 0.00 ? 95  VAL F HG23 1 
ATOM 11432 N N    . LYS F 1 96  ? 135.578 144.409 -17.121 1.00 0.00 ? 96  LYS F N    1 
ATOM 11433 C CA   . LYS F 1 96  ? 136.747 144.330 -16.230 1.00 0.00 ? 96  LYS F CA   1 
ATOM 11434 C C    . LYS F 1 96  ? 137.852 143.502 -16.881 1.00 0.00 ? 96  LYS F C    1 
ATOM 11435 O O    . LYS F 1 96  ? 137.638 142.345 -17.242 1.00 0.00 ? 96  LYS F O    1 
ATOM 11436 C CB   . LYS F 1 96  ? 136.343 143.683 -14.899 1.00 0.00 ? 96  LYS F CB   1 
ATOM 11437 C CG   . LYS F 1 96  ? 137.539 143.699 -13.941 1.00 0.00 ? 96  LYS F CG   1 
ATOM 11438 C CD   . LYS F 1 96  ? 137.124 143.118 -12.587 1.00 0.00 ? 96  LYS F CD   1 
ATOM 11439 C CE   . LYS F 1 96  ? 138.322 143.150 -11.634 1.00 0.00 ? 96  LYS F CE   1 
ATOM 11440 N NZ   . LYS F 1 96  ? 137.920 142.613 -10.303 1.00 0.00 ? 96  LYS F NZ   1 
ATOM 11441 H H    . LYS F 1 96  ? 135.162 143.580 -17.441 1.00 0.00 ? 96  LYS F H    1 
ATOM 11442 H HA   . LYS F 1 96  ? 137.129 145.325 -16.030 1.00 0.00 ? 96  LYS F HA   1 
ATOM 11443 H HB2  . LYS F 1 96  ? 135.524 144.235 -14.463 1.00 0.00 ? 96  LYS F HB2  1 
ATOM 11444 H HB3  . LYS F 1 96  ? 136.039 142.662 -15.074 1.00 0.00 ? 96  LYS F HB3  1 
ATOM 11445 H HG2  . LYS F 1 96  ? 138.340 143.103 -14.355 1.00 0.00 ? 96  LYS F HG2  1 
ATOM 11446 H HG3  . LYS F 1 96  ? 137.877 144.714 -13.805 1.00 0.00 ? 96  LYS F HG3  1 
ATOM 11447 H HD2  . LYS F 1 96  ? 136.316 143.707 -12.175 1.00 0.00 ? 96  LYS F HD2  1 
ATOM 11448 H HD3  . LYS F 1 96  ? 136.797 142.098 -12.717 1.00 0.00 ? 96  LYS F HD3  1 
ATOM 11449 H HE2  . LYS F 1 96  ? 139.119 142.546 -12.040 1.00 0.00 ? 96  LYS F HE2  1 
ATOM 11450 H HE3  . LYS F 1 96  ? 138.664 144.169 -11.522 1.00 0.00 ? 96  LYS F HE3  1 
ATOM 11451 H HZ1  . LYS F 1 96  ? 137.093 143.136 -9.952  1.00 0.00 ? 96  LYS F HZ1  1 
ATOM 11452 H HZ2  . LYS F 1 96  ? 138.710 142.723 -9.632  1.00 0.00 ? 96  LYS F HZ2  1 
ATOM 11453 H HZ3  . LYS F 1 96  ? 137.678 141.606 -10.393 1.00 0.00 ? 96  LYS F HZ3  1 
ATOM 11454 N N    . LYS F 1 97  ? 139.043 144.097 -17.013 1.00 0.00 ? 97  LYS F N    1 
ATOM 11455 C CA   . LYS F 1 97  ? 140.196 143.398 -17.610 1.00 0.00 ? 97  LYS F CA   1 
ATOM 11456 C C    . LYS F 1 97  ? 141.257 143.153 -16.547 1.00 0.00 ? 97  LYS F C    1 
ATOM 11457 O O    . LYS F 1 97  ? 141.720 144.087 -15.891 1.00 0.00 ? 97  LYS F O    1 
ATOM 11458 C CB   . LYS F 1 97  ? 140.795 144.235 -18.745 1.00 0.00 ? 97  LYS F CB   1 
ATOM 11459 C CG   . LYS F 1 97  ? 139.754 144.397 -19.859 1.00 0.00 ? 97  LYS F CG   1 
ATOM 11460 C CD   . LYS F 1 97  ? 140.423 144.916 -21.143 1.00 0.00 ? 97  LYS F CD   1 
ATOM 11461 C CE   . LYS F 1 97  ? 140.931 146.346 -20.937 1.00 0.00 ? 97  LYS F CE   1 
ATOM 11462 N NZ   . LYS F 1 97  ? 141.357 146.914 -22.249 1.00 0.00 ? 97  LYS F NZ   1 
ATOM 11463 H H    . LYS F 1 97  ? 139.155 145.018 -16.696 1.00 0.00 ? 97  LYS F H    1 
ATOM 11464 H HA   . LYS F 1 97  ? 139.880 142.441 -18.013 1.00 0.00 ? 97  LYS F HA   1 
ATOM 11465 H HB2  . LYS F 1 97  ? 141.068 145.207 -18.361 1.00 0.00 ? 97  LYS F HB2  1 
ATOM 11466 H HB3  . LYS F 1 97  ? 141.671 143.740 -19.139 1.00 0.00 ? 97  LYS F HB3  1 
ATOM 11467 H HG2  . LYS F 1 97  ? 139.293 143.440 -20.059 1.00 0.00 ? 97  LYS F HG2  1 
ATOM 11468 H HG3  . LYS F 1 97  ? 138.998 145.100 -19.542 1.00 0.00 ? 97  LYS F HG3  1 
ATOM 11469 H HD2  . LYS F 1 97  ? 141.252 144.274 -21.398 1.00 0.00 ? 97  LYS F HD2  1 
ATOM 11470 H HD3  . LYS F 1 97  ? 139.704 144.907 -21.948 1.00 0.00 ? 97  LYS F HD3  1 
ATOM 11471 H HE2  . LYS F 1 97  ? 140.144 146.954 -20.519 1.00 0.00 ? 97  LYS F HE2  1 
ATOM 11472 H HE3  . LYS F 1 97  ? 141.774 146.335 -20.266 1.00 0.00 ? 97  LYS F HE3  1 
ATOM 11473 H HZ1  . LYS F 1 97  ? 140.528 147.015 -22.869 1.00 0.00 ? 97  LYS F HZ1  1 
ATOM 11474 H HZ2  . LYS F 1 97  ? 142.048 146.275 -22.695 1.00 0.00 ? 97  LYS F HZ2  1 
ATOM 11475 H HZ3  . LYS F 1 97  ? 141.790 147.845 -22.099 1.00 0.00 ? 97  LYS F HZ3  1 
ATOM 11476 N N    . ASP F 1 98  ? 141.634 141.890 -16.381 1.00 0.00 ? 98  ASP F N    1 
ATOM 11477 C CA   . ASP F 1 98  ? 142.635 141.526 -15.391 1.00 0.00 ? 98  ASP F CA   1 
ATOM 11478 C C    . ASP F 1 98  ? 142.185 141.967 -14.001 1.00 0.00 ? 98  ASP F C    1 
ATOM 11479 O O    . ASP F 1 98  ? 141.210 142.705 -13.860 1.00 0.00 ? 98  ASP F O    1 
ATOM 11480 C CB   . ASP F 1 98  ? 143.980 142.185 -15.736 1.00 0.00 ? 98  ASP F CB   1 
ATOM 11481 C CG   . ASP F 1 98  ? 145.125 141.466 -15.022 1.00 0.00 ? 98  ASP F CG   1 
ATOM 11482 O OD1  . ASP F 1 98  ? 145.035 140.261 -14.861 1.00 0.00 ? 98  ASP F OD1  1 
ATOM 11483 O OD2  . ASP F 1 98  ? 146.075 142.133 -14.647 1.00 0.00 ? 98  ASP F OD2  1 
ATOM 11484 H H    . ASP F 1 98  ? 141.226 141.191 -16.931 1.00 0.00 ? 98  ASP F H    1 
ATOM 11485 H HA   . ASP F 1 98  ? 142.756 140.453 -15.396 1.00 0.00 ? 98  ASP F HA   1 
ATOM 11486 H HB2  . ASP F 1 98  ? 144.137 142.135 -16.801 1.00 0.00 ? 98  ASP F HB2  1 
ATOM 11487 H HB3  . ASP F 1 98  ? 143.963 143.222 -15.427 1.00 0.00 ? 98  ASP F HB3  1 
ATOM 11488 N N    . GLN F 1 99  ? 142.903 141.514 -12.979 1.00 0.00 ? 99  GLN F N    1 
ATOM 11489 C CA   . GLN F 1 99  ? 142.576 141.869 -11.597 1.00 0.00 ? 99  GLN F CA   1 
ATOM 11490 C C    . GLN F 1 99  ? 143.843 141.886 -10.752 1.00 0.00 ? 99  GLN F C    1 
ATOM 11491 O O    . GLN F 1 99  ? 144.776 141.123 -11.002 1.00 0.00 ? 99  GLN F O    1 
ATOM 11492 C CB   . GLN F 1 99  ? 141.578 140.860 -11.019 1.00 0.00 ? 99  GLN F CB   1 
ATOM 11493 C CG   . GLN F 1 99  ? 142.229 139.475 -10.952 1.00 0.00 ? 99  GLN F CG   1 
ATOM 11494 C CD   . GLN F 1 99  ? 141.186 138.421 -10.592 1.00 0.00 ? 99  GLN F CD   1 
ATOM 11495 O OE1  . GLN F 1 99  ? 140.510 138.537 -9.570  1.00 0.00 ? 99  GLN F OE1  1 
ATOM 11496 N NE2  . GLN F 1 99  ? 141.015 137.392 -11.378 1.00 0.00 ? 99  GLN F NE2  1 
ATOM 11497 H H    . GLN F 1 99  ? 143.672 140.931 -13.154 1.00 0.00 ? 99  GLN F H    1 
ATOM 11498 H HA   . GLN F 1 99  ? 142.130 142.855 -11.576 1.00 0.00 ? 99  GLN F HA   1 
ATOM 11499 H HB2  . GLN F 1 99  ? 141.286 141.170 -10.026 1.00 0.00 ? 99  GLN F HB2  1 
ATOM 11500 H HB3  . GLN F 1 99  ? 140.705 140.814 -11.654 1.00 0.00 ? 99  GLN F HB3  1 
ATOM 11501 H HG2  . GLN F 1 99  ? 142.665 139.236 -11.910 1.00 0.00 ? 99  GLN F HG2  1 
ATOM 11502 H HG3  . GLN F 1 99  ? 143.002 139.479 -10.198 1.00 0.00 ? 99  GLN F HG3  1 
ATOM 11503 H HE21 . GLN F 1 99  ? 141.555 137.301 -12.191 1.00 0.00 ? 99  GLN F HE21 1 
ATOM 11504 H HE22 . GLN F 1 99  ? 140.347 136.710 -11.155 1.00 0.00 ? 99  GLN F HE22 1 
ATOM 11505 N N    . LEU F 1 100 ? 143.875 142.759 -9.752  1.00 0.00 ? 100 LEU F N    1 
ATOM 11506 C CA   . LEU F 1 100 ? 145.042 142.860 -8.882  1.00 0.00 ? 100 LEU F CA   1 
ATOM 11507 C C    . LEU F 1 100 ? 145.117 141.643 -7.960  1.00 0.00 ? 100 LEU F C    1 
ATOM 11508 O O    . LEU F 1 100 ? 146.089 140.888 -7.987  1.00 0.00 ? 100 LEU F O    1 
ATOM 11509 C CB   . LEU F 1 100 ? 144.962 144.156 -8.046  1.00 0.00 ? 100 LEU F CB   1 
ATOM 11510 C CG   . LEU F 1 100 ? 146.367 144.608 -7.614  1.00 0.00 ? 100 LEU F CG   1 
ATOM 11511 C CD1  . LEU F 1 100 ? 146.251 145.908 -6.813  1.00 0.00 ? 100 LEU F CD1  1 
ATOM 11512 C CD2  . LEU F 1 100 ? 147.026 143.524 -6.745  1.00 0.00 ? 100 LEU F CD2  1 
ATOM 11513 H H    . LEU F 1 100 ? 143.105 143.346 -9.597  1.00 0.00 ? 100 LEU F H    1 
ATOM 11514 H HA   . LEU F 1 100 ? 145.930 142.888 -9.497  1.00 0.00 ? 100 LEU F HA   1 
ATOM 11515 H HB2  . LEU F 1 100 ? 144.509 144.934 -8.644  1.00 0.00 ? 100 LEU F HB2  1 
ATOM 11516 H HB3  . LEU F 1 100 ? 144.354 143.987 -7.168  1.00 0.00 ? 100 LEU F HB3  1 
ATOM 11517 H HG   . LEU F 1 100 ? 146.972 144.784 -8.493  1.00 0.00 ? 100 LEU F HG   1 
ATOM 11518 H HD11 . LEU F 1 100 ? 147.229 146.211 -6.472  1.00 0.00 ? 100 LEU F HD11 1 
ATOM 11519 H HD12 . LEU F 1 100 ? 145.605 145.749 -5.961  1.00 0.00 ? 100 LEU F HD12 1 
ATOM 11520 H HD13 . LEU F 1 100 ? 145.832 146.682 -7.441  1.00 0.00 ? 100 LEU F HD13 1 
ATOM 11521 H HD21 . LEU F 1 100 ? 147.843 143.955 -6.182  1.00 0.00 ? 100 LEU F HD21 1 
ATOM 11522 H HD22 . LEU F 1 100 ? 147.408 142.738 -7.379  1.00 0.00 ? 100 LEU F HD22 1 
ATOM 11523 H HD23 . LEU F 1 100 ? 146.297 143.112 -6.062  1.00 0.00 ? 100 LEU F HD23 1 
ATOM 11524 N N    . GLY F 1 101 ? 144.076 141.461 -7.145  1.00 0.00 ? 101 GLY F N    1 
ATOM 11525 C CA   . GLY F 1 101 ? 144.014 140.335 -6.205  1.00 0.00 ? 101 GLY F CA   1 
ATOM 11526 C C    . GLY F 1 101 ? 143.452 140.787 -4.863  1.00 0.00 ? 101 GLY F C    1 
ATOM 11527 O O    . GLY F 1 101 ? 142.861 141.861 -4.756  1.00 0.00 ? 101 GLY F O    1 
ATOM 11528 H H    . GLY F 1 101 ? 143.332 142.098 -7.173  1.00 0.00 ? 101 GLY F H    1 
ATOM 11529 H HA2  . GLY F 1 101 ? 143.376 139.566 -6.616  1.00 0.00 ? 101 GLY F HA2  1 
ATOM 11530 H HA3  . GLY F 1 101 ? 145.007 139.928 -6.050  1.00 0.00 ? 101 GLY F HA3  1 
ATOM 11531 N N    . LYS F 1 102 ? 143.645 139.956 -3.837  1.00 0.00 ? 102 LYS F N    1 
ATOM 11532 C CA   . LYS F 1 102 ? 143.160 140.270 -2.487  1.00 0.00 ? 102 LYS F CA   1 
ATOM 11533 C C    . LYS F 1 102 ? 144.167 139.796 -1.443  1.00 0.00 ? 102 LYS F C    1 
ATOM 11534 O O    . LYS F 1 102 ? 144.655 138.668 -1.503  1.00 0.00 ? 102 LYS F O    1 
ATOM 11535 C CB   . LYS F 1 102 ? 141.804 139.589 -2.247  1.00 0.00 ? 102 LYS F CB   1 
ATOM 11536 C CG   . LYS F 1 102 ? 141.839 138.155 -2.799  1.00 0.00 ? 102 LYS F CG   1 
ATOM 11537 C CD   . LYS F 1 102 ? 140.698 137.325 -2.191  1.00 0.00 ? 102 LYS F CD   1 
ATOM 11538 C CE   . LYS F 1 102 ? 139.343 137.944 -2.555  1.00 0.00 ? 102 LYS F CE   1 
ATOM 11539 N NZ   . LYS F 1 102 ? 139.273 138.165 -4.028  1.00 0.00 ? 102 LYS F NZ   1 
ATOM 11540 H H    . LYS F 1 102 ? 144.126 139.116 -3.987  1.00 0.00 ? 102 LYS F H    1 
ATOM 11541 H HA   . LYS F 1 102 ? 143.035 141.341 -2.385  1.00 0.00 ? 102 LYS F HA   1 
ATOM 11542 H HB2  . LYS F 1 102 ? 141.591 139.565 -1.186  1.00 0.00 ? 102 LYS F HB2  1 
ATOM 11543 H HB3  . LYS F 1 102 ? 141.034 140.149 -2.756  1.00 0.00 ? 102 LYS F HB3  1 
ATOM 11544 H HG2  . LYS F 1 102 ? 141.727 138.183 -3.874  1.00 0.00 ? 102 LYS F HG2  1 
ATOM 11545 H HG3  . LYS F 1 102 ? 142.784 137.695 -2.550  1.00 0.00 ? 102 LYS F HG3  1 
ATOM 11546 H HD2  . LYS F 1 102 ? 140.745 136.316 -2.574  1.00 0.00 ? 102 LYS F HD2  1 
ATOM 11547 H HD3  . LYS F 1 102 ? 140.804 137.306 -1.117  1.00 0.00 ? 102 LYS F HD3  1 
ATOM 11548 H HE2  . LYS F 1 102 ? 138.552 137.270 -2.259  1.00 0.00 ? 102 LYS F HE2  1 
ATOM 11549 H HE3  . LYS F 1 102 ? 139.222 138.883 -2.041  1.00 0.00 ? 102 LYS F HE3  1 
ATOM 11550 H HZ1  . LYS F 1 102 ? 139.506 139.155 -4.242  1.00 0.00 ? 102 LYS F HZ1  1 
ATOM 11551 H HZ2  . LYS F 1 102 ? 138.312 137.953 -4.366  1.00 0.00 ? 102 LYS F HZ2  1 
ATOM 11552 H HZ3  . LYS F 1 102 ? 139.954 137.542 -4.506  1.00 0.00 ? 102 LYS F HZ3  1 
ATOM 11553 N N    . ASN F 1 103 ? 144.473 140.670 -0.482  1.00 0.00 ? 103 ASN F N    1 
ATOM 11554 C CA   . ASN F 1 103 ? 145.425 140.342 0.586   1.00 0.00 ? 103 ASN F CA   1 
ATOM 11555 C C    . ASN F 1 103 ? 144.942 140.912 1.914   1.00 0.00 ? 103 ASN F C    1 
ATOM 11556 O O    . ASN F 1 103 ? 144.644 142.102 2.019   1.00 0.00 ? 103 ASN F O    1 
ATOM 11557 C CB   . ASN F 1 103 ? 146.801 140.918 0.249   1.00 0.00 ? 103 ASN F CB   1 
ATOM 11558 C CG   . ASN F 1 103 ? 147.251 140.425 -1.123  1.00 0.00 ? 103 ASN F CG   1 
ATOM 11559 O OD1  . ASN F 1 103 ? 147.510 141.230 -2.019  1.00 0.00 ? 103 ASN F OD1  1 
ATOM 11560 N ND2  . ASN F 1 103 ? 147.359 139.143 -1.345  1.00 0.00 ? 103 ASN F ND2  1 
ATOM 11561 H H    . ASN F 1 103 ? 144.049 141.553 -0.489  1.00 0.00 ? 103 ASN F H    1 
ATOM 11562 H HA   . ASN F 1 103 ? 145.510 139.266 0.680   1.00 0.00 ? 103 ASN F HA   1 
ATOM 11563 H HB2  . ASN F 1 103 ? 146.746 141.997 0.242   1.00 0.00 ? 103 ASN F HB2  1 
ATOM 11564 H HB3  . ASN F 1 103 ? 147.515 140.600 0.994   1.00 0.00 ? 103 ASN F HB3  1 
ATOM 11565 H HD21 . ASN F 1 103 ? 147.151 138.504 -0.631  1.00 0.00 ? 103 ASN F HD21 1 
ATOM 11566 H HD22 . ASN F 1 103 ? 147.648 138.820 -2.223  1.00 0.00 ? 103 ASN F HD22 1 
ATOM 11567 N N    . GLU F 1 104 ? 144.871 140.055 2.930   1.00 0.00 ? 104 GLU F N    1 
ATOM 11568 C CA   . GLU F 1 104 ? 144.425 140.480 4.257   1.00 0.00 ? 104 GLU F CA   1 
ATOM 11569 C C    . GLU F 1 104 ? 145.593 141.049 5.051   1.00 0.00 ? 104 GLU F C    1 
ATOM 11570 O O    . GLU F 1 104 ? 145.436 141.445 6.206   1.00 0.00 ? 104 GLU F O    1 
ATOM 11571 C CB   . GLU F 1 104 ? 143.815 139.296 5.009   1.00 0.00 ? 104 GLU F CB   1 
ATOM 11572 C CG   . GLU F 1 104 ? 142.603 138.771 4.235   1.00 0.00 ? 104 GLU F CG   1 
ATOM 11573 C CD   . GLU F 1 104 ? 141.488 139.814 4.246   1.00 0.00 ? 104 GLU F CD   1 
ATOM 11574 O OE1  . GLU F 1 104 ? 141.526 140.685 5.099   1.00 0.00 ? 104 GLU F OE1  1 
ATOM 11575 O OE2  . GLU F 1 104 ? 140.615 139.727 3.399   1.00 0.00 ? 104 GLU F OE2  1 
ATOM 11576 H H    . GLU F 1 104 ? 145.124 139.119 2.786   1.00 0.00 ? 104 GLU F H    1 
ATOM 11577 H HA   . GLU F 1 104 ? 143.670 141.247 4.148   1.00 0.00 ? 104 GLU F HA   1 
ATOM 11578 H HB2  . GLU F 1 104 ? 144.551 138.510 5.102   1.00 0.00 ? 104 GLU F HB2  1 
ATOM 11579 H HB3  . GLU F 1 104 ? 143.502 139.614 5.991   1.00 0.00 ? 104 GLU F HB3  1 
ATOM 11580 H HG2  . GLU F 1 104 ? 142.892 138.566 3.215   1.00 0.00 ? 104 GLU F HG2  1 
ATOM 11581 H HG3  . GLU F 1 104 ? 142.247 137.863 4.697   1.00 0.00 ? 104 GLU F HG3  1 
ATOM 11582 N N    . GLU F 1 105 ? 146.765 141.090 4.420   1.00 0.00 ? 105 GLU F N    1 
ATOM 11583 C CA   . GLU F 1 105 ? 147.957 141.616 5.074   1.00 0.00 ? 105 GLU F CA   1 
ATOM 11584 C C    . GLU F 1 105 ? 148.237 140.852 6.363   1.00 0.00 ? 105 GLU F C    1 
ATOM 11585 O O    . GLU F 1 105 ? 148.301 141.437 7.445   1.00 0.00 ? 105 GLU F O    1 
ATOM 11586 C CB   . GLU F 1 105 ? 147.774 143.105 5.381   1.00 0.00 ? 105 GLU F CB   1 
ATOM 11587 C CG   . GLU F 1 105 ? 147.457 143.857 4.085   1.00 0.00 ? 105 GLU F CG   1 
ATOM 11588 C CD   . GLU F 1 105 ? 148.641 143.768 3.128   1.00 0.00 ? 105 GLU F CD   1 
ATOM 11589 O OE1  . GLU F 1 105 ? 149.740 143.525 3.598   1.00 0.00 ? 105 GLU F OE1  1 
ATOM 11590 O OE2  . GLU F 1 105 ? 148.429 143.943 1.939   1.00 0.00 ? 105 GLU F OE2  1 
ATOM 11591 H H    . GLU F 1 105 ? 146.826 140.761 3.499   1.00 0.00 ? 105 GLU F H    1 
ATOM 11592 H HA   . GLU F 1 105 ? 148.800 141.499 4.410   1.00 0.00 ? 105 GLU F HA   1 
ATOM 11593 H HB2  . GLU F 1 105 ? 146.960 143.233 6.080   1.00 0.00 ? 105 GLU F HB2  1 
ATOM 11594 H HB3  . GLU F 1 105 ? 148.682 143.499 5.809   1.00 0.00 ? 105 GLU F HB3  1 
ATOM 11595 H HG2  . GLU F 1 105 ? 146.585 143.419 3.621   1.00 0.00 ? 105 GLU F HG2  1 
ATOM 11596 H HG3  . GLU F 1 105 ? 147.259 144.894 4.312   1.00 0.00 ? 105 GLU F HG3  1 
ATOM 11597 N N    . GLY F 1 106 ? 148.397 139.539 6.237   1.00 0.00 ? 106 GLY F N    1 
ATOM 11598 C CA   . GLY F 1 106 ? 148.662 138.688 7.392   1.00 0.00 ? 106 GLY F CA   1 
ATOM 11599 C C    . GLY F 1 106 ? 149.947 139.105 8.102   1.00 0.00 ? 106 GLY F C    1 
ATOM 11600 O O    . GLY F 1 106 ? 150.019 139.087 9.331   1.00 0.00 ? 106 GLY F O    1 
ATOM 11601 H H    . GLY F 1 106 ? 148.329 139.131 5.347   1.00 0.00 ? 106 GLY F H    1 
ATOM 11602 H HA2  . GLY F 1 106 ? 147.833 1