data_2N10
# 
_entry.id   2N10 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
RCSB104285   RCSB  
2N10         PDB   
25542        BMRB  
D_1000104285 WWPDB 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
25542 BMRB unspecified . 
2N0Z  PDB  unspecified . 
2N11  PDB  unspecified . 
2N12  PDB  unspecified . 
2N13  PDB  unspecified . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2N10 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-20 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, F.'       1 
'Ehlinger, A.' 2 
'Walters, K.'  3 
# 
_citation.id                        primary 
_citation.title                     'Myosin VI Contains a Compact Structural Motif that Binds to Ubiquitin Chains.' 
_citation.journal_abbrev            'Cell Rep' 
_citation.journal_volume            14 
_citation.page_first                2683 
_citation.page_last                 2694 
_citation.year                      2016 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2211-1247 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26971995 
_citation.pdbx_database_id_DOI      10.1016/j.celrep.2016.01.079 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'He, F.'           1  
primary 'Wollscheid, H.P.' 2  
primary 'Nowicka, U.'      3  
primary 'Biancospino, M.'  4  
primary 'Valentini, E.'    5  
primary 'Ehlinger, A.'     6  
primary 'Acconcia, F.'     7  
primary 'Magistrati, E.'   8  
primary 'Polo, S.'         9  
primary 'Walters, K.J.'    10 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Unconventional myosin-VI' 
_entity.formula_weight             7055.110 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'residues 1080-1131' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Unconventional myosin-6' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GPLGSPNSGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKR 
_entity_poly.pdbx_seq_one_letter_code_can   GPLGSPNSGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKR 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  PRO n 
1 7  ASN n 
1 8  SER n 
1 9  GLY n 
1 10 THR n 
1 11 LYS n 
1 12 LYS n 
1 13 TYR n 
1 14 ASP n 
1 15 LEU n 
1 16 SER n 
1 17 LYS n 
1 18 TRP n 
1 19 LYS n 
1 20 TYR n 
1 21 ALA n 
1 22 GLU n 
1 23 LEU n 
1 24 ARG n 
1 25 ASP n 
1 26 THR n 
1 27 ILE n 
1 28 ASN n 
1 29 THR n 
1 30 SER n 
1 31 CYS n 
1 32 ASP n 
1 33 ILE n 
1 34 GLU n 
1 35 LEU n 
1 36 LEU n 
1 37 ALA n 
1 38 ALA n 
1 39 CYS n 
1 40 ARG n 
1 41 GLU n 
1 42 GLU n 
1 43 PHE n 
1 44 HIS n 
1 45 ARG n 
1 46 ARG n 
1 47 LEU n 
1 48 LYS n 
1 49 VAL n 
1 50 TYR n 
1 51 HIS n 
1 52 ALA n 
1 53 TRP n 
1 54 LYS n 
1 55 SER n 
1 56 LYS n 
1 57 ASN n 
1 58 LYS n 
1 59 LYS n 
1 60 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MYO6, KIAA0389' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pGEX6p 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MYO6_HUMAN 
_struct_ref.pdbx_db_accession          Q9UM54 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   GTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKR 
_struct_ref.pdbx_align_begin           1080 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2N10 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 9 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 60 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UM54 
_struct_ref_seq.db_align_beg                  1080 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1131 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       9 
_struct_ref_seq.pdbx_auth_seq_align_end       60 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2N10 GLY A 1 ? UNP Q9UM54 ? ? 'EXPRESSION TAG' 1 1 
1 2N10 PRO A 2 ? UNP Q9UM54 ? ? 'EXPRESSION TAG' 2 2 
1 2N10 LEU A 3 ? UNP Q9UM54 ? ? 'EXPRESSION TAG' 3 3 
1 2N10 GLY A 4 ? UNP Q9UM54 ? ? 'EXPRESSION TAG' 4 4 
1 2N10 SER A 5 ? UNP Q9UM54 ? ? 'EXPRESSION TAG' 5 5 
1 2N10 PRO A 6 ? UNP Q9UM54 ? ? 'EXPRESSION TAG' 6 6 
1 2N10 ASN A 7 ? UNP Q9UM54 ? ? 'EXPRESSION TAG' 7 7 
1 2N10 SER A 8 ? UNP Q9UM54 ? ? 'EXPRESSION TAG' 8 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D 1H-15N NOESY'           
1 2 1 '3D 1H-13C NOESY aliphatic' 
1 3 1 '3D 1H-13C NOESY aromatic'  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      50 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         283 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '0.7 mM [U-13C; U-15N] protein, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    900 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             UNITY 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Varian Unity' 
# 
_pdbx_nmr_refine.entry_id           2N10 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2N10 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2N10 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe    ? 1 
'Naohiro Kobayashi'                                 'chemical shift assignment' Kujira     ? 2 
'Guntert, Mumenthaler and Wuthrich'                 'structure solution'        CYANA      ? 3 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  X-PLOR_NIH ? 4 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2N10 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2N10 
_struct.title                     'Solution structure of MyUb (1080-1131) of human Myosin VI' 
_struct.pdbx_descriptor           'Unconventional myosin-VI' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2N10 
_struct_keywords.pdbx_keywords   'MOTOR PROTEIN,PROTEIN TRANSPORT' 
_struct_keywords.text            'MOTOR PROTEIN, PROTEIN TRANSPORT' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 19 ? SER A 30 ? LYS A 19 SER A 30 1 ? 12 
HELX_P HELX_P2 2 ASP A 32 ? SER A 55 ? ASP A 32 SER A 55 1 ? 24 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2N10 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
Q 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 9  ? 13.492  12.370  11.122  1.00 0.00 ? 9  GLY A N    1  
ATOM 2     C CA   . GLY A 1 9  ? 13.563  12.044  9.700   1.00 0.00 ? 9  GLY A CA   1  
ATOM 3     C C    . GLY A 1 9  ? 12.584  10.932  9.344   1.00 0.00 ? 9  GLY A C    1  
ATOM 4     O O    . GLY A 1 9  ? 11.655  10.643  10.098  1.00 0.00 ? 9  GLY A O    1  
ATOM 5     H H    . GLY A 1 9  ? 12.685  12.142  11.628  1.00 0.00 ? 9  GLY A H    1  
ATOM 6     H HA2  . GLY A 1 9  ? 13.325  12.926  9.123   1.00 0.00 ? 9  GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 9  ? 14.565  11.723  9.459   1.00 0.00 ? 9  GLY A HA3  1  
ATOM 8     N N    . THR A 1 10 ? 12.800  10.310  8.188   1.00 0.00 ? 10 THR A N    1  
ATOM 9     C CA   . THR A 1 10 ? 11.933  9.230   7.739   1.00 0.00 ? 10 THR A CA   1  
ATOM 10    C C    . THR A 1 10 ? 12.231  7.949   8.514   1.00 0.00 ? 10 THR A C    1  
ATOM 11    O O    . THR A 1 10 ? 13.371  7.698   8.905   1.00 0.00 ? 10 THR A O    1  
ATOM 12    C CB   . THR A 1 10 ? 12.142  8.991   6.240   1.00 0.00 ? 10 THR A CB   1  
ATOM 13    O OG1  . THR A 1 10 ? 13.496  9.254   5.905   1.00 0.00 ? 10 THR A OG1  1  
ATOM 14    C CG2  . THR A 1 10 ? 11.228  9.921   5.437   1.00 0.00 ? 10 THR A CG2  1  
ATOM 15    H H    . THR A 1 10 ? 13.555  10.581  7.629   1.00 0.00 ? 10 THR A H    1  
ATOM 16    H HA   . THR A 1 10 ? 10.905  9.511   7.910   1.00 0.00 ? 10 THR A HA   1  
ATOM 17    H HB   . THR A 1 10 ? 11.905  7.968   6.000   1.00 0.00 ? 10 THR A HB   1  
ATOM 18    H HG1  . THR A 1 10 ? 13.523  9.561   4.995   1.00 0.00 ? 10 THR A HG1  1  
ATOM 19    H HG21 . THR A 1 10 ? 11.397  9.768   4.382   1.00 0.00 ? 10 THR A HG21 1  
ATOM 20    H HG22 . THR A 1 10 ? 11.445  10.948  5.691   1.00 0.00 ? 10 THR A HG22 1  
ATOM 21    H HG23 . THR A 1 10 ? 10.197  9.702   5.672   1.00 0.00 ? 10 THR A HG23 1  
ATOM 22    N N    . LYS A 1 11 ? 11.196  7.142   8.731   1.00 0.00 ? 11 LYS A N    1  
ATOM 23    C CA   . LYS A 1 11 ? 11.355  5.890   9.462   1.00 0.00 ? 11 LYS A CA   1  
ATOM 24    C C    . LYS A 1 11 ? 11.817  4.777   8.527   1.00 0.00 ? 11 LYS A C    1  
ATOM 25    O O    . LYS A 1 11 ? 12.300  5.038   7.426   1.00 0.00 ? 11 LYS A O    1  
ATOM 26    C CB   . LYS A 1 11 ? 10.026  5.495   10.111  1.00 0.00 ? 11 LYS A CB   1  
ATOM 27    C CG   . LYS A 1 11 ? 9.396   6.724   10.768  1.00 0.00 ? 11 LYS A CG   1  
ATOM 28    C CD   . LYS A 1 11 ? 8.087   6.323   11.452  1.00 0.00 ? 11 LYS A CD   1  
ATOM 29    C CE   . LYS A 1 11 ? 7.277   7.579   11.777  1.00 0.00 ? 11 LYS A CE   1  
ATOM 30    N NZ   . LYS A 1 11 ? 6.117   7.213   12.639  1.00 0.00 ? 11 LYS A NZ   1  
ATOM 31    H H    . LYS A 1 11 ? 10.311  7.397   8.397   1.00 0.00 ? 11 LYS A H    1  
ATOM 32    H HA   . LYS A 1 11 ? 12.094  6.026   10.237  1.00 0.00 ? 11 LYS A HA   1  
ATOM 33    H HB2  . LYS A 1 11 ? 9.360   5.106   9.357   1.00 0.00 ? 11 LYS A HB2  1  
ATOM 34    H HB3  . LYS A 1 11 ? 10.203  4.740   10.861  1.00 0.00 ? 11 LYS A HB3  1  
ATOM 35    H HG2  . LYS A 1 11 ? 10.077  7.130   11.501  1.00 0.00 ? 11 LYS A HG2  1  
ATOM 36    H HG3  . LYS A 1 11 ? 9.191   7.470   10.014  1.00 0.00 ? 11 LYS A HG3  1  
ATOM 37    H HD2  . LYS A 1 11 ? 7.517   5.686   10.792  1.00 0.00 ? 11 LYS A HD2  1  
ATOM 38    H HD3  . LYS A 1 11 ? 8.307   5.793   12.366  1.00 0.00 ? 11 LYS A HD3  1  
ATOM 39    H HE2  . LYS A 1 11 ? 7.904   8.288   12.299  1.00 0.00 ? 11 LYS A HE2  1  
ATOM 40    H HE3  . LYS A 1 11 ? 6.916   8.023   10.861  1.00 0.00 ? 11 LYS A HE3  1  
ATOM 41    H HZ1  . LYS A 1 11 ? 5.232   7.472   12.160  1.00 0.00 ? 11 LYS A HZ1  1  
ATOM 42    H HZ2  . LYS A 1 11 ? 6.182   7.724   13.543  1.00 0.00 ? 11 LYS A HZ2  1  
ATOM 43    H HZ3  . LYS A 1 11 ? 6.129   6.188   12.818  1.00 0.00 ? 11 LYS A HZ3  1  
ATOM 44    N N    . LYS A 1 12 ? 11.665  3.534   8.976   1.00 0.00 ? 12 LYS A N    1  
ATOM 45    C CA   . LYS A 1 12 ? 12.070  2.388   8.171   1.00 0.00 ? 12 LYS A CA   1  
ATOM 46    C C    . LYS A 1 12 ? 11.549  2.528   6.744   1.00 0.00 ? 12 LYS A C    1  
ATOM 47    O O    . LYS A 1 12 ? 12.324  2.722   5.807   1.00 0.00 ? 12 LYS A O    1  
ATOM 48    C CB   . LYS A 1 12 ? 11.526  1.095   8.790   1.00 0.00 ? 12 LYS A CB   1  
ATOM 49    C CG   . LYS A 1 12 ? 12.043  0.947   10.229  1.00 0.00 ? 12 LYS A CG   1  
ATOM 50    C CD   . LYS A 1 12 ? 13.412  0.249   10.230  1.00 0.00 ? 12 LYS A CD   1  
ATOM 51    C CE   . LYS A 1 12 ? 13.259  -1.221  9.819   1.00 0.00 ? 12 LYS A CE   1  
ATOM 52    N NZ   . LYS A 1 12 ? 14.263  -2.045  10.548  1.00 0.00 ? 12 LYS A NZ   1  
ATOM 53    H H    . LYS A 1 12 ? 11.273  3.387   9.862   1.00 0.00 ? 12 LYS A H    1  
ATOM 54    H HA   . LYS A 1 12 ? 13.147  2.338   8.147   1.00 0.00 ? 12 LYS A HA   1  
ATOM 55    H HB2  . LYS A 1 12 ? 10.447  1.130   8.798   1.00 0.00 ? 12 LYS A HB2  1  
ATOM 56    H HB3  . LYS A 1 12 ? 11.852  0.252   8.201   1.00 0.00 ? 12 LYS A HB3  1  
ATOM 57    H HG2  . LYS A 1 12 ? 12.140  1.925   10.679  1.00 0.00 ? 12 LYS A HG2  1  
ATOM 58    H HG3  . LYS A 1 12 ? 11.343  0.360   10.802  1.00 0.00 ? 12 LYS A HG3  1  
ATOM 59    H HD2  . LYS A 1 12 ? 14.070  0.750   9.534   1.00 0.00 ? 12 LYS A HD2  1  
ATOM 60    H HD3  . LYS A 1 12 ? 13.836  0.298   11.221  1.00 0.00 ? 12 LYS A HD3  1  
ATOM 61    H HE2  . LYS A 1 12 ? 12.265  -1.570  10.063  1.00 0.00 ? 12 LYS A HE2  1  
ATOM 62    H HE3  . LYS A 1 12 ? 13.421  -1.318  8.756   1.00 0.00 ? 12 LYS A HE3  1  
ATOM 63    H HZ1  . LYS A 1 12 ? 14.525  -2.869  9.969   1.00 0.00 ? 12 LYS A HZ1  1  
ATOM 64    H HZ2  . LYS A 1 12 ? 13.857  -2.373  11.447  1.00 0.00 ? 12 LYS A HZ2  1  
ATOM 65    H HZ3  . LYS A 1 12 ? 15.110  -1.471  10.738  1.00 0.00 ? 12 LYS A HZ3  1  
ATOM 66    N N    . TYR A 1 13 ? 10.231  2.428   6.588   1.00 0.00 ? 13 TYR A N    1  
ATOM 67    C CA   . TYR A 1 13 ? 9.608   2.546   5.270   1.00 0.00 ? 13 TYR A CA   1  
ATOM 68    C C    . TYR A 1 13 ? 8.489   3.581   5.304   1.00 0.00 ? 13 TYR A C    1  
ATOM 69    O O    . TYR A 1 13 ? 7.856   3.794   6.338   1.00 0.00 ? 13 TYR A O    1  
ATOM 70    C CB   . TYR A 1 13 ? 9.043   1.187   4.834   1.00 0.00 ? 13 TYR A CB   1  
ATOM 71    C CG   . TYR A 1 13 ? 10.104  0.406   4.094   1.00 0.00 ? 13 TYR A CG   1  
ATOM 72    C CD1  . TYR A 1 13 ? 11.230  -0.070  4.778   1.00 0.00 ? 13 TYR A CD1  1  
ATOM 73    C CD2  . TYR A 1 13 ? 9.964   0.162   2.723   1.00 0.00 ? 13 TYR A CD2  1  
ATOM 74    C CE1  . TYR A 1 13 ? 12.214  -0.789  4.089   1.00 0.00 ? 13 TYR A CE1  1  
ATOM 75    C CE2  . TYR A 1 13 ? 10.947  -0.558  2.034   1.00 0.00 ? 13 TYR A CE2  1  
ATOM 76    C CZ   . TYR A 1 13 ? 12.073  -1.034  2.718   1.00 0.00 ? 13 TYR A CZ   1  
ATOM 77    O OH   . TYR A 1 13 ? 13.044  -1.742  2.040   1.00 0.00 ? 13 TYR A OH   1  
ATOM 78    H H    . TYR A 1 13 ? 9.664   2.274   7.372   1.00 0.00 ? 13 TYR A H    1  
ATOM 79    H HA   . TYR A 1 13 ? 10.352  2.863   4.552   1.00 0.00 ? 13 TYR A HA   1  
ATOM 80    H HB2  . TYR A 1 13 ? 8.731   0.632   5.707   1.00 0.00 ? 13 TYR A HB2  1  
ATOM 81    H HB3  . TYR A 1 13 ? 8.193   1.341   4.184   1.00 0.00 ? 13 TYR A HB3  1  
ATOM 82    H HD1  . TYR A 1 13 ? 11.338  0.116   5.835   1.00 0.00 ? 13 TYR A HD1  1  
ATOM 83    H HD2  . TYR A 1 13 ? 9.096   0.529   2.194   1.00 0.00 ? 13 TYR A HD2  1  
ATOM 84    H HE1  . TYR A 1 13 ? 13.083  -1.157  4.616   1.00 0.00 ? 13 TYR A HE1  1  
ATOM 85    H HE2  . TYR A 1 13 ? 10.838  -0.746  0.978   1.00 0.00 ? 13 TYR A HE2  1  
ATOM 86    H HH   . TYR A 1 13 ? 13.896  -1.512  2.416   1.00 0.00 ? 13 TYR A HH   1  
ATOM 87    N N    . ASP A 1 14 ? 8.250   4.222   4.163   1.00 0.00 ? 14 ASP A N    1  
ATOM 88    C CA   . ASP A 1 14 ? 7.205   5.235   4.067   1.00 0.00 ? 14 ASP A CA   1  
ATOM 89    C C    . ASP A 1 14 ? 6.620   5.261   2.659   1.00 0.00 ? 14 ASP A C    1  
ATOM 90    O O    . ASP A 1 14 ? 7.282   5.687   1.711   1.00 0.00 ? 14 ASP A O    1  
ATOM 91    C CB   . ASP A 1 14 ? 7.777   6.611   4.411   1.00 0.00 ? 14 ASP A CB   1  
ATOM 92    C CG   . ASP A 1 14 ? 6.644   7.614   4.604   1.00 0.00 ? 14 ASP A CG   1  
ATOM 93    O OD1  . ASP A 1 14 ? 5.763   7.336   5.401   1.00 0.00 ? 14 ASP A OD1  1  
ATOM 94    O OD2  . ASP A 1 14 ? 6.675   8.644   3.953   1.00 0.00 ? 14 ASP A OD2  1  
ATOM 95    H H    . ASP A 1 14 ? 8.787   4.009   3.373   1.00 0.00 ? 14 ASP A H    1  
ATOM 96    H HA   . ASP A 1 14 ? 6.418   4.999   4.768   1.00 0.00 ? 14 ASP A HA   1  
ATOM 97    H HB2  . ASP A 1 14 ? 8.354   6.541   5.322   1.00 0.00 ? 14 ASP A HB2  1  
ATOM 98    H HB3  . ASP A 1 14 ? 8.416   6.945   3.607   1.00 0.00 ? 14 ASP A HB3  1  
ATOM 99    N N    . LEU A 1 15 ? 5.378   4.804   2.529   1.00 0.00 ? 15 LEU A N    1  
ATOM 100   C CA   . LEU A 1 15 ? 4.708   4.778   1.231   1.00 0.00 ? 15 LEU A CA   1  
ATOM 101   C C    . LEU A 1 15 ? 3.406   5.570   1.288   1.00 0.00 ? 15 LEU A C    1  
ATOM 102   O O    . LEU A 1 15 ? 2.329   5.030   1.037   1.00 0.00 ? 15 LEU A O    1  
ATOM 103   C CB   . LEU A 1 15 ? 4.399   3.332   0.821   1.00 0.00 ? 15 LEU A CB   1  
ATOM 104   C CG   . LEU A 1 15 ? 5.619   2.438   1.068   1.00 0.00 ? 15 LEU A CG   1  
ATOM 105   C CD1  . LEU A 1 15 ? 5.197   0.970   0.982   1.00 0.00 ? 15 LEU A CD1  1  
ATOM 106   C CD2  . LEU A 1 15 ? 6.689   2.718   0.009   1.00 0.00 ? 15 LEU A CD2  1  
ATOM 107   H H    . LEU A 1 15 ? 4.902   4.479   3.322   1.00 0.00 ? 15 LEU A H    1  
ATOM 108   H HA   . LEU A 1 15 ? 5.353   5.221   0.487   1.00 0.00 ? 15 LEU A HA   1  
ATOM 109   H HB2  . LEU A 1 15 ? 3.565   2.967   1.402   1.00 0.00 ? 15 LEU A HB2  1  
ATOM 110   H HB3  . LEU A 1 15 ? 4.144   3.304   -0.228  1.00 0.00 ? 15 LEU A HB3  1  
ATOM 111   H HG   . LEU A 1 15 ? 6.023   2.637   2.051   1.00 0.00 ? 15 LEU A HG   1  
ATOM 112   H HD11 . LEU A 1 15 ? 6.073   0.339   1.038   1.00 0.00 ? 15 LEU A HD11 1  
ATOM 113   H HD12 . LEU A 1 15 ? 4.688   0.797   0.045   1.00 0.00 ? 15 LEU A HD12 1  
ATOM 114   H HD13 . LEU A 1 15 ? 4.534   0.739   1.800   1.00 0.00 ? 15 LEU A HD13 1  
ATOM 115   H HD21 . LEU A 1 15 ? 7.491   2.002   0.110   1.00 0.00 ? 15 LEU A HD21 1  
ATOM 116   H HD22 . LEU A 1 15 ? 7.078   3.716   0.143   1.00 0.00 ? 15 LEU A HD22 1  
ATOM 117   H HD23 . LEU A 1 15 ? 6.252   2.630   -0.975  1.00 0.00 ? 15 LEU A HD23 1  
ATOM 118   N N    . SER A 1 16 ? 3.510   6.856   1.620   1.00 0.00 ? 16 SER A N    1  
ATOM 119   C CA   . SER A 1 16 ? 2.330   7.713   1.703   1.00 0.00 ? 16 SER A CA   1  
ATOM 120   C C    . SER A 1 16 ? 1.353   7.383   0.580   1.00 0.00 ? 16 SER A C    1  
ATOM 121   O O    . SER A 1 16 ? 0.165   7.165   0.818   1.00 0.00 ? 16 SER A O    1  
ATOM 122   C CB   . SER A 1 16 ? 2.744   9.182   1.607   1.00 0.00 ? 16 SER A CB   1  
ATOM 123   O OG   . SER A 1 16 ? 1.656   9.944   1.102   1.00 0.00 ? 16 SER A OG   1  
ATOM 124   H H    . SER A 1 16 ? 4.395   7.234   1.808   1.00 0.00 ? 16 SER A H    1  
ATOM 125   H HA   . SER A 1 16 ? 1.842   7.548   2.653   1.00 0.00 ? 16 SER A HA   1  
ATOM 126   H HB2  . SER A 1 16 ? 3.010   9.550   2.585   1.00 0.00 ? 16 SER A HB2  1  
ATOM 127   H HB3  . SER A 1 16 ? 3.597   9.272   0.948   1.00 0.00 ? 16 SER A HB3  1  
ATOM 128   H HG   . SER A 1 16 ? 1.441   10.621  1.748   1.00 0.00 ? 16 SER A HG   1  
ATOM 129   N N    . LYS A 1 17 ? 1.869   7.332   -0.644  1.00 0.00 ? 17 LYS A N    1  
ATOM 130   C CA   . LYS A 1 17 ? 1.045   7.010   -1.800  1.00 0.00 ? 17 LYS A CA   1  
ATOM 131   C C    . LYS A 1 17 ? 1.935   6.643   -2.982  1.00 0.00 ? 17 LYS A C    1  
ATOM 132   O O    . LYS A 1 17 ? 2.853   7.385   -3.333  1.00 0.00 ? 17 LYS A O    1  
ATOM 133   C CB   . LYS A 1 17 ? 0.162   8.208   -2.163  1.00 0.00 ? 17 LYS A CB   1  
ATOM 134   C CG   . LYS A 1 17 ? -0.601  7.927   -3.462  1.00 0.00 ? 17 LYS A CG   1  
ATOM 135   C CD   . LYS A 1 17 ? -1.387  6.618   -3.332  1.00 0.00 ? 17 LYS A CD   1  
ATOM 136   C CE   . LYS A 1 17 ? -2.533  6.603   -4.344  1.00 0.00 ? 17 LYS A CE   1  
ATOM 137   N NZ   . LYS A 1 17 ? -3.207  5.274   -4.313  1.00 0.00 ? 17 LYS A NZ   1  
ATOM 138   H H    . LYS A 1 17 ? 2.826   7.501   -0.770  1.00 0.00 ? 17 LYS A H    1  
ATOM 139   H HA   . LYS A 1 17 ? 0.416   6.167   -1.558  1.00 0.00 ? 17 LYS A HA   1  
ATOM 140   H HB2  . LYS A 1 17 ? -0.543  8.387   -1.364  1.00 0.00 ? 17 LYS A HB2  1  
ATOM 141   H HB3  . LYS A 1 17 ? 0.782   9.083   -2.294  1.00 0.00 ? 17 LYS A HB3  1  
ATOM 142   H HG2  . LYS A 1 17 ? -1.285  8.740   -3.655  1.00 0.00 ? 17 LYS A HG2  1  
ATOM 143   H HG3  . LYS A 1 17 ? 0.097   7.845   -4.281  1.00 0.00 ? 17 LYS A HG3  1  
ATOM 144   H HD2  . LYS A 1 17 ? -0.728  5.783   -3.524  1.00 0.00 ? 17 LYS A HD2  1  
ATOM 145   H HD3  . LYS A 1 17 ? -1.791  6.536   -2.333  1.00 0.00 ? 17 LYS A HD3  1  
ATOM 146   H HE2  . LYS A 1 17 ? -3.246  7.375   -4.093  1.00 0.00 ? 17 LYS A HE2  1  
ATOM 147   H HE3  . LYS A 1 17 ? -2.142  6.785   -5.334  1.00 0.00 ? 17 LYS A HE3  1  
ATOM 148   H HZ1  . LYS A 1 17 ? -3.005  4.804   -3.409  1.00 0.00 ? 17 LYS A HZ1  1  
ATOM 149   H HZ2  . LYS A 1 17 ? -2.852  4.686   -5.093  1.00 0.00 ? 17 LYS A HZ2  1  
ATOM 150   H HZ3  . LYS A 1 17 ? -4.235  5.405   -4.417  1.00 0.00 ? 17 LYS A HZ3  1  
ATOM 151   N N    . TRP A 1 18 ? 1.657   5.494   -3.590  1.00 0.00 ? 18 TRP A N    1  
ATOM 152   C CA   . TRP A 1 18 ? 2.438   5.024   -4.733  1.00 0.00 ? 18 TRP A CA   1  
ATOM 153   C C    . TRP A 1 18 ? 1.526   4.830   -5.944  1.00 0.00 ? 18 TRP A C    1  
ATOM 154   O O    . TRP A 1 18 ? 0.303   4.791   -5.810  1.00 0.00 ? 18 TRP A O    1  
ATOM 155   C CB   . TRP A 1 18 ? 3.113   3.689   -4.381  1.00 0.00 ? 18 TRP A CB   1  
ATOM 156   C CG   . TRP A 1 18 ? 4.502   3.916   -3.859  1.00 0.00 ? 18 TRP A CG   1  
ATOM 157   C CD1  . TRP A 1 18 ? 4.883   4.939   -3.059  1.00 0.00 ? 18 TRP A CD1  1  
ATOM 158   C CD2  . TRP A 1 18 ? 5.695   3.110   -4.085  1.00 0.00 ? 18 TRP A CD2  1  
ATOM 159   N NE1  . TRP A 1 18 ? 6.232   4.814   -2.783  1.00 0.00 ? 18 TRP A NE1  1  
ATOM 160   C CE2  . TRP A 1 18 ? 6.778   3.703   -3.393  1.00 0.00 ? 18 TRP A CE2  1  
ATOM 161   C CE3  . TRP A 1 18 ? 5.942   1.937   -4.817  1.00 0.00 ? 18 TRP A CE3  1  
ATOM 162   C CZ2  . TRP A 1 18 ? 8.059   3.149   -3.427  1.00 0.00 ? 18 TRP A CZ2  1  
ATOM 163   C CZ3  . TRP A 1 18 ? 7.228   1.377   -4.853  1.00 0.00 ? 18 TRP A CZ3  1  
ATOM 164   C CH2  . TRP A 1 18 ? 8.285   1.982   -4.159  1.00 0.00 ? 18 TRP A CH2  1  
ATOM 165   H H    . TRP A 1 18 ? 0.913   4.948   -3.261  1.00 0.00 ? 18 TRP A H    1  
ATOM 166   H HA   . TRP A 1 18 ? 3.196   5.753   -4.976  1.00 0.00 ? 18 TRP A HA   1  
ATOM 167   H HB2  . TRP A 1 18 ? 2.530   3.187   -3.623  1.00 0.00 ? 18 TRP A HB2  1  
ATOM 168   H HB3  . TRP A 1 18 ? 3.162   3.066   -5.263  1.00 0.00 ? 18 TRP A HB3  1  
ATOM 169   H HD1  . TRP A 1 18 ? 4.242   5.722   -2.693  1.00 0.00 ? 18 TRP A HD1  1  
ATOM 170   H HE1  . TRP A 1 18 ? 6.754   5.427   -2.225  1.00 0.00 ? 18 TRP A HE1  1  
ATOM 171   H HE3  . TRP A 1 18 ? 5.136   1.461   -5.354  1.00 0.00 ? 18 TRP A HE3  1  
ATOM 172   H HZ2  . TRP A 1 18 ? 8.869   3.620   -2.889  1.00 0.00 ? 18 TRP A HZ2  1  
ATOM 173   H HZ3  . TRP A 1 18 ? 7.403   0.475   -5.418  1.00 0.00 ? 18 TRP A HZ3  1  
ATOM 174   H HH2  . TRP A 1 18 ? 9.272   1.547   -4.192  1.00 0.00 ? 18 TRP A HH2  1  
ATOM 175   N N    . LYS A 1 19 ? 2.129   4.699   -7.123  1.00 0.00 ? 19 LYS A N    1  
ATOM 176   C CA   . LYS A 1 19 ? 1.357   4.501   -8.348  1.00 0.00 ? 19 LYS A CA   1  
ATOM 177   C C    . LYS A 1 19 ? 1.306   3.017   -8.705  1.00 0.00 ? 19 LYS A C    1  
ATOM 178   O O    . LYS A 1 19 ? 2.085   2.216   -8.187  1.00 0.00 ? 19 LYS A O    1  
ATOM 179   C CB   . LYS A 1 19 ? 1.982   5.293   -9.503  1.00 0.00 ? 19 LYS A CB   1  
ATOM 180   C CG   . LYS A 1 19 ? 2.555   6.610   -8.976  1.00 0.00 ? 19 LYS A CG   1  
ATOM 181   C CD   . LYS A 1 19 ? 1.442   7.425   -8.315  1.00 0.00 ? 19 LYS A CD   1  
ATOM 182   C CE   . LYS A 1 19 ? 1.920   8.864   -8.103  1.00 0.00 ? 19 LYS A CE   1  
ATOM 183   N NZ   . LYS A 1 19 ? 3.349   8.854   -7.684  1.00 0.00 ? 19 LYS A NZ   1  
ATOM 184   H H    . LYS A 1 19 ? 3.106   4.732   -7.170  1.00 0.00 ? 19 LYS A H    1  
ATOM 185   H HA   . LYS A 1 19 ? 0.348   4.855   -8.189  1.00 0.00 ? 19 LYS A HA   1  
ATOM 186   H HB2  . LYS A 1 19 ? 2.773   4.711   -9.954  1.00 0.00 ? 19 LYS A HB2  1  
ATOM 187   H HB3  . LYS A 1 19 ? 1.226   5.502   -10.244 1.00 0.00 ? 19 LYS A HB3  1  
ATOM 188   H HG2  . LYS A 1 19 ? 3.330   6.402   -8.253  1.00 0.00 ? 19 LYS A HG2  1  
ATOM 189   H HG3  . LYS A 1 19 ? 2.971   7.174   -9.798  1.00 0.00 ? 19 LYS A HG3  1  
ATOM 190   H HD2  . LYS A 1 19 ? 0.569   7.426   -8.951  1.00 0.00 ? 19 LYS A HD2  1  
ATOM 191   H HD3  . LYS A 1 19 ? 1.193   6.986   -7.361  1.00 0.00 ? 19 LYS A HD3  1  
ATOM 192   H HE2  . LYS A 1 19 ? 1.819   9.417   -9.024  1.00 0.00 ? 19 LYS A HE2  1  
ATOM 193   H HE3  . LYS A 1 19 ? 1.322   9.332   -7.335  1.00 0.00 ? 19 LYS A HE3  1  
ATOM 194   H HZ1  . LYS A 1 19 ? 3.905   8.287   -8.354  1.00 0.00 ? 19 LYS A HZ1  1  
ATOM 195   H HZ2  . LYS A 1 19 ? 3.431   8.439   -6.734  1.00 0.00 ? 19 LYS A HZ2  1  
ATOM 196   H HZ3  . LYS A 1 19 ? 3.712   9.830   -7.668  1.00 0.00 ? 19 LYS A HZ3  1  
ATOM 197   N N    . TYR A 1 20 ? 0.384   2.655   -9.591  1.00 0.00 ? 20 TYR A N    1  
ATOM 198   C CA   . TYR A 1 20 ? 0.242   1.264   -10.004 1.00 0.00 ? 20 TYR A CA   1  
ATOM 199   C C    . TYR A 1 20 ? 1.470   0.810   -10.791 1.00 0.00 ? 20 TYR A C    1  
ATOM 200   O O    . TYR A 1 20 ? 1.964   -0.303  -10.607 1.00 0.00 ? 20 TYR A O    1  
ATOM 201   C CB   . TYR A 1 20 ? -1.015  1.098   -10.871 1.00 0.00 ? 20 TYR A CB   1  
ATOM 202   C CG   . TYR A 1 20 ? -2.014  2.178   -10.526 1.00 0.00 ? 20 TYR A CG   1  
ATOM 203   C CD1  . TYR A 1 20 ? -1.914  3.439   -11.125 1.00 0.00 ? 20 TYR A CD1  1  
ATOM 204   C CD2  . TYR A 1 20 ? -3.041  1.917   -9.611  1.00 0.00 ? 20 TYR A CD2  1  
ATOM 205   C CE1  . TYR A 1 20 ? -2.840  4.440   -10.809 1.00 0.00 ? 20 TYR A CE1  1  
ATOM 206   C CE2  . TYR A 1 20 ? -3.967  2.918   -9.294  1.00 0.00 ? 20 TYR A CE2  1  
ATOM 207   C CZ   . TYR A 1 20 ? -3.867  4.179   -9.893  1.00 0.00 ? 20 TYR A CZ   1  
ATOM 208   O OH   . TYR A 1 20 ? -4.779  5.166   -9.581  1.00 0.00 ? 20 TYR A OH   1  
ATOM 209   H H    . TYR A 1 20 ? -0.212  3.335   -9.969  1.00 0.00 ? 20 TYR A H    1  
ATOM 210   H HA   . TYR A 1 20 ? 0.142   0.646   -9.125  1.00 0.00 ? 20 TYR A HA   1  
ATOM 211   H HB2  . TYR A 1 20 ? -0.749  1.178   -11.915 1.00 0.00 ? 20 TYR A HB2  1  
ATOM 212   H HB3  . TYR A 1 20 ? -1.457  0.129   -10.685 1.00 0.00 ? 20 TYR A HB3  1  
ATOM 213   H HD1  . TYR A 1 20 ? -1.122  3.640   -11.833 1.00 0.00 ? 20 TYR A HD1  1  
ATOM 214   H HD2  . TYR A 1 20 ? -3.118  0.943   -9.150  1.00 0.00 ? 20 TYR A HD2  1  
ATOM 215   H HE1  . TYR A 1 20 ? -2.762  5.414   -11.271 1.00 0.00 ? 20 TYR A HE1  1  
ATOM 216   H HE2  . TYR A 1 20 ? -4.759  2.717   -8.589  1.00 0.00 ? 20 TYR A HE2  1  
ATOM 217   H HH   . TYR A 1 20 ? -4.512  5.972   -10.032 1.00 0.00 ? 20 TYR A HH   1  
ATOM 218   N N    . ALA A 1 21 ? 1.951   1.681   -11.671 1.00 0.00 ? 21 ALA A N    1  
ATOM 219   C CA   . ALA A 1 21 ? 3.114   1.368   -12.492 1.00 0.00 ? 21 ALA A CA   1  
ATOM 220   C C    . ALA A 1 21 ? 4.321   1.011   -11.626 1.00 0.00 ? 21 ALA A C    1  
ATOM 221   O O    . ALA A 1 21 ? 4.909   -0.060  -11.780 1.00 0.00 ? 21 ALA A O    1  
ATOM 222   C CB   . ALA A 1 21 ? 3.460   2.567   -13.378 1.00 0.00 ? 21 ALA A CB   1  
ATOM 223   H H    . ALA A 1 21 ? 1.510   2.550   -11.775 1.00 0.00 ? 21 ALA A H    1  
ATOM 224   H HA   . ALA A 1 21 ? 2.879   0.527   -13.125 1.00 0.00 ? 21 ALA A HA   1  
ATOM 225   H HB1  . ALA A 1 21 ? 4.108   2.246   -14.181 1.00 0.00 ? 21 ALA A HB1  1  
ATOM 226   H HB2  . ALA A 1 21 ? 3.962   3.318   -12.788 1.00 0.00 ? 21 ALA A HB2  1  
ATOM 227   H HB3  . ALA A 1 21 ? 2.553   2.981   -13.792 1.00 0.00 ? 21 ALA A HB3  1  
ATOM 228   N N    . GLU A 1 22 ? 4.693   1.915   -10.725 1.00 0.00 ? 22 GLU A N    1  
ATOM 229   C CA   . GLU A 1 22 ? 5.840   1.678   -9.855  1.00 0.00 ? 22 GLU A CA   1  
ATOM 230   C C    . GLU A 1 22 ? 5.582   0.501   -8.920  1.00 0.00 ? 22 GLU A C    1  
ATOM 231   O O    . GLU A 1 22 ? 6.484   -0.293  -8.649  1.00 0.00 ? 22 GLU A O    1  
ATOM 232   C CB   . GLU A 1 22 ? 6.148   2.933   -9.033  1.00 0.00 ? 22 GLU A CB   1  
ATOM 233   C CG   . GLU A 1 22 ? 4.955   3.269   -8.140  1.00 0.00 ? 22 GLU A CG   1  
ATOM 234   C CD   . GLU A 1 22 ? 5.148   4.642   -7.508  1.00 0.00 ? 22 GLU A CD   1  
ATOM 235   O OE1  . GLU A 1 22 ? 5.553   5.548   -8.219  1.00 0.00 ? 22 GLU A OE1  1  
ATOM 236   O OE2  . GLU A 1 22 ? 4.888   4.771   -6.324  1.00 0.00 ? 22 GLU A OE2  1  
ATOM 237   H H    . GLU A 1 22 ? 4.194   2.755   -10.648 1.00 0.00 ? 22 GLU A H    1  
ATOM 238   H HA   . GLU A 1 22 ? 6.698   1.449   -10.470 1.00 0.00 ? 22 GLU A HA   1  
ATOM 239   H HB2  . GLU A 1 22 ? 7.019   2.754   -8.419  1.00 0.00 ? 22 GLU A HB2  1  
ATOM 240   H HB3  . GLU A 1 22 ? 6.341   3.760   -9.698  1.00 0.00 ? 22 GLU A HB3  1  
ATOM 241   H HG2  . GLU A 1 22 ? 4.055   3.270   -8.734  1.00 0.00 ? 22 GLU A HG2  1  
ATOM 242   H HG3  . GLU A 1 22 ? 4.869   2.526   -7.362  1.00 0.00 ? 22 GLU A HG3  1  
ATOM 243   N N    . LEU A 1 23 ? 4.353   0.387   -8.425  1.00 0.00 ? 23 LEU A N    1  
ATOM 244   C CA   . LEU A 1 23 ? 4.011   -0.706  -7.519  1.00 0.00 ? 23 LEU A CA   1  
ATOM 245   C C    . LEU A 1 23 ? 4.361   -2.050  -8.154  1.00 0.00 ? 23 LEU A C    1  
ATOM 246   O O    . LEU A 1 23 ? 5.113   -2.840  -7.583  1.00 0.00 ? 23 LEU A O    1  
ATOM 247   C CB   . LEU A 1 23 ? 2.508   -0.669  -7.194  1.00 0.00 ? 23 LEU A CB   1  
ATOM 248   C CG   . LEU A 1 23 ? 2.276   0.007   -5.837  1.00 0.00 ? 23 LEU A CG   1  
ATOM 249   C CD1  . LEU A 1 23 ? 0.847   0.554   -5.775  1.00 0.00 ? 23 LEU A CD1  1  
ATOM 250   C CD2  . LEU A 1 23 ? 2.474   -1.014  -4.711  1.00 0.00 ? 23 LEU A CD2  1  
ATOM 251   H H    . LEU A 1 23 ? 3.668   1.046   -8.669  1.00 0.00 ? 23 LEU A H    1  
ATOM 252   H HA   . LEU A 1 23 ? 4.575   -0.595  -6.607  1.00 0.00 ? 23 LEU A HA   1  
ATOM 253   H HB2  . LEU A 1 23 ? 1.995   -0.112  -7.965  1.00 0.00 ? 23 LEU A HB2  1  
ATOM 254   H HB3  . LEU A 1 23 ? 2.120   -1.676  -7.164  1.00 0.00 ? 23 LEU A HB3  1  
ATOM 255   H HG   . LEU A 1 23 ? 2.973   0.821   -5.714  1.00 0.00 ? 23 LEU A HG   1  
ATOM 256   H HD11 . LEU A 1 23 ? 0.160   -0.190  -6.150  1.00 0.00 ? 23 LEU A HD11 1  
ATOM 257   H HD12 . LEU A 1 23 ? 0.778   1.446   -6.380  1.00 0.00 ? 23 LEU A HD12 1  
ATOM 258   H HD13 . LEU A 1 23 ? 0.596   0.792   -4.752  1.00 0.00 ? 23 LEU A HD13 1  
ATOM 259   H HD21 . LEU A 1 23 ? 3.494   -1.366  -4.718  1.00 0.00 ? 23 LEU A HD21 1  
ATOM 260   H HD22 . LEU A 1 23 ? 1.802   -1.848  -4.858  1.00 0.00 ? 23 LEU A HD22 1  
ATOM 261   H HD23 . LEU A 1 23 ? 2.261   -0.546  -3.759  1.00 0.00 ? 23 LEU A HD23 1  
ATOM 262   N N    . ARG A 1 24 ? 3.812   -2.302  -9.337  1.00 0.00 ? 24 ARG A N    1  
ATOM 263   C CA   . ARG A 1 24 ? 4.071   -3.556  -10.036 1.00 0.00 ? 24 ARG A CA   1  
ATOM 264   C C    . ARG A 1 24 ? 5.550   -3.689  -10.379 1.00 0.00 ? 24 ARG A C    1  
ATOM 265   O O    . ARG A 1 24 ? 6.170   -4.719  -10.113 1.00 0.00 ? 24 ARG A O    1  
ATOM 266   C CB   . ARG A 1 24 ? 3.241   -3.621  -11.319 1.00 0.00 ? 24 ARG A CB   1  
ATOM 267   C CG   . ARG A 1 24 ? 3.435   -4.984  -11.986 1.00 0.00 ? 24 ARG A CG   1  
ATOM 268   C CD   . ARG A 1 24 ? 2.338   -5.207  -13.027 1.00 0.00 ? 24 ARG A CD   1  
ATOM 269   N NE   . ARG A 1 24 ? 2.504   -6.508  -13.666 1.00 0.00 ? 24 ARG A NE   1  
ATOM 270   C CZ   . ARG A 1 24 ? 1.487   -7.111  -14.274 1.00 0.00 ? 24 ARG A CZ   1  
ATOM 271   N NH1  . ARG A 1 24 ? 0.314   -6.538  -14.308 1.00 0.00 ? 24 ARG A NH1  1  
ATOM 272   N NH2  . ARG A 1 24 ? 1.660   -8.274  -14.838 1.00 0.00 ? 24 ARG A NH2  1  
ATOM 273   H H    . ARG A 1 24 ? 3.222   -1.635  -9.747  1.00 0.00 ? 24 ARG A H    1  
ATOM 274   H HA   . ARG A 1 24 ? 3.786   -4.378  -9.397  1.00 0.00 ? 24 ARG A HA   1  
ATOM 275   H HB2  . ARG A 1 24 ? 2.196   -3.484  -11.079 1.00 0.00 ? 24 ARG A HB2  1  
ATOM 276   H HB3  . ARG A 1 24 ? 3.559   -2.843  -11.995 1.00 0.00 ? 24 ARG A HB3  1  
ATOM 277   H HG2  . ARG A 1 24 ? 4.401   -5.014  -12.469 1.00 0.00 ? 24 ARG A HG2  1  
ATOM 278   H HG3  . ARG A 1 24 ? 3.383   -5.763  -11.239 1.00 0.00 ? 24 ARG A HG3  1  
ATOM 279   H HD2  . ARG A 1 24 ? 1.374   -5.169  -12.543 1.00 0.00 ? 24 ARG A HD2  1  
ATOM 280   H HD3  . ARG A 1 24 ? 2.392   -4.429  -13.776 1.00 0.00 ? 24 ARG A HD3  1  
ATOM 281   H HE   . ARG A 1 24 ? 3.380   -6.946  -13.645 1.00 0.00 ? 24 ARG A HE   1  
ATOM 282   H HH11 . ARG A 1 24 ? 0.181   -5.647  -13.876 1.00 0.00 ? 24 ARG A HH11 1  
ATOM 283   H HH12 . ARG A 1 24 ? -0.450  -6.992  -14.766 1.00 0.00 ? 24 ARG A HH12 1  
ATOM 284   H HH21 . ARG A 1 24 ? 2.559   -8.713  -14.812 1.00 0.00 ? 24 ARG A HH21 1  
ATOM 285   H HH22 . ARG A 1 24 ? 0.896   -8.728  -15.296 1.00 0.00 ? 24 ARG A HH22 1  
ATOM 286   N N    . ASP A 1 25 ? 6.111   -2.646  -10.975 1.00 0.00 ? 25 ASP A N    1  
ATOM 287   C CA   . ASP A 1 25 ? 7.517   -2.667  -11.352 1.00 0.00 ? 25 ASP A CA   1  
ATOM 288   C C    . ASP A 1 25 ? 8.396   -2.969  -10.143 1.00 0.00 ? 25 ASP A C    1  
ATOM 289   O O    . ASP A 1 25 ? 9.210   -3.890  -10.172 1.00 0.00 ? 25 ASP A O    1  
ATOM 290   C CB   . ASP A 1 25 ? 7.917   -1.319  -11.953 1.00 0.00 ? 25 ASP A CB   1  
ATOM 291   C CG   . ASP A 1 25 ? 9.281   -1.430  -12.626 1.00 0.00 ? 25 ASP A CG   1  
ATOM 292   O OD1  . ASP A 1 25 ? 10.273  -1.232  -11.943 1.00 0.00 ? 25 ASP A OD1  1  
ATOM 293   O OD2  . ASP A 1 25 ? 9.315   -1.713  -13.811 1.00 0.00 ? 25 ASP A OD2  1  
ATOM 294   H H    . ASP A 1 25 ? 5.571   -1.851  -11.167 1.00 0.00 ? 25 ASP A H    1  
ATOM 295   H HA   . ASP A 1 25 ? 7.666   -3.436  -12.092 1.00 0.00 ? 25 ASP A HA   1  
ATOM 296   H HB2  . ASP A 1 25 ? 7.180   -1.020  -12.686 1.00 0.00 ? 25 ASP A HB2  1  
ATOM 297   H HB3  . ASP A 1 25 ? 7.964   -0.577  -11.171 1.00 0.00 ? 25 ASP A HB3  1  
ATOM 298   N N    . THR A 1 26 ? 8.230   -2.184  -9.086  1.00 0.00 ? 26 THR A N    1  
ATOM 299   C CA   . THR A 1 26 ? 9.021   -2.372  -7.876  1.00 0.00 ? 26 THR A CA   1  
ATOM 300   C C    . THR A 1 26 ? 8.838   -3.776  -7.304  1.00 0.00 ? 26 THR A C    1  
ATOM 301   O O    . THR A 1 26 ? 9.779   -4.358  -6.763  1.00 0.00 ? 26 THR A O    1  
ATOM 302   C CB   . THR A 1 26 ? 8.621   -1.340  -6.821  1.00 0.00 ? 26 THR A CB   1  
ATOM 303   O OG1  . THR A 1 26 ? 8.507   -0.063  -7.430  1.00 0.00 ? 26 THR A OG1  1  
ATOM 304   C CG2  . THR A 1 26 ? 9.687   -1.295  -5.725  1.00 0.00 ? 26 THR A CG2  1  
ATOM 305   H H    . THR A 1 26 ? 7.567   -1.463  -9.120  1.00 0.00 ? 26 THR A H    1  
ATOM 306   H HA   . THR A 1 26 ? 10.064  -2.229  -8.117  1.00 0.00 ? 26 THR A HA   1  
ATOM 307   H HB   . THR A 1 26 ? 7.675   -1.619  -6.385  1.00 0.00 ? 26 THR A HB   1  
ATOM 308   H HG1  . THR A 1 26 ? 8.917   0.582   -6.848  1.00 0.00 ? 26 THR A HG1  1  
ATOM 309   H HG21 . THR A 1 26 ? 9.362   -0.643  -4.930  1.00 0.00 ? 26 THR A HG21 1  
ATOM 310   H HG22 . THR A 1 26 ? 10.614  -0.924  -6.141  1.00 0.00 ? 26 THR A HG22 1  
ATOM 311   H HG23 . THR A 1 26 ? 9.842   -2.290  -5.336  1.00 0.00 ? 26 THR A HG23 1  
ATOM 312   N N    . ILE A 1 27 ? 7.627   -4.315  -7.411  1.00 0.00 ? 27 ILE A N    1  
ATOM 313   C CA   . ILE A 1 27 ? 7.360   -5.650  -6.880  1.00 0.00 ? 27 ILE A CA   1  
ATOM 314   C C    . ILE A 1 27 ? 7.912   -6.727  -7.815  1.00 0.00 ? 27 ILE A C    1  
ATOM 315   O O    . ILE A 1 27 ? 8.143   -7.860  -7.396  1.00 0.00 ? 27 ILE A O    1  
ATOM 316   C CB   . ILE A 1 27 ? 5.845   -5.841  -6.659  1.00 0.00 ? 27 ILE A CB   1  
ATOM 317   C CG1  . ILE A 1 27 ? 5.603   -6.454  -5.273  1.00 0.00 ? 27 ILE A CG1  1  
ATOM 318   C CG2  . ILE A 1 27 ? 5.250   -6.764  -7.734  1.00 0.00 ? 27 ILE A CG2  1  
ATOM 319   C CD1  . ILE A 1 27 ? 4.126   -6.825  -5.119  1.00 0.00 ? 27 ILE A CD1  1  
ATOM 320   H H    . ILE A 1 27 ? 6.904   -3.810  -7.845  1.00 0.00 ? 27 ILE A H    1  
ATOM 321   H HA   . ILE A 1 27 ? 7.862   -5.740  -5.927  1.00 0.00 ? 27 ILE A HA   1  
ATOM 322   H HB   . ILE A 1 27 ? 5.358   -4.880  -6.711  1.00 0.00 ? 27 ILE A HB   1  
ATOM 323   H HG12 . ILE A 1 27 ? 6.211   -7.340  -5.160  1.00 0.00 ? 27 ILE A HG12 1  
ATOM 324   H HG13 . ILE A 1 27 ? 5.872   -5.737  -4.512  1.00 0.00 ? 27 ILE A HG13 1  
ATOM 325   H HG21 . ILE A 1 27 ? 5.576   -7.779  -7.558  1.00 0.00 ? 27 ILE A HG21 1  
ATOM 326   H HG22 . ILE A 1 27 ? 5.579   -6.442  -8.710  1.00 0.00 ? 27 ILE A HG22 1  
ATOM 327   H HG23 . ILE A 1 27 ? 4.172   -6.720  -7.687  1.00 0.00 ? 27 ILE A HG23 1  
ATOM 328   H HD11 . ILE A 1 27 ? 3.937   -7.761  -5.624  1.00 0.00 ? 27 ILE A HD11 1  
ATOM 329   H HD12 . ILE A 1 27 ? 3.512   -6.050  -5.552  1.00 0.00 ? 27 ILE A HD12 1  
ATOM 330   H HD13 . ILE A 1 27 ? 3.890   -6.929  -4.070  1.00 0.00 ? 27 ILE A HD13 1  
ATOM 331   N N    . ASN A 1 28 ? 8.112   -6.369  -9.082  1.00 0.00 ? 28 ASN A N    1  
ATOM 332   C CA   . ASN A 1 28 ? 8.630   -7.324  -10.062 1.00 0.00 ? 28 ASN A CA   1  
ATOM 333   C C    . ASN A 1 28 ? 10.096  -7.033  -10.392 1.00 0.00 ? 28 ASN A C    1  
ATOM 334   O O    . ASN A 1 28 ? 10.723  -7.769  -11.153 1.00 0.00 ? 28 ASN A O    1  
ATOM 335   C CB   . ASN A 1 28 ? 7.772   -7.273  -11.339 1.00 0.00 ? 28 ASN A CB   1  
ATOM 336   C CG   . ASN A 1 28 ? 8.527   -6.590  -12.475 1.00 0.00 ? 28 ASN A CG   1  
ATOM 337   O OD1  . ASN A 1 28 ? 8.694   -7.168  -13.549 1.00 0.00 ? 28 ASN A OD1  1  
ATOM 338   N ND2  . ASN A 1 28 ? 8.997   -5.386  -12.300 1.00 0.00 ? 28 ASN A ND2  1  
ATOM 339   H H    . ASN A 1 28 ? 7.905   -5.454  -9.364  1.00 0.00 ? 28 ASN A H    1  
ATOM 340   H HA   . ASN A 1 28 ? 8.565   -8.318  -9.645  1.00 0.00 ? 28 ASN A HA   1  
ATOM 341   H HB2  . ASN A 1 28 ? 7.517   -8.279  -11.640 1.00 0.00 ? 28 ASN A HB2  1  
ATOM 342   H HB3  . ASN A 1 28 ? 6.866   -6.722  -11.135 1.00 0.00 ? 28 ASN A HB3  1  
ATOM 343   H HD21 . ASN A 1 28 ? 8.863   -4.929  -11.444 1.00 0.00 ? 28 ASN A HD21 1  
ATOM 344   H HD22 . ASN A 1 28 ? 9.482   -4.940  -13.023 1.00 0.00 ? 28 ASN A HD22 1  
ATOM 345   N N    . THR A 1 29 ? 10.638  -5.964  -9.812  1.00 0.00 ? 29 THR A N    1  
ATOM 346   C CA   . THR A 1 29 ? 12.035  -5.599  -10.051 1.00 0.00 ? 29 THR A CA   1  
ATOM 347   C C    . THR A 1 29 ? 12.836  -5.678  -8.756  1.00 0.00 ? 29 THR A C    1  
ATOM 348   O O    . THR A 1 29 ? 13.918  -6.264  -8.720  1.00 0.00 ? 29 THR A O    1  
ATOM 349   C CB   . THR A 1 29 ? 12.126  -4.177  -10.618 1.00 0.00 ? 29 THR A CB   1  
ATOM 350   O OG1  . THR A 1 29 ? 11.407  -3.288  -9.776  1.00 0.00 ? 29 THR A OG1  1  
ATOM 351   C CG2  . THR A 1 29 ? 11.533  -4.132  -12.035 1.00 0.00 ? 29 THR A CG2  1  
ATOM 352   H H    . THR A 1 29 ? 10.093  -5.414  -9.207  1.00 0.00 ? 29 THR A H    1  
ATOM 353   H HA   . THR A 1 29 ? 12.464  -6.286  -10.765 1.00 0.00 ? 29 THR A HA   1  
ATOM 354   H HB   . THR A 1 29 ? 13.161  -3.873  -10.657 1.00 0.00 ? 29 THR A HB   1  
ATOM 355   H HG1  . THR A 1 29 ? 10.867  -2.723  -10.333 1.00 0.00 ? 29 THR A HG1  1  
ATOM 356   H HG21 . THR A 1 29 ? 12.218  -3.618  -12.697 1.00 0.00 ? 29 THR A HG21 1  
ATOM 357   H HG22 . THR A 1 29 ? 10.594  -3.602  -12.015 1.00 0.00 ? 29 THR A HG22 1  
ATOM 358   H HG23 . THR A 1 29 ? 11.371  -5.136  -12.399 1.00 0.00 ? 29 THR A HG23 1  
ATOM 359   N N    . SER A 1 30 ? 12.296  -5.085  -7.697  1.00 0.00 ? 30 SER A N    1  
ATOM 360   C CA   . SER A 1 30 ? 12.968  -5.096  -6.402  1.00 0.00 ? 30 SER A CA   1  
ATOM 361   C C    . SER A 1 30 ? 12.503  -6.293  -5.578  1.00 0.00 ? 30 SER A C    1  
ATOM 362   O O    . SER A 1 30 ? 11.533  -6.963  -5.935  1.00 0.00 ? 30 SER A O    1  
ATOM 363   C CB   . SER A 1 30 ? 12.666  -3.796  -5.652  1.00 0.00 ? 30 SER A CB   1  
ATOM 364   O OG   . SER A 1 30 ? 13.748  -2.892  -5.830  1.00 0.00 ? 30 SER A OG   1  
ATOM 365   H H    . SER A 1 30 ? 11.430  -4.635  -7.786  1.00 0.00 ? 30 SER A H    1  
ATOM 366   H HA   . SER A 1 30 ? 14.034  -5.169  -6.558  1.00 0.00 ? 30 SER A HA   1  
ATOM 367   H HB2  . SER A 1 30 ? 11.767  -3.353  -6.044  1.00 0.00 ? 30 SER A HB2  1  
ATOM 368   H HB3  . SER A 1 30 ? 12.530  -4.006  -4.599  1.00 0.00 ? 30 SER A HB3  1  
ATOM 369   H HG   . SER A 1 30 ? 13.502  -2.053  -5.431  1.00 0.00 ? 30 SER A HG   1  
ATOM 370   N N    . CYS A 1 31 ? 13.197  -6.559  -4.479  1.00 0.00 ? 31 CYS A N    1  
ATOM 371   C CA   . CYS A 1 31 ? 12.839  -7.680  -3.619  1.00 0.00 ? 31 CYS A CA   1  
ATOM 372   C C    . CYS A 1 31 ? 13.393  -7.483  -2.211  1.00 0.00 ? 31 CYS A C    1  
ATOM 373   O O    . CYS A 1 31 ? 14.597  -7.310  -2.024  1.00 0.00 ? 31 CYS A O    1  
ATOM 374   C CB   . CYS A 1 31 ? 13.388  -8.982  -4.207  1.00 0.00 ? 31 CYS A CB   1  
ATOM 375   S SG   . CYS A 1 31 ? 12.803  -10.383 -3.221  1.00 0.00 ? 31 CYS A SG   1  
ATOM 376   H H    . CYS A 1 31 ? 13.962  -5.992  -4.241  1.00 0.00 ? 31 CYS A H    1  
ATOM 377   H HA   . CYS A 1 31 ? 11.763  -7.751  -3.565  1.00 0.00 ? 31 CYS A HA   1  
ATOM 378   H HB2  . CYS A 1 31 ? 13.045  -9.089  -5.225  1.00 0.00 ? 31 CYS A HB2  1  
ATOM 379   H HB3  . CYS A 1 31 ? 14.467  -8.956  -4.191  1.00 0.00 ? 31 CYS A HB3  1  
ATOM 380   H HG   . CYS A 1 31 ? 12.346  -10.988 -3.808  1.00 0.00 ? 31 CYS A HG   1  
ATOM 381   N N    . ASP A 1 32 ? 12.502  -7.519  -1.227  1.00 0.00 ? 32 ASP A N    1  
ATOM 382   C CA   . ASP A 1 32 ? 12.902  -7.353  0.165   1.00 0.00 ? 32 ASP A CA   1  
ATOM 383   C C    . ASP A 1 32 ? 11.705  -7.571  1.084   1.00 0.00 ? 32 ASP A C    1  
ATOM 384   O O    . ASP A 1 32 ? 10.624  -7.031  0.847   1.00 0.00 ? 32 ASP A O    1  
ATOM 385   C CB   . ASP A 1 32 ? 13.482  -5.950  0.391   1.00 0.00 ? 32 ASP A CB   1  
ATOM 386   C CG   . ASP A 1 32 ? 14.571  -5.995  1.458   1.00 0.00 ? 32 ASP A CG   1  
ATOM 387   O OD1  . ASP A 1 32 ? 14.433  -6.778  2.385   1.00 0.00 ? 32 ASP A OD1  1  
ATOM 388   O OD2  . ASP A 1 32 ? 15.527  -5.247  1.336   1.00 0.00 ? 32 ASP A OD2  1  
ATOM 389   H H    . ASP A 1 32 ? 11.558  -7.667  -1.440  1.00 0.00 ? 32 ASP A H    1  
ATOM 390   H HA   . ASP A 1 32 ? 13.658  -8.087  0.399   1.00 0.00 ? 32 ASP A HA   1  
ATOM 391   H HB2  . ASP A 1 32 ? 13.903  -5.582  -0.534  1.00 0.00 ? 32 ASP A HB2  1  
ATOM 392   H HB3  . ASP A 1 32 ? 12.696  -5.283  0.714   1.00 0.00 ? 32 ASP A HB3  1  
ATOM 393   N N    . ILE A 1 33 ? 11.902  -8.368  2.130   1.00 0.00 ? 33 ILE A N    1  
ATOM 394   C CA   . ILE A 1 33 ? 10.828  -8.652  3.075   1.00 0.00 ? 33 ILE A CA   1  
ATOM 395   C C    . ILE A 1 33 ? 9.979   -7.406  3.324   1.00 0.00 ? 33 ILE A C    1  
ATOM 396   O O    . ILE A 1 33 ? 8.756   -7.486  3.427   1.00 0.00 ? 33 ILE A O    1  
ATOM 397   C CB   . ILE A 1 33 ? 11.417  -9.141  4.404   1.00 0.00 ? 33 ILE A CB   1  
ATOM 398   C CG1  . ILE A 1 33 ? 12.672  -8.321  4.744   1.00 0.00 ? 33 ILE A CG1  1  
ATOM 399   C CG2  . ILE A 1 33 ? 11.789  -10.622 4.282   1.00 0.00 ? 33 ILE A CG2  1  
ATOM 400   C CD1  . ILE A 1 33 ? 12.815  -8.203  6.264   1.00 0.00 ? 33 ILE A CD1  1  
ATOM 401   H H    . ILE A 1 33 ? 12.784  -8.772  2.267   1.00 0.00 ? 33 ILE A H    1  
ATOM 402   H HA   . ILE A 1 33 ? 10.197  -9.426  2.667   1.00 0.00 ? 33 ILE A HA   1  
ATOM 403   H HB   . ILE A 1 33 ? 10.681  -9.022  5.187   1.00 0.00 ? 33 ILE A HB   1  
ATOM 404   H HG12 . ILE A 1 33 ? 13.546  -8.811  4.339   1.00 0.00 ? 33 ILE A HG12 1  
ATOM 405   H HG13 . ILE A 1 33 ? 12.586  -7.333  4.318   1.00 0.00 ? 33 ILE A HG13 1  
ATOM 406   H HG21 . ILE A 1 33 ? 12.306  -10.938 5.177   1.00 0.00 ? 33 ILE A HG21 1  
ATOM 407   H HG22 . ILE A 1 33 ? 12.433  -10.763 3.427   1.00 0.00 ? 33 ILE A HG22 1  
ATOM 408   H HG23 . ILE A 1 33 ? 10.892  -11.211 4.159   1.00 0.00 ? 33 ILE A HG23 1  
ATOM 409   H HD11 . ILE A 1 33 ? 12.592  -9.155  6.723   1.00 0.00 ? 33 ILE A HD11 1  
ATOM 410   H HD12 . ILE A 1 33 ? 12.126  -7.457  6.632   1.00 0.00 ? 33 ILE A HD12 1  
ATOM 411   H HD13 . ILE A 1 33 ? 13.825  -7.913  6.509   1.00 0.00 ? 33 ILE A HD13 1  
ATOM 412   N N    . GLU A 1 34 ? 10.638  -6.256  3.423   1.00 0.00 ? 34 GLU A N    1  
ATOM 413   C CA   . GLU A 1 34 ? 9.937   -5.001  3.666   1.00 0.00 ? 34 GLU A CA   1  
ATOM 414   C C    . GLU A 1 34 ? 9.210   -4.524  2.411   1.00 0.00 ? 34 GLU A C    1  
ATOM 415   O O    . GLU A 1 34 ? 8.017   -4.225  2.452   1.00 0.00 ? 34 GLU A O    1  
ATOM 416   C CB   . GLU A 1 34 ? 10.932  -3.928  4.123   1.00 0.00 ? 34 GLU A CB   1  
ATOM 417   C CG   . GLU A 1 34 ? 12.060  -4.580  4.930   1.00 0.00 ? 34 GLU A CG   1  
ATOM 418   C CD   . GLU A 1 34 ? 12.689  -3.558  5.871   1.00 0.00 ? 34 GLU A CD   1  
ATOM 419   O OE1  . GLU A 1 34 ? 11.966  -3.006  6.684   1.00 0.00 ? 34 GLU A OE1  1  
ATOM 420   O OE2  . GLU A 1 34 ? 13.885  -3.341  5.765   1.00 0.00 ? 34 GLU A OE2  1  
ATOM 421   H H    . GLU A 1 34 ? 11.615  -6.252  3.335   1.00 0.00 ? 34 GLU A H    1  
ATOM 422   H HA   . GLU A 1 34 ? 9.212   -5.156  4.451   1.00 0.00 ? 34 GLU A HA   1  
ATOM 423   H HB2  . GLU A 1 34 ? 11.348  -3.433  3.259   1.00 0.00 ? 34 GLU A HB2  1  
ATOM 424   H HB3  . GLU A 1 34 ? 10.421  -3.204  4.742   1.00 0.00 ? 34 GLU A HB3  1  
ATOM 425   H HG2  . GLU A 1 34 ? 11.661  -5.402  5.507   1.00 0.00 ? 34 GLU A HG2  1  
ATOM 426   H HG3  . GLU A 1 34 ? 12.815  -4.951  4.253   1.00 0.00 ? 34 GLU A HG3  1  
ATOM 427   N N    . LEU A 1 35 ? 9.935   -4.448  1.300   1.00 0.00 ? 35 LEU A N    1  
ATOM 428   C CA   . LEU A 1 35 ? 9.340   -3.996  0.046   1.00 0.00 ? 35 LEU A CA   1  
ATOM 429   C C    . LEU A 1 35 ? 8.099   -4.823  -0.278  1.00 0.00 ? 35 LEU A C    1  
ATOM 430   O O    . LEU A 1 35 ? 7.025   -4.276  -0.535  1.00 0.00 ? 35 LEU A O    1  
ATOM 431   C CB   . LEU A 1 35 ? 10.359  -4.127  -1.099  1.00 0.00 ? 35 LEU A CB   1  
ATOM 432   C CG   . LEU A 1 35 ? 10.199  -2.979  -2.118  1.00 0.00 ? 35 LEU A CG   1  
ATOM 433   C CD1  . LEU A 1 35 ? 8.716   -2.730  -2.422  1.00 0.00 ? 35 LEU A CD1  1  
ATOM 434   C CD2  . LEU A 1 35 ? 10.827  -1.691  -1.568  1.00 0.00 ? 35 LEU A CD2  1  
ATOM 435   H H    . LEU A 1 35 ? 10.885  -4.693  1.324   1.00 0.00 ? 35 LEU A H    1  
ATOM 436   H HA   . LEU A 1 35 ? 9.058   -2.961  0.153   1.00 0.00 ? 35 LEU A HA   1  
ATOM 437   H HB2  . LEU A 1 35 ? 11.356  -4.102  -0.690  1.00 0.00 ? 35 LEU A HB2  1  
ATOM 438   H HB3  . LEU A 1 35 ? 10.211  -5.071  -1.605  1.00 0.00 ? 35 LEU A HB3  1  
ATOM 439   H HG   . LEU A 1 35 ? 10.702  -3.253  -3.035  1.00 0.00 ? 35 LEU A HG   1  
ATOM 440   H HD11 . LEU A 1 35 ? 8.627   -2.203  -3.361  1.00 0.00 ? 35 LEU A HD11 1  
ATOM 441   H HD12 . LEU A 1 35 ? 8.278   -2.131  -1.636  1.00 0.00 ? 35 LEU A HD12 1  
ATOM 442   H HD13 . LEU A 1 35 ? 8.197   -3.673  -2.491  1.00 0.00 ? 35 LEU A HD13 1  
ATOM 443   H HD21 . LEU A 1 35 ? 11.240  -1.118  -2.385  1.00 0.00 ? 35 LEU A HD21 1  
ATOM 444   H HD22 . LEU A 1 35 ? 11.614  -1.935  -0.868  1.00 0.00 ? 35 LEU A HD22 1  
ATOM 445   H HD23 . LEU A 1 35 ? 10.071  -1.105  -1.068  1.00 0.00 ? 35 LEU A HD23 1  
ATOM 446   N N    . LEU A 1 36 ? 8.256   -6.143  -0.272  1.00 0.00 ? 36 LEU A N    1  
ATOM 447   C CA   . LEU A 1 36 ? 7.145   -7.038  -0.576  1.00 0.00 ? 36 LEU A CA   1  
ATOM 448   C C    . LEU A 1 36 ? 6.054   -6.933  0.486   1.00 0.00 ? 36 LEU A C    1  
ATOM 449   O O    . LEU A 1 36 ? 4.883   -6.729  0.164   1.00 0.00 ? 36 LEU A O    1  
ATOM 450   C CB   . LEU A 1 36 ? 7.645   -8.480  -0.662  1.00 0.00 ? 36 LEU A CB   1  
ATOM 451   C CG   . LEU A 1 36 ? 8.895   -8.540  -1.544  1.00 0.00 ? 36 LEU A CG   1  
ATOM 452   C CD1  . LEU A 1 36 ? 9.344   -9.994  -1.694  1.00 0.00 ? 36 LEU A CD1  1  
ATOM 453   C CD2  . LEU A 1 36 ? 8.578   -7.959  -2.927  1.00 0.00 ? 36 LEU A CD2  1  
ATOM 454   H H    . LEU A 1 36 ? 9.136   -6.521  -0.065  1.00 0.00 ? 36 LEU A H    1  
ATOM 455   H HA   . LEU A 1 36 ? 6.725   -6.760  -1.532  1.00 0.00 ? 36 LEU A HA   1  
ATOM 456   H HB2  . LEU A 1 36 ? 7.885   -8.837  0.329   1.00 0.00 ? 36 LEU A HB2  1  
ATOM 457   H HB3  . LEU A 1 36 ? 6.875   -9.105  -1.091  1.00 0.00 ? 36 LEU A HB3  1  
ATOM 458   H HG   . LEU A 1 36 ? 9.687   -7.966  -1.083  1.00 0.00 ? 36 LEU A HG   1  
ATOM 459   H HD11 . LEU A 1 36 ? 8.644   -10.524 -2.323  1.00 0.00 ? 36 LEU A HD11 1  
ATOM 460   H HD12 . LEU A 1 36 ? 9.379   -10.462 -0.722  1.00 0.00 ? 36 LEU A HD12 1  
ATOM 461   H HD13 . LEU A 1 36 ? 10.326  -10.024 -2.143  1.00 0.00 ? 36 LEU A HD13 1  
ATOM 462   H HD21 . LEU A 1 36 ? 7.600   -8.290  -3.243  1.00 0.00 ? 36 LEU A HD21 1  
ATOM 463   H HD22 . LEU A 1 36 ? 9.319   -8.296  -3.639  1.00 0.00 ? 36 LEU A HD22 1  
ATOM 464   H HD23 . LEU A 1 36 ? 8.595   -6.880  -2.878  1.00 0.00 ? 36 LEU A HD23 1  
ATOM 465   N N    . ALA A 1 37 ? 6.438   -7.069  1.752   1.00 0.00 ? 37 ALA A N    1  
ATOM 466   C CA   . ALA A 1 37 ? 5.470   -6.983  2.839   1.00 0.00 ? 37 ALA A CA   1  
ATOM 467   C C    . ALA A 1 37 ? 4.666   -5.693  2.730   1.00 0.00 ? 37 ALA A C    1  
ATOM 468   O O    . ALA A 1 37 ? 3.436   -5.707  2.797   1.00 0.00 ? 37 ALA A O    1  
ATOM 469   C CB   . ALA A 1 37 ? 6.187   -7.028  4.190   1.00 0.00 ? 37 ALA A CB   1  
ATOM 470   H H    . ALA A 1 37 ? 7.385   -7.230  1.958   1.00 0.00 ? 37 ALA A H    1  
ATOM 471   H HA   . ALA A 1 37 ? 4.795   -7.824  2.775   1.00 0.00 ? 37 ALA A HA   1  
ATOM 472   H HB1  . ALA A 1 37 ? 6.940   -6.254  4.223   1.00 0.00 ? 37 ALA A HB1  1  
ATOM 473   H HB2  . ALA A 1 37 ? 6.655   -7.991  4.317   1.00 0.00 ? 37 ALA A HB2  1  
ATOM 474   H HB3  . ALA A 1 37 ? 5.472   -6.866  4.982   1.00 0.00 ? 37 ALA A HB3  1  
ATOM 475   N N    . ALA A 1 38 ? 5.369   -4.579  2.559   1.00 0.00 ? 38 ALA A N    1  
ATOM 476   C CA   . ALA A 1 38 ? 4.712   -3.282  2.440   1.00 0.00 ? 38 ALA A CA   1  
ATOM 477   C C    . ALA A 1 38 ? 3.836   -3.240  1.192   1.00 0.00 ? 38 ALA A C    1  
ATOM 478   O O    . ALA A 1 38 ? 2.671   -2.841  1.251   1.00 0.00 ? 38 ALA A O    1  
ATOM 479   C CB   . ALA A 1 38 ? 5.763   -2.171  2.375   1.00 0.00 ? 38 ALA A CB   1  
ATOM 480   H H    . ALA A 1 38 ? 6.346   -4.629  2.512   1.00 0.00 ? 38 ALA A H    1  
ATOM 481   H HA   . ALA A 1 38 ? 4.091   -3.124  3.310   1.00 0.00 ? 38 ALA A HA   1  
ATOM 482   H HB1  . ALA A 1 38 ? 6.107   -2.056  1.359   1.00 0.00 ? 38 ALA A HB1  1  
ATOM 483   H HB2  . ALA A 1 38 ? 6.597   -2.428  3.012   1.00 0.00 ? 38 ALA A HB2  1  
ATOM 484   H HB3  . ALA A 1 38 ? 5.327   -1.243  2.715   1.00 0.00 ? 38 ALA A HB3  1  
ATOM 485   N N    . CYS A 1 39 ? 4.400   -3.653  0.060   1.00 0.00 ? 39 CYS A N    1  
ATOM 486   C CA   . CYS A 1 39 ? 3.658   -3.658  -1.194  1.00 0.00 ? 39 CYS A CA   1  
ATOM 487   C C    . CYS A 1 39 ? 2.348   -4.423  -1.030  1.00 0.00 ? 39 CYS A C    1  
ATOM 488   O O    . CYS A 1 39 ? 1.280   -3.935  -1.406  1.00 0.00 ? 39 CYS A O    1  
ATOM 489   C CB   . CYS A 1 39 ? 4.491   -4.308  -2.299  1.00 0.00 ? 39 CYS A CB   1  
ATOM 490   S SG   . CYS A 1 39 ? 3.753   -3.936  -3.909  1.00 0.00 ? 39 CYS A SG   1  
ATOM 491   H H    . CYS A 1 39 ? 5.331   -3.962  0.071   1.00 0.00 ? 39 CYS A H    1  
ATOM 492   H HA   . CYS A 1 39 ? 3.438   -2.640  -1.475  1.00 0.00 ? 39 CYS A HA   1  
ATOM 493   H HB2  . CYS A 1 39 ? 5.499   -3.922  -2.268  1.00 0.00 ? 39 CYS A HB2  1  
ATOM 494   H HB3  . CYS A 1 39 ? 4.512   -5.379  -2.152  1.00 0.00 ? 39 CYS A HB3  1  
ATOM 495   H HG   . CYS A 1 39 ? 2.809   -3.813  -3.781  1.00 0.00 ? 39 CYS A HG   1  
ATOM 496   N N    . ARG A 1 40 ? 2.439   -5.622  -0.469  1.00 0.00 ? 40 ARG A N    1  
ATOM 497   C CA   . ARG A 1 40 ? 1.256   -6.449  -0.258  1.00 0.00 ? 40 ARG A CA   1  
ATOM 498   C C    . ARG A 1 40 ? 0.252   -5.729  0.636   1.00 0.00 ? 40 ARG A C    1  
ATOM 499   O O    . ARG A 1 40 ? -0.944  -5.710  0.350   1.00 0.00 ? 40 ARG A O    1  
ATOM 500   C CB   . ARG A 1 40 ? 1.655   -7.777  0.386   1.00 0.00 ? 40 ARG A CB   1  
ATOM 501   C CG   . ARG A 1 40 ? 2.402   -8.637  -0.637  1.00 0.00 ? 40 ARG A CG   1  
ATOM 502   C CD   . ARG A 1 40 ? 2.857   -9.936  0.027   1.00 0.00 ? 40 ARG A CD   1  
ATOM 503   N NE   . ARG A 1 40 ? 1.720   -10.828 0.222   1.00 0.00 ? 40 ARG A NE   1  
ATOM 504   C CZ   . ARG A 1 40 ? 1.894   -12.131 0.419   1.00 0.00 ? 40 ARG A CZ   1  
ATOM 505   N NH1  . ARG A 1 40 ? 3.099   -12.632 0.440   1.00 0.00 ? 40 ARG A NH1  1  
ATOM 506   N NH2  . ARG A 1 40 ? 0.861   -12.908 0.592   1.00 0.00 ? 40 ARG A NH2  1  
ATOM 507   H H    . ARG A 1 40 ? 3.316   -5.959  -0.191  1.00 0.00 ? 40 ARG A H    1  
ATOM 508   H HA   . ARG A 1 40 ? 0.794   -6.649  -1.214  1.00 0.00 ? 40 ARG A HA   1  
ATOM 509   H HB2  . ARG A 1 40 ? 2.296   -7.586  1.234   1.00 0.00 ? 40 ARG A HB2  1  
ATOM 510   H HB3  . ARG A 1 40 ? 0.769   -8.300  0.713   1.00 0.00 ? 40 ARG A HB3  1  
ATOM 511   H HG2  . ARG A 1 40 ? 1.745   -8.864  -1.464  1.00 0.00 ? 40 ARG A HG2  1  
ATOM 512   H HG3  . ARG A 1 40 ? 3.264   -8.098  -0.999  1.00 0.00 ? 40 ARG A HG3  1  
ATOM 513   H HD2  . ARG A 1 40 ? 3.586   -10.423 -0.603  1.00 0.00 ? 40 ARG A HD2  1  
ATOM 514   H HD3  . ARG A 1 40 ? 3.307   -9.711  0.983   1.00 0.00 ? 40 ARG A HD3  1  
ATOM 515   H HE   . ARG A 1 40 ? 0.812   -10.461 0.208   1.00 0.00 ? 40 ARG A HE   1  
ATOM 516   H HH11 . ARG A 1 40 ? 3.890   -12.037 0.308   1.00 0.00 ? 40 ARG A HH11 1  
ATOM 517   H HH12 . ARG A 1 40 ? 3.229   -13.612 0.588   1.00 0.00 ? 40 ARG A HH12 1  
ATOM 518   H HH21 . ARG A 1 40 ? -0.063  -12.525 0.576   1.00 0.00 ? 40 ARG A HH21 1  
ATOM 519   H HH22 . ARG A 1 40 ? 0.991   -13.889 0.741   1.00 0.00 ? 40 ARG A HH22 1  
ATOM 520   N N    . GLU A 1 41 ? 0.749   -5.137  1.717   1.00 0.00 ? 41 GLU A N    1  
ATOM 521   C CA   . GLU A 1 41 ? -0.117  -4.417  2.644   1.00 0.00 ? 41 GLU A CA   1  
ATOM 522   C C    . GLU A 1 41 ? -0.926  -3.358  1.902   1.00 0.00 ? 41 GLU A C    1  
ATOM 523   O O    . GLU A 1 41 ? -2.128  -3.211  2.127   1.00 0.00 ? 41 GLU A O    1  
ATOM 524   C CB   . GLU A 1 41 ? 0.722   -3.752  3.736   1.00 0.00 ? 41 GLU A CB   1  
ATOM 525   C CG   . GLU A 1 41 ? 1.185   -4.806  4.744   1.00 0.00 ? 41 GLU A CG   1  
ATOM 526   C CD   . GLU A 1 41 ? 0.017   -5.228  5.628   1.00 0.00 ? 41 GLU A CD   1  
ATOM 527   O OE1  . GLU A 1 41 ? -0.207  -4.572  6.632   1.00 0.00 ? 41 GLU A OE1  1  
ATOM 528   O OE2  . GLU A 1 41 ? -0.637  -6.201  5.288   1.00 0.00 ? 41 GLU A OE2  1  
ATOM 529   H H    . GLU A 1 41 ? 1.712   -5.184  1.895   1.00 0.00 ? 41 GLU A H    1  
ATOM 530   H HA   . GLU A 1 41 ? -0.798  -5.118  3.104   1.00 0.00 ? 41 GLU A HA   1  
ATOM 531   H HB2  . GLU A 1 41 ? 1.584   -3.277  3.288   1.00 0.00 ? 41 GLU A HB2  1  
ATOM 532   H HB3  . GLU A 1 41 ? 0.127   -3.007  4.245   1.00 0.00 ? 41 GLU A HB3  1  
ATOM 533   H HG2  . GLU A 1 41 ? 1.561   -5.668  4.211   1.00 0.00 ? 41 GLU A HG2  1  
ATOM 534   H HG3  . GLU A 1 41 ? 1.969   -4.394  5.359   1.00 0.00 ? 41 GLU A HG3  1  
ATOM 535   N N    . GLU A 1 42 ? -0.262  -2.624  1.015   1.00 0.00 ? 42 GLU A N    1  
ATOM 536   C CA   . GLU A 1 42 ? -0.934  -1.583  0.246   1.00 0.00 ? 42 GLU A CA   1  
ATOM 537   C C    . GLU A 1 42 ? -1.957  -2.198  -0.704  1.00 0.00 ? 42 GLU A C    1  
ATOM 538   O O    . GLU A 1 42 ? -3.079  -1.705  -0.826  1.00 0.00 ? 42 GLU A O    1  
ATOM 539   C CB   . GLU A 1 42 ? 0.095   -0.776  -0.553  1.00 0.00 ? 42 GLU A CB   1  
ATOM 540   C CG   . GLU A 1 42 ? 0.744   0.275   0.354   1.00 0.00 ? 42 GLU A CG   1  
ATOM 541   C CD   . GLU A 1 42 ? 1.219   -0.371  1.652   1.00 0.00 ? 42 GLU A CD   1  
ATOM 542   O OE1  . GLU A 1 42 ? 0.373   -0.756  2.442   1.00 0.00 ? 42 GLU A OE1  1  
ATOM 543   O OE2  . GLU A 1 42 ? 2.421   -0.472  1.835   1.00 0.00 ? 42 GLU A OE2  1  
ATOM 544   H H    . GLU A 1 42 ? 0.695   -2.786  0.875   1.00 0.00 ? 42 GLU A H    1  
ATOM 545   H HA   . GLU A 1 42 ? -1.445  -0.919  0.928   1.00 0.00 ? 42 GLU A HA   1  
ATOM 546   H HB2  . GLU A 1 42 ? 0.857   -1.443  -0.933  1.00 0.00 ? 42 GLU A HB2  1  
ATOM 547   H HB3  . GLU A 1 42 ? -0.394  -0.282  -1.379  1.00 0.00 ? 42 GLU A HB3  1  
ATOM 548   H HG2  . GLU A 1 42 ? 1.587   0.715   -0.158  1.00 0.00 ? 42 GLU A HG2  1  
ATOM 549   H HG3  . GLU A 1 42 ? 0.021   1.044   0.581   1.00 0.00 ? 42 GLU A HG3  1  
ATOM 550   N N    . PHE A 1 43 ? -1.565  -3.279  -1.372  1.00 0.00 ? 43 PHE A N    1  
ATOM 551   C CA   . PHE A 1 43 ? -2.461  -3.952  -2.305  1.00 0.00 ? 43 PHE A CA   1  
ATOM 552   C C    . PHE A 1 43 ? -3.681  -4.500  -1.566  1.00 0.00 ? 43 PHE A C    1  
ATOM 553   O O    . PHE A 1 43 ? -4.820  -4.227  -1.944  1.00 0.00 ? 43 PHE A O    1  
ATOM 554   C CB   . PHE A 1 43 ? -1.717  -5.099  -3.011  1.00 0.00 ? 43 PHE A CB   1  
ATOM 555   C CG   . PHE A 1 43 ? -1.559  -4.782  -4.482  1.00 0.00 ? 43 PHE A CG   1  
ATOM 556   C CD1  . PHE A 1 43 ? -0.834  -3.653  -4.880  1.00 0.00 ? 43 PHE A CD1  1  
ATOM 557   C CD2  . PHE A 1 43 ? -2.137  -5.618  -5.446  1.00 0.00 ? 43 PHE A CD2  1  
ATOM 558   C CE1  . PHE A 1 43 ? -0.687  -3.359  -6.242  1.00 0.00 ? 43 PHE A CE1  1  
ATOM 559   C CE2  . PHE A 1 43 ? -1.990  -5.324  -6.808  1.00 0.00 ? 43 PHE A CE2  1  
ATOM 560   C CZ   . PHE A 1 43 ? -1.265  -4.195  -7.205  1.00 0.00 ? 43 PHE A CZ   1  
ATOM 561   H H    . PHE A 1 43 ? -0.661  -3.629  -1.234  1.00 0.00 ? 43 PHE A H    1  
ATOM 562   H HA   . PHE A 1 43 ? -2.794  -3.239  -3.046  1.00 0.00 ? 43 PHE A HA   1  
ATOM 563   H HB2  . PHE A 1 43 ? -0.741  -5.218  -2.564  1.00 0.00 ? 43 PHE A HB2  1  
ATOM 564   H HB3  . PHE A 1 43 ? -2.274  -6.019  -2.899  1.00 0.00 ? 43 PHE A HB3  1  
ATOM 565   H HD1  . PHE A 1 43 ? -0.389  -3.008  -4.138  1.00 0.00 ? 43 PHE A HD1  1  
ATOM 566   H HD2  . PHE A 1 43 ? -2.696  -6.491  -5.141  1.00 0.00 ? 43 PHE A HD2  1  
ATOM 567   H HE1  . PHE A 1 43 ? -0.129  -2.487  -6.548  1.00 0.00 ? 43 PHE A HE1  1  
ATOM 568   H HE2  . PHE A 1 43 ? -2.436  -5.968  -7.550  1.00 0.00 ? 43 PHE A HE2  1  
ATOM 569   H HZ   . PHE A 1 43 ? -1.151  -3.968  -8.254  1.00 0.00 ? 43 PHE A HZ   1  
ATOM 570   N N    . HIS A 1 44 ? -3.432  -5.269  -0.512  1.00 0.00 ? 44 HIS A N    1  
ATOM 571   C CA   . HIS A 1 44 ? -4.516  -5.847  0.272   1.00 0.00 ? 44 HIS A CA   1  
ATOM 572   C C    . HIS A 1 44 ? -5.418  -4.751  0.828   1.00 0.00 ? 44 HIS A C    1  
ATOM 573   O O    . HIS A 1 44 ? -6.640  -4.897  0.860   1.00 0.00 ? 44 HIS A O    1  
ATOM 574   C CB   . HIS A 1 44 ? -3.942  -6.673  1.427   1.00 0.00 ? 44 HIS A CB   1  
ATOM 575   C CG   . HIS A 1 44 ? -5.041  -7.484  2.057   1.00 0.00 ? 44 HIS A CG   1  
ATOM 576   N ND1  . HIS A 1 44 ? -6.220  -6.910  2.505   1.00 0.00 ? 44 HIS A ND1  1  
ATOM 577   C CD2  . HIS A 1 44 ? -5.153  -8.827  2.321   1.00 0.00 ? 44 HIS A CD2  1  
ATOM 578   C CE1  . HIS A 1 44 ? -6.984  -7.896  3.009   1.00 0.00 ? 44 HIS A CE1  1  
ATOM 579   N NE2  . HIS A 1 44 ? -6.382  -9.084  2.923   1.00 0.00 ? 44 HIS A NE2  1  
ATOM 580   H H    . HIS A 1 44 ? -2.503  -5.450  -0.258  1.00 0.00 ? 44 HIS A H    1  
ATOM 581   H HA   . HIS A 1 44 ? -5.102  -6.496  -0.363  1.00 0.00 ? 44 HIS A HA   1  
ATOM 582   H HB2  . HIS A 1 44 ? -3.176  -7.334  1.050   1.00 0.00 ? 44 HIS A HB2  1  
ATOM 583   H HB3  . HIS A 1 44 ? -3.516  -6.010  2.166   1.00 0.00 ? 44 HIS A HB3  1  
ATOM 584   H HD2  . HIS A 1 44 ? -4.402  -9.570  2.097   1.00 0.00 ? 44 HIS A HD2  1  
ATOM 585   H HE1  . HIS A 1 44 ? -7.967  -7.745  3.435   1.00 0.00 ? 44 HIS A HE1  1  
ATOM 586   H HE2  . HIS A 1 44 ? -6.729  -9.951  3.218   1.00 0.00 ? 44 HIS A HE2  1  
ATOM 587   N N    . ARG A 1 45 ? -4.809  -3.653  1.263   1.00 0.00 ? 45 ARG A N    1  
ATOM 588   C CA   . ARG A 1 45 ? -5.567  -2.537  1.814   1.00 0.00 ? 45 ARG A CA   1  
ATOM 589   C C    . ARG A 1 45 ? -6.496  -1.946  0.758   1.00 0.00 ? 45 ARG A C    1  
ATOM 590   O O    . ARG A 1 45 ? -7.701  -1.818  0.979   1.00 0.00 ? 45 ARG A O    1  
ATOM 591   C CB   . ARG A 1 45 ? -4.611  -1.455  2.318   1.00 0.00 ? 45 ARG A CB   1  
ATOM 592   C CG   . ARG A 1 45 ? -5.415  -0.319  2.958   1.00 0.00 ? 45 ARG A CG   1  
ATOM 593   C CD   . ARG A 1 45 ? -4.503  0.506   3.866   1.00 0.00 ? 45 ARG A CD   1  
ATOM 594   N NE   . ARG A 1 45 ? -4.316  -0.174  5.144   1.00 0.00 ? 45 ARG A NE   1  
ATOM 595   C CZ   . ARG A 1 45 ? -3.550  0.350   6.095   1.00 0.00 ? 45 ARG A CZ   1  
ATOM 596   N NH1  . ARG A 1 45 ? -2.948  1.491   5.894   1.00 0.00 ? 45 ARG A NH1  1  
ATOM 597   N NH2  . ARG A 1 45 ? -3.400  -0.276  7.231   1.00 0.00 ? 45 ARG A NH2  1  
ATOM 598   H H    . ARG A 1 45 ? -3.832  -3.593  1.211   1.00 0.00 ? 45 ARG A H    1  
ATOM 599   H HA   . ARG A 1 45 ? -6.159  -2.889  2.643   1.00 0.00 ? 45 ARG A HA   1  
ATOM 600   H HB2  . ARG A 1 45 ? -3.940  -1.881  3.050   1.00 0.00 ? 45 ARG A HB2  1  
ATOM 601   H HB3  . ARG A 1 45 ? -4.038  -1.066  1.489   1.00 0.00 ? 45 ARG A HB3  1  
ATOM 602   H HG2  . ARG A 1 45 ? -5.819  0.315   2.183   1.00 0.00 ? 45 ARG A HG2  1  
ATOM 603   H HG3  . ARG A 1 45 ? -6.222  -0.733  3.542   1.00 0.00 ? 45 ARG A HG3  1  
ATOM 604   H HD2  . ARG A 1 45 ? -3.544  0.636   3.390   1.00 0.00 ? 45 ARG A HD2  1  
ATOM 605   H HD3  . ARG A 1 45 ? -4.951  1.473   4.037   1.00 0.00 ? 45 ARG A HD3  1  
ATOM 606   H HE   . ARG A 1 45 ? -4.763  -1.031  5.303   1.00 0.00 ? 45 ARG A HE   1  
ATOM 607   H HH11 . ARG A 1 45 ? -3.063  1.970   5.024   1.00 0.00 ? 45 ARG A HH11 1  
ATOM 608   H HH12 . ARG A 1 45 ? -2.372  1.885   6.610   1.00 0.00 ? 45 ARG A HH12 1  
ATOM 609   H HH21 . ARG A 1 45 ? -3.861  -1.149  7.385   1.00 0.00 ? 45 ARG A HH21 1  
ATOM 610   H HH22 . ARG A 1 45 ? -2.825  0.119   7.947   1.00 0.00 ? 45 ARG A HH22 1  
ATOM 611   N N    . ARG A 1 46 ? -5.929  -1.587  -0.389  1.00 0.00 ? 46 ARG A N    1  
ATOM 612   C CA   . ARG A 1 46 ? -6.717  -1.010  -1.472  1.00 0.00 ? 46 ARG A CA   1  
ATOM 613   C C    . ARG A 1 46 ? -7.823  -1.971  -1.900  1.00 0.00 ? 46 ARG A C    1  
ATOM 614   O O    . ARG A 1 46 ? -8.939  -1.550  -2.201  1.00 0.00 ? 46 ARG A O    1  
ATOM 615   C CB   . ARG A 1 46 ? -5.814  -0.698  -2.667  1.00 0.00 ? 46 ARG A CB   1  
ATOM 616   C CG   . ARG A 1 46 ? -6.498  0.327   -3.575  1.00 0.00 ? 46 ARG A CG   1  
ATOM 617   C CD   . ARG A 1 46 ? -5.583  0.659   -4.758  1.00 0.00 ? 46 ARG A CD   1  
ATOM 618   N NE   . ARG A 1 46 ? -5.702  -0.366  -5.788  1.00 0.00 ? 46 ARG A NE   1  
ATOM 619   C CZ   . ARG A 1 46 ? -6.690  -0.338  -6.675  1.00 0.00 ? 46 ARG A CZ   1  
ATOM 620   N NH1  . ARG A 1 46 ? -7.572  0.622   -6.638  1.00 0.00 ? 46 ARG A NH1  1  
ATOM 621   N NH2  . ARG A 1 46 ? -6.776  -1.268  -7.586  1.00 0.00 ? 46 ARG A NH2  1  
ATOM 622   H H    . ARG A 1 46 ? -4.964  -1.711  -0.509  1.00 0.00 ? 46 ARG A H    1  
ATOM 623   H HA   . ARG A 1 46 ? -7.166  -0.091  -1.125  1.00 0.00 ? 46 ARG A HA   1  
ATOM 624   H HB2  . ARG A 1 46 ? -4.875  -0.296  -2.312  1.00 0.00 ? 46 ARG A HB2  1  
ATOM 625   H HB3  . ARG A 1 46 ? -5.629  -1.603  -3.226  1.00 0.00 ? 46 ARG A HB3  1  
ATOM 626   H HG2  . ARG A 1 46 ? -7.428  -0.081  -3.941  1.00 0.00 ? 46 ARG A HG2  1  
ATOM 627   H HG3  . ARG A 1 46 ? -6.696  1.228   -3.014  1.00 0.00 ? 46 ARG A HG3  1  
ATOM 628   H HD2  . ARG A 1 46 ? -5.868  1.613   -5.171  1.00 0.00 ? 46 ARG A HD2  1  
ATOM 629   H HD3  . ARG A 1 46 ? -4.558  0.709   -4.416  1.00 0.00 ? 46 ARG A HD3  1  
ATOM 630   H HE   . ARG A 1 46 ? -5.041  -1.091  -5.825  1.00 0.00 ? 46 ARG A HE   1  
ATOM 631   H HH11 . ARG A 1 46 ? -7.506  1.336   -5.941  1.00 0.00 ? 46 ARG A HH11 1  
ATOM 632   H HH12 . ARG A 1 46 ? -8.316  0.643   -7.306  1.00 0.00 ? 46 ARG A HH12 1  
ATOM 633   H HH21 . ARG A 1 46 ? -6.099  -2.005  -7.615  1.00 0.00 ? 46 ARG A HH21 1  
ATOM 634   H HH22 . ARG A 1 46 ? -7.519  -1.247  -8.255  1.00 0.00 ? 46 ARG A HH22 1  
ATOM 635   N N    . LEU A 1 47 ? -7.505  -3.261  -1.922  1.00 0.00 ? 47 LEU A N    1  
ATOM 636   C CA   . LEU A 1 47 ? -8.483  -4.269  -2.314  1.00 0.00 ? 47 LEU A CA   1  
ATOM 637   C C    . LEU A 1 47 ? -9.538  -4.441  -1.226  1.00 0.00 ? 47 LEU A C    1  
ATOM 638   O O    . LEU A 1 47 ? -10.701 -4.727  -1.514  1.00 0.00 ? 47 LEU A O    1  
ATOM 639   C CB   . LEU A 1 47 ? -7.782  -5.611  -2.564  1.00 0.00 ? 47 LEU A CB   1  
ATOM 640   C CG   . LEU A 1 47 ? -7.070  -5.581  -3.925  1.00 0.00 ? 47 LEU A CG   1  
ATOM 641   C CD1  . LEU A 1 47 ? -5.880  -6.545  -3.903  1.00 0.00 ? 47 LEU A CD1  1  
ATOM 642   C CD2  . LEU A 1 47 ? -8.044  -6.011  -5.028  1.00 0.00 ? 47 LEU A CD2  1  
ATOM 643   H H    . LEU A 1 47 ? -6.600  -3.539  -1.670  1.00 0.00 ? 47 LEU A H    1  
ATOM 644   H HA   . LEU A 1 47 ? -8.967  -3.952  -3.225  1.00 0.00 ? 47 LEU A HA   1  
ATOM 645   H HB2  . LEU A 1 47 ? -7.058  -5.784  -1.782  1.00 0.00 ? 47 LEU A HB2  1  
ATOM 646   H HB3  . LEU A 1 47 ? -8.513  -6.405  -2.559  1.00 0.00 ? 47 LEU A HB3  1  
ATOM 647   H HG   . LEU A 1 47 ? -6.715  -4.581  -4.126  1.00 0.00 ? 47 LEU A HG   1  
ATOM 648   H HD11 . LEU A 1 47 ? -5.455  -6.613  -4.893  1.00 0.00 ? 47 LEU A HD11 1  
ATOM 649   H HD12 . LEU A 1 47 ? -6.215  -7.523  -3.587  1.00 0.00 ? 47 LEU A HD12 1  
ATOM 650   H HD13 . LEU A 1 47 ? -5.134  -6.181  -3.213  1.00 0.00 ? 47 LEU A HD13 1  
ATOM 651   H HD21 . LEU A 1 47 ? -7.647  -5.724  -5.991  1.00 0.00 ? 47 LEU A HD21 1  
ATOM 652   H HD22 . LEU A 1 47 ? -8.999  -5.529  -4.875  1.00 0.00 ? 47 LEU A HD22 1  
ATOM 653   H HD23 . LEU A 1 47 ? -8.174  -7.082  -4.997  1.00 0.00 ? 47 LEU A HD23 1  
ATOM 654   N N    . LYS A 1 48 ? -9.127  -4.261  0.026   1.00 0.00 ? 48 LYS A N    1  
ATOM 655   C CA   . LYS A 1 48 ? -10.047 -4.397  1.149   1.00 0.00 ? 48 LYS A CA   1  
ATOM 656   C C    . LYS A 1 48 ? -11.110 -3.305  1.104   1.00 0.00 ? 48 LYS A C    1  
ATOM 657   O O    . LYS A 1 48 ? -12.308 -3.589  1.144   1.00 0.00 ? 48 LYS A O    1  
ATOM 658   C CB   . LYS A 1 48 ? -9.277  -4.309  2.468   1.00 0.00 ? 48 LYS A CB   1  
ATOM 659   C CG   . LYS A 1 48 ? -10.235 -4.547  3.637   1.00 0.00 ? 48 LYS A CG   1  
ATOM 660   C CD   . LYS A 1 48 ? -9.430  -4.812  4.911   1.00 0.00 ? 48 LYS A CD   1  
ATOM 661   C CE   . LYS A 1 48 ? -10.383 -5.152  6.057   1.00 0.00 ? 48 LYS A CE   1  
ATOM 662   N NZ   . LYS A 1 48 ? -9.613  -5.753  7.183   1.00 0.00 ? 48 LYS A NZ   1  
ATOM 663   H H    . LYS A 1 48 ? -8.188  -4.032  0.196   1.00 0.00 ? 48 LYS A H    1  
ATOM 664   H HA   . LYS A 1 48 ? -10.530 -5.359  1.090   1.00 0.00 ? 48 LYS A HA   1  
ATOM 665   H HB2  . LYS A 1 48 ? -8.498  -5.058  2.481   1.00 0.00 ? 48 LYS A HB2  1  
ATOM 666   H HB3  . LYS A 1 48 ? -8.834  -3.329  2.562   1.00 0.00 ? 48 LYS A HB3  1  
ATOM 667   H HG2  . LYS A 1 48 ? -10.855 -3.674  3.776   1.00 0.00 ? 48 LYS A HG2  1  
ATOM 668   H HG3  . LYS A 1 48 ? -10.859 -5.401  3.423   1.00 0.00 ? 48 LYS A HG3  1  
ATOM 669   H HD2  . LYS A 1 48 ? -8.756  -5.640  4.745   1.00 0.00 ? 48 LYS A HD2  1  
ATOM 670   H HD3  . LYS A 1 48 ? -8.861  -3.931  5.167   1.00 0.00 ? 48 LYS A HD3  1  
ATOM 671   H HE2  . LYS A 1 48 ? -10.873 -4.251  6.397   1.00 0.00 ? 48 LYS A HE2  1  
ATOM 672   H HE3  . LYS A 1 48 ? -11.125 -5.856  5.712   1.00 0.00 ? 48 LYS A HE3  1  
ATOM 673   H HZ1  . LYS A 1 48 ? -10.201 -5.759  8.040   1.00 0.00 ? 48 LYS A HZ1  1  
ATOM 674   H HZ2  . LYS A 1 48 ? -8.756  -5.190  7.357   1.00 0.00 ? 48 LYS A HZ2  1  
ATOM 675   H HZ3  . LYS A 1 48 ? -9.345  -6.728  6.937   1.00 0.00 ? 48 LYS A HZ3  1  
ATOM 676   N N    . VAL A 1 49 ? -10.667 -2.055  1.018   1.00 0.00 ? 49 VAL A N    1  
ATOM 677   C CA   . VAL A 1 49 ? -11.591 -0.930  0.966   1.00 0.00 ? 49 VAL A CA   1  
ATOM 678   C C    . VAL A 1 49 ? -12.380 -0.947  -0.340  1.00 0.00 ? 49 VAL A C    1  
ATOM 679   O O    . VAL A 1 49 ? -13.578 -0.663  -0.357  1.00 0.00 ? 49 VAL A O    1  
ATOM 680   C CB   . VAL A 1 49 ? -10.822 0.386   1.082   1.00 0.00 ? 49 VAL A CB   1  
ATOM 681   C CG1  . VAL A 1 49 ? -10.080 0.430   2.419   1.00 0.00 ? 49 VAL A CG1  1  
ATOM 682   C CG2  . VAL A 1 49 ? -9.811  0.489   -0.063  1.00 0.00 ? 49 VAL A CG2  1  
ATOM 683   H H    . VAL A 1 49 ? -9.702  -1.888  0.987   1.00 0.00 ? 49 VAL A H    1  
ATOM 684   H HA   . VAL A 1 49 ? -12.282 -1.004  1.792   1.00 0.00 ? 49 VAL A HA   1  
ATOM 685   H HB   . VAL A 1 49 ? -11.514 1.215   1.028   1.00 0.00 ? 49 VAL A HB   1  
ATOM 686   H HG11 . VAL A 1 49 ? -9.553  1.369   2.509   1.00 0.00 ? 49 VAL A HG11 1  
ATOM 687   H HG12 . VAL A 1 49 ? -9.373  -0.386  2.464   1.00 0.00 ? 49 VAL A HG12 1  
ATOM 688   H HG13 . VAL A 1 49 ? -10.790 0.337   3.228   1.00 0.00 ? 49 VAL A HG13 1  
ATOM 689   H HG21 . VAL A 1 49 ? -10.334 0.687   -0.988  1.00 0.00 ? 49 VAL A HG21 1  
ATOM 690   H HG22 . VAL A 1 49 ? -9.269  -0.441  -0.149  1.00 0.00 ? 49 VAL A HG22 1  
ATOM 691   H HG23 . VAL A 1 49 ? -9.118  1.292   0.138   1.00 0.00 ? 49 VAL A HG23 1  
ATOM 692   N N    . TYR A 1 50 ? -11.700 -1.287  -1.431  1.00 0.00 ? 50 TYR A N    1  
ATOM 693   C CA   . TYR A 1 50 ? -12.347 -1.342  -2.735  1.00 0.00 ? 50 TYR A CA   1  
ATOM 694   C C    . TYR A 1 50 ? -13.369 -2.471  -2.775  1.00 0.00 ? 50 TYR A C    1  
ATOM 695   O O    . TYR A 1 50 ? -14.372 -2.391  -3.485  1.00 0.00 ? 50 TYR A O    1  
ATOM 696   C CB   . TYR A 1 50 ? -11.298 -1.559  -3.829  1.00 0.00 ? 50 TYR A CB   1  
ATOM 697   C CG   . TYR A 1 50 ? -11.985 -1.687  -5.167  1.00 0.00 ? 50 TYR A CG   1  
ATOM 698   C CD1  . TYR A 1 50 ? -12.367 -0.538  -5.871  1.00 0.00 ? 50 TYR A CD1  1  
ATOM 699   C CD2  . TYR A 1 50 ? -12.243 -2.954  -5.706  1.00 0.00 ? 50 TYR A CD2  1  
ATOM 700   C CE1  . TYR A 1 50 ? -13.005 -0.655  -7.111  1.00 0.00 ? 50 TYR A CE1  1  
ATOM 701   C CE2  . TYR A 1 50 ? -12.880 -3.071  -6.947  1.00 0.00 ? 50 TYR A CE2  1  
ATOM 702   C CZ   . TYR A 1 50 ? -13.262 -1.922  -7.648  1.00 0.00 ? 50 TYR A CZ   1  
ATOM 703   O OH   . TYR A 1 50 ? -13.890 -2.039  -8.873  1.00 0.00 ? 50 TYR A OH   1  
ATOM 704   H H    . TYR A 1 50 ? -10.747 -1.504  -1.355  1.00 0.00 ? 50 TYR A H    1  
ATOM 705   H HA   . TYR A 1 50 ? -12.851 -0.405  -2.918  1.00 0.00 ? 50 TYR A HA   1  
ATOM 706   H HB2  . TYR A 1 50 ? -10.620 -0.719  -3.851  1.00 0.00 ? 50 TYR A HB2  1  
ATOM 707   H HB3  . TYR A 1 50 ? -10.745 -2.463  -3.622  1.00 0.00 ? 50 TYR A HB3  1  
ATOM 708   H HD1  . TYR A 1 50 ? -12.169 0.439   -5.456  1.00 0.00 ? 50 TYR A HD1  1  
ATOM 709   H HD2  . TYR A 1 50 ? -11.949 -3.840  -5.164  1.00 0.00 ? 50 TYR A HD2  1  
ATOM 710   H HE1  . TYR A 1 50 ? -13.299 0.232   -7.653  1.00 0.00 ? 50 TYR A HE1  1  
ATOM 711   H HE2  . TYR A 1 50 ? -13.079 -4.049  -7.361  1.00 0.00 ? 50 TYR A HE2  1  
ATOM 712   H HH   . TYR A 1 50 ? -14.419 -2.839  -8.859  1.00 0.00 ? 50 TYR A HH   1  
ATOM 713   N N    . HIS A 1 51 ? -13.107 -3.525  -2.009  1.00 0.00 ? 51 HIS A N    1  
ATOM 714   C CA   . HIS A 1 51 ? -14.011 -4.669  -1.962  1.00 0.00 ? 51 HIS A CA   1  
ATOM 715   C C    . HIS A 1 51 ? -15.190 -4.380  -1.038  1.00 0.00 ? 51 HIS A C    1  
ATOM 716   O O    . HIS A 1 51 ? -16.306 -4.840  -1.278  1.00 0.00 ? 51 HIS A O    1  
ATOM 717   C CB   . HIS A 1 51 ? -13.261 -5.906  -1.466  1.00 0.00 ? 51 HIS A CB   1  
ATOM 718   C CG   . HIS A 1 51 ? -14.210 -7.069  -1.384  1.00 0.00 ? 51 HIS A CG   1  
ATOM 719   N ND1  . HIS A 1 51 ? -14.770 -7.484  -0.187  1.00 0.00 ? 51 HIS A ND1  1  
ATOM 720   C CD2  . HIS A 1 51 ? -14.706 -7.918  -2.344  1.00 0.00 ? 51 HIS A CD2  1  
ATOM 721   C CE1  . HIS A 1 51 ? -15.563 -8.538  -0.452  1.00 0.00 ? 51 HIS A CE1  1  
ATOM 722   N NE2  . HIS A 1 51 ? -15.560 -8.845  -1.752  1.00 0.00 ? 51 HIS A NE2  1  
ATOM 723   H H    . HIS A 1 51 ? -12.293 -3.533  -1.465  1.00 0.00 ? 51 HIS A H    1  
ATOM 724   H HA   . HIS A 1 51 ? -14.385 -4.862  -2.956  1.00 0.00 ? 51 HIS A HA   1  
ATOM 725   H HB2  . HIS A 1 51 ? -12.461 -6.142  -2.155  1.00 0.00 ? 51 HIS A HB2  1  
ATOM 726   H HB3  . HIS A 1 51 ? -12.848 -5.710  -0.489  1.00 0.00 ? 51 HIS A HB3  1  
ATOM 727   H HD2  . HIS A 1 51 ? -14.470 -7.872  -3.396  1.00 0.00 ? 51 HIS A HD2  1  
ATOM 728   H HE1  . HIS A 1 51 ? -16.132 -9.071  0.295   1.00 0.00 ? 51 HIS A HE1  1  
ATOM 729   H HE2  . HIS A 1 51 ? -16.053 -9.565  -2.195  1.00 0.00 ? 51 HIS A HE2  1  
ATOM 730   N N    . ALA A 1 52 ? -14.935 -3.617  0.019   1.00 0.00 ? 52 ALA A N    1  
ATOM 731   C CA   . ALA A 1 52 ? -15.984 -3.273  0.972   1.00 0.00 ? 52 ALA A CA   1  
ATOM 732   C C    . ALA A 1 52 ? -16.928 -2.234  0.377   1.00 0.00 ? 52 ALA A C    1  
ATOM 733   O O    . ALA A 1 52 ? -18.126 -2.234  0.661   1.00 0.00 ? 52 ALA A O    1  
ATOM 734   C CB   . ALA A 1 52 ? -15.364 -2.724  2.258   1.00 0.00 ? 52 ALA A CB   1  
ATOM 735   H H    . ALA A 1 52 ? -14.027 -3.278  0.161   1.00 0.00 ? 52 ALA A H    1  
ATOM 736   H HA   . ALA A 1 52 ? -16.547 -4.163  1.209   1.00 0.00 ? 52 ALA A HA   1  
ATOM 737   H HB1  . ALA A 1 52 ? -14.618 -3.416  2.622   1.00 0.00 ? 52 ALA A HB1  1  
ATOM 738   H HB2  . ALA A 1 52 ? -16.132 -2.600  3.005   1.00 0.00 ? 52 ALA A HB2  1  
ATOM 739   H HB3  . ALA A 1 52 ? -14.900 -1.771  2.056   1.00 0.00 ? 52 ALA A HB3  1  
ATOM 740   N N    . TRP A 1 53 ? -16.380 -1.348  -0.449  1.00 0.00 ? 53 TRP A N    1  
ATOM 741   C CA   . TRP A 1 53 ? -17.184 -0.306  -1.078  1.00 0.00 ? 53 TRP A CA   1  
ATOM 742   C C    . TRP A 1 53 ? -18.310 -0.923  -1.903  1.00 0.00 ? 53 TRP A C    1  
ATOM 743   O O    . TRP A 1 53 ? -19.475 -0.883  -1.506  1.00 0.00 ? 53 TRP A O    1  
ATOM 744   C CB   . TRP A 1 53 ? -16.300 0.560   -1.982  1.00 0.00 ? 53 TRP A CB   1  
ATOM 745   C CG   . TRP A 1 53 ? -15.530 1.536   -1.148  1.00 0.00 ? 53 TRP A CG   1  
ATOM 746   C CD1  . TRP A 1 53 ? -15.188 1.355   0.148   1.00 0.00 ? 53 TRP A CD1  1  
ATOM 747   C CD2  . TRP A 1 53 ? -15.002 2.841   -1.531  1.00 0.00 ? 53 TRP A CD2  1  
ATOM 748   N NE1  . TRP A 1 53 ? -14.486 2.463   0.585   1.00 0.00 ? 53 TRP A NE1  1  
ATOM 749   C CE2  . TRP A 1 53 ? -14.344 3.405   -0.412  1.00 0.00 ? 53 TRP A CE2  1  
ATOM 750   C CE3  . TRP A 1 53 ? -15.030 3.579   -2.728  1.00 0.00 ? 53 TRP A CE3  1  
ATOM 751   C CZ2  . TRP A 1 53 ? -13.735 4.660   -0.480  1.00 0.00 ? 53 TRP A CZ2  1  
ATOM 752   C CZ3  . TRP A 1 53 ? -14.419 4.842   -2.798  1.00 0.00 ? 53 TRP A CZ3  1  
ATOM 753   C CH2  . TRP A 1 53 ? -13.773 5.381   -1.676  1.00 0.00 ? 53 TRP A CH2  1  
ATOM 754   H H    . TRP A 1 53 ? -15.420 -1.397  -0.637  1.00 0.00 ? 53 TRP A H    1  
ATOM 755   H HA   . TRP A 1 53 ? -17.615 0.316   -0.310  1.00 0.00 ? 53 TRP A HA   1  
ATOM 756   H HB2  . TRP A 1 53 ? -15.610 -0.071  -2.522  1.00 0.00 ? 53 TRP A HB2  1  
ATOM 757   H HB3  . TRP A 1 53 ? -16.919 1.100   -2.684  1.00 0.00 ? 53 TRP A HB3  1  
ATOM 758   H HD1  . TRP A 1 53 ? -15.425 0.487   0.745   1.00 0.00 ? 53 TRP A HD1  1  
ATOM 759   H HE1  . TRP A 1 53 ? -14.123 2.583   1.489   1.00 0.00 ? 53 TRP A HE1  1  
ATOM 760   H HE3  . TRP A 1 53 ? -15.525 3.174   -3.597  1.00 0.00 ? 53 TRP A HE3  1  
ATOM 761   H HZ2  . TRP A 1 53 ? -13.240 5.070   0.387   1.00 0.00 ? 53 TRP A HZ2  1  
ATOM 762   H HZ3  . TRP A 1 53 ? -14.447 5.401   -3.721  1.00 0.00 ? 53 TRP A HZ3  1  
ATOM 763   H HH2  . TRP A 1 53 ? -13.305 6.352   -1.736  1.00 0.00 ? 53 TRP A HH2  1  
ATOM 764   N N    . LYS A 1 54 ? -17.955 -1.492  -3.049  1.00 0.00 ? 54 LYS A N    1  
ATOM 765   C CA   . LYS A 1 54 ? -18.946 -2.115  -3.921  1.00 0.00 ? 54 LYS A CA   1  
ATOM 766   C C    . LYS A 1 54 ? -19.843 -3.058  -3.124  1.00 0.00 ? 54 LYS A C    1  
ATOM 767   O O    . LYS A 1 54 ? -21.049 -3.131  -3.363  1.00 0.00 ? 54 LYS A O    1  
ATOM 768   C CB   . LYS A 1 54 ? -18.246 -2.893  -5.037  1.00 0.00 ? 54 LYS A CB   1  
ATOM 769   C CG   . LYS A 1 54 ? -17.550 -4.123  -4.448  1.00 0.00 ? 54 LYS A CG   1  
ATOM 770   C CD   . LYS A 1 54 ? -16.585 -4.710  -5.482  1.00 0.00 ? 54 LYS A CD   1  
ATOM 771   C CE   . LYS A 1 54 ? -16.210 -6.138  -5.079  1.00 0.00 ? 54 LYS A CE   1  
ATOM 772   N NZ   . LYS A 1 54 ? -14.992 -6.561  -5.826  1.00 0.00 ? 54 LYS A NZ   1  
ATOM 773   H H    . LYS A 1 54 ? -17.012 -1.495  -3.315  1.00 0.00 ? 54 LYS A H    1  
ATOM 774   H HA   . LYS A 1 54 ? -19.556 -1.341  -4.364  1.00 0.00 ? 54 LYS A HA   1  
ATOM 775   H HB2  . LYS A 1 54 ? -18.975 -3.208  -5.769  1.00 0.00 ? 54 LYS A HB2  1  
ATOM 776   H HB3  . LYS A 1 54 ? -17.511 -2.259  -5.511  1.00 0.00 ? 54 LYS A HB3  1  
ATOM 777   H HG2  . LYS A 1 54 ? -16.999 -3.834  -3.564  1.00 0.00 ? 54 LYS A HG2  1  
ATOM 778   H HG3  . LYS A 1 54 ? -18.289 -4.863  -4.187  1.00 0.00 ? 54 LYS A HG3  1  
ATOM 779   H HD2  . LYS A 1 54 ? -17.060 -4.722  -6.452  1.00 0.00 ? 54 LYS A HD2  1  
ATOM 780   H HD3  . LYS A 1 54 ? -15.692 -4.105  -5.526  1.00 0.00 ? 54 LYS A HD3  1  
ATOM 781   H HE2  . LYS A 1 54 ? -16.013 -6.174  -4.018  1.00 0.00 ? 54 LYS A HE2  1  
ATOM 782   H HE3  . LYS A 1 54 ? -17.026 -6.805  -5.315  1.00 0.00 ? 54 LYS A HE3  1  
ATOM 783   H HZ1  . LYS A 1 54 ? -15.215 -7.390  -6.412  1.00 0.00 ? 54 LYS A HZ1  1  
ATOM 784   H HZ2  . LYS A 1 54 ? -14.241 -6.809  -5.153  1.00 0.00 ? 54 LYS A HZ2  1  
ATOM 785   H HZ3  . LYS A 1 54 ? -14.670 -5.780  -6.434  1.00 0.00 ? 54 LYS A HZ3  1  
ATOM 786   N N    . SER A 1 55 ? -19.247 -3.776  -2.179  1.00 0.00 ? 55 SER A N    1  
ATOM 787   C CA   . SER A 1 55 ? -20.001 -4.714  -1.354  1.00 0.00 ? 55 SER A CA   1  
ATOM 788   C C    . SER A 1 55 ? -20.755 -5.711  -2.225  1.00 0.00 ? 55 SER A C    1  
ATOM 789   O O    . SER A 1 55 ? -20.295 -6.830  -2.449  1.00 0.00 ? 55 SER A O    1  
ATOM 790   C CB   . SER A 1 55 ? -20.989 -3.953  -0.470  1.00 0.00 ? 55 SER A CB   1  
ATOM 791   O OG   . SER A 1 55 ? -20.275 -3.260  0.545   1.00 0.00 ? 55 SER A OG   1  
ATOM 792   H H    . SER A 1 55 ? -18.282 -3.677  -2.036  1.00 0.00 ? 55 SER A H    1  
ATOM 793   H HA   . SER A 1 55 ? -19.311 -5.254  -0.721  1.00 0.00 ? 55 SER A HA   1  
ATOM 794   H HB2  . SER A 1 55 ? -21.535 -3.241  -1.067  1.00 0.00 ? 55 SER A HB2  1  
ATOM 795   H HB3  . SER A 1 55 ? -21.683 -4.653  -0.023  1.00 0.00 ? 55 SER A HB3  1  
ATOM 796   H HG   . SER A 1 55 ? -20.683 -3.468  1.389   1.00 0.00 ? 55 SER A HG   1  
ATOM 797   N N    . LYS A 1 56 ? -21.919 -5.297  -2.717  1.00 0.00 ? 56 LYS A N    1  
ATOM 798   C CA   . LYS A 1 56 ? -22.732 -6.163  -3.565  1.00 0.00 ? 56 LYS A CA   1  
ATOM 799   C C    . LYS A 1 56 ? -23.001 -7.494  -2.867  1.00 0.00 ? 56 LYS A C    1  
ATOM 800   O O    . LYS A 1 56 ? -24.001 -7.646  -2.166  1.00 0.00 ? 56 LYS A O    1  
ATOM 801   C CB   . LYS A 1 56 ? -22.014 -6.416  -4.895  1.00 0.00 ? 56 LYS A CB   1  
ATOM 802   C CG   . LYS A 1 56 ? -22.097 -5.161  -5.775  1.00 0.00 ? 56 LYS A CG   1  
ATOM 803   C CD   . LYS A 1 56 ? -23.397 -5.181  -6.595  1.00 0.00 ? 56 LYS A CD   1  
ATOM 804   C CE   . LYS A 1 56 ? -23.176 -5.958  -7.896  1.00 0.00 ? 56 LYS A CE   1  
ATOM 805   N NZ   . LYS A 1 56 ? -22.429 -5.104  -8.863  1.00 0.00 ? 56 LYS A NZ   1  
ATOM 806   H H    . LYS A 1 56 ? -22.239 -4.395  -2.505  1.00 0.00 ? 56 LYS A H    1  
ATOM 807   H HA   . LYS A 1 56 ? -23.674 -5.676  -3.763  1.00 0.00 ? 56 LYS A HA   1  
ATOM 808   H HB2  . LYS A 1 56 ? -20.976 -6.652  -4.702  1.00 0.00 ? 56 LYS A HB2  1  
ATOM 809   H HB3  . LYS A 1 56 ? -22.481 -7.244  -5.404  1.00 0.00 ? 56 LYS A HB3  1  
ATOM 810   H HG2  . LYS A 1 56 ? -22.081 -4.280  -5.149  1.00 0.00 ? 56 LYS A HG2  1  
ATOM 811   H HG3  . LYS A 1 56 ? -21.252 -5.139  -6.446  1.00 0.00 ? 56 LYS A HG3  1  
ATOM 812   H HD2  . LYS A 1 56 ? -24.180 -5.654  -6.020  1.00 0.00 ? 56 LYS A HD2  1  
ATOM 813   H HD3  . LYS A 1 56 ? -23.687 -4.167  -6.828  1.00 0.00 ? 56 LYS A HD3  1  
ATOM 814   H HE2  . LYS A 1 56 ? -22.608 -6.852  -7.691  1.00 0.00 ? 56 LYS A HE2  1  
ATOM 815   H HE3  . LYS A 1 56 ? -24.132 -6.228  -8.318  1.00 0.00 ? 56 LYS A HE3  1  
ATOM 816   H HZ1  . LYS A 1 56 ? -21.707 -5.677  -9.343  1.00 0.00 ? 56 LYS A HZ1  1  
ATOM 817   H HZ2  . LYS A 1 56 ? -21.968 -4.324  -8.353  1.00 0.00 ? 56 LYS A HZ2  1  
ATOM 818   H HZ3  . LYS A 1 56 ? -23.091 -4.716  -9.566  1.00 0.00 ? 56 LYS A HZ3  1  
ATOM 819   N N    . ASN A 1 57 ? -22.102 -8.452  -3.065  1.00 0.00 ? 57 ASN A N    1  
ATOM 820   C CA   . ASN A 1 57 ? -22.254 -9.766  -2.448  1.00 0.00 ? 57 ASN A CA   1  
ATOM 821   C C    . ASN A 1 57 ? -22.521 -9.627  -0.953  1.00 0.00 ? 57 ASN A C    1  
ATOM 822   O O    . ASN A 1 57 ? -21.593 -9.488  -0.156  1.00 0.00 ? 57 ASN A O    1  
ATOM 823   C CB   . ASN A 1 57 ? -20.987 -10.596 -2.668  1.00 0.00 ? 57 ASN A CB   1  
ATOM 824   C CG   . ASN A 1 57 ? -20.744 -10.790 -4.160  1.00 0.00 ? 57 ASN A CG   1  
ATOM 825   O OD1  . ASN A 1 57 ? -19.729 -11.367 -4.554  1.00 0.00 ? 57 ASN A OD1  1  
ATOM 826   N ND2  . ASN A 1 57 ? -21.617 -10.340 -5.019  1.00 0.00 ? 57 ASN A ND2  1  
ATOM 827   H H    . ASN A 1 57 ? -21.324 -8.273  -3.632  1.00 0.00 ? 57 ASN A H    1  
ATOM 828   H HA   . ASN A 1 57 ? -23.087 -10.274 -2.909  1.00 0.00 ? 57 ASN A HA   1  
ATOM 829   H HB2  . ASN A 1 57 ? -20.144 -10.083 -2.229  1.00 0.00 ? 57 ASN A HB2  1  
ATOM 830   H HB3  . ASN A 1 57 ? -21.105 -11.561 -2.197  1.00 0.00 ? 57 ASN A HB3  1  
ATOM 831   H HD21 . ASN A 1 57 ? -22.423 -9.881  -4.704  1.00 0.00 ? 57 ASN A HD21 1  
ATOM 832   H HD22 . ASN A 1 57 ? -21.466 -10.461 -5.981  1.00 0.00 ? 57 ASN A HD22 1  
ATOM 833   N N    . LYS A 1 58 ? -23.796 -9.666  -0.579  1.00 0.00 ? 58 LYS A N    1  
ATOM 834   C CA   . LYS A 1 58 ? -24.174 -9.545  0.824   1.00 0.00 ? 58 LYS A CA   1  
ATOM 835   C C    . LYS A 1 58 ? -25.665 -9.814  1.000   1.00 0.00 ? 58 LYS A C    1  
ATOM 836   O O    . LYS A 1 58 ? -26.489 -9.337  0.219   1.00 0.00 ? 58 LYS A O    1  
ATOM 837   C CB   . LYS A 1 58 ? -23.843 -8.141  1.334   1.00 0.00 ? 58 LYS A CB   1  
ATOM 838   C CG   . LYS A 1 58 ? -24.012 -8.096  2.857   1.00 0.00 ? 58 LYS A CG   1  
ATOM 839   C CD   . LYS A 1 58 ? -23.467 -6.767  3.404   1.00 0.00 ? 58 LYS A CD   1  
ATOM 840   C CE   . LYS A 1 58 ? -22.015 -6.947  3.855   1.00 0.00 ? 58 LYS A CE   1  
ATOM 841   N NZ   . LYS A 1 58 ? -21.288 -7.804  2.878   1.00 0.00 ? 58 LYS A NZ   1  
ATOM 842   H H    . LYS A 1 58 ? -24.494 -9.780  -1.256  1.00 0.00 ? 58 LYS A H    1  
ATOM 843   H HA   . LYS A 1 58 ? -23.618 -10.266 1.402   1.00 0.00 ? 58 LYS A HA   1  
ATOM 844   H HB2  . LYS A 1 58 ? -22.824 -7.895  1.075   1.00 0.00 ? 58 LYS A HB2  1  
ATOM 845   H HB3  . LYS A 1 58 ? -24.513 -7.425  0.880   1.00 0.00 ? 58 LYS A HB3  1  
ATOM 846   H HG2  . LYS A 1 58 ? -25.062 -8.183  3.100   1.00 0.00 ? 58 LYS A HG2  1  
ATOM 847   H HG3  . LYS A 1 58 ? -23.472 -8.918  3.302   1.00 0.00 ? 58 LYS A HG3  1  
ATOM 848   H HD2  . LYS A 1 58 ? -23.514 -6.011  2.633   1.00 0.00 ? 58 LYS A HD2  1  
ATOM 849   H HD3  . LYS A 1 58 ? -24.066 -6.454  4.248   1.00 0.00 ? 58 LYS A HD3  1  
ATOM 850   H HE2  . LYS A 1 58 ? -21.534 -5.981  3.912   1.00 0.00 ? 58 LYS A HE2  1  
ATOM 851   H HE3  . LYS A 1 58 ? -21.995 -7.415  4.829   1.00 0.00 ? 58 LYS A HE3  1  
ATOM 852   H HZ1  . LYS A 1 58 ? -20.296 -7.903  3.171   1.00 0.00 ? 58 LYS A HZ1  1  
ATOM 853   H HZ2  . LYS A 1 58 ? -21.326 -7.365  1.936   1.00 0.00 ? 58 LYS A HZ2  1  
ATOM 854   H HZ3  . LYS A 1 58 ? -21.735 -8.744  2.841   1.00 0.00 ? 58 LYS A HZ3  1  
ATOM 855   N N    . LYS A 1 59 ? -26.005 -10.580 2.031   1.00 0.00 ? 59 LYS A N    1  
ATOM 856   C CA   . LYS A 1 59 ? -27.402 -10.910 2.306   1.00 0.00 ? 59 LYS A CA   1  
ATOM 857   C C    . LYS A 1 59 ? -27.697 -10.795 3.797   1.00 0.00 ? 59 LYS A C    1  
ATOM 858   O O    . LYS A 1 59 ? -27.382 -11.697 4.573   1.00 0.00 ? 59 LYS A O    1  
ATOM 859   C CB   . LYS A 1 59 ? -27.702 -12.334 1.833   1.00 0.00 ? 59 LYS A CB   1  
ATOM 860   C CG   . LYS A 1 59 ? -27.418 -12.447 0.334   1.00 0.00 ? 59 LYS A CG   1  
ATOM 861   C CD   . LYS A 1 59 ? -27.747 -13.862 -0.144  1.00 0.00 ? 59 LYS A CD   1  
ATOM 862   C CE   . LYS A 1 59 ? -27.237 -14.050 -1.574  1.00 0.00 ? 59 LYS A CE   1  
ATOM 863   N NZ   . LYS A 1 59 ? -25.746 -14.050 -1.572  1.00 0.00 ? 59 LYS A NZ   1  
ATOM 864   H H    . LYS A 1 59 ? -25.305 -10.932 2.619   1.00 0.00 ? 59 LYS A H    1  
ATOM 865   H HA   . LYS A 1 59 ? -28.039 -10.223 1.769   1.00 0.00 ? 59 LYS A HA   1  
ATOM 866   H HB2  . LYS A 1 59 ? -27.077 -13.031 2.372   1.00 0.00 ? 59 LYS A HB2  1  
ATOM 867   H HB3  . LYS A 1 59 ? -28.741 -12.564 2.017   1.00 0.00 ? 59 LYS A HB3  1  
ATOM 868   H HG2  . LYS A 1 59 ? -28.027 -11.734 -0.202  1.00 0.00 ? 59 LYS A HG2  1  
ATOM 869   H HG3  . LYS A 1 59 ? -26.375 -12.240 0.148   1.00 0.00 ? 59 LYS A HG3  1  
ATOM 870   H HD2  . LYS A 1 59 ? -27.272 -14.582 0.507   1.00 0.00 ? 59 LYS A HD2  1  
ATOM 871   H HD3  . LYS A 1 59 ? -28.818 -14.009 -0.124  1.00 0.00 ? 59 LYS A HD3  1  
ATOM 872   H HE2  . LYS A 1 59 ? -27.596 -14.991 -1.965  1.00 0.00 ? 59 LYS A HE2  1  
ATOM 873   H HE3  . LYS A 1 59 ? -27.595 -13.242 -2.194  1.00 0.00 ? 59 LYS A HE3  1  
ATOM 874   H HZ1  . LYS A 1 59 ? -25.398 -13.116 -1.866  1.00 0.00 ? 59 LYS A HZ1  1  
ATOM 875   H HZ2  . LYS A 1 59 ? -25.398 -14.771 -2.235  1.00 0.00 ? 59 LYS A HZ2  1  
ATOM 876   H HZ3  . LYS A 1 59 ? -25.400 -14.265 -0.614  1.00 0.00 ? 59 LYS A HZ3  1  
ATOM 877   N N    . ARG A 1 60 ? -28.303 -9.679  4.191   1.00 0.00 ? 60 ARG A N    1  
ATOM 878   C CA   . ARG A 1 60 ? -28.637 -9.456  5.592   1.00 0.00 ? 60 ARG A CA   1  
ATOM 879   C C    . ARG A 1 60 ? -29.778 -10.372 6.023   1.00 0.00 ? 60 ARG A C    1  
ATOM 880   O O    . ARG A 1 60 ? -29.691 -10.926 7.108   1.00 0.00 ? 60 ARG A O    1  
ATOM 881   C CB   . ARG A 1 60 ? -29.043 -7.997  5.808   1.00 0.00 ? 60 ARG A CB   1  
ATOM 882   C CG   . ARG A 1 60 ? -27.825 -7.093  5.603   1.00 0.00 ? 60 ARG A CG   1  
ATOM 883   C CD   . ARG A 1 60 ? -28.287 -5.643  5.448   1.00 0.00 ? 60 ARG A CD   1  
ATOM 884   N NE   . ARG A 1 60 ? -28.935 -5.185  6.671   1.00 0.00 ? 60 ARG A NE   1  
ATOM 885   C CZ   . ARG A 1 60 ? -28.222 -4.803  7.726   1.00 0.00 ? 60 ARG A CZ   1  
ATOM 886   N NH1  . ARG A 1 60 ? -26.918 -4.835  7.678   1.00 0.00 ? 60 ARG A NH1  1  
ATOM 887   N NH2  . ARG A 1 60 ? -28.827 -4.398  8.810   1.00 0.00 ? 60 ARG A NH2  1  
ATOM 888   O OXT  . ARG A 1 60 ? -30.722 -10.507 5.263   1.00 0.00 ? 60 ARG A OXT  1  
ATOM 889   H H    . ARG A 1 60 ? -28.531 -8.995  3.526   1.00 0.00 ? 60 ARG A H    1  
ATOM 890   H HA   . ARG A 1 60 ? -27.768 -9.670  6.198   1.00 0.00 ? 60 ARG A HA   1  
ATOM 891   H HB2  . ARG A 1 60 ? -29.814 -7.731  5.101   1.00 0.00 ? 60 ARG A HB2  1  
ATOM 892   H HB3  . ARG A 1 60 ? -29.415 -7.872  6.813   1.00 0.00 ? 60 ARG A HB3  1  
ATOM 893   H HG2  . ARG A 1 60 ? -27.168 -7.174  6.457   1.00 0.00 ? 60 ARG A HG2  1  
ATOM 894   H HG3  . ARG A 1 60 ? -27.295 -7.397  4.712   1.00 0.00 ? 60 ARG A HG3  1  
ATOM 895   H HD2  . ARG A 1 60 ? -27.431 -5.016  5.243   1.00 0.00 ? 60 ARG A HD2  1  
ATOM 896   H HD3  . ARG A 1 60 ? -28.983 -5.577  4.624   1.00 0.00 ? 60 ARG A HD3  1  
ATOM 897   H HE   . ARG A 1 60 ? -29.914 -5.159  6.715   1.00 0.00 ? 60 ARG A HE   1  
ATOM 898   H HH11 . ARG A 1 60 ? -26.457 -5.147  6.848   1.00 0.00 ? 60 ARG A HH11 1  
ATOM 899   H HH12 . ARG A 1 60 ? -26.383 -4.548  8.473   1.00 0.00 ? 60 ARG A HH12 1  
ATOM 900   H HH21 . ARG A 1 60 ? -29.826 -4.373  8.845   1.00 0.00 ? 60 ARG A HH21 1  
ATOM 901   H HH22 . ARG A 1 60 ? -28.291 -4.109  9.603   1.00 0.00 ? 60 ARG A HH22 1  
ATOM 902   N N    . GLY A 1 9  ? 15.130  2.652   14.143  1.00 0.00 ? 9  GLY A N    2  
ATOM 903   C CA   . GLY A 1 9  ? 13.887  3.159   14.714  1.00 0.00 ? 9  GLY A CA   2  
ATOM 904   C C    . GLY A 1 9  ? 13.312  4.281   13.858  1.00 0.00 ? 9  GLY A C    2  
ATOM 905   O O    . GLY A 1 9  ? 12.096  4.463   13.788  1.00 0.00 ? 9  GLY A O    2  
ATOM 906   H H    . GLY A 1 9  ? 15.377  2.902   13.229  1.00 0.00 ? 9  GLY A H    2  
ATOM 907   H HA2  . GLY A 1 9  ? 13.170  2.353   14.774  1.00 0.00 ? 9  GLY A HA2  2  
ATOM 908   H HA3  . GLY A 1 9  ? 14.081  3.539   15.705  1.00 0.00 ? 9  GLY A HA3  2  
ATOM 909   N N    . THR A 1 10 ? 14.194  5.030   13.204  1.00 0.00 ? 10 THR A N    2  
ATOM 910   C CA   . THR A 1 10 ? 13.768  6.131   12.355  1.00 0.00 ? 10 THR A CA   2  
ATOM 911   C C    . THR A 1 10 ? 12.886  5.621   11.218  1.00 0.00 ? 10 THR A C    2  
ATOM 912   O O    . THR A 1 10 ? 12.662  4.418   11.086  1.00 0.00 ? 10 THR A O    2  
ATOM 913   C CB   . THR A 1 10 ? 14.999  6.837   11.780  1.00 0.00 ? 10 THR A CB   2  
ATOM 914   O OG1  . THR A 1 10 ? 15.981  5.867   11.440  1.00 0.00 ? 10 THR A OG1  2  
ATOM 915   C CG2  . THR A 1 10 ? 15.574  7.802   12.819  1.00 0.00 ? 10 THR A CG2  2  
ATOM 916   H H    . THR A 1 10 ? 15.150  4.840   13.296  1.00 0.00 ? 10 THR A H    2  
ATOM 917   H HA   . THR A 1 10 ? 13.205  6.835   12.947  1.00 0.00 ? 10 THR A HA   2  
ATOM 918   H HB   . THR A 1 10 ? 14.719  7.388   10.899  1.00 0.00 ? 10 THR A HB   2  
ATOM 919   H HG1  . THR A 1 10 ? 16.090  5.279   12.190  1.00 0.00 ? 10 THR A HG1  2  
ATOM 920   H HG21 . THR A 1 10 ? 16.537  8.159   12.485  1.00 0.00 ? 10 THR A HG21 2  
ATOM 921   H HG22 . THR A 1 10 ? 15.687  7.290   13.763  1.00 0.00 ? 10 THR A HG22 2  
ATOM 922   H HG23 . THR A 1 10 ? 14.901  8.639   12.942  1.00 0.00 ? 10 THR A HG23 2  
ATOM 923   N N    . LYS A 1 11 ? 12.389  6.544   10.402  1.00 0.00 ? 11 LYS A N    2  
ATOM 924   C CA   . LYS A 1 11 ? 11.533  6.177   9.280   1.00 0.00 ? 11 LYS A CA   2  
ATOM 925   C C    . LYS A 1 11 ? 12.129  5.003   8.511   1.00 0.00 ? 11 LYS A C    2  
ATOM 926   O O    . LYS A 1 11 ? 13.090  5.164   7.760   1.00 0.00 ? 11 LYS A O    2  
ATOM 927   C CB   . LYS A 1 11 ? 11.363  7.372   8.337   1.00 0.00 ? 11 LYS A CB   2  
ATOM 928   C CG   . LYS A 1 11 ? 11.065  8.635   9.149   1.00 0.00 ? 11 LYS A CG   2  
ATOM 929   C CD   . LYS A 1 11 ? 9.890   8.375   10.096  1.00 0.00 ? 11 LYS A CD   2  
ATOM 930   C CE   . LYS A 1 11 ? 9.315   9.709   10.575  1.00 0.00 ? 11 LYS A CE   2  
ATOM 931   N NZ   . LYS A 1 11 ? 8.333   9.463   11.669  1.00 0.00 ? 11 LYS A NZ   2  
ATOM 932   H H    . LYS A 1 11 ? 12.603  7.488   10.557  1.00 0.00 ? 11 LYS A H    2  
ATOM 933   H HA   . LYS A 1 11 ? 10.563  5.892   9.658   1.00 0.00 ? 11 LYS A HA   2  
ATOM 934   H HB2  . LYS A 1 11 ? 12.272  7.514   7.770   1.00 0.00 ? 11 LYS A HB2  2  
ATOM 935   H HB3  . LYS A 1 11 ? 10.543  7.181   7.660   1.00 0.00 ? 11 LYS A HB3  2  
ATOM 936   H HG2  . LYS A 1 11 ? 11.939  8.905   9.724   1.00 0.00 ? 11 LYS A HG2  2  
ATOM 937   H HG3  . LYS A 1 11 ? 10.814  9.442   8.479   1.00 0.00 ? 11 LYS A HG3  2  
ATOM 938   H HD2  . LYS A 1 11 ? 9.124   7.820   9.574   1.00 0.00 ? 11 LYS A HD2  2  
ATOM 939   H HD3  . LYS A 1 11 ? 10.231  7.807   10.948  1.00 0.00 ? 11 LYS A HD3  2  
ATOM 940   H HE2  . LYS A 1 11 ? 10.114  10.335  10.944  1.00 0.00 ? 11 LYS A HE2  2  
ATOM 941   H HE3  . LYS A 1 11 ? 8.820   10.204  9.752   1.00 0.00 ? 11 LYS A HE3  2  
ATOM 942   H HZ1  . LYS A 1 11 ? 8.083   8.454   11.689  1.00 0.00 ? 11 LYS A HZ1  2  
ATOM 943   H HZ2  . LYS A 1 11 ? 7.477   10.028  11.502  1.00 0.00 ? 11 LYS A HZ2  2  
ATOM 944   H HZ3  . LYS A 1 11 ? 8.755   9.735   12.581  1.00 0.00 ? 11 LYS A HZ3  2  
ATOM 945   N N    . LYS A 1 12 ? 11.551  3.822   8.705   1.00 0.00 ? 12 LYS A N    2  
ATOM 946   C CA   . LYS A 1 12 ? 12.034  2.626   8.022   1.00 0.00 ? 12 LYS A CA   2  
ATOM 947   C C    . LYS A 1 12 ? 11.519  2.587   6.586   1.00 0.00 ? 12 LYS A C    2  
ATOM 948   O O    . LYS A 1 12 ? 12.300  2.479   5.640   1.00 0.00 ? 12 LYS A O    2  
ATOM 949   C CB   . LYS A 1 12 ? 11.569  1.374   8.769   1.00 0.00 ? 12 LYS A CB   2  
ATOM 950   C CG   . LYS A 1 12 ? 12.154  1.374   10.183  1.00 0.00 ? 12 LYS A CG   2  
ATOM 951   C CD   . LYS A 1 12 ? 12.015  -0.024  10.803  1.00 0.00 ? 12 LYS A CD   2  
ATOM 952   C CE   . LYS A 1 12 ? 13.234  -0.876  10.439  1.00 0.00 ? 12 LYS A CE   2  
ATOM 953   N NZ   . LYS A 1 12 ? 14.390  -0.478  11.290  1.00 0.00 ? 12 LYS A NZ   2  
ATOM 954   H H    . LYS A 1 12 ? 10.788  3.752   9.315   1.00 0.00 ? 12 LYS A H    2  
ATOM 955   H HA   . LYS A 1 12 ? 13.114  2.642   8.007   1.00 0.00 ? 12 LYS A HA   2  
ATOM 956   H HB2  . LYS A 1 12 ? 10.489  1.371   8.825   1.00 0.00 ? 12 LYS A HB2  2  
ATOM 957   H HB3  . LYS A 1 12 ? 11.904  0.495   8.241   1.00 0.00 ? 12 LYS A HB3  2  
ATOM 958   H HG2  . LYS A 1 12 ? 13.199  1.650   10.140  1.00 0.00 ? 12 LYS A HG2  2  
ATOM 959   H HG3  . LYS A 1 12 ? 11.620  2.089   10.791  1.00 0.00 ? 12 LYS A HG3  2  
ATOM 960   H HD2  . LYS A 1 12 ? 11.949  0.067   11.878  1.00 0.00 ? 12 LYS A HD2  2  
ATOM 961   H HD3  . LYS A 1 12 ? 11.121  -0.498  10.428  1.00 0.00 ? 12 LYS A HD3  2  
ATOM 962   H HE2  . LYS A 1 12 ? 13.005  -1.918  10.607  1.00 0.00 ? 12 LYS A HE2  2  
ATOM 963   H HE3  . LYS A 1 12 ? 13.483  -0.725  9.400   1.00 0.00 ? 12 LYS A HE3  2  
ATOM 964   H HZ1  . LYS A 1 12 ? 14.346  0.544   11.479  1.00 0.00 ? 12 LYS A HZ1  2  
ATOM 965   H HZ2  . LYS A 1 12 ? 15.277  -0.698  10.796  1.00 0.00 ? 12 LYS A HZ2  2  
ATOM 966   H HZ3  . LYS A 1 12 ? 14.355  -1.001  12.190  1.00 0.00 ? 12 LYS A HZ3  2  
ATOM 967   N N    . TYR A 1 13 ? 10.201  2.673   6.433   1.00 0.00 ? 13 TYR A N    2  
ATOM 968   C CA   . TYR A 1 13 ? 9.588   2.647   5.108   1.00 0.00 ? 13 TYR A CA   2  
ATOM 969   C C    . TYR A 1 13 ? 8.454   3.667   5.028   1.00 0.00 ? 13 TYR A C    2  
ATOM 970   O O    . TYR A 1 13 ? 7.746   3.902   6.008   1.00 0.00 ? 13 TYR A O    2  
ATOM 971   C CB   . TYR A 1 13 ? 9.045   1.241   4.810   1.00 0.00 ? 13 TYR A CB   2  
ATOM 972   C CG   . TYR A 1 13 ? 10.093  0.433   4.079   1.00 0.00 ? 13 TYR A CG   2  
ATOM 973   C CD1  . TYR A 1 13 ? 11.200  -0.072  4.772   1.00 0.00 ? 13 TYR A CD1  2  
ATOM 974   C CD2  . TYR A 1 13 ? 9.956   0.190   2.706   1.00 0.00 ? 13 TYR A CD2  2  
ATOM 975   C CE1  . TYR A 1 13 ? 12.171  -0.817  4.092   1.00 0.00 ? 13 TYR A CE1  2  
ATOM 976   C CE2  . TYR A 1 13 ? 10.925  -0.557  2.029   1.00 0.00 ? 13 TYR A CE2  2  
ATOM 977   C CZ   . TYR A 1 13 ? 12.033  -1.060  2.721   1.00 0.00 ? 13 TYR A CZ   2  
ATOM 978   O OH   . TYR A 1 13 ? 12.990  -1.794  2.050   1.00 0.00 ? 13 TYR A OH   2  
ATOM 979   H H    . TYR A 1 13 ? 9.630   2.757   7.225   1.00 0.00 ? 13 TYR A H    2  
ATOM 980   H HA   . TYR A 1 13 ? 10.333  2.900   4.368   1.00 0.00 ? 13 TYR A HA   2  
ATOM 981   H HB2  . TYR A 1 13 ? 8.794   0.750   5.738   1.00 0.00 ? 13 TYR A HB2  2  
ATOM 982   H HB3  . TYR A 1 13 ? 8.158   1.318   4.195   1.00 0.00 ? 13 TYR A HB3  2  
ATOM 983   H HD1  . TYR A 1 13 ? 11.306  0.114   5.830   1.00 0.00 ? 13 TYR A HD1  2  
ATOM 984   H HD2  . TYR A 1 13 ? 9.102   0.577   2.172   1.00 0.00 ? 13 TYR A HD2  2  
ATOM 985   H HE1  . TYR A 1 13 ? 13.025  -1.206  4.626   1.00 0.00 ? 13 TYR A HE1  2  
ATOM 986   H HE2  . TYR A 1 13 ? 10.819  -0.744  0.972   1.00 0.00 ? 13 TYR A HE2  2  
ATOM 987   H HH   . TYR A 1 13 ? 13.847  -1.406  2.239   1.00 0.00 ? 13 TYR A HH   2  
ATOM 988   N N    . ASP A 1 14 ? 8.289   4.267   3.853   1.00 0.00 ? 14 ASP A N    2  
ATOM 989   C CA   . ASP A 1 14 ? 7.238   5.261   3.648   1.00 0.00 ? 14 ASP A CA   2  
ATOM 990   C C    . ASP A 1 14 ? 6.601   5.085   2.274   1.00 0.00 ? 14 ASP A C    2  
ATOM 991   O O    . ASP A 1 14 ? 7.273   5.210   1.249   1.00 0.00 ? 14 ASP A O    2  
ATOM 992   C CB   . ASP A 1 14 ? 7.822   6.670   3.765   1.00 0.00 ? 14 ASP A CB   2  
ATOM 993   C CG   . ASP A 1 14 ? 6.696   7.691   3.894   1.00 0.00 ? 14 ASP A CG   2  
ATOM 994   O OD1  . ASP A 1 14 ? 6.170   8.095   2.871   1.00 0.00 ? 14 ASP A OD1  2  
ATOM 995   O OD2  . ASP A 1 14 ? 6.380   8.055   5.015   1.00 0.00 ? 14 ASP A OD2  2  
ATOM 996   H H    . ASP A 1 14 ? 8.882   4.038   3.109   1.00 0.00 ? 14 ASP A H    2  
ATOM 997   H HA   . ASP A 1 14 ? 6.478   5.134   4.405   1.00 0.00 ? 14 ASP A HA   2  
ATOM 998   H HB2  . ASP A 1 14 ? 8.456   6.722   4.639   1.00 0.00 ? 14 ASP A HB2  2  
ATOM 999   H HB3  . ASP A 1 14 ? 8.406   6.891   2.886   1.00 0.00 ? 14 ASP A HB3  2  
ATOM 1000  N N    . LEU A 1 15 ? 5.303   4.798   2.260   1.00 0.00 ? 15 LEU A N    2  
ATOM 1001  C CA   . LEU A 1 15 ? 4.574   4.608   1.009   1.00 0.00 ? 15 LEU A CA   2  
ATOM 1002  C C    . LEU A 1 15 ? 3.209   5.271   1.106   1.00 0.00 ? 15 LEU A C    2  
ATOM 1003  O O    . LEU A 1 15 ? 2.208   4.723   0.645   1.00 0.00 ? 15 LEU A O    2  
ATOM 1004  C CB   . LEU A 1 15 ? 4.388   3.114   0.702   1.00 0.00 ? 15 LEU A CB   2  
ATOM 1005  C CG   . LEU A 1 15 ? 5.672   2.332   1.005   1.00 0.00 ? 15 LEU A CG   2  
ATOM 1006  C CD1  . LEU A 1 15 ? 5.355   0.835   1.027   1.00 0.00 ? 15 LEU A CD1  2  
ATOM 1007  C CD2  . LEU A 1 15 ? 6.718   2.606   -0.083  1.00 0.00 ? 15 LEU A CD2  2  
ATOM 1008  H H    . LEU A 1 15 ? 4.820   4.720   3.109   1.00 0.00 ? 15 LEU A H    2  
ATOM 1009  H HA   . LEU A 1 15 ? 5.126   5.069   0.203   1.00 0.00 ? 15 LEU A HA   2  
ATOM 1010  H HB2  . LEU A 1 15 ? 3.583   2.724   1.310   1.00 0.00 ? 15 LEU A HB2  2  
ATOM 1011  H HB3  . LEU A 1 15 ? 4.135   2.994   -0.340  1.00 0.00 ? 15 LEU A HB3  2  
ATOM 1012  H HG   . LEU A 1 15 ? 6.061   2.627   1.966   1.00 0.00 ? 15 LEU A HG   2  
ATOM 1013  H HD11 . LEU A 1 15 ? 6.244   0.284   1.295   1.00 0.00 ? 15 LEU A HD11 2  
ATOM 1014  H HD12 . LEU A 1 15 ? 5.018   0.523   0.050   1.00 0.00 ? 15 LEU A HD12 2  
ATOM 1015  H HD13 . LEU A 1 15 ? 4.579   0.645   1.754   1.00 0.00 ? 15 LEU A HD13 2  
ATOM 1016  H HD21 . LEU A 1 15 ? 7.697   2.339   0.287   1.00 0.00 ? 15 LEU A HD21 2  
ATOM 1017  H HD22 . LEU A 1 15 ? 6.706   3.653   -0.341  1.00 0.00 ? 15 LEU A HD22 2  
ATOM 1018  H HD23 . LEU A 1 15 ? 6.490   2.018   -0.960  1.00 0.00 ? 15 LEU A HD23 2  
ATOM 1019  N N    . SER A 1 16 ? 3.182   6.450   1.716   1.00 0.00 ? 16 SER A N    2  
ATOM 1020  C CA   . SER A 1 16 ? 1.937   7.193   1.883   1.00 0.00 ? 16 SER A CA   2  
ATOM 1021  C C    . SER A 1 16 ? 1.001   6.941   0.702   1.00 0.00 ? 16 SER A C    2  
ATOM 1022  O O    . SER A 1 16 ? -0.197  6.719   0.881   1.00 0.00 ? 16 SER A O    2  
ATOM 1023  C CB   . SER A 1 16 ? 2.243   8.686   2.001   1.00 0.00 ? 16 SER A CB   2  
ATOM 1024  O OG   . SER A 1 16 ? 3.534   8.854   2.570   1.00 0.00 ? 16 SER A OG   2  
ATOM 1025  H H    . SER A 1 16 ? 4.016   6.828   2.064   1.00 0.00 ? 16 SER A H    2  
ATOM 1026  H HA   . SER A 1 16 ? 1.453   6.863   2.790   1.00 0.00 ? 16 SER A HA   2  
ATOM 1027  H HB2  . SER A 1 16 ? 2.225   9.142   1.026   1.00 0.00 ? 16 SER A HB2  2  
ATOM 1028  H HB3  . SER A 1 16 ? 1.499   9.154   2.630   1.00 0.00 ? 16 SER A HB3  2  
ATOM 1029  H HG   . SER A 1 16 ? 3.846   7.993   2.861   1.00 0.00 ? 16 SER A HG   2  
ATOM 1030  N N    . LYS A 1 17 ? 1.565   6.959   -0.500  1.00 0.00 ? 17 LYS A N    2  
ATOM 1031  C CA   . LYS A 1 17 ? 0.784   6.710   -1.705  1.00 0.00 ? 17 LYS A CA   2  
ATOM 1032  C C    . LYS A 1 17 ? 1.716   6.403   -2.874  1.00 0.00 ? 17 LYS A C    2  
ATOM 1033  O O    . LYS A 1 17 ? 2.639   7.166   -3.159  1.00 0.00 ? 17 LYS A O    2  
ATOM 1034  C CB   . LYS A 1 17 ? -0.076  7.936   -2.032  1.00 0.00 ? 17 LYS A CB   2  
ATOM 1035  C CG   . LYS A 1 17 ? -0.785  7.741   -3.377  1.00 0.00 ? 17 LYS A CG   2  
ATOM 1036  C CD   . LYS A 1 17 ? -1.584  6.434   -3.361  1.00 0.00 ? 17 LYS A CD   2  
ATOM 1037  C CE   . LYS A 1 17 ? -2.688  6.493   -4.419  1.00 0.00 ? 17 LYS A CE   2  
ATOM 1038  N NZ   . LYS A 1 17 ? -3.746  7.446   -3.979  1.00 0.00 ? 17 LYS A NZ   2  
ATOM 1039  H H    . LYS A 1 17 ? 2.528   7.127   -0.576  1.00 0.00 ? 17 LYS A H    2  
ATOM 1040  H HA   . LYS A 1 17 ? 0.139   5.862   -1.535  1.00 0.00 ? 17 LYS A HA   2  
ATOM 1041  H HB2  . LYS A 1 17 ? -0.814  8.072   -1.255  1.00 0.00 ? 17 LYS A HB2  2  
ATOM 1042  H HB3  . LYS A 1 17 ? 0.554   8.811   -2.084  1.00 0.00 ? 17 LYS A HB3  2  
ATOM 1043  H HG2  . LYS A 1 17 ? -1.455  8.570   -3.551  1.00 0.00 ? 17 LYS A HG2  2  
ATOM 1044  H HG3  . LYS A 1 17 ? -0.051  7.702   -4.169  1.00 0.00 ? 17 LYS A HG3  2  
ATOM 1045  H HD2  . LYS A 1 17 ? -0.924  5.606   -3.577  1.00 0.00 ? 17 LYS A HD2  2  
ATOM 1046  H HD3  . LYS A 1 17 ? -2.030  6.294   -2.387  1.00 0.00 ? 17 LYS A HD3  2  
ATOM 1047  H HE2  . LYS A 1 17 ? -2.269  6.827   -5.356  1.00 0.00 ? 17 LYS A HE2  2  
ATOM 1048  H HE3  . LYS A 1 17 ? -3.119  5.511   -4.546  1.00 0.00 ? 17 LYS A HE3  2  
ATOM 1049  H HZ1  . LYS A 1 17 ? -3.449  7.915   -3.101  1.00 0.00 ? 17 LYS A HZ1  2  
ATOM 1050  H HZ2  . LYS A 1 17 ? -4.632  6.928   -3.811  1.00 0.00 ? 17 LYS A HZ2  2  
ATOM 1051  H HZ3  . LYS A 1 17 ? -3.898  8.160   -4.722  1.00 0.00 ? 17 LYS A HZ3  2  
ATOM 1052  N N    . TRP A 1 18 ? 1.460   5.286   -3.549  1.00 0.00 ? 18 TRP A N    2  
ATOM 1053  C CA   . TRP A 1 18 ? 2.274   4.874   -4.692  1.00 0.00 ? 18 TRP A CA   2  
ATOM 1054  C C    . TRP A 1 18 ? 1.387   4.687   -5.920  1.00 0.00 ? 18 TRP A C    2  
ATOM 1055  O O    . TRP A 1 18 ? 0.170   4.535   -5.798  1.00 0.00 ? 18 TRP A O    2  
ATOM 1056  C CB   . TRP A 1 18 ? 2.985   3.544   -4.377  1.00 0.00 ? 18 TRP A CB   2  
ATOM 1057  C CG   . TRP A 1 18 ? 4.362   3.787   -3.830  1.00 0.00 ? 18 TRP A CG   2  
ATOM 1058  C CD1  . TRP A 1 18 ? 4.714   4.791   -2.995  1.00 0.00 ? 18 TRP A CD1  2  
ATOM 1059  C CD2  . TRP A 1 18 ? 5.574   3.012   -4.065  1.00 0.00 ? 18 TRP A CD2  2  
ATOM 1060  N NE1  . TRP A 1 18 ? 6.063   4.686   -2.709  1.00 0.00 ? 18 TRP A NE1  2  
ATOM 1061  C CE2  . TRP A 1 18 ? 6.637   3.605   -3.344  1.00 0.00 ? 18 TRP A CE2  2  
ATOM 1062  C CE3  . TRP A 1 18 ? 5.851   1.866   -4.828  1.00 0.00 ? 18 TRP A CE3  2  
ATOM 1063  C CZ2  . TRP A 1 18 ? 7.929   3.077   -3.380  1.00 0.00 ? 18 TRP A CZ2  2  
ATOM 1064  C CZ3  . TRP A 1 18 ? 7.148   1.332   -4.866  1.00 0.00 ? 18 TRP A CZ3  2  
ATOM 1065  C CH2  . TRP A 1 18 ? 8.185   1.936   -4.144  1.00 0.00 ? 18 TRP A CH2  2  
ATOM 1066  H H    . TRP A 1 18 ? 0.705   4.725   -3.273  1.00 0.00 ? 18 TRP A H    2  
ATOM 1067  H HA   . TRP A 1 18 ? 3.013   5.633   -4.901  1.00 0.00 ? 18 TRP A HA   2  
ATOM 1068  H HB2  . TRP A 1 18 ? 2.408   2.996   -3.649  1.00 0.00 ? 18 TRP A HB2  2  
ATOM 1069  H HB3  . TRP A 1 18 ? 3.062   2.958   -5.283  1.00 0.00 ? 18 TRP A HB3  2  
ATOM 1070  H HD1  . TRP A 1 18 ? 4.054   5.551   -2.615  1.00 0.00 ? 18 TRP A HD1  2  
ATOM 1071  H HE1  . TRP A 1 18 ? 6.568   5.294   -2.128  1.00 0.00 ? 18 TRP A HE1  2  
ATOM 1072  H HE3  . TRP A 1 18 ? 5.061   1.389   -5.386  1.00 0.00 ? 18 TRP A HE3  2  
ATOM 1073  H HZ2  . TRP A 1 18 ? 8.726   3.546   -2.822  1.00 0.00 ? 18 TRP A HZ2  2  
ATOM 1074  H HZ3  . TRP A 1 18 ? 7.345   0.451   -5.456  1.00 0.00 ? 18 TRP A HZ3  2  
ATOM 1075  H HH2  . TRP A 1 18 ? 9.181   1.519   -4.179  1.00 0.00 ? 18 TRP A HH2  2  
ATOM 1076  N N    . LYS A 1 19 ? 1.999   4.684   -7.099  1.00 0.00 ? 19 LYS A N    2  
ATOM 1077  C CA   . LYS A 1 19 ? 1.249   4.498   -8.336  1.00 0.00 ? 19 LYS A CA   2  
ATOM 1078  C C    . LYS A 1 19 ? 1.250   3.022   -8.731  1.00 0.00 ? 19 LYS A C    2  
ATOM 1079  O O    . LYS A 1 19 ? 2.114   2.258   -8.304  1.00 0.00 ? 19 LYS A O    2  
ATOM 1080  C CB   . LYS A 1 19 ? 1.867   5.338   -9.460  1.00 0.00 ? 19 LYS A CB   2  
ATOM 1081  C CG   . LYS A 1 19 ? 1.921   6.814   -9.038  1.00 0.00 ? 19 LYS A CG   2  
ATOM 1082  C CD   . LYS A 1 19 ? 3.291   7.129   -8.429  1.00 0.00 ? 19 LYS A CD   2  
ATOM 1083  C CE   . LYS A 1 19 ? 3.317   8.583   -7.954  1.00 0.00 ? 19 LYS A CE   2  
ATOM 1084  N NZ   . LYS A 1 19 ? 4.642   8.882   -7.340  1.00 0.00 ? 19 LYS A NZ   2  
ATOM 1085  H H    . LYS A 1 19 ? 2.971   4.799   -7.138  1.00 0.00 ? 19 LYS A H    2  
ATOM 1086  H HA   . LYS A 1 19 ? 0.229   4.818   -8.182  1.00 0.00 ? 19 LYS A HA   2  
ATOM 1087  H HB2  . LYS A 1 19 ? 2.865   4.983   -9.668  1.00 0.00 ? 19 LYS A HB2  2  
ATOM 1088  H HB3  . LYS A 1 19 ? 1.262   5.245   -10.348 1.00 0.00 ? 19 LYS A HB3  2  
ATOM 1089  H HG2  . LYS A 1 19 ? 1.763   7.440   -9.903  1.00 0.00 ? 19 LYS A HG2  2  
ATOM 1090  H HG3  . LYS A 1 19 ? 1.152   7.012   -8.306  1.00 0.00 ? 19 LYS A HG3  2  
ATOM 1091  H HD2  . LYS A 1 19 ? 3.473   6.473   -7.592  1.00 0.00 ? 19 LYS A HD2  2  
ATOM 1092  H HD3  . LYS A 1 19 ? 4.059   6.983   -9.175  1.00 0.00 ? 19 LYS A HD3  2  
ATOM 1093  H HE2  . LYS A 1 19 ? 3.155   9.240   -8.796  1.00 0.00 ? 19 LYS A HE2  2  
ATOM 1094  H HE3  . LYS A 1 19 ? 2.539   8.737   -7.222  1.00 0.00 ? 19 LYS A HE3  2  
ATOM 1095  H HZ1  . LYS A 1 19 ? 4.506   9.448   -6.479  1.00 0.00 ? 19 LYS A HZ1  2  
ATOM 1096  H HZ2  . LYS A 1 19 ? 5.225   9.414   -8.015  1.00 0.00 ? 19 LYS A HZ2  2  
ATOM 1097  H HZ3  . LYS A 1 19 ? 5.119   7.990   -7.097  1.00 0.00 ? 19 LYS A HZ3  2  
ATOM 1098  N N    . TYR A 1 20 ? 0.274   2.627   -9.540  1.00 0.00 ? 20 TYR A N    2  
ATOM 1099  C CA   . TYR A 1 20 ? 0.177   1.237   -9.975  1.00 0.00 ? 20 TYR A CA   2  
ATOM 1100  C C    . TYR A 1 20 ? 1.417   0.826   -10.761 1.00 0.00 ? 20 TYR A C    2  
ATOM 1101  O O    . TYR A 1 20 ? 1.923   -0.288  -10.608 1.00 0.00 ? 20 TYR A O    2  
ATOM 1102  C CB   . TYR A 1 20 ? -1.066  1.050   -10.848 1.00 0.00 ? 20 TYR A CB   2  
ATOM 1103  C CG   . TYR A 1 20 ? -1.138  -0.381  -11.321 1.00 0.00 ? 20 TYR A CG   2  
ATOM 1104  C CD1  . TYR A 1 20 ? -0.457  -0.772  -12.480 1.00 0.00 ? 20 TYR A CD1  2  
ATOM 1105  C CD2  . TYR A 1 20 ? -1.886  -1.320  -10.599 1.00 0.00 ? 20 TYR A CD2  2  
ATOM 1106  C CE1  . TYR A 1 20 ? -0.525  -2.101  -12.917 1.00 0.00 ? 20 TYR A CE1  2  
ATOM 1107  C CE2  . TYR A 1 20 ? -1.955  -2.648  -11.037 1.00 0.00 ? 20 TYR A CE2  2  
ATOM 1108  C CZ   . TYR A 1 20 ? -1.272  -3.039  -12.196 1.00 0.00 ? 20 TYR A CZ   2  
ATOM 1109  O OH   . TYR A 1 20 ? -1.338  -4.347  -12.627 1.00 0.00 ? 20 TYR A OH   2  
ATOM 1110  H H    . TYR A 1 20 ? -0.392  3.276   -9.847  1.00 0.00 ? 20 TYR A H    2  
ATOM 1111  H HA   . TYR A 1 20 ? 0.086   0.605   -9.105  1.00 0.00 ? 20 TYR A HA   2  
ATOM 1112  H HB2  . TYR A 1 20 ? -1.949  1.286   -10.273 1.00 0.00 ? 20 TYR A HB2  2  
ATOM 1113  H HB3  . TYR A 1 20 ? -1.006  1.708   -11.703 1.00 0.00 ? 20 TYR A HB3  2  
ATOM 1114  H HD1  . TYR A 1 20 ? 0.121   -0.048  -13.036 1.00 0.00 ? 20 TYR A HD1  2  
ATOM 1115  H HD2  . TYR A 1 20 ? -2.413  -1.018  -9.705  1.00 0.00 ? 20 TYR A HD2  2  
ATOM 1116  H HE1  . TYR A 1 20 ? 0.001   -2.402  -13.812 1.00 0.00 ? 20 TYR A HE1  2  
ATOM 1117  H HE2  . TYR A 1 20 ? -2.531  -3.372  -10.480 1.00 0.00 ? 20 TYR A HE2  2  
ATOM 1118  H HH   . TYR A 1 20 ? -1.403  -4.341  -13.585 1.00 0.00 ? 20 TYR A HH   2  
ATOM 1119  N N    . ALA A 1 21 ? 1.899   1.730   -11.607 1.00 0.00 ? 21 ALA A N    2  
ATOM 1120  C CA   . ALA A 1 21 ? 3.078   1.455   -12.423 1.00 0.00 ? 21 ALA A CA   2  
ATOM 1121  C C    . ALA A 1 21 ? 4.270   1.054   -11.558 1.00 0.00 ? 21 ALA A C    2  
ATOM 1122  O O    . ALA A 1 21 ? 4.792   -0.054  -11.680 1.00 0.00 ? 21 ALA A O    2  
ATOM 1123  C CB   . ALA A 1 21 ? 3.438   2.691   -13.246 1.00 0.00 ? 21 ALA A CB   2  
ATOM 1124  H H    . ALA A 1 21 ? 1.451   2.598   -11.688 1.00 0.00 ? 21 ALA A H    2  
ATOM 1125  H HA   . ALA A 1 21 ? 2.851   0.643   -13.098 1.00 0.00 ? 21 ALA A HA   2  
ATOM 1126  H HB1  . ALA A 1 21 ? 2.642   2.903   -13.945 1.00 0.00 ? 21 ALA A HB1  2  
ATOM 1127  H HB2  . ALA A 1 21 ? 4.354   2.508   -13.789 1.00 0.00 ? 21 ALA A HB2  2  
ATOM 1128  H HB3  . ALA A 1 21 ? 3.574   3.536   -12.588 1.00 0.00 ? 21 ALA A HB3  2  
ATOM 1129  N N    . GLU A 1 22 ? 4.706   1.967   -10.693 1.00 0.00 ? 22 GLU A N    2  
ATOM 1130  C CA   . GLU A 1 22 ? 5.850   1.696   -9.827  1.00 0.00 ? 22 GLU A CA   2  
ATOM 1131  C C    . GLU A 1 22 ? 5.579   0.501   -8.917  1.00 0.00 ? 22 GLU A C    2  
ATOM 1132  O O    . GLU A 1 22 ? 6.476   -0.297  -8.650  1.00 0.00 ? 22 GLU A O    2  
ATOM 1133  C CB   . GLU A 1 22 ? 6.171   2.928   -8.978  1.00 0.00 ? 22 GLU A CB   2  
ATOM 1134  C CG   . GLU A 1 22 ? 4.981   3.259   -8.081  1.00 0.00 ? 22 GLU A CG   2  
ATOM 1135  C CD   . GLU A 1 22 ? 5.234   4.571   -7.344  1.00 0.00 ? 22 GLU A CD   2  
ATOM 1136  O OE1  . GLU A 1 22 ? 5.941   5.405   -7.886  1.00 0.00 ? 22 GLU A OE1  2  
ATOM 1137  O OE2  . GLU A 1 22 ? 4.718   4.721   -6.249  1.00 0.00 ? 22 GLU A OE2  2  
ATOM 1138  H H    . GLU A 1 22 ? 4.258   2.837   -10.643 1.00 0.00 ? 22 GLU A H    2  
ATOM 1139  H HA   . GLU A 1 22 ? 6.705   1.471   -10.446 1.00 0.00 ? 22 GLU A HA   2  
ATOM 1140  H HB2  . GLU A 1 22 ? 7.039   2.726   -8.367  1.00 0.00 ? 22 GLU A HB2  2  
ATOM 1141  H HB3  . GLU A 1 22 ? 6.374   3.767   -9.626  1.00 0.00 ? 22 GLU A HB3  2  
ATOM 1142  H HG2  . GLU A 1 22 ? 4.093   3.354   -8.686  1.00 0.00 ? 22 GLU A HG2  2  
ATOM 1143  H HG3  . GLU A 1 22 ? 4.841   2.468   -7.362  1.00 0.00 ? 22 GLU A HG3  2  
ATOM 1144  N N    . LEU A 1 23 ? 4.343   0.380   -8.440  1.00 0.00 ? 23 LEU A N    2  
ATOM 1145  C CA   . LEU A 1 23 ? 3.991   -0.728  -7.558  1.00 0.00 ? 23 LEU A CA   2  
ATOM 1146  C C    . LEU A 1 23 ? 4.347   -2.061  -8.212  1.00 0.00 ? 23 LEU A C    2  
ATOM 1147  O O    . LEU A 1 23 ? 5.091   -2.862  -7.647  1.00 0.00 ? 23 LEU A O    2  
ATOM 1148  C CB   . LEU A 1 23 ? 2.483   -0.694  -7.249  1.00 0.00 ? 23 LEU A CB   2  
ATOM 1149  C CG   . LEU A 1 23 ? 2.242   -0.147  -5.835  1.00 0.00 ? 23 LEU A CG   2  
ATOM 1150  C CD1  . LEU A 1 23 ? 0.797   0.345   -5.718  1.00 0.00 ? 23 LEU A CD1  2  
ATOM 1151  C CD2  . LEU A 1 23 ? 2.480   -1.256  -4.804  1.00 0.00 ? 23 LEU A CD2  2  
ATOM 1152  H H    . LEU A 1 23 ? 3.664   1.043   -8.681  1.00 0.00 ? 23 LEU A H    2  
ATOM 1153  H HA   . LEU A 1 23 ? 4.545   -0.632  -6.638  1.00 0.00 ? 23 LEU A HA   2  
ATOM 1154  H HB2  . LEU A 1 23 ? 1.991   -0.055  -7.967  1.00 0.00 ? 23 LEU A HB2  2  
ATOM 1155  H HB3  . LEU A 1 23 ? 2.074   -1.691  -7.321  1.00 0.00 ? 23 LEU A HB3  2  
ATOM 1156  H HG   . LEU A 1 23 ? 2.914   0.674   -5.646  1.00 0.00 ? 23 LEU A HG   2  
ATOM 1157  H HD11 . LEU A 1 23 ? 0.129   -0.399  -6.126  1.00 0.00 ? 23 LEU A HD11 2  
ATOM 1158  H HD12 . LEU A 1 23 ? 0.686   1.268   -6.267  1.00 0.00 ? 23 LEU A HD12 2  
ATOM 1159  H HD13 . LEU A 1 23 ? 0.557   0.513   -4.678  1.00 0.00 ? 23 LEU A HD13 2  
ATOM 1160  H HD21 . LEU A 1 23 ? 1.873   -2.115  -5.050  1.00 0.00 ? 23 LEU A HD21 2  
ATOM 1161  H HD22 . LEU A 1 23 ? 2.214   -0.897  -3.822  1.00 0.00 ? 23 LEU A HD22 2  
ATOM 1162  H HD23 . LEU A 1 23 ? 3.522   -1.538  -4.811  1.00 0.00 ? 23 LEU A HD23 2  
ATOM 1163  N N    . ARG A 1 24 ? 3.812   -2.288  -9.407  1.00 0.00 ? 24 ARG A N    2  
ATOM 1164  C CA   . ARG A 1 24 ? 4.077   -3.529  -10.127 1.00 0.00 ? 24 ARG A CA   2  
ATOM 1165  C C    . ARG A 1 24 ? 5.562   -3.666  -10.443 1.00 0.00 ? 24 ARG A C    2  
ATOM 1166  O O    . ARG A 1 24 ? 6.175   -4.697  -10.161 1.00 0.00 ? 24 ARG A O    2  
ATOM 1167  C CB   . ARG A 1 24 ? 3.270   -3.556  -11.429 1.00 0.00 ? 24 ARG A CB   2  
ATOM 1168  C CG   . ARG A 1 24 ? 3.628   -4.813  -12.243 1.00 0.00 ? 24 ARG A CG   2  
ATOM 1169  C CD   . ARG A 1 24 ? 4.582   -4.441  -13.382 1.00 0.00 ? 24 ARG A CD   2  
ATOM 1170  N NE   . ARG A 1 24 ? 5.241   -5.637  -13.897 1.00 0.00 ? 24 ARG A NE   2  
ATOM 1171  C CZ   . ARG A 1 24 ? 5.781   -5.655  -15.111 1.00 0.00 ? 24 ARG A CZ   2  
ATOM 1172  N NH1  . ARG A 1 24 ? 5.727   -4.592  -15.866 1.00 0.00 ? 24 ARG A NH1  2  
ATOM 1173  N NH2  . ARG A 1 24 ? 6.365   -6.738  -15.548 1.00 0.00 ? 24 ARG A NH2  2  
ATOM 1174  H H    . ARG A 1 24 ? 3.228   -1.612  -9.810  1.00 0.00 ? 24 ARG A H    2  
ATOM 1175  H HA   . ARG A 1 24 ? 3.771   -4.361  -9.513  1.00 0.00 ? 24 ARG A HA   2  
ATOM 1176  H HB2  . ARG A 1 24 ? 2.215   -3.569  -11.192 1.00 0.00 ? 24 ARG A HB2  2  
ATOM 1177  H HB3  . ARG A 1 24 ? 3.496   -2.674  -12.009 1.00 0.00 ? 24 ARG A HB3  2  
ATOM 1178  H HG2  . ARG A 1 24 ? 4.102   -5.539  -11.599 1.00 0.00 ? 24 ARG A HG2  2  
ATOM 1179  H HG3  . ARG A 1 24 ? 2.727   -5.240  -12.658 1.00 0.00 ? 24 ARG A HG3  2  
ATOM 1180  H HD2  . ARG A 1 24 ? 4.023   -3.974  -14.178 1.00 0.00 ? 24 ARG A HD2  2  
ATOM 1181  H HD3  . ARG A 1 24 ? 5.326   -3.749  -13.015 1.00 0.00 ? 24 ARG A HD3  2  
ATOM 1182  H HE   . ARG A 1 24 ? 5.286   -6.440  -13.337 1.00 0.00 ? 24 ARG A HE   2  
ATOM 1183  H HH11 . ARG A 1 24 ? 5.279   -3.763  -15.530 1.00 0.00 ? 24 ARG A HH11 2  
ATOM 1184  H HH12 . ARG A 1 24 ? 6.133   -4.607  -16.780 1.00 0.00 ? 24 ARG A HH12 2  
ATOM 1185  H HH21 . ARG A 1 24 ? 6.406   -7.552  -14.971 1.00 0.00 ? 24 ARG A HH21 2  
ATOM 1186  H HH22 . ARG A 1 24 ? 6.771   -6.751  -16.463 1.00 0.00 ? 24 ARG A HH22 2  
ATOM 1187  N N    . ASP A 1 25 ? 6.135   -2.628  -11.035 1.00 0.00 ? 25 ASP A N    2  
ATOM 1188  C CA   . ASP A 1 25 ? 7.546   -2.654  -11.390 1.00 0.00 ? 25 ASP A CA   2  
ATOM 1189  C C    . ASP A 1 25 ? 8.410   -2.957  -10.170 1.00 0.00 ? 25 ASP A C    2  
ATOM 1190  O O    . ASP A 1 25 ? 9.222   -3.881  -10.187 1.00 0.00 ? 25 ASP A O    2  
ATOM 1191  C CB   . ASP A 1 25 ? 7.959   -1.309  -11.989 1.00 0.00 ? 25 ASP A CB   2  
ATOM 1192  C CG   . ASP A 1 25 ? 9.306   -1.442  -12.692 1.00 0.00 ? 25 ASP A CG   2  
ATOM 1193  O OD1  . ASP A 1 25 ? 9.318   -1.886  -13.828 1.00 0.00 ? 25 ASP A OD1  2  
ATOM 1194  O OD2  . ASP A 1 25 ? 10.305  -1.097  -12.085 1.00 0.00 ? 25 ASP A OD2  2  
ATOM 1195  H H    . ASP A 1 25 ? 5.599   -1.834  -11.243 1.00 0.00 ? 25 ASP A H    2  
ATOM 1196  H HA   . ASP A 1 25 ? 7.704   -3.425  -12.127 1.00 0.00 ? 25 ASP A HA   2  
ATOM 1197  H HB2  . ASP A 1 25 ? 7.213   -0.990  -12.702 1.00 0.00 ? 25 ASP A HB2  2  
ATOM 1198  H HB3  . ASP A 1 25 ? 8.040   -0.575  -11.201 1.00 0.00 ? 25 ASP A HB3  2  
ATOM 1199  N N    . THR A 1 26 ? 8.235   -2.171  -9.116  1.00 0.00 ? 26 THR A N    2  
ATOM 1200  C CA   . THR A 1 26 ? 9.014   -2.357  -7.899  1.00 0.00 ? 26 THR A CA   2  
ATOM 1201  C C    . THR A 1 26 ? 8.832   -3.763  -7.332  1.00 0.00 ? 26 THR A C    2  
ATOM 1202  O O    . THR A 1 26 ? 9.772   -4.342  -6.786  1.00 0.00 ? 26 THR A O    2  
ATOM 1203  C CB   . THR A 1 26 ? 8.598   -1.331  -6.847  1.00 0.00 ? 26 THR A CB   2  
ATOM 1204  O OG1  . THR A 1 26 ? 8.486   -0.051  -7.454  1.00 0.00 ? 26 THR A OG1  2  
ATOM 1205  C CG2  . THR A 1 26 ? 9.651   -1.285  -5.739  1.00 0.00 ? 26 THR A CG2  2  
ATOM 1206  H H    . THR A 1 26 ? 7.578   -1.445  -9.160  1.00 0.00 ? 26 THR A H    2  
ATOM 1207  H HA   . THR A 1 26 ? 10.058  -2.208  -8.129  1.00 0.00 ? 26 THR A HA   2  
ATOM 1208  H HB   . THR A 1 26 ? 7.647   -1.615  -6.424  1.00 0.00 ? 26 THR A HB   2  
ATOM 1209  H HG1  . THR A 1 26 ? 7.576   0.239   -7.369  1.00 0.00 ? 26 THR A HG1  2  
ATOM 1210  H HG21 . THR A 1 26 ? 10.567  -0.869  -6.131  1.00 0.00 ? 26 THR A HG21 2  
ATOM 1211  H HG22 . THR A 1 26 ? 9.836   -2.286  -5.380  1.00 0.00 ? 26 THR A HG22 2  
ATOM 1212  H HG23 . THR A 1 26 ? 9.295   -0.670  -4.928  1.00 0.00 ? 26 THR A HG23 2  
ATOM 1213  N N    . ILE A 1 27 ? 7.624   -4.306  -7.446  1.00 0.00 ? 27 ILE A N    2  
ATOM 1214  C CA   . ILE A 1 27 ? 7.359   -5.644  -6.919  1.00 0.00 ? 27 ILE A CA   2  
ATOM 1215  C C    . ILE A 1 27 ? 7.913   -6.717  -7.857  1.00 0.00 ? 27 ILE A C    2  
ATOM 1216  O O    . ILE A 1 27 ? 8.147   -7.852  -7.441  1.00 0.00 ? 27 ILE A O    2  
ATOM 1217  C CB   . ILE A 1 27 ? 5.845   -5.840  -6.698  1.00 0.00 ? 27 ILE A CB   2  
ATOM 1218  C CG1  . ILE A 1 27 ? 5.607   -6.479  -5.322  1.00 0.00 ? 27 ILE A CG1  2  
ATOM 1219  C CG2  . ILE A 1 27 ? 5.248   -6.742  -7.787  1.00 0.00 ? 27 ILE A CG2  2  
ATOM 1220  C CD1  . ILE A 1 27 ? 4.131   -6.859  -5.174  1.00 0.00 ? 27 ILE A CD1  2  
ATOM 1221  H H    . ILE A 1 27 ? 6.901   -3.804  -7.883  1.00 0.00 ? 27 ILE A H    2  
ATOM 1222  H HA   . ILE A 1 27 ? 7.861   -5.736  -5.966  1.00 0.00 ? 27 ILE A HA   2  
ATOM 1223  H HB   . ILE A 1 27 ? 5.356   -4.878  -6.730  1.00 0.00 ? 27 ILE A HB   2  
ATOM 1224  H HG12 . ILE A 1 27 ? 6.219   -7.363  -5.226  1.00 0.00 ? 27 ILE A HG12 2  
ATOM 1225  H HG13 . ILE A 1 27 ? 5.873   -5.774  -4.549  1.00 0.00 ? 27 ILE A HG13 2  
ATOM 1226  H HG21 . ILE A 1 27 ? 5.581   -6.407  -8.757  1.00 0.00 ? 27 ILE A HG21 2  
ATOM 1227  H HG22 . ILE A 1 27 ? 4.171   -6.692  -7.744  1.00 0.00 ? 27 ILE A HG22 2  
ATOM 1228  H HG23 . ILE A 1 27 ? 5.569   -7.761  -7.626  1.00 0.00 ? 27 ILE A HG23 2  
ATOM 1229  H HD11 . ILE A 1 27 ? 3.894   -6.977  -4.127  1.00 0.00 ? 27 ILE A HD11 2  
ATOM 1230  H HD12 . ILE A 1 27 ? 3.946   -7.790  -5.691  1.00 0.00 ? 27 ILE A HD12 2  
ATOM 1231  H HD13 . ILE A 1 27 ? 3.513   -6.083  -5.600  1.00 0.00 ? 27 ILE A HD13 2  
ATOM 1232  N N    . ASN A 1 28 ? 8.116   -6.355  -9.122  1.00 0.00 ? 28 ASN A N    2  
ATOM 1233  C CA   . ASN A 1 28 ? 8.639   -7.306  -10.103 1.00 0.00 ? 28 ASN A CA   2  
ATOM 1234  C C    . ASN A 1 28 ? 10.109  -7.019  -10.417 1.00 0.00 ? 28 ASN A C    2  
ATOM 1235  O O    . ASN A 1 28 ? 10.740  -7.751  -11.178 1.00 0.00 ? 28 ASN A O    2  
ATOM 1236  C CB   . ASN A 1 28 ? 7.794   -7.243  -11.389 1.00 0.00 ? 28 ASN A CB   2  
ATOM 1237  C CG   . ASN A 1 28 ? 8.566   -6.556  -12.513 1.00 0.00 ? 28 ASN A CG   2  
ATOM 1238  O OD1  . ASN A 1 28 ? 8.738   -7.128  -13.589 1.00 0.00 ? 28 ASN A OD1  2  
ATOM 1239  N ND2  . ASN A 1 28 ? 9.043   -5.360  -12.323 1.00 0.00 ? 28 ASN A ND2  2  
ATOM 1240  H H    . ASN A 1 28 ? 7.909   -5.437  -9.402  1.00 0.00 ? 28 ASN A H    2  
ATOM 1241  H HA   . ASN A 1 28 ? 8.566   -8.302  -9.693  1.00 0.00 ? 28 ASN A HA   2  
ATOM 1242  H HB2  . ASN A 1 28 ? 7.537   -8.246  -11.698 1.00 0.00 ? 28 ASN A HB2  2  
ATOM 1243  H HB3  . ASN A 1 28 ? 6.889   -6.689  -11.191 1.00 0.00 ? 28 ASN A HB3  2  
ATOM 1244  H HD21 . ASN A 1 28 ? 8.904   -4.906  -11.464 1.00 0.00 ? 28 ASN A HD21 2  
ATOM 1245  H HD22 . ASN A 1 28 ? 9.537   -4.910  -13.038 1.00 0.00 ? 28 ASN A HD22 2  
ATOM 1246  N N    . THR A 1 29 ? 10.650  -5.956  -9.822  1.00 0.00 ? 29 THR A N    2  
ATOM 1247  C CA   . THR A 1 29 ? 12.051  -5.593  -10.046 1.00 0.00 ? 29 THR A CA   2  
ATOM 1248  C C    . THR A 1 29 ? 12.838  -5.683  -8.746  1.00 0.00 ? 29 THR A C    2  
ATOM 1249  O O    . THR A 1 29 ? 13.918  -6.271  -8.702  1.00 0.00 ? 29 THR A O    2  
ATOM 1250  C CB   . THR A 1 29 ? 12.149  -4.166  -10.603 1.00 0.00 ? 29 THR A CB   2  
ATOM 1251  O OG1  . THR A 1 29 ? 11.424  -3.283  -9.761  1.00 0.00 ? 29 THR A OG1  2  
ATOM 1252  C CG2  . THR A 1 29 ? 11.573  -4.109  -12.026 1.00 0.00 ? 29 THR A CG2  2  
ATOM 1253  H H    . THR A 1 29 ? 10.100  -5.410  -9.220  1.00 0.00 ? 29 THR A H    2  
ATOM 1254  H HA   . THR A 1 29 ? 12.484  -6.277  -10.762 1.00 0.00 ? 29 THR A HA   2  
ATOM 1255  H HB   . THR A 1 29 ? 13.186  -3.866  -10.627 1.00 0.00 ? 29 THR A HB   2  
ATOM 1256  H HG1  . THR A 1 29 ? 11.499  -3.603  -8.859  1.00 0.00 ? 29 THR A HG1  2  
ATOM 1257  H HG21 . THR A 1 29 ? 10.629  -3.589  -12.009 1.00 0.00 ? 29 THR A HG21 2  
ATOM 1258  H HG22 . THR A 1 29 ? 11.425  -5.109  -12.404 1.00 0.00 ? 29 THR A HG22 2  
ATOM 1259  H HG23 . THR A 1 29 ? 12.260  -3.582  -12.672 1.00 0.00 ? 29 THR A HG23 2  
ATOM 1260  N N    . SER A 1 30 ? 12.290  -5.096  -7.686  1.00 0.00 ? 30 SER A N    2  
ATOM 1261  C CA   . SER A 1 30 ? 12.951  -5.115  -6.384  1.00 0.00 ? 30 SER A CA   2  
ATOM 1262  C C    . SER A 1 30 ? 12.476  -6.314  -5.568  1.00 0.00 ? 30 SER A C    2  
ATOM 1263  O O    . SER A 1 30 ? 11.498  -6.972  -5.923  1.00 0.00 ? 30 SER A O    2  
ATOM 1264  C CB   . SER A 1 30 ? 12.651  -3.817  -5.631  1.00 0.00 ? 30 SER A CB   2  
ATOM 1265  O OG   . SER A 1 30 ? 13.760  -2.936  -5.756  1.00 0.00 ? 30 SER A OG   2  
ATOM 1266  H H    . SER A 1 30 ? 11.426  -4.644  -7.780  1.00 0.00 ? 30 SER A H    2  
ATOM 1267  H HA   . SER A 1 30 ? 14.019  -5.193  -6.533  1.00 0.00 ? 30 SER A HA   2  
ATOM 1268  H HB2  . SER A 1 30 ? 11.779  -3.348  -6.053  1.00 0.00 ? 30 SER A HB2  2  
ATOM 1269  H HB3  . SER A 1 30 ? 12.469  -4.035  -4.586  1.00 0.00 ? 30 SER A HB3  2  
ATOM 1270  H HG   . SER A 1 30 ? 14.169  -2.850  -4.893  1.00 0.00 ? 30 SER A HG   2  
ATOM 1271  N N    . CYS A 1 31 ? 13.176  -6.594  -4.474  1.00 0.00 ? 31 CYS A N    2  
ATOM 1272  C CA   . CYS A 1 31 ? 12.814  -7.717  -3.617  1.00 0.00 ? 31 CYS A CA   2  
ATOM 1273  C C    . CYS A 1 31 ? 13.378  -7.531  -2.214  1.00 0.00 ? 31 CYS A C    2  
ATOM 1274  O O    . CYS A 1 31 ? 14.586  -7.365  -2.037  1.00 0.00 ? 31 CYS A O    2  
ATOM 1275  C CB   . CYS A 1 31 ? 13.346  -9.021  -4.215  1.00 0.00 ? 31 CYS A CB   2  
ATOM 1276  S SG   . CYS A 1 31 ? 12.767  -10.421 -3.222  1.00 0.00 ? 31 CYS A SG   2  
ATOM 1277  H H    . CYS A 1 31 ? 13.947  -6.036  -4.237  1.00 0.00 ? 31 CYS A H    2  
ATOM 1278  H HA   . CYS A 1 31 ? 11.738  -7.778  -3.556  1.00 0.00 ? 31 CYS A HA   2  
ATOM 1279  H HB2  . CYS A 1 31 ? 12.987  -9.126  -5.228  1.00 0.00 ? 31 CYS A HB2  2  
ATOM 1280  H HB3  . CYS A 1 31 ? 14.426  -9.002  -4.215  1.00 0.00 ? 31 CYS A HB3  2  
ATOM 1281  H HG   . CYS A 1 31 ? 12.714  -11.189 -3.795  1.00 0.00 ? 31 CYS A HG   2  
ATOM 1282  N N    . ASP A 1 32 ? 12.498  -7.567  -1.222  1.00 0.00 ? 32 ASP A N    2  
ATOM 1283  C CA   . ASP A 1 32 ? 12.912  -7.408  0.167   1.00 0.00 ? 32 ASP A CA   2  
ATOM 1284  C C    . ASP A 1 32 ? 11.721  -7.626  1.097   1.00 0.00 ? 32 ASP A C    2  
ATOM 1285  O O    . ASP A 1 32 ? 10.633  -7.103  0.857   1.00 0.00 ? 32 ASP A O    2  
ATOM 1286  C CB   . ASP A 1 32 ? 13.497  -6.005  0.391   1.00 0.00 ? 32 ASP A CB   2  
ATOM 1287  C CG   . ASP A 1 32 ? 14.640  -6.067  1.401   1.00 0.00 ? 32 ASP A CG   2  
ATOM 1288  O OD1  . ASP A 1 32 ? 14.548  -6.859  2.324   1.00 0.00 ? 32 ASP A OD1  2  
ATOM 1289  O OD2  . ASP A 1 32 ? 15.590  -5.319  1.236   1.00 0.00 ? 32 ASP A OD2  2  
ATOM 1290  H H    . ASP A 1 32 ? 11.550  -7.706  -1.427  1.00 0.00 ? 32 ASP A H    2  
ATOM 1291  H HA   . ASP A 1 32 ? 13.668  -8.145  0.391   1.00 0.00 ? 32 ASP A HA   2  
ATOM 1292  H HB2  . ASP A 1 32 ? 13.869  -5.619  -0.547  1.00 0.00 ? 32 ASP A HB2  2  
ATOM 1293  H HB3  . ASP A 1 32 ? 12.727  -5.349  0.767   1.00 0.00 ? 32 ASP A HB3  2  
ATOM 1294  N N    . ILE A 1 33 ? 11.934  -8.400  2.154   1.00 0.00 ? 33 ILE A N    2  
ATOM 1295  C CA   . ILE A 1 33 ? 10.870  -8.682  3.111   1.00 0.00 ? 33 ILE A CA   2  
ATOM 1296  C C    . ILE A 1 33 ? 10.013  -7.439  3.348   1.00 0.00 ? 33 ILE A C    2  
ATOM 1297  O O    . ILE A 1 33 ? 8.789   -7.526  3.438   1.00 0.00 ? 33 ILE A O    2  
ATOM 1298  C CB   . ILE A 1 33 ? 11.473  -9.149  4.440   1.00 0.00 ? 33 ILE A CB   2  
ATOM 1299  C CG1  . ILE A 1 33 ? 12.737  -8.330  4.751   1.00 0.00 ? 33 ILE A CG1  2  
ATOM 1300  C CG2  . ILE A 1 33 ? 11.837  -10.634 4.345   1.00 0.00 ? 33 ILE A CG2  2  
ATOM 1301  C CD1  . ILE A 1 33 ? 12.908  -8.196  6.265   1.00 0.00 ? 33 ILE A CD1  2  
ATOM 1302  H H    . ILE A 1 33 ? 12.823  -8.791  2.294   1.00 0.00 ? 33 ILE A H    2  
ATOM 1303  H HA   . ILE A 1 33 ? 10.243  -9.466  2.716   1.00 0.00 ? 33 ILE A HA   2  
ATOM 1304  H HB   . ILE A 1 33 ? 10.748  -9.011  5.230   1.00 0.00 ? 33 ILE A HB   2  
ATOM 1305  H HG12 . ILE A 1 33 ? 13.602  -8.827  4.333   1.00 0.00 ? 33 ILE A HG12 2  
ATOM 1306  H HG13 . ILE A 1 33 ? 12.646  -7.348  4.314   1.00 0.00 ? 33 ILE A HG13 2  
ATOM 1307  H HG21 . ILE A 1 33 ? 12.329  -10.944 5.255   1.00 0.00 ? 33 ILE A HG21 2  
ATOM 1308  H HG22 . ILE A 1 33 ? 12.500  -10.790 3.506   1.00 0.00 ? 33 ILE A HG22 2  
ATOM 1309  H HG23 . ILE A 1 33 ? 10.938  -11.217 4.205   1.00 0.00 ? 33 ILE A HG23 2  
ATOM 1310  H HD11 . ILE A 1 33 ? 12.697  -9.145  6.737   1.00 0.00 ? 33 ILE A HD11 2  
ATOM 1311  H HD12 . ILE A 1 33 ? 12.224  -7.449  6.640   1.00 0.00 ? 33 ILE A HD12 2  
ATOM 1312  H HD13 . ILE A 1 33 ? 13.922  -7.900  6.488   1.00 0.00 ? 33 ILE A HD13 2  
ATOM 1313  N N    . GLU A 1 34 ? 10.667  -6.286  3.453   1.00 0.00 ? 34 GLU A N    2  
ATOM 1314  C CA   . GLU A 1 34 ? 9.957   -5.035  3.689   1.00 0.00 ? 34 GLU A CA   2  
ATOM 1315  C C    . GLU A 1 34 ? 9.250   -4.557  2.423   1.00 0.00 ? 34 GLU A C    2  
ATOM 1316  O O    . GLU A 1 34 ? 8.056   -4.258  2.445   1.00 0.00 ? 34 GLU A O    2  
ATOM 1317  C CB   . GLU A 1 34 ? 10.939  -3.961  4.169   1.00 0.00 ? 34 GLU A CB   2  
ATOM 1318  C CG   . GLU A 1 34 ? 12.044  -4.609  5.009   1.00 0.00 ? 34 GLU A CG   2  
ATOM 1319  C CD   . GLU A 1 34 ? 12.624  -3.593  5.989   1.00 0.00 ? 34 GLU A CD   2  
ATOM 1320  O OE1  . GLU A 1 34 ? 11.848  -2.983  6.707   1.00 0.00 ? 34 GLU A OE1  2  
ATOM 1321  O OE2  . GLU A 1 34 ? 13.834  -3.440  6.006   1.00 0.00 ? 34 GLU A OE2  2  
ATOM 1322  H H    . GLU A 1 34 ? 11.643  -6.278  3.376   1.00 0.00 ? 34 GLU A H    2  
ATOM 1323  H HA   . GLU A 1 34 ? 9.218   -5.196  4.460   1.00 0.00 ? 34 GLU A HA   2  
ATOM 1324  H HB2  . GLU A 1 34 ? 11.380  -3.469  3.314   1.00 0.00 ? 34 GLU A HB2  2  
ATOM 1325  H HB3  . GLU A 1 34 ? 10.412  -3.234  4.769   1.00 0.00 ? 34 GLU A HB3  2  
ATOM 1326  H HG2  . GLU A 1 34 ? 11.635  -5.444  5.560   1.00 0.00 ? 34 GLU A HG2  2  
ATOM 1327  H HG3  . GLU A 1 34 ? 12.829  -4.960  4.357   1.00 0.00 ? 34 GLU A HG3  2  
ATOM 1328  N N    . LEU A 1 35 ? 9.992   -4.480  1.323   1.00 0.00 ? 35 LEU A N    2  
ATOM 1329  C CA   . LEU A 1 35 ? 9.414   -4.027  0.061   1.00 0.00 ? 35 LEU A CA   2  
ATOM 1330  C C    . LEU A 1 35 ? 8.177   -4.855  -0.282  1.00 0.00 ? 35 LEU A C    2  
ATOM 1331  O O    . LEU A 1 35 ? 7.109   -4.309  -0.555  1.00 0.00 ? 35 LEU A O    2  
ATOM 1332  C CB   . LEU A 1 35 ? 10.447  -4.155  -1.072  1.00 0.00 ? 35 LEU A CB   2  
ATOM 1333  C CG   . LEU A 1 35 ? 10.276  -3.025  -2.108  1.00 0.00 ? 35 LEU A CG   2  
ATOM 1334  C CD1  . LEU A 1 35 ? 8.791   -2.812  -2.432  1.00 0.00 ? 35 LEU A CD1  2  
ATOM 1335  C CD2  . LEU A 1 35 ? 10.868  -1.716  -1.568  1.00 0.00 ? 35 LEU A CD2  2  
ATOM 1336  H H    . LEU A 1 35 ? 10.941  -4.725  1.360   1.00 0.00 ? 35 LEU A H    2  
ATOM 1337  H HA   . LEU A 1 35 ? 9.130   -2.991  0.165   1.00 0.00 ? 35 LEU A HA   2  
ATOM 1338  H HB2  . LEU A 1 35 ? 11.440  -4.106  -0.652  1.00 0.00 ? 35 LEU A HB2  2  
ATOM 1339  H HB3  . LEU A 1 35 ? 10.321  -5.108  -1.565  1.00 0.00 ? 35 LEU A HB3  2  
ATOM 1340  H HG   . LEU A 1 35 ? 10.795  -3.300  -3.015  1.00 0.00 ? 35 LEU A HG   2  
ATOM 1341  H HD11 . LEU A 1 35 ? 8.702   -2.271  -3.361  1.00 0.00 ? 35 LEU A HD11 2  
ATOM 1342  H HD12 . LEU A 1 35 ? 8.325   -2.239  -1.643  1.00 0.00 ? 35 LEU A HD12 2  
ATOM 1343  H HD13 . LEU A 1 35 ? 8.300   -3.768  -2.525  1.00 0.00 ? 35 LEU A HD13 2  
ATOM 1344  H HD21 . LEU A 1 35 ? 10.092  -1.137  -1.091  1.00 0.00 ? 35 LEU A HD21 2  
ATOM 1345  H HD22 . LEU A 1 35 ? 11.282  -1.148  -2.389  1.00 0.00 ? 35 LEU A HD22 2  
ATOM 1346  H HD23 . LEU A 1 35 ? 11.649  -1.931  -0.855  1.00 0.00 ? 35 LEU A HD23 2  
ATOM 1347  N N    . LEU A 1 36 ? 8.335   -6.174  -0.272  1.00 0.00 ? 36 LEU A N    2  
ATOM 1348  C CA   . LEU A 1 36 ? 7.229   -7.070  -0.589  1.00 0.00 ? 36 LEU A CA   2  
ATOM 1349  C C    . LEU A 1 36 ? 6.126   -6.967  0.460   1.00 0.00 ? 36 LEU A C    2  
ATOM 1350  O O    . LEU A 1 36 ? 4.959   -6.765  0.126   1.00 0.00 ? 36 LEU A O    2  
ATOM 1351  C CB   . LEU A 1 36 ? 7.729   -8.513  -0.671  1.00 0.00 ? 36 LEU A CB   2  
ATOM 1352  C CG   . LEU A 1 36 ? 8.970   -8.579  -1.567  1.00 0.00 ? 36 LEU A CG   2  
ATOM 1353  C CD1  . LEU A 1 36 ? 9.419   -10.035 -1.707  1.00 0.00 ? 36 LEU A CD1  2  
ATOM 1354  C CD2  . LEU A 1 36 ? 8.637   -8.012  -2.951  1.00 0.00 ? 36 LEU A CD2  2  
ATOM 1355  H H    . LEU A 1 36 ? 9.211   -6.552  -0.051  1.00 0.00 ? 36 LEU A H    2  
ATOM 1356  H HA   . LEU A 1 36 ? 6.820   -6.791  -1.549  1.00 0.00 ? 36 LEU A HA   2  
ATOM 1357  H HB2  . LEU A 1 36 ? 7.983   -8.862  0.321   1.00 0.00 ? 36 LEU A HB2  2  
ATOM 1358  H HB3  . LEU A 1 36 ? 6.955   -9.140  -1.085  1.00 0.00 ? 36 LEU A HB3  2  
ATOM 1359  H HG   . LEU A 1 36 ? 9.767   -8.000  -1.121  1.00 0.00 ? 36 LEU A HG   2  
ATOM 1360  H HD11 . LEU A 1 36 ? 8.562   -10.657 -1.920  1.00 0.00 ? 36 LEU A HD11 2  
ATOM 1361  H HD12 . LEU A 1 36 ? 9.880   -10.359 -0.787  1.00 0.00 ? 36 LEU A HD12 2  
ATOM 1362  H HD13 . LEU A 1 36 ? 10.132  -10.116 -2.515  1.00 0.00 ? 36 LEU A HD13 2  
ATOM 1363  H HD21 . LEU A 1 36 ? 9.356   -8.373  -3.673  1.00 0.00 ? 36 LEU A HD21 2  
ATOM 1364  H HD22 . LEU A 1 36 ? 8.675   -6.933  -2.918  1.00 0.00 ? 36 LEU A HD22 2  
ATOM 1365  H HD23 . LEU A 1 36 ? 7.646   -8.328  -3.244  1.00 0.00 ? 36 LEU A HD23 2  
ATOM 1366  N N    . ALA A 1 37 ? 6.497   -7.106  1.730   1.00 0.00 ? 37 ALA A N    2  
ATOM 1367  C CA   . ALA A 1 37 ? 5.517   -7.024  2.807   1.00 0.00 ? 37 ALA A CA   2  
ATOM 1368  C C    . ALA A 1 37 ? 4.712   -5.735  2.692   1.00 0.00 ? 37 ALA A C    2  
ATOM 1369  O O    . ALA A 1 37 ? 3.482   -5.759  2.698   1.00 0.00 ? 37 ALA A O    2  
ATOM 1370  C CB   . ALA A 1 37 ? 6.218   -7.069  4.166   1.00 0.00 ? 37 ALA A CB   2  
ATOM 1371  H H    . ALA A 1 37 ? 7.442   -7.266  1.944   1.00 0.00 ? 37 ALA A H    2  
ATOM 1372  H HA   . ALA A 1 37 ? 4.844   -7.865  2.733   1.00 0.00 ? 37 ALA A HA   2  
ATOM 1373  H HB1  . ALA A 1 37 ? 6.968   -6.295  4.209   1.00 0.00 ? 37 ALA A HB1  2  
ATOM 1374  H HB2  . ALA A 1 37 ? 6.684   -8.033  4.299   1.00 0.00 ? 37 ALA A HB2  2  
ATOM 1375  H HB3  . ALA A 1 37 ? 5.491   -6.910  4.948   1.00 0.00 ? 37 ALA A HB3  2  
ATOM 1376  N N    . ALA A 1 38 ? 5.415   -4.614  2.584   1.00 0.00 ? 38 ALA A N    2  
ATOM 1377  C CA   . ALA A 1 38 ? 4.753   -3.320  2.467   1.00 0.00 ? 38 ALA A CA   2  
ATOM 1378  C C    . ALA A 1 38 ? 3.869   -3.288  1.223   1.00 0.00 ? 38 ALA A C    2  
ATOM 1379  O O    . ALA A 1 38 ? 2.711   -2.875  1.284   1.00 0.00 ? 38 ALA A O    2  
ATOM 1380  C CB   . ALA A 1 38 ? 5.796   -2.203  2.396   1.00 0.00 ? 38 ALA A CB   2  
ATOM 1381  H H    . ALA A 1 38 ? 6.394   -4.656  2.582   1.00 0.00 ? 38 ALA A H    2  
ATOM 1382  H HA   . ALA A 1 38 ? 4.134   -3.165  3.338   1.00 0.00 ? 38 ALA A HA   2  
ATOM 1383  H HB1  . ALA A 1 38 ? 6.647   -2.467  3.005   1.00 0.00 ? 38 ALA A HB1  2  
ATOM 1384  H HB2  . ALA A 1 38 ? 5.364   -1.284  2.763   1.00 0.00 ? 38 ALA A HB2  2  
ATOM 1385  H HB3  . ALA A 1 38 ? 6.114   -2.067  1.371   1.00 0.00 ? 38 ALA A HB3  2  
ATOM 1386  N N    . CYS A 1 39 ? 4.421   -3.730  0.096   1.00 0.00 ? 39 CYS A N    2  
ATOM 1387  C CA   . CYS A 1 39 ? 3.667   -3.750  -1.152  1.00 0.00 ? 39 CYS A CA   2  
ATOM 1388  C C    . CYS A 1 39 ? 2.361   -4.514  -0.965  1.00 0.00 ? 39 CYS A C    2  
ATOM 1389  O O    . CYS A 1 39 ? 1.293   -4.051  -1.370  1.00 0.00 ? 39 CYS A O    2  
ATOM 1390  C CB   . CYS A 1 39 ? 4.490   -4.414  -2.258  1.00 0.00 ? 39 CYS A CB   2  
ATOM 1391  S SG   . CYS A 1 39 ? 3.748   -4.043  -3.866  1.00 0.00 ? 39 CYS A SG   2  
ATOM 1392  H H    . CYS A 1 39 ? 5.347   -4.052  0.106   1.00 0.00 ? 39 CYS A H    2  
ATOM 1393  H HA   . CYS A 1 39 ? 3.443   -2.734  -1.443  1.00 0.00 ? 39 CYS A HA   2  
ATOM 1394  H HB2  . CYS A 1 39 ? 5.502   -4.037  -2.233  1.00 0.00 ? 39 CYS A HB2  2  
ATOM 1395  H HB3  . CYS A 1 39 ? 4.503   -5.484  -2.105  1.00 0.00 ? 39 CYS A HB3  2  
ATOM 1396  H HG   . CYS A 1 39 ? 4.177   -3.260  -4.217  1.00 0.00 ? 39 CYS A HG   2  
ATOM 1397  N N    . ARG A 1 40 ? 2.455   -5.685  -0.342  1.00 0.00 ? 40 ARG A N    2  
ATOM 1398  C CA   . ARG A 1 40 ? 1.279   -6.508  -0.098  1.00 0.00 ? 40 ARG A CA   2  
ATOM 1399  C C    . ARG A 1 40 ? 0.265   -5.747  0.749   1.00 0.00 ? 40 ARG A C    2  
ATOM 1400  O O    . ARG A 1 40 ? -0.927  -5.725  0.438   1.00 0.00 ? 40 ARG A O    2  
ATOM 1401  C CB   . ARG A 1 40 ? 1.684   -7.796  0.620   1.00 0.00 ? 40 ARG A CB   2  
ATOM 1402  C CG   . ARG A 1 40 ? 0.511   -8.779  0.618   1.00 0.00 ? 40 ARG A CG   2  
ATOM 1403  C CD   . ARG A 1 40 ? 0.795   -9.915  1.602   1.00 0.00 ? 40 ARG A CD   2  
ATOM 1404  N NE   . ARG A 1 40 ? 1.923   -10.715 1.138   1.00 0.00 ? 40 ARG A NE   2  
ATOM 1405  C CZ   . ARG A 1 40 ? 2.431   -11.688 1.887   1.00 0.00 ? 40 ARG A CZ   2  
ATOM 1406  N NH1  . ARG A 1 40 ? 1.919   -11.942 3.061   1.00 0.00 ? 40 ARG A NH1  2  
ATOM 1407  N NH2  . ARG A 1 40 ? 3.441   -12.389 1.451   1.00 0.00 ? 40 ARG A NH2  2  
ATOM 1408  H H    . ARG A 1 40 ? 3.333   -5.999  -0.040  1.00 0.00 ? 40 ARG A H    2  
ATOM 1409  H HA   . ARG A 1 40 ? 0.825   -6.763  -1.045  1.00 0.00 ? 40 ARG A HA   2  
ATOM 1410  H HB2  . ARG A 1 40 ? 2.527   -8.240  0.111   1.00 0.00 ? 40 ARG A HB2  2  
ATOM 1411  H HB3  . ARG A 1 40 ? 1.958   -7.569  1.640   1.00 0.00 ? 40 ARG A HB3  2  
ATOM 1412  H HG2  . ARG A 1 40 ? -0.391  -8.262  0.914   1.00 0.00 ? 40 ARG A HG2  2  
ATOM 1413  H HG3  . ARG A 1 40 ? 0.385   -9.187  -0.373  1.00 0.00 ? 40 ARG A HG3  2  
ATOM 1414  H HD2  . ARG A 1 40 ? 1.029   -9.500  2.570   1.00 0.00 ? 40 ARG A HD2  2  
ATOM 1415  H HD3  . ARG A 1 40 ? -0.080  -10.542 1.685   1.00 0.00 ? 40 ARG A HD3  2  
ATOM 1416  H HE   . ARG A 1 40 ? 2.314   -10.531 0.259   1.00 0.00 ? 40 ARG A HE   2  
ATOM 1417  H HH11 . ARG A 1 40 ? 1.145   -11.405 3.395   1.00 0.00 ? 40 ARG A HH11 2  
ATOM 1418  H HH12 . ARG A 1 40 ? 2.300   -12.674 3.625   1.00 0.00 ? 40 ARG A HH12 2  
ATOM 1419  H HH21 . ARG A 1 40 ? 3.833   -12.195 0.552   1.00 0.00 ? 40 ARG A HH21 2  
ATOM 1420  H HH22 . ARG A 1 40 ? 3.823   -13.121 2.014   1.00 0.00 ? 40 ARG A HH22 2  
ATOM 1421  N N    . GLU A 1 41 ? 0.746   -5.119  1.817   1.00 0.00 ? 41 GLU A N    2  
ATOM 1422  C CA   . GLU A 1 41 ? -0.126  -4.356  2.699   1.00 0.00 ? 41 GLU A CA   2  
ATOM 1423  C C    . GLU A 1 41 ? -0.907  -3.316  1.901   1.00 0.00 ? 41 GLU A C    2  
ATOM 1424  O O    . GLU A 1 41 ? -2.113  -3.155  2.086   1.00 0.00 ? 41 GLU A O    2  
ATOM 1425  C CB   . GLU A 1 41 ? 0.704   -3.659  3.780   1.00 0.00 ? 41 GLU A CB   2  
ATOM 1426  C CG   . GLU A 1 41 ? 1.172   -4.687  4.812   1.00 0.00 ? 41 GLU A CG   2  
ATOM 1427  C CD   . GLU A 1 41 ? 1.892   -3.986  5.957   1.00 0.00 ? 41 GLU A CD   2  
ATOM 1428  O OE1  . GLU A 1 41 ? 1.213   -3.482  6.838   1.00 0.00 ? 41 GLU A OE1  2  
ATOM 1429  O OE2  . GLU A 1 41 ? 3.112   -3.963  5.940   1.00 0.00 ? 41 GLU A OE2  2  
ATOM 1430  H H    . GLU A 1 41 ? 1.706   -5.168  2.012   1.00 0.00 ? 41 GLU A H    2  
ATOM 1431  H HA   . GLU A 1 41 ? -0.823  -5.030  3.174   1.00 0.00 ? 41 GLU A HA   2  
ATOM 1432  H HB2  . GLU A 1 41 ? 1.562   -3.185  3.326   1.00 0.00 ? 41 GLU A HB2  2  
ATOM 1433  H HB3  . GLU A 1 41 ? 0.098   -2.910  4.271   1.00 0.00 ? 41 GLU A HB3  2  
ATOM 1434  H HG2  . GLU A 1 41 ? 0.318   -5.224  5.199   1.00 0.00 ? 41 GLU A HG2  2  
ATOM 1435  H HG3  . GLU A 1 41 ? 1.849   -5.385  4.339   1.00 0.00 ? 41 GLU A HG3  2  
ATOM 1436  N N    . GLU A 1 42 ? -0.209  -2.616  1.012   1.00 0.00 ? 42 GLU A N    2  
ATOM 1437  C CA   . GLU A 1 42 ? -0.849  -1.598  0.187   1.00 0.00 ? 42 GLU A CA   2  
ATOM 1438  C C    . GLU A 1 42 ? -1.940  -2.223  -0.675  1.00 0.00 ? 42 GLU A C    2  
ATOM 1439  O O    . GLU A 1 42 ? -3.079  -1.753  -0.689  1.00 0.00 ? 42 GLU A O    2  
ATOM 1440  C CB   . GLU A 1 42 ? 0.191   -0.922  -0.709  1.00 0.00 ? 42 GLU A CB   2  
ATOM 1441  C CG   . GLU A 1 42 ? 1.189   -0.152  0.158   1.00 0.00 ? 42 GLU A CG   2  
ATOM 1442  C CD   . GLU A 1 42 ? 0.539   1.115   0.703   1.00 0.00 ? 42 GLU A CD   2  
ATOM 1443  O OE1  . GLU A 1 42 ? 0.580   2.122   0.015   1.00 0.00 ? 42 GLU A OE1  2  
ATOM 1444  O OE2  . GLU A 1 42 ? 0.007   1.059   1.800   1.00 0.00 ? 42 GLU A OE2  2  
ATOM 1445  H H    . GLU A 1 42 ? 0.749   -2.791  0.905   1.00 0.00 ? 42 GLU A H    2  
ATOM 1446  H HA   . GLU A 1 42 ? -1.292  -0.853  0.831   1.00 0.00 ? 42 GLU A HA   2  
ATOM 1447  H HB2  . GLU A 1 42 ? 0.716   -1.674  -1.282  1.00 0.00 ? 42 GLU A HB2  2  
ATOM 1448  H HB3  . GLU A 1 42 ? -0.302  -0.236  -1.380  1.00 0.00 ? 42 GLU A HB3  2  
ATOM 1449  H HG2  . GLU A 1 42 ? 1.506   -0.777  0.981   1.00 0.00 ? 42 GLU A HG2  2  
ATOM 1450  H HG3  . GLU A 1 42 ? 2.049   0.116   -0.438  1.00 0.00 ? 42 GLU A HG3  2  
ATOM 1451  N N    . PHE A 1 43 ? -1.587  -3.286  -1.387  1.00 0.00 ? 43 PHE A N    2  
ATOM 1452  C CA   . PHE A 1 43 ? -2.548  -3.973  -2.245  1.00 0.00 ? 43 PHE A CA   2  
ATOM 1453  C C    . PHE A 1 43 ? -3.726  -4.475  -1.415  1.00 0.00 ? 43 PHE A C    2  
ATOM 1454  O O    . PHE A 1 43 ? -4.885  -4.259  -1.768  1.00 0.00 ? 43 PHE A O    2  
ATOM 1455  C CB   . PHE A 1 43 ? -1.865  -5.153  -2.953  1.00 0.00 ? 43 PHE A CB   2  
ATOM 1456  C CG   . PHE A 1 43 ? -1.663  -4.830  -4.417  1.00 0.00 ? 43 PHE A CG   2  
ATOM 1457  C CD1  . PHE A 1 43 ? -0.781  -3.810  -4.792  1.00 0.00 ? 43 PHE A CD1  2  
ATOM 1458  C CD2  . PHE A 1 43 ? -2.356  -5.552  -5.398  1.00 0.00 ? 43 PHE A CD2  2  
ATOM 1459  C CE1  . PHE A 1 43 ? -0.593  -3.511  -6.148  1.00 0.00 ? 43 PHE A CE1  2  
ATOM 1460  C CE2  . PHE A 1 43 ? -2.168  -5.251  -6.751  1.00 0.00 ? 43 PHE A CE2  2  
ATOM 1461  C CZ   . PHE A 1 43 ? -1.287  -4.230  -7.127  1.00 0.00 ? 43 PHE A CZ   2  
ATOM 1462  H H    . PHE A 1 43 ? -0.666  -3.619  -1.334  1.00 0.00 ? 43 PHE A H    2  
ATOM 1463  H HA   . PHE A 1 43 ? -2.914  -3.279  -2.986  1.00 0.00 ? 43 PHE A HA   2  
ATOM 1464  H HB2  . PHE A 1 43 ? -0.907  -5.340  -2.493  1.00 0.00 ? 43 PHE A HB2  2  
ATOM 1465  H HB3  . PHE A 1 43 ? -2.482  -6.038  -2.863  1.00 0.00 ? 43 PHE A HB3  2  
ATOM 1466  H HD1  . PHE A 1 43 ? -0.246  -3.255  -4.036  1.00 0.00 ? 43 PHE A HD1  2  
ATOM 1467  H HD2  . PHE A 1 43 ? -3.038  -6.338  -5.109  1.00 0.00 ? 43 PHE A HD2  2  
ATOM 1468  H HE1  . PHE A 1 43 ? 0.087   -2.723  -6.437  1.00 0.00 ? 43 PHE A HE1  2  
ATOM 1469  H HE2  . PHE A 1 43 ? -2.704  -5.806  -7.508  1.00 0.00 ? 43 PHE A HE2  2  
ATOM 1470  H HZ   . PHE A 1 43 ? -1.142  -3.999  -8.171  1.00 0.00 ? 43 PHE A HZ   2  
ATOM 1471  N N    . HIS A 1 44 ? -3.419  -5.142  -0.308  1.00 0.00 ? 44 HIS A N    2  
ATOM 1472  C CA   . HIS A 1 44 ? -4.459  -5.669  0.570   1.00 0.00 ? 44 HIS A CA   2  
ATOM 1473  C C    . HIS A 1 44 ? -5.455  -4.573  0.932   1.00 0.00 ? 44 HIS A C    2  
ATOM 1474  O O    . HIS A 1 44 ? -6.668  -4.778  0.875   1.00 0.00 ? 44 HIS A O    2  
ATOM 1475  C CB   . HIS A 1 44 ? -3.828  -6.234  1.844   1.00 0.00 ? 44 HIS A CB   2  
ATOM 1476  C CG   . HIS A 1 44 ? -4.884  -6.919  2.666   1.00 0.00 ? 44 HIS A CG   2  
ATOM 1477  N ND1  . HIS A 1 44 ? -5.313  -8.208  2.393   1.00 0.00 ? 44 HIS A ND1  2  
ATOM 1478  C CD2  . HIS A 1 44 ? -5.608  -6.507  3.757   1.00 0.00 ? 44 HIS A CD2  2  
ATOM 1479  C CE1  . HIS A 1 44 ? -6.252  -8.524  3.301   1.00 0.00 ? 44 HIS A CE1  2  
ATOM 1480  N NE2  . HIS A 1 44 ? -6.471  -7.523  4.157   1.00 0.00 ? 44 HIS A NE2  2  
ATOM 1481  H H    . HIS A 1 44 ? -2.477  -5.283  -0.074  1.00 0.00 ? 44 HIS A H    2  
ATOM 1482  H HA   . HIS A 1 44 ? -4.981  -6.463  0.059   1.00 0.00 ? 44 HIS A HA   2  
ATOM 1483  H HB2  . HIS A 1 44 ? -3.059  -6.945  1.582   1.00 0.00 ? 44 HIS A HB2  2  
ATOM 1484  H HB3  . HIS A 1 44 ? -3.393  -5.428  2.418   1.00 0.00 ? 44 HIS A HB3  2  
ATOM 1485  H HD2  . HIS A 1 44 ? -5.520  -5.542  4.234   1.00 0.00 ? 44 HIS A HD2  2  
ATOM 1486  H HE1  . HIS A 1 44 ? -6.768  -9.473  3.334   1.00 0.00 ? 44 HIS A HE1  2  
ATOM 1487  H HE2  . HIS A 1 44 ? -7.104  -7.506  4.905   1.00 0.00 ? 44 HIS A HE2  2  
ATOM 1488  N N    . ARG A 1 45 ? -4.935  -3.408  1.306   1.00 0.00 ? 45 ARG A N    2  
ATOM 1489  C CA   . ARG A 1 45 ? -5.790  -2.287  1.674   1.00 0.00 ? 45 ARG A CA   2  
ATOM 1490  C C    . ARG A 1 45 ? -6.681  -1.886  0.503   1.00 0.00 ? 45 ARG A C    2  
ATOM 1491  O O    . ARG A 1 45 ? -7.905  -1.846  0.628   1.00 0.00 ? 45 ARG A O    2  
ATOM 1492  C CB   . ARG A 1 45 ? -4.929  -1.092  2.095   1.00 0.00 ? 45 ARG A CB   2  
ATOM 1493  C CG   . ARG A 1 45 ? -5.822  -0.002  2.689   1.00 0.00 ? 45 ARG A CG   2  
ATOM 1494  C CD   . ARG A 1 45 ? -4.959  1.176   3.141   1.00 0.00 ? 45 ARG A CD   2  
ATOM 1495  N NE   . ARG A 1 45 ? -5.798  2.328   3.452   1.00 0.00 ? 45 ARG A NE   2  
ATOM 1496  C CZ   . ARG A 1 45 ? -5.266  3.481   3.844   1.00 0.00 ? 45 ARG A CZ   2  
ATOM 1497  N NH1  . ARG A 1 45 ? -3.970  3.598   3.955   1.00 0.00 ? 45 ARG A NH1  2  
ATOM 1498  N NH2  . ARG A 1 45 ? -6.038  4.496   4.117   1.00 0.00 ? 45 ARG A NH2  2  
ATOM 1499  H H    . ARG A 1 45 ? -3.962  -3.301  1.332   1.00 0.00 ? 45 ARG A H    2  
ATOM 1500  H HA   . ARG A 1 45 ? -6.412  -2.577  2.506   1.00 0.00 ? 45 ARG A HA   2  
ATOM 1501  H HB2  . ARG A 1 45 ? -4.209  -1.412  2.834   1.00 0.00 ? 45 ARG A HB2  2  
ATOM 1502  H HB3  . ARG A 1 45 ? -4.412  -0.701  1.233   1.00 0.00 ? 45 ARG A HB3  2  
ATOM 1503  H HG2  . ARG A 1 45 ? -6.527  0.332   1.941   1.00 0.00 ? 45 ARG A HG2  2  
ATOM 1504  H HG3  . ARG A 1 45 ? -6.359  -0.398  3.538   1.00 0.00 ? 45 ARG A HG3  2  
ATOM 1505  H HD2  . ARG A 1 45 ? -4.401  0.894   4.020   1.00 0.00 ? 45 ARG A HD2  2  
ATOM 1506  H HD3  . ARG A 1 45 ? -4.270  1.437   2.351   1.00 0.00 ? 45 ARG A HD3  2  
ATOM 1507  H HE   . ARG A 1 45 ? -6.773  2.249   3.372   1.00 0.00 ? 45 ARG A HE   2  
ATOM 1508  H HH11 . ARG A 1 45 ? -3.379  2.818   3.746   1.00 0.00 ? 45 ARG A HH11 2  
ATOM 1509  H HH12 . ARG A 1 45 ? -3.570  4.465   4.250   1.00 0.00 ? 45 ARG A HH12 2  
ATOM 1510  H HH21 . ARG A 1 45 ? -7.030  4.407   4.033   1.00 0.00 ? 45 ARG A HH21 2  
ATOM 1511  H HH22 . ARG A 1 45 ? -5.638  5.364   4.412   1.00 0.00 ? 45 ARG A HH22 2  
ATOM 1512  N N    . ARG A 1 46 ? -6.061  -1.598  -0.636  1.00 0.00 ? 46 ARG A N    2  
ATOM 1513  C CA   . ARG A 1 46 ? -6.809  -1.206  -1.825  1.00 0.00 ? 46 ARG A CA   2  
ATOM 1514  C C    . ARG A 1 46 ? -7.861  -2.259  -2.163  1.00 0.00 ? 46 ARG A C    2  
ATOM 1515  O O    . ARG A 1 46 ? -8.995  -1.928  -2.509  1.00 0.00 ? 46 ARG A O    2  
ATOM 1516  C CB   . ARG A 1 46 ? -5.855  -1.036  -3.011  1.00 0.00 ? 46 ARG A CB   2  
ATOM 1517  C CG   . ARG A 1 46 ? -6.581  -0.329  -4.165  1.00 0.00 ? 46 ARG A CG   2  
ATOM 1518  C CD   . ARG A 1 46 ? -6.437  1.189   -4.017  1.00 0.00 ? 46 ARG A CD   2  
ATOM 1519  N NE   . ARG A 1 46 ? -7.270  1.872   -5.001  1.00 0.00 ? 46 ARG A NE   2  
ATOM 1520  C CZ   . ARG A 1 46 ? -7.268  3.197   -5.101  1.00 0.00 ? 46 ARG A CZ   2  
ATOM 1521  N NH1  . ARG A 1 46 ? -6.512  3.911   -4.312  1.00 0.00 ? 46 ARG A NH1  2  
ATOM 1522  N NH2  . ARG A 1 46 ? -8.023  3.786   -5.990  1.00 0.00 ? 46 ARG A NH2  2  
ATOM 1523  H H    . ARG A 1 46 ? -5.083  -1.648  -0.678  1.00 0.00 ? 46 ARG A H    2  
ATOM 1524  H HA   . ARG A 1 46 ? -7.303  -0.266  -1.634  1.00 0.00 ? 46 ARG A HA   2  
ATOM 1525  H HB2  . ARG A 1 46 ? -5.002  -0.447  -2.703  1.00 0.00 ? 46 ARG A HB2  2  
ATOM 1526  H HB3  . ARG A 1 46 ? -5.520  -2.007  -3.343  1.00 0.00 ? 46 ARG A HB3  2  
ATOM 1527  H HG2  . ARG A 1 46 ? -6.148  -0.640  -5.105  1.00 0.00 ? 46 ARG A HG2  2  
ATOM 1528  H HG3  . ARG A 1 46 ? -7.628  -0.591  -4.150  1.00 0.00 ? 46 ARG A HG3  2  
ATOM 1529  H HD2  . ARG A 1 46 ? -6.743  1.484   -3.026  1.00 0.00 ? 46 ARG A HD2  2  
ATOM 1530  H HD3  . ARG A 1 46 ? -5.403  1.465   -4.168  1.00 0.00 ? 46 ARG A HD3  2  
ATOM 1531  H HE   . ARG A 1 46 ? -7.840  1.345   -5.598  1.00 0.00 ? 46 ARG A HE   2  
ATOM 1532  H HH11 . ARG A 1 46 ? -5.934  3.461   -3.632  1.00 0.00 ? 46 ARG A HH11 2  
ATOM 1533  H HH12 . ARG A 1 46 ? -6.511  4.908   -4.388  1.00 0.00 ? 46 ARG A HH12 2  
ATOM 1534  H HH21 . ARG A 1 46 ? -8.603  3.239   -6.594  1.00 0.00 ? 46 ARG A HH21 2  
ATOM 1535  H HH22 . ARG A 1 46 ? -8.022  4.783   -6.064  1.00 0.00 ? 46 ARG A HH22 2  
ATOM 1536  N N    . LEU A 1 47 ? -7.476  -3.527  -2.061  1.00 0.00 ? 47 LEU A N    2  
ATOM 1537  C CA   . LEU A 1 47 ? -8.396  -4.620  -2.359  1.00 0.00 ? 47 LEU A CA   2  
ATOM 1538  C C    . LEU A 1 47 ? -9.646  -4.516  -1.492  1.00 0.00 ? 47 LEU A C    2  
ATOM 1539  O O    . LEU A 1 47 ? -10.764 -4.459  -2.003  1.00 0.00 ? 47 LEU A O    2  
ATOM 1540  C CB   . LEU A 1 47 ? -7.704  -5.967  -2.113  1.00 0.00 ? 47 LEU A CB   2  
ATOM 1541  C CG   . LEU A 1 47 ? -6.786  -6.305  -3.296  1.00 0.00 ? 47 LEU A CG   2  
ATOM 1542  C CD1  . LEU A 1 47 ? -5.652  -7.218  -2.821  1.00 0.00 ? 47 LEU A CD1  2  
ATOM 1543  C CD2  . LEU A 1 47 ? -7.589  -7.026  -4.385  1.00 0.00 ? 47 LEU A CD2  2  
ATOM 1544  H H    . LEU A 1 47 ? -6.560  -3.731  -1.781  1.00 0.00 ? 47 LEU A H    2  
ATOM 1545  H HA   . LEU A 1 47 ? -8.685  -4.559  -3.397  1.00 0.00 ? 47 LEU A HA   2  
ATOM 1546  H HB2  . LEU A 1 47 ? -7.118  -5.905  -1.206  1.00 0.00 ? 47 LEU A HB2  2  
ATOM 1547  H HB3  . LEU A 1 47 ? -8.452  -6.739  -2.004  1.00 0.00 ? 47 LEU A HB3  2  
ATOM 1548  H HG   . LEU A 1 47 ? -6.365  -5.394  -3.699  1.00 0.00 ? 47 LEU A HG   2  
ATOM 1549  H HD11 . LEU A 1 47 ? -6.053  -7.987  -2.179  1.00 0.00 ? 47 LEU A HD11 2  
ATOM 1550  H HD12 . LEU A 1 47 ? -4.926  -6.634  -2.273  1.00 0.00 ? 47 LEU A HD12 2  
ATOM 1551  H HD13 . LEU A 1 47 ? -5.173  -7.674  -3.676  1.00 0.00 ? 47 LEU A HD13 2  
ATOM 1552  H HD21 . LEU A 1 47 ? -6.927  -7.308  -5.193  1.00 0.00 ? 47 LEU A HD21 2  
ATOM 1553  H HD22 . LEU A 1 47 ? -8.357  -6.368  -4.763  1.00 0.00 ? 47 LEU A HD22 2  
ATOM 1554  H HD23 . LEU A 1 47 ? -8.046  -7.911  -3.970  1.00 0.00 ? 47 LEU A HD23 2  
ATOM 1555  N N    . LYS A 1 48 ? -9.451  -4.492  -0.177  1.00 0.00 ? 48 LYS A N    2  
ATOM 1556  C CA   . LYS A 1 48 ? -10.575 -4.392  0.749   1.00 0.00 ? 48 LYS A CA   2  
ATOM 1557  C C    . LYS A 1 48 ? -11.279 -3.051  0.588   1.00 0.00 ? 48 LYS A C    2  
ATOM 1558  O O    . LYS A 1 48 ? -12.499 -2.993  0.432   1.00 0.00 ? 48 LYS A O    2  
ATOM 1559  C CB   . LYS A 1 48 ? -10.081 -4.544  2.189   1.00 0.00 ? 48 LYS A CB   2  
ATOM 1560  C CG   . LYS A 1 48 ? -9.524  -5.953  2.395   1.00 0.00 ? 48 LYS A CG   2  
ATOM 1561  C CD   . LYS A 1 48 ? -9.350  -6.223  3.892   1.00 0.00 ? 48 LYS A CD   2  
ATOM 1562  C CE   . LYS A 1 48 ? -8.507  -5.112  4.522   1.00 0.00 ? 48 LYS A CE   2  
ATOM 1563  N NZ   . LYS A 1 48 ? -9.368  -3.928  4.794   1.00 0.00 ? 48 LYS A NZ   2  
ATOM 1564  H H    . LYS A 1 48 ? -8.538  -4.539  0.177   1.00 0.00 ? 48 LYS A H    2  
ATOM 1565  H HA   . LYS A 1 48 ? -11.276 -5.185  0.535   1.00 0.00 ? 48 LYS A HA   2  
ATOM 1566  H HB2  . LYS A 1 48 ? -9.304  -3.817  2.382   1.00 0.00 ? 48 LYS A HB2  2  
ATOM 1567  H HB3  . LYS A 1 48 ? -10.903 -4.382  2.871   1.00 0.00 ? 48 LYS A HB3  2  
ATOM 1568  H HG2  . LYS A 1 48 ? -10.209 -6.677  1.976   1.00 0.00 ? 48 LYS A HG2  2  
ATOM 1569  H HG3  . LYS A 1 48 ? -8.566  -6.038  1.903   1.00 0.00 ? 48 LYS A HG3  2  
ATOM 1570  H HD2  . LYS A 1 48 ? -10.321 -6.251  4.366   1.00 0.00 ? 48 LYS A HD2  2  
ATOM 1571  H HD3  . LYS A 1 48 ? -8.855  -7.172  4.032   1.00 0.00 ? 48 LYS A HD3  2  
ATOM 1572  H HE2  . LYS A 1 48 ? -8.078  -5.466  5.447   1.00 0.00 ? 48 LYS A HE2  2  
ATOM 1573  H HE3  . LYS A 1 48 ? -7.714  -4.832  3.843   1.00 0.00 ? 48 LYS A HE3  2  
ATOM 1574  H HZ1  . LYS A 1 48 ? -10.360 -4.167  4.599   1.00 0.00 ? 48 LYS A HZ1  2  
ATOM 1575  H HZ2  . LYS A 1 48 ? -9.078  -3.139  4.183   1.00 0.00 ? 48 LYS A HZ2  2  
ATOM 1576  H HZ3  . LYS A 1 48 ? -9.268  -3.649  5.792   1.00 0.00 ? 48 LYS A HZ3  2  
ATOM 1577  N N    . VAL A 1 49 ? -10.503 -1.973  0.625   1.00 0.00 ? 49 VAL A N    2  
ATOM 1578  C CA   . VAL A 1 49 ? -11.061 -0.633  0.480   1.00 0.00 ? 49 VAL A CA   2  
ATOM 1579  C C    . VAL A 1 49 ? -11.903 -0.543  -0.790  1.00 0.00 ? 49 VAL A C    2  
ATOM 1580  O O    . VAL A 1 49 ? -12.985 0.047   -0.788  1.00 0.00 ? 49 VAL A O    2  
ATOM 1581  C CB   . VAL A 1 49 ? -9.928  0.398   0.431   1.00 0.00 ? 49 VAL A CB   2  
ATOM 1582  C CG1  . VAL A 1 49 ? -10.469 1.743   -0.060  1.00 0.00 ? 49 VAL A CG1  2  
ATOM 1583  C CG2  . VAL A 1 49 ? -9.334  0.571   1.830   1.00 0.00 ? 49 VAL A CG2  2  
ATOM 1584  H H    . VAL A 1 49 ? -9.537  -2.080  0.751   1.00 0.00 ? 49 VAL A H    2  
ATOM 1585  H HA   . VAL A 1 49 ? -11.689 -0.420  1.333   1.00 0.00 ? 49 VAL A HA   2  
ATOM 1586  H HB   . VAL A 1 49 ? -9.160  0.053   -0.247  1.00 0.00 ? 49 VAL A HB   2  
ATOM 1587  H HG11 . VAL A 1 49 ? -10.625 1.701   -1.128  1.00 0.00 ? 49 VAL A HG11 2  
ATOM 1588  H HG12 . VAL A 1 49 ? -9.756  2.522   0.168   1.00 0.00 ? 49 VAL A HG12 2  
ATOM 1589  H HG13 . VAL A 1 49 ? -11.405 1.956   0.432   1.00 0.00 ? 49 VAL A HG13 2  
ATOM 1590  H HG21 . VAL A 1 49 ? -8.854  -0.347  2.135   1.00 0.00 ? 49 VAL A HG21 2  
ATOM 1591  H HG22 . VAL A 1 49 ? -10.122 0.816   2.529   1.00 0.00 ? 49 VAL A HG22 2  
ATOM 1592  H HG23 . VAL A 1 49 ? -8.607  1.371   1.816   1.00 0.00 ? 49 VAL A HG23 2  
ATOM 1593  N N    . TYR A 1 50 ? -11.401 -1.127  -1.871  1.00 0.00 ? 50 TYR A N    2  
ATOM 1594  C CA   . TYR A 1 50 ? -12.115 -1.103  -3.143  1.00 0.00 ? 50 TYR A CA   2  
ATOM 1595  C C    . TYR A 1 50 ? -13.369 -1.969  -3.069  1.00 0.00 ? 50 TYR A C    2  
ATOM 1596  O O    . TYR A 1 50 ? -14.446 -1.555  -3.496  1.00 0.00 ? 50 TYR A O    2  
ATOM 1597  C CB   . TYR A 1 50 ? -11.206 -1.613  -4.262  1.00 0.00 ? 50 TYR A CB   2  
ATOM 1598  C CG   . TYR A 1 50 ? -11.929 -1.510  -5.584  1.00 0.00 ? 50 TYR A CG   2  
ATOM 1599  C CD1  . TYR A 1 50 ? -11.959 -0.291  -6.272  1.00 0.00 ? 50 TYR A CD1  2  
ATOM 1600  C CD2  . TYR A 1 50 ? -12.572 -2.632  -6.120  1.00 0.00 ? 50 TYR A CD2  2  
ATOM 1601  C CE1  . TYR A 1 50 ? -12.631 -0.196  -7.498  1.00 0.00 ? 50 TYR A CE1  2  
ATOM 1602  C CE2  . TYR A 1 50 ? -13.243 -2.537  -7.344  1.00 0.00 ? 50 TYR A CE2  2  
ATOM 1603  C CZ   . TYR A 1 50 ? -13.273 -1.319  -8.033  1.00 0.00 ? 50 TYR A CZ   2  
ATOM 1604  O OH   . TYR A 1 50 ? -13.934 -1.224  -9.241  1.00 0.00 ? 50 TYR A OH   2  
ATOM 1605  H H    . TYR A 1 50 ? -10.534 -1.580  -1.814  1.00 0.00 ? 50 TYR A H    2  
ATOM 1606  H HA   . TYR A 1 50 ? -12.404 -0.087  -3.363  1.00 0.00 ? 50 TYR A HA   2  
ATOM 1607  H HB2  . TYR A 1 50 ? -10.307 -1.014  -4.296  1.00 0.00 ? 50 TYR A HB2  2  
ATOM 1608  H HB3  . TYR A 1 50 ? -10.947 -2.644  -4.074  1.00 0.00 ? 50 TYR A HB3  2  
ATOM 1609  H HD1  . TYR A 1 50 ? -11.464 0.574   -5.859  1.00 0.00 ? 50 TYR A HD1  2  
ATOM 1610  H HD2  . TYR A 1 50 ? -12.549 -3.572  -5.588  1.00 0.00 ? 50 TYR A HD2  2  
ATOM 1611  H HE1  . TYR A 1 50 ? -12.653 0.744   -8.029  1.00 0.00 ? 50 TYR A HE1  2  
ATOM 1612  H HE2  . TYR A 1 50 ? -13.738 -3.403  -7.758  1.00 0.00 ? 50 TYR A HE2  2  
ATOM 1613  H HH   . TYR A 1 50 ? -13.633 -1.943  -9.801  1.00 0.00 ? 50 TYR A HH   2  
ATOM 1614  N N    . HIS A 1 51 ? -13.220 -3.173  -2.525  1.00 0.00 ? 51 HIS A N    2  
ATOM 1615  C CA   . HIS A 1 51 ? -14.349 -4.089  -2.402  1.00 0.00 ? 51 HIS A CA   2  
ATOM 1616  C C    . HIS A 1 51 ? -15.286 -3.639  -1.286  1.00 0.00 ? 51 HIS A C    2  
ATOM 1617  O O    . HIS A 1 51 ? -16.448 -4.043  -1.237  1.00 0.00 ? 51 HIS A O    2  
ATOM 1618  C CB   . HIS A 1 51 ? -13.843 -5.502  -2.109  1.00 0.00 ? 51 HIS A CB   2  
ATOM 1619  C CG   . HIS A 1 51 ? -15.003 -6.460  -2.109  1.00 0.00 ? 51 HIS A CG   2  
ATOM 1620  N ND1  . HIS A 1 51 ? -15.355 -7.196  -0.988  1.00 0.00 ? 51 HIS A ND1  2  
ATOM 1621  C CD2  . HIS A 1 51 ? -15.902 -6.813  -3.085  1.00 0.00 ? 51 HIS A CD2  2  
ATOM 1622  C CE1  . HIS A 1 51 ? -16.423 -7.948  -1.315  1.00 0.00 ? 51 HIS A CE1  2  
ATOM 1623  N NE2  . HIS A 1 51 ? -16.796 -7.753  -2.582  1.00 0.00 ? 51 HIS A NE2  2  
ATOM 1624  H H    . HIS A 1 51 ? -12.339 -3.450  -2.203  1.00 0.00 ? 51 HIS A H    2  
ATOM 1625  H HA   . HIS A 1 51 ? -14.894 -4.101  -3.334  1.00 0.00 ? 51 HIS A HA   2  
ATOM 1626  H HB2  . HIS A 1 51 ? -13.134 -5.796  -2.869  1.00 0.00 ? 51 HIS A HB2  2  
ATOM 1627  H HB3  . HIS A 1 51 ? -13.363 -5.520  -1.142  1.00 0.00 ? 51 HIS A HB3  2  
ATOM 1628  H HD2  . HIS A 1 51 ? -15.913 -6.421  -4.093  1.00 0.00 ? 51 HIS A HD2  2  
ATOM 1629  H HE1  . HIS A 1 51 ? -16.916 -8.626  -0.634  1.00 0.00 ? 51 HIS A HE1  2  
ATOM 1630  H HE2  . HIS A 1 51 ? -17.541 -8.179  -3.055  1.00 0.00 ? 51 HIS A HE2  2  
ATOM 1631  N N    . ALA A 1 52 ? -14.772 -2.801  -0.389  1.00 0.00 ? 52 ALA A N    2  
ATOM 1632  C CA   . ALA A 1 52 ? -15.573 -2.303  0.725   1.00 0.00 ? 52 ALA A CA   2  
ATOM 1633  C C    . ALA A 1 52 ? -16.345 -1.053  0.315   1.00 0.00 ? 52 ALA A C    2  
ATOM 1634  O O    . ALA A 1 52 ? -17.572 -1.009  0.411   1.00 0.00 ? 52 ALA A O    2  
ATOM 1635  C CB   . ALA A 1 52 ? -14.666 -1.978  1.913   1.00 0.00 ? 52 ALA A CB   2  
ATOM 1636  H H    . ALA A 1 52 ? -13.841 -2.514  -0.478  1.00 0.00 ? 52 ALA A H    2  
ATOM 1637  H HA   . ALA A 1 52 ? -16.276 -3.067  1.024   1.00 0.00 ? 52 ALA A HA   2  
ATOM 1638  H HB1  . ALA A 1 52 ? -13.994 -1.177  1.644   1.00 0.00 ? 52 ALA A HB1  2  
ATOM 1639  H HB2  . ALA A 1 52 ? -14.094 -2.853  2.180   1.00 0.00 ? 52 ALA A HB2  2  
ATOM 1640  H HB3  . ALA A 1 52 ? -15.270 -1.671  2.754   1.00 0.00 ? 52 ALA A HB3  2  
ATOM 1641  N N    . TRP A 1 53 ? -15.618 -0.037  -0.139  1.00 0.00 ? 53 TRP A N    2  
ATOM 1642  C CA   . TRP A 1 53 ? -16.244 1.212   -0.560  1.00 0.00 ? 53 TRP A CA   2  
ATOM 1643  C C    . TRP A 1 53 ? -17.389 0.937   -1.531  1.00 0.00 ? 53 TRP A C    2  
ATOM 1644  O O    . TRP A 1 53 ? -18.169 1.834   -1.854  1.00 0.00 ? 53 TRP A O    2  
ATOM 1645  C CB   . TRP A 1 53 ? -15.205 2.115   -1.233  1.00 0.00 ? 53 TRP A CB   2  
ATOM 1646  C CG   . TRP A 1 53 ? -14.321 2.733   -0.194  1.00 0.00 ? 53 TRP A CG   2  
ATOM 1647  C CD1  . TRP A 1 53 ? -14.157 2.271   1.068   1.00 0.00 ? 53 TRP A CD1  2  
ATOM 1648  C CD2  . TRP A 1 53 ? -13.477 3.916   -0.309  1.00 0.00 ? 53 TRP A CD2  2  
ATOM 1649  N NE1  . TRP A 1 53 ? -13.267 3.095   1.734   1.00 0.00 ? 53 TRP A NE1  2  
ATOM 1650  C CE2  . TRP A 1 53 ? -12.820 4.123   0.928   1.00 0.00 ? 53 TRP A CE2  2  
ATOM 1651  C CE3  . TRP A 1 53 ? -13.220 4.820   -1.353  1.00 0.00 ? 53 TRP A CE3  2  
ATOM 1652  C CZ2  . TRP A 1 53 ? -11.941 5.189   1.120   1.00 0.00 ? 53 TRP A CZ2  2  
ATOM 1653  C CZ3  . TRP A 1 53 ? -12.335 5.896   -1.164  1.00 0.00 ? 53 TRP A CZ3  2  
ATOM 1654  C CH2  . TRP A 1 53 ? -11.697 6.079   0.071   1.00 0.00 ? 53 TRP A CH2  2  
ATOM 1655  H H    . TRP A 1 53 ? -14.643 -0.129  -0.193  1.00 0.00 ? 53 TRP A H    2  
ATOM 1656  H HA   . TRP A 1 53 ? -16.636 1.717   0.310   1.00 0.00 ? 53 TRP A HA   2  
ATOM 1657  H HB2  . TRP A 1 53 ? -14.605 1.529   -1.911  1.00 0.00 ? 53 TRP A HB2  2  
ATOM 1658  H HB3  . TRP A 1 53 ? -15.711 2.896   -1.782  1.00 0.00 ? 53 TRP A HB3  2  
ATOM 1659  H HD1  . TRP A 1 53 ? -14.641 1.401   1.487   1.00 0.00 ? 53 TRP A HD1  2  
ATOM 1660  H HE1  . TRP A 1 53 ? -12.977 2.980   2.664   1.00 0.00 ? 53 TRP A HE1  2  
ATOM 1661  H HE3  . TRP A 1 53 ? -13.707 4.688   -2.309  1.00 0.00 ? 53 TRP A HE3  2  
ATOM 1662  H HZ2  . TRP A 1 53 ? -11.452 5.326   2.074   1.00 0.00 ? 53 TRP A HZ2  2  
ATOM 1663  H HZ3  . TRP A 1 53 ? -12.146 6.583   -1.974  1.00 0.00 ? 53 TRP A HZ3  2  
ATOM 1664  H HH2  . TRP A 1 53 ? -11.018 6.906   0.210   1.00 0.00 ? 53 TRP A HH2  2  
ATOM 1665  N N    . LYS A 1 54 ? -17.484 -0.305  -1.992  1.00 0.00 ? 54 LYS A N    2  
ATOM 1666  C CA   . LYS A 1 54 ? -18.538 -0.683  -2.925  1.00 0.00 ? 54 LYS A CA   2  
ATOM 1667  C C    . LYS A 1 54 ? -19.911 -0.396  -2.330  1.00 0.00 ? 54 LYS A C    2  
ATOM 1668  O O    . LYS A 1 54 ? -20.747 0.257   -2.955  1.00 0.00 ? 54 LYS A O    2  
ATOM 1669  C CB   . LYS A 1 54 ? -18.425 -2.174  -3.264  1.00 0.00 ? 54 LYS A CB   2  
ATOM 1670  C CG   . LYS A 1 54 ? -19.598 -2.600  -4.162  1.00 0.00 ? 54 LYS A CG   2  
ATOM 1671  C CD   . LYS A 1 54 ? -20.639 -3.363  -3.335  1.00 0.00 ? 54 LYS A CD   2  
ATOM 1672  C CE   . LYS A 1 54 ? -21.803 -3.777  -4.238  1.00 0.00 ? 54 LYS A CE   2  
ATOM 1673  N NZ   . LYS A 1 54 ? -21.341 -4.815  -5.200  1.00 0.00 ? 54 LYS A NZ   2  
ATOM 1674  H H    . LYS A 1 54 ? -16.834 -0.978  -1.701  1.00 0.00 ? 54 LYS A H    2  
ATOM 1675  H HA   . LYS A 1 54 ? -18.424 -0.112  -3.834  1.00 0.00 ? 54 LYS A HA   2  
ATOM 1676  H HB2  . LYS A 1 54 ? -17.492 -2.352  -3.781  1.00 0.00 ? 54 LYS A HB2  2  
ATOM 1677  H HB3  . LYS A 1 54 ? -18.442 -2.751  -2.351  1.00 0.00 ? 54 LYS A HB3  2  
ATOM 1678  H HG2  . LYS A 1 54 ? -20.058 -1.724  -4.598  1.00 0.00 ? 54 LYS A HG2  2  
ATOM 1679  H HG3  . LYS A 1 54 ? -19.233 -3.241  -4.951  1.00 0.00 ? 54 LYS A HG3  2  
ATOM 1680  H HD2  . LYS A 1 54 ? -20.183 -4.243  -2.909  1.00 0.00 ? 54 LYS A HD2  2  
ATOM 1681  H HD3  . LYS A 1 54 ? -21.008 -2.728  -2.544  1.00 0.00 ? 54 LYS A HD3  2  
ATOM 1682  H HE2  . LYS A 1 54 ? -22.602 -4.176  -3.632  1.00 0.00 ? 54 LYS A HE2  2  
ATOM 1683  H HE3  . LYS A 1 54 ? -22.160 -2.914  -4.783  1.00 0.00 ? 54 LYS A HE3  2  
ATOM 1684  H HZ1  . LYS A 1 54 ? -20.546 -5.343  -4.787  1.00 0.00 ? 54 LYS A HZ1  2  
ATOM 1685  H HZ2  . LYS A 1 54 ? -21.030 -4.358  -6.081  1.00 0.00 ? 54 LYS A HZ2  2  
ATOM 1686  H HZ3  . LYS A 1 54 ? -22.124 -5.470  -5.405  1.00 0.00 ? 54 LYS A HZ3  2  
ATOM 1687  N N    . SER A 1 55 ? -20.141 -0.890  -1.117  1.00 0.00 ? 55 SER A N    2  
ATOM 1688  C CA   . SER A 1 55 ? -21.419 -0.682  -0.445  1.00 0.00 ? 55 SER A CA   2  
ATOM 1689  C C    . SER A 1 55 ? -21.800 0.796   -0.463  1.00 0.00 ? 55 SER A C    2  
ATOM 1690  O O    . SER A 1 55 ? -21.086 1.637   0.082   1.00 0.00 ? 55 SER A O    2  
ATOM 1691  C CB   . SER A 1 55 ? -21.334 -1.171  1.000   1.00 0.00 ? 55 SER A CB   2  
ATOM 1692  O OG   . SER A 1 55 ? -21.284 -2.592  1.012   1.00 0.00 ? 55 SER A OG   2  
ATOM 1693  H H    . SER A 1 55 ? -19.439 -1.405  -0.667  1.00 0.00 ? 55 SER A H    2  
ATOM 1694  H HA   . SER A 1 55 ? -22.181 -1.247  -0.960  1.00 0.00 ? 55 SER A HA   2  
ATOM 1695  H HB2  . SER A 1 55 ? -20.444 -0.780  1.462   1.00 0.00 ? 55 SER A HB2  2  
ATOM 1696  H HB3  . SER A 1 55 ? -22.203 -0.826  1.547   1.00 0.00 ? 55 SER A HB3  2  
ATOM 1697  H HG   . SER A 1 55 ? -20.773 -2.877  0.251   1.00 0.00 ? 55 SER A HG   2  
ATOM 1698  N N    . LYS A 1 56 ? -22.932 1.102   -1.092  1.00 0.00 ? 56 LYS A N    2  
ATOM 1699  C CA   . LYS A 1 56 ? -23.402 2.482   -1.175  1.00 0.00 ? 56 LYS A CA   2  
ATOM 1700  C C    . LYS A 1 56 ? -24.276 2.825   0.028   1.00 0.00 ? 56 LYS A C    2  
ATOM 1701  O O    . LYS A 1 56 ? -25.503 2.731   -0.039  1.00 0.00 ? 56 LYS A O    2  
ATOM 1702  C CB   . LYS A 1 56 ? -24.203 2.683   -2.464  1.00 0.00 ? 56 LYS A CB   2  
ATOM 1703  C CG   . LYS A 1 56 ? -23.257 2.673   -3.672  1.00 0.00 ? 56 LYS A CG   2  
ATOM 1704  C CD   . LYS A 1 56 ? -22.690 4.080   -3.909  1.00 0.00 ? 56 LYS A CD   2  
ATOM 1705  C CE   . LYS A 1 56 ? -23.652 4.884   -4.788  1.00 0.00 ? 56 LYS A CE   2  
ATOM 1706  N NZ   . LYS A 1 56 ? -23.107 6.257   -4.993  1.00 0.00 ? 56 LYS A NZ   2  
ATOM 1707  H H    . LYS A 1 56 ? -23.460 0.389   -1.508  1.00 0.00 ? 56 LYS A H    2  
ATOM 1708  H HA   . LYS A 1 56 ? -22.550 3.143   -1.188  1.00 0.00 ? 56 LYS A HA   2  
ATOM 1709  H HB2  . LYS A 1 56 ? -24.925 1.884   -2.565  1.00 0.00 ? 56 LYS A HB2  2  
ATOM 1710  H HB3  . LYS A 1 56 ? -24.722 3.630   -2.421  1.00 0.00 ? 56 LYS A HB3  2  
ATOM 1711  H HG2  . LYS A 1 56 ? -22.442 1.985   -3.485  1.00 0.00 ? 56 LYS A HG2  2  
ATOM 1712  H HG3  . LYS A 1 56 ? -23.798 2.354   -4.549  1.00 0.00 ? 56 LYS A HG3  2  
ATOM 1713  H HD2  . LYS A 1 56 ? -22.563 4.586   -2.962  1.00 0.00 ? 56 LYS A HD2  2  
ATOM 1714  H HD3  . LYS A 1 56 ? -21.735 4.004   -4.405  1.00 0.00 ? 56 LYS A HD3  2  
ATOM 1715  H HE2  . LYS A 1 56 ? -23.762 4.393   -5.743  1.00 0.00 ? 56 LYS A HE2  2  
ATOM 1716  H HE3  . LYS A 1 56 ? -24.615 4.950   -4.303  1.00 0.00 ? 56 LYS A HE3  2  
ATOM 1717  H HZ1  . LYS A 1 56 ? -23.554 6.912   -4.322  1.00 0.00 ? 56 LYS A HZ1  2  
ATOM 1718  H HZ2  . LYS A 1 56 ? -23.310 6.568   -5.965  1.00 0.00 ? 56 LYS A HZ2  2  
ATOM 1719  H HZ3  . LYS A 1 56 ? -22.079 6.248   -4.838  1.00 0.00 ? 56 LYS A HZ3  2  
ATOM 1720  N N    . ASN A 1 57 ? -23.639 3.224   1.123   1.00 0.00 ? 57 ASN A N    2  
ATOM 1721  C CA   . ASN A 1 57 ? -24.370 3.581   2.335   1.00 0.00 ? 57 ASN A CA   2  
ATOM 1722  C C    . ASN A 1 57 ? -24.820 5.036   2.280   1.00 0.00 ? 57 ASN A C    2  
ATOM 1723  O O    . ASN A 1 57 ? -24.257 5.843   1.540   1.00 0.00 ? 57 ASN A O    2  
ATOM 1724  C CB   . ASN A 1 57 ? -23.483 3.367   3.563   1.00 0.00 ? 57 ASN A CB   2  
ATOM 1725  C CG   . ASN A 1 57 ? -22.937 1.942   3.571   1.00 0.00 ? 57 ASN A CG   2  
ATOM 1726  O OD1  . ASN A 1 57 ? -23.706 0.982   3.540   1.00 0.00 ? 57 ASN A OD1  2  
ATOM 1727  N ND2  . ASN A 1 57 ? -21.647 1.749   3.612   1.00 0.00 ? 57 ASN A ND2  2  
ATOM 1728  H H    . ASN A 1 57 ? -22.659 3.281   1.117   1.00 0.00 ? 57 ASN A H    2  
ATOM 1729  H HA   . ASN A 1 57 ? -25.239 2.948   2.420   1.00 0.00 ? 57 ASN A HA   2  
ATOM 1730  H HB2  . ASN A 1 57 ? -22.659 4.066   3.535   1.00 0.00 ? 57 ASN A HB2  2  
ATOM 1731  H HB3  . ASN A 1 57 ? -24.063 3.531   4.458   1.00 0.00 ? 57 ASN A HB3  2  
ATOM 1732  H HD21 . ASN A 1 57 ? -21.037 2.514   3.638   1.00 0.00 ? 57 ASN A HD21 2  
ATOM 1733  H HD22 . ASN A 1 57 ? -21.288 0.836   3.618   1.00 0.00 ? 57 ASN A HD22 2  
ATOM 1734  N N    . LYS A 1 58 ? -25.836 5.367   3.070   1.00 0.00 ? 58 LYS A N    2  
ATOM 1735  C CA   . LYS A 1 58 ? -26.352 6.731   3.104   1.00 0.00 ? 58 LYS A CA   2  
ATOM 1736  C C    . LYS A 1 58 ? -27.178 6.956   4.367   1.00 0.00 ? 58 LYS A C    2  
ATOM 1737  O O    . LYS A 1 58 ? -27.648 8.064   4.627   1.00 0.00 ? 58 LYS A O    2  
ATOM 1738  C CB   . LYS A 1 58 ? -27.216 6.994   1.867   1.00 0.00 ? 58 LYS A CB   2  
ATOM 1739  C CG   . LYS A 1 58 ? -27.650 8.462   1.841   1.00 0.00 ? 58 LYS A CG   2  
ATOM 1740  C CD   . LYS A 1 58 ? -28.083 8.844   0.425   1.00 0.00 ? 58 LYS A CD   2  
ATOM 1741  C CE   . LYS A 1 58 ? -28.817 10.186  0.457   1.00 0.00 ? 58 LYS A CE   2  
ATOM 1742  N NZ   . LYS A 1 58 ? -29.318 10.512  -0.908  1.00 0.00 ? 58 LYS A NZ   2  
ATOM 1743  H H    . LYS A 1 58 ? -26.245 4.683   3.640   1.00 0.00 ? 58 LYS A H    2  
ATOM 1744  H HA   . LYS A 1 58 ? -25.522 7.418   3.104   1.00 0.00 ? 58 LYS A HA   2  
ATOM 1745  H HB2  . LYS A 1 58 ? -26.643 6.770   0.978   1.00 0.00 ? 58 LYS A HB2  2  
ATOM 1746  H HB3  . LYS A 1 58 ? -28.091 6.363   1.899   1.00 0.00 ? 58 LYS A HB3  2  
ATOM 1747  H HG2  . LYS A 1 58 ? -28.478 8.605   2.520   1.00 0.00 ? 58 LYS A HG2  2  
ATOM 1748  H HG3  . LYS A 1 58 ? -26.824 9.090   2.144   1.00 0.00 ? 58 LYS A HG3  2  
ATOM 1749  H HD2  . LYS A 1 58 ? -27.210 8.926   -0.208  1.00 0.00 ? 58 LYS A HD2  2  
ATOM 1750  H HD3  . LYS A 1 58 ? -28.743 8.084   0.033   1.00 0.00 ? 58 LYS A HD3  2  
ATOM 1751  H HE2  . LYS A 1 58 ? -29.651 10.123  1.142   1.00 0.00 ? 58 LYS A HE2  2  
ATOM 1752  H HE3  . LYS A 1 58 ? -28.139 10.959  0.787   1.00 0.00 ? 58 LYS A HE3  2  
ATOM 1753  H HZ1  . LYS A 1 58 ? -29.957 11.330  -0.856  1.00 0.00 ? 58 LYS A HZ1  2  
ATOM 1754  H HZ2  . LYS A 1 58 ? -29.834 9.697   -1.291  1.00 0.00 ? 58 LYS A HZ2  2  
ATOM 1755  H HZ3  . LYS A 1 58 ? -28.512 10.739  -1.526  1.00 0.00 ? 58 LYS A HZ3  2  
ATOM 1756  N N    . LYS A 1 59 ? -27.344 5.896   5.150   1.00 0.00 ? 59 LYS A N    2  
ATOM 1757  C CA   . LYS A 1 59 ? -28.112 5.984   6.388   1.00 0.00 ? 59 LYS A CA   2  
ATOM 1758  C C    . LYS A 1 59 ? -29.537 6.448   6.104   1.00 0.00 ? 59 LYS A C    2  
ATOM 1759  O O    . LYS A 1 59 ? -29.777 7.219   5.175   1.00 0.00 ? 59 LYS A O    2  
ATOM 1760  C CB   . LYS A 1 59 ? -27.437 6.962   7.352   1.00 0.00 ? 59 LYS A CB   2  
ATOM 1761  C CG   . LYS A 1 59 ? -28.003 6.766   8.760   1.00 0.00 ? 59 LYS A CG   2  
ATOM 1762  C CD   . LYS A 1 59 ? -27.252 7.668   9.742   1.00 0.00 ? 59 LYS A CD   2  
ATOM 1763  C CE   . LYS A 1 59 ? -27.700 7.353   11.170  1.00 0.00 ? 59 LYS A CE   2  
ATOM 1764  N NZ   . LYS A 1 59 ? -26.805 8.048   12.136  1.00 0.00 ? 59 LYS A NZ   2  
ATOM 1765  H H    . LYS A 1 59 ? -26.942 5.041   4.892   1.00 0.00 ? 59 LYS A H    2  
ATOM 1766  H HA   . LYS A 1 59 ? -28.146 5.008   6.848   1.00 0.00 ? 59 LYS A HA   2  
ATOM 1767  H HB2  . LYS A 1 59 ? -26.373 6.778   7.362   1.00 0.00 ? 59 LYS A HB2  2  
ATOM 1768  H HB3  . LYS A 1 59 ? -27.625 7.974   7.029   1.00 0.00 ? 59 LYS A HB3  2  
ATOM 1769  H HG2  . LYS A 1 59 ? -29.053 7.021   8.764   1.00 0.00 ? 59 LYS A HG2  2  
ATOM 1770  H HG3  . LYS A 1 59 ? -27.881 5.735   9.058   1.00 0.00 ? 59 LYS A HG3  2  
ATOM 1771  H HD2  . LYS A 1 59 ? -26.191 7.495   9.650   1.00 0.00 ? 59 LYS A HD2  2  
ATOM 1772  H HD3  . LYS A 1 59 ? -27.471 8.702   9.518   1.00 0.00 ? 59 LYS A HD3  2  
ATOM 1773  H HE2  . LYS A 1 59 ? -28.716 7.694   11.312  1.00 0.00 ? 59 LYS A HE2  2  
ATOM 1774  H HE3  . LYS A 1 59 ? -27.652 6.288   11.337  1.00 0.00 ? 59 LYS A HE3  2  
ATOM 1775  H HZ1  . LYS A 1 59 ? -26.695 7.465   12.991  1.00 0.00 ? 59 LYS A HZ1  2  
ATOM 1776  H HZ2  . LYS A 1 59 ? -27.219 8.965   12.397  1.00 0.00 ? 59 LYS A HZ2  2  
ATOM 1777  H HZ3  . LYS A 1 59 ? -25.873 8.200   11.698  1.00 0.00 ? 59 LYS A HZ3  2  
ATOM 1778  N N    . ARG A 1 60 ? -30.481 5.972   6.911   1.00 0.00 ? 60 ARG A N    2  
ATOM 1779  C CA   . ARG A 1 60 ? -31.880 6.346   6.739   1.00 0.00 ? 60 ARG A CA   2  
ATOM 1780  C C    . ARG A 1 60 ? -32.153 7.706   7.371   1.00 0.00 ? 60 ARG A C    2  
ATOM 1781  O O    . ARG A 1 60 ? -31.344 8.600   7.180   1.00 0.00 ? 60 ARG A O    2  
ATOM 1782  C CB   . ARG A 1 60 ? -32.785 5.293   7.379   1.00 0.00 ? 60 ARG A CB   2  
ATOM 1783  C CG   . ARG A 1 60 ? -32.446 3.913   6.811   1.00 0.00 ? 60 ARG A CG   2  
ATOM 1784  C CD   . ARG A 1 60 ? -33.552 2.923   7.179   1.00 0.00 ? 60 ARG A CD   2  
ATOM 1785  N NE   . ARG A 1 60 ? -33.240 1.599   6.656   1.00 0.00 ? 60 ARG A NE   2  
ATOM 1786  C CZ   . ARG A 1 60 ? -32.289 0.850   7.205   1.00 0.00 ? 60 ARG A CZ   2  
ATOM 1787  N NH1  . ARG A 1 60 ? -31.618 1.297   8.231   1.00 0.00 ? 60 ARG A NH1  2  
ATOM 1788  N NH2  . ARG A 1 60 ? -32.027 -0.332  6.718   1.00 0.00 ? 60 ARG A NH2  2  
ATOM 1789  O OXT  . ARG A 1 60 ? -33.166 7.836   8.038   1.00 0.00 ? 60 ARG A OXT  2  
ATOM 1790  H H    . ARG A 1 60 ? -30.231 5.362   7.636   1.00 0.00 ? 60 ARG A H    2  
ATOM 1791  H HA   . ARG A 1 60 ? -32.102 6.400   5.683   1.00 0.00 ? 60 ARG A HA   2  
ATOM 1792  H HB2  . ARG A 1 60 ? -32.633 5.290   8.449   1.00 0.00 ? 60 ARG A HB2  2  
ATOM 1793  H HB3  . ARG A 1 60 ? -33.817 5.525   7.164   1.00 0.00 ? 60 ARG A HB3  2  
ATOM 1794  H HG2  . ARG A 1 60 ? -32.364 3.978   5.735   1.00 0.00 ? 60 ARG A HG2  2  
ATOM 1795  H HG3  . ARG A 1 60 ? -31.509 3.573   7.224   1.00 0.00 ? 60 ARG A HG3  2  
ATOM 1796  H HD2  . ARG A 1 60 ? -33.641 2.869   8.254   1.00 0.00 ? 60 ARG A HD2  2  
ATOM 1797  H HD3  . ARG A 1 60 ? -34.490 3.264   6.762   1.00 0.00 ? 60 ARG A HD3  2  
ATOM 1798  H HE   . ARG A 1 60 ? -33.739 1.255   5.885   1.00 0.00 ? 60 ARG A HE   2  
ATOM 1799  H HH11 . ARG A 1 60 ? -31.821 2.203   8.604   1.00 0.00 ? 60 ARG A HH11 2  
ATOM 1800  H HH12 . ARG A 1 60 ? -30.903 0.734   8.644   1.00 0.00 ? 60 ARG A HH12 2  
ATOM 1801  H HH21 . ARG A 1 60 ? -32.540 -0.674  5.932   1.00 0.00 ? 60 ARG A HH21 2  
ATOM 1802  H HH22 . ARG A 1 60 ? -31.310 -0.895  7.131   1.00 0.00 ? 60 ARG A HH22 2  
ATOM 1803  N N    . GLY A 1 9  ? 11.234  11.029  14.636  1.00 0.00 ? 9  GLY A N    3  
ATOM 1804  C CA   . GLY A 1 9  ? 11.686  9.655   14.451  1.00 0.00 ? 9  GLY A CA   3  
ATOM 1805  C C    . GLY A 1 9  ? 10.983  9.002   13.266  1.00 0.00 ? 9  GLY A C    3  
ATOM 1806  O O    . GLY A 1 9  ? 9.793   8.691   13.333  1.00 0.00 ? 9  GLY A O    3  
ATOM 1807  H H    . GLY A 1 9  ? 11.023  11.348  15.538  1.00 0.00 ? 9  GLY A H    3  
ATOM 1808  H HA2  . GLY A 1 9  ? 12.752  9.653   14.277  1.00 0.00 ? 9  GLY A HA2  3  
ATOM 1809  H HA3  . GLY A 1 9  ? 11.471  9.087   15.344  1.00 0.00 ? 9  GLY A HA3  3  
ATOM 1810  N N    . THR A 1 10 ? 11.725  8.799   12.182  1.00 0.00 ? 10 THR A N    3  
ATOM 1811  C CA   . THR A 1 10 ? 11.164  8.184   10.988  1.00 0.00 ? 10 THR A CA   3  
ATOM 1812  C C    . THR A 1 10 ? 10.983  6.683   11.196  1.00 0.00 ? 10 THR A C    3  
ATOM 1813  O O    . THR A 1 10 ? 11.734  6.055   11.945  1.00 0.00 ? 10 THR A O    3  
ATOM 1814  C CB   . THR A 1 10 ? 12.093  8.434   9.795   1.00 0.00 ? 10 THR A CB   3  
ATOM 1815  O OG1  . THR A 1 10 ? 13.441  8.448   10.244  1.00 0.00 ? 10 THR A OG1  3  
ATOM 1816  C CG2  . THR A 1 10 ? 11.756  9.780   9.150   1.00 0.00 ? 10 THR A CG2  3  
ATOM 1817  H H    . THR A 1 10 ? 12.666  9.067   12.185  1.00 0.00 ? 10 THR A H    3  
ATOM 1818  H HA   . THR A 1 10 ? 10.201  8.627   10.782  1.00 0.00 ? 10 THR A HA   3  
ATOM 1819  H HB   . THR A 1 10 ? 11.966  7.650   9.068   1.00 0.00 ? 10 THR A HB   3  
ATOM 1820  H HG1  . THR A 1 10 ? 14.010  8.341   9.477   1.00 0.00 ? 10 THR A HG1  3  
ATOM 1821  H HG21 . THR A 1 10 ? 12.439  9.969   8.334   1.00 0.00 ? 10 THR A HG21 3  
ATOM 1822  H HG22 . THR A 1 10 ? 11.849  10.565  9.886   1.00 0.00 ? 10 THR A HG22 3  
ATOM 1823  H HG23 . THR A 1 10 ? 10.744  9.757   8.774   1.00 0.00 ? 10 THR A HG23 3  
ATOM 1824  N N    . LYS A 1 11 ? 9.984   6.114   10.531  1.00 0.00 ? 11 LYS A N    3  
ATOM 1825  C CA   . LYS A 1 11 ? 9.712   4.686   10.650  1.00 0.00 ? 11 LYS A CA   3  
ATOM 1826  C C    . LYS A 1 11 ? 10.619  3.891   9.717   1.00 0.00 ? 11 LYS A C    3  
ATOM 1827  O O    . LYS A 1 11 ? 11.617  4.406   9.215   1.00 0.00 ? 11 LYS A O    3  
ATOM 1828  C CB   . LYS A 1 11 ? 8.249   4.401   10.305  1.00 0.00 ? 11 LYS A CB   3  
ATOM 1829  C CG   . LYS A 1 11 ? 7.335   5.210   11.233  1.00 0.00 ? 11 LYS A CG   3  
ATOM 1830  C CD   . LYS A 1 11 ? 5.923   5.283   10.637  1.00 0.00 ? 11 LYS A CD   3  
ATOM 1831  C CE   . LYS A 1 11 ? 5.823   6.477   9.681   1.00 0.00 ? 11 LYS A CE   3  
ATOM 1832  N NZ   . LYS A 1 11 ? 4.681   6.269   8.746   1.00 0.00 ? 11 LYS A NZ   3  
ATOM 1833  H H    . LYS A 1 11 ? 9.418   6.665   9.950   1.00 0.00 ? 11 LYS A H    3  
ATOM 1834  H HA   . LYS A 1 11 ? 9.896   4.376   11.667  1.00 0.00 ? 11 LYS A HA   3  
ATOM 1835  H HB2  . LYS A 1 11 ? 8.061   4.681   9.278   1.00 0.00 ? 11 LYS A HB2  3  
ATOM 1836  H HB3  . LYS A 1 11 ? 8.047   3.350   10.432  1.00 0.00 ? 11 LYS A HB3  3  
ATOM 1837  H HG2  . LYS A 1 11 ? 7.293   4.728   12.200  1.00 0.00 ? 11 LYS A HG2  3  
ATOM 1838  H HG3  . LYS A 1 11 ? 7.729   6.208   11.348  1.00 0.00 ? 11 LYS A HG3  3  
ATOM 1839  H HD2  . LYS A 1 11 ? 5.710   4.371   10.097  1.00 0.00 ? 11 LYS A HD2  3  
ATOM 1840  H HD3  . LYS A 1 11 ? 5.204   5.404   11.432  1.00 0.00 ? 11 LYS A HD3  3  
ATOM 1841  H HE2  . LYS A 1 11 ? 5.661   7.381   10.250  1.00 0.00 ? 11 LYS A HE2  3  
ATOM 1842  H HE3  . LYS A 1 11 ? 6.739   6.567   9.117   1.00 0.00 ? 11 LYS A HE3  3  
ATOM 1843  H HZ1  . LYS A 1 11 ? 3.820   6.070   9.289   1.00 0.00 ? 11 LYS A HZ1  3  
ATOM 1844  H HZ2  . LYS A 1 11 ? 4.889   5.467   8.120   1.00 0.00 ? 11 LYS A HZ2  3  
ATOM 1845  H HZ3  . LYS A 1 11 ? 4.542   7.129   8.175   1.00 0.00 ? 11 LYS A HZ3  3  
ATOM 1846  N N    . LYS A 1 12 ? 10.264  2.629   9.489   1.00 0.00 ? 12 LYS A N    3  
ATOM 1847  C CA   . LYS A 1 12 ? 11.051  1.770   8.613   1.00 0.00 ? 12 LYS A CA   3  
ATOM 1848  C C    . LYS A 1 12 ? 10.725  2.055   7.151   1.00 0.00 ? 12 LYS A C    3  
ATOM 1849  O O    . LYS A 1 12 ? 11.617  2.330   6.348   1.00 0.00 ? 12 LYS A O    3  
ATOM 1850  C CB   . LYS A 1 12 ? 10.761  0.300   8.925   1.00 0.00 ? 12 LYS A CB   3  
ATOM 1851  C CG   . LYS A 1 12 ? 11.203  -0.018  10.357  1.00 0.00 ? 12 LYS A CG   3  
ATOM 1852  C CD   . LYS A 1 12 ? 11.294  -1.537  10.549  1.00 0.00 ? 12 LYS A CD   3  
ATOM 1853  C CE   . LYS A 1 12 ? 12.687  -2.030  10.139  1.00 0.00 ? 12 LYS A CE   3  
ATOM 1854  N NZ   . LYS A 1 12 ? 13.658  -1.730  11.227  1.00 0.00 ? 12 LYS A NZ   3  
ATOM 1855  H H    . LYS A 1 12 ? 9.457   2.273   9.916   1.00 0.00 ? 12 LYS A H    3  
ATOM 1856  H HA   . LYS A 1 12 ? 12.099  1.962   8.782   1.00 0.00 ? 12 LYS A HA   3  
ATOM 1857  H HB2  . LYS A 1 12 ? 9.701   0.115   8.825   1.00 0.00 ? 12 LYS A HB2  3  
ATOM 1858  H HB3  . LYS A 1 12 ? 11.303  -0.328  8.236   1.00 0.00 ? 12 LYS A HB3  3  
ATOM 1859  H HG2  . LYS A 1 12 ? 12.169  0.430   10.543  1.00 0.00 ? 12 LYS A HG2  3  
ATOM 1860  H HG3  . LYS A 1 12 ? 10.482  0.387   11.052  1.00 0.00 ? 12 LYS A HG3  3  
ATOM 1861  H HD2  . LYS A 1 12 ? 11.120  -1.780  11.587  1.00 0.00 ? 12 LYS A HD2  3  
ATOM 1862  H HD3  . LYS A 1 12 ? 10.549  -2.025  9.937   1.00 0.00 ? 12 LYS A HD3  3  
ATOM 1863  H HE2  . LYS A 1 12 ? 12.655  -3.095  9.968   1.00 0.00 ? 12 LYS A HE2  3  
ATOM 1864  H HE3  . LYS A 1 12 ? 12.994  -1.530  9.232   1.00 0.00 ? 12 LYS A HE3  3  
ATOM 1865  H HZ1  . LYS A 1 12 ? 14.169  -2.598  11.484  1.00 0.00 ? 12 LYS A HZ1  3  
ATOM 1866  H HZ2  . LYS A 1 12 ? 13.149  -1.371  12.059  1.00 0.00 ? 12 LYS A HZ2  3  
ATOM 1867  H HZ3  . LYS A 1 12 ? 14.336  -1.012  10.897  1.00 0.00 ? 12 LYS A HZ3  3  
ATOM 1868  N N    . TYR A 1 13 ? 9.439   1.987   6.814   1.00 0.00 ? 13 TYR A N    3  
ATOM 1869  C CA   . TYR A 1 13 ? 8.997   2.237   5.444   1.00 0.00 ? 13 TYR A CA   3  
ATOM 1870  C C    . TYR A 1 13 ? 7.866   3.262   5.430   1.00 0.00 ? 13 TYR A C    3  
ATOM 1871  O O    . TYR A 1 13 ? 7.095   3.363   6.384   1.00 0.00 ? 13 TYR A O    3  
ATOM 1872  C CB   . TYR A 1 13 ? 8.520   0.927   4.804   1.00 0.00 ? 13 TYR A CB   3  
ATOM 1873  C CG   . TYR A 1 13 ? 9.668   0.266   4.076   1.00 0.00 ? 13 TYR A CG   3  
ATOM 1874  C CD1  . TYR A 1 13 ? 10.749  -0.258  4.799   1.00 0.00 ? 13 TYR A CD1  3  
ATOM 1875  C CD2  . TYR A 1 13 ? 9.654   0.179   2.679   1.00 0.00 ? 13 TYR A CD2  3  
ATOM 1876  C CE1  . TYR A 1 13 ? 11.812  -0.867  4.123   1.00 0.00 ? 13 TYR A CE1  3  
ATOM 1877  C CE2  . TYR A 1 13 ? 10.718  -0.431  2.005   1.00 0.00 ? 13 TYR A CE2  3  
ATOM 1878  C CZ   . TYR A 1 13 ? 11.797  -0.953  2.726   1.00 0.00 ? 13 TYR A CZ   3  
ATOM 1879  O OH   . TYR A 1 13 ? 12.846  -1.554  2.060   1.00 0.00 ? 13 TYR A OH   3  
ATOM 1880  H H    . TYR A 1 13 ? 8.776   1.763   7.499   1.00 0.00 ? 13 TYR A H    3  
ATOM 1881  H HA   . TYR A 1 13 ? 9.825   2.627   4.870   1.00 0.00 ? 13 TYR A HA   3  
ATOM 1882  H HB2  . TYR A 1 13 ? 8.155   0.264   5.575   1.00 0.00 ? 13 TYR A HB2  3  
ATOM 1883  H HB3  . TYR A 1 13 ? 7.723   1.135   4.104   1.00 0.00 ? 13 TYR A HB3  3  
ATOM 1884  H HD1  . TYR A 1 13 ? 10.760  -0.192  5.877   1.00 0.00 ? 13 TYR A HD1  3  
ATOM 1885  H HD2  . TYR A 1 13 ? 8.822   0.582   2.122   1.00 0.00 ? 13 TYR A HD2  3  
ATOM 1886  H HE1  . TYR A 1 13 ? 12.645  -1.271  4.680   1.00 0.00 ? 13 TYR A HE1  3  
ATOM 1887  H HE2  . TYR A 1 13 ? 10.705  -0.497  0.929   1.00 0.00 ? 13 TYR A HE2  3  
ATOM 1888  H HH   . TYR A 1 13 ? 13.660  -1.139  2.353   1.00 0.00 ? 13 TYR A HH   3  
ATOM 1889  N N    . ASP A 1 14 ? 7.775   4.016   4.340   1.00 0.00 ? 14 ASP A N    3  
ATOM 1890  C CA   . ASP A 1 14 ? 6.736   5.031   4.204   1.00 0.00 ? 14 ASP A CA   3  
ATOM 1891  C C    . ASP A 1 14 ? 6.234   5.089   2.766   1.00 0.00 ? 14 ASP A C    3  
ATOM 1892  O O    . ASP A 1 14 ? 6.957   5.506   1.862   1.00 0.00 ? 14 ASP A O    3  
ATOM 1893  C CB   . ASP A 1 14 ? 7.287   6.400   4.609   1.00 0.00 ? 14 ASP A CB   3  
ATOM 1894  C CG   . ASP A 1 14 ? 6.142   7.385   4.811   1.00 0.00 ? 14 ASP A CG   3  
ATOM 1895  O OD1  . ASP A 1 14 ? 5.476   7.697   3.837   1.00 0.00 ? 14 ASP A OD1  3  
ATOM 1896  O OD2  . ASP A 1 14 ? 5.946   7.814   5.936   1.00 0.00 ? 14 ASP A OD2  3  
ATOM 1897  H H    . ASP A 1 14 ? 8.419   3.887   3.612   1.00 0.00 ? 14 ASP A H    3  
ATOM 1898  H HA   . ASP A 1 14 ? 5.910   4.782   4.854   1.00 0.00 ? 14 ASP A HA   3  
ATOM 1899  H HB2  . ASP A 1 14 ? 7.844   6.304   5.530   1.00 0.00 ? 14 ASP A HB2  3  
ATOM 1900  H HB3  . ASP A 1 14 ? 7.941   6.767   3.833   1.00 0.00 ? 14 ASP A HB3  3  
ATOM 1901  N N    . LEU A 1 15 ? 4.988   4.667   2.562   1.00 0.00 ? 15 LEU A N    3  
ATOM 1902  C CA   . LEU A 1 15 ? 4.391   4.673   1.229   1.00 0.00 ? 15 LEU A CA   3  
ATOM 1903  C C    . LEU A 1 15 ? 3.078   5.450   1.241   1.00 0.00 ? 15 LEU A C    3  
ATOM 1904  O O    . LEU A 1 15 ? 2.015   4.892   0.965   1.00 0.00 ? 15 LEU A O    3  
ATOM 1905  C CB   . LEU A 1 15 ? 4.125   3.237   0.761   1.00 0.00 ? 15 LEU A CB   3  
ATOM 1906  C CG   . LEU A 1 15 ? 5.361   2.364   1.004   1.00 0.00 ? 15 LEU A CG   3  
ATOM 1907  C CD1  . LEU A 1 15 ? 4.976   0.891   0.868   1.00 0.00 ? 15 LEU A CD1  3  
ATOM 1908  C CD2  . LEU A 1 15 ? 6.443   2.695   -0.028  1.00 0.00 ? 15 LEU A CD2  3  
ATOM 1909  H H    . LEU A 1 15 ? 4.461   4.349   3.322   1.00 0.00 ? 15 LEU A H    3  
ATOM 1910  H HA   . LEU A 1 15 ? 5.070   5.147   0.535   1.00 0.00 ? 15 LEU A HA   3  
ATOM 1911  H HB2  . LEU A 1 15 ? 3.288   2.832   1.309   1.00 0.00 ? 15 LEU A HB2  3  
ATOM 1912  H HB3  . LEU A 1 15 ? 3.894   3.243   -0.294  1.00 0.00 ? 15 LEU A HB3  3  
ATOM 1913  H HG   . LEU A 1 15 ? 5.742   2.543   1.999   1.00 0.00 ? 15 LEU A HG   3  
ATOM 1914  H HD11 . LEU A 1 15 ? 4.271   0.630   1.645   1.00 0.00 ? 15 LEU A HD11 3  
ATOM 1915  H HD12 . LEU A 1 15 ? 5.860   0.275   0.961   1.00 0.00 ? 15 LEU A HD12 3  
ATOM 1916  H HD13 . LEU A 1 15 ? 4.522   0.724   -0.098  1.00 0.00 ? 15 LEU A HD13 3  
ATOM 1917  H HD21 . LEU A 1 15 ? 7.241   1.970   0.042   1.00 0.00 ? 15 LEU A HD21 3  
ATOM 1918  H HD22 . LEU A 1 15 ? 6.836   3.682   0.165   1.00 0.00 ? 15 LEU A HD22 3  
ATOM 1919  H HD23 . LEU A 1 15 ? 6.017   2.664   -1.020  1.00 0.00 ? 15 LEU A HD23 3  
ATOM 1920  N N    . SER A 1 16 ? 3.157   6.740   1.565   1.00 0.00 ? 16 SER A N    3  
ATOM 1921  C CA   . SER A 1 16 ? 1.967   7.585   1.610   1.00 0.00 ? 16 SER A CA   3  
ATOM 1922  C C    . SER A 1 16 ? 1.017   7.229   0.470   1.00 0.00 ? 16 SER A C    3  
ATOM 1923  O O    . SER A 1 16 ? -0.172  6.998   0.688   1.00 0.00 ? 16 SER A O    3  
ATOM 1924  C CB   . SER A 1 16 ? 2.369   9.057   1.501   1.00 0.00 ? 16 SER A CB   3  
ATOM 1925  O OG   . SER A 1 16 ? 1.305   9.793   0.914   1.00 0.00 ? 16 SER A OG   3  
ATOM 1926  H H    . SER A 1 16 ? 4.032   7.128   1.776   1.00 0.00 ? 16 SER A H    3  
ATOM 1927  H HA   . SER A 1 16 ? 1.460   7.429   2.550   1.00 0.00 ? 16 SER A HA   3  
ATOM 1928  H HB2  . SER A 1 16 ? 2.573   9.451   2.484   1.00 0.00 ? 16 SER A HB2  3  
ATOM 1929  H HB3  . SER A 1 16 ? 3.259   9.141   0.891   1.00 0.00 ? 16 SER A HB3  3  
ATOM 1930  H HG   . SER A 1 16 ? 1.608   10.125  0.065   1.00 0.00 ? 16 SER A HG   3  
ATOM 1931  N N    . LYS A 1 17 ? 1.557   7.173   -0.741  1.00 0.00 ? 17 LYS A N    3  
ATOM 1932  C CA   . LYS A 1 17 ? 0.759   6.828   -1.910  1.00 0.00 ? 17 LYS A CA   3  
ATOM 1933  C C    . LYS A 1 17 ? 1.675   6.442   -3.067  1.00 0.00 ? 17 LYS A C    3  
ATOM 1934  O O    . LYS A 1 17 ? 2.596   7.183   -3.415  1.00 0.00 ? 17 LYS A O    3  
ATOM 1935  C CB   . LYS A 1 17 ? -0.118  8.022   -2.312  1.00 0.00 ? 17 LYS A CB   3  
ATOM 1936  C CG   . LYS A 1 17 ? -1.420  7.524   -2.950  1.00 0.00 ? 17 LYS A CG   3  
ATOM 1937  C CD   . LYS A 1 17 ? -1.105  6.707   -4.209  1.00 0.00 ? 17 LYS A CD   3  
ATOM 1938  C CE   . LYS A 1 17 ? -2.305  6.741   -5.158  1.00 0.00 ? 17 LYS A CE   3  
ATOM 1939  N NZ   . LYS A 1 17 ? -2.363  8.067   -5.839  1.00 0.00 ? 17 LYS A NZ   3  
ATOM 1940  H H    . LYS A 1 17 ? 2.514   7.357   -0.850  1.00 0.00 ? 17 LYS A H    3  
ATOM 1941  H HA   . LYS A 1 17 ? 0.125   5.988   -1.667  1.00 0.00 ? 17 LYS A HA   3  
ATOM 1942  H HB2  . LYS A 1 17 ? -0.350  8.605   -1.433  1.00 0.00 ? 17 LYS A HB2  3  
ATOM 1943  H HB3  . LYS A 1 17 ? 0.413   8.639   -3.021  1.00 0.00 ? 17 LYS A HB3  3  
ATOM 1944  H HG2  . LYS A 1 17 ? -1.952  6.903   -2.241  1.00 0.00 ? 17 LYS A HG2  3  
ATOM 1945  H HG3  . LYS A 1 17 ? -2.035  8.370   -3.216  1.00 0.00 ? 17 LYS A HG3  3  
ATOM 1946  H HD2  . LYS A 1 17 ? -0.241  7.127   -4.705  1.00 0.00 ? 17 LYS A HD2  3  
ATOM 1947  H HD3  . LYS A 1 17 ? -0.899  5.685   -3.932  1.00 0.00 ? 17 LYS A HD3  3  
ATOM 1948  H HE2  . LYS A 1 17 ? -2.200  5.961   -5.898  1.00 0.00 ? 17 LYS A HE2  3  
ATOM 1949  H HE3  . LYS A 1 17 ? -3.214  6.584   -4.596  1.00 0.00 ? 17 LYS A HE3  3  
ATOM 1950  H HZ1  . LYS A 1 17 ? -2.201  7.942   -6.858  1.00 0.00 ? 17 LYS A HZ1  3  
ATOM 1951  H HZ2  . LYS A 1 17 ? -1.630  8.690   -5.446  1.00 0.00 ? 17 LYS A HZ2  3  
ATOM 1952  H HZ3  . LYS A 1 17 ? -3.299  8.493   -5.685  1.00 0.00 ? 17 LYS A HZ3  3  
ATOM 1953  N N    . TRP A 1 18 ? 1.418   5.280   -3.655  1.00 0.00 ? 18 TRP A N    3  
ATOM 1954  C CA   . TRP A 1 18 ? 2.223   4.789   -4.771  1.00 0.00 ? 18 TRP A CA   3  
ATOM 1955  C C    . TRP A 1 18 ? 1.330   4.521   -5.981  1.00 0.00 ? 18 TRP A C    3  
ATOM 1956  O O    . TRP A 1 18 ? 0.146   4.215   -5.831  1.00 0.00 ? 18 TRP A O    3  
ATOM 1957  C CB   . TRP A 1 18 ? 2.933   3.487   -4.368  1.00 0.00 ? 18 TRP A CB   3  
ATOM 1958  C CG   . TRP A 1 18 ? 4.308   3.770   -3.836  1.00 0.00 ? 18 TRP A CG   3  
ATOM 1959  C CD1  . TRP A 1 18 ? 4.644   4.799   -3.024  1.00 0.00 ? 18 TRP A CD1  3  
ATOM 1960  C CD2  . TRP A 1 18 ? 5.534   3.014   -4.061  1.00 0.00 ? 18 TRP A CD2  3  
ATOM 1961  N NE1  . TRP A 1 18 ? 5.997   4.726   -2.744  1.00 0.00 ? 18 TRP A NE1  3  
ATOM 1962  C CE2  . TRP A 1 18 ? 6.589   3.643   -3.359  1.00 0.00 ? 18 TRP A CE2  3  
ATOM 1963  C CE3  . TRP A 1 18 ? 5.828   1.856   -4.801  1.00 0.00 ? 18 TRP A CE3  3  
ATOM 1964  C CZ2  . TRP A 1 18 ? 7.890   3.139   -3.392  1.00 0.00 ? 18 TRP A CZ2  3  
ATOM 1965  C CZ3  . TRP A 1 18 ? 7.135   1.348   -4.836  1.00 0.00 ? 18 TRP A CZ3  3  
ATOM 1966  C CH2  . TRP A 1 18 ? 8.164   1.986   -4.133  1.00 0.00 ? 18 TRP A CH2  3  
ATOM 1967  H H    . TRP A 1 18 ? 0.670   4.735   -3.331  1.00 0.00 ? 18 TRP A H    3  
ATOM 1968  H HA   . TRP A 1 18 ? 2.963   5.530   -5.036  1.00 0.00 ? 18 TRP A HA   3  
ATOM 1969  H HB2  . TRP A 1 18 ? 2.355   2.990   -3.604  1.00 0.00 ? 18 TRP A HB2  3  
ATOM 1970  H HB3  . TRP A 1 18 ? 3.013   2.840   -5.230  1.00 0.00 ? 18 TRP A HB3  3  
ATOM 1971  H HD1  . TRP A 1 18 ? 3.971   5.554   -2.655  1.00 0.00 ? 18 TRP A HD1  3  
ATOM 1972  H HE1  . TRP A 1 18 ? 6.492   5.356   -2.179  1.00 0.00 ? 18 TRP A HE1  3  
ATOM 1973  H HE3  . TRP A 1 18 ? 5.044   1.354   -5.347  1.00 0.00 ? 18 TRP A HE3  3  
ATOM 1974  H HZ2  . TRP A 1 18 ? 8.679   3.635   -2.848  1.00 0.00 ? 18 TRP A HZ2  3  
ATOM 1975  H HZ3  . TRP A 1 18 ? 7.346   0.458   -5.407  1.00 0.00 ? 18 TRP A HZ3  3  
ATOM 1976  H HH2  . TRP A 1 18 ? 9.167   1.588   -4.164  1.00 0.00 ? 18 TRP A HH2  3  
ATOM 1977  N N    . LYS A 1 19 ? 1.901   4.627   -7.176  1.00 0.00 ? 19 LYS A N    3  
ATOM 1978  C CA   . LYS A 1 19 ? 1.140   4.384   -8.397  1.00 0.00 ? 19 LYS A CA   3  
ATOM 1979  C C    . LYS A 1 19 ? 1.162   2.896   -8.742  1.00 0.00 ? 19 LYS A C    3  
ATOM 1980  O O    . LYS A 1 19 ? 2.023   2.154   -8.271  1.00 0.00 ? 19 LYS A O    3  
ATOM 1981  C CB   . LYS A 1 19 ? 1.727   5.190   -9.562  1.00 0.00 ? 19 LYS A CB   3  
ATOM 1982  C CG   . LYS A 1 19 ? 1.945   6.650   -9.138  1.00 0.00 ? 19 LYS A CG   3  
ATOM 1983  C CD   . LYS A 1 19 ? 0.634   7.440   -9.276  1.00 0.00 ? 19 LYS A CD   3  
ATOM 1984  C CE   . LYS A 1 19 ? 0.570   8.103   -10.656 1.00 0.00 ? 19 LYS A CE   3  
ATOM 1985  N NZ   . LYS A 1 19 ? 1.134   7.179   -11.680 1.00 0.00 ? 19 LYS A NZ   3  
ATOM 1986  H H    . LYS A 1 19 ? 2.848   4.869   -7.239  1.00 0.00 ? 19 LYS A H    3  
ATOM 1987  H HA   . LYS A 1 19 ? 0.116   4.690   -8.241  1.00 0.00 ? 19 LYS A HA   3  
ATOM 1988  H HB2  . LYS A 1 19 ? 2.671   4.758   -9.858  1.00 0.00 ? 19 LYS A HB2  3  
ATOM 1989  H HB3  . LYS A 1 19 ? 1.043   5.160   -10.398 1.00 0.00 ? 19 LYS A HB3  3  
ATOM 1990  H HG2  . LYS A 1 19 ? 2.276   6.682   -8.110  1.00 0.00 ? 19 LYS A HG2  3  
ATOM 1991  H HG3  . LYS A 1 19 ? 2.700   7.097   -9.768  1.00 0.00 ? 19 LYS A HG3  3  
ATOM 1992  H HD2  . LYS A 1 19 ? -0.206  6.770   -9.161  1.00 0.00 ? 19 LYS A HD2  3  
ATOM 1993  H HD3  . LYS A 1 19 ? 0.592   8.201   -8.513  1.00 0.00 ? 19 LYS A HD3  3  
ATOM 1994  H HE2  . LYS A 1 19 ? -0.457  8.328   -10.900 1.00 0.00 ? 19 LYS A HE2  3  
ATOM 1995  H HE3  . LYS A 1 19 ? 1.144   9.017   -10.641 1.00 0.00 ? 19 LYS A HE3  3  
ATOM 1996  H HZ1  . LYS A 1 19 ? 1.825   6.544   -11.234 1.00 0.00 ? 19 LYS A HZ1  3  
ATOM 1997  H HZ2  . LYS A 1 19 ? 1.604   7.732   -12.424 1.00 0.00 ? 19 LYS A HZ2  3  
ATOM 1998  H HZ3  . LYS A 1 19 ? 0.365   6.616   -12.099 1.00 0.00 ? 19 LYS A HZ3  3  
ATOM 1999  N N    . TYR A 1 20 ? 0.210   2.468   -9.562  1.00 0.00 ? 20 TYR A N    3  
ATOM 2000  C CA   . TYR A 1 20 ? 0.133   1.065   -9.957  1.00 0.00 ? 20 TYR A CA   3  
ATOM 2001  C C    . TYR A 1 20 ? 1.374   0.669   -10.755 1.00 0.00 ? 20 TYR A C    3  
ATOM 2002  O O    . TYR A 1 20 ? 1.881   -0.448  -10.627 1.00 0.00 ? 20 TYR A O    3  
ATOM 2003  C CB   . TYR A 1 20 ? -1.132  0.816   -10.798 1.00 0.00 ? 20 TYR A CB   3  
ATOM 2004  C CG   . TYR A 1 20 ? -1.786  2.136   -11.139 1.00 0.00 ? 20 TYR A CG   3  
ATOM 2005  C CD1  . TYR A 1 20 ? -2.618  2.765   -10.205 1.00 0.00 ? 20 TYR A CD1  3  
ATOM 2006  C CD2  . TYR A 1 20 ? -1.560  2.728   -12.387 1.00 0.00 ? 20 TYR A CD2  3  
ATOM 2007  C CE1  . TYR A 1 20 ? -3.225  3.986   -10.520 1.00 0.00 ? 20 TYR A CE1  3  
ATOM 2008  C CE2  . TYR A 1 20 ? -2.166  3.950   -12.702 1.00 0.00 ? 20 TYR A CE2  3  
ATOM 2009  C CZ   . TYR A 1 20 ? -2.999  4.579   -11.769 1.00 0.00 ? 20 TYR A CZ   3  
ATOM 2010  O OH   . TYR A 1 20 ? -3.596  5.783   -12.079 1.00 0.00 ? 20 TYR A OH   3  
ATOM 2011  H H    . TYR A 1 20 ? -0.453  3.102   -9.906  1.00 0.00 ? 20 TYR A H    3  
ATOM 2012  H HA   . TYR A 1 20 ? 0.084   0.455   -9.066  1.00 0.00 ? 20 TYR A HA   3  
ATOM 2013  H HB2  . TYR A 1 20 ? -0.868  0.302   -11.711 1.00 0.00 ? 20 TYR A HB2  3  
ATOM 2014  H HB3  . TYR A 1 20 ? -1.826  0.211   -10.233 1.00 0.00 ? 20 TYR A HB3  3  
ATOM 2015  H HD1  . TYR A 1 20 ? -2.793  2.308   -9.244  1.00 0.00 ? 20 TYR A HD1  3  
ATOM 2016  H HD2  . TYR A 1 20 ? -0.918  2.242   -13.107 1.00 0.00 ? 20 TYR A HD2  3  
ATOM 2017  H HE1  . TYR A 1 20 ? -3.867  4.473   -9.801  1.00 0.00 ? 20 TYR A HE1  3  
ATOM 2018  H HE2  . TYR A 1 20 ? -1.992  4.406   -13.665 1.00 0.00 ? 20 TYR A HE2  3  
ATOM 2019  H HH   . TYR A 1 20 ? -4.368  5.886   -11.517 1.00 0.00 ? 20 TYR A HH   3  
ATOM 2020  N N    . ALA A 1 21 ? 1.855   1.590   -11.583 1.00 0.00 ? 21 ALA A N    3  
ATOM 2021  C CA   . ALA A 1 21 ? 3.032   1.332   -12.405 1.00 0.00 ? 21 ALA A CA   3  
ATOM 2022  C C    . ALA A 1 21 ? 4.241   0.985   -11.542 1.00 0.00 ? 21 ALA A C    3  
ATOM 2023  O O    . ALA A 1 21 ? 4.819   -0.094  -11.677 1.00 0.00 ? 21 ALA A O    3  
ATOM 2024  C CB   . ALA A 1 21 ? 3.350   2.563   -13.257 1.00 0.00 ? 21 ALA A CB   3  
ATOM 2025  H H    . ALA A 1 21 ? 1.406   2.459   -11.645 1.00 0.00 ? 21 ALA A H    3  
ATOM 2026  H HA   . ALA A 1 21 ? 2.822   0.503   -13.063 1.00 0.00 ? 21 ALA A HA   3  
ATOM 2027  H HB1  . ALA A 1 21 ? 3.708   3.359   -12.620 1.00 0.00 ? 21 ALA A HB1  3  
ATOM 2028  H HB2  . ALA A 1 21 ? 2.456   2.887   -13.770 1.00 0.00 ? 21 ALA A HB2  3  
ATOM 2029  H HB3  . ALA A 1 21 ? 4.110   2.312   -13.981 1.00 0.00 ? 21 ALA A HB3  3  
ATOM 2030  N N    . GLU A 1 22 ? 4.624   1.905   -10.662 1.00 0.00 ? 22 GLU A N    3  
ATOM 2031  C CA   . GLU A 1 22 ? 5.775   1.681   -9.793  1.00 0.00 ? 22 GLU A CA   3  
ATOM 2032  C C    . GLU A 1 22 ? 5.543   0.483   -8.877  1.00 0.00 ? 22 GLU A C    3  
ATOM 2033  O O    . GLU A 1 22 ? 6.465   -0.285  -8.605  1.00 0.00 ? 22 GLU A O    3  
ATOM 2034  C CB   . GLU A 1 22 ? 6.052   2.929   -8.950  1.00 0.00 ? 22 GLU A CB   3  
ATOM 2035  C CG   . GLU A 1 22 ? 4.843   3.232   -8.068  1.00 0.00 ? 22 GLU A CG   3  
ATOM 2036  C CD   . GLU A 1 22 ? 5.051   4.551   -7.332  1.00 0.00 ? 22 GLU A CD   3  
ATOM 2037  O OE1  . GLU A 1 22 ? 5.897   4.590   -6.454  1.00 0.00 ? 22 GLU A OE1  3  
ATOM 2038  O OE2  . GLU A 1 22 ? 4.360   5.503   -7.657  1.00 0.00 ? 22 GLU A OE2  3  
ATOM 2039  H H    . GLU A 1 22 ? 4.130   2.750   -10.601 1.00 0.00 ? 22 GLU A H    3  
ATOM 2040  H HA   . GLU A 1 22 ? 6.641   1.483   -10.408 1.00 0.00 ? 22 GLU A HA   3  
ATOM 2041  H HB2  . GLU A 1 22 ? 6.919   2.758   -8.328  1.00 0.00 ? 22 GLU A HB2  3  
ATOM 2042  H HB3  . GLU A 1 22 ? 6.238   3.769   -9.601  1.00 0.00 ? 22 GLU A HB3  3  
ATOM 2043  H HG2  . GLU A 1 22 ? 3.961   3.301   -8.683  1.00 0.00 ? 22 GLU A HG2  3  
ATOM 2044  H HG3  . GLU A 1 22 ? 4.716   2.439   -7.348  1.00 0.00 ? 22 GLU A HG3  3  
ATOM 2045  N N    . LEU A 1 23 ? 4.311   0.326   -8.402  1.00 0.00 ? 23 LEU A N    3  
ATOM 2046  C CA   . LEU A 1 23 ? 3.991   -0.788  -7.515  1.00 0.00 ? 23 LEU A CA   3  
ATOM 2047  C C    . LEU A 1 23 ? 4.371   -2.114  -8.173  1.00 0.00 ? 23 LEU A C    3  
ATOM 2048  O O    . LEU A 1 23 ? 5.137   -2.898  -7.613  1.00 0.00 ? 23 LEU A O    3  
ATOM 2049  C CB   . LEU A 1 23 ? 2.487   -0.786  -7.193  1.00 0.00 ? 23 LEU A CB   3  
ATOM 2050  C CG   . LEU A 1 23 ? 2.248   -0.245  -5.776  1.00 0.00 ? 23 LEU A CG   3  
ATOM 2051  C CD1  . LEU A 1 23 ? 0.796   0.222   -5.646  1.00 0.00 ? 23 LEU A CD1  3  
ATOM 2052  C CD2  . LEU A 1 23 ? 2.517   -1.350  -4.748  1.00 0.00 ? 23 LEU A CD2  3  
ATOM 2053  H H    . LEU A 1 23 ? 3.611   0.967   -8.647  1.00 0.00 ? 23 LEU A H    3  
ATOM 2054  H HA   . LEU A 1 23 ? 4.552   -0.681  -6.601  1.00 0.00 ? 23 LEU A HA   3  
ATOM 2055  H HB2  . LEU A 1 23 ? 1.975   -0.159  -7.905  1.00 0.00 ? 23 LEU A HB2  3  
ATOM 2056  H HB3  . LEU A 1 23 ? 2.099   -1.791  -7.261  1.00 0.00 ? 23 LEU A HB3  3  
ATOM 2057  H HG   . LEU A 1 23 ? 2.908   0.588   -5.593  1.00 0.00 ? 23 LEU A HG   3  
ATOM 2058  H HD11 . LEU A 1 23 ? 0.551   0.351   -4.602  1.00 0.00 ? 23 LEU A HD11 3  
ATOM 2059  H HD12 . LEU A 1 23 ? 0.138   -0.518  -6.080  1.00 0.00 ? 23 LEU A HD12 3  
ATOM 2060  H HD13 . LEU A 1 23 ? 0.672   1.161   -6.164  1.00 0.00 ? 23 LEU A HD13 3  
ATOM 2061  H HD21 . LEU A 1 23 ? 2.231   -1.003  -3.766  1.00 0.00 ? 23 LEU A HD21 3  
ATOM 2062  H HD22 . LEU A 1 23 ? 3.568   -1.597  -4.750  1.00 0.00 ? 23 LEU A HD22 3  
ATOM 2063  H HD23 . LEU A 1 23 ? 1.939   -2.228  -5.000  1.00 0.00 ? 23 LEU A HD23 3  
ATOM 2064  N N    . ARG A 1 24 ? 3.831   -2.352  -9.362  1.00 0.00 ? 24 ARG A N    3  
ATOM 2065  C CA   . ARG A 1 24 ? 4.117   -3.587  -10.085 1.00 0.00 ? 24 ARG A CA   3  
ATOM 2066  C C    . ARG A 1 24 ? 5.604   -3.692  -10.411 1.00 0.00 ? 24 ARG A C    3  
ATOM 2067  O O    . ARG A 1 24 ? 6.237   -4.714  -10.148 1.00 0.00 ? 24 ARG A O    3  
ATOM 2068  C CB   . ARG A 1 24 ? 3.304   -3.634  -11.381 1.00 0.00 ? 24 ARG A CB   3  
ATOM 2069  C CG   . ARG A 1 24 ? 3.631   -4.919  -12.144 1.00 0.00 ? 24 ARG A CG   3  
ATOM 2070  C CD   . ARG A 1 24 ? 2.552   -5.175  -13.198 1.00 0.00 ? 24 ARG A CD   3  
ATOM 2071  N NE   . ARG A 1 24 ? 3.001   -6.192  -14.142 1.00 0.00 ? 24 ARG A NE   3  
ATOM 2072  C CZ   . ARG A 1 24 ? 2.159   -6.743  -15.011 1.00 0.00 ? 24 ARG A CZ   3  
ATOM 2073  N NH1  . ARG A 1 24 ? 0.907   -6.374  -15.028 1.00 0.00 ? 24 ARG A NH1  3  
ATOM 2074  N NH2  . ARG A 1 24 ? 2.582   -7.651  -15.846 1.00 0.00 ? 24 ARG A NH2  3  
ATOM 2075  H H    . ARG A 1 24 ? 3.227   -1.691  -9.761  1.00 0.00 ? 24 ARG A H    3  
ATOM 2076  H HA   . ARG A 1 24 ? 3.835   -4.427  -9.467  1.00 0.00 ? 24 ARG A HA   3  
ATOM 2077  H HB2  . ARG A 1 24 ? 2.250   -3.613  -11.144 1.00 0.00 ? 24 ARG A HB2  3  
ATOM 2078  H HB3  . ARG A 1 24 ? 3.553   -2.781  -11.991 1.00 0.00 ? 24 ARG A HB3  3  
ATOM 2079  H HG2  . ARG A 1 24 ? 4.592   -4.815  -12.628 1.00 0.00 ? 24 ARG A HG2  3  
ATOM 2080  H HG3  . ARG A 1 24 ? 3.664   -5.750  -11.456 1.00 0.00 ? 24 ARG A HG3  3  
ATOM 2081  H HD2  . ARG A 1 24 ? 1.652   -5.515  -12.711 1.00 0.00 ? 24 ARG A HD2  3  
ATOM 2082  H HD3  . ARG A 1 24 ? 2.348   -4.257  -13.729 1.00 0.00 ? 24 ARG A HD3  3  
ATOM 2083  H HE   . ARG A 1 24 ? 3.939   -6.476  -14.136 1.00 0.00 ? 24 ARG A HE   3  
ATOM 2084  H HH11 . ARG A 1 24 ? 0.581   -5.678  -14.388 1.00 0.00 ? 24 ARG A HH11 3  
ATOM 2085  H HH12 . ARG A 1 24 ? 0.272   -6.788  -15.682 1.00 0.00 ? 24 ARG A HH12 3  
ATOM 2086  H HH21 . ARG A 1 24 ? 3.542   -7.933  -15.832 1.00 0.00 ? 24 ARG A HH21 3  
ATOM 2087  H HH22 . ARG A 1 24 ? 1.949   -8.064  -16.500 1.00 0.00 ? 24 ARG A HH22 3  
ATOM 2088  N N    . ASP A 1 25 ? 6.154   -2.632  -10.987 1.00 0.00 ? 25 ASP A N    3  
ATOM 2089  C CA   . ASP A 1 25 ? 7.565   -2.627  -11.348 1.00 0.00 ? 25 ASP A CA   3  
ATOM 2090  C C    . ASP A 1 25 ? 8.439   -2.922  -10.132 1.00 0.00 ? 25 ASP A C    3  
ATOM 2091  O O    . ASP A 1 25 ? 9.269   -3.831  -10.160 1.00 0.00 ? 25 ASP A O    3  
ATOM 2092  C CB   . ASP A 1 25 ? 7.947   -1.269  -11.936 1.00 0.00 ? 25 ASP A CB   3  
ATOM 2093  C CG   . ASP A 1 25 ? 9.280   -1.373  -12.670 1.00 0.00 ? 25 ASP A CG   3  
ATOM 2094  O OD1  . ASP A 1 25 ? 9.331   -2.071  -13.668 1.00 0.00 ? 25 ASP A OD1  3  
ATOM 2095  O OD2  . ASP A 1 25 ? 10.231  -0.755  -12.223 1.00 0.00 ? 25 ASP A OD2  3  
ATOM 2096  H H    . ASP A 1 25 ? 5.603   -1.844  -11.177 1.00 0.00 ? 25 ASP A H    3  
ATOM 2097  H HA   . ASP A 1 25 ? 7.735   -3.387  -12.092 1.00 0.00 ? 25 ASP A HA   3  
ATOM 2098  H HB2  . ASP A 1 25 ? 7.181   -0.949  -12.628 1.00 0.00 ? 25 ASP A HB2  3  
ATOM 2099  H HB3  . ASP A 1 25 ? 8.036   -0.545  -11.139 1.00 0.00 ? 25 ASP A HB3  3  
ATOM 2100  N N    . THR A 1 26 ? 8.252   -2.147  -9.072  1.00 0.00 ? 26 THR A N    3  
ATOM 2101  C CA   . THR A 1 26 ? 9.038   -2.332  -7.858  1.00 0.00 ? 26 THR A CA   3  
ATOM 2102  C C    . THR A 1 26 ? 8.883   -3.745  -7.302  1.00 0.00 ? 26 THR A C    3  
ATOM 2103  O O    . THR A 1 26 ? 9.833   -4.311  -6.761  1.00 0.00 ? 26 THR A O    3  
ATOM 2104  C CB   . THR A 1 26 ? 8.611   -1.319  -6.796  1.00 0.00 ? 26 THR A CB   3  
ATOM 2105  O OG1  . THR A 1 26 ? 8.475   -0.038  -7.396  1.00 0.00 ? 26 THR A OG1  3  
ATOM 2106  C CG2  . THR A 1 26 ? 9.670   -1.261  -5.695  1.00 0.00 ? 26 THR A CG2  3  
ATOM 2107  H H    . THR A 1 26 ? 7.580   -1.436  -9.106  1.00 0.00 ? 26 THR A H    3  
ATOM 2108  H HA   . THR A 1 26 ? 10.080  -2.165  -8.089  1.00 0.00 ? 26 THR A HA   3  
ATOM 2109  H HB   . THR A 1 26 ? 7.668   -1.621  -6.369  1.00 0.00 ? 26 THR A HB   3  
ATOM 2110  H HG1  . THR A 1 26 ? 7.542   0.190   -7.401  1.00 0.00 ? 26 THR A HG1  3  
ATOM 2111  H HG21 . THR A 1 26 ? 9.327   -0.618  -4.898  1.00 0.00 ? 26 THR A HG21 3  
ATOM 2112  H HG22 . THR A 1 26 ? 10.591  -0.870  -6.102  1.00 0.00 ? 26 THR A HG22 3  
ATOM 2113  H HG23 . THR A 1 26 ? 9.840   -2.254  -5.309  1.00 0.00 ? 26 THR A HG23 3  
ATOM 2114  N N    . ILE A 1 27 ? 7.684   -4.311  -7.423  1.00 0.00 ? 27 ILE A N    3  
ATOM 2115  C CA   . ILE A 1 27 ? 7.445   -5.657  -6.909  1.00 0.00 ? 27 ILE A CA   3  
ATOM 2116  C C    . ILE A 1 27 ? 8.022   -6.710  -7.855  1.00 0.00 ? 27 ILE A C    3  
ATOM 2117  O O    . ILE A 1 27 ? 8.283   -7.842  -7.449  1.00 0.00 ? 27 ILE A O    3  
ATOM 2118  C CB   . ILE A 1 27 ? 5.933   -5.885  -6.696  1.00 0.00 ? 27 ILE A CB   3  
ATOM 2119  C CG1  . ILE A 1 27 ? 5.702   -6.545  -5.329  1.00 0.00 ? 27 ILE A CG1  3  
ATOM 2120  C CG2  . ILE A 1 27 ? 5.359   -6.786  -7.799  1.00 0.00 ? 27 ILE A CG2  3  
ATOM 2121  C CD1  . ILE A 1 27 ? 4.240   -6.981  -5.200  1.00 0.00 ? 27 ILE A CD1  3  
ATOM 2122  H H    . ILE A 1 27 ? 6.953   -3.817  -7.857  1.00 0.00 ? 27 ILE A H    3  
ATOM 2123  H HA   . ILE A 1 27 ? 7.944   -5.749  -5.955  1.00 0.00 ? 27 ILE A HA   3  
ATOM 2124  H HB   . ILE A 1 27 ? 5.425   -4.935  -6.720  1.00 0.00 ? 27 ILE A HB   3  
ATOM 2125  H HG12 . ILE A 1 27 ? 6.345   -7.407  -5.232  1.00 0.00 ? 27 ILE A HG12 3  
ATOM 2126  H HG13 . ILE A 1 27 ? 5.932   -5.838  -4.547  1.00 0.00 ? 27 ILE A HG13 3  
ATOM 2127  H HG21 . ILE A 1 27 ? 5.692   -7.802  -7.646  1.00 0.00 ? 27 ILE A HG21 3  
ATOM 2128  H HG22 . ILE A 1 27 ? 5.693   -6.438  -8.764  1.00 0.00 ? 27 ILE A HG22 3  
ATOM 2129  H HG23 . ILE A 1 27 ? 4.280   -6.756  -7.762  1.00 0.00 ? 27 ILE A HG23 3  
ATOM 2130  H HD11 . ILE A 1 27 ? 3.993   -7.113  -4.157  1.00 0.00 ? 27 ILE A HD11 3  
ATOM 2131  H HD12 . ILE A 1 27 ? 4.096   -7.915  -5.725  1.00 0.00 ? 27 ILE A HD12 3  
ATOM 2132  H HD13 . ILE A 1 27 ? 3.598   -6.226  -5.629  1.00 0.00 ? 27 ILE A HD13 3  
ATOM 2133  N N    . ASN A 1 28 ? 8.215   -6.333  -9.118  1.00 0.00 ? 28 ASN A N    3  
ATOM 2134  C CA   . ASN A 1 28 ? 8.757   -7.261  -10.109 1.00 0.00 ? 28 ASN A CA   3  
ATOM 2135  C C    . ASN A 1 28 ? 10.217  -6.937  -10.422 1.00 0.00 ? 28 ASN A C    3  
ATOM 2136  O O    . ASN A 1 28 ? 10.863  -7.643  -11.196 1.00 0.00 ? 28 ASN A O    3  
ATOM 2137  C CB   . ASN A 1 28 ? 7.908   -7.210  -11.391 1.00 0.00 ? 28 ASN A CB   3  
ATOM 2138  C CG   . ASN A 1 28 ? 8.660   -6.497  -12.513 1.00 0.00 ? 28 ASN A CG   3  
ATOM 2139  O OD1  . ASN A 1 28 ? 8.829   -7.051  -13.599 1.00 0.00 ? 28 ASN A OD1  3  
ATOM 2140  N ND2  . ASN A 1 28 ? 9.122   -5.296  -12.311 1.00 0.00 ? 28 ASN A ND2  3  
ATOM 2141  H H    . ASN A 1 28 ? 7.985   -5.418  -9.389  1.00 0.00 ? 28 ASN A H    3  
ATOM 2142  H HA   . ASN A 1 28 ? 8.709   -8.263  -9.706  1.00 0.00 ? 28 ASN A HA   3  
ATOM 2143  H HB2  . ASN A 1 28 ? 7.672   -8.215  -11.707 1.00 0.00 ? 28 ASN A HB2  3  
ATOM 2144  H HB3  . ASN A 1 28 ? 6.991   -6.677  -11.188 1.00 0.00 ? 28 ASN A HB3  3  
ATOM 2145  H HD21 . ASN A 1 28 ? 8.986   -4.857  -11.446 1.00 0.00 ? 28 ASN A HD21 3  
ATOM 2146  H HD22 . ASN A 1 28 ? 9.605   -4.830  -13.025 1.00 0.00 ? 28 ASN A HD22 3  
ATOM 2147  N N    . THR A 1 29 ? 10.736  -5.872  -9.813  1.00 0.00 ? 29 THR A N    3  
ATOM 2148  C CA   . THR A 1 29 ? 12.127  -5.474  -10.034 1.00 0.00 ? 29 THR A CA   3  
ATOM 2149  C C    . THR A 1 29 ? 12.916  -5.557  -8.733  1.00 0.00 ? 29 THR A C    3  
ATOM 2150  O O    . THR A 1 29 ? 14.007  -6.126  -8.691  1.00 0.00 ? 29 THR A O    3  
ATOM 2151  C CB   . THR A 1 29 ? 12.196  -4.041  -10.577 1.00 0.00 ? 29 THR A CB   3  
ATOM 2152  O OG1  . THR A 1 29 ? 11.450  -3.181  -9.729  1.00 0.00 ? 29 THR A OG1  3  
ATOM 2153  C CG2  . THR A 1 29 ? 11.620  -3.983  -12.000 1.00 0.00 ? 29 THR A CG2  3  
ATOM 2154  H H    . THR A 1 29 ? 10.177  -5.348  -9.199  1.00 0.00 ? 29 THR A H    3  
ATOM 2155  H HA   . THR A 1 29 ? 12.578  -6.141  -10.756 1.00 0.00 ? 29 THR A HA   3  
ATOM 2156  H HB   . THR A 1 29 ? 13.226  -3.717  -10.597 1.00 0.00 ? 29 THR A HB   3  
ATOM 2157  H HG1  . THR A 1 29 ? 11.412  -2.315  -10.141 1.00 0.00 ? 29 THR A HG1  3  
ATOM 2158  H HG21 . THR A 1 29 ? 12.296  -3.434  -12.640 1.00 0.00 ? 29 THR A HG21 3  
ATOM 2159  H HG22 . THR A 1 29 ? 10.663  -3.484  -11.980 1.00 0.00 ? 29 THR A HG22 3  
ATOM 2160  H HG23 . THR A 1 29 ? 11.495  -4.983  -12.388 1.00 0.00 ? 29 THR A HG23 3  
ATOM 2161  N N    . SER A 1 30 ? 12.355  -4.988  -7.671  1.00 0.00 ? 30 SER A N    3  
ATOM 2162  C CA   . SER A 1 30 ? 13.010  -5.004  -6.370  1.00 0.00 ? 30 SER A CA   3  
ATOM 2163  C C    . SER A 1 30 ? 12.543  -6.210  -5.560  1.00 0.00 ? 30 SER A C    3  
ATOM 2164  O O    . SER A 1 30 ? 11.580  -6.880  -5.930  1.00 0.00 ? 30 SER A O    3  
ATOM 2165  C CB   . SER A 1 30 ? 12.693  -3.711  -5.612  1.00 0.00 ? 30 SER A CB   3  
ATOM 2166  O OG   . SER A 1 30 ? 13.785  -2.811  -5.750  1.00 0.00 ? 30 SER A OG   3  
ATOM 2167  H H    . SER A 1 30 ? 11.482  -4.551  -7.765  1.00 0.00 ? 30 SER A H    3  
ATOM 2168  H HA   . SER A 1 30 ? 14.079  -5.071  -6.512  1.00 0.00 ? 30 SER A HA   3  
ATOM 2169  H HB2  . SER A 1 30 ? 11.808  -3.259  -6.027  1.00 0.00 ? 30 SER A HB2  3  
ATOM 2170  H HB3  . SER A 1 30 ? 12.526  -3.933  -4.567  1.00 0.00 ? 30 SER A HB3  3  
ATOM 2171  H HG   . SER A 1 30 ? 14.584  -3.328  -5.865  1.00 0.00 ? 30 SER A HG   3  
ATOM 2172  N N    . CYS A 1 31 ? 13.231  -6.480  -4.456  1.00 0.00 ? 31 CYS A N    3  
ATOM 2173  C CA   . CYS A 1 31 ? 12.871  -7.610  -3.607  1.00 0.00 ? 31 CYS A CA   3  
ATOM 2174  C C    . CYS A 1 31 ? 13.411  -7.419  -2.196  1.00 0.00 ? 31 CYS A C    3  
ATOM 2175  O O    . CYS A 1 31 ? 14.613  -7.238  -1.998  1.00 0.00 ? 31 CYS A O    3  
ATOM 2176  C CB   . CYS A 1 31 ? 13.430  -8.905  -4.198  1.00 0.00 ? 31 CYS A CB   3  
ATOM 2177  S SG   . CYS A 1 31 ? 12.610  -10.323 -3.428  1.00 0.00 ? 31 CYS A SG   3  
ATOM 2178  H H    . CYS A 1 31 ? 13.989  -5.913  -4.207  1.00 0.00 ? 31 CYS A H    3  
ATOM 2179  H HA   . CYS A 1 31 ? 11.795  -7.686  -3.562  1.00 0.00 ? 31 CYS A HA   3  
ATOM 2180  H HB2  . CYS A 1 31 ? 13.252  -8.921  -5.263  1.00 0.00 ? 31 CYS A HB2  3  
ATOM 2181  H HB3  . CYS A 1 31 ? 14.492  -8.958  -4.009  1.00 0.00 ? 31 CYS A HB3  3  
ATOM 2182  H HG   . CYS A 1 31 ? 11.714  -10.369 -3.771  1.00 0.00 ? 31 CYS A HG   3  
ATOM 2183  N N    . ASP A 1 32 ? 12.514  -7.467  -1.218  1.00 0.00 ? 32 ASP A N    3  
ATOM 2184  C CA   . ASP A 1 32 ? 12.902  -7.306  0.177   1.00 0.00 ? 32 ASP A CA   3  
ATOM 2185  C C    . ASP A 1 32 ? 11.700  -7.541  1.085   1.00 0.00 ? 32 ASP A C    3  
ATOM 2186  O O    . ASP A 1 32 ? 10.621  -6.999  0.851   1.00 0.00 ? 32 ASP A O    3  
ATOM 2187  C CB   . ASP A 1 32 ? 13.467  -5.898  0.413   1.00 0.00 ? 32 ASP A CB   3  
ATOM 2188  C CG   . ASP A 1 32 ? 14.580  -5.942  1.457   1.00 0.00 ? 32 ASP A CG   3  
ATOM 2189  O OD1  . ASP A 1 32 ? 14.512  -6.792  2.330   1.00 0.00 ? 32 ASP A OD1  3  
ATOM 2190  O OD2  . ASP A 1 32 ? 15.484  -5.128  1.365   1.00 0.00 ? 32 ASP A OD2  3  
ATOM 2191  H H    . ASP A 1 32 ? 11.572  -7.620  -1.440  1.00 0.00 ? 32 ASP A H    3  
ATOM 2192  H HA   . ASP A 1 32 ? 13.665  -8.035  0.412   1.00 0.00 ? 32 ASP A HA   3  
ATOM 2193  H HB2  . ASP A 1 32 ? 13.863  -5.510  -0.514  1.00 0.00 ? 32 ASP A HB2  3  
ATOM 2194  H HB3  . ASP A 1 32 ? 12.680  -5.248  0.762   1.00 0.00 ? 32 ASP A HB3  3  
ATOM 2195  N N    . ILE A 1 33 ? 11.893  -8.353  2.119   1.00 0.00 ? 33 ILE A N    3  
ATOM 2196  C CA   . ILE A 1 33 ? 10.813  -8.654  3.054   1.00 0.00 ? 33 ILE A CA   3  
ATOM 2197  C C    . ILE A 1 33 ? 9.965   -7.412  3.318   1.00 0.00 ? 33 ILE A C    3  
ATOM 2198  O O    . ILE A 1 33 ? 8.743   -7.495  3.428   1.00 0.00 ? 33 ILE A O    3  
ATOM 2199  C CB   . ILE A 1 33 ? 11.397  -9.164  4.377   1.00 0.00 ? 33 ILE A CB   3  
ATOM 2200  C CG1  . ILE A 1 33 ? 12.646  -8.345  4.738   1.00 0.00 ? 33 ILE A CG1  3  
ATOM 2201  C CG2  . ILE A 1 33 ? 11.777  -10.640 4.234   1.00 0.00 ? 33 ILE A CG2  3  
ATOM 2202  C CD1  . ILE A 1 33 ? 12.785  -8.258  6.261   1.00 0.00 ? 33 ILE A CD1  3  
ATOM 2203  H H    . ILE A 1 33 ? 12.774  -8.759  2.255   1.00 0.00 ? 33 ILE A H    3  
ATOM 2204  H HA   . ILE A 1 33 ? 10.186  -9.422  2.630   1.00 0.00 ? 33 ILE A HA   3  
ATOM 2205  H HB   . ILE A 1 33 ? 10.655  -9.061  5.158   1.00 0.00 ? 33 ILE A HB   3  
ATOM 2206  H HG12 . ILE A 1 33 ? 13.524  -8.821  4.324   1.00 0.00 ? 33 ILE A HG12 3  
ATOM 2207  H HG13 . ILE A 1 33 ? 12.555  -7.347  4.334   1.00 0.00 ? 33 ILE A HG13 3  
ATOM 2208  H HG21 . ILE A 1 33 ? 10.879  -11.239 4.174   1.00 0.00 ? 33 ILE A HG21 3  
ATOM 2209  H HG22 . ILE A 1 33 ? 12.358  -10.948 5.090   1.00 0.00 ? 33 ILE A HG22 3  
ATOM 2210  H HG23 . ILE A 1 33 ? 12.360  -10.777 3.335   1.00 0.00 ? 33 ILE A HG23 3  
ATOM 2211  H HD11 . ILE A 1 33 ? 12.565  -9.221  6.699   1.00 0.00 ? 33 ILE A HD11 3  
ATOM 2212  H HD12 . ILE A 1 33 ? 12.094  -7.522  6.643   1.00 0.00 ? 33 ILE A HD12 3  
ATOM 2213  H HD13 . ILE A 1 33 ? 13.795  -7.969  6.514   1.00 0.00 ? 33 ILE A HD13 3  
ATOM 2214  N N    . GLU A 1 34 ? 10.625  -6.263  3.419   1.00 0.00 ? 34 GLU A N    3  
ATOM 2215  C CA   . GLU A 1 34 ? 9.925   -5.010  3.677   1.00 0.00 ? 34 GLU A CA   3  
ATOM 2216  C C    . GLU A 1 34 ? 9.202   -4.519  2.426   1.00 0.00 ? 34 GLU A C    3  
ATOM 2217  O O    . GLU A 1 34 ? 8.011   -4.212  2.468   1.00 0.00 ? 34 GLU A O    3  
ATOM 2218  C CB   . GLU A 1 34 ? 10.920  -3.945  4.151   1.00 0.00 ? 34 GLU A CB   3  
ATOM 2219  C CG   . GLU A 1 34 ? 12.055  -4.614  4.933   1.00 0.00 ? 34 GLU A CG   3  
ATOM 2220  C CD   . GLU A 1 34 ? 12.712  -3.607  5.872   1.00 0.00 ? 34 GLU A CD   3  
ATOM 2221  O OE1  . GLU A 1 34 ? 12.021  -3.091  6.734   1.00 0.00 ? 34 GLU A OE1  3  
ATOM 2222  O OE2  . GLU A 1 34 ? 13.897  -3.363  5.713   1.00 0.00 ? 34 GLU A OE2  3  
ATOM 2223  H H    . GLU A 1 34 ? 11.600  -6.258  3.325   1.00 0.00 ? 34 GLU A H    3  
ATOM 2224  H HA   . GLU A 1 34 ? 9.196   -5.173  4.457   1.00 0.00 ? 34 GLU A HA   3  
ATOM 2225  H HB2  . GLU A 1 34 ? 11.331  -3.429  3.295   1.00 0.00 ? 34 GLU A HB2  3  
ATOM 2226  H HB3  . GLU A 1 34 ? 10.414  -3.239  4.791   1.00 0.00 ? 34 GLU A HB3  3  
ATOM 2227  H HG2  . GLU A 1 34 ? 11.658  -5.436  5.511   1.00 0.00 ? 34 GLU A HG2  3  
ATOM 2228  H HG3  . GLU A 1 34 ? 12.794  -4.990  4.241   1.00 0.00 ? 34 GLU A HG3  3  
ATOM 2229  N N    . LEU A 1 35 ? 9.926   -4.439  1.314   1.00 0.00 ? 35 LEU A N    3  
ATOM 2230  C CA   . LEU A 1 35 ? 9.331   -3.976  0.064   1.00 0.00 ? 35 LEU A CA   3  
ATOM 2231  C C    . LEU A 1 35 ? 8.086   -4.798  -0.265  1.00 0.00 ? 35 LEU A C    3  
ATOM 2232  O O    . LEU A 1 35 ? 7.015   -4.246  -0.516  1.00 0.00 ? 35 LEU A O    3  
ATOM 2233  C CB   . LEU A 1 35 ? 10.346  -4.103  -1.085  1.00 0.00 ? 35 LEU A CB   3  
ATOM 2234  C CG   . LEU A 1 35 ? 10.181  -2.950  -2.097  1.00 0.00 ? 35 LEU A CG   3  
ATOM 2235  C CD1  . LEU A 1 35 ? 8.695   -2.717  -2.409  1.00 0.00 ? 35 LEU A CD1  3  
ATOM 2236  C CD2  . LEU A 1 35 ? 10.791  -1.657  -1.536  1.00 0.00 ? 35 LEU A CD2  3  
ATOM 2237  H H    . LEU A 1 35 ? 10.873  -4.693  1.335   1.00 0.00 ? 35 LEU A H    3  
ATOM 2238  H HA   . LEU A 1 35 ? 9.052   -2.941  0.177   1.00 0.00 ? 35 LEU A HA   3  
ATOM 2239  H HB2  . LEU A 1 35 ? 11.345  -4.078  -0.679  1.00 0.00 ? 35 LEU A HB2  3  
ATOM 2240  H HB3  . LEU A 1 35 ? 10.197  -5.043  -1.594  1.00 0.00 ? 35 LEU A HB3  3  
ATOM 2241  H HG   . LEU A 1 35 ? 10.691  -3.213  -3.012  1.00 0.00 ? 35 LEU A HG   3  
ATOM 2242  H HD11 . LEU A 1 35 ? 8.188   -3.666  -2.486  1.00 0.00 ? 35 LEU A HD11 3  
ATOM 2243  H HD12 . LEU A 1 35 ? 8.605   -2.188  -3.345  1.00 0.00 ? 35 LEU A HD12 3  
ATOM 2244  H HD13 . LEU A 1 35 ? 8.246   -2.128  -1.622  1.00 0.00 ? 35 LEU A HD13 3  
ATOM 2245  H HD21 . LEU A 1 35 ? 11.295  -1.126  -2.331  1.00 0.00 ? 35 LEU A HD21 3  
ATOM 2246  H HD22 . LEU A 1 35 ? 11.502  -1.893  -0.758  1.00 0.00 ? 35 LEU A HD22 3  
ATOM 2247  H HD23 . LEU A 1 35 ? 10.008  -1.034  -1.131  1.00 0.00 ? 35 LEU A HD23 3  
ATOM 2248  N N    . LEU A 1 36 ? 8.240   -6.118  -0.266  1.00 0.00 ? 36 LEU A N    3  
ATOM 2249  C CA   . LEU A 1 36 ? 7.125   -7.008  -0.573  1.00 0.00 ? 36 LEU A CA   3  
ATOM 2250  C C    . LEU A 1 36 ? 6.041   -6.908  0.496   1.00 0.00 ? 36 LEU A C    3  
ATOM 2251  O O    . LEU A 1 36 ? 4.867   -6.718  0.180   1.00 0.00 ? 36 LEU A O    3  
ATOM 2252  C CB   . LEU A 1 36 ? 7.621   -8.452  -0.672  1.00 0.00 ? 36 LEU A CB   3  
ATOM 2253  C CG   . LEU A 1 36 ? 8.872   -8.509  -1.556  1.00 0.00 ? 36 LEU A CG   3  
ATOM 2254  C CD1  . LEU A 1 36 ? 9.282   -9.968  -1.763  1.00 0.00 ? 36 LEU A CD1  3  
ATOM 2255  C CD2  . LEU A 1 36 ? 8.573   -7.865  -2.916  1.00 0.00 ? 36 LEU A CD2  3  
ATOM 2256  H H    . LEU A 1 36 ? 9.119   -6.500  -0.062  1.00 0.00 ? 36 LEU A H    3  
ATOM 2257  H HA   . LEU A 1 36 ? 6.703   -6.721  -1.523  1.00 0.00 ? 36 LEU A HA   3  
ATOM 2258  H HB2  . LEU A 1 36 ? 7.862   -8.818  0.315   1.00 0.00 ? 36 LEU A HB2  3  
ATOM 2259  H HB3  . LEU A 1 36 ? 6.849   -9.068  -1.107  1.00 0.00 ? 36 LEU A HB3  3  
ATOM 2260  H HG   . LEU A 1 36 ? 9.677   -7.974  -1.073  1.00 0.00 ? 36 LEU A HG   3  
ATOM 2261  H HD11 . LEU A 1 36 ? 9.616   -10.384 -0.825  1.00 0.00 ? 36 LEU A HD11 3  
ATOM 2262  H HD12 . LEU A 1 36 ? 10.084  -10.018 -2.485  1.00 0.00 ? 36 LEU A HD12 3  
ATOM 2263  H HD13 . LEU A 1 36 ? 8.435   -10.532 -2.126  1.00 0.00 ? 36 LEU A HD13 3  
ATOM 2264  H HD21 . LEU A 1 36 ? 8.622   -6.790  -2.824  1.00 0.00 ? 36 LEU A HD21 3  
ATOM 2265  H HD22 . LEU A 1 36 ? 7.585   -8.153  -3.243  1.00 0.00 ? 36 LEU A HD22 3  
ATOM 2266  H HD23 . LEU A 1 36 ? 9.303   -8.196  -3.641  1.00 0.00 ? 36 LEU A HD23 3  
ATOM 2267  N N    . ALA A 1 37 ? 6.435   -7.036  1.759   1.00 0.00 ? 37 ALA A N    3  
ATOM 2268  C CA   . ALA A 1 37 ? 5.472   -6.953  2.852   1.00 0.00 ? 37 ALA A CA   3  
ATOM 2269  C C    . ALA A 1 37 ? 4.657   -5.672  2.737   1.00 0.00 ? 37 ALA A C    3  
ATOM 2270  O O    . ALA A 1 37 ? 3.429   -5.693  2.836   1.00 0.00 ? 37 ALA A O    3  
ATOM 2271  C CB   . ALA A 1 37 ? 6.196   -6.981  4.199   1.00 0.00 ? 37 ALA A CB   3  
ATOM 2272  H H    . ALA A 1 37 ? 7.384   -7.186  1.959   1.00 0.00 ? 37 ALA A H    3  
ATOM 2273  H HA   . ALA A 1 37 ? 4.804   -7.801  2.796   1.00 0.00 ? 37 ALA A HA   3  
ATOM 2274  H HB1  . ALA A 1 37 ? 5.488   -6.796  4.991   1.00 0.00 ? 37 ALA A HB1  3  
ATOM 2275  H HB2  . ALA A 1 37 ? 6.960   -6.217  4.213   1.00 0.00 ? 37 ALA A HB2  3  
ATOM 2276  H HB3  . ALA A 1 37 ? 6.651   -7.951  4.343   1.00 0.00 ? 37 ALA A HB3  3  
ATOM 2277  N N    . ALA A 1 38 ? 5.348   -4.558  2.519   1.00 0.00 ? 38 ALA A N    3  
ATOM 2278  C CA   . ALA A 1 38 ? 4.679   -3.271  2.386   1.00 0.00 ? 38 ALA A CA   3  
ATOM 2279  C C    . ALA A 1 38 ? 3.813   -3.254  1.130   1.00 0.00 ? 38 ALA A C    3  
ATOM 2280  O O    . ALA A 1 38 ? 2.665   -2.806  1.161   1.00 0.00 ? 38 ALA A O    3  
ATOM 2281  C CB   . ALA A 1 38 ? 5.716   -2.147  2.316   1.00 0.00 ? 38 ALA A CB   3  
ATOM 2282  H H    . ALA A 1 38 ? 6.324   -4.604  2.444   1.00 0.00 ? 38 ALA A H    3  
ATOM 2283  H HA   . ALA A 1 38 ? 4.049   -3.112  3.248   1.00 0.00 ? 38 ALA A HA   3  
ATOM 2284  H HB1  . ALA A 1 38 ? 5.269   -1.222  2.647   1.00 0.00 ? 38 ALA A HB1  3  
ATOM 2285  H HB2  . ALA A 1 38 ? 6.062   -2.036  1.298   1.00 0.00 ? 38 ALA A HB2  3  
ATOM 2286  H HB3  . ALA A 1 38 ? 6.553   -2.392  2.955   1.00 0.00 ? 38 ALA A HB3  3  
ATOM 2287  N N    . CYS A 1 39 ? 4.366   -3.751  0.028   1.00 0.00 ? 39 CYS A N    3  
ATOM 2288  C CA   . CYS A 1 39 ? 3.631   -3.793  -1.231  1.00 0.00 ? 39 CYS A CA   3  
ATOM 2289  C C    . CYS A 1 39 ? 2.327   -4.562  -1.051  1.00 0.00 ? 39 CYS A C    3  
ATOM 2290  O O    . CYS A 1 39 ? 1.254   -4.081  -1.418  1.00 0.00 ? 39 CYS A O    3  
ATOM 2291  C CB   . CYS A 1 39 ? 4.477   -4.468  -2.313  1.00 0.00 ? 39 CYS A CB   3  
ATOM 2292  S SG   . CYS A 1 39 ? 3.745   -4.149  -3.936  1.00 0.00 ? 39 CYS A SG   3  
ATOM 2293  H H    . CYS A 1 39 ? 5.283   -4.097  0.063   1.00 0.00 ? 39 CYS A H    3  
ATOM 2294  H HA   . CYS A 1 39 ? 3.407   -2.783  -1.541  1.00 0.00 ? 39 CYS A HA   3  
ATOM 2295  H HB2  . CYS A 1 39 ? 5.481   -4.074  -2.286  1.00 0.00 ? 39 CYS A HB2  3  
ATOM 2296  H HB3  . CYS A 1 39 ? 4.504   -5.534  -2.135  1.00 0.00 ? 39 CYS A HB3  3  
ATOM 2297  H HG   . CYS A 1 39 ? 3.473   -4.990  -4.311  1.00 0.00 ? 39 CYS A HG   3  
ATOM 2298  N N    . ARG A 1 40 ? 2.429   -5.758  -0.480  1.00 0.00 ? 40 ARG A N    3  
ATOM 2299  C CA   . ARG A 1 40 ? 1.253   -6.587  -0.250  1.00 0.00 ? 40 ARG A CA   3  
ATOM 2300  C C    . ARG A 1 40 ? 0.243   -5.846  0.619   1.00 0.00 ? 40 ARG A C    3  
ATOM 2301  O O    . ARG A 1 40 ? -0.949  -5.812  0.313   1.00 0.00 ? 40 ARG A O    3  
ATOM 2302  C CB   . ARG A 1 40 ? 1.663   -7.892  0.437   1.00 0.00 ? 40 ARG A CB   3  
ATOM 2303  C CG   . ARG A 1 40 ? 2.363   -8.806  -0.573  1.00 0.00 ? 40 ARG A CG   3  
ATOM 2304  C CD   . ARG A 1 40 ? 3.188   -9.859  0.173   1.00 0.00 ? 40 ARG A CD   3  
ATOM 2305  N NE   . ARG A 1 40 ? 2.541   -10.208 1.432   1.00 0.00 ? 40 ARG A NE   3  
ATOM 2306  C CZ   . ARG A 1 40 ? 1.513   -11.050 1.466   1.00 0.00 ? 40 ARG A CZ   3  
ATOM 2307  N NH1  . ARG A 1 40 ? 1.065   -11.579 0.359   1.00 0.00 ? 40 ARG A NH1  3  
ATOM 2308  N NH2  . ARG A 1 40 ? 0.951   -11.349 2.605   1.00 0.00 ? 40 ARG A NH2  3  
ATOM 2309  H H    . ARG A 1 40 ? 3.311   -6.086  -0.206  1.00 0.00 ? 40 ARG A H    3  
ATOM 2310  H HA   . ARG A 1 40 ? 0.795   -6.820  -1.199  1.00 0.00 ? 40 ARG A HA   3  
ATOM 2311  H HB2  . ARG A 1 40 ? 2.336   -7.672  1.254   1.00 0.00 ? 40 ARG A HB2  3  
ATOM 2312  H HB3  . ARG A 1 40 ? 0.784   -8.388  0.819   1.00 0.00 ? 40 ARG A HB3  3  
ATOM 2313  H HG2  . ARG A 1 40 ? 1.622   -9.296  -1.188  1.00 0.00 ? 40 ARG A HG2  3  
ATOM 2314  H HG3  . ARG A 1 40 ? 3.017   -8.217  -1.201  1.00 0.00 ? 40 ARG A HG3  3  
ATOM 2315  H HD2  . ARG A 1 40 ? 3.277   -10.743 -0.440  1.00 0.00 ? 40 ARG A HD2  3  
ATOM 2316  H HD3  . ARG A 1 40 ? 4.174   -9.464  0.372   1.00 0.00 ? 40 ARG A HD3  3  
ATOM 2317  H HE   . ARG A 1 40 ? 2.870   -9.815  2.267   1.00 0.00 ? 40 ARG A HE   3  
ATOM 2318  H HH11 . ARG A 1 40 ? 1.496   -11.351 -0.514  1.00 0.00 ? 40 ARG A HH11 3  
ATOM 2319  H HH12 . ARG A 1 40 ? 0.292   -12.213 0.386   1.00 0.00 ? 40 ARG A HH12 3  
ATOM 2320  H HH21 . ARG A 1 40 ? 1.294   -10.943 3.453   1.00 0.00 ? 40 ARG A HH21 3  
ATOM 2321  H HH22 . ARG A 1 40 ? 0.177   -11.982 2.631   1.00 0.00 ? 40 ARG A HH22 3  
ATOM 2322  N N    . GLU A 1 41 ? 0.728   -5.251  1.704   1.00 0.00 ? 41 GLU A N    3  
ATOM 2323  C CA   . GLU A 1 41 ? -0.143  -4.510  2.609   1.00 0.00 ? 41 GLU A CA   3  
ATOM 2324  C C    . GLU A 1 41 ? -0.921  -3.445  1.844   1.00 0.00 ? 41 GLU A C    3  
ATOM 2325  O O    . GLU A 1 41 ? -2.110  -3.240  2.081   1.00 0.00 ? 41 GLU A O    3  
ATOM 2326  C CB   . GLU A 1 41 ? 0.689   -3.847  3.710   1.00 0.00 ? 41 GLU A CB   3  
ATOM 2327  C CG   . GLU A 1 41 ? 1.150   -4.907  4.714   1.00 0.00 ? 41 GLU A CG   3  
ATOM 2328  C CD   . GLU A 1 41 ? -0.001  -5.285  5.639   1.00 0.00 ? 41 GLU A CD   3  
ATOM 2329  O OE1  . GLU A 1 41 ? -0.509  -4.403  6.313   1.00 0.00 ? 41 GLU A OE1  3  
ATOM 2330  O OE2  . GLU A 1 41 ? -0.360  -6.451  5.661   1.00 0.00 ? 41 GLU A OE2  3  
ATOM 2331  H H    . GLU A 1 41 ? 1.687   -5.310  1.900   1.00 0.00 ? 41 GLU A H    3  
ATOM 2332  H HA   . GLU A 1 41 ? -0.841  -5.196  3.064   1.00 0.00 ? 41 GLU A HA   3  
ATOM 2333  H HB2  . GLU A 1 41 ? 1.551   -3.369  3.269   1.00 0.00 ? 41 GLU A HB2  3  
ATOM 2334  H HB3  . GLU A 1 41 ? 0.088   -3.109  4.220   1.00 0.00 ? 41 GLU A HB3  3  
ATOM 2335  H HG2  . GLU A 1 41 ? 1.485   -5.783  4.181   1.00 0.00 ? 41 GLU A HG2  3  
ATOM 2336  H HG3  . GLU A 1 41 ? 1.965   -4.512  5.302   1.00 0.00 ? 41 GLU A HG3  3  
ATOM 2337  N N    . GLU A 1 42 ? -0.239  -2.772  0.922   1.00 0.00 ? 42 GLU A N    3  
ATOM 2338  C CA   . GLU A 1 42 ? -0.875  -1.729  0.125   1.00 0.00 ? 42 GLU A CA   3  
ATOM 2339  C C    . GLU A 1 42 ? -1.971  -2.325  -0.754  1.00 0.00 ? 42 GLU A C    3  
ATOM 2340  O O    . GLU A 1 42 ? -3.097  -1.826  -0.782  1.00 0.00 ? 42 GLU A O    3  
ATOM 2341  C CB   . GLU A 1 42 ? 0.166   -1.035  -0.755  1.00 0.00 ? 42 GLU A CB   3  
ATOM 2342  C CG   . GLU A 1 42 ? 1.026   -0.108  0.105   1.00 0.00 ? 42 GLU A CG   3  
ATOM 2343  C CD   . GLU A 1 42 ? 0.223   1.124   0.509   1.00 0.00 ? 42 GLU A CD   3  
ATOM 2344  O OE1  . GLU A 1 42 ? 0.257   2.096   -0.227  1.00 0.00 ? 42 GLU A OE1  3  
ATOM 2345  O OE2  . GLU A 1 42 ? -0.414  1.076   1.548   1.00 0.00 ? 42 GLU A OE2  3  
ATOM 2346  H H    . GLU A 1 42 ? 0.708   -2.979  0.776   1.00 0.00 ? 42 GLU A H    3  
ATOM 2347  H HA   . GLU A 1 42 ? -1.316  -1.000  0.787   1.00 0.00 ? 42 GLU A HA   3  
ATOM 2348  H HB2  . GLU A 1 42 ? 0.793   -1.779  -1.224  1.00 0.00 ? 42 GLU A HB2  3  
ATOM 2349  H HB3  . GLU A 1 42 ? -0.335  -0.454  -1.517  1.00 0.00 ? 42 GLU A HB3  3  
ATOM 2350  H HG2  . GLU A 1 42 ? 1.345   -0.636  0.992   1.00 0.00 ? 42 GLU A HG2  3  
ATOM 2351  H HG3  . GLU A 1 42 ? 1.895   0.202   -0.458  1.00 0.00 ? 42 GLU A HG3  3  
ATOM 2352  N N    . PHE A 1 43 ? -1.636  -3.393  -1.469  1.00 0.00 ? 43 PHE A N    3  
ATOM 2353  C CA   . PHE A 1 43 ? -2.601  -4.048  -2.344  1.00 0.00 ? 43 PHE A CA   3  
ATOM 2354  C C    . PHE A 1 43 ? -3.817  -4.509  -1.543  1.00 0.00 ? 43 PHE A C    3  
ATOM 2355  O O    . PHE A 1 43 ? -4.956  -4.189  -1.882  1.00 0.00 ? 43 PHE A O    3  
ATOM 2356  C CB   . PHE A 1 43 ? -1.946  -5.254  -3.038  1.00 0.00 ? 43 PHE A CB   3  
ATOM 2357  C CG   . PHE A 1 43 ? -1.677  -4.927  -4.490  1.00 0.00 ? 43 PHE A CG   3  
ATOM 2358  C CD1  . PHE A 1 43 ? -0.771  -3.914  -4.823  1.00 0.00 ? 43 PHE A CD1  3  
ATOM 2359  C CD2  . PHE A 1 43 ? -2.335  -5.639  -5.503  1.00 0.00 ? 43 PHE A CD2  3  
ATOM 2360  C CE1  . PHE A 1 43 ? -0.521  -3.611  -6.167  1.00 0.00 ? 43 PHE A CE1  3  
ATOM 2361  C CE2  . PHE A 1 43 ? -2.083  -5.335  -6.847  1.00 0.00 ? 43 PHE A CE2  3  
ATOM 2362  C CZ   . PHE A 1 43 ? -1.177  -4.323  -7.179  1.00 0.00 ? 43 PHE A CZ   3  
ATOM 2363  H H    . PHE A 1 43 ? -0.723  -3.749  -1.408  1.00 0.00 ? 43 PHE A H    3  
ATOM 2364  H HA   . PHE A 1 43 ? -2.929  -3.343  -3.094  1.00 0.00 ? 43 PHE A HA   3  
ATOM 2365  H HB2  . PHE A 1 43 ? -1.014  -5.484  -2.544  1.00 0.00 ? 43 PHE A HB2  3  
ATOM 2366  H HB3  . PHE A 1 43 ? -2.603  -6.110  -2.977  1.00 0.00 ? 43 PHE A HB3  3  
ATOM 2367  H HD1  . PHE A 1 43 ? -0.263  -3.365  -4.043  1.00 0.00 ? 43 PHE A HD1  3  
ATOM 2368  H HD2  . PHE A 1 43 ? -3.034  -6.421  -5.248  1.00 0.00 ? 43 PHE A HD2  3  
ATOM 2369  H HE1  . PHE A 1 43 ? 0.178   -2.831  -6.424  1.00 0.00 ? 43 PHE A HE1  3  
ATOM 2370  H HE2  . PHE A 1 43 ? -2.591  -5.883  -7.627  1.00 0.00 ? 43 PHE A HE2  3  
ATOM 2371  H HZ   . PHE A 1 43 ? -0.985  -4.088  -8.215  1.00 0.00 ? 43 PHE A HZ   3  
ATOM 2372  N N    . HIS A 1 44 ? -3.565  -5.261  -0.477  1.00 0.00 ? 44 HIS A N    3  
ATOM 2373  C CA   . HIS A 1 44 ? -4.645  -5.760  0.367   1.00 0.00 ? 44 HIS A CA   3  
ATOM 2374  C C    . HIS A 1 44 ? -5.432  -4.601  0.969   1.00 0.00 ? 44 HIS A C    3  
ATOM 2375  O O    . HIS A 1 44 ? -6.637  -4.709  1.203   1.00 0.00 ? 44 HIS A O    3  
ATOM 2376  C CB   . HIS A 1 44 ? -4.073  -6.631  1.488   1.00 0.00 ? 44 HIS A CB   3  
ATOM 2377  C CG   . HIS A 1 44 ? -5.167  -7.479  2.076   1.00 0.00 ? 44 HIS A CG   3  
ATOM 2378  N ND1  . HIS A 1 44 ? -5.512  -8.712  1.547   1.00 0.00 ? 44 HIS A ND1  3  
ATOM 2379  C CD2  . HIS A 1 44 ? -6.004  -7.285  3.148   1.00 0.00 ? 44 HIS A CD2  3  
ATOM 2380  C CE1  . HIS A 1 44 ? -6.515  -9.210  2.293   1.00 0.00 ? 44 HIS A CE1  3  
ATOM 2381  N NE2  . HIS A 1 44 ? -6.855  -8.379  3.283   1.00 0.00 ? 44 HIS A NE2  3  
ATOM 2382  H H    . HIS A 1 44 ? -2.637  -5.486  -0.253  1.00 0.00 ? 44 HIS A H    3  
ATOM 2383  H HA   . HIS A 1 44 ? -5.311  -6.360  -0.237  1.00 0.00 ? 44 HIS A HA   3  
ATOM 2384  H HB2  . HIS A 1 44 ? -3.299  -7.269  1.089   1.00 0.00 ? 44 HIS A HB2  3  
ATOM 2385  H HB3  . HIS A 1 44 ? -3.656  -5.998  2.258   1.00 0.00 ? 44 HIS A HB3  3  
ATOM 2386  H HD2  . HIS A 1 44 ? -6.002  -6.417  3.790   1.00 0.00 ? 44 HIS A HD2  3  
ATOM 2387  H HE1  . HIS A 1 44 ? -6.989  -10.164 2.112   1.00 0.00 ? 44 HIS A HE1  3  
ATOM 2388  H HE2  . HIS A 1 44 ? -7.552  -8.512  3.957   1.00 0.00 ? 44 HIS A HE2  3  
ATOM 2389  N N    . ARG A 1 45 ? -4.745  -3.491  1.217   1.00 0.00 ? 45 ARG A N    3  
ATOM 2390  C CA   . ARG A 1 45 ? -5.388  -2.315  1.791   1.00 0.00 ? 45 ARG A CA   3  
ATOM 2391  C C    . ARG A 1 45 ? -6.344  -1.682  0.783   1.00 0.00 ? 45 ARG A C    3  
ATOM 2392  O O    . ARG A 1 45 ? -7.525  -1.489  1.070   1.00 0.00 ? 45 ARG A O    3  
ATOM 2393  C CB   . ARG A 1 45 ? -4.329  -1.293  2.210   1.00 0.00 ? 45 ARG A CB   3  
ATOM 2394  C CG   . ARG A 1 45 ? -5.010  0.011   2.643   1.00 0.00 ? 45 ARG A CG   3  
ATOM 2395  C CD   . ARG A 1 45 ? -3.998  0.906   3.362   1.00 0.00 ? 45 ARG A CD   3  
ATOM 2396  N NE   . ARG A 1 45 ? -4.423  2.300   3.293   1.00 0.00 ? 45 ARG A NE   3  
ATOM 2397  C CZ   . ARG A 1 45 ? -5.365  2.773   4.103   1.00 0.00 ? 45 ARG A CZ   3  
ATOM 2398  N NH1  . ARG A 1 45 ? -5.926  1.986   4.981   1.00 0.00 ? 45 ARG A NH1  3  
ATOM 2399  N NH2  . ARG A 1 45 ? -5.728  4.023   4.022   1.00 0.00 ? 45 ARG A NH2  3  
ATOM 2400  H H    . ARG A 1 45 ? -3.788  -3.461  1.009   1.00 0.00 ? 45 ARG A H    3  
ATOM 2401  H HA   . ARG A 1 45 ? -5.950  -2.614  2.664   1.00 0.00 ? 45 ARG A HA   3  
ATOM 2402  H HB2  . ARG A 1 45 ? -3.753  -1.690  3.035   1.00 0.00 ? 45 ARG A HB2  3  
ATOM 2403  H HB3  . ARG A 1 45 ? -3.673  -1.094  1.377   1.00 0.00 ? 45 ARG A HB3  3  
ATOM 2404  H HG2  . ARG A 1 45 ? -5.390  0.523   1.770   1.00 0.00 ? 45 ARG A HG2  3  
ATOM 2405  H HG3  . ARG A 1 45 ? -5.827  -0.215  3.311   1.00 0.00 ? 45 ARG A HG3  3  
ATOM 2406  H HD2  . ARG A 1 45 ? -3.927  0.607   4.396   1.00 0.00 ? 45 ARG A HD2  3  
ATOM 2407  H HD3  . ARG A 1 45 ? -3.031  0.803   2.892   1.00 0.00 ? 45 ARG A HD3  3  
ATOM 2408  H HE   . ARG A 1 45 ? -4.007  2.899   2.639   1.00 0.00 ? 45 ARG A HE   3  
ATOM 2409  H HH11 . ARG A 1 45 ? -5.647  1.027   5.043   1.00 0.00 ? 45 ARG A HH11 3  
ATOM 2410  H HH12 . ARG A 1 45 ? -6.634  2.342   5.590   1.00 0.00 ? 45 ARG A HH12 3  
ATOM 2411  H HH21 . ARG A 1 45 ? -5.299  4.627   3.349   1.00 0.00 ? 45 ARG A HH21 3  
ATOM 2412  H HH22 . ARG A 1 45 ? -6.436  4.379   4.631   1.00 0.00 ? 45 ARG A HH22 3  
ATOM 2413  N N    . ARG A 1 46 ? -5.822  -1.360  -0.396  1.00 0.00 ? 46 ARG A N    3  
ATOM 2414  C CA   . ARG A 1 46 ? -6.638  -0.746  -1.438  1.00 0.00 ? 46 ARG A CA   3  
ATOM 2415  C C    . ARG A 1 46 ? -7.813  -1.647  -1.805  1.00 0.00 ? 46 ARG A C    3  
ATOM 2416  O O    . ARG A 1 46 ? -8.911  -1.167  -2.084  1.00 0.00 ? 46 ARG A O    3  
ATOM 2417  C CB   . ARG A 1 46 ? -5.784  -0.481  -2.682  1.00 0.00 ? 46 ARG A CB   3  
ATOM 2418  C CG   . ARG A 1 46 ? -6.641  0.194   -3.760  1.00 0.00 ? 46 ARG A CG   3  
ATOM 2419  C CD   . ARG A 1 46 ? -5.743  0.996   -4.704  1.00 0.00 ? 46 ARG A CD   3  
ATOM 2420  N NE   . ARG A 1 46 ? -4.493  0.283   -4.943  1.00 0.00 ? 46 ARG A NE   3  
ATOM 2421  C CZ   . ARG A 1 46 ? -4.391  -0.622  -5.913  1.00 0.00 ? 46 ARG A CZ   3  
ATOM 2422  N NH1  . ARG A 1 46 ? -5.421  -0.889  -6.669  1.00 0.00 ? 46 ARG A NH1  3  
ATOM 2423  N NH2  . ARG A 1 46 ? -3.260  -1.245  -6.107  1.00 0.00 ? 46 ARG A NH2  3  
ATOM 2424  H H    . ARG A 1 46 ? -4.873  -1.535  -0.568  1.00 0.00 ? 46 ARG A H    3  
ATOM 2425  H HA   . ARG A 1 46 ? -7.020  0.196   -1.073  1.00 0.00 ? 46 ARG A HA   3  
ATOM 2426  H HB2  . ARG A 1 46 ? -4.960  0.166   -2.417  1.00 0.00 ? 46 ARG A HB2  3  
ATOM 2427  H HB3  . ARG A 1 46 ? -5.403  -1.416  -3.061  1.00 0.00 ? 46 ARG A HB3  3  
ATOM 2428  H HG2  . ARG A 1 46 ? -7.170  -0.562  -4.323  1.00 0.00 ? 46 ARG A HG2  3  
ATOM 2429  H HG3  . ARG A 1 46 ? -7.354  0.859   -3.293  1.00 0.00 ? 46 ARG A HG3  3  
ATOM 2430  H HD2  . ARG A 1 46 ? -6.253  1.147   -5.644  1.00 0.00 ? 46 ARG A HD2  3  
ATOM 2431  H HD3  . ARG A 1 46 ? -5.528  1.958   -4.259  1.00 0.00 ? 46 ARG A HD3  3  
ATOM 2432  H HE   . ARG A 1 46 ? -3.715  0.475   -4.381  1.00 0.00 ? 46 ARG A HE   3  
ATOM 2433  H HH11 . ARG A 1 46 ? -6.287  -0.413  -6.520  1.00 0.00 ? 46 ARG A HH11 3  
ATOM 2434  H HH12 . ARG A 1 46 ? -5.343  -1.570  -7.397  1.00 0.00 ? 46 ARG A HH12 3  
ATOM 2435  H HH21 . ARG A 1 46 ? -2.472  -1.040  -5.528  1.00 0.00 ? 46 ARG A HH21 3  
ATOM 2436  H HH22 . ARG A 1 46 ? -3.183  -1.925  -6.836  1.00 0.00 ? 46 ARG A HH22 3  
ATOM 2437  N N    . LEU A 1 47 ? -7.575  -2.955  -1.799  1.00 0.00 ? 47 LEU A N    3  
ATOM 2438  C CA   . LEU A 1 47 ? -8.627  -3.910  -2.131  1.00 0.00 ? 47 LEU A CA   3  
ATOM 2439  C C    . LEU A 1 47 ? -9.657  -3.979  -1.008  1.00 0.00 ? 47 LEU A C    3  
ATOM 2440  O O    . LEU A 1 47 ? -10.857 -4.096  -1.259  1.00 0.00 ? 47 LEU A O    3  
ATOM 2441  C CB   . LEU A 1 47 ? -8.021  -5.301  -2.360  1.00 0.00 ? 47 LEU A CB   3  
ATOM 2442  C CG   . LEU A 1 47 ? -7.363  -5.363  -3.745  1.00 0.00 ? 47 LEU A CG   3  
ATOM 2443  C CD1  . LEU A 1 47 ? -6.272  -6.437  -3.746  1.00 0.00 ? 47 LEU A CD1  3  
ATOM 2444  C CD2  . LEU A 1 47 ? -8.416  -5.717  -4.804  1.00 0.00 ? 47 LEU A CD2  3  
ATOM 2445  H H    . LEU A 1 47 ? -6.682  -3.282  -1.567  1.00 0.00 ? 47 LEU A H    3  
ATOM 2446  H HA   . LEU A 1 47 ? -9.117  -3.588  -3.037  1.00 0.00 ? 47 LEU A HA   3  
ATOM 2447  H HB2  . LEU A 1 47 ? -7.277  -5.493  -1.598  1.00 0.00 ? 47 LEU A HB2  3  
ATOM 2448  H HB3  . LEU A 1 47 ? -8.799  -6.047  -2.296  1.00 0.00 ? 47 LEU A HB3  3  
ATOM 2449  H HG   . LEU A 1 47 ? -6.922  -4.405  -3.980  1.00 0.00 ? 47 LEU A HG   3  
ATOM 2450  H HD11 . LEU A 1 47 ? -6.660  -7.345  -3.309  1.00 0.00 ? 47 LEU A HD11 3  
ATOM 2451  H HD12 . LEU A 1 47 ? -5.427  -6.093  -3.170  1.00 0.00 ? 47 LEU A HD12 3  
ATOM 2452  H HD13 . LEU A 1 47 ? -5.961  -6.633  -4.762  1.00 0.00 ? 47 LEU A HD13 3  
ATOM 2453  H HD21 . LEU A 1 47 ? -8.897  -6.645  -4.537  1.00 0.00 ? 47 LEU A HD21 3  
ATOM 2454  H HD22 . LEU A 1 47 ? -7.935  -5.825  -5.765  1.00 0.00 ? 47 LEU A HD22 3  
ATOM 2455  H HD23 . LEU A 1 47 ? -9.154  -4.931  -4.857  1.00 0.00 ? 47 LEU A HD23 3  
ATOM 2456  N N    . LYS A 1 48 ? -9.181  -3.906  0.230   1.00 0.00 ? 48 LYS A N    3  
ATOM 2457  C CA   . LYS A 1 48 ? -10.068 -3.961  1.385   1.00 0.00 ? 48 LYS A CA   3  
ATOM 2458  C C    . LYS A 1 48 ? -11.042 -2.788  1.372   1.00 0.00 ? 48 LYS A C    3  
ATOM 2459  O O    . LYS A 1 48 ? -12.255 -2.976  1.460   1.00 0.00 ? 48 LYS A O    3  
ATOM 2460  C CB   . LYS A 1 48 ? -9.245  -3.933  2.677   1.00 0.00 ? 48 LYS A CB   3  
ATOM 2461  C CG   . LYS A 1 48 ? -10.178 -4.021  3.897   1.00 0.00 ? 48 LYS A CG   3  
ATOM 2462  C CD   . LYS A 1 48 ? -10.346 -2.632  4.527   1.00 0.00 ? 48 LYS A CD   3  
ATOM 2463  C CE   . LYS A 1 48 ? -11.220 -2.743  5.777   1.00 0.00 ? 48 LYS A CE   3  
ATOM 2464  N NZ   . LYS A 1 48 ? -12.499 -3.425  5.431   1.00 0.00 ? 48 LYS A NZ   3  
ATOM 2465  H H    . LYS A 1 48 ? -8.215  -3.814  0.368   1.00 0.00 ? 48 LYS A H    3  
ATOM 2466  H HA   . LYS A 1 48 ? -10.629 -4.883  1.351   1.00 0.00 ? 48 LYS A HA   3  
ATOM 2467  H HB2  . LYS A 1 48 ? -8.563  -4.772  2.683   1.00 0.00 ? 48 LYS A HB2  3  
ATOM 2468  H HB3  . LYS A 1 48 ? -8.678  -3.013  2.720   1.00 0.00 ? 48 LYS A HB3  3  
ATOM 2469  H HG2  . LYS A 1 48 ? -11.143 -4.394  3.590   1.00 0.00 ? 48 LYS A HG2  3  
ATOM 2470  H HG3  . LYS A 1 48 ? -9.750  -4.692  4.627   1.00 0.00 ? 48 LYS A HG3  3  
ATOM 2471  H HD2  . LYS A 1 48 ? -9.377  -2.241  4.798   1.00 0.00 ? 48 LYS A HD2  3  
ATOM 2472  H HD3  . LYS A 1 48 ? -10.818 -1.970  3.817   1.00 0.00 ? 48 LYS A HD3  3  
ATOM 2473  H HE2  . LYS A 1 48 ? -10.699 -3.318  6.531   1.00 0.00 ? 48 LYS A HE2  3  
ATOM 2474  H HE3  . LYS A 1 48 ? -11.429 -1.756  6.158   1.00 0.00 ? 48 LYS A HE3  3  
ATOM 2475  H HZ1  . LYS A 1 48 ? -12.689 -3.311  4.415   1.00 0.00 ? 48 LYS A HZ1  3  
ATOM 2476  H HZ2  . LYS A 1 48 ? -13.277 -3.001  5.976   1.00 0.00 ? 48 LYS A HZ2  3  
ATOM 2477  H HZ3  . LYS A 1 48 ? -12.426 -4.437  5.661   1.00 0.00 ? 48 LYS A HZ3  3  
ATOM 2478  N N    . VAL A 1 49 ? -10.506 -1.577  1.262   1.00 0.00 ? 49 VAL A N    3  
ATOM 2479  C CA   . VAL A 1 49 ? -11.342 -0.382  1.240   1.00 0.00 ? 49 VAL A CA   3  
ATOM 2480  C C    . VAL A 1 49 ? -12.192 -0.348  -0.026  1.00 0.00 ? 49 VAL A C    3  
ATOM 2481  O O    . VAL A 1 49 ? -13.363 0.033   0.011   1.00 0.00 ? 49 VAL A O    3  
ATOM 2482  C CB   . VAL A 1 49 ? -10.468 0.872   1.304   1.00 0.00 ? 49 VAL A CB   3  
ATOM 2483  C CG1  . VAL A 1 49 ? -9.664  0.868   2.605   1.00 0.00 ? 49 VAL A CG1  3  
ATOM 2484  C CG2  . VAL A 1 49 ? -9.507  0.884   0.113   1.00 0.00 ? 49 VAL A CG2  3  
ATOM 2485  H H    . VAL A 1 49 ? -9.531  -1.485  1.196   1.00 0.00 ? 49 VAL A H    3  
ATOM 2486  H HA   . VAL A 1 49 ? -11.994 -0.395  2.099   1.00 0.00 ? 49 VAL A HA   3  
ATOM 2487  H HB   . VAL A 1 49 ? -11.097 1.751   1.271   1.00 0.00 ? 49 VAL A HB   3  
ATOM 2488  H HG11 . VAL A 1 49 ? -9.026  1.738   2.637   1.00 0.00 ? 49 VAL A HG11 3  
ATOM 2489  H HG12 . VAL A 1 49 ? -9.058  -0.025  2.652   1.00 0.00 ? 49 VAL A HG12 3  
ATOM 2490  H HG13 . VAL A 1 49 ? -10.341 0.887   3.447   1.00 0.00 ? 49 VAL A HG13 3  
ATOM 2491  H HG21 . VAL A 1 49 ? -10.047 1.153   -0.784  1.00 0.00 ? 49 VAL A HG21 3  
ATOM 2492  H HG22 . VAL A 1 49 ? -9.074  -0.097  -0.010  1.00 0.00 ? 49 VAL A HG22 3  
ATOM 2493  H HG23 . VAL A 1 49 ? -8.723  1.605   0.289   1.00 0.00 ? 49 VAL A HG23 3  
ATOM 2494  N N    . TYR A 1 50 ? -11.598 -0.751  -1.145  1.00 0.00 ? 50 TYR A N    3  
ATOM 2495  C CA   . TYR A 1 50 ? -12.314 -0.764  -2.415  1.00 0.00 ? 50 TYR A CA   3  
ATOM 2496  C C    . TYR A 1 50 ? -13.595 -1.583  -2.297  1.00 0.00 ? 50 TYR A C    3  
ATOM 2497  O O    . TYR A 1 50 ? -14.672 -1.129  -2.683  1.00 0.00 ? 50 TYR A O    3  
ATOM 2498  C CB   . TYR A 1 50 ? -11.424 -1.354  -3.511  1.00 0.00 ? 50 TYR A CB   3  
ATOM 2499  C CG   . TYR A 1 50 ? -12.215 -1.488  -4.793  1.00 0.00 ? 50 TYR A CG   3  
ATOM 2500  C CD1  . TYR A 1 50 ? -12.721 -0.344  -5.424  1.00 0.00 ? 50 TYR A CD1  3  
ATOM 2501  C CD2  . TYR A 1 50 ? -12.444 -2.752  -5.349  1.00 0.00 ? 50 TYR A CD2  3  
ATOM 2502  C CE1  . TYR A 1 50 ? -13.453 -0.464  -6.610  1.00 0.00 ? 50 TYR A CE1  3  
ATOM 2503  C CE2  . TYR A 1 50 ? -13.176 -2.872  -6.537  1.00 0.00 ? 50 TYR A CE2  3  
ATOM 2504  C CZ   . TYR A 1 50 ? -13.680 -1.729  -7.166  1.00 0.00 ? 50 TYR A CZ   3  
ATOM 2505  O OH   . TYR A 1 50 ? -14.404 -1.848  -8.337  1.00 0.00 ? 50 TYR A OH   3  
ATOM 2506  H H    . TYR A 1 50 ? -10.664 -1.046  -1.116  1.00 0.00 ? 50 TYR A H    3  
ATOM 2507  H HA   . TYR A 1 50 ? -12.570 0.250   -2.682  1.00 0.00 ? 50 TYR A HA   3  
ATOM 2508  H HB2  . TYR A 1 50 ? -10.578 -0.704  -3.676  1.00 0.00 ? 50 TYR A HB2  3  
ATOM 2509  H HB3  . TYR A 1 50 ? -11.073 -2.328  -3.204  1.00 0.00 ? 50 TYR A HB3  3  
ATOM 2510  H HD1  . TYR A 1 50 ? -12.545 0.633   -4.995  1.00 0.00 ? 50 TYR A HD1  3  
ATOM 2511  H HD2  . TYR A 1 50 ? -12.054 -3.633  -4.864  1.00 0.00 ? 50 TYR A HD2  3  
ATOM 2512  H HE1  . TYR A 1 50 ? -13.842 0.418   -7.097  1.00 0.00 ? 50 TYR A HE1  3  
ATOM 2513  H HE2  . TYR A 1 50 ? -13.353 -3.847  -6.965  1.00 0.00 ? 50 TYR A HE2  3  
ATOM 2514  H HH   . TYR A 1 50 ? -14.177 -2.689  -8.741  1.00 0.00 ? 50 TYR A HH   3  
ATOM 2515  N N    . HIS A 1 51 ? -13.471 -2.793  -1.761  1.00 0.00 ? 51 HIS A N    3  
ATOM 2516  C CA   . HIS A 1 51 ? -14.627 -3.667  -1.595  1.00 0.00 ? 51 HIS A CA   3  
ATOM 2517  C C    . HIS A 1 51 ? -15.548 -3.133  -0.502  1.00 0.00 ? 51 HIS A C    3  
ATOM 2518  O O    . HIS A 1 51 ? -16.770 -3.246  -0.598  1.00 0.00 ? 51 HIS A O    3  
ATOM 2519  C CB   . HIS A 1 51 ? -14.166 -5.081  -1.233  1.00 0.00 ? 51 HIS A CB   3  
ATOM 2520  C CG   . HIS A 1 51 ? -13.602 -5.756  -2.454  1.00 0.00 ? 51 HIS A CG   3  
ATOM 2521  N ND1  . HIS A 1 51 ? -12.277 -6.152  -2.534  1.00 0.00 ? 51 HIS A ND1  3  
ATOM 2522  C CD2  . HIS A 1 51 ? -14.172 -6.110  -3.652  1.00 0.00 ? 51 HIS A CD2  3  
ATOM 2523  C CE1  . HIS A 1 51 ? -12.093 -6.716  -3.742  1.00 0.00 ? 51 HIS A CE1  3  
ATOM 2524  N NE2  . HIS A 1 51 ? -13.217 -6.716  -4.462  1.00 0.00 ? 51 HIS A NE2  3  
ATOM 2525  H H    . HIS A 1 51 ? -12.587 -3.102  -1.469  1.00 0.00 ? 51 HIS A H    3  
ATOM 2526  H HA   . HIS A 1 51 ? -15.173 -3.705  -2.525  1.00 0.00 ? 51 HIS A HA   3  
ATOM 2527  H HB2  . HIS A 1 51 ? -13.405 -5.026  -0.469  1.00 0.00 ? 51 HIS A HB2  3  
ATOM 2528  H HB3  . HIS A 1 51 ? -15.007 -5.651  -0.865  1.00 0.00 ? 51 HIS A HB3  3  
ATOM 2529  H HD2  . HIS A 1 51 ? -15.204 -5.944  -3.923  1.00 0.00 ? 51 HIS A HD2  3  
ATOM 2530  H HE1  . HIS A 1 51 ? -11.153 -7.121  -4.085  1.00 0.00 ? 51 HIS A HE1  3  
ATOM 2531  H HE2  . HIS A 1 51 ? -13.344 -7.068  -5.369  1.00 0.00 ? 51 HIS A HE2  3  
ATOM 2532  N N    . ALA A 1 52 ? -14.953 -2.552  0.534   1.00 0.00 ? 52 ALA A N    3  
ATOM 2533  C CA   . ALA A 1 52 ? -15.731 -2.004  1.639   1.00 0.00 ? 52 ALA A CA   3  
ATOM 2534  C C    . ALA A 1 52 ? -16.647 -0.888  1.148   1.00 0.00 ? 52 ALA A C    3  
ATOM 2535  O O    . ALA A 1 52 ? -17.866 -0.963  1.292   1.00 0.00 ? 52 ALA A O    3  
ATOM 2536  C CB   . ALA A 1 52 ? -14.794 -1.460  2.719   1.00 0.00 ? 52 ALA A CB   3  
ATOM 2537  H H    . ALA A 1 52 ? -13.975 -2.489  0.557   1.00 0.00 ? 52 ALA A H    3  
ATOM 2538  H HA   . ALA A 1 52 ? -16.336 -2.790  2.067   1.00 0.00 ? 52 ALA A HA   3  
ATOM 2539  H HB1  . ALA A 1 52 ? -14.320 -0.557  2.364   1.00 0.00 ? 52 ALA A HB1  3  
ATOM 2540  H HB2  . ALA A 1 52 ? -14.037 -2.198  2.944   1.00 0.00 ? 52 ALA A HB2  3  
ATOM 2541  H HB3  . ALA A 1 52 ? -15.360 -1.242  3.612   1.00 0.00 ? 52 ALA A HB3  3  
ATOM 2542  N N    . TRP A 1 53 ? -16.048 0.149   0.570   1.00 0.00 ? 53 TRP A N    3  
ATOM 2543  C CA   . TRP A 1 53 ? -16.821 1.278   0.061   1.00 0.00 ? 53 TRP A CA   3  
ATOM 2544  C C    . TRP A 1 53 ? -17.758 0.824   -1.055  1.00 0.00 ? 53 TRP A C    3  
ATOM 2545  O O    . TRP A 1 53 ? -18.975 0.969   -0.952  1.00 0.00 ? 53 TRP A O    3  
ATOM 2546  C CB   . TRP A 1 53 ? -15.875 2.360   -0.471  1.00 0.00 ? 53 TRP A CB   3  
ATOM 2547  C CG   . TRP A 1 53 ? -15.327 3.160   0.669   1.00 0.00 ? 53 TRP A CG   3  
ATOM 2548  C CD1  . TRP A 1 53 ? -15.110 2.686   1.918   1.00 0.00 ? 53 TRP A CD1  3  
ATOM 2549  C CD2  . TRP A 1 53 ? -14.926 4.559   0.686   1.00 0.00 ? 53 TRP A CD2  3  
ATOM 2550  N NE1  . TRP A 1 53 ? -14.600 3.707   2.700   1.00 0.00 ? 53 TRP A NE1  3  
ATOM 2551  C CE2  . TRP A 1 53 ? -14.468 4.882   1.985   1.00 0.00 ? 53 TRP A CE2  3  
ATOM 2552  C CE3  . TRP A 1 53 ? -14.914 5.572   -0.290  1.00 0.00 ? 53 TRP A CE3  3  
ATOM 2553  C CZ2  . TRP A 1 53 ? -14.014 6.162   2.305   1.00 0.00 ? 53 TRP A CZ2  3  
ATOM 2554  C CZ3  . TRP A 1 53 ? -14.458 6.862   0.028   1.00 0.00 ? 53 TRP A CZ3  3  
ATOM 2555  C CH2  . TRP A 1 53 ? -14.008 7.156   1.324   1.00 0.00 ? 53 TRP A CH2  3  
ATOM 2556  H H    . TRP A 1 53 ? -15.073 0.156   0.484   1.00 0.00 ? 53 TRP A H    3  
ATOM 2557  H HA   . TRP A 1 53 ? -17.410 1.692   0.866   1.00 0.00 ? 53 TRP A HA   3  
ATOM 2558  H HB2  . TRP A 1 53 ? -15.061 1.895   -1.007  1.00 0.00 ? 53 TRP A HB2  3  
ATOM 2559  H HB3  . TRP A 1 53 ? -16.416 3.014   -1.140  1.00 0.00 ? 53 TRP A HB3  3  
ATOM 2560  H HD1  . TRP A 1 53 ? -15.303 1.677   2.251   1.00 0.00 ? 53 TRP A HD1  3  
ATOM 2561  H HE1  . TRP A 1 53 ? -14.356 3.627   3.647   1.00 0.00 ? 53 TRP A HE1  3  
ATOM 2562  H HE3  . TRP A 1 53 ? -15.256 5.357   -1.291  1.00 0.00 ? 53 TRP A HE3  3  
ATOM 2563  H HZ2  . TRP A 1 53 ? -13.670 6.383   3.306   1.00 0.00 ? 53 TRP A HZ2  3  
ATOM 2564  H HZ3  . TRP A 1 53 ? -14.452 7.632   -0.730  1.00 0.00 ? 53 TRP A HZ3  3  
ATOM 2565  H HH2  . TRP A 1 53 ? -13.659 8.149   1.563   1.00 0.00 ? 53 TRP A HH2  3  
ATOM 2566  N N    . LYS A 1 54 ? -17.180 0.275   -2.118  1.00 0.00 ? 54 LYS A N    3  
ATOM 2567  C CA   . LYS A 1 54 ? -17.970 -0.197  -3.250  1.00 0.00 ? 54 LYS A CA   3  
ATOM 2568  C C    . LYS A 1 54 ? -18.713 0.964   -3.904  1.00 0.00 ? 54 LYS A C    3  
ATOM 2569  O O    . LYS A 1 54 ? -18.391 1.369   -5.020  1.00 0.00 ? 54 LYS A O    3  
ATOM 2570  C CB   . LYS A 1 54 ? -18.975 -1.254  -2.785  1.00 0.00 ? 54 LYS A CB   3  
ATOM 2571  C CG   . LYS A 1 54 ? -19.496 -2.032  -3.994  1.00 0.00 ? 54 LYS A CG   3  
ATOM 2572  C CD   . LYS A 1 54 ? -20.616 -2.976  -3.553  1.00 0.00 ? 54 LYS A CD   3  
ATOM 2573  C CE   . LYS A 1 54 ? -21.225 -3.659  -4.779  1.00 0.00 ? 54 LYS A CE   3  
ATOM 2574  N NZ   . LYS A 1 54 ? -21.969 -4.877  -4.350  1.00 0.00 ? 54 LYS A NZ   3  
ATOM 2575  H H    . LYS A 1 54 ? -16.203 0.186   -2.143  1.00 0.00 ? 54 LYS A H    3  
ATOM 2576  H HA   . LYS A 1 54 ? -17.308 -0.643  -3.977  1.00 0.00 ? 54 LYS A HA   3  
ATOM 2577  H HB2  . LYS A 1 54 ? -18.490 -1.934  -2.100  1.00 0.00 ? 54 LYS A HB2  3  
ATOM 2578  H HB3  . LYS A 1 54 ? -19.802 -0.771  -2.286  1.00 0.00 ? 54 LYS A HB3  3  
ATOM 2579  H HG2  . LYS A 1 54 ? -19.878 -1.339  -4.730  1.00 0.00 ? 54 LYS A HG2  3  
ATOM 2580  H HG3  . LYS A 1 54 ? -18.692 -2.608  -4.427  1.00 0.00 ? 54 LYS A HG3  3  
ATOM 2581  H HD2  . LYS A 1 54 ? -20.212 -3.725  -2.886  1.00 0.00 ? 54 LYS A HD2  3  
ATOM 2582  H HD3  . LYS A 1 54 ? -21.381 -2.412  -3.040  1.00 0.00 ? 54 LYS A HD3  3  
ATOM 2583  H HE2  . LYS A 1 54 ? -21.904 -2.978  -5.271  1.00 0.00 ? 54 LYS A HE2  3  
ATOM 2584  H HE3  . LYS A 1 54 ? -20.439 -3.941  -5.464  1.00 0.00 ? 54 LYS A HE3  3  
ATOM 2585  H HZ1  . LYS A 1 54 ? -22.960 -4.805  -4.656  1.00 0.00 ? 54 LYS A HZ1  3  
ATOM 2586  H HZ2  . LYS A 1 54 ? -21.934 -4.959  -3.314  1.00 0.00 ? 54 LYS A HZ2  3  
ATOM 2587  H HZ3  . LYS A 1 54 ? -21.532 -5.719  -4.780  1.00 0.00 ? 54 LYS A HZ3  3  
ATOM 2588  N N    . SER A 1 55 ? -19.708 1.493   -3.199  1.00 0.00 ? 55 SER A N    3  
ATOM 2589  C CA   . SER A 1 55 ? -20.489 2.608   -3.721  1.00 0.00 ? 55 SER A CA   3  
ATOM 2590  C C    . SER A 1 55 ? -19.617 3.852   -3.862  1.00 0.00 ? 55 SER A C    3  
ATOM 2591  O O    . SER A 1 55 ? -18.507 3.786   -4.391  1.00 0.00 ? 55 SER A O    3  
ATOM 2592  C CB   . SER A 1 55 ? -21.661 2.907   -2.784  1.00 0.00 ? 55 SER A CB   3  
ATOM 2593  O OG   . SER A 1 55 ? -22.562 3.798   -3.427  1.00 0.00 ? 55 SER A OG   3  
ATOM 2594  H H    . SER A 1 55 ? -19.919 1.129   -2.315  1.00 0.00 ? 55 SER A H    3  
ATOM 2595  H HA   . SER A 1 55 ? -20.878 2.341   -4.690  1.00 0.00 ? 55 SER A HA   3  
ATOM 2596  H HB2  . SER A 1 55 ? -22.177 1.991   -2.546  1.00 0.00 ? 55 SER A HB2  3  
ATOM 2597  H HB3  . SER A 1 55 ? -21.286 3.354   -1.871  1.00 0.00 ? 55 SER A HB3  3  
ATOM 2598  H HG   . SER A 1 55 ? -22.104 4.197   -4.170  1.00 0.00 ? 55 SER A HG   3  
ATOM 2599  N N    . LYS A 1 56 ? -20.124 4.986   -3.386  1.00 0.00 ? 56 LYS A N    3  
ATOM 2600  C CA   . LYS A 1 56 ? -19.380 6.238   -3.468  1.00 0.00 ? 56 LYS A CA   3  
ATOM 2601  C C    . LYS A 1 56 ? -18.772 6.411   -4.856  1.00 0.00 ? 56 LYS A C    3  
ATOM 2602  O O    . LYS A 1 56 ? -17.717 7.027   -5.009  1.00 0.00 ? 56 LYS A O    3  
ATOM 2603  C CB   . LYS A 1 56 ? -18.268 6.253   -2.416  1.00 0.00 ? 56 LYS A CB   3  
ATOM 2604  C CG   . LYS A 1 56 ? -18.883 6.288   -1.010  1.00 0.00 ? 56 LYS A CG   3  
ATOM 2605  C CD   . LYS A 1 56 ? -19.141 7.742   -0.585  1.00 0.00 ? 56 LYS A CD   3  
ATOM 2606  C CE   . LYS A 1 56 ? -17.882 8.325   0.062   1.00 0.00 ? 56 LYS A CE   3  
ATOM 2607  N NZ   . LYS A 1 56 ? -17.528 7.524   1.267   1.00 0.00 ? 56 LYS A NZ   3  
ATOM 2608  H H    . LYS A 1 56 ? -21.012 4.979   -2.975  1.00 0.00 ? 56 LYS A H    3  
ATOM 2609  H HA   . LYS A 1 56 ? -20.054 7.058   -3.276  1.00 0.00 ? 56 LYS A HA   3  
ATOM 2610  H HB2  . LYS A 1 56 ? -17.662 5.364   -2.522  1.00 0.00 ? 56 LYS A HB2  3  
ATOM 2611  H HB3  . LYS A 1 56 ? -17.648 7.126   -2.560  1.00 0.00 ? 56 LYS A HB3  3  
ATOM 2612  H HG2  . LYS A 1 56 ? -19.816 5.744   -1.011  1.00 0.00 ? 56 LYS A HG2  3  
ATOM 2613  H HG3  . LYS A 1 56 ? -18.202 5.828   -0.308  1.00 0.00 ? 56 LYS A HG3  3  
ATOM 2614  H HD2  . LYS A 1 56 ? -19.405 8.331   -1.453  1.00 0.00 ? 56 LYS A HD2  3  
ATOM 2615  H HD3  . LYS A 1 56 ? -19.953 7.769   0.126   1.00 0.00 ? 56 LYS A HD3  3  
ATOM 2616  H HE2  . LYS A 1 56 ? -17.066 8.293   -0.644  1.00 0.00 ? 56 LYS A HE2  3  
ATOM 2617  H HE3  . LYS A 1 56 ? -18.068 9.349   0.351   1.00 0.00 ? 56 LYS A HE3  3  
ATOM 2618  H HZ1  . LYS A 1 56 ? -18.384 7.077   1.651   1.00 0.00 ? 56 LYS A HZ1  3  
ATOM 2619  H HZ2  . LYS A 1 56 ? -17.113 8.148   1.987   1.00 0.00 ? 56 LYS A HZ2  3  
ATOM 2620  H HZ3  . LYS A 1 56 ? -16.840 6.789   1.004   1.00 0.00 ? 56 LYS A HZ3  3  
ATOM 2621  N N    . ASN A 1 57 ? -19.445 5.863   -5.864  1.00 0.00 ? 57 ASN A N    3  
ATOM 2622  C CA   . ASN A 1 57 ? -18.960 5.962   -7.236  1.00 0.00 ? 57 ASN A CA   3  
ATOM 2623  C C    . ASN A 1 57 ? -20.091 5.691   -8.223  1.00 0.00 ? 57 ASN A C    3  
ATOM 2624  O O    . ASN A 1 57 ? -21.237 5.476   -7.826  1.00 0.00 ? 57 ASN A O    3  
ATOM 2625  C CB   . ASN A 1 57 ? -17.828 4.959   -7.463  1.00 0.00 ? 57 ASN A CB   3  
ATOM 2626  C CG   . ASN A 1 57 ? -17.118 5.265   -8.777  1.00 0.00 ? 57 ASN A CG   3  
ATOM 2627  O OD1  . ASN A 1 57 ? -17.435 4.671   -9.809  1.00 0.00 ? 57 ASN A OD1  3  
ATOM 2628  N ND2  . ASN A 1 57 ? -16.168 6.161   -8.803  1.00 0.00 ? 57 ASN A ND2  3  
ATOM 2629  H H    . ASN A 1 57 ? -20.279 5.384   -5.680  1.00 0.00 ? 57 ASN A H    3  
ATOM 2630  H HA   . ASN A 1 57 ? -18.581 6.960   -7.402  1.00 0.00 ? 57 ASN A HA   3  
ATOM 2631  H HB2  . ASN A 1 57 ? -17.121 5.026   -6.650  1.00 0.00 ? 57 ASN A HB2  3  
ATOM 2632  H HB3  . ASN A 1 57 ? -18.237 3.960   -7.502  1.00 0.00 ? 57 ASN A HB3  3  
ATOM 2633  H HD21 . ASN A 1 57 ? -15.917 6.632   -7.981  1.00 0.00 ? 57 ASN A HD21 3  
ATOM 2634  H HD22 . ASN A 1 57 ? -15.708 6.362   -9.644  1.00 0.00 ? 57 ASN A HD22 3  
ATOM 2635  N N    . LYS A 1 58 ? -19.761 5.702   -9.510  1.00 0.00 ? 58 LYS A N    3  
ATOM 2636  C CA   . LYS A 1 58 ? -20.757 5.455   -10.546 1.00 0.00 ? 58 LYS A CA   3  
ATOM 2637  C C    . LYS A 1 58 ? -21.183 3.991   -10.539 1.00 0.00 ? 58 LYS A C    3  
ATOM 2638  O O    . LYS A 1 58 ? -22.012 3.570   -11.345 1.00 0.00 ? 58 LYS A O    3  
ATOM 2639  C CB   . LYS A 1 58 ? -20.179 5.820   -11.919 1.00 0.00 ? 58 LYS A CB   3  
ATOM 2640  C CG   . LYS A 1 58 ? -21.317 6.139   -12.893 1.00 0.00 ? 58 LYS A CG   3  
ATOM 2641  C CD   . LYS A 1 58 ? -20.789 6.094   -14.329 1.00 0.00 ? 58 LYS A CD   3  
ATOM 2642  C CE   . LYS A 1 58 ? -21.787 6.779   -15.265 1.00 0.00 ? 58 LYS A CE   3  
ATOM 2643  N NZ   . LYS A 1 58 ? -21.688 8.256   -15.102 1.00 0.00 ? 58 LYS A NZ   3  
ATOM 2644  H H    . LYS A 1 58 ? -18.833 5.880   -9.767  1.00 0.00 ? 58 LYS A H    3  
ATOM 2645  H HA   . LYS A 1 58 ? -21.621 6.074   -10.355 1.00 0.00 ? 58 LYS A HA   3  
ATOM 2646  H HB2  . LYS A 1 58 ? -19.538 6.684   -11.819 1.00 0.00 ? 58 LYS A HB2  3  
ATOM 2647  H HB3  . LYS A 1 58 ? -19.603 4.989   -12.300 1.00 0.00 ? 58 LYS A HB3  3  
ATOM 2648  H HG2  . LYS A 1 58 ? -22.106 5.411   -12.776 1.00 0.00 ? 58 LYS A HG2  3  
ATOM 2649  H HG3  . LYS A 1 58 ? -21.703 7.126   -12.685 1.00 0.00 ? 58 LYS A HG3  3  
ATOM 2650  H HD2  . LYS A 1 58 ? -19.838 6.606   -14.379 1.00 0.00 ? 58 LYS A HD2  3  
ATOM 2651  H HD3  . LYS A 1 58 ? -20.660 5.066   -14.633 1.00 0.00 ? 58 LYS A HD3  3  
ATOM 2652  H HE2  . LYS A 1 58 ? -21.564 6.512   -16.287 1.00 0.00 ? 58 LYS A HE2  3  
ATOM 2653  H HE3  . LYS A 1 58 ? -22.788 6.456   -15.020 1.00 0.00 ? 58 LYS A HE3  3  
ATOM 2654  H HZ1  . LYS A 1 58 ? -20.975 8.631   -15.760 1.00 0.00 ? 58 LYS A HZ1  3  
ATOM 2655  H HZ2  . LYS A 1 58 ? -21.407 8.480   -14.127 1.00 0.00 ? 58 LYS A HZ2  3  
ATOM 2656  H HZ3  . LYS A 1 58 ? -22.611 8.690   -15.306 1.00 0.00 ? 58 LYS A HZ3  3  
ATOM 2657  N N    . LYS A 1 59 ? -20.609 3.217   -9.622  1.00 0.00 ? 59 LYS A N    3  
ATOM 2658  C CA   . LYS A 1 59 ? -20.934 1.798   -9.516  1.00 0.00 ? 59 LYS A CA   3  
ATOM 2659  C C    . LYS A 1 59 ? -22.094 1.582   -8.549  1.00 0.00 ? 59 LYS A C    3  
ATOM 2660  O O    . LYS A 1 59 ? -21.968 0.844   -7.571  1.00 0.00 ? 59 LYS A O    3  
ATOM 2661  C CB   . LYS A 1 59 ? -19.710 1.017   -9.029  1.00 0.00 ? 59 LYS A CB   3  
ATOM 2662  C CG   . LYS A 1 59 ? -18.541 1.220   -10.003 1.00 0.00 ? 59 LYS A CG   3  
ATOM 2663  C CD   . LYS A 1 59 ? -18.660 0.237   -11.171 1.00 0.00 ? 59 LYS A CD   3  
ATOM 2664  C CE   . LYS A 1 59 ? -17.437 0.376   -12.081 1.00 0.00 ? 59 LYS A CE   3  
ATOM 2665  N NZ   . LYS A 1 59 ? -17.468 -0.692  -13.119 1.00 0.00 ? 59 LYS A NZ   3  
ATOM 2666  H H    . LYS A 1 59 ? -19.954 3.608   -9.007  1.00 0.00 ? 59 LYS A H    3  
ATOM 2667  H HA   . LYS A 1 59 ? -21.218 1.428   -10.490 1.00 0.00 ? 59 LYS A HA   3  
ATOM 2668  H HB2  . LYS A 1 59 ? -19.428 1.372   -8.048  1.00 0.00 ? 59 LYS A HB2  3  
ATOM 2669  H HB3  . LYS A 1 59 ? -19.953 -0.033  -8.973  1.00 0.00 ? 59 LYS A HB3  3  
ATOM 2670  H HG2  . LYS A 1 59 ? -18.559 2.233   -10.380 1.00 0.00 ? 59 LYS A HG2  3  
ATOM 2671  H HG3  . LYS A 1 59 ? -17.610 1.048   -9.484  1.00 0.00 ? 59 LYS A HG3  3  
ATOM 2672  H HD2  . LYS A 1 59 ? -18.711 -0.773  -10.789 1.00 0.00 ? 59 LYS A HD2  3  
ATOM 2673  H HD3  . LYS A 1 59 ? -19.553 0.454   -11.737 1.00 0.00 ? 59 LYS A HD3  3  
ATOM 2674  H HE2  . LYS A 1 59 ? -17.453 1.344   -12.558 1.00 0.00 ? 59 LYS A HE2  3  
ATOM 2675  H HE3  . LYS A 1 59 ? -16.538 0.280   -11.490 1.00 0.00 ? 59 LYS A HE3  3  
ATOM 2676  H HZ1  . LYS A 1 59 ? -18.022 -0.365  -13.936 1.00 0.00 ? 59 LYS A HZ1  3  
ATOM 2677  H HZ2  . LYS A 1 59 ? -17.906 -1.547  -12.726 1.00 0.00 ? 59 LYS A HZ2  3  
ATOM 2678  H HZ3  . LYS A 1 59 ? -16.496 -0.907  -13.422 1.00 0.00 ? 59 LYS A HZ3  3  
ATOM 2679  N N    . ARG A 1 60 ? -23.222 2.229   -8.830  1.00 0.00 ? 60 ARG A N    3  
ATOM 2680  C CA   . ARG A 1 60 ? -24.404 2.102   -7.980  1.00 0.00 ? 60 ARG A CA   3  
ATOM 2681  C C    . ARG A 1 60 ? -25.535 1.415   -8.740  1.00 0.00 ? 60 ARG A C    3  
ATOM 2682  O O    . ARG A 1 60 ? -25.740 0.234   -8.517  1.00 0.00 ? 60 ARG A O    3  
ATOM 2683  C CB   . ARG A 1 60 ? -24.866 3.487   -7.519  1.00 0.00 ? 60 ARG A CB   3  
ATOM 2684  C CG   . ARG A 1 60 ? -23.923 4.006   -6.430  1.00 0.00 ? 60 ARG A CG   3  
ATOM 2685  C CD   . ARG A 1 60 ? -24.466 5.323   -5.870  1.00 0.00 ? 60 ARG A CD   3  
ATOM 2686  N NE   . ARG A 1 60 ? -25.595 5.068   -4.983  1.00 0.00 ? 60 ARG A NE   3  
ATOM 2687  C CZ   . ARG A 1 60 ? -26.230 6.064   -4.375  1.00 0.00 ? 60 ARG A CZ   3  
ATOM 2688  N NH1  . ARG A 1 60 ? -25.847 7.296   -4.566  1.00 0.00 ? 60 ARG A NH1  3  
ATOM 2689  N NH2  . ARG A 1 60 ? -27.238 5.810   -3.586  1.00 0.00 ? 60 ARG A NH2  3  
ATOM 2690  O OXT  . ARG A 1 60 ? -26.179 2.081   -9.535  1.00 0.00 ? 60 ARG A OXT  3  
ATOM 2691  H H    . ARG A 1 60 ? -23.262 2.802   -9.625  1.00 0.00 ? 60 ARG A H    3  
ATOM 2692  H HA   . ARG A 1 60 ? -24.158 1.508   -7.112  1.00 0.00 ? 60 ARG A HA   3  
ATOM 2693  H HB2  . ARG A 1 60 ? -24.856 4.167   -8.357  1.00 0.00 ? 60 ARG A HB2  3  
ATOM 2694  H HB3  . ARG A 1 60 ? -25.868 3.419   -7.121  1.00 0.00 ? 60 ARG A HB3  3  
ATOM 2695  H HG2  . ARG A 1 60 ? -23.855 3.277   -5.635  1.00 0.00 ? 60 ARG A HG2  3  
ATOM 2696  H HG3  . ARG A 1 60 ? -22.945 4.172   -6.851  1.00 0.00 ? 60 ARG A HG3  3  
ATOM 2697  H HD2  . ARG A 1 60 ? -23.687 5.824   -5.318  1.00 0.00 ? 60 ARG A HD2  3  
ATOM 2698  H HD3  . ARG A 1 60 ? -24.785 5.954   -6.688  1.00 0.00 ? 60 ARG A HD3  3  
ATOM 2699  H HE   . ARG A 1 60 ? -25.890 4.146   -4.834  1.00 0.00 ? 60 ARG A HE   3  
ATOM 2700  H HH11 . ARG A 1 60 ? -25.074 7.491   -5.171  1.00 0.00 ? 60 ARG A HH11 3  
ATOM 2701  H HH12 . ARG A 1 60 ? -26.324 8.045   -4.109  1.00 0.00 ? 60 ARG A HH12 3  
ATOM 2702  H HH21 . ARG A 1 60 ? -27.532 4.865   -3.438  1.00 0.00 ? 60 ARG A HH21 3  
ATOM 2703  H HH22 . ARG A 1 60 ? -27.715 6.559   -3.126  1.00 0.00 ? 60 ARG A HH22 3  
ATOM 2704  N N    . GLY A 1 9  ? 8.924   10.322  14.300  1.00 0.00 ? 9  GLY A N    4  
ATOM 2705  C CA   . GLY A 1 9  ? 10.137  9.510   14.264  1.00 0.00 ? 9  GLY A CA   4  
ATOM 2706  C C    . GLY A 1 9  ? 10.196  8.679   12.987  1.00 0.00 ? 9  GLY A C    4  
ATOM 2707  O O    . GLY A 1 9  ? 9.204   8.074   12.582  1.00 0.00 ? 9  GLY A O    4  
ATOM 2708  H H    . GLY A 1 9  ? 8.145   10.048  13.772  1.00 0.00 ? 9  GLY A H    4  
ATOM 2709  H HA2  . GLY A 1 9  ? 11.000  10.159  14.308  1.00 0.00 ? 9  GLY A HA2  4  
ATOM 2710  H HA3  . GLY A 1 9  ? 10.145  8.848   15.117  1.00 0.00 ? 9  GLY A HA3  4  
ATOM 2711  N N    . THR A 1 10 ? 11.366  8.657   12.358  1.00 0.00 ? 10 THR A N    4  
ATOM 2712  C CA   . THR A 1 10 ? 11.542  7.898   11.125  1.00 0.00 ? 10 THR A CA   4  
ATOM 2713  C C    . THR A 1 10 ? 11.279  6.413   11.370  1.00 0.00 ? 10 THR A C    4  
ATOM 2714  O O    . THR A 1 10 ? 11.946  5.782   12.191  1.00 0.00 ? 10 THR A O    4  
ATOM 2715  C CB   . THR A 1 10 ? 12.970  8.097   10.590  1.00 0.00 ? 10 THR A CB   4  
ATOM 2716  O OG1  . THR A 1 10 ? 13.697  8.918   11.492  1.00 0.00 ? 10 THR A OG1  4  
ATOM 2717  C CG2  . THR A 1 10 ? 12.923  8.770   9.214   1.00 0.00 ? 10 THR A CG2  4  
ATOM 2718  H H    . THR A 1 10 ? 12.121  9.159   12.725  1.00 0.00 ? 10 THR A H    4  
ATOM 2719  H HA   . THR A 1 10 ? 10.838  8.258   10.391  1.00 0.00 ? 10 THR A HA   4  
ATOM 2720  H HB   . THR A 1 10 ? 13.463  7.141   10.499  1.00 0.00 ? 10 THR A HB   4  
ATOM 2721  H HG1  . THR A 1 10 ? 13.438  8.680   12.385  1.00 0.00 ? 10 THR A HG1  4  
ATOM 2722  H HG21 . THR A 1 10 ? 13.928  8.983   8.883   1.00 0.00 ? 10 THR A HG21 4  
ATOM 2723  H HG22 . THR A 1 10 ? 12.364  9.692   9.284   1.00 0.00 ? 10 THR A HG22 4  
ATOM 2724  H HG23 . THR A 1 10 ? 12.442  8.111   8.507   1.00 0.00 ? 10 THR A HG23 4  
ATOM 2725  N N    . LYS A 1 11 ? 10.302  5.865   10.655  1.00 0.00 ? 11 LYS A N    4  
ATOM 2726  C CA   . LYS A 1 11 ? 9.956   4.456   10.801  1.00 0.00 ? 11 LYS A CA   4  
ATOM 2727  C C    . LYS A 1 11 ? 10.794  3.597   9.858   1.00 0.00 ? 11 LYS A C    4  
ATOM 2728  O O    . LYS A 1 11 ? 11.793  4.057   9.306   1.00 0.00 ? 11 LYS A O    4  
ATOM 2729  C CB   . LYS A 1 11 ? 8.469   4.249   10.495  1.00 0.00 ? 11 LYS A CB   4  
ATOM 2730  C CG   . LYS A 1 11 ? 7.619   5.062   11.481  1.00 0.00 ? 11 LYS A CG   4  
ATOM 2731  C CD   . LYS A 1 11 ? 7.366   4.244   12.756  1.00 0.00 ? 11 LYS A CD   4  
ATOM 2732  C CE   . LYS A 1 11 ? 6.061   3.454   12.616  1.00 0.00 ? 11 LYS A CE   4  
ATOM 2733  N NZ   . LYS A 1 11 ? 5.939   2.930   11.226  1.00 0.00 ? 11 LYS A NZ   4  
ATOM 2734  H H    . LYS A 1 11 ? 9.805   6.418   10.016  1.00 0.00 ? 11 LYS A H    4  
ATOM 2735  H HA   . LYS A 1 11 ? 10.148  4.149   11.818  1.00 0.00 ? 11 LYS A HA   4  
ATOM 2736  H HB2  . LYS A 1 11 ? 8.263   4.577   9.485   1.00 0.00 ? 11 LYS A HB2  4  
ATOM 2737  H HB3  . LYS A 1 11 ? 8.225   3.202   10.588  1.00 0.00 ? 11 LYS A HB3  4  
ATOM 2738  H HG2  . LYS A 1 11 ? 8.141   5.974   11.737  1.00 0.00 ? 11 LYS A HG2  4  
ATOM 2739  H HG3  . LYS A 1 11 ? 6.674   5.309   11.020  1.00 0.00 ? 11 LYS A HG3  4  
ATOM 2740  H HD2  . LYS A 1 11 ? 8.185   3.556   12.915  1.00 0.00 ? 11 LYS A HD2  4  
ATOM 2741  H HD3  . LYS A 1 11 ? 7.290   4.910   13.602  1.00 0.00 ? 11 LYS A HD3  4  
ATOM 2742  H HE2  . LYS A 1 11 ? 6.063   2.628   13.313  1.00 0.00 ? 11 LYS A HE2  4  
ATOM 2743  H HE3  . LYS A 1 11 ? 5.223   4.102   12.831  1.00 0.00 ? 11 LYS A HE3  4  
ATOM 2744  H HZ1  . LYS A 1 11 ? 5.040   2.421   11.124  1.00 0.00 ? 11 LYS A HZ1  4  
ATOM 2745  H HZ2  . LYS A 1 11 ? 6.727   2.281   11.030  1.00 0.00 ? 11 LYS A HZ2  4  
ATOM 2746  H HZ3  . LYS A 1 11 ? 5.968   3.723   10.554  1.00 0.00 ? 11 LYS A HZ3  4  
ATOM 2747  N N    . LYS A 1 12 ? 10.380  2.347   9.680   1.00 0.00 ? 12 LYS A N    4  
ATOM 2748  C CA   . LYS A 1 12 ? 11.099  1.430   8.803   1.00 0.00 ? 12 LYS A CA   4  
ATOM 2749  C C    . LYS A 1 12 ? 10.831  1.767   7.340   1.00 0.00 ? 12 LYS A C    4  
ATOM 2750  O O    . LYS A 1 12 ? 11.755  2.065   6.582   1.00 0.00 ? 12 LYS A O    4  
ATOM 2751  C CB   . LYS A 1 12 ? 10.661  -0.012  9.084   1.00 0.00 ? 12 LYS A CB   4  
ATOM 2752  C CG   . LYS A 1 12 ? 11.098  -0.423  10.497  1.00 0.00 ? 12 LYS A CG   4  
ATOM 2753  C CD   . LYS A 1 12 ? 12.510  -1.025  10.455  1.00 0.00 ? 12 LYS A CD   4  
ATOM 2754  C CE   . LYS A 1 12 ? 12.448  -2.483  9.984   1.00 0.00 ? 12 LYS A CE   4  
ATOM 2755  N NZ   . LYS A 1 12 ? 13.692  -3.191  10.402  1.00 0.00 ? 12 LYS A NZ   4  
ATOM 2756  H H    . LYS A 1 12 ? 9.576   2.035   10.147  1.00 0.00 ? 12 LYS A H    4  
ATOM 2757  H HA   . LYS A 1 12 ? 12.157  1.517   8.995   1.00 0.00 ? 12 LYS A HA   4  
ATOM 2758  H HB2  . LYS A 1 12 ? 9.585   -0.079  9.006   1.00 0.00 ? 12 LYS A HB2  4  
ATOM 2759  H HB3  . LYS A 1 12 ? 11.115  -0.671  8.360   1.00 0.00 ? 12 LYS A HB3  4  
ATOM 2760  H HG2  . LYS A 1 12 ? 11.100  0.447   11.140  1.00 0.00 ? 12 LYS A HG2  4  
ATOM 2761  H HG3  . LYS A 1 12 ? 10.407  -1.154  10.888  1.00 0.00 ? 12 LYS A HG3  4  
ATOM 2762  H HD2  . LYS A 1 12 ? 13.125  -0.454  9.776   1.00 0.00 ? 12 LYS A HD2  4  
ATOM 2763  H HD3  . LYS A 1 12 ? 12.943  -0.989  11.445  1.00 0.00 ? 12 LYS A HD3  4  
ATOM 2764  H HE2  . LYS A 1 12 ? 11.593  -2.973  10.423  1.00 0.00 ? 12 LYS A HE2  4  
ATOM 2765  H HE3  . LYS A 1 12 ? 12.365  -2.511  8.907   1.00 0.00 ? 12 LYS A HE3  4  
ATOM 2766  H HZ1  . LYS A 1 12 ? 13.942  -3.902  9.686   1.00 0.00 ? 12 LYS A HZ1  4  
ATOM 2767  H HZ2  . LYS A 1 12 ? 13.533  -3.661  11.314  1.00 0.00 ? 12 LYS A HZ2  4  
ATOM 2768  H HZ3  . LYS A 1 12 ? 14.466  -2.503  10.494  1.00 0.00 ? 12 LYS A HZ3  4  
ATOM 2769  N N    . TYR A 1 13 ? 9.561   1.715   6.950   1.00 0.00 ? 13 TYR A N    4  
ATOM 2770  C CA   . TYR A 1 13 ? 9.172   2.015   5.573   1.00 0.00 ? 13 TYR A CA   4  
ATOM 2771  C C    . TYR A 1 13 ? 8.073   3.073   5.550   1.00 0.00 ? 13 TYR A C    4  
ATOM 2772  O O    . TYR A 1 13 ? 7.225   3.122   6.441   1.00 0.00 ? 13 TYR A O    4  
ATOM 2773  C CB   . TYR A 1 13 ? 8.676   0.737   4.881   1.00 0.00 ? 13 TYR A CB   4  
ATOM 2774  C CG   . TYR A 1 13 ? 9.817   0.088   4.129   1.00 0.00 ? 13 TYR A CG   4  
ATOM 2775  C CD1  . TYR A 1 13 ? 10.903  -0.450  4.829   1.00 0.00 ? 13 TYR A CD1  4  
ATOM 2776  C CD2  . TYR A 1 13 ? 9.789   0.031   2.730   1.00 0.00 ? 13 TYR A CD2  4  
ATOM 2777  C CE1  . TYR A 1 13 ? 11.959  -1.046  4.131   1.00 0.00 ? 13 TYR A CE1  4  
ATOM 2778  C CE2  . TYR A 1 13 ? 10.845  -0.565  2.033   1.00 0.00 ? 13 TYR A CE2  4  
ATOM 2779  C CZ   . TYR A 1 13 ? 11.931  -1.104  2.733   1.00 0.00 ? 13 TYR A CZ   4  
ATOM 2780  O OH   . TYR A 1 13 ? 12.973  -1.692  2.045   1.00 0.00 ? 13 TYR A OH   4  
ATOM 2781  H H    . TYR A 1 13 ? 8.869   1.469   7.600   1.00 0.00 ? 13 TYR A H    4  
ATOM 2782  H HA   . TYR A 1 13 ? 10.029  2.395   5.036   1.00 0.00 ? 13 TYR A HA   4  
ATOM 2783  H HB2  . TYR A 1 13 ? 8.302   0.049   5.627   1.00 0.00 ? 13 TYR A HB2  4  
ATOM 2784  H HB3  . TYR A 1 13 ? 7.882   0.981   4.190   1.00 0.00 ? 13 TYR A HB3  4  
ATOM 2785  H HD1  . TYR A 1 13 ? 10.924  -0.408  5.908   1.00 0.00 ? 13 TYR A HD1  4  
ATOM 2786  H HD2  . TYR A 1 13 ? 8.952   0.447   2.189   1.00 0.00 ? 13 TYR A HD2  4  
ATOM 2787  H HE1  . TYR A 1 13 ? 12.797  -1.464  4.672   1.00 0.00 ? 13 TYR A HE1  4  
ATOM 2788  H HE2  . TYR A 1 13 ? 10.823  -0.610  0.955   1.00 0.00 ? 13 TYR A HE2  4  
ATOM 2789  H HH   . TYR A 1 13 ? 12.943  -1.379  1.138   1.00 0.00 ? 13 TYR A HH   4  
ATOM 2790  N N    . ASP A 1 14 ? 8.096   3.920   4.524   1.00 0.00 ? 14 ASP A N    4  
ATOM 2791  C CA   . ASP A 1 14 ? 7.099   4.977   4.389   1.00 0.00 ? 14 ASP A CA   4  
ATOM 2792  C C    . ASP A 1 14 ? 6.598   5.058   2.951   1.00 0.00 ? 14 ASP A C    4  
ATOM 2793  O O    . ASP A 1 14 ? 7.340   5.440   2.046   1.00 0.00 ? 14 ASP A O    4  
ATOM 2794  C CB   . ASP A 1 14 ? 7.706   6.321   4.795   1.00 0.00 ? 14 ASP A CB   4  
ATOM 2795  C CG   . ASP A 1 14 ? 6.604   7.361   4.966   1.00 0.00 ? 14 ASP A CG   4  
ATOM 2796  O OD1  . ASP A 1 14 ? 5.557   7.189   4.363   1.00 0.00 ? 14 ASP A OD1  4  
ATOM 2797  O OD2  . ASP A 1 14 ? 6.823   8.313   5.696   1.00 0.00 ? 14 ASP A OD2  4  
ATOM 2798  H H    . ASP A 1 14 ? 8.798   3.831   3.845   1.00 0.00 ? 14 ASP A H    4  
ATOM 2799  H HA   . ASP A 1 14 ? 6.263   4.762   5.039   1.00 0.00 ? 14 ASP A HA   4  
ATOM 2800  H HB2  . ASP A 1 14 ? 8.238   6.207   5.728   1.00 0.00 ? 14 ASP A HB2  4  
ATOM 2801  H HB3  . ASP A 1 14 ? 8.392   6.651   4.029   1.00 0.00 ? 14 ASP A HB3  4  
ATOM 2802  N N    . LEU A 1 15 ? 5.334   4.698   2.751   1.00 0.00 ? 15 LEU A N    4  
ATOM 2803  C CA   . LEU A 1 15 ? 4.733   4.732   1.420   1.00 0.00 ? 15 LEU A CA   4  
ATOM 2804  C C    . LEU A 1 15 ? 3.444   5.545   1.448   1.00 0.00 ? 15 LEU A C    4  
ATOM 2805  O O    . LEU A 1 15 ? 2.365   5.022   1.175   1.00 0.00 ? 15 LEU A O    4  
ATOM 2806  C CB   . LEU A 1 15 ? 4.425   3.308   0.940   1.00 0.00 ? 15 LEU A CB   4  
ATOM 2807  C CG   . LEU A 1 15 ? 5.640   2.399   1.159   1.00 0.00 ? 15 LEU A CG   4  
ATOM 2808  C CD1  . LEU A 1 15 ? 5.208   0.938   1.032   1.00 0.00 ? 15 LEU A CD1  4  
ATOM 2809  C CD2  . LEU A 1 15 ? 6.711   2.701   0.107   1.00 0.00 ? 15 LEU A CD2  4  
ATOM 2810  H H    . LEU A 1 15 ? 4.792   4.405   3.512   1.00 0.00 ? 15 LEU A H    4  
ATOM 2811  H HA   . LEU A 1 15 ? 5.424   5.192   0.729   1.00 0.00 ? 15 LEU A HA   4  
ATOM 2812  H HB2  . LEU A 1 15 ? 3.582   2.920   1.494   1.00 0.00 ? 15 LEU A HB2  4  
ATOM 2813  H HB3  . LEU A 1 15 ? 4.180   3.331   -0.112  1.00 0.00 ? 15 LEU A HB3  4  
ATOM 2814  H HG   . LEU A 1 15 ? 6.044   2.569   2.146   1.00 0.00 ? 15 LEU A HG   4  
ATOM 2815  H HD11 . LEU A 1 15 ? 4.531   0.692   1.834   1.00 0.00 ? 15 LEU A HD11 4  
ATOM 2816  H HD12 . LEU A 1 15 ? 6.079   0.300   1.086   1.00 0.00 ? 15 LEU A HD12 4  
ATOM 2817  H HD13 . LEU A 1 15 ? 4.714   0.790   0.082   1.00 0.00 ? 15 LEU A HD13 4  
ATOM 2818  H HD21 . LEU A 1 15 ? 7.486   1.949   0.157   1.00 0.00 ? 15 LEU A HD21 4  
ATOM 2819  H HD22 . LEU A 1 15 ? 7.142   3.672   0.298   1.00 0.00 ? 15 LEU A HD22 4  
ATOM 2820  H HD23 . LEU A 1 15 ? 6.265   2.691   -0.876  1.00 0.00 ? 15 LEU A HD23 4  
ATOM 2821  N N    . SER A 1 16 ? 3.567   6.829   1.787   1.00 0.00 ? 16 SER A N    4  
ATOM 2822  C CA   . SER A 1 16 ? 2.403   7.712   1.852   1.00 0.00 ? 16 SER A CA   4  
ATOM 2823  C C    . SER A 1 16 ? 1.400   7.361   0.758   1.00 0.00 ? 16 SER A C    4  
ATOM 2824  O O    . SER A 1 16 ? 0.218   7.148   1.031   1.00 0.00 ? 16 SER A O    4  
ATOM 2825  C CB   . SER A 1 16 ? 2.846   9.166   1.695   1.00 0.00 ? 16 SER A CB   4  
ATOM 2826  O OG   . SER A 1 16 ? 1.779   9.925   1.138   1.00 0.00 ? 16 SER A OG   4  
ATOM 2827  H H    . SER A 1 16 ? 4.454   7.187   1.997   1.00 0.00 ? 16 SER A H    4  
ATOM 2828  H HA   . SER A 1 16 ? 1.929   7.593   2.814   1.00 0.00 ? 16 SER A HA   4  
ATOM 2829  H HB2  . SER A 1 16 ? 3.104   9.574   2.658   1.00 0.00 ? 16 SER A HB2  4  
ATOM 2830  H HB3  . SER A 1 16 ? 3.710   9.210   1.045   1.00 0.00 ? 16 SER A HB3  4  
ATOM 2831  H HG   . SER A 1 16 ? 1.214   10.215  1.858   1.00 0.00 ? 16 SER A HG   4  
ATOM 2832  N N    . LYS A 1 17 ? 1.882   7.294   -0.477  1.00 0.00 ? 17 LYS A N    4  
ATOM 2833  C CA   . LYS A 1 17 ? 1.027   6.955   -1.604  1.00 0.00 ? 17 LYS A CA   4  
ATOM 2834  C C    . LYS A 1 17 ? 1.881   6.577   -2.807  1.00 0.00 ? 17 LYS A C    4  
ATOM 2835  O O    . LYS A 1 17 ? 2.786   7.316   -3.195  1.00 0.00 ? 17 LYS A O    4  
ATOM 2836  C CB   . LYS A 1 17 ? 0.128   8.146   -1.956  1.00 0.00 ? 17 LYS A CB   4  
ATOM 2837  C CG   . LYS A 1 17 ? -0.686  7.836   -3.218  1.00 0.00 ? 17 LYS A CG   4  
ATOM 2838  C CD   . LYS A 1 17 ? -1.466  6.529   -3.028  1.00 0.00 ? 17 LYS A CD   4  
ATOM 2839  C CE   . LYS A 1 17 ? -2.666  6.505   -3.977  1.00 0.00 ? 17 LYS A CE   4  
ATOM 2840  N NZ   . LYS A 1 17 ? -3.432  5.242   -3.773  1.00 0.00 ? 17 LYS A NZ   4  
ATOM 2841  H H    . LYS A 1 17 ? 2.834   7.463   -0.631  1.00 0.00 ? 17 LYS A H    4  
ATOM 2842  H HA   . LYS A 1 17 ? 0.408   6.113   -1.332  1.00 0.00 ? 17 LYS A HA   4  
ATOM 2843  H HB2  . LYS A 1 17 ? -0.545  8.340   -1.133  1.00 0.00 ? 17 LYS A HB2  4  
ATOM 2844  H HB3  . LYS A 1 17 ? 0.741   9.017   -2.132  1.00 0.00 ? 17 LYS A HB3  4  
ATOM 2845  H HG2  . LYS A 1 17 ? -1.378  8.645   -3.403  1.00 0.00 ? 17 LYS A HG2  4  
ATOM 2846  H HG3  . LYS A 1 17 ? -0.020  7.736   -4.062  1.00 0.00 ? 17 LYS A HG3  4  
ATOM 2847  H HD2  . LYS A 1 17 ? -0.820  5.690   -3.245  1.00 0.00 ? 17 LYS A HD2  4  
ATOM 2848  H HD3  . LYS A 1 17 ? -1.814  6.462   -2.009  1.00 0.00 ? 17 LYS A HD3  4  
ATOM 2849  H HE2  . LYS A 1 17 ? -3.307  7.350   -3.769  1.00 0.00 ? 17 LYS A HE2  4  
ATOM 2850  H HE3  . LYS A 1 17 ? -2.320  6.555   -4.998  1.00 0.00 ? 17 LYS A HE3  4  
ATOM 2851  H HZ1  . LYS A 1 17 ? -4.404  5.364   -4.121  1.00 0.00 ? 17 LYS A HZ1  4  
ATOM 2852  H HZ2  . LYS A 1 17 ? -3.455  5.009   -2.761  1.00 0.00 ? 17 LYS A HZ2  4  
ATOM 2853  H HZ3  . LYS A 1 17 ? -2.969  4.470   -4.297  1.00 0.00 ? 17 LYS A HZ3  4  
ATOM 2854  N N    . TRP A 1 18 ? 1.588   5.420   -3.392  1.00 0.00 ? 18 TRP A N    4  
ATOM 2855  C CA   . TRP A 1 18 ? 2.335   4.938   -4.551  1.00 0.00 ? 18 TRP A CA   4  
ATOM 2856  C C    . TRP A 1 18 ? 1.387   4.726   -5.730  1.00 0.00 ? 18 TRP A C    4  
ATOM 2857  O O    . TRP A 1 18 ? 0.168   4.679   -5.555  1.00 0.00 ? 18 TRP A O    4  
ATOM 2858  C CB   . TRP A 1 18 ? 3.025   3.609   -4.202  1.00 0.00 ? 18 TRP A CB   4  
ATOM 2859  C CG   . TRP A 1 18 ? 4.420   3.849   -3.705  1.00 0.00 ? 18 TRP A CG   4  
ATOM 2860  C CD1  . TRP A 1 18 ? 4.806   4.868   -2.902  1.00 0.00 ? 18 TRP A CD1  4  
ATOM 2861  C CD2  . TRP A 1 18 ? 5.619   3.059   -3.960  1.00 0.00 ? 18 TRP A CD2  4  
ATOM 2862  N NE1  . TRP A 1 18 ? 6.161   4.756   -2.654  1.00 0.00 ? 18 TRP A NE1  4  
ATOM 2863  C CE2  . TRP A 1 18 ? 6.708   3.658   -3.284  1.00 0.00 ? 18 TRP A CE2  4  
ATOM 2864  C CE3  . TRP A 1 18 ? 5.864   1.894   -4.708  1.00 0.00 ? 18 TRP A CE3  4  
ATOM 2865  C CZ2  . TRP A 1 18 ? 7.994   3.119   -3.347  1.00 0.00 ? 18 TRP A CZ2  4  
ATOM 2866  C CZ3  . TRP A 1 18 ? 7.156   1.349   -4.772  1.00 0.00 ? 18 TRP A CZ3  4  
ATOM 2867  C CH2  . TRP A 1 18 ? 8.219   1.960   -4.094  1.00 0.00 ? 18 TRP A CH2  4  
ATOM 2868  H H    . TRP A 1 18 ? 0.855   4.876   -3.034  1.00 0.00 ? 18 TRP A H    4  
ATOM 2869  H HA   . TRP A 1 18 ? 3.084   5.665   -4.826  1.00 0.00 ? 18 TRP A HA   4  
ATOM 2870  H HB2  . TRP A 1 18 ? 2.458   3.109   -3.432  1.00 0.00 ? 18 TRP A HB2  4  
ATOM 2871  H HB3  . TRP A 1 18 ? 3.063   2.982   -5.081  1.00 0.00 ? 18 TRP A HB3  4  
ATOM 2872  H HD1  . TRP A 1 18 ? 4.164   5.641   -2.518  1.00 0.00 ? 18 TRP A HD1  4  
ATOM 2873  H HE1  . TRP A 1 18 ? 6.688   5.373   -2.102  1.00 0.00 ? 18 TRP A HE1  4  
ATOM 2874  H HE3  . TRP A 1 18 ? 5.054   1.414   -5.233  1.00 0.00 ? 18 TRP A HE3  4  
ATOM 2875  H HZ2  . TRP A 1 18 ? 8.808   3.592   -2.822  1.00 0.00 ? 18 TRP A HZ2  4  
ATOM 2876  H HZ3  . TRP A 1 18 ? 7.332   0.456   -5.349  1.00 0.00 ? 18 TRP A HZ3  4  
ATOM 2877  H HH2  . TRP A 1 18 ? 9.210   1.537   -4.149  1.00 0.00 ? 18 TRP A HH2  4  
ATOM 2878  N N    . LYS A 1 19 ? 1.950   4.592   -6.928  1.00 0.00 ? 19 LYS A N    4  
ATOM 2879  C CA   . LYS A 1 19 ? 1.139   4.381   -8.123  1.00 0.00 ? 19 LYS A CA   4  
ATOM 2880  C C    . LYS A 1 19 ? 1.124   2.902   -8.502  1.00 0.00 ? 19 LYS A C    4  
ATOM 2881  O O    . LYS A 1 19 ? 1.958   2.124   -8.039  1.00 0.00 ? 19 LYS A O    4  
ATOM 2882  C CB   . LYS A 1 19 ? 1.691   5.209   -9.288  1.00 0.00 ? 19 LYS A CB   4  
ATOM 2883  C CG   . LYS A 1 19 ? 2.117   6.588   -8.780  1.00 0.00 ? 19 LYS A CG   4  
ATOM 2884  C CD   . LYS A 1 19 ? 0.927   7.276   -8.107  1.00 0.00 ? 19 LYS A CD   4  
ATOM 2885  C CE   . LYS A 1 19 ? 1.238   8.761   -7.910  1.00 0.00 ? 19 LYS A CE   4  
ATOM 2886  N NZ   . LYS A 1 19 ? 2.566   8.908   -7.251  1.00 0.00 ? 19 LYS A NZ   4  
ATOM 2887  H H    . LYS A 1 19 ? 2.925   4.634   -7.008  1.00 0.00 ? 19 LYS A H    4  
ATOM 2888  H HA   . LYS A 1 19 ? 0.126   4.700   -7.923  1.00 0.00 ? 19 LYS A HA   4  
ATOM 2889  H HB2  . LYS A 1 19 ? 2.543   4.704   -9.718  1.00 0.00 ? 19 LYS A HB2  4  
ATOM 2890  H HB3  . LYS A 1 19 ? 0.925   5.326   -10.039 1.00 0.00 ? 19 LYS A HB3  4  
ATOM 2891  H HG2  . LYS A 1 19 ? 2.921   6.477   -8.066  1.00 0.00 ? 19 LYS A HG2  4  
ATOM 2892  H HG3  . LYS A 1 19 ? 2.453   7.190   -9.610  1.00 0.00 ? 19 LYS A HG3  4  
ATOM 2893  H HD2  . LYS A 1 19 ? 0.050   7.171   -8.729  1.00 0.00 ? 19 LYS A HD2  4  
ATOM 2894  H HD3  . LYS A 1 19 ? 0.743   6.819   -7.146  1.00 0.00 ? 19 LYS A HD3  4  
ATOM 2895  H HE2  . LYS A 1 19 ? 1.256   9.255   -8.870  1.00 0.00 ? 19 LYS A HE2  4  
ATOM 2896  H HE3  . LYS A 1 19 ? 0.477   9.210   -7.289  1.00 0.00 ? 19 LYS A HE3  4  
ATOM 2897  H HZ1  . LYS A 1 19 ? 2.806   8.028   -6.752  1.00 0.00 ? 19 LYS A HZ1  4  
ATOM 2898  H HZ2  . LYS A 1 19 ? 2.530   9.691   -6.569  1.00 0.00 ? 19 LYS A HZ2  4  
ATOM 2899  H HZ3  . LYS A 1 19 ? 3.291   9.106   -7.971  1.00 0.00 ? 19 LYS A HZ3  4  
ATOM 2900  N N    . TYR A 1 20 ? 0.168   2.520   -9.343  1.00 0.00 ? 20 TYR A N    4  
ATOM 2901  C CA   . TYR A 1 20 ? 0.054   1.130   -9.772  1.00 0.00 ? 20 TYR A CA   4  
ATOM 2902  C C    . TYR A 1 20 ? 1.268   0.717   -10.597 1.00 0.00 ? 20 TYR A C    4  
ATOM 2903  O O    . TYR A 1 20 ? 1.767   -0.403  -10.473 1.00 0.00 ? 20 TYR A O    4  
ATOM 2904  C CB   . TYR A 1 20 ? -1.216  0.945   -10.607 1.00 0.00 ? 20 TYR A CB   4  
ATOM 2905  C CG   . TYR A 1 20 ? -1.377  -0.512  -10.967 1.00 0.00 ? 20 TYR A CG   4  
ATOM 2906  C CD1  . TYR A 1 20 ? -0.736  -1.028  -12.100 1.00 0.00 ? 20 TYR A CD1  4  
ATOM 2907  C CD2  . TYR A 1 20 ? -2.167  -1.348  -10.168 1.00 0.00 ? 20 TYR A CD2  4  
ATOM 2908  C CE1  . TYR A 1 20 ? -0.885  -2.380  -12.434 1.00 0.00 ? 20 TYR A CE1  4  
ATOM 2909  C CE2  . TYR A 1 20 ? -2.316  -2.699  -10.503 1.00 0.00 ? 20 TYR A CE2  4  
ATOM 2910  C CZ   . TYR A 1 20 ? -1.675  -3.214  -11.635 1.00 0.00 ? 20 TYR A CZ   4  
ATOM 2911  O OH   . TYR A 1 20 ? -1.821  -4.547  -11.965 1.00 0.00 ? 20 TYR A OH   4  
ATOM 2912  H H    . TYR A 1 20 ? -0.473  3.181   -9.677  1.00 0.00 ? 20 TYR A H    4  
ATOM 2913  H HA   . TYR A 1 20 ? -0.011  0.497   -8.900  1.00 0.00 ? 20 TYR A HA   4  
ATOM 2914  H HB2  . TYR A 1 20 ? -2.073  1.272   -10.036 1.00 0.00 ? 20 TYR A HB2  4  
ATOM 2915  H HB3  . TYR A 1 20 ? -1.140  1.533   -11.510 1.00 0.00 ? 20 TYR A HB3  4  
ATOM 2916  H HD1  . TYR A 1 20 ? -0.126  -0.383  -12.716 1.00 0.00 ? 20 TYR A HD1  4  
ATOM 2917  H HD2  . TYR A 1 20 ? -2.661  -0.949  -9.294  1.00 0.00 ? 20 TYR A HD2  4  
ATOM 2918  H HE1  . TYR A 1 20 ? -0.390  -2.777  -13.308 1.00 0.00 ? 20 TYR A HE1  4  
ATOM 2919  H HE2  . TYR A 1 20 ? -2.926  -3.343  -9.886  1.00 0.00 ? 20 TYR A HE2  4  
ATOM 2920  H HH   . TYR A 1 20 ? -2.363  -4.599  -12.756 1.00 0.00 ? 20 TYR A HH   4  
ATOM 2921  N N    . ALA A 1 21 ? 1.736   1.629   -11.442 1.00 0.00 ? 21 ALA A N    4  
ATOM 2922  C CA   . ALA A 1 21 ? 2.890   1.354   -12.293 1.00 0.00 ? 21 ALA A CA   4  
ATOM 2923  C C    . ALA A 1 21 ? 4.120   1.011   -11.458 1.00 0.00 ? 21 ALA A C    4  
ATOM 2924  O O    . ALA A 1 21 ? 4.709   -0.059  -11.615 1.00 0.00 ? 21 ALA A O    4  
ATOM 2925  C CB   . ALA A 1 21 ? 3.191   2.570   -13.169 1.00 0.00 ? 21 ALA A CB   4  
ATOM 2926  H H    . ALA A 1 21 ? 1.295   2.502   -11.499 1.00 0.00 ? 21 ALA A H    4  
ATOM 2927  H HA   . ALA A 1 21 ? 2.658   0.515   -12.933 1.00 0.00 ? 21 ALA A HA   4  
ATOM 2928  H HB1  . ALA A 1 21 ? 2.428   2.665   -13.929 1.00 0.00 ? 21 ALA A HB1  4  
ATOM 2929  H HB2  . ALA A 1 21 ? 4.154   2.444   -13.642 1.00 0.00 ? 21 ALA A HB2  4  
ATOM 2930  H HB3  . ALA A 1 21 ? 3.205   3.460   -12.559 1.00 0.00 ? 21 ALA A HB3  4  
ATOM 2931  N N    . GLU A 1 22 ? 4.511   1.927   -10.575 1.00 0.00 ? 22 GLU A N    4  
ATOM 2932  C CA   . GLU A 1 22 ? 5.681   1.707   -9.733  1.00 0.00 ? 22 GLU A CA   4  
ATOM 2933  C C    . GLU A 1 22 ? 5.467   0.514   -8.806  1.00 0.00 ? 22 GLU A C    4  
ATOM 2934  O O    . GLU A 1 22 ? 6.398   -0.244  -8.536  1.00 0.00 ? 22 GLU A O    4  
ATOM 2935  C CB   . GLU A 1 22 ? 5.977   2.958   -8.905  1.00 0.00 ? 22 GLU A CB   4  
ATOM 2936  C CG   . GLU A 1 22 ? 4.788   3.265   -7.995  1.00 0.00 ? 22 GLU A CG   4  
ATOM 2937  C CD   . GLU A 1 22 ? 4.967   4.634   -7.348  1.00 0.00 ? 22 GLU A CD   4  
ATOM 2938  O OE1  . GLU A 1 22 ? 5.210   5.584   -8.075  1.00 0.00 ? 22 GLU A OE1  4  
ATOM 2939  O OE2  . GLU A 1 22 ? 4.859   4.714   -6.135  1.00 0.00 ? 22 GLU A OE2  4  
ATOM 2940  H H    . GLU A 1 22 ? 4.009   2.765   -10.494 1.00 0.00 ? 22 GLU A H    4  
ATOM 2941  H HA   . GLU A 1 22 ? 6.531   1.505   -10.368 1.00 0.00 ? 22 GLU A HA   4  
ATOM 2942  H HB2  . GLU A 1 22 ? 6.858   2.790   -8.302  1.00 0.00 ? 22 GLU A HB2  4  
ATOM 2943  H HB3  . GLU A 1 22 ? 6.146   3.795   -9.565  1.00 0.00 ? 22 GLU A HB3  4  
ATOM 2944  H HG2  . GLU A 1 22 ? 3.881   3.260   -8.579  1.00 0.00 ? 22 GLU A HG2  4  
ATOM 2945  H HG3  . GLU A 1 22 ? 4.721   2.512   -7.225  1.00 0.00 ? 22 GLU A HG3  4  
ATOM 2946  N N    . LEU A 1 23 ? 4.241   0.351   -8.319  1.00 0.00 ? 23 LEU A N    4  
ATOM 2947  C CA   . LEU A 1 23 ? 3.937   -0.760  -7.423  1.00 0.00 ? 23 LEU A CA   4  
ATOM 2948  C C    . LEU A 1 23 ? 4.294   -2.087  -8.085  1.00 0.00 ? 23 LEU A C    4  
ATOM 2949  O O    . LEU A 1 23 ? 5.070   -2.873  -7.543  1.00 0.00 ? 23 LEU A O    4  
ATOM 2950  C CB   . LEU A 1 23 ? 2.443   -0.752  -7.064  1.00 0.00 ? 23 LEU A CB   4  
ATOM 2951  C CG   . LEU A 1 23 ? 2.227   -0.077  -5.703  1.00 0.00 ? 23 LEU A CG   4  
ATOM 2952  C CD1  . LEU A 1 23 ? 0.783   0.423   -5.601  1.00 0.00 ? 23 LEU A CD1  4  
ATOM 2953  C CD2  . LEU A 1 23 ? 2.491   -1.085  -4.580  1.00 0.00 ? 23 LEU A CD2  4  
ATOM 2954  H H    . LEU A 1 23 ? 3.533   0.983   -8.564  1.00 0.00 ? 23 LEU A H    4  
ATOM 2955  H HA   . LEU A 1 23 ? 4.519   -0.652  -6.521  1.00 0.00 ? 23 LEU A HA   4  
ATOM 2956  H HB2  . LEU A 1 23 ? 1.899   -0.209  -7.823  1.00 0.00 ? 23 LEU A HB2  4  
ATOM 2957  H HB3  . LEU A 1 23 ? 2.074   -1.767  -7.022  1.00 0.00 ? 23 LEU A HB3  4  
ATOM 2958  H HG   . LEU A 1 23 ? 2.901   0.758   -5.606  1.00 0.00 ? 23 LEU A HG   4  
ATOM 2959  H HD11 . LEU A 1 23 ? 0.653   1.281   -6.245  1.00 0.00 ? 23 LEU A HD11 4  
ATOM 2960  H HD12 . LEU A 1 23 ? 0.570   0.703   -4.580  1.00 0.00 ? 23 LEU A HD12 4  
ATOM 2961  H HD13 . LEU A 1 23 ? 0.108   -0.362  -5.909  1.00 0.00 ? 23 LEU A HD13 4  
ATOM 2962  H HD21 . LEU A 1 23 ? 2.280   -0.623  -3.626  1.00 0.00 ? 23 LEU A HD21 4  
ATOM 2963  H HD22 . LEU A 1 23 ? 3.525   -1.393  -4.607  1.00 0.00 ? 23 LEU A HD22 4  
ATOM 2964  H HD23 . LEU A 1 23 ? 1.854   -1.946  -4.711  1.00 0.00 ? 23 LEU A HD23 4  
ATOM 2965  N N    . ARG A 1 24 ? 3.726   -2.328  -9.262  1.00 0.00 ? 24 ARG A N    4  
ATOM 2966  C CA   . ARG A 1 24 ? 3.989   -3.564  -9.988  1.00 0.00 ? 24 ARG A CA   4  
ATOM 2967  C C    . ARG A 1 24 ? 5.469   -3.684  -10.333 1.00 0.00 ? 24 ARG A C    4  
ATOM 2968  O O    . ARG A 1 24 ? 6.098   -4.711  -10.074 1.00 0.00 ? 24 ARG A O    4  
ATOM 2969  C CB   . ARG A 1 24 ? 3.162   -3.600  -11.274 1.00 0.00 ? 24 ARG A CB   4  
ATOM 2970  C CG   . ARG A 1 24 ? 3.192   -5.011  -11.864 1.00 0.00 ? 24 ARG A CG   4  
ATOM 2971  C CD   . ARG A 1 24 ? 2.635   -4.981  -13.288 1.00 0.00 ? 24 ARG A CD   4  
ATOM 2972  N NE   . ARG A 1 24 ? 2.598   -6.330  -13.844 1.00 0.00 ? 24 ARG A NE   4  
ATOM 2973  C CZ   . ARG A 1 24 ? 2.453   -6.530  -15.151 1.00 0.00 ? 24 ARG A CZ   4  
ATOM 2974  N NH1  . ARG A 1 24 ? 2.339   -5.511  -15.957 1.00 0.00 ? 24 ARG A NH1  4  
ATOM 2975  N NH2  . ARG A 1 24 ? 2.422   -7.745  -15.624 1.00 0.00 ? 24 ARG A NH2  4  
ATOM 2976  H H    . ARG A 1 24 ? 3.116   -1.662  -9.648  1.00 0.00 ? 24 ARG A H    4  
ATOM 2977  H HA   . ARG A 1 24 ? 3.705   -4.402  -9.368  1.00 0.00 ? 24 ARG A HA   4  
ATOM 2978  H HB2  . ARG A 1 24 ? 2.140   -3.324  -11.052 1.00 0.00 ? 24 ARG A HB2  4  
ATOM 2979  H HB3  . ARG A 1 24 ? 3.575   -2.905  -11.989 1.00 0.00 ? 24 ARG A HB3  4  
ATOM 2980  H HG2  . ARG A 1 24 ? 4.210   -5.372  -11.881 1.00 0.00 ? 24 ARG A HG2  4  
ATOM 2981  H HG3  . ARG A 1 24 ? 2.589   -5.669  -11.257 1.00 0.00 ? 24 ARG A HG3  4  
ATOM 2982  H HD2  . ARG A 1 24 ? 1.635   -4.577  -13.272 1.00 0.00 ? 24 ARG A HD2  4  
ATOM 2983  H HD3  . ARG A 1 24 ? 3.265   -4.355  -13.904 1.00 0.00 ? 24 ARG A HD3  4  
ATOM 2984  H HE   . ARG A 1 24 ? 2.684   -7.101  -13.246 1.00 0.00 ? 24 ARG A HE   4  
ATOM 2985  H HH11 . ARG A 1 24 ? 2.361   -4.579  -15.594 1.00 0.00 ? 24 ARG A HH11 4  
ATOM 2986  H HH12 . ARG A 1 24 ? 2.228   -5.662  -16.940 1.00 0.00 ? 24 ARG A HH12 4  
ATOM 2987  H HH21 . ARG A 1 24 ? 2.509   -8.526  -15.005 1.00 0.00 ? 24 ARG A HH21 4  
ATOM 2988  H HH22 . ARG A 1 24 ? 2.312   -7.896  -16.606 1.00 0.00 ? 24 ARG A HH22 4  
ATOM 2989  N N    . ASP A 1 25 ? 6.021   -2.631  -10.922 1.00 0.00 ? 25 ASP A N    4  
ATOM 2990  C CA   . ASP A 1 25 ? 7.427   -2.637  -11.304 1.00 0.00 ? 25 ASP A CA   4  
ATOM 2991  C C    . ASP A 1 25 ? 8.316   -2.944  -10.103 1.00 0.00 ? 25 ASP A C    4  
ATOM 2992  O O    . ASP A 1 25 ? 9.136   -3.860  -10.145 1.00 0.00 ? 25 ASP A O    4  
ATOM 2993  C CB   . ASP A 1 25 ? 7.811   -1.279  -11.891 1.00 0.00 ? 25 ASP A CB   4  
ATOM 2994  C CG   . ASP A 1 25 ? 9.155   -1.382  -12.607 1.00 0.00 ? 25 ASP A CG   4  
ATOM 2995  O OD1  . ASP A 1 25 ? 9.167   -1.830  -13.742 1.00 0.00 ? 25 ASP A OD1  4  
ATOM 2996  O OD2  . ASP A 1 25 ? 10.152  -1.012  -12.009 1.00 0.00 ? 25 ASP A OD2  4  
ATOM 2997  H H    . ASP A 1 25 ? 5.473   -1.839  -11.109 1.00 0.00 ? 25 ASP A H    4  
ATOM 2998  H HA   . ASP A 1 25 ? 7.579   -3.395  -12.053 1.00 0.00 ? 25 ASP A HA   4  
ATOM 2999  H HB2  . ASP A 1 25 ? 7.055   -0.965  -12.596 1.00 0.00 ? 25 ASP A HB2  4  
ATOM 3000  H HB3  . ASP A 1 25 ? 7.886   -0.552  -11.097 1.00 0.00 ? 25 ASP A HB3  4  
ATOM 3001  N N    . THR A 1 26 ? 8.153   -2.171  -9.036  1.00 0.00 ? 26 THR A N    4  
ATOM 3002  C CA   . THR A 1 26 ? 8.955   -2.366  -7.834  1.00 0.00 ? 26 THR A CA   4  
ATOM 3003  C C    . THR A 1 26 ? 8.788   -3.776  -7.276  1.00 0.00 ? 26 THR A C    4  
ATOM 3004  O O    . THR A 1 26 ? 9.736   -4.354  -6.744  1.00 0.00 ? 26 THR A O    4  
ATOM 3005  C CB   . THR A 1 26 ? 8.559   -1.348  -6.766  1.00 0.00 ? 26 THR A CB   4  
ATOM 3006  O OG1  . THR A 1 26 ? 8.435   -0.063  -7.362  1.00 0.00 ? 26 THR A OG1  4  
ATOM 3007  C CG2  . THR A 1 26 ? 9.632   -1.309  -5.679  1.00 0.00 ? 26 THR A CG2  4  
ATOM 3008  H H    . THR A 1 26 ? 7.487   -1.452  -9.059  1.00 0.00 ? 26 THR A H    4  
ATOM 3009  H HA   . THR A 1 26 ? 9.995   -2.213  -8.083  1.00 0.00 ? 26 THR A HA   4  
ATOM 3010  H HB   . THR A 1 26 ? 7.615   -1.635  -6.327  1.00 0.00 ? 26 THR A HB   4  
ATOM 3011  H HG1  . THR A 1 26 ? 8.745   -0.126  -8.267  1.00 0.00 ? 26 THR A HG1  4  
ATOM 3012  H HG21 . THR A 1 26 ? 9.797   -2.307  -5.301  1.00 0.00 ? 26 THR A HG21 4  
ATOM 3013  H HG22 . THR A 1 26 ? 9.306   -0.669  -4.873  1.00 0.00 ? 26 THR A HG22 4  
ATOM 3014  H HG23 . THR A 1 26 ? 10.551  -0.923  -6.095  1.00 0.00 ? 26 THR A HG23 4  
ATOM 3015  N N    . ILE A 1 27 ? 7.582   -4.327  -7.388  1.00 0.00 ? 27 ILE A N    4  
ATOM 3016  C CA   . ILE A 1 27 ? 7.328   -5.670  -6.871  1.00 0.00 ? 27 ILE A CA   4  
ATOM 3017  C C    . ILE A 1 27 ? 7.879   -6.731  -7.824  1.00 0.00 ? 27 ILE A C    4  
ATOM 3018  O O    . ILE A 1 27 ? 8.123   -7.867  -7.422  1.00 0.00 ? 27 ILE A O    4  
ATOM 3019  C CB   . ILE A 1 27 ? 5.814   -5.871  -6.646  1.00 0.00 ? 27 ILE A CB   4  
ATOM 3020  C CG1  . ILE A 1 27 ? 5.580   -6.476  -5.254  1.00 0.00 ? 27 ILE A CG1  4  
ATOM 3021  C CG2  . ILE A 1 27 ? 5.222   -6.805  -7.712  1.00 0.00 ? 27 ILE A CG2  4  
ATOM 3022  C CD1  . ILE A 1 27 ? 4.101   -6.836  -5.086  1.00 0.00 ? 27 ILE A CD1  4  
ATOM 3023  H H    . ILE A 1 27 ? 6.855   -3.823  -7.816  1.00 0.00 ? 27 ILE A H    4  
ATOM 3024  H HA   . ILE A 1 27 ? 7.835   -5.770  -5.922  1.00 0.00 ? 27 ILE A HA   4  
ATOM 3025  H HB   . ILE A 1 27 ? 5.319   -4.916  -6.703  1.00 0.00 ? 27 ILE A HB   4  
ATOM 3026  H HG12 . ILE A 1 27 ? 6.182   -7.363  -5.140  1.00 0.00 ? 27 ILE A HG12 4  
ATOM 3027  H HG13 . ILE A 1 27 ? 5.859   -5.755  -4.499  1.00 0.00 ? 27 ILE A HG13 4  
ATOM 3028  H HG21 . ILE A 1 27 ? 5.535   -6.479  -8.693  1.00 0.00 ? 27 ILE A HG21 4  
ATOM 3029  H HG22 . ILE A 1 27 ? 4.145   -6.779  -7.654  1.00 0.00 ? 27 ILE A HG22 4  
ATOM 3030  H HG23 . ILE A 1 27 ? 5.569   -7.814  -7.539  1.00 0.00 ? 27 ILE A HG23 4  
ATOM 3031  H HD11 . ILE A 1 27 ? 3.874   -6.943  -4.035  1.00 0.00 ? 27 ILE A HD11 4  
ATOM 3032  H HD12 . ILE A 1 27 ? 3.898   -7.766  -5.596  1.00 0.00 ? 27 ILE A HD12 4  
ATOM 3033  H HD13 . ILE A 1 27 ? 3.488   -6.052  -5.508  1.00 0.00 ? 27 ILE A HD13 4  
ATOM 3034  N N    . ASN A 1 28 ? 8.067   -6.355  -9.088  1.00 0.00 ? 28 ASN A N    4  
ATOM 3035  C CA   . ASN A 1 28 ? 8.583   -7.293  -10.084 1.00 0.00 ? 28 ASN A CA   4  
ATOM 3036  C C    . ASN A 1 28 ? 10.043  -6.985  -10.422 1.00 0.00 ? 28 ASN A C    4  
ATOM 3037  O O    . ASN A 1 28 ? 10.668  -7.704  -11.203 1.00 0.00 ? 28 ASN A O    4  
ATOM 3038  C CB   . ASN A 1 28 ? 7.716   -7.234  -11.354 1.00 0.00 ? 28 ASN A CB   4  
ATOM 3039  C CG   . ASN A 1 28 ? 8.454   -6.521  -12.485 1.00 0.00 ? 28 ASN A CG   4  
ATOM 3040  O OD1  . ASN A 1 28 ? 8.609   -7.075  -13.573 1.00 0.00 ? 28 ASN A OD1  4  
ATOM 3041  N ND2  . ASN A 1 28 ? 8.919   -5.321  -12.288 1.00 0.00 ? 28 ASN A ND2  4  
ATOM 3042  H H    . ASN A 1 28 ? 7.850   -5.437  -9.357  1.00 0.00 ? 28 ASN A H    4  
ATOM 3043  H HA   . ASN A 1 28 ? 8.531   -8.293  -9.679  1.00 0.00 ? 28 ASN A HA   4  
ATOM 3044  H HB2  . ASN A 1 28 ? 7.470   -8.238  -11.669 1.00 0.00 ? 28 ASN A HB2  4  
ATOM 3045  H HB3  . ASN A 1 28 ? 6.804   -6.697  -11.135 1.00 0.00 ? 28 ASN A HB3  4  
ATOM 3046  H HD21 . ASN A 1 28 ? 8.795   -4.883  -11.420 1.00 0.00 ? 28 ASN A HD21 4  
ATOM 3047  H HD22 . ASN A 1 28 ? 9.394   -4.855  -13.007 1.00 0.00 ? 28 ASN A HD22 4  
ATOM 3048  N N    . THR A 1 29 ? 10.583  -5.922  -9.828  1.00 0.00 ? 29 THR A N    4  
ATOM 3049  C CA   . THR A 1 29 ? 11.975  -5.541  -10.073 1.00 0.00 ? 29 THR A CA   4  
ATOM 3050  C C    . THR A 1 29 ? 12.785  -5.635  -8.787  1.00 0.00 ? 29 THR A C    4  
ATOM 3051  O O    . THR A 1 29 ? 13.869  -6.221  -8.764  1.00 0.00 ? 29 THR A O    4  
ATOM 3052  C CB   . THR A 1 29 ? 12.050  -4.109  -10.618 1.00 0.00 ? 29 THR A CB   4  
ATOM 3053  O OG1  . THR A 1 29 ? 11.332  -3.241  -9.752  1.00 0.00 ? 29 THR A OG1  4  
ATOM 3054  C CG2  . THR A 1 29 ? 11.447  -4.043  -12.028 1.00 0.00 ? 29 THR A CG2  4  
ATOM 3055  H H    . THR A 1 29 ? 10.040  -5.388  -9.209  1.00 0.00 ? 29 THR A H    4  
ATOM 3056  H HA   . THR A 1 29 ? 12.405  -6.214  -10.803 1.00 0.00 ? 29 THR A HA   4  
ATOM 3057  H HB   . THR A 1 29 ? 13.084  -3.798  -10.659 1.00 0.00 ? 29 THR A HB   4  
ATOM 3058  H HG1  . THR A 1 29 ? 10.579  -2.895  -10.237 1.00 0.00 ? 29 THR A HG1  4  
ATOM 3059  H HG21 . THR A 1 29 ? 12.115  -3.503  -12.682 1.00 0.00 ? 29 THR A HG21 4  
ATOM 3060  H HG22 . THR A 1 29 ? 10.496  -3.532  -11.988 1.00 0.00 ? 29 THR A HG22 4  
ATOM 3061  H HG23 . THR A 1 29 ? 11.299  -5.041  -12.413 1.00 0.00 ? 29 THR A HG23 4  
ATOM 3062  N N    . SER A 1 30 ? 12.251  -5.059  -7.716  1.00 0.00 ? 30 SER A N    4  
ATOM 3063  C CA   . SER A 1 30 ? 12.930  -5.086  -6.426  1.00 0.00 ? 30 SER A CA   4  
ATOM 3064  C C    . SER A 1 30 ? 12.473  -6.296  -5.618  1.00 0.00 ? 30 SER A C    4  
ATOM 3065  O O    . SER A 1 30 ? 11.502  -6.962  -5.978  1.00 0.00 ? 30 SER A O    4  
ATOM 3066  C CB   . SER A 1 30 ? 12.631  -3.796  -5.654  1.00 0.00 ? 30 SER A CB   4  
ATOM 3067  O OG   . SER A 1 30 ? 13.727  -2.901  -5.795  1.00 0.00 ? 30 SER A OG   4  
ATOM 3068  H H    . SER A 1 30 ? 11.383  -4.609  -7.795  1.00 0.00 ? 30 SER A H    4  
ATOM 3069  H HA   . SER A 1 30 ? 13.995  -5.154  -6.588  1.00 0.00 ? 30 SER A HA   4  
ATOM 3070  H HB2  . SER A 1 30 ? 11.744  -3.333  -6.053  1.00 0.00 ? 30 SER A HB2  4  
ATOM 3071  H HB3  . SER A 1 30 ? 12.473  -4.026  -4.608  1.00 0.00 ? 30 SER A HB3  4  
ATOM 3072  H HG   . SER A 1 30 ? 14.460  -3.387  -6.180  1.00 0.00 ? 30 SER A HG   4  
ATOM 3073  N N    . CYS A 1 31 ? 13.176  -6.577  -4.527  1.00 0.00 ? 31 CYS A N    4  
ATOM 3074  C CA   . CYS A 1 31 ? 12.825  -7.713  -3.681  1.00 0.00 ? 31 CYS A CA   4  
ATOM 3075  C C    . CYS A 1 31 ? 13.387  -7.535  -2.277  1.00 0.00 ? 31 CYS A C    4  
ATOM 3076  O O    . CYS A 1 31 ? 14.592  -7.363  -2.094  1.00 0.00 ? 31 CYS A O    4  
ATOM 3077  C CB   . CYS A 1 31 ? 13.372  -9.005  -4.292  1.00 0.00 ? 31 CYS A CB   4  
ATOM 3078  S SG   . CYS A 1 31 ? 12.673  -10.428 -3.418  1.00 0.00 ? 31 CYS A SG   4  
ATOM 3079  H H    . CYS A 1 31 ? 13.941  -6.013  -4.285  1.00 0.00 ? 31 CYS A H    4  
ATOM 3080  H HA   . CYS A 1 31 ? 11.750  -7.785  -3.621  1.00 0.00 ? 31 CYS A HA   4  
ATOM 3081  H HB2  . CYS A 1 31 ? 13.098  -9.055  -5.336  1.00 0.00 ? 31 CYS A HB2  4  
ATOM 3082  H HB3  . CYS A 1 31 ? 14.448  -9.019  -4.201  1.00 0.00 ? 31 CYS A HB3  4  
ATOM 3083  H HG   . CYS A 1 31 ? 13.100  -10.487 -2.560  1.00 0.00 ? 31 CYS A HG   4  
ATOM 3084  N N    . ASP A 1 32 ? 12.503  -7.586  -1.286  1.00 0.00 ? 32 ASP A N    4  
ATOM 3085  C CA   . ASP A 1 32 ? 12.911  -7.437  0.105   1.00 0.00 ? 32 ASP A CA   4  
ATOM 3086  C C    . ASP A 1 32 ? 11.717  -7.667  1.027   1.00 0.00 ? 32 ASP A C    4  
ATOM 3087  O O    . ASP A 1 32 ? 10.644  -7.104  0.815   1.00 0.00 ? 32 ASP A O    4  
ATOM 3088  C CB   . ASP A 1 32 ? 13.490  -6.036  0.343   1.00 0.00 ? 32 ASP A CB   4  
ATOM 3089  C CG   . ASP A 1 32 ? 14.628  -6.099  1.359   1.00 0.00 ? 32 ASP A CG   4  
ATOM 3090  O OD1  . ASP A 1 32 ? 15.640  -6.704  1.048   1.00 0.00 ? 32 ASP A OD1  4  
ATOM 3091  O OD2  . ASP A 1 32 ? 14.467  -5.543  2.433   1.00 0.00 ? 32 ASP A OD2  4  
ATOM 3092  H H    . ASP A 1 32 ? 11.557  -7.730  -1.496  1.00 0.00 ? 32 ASP A H    4  
ATOM 3093  H HA   . ASP A 1 32 ? 13.670  -8.173  0.325   1.00 0.00 ? 32 ASP A HA   4  
ATOM 3094  H HB2  . ASP A 1 32 ? 13.867  -5.641  -0.590  1.00 0.00 ? 32 ASP A HB2  4  
ATOM 3095  H HB3  . ASP A 1 32 ? 12.715  -5.384  0.718   1.00 0.00 ? 32 ASP A HB3  4  
ATOM 3096  N N    . ILE A 1 33 ? 11.909  -8.498  2.044   1.00 0.00 ? 33 ILE A N    4  
ATOM 3097  C CA   . ILE A 1 33 ? 10.838  -8.794  2.990   1.00 0.00 ? 33 ILE A CA   4  
ATOM 3098  C C    . ILE A 1 33 ? 10.020  -7.540  3.287   1.00 0.00 ? 33 ILE A C    4  
ATOM 3099  O O    . ILE A 1 33 ? 8.799   -7.602  3.428   1.00 0.00 ? 33 ILE A O    4  
ATOM 3100  C CB   . ILE A 1 33 ? 11.431  -9.340  4.295   1.00 0.00 ? 33 ILE A CB   4  
ATOM 3101  C CG1  . ILE A 1 33 ? 12.694  -8.543  4.660   1.00 0.00 ? 33 ILE A CG1  4  
ATOM 3102  C CG2  . ILE A 1 33 ? 11.791  -10.819 4.115   1.00 0.00 ? 33 ILE A CG2  4  
ATOM 3103  C CD1  . ILE A 1 33 ? 12.852  -8.489  6.181   1.00 0.00 ? 33 ILE A CD1  4  
ATOM 3104  H H    . ILE A 1 33 ? 12.787  -8.920  2.163   1.00 0.00 ? 33 ILE A H    4  
ATOM 3105  H HA   . ILE A 1 33 ? 10.189  -9.542  2.561   1.00 0.00 ? 33 ILE A HA   4  
ATOM 3106  H HB   . ILE A 1 33 ? 10.701  -9.245  5.087   1.00 0.00 ? 33 ILE A HB   4  
ATOM 3107  H HG12 . ILE A 1 33 ? 13.562  -9.021  4.226   1.00 0.00 ? 33 ILE A HG12 4  
ATOM 3108  H HG13 . ILE A 1 33 ? 12.613  -7.537  4.275   1.00 0.00 ? 33 ILE A HG13 4  
ATOM 3109  H HG21 . ILE A 1 33 ? 12.542  -10.913 3.344   1.00 0.00 ? 33 ILE A HG21 4  
ATOM 3110  H HG22 . ILE A 1 33 ? 10.909  -11.371 3.829   1.00 0.00 ? 33 ILE A HG22 4  
ATOM 3111  H HG23 . ILE A 1 33 ? 12.178  -11.210 5.045   1.00 0.00 ? 33 ILE A HG23 4  
ATOM 3112  H HD11 . ILE A 1 33 ? 12.190  -7.735  6.583   1.00 0.00 ? 33 ILE A HD11 4  
ATOM 3113  H HD12 . ILE A 1 33 ? 13.872  -8.241  6.430   1.00 0.00 ? 33 ILE A HD12 4  
ATOM 3114  H HD13 . ILE A 1 33 ? 12.601  -9.451  6.604   1.00 0.00 ? 33 ILE A HD13 4  
ATOM 3115  N N    . GLU A 1 34 ? 10.705  -6.404  3.383   1.00 0.00 ? 34 GLU A N    4  
ATOM 3116  C CA   . GLU A 1 34 ? 10.035  -5.141  3.671   1.00 0.00 ? 34 GLU A CA   4  
ATOM 3117  C C    . GLU A 1 34 ? 9.299   -4.620  2.437   1.00 0.00 ? 34 GLU A C    4  
ATOM 3118  O O    . GLU A 1 34 ? 8.113   -4.297  2.505   1.00 0.00 ? 34 GLU A O    4  
ATOM 3119  C CB   . GLU A 1 34 ? 11.063  -4.103  4.138   1.00 0.00 ? 34 GLU A CB   4  
ATOM 3120  C CG   . GLU A 1 34 ? 12.201  -4.805  4.883   1.00 0.00 ? 34 GLU A CG   4  
ATOM 3121  C CD   . GLU A 1 34 ? 12.906  -3.820  5.811   1.00 0.00 ? 34 GLU A CD   4  
ATOM 3122  O OE1  . GLU A 1 34 ? 12.215  -3.082  6.494   1.00 0.00 ? 34 GLU A OE1  4  
ATOM 3123  O OE2  . GLU A 1 34 ? 14.126  -3.821  5.827   1.00 0.00 ? 34 GLU A OE2  4  
ATOM 3124  H H    . GLU A 1 34 ? 11.677  -6.417  3.264   1.00 0.00 ? 34 GLU A H    4  
ATOM 3125  H HA   . GLU A 1 34 ? 9.319   -5.300  4.461   1.00 0.00 ? 34 GLU A HA   4  
ATOM 3126  H HB2  . GLU A 1 34 ? 11.463  -3.580  3.281   1.00 0.00 ? 34 GLU A HB2  4  
ATOM 3127  H HB3  . GLU A 1 34 ? 10.585  -3.397  4.799   1.00 0.00 ? 34 GLU A HB3  4  
ATOM 3128  H HG2  . GLU A 1 34 ? 11.800  -5.623  5.465   1.00 0.00 ? 34 GLU A HG2  4  
ATOM 3129  H HG3  . GLU A 1 34 ? 12.913  -5.191  4.168   1.00 0.00 ? 34 GLU A HG3  4  
ATOM 3130  N N    . LEU A 1 35 ? 10.007  -4.537  1.315   1.00 0.00 ? 35 LEU A N    4  
ATOM 3131  C CA   . LEU A 1 35 ? 9.397   -4.048  0.082   1.00 0.00 ? 35 LEU A CA   4  
ATOM 3132  C C    . LEU A 1 35 ? 8.136   -4.850  -0.233  1.00 0.00 ? 35 LEU A C    4  
ATOM 3133  O O    . LEU A 1 35 ? 7.067   -4.281  -0.456  1.00 0.00 ? 35 LEU A O    4  
ATOM 3134  C CB   . LEU A 1 35 ? 10.390  -4.173  -1.087  1.00 0.00 ? 35 LEU A CB   4  
ATOM 3135  C CG   . LEU A 1 35 ? 10.213  -3.013  -2.089  1.00 0.00 ? 35 LEU A CG   4  
ATOM 3136  C CD1  . LEU A 1 35 ? 8.724   -2.763  -2.367  1.00 0.00 ? 35 LEU A CD1  4  
ATOM 3137  C CD2  . LEU A 1 35 ? 10.849  -1.729  -1.534  1.00 0.00 ? 35 LEU A CD2  4  
ATOM 3138  H H    . LEU A 1 35 ? 10.950  -4.805  1.316   1.00 0.00 ? 35 LEU A H    4  
ATOM 3139  H HA   . LEU A 1 35 ? 9.135   -3.011  0.214   1.00 0.00 ? 35 LEU A HA   4  
ATOM 3140  H HB2  . LEU A 1 35 ? 11.396  -4.159  -0.700  1.00 0.00 ? 35 LEU A HB2  4  
ATOM 3141  H HB3  . LEU A 1 35 ? 10.223  -5.111  -1.599  1.00 0.00 ? 35 LEU A HB3  4  
ATOM 3142  H HG   . LEU A 1 35 ? 10.702  -3.276  -3.016  1.00 0.00 ? 35 LEU A HG   4  
ATOM 3143  H HD11 . LEU A 1 35 ? 8.206   -3.705  -2.443  1.00 0.00 ? 35 LEU A HD11 4  
ATOM 3144  H HD12 . LEU A 1 35 ? 8.620   -2.223  -3.296  1.00 0.00 ? 35 LEU A HD12 4  
ATOM 3145  H HD13 . LEU A 1 35 ? 8.297   -2.177  -1.566  1.00 0.00 ? 35 LEU A HD13 4  
ATOM 3146  H HD21 . LEU A 1 35 ? 11.329  -1.193  -2.340  1.00 0.00 ? 35 LEU A HD21 4  
ATOM 3147  H HD22 . LEU A 1 35 ? 11.582  -1.976  -0.781  1.00 0.00 ? 35 LEU A HD22 4  
ATOM 3148  H HD23 . LEU A 1 35 ? 10.082  -1.105  -1.098  1.00 0.00 ? 35 LEU A HD23 4  
ATOM 3149  N N    . LEU A 1 36 ? 8.273   -6.171  -0.254  1.00 0.00 ? 36 LEU A N    4  
ATOM 3150  C CA   . LEU A 1 36 ? 7.143   -7.044  -0.549  1.00 0.00 ? 36 LEU A CA   4  
ATOM 3151  C C    . LEU A 1 36 ? 6.073   -6.927  0.533   1.00 0.00 ? 36 LEU A C    4  
ATOM 3152  O O    . LEU A 1 36 ? 4.898   -6.713  0.232   1.00 0.00 ? 36 LEU A O    4  
ATOM 3153  C CB   . LEU A 1 36 ? 7.614   -8.495  -0.656  1.00 0.00 ? 36 LEU A CB   4  
ATOM 3154  C CG   . LEU A 1 36 ? 8.843   -8.570  -1.567  1.00 0.00 ? 36 LEU A CG   4  
ATOM 3155  C CD1  . LEU A 1 36 ? 9.245   -10.033 -1.758  1.00 0.00 ? 36 LEU A CD1  4  
ATOM 3156  C CD2  . LEU A 1 36 ? 8.516   -7.949  -2.930  1.00 0.00 ? 36 LEU A CD2  4  
ATOM 3157  H H    . LEU A 1 36 ? 9.151   -6.567  -0.073  1.00 0.00 ? 36 LEU A H    4  
ATOM 3158  H HA   . LEU A 1 36 ? 6.712   -6.748  -1.495  1.00 0.00 ? 36 LEU A HA   4  
ATOM 3159  H HB2  . LEU A 1 36 ? 7.872   -8.862  0.327   1.00 0.00 ? 36 LEU A HB2  4  
ATOM 3160  H HB3  . LEU A 1 36 ? 6.825   -9.101  -1.072  1.00 0.00 ? 36 LEU A HB3  4  
ATOM 3161  H HG   . LEU A 1 36 ? 9.662   -8.030  -1.111  1.00 0.00 ? 36 LEU A HG   4  
ATOM 3162  H HD11 . LEU A 1 36 ? 8.366   -10.623 -1.973  1.00 0.00 ? 36 LEU A HD11 4  
ATOM 3163  H HD12 . LEU A 1 36 ? 9.713   -10.401 -0.856  1.00 0.00 ? 36 LEU A HD12 4  
ATOM 3164  H HD13 . LEU A 1 36 ? 9.940   -10.113 -2.580  1.00 0.00 ? 36 LEU A HD13 4  
ATOM 3165  H HD21 . LEU A 1 36 ? 7.514   -8.229  -3.225  1.00 0.00 ? 36 LEU A HD21 4  
ATOM 3166  H HD22 . LEU A 1 36 ? 9.219   -8.304  -3.669  1.00 0.00 ? 36 LEU A HD22 4  
ATOM 3167  H HD23 . LEU A 1 36 ? 8.581   -6.873  -2.861  1.00 0.00 ? 36 LEU A HD23 4  
ATOM 3168  N N    . ALA A 1 37 ? 6.479   -7.064  1.792   1.00 0.00 ? 37 ALA A N    4  
ATOM 3169  C CA   . ALA A 1 37 ? 5.532   -6.964  2.897   1.00 0.00 ? 37 ALA A CA   4  
ATOM 3170  C C    . ALA A 1 37 ? 4.743   -5.666  2.791   1.00 0.00 ? 37 ALA A C    4  
ATOM 3171  O O    . ALA A 1 37 ? 3.513   -5.664  2.870   1.00 0.00 ? 37 ALA A O    4  
ATOM 3172  C CB   . ALA A 1 37 ? 6.275   -7.007  4.234   1.00 0.00 ? 37 ALA A CB   4  
ATOM 3173  H H    . ALA A 1 37 ? 7.428   -7.230  1.980   1.00 0.00 ? 37 ALA A H    4  
ATOM 3174  H HA   . ALA A 1 37 ? 4.849   -7.798  2.848   1.00 0.00 ? 37 ALA A HA   4  
ATOM 3175  H HB1  . ALA A 1 37 ? 6.700   -7.988  4.379   1.00 0.00 ? 37 ALA A HB1  4  
ATOM 3176  H HB2  . ALA A 1 37 ? 5.583   -6.794  5.035   1.00 0.00 ? 37 ALA A HB2  4  
ATOM 3177  H HB3  . ALA A 1 37 ? 7.061   -6.268  4.233   1.00 0.00 ? 37 ALA A HB3  4  
ATOM 3178  N N    . ALA A 1 38 ? 5.459   -4.562  2.605   1.00 0.00 ? 38 ALA A N    4  
ATOM 3179  C CA   . ALA A 1 38 ? 4.817   -3.260  2.481   1.00 0.00 ? 38 ALA A CA   4  
ATOM 3180  C C    . ALA A 1 38 ? 3.933   -3.225  1.239   1.00 0.00 ? 38 ALA A C    4  
ATOM 3181  O O    . ALA A 1 38 ? 2.774   -2.810  1.300   1.00 0.00 ? 38 ALA A O    4  
ATOM 3182  C CB   . ALA A 1 38 ? 5.880   -2.161  2.395   1.00 0.00 ? 38 ALA A CB   4  
ATOM 3183  H H    . ALA A 1 38 ? 6.435   -4.626  2.543   1.00 0.00 ? 38 ALA A H    4  
ATOM 3184  H HA   . ALA A 1 38 ? 4.205   -3.087  3.353   1.00 0.00 ? 38 ALA A HA   4  
ATOM 3185  H HB1  . ALA A 1 38 ? 6.724   -2.429  3.013   1.00 0.00 ? 38 ALA A HB1  4  
ATOM 3186  H HB2  . ALA A 1 38 ? 5.462   -1.229  2.744   1.00 0.00 ? 38 ALA A HB2  4  
ATOM 3187  H HB3  . ALA A 1 38 ? 6.204   -2.049  1.370   1.00 0.00 ? 38 ALA A HB3  4  
ATOM 3188  N N    . CYS A 1 39 ? 4.483   -3.670  0.112   1.00 0.00 ? 39 CYS A N    4  
ATOM 3189  C CA   . CYS A 1 39 ? 3.727   -3.690  -1.135  1.00 0.00 ? 39 CYS A CA   4  
ATOM 3190  C C    . CYS A 1 39 ? 2.431   -4.471  -0.952  1.00 0.00 ? 39 CYS A C    4  
ATOM 3191  O O    . CYS A 1 39 ? 1.362   -4.029  -1.373  1.00 0.00 ? 39 CYS A O    4  
ATOM 3192  C CB   . CYS A 1 39 ? 4.557   -4.338  -2.246  1.00 0.00 ? 39 CYS A CB   4  
ATOM 3193  S SG   . CYS A 1 39 ? 3.813   -3.960  -3.852  1.00 0.00 ? 39 CYS A SG   4  
ATOM 3194  H H    . CYS A 1 39 ? 5.407   -3.995  0.122   1.00 0.00 ? 39 CYS A H    4  
ATOM 3195  H HA   . CYS A 1 39 ? 3.492   -2.676  -1.419  1.00 0.00 ? 39 CYS A HA   4  
ATOM 3196  H HB2  . CYS A 1 39 ? 5.566   -3.952  -2.217  1.00 0.00 ? 39 CYS A HB2  4  
ATOM 3197  H HB3  . CYS A 1 39 ? 4.579   -5.409  -2.103  1.00 0.00 ? 39 CYS A HB3  4  
ATOM 3198  H HG   . CYS A 1 39 ? 3.182   -3.249  -3.727  1.00 0.00 ? 39 CYS A HG   4  
ATOM 3199  N N    . ARG A 1 40 ? 2.536   -5.635  -0.316  1.00 0.00 ? 40 ARG A N    4  
ATOM 3200  C CA   . ARG A 1 40 ? 1.368   -6.472  -0.075  1.00 0.00 ? 40 ARG A CA   4  
ATOM 3201  C C    . ARG A 1 40 ? 0.339   -5.720  0.763   1.00 0.00 ? 40 ARG A C    4  
ATOM 3202  O O    . ARG A 1 40 ? -0.852  -5.724  0.452   1.00 0.00 ? 40 ARG A O    4  
ATOM 3203  C CB   . ARG A 1 40 ? 1.783   -7.754  0.651   1.00 0.00 ? 40 ARG A CB   4  
ATOM 3204  C CG   . ARG A 1 40 ? 0.540   -8.585  0.973   1.00 0.00 ? 40 ARG A CG   4  
ATOM 3205  C CD   . ARG A 1 40 ? 0.966   -9.984  1.425   1.00 0.00 ? 40 ARG A CD   4  
ATOM 3206  N NE   . ARG A 1 40 ? -0.163  -10.684 2.029   1.00 0.00 ? 40 ARG A NE   4  
ATOM 3207  C CZ   . ARG A 1 40 ? -1.138  -11.190 1.281   1.00 0.00 ? 40 ARG A CZ   4  
ATOM 3208  N NH1  . ARG A 1 40 ? -1.097  -11.063 -0.017  1.00 0.00 ? 40 ARG A NH1  4  
ATOM 3209  N NH2  . ARG A 1 40 ? -2.135  -11.815 1.845   1.00 0.00 ? 40 ARG A NH2  4  
ATOM 3210  H H    . ARG A 1 40 ? 3.414   -5.933  -0.001  1.00 0.00 ? 40 ARG A H    4  
ATOM 3211  H HA   . ARG A 1 40 ? 0.923   -6.735  -1.023  1.00 0.00 ? 40 ARG A HA   4  
ATOM 3212  H HB2  . ARG A 1 40 ? 2.446   -8.325  0.018   1.00 0.00 ? 40 ARG A HB2  4  
ATOM 3213  H HB3  . ARG A 1 40 ? 2.291   -7.499  1.569   1.00 0.00 ? 40 ARG A HB3  4  
ATOM 3214  H HG2  . ARG A 1 40 ? -0.020  -8.104  1.761   1.00 0.00 ? 40 ARG A HG2  4  
ATOM 3215  H HG3  . ARG A 1 40 ? -0.078  -8.666  0.091   1.00 0.00 ? 40 ARG A HG3  4  
ATOM 3216  H HD2  . ARG A 1 40 ? 1.315   -10.543 0.572   1.00 0.00 ? 40 ARG A HD2  4  
ATOM 3217  H HD3  . ARG A 1 40 ? 1.765   -9.896  2.148   1.00 0.00 ? 40 ARG A HD3  4  
ATOM 3218  H HE   . ARG A 1 40 ? -0.202  -10.783 3.003   1.00 0.00 ? 40 ARG A HE   4  
ATOM 3219  H HH11 . ARG A 1 40 ? -0.333  -10.585 -0.449  1.00 0.00 ? 40 ARG A HH11 4  
ATOM 3220  H HH12 . ARG A 1 40 ? -1.831  -11.445 -0.580  1.00 0.00 ? 40 ARG A HH12 4  
ATOM 3221  H HH21 . ARG A 1 40 ? -2.166  -11.913 2.840   1.00 0.00 ? 40 ARG A HH21 4  
ATOM 3222  H HH22 . ARG A 1 40 ? -2.870  -12.196 1.282   1.00 0.00 ? 40 ARG A HH22 4  
ATOM 3223  N N    . GLU A 1 41 ? 0.807   -5.072  1.825   1.00 0.00 ? 41 GLU A N    4  
ATOM 3224  C CA   . GLU A 1 41 ? -0.085  -4.317  2.696   1.00 0.00 ? 41 GLU A CA   4  
ATOM 3225  C C    . GLU A 1 41 ? -0.884  -3.303  1.885   1.00 0.00 ? 41 GLU A C    4  
ATOM 3226  O O    . GLU A 1 41 ? -2.109  -3.240  1.984   1.00 0.00 ? 41 GLU A O    4  
ATOM 3227  C CB   . GLU A 1 41 ? 0.727   -3.589  3.772   1.00 0.00 ? 41 GLU A CB   4  
ATOM 3228  C CG   . GLU A 1 41 ? 1.226   -4.598  4.806   1.00 0.00 ? 41 GLU A CG   4  
ATOM 3229  C CD   . GLU A 1 41 ? 0.076   -5.030  5.710   1.00 0.00 ? 41 GLU A CD   4  
ATOM 3230  O OE1  . GLU A 1 41 ? -1.014  -4.511  5.537   1.00 0.00 ? 41 GLU A OE1  4  
ATOM 3231  O OE2  . GLU A 1 41 ? 0.303   -5.873  6.562   1.00 0.00 ? 41 GLU A OE2  4  
ATOM 3232  H H    . GLU A 1 41 ? 1.766   -5.101  2.024   1.00 0.00 ? 41 GLU A H    4  
ATOM 3233  H HA   . GLU A 1 41 ? -0.769  -4.999  3.178   1.00 0.00 ? 41 GLU A HA   4  
ATOM 3234  H HB2  . GLU A 1 41 ? 1.570   -3.095  3.312   1.00 0.00 ? 41 GLU A HB2  4  
ATOM 3235  H HB3  . GLU A 1 41 ? 0.103   -2.855  4.260   1.00 0.00 ? 41 GLU A HB3  4  
ATOM 3236  H HG2  . GLU A 1 41 ? 1.628   -5.462  4.299   1.00 0.00 ? 41 GLU A HG2  4  
ATOM 3237  H HG3  . GLU A 1 41 ? 1.999   -4.143  5.407   1.00 0.00 ? 41 GLU A HG3  4  
ATOM 3238  N N    . GLU A 1 42 ? -0.182  -2.512  1.079   1.00 0.00 ? 42 GLU A N    4  
ATOM 3239  C CA   . GLU A 1 42 ? -0.837  -1.509  0.248   1.00 0.00 ? 42 GLU A CA   4  
ATOM 3240  C C    . GLU A 1 42 ? -1.805  -2.176  -0.722  1.00 0.00 ? 42 GLU A C    4  
ATOM 3241  O O    . GLU A 1 42 ? -2.929  -1.712  -0.912  1.00 0.00 ? 42 GLU A O    4  
ATOM 3242  C CB   . GLU A 1 42 ? 0.210   -0.710  -0.532  1.00 0.00 ? 42 GLU A CB   4  
ATOM 3243  C CG   . GLU A 1 42 ? 0.854   0.334   0.386   1.00 0.00 ? 42 GLU A CG   4  
ATOM 3244  C CD   . GLU A 1 42 ? 1.323   -0.325  1.681   1.00 0.00 ? 42 GLU A CD   4  
ATOM 3245  O OE1  . GLU A 1 42 ? 0.480   -0.625  2.509   1.00 0.00 ? 42 GLU A OE1  4  
ATOM 3246  O OE2  . GLU A 1 42 ? 2.519   -0.520  1.822   1.00 0.00 ? 42 GLU A OE2  4  
ATOM 3247  H H    . GLU A 1 42 ? 0.794   -2.610  1.038   1.00 0.00 ? 42 GLU A H    4  
ATOM 3248  H HA   . GLU A 1 42 ? -1.390  -0.835  0.885   1.00 0.00 ? 42 GLU A HA   4  
ATOM 3249  H HB2  . GLU A 1 42 ? 0.972   -1.381  -0.903  1.00 0.00 ? 42 GLU A HB2  4  
ATOM 3250  H HB3  . GLU A 1 42 ? -0.263  -0.209  -1.364  1.00 0.00 ? 42 GLU A HB3  4  
ATOM 3251  H HG2  . GLU A 1 42 ? 1.700   0.778   -0.116  1.00 0.00 ? 42 GLU A HG2  4  
ATOM 3252  H HG3  . GLU A 1 42 ? 0.130   1.100   0.618   1.00 0.00 ? 42 GLU A HG3  4  
ATOM 3253  N N    . PHE A 1 43 ? -1.361  -3.270  -1.334  1.00 0.00 ? 43 PHE A N    4  
ATOM 3254  C CA   . PHE A 1 43 ? -2.199  -3.996  -2.282  1.00 0.00 ? 43 PHE A CA   4  
ATOM 3255  C C    . PHE A 1 43 ? -3.457  -4.507  -1.585  1.00 0.00 ? 43 PHE A C    4  
ATOM 3256  O O    . PHE A 1 43 ? -4.567  -4.353  -2.094  1.00 0.00 ? 43 PHE A O    4  
ATOM 3257  C CB   . PHE A 1 43 ? -1.411  -5.173  -2.880  1.00 0.00 ? 43 PHE A CB   4  
ATOM 3258  C CG   . PHE A 1 43 ? -1.224  -4.966  -4.368  1.00 0.00 ? 43 PHE A CG   4  
ATOM 3259  C CD1  . PHE A 1 43 ? -0.653  -3.780  -4.842  1.00 0.00 ? 43 PHE A CD1  4  
ATOM 3260  C CD2  . PHE A 1 43 ? -1.621  -5.961  -5.270  1.00 0.00 ? 43 PHE A CD2  4  
ATOM 3261  C CE1  . PHE A 1 43 ? -0.479  -3.586  -6.218  1.00 0.00 ? 43 PHE A CE1  4  
ATOM 3262  C CE2  . PHE A 1 43 ? -1.447  -5.767  -6.645  1.00 0.00 ? 43 PHE A CE2  4  
ATOM 3263  C CZ   . PHE A 1 43 ? -0.876  -4.581  -7.119  1.00 0.00 ? 43 PHE A CZ   4  
ATOM 3264  H H    . PHE A 1 43 ? -0.456  -3.596  -1.143  1.00 0.00 ? 43 PHE A H    4  
ATOM 3265  H HA   . PHE A 1 43 ? -2.490  -3.323  -3.075  1.00 0.00 ? 43 PHE A HA   4  
ATOM 3266  H HB2  . PHE A 1 43 ? -0.444  -5.233  -2.404  1.00 0.00 ? 43 PHE A HB2  4  
ATOM 3267  H HB3  . PHE A 1 43 ? -1.950  -6.095  -2.710  1.00 0.00 ? 43 PHE A HB3  4  
ATOM 3268  H HD1  . PHE A 1 43 ? -0.347  -3.012  -4.146  1.00 0.00 ? 43 PHE A HD1  4  
ATOM 3269  H HD2  . PHE A 1 43 ? -2.062  -6.877  -4.905  1.00 0.00 ? 43 PHE A HD2  4  
ATOM 3270  H HE1  . PHE A 1 43 ? -0.038  -2.670  -6.583  1.00 0.00 ? 43 PHE A HE1  4  
ATOM 3271  H HE2  . PHE A 1 43 ? -1.753  -6.535  -7.342  1.00 0.00 ? 43 PHE A HE2  4  
ATOM 3272  H HZ   . PHE A 1 43 ? -0.741  -4.432  -8.181  1.00 0.00 ? 43 PHE A HZ   4  
ATOM 3273  N N    . HIS A 1 44 ? -3.274  -5.111  -0.416  1.00 0.00 ? 44 HIS A N    4  
ATOM 3274  C CA   . HIS A 1 44 ? -4.401  -5.637  0.345   1.00 0.00 ? 44 HIS A CA   4  
ATOM 3275  C C    . HIS A 1 44 ? -5.391  -4.521  0.661   1.00 0.00 ? 44 HIS A C    4  
ATOM 3276  O O    . HIS A 1 44 ? -6.605  -4.714  0.583   1.00 0.00 ? 44 HIS A O    4  
ATOM 3277  C CB   . HIS A 1 44 ? -3.905  -6.266  1.648   1.00 0.00 ? 44 HIS A CB   4  
ATOM 3278  C CG   . HIS A 1 44 ? -5.039  -6.994  2.318   1.00 0.00 ? 44 HIS A CG   4  
ATOM 3279  N ND1  . HIS A 1 44 ? -5.429  -8.268  1.936   1.00 0.00 ? 44 HIS A ND1  4  
ATOM 3280  C CD2  . HIS A 1 44 ? -5.875  -6.637  3.348   1.00 0.00 ? 44 HIS A CD2  4  
ATOM 3281  C CE1  . HIS A 1 44 ? -6.459  -8.629  2.723   1.00 0.00 ? 44 HIS A CE1  4  
ATOM 3282  N NE2  . HIS A 1 44 ? -6.771  -7.671  3.601   1.00 0.00 ? 44 HIS A NE2  4  
ATOM 3283  H H    . HIS A 1 44 ? -2.366  -5.202  -0.057  1.00 0.00 ? 44 HIS A H    4  
ATOM 3284  H HA   . HIS A 1 44 ? -4.900  -6.393  -0.241  1.00 0.00 ? 44 HIS A HA   4  
ATOM 3285  H HB2  . HIS A 1 44 ? -3.109  -6.964  1.430   1.00 0.00 ? 44 HIS A HB2  4  
ATOM 3286  H HB3  . HIS A 1 44 ? -3.536  -5.493  2.305   1.00 0.00 ? 44 HIS A HB3  4  
ATOM 3287  H HD2  . HIS A 1 44 ? -5.843  -5.697  3.878   1.00 0.00 ? 44 HIS A HD2  4  
ATOM 3288  H HE1  . HIS A 1 44 ? -6.971  -9.577  2.652   1.00 0.00 ? 44 HIS A HE1  4  
ATOM 3289  H HE2  . HIS A 1 44 ? -7.480  -7.693  4.278   1.00 0.00 ? 44 HIS A HE2  4  
ATOM 3290  N N    . ARG A 1 45 ? -4.863  -3.354  1.016   1.00 0.00 ? 45 ARG A N    4  
ATOM 3291  C CA   . ARG A 1 45 ? -5.709  -2.211  1.338   1.00 0.00 ? 45 ARG A CA   4  
ATOM 3292  C C    . ARG A 1 45 ? -6.557  -1.822  0.132   1.00 0.00 ? 45 ARG A C    4  
ATOM 3293  O O    . ARG A 1 45 ? -7.783  -1.752  0.220   1.00 0.00 ? 45 ARG A O    4  
ATOM 3294  C CB   . ARG A 1 45 ? -4.842  -1.025  1.762   1.00 0.00 ? 45 ARG A CB   4  
ATOM 3295  C CG   . ARG A 1 45 ? -5.726  0.204   1.986   1.00 0.00 ? 45 ARG A CG   4  
ATOM 3296  C CD   . ARG A 1 45 ? -4.925  1.287   2.711   1.00 0.00 ? 45 ARG A CD   4  
ATOM 3297  N NE   . ARG A 1 45 ? -5.698  2.520   2.786   1.00 0.00 ? 45 ARG A NE   4  
ATOM 3298  C CZ   . ARG A 1 45 ? -5.275  3.554   3.507   1.00 0.00 ? 45 ARG A CZ   4  
ATOM 3299  N NH1  . ARG A 1 45 ? -4.150  3.474   4.166   1.00 0.00 ? 45 ARG A NH1  4  
ATOM 3300  N NH2  . ARG A 1 45 ? -5.985  4.648   3.558   1.00 0.00 ? 45 ARG A NH2  4  
ATOM 3301  H H    . ARG A 1 45 ? -3.889  -3.259  1.058   1.00 0.00 ? 45 ARG A H    4  
ATOM 3302  H HA   . ARG A 1 45 ? -6.362  -2.477  2.155   1.00 0.00 ? 45 ARG A HA   4  
ATOM 3303  H HB2  . ARG A 1 45 ? -4.323  -1.268  2.679   1.00 0.00 ? 45 ARG A HB2  4  
ATOM 3304  H HB3  . ARG A 1 45 ? -4.120  -0.810  0.987   1.00 0.00 ? 45 ARG A HB3  4  
ATOM 3305  H HG2  . ARG A 1 45 ? -6.064  0.582   1.032   1.00 0.00 ? 45 ARG A HG2  4  
ATOM 3306  H HG3  . ARG A 1 45 ? -6.580  -0.073  2.587   1.00 0.00 ? 45 ARG A HG3  4  
ATOM 3307  H HD2  . ARG A 1 45 ? -4.692  0.951   3.710   1.00 0.00 ? 45 ARG A HD2  4  
ATOM 3308  H HD3  . ARG A 1 45 ? -4.006  1.470   2.173   1.00 0.00 ? 45 ARG A HD3  4  
ATOM 3309  H HE   . ARG A 1 45 ? -6.543  2.589   2.295   1.00 0.00 ? 45 ARG A HE   4  
ATOM 3310  H HH11 . ARG A 1 45 ? -3.607  2.636   4.127   1.00 0.00 ? 45 ARG A HH11 4  
ATOM 3311  H HH12 . ARG A 1 45 ? -3.832  4.251   4.708   1.00 0.00 ? 45 ARG A HH12 4  
ATOM 3312  H HH21 . ARG A 1 45 ? -6.846  4.708   3.054   1.00 0.00 ? 45 ARG A HH21 4  
ATOM 3313  H HH22 . ARG A 1 45 ? -5.667  5.426   4.101   1.00 0.00 ? 45 ARG A HH22 4  
ATOM 3314  N N    . ARG A 1 46 ? -5.897  -1.574  -0.994  1.00 0.00 ? 46 ARG A N    4  
ATOM 3315  C CA   . ARG A 1 46 ? -6.601  -1.196  -2.214  1.00 0.00 ? 46 ARG A CA   4  
ATOM 3316  C C    . ARG A 1 46 ? -7.602  -2.276  -2.608  1.00 0.00 ? 46 ARG A C    4  
ATOM 3317  O O    . ARG A 1 46 ? -8.717  -1.977  -3.037  1.00 0.00 ? 46 ARG A O    4  
ATOM 3318  C CB   . ARG A 1 46 ? -5.598  -0.986  -3.349  1.00 0.00 ? 46 ARG A CB   4  
ATOM 3319  C CG   . ARG A 1 46 ? -6.277  -0.241  -4.501  1.00 0.00 ? 46 ARG A CG   4  
ATOM 3320  C CD   . ARG A 1 46 ? -5.292  -0.080  -5.660  1.00 0.00 ? 46 ARG A CD   4  
ATOM 3321  N NE   . ARG A 1 46 ? -4.277  0.917   -5.327  1.00 0.00 ? 46 ARG A NE   4  
ATOM 3322  C CZ   . ARG A 1 46 ? -3.128  0.572   -4.753  1.00 0.00 ? 46 ARG A CZ   4  
ATOM 3323  N NH1  . ARG A 1 46 ? -2.887  -0.679  -4.467  1.00 0.00 ? 46 ARG A NH1  4  
ATOM 3324  N NH2  . ARG A 1 46 ? -2.240  1.486   -4.472  1.00 0.00 ? 46 ARG A NH2  4  
ATOM 3325  H H    . ARG A 1 46 ? -4.920  -1.647  -1.005  1.00 0.00 ? 46 ARG A H    4  
ATOM 3326  H HA   . ARG A 1 46 ? -7.131  -0.272  -2.040  1.00 0.00 ? 46 ARG A HA   4  
ATOM 3327  H HB2  . ARG A 1 46 ? -4.761  -0.405  -2.988  1.00 0.00 ? 46 ARG A HB2  4  
ATOM 3328  H HB3  . ARG A 1 46 ? -5.246  -1.943  -3.701  1.00 0.00 ? 46 ARG A HB3  4  
ATOM 3329  H HG2  . ARG A 1 46 ? -7.137  -0.804  -4.835  1.00 0.00 ? 46 ARG A HG2  4  
ATOM 3330  H HG3  . ARG A 1 46 ? -6.593  0.734   -4.161  1.00 0.00 ? 46 ARG A HG3  4  
ATOM 3331  H HD2  . ARG A 1 46 ? -4.813  -1.027  -5.858  1.00 0.00 ? 46 ARG A HD2  4  
ATOM 3332  H HD3  . ARG A 1 46 ? -5.830  0.237   -6.542  1.00 0.00 ? 46 ARG A HD3  4  
ATOM 3333  H HE   . ARG A 1 46 ? -4.446  1.860   -5.533  1.00 0.00 ? 46 ARG A HE   4  
ATOM 3334  H HH11 . ARG A 1 46 ? -3.567  -1.381  -4.679  1.00 0.00 ? 46 ARG A HH11 4  
ATOM 3335  H HH12 . ARG A 1 46 ? -2.022  -0.936  -4.036  1.00 0.00 ? 46 ARG A HH12 4  
ATOM 3336  H HH21 . ARG A 1 46 ? -2.425  2.444   -4.687  1.00 0.00 ? 46 ARG A HH21 4  
ATOM 3337  H HH22 . ARG A 1 46 ? -1.376  1.227   -4.040  1.00 0.00 ? 46 ARG A HH22 4  
ATOM 3338  N N    . LEU A 1 47 ? -7.198  -3.535  -2.461  1.00 0.00 ? 47 LEU A N    4  
ATOM 3339  C CA   . LEU A 1 47 ? -8.069  -4.652  -2.805  1.00 0.00 ? 47 LEU A CA   4  
ATOM 3340  C C    . LEU A 1 47 ? -9.382  -4.558  -2.032  1.00 0.00 ? 47 LEU A C    4  
ATOM 3341  O O    . LEU A 1 47 ? -10.462 -4.534  -2.623  1.00 0.00 ? 47 LEU A O    4  
ATOM 3342  C CB   . LEU A 1 47 ? -7.366  -5.978  -2.482  1.00 0.00 ? 47 LEU A CB   4  
ATOM 3343  C CG   . LEU A 1 47 ? -7.860  -7.090  -3.420  1.00 0.00 ? 47 LEU A CG   4  
ATOM 3344  C CD1  . LEU A 1 47 ? -9.389  -7.162  -3.378  1.00 0.00 ? 47 LEU A CD1  4  
ATOM 3345  C CD2  . LEU A 1 47 ? -7.397  -6.811  -4.861  1.00 0.00 ? 47 LEU A CD2  4  
ATOM 3346  H H    . LEU A 1 47 ? -6.299  -3.712  -2.114  1.00 0.00 ? 47 LEU A H    4  
ATOM 3347  H HA   . LEU A 1 47 ? -8.281  -4.612  -3.861  1.00 0.00 ? 47 LEU A HA   4  
ATOM 3348  H HB2  . LEU A 1 47 ? -6.300  -5.856  -2.604  1.00 0.00 ? 47 LEU A HB2  4  
ATOM 3349  H HB3  . LEU A 1 47 ? -7.576  -6.257  -1.460  1.00 0.00 ? 47 LEU A HB3  4  
ATOM 3350  H HG   . LEU A 1 47 ? -7.454  -8.036  -3.091  1.00 0.00 ? 47 LEU A HG   4  
ATOM 3351  H HD11 . LEU A 1 47 ? -9.805  -6.350  -3.955  1.00 0.00 ? 47 LEU A HD11 4  
ATOM 3352  H HD12 . LEU A 1 47 ? -9.726  -7.087  -2.355  1.00 0.00 ? 47 LEU A HD12 4  
ATOM 3353  H HD13 . LEU A 1 47 ? -9.717  -8.103  -3.795  1.00 0.00 ? 47 LEU A HD13 4  
ATOM 3354  H HD21 . LEU A 1 47 ? -8.171  -6.281  -5.397  1.00 0.00 ? 47 LEU A HD21 4  
ATOM 3355  H HD22 . LEU A 1 47 ? -7.195  -7.748  -5.358  1.00 0.00 ? 47 LEU A HD22 4  
ATOM 3356  H HD23 . LEU A 1 47 ? -6.497  -6.214  -4.845  1.00 0.00 ? 47 LEU A HD23 4  
ATOM 3357  N N    . LYS A 1 48 ? -9.281  -4.505  -0.708  1.00 0.00 ? 48 LYS A N    4  
ATOM 3358  C CA   . LYS A 1 48 ? -10.468 -4.412  0.137   1.00 0.00 ? 48 LYS A CA   4  
ATOM 3359  C C    . LYS A 1 48 ? -11.151 -3.062  -0.050  1.00 0.00 ? 48 LYS A C    4  
ATOM 3360  O O    . LYS A 1 48 ? -12.353 -2.992  -0.302  1.00 0.00 ? 48 LYS A O    4  
ATOM 3361  C CB   . LYS A 1 48 ? -10.080 -4.592  1.605   1.00 0.00 ? 48 LYS A CB   4  
ATOM 3362  C CG   . LYS A 1 48 ? -11.345 -4.773  2.450   1.00 0.00 ? 48 LYS A CG   4  
ATOM 3363  C CD   . LYS A 1 48 ? -10.976 -4.813  3.941   1.00 0.00 ? 48 LYS A CD   4  
ATOM 3364  C CE   . LYS A 1 48 ? -11.141 -3.419  4.557   1.00 0.00 ? 48 LYS A CE   4  
ATOM 3365  N NZ   . LYS A 1 48 ? -10.581 -2.395  3.631   1.00 0.00 ? 48 LYS A NZ   4  
ATOM 3366  H H    . LYS A 1 48 ? -8.394  -4.526  -0.291  1.00 0.00 ? 48 LYS A H    4  
ATOM 3367  H HA   . LYS A 1 48 ? -11.157 -5.196  -0.141  1.00 0.00 ? 48 LYS A HA   4  
ATOM 3368  H HB2  . LYS A 1 48 ? -9.450  -5.464  1.707   1.00 0.00 ? 48 LYS A HB2  4  
ATOM 3369  H HB3  . LYS A 1 48 ? -9.545  -3.719  1.945   1.00 0.00 ? 48 LYS A HB3  4  
ATOM 3370  H HG2  . LYS A 1 48 ? -12.022 -3.951  2.262   1.00 0.00 ? 48 LYS A HG2  4  
ATOM 3371  H HG3  . LYS A 1 48 ? -11.825 -5.701  2.176   1.00 0.00 ? 48 LYS A HG3  4  
ATOM 3372  H HD2  . LYS A 1 48 ? -11.627 -5.507  4.453   1.00 0.00 ? 48 LYS A HD2  4  
ATOM 3373  H HD3  . LYS A 1 48 ? -9.951  -5.135  4.055   1.00 0.00 ? 48 LYS A HD3  4  
ATOM 3374  H HE2  . LYS A 1 48 ? -12.190 -3.220  4.720   1.00 0.00 ? 48 LYS A HE2  4  
ATOM 3375  H HE3  . LYS A 1 48 ? -10.616 -3.379  5.499   1.00 0.00 ? 48 LYS A HE3  4  
ATOM 3376  H HZ1  . LYS A 1 48 ? -9.543  -2.437  3.654   1.00 0.00 ? 48 LYS A HZ1  4  
ATOM 3377  H HZ2  . LYS A 1 48 ? -10.894 -1.450  3.929   1.00 0.00 ? 48 LYS A HZ2  4  
ATOM 3378  H HZ3  . LYS A 1 48 ? -10.914 -2.582  2.663   1.00 0.00 ? 48 LYS A HZ3  4  
ATOM 3379  N N    . VAL A 1 49 ? -10.373 -1.990  0.077   1.00 0.00 ? 49 VAL A N    4  
ATOM 3380  C CA   . VAL A 1 49 ? -10.909 -0.644  -0.080  1.00 0.00 ? 49 VAL A CA   4  
ATOM 3381  C C    . VAL A 1 49 ? -11.638 -0.509  -1.413  1.00 0.00 ? 49 VAL A C    4  
ATOM 3382  O O    . VAL A 1 49 ? -12.729 0.056   -1.479  1.00 0.00 ? 49 VAL A O    4  
ATOM 3383  C CB   . VAL A 1 49 ? -9.773  0.378   -0.001  1.00 0.00 ? 49 VAL A CB   4  
ATOM 3384  C CG1  . VAL A 1 49 ? -10.287 1.759   -0.412  1.00 0.00 ? 49 VAL A CG1  4  
ATOM 3385  C CG2  . VAL A 1 49 ? -9.245  0.439   1.434   1.00 0.00 ? 49 VAL A CG2  4  
ATOM 3386  H H    . VAL A 1 49 ? -9.422  -2.109  0.278   1.00 0.00 ? 49 VAL A H    4  
ATOM 3387  H HA   . VAL A 1 49 ? -11.607 -0.451  0.722   1.00 0.00 ? 49 VAL A HA   4  
ATOM 3388  H HB   . VAL A 1 49 ? -8.976  0.079   -0.666  1.00 0.00 ? 49 VAL A HB   4  
ATOM 3389  H HG11 . VAL A 1 49 ? -10.404 1.795   -1.485  1.00 0.00 ? 49 VAL A HG11 4  
ATOM 3390  H HG12 . VAL A 1 49 ? -9.580  2.513   -0.102  1.00 0.00 ? 49 VAL A HG12 4  
ATOM 3391  H HG13 . VAL A 1 49 ? -11.240 1.944   0.061   1.00 0.00 ? 49 VAL A HG13 4  
ATOM 3392  H HG21 . VAL A 1 49 ? -9.060  -0.562  1.793   1.00 0.00 ? 49 VAL A HG21 4  
ATOM 3393  H HG22 . VAL A 1 49 ? -9.977  0.920   2.067   1.00 0.00 ? 49 VAL A HG22 4  
ATOM 3394  H HG23 . VAL A 1 49 ? -8.325  1.004   1.456   1.00 0.00 ? 49 VAL A HG23 4  
ATOM 3395  N N    . TYR A 1 50 ? -11.029 -1.033  -2.472  1.00 0.00 ? 50 TYR A N    4  
ATOM 3396  C CA   . TYR A 1 50 ? -11.631 -0.964  -3.799  1.00 0.00 ? 50 TYR A CA   4  
ATOM 3397  C C    . TYR A 1 50 ? -12.930 -1.766  -3.837  1.00 0.00 ? 50 TYR A C    4  
ATOM 3398  O O    . TYR A 1 50 ? -13.971 -1.256  -4.250  1.00 0.00 ? 50 TYR A O    4  
ATOM 3399  C CB   . TYR A 1 50 ? -10.659 -1.515  -4.844  1.00 0.00 ? 50 TYR A CB   4  
ATOM 3400  C CG   . TYR A 1 50 ? -11.308 -1.478  -6.207  1.00 0.00 ? 50 TYR A CG   4  
ATOM 3401  C CD1  . TYR A 1 50 ? -12.160 -2.516  -6.605  1.00 0.00 ? 50 TYR A CD1  4  
ATOM 3402  C CD2  . TYR A 1 50 ? -11.058 -0.407  -7.071  1.00 0.00 ? 50 TYR A CD2  4  
ATOM 3403  C CE1  . TYR A 1 50 ? -12.760 -2.483  -7.869  1.00 0.00 ? 50 TYR A CE1  4  
ATOM 3404  C CE2  . TYR A 1 50 ? -11.659 -0.373  -8.337  1.00 0.00 ? 50 TYR A CE2  4  
ATOM 3405  C CZ   . TYR A 1 50 ? -12.511 -1.410  -8.734  1.00 0.00 ? 50 TYR A CZ   4  
ATOM 3406  O OH   . TYR A 1 50 ? -13.102 -1.378  -9.980  1.00 0.00 ? 50 TYR A OH   4  
ATOM 3407  H H    . TYR A 1 50 ? -10.161 -1.474  -2.358  1.00 0.00 ? 50 TYR A H    4  
ATOM 3408  H HA   . TYR A 1 50 ? -11.849 0.066   -4.033  1.00 0.00 ? 50 TYR A HA   4  
ATOM 3409  H HB2  . TYR A 1 50 ? -9.763  -0.909  -4.855  1.00 0.00 ? 50 TYR A HB2  4  
ATOM 3410  H HB3  . TYR A 1 50 ? -10.403 -2.534  -4.594  1.00 0.00 ? 50 TYR A HB3  4  
ATOM 3411  H HD1  . TYR A 1 50 ? -12.352 -3.343  -5.937  1.00 0.00 ? 50 TYR A HD1  4  
ATOM 3412  H HD2  . TYR A 1 50 ? -10.403 0.394   -6.764  1.00 0.00 ? 50 TYR A HD2  4  
ATOM 3413  H HE1  . TYR A 1 50 ? -13.416 -3.284  -8.177  1.00 0.00 ? 50 TYR A HE1  4  
ATOM 3414  H HE2  . TYR A 1 50 ? -11.467 0.455   -9.004  1.00 0.00 ? 50 TYR A HE2  4  
ATOM 3415  H HH   . TYR A 1 50 ? -13.815 -2.021  -9.988  1.00 0.00 ? 50 TYR A HH   4  
ATOM 3416  N N    . HIS A 1 51 ? -12.859 -3.019  -3.403  1.00 0.00 ? 51 HIS A N    4  
ATOM 3417  C CA   . HIS A 1 51 ? -14.036 -3.881  -3.391  1.00 0.00 ? 51 HIS A CA   4  
ATOM 3418  C C    . HIS A 1 51 ? -15.138 -3.267  -2.535  1.00 0.00 ? 51 HIS A C    4  
ATOM 3419  O O    . HIS A 1 51 ? -16.324 -3.454  -2.803  1.00 0.00 ? 51 HIS A O    4  
ATOM 3420  C CB   . HIS A 1 51 ? -13.669 -5.261  -2.842  1.00 0.00 ? 51 HIS A CB   4  
ATOM 3421  C CG   . HIS A 1 51 ? -14.816 -6.208  -3.057  1.00 0.00 ? 51 HIS A CG   4  
ATOM 3422  N ND1  . HIS A 1 51 ? -15.957 -6.178  -2.270  1.00 0.00 ? 51 HIS A ND1  4  
ATOM 3423  C CD2  . HIS A 1 51 ? -15.015 -7.218  -3.966  1.00 0.00 ? 51 HIS A CD2  4  
ATOM 3424  C CE1  . HIS A 1 51 ? -16.783 -7.142  -2.715  1.00 0.00 ? 51 HIS A CE1  4  
ATOM 3425  N NE2  . HIS A 1 51 ? -16.257 -7.806  -3.748  1.00 0.00 ? 51 HIS A NE2  4  
ATOM 3426  H H    . HIS A 1 51 ? -12.002 -3.371  -3.085  1.00 0.00 ? 51 HIS A H    4  
ATOM 3427  H HA   . HIS A 1 51 ? -14.398 -3.993  -4.402  1.00 0.00 ? 51 HIS A HA   4  
ATOM 3428  H HB2  . HIS A 1 51 ? -12.794 -5.632  -3.356  1.00 0.00 ? 51 HIS A HB2  4  
ATOM 3429  H HB3  . HIS A 1 51 ? -13.459 -5.184  -1.786  1.00 0.00 ? 51 HIS A HB3  4  
ATOM 3430  H HD2  . HIS A 1 51 ? -14.315 -7.510  -4.733  1.00 0.00 ? 51 HIS A HD2  4  
ATOM 3431  H HE1  . HIS A 1 51 ? -17.753 -7.352  -2.290  1.00 0.00 ? 51 HIS A HE1  4  
ATOM 3432  H HE2  . HIS A 1 51 ? -16.660 -8.549  -4.246  1.00 0.00 ? 51 HIS A HE2  4  
ATOM 3433  N N    . ALA A 1 52 ? -14.738 -2.533  -1.501  1.00 0.00 ? 52 ALA A N    4  
ATOM 3434  C CA   . ALA A 1 52 ? -15.700 -1.894  -0.612  1.00 0.00 ? 52 ALA A CA   4  
ATOM 3435  C C    . ALA A 1 52 ? -16.257 -0.624  -1.248  1.00 0.00 ? 52 ALA A C    4  
ATOM 3436  O O    . ALA A 1 52 ? -17.450 -0.534  -1.534  1.00 0.00 ? 52 ALA A O    4  
ATOM 3437  C CB   . ALA A 1 52 ? -15.032 -1.549  0.720   1.00 0.00 ? 52 ALA A CB   4  
ATOM 3438  H H    . ALA A 1 52 ? -13.779 -2.417  -1.336  1.00 0.00 ? 52 ALA A H    4  
ATOM 3439  H HA   . ALA A 1 52 ? -16.513 -2.579  -0.425  1.00 0.00 ? 52 ALA A HA   4  
ATOM 3440  H HB1  . ALA A 1 52 ? -14.490 -2.408  1.085   1.00 0.00 ? 52 ALA A HB1  4  
ATOM 3441  H HB2  . ALA A 1 52 ? -15.786 -1.267  1.439   1.00 0.00 ? 52 ALA A HB2  4  
ATOM 3442  H HB3  . ALA A 1 52 ? -14.346 -0.726  0.576   1.00 0.00 ? 52 ALA A HB3  4  
ATOM 3443  N N    . TRP A 1 53 ? -15.382 0.352   -1.469  1.00 0.00 ? 53 TRP A N    4  
ATOM 3444  C CA   . TRP A 1 53 ? -15.798 1.613   -2.074  1.00 0.00 ? 53 TRP A CA   4  
ATOM 3445  C C    . TRP A 1 53 ? -16.650 1.353   -3.312  1.00 0.00 ? 53 TRP A C    4  
ATOM 3446  O O    . TRP A 1 53 ? -17.767 1.858   -3.427  1.00 0.00 ? 53 TRP A O    4  
ATOM 3447  C CB   . TRP A 1 53 ? -14.566 2.438   -2.461  1.00 0.00 ? 53 TRP A CB   4  
ATOM 3448  C CG   . TRP A 1 53 ? -13.983 3.083   -1.243  1.00 0.00 ? 53 TRP A CG   4  
ATOM 3449  C CD1  . TRP A 1 53 ? -14.135 2.634   0.026   1.00 0.00 ? 53 TRP A CD1  4  
ATOM 3450  C CD2  . TRP A 1 53 ? -13.162 4.284   -1.157  1.00 0.00 ? 53 TRP A CD2  4  
ATOM 3451  N NE1  . TRP A 1 53 ? -13.457 3.484   0.883   1.00 0.00 ? 53 TRP A NE1  4  
ATOM 3452  C CE2  . TRP A 1 53 ? -12.842 4.515   0.202   1.00 0.00 ? 53 TRP A CE2  4  
ATOM 3453  C CE3  . TRP A 1 53 ? -12.668 5.186   -2.118  1.00 0.00 ? 53 TRP A CE3  4  
ATOM 3454  C CZ2  . TRP A 1 53 ? -12.061 5.603   0.594   1.00 0.00 ? 53 TRP A CZ2  4  
ATOM 3455  C CZ3  . TRP A 1 53 ? -11.881 6.281   -1.726  1.00 0.00 ? 53 TRP A CZ3  4  
ATOM 3456  C CH2  . TRP A 1 53 ? -11.578 6.489   -0.372  1.00 0.00 ? 53 TRP A CH2  4  
ATOM 3457  H H    . TRP A 1 53 ? -14.443 0.223   -1.221  1.00 0.00 ? 53 TRP A H    4  
ATOM 3458  H HA   . TRP A 1 53 ? -16.382 2.170   -1.358  1.00 0.00 ? 53 TRP A HA   4  
ATOM 3459  H HB2  . TRP A 1 53 ? -13.829 1.790   -2.913  1.00 0.00 ? 53 TRP A HB2  4  
ATOM 3460  H HB3  . TRP A 1 53 ? -14.854 3.201   -3.170  1.00 0.00 ? 53 TRP A HB3  4  
ATOM 3461  H HD1  . TRP A 1 53 ? -14.692 1.759   0.320   1.00 0.00 ? 53 TRP A HD1  4  
ATOM 3462  H HE1  . TRP A 1 53 ? -13.408 3.383   1.857   1.00 0.00 ? 53 TRP A HE1  4  
ATOM 3463  H HE3  . TRP A 1 53 ? -12.895 5.034   -3.162  1.00 0.00 ? 53 TRP A HE3  4  
ATOM 3464  H HZ2  . TRP A 1 53 ? -11.830 5.757   1.638   1.00 0.00 ? 53 TRP A HZ2  4  
ATOM 3465  H HZ3  . TRP A 1 53 ? -11.508 6.968   -2.471  1.00 0.00 ? 53 TRP A HZ3  4  
ATOM 3466  H HH2  . TRP A 1 53 ? -10.971 7.333   -0.077  1.00 0.00 ? 53 TRP A HH2  4  
ATOM 3467  N N    . LYS A 1 54 ? -16.117 0.558   -4.235  1.00 0.00 ? 54 LYS A N    4  
ATOM 3468  C CA   . LYS A 1 54 ? -16.839 0.236   -5.460  1.00 0.00 ? 54 LYS A CA   4  
ATOM 3469  C C    . LYS A 1 54 ? -17.443 1.496   -6.073  1.00 0.00 ? 54 LYS A C    4  
ATOM 3470  O O    . LYS A 1 54 ? -18.544 1.908   -5.704  1.00 0.00 ? 54 LYS A O    4  
ATOM 3471  C CB   . LYS A 1 54 ? -17.947 -0.779  -5.159  1.00 0.00 ? 54 LYS A CB   4  
ATOM 3472  C CG   . LYS A 1 54 ? -18.286 -1.573  -6.425  1.00 0.00 ? 54 LYS A CG   4  
ATOM 3473  C CD   . LYS A 1 54 ? -18.811 -0.622  -7.506  1.00 0.00 ? 54 LYS A CD   4  
ATOM 3474  C CE   . LYS A 1 54 ? -19.619 -1.415  -8.537  1.00 0.00 ? 54 LYS A CE   4  
ATOM 3475  N NZ   . LYS A 1 54 ? -20.125 -0.489  -9.589  1.00 0.00 ? 54 LYS A NZ   4  
ATOM 3476  H H    . LYS A 1 54 ? -15.224 0.183   -4.089  1.00 0.00 ? 54 LYS A H    4  
ATOM 3477  H HA   . LYS A 1 54 ? -16.147 -0.199  -6.167  1.00 0.00 ? 54 LYS A HA   4  
ATOM 3478  H HB2  . LYS A 1 54 ? -17.611 -1.459  -4.389  1.00 0.00 ? 54 LYS A HB2  4  
ATOM 3479  H HB3  . LYS A 1 54 ? -18.830 -0.258  -4.818  1.00 0.00 ? 54 LYS A HB3  4  
ATOM 3480  H HG2  . LYS A 1 54 ? -17.398 -2.071  -6.785  1.00 0.00 ? 54 LYS A HG2  4  
ATOM 3481  H HG3  . LYS A 1 54 ? -19.043 -2.307  -6.197  1.00 0.00 ? 54 LYS A HG3  4  
ATOM 3482  H HD2  . LYS A 1 54 ? -19.443 0.128   -7.052  1.00 0.00 ? 54 LYS A HD2  4  
ATOM 3483  H HD3  . LYS A 1 54 ? -17.980 -0.143  -7.998  1.00 0.00 ? 54 LYS A HD3  4  
ATOM 3484  H HE2  . LYS A 1 54 ? -18.988 -2.165  -8.989  1.00 0.00 ? 54 LYS A HE2  4  
ATOM 3485  H HE3  . LYS A 1 54 ? -20.454 -1.894  -8.047  1.00 0.00 ? 54 LYS A HE3  4  
ATOM 3486  H HZ1  . LYS A 1 54 ? -20.017 -0.934  -10.522 1.00 0.00 ? 54 LYS A HZ1  4  
ATOM 3487  H HZ2  . LYS A 1 54 ? -19.580 0.396   -9.564  1.00 0.00 ? 54 LYS A HZ2  4  
ATOM 3488  H HZ3  . LYS A 1 54 ? -21.130 -0.284  -9.416  1.00 0.00 ? 54 LYS A HZ3  4  
ATOM 3489  N N    . SER A 1 55 ? -16.716 2.102   -7.008  1.00 0.00 ? 55 SER A N    4  
ATOM 3490  C CA   . SER A 1 55 ? -17.185 3.316   -7.671  1.00 0.00 ? 55 SER A CA   4  
ATOM 3491  C C    . SER A 1 55 ? -17.398 3.063   -9.160  1.00 0.00 ? 55 SER A C    4  
ATOM 3492  O O    . SER A 1 55 ? -18.399 2.472   -9.562  1.00 0.00 ? 55 SER A O    4  
ATOM 3493  C CB   . SER A 1 55 ? -16.164 4.438   -7.484  1.00 0.00 ? 55 SER A CB   4  
ATOM 3494  O OG   . SER A 1 55 ? -16.159 4.847   -6.123  1.00 0.00 ? 55 SER A OG   4  
ATOM 3495  H H    . SER A 1 55 ? -15.847 1.723   -7.258  1.00 0.00 ? 55 SER A H    4  
ATOM 3496  H HA   . SER A 1 55 ? -18.123 3.622   -7.231  1.00 0.00 ? 55 SER A HA   4  
ATOM 3497  H HB2  . SER A 1 55 ? -15.182 4.083   -7.752  1.00 0.00 ? 55 SER A HB2  4  
ATOM 3498  H HB3  . SER A 1 55 ? -16.428 5.273   -8.121  1.00 0.00 ? 55 SER A HB3  4  
ATOM 3499  H HG   . SER A 1 55 ? -15.374 5.379   -5.976  1.00 0.00 ? 55 SER A HG   4  
ATOM 3500  N N    . LYS A 1 56 ? -16.449 3.515   -9.975  1.00 0.00 ? 56 LYS A N    4  
ATOM 3501  C CA   . LYS A 1 56 ? -16.544 3.332   -11.418 1.00 0.00 ? 56 LYS A CA   4  
ATOM 3502  C C    . LYS A 1 56 ? -17.867 3.880   -11.941 1.00 0.00 ? 56 LYS A C    4  
ATOM 3503  O O    . LYS A 1 56 ? -18.504 3.276   -12.803 1.00 0.00 ? 56 LYS A O    4  
ATOM 3504  C CB   . LYS A 1 56 ? -16.435 1.845   -11.767 1.00 0.00 ? 56 LYS A CB   4  
ATOM 3505  C CG   . LYS A 1 56 ? -15.199 1.239   -11.092 1.00 0.00 ? 56 LYS A CG   4  
ATOM 3506  C CD   . LYS A 1 56 ? -13.918 1.830   -11.706 1.00 0.00 ? 56 LYS A CD   4  
ATOM 3507  C CE   . LYS A 1 56 ? -13.313 2.863   -10.751 1.00 0.00 ? 56 LYS A CE   4  
ATOM 3508  N NZ   . LYS A 1 56 ? -12.349 3.724   -11.494 1.00 0.00 ? 56 LYS A NZ   4  
ATOM 3509  H H    . LYS A 1 56 ? -15.673 3.980   -9.598  1.00 0.00 ? 56 LYS A H    4  
ATOM 3510  H HA   . LYS A 1 56 ? -15.732 3.862   -11.895 1.00 0.00 ? 56 LYS A HA   4  
ATOM 3511  H HB2  . LYS A 1 56 ? -17.320 1.332   -11.420 1.00 0.00 ? 56 LYS A HB2  4  
ATOM 3512  H HB3  . LYS A 1 56 ? -16.350 1.732   -12.837 1.00 0.00 ? 56 LYS A HB3  4  
ATOM 3513  H HG2  . LYS A 1 56 ? -15.228 1.453   -10.034 1.00 0.00 ? 56 LYS A HG2  4  
ATOM 3514  H HG3  . LYS A 1 56 ? -15.203 0.168   -11.239 1.00 0.00 ? 56 LYS A HG3  4  
ATOM 3515  H HD2  . LYS A 1 56 ? -13.201 1.038   -11.874 1.00 0.00 ? 56 LYS A HD2  4  
ATOM 3516  H HD3  . LYS A 1 56 ? -14.148 2.308   -12.647 1.00 0.00 ? 56 LYS A HD3  4  
ATOM 3517  H HE2  . LYS A 1 56 ? -14.099 3.477   -10.340 1.00 0.00 ? 56 LYS A HE2  4  
ATOM 3518  H HE3  . LYS A 1 56 ? -12.797 2.354   -9.950  1.00 0.00 ? 56 LYS A HE3  4  
ATOM 3519  H HZ1  . LYS A 1 56 ? -11.909 4.398   -10.837 1.00 0.00 ? 56 LYS A HZ1  4  
ATOM 3520  H HZ2  . LYS A 1 56 ? -12.853 4.245   -12.239 1.00 0.00 ? 56 LYS A HZ2  4  
ATOM 3521  H HZ3  . LYS A 1 56 ? -11.613 3.126   -11.924 1.00 0.00 ? 56 LYS A HZ3  4  
ATOM 3522  N N    . ASN A 1 57 ? -18.274 5.030   -11.413 1.00 0.00 ? 57 ASN A N    4  
ATOM 3523  C CA   . ASN A 1 57 ? -19.525 5.653   -11.834 1.00 0.00 ? 57 ASN A CA   4  
ATOM 3524  C C    . ASN A 1 57 ? -20.680 4.662   -11.719 1.00 0.00 ? 57 ASN A C    4  
ATOM 3525  O O    . ASN A 1 57 ? -20.934 3.880   -12.635 1.00 0.00 ? 57 ASN A O    4  
ATOM 3526  C CB   . ASN A 1 57 ? -19.407 6.136   -13.280 1.00 0.00 ? 57 ASN A CB   4  
ATOM 3527  C CG   . ASN A 1 57 ? -18.503 7.363   -13.347 1.00 0.00 ? 57 ASN A CG   4  
ATOM 3528  O OD1  . ASN A 1 57 ? -17.323 7.248   -13.681 1.00 0.00 ? 57 ASN A OD1  4  
ATOM 3529  N ND2  . ASN A 1 57 ? -18.988 8.537   -13.049 1.00 0.00 ? 57 ASN A ND2  4  
ATOM 3530  H H    . ASN A 1 57 ? -17.725 5.468   -10.729 1.00 0.00 ? 57 ASN A H    4  
ATOM 3531  H HA   . ASN A 1 57 ? -19.725 6.501   -11.197 1.00 0.00 ? 57 ASN A HA   4  
ATOM 3532  H HB2  . ASN A 1 57 ? -18.988 5.348   -13.889 1.00 0.00 ? 57 ASN A HB2  4  
ATOM 3533  H HB3  . ASN A 1 57 ? -20.386 6.393   -13.653 1.00 0.00 ? 57 ASN A HB3  4  
ATOM 3534  H HD21 . ASN A 1 57 ? -19.927 8.627   -12.783 1.00 0.00 ? 57 ASN A HD21 4  
ATOM 3535  H HD22 . ASN A 1 57 ? -18.414 9.329   -13.089 1.00 0.00 ? 57 ASN A HD22 4  
ATOM 3536  N N    . LYS A 1 58 ? -21.374 4.701   -10.586 1.00 0.00 ? 58 LYS A N    4  
ATOM 3537  C CA   . LYS A 1 58 ? -22.500 3.802   -10.359 1.00 0.00 ? 58 LYS A CA   4  
ATOM 3538  C C    . LYS A 1 58 ? -23.585 4.025   -11.409 1.00 0.00 ? 58 LYS A C    4  
ATOM 3539  O O    . LYS A 1 58 ? -23.298 4.113   -12.604 1.00 0.00 ? 58 LYS A O    4  
ATOM 3540  C CB   . LYS A 1 58 ? -23.081 4.035   -8.963  1.00 0.00 ? 58 LYS A CB   4  
ATOM 3541  C CG   . LYS A 1 58 ? -21.986 3.833   -7.914  1.00 0.00 ? 58 LYS A CG   4  
ATOM 3542  C CD   . LYS A 1 58 ? -22.528 4.198   -6.531  1.00 0.00 ? 58 LYS A CD   4  
ATOM 3543  C CE   . LYS A 1 58 ? -21.447 3.957   -5.477  1.00 0.00 ? 58 LYS A CE   4  
ATOM 3544  N NZ   . LYS A 1 58 ? -20.873 2.593   -5.658  1.00 0.00 ? 58 LYS A NZ   4  
ATOM 3545  H H    . LYS A 1 58 ? -21.125 5.346   -9.892  1.00 0.00 ? 58 LYS A H    4  
ATOM 3546  H HA   . LYS A 1 58 ? -22.152 2.782   -10.426 1.00 0.00 ? 58 LYS A HA   4  
ATOM 3547  H HB2  . LYS A 1 58 ? -23.463 5.042   -8.896  1.00 0.00 ? 58 LYS A HB2  4  
ATOM 3548  H HB3  . LYS A 1 58 ? -23.881 3.333   -8.783  1.00 0.00 ? 58 LYS A HB3  4  
ATOM 3549  H HG2  . LYS A 1 58 ? -21.672 2.799   -7.918  1.00 0.00 ? 58 LYS A HG2  4  
ATOM 3550  H HG3  . LYS A 1 58 ? -21.143 4.467   -8.146  1.00 0.00 ? 58 LYS A HG3  4  
ATOM 3551  H HD2  . LYS A 1 58 ? -22.817 5.240   -6.521  1.00 0.00 ? 58 LYS A HD2  4  
ATOM 3552  H HD3  . LYS A 1 58 ? -23.389 3.584   -6.308  1.00 0.00 ? 58 LYS A HD3  4  
ATOM 3553  H HE2  . LYS A 1 58 ? -20.666 4.694   -5.588  1.00 0.00 ? 58 LYS A HE2  4  
ATOM 3554  H HE3  . LYS A 1 58 ? -21.881 4.036   -4.491  1.00 0.00 ? 58 LYS A HE3  4  
ATOM 3555  H HZ1  . LYS A 1 58 ? -20.332 2.329   -4.810  1.00 0.00 ? 58 LYS A HZ1  4  
ATOM 3556  H HZ2  . LYS A 1 58 ? -20.240 2.589   -6.483  1.00 0.00 ? 58 LYS A HZ2  4  
ATOM 3557  H HZ3  . LYS A 1 58 ? -21.643 1.910   -5.806  1.00 0.00 ? 58 LYS A HZ3  4  
ATOM 3558  N N    . LYS A 1 59 ? -24.831 4.113   -10.956 1.00 0.00 ? 59 LYS A N    4  
ATOM 3559  C CA   . LYS A 1 59 ? -25.952 4.325   -11.865 1.00 0.00 ? 59 LYS A CA   4  
ATOM 3560  C C    . LYS A 1 59 ? -25.890 5.719   -12.480 1.00 0.00 ? 59 LYS A C    4  
ATOM 3561  O O    . LYS A 1 59 ? -25.048 6.536   -12.107 1.00 0.00 ? 59 LYS A O    4  
ATOM 3562  C CB   . LYS A 1 59 ? -27.273 4.157   -11.112 1.00 0.00 ? 59 LYS A CB   4  
ATOM 3563  C CG   . LYS A 1 59 ? -27.240 4.992   -9.830  1.00 0.00 ? 59 LYS A CG   4  
ATOM 3564  C CD   . LYS A 1 59 ? -28.659 5.131   -9.274  1.00 0.00 ? 59 LYS A CD   4  
ATOM 3565  C CE   . LYS A 1 59 ? -28.595 5.704   -7.857  1.00 0.00 ? 59 LYS A CE   4  
ATOM 3566  N NZ   . LYS A 1 59 ? -27.499 6.710   -7.774  1.00 0.00 ? 59 LYS A NZ   4  
ATOM 3567  H H    . LYS A 1 59 ? -25.000 4.036   -9.995  1.00 0.00 ? 59 LYS A H    4  
ATOM 3568  H HA   . LYS A 1 59 ? -25.907 3.591   -12.655 1.00 0.00 ? 59 LYS A HA   4  
ATOM 3569  H HB2  . LYS A 1 59 ? -28.089 4.488   -11.739 1.00 0.00 ? 59 LYS A HB2  4  
ATOM 3570  H HB3  . LYS A 1 59 ? -27.413 3.117   -10.858 1.00 0.00 ? 59 LYS A HB3  4  
ATOM 3571  H HG2  . LYS A 1 59 ? -26.611 4.503   -9.100  1.00 0.00 ? 59 LYS A HG2  4  
ATOM 3572  H HG3  . LYS A 1 59 ? -26.843 5.972   -10.049 1.00 0.00 ? 59 LYS A HG3  4  
ATOM 3573  H HD2  . LYS A 1 59 ? -29.228 5.795   -9.906  1.00 0.00 ? 59 LYS A HD2  4  
ATOM 3574  H HD3  . LYS A 1 59 ? -29.131 4.161   -9.249  1.00 0.00 ? 59 LYS A HD3  4  
ATOM 3575  H HE2  . LYS A 1 59 ? -29.537 6.175   -7.616  1.00 0.00 ? 59 LYS A HE2  4  
ATOM 3576  H HE3  . LYS A 1 59 ? -28.405 4.906   -7.154  1.00 0.00 ? 59 LYS A HE3  4  
ATOM 3577  H HZ1  . LYS A 1 59 ? -27.575 7.234   -6.880  1.00 0.00 ? 59 LYS A HZ1  4  
ATOM 3578  H HZ2  . LYS A 1 59 ? -27.579 7.375   -8.570  1.00 0.00 ? 59 LYS A HZ2  4  
ATOM 3579  H HZ3  . LYS A 1 59 ? -26.580 6.226   -7.816  1.00 0.00 ? 59 LYS A HZ3  4  
ATOM 3580  N N    . ARG A 1 60 ? -26.787 5.985   -13.424 1.00 0.00 ? 60 ARG A N    4  
ATOM 3581  C CA   . ARG A 1 60 ? -26.831 7.285   -14.089 1.00 0.00 ? 60 ARG A CA   4  
ATOM 3582  C C    . ARG A 1 60 ? -28.037 8.090   -13.614 1.00 0.00 ? 60 ARG A C    4  
ATOM 3583  O O    . ARG A 1 60 ? -28.199 9.206   -14.078 1.00 0.00 ? 60 ARG A O    4  
ATOM 3584  C CB   . ARG A 1 60 ? -26.911 7.092   -15.606 1.00 0.00 ? 60 ARG A CB   4  
ATOM 3585  C CG   . ARG A 1 60 ? -25.564 6.588   -16.128 1.00 0.00 ? 60 ARG A CG   4  
ATOM 3586  C CD   . ARG A 1 60 ? -25.712 6.155   -17.587 1.00 0.00 ? 60 ARG A CD   4  
ATOM 3587  N NE   . ARG A 1 60 ? -26.417 4.882   -17.668 1.00 0.00 ? 60 ARG A NE   4  
ATOM 3588  C CZ   . ARG A 1 60 ? -25.844 3.751   -17.269 1.00 0.00 ? 60 ARG A CZ   4  
ATOM 3589  N NH1  . ARG A 1 60 ? -24.627 3.767   -16.797 1.00 0.00 ? 60 ARG A NH1  4  
ATOM 3590  N NH2  . ARG A 1 60 ? -26.498 2.625   -17.348 1.00 0.00 ? 60 ARG A NH2  4  
ATOM 3591  O OXT  . ARG A 1 60 ? -28.781 7.576   -12.795 1.00 0.00 ? 60 ARG A OXT  4  
ATOM 3592  H H    . ARG A 1 60 ? -27.434 5.294   -13.681 1.00 0.00 ? 60 ARG A H    4  
ATOM 3593  H HA   . ARG A 1 60 ? -25.930 7.834   -13.856 1.00 0.00 ? 60 ARG A HA   4  
ATOM 3594  H HB2  . ARG A 1 60 ? -27.681 6.370   -15.836 1.00 0.00 ? 60 ARG A HB2  4  
ATOM 3595  H HB3  . ARG A 1 60 ? -27.148 8.034   -16.077 1.00 0.00 ? 60 ARG A HB3  4  
ATOM 3596  H HG2  . ARG A 1 60 ? -24.832 7.380   -16.058 1.00 0.00 ? 60 ARG A HG2  4  
ATOM 3597  H HG3  . ARG A 1 60 ? -25.241 5.745   -15.536 1.00 0.00 ? 60 ARG A HG3  4  
ATOM 3598  H HD2  . ARG A 1 60 ? -26.267 6.906   -18.129 1.00 0.00 ? 60 ARG A HD2  4  
ATOM 3599  H HD3  . ARG A 1 60 ? -24.731 6.051   -18.029 1.00 0.00 ? 60 ARG A HD3  4  
ATOM 3600  H HE   . ARG A 1 60 ? -27.332 4.859   -18.020 1.00 0.00 ? 60 ARG A HE   4  
ATOM 3601  H HH11 . ARG A 1 60 ? -24.127 4.632   -16.736 1.00 0.00 ? 60 ARG A HH11 4  
ATOM 3602  H HH12 . ARG A 1 60 ? -24.195 2.917   -16.496 1.00 0.00 ? 60 ARG A HH12 4  
ATOM 3603  H HH21 . ARG A 1 60 ? -27.430 2.611   -17.709 1.00 0.00 ? 60 ARG A HH21 4  
ATOM 3604  H HH22 . ARG A 1 60 ? -26.066 1.774   -17.047 1.00 0.00 ? 60 ARG A HH22 4  
ATOM 3605  N N    . GLY A 1 9  ? 14.539  10.630  12.496  1.00 0.00 ? 9  GLY A N    5  
ATOM 3606  C CA   . GLY A 1 9  ? 13.619  11.030  11.438  1.00 0.00 ? 9  GLY A CA   5  
ATOM 3607  C C    . GLY A 1 9  ? 12.483  10.023  11.293  1.00 0.00 ? 9  GLY A C    5  
ATOM 3608  O O    . GLY A 1 9  ? 11.749  9.760   12.245  1.00 0.00 ? 9  GLY A O    5  
ATOM 3609  H H    . GLY A 1 9  ? 15.374  10.176  12.261  1.00 0.00 ? 9  GLY A H    5  
ATOM 3610  H HA2  . GLY A 1 9  ? 13.207  12.000  11.675  1.00 0.00 ? 9  GLY A HA2  5  
ATOM 3611  H HA3  . GLY A 1 9  ? 14.157  11.091  10.505  1.00 0.00 ? 9  GLY A HA3  5  
ATOM 3612  N N    . THR A 1 10 ? 12.345  9.464   10.096  1.00 0.00 ? 10 THR A N    5  
ATOM 3613  C CA   . THR A 1 10 ? 11.293  8.487   9.837   1.00 0.00 ? 10 THR A CA   5  
ATOM 3614  C C    . THR A 1 10 ? 11.665  7.131   10.429  1.00 0.00 ? 10 THR A C    5  
ATOM 3615  O O    . THR A 1 10 ? 12.755  6.958   10.973  1.00 0.00 ? 10 THR A O    5  
ATOM 3616  C CB   . THR A 1 10 ? 11.071  8.344   8.330   1.00 0.00 ? 10 THR A CB   5  
ATOM 3617  O OG1  . THR A 1 10 ? 9.998   7.443   8.094   1.00 0.00 ? 10 THR A OG1  5  
ATOM 3618  C CG2  . THR A 1 10 ? 12.344  7.808   7.673   1.00 0.00 ? 10 THR A CG2  5  
ATOM 3619  H H    . THR A 1 10 ? 12.958  9.713   9.374   1.00 0.00 ? 10 THR A H    5  
ATOM 3620  H HA   . THR A 1 10 ? 10.377  8.828   10.293  1.00 0.00 ? 10 THR A HA   5  
ATOM 3621  H HB   . THR A 1 10 ? 10.832  9.309   7.909   1.00 0.00 ? 10 THR A HB   5  
ATOM 3622  H HG1  . THR A 1 10 ? 9.213   7.961   7.899   1.00 0.00 ? 10 THR A HG1  5  
ATOM 3623  H HG21 . THR A 1 10 ? 12.244  7.860   6.598   1.00 0.00 ? 10 THR A HG21 5  
ATOM 3624  H HG22 . THR A 1 10 ? 12.498  6.782   7.971   1.00 0.00 ? 10 THR A HG22 5  
ATOM 3625  H HG23 . THR A 1 10 ? 13.189  8.405   7.985   1.00 0.00 ? 10 THR A HG23 5  
ATOM 3626  N N    . LYS A 1 11 ? 10.752  6.172   10.318  1.00 0.00 ? 11 LYS A N    5  
ATOM 3627  C CA   . LYS A 1 11 ? 10.993  4.835   10.846  1.00 0.00 ? 11 LYS A CA   5  
ATOM 3628  C C    . LYS A 1 11 ? 11.901  4.044   9.907   1.00 0.00 ? 11 LYS A C    5  
ATOM 3629  O O    . LYS A 1 11 ? 13.125  4.176   9.955   1.00 0.00 ? 11 LYS A O    5  
ATOM 3630  C CB   . LYS A 1 11 ? 9.662   4.095   11.019  1.00 0.00 ? 11 LYS A CB   5  
ATOM 3631  C CG   . LYS A 1 11 ? 8.753   4.360   9.809   1.00 0.00 ? 11 LYS A CG   5  
ATOM 3632  C CD   . LYS A 1 11 ? 7.738   5.455   10.153  1.00 0.00 ? 11 LYS A CD   5  
ATOM 3633  C CE   . LYS A 1 11 ? 6.934   5.817   8.902   1.00 0.00 ? 11 LYS A CE   5  
ATOM 3634  N NZ   . LYS A 1 11 ? 5.970   4.722   8.597   1.00 0.00 ? 11 LYS A NZ   5  
ATOM 3635  H H    . LYS A 1 11 ? 9.901   6.366   9.874   1.00 0.00 ? 11 LYS A H    5  
ATOM 3636  H HA   . LYS A 1 11 ? 11.473  4.919   11.809  1.00 0.00 ? 11 LYS A HA   5  
ATOM 3637  H HB2  . LYS A 1 11 ? 9.851   3.034   11.104  1.00 0.00 ? 11 LYS A HB2  5  
ATOM 3638  H HB3  . LYS A 1 11 ? 9.176   4.443   11.917  1.00 0.00 ? 11 LYS A HB3  5  
ATOM 3639  H HG2  . LYS A 1 11 ? 9.352   4.678   8.967   1.00 0.00 ? 11 LYS A HG2  5  
ATOM 3640  H HG3  . LYS A 1 11 ? 8.226   3.453   9.551   1.00 0.00 ? 11 LYS A HG3  5  
ATOM 3641  H HD2  . LYS A 1 11 ? 7.068   5.094   10.919  1.00 0.00 ? 11 LYS A HD2  5  
ATOM 3642  H HD3  . LYS A 1 11 ? 8.256   6.330   10.510  1.00 0.00 ? 11 LYS A HD3  5  
ATOM 3643  H HE2  . LYS A 1 11 ? 6.391   6.734   9.077   1.00 0.00 ? 11 LYS A HE2  5  
ATOM 3644  H HE3  . LYS A 1 11 ? 7.605   5.949   8.067   1.00 0.00 ? 11 LYS A HE3  5  
ATOM 3645  H HZ1  . LYS A 1 11 ? 6.407   4.050   7.935   1.00 0.00 ? 11 LYS A HZ1  5  
ATOM 3646  H HZ2  . LYS A 1 11 ? 5.114   5.122   8.165   1.00 0.00 ? 11 LYS A HZ2  5  
ATOM 3647  H HZ3  . LYS A 1 11 ? 5.718   4.226   9.477   1.00 0.00 ? 11 LYS A HZ3  5  
ATOM 3648  N N    . LYS A 1 12 ? 11.293  3.222   9.056   1.00 0.00 ? 12 LYS A N    5  
ATOM 3649  C CA   . LYS A 1 12 ? 12.053  2.410   8.108   1.00 0.00 ? 12 LYS A CA   5  
ATOM 3650  C C    . LYS A 1 12 ? 11.463  2.531   6.708   1.00 0.00 ? 12 LYS A C    5  
ATOM 3651  O O    . LYS A 1 12 ? 12.187  2.743   5.736   1.00 0.00 ? 12 LYS A O    5  
ATOM 3652  C CB   . LYS A 1 12 ? 12.036  0.944   8.546   1.00 0.00 ? 12 LYS A CB   5  
ATOM 3653  C CG   . LYS A 1 12 ? 12.379  0.850   10.036  1.00 0.00 ? 12 LYS A CG   5  
ATOM 3654  C CD   . LYS A 1 12 ? 12.789  -0.584  10.378  1.00 0.00 ? 12 LYS A CD   5  
ATOM 3655  C CE   . LYS A 1 12 ? 11.679  -1.549  9.957   1.00 0.00 ? 12 LYS A CE   5  
ATOM 3656  N NZ   . LYS A 1 12 ? 11.902  -2.874  10.603  1.00 0.00 ? 12 LYS A NZ   5  
ATOM 3657  H H    . LYS A 1 12 ? 10.315  3.158   9.066   1.00 0.00 ? 12 LYS A H    5  
ATOM 3658  H HA   . LYS A 1 12 ? 13.075  2.753   8.085   1.00 0.00 ? 12 LYS A HA   5  
ATOM 3659  H HB2  . LYS A 1 12 ? 11.051  0.531   8.376   1.00 0.00 ? 12 LYS A HB2  5  
ATOM 3660  H HB3  . LYS A 1 12 ? 12.764  0.390   7.974   1.00 0.00 ? 12 LYS A HB3  5  
ATOM 3661  H HG2  . LYS A 1 12 ? 13.195  1.521   10.260  1.00 0.00 ? 12 LYS A HG2  5  
ATOM 3662  H HG3  . LYS A 1 12 ? 11.515  1.124   10.621  1.00 0.00 ? 12 LYS A HG3  5  
ATOM 3663  H HD2  . LYS A 1 12 ? 13.702  -0.832  9.853   1.00 0.00 ? 12 LYS A HD2  5  
ATOM 3664  H HD3  . LYS A 1 12 ? 12.952  -0.668  11.441  1.00 0.00 ? 12 LYS A HD3  5  
ATOM 3665  H HE2  . LYS A 1 12 ? 10.723  -1.154  10.266  1.00 0.00 ? 12 LYS A HE2  5  
ATOM 3666  H HE3  . LYS A 1 12 ? 11.691  -1.665  8.883   1.00 0.00 ? 12 LYS A HE3  5  
ATOM 3667  H HZ1  . LYS A 1 12 ? 11.117  -3.512  10.364  1.00 0.00 ? 12 LYS A HZ1  5  
ATOM 3668  H HZ2  . LYS A 1 12 ? 11.947  -2.754  11.634  1.00 0.00 ? 12 LYS A HZ2  5  
ATOM 3669  H HZ3  . LYS A 1 12 ? 12.797  -3.281  10.260  1.00 0.00 ? 12 LYS A HZ3  5  
ATOM 3670  N N    . TYR A 1 13 ? 10.144  2.390   6.613   1.00 0.00 ? 13 TYR A N    5  
ATOM 3671  C CA   . TYR A 1 13 ? 9.462   2.479   5.325   1.00 0.00 ? 13 TYR A CA   5  
ATOM 3672  C C    . TYR A 1 13 ? 8.283   3.443   5.414   1.00 0.00 ? 13 TYR A C    5  
ATOM 3673  O O    . TYR A 1 13 ? 7.697   3.629   6.480   1.00 0.00 ? 13 TYR A O    5  
ATOM 3674  C CB   . TYR A 1 13 ? 8.965   1.091   4.905   1.00 0.00 ? 13 TYR A CB   5  
ATOM 3675  C CG   . TYR A 1 13 ? 10.065  0.354   4.175   1.00 0.00 ? 13 TYR A CG   5  
ATOM 3676  C CD1  . TYR A 1 13 ? 11.196  -0.090  4.868   1.00 0.00 ? 13 TYR A CD1  5  
ATOM 3677  C CD2  . TYR A 1 13 ? 9.953   0.118   2.798   1.00 0.00 ? 13 TYR A CD2  5  
ATOM 3678  C CE1  . TYR A 1 13 ? 12.215  -0.771  4.189   1.00 0.00 ? 13 TYR A CE1  5  
ATOM 3679  C CE2  . TYR A 1 13 ? 10.969  -0.563  2.120   1.00 0.00 ? 13 TYR A CE2  5  
ATOM 3680  C CZ   . TYR A 1 13 ? 12.099  -1.006  2.813   1.00 0.00 ? 13 TYR A CZ   5  
ATOM 3681  O OH   . TYR A 1 13 ? 13.103  -1.678  2.144   1.00 0.00 ? 13 TYR A OH   5  
ATOM 3682  H H    . TYR A 1 13 ? 9.620   2.219   7.423   1.00 0.00 ? 13 TYR A H    5  
ATOM 3683  H HA   . TYR A 1 13 ? 10.155  2.845   4.580   1.00 0.00 ? 13 TYR A HA   5  
ATOM 3684  H HB2  . TYR A 1 13 ? 8.682   0.532   5.785   1.00 0.00 ? 13 TYR A HB2  5  
ATOM 3685  H HB3  . TYR A 1 13 ? 8.109   1.196   4.253   1.00 0.00 ? 13 TYR A HB3  5  
ATOM 3686  H HD1  . TYR A 1 13 ? 11.285  0.090   5.930   1.00 0.00 ? 13 TYR A HD1  5  
ATOM 3687  H HD2  . TYR A 1 13 ? 9.080   0.460   2.261   1.00 0.00 ? 13 TYR A HD2  5  
ATOM 3688  H HE1  . TYR A 1 13 ? 13.086  -1.115  4.725   1.00 0.00 ? 13 TYR A HE1  5  
ATOM 3689  H HE2  . TYR A 1 13 ? 10.880  -0.746  1.060   1.00 0.00 ? 13 TYR A HE2  5  
ATOM 3690  H HH   . TYR A 1 13 ? 12.901  -1.649  1.205   1.00 0.00 ? 13 TYR A HH   5  
ATOM 3691  N N    . ASP A 1 14 ? 7.939   4.050   4.282   1.00 0.00 ? 14 ASP A N    5  
ATOM 3692  C CA   . ASP A 1 14 ? 6.827   4.992   4.234   1.00 0.00 ? 14 ASP A CA   5  
ATOM 3693  C C    . ASP A 1 14 ? 6.239   5.047   2.829   1.00 0.00 ? 14 ASP A C    5  
ATOM 3694  O O    . ASP A 1 14 ? 6.868   5.557   1.901   1.00 0.00 ? 14 ASP A O    5  
ATOM 3695  C CB   . ASP A 1 14 ? 7.305   6.388   4.644   1.00 0.00 ? 14 ASP A CB   5  
ATOM 3696  C CG   . ASP A 1 14 ? 6.108   7.312   4.838   1.00 0.00 ? 14 ASP A CG   5  
ATOM 3697  O OD1  . ASP A 1 14 ? 5.031   6.804   5.105   1.00 0.00 ? 14 ASP A OD1  5  
ATOM 3698  O OD2  . ASP A 1 14 ? 6.285   8.512   4.719   1.00 0.00 ? 14 ASP A OD2  5  
ATOM 3699  H H    . ASP A 1 14 ? 8.443   3.860   3.463   1.00 0.00 ? 14 ASP A H    5  
ATOM 3700  H HA   . ASP A 1 14 ? 6.061   4.669   4.923   1.00 0.00 ? 14 ASP A HA   5  
ATOM 3701  H HB2  . ASP A 1 14 ? 7.859   6.319   5.568   1.00 0.00 ? 14 ASP A HB2  5  
ATOM 3702  H HB3  . ASP A 1 14 ? 7.944   6.788   3.872   1.00 0.00 ? 14 ASP A HB3  5  
ATOM 3703  N N    . LEU A 1 15 ? 5.029   4.513   2.678   1.00 0.00 ? 15 LEU A N    5  
ATOM 3704  C CA   . LEU A 1 15 ? 4.359   4.501   1.380   1.00 0.00 ? 15 LEU A CA   5  
ATOM 3705  C C    . LEU A 1 15 ? 3.004   5.195   1.475   1.00 0.00 ? 15 LEU A C    5  
ATOM 3706  O O    . LEU A 1 15 ? 1.966   4.582   1.225   1.00 0.00 ? 15 LEU A O    5  
ATOM 3707  C CB   . LEU A 1 15 ? 4.156   3.059   0.903   1.00 0.00 ? 15 LEU A CB   5  
ATOM 3708  C CG   . LEU A 1 15 ? 5.427   2.236   1.141   1.00 0.00 ? 15 LEU A CG   5  
ATOM 3709  C CD1  . LEU A 1 15 ? 5.107   0.751   0.975   1.00 0.00 ? 15 LEU A CD1  5  
ATOM 3710  C CD2  . LEU A 1 15 ? 6.498   2.635   0.123   1.00 0.00 ? 15 LEU A CD2  5  
ATOM 3711  H H    . LEU A 1 15 ? 4.579   4.120   3.454   1.00 0.00 ? 15 LEU A H    5  
ATOM 3712  H HA   . LEU A 1 15 ? 4.970   5.024   0.659   1.00 0.00 ? 15 LEU A HA   5  
ATOM 3713  H HB2  . LEU A 1 15 ? 3.336   2.615   1.448   1.00 0.00 ? 15 LEU A HB2  5  
ATOM 3714  H HB3  . LEU A 1 15 ? 3.925   3.061   -0.152  1.00 0.00 ? 15 LEU A HB3  5  
ATOM 3715  H HG   . LEU A 1 15 ? 5.791   2.414   2.142   1.00 0.00 ? 15 LEU A HG   5  
ATOM 3716  H HD11 . LEU A 1 15 ? 4.347   0.465   1.688   1.00 0.00 ? 15 LEU A HD11 5  
ATOM 3717  H HD12 . LEU A 1 15 ? 5.999   0.169   1.148   1.00 0.00 ? 15 LEU A HD12 5  
ATOM 3718  H HD13 . LEU A 1 15 ? 4.747   0.569   -0.027  1.00 0.00 ? 15 LEU A HD13 5  
ATOM 3719  H HD21 . LEU A 1 15 ? 7.346   1.970   0.216   1.00 0.00 ? 15 LEU A HD21 5  
ATOM 3720  H HD22 . LEU A 1 15 ? 6.816   3.649   0.311   1.00 0.00 ? 15 LEU A HD22 5  
ATOM 3721  H HD23 . LEU A 1 15 ? 6.094   2.562   -0.875  1.00 0.00 ? 15 LEU A HD23 5  
ATOM 3722  N N    . SER A 1 16 ? 3.019   6.477   1.834   1.00 0.00 ? 16 SER A N    5  
ATOM 3723  C CA   . SER A 1 16 ? 1.781   7.241   1.954   1.00 0.00 ? 16 SER A CA   5  
ATOM 3724  C C    . SER A 1 16 ? 0.824   6.878   0.824   1.00 0.00 ? 16 SER A C    5  
ATOM 3725  O O    . SER A 1 16 ? -0.346  6.577   1.058   1.00 0.00 ? 16 SER A O    5  
ATOM 3726  C CB   . SER A 1 16 ? 2.087   8.738   1.907   1.00 0.00 ? 16 SER A CB   5  
ATOM 3727  O OG   . SER A 1 16 ? 0.957   9.433   1.395   1.00 0.00 ? 16 SER A OG   5  
ATOM 3728  H H    . SER A 1 16 ? 3.877   6.914   2.019   1.00 0.00 ? 16 SER A H    5  
ATOM 3729  H HA   . SER A 1 16 ? 1.313   7.008   2.899   1.00 0.00 ? 16 SER A HA   5  
ATOM 3730  H HB2  . SER A 1 16 ? 2.303   9.096   2.901   1.00 0.00 ? 16 SER A HB2  5  
ATOM 3731  H HB3  . SER A 1 16 ? 2.946   8.909   1.272   1.00 0.00 ? 16 SER A HB3  5  
ATOM 3732  H HG   . SER A 1 16 ? 0.184   9.145   1.886   1.00 0.00 ? 16 SER A HG   5  
ATOM 3733  N N    . LYS A 1 17 ? 1.338   6.895   -0.401  1.00 0.00 ? 17 LYS A N    5  
ATOM 3734  C CA   . LYS A 1 17 ? 0.533   6.553   -1.565  1.00 0.00 ? 17 LYS A CA   5  
ATOM 3735  C C    . LYS A 1 17 ? 1.442   6.281   -2.760  1.00 0.00 ? 17 LYS A C    5  
ATOM 3736  O O    . LYS A 1 17 ? 2.303   7.094   -3.093  1.00 0.00 ? 17 LYS A O    5  
ATOM 3737  C CB   . LYS A 1 17 ? -0.430  7.703   -1.890  1.00 0.00 ? 17 LYS A CB   5  
ATOM 3738  C CG   . LYS A 1 17 ? -1.743  7.145   -2.452  1.00 0.00 ? 17 LYS A CG   5  
ATOM 3739  C CD   . LYS A 1 17 ? -1.456  6.292   -3.690  1.00 0.00 ? 17 LYS A CD   5  
ATOM 3740  C CE   . LYS A 1 17 ? -2.726  6.170   -4.536  1.00 0.00 ? 17 LYS A CE   5  
ATOM 3741  N NZ   . LYS A 1 17 ? -2.560  5.071   -5.528  1.00 0.00 ? 17 LYS A NZ   5  
ATOM 3742  H H    . LYS A 1 17 ? 2.281   7.132   -0.524  1.00 0.00 ? 17 LYS A H    5  
ATOM 3743  H HA   . LYS A 1 17 ? -0.039  5.662   -1.347  1.00 0.00 ? 17 LYS A HA   5  
ATOM 3744  H HB2  . LYS A 1 17 ? -0.636  8.261   -0.989  1.00 0.00 ? 17 LYS A HB2  5  
ATOM 3745  H HB3  . LYS A 1 17 ? 0.020   8.358   -2.621  1.00 0.00 ? 17 LYS A HB3  5  
ATOM 3746  H HG2  . LYS A 1 17 ? -2.224  6.535   -1.699  1.00 0.00 ? 17 LYS A HG2  5  
ATOM 3747  H HG3  . LYS A 1 17 ? -2.394  7.962   -2.721  1.00 0.00 ? 17 LYS A HG3  5  
ATOM 3748  H HD2  . LYS A 1 17 ? -0.677  6.759   -4.278  1.00 0.00 ? 17 LYS A HD2  5  
ATOM 3749  H HD3  . LYS A 1 17 ? -1.135  5.309   -3.385  1.00 0.00 ? 17 LYS A HD3  5  
ATOM 3750  H HE2  . LYS A 1 17 ? -3.566  5.951   -3.892  1.00 0.00 ? 17 LYS A HE2  5  
ATOM 3751  H HE3  . LYS A 1 17 ? -2.904  7.100   -5.054  1.00 0.00 ? 17 LYS A HE3  5  
ATOM 3752  H HZ1  . LYS A 1 17 ? -1.795  4.438   -5.220  1.00 0.00 ? 17 LYS A HZ1  5  
ATOM 3753  H HZ2  . LYS A 1 17 ? -2.320  5.475   -6.455  1.00 0.00 ? 17 LYS A HZ2  5  
ATOM 3754  H HZ3  . LYS A 1 17 ? -3.448  4.534   -5.601  1.00 0.00 ? 17 LYS A HZ3  5  
ATOM 3755  N N    . TRP A 1 18 ? 1.242   5.131   -3.399  1.00 0.00 ? 18 TRP A N    5  
ATOM 3756  C CA   . TRP A 1 18 ? 2.047   4.749   -4.558  1.00 0.00 ? 18 TRP A CA   5  
ATOM 3757  C C    . TRP A 1 18 ? 1.144   4.530   -5.770  1.00 0.00 ? 18 TRP A C    5  
ATOM 3758  O O    . TRP A 1 18 ? -0.075  4.418   -5.633  1.00 0.00 ? 18 TRP A O    5  
ATOM 3759  C CB   . TRP A 1 18 ? 2.812   3.451   -4.251  1.00 0.00 ? 18 TRP A CB   5  
ATOM 3760  C CG   . TRP A 1 18 ? 4.192   3.753   -3.741  1.00 0.00 ? 18 TRP A CG   5  
ATOM 3761  C CD1  . TRP A 1 18 ? 4.525   4.789   -2.938  1.00 0.00 ? 18 TRP A CD1  5  
ATOM 3762  C CD2  . TRP A 1 18 ? 5.424   3.014   -3.984  1.00 0.00 ? 18 TRP A CD2  5  
ATOM 3763  N NE1  . TRP A 1 18 ? 5.882   4.735   -2.676  1.00 0.00 ? 18 TRP A NE1  5  
ATOM 3764  C CE2  . TRP A 1 18 ? 6.481   3.659   -3.299  1.00 0.00 ? 18 TRP A CE2  5  
ATOM 3765  C CE3  . TRP A 1 18 ? 5.725   1.859   -4.726  1.00 0.00 ? 18 TRP A CE3  5  
ATOM 3766  C CZ2  . TRP A 1 18 ? 7.789   3.173   -3.348  1.00 0.00 ? 18 TRP A CZ2  5  
ATOM 3767  C CZ3  . TRP A 1 18 ? 7.040   1.368   -4.779  1.00 0.00 ? 18 TRP A CZ3  5  
ATOM 3768  C CH2  . TRP A 1 18 ? 8.069   2.024   -4.091  1.00 0.00 ? 18 TRP A CH2  5  
ATOM 3769  H H    . TRP A 1 18 ? 0.538   4.526   -3.085  1.00 0.00 ? 18 TRP A H    5  
ATOM 3770  H HA   . TRP A 1 18 ? 2.753   5.535   -4.782  1.00 0.00 ? 18 TRP A HA   5  
ATOM 3771  H HB2  . TRP A 1 18 ? 2.274   2.892   -3.501  1.00 0.00 ? 18 TRP A HB2  5  
ATOM 3772  H HB3  . TRP A 1 18 ? 2.888   2.858   -5.152  1.00 0.00 ? 18 TRP A HB3  5  
ATOM 3773  H HD1  . TRP A 1 18 ? 3.847   5.535   -2.564  1.00 0.00 ? 18 TRP A HD1  5  
ATOM 3774  H HE1  . TRP A 1 18 ? 6.376   5.372   -2.121  1.00 0.00 ? 18 TRP A HE1  5  
ATOM 3775  H HE3  . TRP A 1 18 ? 4.942   1.344   -5.258  1.00 0.00 ? 18 TRP A HE3  5  
ATOM 3776  H HZ2  . TRP A 1 18 ? 8.578   3.682   -2.818  1.00 0.00 ? 18 TRP A HZ2  5  
ATOM 3777  H HZ3  . TRP A 1 18 ? 7.256   0.480   -5.352  1.00 0.00 ? 18 TRP A HZ3  5  
ATOM 3778  H HH2  . TRP A 1 18 ? 9.077   1.641   -4.136  1.00 0.00 ? 18 TRP A HH2  5  
ATOM 3779  N N    . LYS A 1 19 ? 1.747   4.456   -6.951  1.00 0.00 ? 19 LYS A N    5  
ATOM 3780  C CA   . LYS A 1 19 ? 0.984   4.237   -8.177  1.00 0.00 ? 19 LYS A CA   5  
ATOM 3781  C C    . LYS A 1 19 ? 1.011   2.757   -8.552  1.00 0.00 ? 19 LYS A C    5  
ATOM 3782  O O    . LYS A 1 19 ? 1.887   2.013   -8.111  1.00 0.00 ? 19 LYS A O    5  
ATOM 3783  C CB   . LYS A 1 19 ? 1.565   5.074   -9.323  1.00 0.00 ? 19 LYS A CB   5  
ATOM 3784  C CG   . LYS A 1 19 ? 2.045   6.423   -8.783  1.00 0.00 ? 19 LYS A CG   5  
ATOM 3785  C CD   . LYS A 1 19 ? 0.879   7.151   -8.111  1.00 0.00 ? 19 LYS A CD   5  
ATOM 3786  C CE   . LYS A 1 19 ? 1.293   8.587   -7.785  1.00 0.00 ? 19 LYS A CE   5  
ATOM 3787  N NZ   . LYS A 1 19 ? 2.676   8.590   -7.231  1.00 0.00 ? 19 LYS A NZ   5  
ATOM 3788  H H    . LYS A 1 19 ? 2.722   4.545   -7.001  1.00 0.00 ? 19 LYS A H    5  
ATOM 3789  H HA   . LYS A 1 19 ? -0.042  4.536   -8.012  1.00 0.00 ? 19 LYS A HA   5  
ATOM 3790  H HB2  . LYS A 1 19 ? 2.396   4.549   -9.770  1.00 0.00 ? 19 LYS A HB2  5  
ATOM 3791  H HB3  . LYS A 1 19 ? 0.803   5.240   -10.068 1.00 0.00 ? 19 LYS A HB3  5  
ATOM 3792  H HG2  . LYS A 1 19 ? 2.834   6.262   -8.062  1.00 0.00 ? 19 LYS A HG2  5  
ATOM 3793  H HG3  . LYS A 1 19 ? 2.420   7.023   -9.598  1.00 0.00 ? 19 LYS A HG3  5  
ATOM 3794  H HD2  . LYS A 1 19 ? 0.030   7.165   -8.781  1.00 0.00 ? 19 LYS A HD2  5  
ATOM 3795  H HD3  . LYS A 1 19 ? 0.611   6.640   -7.200  1.00 0.00 ? 19 LYS A HD3  5  
ATOM 3796  H HE2  . LYS A 1 19 ? 1.266   9.183   -8.684  1.00 0.00 ? 19 LYS A HE2  5  
ATOM 3797  H HE3  . LYS A 1 19 ? 0.612   9.001   -7.056  1.00 0.00 ? 19 LYS A HE3  5  
ATOM 3798  H HZ1  . LYS A 1 19 ? 3.360   8.726   -8.002  1.00 0.00 ? 19 LYS A HZ1  5  
ATOM 3799  H HZ2  . LYS A 1 19 ? 2.866   7.682   -6.761  1.00 0.00 ? 19 LYS A HZ2  5  
ATOM 3800  H HZ3  . LYS A 1 19 ? 2.772   9.364   -6.541  1.00 0.00 ? 19 LYS A HZ3  5  
ATOM 3801  N N    . TYR A 1 20 ? 0.049   2.335   -9.363  1.00 0.00 ? 20 TYR A N    5  
ATOM 3802  C CA   . TYR A 1 20 ? -0.021  0.940   -9.784  1.00 0.00 ? 20 TYR A CA   5  
ATOM 3803  C C    . TYR A 1 20 ? 1.210   0.563   -10.604 1.00 0.00 ? 20 TYR A C    5  
ATOM 3804  O O    . TYR A 1 20 ? 1.746   -0.538  -10.472 1.00 0.00 ? 20 TYR A O    5  
ATOM 3805  C CB   . TYR A 1 20 ? -1.284  0.709   -10.619 1.00 0.00 ? 20 TYR A CB   5  
ATOM 3806  C CG   . TYR A 1 20 ? -1.209  1.531   -11.883 1.00 0.00 ? 20 TYR A CG   5  
ATOM 3807  C CD1  . TYR A 1 20 ? -0.551  1.024   -13.009 1.00 0.00 ? 20 TYR A CD1  5  
ATOM 3808  C CD2  . TYR A 1 20 ? -1.799  2.799   -11.929 1.00 0.00 ? 20 TYR A CD2  5  
ATOM 3809  C CE1  . TYR A 1 20 ? -0.481  1.787   -14.181 1.00 0.00 ? 20 TYR A CE1  5  
ATOM 3810  C CE2  . TYR A 1 20 ? -1.730  3.561   -13.102 1.00 0.00 ? 20 TYR A CE2  5  
ATOM 3811  C CZ   . TYR A 1 20 ? -1.072  3.055   -14.227 1.00 0.00 ? 20 TYR A CZ   5  
ATOM 3812  O OH   . TYR A 1 20 ? -1.004  3.805   -15.383 1.00 0.00 ? 20 TYR A OH   5  
ATOM 3813  H H    . TYR A 1 20 ? -0.627  2.970   -9.684  1.00 0.00 ? 20 TYR A H    5  
ATOM 3814  H HA   . TYR A 1 20 ? -0.065  0.310   -8.907  1.00 0.00 ? 20 TYR A HA   5  
ATOM 3815  H HB2  . TYR A 1 20 ? -1.359  -0.338  -10.873 1.00 0.00 ? 20 TYR A HB2  5  
ATOM 3816  H HB3  . TYR A 1 20 ? -2.151  1.004   -10.049 1.00 0.00 ? 20 TYR A HB3  5  
ATOM 3817  H HD1  . TYR A 1 20 ? -0.094  0.046   -12.974 1.00 0.00 ? 20 TYR A HD1  5  
ATOM 3818  H HD2  . TYR A 1 20 ? -2.307  3.190   -11.060 1.00 0.00 ? 20 TYR A HD2  5  
ATOM 3819  H HE1  . TYR A 1 20 ? 0.027   1.395   -15.051 1.00 0.00 ? 20 TYR A HE1  5  
ATOM 3820  H HE2  . TYR A 1 20 ? -2.185  4.540   -13.137 1.00 0.00 ? 20 TYR A HE2  5  
ATOM 3821  H HH   . TYR A 1 20 ? -0.143  3.658   -15.783 1.00 0.00 ? 20 TYR A HH   5  
ATOM 3822  N N    . ALA A 1 21 ? 1.645   1.486   -11.456 1.00 0.00 ? 21 ALA A N    5  
ATOM 3823  C CA   . ALA A 1 21 ? 2.808   1.247   -12.304 1.00 0.00 ? 21 ALA A CA   5  
ATOM 3824  C C    . ALA A 1 21 ? 4.044   0.925   -11.467 1.00 0.00 ? 21 ALA A C    5  
ATOM 3825  O O    . ALA A 1 21 ? 4.636   -0.144  -11.606 1.00 0.00 ? 21 ALA A O    5  
ATOM 3826  C CB   . ALA A 1 21 ? 3.083   2.480   -13.167 1.00 0.00 ? 21 ALA A CB   5  
ATOM 3827  H H    . ALA A 1 21 ? 1.174   2.342   -11.519 1.00 0.00 ? 21 ALA A H    5  
ATOM 3828  H HA   . ALA A 1 21 ? 2.600   0.410   -12.952 1.00 0.00 ? 21 ALA A HA   5  
ATOM 3829  H HB1  . ALA A 1 21 ? 3.984   2.323   -13.742 1.00 0.00 ? 21 ALA A HB1  5  
ATOM 3830  H HB2  . ALA A 1 21 ? 3.206   3.343   -12.531 1.00 0.00 ? 21 ALA A HB2  5  
ATOM 3831  H HB3  . ALA A 1 21 ? 2.252   2.641   -13.838 1.00 0.00 ? 21 ALA A HB3  5  
ATOM 3832  N N    . GLU A 1 22 ? 4.437   1.861   -10.608 1.00 0.00 ? 22 GLU A N    5  
ATOM 3833  C CA   . GLU A 1 22 ? 5.613   1.663   -9.768  1.00 0.00 ? 22 GLU A CA   5  
ATOM 3834  C C    . GLU A 1 22 ? 5.426   0.464   -8.842  1.00 0.00 ? 22 GLU A C    5  
ATOM 3835  O O    . GLU A 1 22 ? 6.372   -0.278  -8.579  1.00 0.00 ? 22 GLU A O    5  
ATOM 3836  C CB   . GLU A 1 22 ? 5.889   2.918   -8.938  1.00 0.00 ? 22 GLU A CB   5  
ATOM 3837  C CG   . GLU A 1 22 ? 4.711   3.186   -8.002  1.00 0.00 ? 22 GLU A CG   5  
ATOM 3838  C CD   . GLU A 1 22 ? 4.905   4.521   -7.292  1.00 0.00 ? 22 GLU A CD   5  
ATOM 3839  O OE1  . GLU A 1 22 ? 5.538   5.390   -7.868  1.00 0.00 ? 22 GLU A OE1  5  
ATOM 3840  O OE2  . GLU A 1 22 ? 4.417   4.655   -6.183  1.00 0.00 ? 22 GLU A OE2  5  
ATOM 3841  H H    . GLU A 1 22 ? 3.934   2.700   -10.542 1.00 0.00 ? 22 GLU A H    5  
ATOM 3842  H HA   . GLU A 1 22 ? 6.465   1.477   -10.404 1.00 0.00 ? 22 GLU A HA   5  
ATOM 3843  H HB2  . GLU A 1 22 ? 6.788   2.773   -8.355  1.00 0.00 ? 22 GLU A HB2  5  
ATOM 3844  H HB3  . GLU A 1 22 ? 6.020   3.763   -9.597  1.00 0.00 ? 22 GLU A HB3  5  
ATOM 3845  H HG2  . GLU A 1 22 ? 3.799   3.214   -8.575  1.00 0.00 ? 22 GLU A HG2  5  
ATOM 3846  H HG3  . GLU A 1 22 ? 4.649   2.397   -7.268  1.00 0.00 ? 22 GLU A HG3  5  
ATOM 3847  N N    . LEU A 1 23 ? 4.206   0.278   -8.348  1.00 0.00 ? 23 LEU A N    5  
ATOM 3848  C CA   . LEU A 1 23 ? 3.928   -0.840  -7.453  1.00 0.00 ? 23 LEU A CA   5  
ATOM 3849  C C    . LEU A 1 23 ? 4.329   -2.157  -8.112  1.00 0.00 ? 23 LEU A C    5  
ATOM 3850  O O    . LEU A 1 23 ? 5.123   -2.920  -7.561  1.00 0.00 ? 23 LEU A O    5  
ATOM 3851  C CB   . LEU A 1 23 ? 2.430   -0.875  -7.105  1.00 0.00 ? 23 LEU A CB   5  
ATOM 3852  C CG   . LEU A 1 23 ? 2.192   -0.262  -5.718  1.00 0.00 ? 23 LEU A CG   5  
ATOM 3853  C CD1  . LEU A 1 23 ? 0.731   0.176   -5.595  1.00 0.00 ? 23 LEU A CD1  5  
ATOM 3854  C CD2  . LEU A 1 23 ? 2.500   -1.300  -4.634  1.00 0.00 ? 23 LEU A CD2  5  
ATOM 3855  H H    . LEU A 1 23 ? 3.486   0.898   -8.587  1.00 0.00 ? 23 LEU A H    5  
ATOM 3856  H HA   . LEU A 1 23 ? 4.500   -0.713  -6.547  1.00 0.00 ? 23 LEU A HA   5  
ATOM 3857  H HB2  . LEU A 1 23 ? 1.882   -0.310  -7.845  1.00 0.00 ? 23 LEU A HB2  5  
ATOM 3858  H HB3  . LEU A 1 23 ? 2.080   -1.897  -7.108  1.00 0.00 ? 23 LEU A HB3  5  
ATOM 3859  H HG   . LEU A 1 23 ? 2.832   0.597   -5.589  1.00 0.00 ? 23 LEU A HG   5  
ATOM 3860  H HD11 . LEU A 1 23 ? 0.576   0.644   -4.634  1.00 0.00 ? 23 LEU A HD11 5  
ATOM 3861  H HD12 . LEU A 1 23 ? 0.088   -0.688  -5.682  1.00 0.00 ? 23 LEU A HD12 5  
ATOM 3862  H HD13 . LEU A 1 23 ? 0.497   0.879   -6.380  1.00 0.00 ? 23 LEU A HD13 5  
ATOM 3863  H HD21 . LEU A 1 23 ? 2.246   -0.895  -3.665  1.00 0.00 ? 23 LEU A HD21 5  
ATOM 3864  H HD22 . LEU A 1 23 ? 3.551   -1.547  -4.656  1.00 0.00 ? 23 LEU A HD22 5  
ATOM 3865  H HD23 . LEU A 1 23 ? 1.918   -2.192  -4.814  1.00 0.00 ? 23 LEU A HD23 5  
ATOM 3866  N N    . ARG A 1 24 ? 3.777   -2.414  -9.292  1.00 0.00 ? 24 ARG A N    5  
ATOM 3867  C CA   . ARG A 1 24 ? 4.084   -3.642  -10.014 1.00 0.00 ? 24 ARG A CA   5  
ATOM 3868  C C    . ARG A 1 24 ? 5.569   -3.714  -10.352 1.00 0.00 ? 24 ARG A C    5  
ATOM 3869  O O    . ARG A 1 24 ? 6.228   -4.723  -10.098 1.00 0.00 ? 24 ARG A O    5  
ATOM 3870  C CB   . ARG A 1 24 ? 3.263   -3.710  -11.303 1.00 0.00 ? 24 ARG A CB   5  
ATOM 3871  C CG   . ARG A 1 24 ? 3.320   -5.129  -11.873 1.00 0.00 ? 24 ARG A CG   5  
ATOM 3872  C CD   . ARG A 1 24 ? 2.396   -5.229  -13.087 1.00 0.00 ? 24 ARG A CD   5  
ATOM 3873  N NE   . ARG A 1 24 ? 2.451   -6.572  -13.655 1.00 0.00 ? 24 ARG A NE   5  
ATOM 3874  C CZ   . ARG A 1 24 ? 2.045   -6.811  -14.897 1.00 0.00 ? 24 ARG A CZ   5  
ATOM 3875  N NH1  . ARG A 1 24 ? 1.588   -5.835  -15.633 1.00 0.00 ? 24 ARG A NH1  5  
ATOM 3876  N NH2  . ARG A 1 24 ? 2.104   -8.021  -15.382 1.00 0.00 ? 24 ARG A NH2  5  
ATOM 3877  H H    . ARG A 1 24 ? 3.152   -1.768  -9.683  1.00 0.00 ? 24 ARG A H    5  
ATOM 3878  H HA   . ARG A 1 24 ? 3.826   -4.487  -9.393  1.00 0.00 ? 24 ARG A HA   5  
ATOM 3879  H HB2  . ARG A 1 24 ? 2.236   -3.448  -11.089 1.00 0.00 ? 24 ARG A HB2  5  
ATOM 3880  H HB3  . ARG A 1 24 ? 3.668   -3.017  -12.026 1.00 0.00 ? 24 ARG A HB3  5  
ATOM 3881  H HG2  . ARG A 1 24 ? 4.334   -5.356  -12.171 1.00 0.00 ? 24 ARG A HG2  5  
ATOM 3882  H HG3  . ARG A 1 24 ? 2.999   -5.832  -11.120 1.00 0.00 ? 24 ARG A HG3  5  
ATOM 3883  H HD2  . ARG A 1 24 ? 1.383   -5.012  -12.786 1.00 0.00 ? 24 ARG A HD2  5  
ATOM 3884  H HD3  . ARG A 1 24 ? 2.708   -4.512  -13.833 1.00 0.00 ? 24 ARG A HD3  5  
ATOM 3885  H HE   . ARG A 1 24 ? 2.794   -7.311  -13.109 1.00 0.00 ? 24 ARG A HE   5  
ATOM 3886  H HH11 . ARG A 1 24 ? 1.543   -4.908  -15.262 1.00 0.00 ? 24 ARG A HH11 5  
ATOM 3887  H HH12 . ARG A 1 24 ? 1.282   -6.015  -16.568 1.00 0.00 ? 24 ARG A HH12 5  
ATOM 3888  H HH21 . ARG A 1 24 ? 2.454   -8.769  -14.819 1.00 0.00 ? 24 ARG A HH21 5  
ATOM 3889  H HH22 . ARG A 1 24 ? 1.799   -8.202  -16.317 1.00 0.00 ? 24 ARG A HH22 5  
ATOM 3890  N N    . ASP A 1 25 ? 6.091   -2.641  -10.932 1.00 0.00 ? 25 ASP A N    5  
ATOM 3891  C CA   . ASP A 1 25 ? 7.497   -2.601  -11.305 1.00 0.00 ? 25 ASP A CA   5  
ATOM 3892  C C    . ASP A 1 25 ? 8.390   -2.877  -10.100 1.00 0.00 ? 25 ASP A C    5  
ATOM 3893  O O    . ASP A 1 25 ? 9.243   -3.763  -10.137 1.00 0.00 ? 25 ASP A O    5  
ATOM 3894  C CB   . ASP A 1 25 ? 7.842   -1.231  -11.895 1.00 0.00 ? 25 ASP A CB   5  
ATOM 3895  C CG   . ASP A 1 25 ? 9.184   -1.298  -12.618 1.00 0.00 ? 25 ASP A CG   5  
ATOM 3896  O OD1  . ASP A 1 25 ? 9.262   -1.993  -13.617 1.00 0.00 ? 25 ASP A OD1  5  
ATOM 3897  O OD2  . ASP A 1 25 ? 10.112  -0.652  -12.160 1.00 0.00 ? 25 ASP A OD2  5  
ATOM 3898  H H    . ASP A 1 25 ? 5.521   -1.866  -11.115 1.00 0.00 ? 25 ASP A H    5  
ATOM 3899  H HA   . ASP A 1 25 ? 7.680   -3.356  -12.053 1.00 0.00 ? 25 ASP A HA   5  
ATOM 3900  H HB2  . ASP A 1 25 ? 7.073   -0.939  -12.593 1.00 0.00 ? 25 ASP A HB2  5  
ATOM 3901  H HB3  . ASP A 1 25 ? 7.901   -0.504  -11.099 1.00 0.00 ? 25 ASP A HB3  5  
ATOM 3902  N N    . THR A 1 26 ? 8.193   -2.109  -9.035  1.00 0.00 ? 26 THR A N    5  
ATOM 3903  C CA   . THR A 1 26 ? 8.995   -2.276  -7.828  1.00 0.00 ? 26 THR A CA   5  
ATOM 3904  C C    . THR A 1 26 ? 8.875   -3.692  -7.271  1.00 0.00 ? 26 THR A C    5  
ATOM 3905  O O    . THR A 1 26 ? 9.841   -4.235  -6.735  1.00 0.00 ? 26 THR A O    5  
ATOM 3906  C CB   . THR A 1 26 ? 8.554   -1.272  -6.763  1.00 0.00 ? 26 THR A CB   5  
ATOM 3907  O OG1  . THR A 1 26 ? 8.373   0.003   -7.362  1.00 0.00 ? 26 THR A OG1  5  
ATOM 3908  C CG2  . THR A 1 26 ? 9.627   -1.182  -5.678  1.00 0.00 ? 26 THR A CG2  5  
ATOM 3909  H H    . THR A 1 26 ? 7.502   -1.416  -9.063  1.00 0.00 ? 26 THR A H    5  
ATOM 3910  H HA   . THR A 1 26 ? 10.029  -2.085  -8.071  1.00 0.00 ? 26 THR A HA   5  
ATOM 3911  H HB   . THR A 1 26 ? 7.626   -1.599  -6.321  1.00 0.00 ? 26 THR A HB   5  
ATOM 3912  H HG1  . THR A 1 26 ? 8.860   0.647   -6.842  1.00 0.00 ? 26 THR A HG1  5  
ATOM 3913  H HG21 . THR A 1 26 ? 9.275   -0.556  -4.873  1.00 0.00 ? 26 THR A HG21 5  
ATOM 3914  H HG22 . THR A 1 26 ? 10.528  -0.759  -6.096  1.00 0.00 ? 26 THR A HG22 5  
ATOM 3915  H HG23 . THR A 1 26 ? 9.838   -2.172  -5.299  1.00 0.00 ? 26 THR A HG23 5  
ATOM 3916  N N    . ILE A 1 27 ? 7.690   -4.287  -7.387  1.00 0.00 ? 27 ILE A N    5  
ATOM 3917  C CA   . ILE A 1 27 ? 7.483   -5.638  -6.871  1.00 0.00 ? 27 ILE A CA   5  
ATOM 3918  C C    . ILE A 1 27 ? 8.078   -6.678  -7.821  1.00 0.00 ? 27 ILE A C    5  
ATOM 3919  O O    . ILE A 1 27 ? 8.369   -7.803  -7.415  1.00 0.00 ? 27 ILE A O    5  
ATOM 3920  C CB   . ILE A 1 27 ? 5.978   -5.897  -6.650  1.00 0.00 ? 27 ILE A CB   5  
ATOM 3921  C CG1  . ILE A 1 27 ? 5.766   -6.545  -5.274  1.00 0.00 ? 27 ILE A CG1  5  
ATOM 3922  C CG2  . ILE A 1 27 ? 5.420   -6.825  -7.738  1.00 0.00 ? 27 ILE A CG2  5  
ATOM 3923  C CD1  . ILE A 1 27 ? 4.304   -6.971  -5.120  1.00 0.00 ? 27 ILE A CD1  5  
ATOM 3924  H H    . ILE A 1 27 ? 6.946   -3.810  -7.818  1.00 0.00 ? 27 ILE A H    5  
ATOM 3925  H HA   . ILE A 1 27 ? 7.990   -5.718  -5.920  1.00 0.00 ? 27 ILE A HA   5  
ATOM 3926  H HB   . ILE A 1 27 ? 5.450   -4.958  -6.683  1.00 0.00 ? 27 ILE A HB   5  
ATOM 3927  H HG12 . ILE A 1 27 ? 6.405   -7.410  -5.183  1.00 0.00 ? 27 ILE A HG12 5  
ATOM 3928  H HG13 . ILE A 1 27 ? 6.014   -5.833  -4.501  1.00 0.00 ? 27 ILE A HG13 5  
ATOM 3929  H HG21 . ILE A 1 27 ? 4.340   -6.828  -7.690  1.00 0.00 ? 27 ILE A HG21 5  
ATOM 3930  H HG22 . ILE A 1 27 ? 5.787   -7.828  -7.582  1.00 0.00 ? 27 ILE A HG22 5  
ATOM 3931  H HG23 . ILE A 1 27 ? 5.732   -6.474  -8.710  1.00 0.00 ? 27 ILE A HG23 5  
ATOM 3932  H HD11 . ILE A 1 27 ? 3.660   -6.213  -5.543  1.00 0.00 ? 27 ILE A HD11 5  
ATOM 3933  H HD12 . ILE A 1 27 ? 4.074   -7.096  -4.072  1.00 0.00 ? 27 ILE A HD12 5  
ATOM 3934  H HD13 . ILE A 1 27 ? 4.145   -7.906  -5.637  1.00 0.00 ? 27 ILE A HD13 5  
ATOM 3935  N N    . ASN A 1 28 ? 8.250   -6.300  -9.086  1.00 0.00 ? 28 ASN A N    5  
ATOM 3936  C CA   . ASN A 1 28 ? 8.804   -7.218  -10.079 1.00 0.00 ? 28 ASN A CA   5  
ATOM 3937  C C    . ASN A 1 28 ? 10.262  -6.872  -10.390 1.00 0.00 ? 28 ASN A C    5  
ATOM 3938  O O    . ASN A 1 28 ? 10.924  -7.580  -11.150 1.00 0.00 ? 28 ASN A O    5  
ATOM 3939  C CB   . ASN A 1 28 ? 7.957   -7.173  -11.363 1.00 0.00 ? 28 ASN A CB   5  
ATOM 3940  C CG   . ASN A 1 28 ? 8.699   -6.439  -12.477 1.00 0.00 ? 28 ASN A CG   5  
ATOM 3941  O OD1  . ASN A 1 28 ? 8.899   -6.990  -13.560 1.00 0.00 ? 28 ASN A OD1  5  
ATOM 3942  N ND2  . ASN A 1 28 ? 9.120   -5.222  -12.275 1.00 0.00 ? 28 ASN A ND2  5  
ATOM 3943  H H    . ASN A 1 28 ? 7.996   -5.392  -9.357  1.00 0.00 ? 28 ASN A H    5  
ATOM 3944  H HA   . ASN A 1 28 ? 8.771   -8.223  -9.680  1.00 0.00 ? 28 ASN A HA   5  
ATOM 3945  H HB2  . ASN A 1 28 ? 7.742   -8.181  -11.686 1.00 0.00 ? 28 ASN A HB2  5  
ATOM 3946  H HB3  . ASN A 1 28 ? 7.030   -6.661  -11.157 1.00 0.00 ? 28 ASN A HB3  5  
ATOM 3947  H HD21 . ASN A 1 28 ? 8.959   -4.786  -11.412 1.00 0.00 ? 28 ASN A HD21 5  
ATOM 3948  H HD22 . ASN A 1 28 ? 9.594   -4.743  -12.985 1.00 0.00 ? 28 ASN A HD22 5  
ATOM 3949  N N    . THR A 1 29 ? 10.756  -5.787  -9.796  1.00 0.00 ? 29 THR A N    5  
ATOM 3950  C CA   . THR A 1 29 ? 12.140  -5.367  -10.018 1.00 0.00 ? 29 THR A CA   5  
ATOM 3951  C C    . THR A 1 29 ? 12.935  -5.449  -8.719  1.00 0.00 ? 29 THR A C    5  
ATOM 3952  O O    . THR A 1 29 ? 14.035  -6.000  -8.685  1.00 0.00 ? 29 THR A O    5  
ATOM 3953  C CB   . THR A 1 29 ? 12.183  -3.929  -10.549 1.00 0.00 ? 29 THR A CB   5  
ATOM 3954  O OG1  . THR A 1 29 ? 11.423  -3.089  -9.692  1.00 0.00 ? 29 THR A OG1  5  
ATOM 3955  C CG2  . THR A 1 29 ? 11.604  -3.869  -11.971 1.00 0.00 ? 29 THR A CG2  5  
ATOM 3956  H H    . THR A 1 29 ? 10.184  -5.264  -9.196  1.00 0.00 ? 29 THR A H    5  
ATOM 3957  H HA   . THR A 1 29 ? 12.599  -6.021  -10.746 1.00 0.00 ? 29 THR A HA   5  
ATOM 3958  H HB   . THR A 1 29 ? 13.206  -3.586  -10.568 1.00 0.00 ? 29 THR A HB   5  
ATOM 3959  H HG1  . THR A 1 29 ? 11.838  -3.093  -8.827  1.00 0.00 ? 29 THR A HG1  5  
ATOM 3960  H HG21 . THR A 1 29 ? 12.269  -3.305  -12.609 1.00 0.00 ? 29 THR A HG21 5  
ATOM 3961  H HG22 . THR A 1 29 ? 10.640  -3.386  -11.946 1.00 0.00 ? 29 THR A HG22 5  
ATOM 3962  H HG23 . THR A 1 29 ? 11.494  -4.869  -12.365 1.00 0.00 ? 29 THR A HG23 5  
ATOM 3963  N N    . SER A 1 30 ? 12.368  -4.899  -7.650  1.00 0.00 ? 30 SER A N    5  
ATOM 3964  C CA   . SER A 1 30 ? 13.028  -4.918  -6.351  1.00 0.00 ? 30 SER A CA   5  
ATOM 3965  C C    . SER A 1 30 ? 12.575  -6.133  -5.546  1.00 0.00 ? 30 SER A C    5  
ATOM 3966  O O    . SER A 1 30 ? 11.612  -6.805  -5.912  1.00 0.00 ? 30 SER A O    5  
ATOM 3967  C CB   . SER A 1 30 ? 12.702  -3.632  -5.584  1.00 0.00 ? 30 SER A CB   5  
ATOM 3968  O OG   . SER A 1 30 ? 13.785  -2.720  -5.721  1.00 0.00 ? 30 SER A OG   5  
ATOM 3969  H H    . SER A 1 30 ? 11.487  -4.476  -7.737  1.00 0.00 ? 30 SER A H    5  
ATOM 3970  H HA   . SER A 1 30 ? 14.098  -4.973  -6.498  1.00 0.00 ? 30 SER A HA   5  
ATOM 3971  H HB2  . SER A 1 30 ? 11.812  -3.185  -5.992  1.00 0.00 ? 30 SER A HB2  5  
ATOM 3972  H HB3  . SER A 1 30 ? 12.540  -3.862  -4.539  1.00 0.00 ? 30 SER A HB3  5  
ATOM 3973  H HG   . SER A 1 30 ? 14.541  -3.205  -6.058  1.00 0.00 ? 30 SER A HG   5  
ATOM 3974  N N    . CYS A 1 31 ? 13.275  -6.408  -4.451  1.00 0.00 ? 31 CYS A N    5  
ATOM 3975  C CA   . CYS A 1 31 ? 12.929  -7.547  -3.608  1.00 0.00 ? 31 CYS A CA   5  
ATOM 3976  C C    . CYS A 1 31 ? 13.482  -7.363  -2.198  1.00 0.00 ? 31 CYS A C    5  
ATOM 3977  O O    . CYS A 1 31 ? 14.684  -7.176  -2.010  1.00 0.00 ? 31 CYS A O    5  
ATOM 3978  C CB   . CYS A 1 31 ? 13.491  -8.834  -4.213  1.00 0.00 ? 31 CYS A CB   5  
ATOM 3979  S SG   . CYS A 1 31 ? 12.949  -10.252 -3.228  1.00 0.00 ? 31 CYS A SG   5  
ATOM 3980  H H    . CYS A 1 31 ? 14.035  -5.839  -4.206  1.00 0.00 ? 31 CYS A H    5  
ATOM 3981  H HA   . CYS A 1 31 ? 11.854  -7.629  -3.554  1.00 0.00 ? 31 CYS A HA   5  
ATOM 3982  H HB2  . CYS A 1 31 ? 13.133  -8.941  -5.226  1.00 0.00 ? 31 CYS A HB2  5  
ATOM 3983  H HB3  . CYS A 1 31 ? 14.570  -8.790  -4.217  1.00 0.00 ? 31 CYS A HB3  5  
ATOM 3984  H HG   . CYS A 1 31 ? 13.027  -10.015 -2.300  1.00 0.00 ? 31 CYS A HG   5  
ATOM 3985  N N    . ASP A 1 32 ? 12.594  -7.425  -1.214  1.00 0.00 ? 32 ASP A N    5  
ATOM 3986  C CA   . ASP A 1 32 ? 12.993  -7.272  0.179   1.00 0.00 ? 32 ASP A CA   5  
ATOM 3987  C C    . ASP A 1 32 ? 11.798  -7.521  1.095   1.00 0.00 ? 32 ASP A C    5  
ATOM 3988  O O    . ASP A 1 32 ? 10.711  -6.994  0.866   1.00 0.00 ? 32 ASP A O    5  
ATOM 3989  C CB   . ASP A 1 32 ? 13.549  -5.862  0.421   1.00 0.00 ? 32 ASP A CB   5  
ATOM 3990  C CG   . ASP A 1 32 ? 14.657  -5.904  1.471   1.00 0.00 ? 32 ASP A CG   5  
ATOM 3991  O OD1  . ASP A 1 32 ? 15.641  -6.585  1.236   1.00 0.00 ? 32 ASP A OD1  5  
ATOM 3992  O OD2  . ASP A 1 32 ? 14.502  -5.254  2.492   1.00 0.00 ? 32 ASP A OD2  5  
ATOM 3993  H H    . ASP A 1 32 ? 11.650  -7.581  -1.428  1.00 0.00 ? 32 ASP A H    5  
ATOM 3994  H HA   . ASP A 1 32 ? 13.763  -7.997  0.404   1.00 0.00 ? 32 ASP A HA   5  
ATOM 3995  H HB2  . ASP A 1 32 ? 13.948  -5.470  -0.503  1.00 0.00 ? 32 ASP A HB2  5  
ATOM 3996  H HB3  . ASP A 1 32 ? 12.756  -5.216  0.768   1.00 0.00 ? 32 ASP A HB3  5  
ATOM 3997  N N    . ILE A 1 33 ? 12.007  -8.328  2.130   1.00 0.00 ? 33 ILE A N    5  
ATOM 3998  C CA   . ILE A 1 33 ? 10.938  -8.641  3.072   1.00 0.00 ? 33 ILE A CA   5  
ATOM 3999  C C    . ILE A 1 33 ? 10.065  -7.413  3.327   1.00 0.00 ? 33 ILE A C    5  
ATOM 4000  O O    . ILE A 1 33 ? 8.843   -7.518  3.423   1.00 0.00 ? 33 ILE A O    5  
ATOM 4001  C CB   . ILE A 1 33 ? 11.536  -9.129  4.397   1.00 0.00 ? 33 ILE A CB   5  
ATOM 4002  C CG1  . ILE A 1 33 ? 12.779  -8.292  4.739   1.00 0.00 ? 33 ILE A CG1  5  
ATOM 4003  C CG2  . ILE A 1 33 ? 11.930  -10.603 4.269   1.00 0.00 ? 33 ILE A CG2  5  
ATOM 4004  C CD1  . ILE A 1 33 ? 12.932  -8.192  6.259   1.00 0.00 ? 33 ILE A CD1  5  
ATOM 4005  H H    . ILE A 1 33 ? 12.896  -8.721  2.262   1.00 0.00 ? 33 ILE A H    5  
ATOM 4006  H HA   . ILE A 1 33 ? 10.323  -9.426  2.656   1.00 0.00 ? 33 ILE A HA   5  
ATOM 4007  H HB   . ILE A 1 33 ? 10.800  -9.024  5.182   1.00 0.00 ? 33 ILE A HB   5  
ATOM 4008  H HG12 . ILE A 1 33 ? 13.658  -8.762  4.319   1.00 0.00 ? 33 ILE A HG12 5  
ATOM 4009  H HG13 . ILE A 1 33 ? 12.672  -7.300  4.327   1.00 0.00 ? 33 ILE A HG13 5  
ATOM 4010  H HG21 . ILE A 1 33 ? 11.040  -11.215 4.259   1.00 0.00 ? 33 ILE A HG21 5  
ATOM 4011  H HG22 . ILE A 1 33 ? 12.550  -10.885 5.107   1.00 0.00 ? 33 ILE A HG22 5  
ATOM 4012  H HG23 . ILE A 1 33 ? 12.479  -10.751 3.350   1.00 0.00 ? 33 ILE A HG23 5  
ATOM 4013  H HD11 . ILE A 1 33 ? 12.727  -9.152  6.707   1.00 0.00 ? 33 ILE A HD11 5  
ATOM 4014  H HD12 . ILE A 1 33 ? 12.238  -7.459  6.643   1.00 0.00 ? 33 ILE A HD12 5  
ATOM 4015  H HD13 . ILE A 1 33 ? 13.942  -7.892  6.500   1.00 0.00 ? 33 ILE A HD13 5  
ATOM 4016  N N    . GLU A 1 34 ? 10.704  -6.254  3.437   1.00 0.00 ? 34 GLU A N    5  
ATOM 4017  C CA   . GLU A 1 34 ? 9.979   -5.014  3.688   1.00 0.00 ? 34 GLU A CA   5  
ATOM 4018  C C    . GLU A 1 34 ? 9.254   -4.539  2.430   1.00 0.00 ? 34 GLU A C    5  
ATOM 4019  O O    . GLU A 1 34 ? 8.053   -4.275  2.460   1.00 0.00 ? 34 GLU A O    5  
ATOM 4020  C CB   . GLU A 1 34 ? 10.952  -3.929  4.165   1.00 0.00 ? 34 GLU A CB   5  
ATOM 4021  C CG   . GLU A 1 34 ? 12.096  -4.574  4.955   1.00 0.00 ? 34 GLU A CG   5  
ATOM 4022  C CD   . GLU A 1 34 ? 12.728  -3.549  5.892   1.00 0.00 ? 34 GLU A CD   5  
ATOM 4023  O OE1  . GLU A 1 34 ? 12.034  -3.079  6.778   1.00 0.00 ? 34 GLU A OE1  5  
ATOM 4024  O OE2  . GLU A 1 34 ? 13.896  -3.249  5.707   1.00 0.00 ? 34 GLU A OE2  5  
ATOM 4025  H H    . GLU A 1 34 ? 11.679  -6.232  3.353   1.00 0.00 ? 34 GLU A H    5  
ATOM 4026  H HA   . GLU A 1 34 ? 9.249   -5.189  4.464   1.00 0.00 ? 34 GLU A HA   5  
ATOM 4027  H HB2  . GLU A 1 34 ? 11.356  -3.408  3.309   1.00 0.00 ? 34 GLU A HB2  5  
ATOM 4028  H HB3  . GLU A 1 34 ? 10.428  -3.230  4.800   1.00 0.00 ? 34 GLU A HB3  5  
ATOM 4029  H HG2  . GLU A 1 34 ? 11.712  -5.400  5.534   1.00 0.00 ? 34 GLU A HG2  5  
ATOM 4030  H HG3  . GLU A 1 34 ? 12.844  -4.936  4.265   1.00 0.00 ? 34 GLU A HG3  5  
ATOM 4031  N N    . LEU A 1 35 ? 9.992   -4.425  1.329   1.00 0.00 ? 35 LEU A N    5  
ATOM 4032  C CA   . LEU A 1 35 ? 9.398   -3.973  0.075   1.00 0.00 ? 35 LEU A CA   5  
ATOM 4033  C C    . LEU A 1 35 ? 8.187   -4.834  -0.275  1.00 0.00 ? 35 LEU A C    5  
ATOM 4034  O O    . LEU A 1 35 ? 7.099   -4.318  -0.535  1.00 0.00 ? 35 LEU A O    5  
ATOM 4035  C CB   . LEU A 1 35 ? 10.434  -4.055  -1.060  1.00 0.00 ? 35 LEU A CB   5  
ATOM 4036  C CG   . LEU A 1 35 ? 10.246  -2.903  -2.070  1.00 0.00 ? 35 LEU A CG   5  
ATOM 4037  C CD1  . LEU A 1 35 ? 8.760   -2.684  -2.374  1.00 0.00 ? 35 LEU A CD1  5  
ATOM 4038  C CD2  . LEU A 1 35 ? 10.844  -1.604  -1.511  1.00 0.00 ? 35 LEU A CD2  5  
ATOM 4039  H H    . LEU A 1 35 ? 10.947  -4.644  1.360   1.00 0.00 ? 35 LEU A H    5  
ATOM 4040  H HA   . LEU A 1 35 ? 9.082   -2.948  0.193   1.00 0.00 ? 35 LEU A HA   5  
ATOM 4041  H HB2  . LEU A 1 35 ? 11.425  -4.000  -0.639  1.00 0.00 ? 35 LEU A HB2  5  
ATOM 4042  H HB3  . LEU A 1 35 ? 10.322  -4.997  -1.576  1.00 0.00 ? 35 LEU A HB3  5  
ATOM 4043  H HG   . LEU A 1 35 ? 10.755  -3.158  -2.989  1.00 0.00 ? 35 LEU A HG   5  
ATOM 4044  H HD11 . LEU A 1 35 ? 8.307   -2.108  -1.577  1.00 0.00 ? 35 LEU A HD11 5  
ATOM 4045  H HD12 . LEU A 1 35 ? 8.262   -3.638  -2.460  1.00 0.00 ? 35 LEU A HD12 5  
ATOM 4046  H HD13 . LEU A 1 35 ? 8.659   -2.144  -3.302  1.00 0.00 ? 35 LEU A HD13 5  
ATOM 4047  H HD21 . LEU A 1 35 ? 11.661  -1.833  -0.843  1.00 0.00 ? 35 LEU A HD21 5  
ATOM 4048  H HD22 . LEU A 1 35 ? 10.082  -1.057  -0.976  1.00 0.00 ? 35 LEU A HD22 5  
ATOM 4049  H HD23 . LEU A 1 35 ? 11.210  -1.000  -2.328  1.00 0.00 ? 35 LEU A HD23 5  
ATOM 4050  N N    . LEU A 1 36 ? 8.386   -6.147  -0.288  1.00 0.00 ? 36 LEU A N    5  
ATOM 4051  C CA   . LEU A 1 36 ? 7.309   -7.074  -0.616  1.00 0.00 ? 36 LEU A CA   5  
ATOM 4052  C C    . LEU A 1 36 ? 6.194   -7.005  0.423   1.00 0.00 ? 36 LEU A C    5  
ATOM 4053  O O    . LEU A 1 36 ? 5.028   -6.818  0.079   1.00 0.00 ? 36 LEU A O    5  
ATOM 4054  C CB   . LEU A 1 36 ? 7.853   -8.502  -0.693  1.00 0.00 ? 36 LEU A CB   5  
ATOM 4055  C CG   . LEU A 1 36 ? 9.103   -8.530  -1.577  1.00 0.00 ? 36 LEU A CG   5  
ATOM 4056  C CD1  . LEU A 1 36 ? 9.597   -9.971  -1.714  1.00 0.00 ? 36 LEU A CD1  5  
ATOM 4057  C CD2  . LEU A 1 36 ? 8.769   -7.970  -2.964  1.00 0.00 ? 36 LEU A CD2  5  
ATOM 4058  H H    . LEU A 1 36 ? 9.276   -6.501  -0.077  1.00 0.00 ? 36 LEU A H    5  
ATOM 4059  H HA   . LEU A 1 36 ? 6.901   -6.806  -1.578  1.00 0.00 ? 36 LEU A HA   5  
ATOM 4060  H HB2  . LEU A 1 36 ? 8.105   -8.845  0.299   1.00 0.00 ? 36 LEU A HB2  5  
ATOM 4061  H HB3  . LEU A 1 36 ? 7.102   -9.150  -1.119  1.00 0.00 ? 36 LEU A HB3  5  
ATOM 4062  H HG   . LEU A 1 36 ? 9.877   -7.928  -1.120  1.00 0.00 ? 36 LEU A HG   5  
ATOM 4063  H HD11 . LEU A 1 36 ? 9.990   -10.309 -0.766  1.00 0.00 ? 36 LEU A HD11 5  
ATOM 4064  H HD12 . LEU A 1 36 ? 10.375  -10.015 -2.463  1.00 0.00 ? 36 LEU A HD12 5  
ATOM 4065  H HD13 . LEU A 1 36 ? 8.776   -10.606 -2.010  1.00 0.00 ? 36 LEU A HD13 5  
ATOM 4066  H HD21 . LEU A 1 36 ? 8.777   -6.891  -2.930  1.00 0.00 ? 36 LEU A HD21 5  
ATOM 4067  H HD22 . LEU A 1 36 ? 7.790   -8.313  -3.267  1.00 0.00 ? 36 LEU A HD22 5  
ATOM 4068  H HD23 . LEU A 1 36 ? 9.505   -8.309  -3.678  1.00 0.00 ? 36 LEU A HD23 5  
ATOM 4069  N N    . ALA A 1 37 ? 6.554   -7.157  1.695   1.00 0.00 ? 37 ALA A N    5  
ATOM 4070  C CA   . ALA A 1 37 ? 5.560   -7.107  2.761   1.00 0.00 ? 37 ALA A CA   5  
ATOM 4071  C C    . ALA A 1 37 ? 4.734   -5.831  2.655   1.00 0.00 ? 37 ALA A C    5  
ATOM 4072  O O    . ALA A 1 37 ? 3.504   -5.875  2.643   1.00 0.00 ? 37 ALA A O    5  
ATOM 4073  C CB   . ALA A 1 37 ? 6.246   -7.159  4.127   1.00 0.00 ? 37 ALA A CB   5  
ATOM 4074  H H    . ALA A 1 37 ? 7.499   -7.304  1.918   1.00 0.00 ? 37 ALA A H    5  
ATOM 4075  H HA   . ALA A 1 37 ? 4.903   -7.959  2.667   1.00 0.00 ? 37 ALA A HA   5  
ATOM 4076  H HB1  . ALA A 1 37 ? 5.506   -7.038  4.905   1.00 0.00 ? 37 ALA A HB1  5  
ATOM 4077  H HB2  . ALA A 1 37 ? 6.973   -6.364  4.196   1.00 0.00 ? 37 ALA A HB2  5  
ATOM 4078  H HB3  . ALA A 1 37 ? 6.741   -8.112  4.245   1.00 0.00 ? 37 ALA A HB3  5  
ATOM 4079  N N    . ALA A 1 38 ? 5.418   -4.695  2.575   1.00 0.00 ? 38 ALA A N    5  
ATOM 4080  C CA   . ALA A 1 38 ? 4.737   -3.412  2.468   1.00 0.00 ? 38 ALA A CA   5  
ATOM 4081  C C    . ALA A 1 38 ? 3.860   -3.376  1.220   1.00 0.00 ? 38 ALA A C    5  
ATOM 4082  O O    . ALA A 1 38 ? 2.703   -2.960  1.274   1.00 0.00 ? 38 ALA A O    5  
ATOM 4083  C CB   . ALA A 1 38 ? 5.764   -2.279  2.414   1.00 0.00 ? 38 ALA A CB   5  
ATOM 4084  H H    . ALA A 1 38 ? 6.397   -4.721  2.586   1.00 0.00 ? 38 ALA A H    5  
ATOM 4085  H HA   . ALA A 1 38 ? 4.111   -3.275  3.338   1.00 0.00 ? 38 ALA A HA   5  
ATOM 4086  H HB1  . ALA A 1 38 ? 6.599   -2.522  3.054   1.00 0.00 ? 38 ALA A HB1  5  
ATOM 4087  H HB2  . ALA A 1 38 ? 5.306   -1.362  2.755   1.00 0.00 ? 38 ALA A HB2  5  
ATOM 4088  H HB3  . ALA A 1 38 ? 6.111   -2.153  1.399   1.00 0.00 ? 38 ALA A HB3  5  
ATOM 4089  N N    . CYS A 1 39 ? 4.419   -3.816  0.095   1.00 0.00 ? 39 CYS A N    5  
ATOM 4090  C CA   . CYS A 1 39 ? 3.673   -3.831  -1.158  1.00 0.00 ? 39 CYS A CA   5  
ATOM 4091  C C    . CYS A 1 39 ? 2.368   -4.603  -0.988  1.00 0.00 ? 39 CYS A C    5  
ATOM 4092  O O    . CYS A 1 39 ? 1.292   -4.105  -1.317  1.00 0.00 ? 39 CYS A O    5  
ATOM 4093  C CB   . CYS A 1 39 ? 4.509   -4.480  -2.262  1.00 0.00 ? 39 CYS A CB   5  
ATOM 4094  S SG   . CYS A 1 39 ? 3.769   -4.114  -3.873  1.00 0.00 ? 39 CYS A SG   5  
ATOM 4095  H H    . CYS A 1 39 ? 5.343   -4.139  0.110   1.00 0.00 ? 39 CYS A H    5  
ATOM 4096  H HA   . CYS A 1 39 ? 3.446   -2.813  -1.444  1.00 0.00 ? 39 CYS A HA   5  
ATOM 4097  H HB2  . CYS A 1 39 ? 5.515   -4.090  -2.232  1.00 0.00 ? 39 CYS A HB2  5  
ATOM 4098  H HB3  . CYS A 1 39 ? 4.534   -5.551  -2.113  1.00 0.00 ? 39 CYS A HB3  5  
ATOM 4099  H HG   . CYS A 1 39 ? 4.148   -3.292  -4.193  1.00 0.00 ? 39 CYS A HG   5  
ATOM 4100  N N    . ARG A 1 40 ? 2.473   -5.822  -0.470  1.00 0.00 ? 40 ARG A N    5  
ATOM 4101  C CA   . ARG A 1 40 ? 1.297   -6.655  -0.256  1.00 0.00 ? 40 ARG A CA   5  
ATOM 4102  C C    . ARG A 1 40 ? 0.277   -5.924  0.610   1.00 0.00 ? 40 ARG A C    5  
ATOM 4103  O O    . ARG A 1 40 ? -0.913  -5.898  0.296   1.00 0.00 ? 40 ARG A O    5  
ATOM 4104  C CB   . ARG A 1 40 ? 1.699   -7.966  0.420   1.00 0.00 ? 40 ARG A CB   5  
ATOM 4105  C CG   . ARG A 1 40 ? 2.514   -8.817  -0.558  1.00 0.00 ? 40 ARG A CG   5  
ATOM 4106  C CD   . ARG A 1 40 ? 2.833   -10.170 0.082   1.00 0.00 ? 40 ARG A CD   5  
ATOM 4107  N NE   . ARG A 1 40 ? 1.663   -11.037 0.037   1.00 0.00 ? 40 ARG A NE   5  
ATOM 4108  C CZ   . ARG A 1 40 ? 1.346   -11.709 -1.066  1.00 0.00 ? 40 ARG A CZ   5  
ATOM 4109  N NH1  . ARG A 1 40 ? 2.088   -11.597 -2.134  1.00 0.00 ? 40 ARG A NH1  5  
ATOM 4110  N NH2  . ARG A 1 40 ? 0.292   -12.479 -1.081  1.00 0.00 ? 40 ARG A NH2  5  
ATOM 4111  H H    . ARG A 1 40 ? 3.358   -6.166  -0.224  1.00 0.00 ? 40 ARG A H    5  
ATOM 4112  H HA   . ARG A 1 40 ? 0.848   -6.880  -1.213  1.00 0.00 ? 40 ARG A HA   5  
ATOM 4113  H HB2  . ARG A 1 40 ? 2.297   -7.751  1.295   1.00 0.00 ? 40 ARG A HB2  5  
ATOM 4114  H HB3  . ARG A 1 40 ? 0.813   -8.508  0.712   1.00 0.00 ? 40 ARG A HB3  5  
ATOM 4115  H HG2  . ARG A 1 40 ? 1.942   -8.970  -1.462  1.00 0.00 ? 40 ARG A HG2  5  
ATOM 4116  H HG3  . ARG A 1 40 ? 3.435   -8.307  -0.798  1.00 0.00 ? 40 ARG A HG3  5  
ATOM 4117  H HD2  . ARG A 1 40 ? 3.643   -10.636 -0.457  1.00 0.00 ? 40 ARG A HD2  5  
ATOM 4118  H HD3  . ARG A 1 40 ? 3.130   -10.017 1.109   1.00 0.00 ? 40 ARG A HD3  5  
ATOM 4119  H HE   . ARG A 1 40 ? 1.098   -11.127 0.833   1.00 0.00 ? 40 ARG A HE   5  
ATOM 4120  H HH11 . ARG A 1 40 ? 2.895   -11.006 -2.123  1.00 0.00 ? 40 ARG A HH11 5  
ATOM 4121  H HH12 . ARG A 1 40 ? 1.849   -12.103 -2.963  1.00 0.00 ? 40 ARG A HH12 5  
ATOM 4122  H HH21 . ARG A 1 40 ? -0.276  -12.565 -0.263  1.00 0.00 ? 40 ARG A HH21 5  
ATOM 4123  H HH22 . ARG A 1 40 ? 0.055   -12.985 -1.911  1.00 0.00 ? 40 ARG A HH22 5  
ATOM 4124  N N    . GLU A 1 41 ? 0.752   -5.327  1.700   1.00 0.00 ? 41 GLU A N    5  
ATOM 4125  C CA   . GLU A 1 41 ? -0.131  -4.595  2.599   1.00 0.00 ? 41 GLU A CA   5  
ATOM 4126  C C    . GLU A 1 41 ? -0.912  -3.536  1.827   1.00 0.00 ? 41 GLU A C    5  
ATOM 4127  O O    . GLU A 1 41 ? -2.118  -3.379  2.019   1.00 0.00 ? 41 GLU A O    5  
ATOM 4128  C CB   . GLU A 1 41 ? 0.689   -3.926  3.707   1.00 0.00 ? 41 GLU A CB   5  
ATOM 4129  C CG   . GLU A 1 41 ? 1.141   -4.979  4.720   1.00 0.00 ? 41 GLU A CG   5  
ATOM 4130  C CD   . GLU A 1 41 ? 1.861   -4.307  5.885   1.00 0.00 ? 41 GLU A CD   5  
ATOM 4131  O OE1  . GLU A 1 41 ? 2.683   -3.443  5.628   1.00 0.00 ? 41 GLU A OE1  5  
ATOM 4132  O OE2  . GLU A 1 41 ? 1.577   -4.665  7.016   1.00 0.00 ? 41 GLU A OE2  5  
ATOM 4133  H H    . GLU A 1 41 ? 1.710   -5.379  1.899   1.00 0.00 ? 41 GLU A H    5  
ATOM 4134  H HA   . GLU A 1 41 ? -0.827  -5.287  3.049   1.00 0.00 ? 41 GLU A HA   5  
ATOM 4135  H HB2  . GLU A 1 41 ? 1.553   -3.446  3.274   1.00 0.00 ? 41 GLU A HB2  5  
ATOM 4136  H HB3  . GLU A 1 41 ? 0.080   -3.187  4.207   1.00 0.00 ? 41 GLU A HB3  5  
ATOM 4137  H HG2  . GLU A 1 41 ? 0.279   -5.514  5.092   1.00 0.00 ? 41 GLU A HG2  5  
ATOM 4138  H HG3  . GLU A 1 41 ? 1.814   -5.674  4.239   1.00 0.00 ? 41 GLU A HG3  5  
ATOM 4139  N N    . GLU A 1 42 ? -0.215  -2.816  0.954   1.00 0.00 ? 42 GLU A N    5  
ATOM 4140  C CA   . GLU A 1 42 ? -0.855  -1.776  0.155   1.00 0.00 ? 42 GLU A CA   5  
ATOM 4141  C C    . GLU A 1 42 ? -1.951  -2.378  -0.718  1.00 0.00 ? 42 GLU A C    5  
ATOM 4142  O O    . GLU A 1 42 ? -3.083  -1.892  -0.733  1.00 0.00 ? 42 GLU A O    5  
ATOM 4143  C CB   . GLU A 1 42 ? 0.182   -1.079  -0.727  1.00 0.00 ? 42 GLU A CB   5  
ATOM 4144  C CG   . GLU A 1 42 ? 1.155   -0.292  0.153   1.00 0.00 ? 42 GLU A CG   5  
ATOM 4145  C CD   . GLU A 1 42 ? 0.454   0.928   0.742   1.00 0.00 ? 42 GLU A CD   5  
ATOM 4146  O OE1  . GLU A 1 42 ? -0.144  0.793   1.795   1.00 0.00 ? 42 GLU A OE1  5  
ATOM 4147  O OE2  . GLU A 1 42 ? 0.527   1.981   0.128   1.00 0.00 ? 42 GLU A OE2  5  
ATOM 4148  H H    . GLU A 1 42 ? 0.743   -2.987  0.843   1.00 0.00 ? 42 GLU A H    5  
ATOM 4149  H HA   . GLU A 1 42 ? -1.296  -1.047  0.819   1.00 0.00 ? 42 GLU A HA   5  
ATOM 4150  H HB2  . GLU A 1 42 ? 0.727   -1.821  -1.294  1.00 0.00 ? 42 GLU A HB2  5  
ATOM 4151  H HB3  . GLU A 1 42 ? -0.317  -0.402  -1.404  1.00 0.00 ? 42 GLU A HB3  5  
ATOM 4152  H HG2  . GLU A 1 42 ? 1.507   -0.925  0.955   1.00 0.00 ? 42 GLU A HG2  5  
ATOM 4153  H HG3  . GLU A 1 42 ? 1.996   0.031   -0.443  1.00 0.00 ? 42 GLU A HG3  5  
ATOM 4154  N N    . PHE A 1 43 ? -1.608  -3.437  -1.445  1.00 0.00 ? 43 PHE A N    5  
ATOM 4155  C CA   . PHE A 1 43 ? -2.574  -4.099  -2.316  1.00 0.00 ? 43 PHE A CA   5  
ATOM 4156  C C    . PHE A 1 43 ? -3.845  -4.432  -1.537  1.00 0.00 ? 43 PHE A C    5  
ATOM 4157  O O    . PHE A 1 43 ? -4.948  -4.074  -1.947  1.00 0.00 ? 43 PHE A O    5  
ATOM 4158  C CB   . PHE A 1 43 ? -1.963  -5.383  -2.895  1.00 0.00 ? 43 PHE A CB   5  
ATOM 4159  C CG   . PHE A 1 43 ? -1.554  -5.155  -4.333  1.00 0.00 ? 43 PHE A CG   5  
ATOM 4160  C CD1  . PHE A 1 43 ? -0.796  -4.030  -4.675  1.00 0.00 ? 43 PHE A CD1  5  
ATOM 4161  C CD2  . PHE A 1 43 ? -1.934  -6.070  -5.325  1.00 0.00 ? 43 PHE A CD2  5  
ATOM 4162  C CE1  . PHE A 1 43 ? -0.417  -3.818  -6.006  1.00 0.00 ? 43 PHE A CE1  5  
ATOM 4163  C CE2  . PHE A 1 43 ? -1.555  -5.857  -6.656  1.00 0.00 ? 43 PHE A CE2  5  
ATOM 4164  C CZ   . PHE A 1 43 ? -0.798  -4.731  -6.997  1.00 0.00 ? 43 PHE A CZ   5  
ATOM 4165  H H    . PHE A 1 43 ? -0.692  -3.783  -1.392  1.00 0.00 ? 43 PHE A H    5  
ATOM 4166  H HA   . PHE A 1 43 ? -2.828  -3.431  -3.125  1.00 0.00 ? 43 PHE A HA   5  
ATOM 4167  H HB2  . PHE A 1 43 ? -1.095  -5.659  -2.315  1.00 0.00 ? 43 PHE A HB2  5  
ATOM 4168  H HB3  . PHE A 1 43 ? -2.690  -6.184  -2.853  1.00 0.00 ? 43 PHE A HB3  5  
ATOM 4169  H HD1  . PHE A 1 43 ? -0.503  -3.324  -3.911  1.00 0.00 ? 43 PHE A HD1  5  
ATOM 4170  H HD2  . PHE A 1 43 ? -2.519  -6.939  -5.062  1.00 0.00 ? 43 PHE A HD2  5  
ATOM 4171  H HE1  . PHE A 1 43 ? 0.167   -2.948  -6.269  1.00 0.00 ? 43 PHE A HE1  5  
ATOM 4172  H HE2  . PHE A 1 43 ? -1.848  -6.562  -7.419  1.00 0.00 ? 43 PHE A HE2  5  
ATOM 4173  H HZ   . PHE A 1 43 ? -0.504  -4.567  -8.022  1.00 0.00 ? 43 PHE A HZ   5  
ATOM 4174  N N    . HIS A 1 44 ? -3.679  -5.117  -0.410  1.00 0.00 ? 44 HIS A N    5  
ATOM 4175  C CA   . HIS A 1 44 ? -4.818  -5.492  0.418   1.00 0.00 ? 44 HIS A CA   5  
ATOM 4176  C C    . HIS A 1 44 ? -5.618  -4.253  0.809   1.00 0.00 ? 44 HIS A C    5  
ATOM 4177  O O    . HIS A 1 44 ? -6.849  -4.263  0.786   1.00 0.00 ? 44 HIS A O    5  
ATOM 4178  C CB   . HIS A 1 44 ? -4.334  -6.211  1.679   1.00 0.00 ? 44 HIS A CB   5  
ATOM 4179  C CG   . HIS A 1 44 ? -5.497  -6.893  2.346   1.00 0.00 ? 44 HIS A CG   5  
ATOM 4180  N ND1  . HIS A 1 44 ? -6.654  -6.213  2.695   1.00 0.00 ? 44 HIS A ND1  5  
ATOM 4181  C CD2  . HIS A 1 44 ? -5.695  -8.194  2.736   1.00 0.00 ? 44 HIS A CD2  5  
ATOM 4182  C CE1  . HIS A 1 44 ? -7.489  -7.100  3.266   1.00 0.00 ? 44 HIS A CE1  5  
ATOM 4183  N NE2  . HIS A 1 44 ? -6.954  -8.323  3.317   1.00 0.00 ? 44 HIS A NE2  5  
ATOM 4184  H H    . HIS A 1 44 ? -2.775  -5.376  -0.132  1.00 0.00 ? 44 HIS A H    5  
ATOM 4185  H HA   . HIS A 1 44 ? -5.456  -6.159  -0.143  1.00 0.00 ? 44 HIS A HA   5  
ATOM 4186  H HB2  . HIS A 1 44 ? -3.591  -6.946  1.411   1.00 0.00 ? 44 HIS A HB2  5  
ATOM 4187  H HB3  . HIS A 1 44 ? -3.902  -5.492  2.358   1.00 0.00 ? 44 HIS A HB3  5  
ATOM 4188  H HD2  . HIS A 1 44 ? -4.983  -8.997  2.612   1.00 0.00 ? 44 HIS A HD2  5  
ATOM 4189  H HE1  . HIS A 1 44 ? -8.471  -6.853  3.639   1.00 0.00 ? 44 HIS A HE1  5  
ATOM 4190  H HE2  . HIS A 1 44 ? -7.359  -9.137  3.685   1.00 0.00 ? 44 HIS A HE2  5  
ATOM 4191  N N    . ARG A 1 45 ? -4.908  -3.187  1.168   1.00 0.00 ? 45 ARG A N    5  
ATOM 4192  C CA   . ARG A 1 45 ? -5.562  -1.945  1.561   1.00 0.00 ? 45 ARG A CA   5  
ATOM 4193  C C    . ARG A 1 45 ? -6.342  -1.359  0.388   1.00 0.00 ? 45 ARG A C    5  
ATOM 4194  O O    . ARG A 1 45 ? -7.513  -1.003  0.526   1.00 0.00 ? 45 ARG A O    5  
ATOM 4195  C CB   . ARG A 1 45 ? -4.517  -0.934  2.038   1.00 0.00 ? 45 ARG A CB   5  
ATOM 4196  C CG   . ARG A 1 45 ? -5.201  0.400   2.346   1.00 0.00 ? 45 ARG A CG   5  
ATOM 4197  C CD   . ARG A 1 45 ? -4.254  1.285   3.161   1.00 0.00 ? 45 ARG A CD   5  
ATOM 4198  N NE   . ARG A 1 45 ? -4.705  2.673   3.123   1.00 0.00 ? 45 ARG A NE   5  
ATOM 4199  C CZ   . ARG A 1 45 ? -4.417  3.461   2.094   1.00 0.00 ? 45 ARG A CZ   5  
ATOM 4200  N NH1  . ARG A 1 45 ? -3.719  2.999   1.093   1.00 0.00 ? 45 ARG A NH1  5  
ATOM 4201  N NH2  . ARG A 1 45 ? -4.832  4.698   2.084   1.00 0.00 ? 45 ARG A NH2  5  
ATOM 4202  H H    . ARG A 1 45 ? -3.930  -3.238  1.166   1.00 0.00 ? 45 ARG A H    5  
ATOM 4203  H HA   . ARG A 1 45 ? -6.246  -2.150  2.370   1.00 0.00 ? 45 ARG A HA   5  
ATOM 4204  H HB2  . ARG A 1 45 ? -4.037  -1.309  2.931   1.00 0.00 ? 45 ARG A HB2  5  
ATOM 4205  H HB3  . ARG A 1 45 ? -3.779  -0.787  1.265   1.00 0.00 ? 45 ARG A HB3  5  
ATOM 4206  H HG2  . ARG A 1 45 ? -5.452  0.898   1.421   1.00 0.00 ? 45 ARG A HG2  5  
ATOM 4207  H HG3  . ARG A 1 45 ? -6.101  0.221   2.915   1.00 0.00 ? 45 ARG A HG3  5  
ATOM 4208  H HD2  . ARG A 1 45 ? -4.237  0.944   4.184   1.00 0.00 ? 45 ARG A HD2  5  
ATOM 4209  H HD3  . ARG A 1 45 ? -3.259  1.220   2.746   1.00 0.00 ? 45 ARG A HD3  5  
ATOM 4210  H HE   . ARG A 1 45 ? -5.230  3.027   3.871   1.00 0.00 ? 45 ARG A HE   5  
ATOM 4211  H HH11 . ARG A 1 45 ? -3.401  2.051   1.101   1.00 0.00 ? 45 ARG A HH11 5  
ATOM 4212  H HH12 . ARG A 1 45 ? -3.502  3.593   0.318   1.00 0.00 ? 45 ARG A HH12 5  
ATOM 4213  H HH21 . ARG A 1 45 ? -5.367  5.053   2.851   1.00 0.00 ? 45 ARG A HH21 5  
ATOM 4214  H HH22 . ARG A 1 45 ? -4.615  5.292   1.309   1.00 0.00 ? 45 ARG A HH22 5  
ATOM 4215  N N    . ARG A 1 46 ? -5.688  -1.265  -0.766  1.00 0.00 ? 46 ARG A N    5  
ATOM 4216  C CA   . ARG A 1 46 ? -6.332  -0.723  -1.955  1.00 0.00 ? 46 ARG A CA   5  
ATOM 4217  C C    . ARG A 1 46 ? -7.623  -1.480  -2.253  1.00 0.00 ? 46 ARG A C    5  
ATOM 4218  O O    . ARG A 1 46 ? -8.649  -0.877  -2.571  1.00 0.00 ? 46 ARG A O    5  
ATOM 4219  C CB   . ARG A 1 46 ? -5.392  -0.830  -3.160  1.00 0.00 ? 46 ARG A CB   5  
ATOM 4220  C CG   . ARG A 1 46 ? -5.934  0.025   -4.315  1.00 0.00 ? 46 ARG A CG   5  
ATOM 4221  C CD   . ARG A 1 46 ? -5.555  -0.613  -5.653  1.00 0.00 ? 46 ARG A CD   5  
ATOM 4222  N NE   . ARG A 1 46 ? -4.106  -0.718  -5.773  1.00 0.00 ? 46 ARG A NE   5  
ATOM 4223  C CZ   . ARG A 1 46 ? -3.376  0.303   -6.209  1.00 0.00 ? 46 ARG A CZ   5  
ATOM 4224  N NH1  . ARG A 1 46 ? -3.952  1.427   -6.536  1.00 0.00 ? 46 ARG A NH1  5  
ATOM 4225  N NH2  . ARG A 1 46 ? -2.080  0.181   -6.312  1.00 0.00 ? 46 ARG A NH2  5  
ATOM 4226  H H    . ARG A 1 46 ? -4.756  -1.565  -0.817  1.00 0.00 ? 46 ARG A H    5  
ATOM 4227  H HA   . ARG A 1 46 ? -6.564  0.316   -1.786  1.00 0.00 ? 46 ARG A HA   5  
ATOM 4228  H HB2  . ARG A 1 46 ? -4.409  -0.479  -2.878  1.00 0.00 ? 46 ARG A HB2  5  
ATOM 4229  H HB3  . ARG A 1 46 ? -5.329  -1.862  -3.473  1.00 0.00 ? 46 ARG A HB3  5  
ATOM 4230  H HG2  . ARG A 1 46 ? -7.010  0.093   -4.241  1.00 0.00 ? 46 ARG A HG2  5  
ATOM 4231  H HG3  . ARG A 1 46 ? -5.507  1.017   -4.258  1.00 0.00 ? 46 ARG A HG3  5  
ATOM 4232  H HD2  . ARG A 1 46 ? -5.988  -1.599  -5.714  1.00 0.00 ? 46 ARG A HD2  5  
ATOM 4233  H HD3  . ARG A 1 46 ? -5.939  -0.005  -6.460  1.00 0.00 ? 46 ARG A HD3  5  
ATOM 4234  H HE   . ARG A 1 46 ? -3.661  -1.557  -5.528  1.00 0.00 ? 46 ARG A HE   5  
ATOM 4235  H HH11 . ARG A 1 46 ? -4.945  1.520   -6.458  1.00 0.00 ? 46 ARG A HH11 5  
ATOM 4236  H HH12 . ARG A 1 46 ? -3.403  2.195   -6.865  1.00 0.00 ? 46 ARG A HH12 5  
ATOM 4237  H HH21 . ARG A 1 46 ? -1.639  -0.679  -6.061  1.00 0.00 ? 46 ARG A HH21 5  
ATOM 4238  H HH22 . ARG A 1 46 ? -1.530  0.950   -6.640  1.00 0.00 ? 46 ARG A HH22 5  
ATOM 4239  N N    . LEU A 1 47 ? -7.561  -2.803  -2.155  1.00 0.00 ? 47 LEU A N    5  
ATOM 4240  C CA   . LEU A 1 47 ? -8.728  -3.635  -2.421  1.00 0.00 ? 47 LEU A CA   5  
ATOM 4241  C C    . LEU A 1 47 ? -9.796  -3.432  -1.349  1.00 0.00 ? 47 LEU A C    5  
ATOM 4242  O O    . LEU A 1 47 ? -10.991 -3.464  -1.638  1.00 0.00 ? 47 LEU A O    5  
ATOM 4243  C CB   . LEU A 1 47 ? -8.315  -5.109  -2.456  1.00 0.00 ? 47 LEU A CB   5  
ATOM 4244  C CG   . LEU A 1 47 ? -7.431  -5.372  -3.685  1.00 0.00 ? 47 LEU A CG   5  
ATOM 4245  C CD1  . LEU A 1 47 ? -6.526  -6.577  -3.416  1.00 0.00 ? 47 LEU A CD1  5  
ATOM 4246  C CD2  . LEU A 1 47 ? -8.310  -5.665  -4.906  1.00 0.00 ? 47 LEU A CD2  5  
ATOM 4247  H H    . LEU A 1 47 ? -6.715  -3.227  -1.900  1.00 0.00 ? 47 LEU A H    5  
ATOM 4248  H HA   . LEU A 1 47 ? -9.140  -3.365  -3.379  1.00 0.00 ? 47 LEU A HA   5  
ATOM 4249  H HB2  . LEU A 1 47 ? -7.763  -5.346  -1.558  1.00 0.00 ? 47 LEU A HB2  5  
ATOM 4250  H HB3  . LEU A 1 47 ? -9.197  -5.729  -2.509  1.00 0.00 ? 47 LEU A HB3  5  
ATOM 4251  H HG   . LEU A 1 47 ? -6.818  -4.503  -3.879  1.00 0.00 ? 47 LEU A HG   5  
ATOM 4252  H HD11 . LEU A 1 47 ? -5.876  -6.361  -2.583  1.00 0.00 ? 47 LEU A HD11 5  
ATOM 4253  H HD12 . LEU A 1 47 ? -5.932  -6.784  -4.294  1.00 0.00 ? 47 LEU A HD12 5  
ATOM 4254  H HD13 . LEU A 1 47 ? -7.135  -7.439  -3.183  1.00 0.00 ? 47 LEU A HD13 5  
ATOM 4255  H HD21 . LEU A 1 47 ? -8.974  -6.486  -4.683  1.00 0.00 ? 47 LEU A HD21 5  
ATOM 4256  H HD22 . LEU A 1 47 ? -7.683  -5.926  -5.745  1.00 0.00 ? 47 LEU A HD22 5  
ATOM 4257  H HD23 . LEU A 1 47 ? -8.891  -4.790  -5.152  1.00 0.00 ? 47 LEU A HD23 5  
ATOM 4258  N N    . LYS A 1 48 ? -9.357  -3.228  -0.111  1.00 0.00 ? 48 LYS A N    5  
ATOM 4259  C CA   . LYS A 1 48 ? -10.288 -3.027  0.994   1.00 0.00 ? 48 LYS A CA   5  
ATOM 4260  C C    . LYS A 1 48 ? -11.027 -1.701  0.848   1.00 0.00 ? 48 LYS A C    5  
ATOM 4261  O O    . LYS A 1 48 ? -12.257 -1.659  0.885   1.00 0.00 ? 48 LYS A O    5  
ATOM 4262  C CB   . LYS A 1 48 ? -9.531  -3.047  2.324   1.00 0.00 ? 48 LYS A CB   5  
ATOM 4263  C CG   . LYS A 1 48 ? -10.526 -3.216  3.475   1.00 0.00 ? 48 LYS A CG   5  
ATOM 4264  C CD   . LYS A 1 48 ? -9.812  -2.978  4.807   1.00 0.00 ? 48 LYS A CD   5  
ATOM 4265  C CE   . LYS A 1 48 ? -10.794 -3.203  5.959   1.00 0.00 ? 48 LYS A CE   5  
ATOM 4266  N NZ   . LYS A 1 48 ? -11.164 -4.645  6.024   1.00 0.00 ? 48 LYS A NZ   5  
ATOM 4267  H H    . LYS A 1 48 ? -8.392  -3.217  0.062   1.00 0.00 ? 48 LYS A H    5  
ATOM 4268  H HA   . LYS A 1 48 ? -11.009 -3.830  0.992   1.00 0.00 ? 48 LYS A HA   5  
ATOM 4269  H HB2  . LYS A 1 48 ? -8.833  -3.871  2.328   1.00 0.00 ? 48 LYS A HB2  5  
ATOM 4270  H HB3  . LYS A 1 48 ? -8.995  -2.119  2.447   1.00 0.00 ? 48 LYS A HB3  5  
ATOM 4271  H HG2  . LYS A 1 48 ? -11.328 -2.502  3.364   1.00 0.00 ? 48 LYS A HG2  5  
ATOM 4272  H HG3  . LYS A 1 48 ? -10.930 -4.217  3.458   1.00 0.00 ? 48 LYS A HG3  5  
ATOM 4273  H HD2  . LYS A 1 48 ? -8.984  -3.667  4.899   1.00 0.00 ? 48 LYS A HD2  5  
ATOM 4274  H HD3  . LYS A 1 48 ? -9.444  -1.964  4.843   1.00 0.00 ? 48 LYS A HD3  5  
ATOM 4275  H HE2  . LYS A 1 48 ? -10.330 -2.909  6.889   1.00 0.00 ? 48 LYS A HE2  5  
ATOM 4276  H HE3  . LYS A 1 48 ? -11.682 -2.611  5.797   1.00 0.00 ? 48 LYS A HE3  5  
ATOM 4277  H HZ1  . LYS A 1 48 ? -11.266 -4.933  7.017   1.00 0.00 ? 48 LYS A HZ1  5  
ATOM 4278  H HZ2  . LYS A 1 48 ? -10.418 -5.216  5.576   1.00 0.00 ? 48 LYS A HZ2  5  
ATOM 4279  H HZ3  . LYS A 1 48 ? -12.063 -4.795  5.524   1.00 0.00 ? 48 LYS A HZ3  5  
ATOM 4280  N N    . VAL A 1 49 ? -10.272 -0.619  0.686   1.00 0.00 ? 49 VAL A N    5  
ATOM 4281  C CA   . VAL A 1 49 ? -10.873 0.702   0.540   1.00 0.00 ? 49 VAL A CA   5  
ATOM 4282  C C    . VAL A 1 49 ? -11.622 0.808   -0.785  1.00 0.00 ? 49 VAL A C    5  
ATOM 4283  O O    . VAL A 1 49 ? -12.697 1.405   -0.854  1.00 0.00 ? 49 VAL A O    5  
ATOM 4284  C CB   . VAL A 1 49 ? -9.789  1.779   0.605   1.00 0.00 ? 49 VAL A CB   5  
ATOM 4285  C CG1  . VAL A 1 49 ? -8.961  1.596   1.878   1.00 0.00 ? 49 VAL A CG1  5  
ATOM 4286  C CG2  . VAL A 1 49 ? -8.878  1.658   -0.617  1.00 0.00 ? 49 VAL A CG2  5  
ATOM 4287  H H    . VAL A 1 49 ? -9.296  -0.711  0.666   1.00 0.00 ? 49 VAL A H    5  
ATOM 4288  H HA   . VAL A 1 49 ? -11.569 0.860   1.349   1.00 0.00 ? 49 VAL A HA   5  
ATOM 4289  H HB   . VAL A 1 49 ? -10.254 2.755   0.615   1.00 0.00 ? 49 VAL A HB   5  
ATOM 4290  H HG11 . VAL A 1 49 ? -8.136  2.290   1.874   1.00 0.00 ? 49 VAL A HG11 5  
ATOM 4291  H HG12 . VAL A 1 49 ? -8.582  0.585   1.916   1.00 0.00 ? 49 VAL A HG12 5  
ATOM 4292  H HG13 . VAL A 1 49 ? -9.584  1.780   2.741   1.00 0.00 ? 49 VAL A HG13 5  
ATOM 4293  H HG21 . VAL A 1 49 ? -8.625  0.621   -0.775  1.00 0.00 ? 49 VAL A HG21 5  
ATOM 4294  H HG22 . VAL A 1 49 ? -7.975  2.229   -0.453  1.00 0.00 ? 49 VAL A HG22 5  
ATOM 4295  H HG23 . VAL A 1 49 ? -9.391  2.040   -1.488  1.00 0.00 ? 49 VAL A HG23 5  
ATOM 4296  N N    . TYR A 1 50 ? -11.050 0.227   -1.834  1.00 0.00 ? 50 TYR A N    5  
ATOM 4297  C CA   . TYR A 1 50 ? -11.678 0.267   -3.151  1.00 0.00 ? 50 TYR A CA   5  
ATOM 4298  C C    . TYR A 1 50 ? -13.017 -0.464  -3.125  1.00 0.00 ? 50 TYR A C    5  
ATOM 4299  O O    . TYR A 1 50 ? -14.001 0.005   -3.698  1.00 0.00 ? 50 TYR A O    5  
ATOM 4300  C CB   . TYR A 1 50 ? -10.760 -0.381  -4.190  1.00 0.00 ? 50 TYR A CB   5  
ATOM 4301  C CG   . TYR A 1 50 ? -11.455 -0.407  -5.531  1.00 0.00 ? 50 TYR A CG   5  
ATOM 4302  C CD1  . TYR A 1 50 ? -11.335 0.683   -6.401  1.00 0.00 ? 50 TYR A CD1  5  
ATOM 4303  C CD2  . TYR A 1 50 ? -12.218 -1.520  -5.902  1.00 0.00 ? 50 TYR A CD2  5  
ATOM 4304  C CE1  . TYR A 1 50 ? -11.979 0.660   -7.644  1.00 0.00 ? 50 TYR A CE1  5  
ATOM 4305  C CE2  . TYR A 1 50 ? -12.862 -1.543  -7.146  1.00 0.00 ? 50 TYR A CE2  5  
ATOM 4306  C CZ   . TYR A 1 50 ? -12.743 -0.453  -8.016  1.00 0.00 ? 50 TYR A CZ   5  
ATOM 4307  O OH   . TYR A 1 50 ? -13.378 -0.475  -9.242  1.00 0.00 ? 50 TYR A OH   5  
ATOM 4308  H H    . TYR A 1 50 ? -10.193 -0.235  -1.722  1.00 0.00 ? 50 TYR A H    5  
ATOM 4309  H HA   . TYR A 1 50 ? -11.846 1.296   -3.428  1.00 0.00 ? 50 TYR A HA   5  
ATOM 4310  H HB2  . TYR A 1 50 ? -9.847  0.189   -4.269  1.00 0.00 ? 50 TYR A HB2  5  
ATOM 4311  H HB3  . TYR A 1 50 ? -10.529 -1.392  -3.886  1.00 0.00 ? 50 TYR A HB3  5  
ATOM 4312  H HD1  . TYR A 1 50 ? -10.747 1.541   -6.115  1.00 0.00 ? 50 TYR A HD1  5  
ATOM 4313  H HD2  . TYR A 1 50 ? -12.311 -2.360  -5.231  1.00 0.00 ? 50 TYR A HD2  5  
ATOM 4314  H HE1  . TYR A 1 50 ? -11.886 1.501   -8.316  1.00 0.00 ? 50 TYR A HE1  5  
ATOM 4315  H HE2  . TYR A 1 50 ? -13.452 -2.402  -7.433  1.00 0.00 ? 50 TYR A HE2  5  
ATOM 4316  H HH   . TYR A 1 50 ? -12.760 -0.155  -9.902  1.00 0.00 ? 50 TYR A HH   5  
ATOM 4317  N N    . HIS A 1 51 ? -13.047 -1.611  -2.455  1.00 0.00 ? 51 HIS A N    5  
ATOM 4318  C CA   . HIS A 1 51 ? -14.271 -2.396  -2.359  1.00 0.00 ? 51 HIS A CA   5  
ATOM 4319  C C    . HIS A 1 51 ? -15.171 -1.850  -1.256  1.00 0.00 ? 51 HIS A C    5  
ATOM 4320  O O    . HIS A 1 51 ? -16.392 -1.996  -1.308  1.00 0.00 ? 51 HIS A O    5  
ATOM 4321  C CB   . HIS A 1 51 ? -13.931 -3.859  -2.066  1.00 0.00 ? 51 HIS A CB   5  
ATOM 4322  C CG   . HIS A 1 51 ? -15.167 -4.702  -2.225  1.00 0.00 ? 51 HIS A CG   5  
ATOM 4323  N ND1  . HIS A 1 51 ? -15.799 -5.298  -1.144  1.00 0.00 ? 51 HIS A ND1  5  
ATOM 4324  C CD2  . HIS A 1 51 ? -15.898 -5.059  -3.330  1.00 0.00 ? 51 HIS A CD2  5  
ATOM 4325  C CE1  . HIS A 1 51 ? -16.861 -5.975  -1.618  1.00 0.00 ? 51 HIS A CE1  5  
ATOM 4326  N NE2  . HIS A 1 51 ? -16.968 -5.861  -2.945  1.00 0.00 ? 51 HIS A NE2  5  
ATOM 4327  H H    . HIS A 1 51 ? -12.231 -1.934  -2.017  1.00 0.00 ? 51 HIS A H    5  
ATOM 4328  H HA   . HIS A 1 51 ? -14.797 -2.343  -3.301  1.00 0.00 ? 51 HIS A HA   5  
ATOM 4329  H HB2  . HIS A 1 51 ? -13.173 -4.198  -2.756  1.00 0.00 ? 51 HIS A HB2  5  
ATOM 4330  H HB3  . HIS A 1 51 ? -13.564 -3.948  -1.054  1.00 0.00 ? 51 HIS A HB3  5  
ATOM 4331  H HD2  . HIS A 1 51 ? -15.679 -4.760  -4.344  1.00 0.00 ? 51 HIS A HD2  5  
ATOM 4332  H HE1  . HIS A 1 51 ? -17.542 -6.541  -1.001  1.00 0.00 ? 51 HIS A HE1  5  
ATOM 4333  H HE2  . HIS A 1 51 ? -17.652 -6.260  -3.523  1.00 0.00 ? 51 HIS A HE2  5  
ATOM 4334  N N    . ALA A 1 52 ? -14.558 -1.219  -0.259  1.00 0.00 ? 52 ALA A N    5  
ATOM 4335  C CA   . ALA A 1 52 ? -15.312 -0.652  0.855   1.00 0.00 ? 52 ALA A CA   5  
ATOM 4336  C C    . ALA A 1 52 ? -15.659 0.809   0.580   1.00 0.00 ? 52 ALA A C    5  
ATOM 4337  O O    . ALA A 1 52 ? -16.377 1.442   1.355   1.00 0.00 ? 52 ALA A O    5  
ATOM 4338  C CB   . ALA A 1 52 ? -14.489 -0.746  2.142   1.00 0.00 ? 52 ALA A CB   5  
ATOM 4339  H H    . ALA A 1 52 ? -13.582 -1.133  -0.272  1.00 0.00 ? 52 ALA A H    5  
ATOM 4340  H HA   . ALA A 1 52 ? -16.225 -1.212  0.985   1.00 0.00 ? 52 ALA A HA   5  
ATOM 4341  H HB1  . ALA A 1 52 ? -15.091 -0.424  2.979   1.00 0.00 ? 52 ALA A HB1  5  
ATOM 4342  H HB2  . ALA A 1 52 ? -13.618 -0.113  2.060   1.00 0.00 ? 52 ALA A HB2  5  
ATOM 4343  H HB3  . ALA A 1 52 ? -14.177 -1.769  2.295   1.00 0.00 ? 52 ALA A HB3  5  
ATOM 4344  N N    . TRP A 1 53 ? -15.148 1.336   -0.527  1.00 0.00 ? 53 TRP A N    5  
ATOM 4345  C CA   . TRP A 1 53 ? -15.414 2.723   -0.891  1.00 0.00 ? 53 TRP A CA   5  
ATOM 4346  C C    . TRP A 1 53 ? -16.903 3.033   -0.772  1.00 0.00 ? 53 TRP A C    5  
ATOM 4347  O O    . TRP A 1 53 ? -17.291 4.165   -0.481  1.00 0.00 ? 53 TRP A O    5  
ATOM 4348  C CB   . TRP A 1 53 ? -14.943 2.988   -2.326  1.00 0.00 ? 53 TRP A CB   5  
ATOM 4349  C CG   . TRP A 1 53 ? -15.897 2.368   -3.298  1.00 0.00 ? 53 TRP A CG   5  
ATOM 4350  C CD1  . TRP A 1 53 ? -16.339 1.090   -3.248  1.00 0.00 ? 53 TRP A CD1  5  
ATOM 4351  C CD2  . TRP A 1 53 ? -16.532 2.976   -4.460  1.00 0.00 ? 53 TRP A CD2  5  
ATOM 4352  N NE1  . TRP A 1 53 ? -17.205 0.876   -4.305  1.00 0.00 ? 53 TRP A NE1  5  
ATOM 4353  C CE2  . TRP A 1 53 ? -17.357 2.008   -5.081  1.00 0.00 ? 53 TRP A CE2  5  
ATOM 4354  C CE3  . TRP A 1 53 ? -16.474 4.260   -5.031  1.00 0.00 ? 53 TRP A CE3  5  
ATOM 4355  C CZ2  . TRP A 1 53 ? -18.097 2.303   -6.227  1.00 0.00 ? 53 TRP A CZ2  5  
ATOM 4356  C CZ3  . TRP A 1 53 ? -17.218 4.562   -6.183  1.00 0.00 ? 53 TRP A CZ3  5  
ATOM 4357  C CH2  . TRP A 1 53 ? -18.027 3.584   -6.780  1.00 0.00 ? 53 TRP A CH2  5  
ATOM 4358  H H    . TRP A 1 53 ? -14.583 0.784   -1.108  1.00 0.00 ? 53 TRP A H    5  
ATOM 4359  H HA   . TRP A 1 53 ? -14.868 3.370   -0.222  1.00 0.00 ? 53 TRP A HA   5  
ATOM 4360  H HB2  . TRP A 1 53 ? -14.897 4.053   -2.497  1.00 0.00 ? 53 TRP A HB2  5  
ATOM 4361  H HB3  . TRP A 1 53 ? -13.960 2.560   -2.466  1.00 0.00 ? 53 TRP A HB3  5  
ATOM 4362  H HD1  . TRP A 1 53 ? -16.062 0.358   -2.505  1.00 0.00 ? 53 TRP A HD1  5  
ATOM 4363  H HE1  . TRP A 1 53 ? -17.664 0.031   -4.498  1.00 0.00 ? 53 TRP A HE1  5  
ATOM 4364  H HE3  . TRP A 1 53 ? -15.853 5.020   -4.579  1.00 0.00 ? 53 TRP A HE3  5  
ATOM 4365  H HZ2  . TRP A 1 53 ? -18.719 1.548   -6.682  1.00 0.00 ? 53 TRP A HZ2  5  
ATOM 4366  H HZ3  . TRP A 1 53 ? -17.166 5.551   -6.613  1.00 0.00 ? 53 TRP A HZ3  5  
ATOM 4367  H HH2  . TRP A 1 53 ? -18.596 3.823   -7.666  1.00 0.00 ? 53 TRP A HH2  5  
ATOM 4368  N N    . LYS A 1 54 ? -17.733 2.019   -0.998  1.00 0.00 ? 54 LYS A N    5  
ATOM 4369  C CA   . LYS A 1 54 ? -19.178 2.194   -0.914  1.00 0.00 ? 54 LYS A CA   5  
ATOM 4370  C C    . LYS A 1 54 ? -19.579 2.672   0.477   1.00 0.00 ? 54 LYS A C    5  
ATOM 4371  O O    . LYS A 1 54 ? -20.500 3.476   0.627   1.00 0.00 ? 54 LYS A O    5  
ATOM 4372  C CB   . LYS A 1 54 ? -19.882 0.871   -1.224  1.00 0.00 ? 54 LYS A CB   5  
ATOM 4373  C CG   . LYS A 1 54 ? -19.425 -0.198  -0.229  1.00 0.00 ? 54 LYS A CG   5  
ATOM 4374  C CD   . LYS A 1 54 ? -19.805 -1.585  -0.755  1.00 0.00 ? 54 LYS A CD   5  
ATOM 4375  C CE   . LYS A 1 54 ? -21.324 -1.672  -0.918  1.00 0.00 ? 54 LYS A CE   5  
ATOM 4376  N NZ   . LYS A 1 54 ? -21.729 -3.100  -1.040  1.00 0.00 ? 54 LYS A NZ   5  
ATOM 4377  H H    . LYS A 1 54 ? -17.366 1.140   -1.228  1.00 0.00 ? 54 LYS A H    5  
ATOM 4378  H HA   . LYS A 1 54 ? -19.485 2.930   -1.639  1.00 0.00 ? 54 LYS A HA   5  
ATOM 4379  H HB2  . LYS A 1 54 ? -20.952 1.007   -1.143  1.00 0.00 ? 54 LYS A HB2  5  
ATOM 4380  H HB3  . LYS A 1 54 ? -19.634 0.556   -2.226  1.00 0.00 ? 54 LYS A HB3  5  
ATOM 4381  H HG2  . LYS A 1 54 ? -18.353 -0.141  -0.106  1.00 0.00 ? 54 LYS A HG2  5  
ATOM 4382  H HG3  . LYS A 1 54 ? -19.905 -0.033  0.725   1.00 0.00 ? 54 LYS A HG3  5  
ATOM 4383  H HD2  . LYS A 1 54 ? -19.329 -1.749  -1.711  1.00 0.00 ? 54 LYS A HD2  5  
ATOM 4384  H HD3  . LYS A 1 54 ? -19.477 -2.337  -0.055  1.00 0.00 ? 54 LYS A HD3  5  
ATOM 4385  H HE2  . LYS A 1 54 ? -21.805 -1.234  -0.055  1.00 0.00 ? 54 LYS A HE2  5  
ATOM 4386  H HE3  . LYS A 1 54 ? -21.622 -1.136  -1.808  1.00 0.00 ? 54 LYS A HE3  5  
ATOM 4387  H HZ1  . LYS A 1 54 ? -21.294 -3.651  -0.273  1.00 0.00 ? 54 LYS A HZ1  5  
ATOM 4388  H HZ2  . LYS A 1 54 ? -21.410 -3.475  -1.956  1.00 0.00 ? 54 LYS A HZ2  5  
ATOM 4389  H HZ3  . LYS A 1 54 ? -22.765 -3.174  -0.977  1.00 0.00 ? 54 LYS A HZ3  5  
ATOM 4390  N N    . SER A 1 55 ? -18.883 2.172   1.494   1.00 0.00 ? 55 SER A N    5  
ATOM 4391  C CA   . SER A 1 55 ? -19.177 2.557   2.870   1.00 0.00 ? 55 SER A CA   5  
ATOM 4392  C C    . SER A 1 55 ? -20.680 2.522   3.126   1.00 0.00 ? 55 SER A C    5  
ATOM 4393  O O    . SER A 1 55 ? -21.201 3.290   3.934   1.00 0.00 ? 55 SER A O    5  
ATOM 4394  C CB   . SER A 1 55 ? -18.644 3.962   3.145   1.00 0.00 ? 55 SER A CB   5  
ATOM 4395  O OG   . SER A 1 55 ? -17.245 3.992   2.890   1.00 0.00 ? 55 SER A OG   5  
ATOM 4396  H H    . SER A 1 55 ? -18.160 1.535   1.316   1.00 0.00 ? 55 SER A H    5  
ATOM 4397  H HA   . SER A 1 55 ? -18.691 1.862   3.539   1.00 0.00 ? 55 SER A HA   5  
ATOM 4398  H HB2  . SER A 1 55 ? -19.136 4.670   2.501   1.00 0.00 ? 55 SER A HB2  5  
ATOM 4399  H HB3  . SER A 1 55 ? -18.838 4.224   4.178   1.00 0.00 ? 55 SER A HB3  5  
ATOM 4400  H HG   . SER A 1 55 ? -16.832 4.534   3.566   1.00 0.00 ? 55 SER A HG   5  
ATOM 4401  N N    . LYS A 1 56 ? -21.372 1.626   2.429   1.00 0.00 ? 56 LYS A N    5  
ATOM 4402  C CA   . LYS A 1 56 ? -22.816 1.501   2.588   1.00 0.00 ? 56 LYS A CA   5  
ATOM 4403  C C    . LYS A 1 56 ? -23.499 2.844   2.349   1.00 0.00 ? 56 LYS A C    5  
ATOM 4404  O O    . LYS A 1 56 ? -23.957 3.131   1.243   1.00 0.00 ? 56 LYS A O    5  
ATOM 4405  C CB   . LYS A 1 56 ? -23.148 0.999   3.994   1.00 0.00 ? 56 LYS A CB   5  
ATOM 4406  C CG   . LYS A 1 56 ? -24.668 0.954   4.177   1.00 0.00 ? 56 LYS A CG   5  
ATOM 4407  C CD   . LYS A 1 56 ? -25.019 0.087   5.393   1.00 0.00 ? 56 LYS A CD   5  
ATOM 4408  C CE   . LYS A 1 56 ? -25.153 -1.379  4.964   1.00 0.00 ? 56 LYS A CE   5  
ATOM 4409  N NZ   . LYS A 1 56 ? -25.100 -2.254  6.170   1.00 0.00 ? 56 LYS A NZ   5  
ATOM 4410  H H    . LYS A 1 56 ? -20.904 1.041   1.797   1.00 0.00 ? 56 LYS A H    5  
ATOM 4411  H HA   . LYS A 1 56 ? -23.187 0.787   1.867   1.00 0.00 ? 56 LYS A HA   5  
ATOM 4412  H HB2  . LYS A 1 56 ? -22.736 0.010   4.129   1.00 0.00 ? 56 LYS A HB2  5  
ATOM 4413  H HB3  . LYS A 1 56 ? -22.720 1.671   4.724   1.00 0.00 ? 56 LYS A HB3  5  
ATOM 4414  H HG2  . LYS A 1 56 ? -25.039 1.957   4.331   1.00 0.00 ? 56 LYS A HG2  5  
ATOM 4415  H HG3  . LYS A 1 56 ? -25.124 0.535   3.292   1.00 0.00 ? 56 LYS A HG3  5  
ATOM 4416  H HD2  . LYS A 1 56 ? -24.240 0.173   6.137   1.00 0.00 ? 56 LYS A HD2  5  
ATOM 4417  H HD3  . LYS A 1 56 ? -25.956 0.421   5.814   1.00 0.00 ? 56 LYS A HD3  5  
ATOM 4418  H HE2  . LYS A 1 56 ? -26.096 -1.520  4.459   1.00 0.00 ? 56 LYS A HE2  5  
ATOM 4419  H HE3  . LYS A 1 56 ? -24.345 -1.634  4.297   1.00 0.00 ? 56 LYS A HE3  5  
ATOM 4420  H HZ1  . LYS A 1 56 ? -25.901 -2.915  6.154   1.00 0.00 ? 56 LYS A HZ1  5  
ATOM 4421  H HZ2  . LYS A 1 56 ? -25.152 -1.669  7.027   1.00 0.00 ? 56 LYS A HZ2  5  
ATOM 4422  H HZ3  . LYS A 1 56 ? -24.207 -2.791  6.167   1.00 0.00 ? 56 LYS A HZ3  5  
ATOM 4423  N N    . ASN A 1 57 ? -23.563 3.663   3.394   1.00 0.00 ? 57 ASN A N    5  
ATOM 4424  C CA   . ASN A 1 57 ? -24.192 4.975   3.290   1.00 0.00 ? 57 ASN A CA   5  
ATOM 4425  C C    . ASN A 1 57 ? -23.165 6.032   2.898   1.00 0.00 ? 57 ASN A C    5  
ATOM 4426  O O    . ASN A 1 57 ? -22.076 6.095   3.469   1.00 0.00 ? 57 ASN A O    5  
ATOM 4427  C CB   . ASN A 1 57 ? -24.831 5.354   4.627   1.00 0.00 ? 57 ASN A CB   5  
ATOM 4428  C CG   . ASN A 1 57 ? -25.801 6.516   4.433   1.00 0.00 ? 57 ASN A CG   5  
ATOM 4429  O OD1  . ASN A 1 57 ? -26.516 6.891   5.362   1.00 0.00 ? 57 ASN A OD1  5  
ATOM 4430  N ND2  . ASN A 1 57 ? -25.869 7.109   3.273   1.00 0.00 ? 57 ASN A ND2  5  
ATOM 4431  H H    . ASN A 1 57 ? -23.181 3.379   4.251   1.00 0.00 ? 57 ASN A H    5  
ATOM 4432  H HA   . ASN A 1 57 ? -24.962 4.939   2.534   1.00 0.00 ? 57 ASN A HA   5  
ATOM 4433  H HB2  . ASN A 1 57 ? -25.366 4.503   5.024   1.00 0.00 ? 57 ASN A HB2  5  
ATOM 4434  H HB3  . ASN A 1 57 ? -24.059 5.647   5.323   1.00 0.00 ? 57 ASN A HB3  5  
ATOM 4435  H HD21 . ASN A 1 57 ? -25.298 6.808   2.534   1.00 0.00 ? 57 ASN A HD21 5  
ATOM 4436  H HD22 . ASN A 1 57 ? -26.490 7.855   3.140   1.00 0.00 ? 57 ASN A HD22 5  
ATOM 4437  N N    . LYS A 1 58 ? -23.518 6.861   1.920   1.00 0.00 ? 58 LYS A N    5  
ATOM 4438  C CA   . LYS A 1 58 ? -22.622 7.915   1.456   1.00 0.00 ? 58 LYS A CA   5  
ATOM 4439  C C    . LYS A 1 58 ? -23.426 9.118   0.972   1.00 0.00 ? 58 LYS A C    5  
ATOM 4440  O O    . LYS A 1 58 ? -22.861 10.130  0.558   1.00 0.00 ? 58 LYS A O    5  
ATOM 4441  C CB   . LYS A 1 58 ? -21.737 7.384   0.316   1.00 0.00 ? 58 LYS A CB   5  
ATOM 4442  C CG   . LYS A 1 58 ? -20.350 7.004   0.855   1.00 0.00 ? 58 LYS A CG   5  
ATOM 4443  C CD   . LYS A 1 58 ? -19.470 8.254   0.940   1.00 0.00 ? 58 LYS A CD   5  
ATOM 4444  C CE   . LYS A 1 58 ? -18.246 7.960   1.808   1.00 0.00 ? 58 LYS A CE   5  
ATOM 4445  N NZ   . LYS A 1 58 ? -17.415 9.191   1.928   1.00 0.00 ? 58 LYS A NZ   5  
ATOM 4446  H H    . LYS A 1 58 ? -24.399 6.762   1.503   1.00 0.00 ? 58 LYS A H    5  
ATOM 4447  H HA   . LYS A 1 58 ? -21.994 8.228   2.276   1.00 0.00 ? 58 LYS A HA   5  
ATOM 4448  H HB2  . LYS A 1 58 ? -22.202 6.511   -0.118  1.00 0.00 ? 58 LYS A HB2  5  
ATOM 4449  H HB3  . LYS A 1 58 ? -21.628 8.145   -0.443  1.00 0.00 ? 58 LYS A HB3  5  
ATOM 4450  H HG2  . LYS A 1 58 ? -20.452 6.567   1.838   1.00 0.00 ? 58 LYS A HG2  5  
ATOM 4451  H HG3  . LYS A 1 58 ? -19.892 6.288   0.189   1.00 0.00 ? 58 LYS A HG3  5  
ATOM 4452  H HD2  . LYS A 1 58 ? -19.147 8.535   -0.053  1.00 0.00 ? 58 LYS A HD2  5  
ATOM 4453  H HD3  . LYS A 1 58 ? -20.034 9.064   1.377   1.00 0.00 ? 58 LYS A HD3  5  
ATOM 4454  H HE2  . LYS A 1 58 ? -18.569 7.647   2.791   1.00 0.00 ? 58 LYS A HE2  5  
ATOM 4455  H HE3  . LYS A 1 58 ? -17.662 7.173   1.354   1.00 0.00 ? 58 LYS A HE3  5  
ATOM 4456  H HZ1  . LYS A 1 58 ? -16.558 8.980   2.476   1.00 0.00 ? 58 LYS A HZ1  5  
ATOM 4457  H HZ2  . LYS A 1 58 ? -17.959 9.931   2.413   1.00 0.00 ? 58 LYS A HZ2  5  
ATOM 4458  H HZ3  . LYS A 1 58 ? -17.146 9.523   0.979   1.00 0.00 ? 58 LYS A HZ3  5  
ATOM 4459  N N    . LYS A 1 59 ? -24.749 8.997   1.027   1.00 0.00 ? 59 LYS A N    5  
ATOM 4460  C CA   . LYS A 1 59 ? -25.629 10.079  0.593   1.00 0.00 ? 59 LYS A CA   5  
ATOM 4461  C C    . LYS A 1 59 ? -26.228 10.794  1.801   1.00 0.00 ? 59 LYS A C    5  
ATOM 4462  O O    . LYS A 1 59 ? -27.374 11.239  1.766   1.00 0.00 ? 59 LYS A O    5  
ATOM 4463  C CB   . LYS A 1 59 ? -26.756 9.513   -0.279  1.00 0.00 ? 59 LYS A CB   5  
ATOM 4464  C CG   . LYS A 1 59 ? -27.385 10.639  -1.110  1.00 0.00 ? 59 LYS A CG   5  
ATOM 4465  C CD   . LYS A 1 59 ? -26.618 10.805  -2.425  1.00 0.00 ? 59 LYS A CD   5  
ATOM 4466  C CE   . LYS A 1 59 ? -27.263 11.915  -3.256  1.00 0.00 ? 59 LYS A CE   5  
ATOM 4467  N NZ   . LYS A 1 59 ? -28.557 11.429  -3.814  1.00 0.00 ? 59 LYS A NZ   5  
ATOM 4468  H H    . LYS A 1 59 ? -25.142 8.167   1.368   1.00 0.00 ? 59 LYS A H    5  
ATOM 4469  H HA   . LYS A 1 59 ? -25.059 10.788  0.012   1.00 0.00 ? 59 LYS A HA   5  
ATOM 4470  H HB2  . LYS A 1 59 ? -26.353 8.758   -0.939  1.00 0.00 ? 59 LYS A HB2  5  
ATOM 4471  H HB3  . LYS A 1 59 ? -27.510 9.070   0.353   1.00 0.00 ? 59 LYS A HB3  5  
ATOM 4472  H HG2  . LYS A 1 59 ? -28.414 10.393  -1.323  1.00 0.00 ? 59 LYS A HG2  5  
ATOM 4473  H HG3  . LYS A 1 59 ? -27.346 11.564  -0.554  1.00 0.00 ? 59 LYS A HG3  5  
ATOM 4474  H HD2  . LYS A 1 59 ? -25.591 11.064  -2.213  1.00 0.00 ? 59 LYS A HD2  5  
ATOM 4475  H HD3  . LYS A 1 59 ? -26.650 9.879   -2.980  1.00 0.00 ? 59 LYS A HD3  5  
ATOM 4476  H HE2  . LYS A 1 59 ? -27.443 12.777  -2.628  1.00 0.00 ? 59 LYS A HE2  5  
ATOM 4477  H HE3  . LYS A 1 59 ? -26.603 12.189  -4.064  1.00 0.00 ? 59 LYS A HE3  5  
ATOM 4478  H HZ1  . LYS A 1 59 ? -28.995 10.764  -3.146  1.00 0.00 ? 59 LYS A HZ1  5  
ATOM 4479  H HZ2  . LYS A 1 59 ? -28.386 10.947  -4.719  1.00 0.00 ? 59 LYS A HZ2  5  
ATOM 4480  H HZ3  . LYS A 1 59 ? -29.194 12.238  -3.966  1.00 0.00 ? 59 LYS A HZ3  5  
ATOM 4481  N N    . ARG A 1 60 ? -25.441 10.902  2.867   1.00 0.00 ? 60 ARG A N    5  
ATOM 4482  C CA   . ARG A 1 60 ? -25.902 11.566  4.080   1.00 0.00 ? 60 ARG A CA   5  
ATOM 4483  C C    . ARG A 1 60 ? -25.818 13.081  3.927   1.00 0.00 ? 60 ARG A C    5  
ATOM 4484  O O    . ARG A 1 60 ? -26.648 13.762  4.507   1.00 0.00 ? 60 ARG A O    5  
ATOM 4485  C CB   . ARG A 1 60 ? -25.051 11.123  5.273   1.00 0.00 ? 60 ARG A CB   5  
ATOM 4486  C CG   . ARG A 1 60 ? -24.855 9.607   5.225   1.00 0.00 ? 60 ARG A CG   5  
ATOM 4487  C CD   . ARG A 1 60 ? -24.271 9.124   6.554   1.00 0.00 ? 60 ARG A CD   5  
ATOM 4488  N NE   . ARG A 1 60 ? -23.279 10.074  7.042   1.00 0.00 ? 60 ARG A NE   5  
ATOM 4489  C CZ   . ARG A 1 60 ? -22.847 10.031  8.300   1.00 0.00 ? 60 ARG A CZ   5  
ATOM 4490  N NH1  . ARG A 1 60 ? -23.314 9.128   9.119   1.00 0.00 ? 60 ARG A NH1  5  
ATOM 4491  N NH2  . ARG A 1 60 ? -21.958 10.891  8.714   1.00 0.00 ? 60 ARG A NH2  5  
ATOM 4492  O OXT  . ARG A 1 60 ? -24.925 13.537  3.233   1.00 0.00 ? 60 ARG A OXT  5  
ATOM 4493  H H    . ARG A 1 60 ? -24.535 10.529  2.837   1.00 0.00 ? 60 ARG A H    5  
ATOM 4494  H HA   . ARG A 1 60 ? -26.929 11.289  4.264   1.00 0.00 ? 60 ARG A HA   5  
ATOM 4495  H HB2  . ARG A 1 60 ? -24.088 11.613  5.229   1.00 0.00 ? 60 ARG A HB2  5  
ATOM 4496  H HB3  . ARG A 1 60 ? -25.550 11.392  6.191   1.00 0.00 ? 60 ARG A HB3  5  
ATOM 4497  H HG2  . ARG A 1 60 ? -25.809 9.127   5.055   1.00 0.00 ? 60 ARG A HG2  5  
ATOM 4498  H HG3  . ARG A 1 60 ? -24.178 9.356   4.424   1.00 0.00 ? 60 ARG A HG3  5  
ATOM 4499  H HD2  . ARG A 1 60 ? -25.063 9.032   7.280   1.00 0.00 ? 60 ARG A HD2  5  
ATOM 4500  H HD3  . ARG A 1 60 ? -23.806 8.160   6.408   1.00 0.00 ? 60 ARG A HD3  5  
ATOM 4501  H HE   . ARG A 1 60 ? -22.922 10.756  6.434   1.00 0.00 ? 60 ARG A HE   5  
ATOM 4502  H HH11 . ARG A 1 60 ? -23.996 8.470   8.801   1.00 0.00 ? 60 ARG A HH11 5  
ATOM 4503  H HH12 . ARG A 1 60 ? -22.990 9.096   10.065  1.00 0.00 ? 60 ARG A HH12 5  
ATOM 4504  H HH21 . ARG A 1 60 ? -21.600 11.584  8.086   1.00 0.00 ? 60 ARG A HH21 5  
ATOM 4505  H HH22 . ARG A 1 60 ? -21.635 10.860  9.659   1.00 0.00 ? 60 ARG A HH22 5  
ATOM 4506  N N    . GLY A 1 9  ? 10.064  5.224   17.877  1.00 0.00 ? 9  GLY A N    6  
ATOM 4507  C CA   . GLY A 1 9  ? 10.293  6.601   17.453  1.00 0.00 ? 9  GLY A CA   6  
ATOM 4508  C C    . GLY A 1 9  ? 10.677  6.658   15.978  1.00 0.00 ? 9  GLY A C    6  
ATOM 4509  O O    . GLY A 1 9  ? 9.983   7.273   15.170  1.00 0.00 ? 9  GLY A O    6  
ATOM 4510  H H    . GLY A 1 9  ? 10.738  4.541   17.677  1.00 0.00 ? 9  GLY A H    6  
ATOM 4511  H HA2  . GLY A 1 9  ? 9.393   7.180   17.607  1.00 0.00 ? 9  GLY A HA2  6  
ATOM 4512  H HA3  . GLY A 1 9  ? 11.093  7.025   18.041  1.00 0.00 ? 9  GLY A HA3  6  
ATOM 4513  N N    . THR A 1 10 ? 11.787  6.011   15.636  1.00 0.00 ? 10 THR A N    6  
ATOM 4514  C CA   . THR A 1 10 ? 12.253  5.993   14.258  1.00 0.00 ? 10 THR A CA   6  
ATOM 4515  C C    . THR A 1 10 ? 11.400  5.045   13.419  1.00 0.00 ? 10 THR A C    6  
ATOM 4516  O O    . THR A 1 10 ? 10.868  4.059   13.928  1.00 0.00 ? 10 THR A O    6  
ATOM 4517  C CB   . THR A 1 10 ? 13.719  5.547   14.215  1.00 0.00 ? 10 THR A CB   6  
ATOM 4518  O OG1  . THR A 1 10 ? 13.950  4.596   15.245  1.00 0.00 ? 10 THR A OG1  6  
ATOM 4519  C CG2  . THR A 1 10 ? 14.633  6.757   14.425  1.00 0.00 ? 10 THR A CG2  6  
ATOM 4520  H H    . THR A 1 10 ? 12.301  5.538   16.321  1.00 0.00 ? 10 THR A H    6  
ATOM 4521  H HA   . THR A 1 10 ? 12.176  6.990   13.846  1.00 0.00 ? 10 THR A HA   6  
ATOM 4522  H HB   . THR A 1 10 ? 13.933  5.100   13.259  1.00 0.00 ? 10 THR A HB   6  
ATOM 4523  H HG1  . THR A 1 10 ? 13.711  3.729   14.907  1.00 0.00 ? 10 THR A HG1  6  
ATOM 4524  H HG21 . THR A 1 10 ? 15.664  6.434   14.422  1.00 0.00 ? 10 THR A HG21 6  
ATOM 4525  H HG22 . THR A 1 10 ? 14.404  7.223   15.371  1.00 0.00 ? 10 THR A HG22 6  
ATOM 4526  H HG23 . THR A 1 10 ? 14.478  7.467   13.626  1.00 0.00 ? 10 THR A HG23 6  
ATOM 4527  N N    . LYS A 1 11 ? 11.276  5.351   12.130  1.00 0.00 ? 11 LYS A N    6  
ATOM 4528  C CA   . LYS A 1 11 ? 10.485  4.520   11.226  1.00 0.00 ? 11 LYS A CA   6  
ATOM 4529  C C    . LYS A 1 11 ? 11.395  3.674   10.344  1.00 0.00 ? 11 LYS A C    6  
ATOM 4530  O O    . LYS A 1 11 ? 12.609  3.627   10.549  1.00 0.00 ? 11 LYS A O    6  
ATOM 4531  C CB   . LYS A 1 11 ? 9.600   5.405   10.346  1.00 0.00 ? 11 LYS A CB   6  
ATOM 4532  C CG   . LYS A 1 11 ? 8.874   6.431   11.221  1.00 0.00 ? 11 LYS A CG   6  
ATOM 4533  C CD   . LYS A 1 11 ? 7.883   7.233   10.369  1.00 0.00 ? 11 LYS A CD   6  
ATOM 4534  C CE   . LYS A 1 11 ? 8.616   8.364   9.643   1.00 0.00 ? 11 LYS A CE   6  
ATOM 4535  N NZ   . LYS A 1 11 ? 9.297   9.238   10.640  1.00 0.00 ? 11 LYS A NZ   6  
ATOM 4536  H H    . LYS A 1 11 ? 11.722  6.149   11.780  1.00 0.00 ? 11 LYS A H    6  
ATOM 4537  H HA   . LYS A 1 11 ? 9.854   3.866   11.807  1.00 0.00 ? 11 LYS A HA   6  
ATOM 4538  H HB2  . LYS A 1 11 ? 10.215  5.918   9.621   1.00 0.00 ? 11 LYS A HB2  6  
ATOM 4539  H HB3  . LYS A 1 11 ? 8.873   4.791   9.835   1.00 0.00 ? 11 LYS A HB3  6  
ATOM 4540  H HG2  . LYS A 1 11 ? 8.338   5.916   12.007  1.00 0.00 ? 11 LYS A HG2  6  
ATOM 4541  H HG3  . LYS A 1 11 ? 9.595   7.103   11.661  1.00 0.00 ? 11 LYS A HG3  6  
ATOM 4542  H HD2  . LYS A 1 11 ? 7.418   6.582   9.644   1.00 0.00 ? 11 LYS A HD2  6  
ATOM 4543  H HD3  . LYS A 1 11 ? 7.121   7.656   11.008  1.00 0.00 ? 11 LYS A HD3  6  
ATOM 4544  H HE2  . LYS A 1 11 ? 9.349   7.945   8.970   1.00 0.00 ? 11 LYS A HE2  6  
ATOM 4545  H HE3  . LYS A 1 11 ? 7.905   8.950   9.079   1.00 0.00 ? 11 LYS A HE3  6  
ATOM 4546  H HZ1  . LYS A 1 11 ? 8.673   9.385   11.458  1.00 0.00 ? 11 LYS A HZ1  6  
ATOM 4547  H HZ2  . LYS A 1 11 ? 9.518   10.156  10.204  1.00 0.00 ? 11 LYS A HZ2  6  
ATOM 4548  H HZ3  . LYS A 1 11 ? 10.179  8.781   10.953  1.00 0.00 ? 11 LYS A HZ3  6  
ATOM 4549  N N    . LYS A 1 12 ? 10.801  3.006   9.360   1.00 0.00 ? 12 LYS A N    6  
ATOM 4550  C CA   . LYS A 1 12 ? 11.561  2.158   8.447   1.00 0.00 ? 12 LYS A CA   6  
ATOM 4551  C C    . LYS A 1 12 ? 11.108  2.378   7.007   1.00 0.00 ? 12 LYS A C    6  
ATOM 4552  O O    . LYS A 1 12 ? 11.914  2.706   6.136   1.00 0.00 ? 12 LYS A O    6  
ATOM 4553  C CB   . LYS A 1 12 ? 11.367  0.688   8.822   1.00 0.00 ? 12 LYS A CB   6  
ATOM 4554  C CG   . LYS A 1 12 ? 11.587  0.510   10.328  1.00 0.00 ? 12 LYS A CG   6  
ATOM 4555  C CD   . LYS A 1 12 ? 11.874  -0.964  10.643  1.00 0.00 ? 12 LYS A CD   6  
ATOM 4556  C CE   . LYS A 1 12 ? 13.375  -1.241  10.507  1.00 0.00 ? 12 LYS A CE   6  
ATOM 4557  N NZ   . LYS A 1 12 ? 13.642  -2.680  10.789  1.00 0.00 ? 12 LYS A NZ   6  
ATOM 4558  H H    . LYS A 1 12 ? 9.831   3.081   9.248   1.00 0.00 ? 12 LYS A H    6  
ATOM 4559  H HA   . LYS A 1 12 ? 12.608  2.402   8.525   1.00 0.00 ? 12 LYS A HA   6  
ATOM 4560  H HB2  . LYS A 1 12 ? 10.364  0.382   8.567   1.00 0.00 ? 12 LYS A HB2  6  
ATOM 4561  H HB3  . LYS A 1 12 ? 12.078  0.082   8.281   1.00 0.00 ? 12 LYS A HB3  6  
ATOM 4562  H HG2  . LYS A 1 12 ? 12.423  1.118   10.644  1.00 0.00 ? 12 LYS A HG2  6  
ATOM 4563  H HG3  . LYS A 1 12 ? 10.699  0.821   10.858  1.00 0.00 ? 12 LYS A HG3  6  
ATOM 4564  H HD2  . LYS A 1 12 ? 11.560  -1.184  11.653  1.00 0.00 ? 12 LYS A HD2  6  
ATOM 4565  H HD3  . LYS A 1 12 ? 11.331  -1.594  9.954   1.00 0.00 ? 12 LYS A HD3  6  
ATOM 4566  H HE2  . LYS A 1 12 ? 13.696  -1.007  9.503   1.00 0.00 ? 12 LYS A HE2  6  
ATOM 4567  H HE3  . LYS A 1 12 ? 13.919  -0.628  11.210  1.00 0.00 ? 12 LYS A HE3  6  
ATOM 4568  H HZ1  . LYS A 1 12 ? 14.277  -3.063  10.062  1.00 0.00 ? 12 LYS A HZ1  6  
ATOM 4569  H HZ2  . LYS A 1 12 ? 12.747  -3.207  10.779  1.00 0.00 ? 12 LYS A HZ2  6  
ATOM 4570  H HZ3  . LYS A 1 12 ? 14.089  -2.771  11.725  1.00 0.00 ? 12 LYS A HZ3  6  
ATOM 4571  N N    . TYR A 1 13 ? 9.813   2.191   6.766   1.00 0.00 ? 13 TYR A N    6  
ATOM 4572  C CA   . TYR A 1 13 ? 9.254   2.367   5.428   1.00 0.00 ? 13 TYR A CA   6  
ATOM 4573  C C    . TYR A 1 13 ? 8.103   3.367   5.459   1.00 0.00 ? 13 TYR A C    6  
ATOM 4574  O O    . TYR A 1 13 ? 7.435   3.530   6.480   1.00 0.00 ? 13 TYR A O    6  
ATOM 4575  C CB   . TYR A 1 13 ? 8.753   1.018   4.894   1.00 0.00 ? 13 TYR A CB   6  
ATOM 4576  C CG   . TYR A 1 13 ? 9.873   0.310   4.165   1.00 0.00 ? 13 TYR A CG   6  
ATOM 4577  C CD1  . TYR A 1 13 ? 10.996  -0.139  4.870   1.00 0.00 ? 13 TYR A CD1  6  
ATOM 4578  C CD2  . TYR A 1 13 ? 9.787   0.104   2.783   1.00 0.00 ? 13 TYR A CD2  6  
ATOM 4579  C CE1  . TYR A 1 13 ? 12.033  -0.793  4.192   1.00 0.00 ? 13 TYR A CE1  6  
ATOM 4580  C CE2  . TYR A 1 13 ? 10.822  -0.547  2.107   1.00 0.00 ? 13 TYR A CE2  6  
ATOM 4581  C CZ   . TYR A 1 13 ? 11.946  -0.997  2.811   1.00 0.00 ? 13 TYR A CZ   6  
ATOM 4582  O OH   . TYR A 1 13 ? 12.968  -1.639  2.143   1.00 0.00 ? 13 TYR A OH   6  
ATOM 4583  H H    . TYR A 1 13 ? 9.221   1.929   7.500   1.00 0.00 ? 13 TYR A H    6  
ATOM 4584  H HA   . TYR A 1 13 ? 10.022  2.742   4.767   1.00 0.00 ? 13 TYR A HA   6  
ATOM 4585  H HB2  . TYR A 1 13 ? 8.423   0.408   5.722   1.00 0.00 ? 13 TYR A HB2  6  
ATOM 4586  H HB3  . TYR A 1 13 ? 7.928   1.181   4.215   1.00 0.00 ? 13 TYR A HB3  6  
ATOM 4587  H HD1  . TYR A 1 13 ? 11.064  0.017   5.936   1.00 0.00 ? 13 TYR A HD1  6  
ATOM 4588  H HD2  . TYR A 1 13 ? 8.920   0.450   2.237   1.00 0.00 ? 13 TYR A HD2  6  
ATOM 4589  H HE1  . TYR A 1 13 ? 12.899  -1.139  4.737   1.00 0.00 ? 13 TYR A HE1  6  
ATOM 4590  H HE2  . TYR A 1 13 ? 10.755  -0.707  1.041   1.00 0.00 ? 13 TYR A HE2  6  
ATOM 4591  H HH   . TYR A 1 13 ? 13.510  -2.090  2.793   1.00 0.00 ? 13 TYR A HH   6  
ATOM 4592  N N    . ASP A 1 14 ? 7.879   4.032   4.331   1.00 0.00 ? 14 ASP A N    6  
ATOM 4593  C CA   . ASP A 1 14 ? 6.806   5.015   4.230   1.00 0.00 ? 14 ASP A CA   6  
ATOM 4594  C C    . ASP A 1 14 ? 6.238   5.041   2.815   1.00 0.00 ? 14 ASP A C    6  
ATOM 4595  O O    . ASP A 1 14 ? 6.910   5.462   1.874   1.00 0.00 ? 14 ASP A O    6  
ATOM 4596  C CB   . ASP A 1 14 ? 7.336   6.404   4.594   1.00 0.00 ? 14 ASP A CB   6  
ATOM 4597  C CG   . ASP A 1 14 ? 6.171   7.362   4.823   1.00 0.00 ? 14 ASP A CG   6  
ATOM 4598  O OD1  . ASP A 1 14 ? 5.273   7.379   3.998   1.00 0.00 ? 14 ASP A OD1  6  
ATOM 4599  O OD2  . ASP A 1 14 ? 6.196   8.064   5.820   1.00 0.00 ? 14 ASP A OD2  6  
ATOM 4600  H H    . ASP A 1 14 ? 8.445   3.857   3.551   1.00 0.00 ? 14 ASP A H    6  
ATOM 4601  H HA   . ASP A 1 14 ? 6.018   4.752   4.919   1.00 0.00 ? 14 ASP A HA   6  
ATOM 4602  H HB2  . ASP A 1 14 ? 7.927   6.337   5.494   1.00 0.00 ? 14 ASP A HB2  6  
ATOM 4603  H HB3  . ASP A 1 14 ? 7.949   6.777   3.787   1.00 0.00 ? 14 ASP A HB3  6  
ATOM 4604  N N    . LEU A 1 15 ? 4.994   4.588   2.673   1.00 0.00 ? 15 LEU A N    6  
ATOM 4605  C CA   . LEU A 1 15 ? 4.339   4.560   1.368   1.00 0.00 ? 15 LEU A CA   6  
ATOM 4606  C C    . LEU A 1 15 ? 3.005   5.298   1.430   1.00 0.00 ? 15 LEU A C    6  
ATOM 4607  O O    . LEU A 1 15 ? 1.950   4.710   1.196   1.00 0.00 ? 15 LEU A O    6  
ATOM 4608  C CB   . LEU A 1 15 ? 4.094   3.112   0.928   1.00 0.00 ? 15 LEU A CB   6  
ATOM 4609  C CG   . LEU A 1 15 ? 5.356   2.271   1.146   1.00 0.00 ? 15 LEU A CG   6  
ATOM 4610  C CD1  . LEU A 1 15 ? 5.005   0.787   1.022   1.00 0.00 ? 15 LEU A CD1  6  
ATOM 4611  C CD2  . LEU A 1 15 ? 6.406   2.628   0.091   1.00 0.00 ? 15 LEU A CD2  6  
ATOM 4612  H H    . LEU A 1 15 ? 4.510   4.266   3.461   1.00 0.00 ? 15 LEU A H    6  
ATOM 4613  H HA   . LEU A 1 15 ? 4.972   5.043   0.641   1.00 0.00 ? 15 LEU A HA   6  
ATOM 4614  H HB2  . LEU A 1 15 ? 3.281   2.696   1.506   1.00 0.00 ? 15 LEU A HB2  6  
ATOM 4615  H HB3  . LEU A 1 15 ? 3.830   3.097   -0.120  1.00 0.00 ? 15 LEU A HB3  6  
ATOM 4616  H HG   . LEU A 1 15 ? 5.753   2.463   2.131   1.00 0.00 ? 15 LEU A HG   6  
ATOM 4617  H HD11 . LEU A 1 15 ? 4.571   0.600   0.050   1.00 0.00 ? 15 LEU A HD11 6  
ATOM 4618  H HD12 . LEU A 1 15 ? 4.295   0.521   1.791   1.00 0.00 ? 15 LEU A HD12 6  
ATOM 4619  H HD13 . LEU A 1 15 ? 5.900   0.195   1.136   1.00 0.00 ? 15 LEU A HD13 6  
ATOM 4620  H HD21 . LEU A 1 15 ? 6.778   3.624   0.275   1.00 0.00 ? 15 LEU A HD21 6  
ATOM 4621  H HD22 . LEU A 1 15 ? 5.959   2.585   -0.892  1.00 0.00 ? 15 LEU A HD22 6  
ATOM 4622  H HD23 . LEU A 1 15 ? 7.223   1.922   0.143   1.00 0.00 ? 15 LEU A HD23 6  
ATOM 4623  N N    . SER A 1 16 ? 3.060   6.591   1.745   1.00 0.00 ? 16 SER A N    6  
ATOM 4624  C CA   . SER A 1 16 ? 1.847   7.400   1.833   1.00 0.00 ? 16 SER A CA   6  
ATOM 4625  C C    . SER A 1 16 ? 0.873   7.017   0.723   1.00 0.00 ? 16 SER A C    6  
ATOM 4626  O O    . SER A 1 16 ? -0.300  6.742   0.978   1.00 0.00 ? 16 SER A O    6  
ATOM 4627  C CB   . SER A 1 16 ? 2.199   8.884   1.716   1.00 0.00 ? 16 SER A CB   6  
ATOM 4628  O OG   . SER A 1 16 ? 1.081   9.593   1.199   1.00 0.00 ? 16 SER A OG   6  
ATOM 4629  H H    . SER A 1 16 ? 3.930   7.007   1.922   1.00 0.00 ? 16 SER A H    6  
ATOM 4630  H HA   . SER A 1 16 ? 1.376   7.226   2.788   1.00 0.00 ? 16 SER A HA   6  
ATOM 4631  H HB2  . SER A 1 16 ? 2.448   9.275   2.689   1.00 0.00 ? 16 SER A HB2  6  
ATOM 4632  H HB3  . SER A 1 16 ? 3.049   8.999   1.056   1.00 0.00 ? 16 SER A HB3  6  
ATOM 4633  H HG   . SER A 1 16 ? 1.304   10.526  1.179   1.00 0.00 ? 16 SER A HG   6  
ATOM 4634  N N    . LYS A 1 17 ? 1.375   6.987   -0.506  1.00 0.00 ? 17 LYS A N    6  
ATOM 4635  C CA   . LYS A 1 17 ? 0.552   6.620   -1.650  1.00 0.00 ? 17 LYS A CA   6  
ATOM 4636  C C    . LYS A 1 17 ? 1.443   6.296   -2.844  1.00 0.00 ? 17 LYS A C    6  
ATOM 4637  O O    . LYS A 1 17 ? 2.314   7.085   -3.212  1.00 0.00 ? 17 LYS A O    6  
ATOM 4638  C CB   . LYS A 1 17 ? -0.400  7.773   -2.001  1.00 0.00 ? 17 LYS A CB   6  
ATOM 4639  C CG   . LYS A 1 17 ? -1.732  7.215   -2.513  1.00 0.00 ? 17 LYS A CG   6  
ATOM 4640  C CD   . LYS A 1 17 ? -1.489  6.356   -3.758  1.00 0.00 ? 17 LYS A CD   6  
ATOM 4641  C CE   . LYS A 1 17 ? -2.794  6.213   -4.545  1.00 0.00 ? 17 LYS A CE   6  
ATOM 4642  N NZ   . LYS A 1 17 ? -2.650  5.122   -5.551  1.00 0.00 ? 17 LYS A NZ   6  
ATOM 4643  H H    . LYS A 1 17 ? 2.320   7.202   -0.645  1.00 0.00 ? 17 LYS A H    6  
ATOM 4644  H HA   . LYS A 1 17 ? -0.029  5.746   -1.397  1.00 0.00 ? 17 LYS A HA   6  
ATOM 4645  H HB2  . LYS A 1 17 ? -0.577  8.369   -1.119  1.00 0.00 ? 17 LYS A HB2  6  
ATOM 4646  H HB3  . LYS A 1 17 ? 0.047   8.391   -2.768  1.00 0.00 ? 17 LYS A HB3  6  
ATOM 4647  H HG2  . LYS A 1 17 ? -2.188  6.609   -1.742  1.00 0.00 ? 17 LYS A HG2  6  
ATOM 4648  H HG3  . LYS A 1 17 ? -2.390  8.032   -2.765  1.00 0.00 ? 17 LYS A HG3  6  
ATOM 4649  H HD2  . LYS A 1 17 ? -0.742  6.826   -4.381  1.00 0.00 ? 17 LYS A HD2  6  
ATOM 4650  H HD3  . LYS A 1 17 ? -1.144  5.377   -3.458  1.00 0.00 ? 17 LYS A HD3  6  
ATOM 4651  H HE2  . LYS A 1 17 ? -3.598  5.971   -3.866  1.00 0.00 ? 17 LYS A HE2  6  
ATOM 4652  H HE3  . LYS A 1 17 ? -3.014  7.141   -5.049  1.00 0.00 ? 17 LYS A HE3  6  
ATOM 4653  H HZ1  . LYS A 1 17 ? -3.315  5.282   -6.334  1.00 0.00 ? 17 LYS A HZ1  6  
ATOM 4654  H HZ2  . LYS A 1 17 ? -2.858  4.208   -5.104  1.00 0.00 ? 17 LYS A HZ2  6  
ATOM 4655  H HZ3  . LYS A 1 17 ? -1.676  5.115   -5.917  1.00 0.00 ? 17 LYS A HZ3  6  
ATOM 4656  N N    . TRP A 1 18 ? 1.218   5.132   -3.442  1.00 0.00 ? 18 TRP A N    6  
ATOM 4657  C CA   . TRP A 1 18 ? 2.003   4.697   -4.595  1.00 0.00 ? 18 TRP A CA   6  
ATOM 4658  C C    . TRP A 1 18 ? 1.079   4.448   -5.786  1.00 0.00 ? 18 TRP A C    6  
ATOM 4659  O O    . TRP A 1 18 ? -0.138  4.357   -5.627  1.00 0.00 ? 18 TRP A O    6  
ATOM 4660  C CB   . TRP A 1 18 ? 2.756   3.403   -4.248  1.00 0.00 ? 18 TRP A CB   6  
ATOM 4661  C CG   . TRP A 1 18 ? 4.131   3.708   -3.729  1.00 0.00 ? 18 TRP A CG   6  
ATOM 4662  C CD1  . TRP A 1 18 ? 4.453   4.736   -2.908  1.00 0.00 ? 18 TRP A CD1  6  
ATOM 4663  C CD2  . TRP A 1 18 ? 5.372   2.983   -3.976  1.00 0.00 ? 18 TRP A CD2  6  
ATOM 4664  N NE1  . TRP A 1 18 ? 5.811   4.690   -2.643  1.00 0.00 ? 18 TRP A NE1  6  
ATOM 4665  C CE2  . TRP A 1 18 ? 6.420   3.628   -3.277  1.00 0.00 ? 18 TRP A CE2  6  
ATOM 4666  C CE3  . TRP A 1 18 ? 5.687   1.841   -4.732  1.00 0.00 ? 18 TRP A CE3  6  
ATOM 4667  C CZ2  . TRP A 1 18 ? 7.732   3.154   -3.327  1.00 0.00 ? 18 TRP A CZ2  6  
ATOM 4668  C CZ3  . TRP A 1 18 ? 7.005   1.362   -4.785  1.00 0.00 ? 18 TRP A CZ3  6  
ATOM 4669  C CH2  . TRP A 1 18 ? 8.025   2.018   -4.084  1.00 0.00 ? 18 TRP A CH2  6  
ATOM 4670  H H    . TRP A 1 18 ? 0.509   4.547   -3.100  1.00 0.00 ? 18 TRP A H    6  
ATOM 4671  H HA   . TRP A 1 18 ? 2.717   5.466   -4.856  1.00 0.00 ? 18 TRP A HA   6  
ATOM 4672  H HB2  . TRP A 1 18 ? 2.205   2.867   -3.489  1.00 0.00 ? 18 TRP A HB2  6  
ATOM 4673  H HB3  . TRP A 1 18 ? 2.837   2.788   -5.131  1.00 0.00 ? 18 TRP A HB3  6  
ATOM 4674  H HD1  . TRP A 1 18 ? 3.769   5.471   -2.524  1.00 0.00 ? 18 TRP A HD1  6  
ATOM 4675  H HE1  . TRP A 1 18 ? 6.297   5.324   -2.075  1.00 0.00 ? 18 TRP A HE1  6  
ATOM 4676  H HE3  . TRP A 1 18 ? 4.909   1.327   -5.274  1.00 0.00 ? 18 TRP A HE3  6  
ATOM 4677  H HZ2  . TRP A 1 18 ? 8.515   3.663   -2.784  1.00 0.00 ? 18 TRP A HZ2  6  
ATOM 4678  H HZ3  . TRP A 1 18 ? 7.233   0.486   -5.370  1.00 0.00 ? 18 TRP A HZ3  6  
ATOM 4679  H HH2  . TRP A 1 18 ? 9.037   1.645   -4.128  1.00 0.00 ? 18 TRP A HH2  6  
ATOM 4680  N N    . LYS A 1 19 ? 1.661   4.331   -6.976  1.00 0.00 ? 19 LYS A N    6  
ATOM 4681  C CA   . LYS A 1 19 ? 0.872   4.087   -8.182  1.00 0.00 ? 19 LYS A CA   6  
ATOM 4682  C C    . LYS A 1 19 ? 0.937   2.612   -8.571  1.00 0.00 ? 19 LYS A C    6  
ATOM 4683  O O    . LYS A 1 19 ? 1.802   1.874   -8.100  1.00 0.00 ? 19 LYS A O    6  
ATOM 4684  C CB   . LYS A 1 19 ? 1.389   4.952   -9.335  1.00 0.00 ? 19 LYS A CB   6  
ATOM 4685  C CG   . LYS A 1 19 ? 1.741   6.346   -8.813  1.00 0.00 ? 19 LYS A CG   6  
ATOM 4686  C CD   . LYS A 1 19 ? 0.512   6.972   -8.154  1.00 0.00 ? 19 LYS A CD   6  
ATOM 4687  C CE   . LYS A 1 19 ? 0.735   8.475   -7.975  1.00 0.00 ? 19 LYS A CE   6  
ATOM 4688  N NZ   . LYS A 1 19 ? 2.147   8.722   -7.567  1.00 0.00 ? 19 LYS A NZ   6  
ATOM 4689  H H    . LYS A 1 19 ? 2.635   4.409   -7.046  1.00 0.00 ? 19 LYS A H    6  
ATOM 4690  H HA   . LYS A 1 19 ? -0.158  4.350   -7.986  1.00 0.00 ? 19 LYS A HA   6  
ATOM 4691  H HB2  . LYS A 1 19 ? 2.268   4.494   -9.765  1.00 0.00 ? 19 LYS A HB2  6  
ATOM 4692  H HB3  . LYS A 1 19 ? 0.622   5.037   -10.091 1.00 0.00 ? 19 LYS A HB3  6  
ATOM 4693  H HG2  . LYS A 1 19 ? 2.540   6.268   -8.088  1.00 0.00 ? 19 LYS A HG2  6  
ATOM 4694  H HG3  . LYS A 1 19 ? 2.063   6.967   -9.635  1.00 0.00 ? 19 LYS A HG3  6  
ATOM 4695  H HD2  . LYS A 1 19 ? -0.354  6.809   -8.780  1.00 0.00 ? 19 LYS A HD2  6  
ATOM 4696  H HD3  . LYS A 1 19 ? 0.350   6.519   -7.188  1.00 0.00 ? 19 LYS A HD3  6  
ATOM 4697  H HE2  . LYS A 1 19 ? 0.537   8.982   -8.908  1.00 0.00 ? 19 LYS A HE2  6  
ATOM 4698  H HE3  . LYS A 1 19 ? 0.068   8.851   -7.214  1.00 0.00 ? 19 LYS A HE3  6  
ATOM 4699  H HZ1  . LYS A 1 19 ? 2.328   9.746   -7.546  1.00 0.00 ? 19 LYS A HZ1  6  
ATOM 4700  H HZ2  . LYS A 1 19 ? 2.790   8.273   -8.249  1.00 0.00 ? 19 LYS A HZ2  6  
ATOM 4701  H HZ3  . LYS A 1 19 ? 2.308   8.320   -6.620  1.00 0.00 ? 19 LYS A HZ3  6  
ATOM 4702  N N    . TYR A 1 20 ? 0.017   2.190   -9.430  1.00 0.00 ? 20 TYR A N    6  
ATOM 4703  C CA   . TYR A 1 20 ? -0.022  0.801   -9.873  1.00 0.00 ? 20 TYR A CA   6  
ATOM 4704  C C    . TYR A 1 20 ? 1.226   0.457   -10.682 1.00 0.00 ? 20 TYR A C    6  
ATOM 4705  O O    . TYR A 1 20 ? 1.782   -0.636  -10.554 1.00 0.00 ? 20 TYR A O    6  
ATOM 4706  C CB   . TYR A 1 20 ? -1.268  0.560   -10.728 1.00 0.00 ? 20 TYR A CB   6  
ATOM 4707  C CG   . TYR A 1 20 ? -1.154  1.342   -12.017 1.00 0.00 ? 20 TYR A CG   6  
ATOM 4708  C CD1  . TYR A 1 20 ? -1.489  2.700   -12.043 1.00 0.00 ? 20 TYR A CD1  6  
ATOM 4709  C CD2  . TYR A 1 20 ? -0.714  0.707   -13.183 1.00 0.00 ? 20 TYR A CD2  6  
ATOM 4710  C CE1  . TYR A 1 20 ? -1.384  3.424   -13.236 1.00 0.00 ? 20 TYR A CE1  6  
ATOM 4711  C CE2  . TYR A 1 20 ? -0.608  1.430   -14.378 1.00 0.00 ? 20 TYR A CE2  6  
ATOM 4712  C CZ   . TYR A 1 20 ? -0.942  2.789   -14.404 1.00 0.00 ? 20 TYR A CZ   6  
ATOM 4713  O OH   . TYR A 1 20 ? -0.839  3.503   -15.579 1.00 0.00 ? 20 TYR A OH   6  
ATOM 4714  H H    . TYR A 1 20 ? -0.650  2.823   -9.772  1.00 0.00 ? 20 TYR A H    6  
ATOM 4715  H HA   . TYR A 1 20 ? -0.067  0.159   -9.007  1.00 0.00 ? 20 TYR A HA   6  
ATOM 4716  H HB2  . TYR A 1 20 ? -1.353  -0.493  -10.952 1.00 0.00 ? 20 TYR A HB2  6  
ATOM 4717  H HB3  . TYR A 1 20 ? -2.143  0.887   -10.187 1.00 0.00 ? 20 TYR A HB3  6  
ATOM 4718  H HD1  . TYR A 1 20 ? -1.829  3.190   -11.142 1.00 0.00 ? 20 TYR A HD1  6  
ATOM 4719  H HD2  . TYR A 1 20 ? -0.456  -0.342  -13.163 1.00 0.00 ? 20 TYR A HD2  6  
ATOM 4720  H HE1  . TYR A 1 20 ? -1.641  4.474   -13.256 1.00 0.00 ? 20 TYR A HE1  6  
ATOM 4721  H HE2  . TYR A 1 20 ? -0.269  0.941   -15.278 1.00 0.00 ? 20 TYR A HE2  6  
ATOM 4722  H HH   . TYR A 1 20 ? -0.859  2.878   -16.309 1.00 0.00 ? 20 TYR A HH   6  
ATOM 4723  N N    . ALA A 1 21 ? 1.656   1.395   -11.519 1.00 0.00 ? 21 ALA A N    6  
ATOM 4724  C CA   . ALA A 1 21 ? 2.835   1.184   -12.353 1.00 0.00 ? 21 ALA A CA   6  
ATOM 4725  C C    . ALA A 1 21 ? 4.069   0.907   -11.501 1.00 0.00 ? 21 ALA A C    6  
ATOM 4726  O O    . ALA A 1 21 ? 4.722   -0.125  -11.657 1.00 0.00 ? 21 ALA A O    6  
ATOM 4727  C CB   . ALA A 1 21 ? 3.083   2.418   -13.223 1.00 0.00 ? 21 ALA A CB   6  
ATOM 4728  H H    . ALA A 1 21 ? 1.169   2.243   -11.581 1.00 0.00 ? 21 ALA A H    6  
ATOM 4729  H HA   . ALA A 1 21 ? 2.658   0.336   -12.998 1.00 0.00 ? 21 ALA A HA   6  
ATOM 4730  H HB1  . ALA A 1 21 ? 3.824   2.186   -13.973 1.00 0.00 ? 21 ALA A HB1  6  
ATOM 4731  H HB2  . ALA A 1 21 ? 3.436   3.229   -12.605 1.00 0.00 ? 21 ALA A HB2  6  
ATOM 4732  H HB3  . ALA A 1 21 ? 2.162   2.708   -13.706 1.00 0.00 ? 21 ALA A HB3  6  
ATOM 4733  N N    . GLU A 1 22 ? 4.394   1.837   -10.606 1.00 0.00 ? 22 GLU A N    6  
ATOM 4734  C CA   . GLU A 1 22 ? 5.563   1.677   -9.749  1.00 0.00 ? 22 GLU A CA   6  
ATOM 4735  C C    . GLU A 1 22 ? 5.401   0.473   -8.825  1.00 0.00 ? 22 GLU A C    6  
ATOM 4736  O O    . GLU A 1 22 ? 6.369   -0.230  -8.537  1.00 0.00 ? 22 GLU A O    6  
ATOM 4737  C CB   . GLU A 1 22 ? 5.783   2.941   -8.916  1.00 0.00 ? 22 GLU A CB   6  
ATOM 4738  C CG   . GLU A 1 22 ? 4.572   3.180   -8.014  1.00 0.00 ? 22 GLU A CG   6  
ATOM 4739  C CD   . GLU A 1 22 ? 4.675   4.553   -7.360  1.00 0.00 ? 22 GLU A CD   6  
ATOM 4740  O OE1  . GLU A 1 22 ? 4.824   5.524   -8.084  1.00 0.00 ? 22 GLU A OE1  6  
ATOM 4741  O OE2  . GLU A 1 22 ? 4.601   4.615   -6.144  1.00 0.00 ? 22 GLU A OE2  6  
ATOM 4742  H H    . GLU A 1 22 ? 3.844   2.643   -10.528 1.00 0.00 ? 22 GLU A H    6  
ATOM 4743  H HA   . GLU A 1 22 ? 6.430   1.520   -10.372 1.00 0.00 ? 22 GLU A HA   6  
ATOM 4744  H HB2  . GLU A 1 22 ? 6.667   2.820   -8.307  1.00 0.00 ? 22 GLU A HB2  6  
ATOM 4745  H HB3  . GLU A 1 22 ? 5.911   3.787   -9.574  1.00 0.00 ? 22 GLU A HB3  6  
ATOM 4746  H HG2  . GLU A 1 22 ? 3.672   3.132   -8.606  1.00 0.00 ? 22 GLU A HG2  6  
ATOM 4747  H HG3  . GLU A 1 22 ? 4.540   2.422   -7.249  1.00 0.00 ? 22 GLU A HG3  6  
ATOM 4748  N N    . LEU A 1 23 ? 4.177   0.236   -8.361  1.00 0.00 ? 23 LEU A N    6  
ATOM 4749  C CA   . LEU A 1 23 ? 3.923   -0.891  -7.471  1.00 0.00 ? 23 LEU A CA   6  
ATOM 4750  C C    . LEU A 1 23 ? 4.357   -2.197  -8.132  1.00 0.00 ? 23 LEU A C    6  
ATOM 4751  O O    . LEU A 1 23 ? 5.168   -2.943  -7.582  1.00 0.00 ? 23 LEU A O    6  
ATOM 4752  C CB   . LEU A 1 23 ? 2.427   -0.964  -7.125  1.00 0.00 ? 23 LEU A CB   6  
ATOM 4753  C CG   . LEU A 1 23 ? 2.159   -0.280  -5.779  1.00 0.00 ? 23 LEU A CG   6  
ATOM 4754  C CD1  . LEU A 1 23 ? 0.690   0.142   -5.699  1.00 0.00 ? 23 LEU A CD1  6  
ATOM 4755  C CD2  . LEU A 1 23 ? 2.470   -1.251  -4.635  1.00 0.00 ? 23 LEU A CD2  6  
ATOM 4756  H H    . LEU A 1 23 ? 3.437   0.826   -8.620  1.00 0.00 ? 23 LEU A H    6  
ATOM 4757  H HA   . LEU A 1 23 ? 4.489   -0.753  -6.562  1.00 0.00 ? 23 LEU A HA   6  
ATOM 4758  H HB2  . LEU A 1 23 ? 1.860   -0.468  -7.899  1.00 0.00 ? 23 LEU A HB2  6  
ATOM 4759  H HB3  . LEU A 1 23 ? 2.118   -1.998  -7.067  1.00 0.00 ? 23 LEU A HB3  6  
ATOM 4760  H HG   . LEU A 1 23 ? 2.786   0.593   -5.690  1.00 0.00 ? 23 LEU A HG   6  
ATOM 4761  H HD11 . LEU A 1 23 ? 0.438   0.378   -4.676  1.00 0.00 ? 23 LEU A HD11 6  
ATOM 4762  H HD12 . LEU A 1 23 ? 0.063   -0.665  -6.046  1.00 0.00 ? 23 LEU A HD12 6  
ATOM 4763  H HD13 . LEU A 1 23 ? 0.531   1.013   -6.318  1.00 0.00 ? 23 LEU A HD13 6  
ATOM 4764  H HD21 . LEU A 1 23 ? 3.387   -1.779  -4.848  1.00 0.00 ? 23 LEU A HD21 6  
ATOM 4765  H HD22 . LEU A 1 23 ? 1.662   -1.961  -4.535  1.00 0.00 ? 23 LEU A HD22 6  
ATOM 4766  H HD23 . LEU A 1 23 ? 2.579   -0.699  -3.713  1.00 0.00 ? 23 LEU A HD23 6  
ATOM 4767  N N    . ARG A 1 24 ? 3.815   -2.461  -9.315  1.00 0.00 ? 24 ARG A N    6  
ATOM 4768  C CA   . ARG A 1 24 ? 4.150   -3.681  -10.042 1.00 0.00 ? 24 ARG A CA   6  
ATOM 4769  C C    . ARG A 1 24 ? 5.639   -3.720  -10.375 1.00 0.00 ? 24 ARG A C    6  
ATOM 4770  O O    . ARG A 1 24 ? 6.317   -4.712  -10.113 1.00 0.00 ? 24 ARG A O    6  
ATOM 4771  C CB   . ARG A 1 24 ? 3.337   -3.755  -11.336 1.00 0.00 ? 24 ARG A CB   6  
ATOM 4772  C CG   . ARG A 1 24 ? 3.417   -5.172  -11.908 1.00 0.00 ? 24 ARG A CG   6  
ATOM 4773  C CD   . ARG A 1 24 ? 2.919   -5.165  -13.355 1.00 0.00 ? 24 ARG A CD   6  
ATOM 4774  N NE   . ARG A 1 24 ? 1.793   -4.250  -13.496 1.00 0.00 ? 24 ARG A NE   6  
ATOM 4775  C CZ   . ARG A 1 24 ? 1.347   -3.889  -14.695 1.00 0.00 ? 24 ARG A CZ   6  
ATOM 4776  N NH1  . ARG A 1 24 ? 1.918   -4.356  -15.771 1.00 0.00 ? 24 ARG A NH1  6  
ATOM 4777  N NH2  . ARG A 1 24 ? 0.338   -3.068  -14.795 1.00 0.00 ? 24 ARG A NH2  6  
ATOM 4778  H H    . ARG A 1 24 ? 3.176   -1.828  -9.705  1.00 0.00 ? 24 ARG A H    6  
ATOM 4779  H HA   . ARG A 1 24 ? 3.906   -4.533  -9.429  1.00 0.00 ? 24 ARG A HA   6  
ATOM 4780  H HB2  . ARG A 1 24 ? 2.306   -3.508  -11.127 1.00 0.00 ? 24 ARG A HB2  6  
ATOM 4781  H HB3  . ARG A 1 24 ? 3.737   -3.056  -12.053 1.00 0.00 ? 24 ARG A HB3  6  
ATOM 4782  H HG2  . ARG A 1 24 ? 4.442   -5.513  -11.882 1.00 0.00 ? 24 ARG A HG2  6  
ATOM 4783  H HG3  . ARG A 1 24 ? 2.800   -5.833  -11.321 1.00 0.00 ? 24 ARG A HG3  6  
ATOM 4784  H HD2  . ARG A 1 24 ? 3.719   -4.849  -14.009 1.00 0.00 ? 24 ARG A HD2  6  
ATOM 4785  H HD3  . ARG A 1 24 ? 2.608   -6.164  -13.631 1.00 0.00 ? 24 ARG A HD3  6  
ATOM 4786  H HE   . ARG A 1 24 ? 1.358   -3.894  -12.693 1.00 0.00 ? 24 ARG A HE   6  
ATOM 4787  H HH11 . ARG A 1 24 ? 2.692   -4.985  -15.694 1.00 0.00 ? 24 ARG A HH11 6  
ATOM 4788  H HH12 . ARG A 1 24 ? 1.582   -4.084  -16.672 1.00 0.00 ? 24 ARG A HH12 6  
ATOM 4789  H HH21 . ARG A 1 24 ? -0.100  -2.710  -13.971 1.00 0.00 ? 24 ARG A HH21 6  
ATOM 4790  H HH22 . ARG A 1 24 ? 0.002   -2.796  -15.698 1.00 0.00 ? 24 ARG A HH22 6  
ATOM 4791  N N    . ASP A 1 25 ? 6.137   -2.640  -10.959 1.00 0.00 ? 25 ASP A N    6  
ATOM 4792  C CA   . ASP A 1 25 ? 7.544   -2.571  -11.329 1.00 0.00 ? 25 ASP A CA   6  
ATOM 4793  C C    . ASP A 1 25 ? 8.439   -2.834  -10.122 1.00 0.00 ? 25 ASP A C    6  
ATOM 4794  O O    . ASP A 1 25 ? 9.310   -3.703  -10.159 1.00 0.00 ? 25 ASP A O    6  
ATOM 4795  C CB   . ASP A 1 25 ? 7.863   -1.195  -11.914 1.00 0.00 ? 25 ASP A CB   6  
ATOM 4796  C CG   . ASP A 1 25 ? 9.246   -1.210  -12.558 1.00 0.00 ? 25 ASP A CG   6  
ATOM 4797  O OD1  . ASP A 1 25 ? 10.211  -0.976  -11.849 1.00 0.00 ? 25 ASP A OD1  6  
ATOM 4798  O OD2  . ASP A 1 25 ? 9.320   -1.457  -13.751 1.00 0.00 ? 25 ASP A OD2  6  
ATOM 4799  H H    . ASP A 1 25 ? 5.550   -1.878  -11.149 1.00 0.00 ? 25 ASP A H    6  
ATOM 4800  H HA   . ASP A 1 25 ? 7.742   -3.321  -12.077 1.00 0.00 ? 25 ASP A HA   6  
ATOM 4801  H HB2  . ASP A 1 25 ? 7.124   -0.944  -12.661 1.00 0.00 ? 25 ASP A HB2  6  
ATOM 4802  H HB3  . ASP A 1 25 ? 7.844   -0.457  -11.127 1.00 0.00 ? 25 ASP A HB3  6  
ATOM 4803  N N    . THR A 1 26 ? 8.225   -2.075  -9.055  1.00 0.00 ? 26 THR A N    6  
ATOM 4804  C CA   . THR A 1 26 ? 9.030   -2.231  -7.848  1.00 0.00 ? 26 THR A CA   6  
ATOM 4805  C C    . THR A 1 26 ? 8.936   -3.649  -7.294  1.00 0.00 ? 26 THR A C    6  
ATOM 4806  O O    . THR A 1 26 ? 9.912   -4.177  -6.762  1.00 0.00 ? 26 THR A O    6  
ATOM 4807  C CB   . THR A 1 26 ? 8.571   -1.238  -6.780  1.00 0.00 ? 26 THR A CB   6  
ATOM 4808  O OG1  . THR A 1 26 ? 8.399   0.044   -7.368  1.00 0.00 ? 26 THR A OG1  6  
ATOM 4809  C CG2  . THR A 1 26 ? 9.625   -1.159  -5.676  1.00 0.00 ? 26 THR A CG2  6  
ATOM 4810  H H    . THR A 1 26 ? 7.522   -1.393  -9.081  1.00 0.00 ? 26 THR A H    6  
ATOM 4811  H HA   . THR A 1 26 ? 10.061  -2.020  -8.090  1.00 0.00 ? 26 THR A HA   6  
ATOM 4812  H HB   . THR A 1 26 ? 7.636   -1.571  -6.357  1.00 0.00 ? 26 THR A HB   6  
ATOM 4813  H HG1  . THR A 1 26 ? 9.240   0.312   -7.745  1.00 0.00 ? 26 THR A HG1  6  
ATOM 4814  H HG21 . THR A 1 26 ? 9.837   -2.153  -5.309  1.00 0.00 ? 26 THR A HG21 6  
ATOM 4815  H HG22 . THR A 1 26 ? 9.256   -0.548  -4.867  1.00 0.00 ? 26 THR A HG22 6  
ATOM 4816  H HG23 . THR A 1 26 ? 10.529  -0.722  -6.072  1.00 0.00 ? 26 THR A HG23 6  
ATOM 4817  N N    . ILE A 1 27 ? 7.763   -4.264  -7.410  1.00 0.00 ? 27 ILE A N    6  
ATOM 4818  C CA   . ILE A 1 27 ? 7.582   -5.619  -6.895  1.00 0.00 ? 27 ILE A CA   6  
ATOM 4819  C C    . ILE A 1 27 ? 8.187   -6.649  -7.851  1.00 0.00 ? 27 ILE A C    6  
ATOM 4820  O O    . ILE A 1 27 ? 8.492   -7.772  -7.451  1.00 0.00 ? 27 ILE A O    6  
ATOM 4821  C CB   . ILE A 1 27 ? 6.084   -5.906  -6.661  1.00 0.00 ? 27 ILE A CB   6  
ATOM 4822  C CG1  . ILE A 1 27 ? 5.900   -6.571  -5.289  1.00 0.00 ? 27 ILE A CG1  6  
ATOM 4823  C CG2  . ILE A 1 27 ? 5.528   -6.829  -7.753  1.00 0.00 ? 27 ILE A CG2  6  
ATOM 4824  C CD1  . ILE A 1 27 ? 4.456   -7.059  -5.135  1.00 0.00 ? 27 ILE A CD1  6  
ATOM 4825  H H    . ILE A 1 27 ? 7.009   -3.801  -7.837  1.00 0.00 ? 27 ILE A H    6  
ATOM 4826  H HA   . ILE A 1 27 ? 8.099   -5.694  -5.949  1.00 0.00 ? 27 ILE A HA   6  
ATOM 4827  H HB   . ILE A 1 27 ? 5.540   -4.974  -6.678  1.00 0.00 ? 27 ILE A HB   6  
ATOM 4828  H HG12 . ILE A 1 27 ? 6.574   -7.410  -5.203  1.00 0.00 ? 27 ILE A HG12 6  
ATOM 4829  H HG13 . ILE A 1 27 ? 6.118   -5.854  -4.512  1.00 0.00 ? 27 ILE A HG13 6  
ATOM 4830  H HG21 . ILE A 1 27 ? 5.907   -7.830  -7.606  1.00 0.00 ? 27 ILE A HG21 6  
ATOM 4831  H HG22 . ILE A 1 27 ? 5.832   -6.468  -8.723  1.00 0.00 ? 27 ILE A HG22 6  
ATOM 4832  H HG23 . ILE A 1 27 ? 4.450   -6.842  -7.698  1.00 0.00 ? 27 ILE A HG23 6  
ATOM 4833  H HD11 . ILE A 1 27 ? 3.782   -6.337  -5.573  1.00 0.00 ? 27 ILE A HD11 6  
ATOM 4834  H HD12 . ILE A 1 27 ? 4.226   -7.175  -4.087  1.00 0.00 ? 27 ILE A HD12 6  
ATOM 4835  H HD13 . ILE A 1 27 ? 4.343   -8.008  -5.637  1.00 0.00 ? 27 ILE A HD13 6  
ATOM 4836  N N    . ASN A 1 28 ? 8.355   -6.261  -9.115  1.00 0.00 ? 28 ASN A N    6  
ATOM 4837  C CA   . ASN A 1 28 ? 8.922   -7.167  -10.113 1.00 0.00 ? 28 ASN A CA   6  
ATOM 4838  C C    . ASN A 1 28 ? 10.374  -6.797  -10.420 1.00 0.00 ? 28 ASN A C    6  
ATOM 4839  O O    . ASN A 1 28 ? 11.049  -7.492  -11.182 1.00 0.00 ? 28 ASN A O    6  
ATOM 4840  C CB   . ASN A 1 28 ? 8.074   -7.128  -11.396 1.00 0.00 ? 28 ASN A CB   6  
ATOM 4841  C CG   . ASN A 1 28 ? 8.799   -6.366  -12.503 1.00 0.00 ? 28 ASN A CG   6  
ATOM 4842  O OD1  . ASN A 1 28 ? 8.989   -6.892  -13.599 1.00 0.00 ? 28 ASN A OD1  6  
ATOM 4843  N ND2  . ASN A 1 28 ? 9.216   -5.152  -12.277 1.00 0.00 ? 28 ASN A ND2  6  
ATOM 4844  H H    . ASN A 1 28 ? 8.092   -5.354  -9.380  1.00 0.00 ? 28 ASN A H    6  
ATOM 4845  H HA   . ASN A 1 28 ? 8.903   -8.172  -9.718  1.00 0.00 ? 28 ASN A HA   6  
ATOM 4846  H HB2  . ASN A 1 28 ? 7.881   -8.136  -11.730 1.00 0.00 ? 28 ASN A HB2  6  
ATOM 4847  H HB3  . ASN A 1 28 ? 7.136   -6.636  -11.187 1.00 0.00 ? 28 ASN A HB3  6  
ATOM 4848  H HD21 . ASN A 1 28 ? 9.064   -4.737  -11.403 1.00 0.00 ? 28 ASN A HD21 6  
ATOM 4849  H HD22 . ASN A 1 28 ? 9.681   -4.656  -12.981 1.00 0.00 ? 28 ASN A HD22 6  
ATOM 4850  N N    . THR A 1 29 ? 10.851  -5.709  -9.819  1.00 0.00 ? 29 THR A N    6  
ATOM 4851  C CA   . THR A 1 29 ? 12.230  -5.267  -10.034 1.00 0.00 ? 29 THR A CA   6  
ATOM 4852  C C    . THR A 1 29 ? 13.019  -5.347  -8.734  1.00 0.00 ? 29 THR A C    6  
ATOM 4853  O O    . THR A 1 29 ? 14.121  -5.893  -8.697  1.00 0.00 ? 29 THR A O    6  
ATOM 4854  C CB   . THR A 1 29 ? 12.253  -3.825  -10.556 1.00 0.00 ? 29 THR A CB   6  
ATOM 4855  O OG1  . THR A 1 29 ? 11.478  -3.001  -9.697  1.00 0.00 ? 29 THR A OG1  6  
ATOM 4856  C CG2  . THR A 1 29 ? 11.680  -3.763  -11.980 1.00 0.00 ? 29 THR A CG2  6  
ATOM 4857  H H    . THR A 1 29 ? 10.269  -5.197  -9.218  1.00 0.00 ? 29 THR A H    6  
ATOM 4858  H HA   . THR A 1 29 ? 12.700  -5.910  -10.765 1.00 0.00 ? 29 THR A HA   6  
ATOM 4859  H HB   . THR A 1 29 ? 13.272  -3.467  -10.568 1.00 0.00 ? 29 THR A HB   6  
ATOM 4860  H HG1  . THR A 1 29 ? 12.075  -2.411  -9.232  1.00 0.00 ? 29 THR A HG1  6  
ATOM 4861  H HG21 . THR A 1 29 ? 12.343  -3.191  -12.612 1.00 0.00 ? 29 THR A HG21 6  
ATOM 4862  H HG22 . THR A 1 29 ? 10.711  -3.288  -11.956 1.00 0.00 ? 29 THR A HG22 6  
ATOM 4863  H HG23 . THR A 1 29 ? 11.580  -4.762  -12.379 1.00 0.00 ? 29 THR A HG23 6  
ATOM 4864  N N    . SER A 1 30 ? 12.443  -4.803  -7.666  1.00 0.00 ? 30 SER A N    6  
ATOM 4865  C CA   . SER A 1 30 ? 13.097  -4.823  -6.362  1.00 0.00 ? 30 SER A CA   6  
ATOM 4866  C C    . SER A 1 30 ? 12.653  -6.048  -5.570  1.00 0.00 ? 30 SER A C    6  
ATOM 4867  O O    . SER A 1 30 ? 11.706  -6.734  -5.952  1.00 0.00 ? 30 SER A O    6  
ATOM 4868  C CB   . SER A 1 30 ? 12.753  -3.544  -5.591  1.00 0.00 ? 30 SER A CB   6  
ATOM 4869  O OG   . SER A 1 30 ? 13.823  -2.617  -5.720  1.00 0.00 ? 30 SER A OG   6  
ATOM 4870  H H    . SER A 1 30 ? 11.560  -4.387  -7.755  1.00 0.00 ? 30 SER A H    6  
ATOM 4871  H HA   . SER A 1 30 ? 14.167  -4.866  -6.505  1.00 0.00 ? 30 SER A HA   6  
ATOM 4872  H HB2  . SER A 1 30 ? 11.856  -3.109  -5.996  1.00 0.00 ? 30 SER A HB2  6  
ATOM 4873  H HB3  . SER A 1 30 ? 12.595  -3.781  -4.547  1.00 0.00 ? 30 SER A HB3  6  
ATOM 4874  H HG   . SER A 1 30 ? 14.625  -3.112  -5.901  1.00 0.00 ? 30 SER A HG   6  
ATOM 4875  N N    . CYS A 1 31 ? 13.341  -6.319  -4.466  1.00 0.00 ? 31 CYS A N    6  
ATOM 4876  C CA   . CYS A 1 31 ? 13.002  -7.468  -3.635  1.00 0.00 ? 31 CYS A CA   6  
ATOM 4877  C C    . CYS A 1 31 ? 13.528  -7.287  -2.217  1.00 0.00 ? 31 CYS A C    6  
ATOM 4878  O O    . CYS A 1 31 ? 14.724  -7.083  -2.006  1.00 0.00 ? 31 CYS A O    6  
ATOM 4879  C CB   . CYS A 1 31 ? 13.593  -8.742  -4.241  1.00 0.00 ? 31 CYS A CB   6  
ATOM 4880  S SG   . CYS A 1 31 ? 12.891  -10.189 -3.410  1.00 0.00 ? 31 CYS A SG   6  
ATOM 4881  H H    . CYS A 1 31 ? 14.089  -5.739  -4.207  1.00 0.00 ? 31 CYS A H    6  
ATOM 4882  H HA   . CYS A 1 31 ? 11.926  -7.569  -3.599  1.00 0.00 ? 31 CYS A HA   6  
ATOM 4883  H HB2  . CYS A 1 31 ? 13.358  -8.782  -5.294  1.00 0.00 ? 31 CYS A HB2  6  
ATOM 4884  H HB3  . CYS A 1 31 ? 14.666  -8.738  -4.111  1.00 0.00 ? 31 CYS A HB3  6  
ATOM 4885  H HG   . CYS A 1 31 ? 13.460  -10.411 -2.669  1.00 0.00 ? 31 CYS A HG   6  
ATOM 4886  N N    . ASP A 1 32 ? 12.624  -7.370  -1.245  1.00 0.00 ? 32 ASP A N    6  
ATOM 4887  C CA   . ASP A 1 32 ? 12.998  -7.222  0.156   1.00 0.00 ? 32 ASP A CA   6  
ATOM 4888  C C    . ASP A 1 32 ? 11.793  -7.496  1.050   1.00 0.00 ? 32 ASP A C    6  
ATOM 4889  O O    . ASP A 1 32 ? 10.703  -6.973  0.813   1.00 0.00 ? 32 ASP A O    6  
ATOM 4890  C CB   . ASP A 1 32 ? 13.531  -5.808  0.417   1.00 0.00 ? 32 ASP A CB   6  
ATOM 4891  C CG   . ASP A 1 32 ? 14.618  -5.843  1.488   1.00 0.00 ? 32 ASP A CG   6  
ATOM 4892  O OD1  . ASP A 1 32 ? 14.276  -6.027  2.645   1.00 0.00 ? 32 ASP A OD1  6  
ATOM 4893  O OD2  . ASP A 1 32 ? 15.775  -5.686  1.135   1.00 0.00 ? 32 ASP A OD2  6  
ATOM 4894  H H    . ASP A 1 32 ? 11.687  -7.540  -1.476  1.00 0.00 ? 32 ASP A H    6  
ATOM 4895  H HA   . ASP A 1 32 ? 13.773  -7.938  0.386   1.00 0.00 ? 32 ASP A HA   6  
ATOM 4896  H HB2  . ASP A 1 32 ? 13.944  -5.406  -0.496  1.00 0.00 ? 32 ASP A HB2  6  
ATOM 4897  H HB3  . ASP A 1 32 ? 12.723  -5.174  0.752   1.00 0.00 ? 32 ASP A HB3  6  
ATOM 4898  N N    . ILE A 1 33 ? 11.994  -8.318  2.074   1.00 0.00 ? 33 ILE A N    6  
ATOM 4899  C CA   . ILE A 1 33 ? 10.914  -8.655  2.998   1.00 0.00 ? 33 ILE A CA   6  
ATOM 4900  C C    . ILE A 1 33 ? 10.032  -7.438  3.267   1.00 0.00 ? 33 ILE A C    6  
ATOM 4901  O O    . ILE A 1 33 ? 8.810   -7.554  3.359   1.00 0.00 ? 33 ILE A O    6  
ATOM 4902  C CB   . ILE A 1 33 ? 11.499  -9.166  4.320   1.00 0.00 ? 33 ILE A CB   6  
ATOM 4903  C CG1  . ILE A 1 33 ? 12.728  -8.322  4.697   1.00 0.00 ? 33 ILE A CG1  6  
ATOM 4904  C CG2  . ILE A 1 33 ? 11.912  -10.633 4.165   1.00 0.00 ? 33 ILE A CG2  6  
ATOM 4905  C CD1  . ILE A 1 33 ? 12.859  -8.252  6.221   1.00 0.00 ? 33 ILE A CD1  6  
ATOM 4906  H H    . ILE A 1 33 ? 12.883  -8.705  2.212   1.00 0.00 ? 33 ILE A H    6  
ATOM 4907  H HA   . ILE A 1 33 ? 10.310  -9.435  2.559   1.00 0.00 ? 33 ILE A HA   6  
ATOM 4908  H HB   . ILE A 1 33 ? 10.751  -9.085  5.096   1.00 0.00 ? 33 ILE A HB   6  
ATOM 4909  H HG12 . ILE A 1 33 ? 13.618  -8.774  4.281   1.00 0.00 ? 33 ILE A HG12 6  
ATOM 4910  H HG13 . ILE A 1 33 ? 12.618  -7.324  4.304   1.00 0.00 ? 33 ILE A HG13 6  
ATOM 4911  H HG21 . ILE A 1 33 ? 12.564  -10.735 3.310   1.00 0.00 ? 33 ILE A HG21 6  
ATOM 4912  H HG22 . ILE A 1 33 ? 11.031  -11.241 4.020   1.00 0.00 ? 33 ILE A HG22 6  
ATOM 4913  H HG23 . ILE A 1 33 ? 12.431  -10.956 5.055   1.00 0.00 ? 33 ILE A HG23 6  
ATOM 4914  H HD11 . ILE A 1 33 ? 12.663  -9.225  6.647   1.00 0.00 ? 33 ILE A HD11 6  
ATOM 4915  H HD12 . ILE A 1 33 ? 12.146  -7.539  6.610   1.00 0.00 ? 33 ILE A HD12 6  
ATOM 4916  H HD13 . ILE A 1 33 ? 13.859  -7.939  6.482   1.00 0.00 ? 33 ILE A HD13 6  
ATOM 4917  N N    . GLU A 1 34 ? 10.661  -6.275  3.398   1.00 0.00 ? 34 GLU A N    6  
ATOM 4918  C CA   . GLU A 1 34 ? 9.925   -5.044  3.665   1.00 0.00 ? 34 GLU A CA   6  
ATOM 4919  C C    . GLU A 1 34 ? 9.204   -4.552  2.413   1.00 0.00 ? 34 GLU A C    6  
ATOM 4920  O O    . GLU A 1 34 ? 8.004   -4.276  2.448   1.00 0.00 ? 34 GLU A O    6  
ATOM 4921  C CB   . GLU A 1 34 ? 10.887  -3.962  4.168   1.00 0.00 ? 34 GLU A CB   6  
ATOM 4922  C CG   . GLU A 1 34 ? 12.029  -4.609  4.957   1.00 0.00 ? 34 GLU A CG   6  
ATOM 4923  C CD   . GLU A 1 34 ? 12.632  -3.601  5.930   1.00 0.00 ? 34 GLU A CD   6  
ATOM 4924  O OE1  . GLU A 1 34 ? 11.871  -2.962  6.637   1.00 0.00 ? 34 GLU A OE1  6  
ATOM 4925  O OE2  . GLU A 1 34 ? 13.846  -3.484  5.953   1.00 0.00 ? 34 GLU A OE2  6  
ATOM 4926  H H    . GLU A 1 34 ? 11.637  -6.243  3.318   1.00 0.00 ? 34 GLU A H    6  
ATOM 4927  H HA   . GLU A 1 34 ? 9.193   -5.239  4.434   1.00 0.00 ? 34 GLU A HA   6  
ATOM 4928  H HB2  . GLU A 1 34 ? 11.295  -3.424  3.323   1.00 0.00 ? 34 GLU A HB2  6  
ATOM 4929  H HB3  . GLU A 1 34 ? 10.353  -3.275  4.808   1.00 0.00 ? 34 GLU A HB3  6  
ATOM 4930  H HG2  . GLU A 1 34 ? 11.647  -5.456  5.510   1.00 0.00 ? 34 GLU A HG2  6  
ATOM 4931  H HG3  . GLU A 1 34 ? 12.791  -4.944  4.272   1.00 0.00 ? 34 GLU A HG3  6  
ATOM 4932  N N    . LEU A 1 35 ? 9.937   -4.439  1.310   1.00 0.00 ? 35 LEU A N    6  
ATOM 4933  C CA   . LEU A 1 35 ? 9.345   -3.971  0.060   1.00 0.00 ? 35 LEU A CA   6  
ATOM 4934  C C    . LEU A 1 35 ? 8.123   -4.817  -0.292  1.00 0.00 ? 35 LEU A C    6  
ATOM 4935  O O    . LEU A 1 35 ? 7.041   -4.287  -0.547  1.00 0.00 ? 35 LEU A O    6  
ATOM 4936  C CB   . LEU A 1 35 ? 10.376  -4.057  -1.078  1.00 0.00 ? 35 LEU A CB   6  
ATOM 4937  C CG   . LEU A 1 35 ? 10.187  -2.902  -2.085  1.00 0.00 ? 35 LEU A CG   6  
ATOM 4938  C CD1  . LEU A 1 35 ? 8.700   -2.697  -2.400  1.00 0.00 ? 35 LEU A CD1  6  
ATOM 4939  C CD2  . LEU A 1 35 ? 10.766  -1.601  -1.513  1.00 0.00 ? 35 LEU A CD2  6  
ATOM 4940  H H    . LEU A 1 35 ? 10.890  -4.667  1.338   1.00 0.00 ? 35 LEU A H    6  
ATOM 4941  H HA   . LEU A 1 35 ? 9.040   -2.944  0.187   1.00 0.00 ? 35 LEU A HA   6  
ATOM 4942  H HB2  . LEU A 1 35 ? 11.368  -4.006  -0.661  1.00 0.00 ? 35 LEU A HB2  6  
ATOM 4943  H HB3  . LEU A 1 35 ? 10.259  -4.998  -1.596  1.00 0.00 ? 35 LEU A HB3  6  
ATOM 4944  H HG   . LEU A 1 35 ? 10.708  -3.149  -3.000  1.00 0.00 ? 35 LEU A HG   6  
ATOM 4945  H HD11 . LEU A 1 35 ? 8.214   -3.656  -2.492  1.00 0.00 ? 35 LEU A HD11 6  
ATOM 4946  H HD12 . LEU A 1 35 ? 8.602   -2.157  -3.329  1.00 0.00 ? 35 LEU A HD12 6  
ATOM 4947  H HD13 . LEU A 1 35 ? 8.234   -2.129  -1.608  1.00 0.00 ? 35 LEU A HD13 6  
ATOM 4948  H HD21 . LEU A 1 35 ? 9.989   -1.054  -1.000  1.00 0.00 ? 35 LEU A HD21 6  
ATOM 4949  H HD22 . LEU A 1 35 ? 11.151  -0.996  -2.323  1.00 0.00 ? 35 LEU A HD22 6  
ATOM 4950  H HD23 . LEU A 1 35 ? 11.567  -1.825  -0.824  1.00 0.00 ? 35 LEU A HD23 6  
ATOM 4951  N N    . LEU A 1 36 ? 8.308   -6.133  -0.310  1.00 0.00 ? 36 LEU A N    6  
ATOM 4952  C CA   . LEU A 1 36 ? 7.218   -7.046  -0.641  1.00 0.00 ? 36 LEU A CA   6  
ATOM 4953  C C    . LEU A 1 36 ? 6.120   -6.988  0.415   1.00 0.00 ? 36 LEU A C    6  
ATOM 4954  O O    . LEU A 1 36 ? 4.947   -6.801  0.089   1.00 0.00 ? 36 LEU A O    6  
ATOM 4955  C CB   . LEU A 1 36 ? 7.751   -8.476  -0.755  1.00 0.00 ? 36 LEU A CB   6  
ATOM 4956  C CG   . LEU A 1 36 ? 9.013   -8.485  -1.621  1.00 0.00 ? 36 LEU A CG   6  
ATOM 4957  C CD1  . LEU A 1 36 ? 9.487   -9.928  -1.814  1.00 0.00 ? 36 LEU A CD1  6  
ATOM 4958  C CD2  . LEU A 1 36 ? 8.707   -7.863  -2.987  1.00 0.00 ? 36 LEU A CD2  6  
ATOM 4959  H H    . LEU A 1 36 ? 9.195   -6.498  -0.102  1.00 0.00 ? 36 LEU A H    6  
ATOM 4960  H HA   . LEU A 1 36 ? 6.800   -6.757  -1.594  1.00 0.00 ? 36 LEU A HA   6  
ATOM 4961  H HB2  . LEU A 1 36 ? 7.986   -8.850  0.232   1.00 0.00 ? 36 LEU A HB2  6  
ATOM 4962  H HB3  . LEU A 1 36 ? 7.001   -9.105  -1.209  1.00 0.00 ? 36 LEU A HB3  6  
ATOM 4963  H HG   . LEU A 1 36 ? 9.790   -7.917  -1.130  1.00 0.00 ? 36 LEU A HG   6  
ATOM 4964  H HD11 . LEU A 1 36 ? 9.668   -10.379 -0.850  1.00 0.00 ? 36 LEU A HD11 6  
ATOM 4965  H HD12 . LEU A 1 36 ? 10.398  -9.934  -2.393  1.00 0.00 ? 36 LEU A HD12 6  
ATOM 4966  H HD13 . LEU A 1 36 ? 8.726   -10.490 -2.336  1.00 0.00 ? 36 LEU A HD13 6  
ATOM 4967  H HD21 . LEU A 1 36 ? 7.736   -8.193  -3.326  1.00 0.00 ? 36 LEU A HD21 6  
ATOM 4968  H HD22 . LEU A 1 36 ? 9.459   -8.165  -3.701  1.00 0.00 ? 36 LEU A HD22 6  
ATOM 4969  H HD23 . LEU A 1 36 ? 8.709   -6.786  -2.901  1.00 0.00 ? 36 LEU A HD23 6  
ATOM 4970  N N    . ALA A 1 37 ? 6.499   -7.148  1.679   1.00 0.00 ? 37 ALA A N    6  
ATOM 4971  C CA   . ALA A 1 37 ? 5.522   -7.107  2.762   1.00 0.00 ? 37 ALA A CA   6  
ATOM 4972  C C    . ALA A 1 37 ? 4.693   -5.832  2.674   1.00 0.00 ? 37 ALA A C    6  
ATOM 4973  O O    . ALA A 1 37 ? 3.462   -5.874  2.714   1.00 0.00 ? 37 ALA A O    6  
ATOM 4974  C CB   . ALA A 1 37 ? 6.230   -7.166  4.116   1.00 0.00 ? 37 ALA A CB   6  
ATOM 4975  H H    . ALA A 1 37 ? 7.447   -7.294  1.887   1.00 0.00 ? 37 ALA A H    6  
ATOM 4976  H HA   . ALA A 1 37 ? 4.865   -7.960  2.673   1.00 0.00 ? 37 ALA A HA   6  
ATOM 4977  H HB1  . ALA A 1 37 ? 5.506   -7.040  4.907   1.00 0.00 ? 37 ALA A HB1  6  
ATOM 4978  H HB2  . ALA A 1 37 ? 6.965   -6.376  4.172   1.00 0.00 ? 37 ALA A HB2  6  
ATOM 4979  H HB3  . ALA A 1 37 ? 6.720   -8.123  4.227   1.00 0.00 ? 37 ALA A HB3  6  
ATOM 4980  N N    . ALA A 1 38 ? 5.375   -4.700  2.547   1.00 0.00 ? 38 ALA A N    6  
ATOM 4981  C CA   . ALA A 1 38 ? 4.692   -3.417  2.448   1.00 0.00 ? 38 ALA A CA   6  
ATOM 4982  C C    . ALA A 1 38 ? 3.824   -3.375  1.195   1.00 0.00 ? 38 ALA A C    6  
ATOM 4983  O O    . ALA A 1 38 ? 2.685   -2.907  1.233   1.00 0.00 ? 38 ALA A O    6  
ATOM 4984  C CB   . ALA A 1 38 ? 5.717   -2.280  2.407   1.00 0.00 ? 38 ALA A CB   6  
ATOM 4985  H H    . ALA A 1 38 ? 6.355   -4.728  2.517   1.00 0.00 ? 38 ALA A H    6  
ATOM 4986  H HA   . ALA A 1 38 ? 4.062   -3.288  3.316   1.00 0.00 ? 38 ALA A HA   6  
ATOM 4987  H HB1  . ALA A 1 38 ? 6.072   -2.148  1.396   1.00 0.00 ? 38 ALA A HB1  6  
ATOM 4988  H HB2  . ALA A 1 38 ? 6.550   -2.525  3.051   1.00 0.00 ? 38 ALA A HB2  6  
ATOM 4989  H HB3  . ALA A 1 38 ? 5.255   -1.367  2.751   1.00 0.00 ? 38 ALA A HB3  6  
ATOM 4990  N N    . CYS A 1 39 ? 4.366   -3.871  0.087   1.00 0.00 ? 39 CYS A N    6  
ATOM 4991  C CA   . CYS A 1 39 ? 3.625   -3.888  -1.170  1.00 0.00 ? 39 CYS A CA   6  
ATOM 4992  C C    . CYS A 1 39 ? 2.312   -4.641  -0.995  1.00 0.00 ? 39 CYS A C    6  
ATOM 4993  O O    . CYS A 1 39 ? 1.241   -4.128  -1.322  1.00 0.00 ? 39 CYS A O    6  
ATOM 4994  C CB   . CYS A 1 39 ? 4.459   -4.561  -2.265  1.00 0.00 ? 39 CYS A CB   6  
ATOM 4995  S SG   . CYS A 1 39 ? 3.690   -4.261  -3.875  1.00 0.00 ? 39 CYS A SG   6  
ATOM 4996  H H    . CYS A 1 39 ? 5.276   -4.234  0.115   1.00 0.00 ? 39 CYS A H    6  
ATOM 4997  H HA   . CYS A 1 39 ? 3.413   -2.871  -1.466  1.00 0.00 ? 39 CYS A HA   6  
ATOM 4998  H HB2  . CYS A 1 39 ? 5.457   -4.153  -2.261  1.00 0.00 ? 39 CYS A HB2  6  
ATOM 4999  H HB3  . CYS A 1 39 ? 4.504   -5.623  -2.081  1.00 0.00 ? 39 CYS A HB3  6  
ATOM 5000  H HG   . CYS A 1 39 ? 2.929   -3.692  -3.740  1.00 0.00 ? 39 CYS A HG   6  
ATOM 5001  N N    . ARG A 1 40 ? 2.402   -5.859  -0.470  1.00 0.00 ? 40 ARG A N    6  
ATOM 5002  C CA   . ARG A 1 40 ? 1.214   -6.676  -0.248  1.00 0.00 ? 40 ARG A CA   6  
ATOM 5003  C C    . ARG A 1 40 ? 0.216   -5.930  0.628   1.00 0.00 ? 40 ARG A C    6  
ATOM 5004  O O    . ARG A 1 40 ? -0.977  -5.884  0.327   1.00 0.00 ? 40 ARG A O    6  
ATOM 5005  C CB   . ARG A 1 40 ? 1.604   -7.993  0.426   1.00 0.00 ? 40 ARG A CB   6  
ATOM 5006  C CG   . ARG A 1 40 ? 2.293   -8.907  -0.589  1.00 0.00 ? 40 ARG A CG   6  
ATOM 5007  C CD   . ARG A 1 40 ? 2.604   -10.253 0.066   1.00 0.00 ? 40 ARG A CD   6  
ATOM 5008  N NE   . ARG A 1 40 ? 2.955   -11.241 -0.950  1.00 0.00 ? 40 ARG A NE   6  
ATOM 5009  C CZ   . ARG A 1 40 ? 2.972   -12.540 -0.667  1.00 0.00 ? 40 ARG A CZ   6  
ATOM 5010  N NH1  . ARG A 1 40 ? 2.670   -12.950 0.534   1.00 0.00 ? 40 ARG A NH1  6  
ATOM 5011  N NH2  . ARG A 1 40 ? 3.289   -13.403 -1.592  1.00 0.00 ? 40 ARG A NH2  6  
ATOM 5012  H H    . ARG A 1 40 ? 3.283   -6.213  -0.225  1.00 0.00 ? 40 ARG A H    6  
ATOM 5013  H HA   . ARG A 1 40 ? 0.755   -6.894  -1.200  1.00 0.00 ? 40 ARG A HA   6  
ATOM 5014  H HB2  . ARG A 1 40 ? 2.279   -7.792  1.245   1.00 0.00 ? 40 ARG A HB2  6  
ATOM 5015  H HB3  . ARG A 1 40 ? 0.718   -8.480  0.804   1.00 0.00 ? 40 ARG A HB3  6  
ATOM 5016  H HG2  . ARG A 1 40 ? 1.639   -9.060  -1.437  1.00 0.00 ? 40 ARG A HG2  6  
ATOM 5017  H HG3  . ARG A 1 40 ? 3.211   -8.449  -0.921  1.00 0.00 ? 40 ARG A HG3  6  
ATOM 5018  H HD2  . ARG A 1 40 ? 3.431   -10.136 0.749   1.00 0.00 ? 40 ARG A HD2  6  
ATOM 5019  H HD3  . ARG A 1 40 ? 1.735   -10.594 0.613   1.00 0.00 ? 40 ARG A HD3  6  
ATOM 5020  H HE   . ARG A 1 40 ? 3.184   -10.942 -1.855  1.00 0.00 ? 40 ARG A HE   6  
ATOM 5021  H HH11 . ARG A 1 40 ? 2.427   -12.287 1.243   1.00 0.00 ? 40 ARG A HH11 6  
ATOM 5022  H HH12 . ARG A 1 40 ? 2.683   -13.928 0.746   1.00 0.00 ? 40 ARG A HH12 6  
ATOM 5023  H HH21 . ARG A 1 40 ? 3.519   -13.089 -2.512  1.00 0.00 ? 40 ARG A HH21 6  
ATOM 5024  H HH22 . ARG A 1 40 ? 3.301   -14.382 -1.380  1.00 0.00 ? 40 ARG A HH22 6  
ATOM 5025  N N    . GLU A 1 41 ? 0.711   -5.342  1.713   1.00 0.00 ? 41 GLU A N    6  
ATOM 5026  C CA   . GLU A 1 41 ? -0.149  -4.597  2.624   1.00 0.00 ? 41 GLU A CA   6  
ATOM 5027  C C    . GLU A 1 41 ? -0.924  -3.526  1.863   1.00 0.00 ? 41 GLU A C    6  
ATOM 5028  O O    . GLU A 1 41 ? -2.123  -3.345  2.076   1.00 0.00 ? 41 GLU A O    6  
ATOM 5029  C CB   . GLU A 1 41 ? 0.695   -3.939  3.718   1.00 0.00 ? 41 GLU A CB   6  
ATOM 5030  C CG   . GLU A 1 41 ? 1.177   -5.005  4.702   1.00 0.00 ? 41 GLU A CG   6  
ATOM 5031  C CD   . GLU A 1 41 ? 0.011   -5.492  5.557   1.00 0.00 ? 41 GLU A CD   6  
ATOM 5032  O OE1  . GLU A 1 41 ? -1.036  -4.869  5.505   1.00 0.00 ? 41 GLU A OE1  6  
ATOM 5033  O OE2  . GLU A 1 41 ? 0.184   -6.481  6.252   1.00 0.00 ? 41 GLU A OE2  6  
ATOM 5034  H H    . GLU A 1 41 ? 1.672   -5.409  1.902   1.00 0.00 ? 41 GLU A H    6  
ATOM 5035  H HA   . GLU A 1 41 ? -0.848  -5.278  3.083   1.00 0.00 ? 41 GLU A HA   6  
ATOM 5036  H HB2  . GLU A 1 41 ? 1.547   -3.451  3.269   1.00 0.00 ? 41 GLU A HB2  6  
ATOM 5037  H HB3  . GLU A 1 41 ? 0.098   -3.210  4.244   1.00 0.00 ? 41 GLU A HB3  6  
ATOM 5038  H HG2  . GLU A 1 41 ? 1.592   -5.839  4.154   1.00 0.00 ? 41 GLU A HG2  6  
ATOM 5039  H HG3  . GLU A 1 41 ? 1.937   -4.584  5.343   1.00 0.00 ? 41 GLU A HG3  6  
ATOM 5040  N N    . GLU A 1 42 ? -0.233  -2.824  0.971   1.00 0.00 ? 42 GLU A N    6  
ATOM 5041  C CA   . GLU A 1 42 ? -0.866  -1.777  0.181   1.00 0.00 ? 42 GLU A CA   6  
ATOM 5042  C C    . GLU A 1 42 ? -1.953  -2.367  -0.713  1.00 0.00 ? 42 GLU A C    6  
ATOM 5043  O O    . GLU A 1 42 ? -3.051  -1.822  -0.813  1.00 0.00 ? 42 GLU A O    6  
ATOM 5044  C CB   . GLU A 1 42 ? 0.179   -1.068  -0.683  1.00 0.00 ? 42 GLU A CB   6  
ATOM 5045  C CG   . GLU A 1 42 ? 1.123   -0.264  0.213   1.00 0.00 ? 42 GLU A CG   6  
ATOM 5046  C CD   . GLU A 1 42 ? 0.403   0.967   0.754   1.00 0.00 ? 42 GLU A CD   6  
ATOM 5047  O OE1  . GLU A 1 42 ? -0.210  0.858   1.804   1.00 0.00 ? 42 GLU A OE1  6  
ATOM 5048  O OE2  . GLU A 1 42 ? 0.473   2.001   0.111   1.00 0.00 ? 42 GLU A OE2  6  
ATOM 5049  H H    . GLU A 1 42 ? 0.721   -3.016  0.842   1.00 0.00 ? 42 GLU A H    6  
ATOM 5050  H HA   . GLU A 1 42 ? -1.314  -1.055  0.847   1.00 0.00 ? 42 GLU A HA   6  
ATOM 5051  H HB2  . GLU A 1 42 ? 0.747   -1.804  -1.236  1.00 0.00 ? 42 GLU A HB2  6  
ATOM 5052  H HB3  . GLU A 1 42 ? -0.314  -0.402  -1.374  1.00 0.00 ? 42 GLU A HB3  6  
ATOM 5053  H HG2  . GLU A 1 42 ? 1.447   -0.881  1.038   1.00 0.00 ? 42 GLU A HG2  6  
ATOM 5054  H HG3  . GLU A 1 42 ? 1.982   0.050   -0.360  1.00 0.00 ? 42 GLU A HG3  6  
ATOM 5055  N N    . PHE A 1 43 ? -1.637  -3.486  -1.358  1.00 0.00 ? 43 PHE A N    6  
ATOM 5056  C CA   . PHE A 1 43 ? -2.595  -4.144  -2.239  1.00 0.00 ? 43 PHE A CA   6  
ATOM 5057  C C    . PHE A 1 43 ? -3.885  -4.454  -1.483  1.00 0.00 ? 43 PHE A C    6  
ATOM 5058  O O    . PHE A 1 43 ? -4.977  -4.087  -1.919  1.00 0.00 ? 43 PHE A O    6  
ATOM 5059  C CB   . PHE A 1 43 ? -1.989  -5.446  -2.789  1.00 0.00 ? 43 PHE A CB   6  
ATOM 5060  C CG   . PHE A 1 43 ? -1.497  -5.230  -4.202  1.00 0.00 ? 43 PHE A CG   6  
ATOM 5061  C CD1  . PHE A 1 43 ? -0.762  -4.081  -4.523  1.00 0.00 ? 43 PHE A CD1  6  
ATOM 5062  C CD2  . PHE A 1 43 ? -1.776  -6.181  -5.192  1.00 0.00 ? 43 PHE A CD2  6  
ATOM 5063  C CE1  . PHE A 1 43 ? -0.308  -3.885  -5.833  1.00 0.00 ? 43 PHE A CE1  6  
ATOM 5064  C CE2  . PHE A 1 43 ? -1.323  -5.982  -6.501  1.00 0.00 ? 43 PHE A CE2  6  
ATOM 5065  C CZ   . PHE A 1 43 ? -0.589  -4.835  -6.821  1.00 0.00 ? 43 PHE A CZ   6  
ATOM 5066  H H    . PHE A 1 43 ? -0.746  -3.876  -1.237  1.00 0.00 ? 43 PHE A H    6  
ATOM 5067  H HA   . PHE A 1 43 ? -2.825  -3.486  -3.062  1.00 0.00 ? 43 PHE A HA   6  
ATOM 5068  H HB2  . PHE A 1 43 ? -1.159  -5.744  -2.163  1.00 0.00 ? 43 PHE A HB2  6  
ATOM 5069  H HB3  . PHE A 1 43 ? -2.737  -6.225  -2.785  1.00 0.00 ? 43 PHE A HB3  6  
ATOM 5070  H HD1  . PHE A 1 43 ? -0.546  -3.348  -3.761  1.00 0.00 ? 43 PHE A HD1  6  
ATOM 5071  H HD2  . PHE A 1 43 ? -2.343  -7.066  -4.945  1.00 0.00 ? 43 PHE A HD2  6  
ATOM 5072  H HE1  . PHE A 1 43 ? 0.257   -3.000  -6.080  1.00 0.00 ? 43 PHE A HE1  6  
ATOM 5073  H HE2  . PHE A 1 43 ? -1.538  -6.716  -7.263  1.00 0.00 ? 43 PHE A HE2  6  
ATOM 5074  H HZ   . PHE A 1 43 ? -0.238  -4.682  -7.831  1.00 0.00 ? 43 PHE A HZ   6  
ATOM 5075  N N    . HIS A 1 44 ? -3.752  -5.131  -0.346  1.00 0.00 ? 44 HIS A N    6  
ATOM 5076  C CA   . HIS A 1 44 ? -4.915  -5.483  0.460   1.00 0.00 ? 44 HIS A CA   6  
ATOM 5077  C C    . HIS A 1 44 ? -5.698  -4.230  0.841   1.00 0.00 ? 44 HIS A C    6  
ATOM 5078  O O    . HIS A 1 44 ? -6.921  -4.186  0.703   1.00 0.00 ? 44 HIS A O    6  
ATOM 5079  C CB   . HIS A 1 44 ? -4.467  -6.218  1.729   1.00 0.00 ? 44 HIS A CB   6  
ATOM 5080  C CG   . HIS A 1 44 ? -4.209  -7.666  1.407   1.00 0.00 ? 44 HIS A CG   6  
ATOM 5081  N ND1  . HIS A 1 44 ? -5.058  -8.678  1.828   1.00 0.00 ? 44 HIS A ND1  6  
ATOM 5082  C CD2  . HIS A 1 44 ? -3.205  -8.285  0.705   1.00 0.00 ? 44 HIS A CD2  6  
ATOM 5083  C CE1  . HIS A 1 44 ? -4.554  -9.842  1.379   1.00 0.00 ? 44 HIS A CE1  6  
ATOM 5084  N NE2  . HIS A 1 44 ? -3.426  -9.661  0.689   1.00 0.00 ? 44 HIS A NE2  6  
ATOM 5085  H H    . HIS A 1 44 ? -2.859  -5.399  -0.047  1.00 0.00 ? 44 HIS A H    6  
ATOM 5086  H HA   . HIS A 1 44 ? -5.557  -6.135  -0.114  1.00 0.00 ? 44 HIS A HA   6  
ATOM 5087  H HB2  . HIS A 1 44 ? -3.561  -5.766  2.105   1.00 0.00 ? 44 HIS A HB2  6  
ATOM 5088  H HB3  . HIS A 1 44 ? -5.242  -6.150  2.479   1.00 0.00 ? 44 HIS A HB3  6  
ATOM 5089  H HD2  . HIS A 1 44 ? -2.372  -7.784  0.237   1.00 0.00 ? 44 HIS A HD2  6  
ATOM 5090  H HE1  . HIS A 1 44 ? -5.009  -10.805 1.555   1.00 0.00 ? 44 HIS A HE1  6  
ATOM 5091  H HE2  . HIS A 1 44 ? -2.872  -10.347 0.262   1.00 0.00 ? 44 HIS A HE2  6  
ATOM 5092  N N    . ARG A 1 45 ? -4.987  -3.214  1.320   1.00 0.00 ? 45 ARG A N    6  
ATOM 5093  C CA   . ARG A 1 45 ? -5.628  -1.967  1.716   1.00 0.00 ? 45 ARG A CA   6  
ATOM 5094  C C    . ARG A 1 45 ? -6.332  -1.325  0.524   1.00 0.00 ? 45 ARG A C    6  
ATOM 5095  O O    . ARG A 1 45 ? -7.521  -1.009  0.589   1.00 0.00 ? 45 ARG A O    6  
ATOM 5096  C CB   . ARG A 1 45 ? -4.585  -0.998  2.276   1.00 0.00 ? 45 ARG A CB   6  
ATOM 5097  C CG   . ARG A 1 45 ? -5.289  0.133   3.030   1.00 0.00 ? 45 ARG A CG   6  
ATOM 5098  C CD   . ARG A 1 45 ? -4.244  1.075   3.631   1.00 0.00 ? 45 ARG A CD   6  
ATOM 5099  N NE   . ARG A 1 45 ? -4.855  1.921   4.650   1.00 0.00 ? 45 ARG A NE   6  
ATOM 5100  C CZ   . ARG A 1 45 ? -5.733  2.863   4.325   1.00 0.00 ? 45 ARG A CZ   6  
ATOM 5101  N NH1  . ARG A 1 45 ? -6.063  3.046   3.076   1.00 0.00 ? 45 ARG A NH1  6  
ATOM 5102  N NH2  . ARG A 1 45 ? -6.267  3.607   5.255   1.00 0.00 ? 45 ARG A NH2  6  
ATOM 5103  H H    . ARG A 1 45 ? -4.015  -3.306  1.407   1.00 0.00 ? 45 ARG A H    6  
ATOM 5104  H HA   . ARG A 1 45 ? -6.359  -2.176  2.483   1.00 0.00 ? 45 ARG A HA   6  
ATOM 5105  H HB2  . ARG A 1 45 ? -3.929  -1.528  2.951   1.00 0.00 ? 45 ARG A HB2  6  
ATOM 5106  H HB3  . ARG A 1 45 ? -4.007  -0.581  1.465   1.00 0.00 ? 45 ARG A HB3  6  
ATOM 5107  H HG2  . ARG A 1 45 ? -5.920  0.683   2.346   1.00 0.00 ? 45 ARG A HG2  6  
ATOM 5108  H HG3  . ARG A 1 45 ? -5.892  -0.284  3.823   1.00 0.00 ? 45 ARG A HG3  6  
ATOM 5109  H HD2  . ARG A 1 45 ? -3.454  0.493   4.081   1.00 0.00 ? 45 ARG A HD2  6  
ATOM 5110  H HD3  . ARG A 1 45 ? -3.831  1.695   2.849   1.00 0.00 ? 45 ARG A HD3  6  
ATOM 5111  H HE   . ARG A 1 45 ? -4.614  1.792   5.592   1.00 0.00 ? 45 ARG A HE   6  
ATOM 5112  H HH11 . ARG A 1 45 ? -5.654  2.476   2.362   1.00 0.00 ? 45 ARG A HH11 6  
ATOM 5113  H HH12 . ARG A 1 45 ? -6.725  3.754   2.831   1.00 0.00 ? 45 ARG A HH12 6  
ATOM 5114  H HH21 . ARG A 1 45 ? -6.015  3.466   6.213   1.00 0.00 ? 45 ARG A HH21 6  
ATOM 5115  H HH22 . ARG A 1 45 ? -6.929  4.316   5.011   1.00 0.00 ? 45 ARG A HH22 6  
ATOM 5116  N N    . ARG A 1 46 ? -5.591  -1.136  -0.564  1.00 0.00 ? 46 ARG A N    6  
ATOM 5117  C CA   . ARG A 1 46 ? -6.151  -0.530  -1.766  1.00 0.00 ? 46 ARG A CA   6  
ATOM 5118  C C    . ARG A 1 46 ? -7.312  -1.365  -2.298  1.00 0.00 ? 46 ARG A C    6  
ATOM 5119  O O    . ARG A 1 46 ? -8.295  -0.826  -2.808  1.00 0.00 ? 46 ARG A O    6  
ATOM 5120  C CB   . ARG A 1 46 ? -5.070  -0.413  -2.844  1.00 0.00 ? 46 ARG A CB   6  
ATOM 5121  C CG   . ARG A 1 46 ? -3.928  0.480   -2.341  1.00 0.00 ? 46 ARG A CG   6  
ATOM 5122  C CD   . ARG A 1 46 ? -4.223  1.943   -2.680  1.00 0.00 ? 46 ARG A CD   6  
ATOM 5123  N NE   . ARG A 1 46 ? -3.380  2.826   -1.882  1.00 0.00 ? 46 ARG A NE   6  
ATOM 5124  C CZ   . ARG A 1 46 ? -2.070  2.902   -2.094  1.00 0.00 ? 46 ARG A CZ   6  
ATOM 5125  N NH1  . ARG A 1 46 ? -1.517  2.175   -3.025  1.00 0.00 ? 46 ARG A NH1  6  
ATOM 5126  N NH2  . ARG A 1 46 ? -1.339  3.702   -1.369  1.00 0.00 ? 46 ARG A NH2  6  
ATOM 5127  H H    . ARG A 1 46 ? -4.649  -1.408  -0.557  1.00 0.00 ? 46 ARG A H    6  
ATOM 5128  H HA   . ARG A 1 46 ? -6.512  0.458   -1.526  1.00 0.00 ? 46 ARG A HA   6  
ATOM 5129  H HB2  . ARG A 1 46 ? -4.686  -1.398  -3.071  1.00 0.00 ? 46 ARG A HB2  6  
ATOM 5130  H HB3  . ARG A 1 46 ? -5.498  0.019   -3.737  1.00 0.00 ? 46 ARG A HB3  6  
ATOM 5131  H HG2  . ARG A 1 46 ? -3.830  0.371   -1.270  1.00 0.00 ? 46 ARG A HG2  6  
ATOM 5132  H HG3  . ARG A 1 46 ? -3.004  0.182   -2.816  1.00 0.00 ? 46 ARG A HG3  6  
ATOM 5133  H HD2  . ARG A 1 46 ? -4.024  2.114   -3.727  1.00 0.00 ? 46 ARG A HD2  6  
ATOM 5134  H HD3  . ARG A 1 46 ? -5.262  2.156   -2.475  1.00 0.00 ? 46 ARG A HD3  6  
ATOM 5135  H HE   . ARG A 1 46 ? -3.786  3.374   -1.180  1.00 0.00 ? 46 ARG A HE   6  
ATOM 5136  H HH11 . ARG A 1 46 ? -2.077  1.560   -3.580  1.00 0.00 ? 46 ARG A HH11 6  
ATOM 5137  H HH12 . ARG A 1 46 ? -0.530  2.231   -3.184  1.00 0.00 ? 46 ARG A HH12 6  
ATOM 5138  H HH21 . ARG A 1 46 ? -1.763  4.259   -0.655  1.00 0.00 ? 46 ARG A HH21 6  
ATOM 5139  H HH22 . ARG A 1 46 ? -0.352  3.760   -1.528  1.00 0.00 ? 46 ARG A HH22 6  
ATOM 5140  N N    . LEU A 1 47 ? -7.194  -2.683  -2.175  1.00 0.00 ? 47 LEU A N    6  
ATOM 5141  C CA   . LEU A 1 47 ? -8.241  -3.580  -2.648  1.00 0.00 ? 47 LEU A CA   6  
ATOM 5142  C C    . LEU A 1 47 ? -9.462  -3.505  -1.737  1.00 0.00 ? 47 LEU A C    6  
ATOM 5143  O O    . LEU A 1 47 ? -10.601 -3.488  -2.207  1.00 0.00 ? 47 LEU A O    6  
ATOM 5144  C CB   . LEU A 1 47 ? -7.719  -5.020  -2.687  1.00 0.00 ? 47 LEU A CB   6  
ATOM 5145  C CG   . LEU A 1 47 ? -8.687  -5.902  -3.489  1.00 0.00 ? 47 LEU A CG   6  
ATOM 5146  C CD1  . LEU A 1 47 ? -8.313  -5.866  -4.974  1.00 0.00 ? 47 LEU A CD1  6  
ATOM 5147  C CD2  . LEU A 1 47 ? -8.600  -7.345  -2.983  1.00 0.00 ? 47 LEU A CD2  6  
ATOM 5148  H H    . LEU A 1 47 ? -6.389  -3.058  -1.761  1.00 0.00 ? 47 LEU A H    6  
ATOM 5149  H HA   . LEU A 1 47 ? -8.530  -3.286  -3.645  1.00 0.00 ? 47 LEU A HA   6  
ATOM 5150  H HB2  . LEU A 1 47 ? -6.744  -5.035  -3.154  1.00 0.00 ? 47 LEU A HB2  6  
ATOM 5151  H HB3  . LEU A 1 47 ? -7.640  -5.399  -1.679  1.00 0.00 ? 47 LEU A HB3  6  
ATOM 5152  H HG   . LEU A 1 47 ? -9.697  -5.537  -3.365  1.00 0.00 ? 47 LEU A HG   6  
ATOM 5153  H HD11 . LEU A 1 47 ? -7.416  -6.445  -5.133  1.00 0.00 ? 47 LEU A HD11 6  
ATOM 5154  H HD12 . LEU A 1 47 ? -8.141  -4.846  -5.280  1.00 0.00 ? 47 LEU A HD12 6  
ATOM 5155  H HD13 . LEU A 1 47 ? -9.119  -6.286  -5.558  1.00 0.00 ? 47 LEU A HD13 6  
ATOM 5156  H HD21 . LEU A 1 47 ? -7.565  -7.629  -2.878  1.00 0.00 ? 47 LEU A HD21 6  
ATOM 5157  H HD22 . LEU A 1 47 ? -9.084  -8.004  -3.691  1.00 0.00 ? 47 LEU A HD22 6  
ATOM 5158  H HD23 . LEU A 1 47 ? -9.095  -7.422  -2.027  1.00 0.00 ? 47 LEU A HD23 6  
ATOM 5159  N N    . LYS A 1 48 ? -9.218  -3.463  -0.431  1.00 0.00 ? 48 LYS A N    6  
ATOM 5160  C CA   . LYS A 1 48 ? -10.306 -3.393  0.538   1.00 0.00 ? 48 LYS A CA   6  
ATOM 5161  C C    . LYS A 1 48 ? -11.150 -2.144  0.308   1.00 0.00 ? 48 LYS A C    6  
ATOM 5162  O O    . LYS A 1 48 ? -12.371 -2.226  0.166   1.00 0.00 ? 48 LYS A O    6  
ATOM 5163  C CB   . LYS A 1 48 ? -9.738  -3.376  1.961   1.00 0.00 ? 48 LYS A CB   6  
ATOM 5164  C CG   . LYS A 1 48 ? -10.832 -3.776  2.963   1.00 0.00 ? 48 LYS A CG   6  
ATOM 5165  C CD   . LYS A 1 48 ? -10.866 -5.303  3.115   1.00 0.00 ? 48 LYS A CD   6  
ATOM 5166  C CE   . LYS A 1 48 ? -9.846  -5.742  4.169   1.00 0.00 ? 48 LYS A CE   6  
ATOM 5167  N NZ   . LYS A 1 48 ? -9.523  -7.185  3.977   1.00 0.00 ? 48 LYS A NZ   6  
ATOM 5168  H H    . LYS A 1 48 ? -8.291  -3.481  -0.113  1.00 0.00 ? 48 LYS A H    6  
ATOM 5169  H HA   . LYS A 1 48 ? -10.932 -4.264  0.422   1.00 0.00 ? 48 LYS A HA   6  
ATOM 5170  H HB2  . LYS A 1 48 ? -8.914  -4.071  2.025   1.00 0.00 ? 48 LYS A HB2  6  
ATOM 5171  H HB3  . LYS A 1 48 ? -9.386  -2.381  2.194   1.00 0.00 ? 48 LYS A HB3  6  
ATOM 5172  H HG2  . LYS A 1 48 ? -10.621 -3.323  3.921   1.00 0.00 ? 48 LYS A HG2  6  
ATOM 5173  H HG3  . LYS A 1 48 ? -11.790 -3.430  2.606   1.00 0.00 ? 48 LYS A HG3  6  
ATOM 5174  H HD2  . LYS A 1 48 ? -11.856 -5.610  3.422   1.00 0.00 ? 48 LYS A HD2  6  
ATOM 5175  H HD3  . LYS A 1 48 ? -10.626 -5.767  2.169   1.00 0.00 ? 48 LYS A HD3  6  
ATOM 5176  H HE2  . LYS A 1 48 ? -8.944  -5.157  4.067   1.00 0.00 ? 48 LYS A HE2  6  
ATOM 5177  H HE3  . LYS A 1 48 ? -10.263 -5.596  5.154   1.00 0.00 ? 48 LYS A HE3  6  
ATOM 5178  H HZ1  . LYS A 1 48 ? -10.311 -7.766  4.326   1.00 0.00 ? 48 LYS A HZ1  6  
ATOM 5179  H HZ2  . LYS A 1 48 ? -8.661  -7.421  4.505   1.00 0.00 ? 48 LYS A HZ2  6  
ATOM 5180  H HZ3  . LYS A 1 48 ? -9.375  -7.374  2.964   1.00 0.00 ? 48 LYS A HZ3  6  
ATOM 5181  N N    . VAL A 1 49 ? -10.495 -0.989  0.273   1.00 0.00 ? 49 VAL A N    6  
ATOM 5182  C CA   . VAL A 1 49 ? -11.202 0.268   0.058   1.00 0.00 ? 49 VAL A CA   6  
ATOM 5183  C C    . VAL A 1 49 ? -11.805 0.308   -1.341  1.00 0.00 ? 49 VAL A C    6  
ATOM 5184  O O    . VAL A 1 49 ? -12.934 0.760   -1.528  1.00 0.00 ? 49 VAL A O    6  
ATOM 5185  C CB   . VAL A 1 49 ? -10.245 1.447   0.240   1.00 0.00 ? 49 VAL A CB   6  
ATOM 5186  C CG1  . VAL A 1 49 ? -9.623  1.389   1.636   1.00 0.00 ? 49 VAL A CG1  6  
ATOM 5187  C CG2  . VAL A 1 49 ? -9.139  1.372   -0.814  1.00 0.00 ? 49 VAL A CG2  6  
ATOM 5188  H H    . VAL A 1 49 ? -9.521  -0.980  0.392   1.00 0.00 ? 49 VAL A H    6  
ATOM 5189  H HA   . VAL A 1 49 ? -11.998 0.350   0.785   1.00 0.00 ? 49 VAL A HA   6  
ATOM 5190  H HB   . VAL A 1 49 ? -10.790 2.373   0.128   1.00 0.00 ? 49 VAL A HB   6  
ATOM 5191  H HG11 . VAL A 1 49 ? -10.385 1.576   2.378   1.00 0.00 ? 49 VAL A HG11 6  
ATOM 5192  H HG12 . VAL A 1 49 ? -8.849  2.139   1.717   1.00 0.00 ? 49 VAL A HG12 6  
ATOM 5193  H HG13 . VAL A 1 49 ? -9.194  0.410   1.800   1.00 0.00 ? 49 VAL A HG13 6  
ATOM 5194  H HG21 . VAL A 1 49 ? -9.540  1.646   -1.777  1.00 0.00 ? 49 VAL A HG21 6  
ATOM 5195  H HG22 . VAL A 1 49 ? -8.753  0.365   -0.857  1.00 0.00 ? 49 VAL A HG22 6  
ATOM 5196  H HG23 . VAL A 1 49 ? -8.342  2.051   -0.548  1.00 0.00 ? 49 VAL A HG23 6  
ATOM 5197  N N    . TYR A 1 50 ? -11.046 -0.173  -2.321  1.00 0.00 ? 50 TYR A N    6  
ATOM 5198  C CA   . TYR A 1 50 ? -11.521 -0.188  -3.699  1.00 0.00 ? 50 TYR A CA   6  
ATOM 5199  C C    . TYR A 1 50 ? -12.772 -1.052  -3.818  1.00 0.00 ? 50 TYR A C    6  
ATOM 5200  O O    . TYR A 1 50 ? -13.633 -0.804  -4.661  1.00 0.00 ? 50 TYR A O    6  
ATOM 5201  C CB   . TYR A 1 50 ? -10.427 -0.727  -4.626  1.00 0.00 ? 50 TYR A CB   6  
ATOM 5202  C CG   . TYR A 1 50 ? -10.963 -0.853  -6.034  1.00 0.00 ? 50 TYR A CG   6  
ATOM 5203  C CD1  . TYR A 1 50 ? -11.446 0.277   -6.706  1.00 0.00 ? 50 TYR A CD1  6  
ATOM 5204  C CD2  . TYR A 1 50 ? -10.977 -2.101  -6.669  1.00 0.00 ? 50 TYR A CD2  6  
ATOM 5205  C CE1  . TYR A 1 50 ? -11.942 0.159   -8.010  1.00 0.00 ? 50 TYR A CE1  6  
ATOM 5206  C CE2  . TYR A 1 50 ? -11.473 -2.218  -7.973  1.00 0.00 ? 50 TYR A CE2  6  
ATOM 5207  C CZ   . TYR A 1 50 ? -11.955 -1.087  -8.644  1.00 0.00 ? 50 TYR A CZ   6  
ATOM 5208  O OH   . TYR A 1 50 ? -12.444 -1.205  -9.929  1.00 0.00 ? 50 TYR A OH   6  
ATOM 5209  H H    . TYR A 1 50 ? -10.155 -0.524  -2.114  1.00 0.00 ? 50 TYR A H    6  
ATOM 5210  H HA   . TYR A 1 50 ? -11.764 0.822   -3.997  1.00 0.00 ? 50 TYR A HA   6  
ATOM 5211  H HB2  . TYR A 1 50 ? -9.586  -0.047  -4.621  1.00 0.00 ? 50 TYR A HB2  6  
ATOM 5212  H HB3  . TYR A 1 50 ? -10.106 -1.696  -4.274  1.00 0.00 ? 50 TYR A HB3  6  
ATOM 5213  H HD1  . TYR A 1 50 ? -11.434 1.242   -6.219  1.00 0.00 ? 50 TYR A HD1  6  
ATOM 5214  H HD2  . TYR A 1 50 ? -10.604 -2.974  -6.154  1.00 0.00 ? 50 TYR A HD2  6  
ATOM 5215  H HE1  . TYR A 1 50 ? -12.314 1.032   -8.527  1.00 0.00 ? 50 TYR A HE1  6  
ATOM 5216  H HE2  . TYR A 1 50 ? -11.484 -3.181  -8.462  1.00 0.00 ? 50 TYR A HE2  6  
ATOM 5217  H HH   . TYR A 1 50 ? -12.699 -0.329  -10.229 1.00 0.00 ? 50 TYR A HH   6  
ATOM 5218  N N    . HIS A 1 51 ? -12.868 -2.064  -2.960  1.00 0.00 ? 51 HIS A N    6  
ATOM 5219  C CA   . HIS A 1 51 ? -14.022 -2.955  -2.969  1.00 0.00 ? 51 HIS A CA   6  
ATOM 5220  C C    . HIS A 1 51 ? -15.196 -2.308  -2.240  1.00 0.00 ? 51 HIS A C    6  
ATOM 5221  O O    . HIS A 1 51 ? -16.346 -2.438  -2.657  1.00 0.00 ? 51 HIS A O    6  
ATOM 5222  C CB   . HIS A 1 51 ? -13.666 -4.282  -2.289  1.00 0.00 ? 51 HIS A CB   6  
ATOM 5223  C CG   . HIS A 1 51 ? -12.857 -5.133  -3.231  1.00 0.00 ? 51 HIS A CG   6  
ATOM 5224  N ND1  . HIS A 1 51 ? -12.538 -6.451  -2.946  1.00 0.00 ? 51 HIS A ND1  6  
ATOM 5225  C CD2  . HIS A 1 51 ? -12.299 -4.870  -4.458  1.00 0.00 ? 51 HIS A CD2  6  
ATOM 5226  C CE1  . HIS A 1 51 ? -11.820 -6.928  -3.978  1.00 0.00 ? 51 HIS A CE1  6  
ATOM 5227  N NE2  . HIS A 1 51 ? -11.644 -6.005  -4.926  1.00 0.00 ? 51 HIS A NE2  6  
ATOM 5228  H H    . HIS A 1 51 ? -12.151 -2.210  -2.306  1.00 0.00 ? 51 HIS A H    6  
ATOM 5229  H HA   . HIS A 1 51 ? -14.309 -3.151  -3.991  1.00 0.00 ? 51 HIS A HA   6  
ATOM 5230  H HB2  . HIS A 1 51 ? -13.087 -4.085  -1.399  1.00 0.00 ? 51 HIS A HB2  6  
ATOM 5231  H HB3  . HIS A 1 51 ? -14.572 -4.804  -2.022  1.00 0.00 ? 51 HIS A HB3  6  
ATOM 5232  H HD2  . HIS A 1 51 ? -12.359 -3.927  -4.979  1.00 0.00 ? 51 HIS A HD2  6  
ATOM 5233  H HE1  . HIS A 1 51 ? -11.431 -7.935  -4.033  1.00 0.00 ? 51 HIS A HE1  6  
ATOM 5234  H HE2  . HIS A 1 51 ? -11.158 -6.105  -5.772  1.00 0.00 ? 51 HIS A HE2  6  
ATOM 5235  N N    . ALA A 1 52 ? -14.895 -1.610  -1.149  1.00 0.00 ? 52 ALA A N    6  
ATOM 5236  C CA   . ALA A 1 52 ? -15.933 -0.947  -0.368  1.00 0.00 ? 52 ALA A CA   6  
ATOM 5237  C C    . ALA A 1 52 ? -16.643 0.111   -1.208  1.00 0.00 ? 52 ALA A C    6  
ATOM 5238  O O    . ALA A 1 52 ? -17.873 0.175   -1.232  1.00 0.00 ? 52 ALA A O    6  
ATOM 5239  C CB   . ALA A 1 52 ? -15.317 -0.290  0.868   1.00 0.00 ? 52 ALA A CB   6  
ATOM 5240  H H    . ALA A 1 52 ? -13.959 -1.542  -0.863  1.00 0.00 ? 52 ALA A H    6  
ATOM 5241  H HA   . ALA A 1 52 ? -16.655 -1.683  -0.049  1.00 0.00 ? 52 ALA A HA   6  
ATOM 5242  H HB1  . ALA A 1 52 ? -14.610 0.466   0.560   1.00 0.00 ? 52 ALA A HB1  6  
ATOM 5243  H HB2  . ALA A 1 52 ? -14.808 -1.039  1.457   1.00 0.00 ? 52 ALA A HB2  6  
ATOM 5244  H HB3  . ALA A 1 52 ? -16.097 0.165   1.460   1.00 0.00 ? 52 ALA A HB3  6  
ATOM 5245  N N    . TRP A 1 53 ? -15.861 0.940   -1.893  1.00 0.00 ? 53 TRP A N    6  
ATOM 5246  C CA   . TRP A 1 53 ? -16.429 1.992   -2.730  1.00 0.00 ? 53 TRP A CA   6  
ATOM 5247  C C    . TRP A 1 53 ? -17.486 1.419   -3.668  1.00 0.00 ? 53 TRP A C    6  
ATOM 5248  O O    . TRP A 1 53 ? -18.293 2.159   -4.236  1.00 0.00 ? 53 TRP A O    6  
ATOM 5249  C CB   . TRP A 1 53 ? -15.323 2.663   -3.551  1.00 0.00 ? 53 TRP A CB   6  
ATOM 5250  C CG   . TRP A 1 53 ? -14.595 3.653   -2.698  1.00 0.00 ? 53 TRP A CG   6  
ATOM 5251  C CD1  . TRP A 1 53 ? -13.290 3.568   -2.355  1.00 0.00 ? 53 TRP A CD1  6  
ATOM 5252  C CD2  . TRP A 1 53 ? -15.103 4.870   -2.080  1.00 0.00 ? 53 TRP A CD2  6  
ATOM 5253  N NE1  . TRP A 1 53 ? -12.964 4.655   -1.563  1.00 0.00 ? 53 TRP A NE1  6  
ATOM 5254  C CE2  . TRP A 1 53 ? -14.049 5.487   -1.366  1.00 0.00 ? 53 TRP A CE2  6  
ATOM 5255  C CE3  . TRP A 1 53 ? -16.364 5.493   -2.069  1.00 0.00 ? 53 TRP A CE3  6  
ATOM 5256  C CZ2  . TRP A 1 53 ? -14.238 6.679   -0.665  1.00 0.00 ? 53 TRP A CZ2  6  
ATOM 5257  C CZ3  . TRP A 1 53 ? -16.558 6.693   -1.366  1.00 0.00 ? 53 TRP A CZ3  6  
ATOM 5258  C CH2  . TRP A 1 53 ? -15.497 7.284   -0.665  1.00 0.00 ? 53 TRP A CH2  6  
ATOM 5259  H H    . TRP A 1 53 ? -14.889 0.843   -1.835  1.00 0.00 ? 53 TRP A H    6  
ATOM 5260  H HA   . TRP A 1 53 ? -16.891 2.734   -2.095  1.00 0.00 ? 53 TRP A HA   6  
ATOM 5261  H HB2  . TRP A 1 53 ? -14.632 1.912   -3.902  1.00 0.00 ? 53 TRP A HB2  6  
ATOM 5262  H HB3  . TRP A 1 53 ? -15.761 3.173   -4.398  1.00 0.00 ? 53 TRP A HB3  6  
ATOM 5263  H HD1  . TRP A 1 53 ? -12.614 2.781   -2.648  1.00 0.00 ? 53 TRP A HD1  6  
ATOM 5264  H HE1  . TRP A 1 53 ? -12.079 4.831   -1.180  1.00 0.00 ? 53 TRP A HE1  6  
ATOM 5265  H HE3  . TRP A 1 53 ? -17.188 5.047   -2.606  1.00 0.00 ? 53 TRP A HE3  6  
ATOM 5266  H HZ2  . TRP A 1 53 ? -13.417 7.130   -0.127  1.00 0.00 ? 53 TRP A HZ2  6  
ATOM 5267  H HZ3  . TRP A 1 53 ? -17.530 7.164   -1.364  1.00 0.00 ? 53 TRP A HZ3  6  
ATOM 5268  H HH2  . TRP A 1 53 ? -15.654 8.208   -0.126  1.00 0.00 ? 53 TRP A HH2  6  
ATOM 5269  N N    . LYS A 1 54 ? -17.480 0.100   -3.828  1.00 0.00 ? 54 LYS A N    6  
ATOM 5270  C CA   . LYS A 1 54 ? -18.443 -0.559  -4.703  1.00 0.00 ? 54 LYS A CA   6  
ATOM 5271  C C    . LYS A 1 54 ? -19.817 -0.616  -4.041  1.00 0.00 ? 54 LYS A C    6  
ATOM 5272  O O    . LYS A 1 54 ? -20.786 -0.054  -4.551  1.00 0.00 ? 54 LYS A O    6  
ATOM 5273  C CB   . LYS A 1 54 ? -17.971 -1.978  -5.027  1.00 0.00 ? 54 LYS A CB   6  
ATOM 5274  C CG   . LYS A 1 54 ? -18.762 -2.521  -6.219  1.00 0.00 ? 54 LYS A CG   6  
ATOM 5275  C CD   . LYS A 1 54 ? -18.566 -4.035  -6.314  1.00 0.00 ? 54 LYS A CD   6  
ATOM 5276  C CE   . LYS A 1 54 ? -19.338 -4.574  -7.519  1.00 0.00 ? 54 LYS A CE   6  
ATOM 5277  N NZ   . LYS A 1 54 ? -19.299 -6.064  -7.508  1.00 0.00 ? 54 LYS A NZ   6  
ATOM 5278  H H    . LYS A 1 54 ? -16.814 -0.440  -3.352  1.00 0.00 ? 54 LYS A H    6  
ATOM 5279  H HA   . LYS A 1 54 ? -18.521 0.001   -5.623  1.00 0.00 ? 54 LYS A HA   6  
ATOM 5280  H HB2  . LYS A 1 54 ? -16.919 -1.959  -5.271  1.00 0.00 ? 54 LYS A HB2  6  
ATOM 5281  H HB3  . LYS A 1 54 ? -18.131 -2.614  -4.171  1.00 0.00 ? 54 LYS A HB3  6  
ATOM 5282  H HG2  . LYS A 1 54 ? -19.811 -2.300  -6.084  1.00 0.00 ? 54 LYS A HG2  6  
ATOM 5283  H HG3  . LYS A 1 54 ? -18.409 -2.056  -7.127  1.00 0.00 ? 54 LYS A HG3  6  
ATOM 5284  H HD2  . LYS A 1 54 ? -17.516 -4.255  -6.431  1.00 0.00 ? 54 LYS A HD2  6  
ATOM 5285  H HD3  . LYS A 1 54 ? -18.935 -4.503  -5.414  1.00 0.00 ? 54 LYS A HD3  6  
ATOM 5286  H HE2  . LYS A 1 54 ? -20.365 -4.242  -7.468  1.00 0.00 ? 54 LYS A HE2  6  
ATOM 5287  H HE3  . LYS A 1 54 ? -18.887 -4.210  -8.430  1.00 0.00 ? 54 LYS A HE3  6  
ATOM 5288  H HZ1  . LYS A 1 54 ? -18.580 -6.397  -8.181  1.00 0.00 ? 54 LYS A HZ1  6  
ATOM 5289  H HZ2  . LYS A 1 54 ? -20.227 -6.439  -7.785  1.00 0.00 ? 54 LYS A HZ2  6  
ATOM 5290  H HZ3  . LYS A 1 54 ? -19.059 -6.397  -6.551  1.00 0.00 ? 54 LYS A HZ3  6  
ATOM 5291  N N    . SER A 1 55 ? -19.893 -1.301  -2.904  1.00 0.00 ? 55 SER A N    6  
ATOM 5292  C CA   . SER A 1 55 ? -21.154 -1.425  -2.183  1.00 0.00 ? 55 SER A CA   6  
ATOM 5293  C C    . SER A 1 55 ? -22.246 -1.965  -3.102  1.00 0.00 ? 55 SER A C    6  
ATOM 5294  O O    . SER A 1 55 ? -22.045 -2.957  -3.803  1.00 0.00 ? 55 SER A O    6  
ATOM 5295  C CB   . SER A 1 55 ? -21.575 -0.063  -1.628  1.00 0.00 ? 55 SER A CB   6  
ATOM 5296  O OG   . SER A 1 55 ? -20.488 0.506   -0.909  1.00 0.00 ? 55 SER A OG   6  
ATOM 5297  H H    . SER A 1 55 ? -19.087 -1.729  -2.545  1.00 0.00 ? 55 SER A H    6  
ATOM 5298  H HA   . SER A 1 55 ? -21.019 -2.110  -1.358  1.00 0.00 ? 55 SER A HA   6  
ATOM 5299  H HB2  . SER A 1 55 ? -21.844 0.590   -2.440  1.00 0.00 ? 55 SER A HB2  6  
ATOM 5300  H HB3  . SER A 1 55 ? -22.427 -0.191  -0.973  1.00 0.00 ? 55 SER A HB3  6  
ATOM 5301  H HG   . SER A 1 55 ? -19.687 0.043   -1.166  1.00 0.00 ? 55 SER A HG   6  
ATOM 5302  N N    . LYS A 1 56 ? -23.400 -1.307  -3.096  1.00 0.00 ? 56 LYS A N    6  
ATOM 5303  C CA   . LYS A 1 56 ? -24.516 -1.732  -3.934  1.00 0.00 ? 56 LYS A CA   6  
ATOM 5304  C C    . LYS A 1 56 ? -25.485 -0.574  -4.161  1.00 0.00 ? 56 LYS A C    6  
ATOM 5305  O O    . LYS A 1 56 ? -26.273 -0.589  -5.106  1.00 0.00 ? 56 LYS A O    6  
ATOM 5306  C CB   . LYS A 1 56 ? -25.256 -2.898  -3.270  1.00 0.00 ? 56 LYS A CB   6  
ATOM 5307  C CG   . LYS A 1 56 ? -26.085 -3.652  -4.320  1.00 0.00 ? 56 LYS A CG   6  
ATOM 5308  C CD   . LYS A 1 56 ? -25.218 -4.715  -5.008  1.00 0.00 ? 56 LYS A CD   6  
ATOM 5309  C CE   . LYS A 1 56 ? -25.229 -6.004  -4.183  1.00 0.00 ? 56 LYS A CE   6  
ATOM 5310  N NZ   . LYS A 1 56 ? -24.390 -7.033  -4.857  1.00 0.00 ? 56 LYS A NZ   6  
ATOM 5311  H H    . LYS A 1 56 ? -23.505 -0.523  -2.517  1.00 0.00 ? 56 LYS A H    6  
ATOM 5312  H HA   . LYS A 1 56 ? -24.132 -2.058  -4.888  1.00 0.00 ? 56 LYS A HA   6  
ATOM 5313  H HB2  . LYS A 1 56 ? -24.536 -3.569  -2.825  1.00 0.00 ? 56 LYS A HB2  6  
ATOM 5314  H HB3  . LYS A 1 56 ? -25.912 -2.516  -2.503  1.00 0.00 ? 56 LYS A HB3  6  
ATOM 5315  H HG2  . LYS A 1 56 ? -26.925 -4.130  -3.836  1.00 0.00 ? 56 LYS A HG2  6  
ATOM 5316  H HG3  . LYS A 1 56 ? -26.449 -2.953  -5.059  1.00 0.00 ? 56 LYS A HG3  6  
ATOM 5317  H HD2  . LYS A 1 56 ? -25.614 -4.917  -5.993  1.00 0.00 ? 56 LYS A HD2  6  
ATOM 5318  H HD3  . LYS A 1 56 ? -24.204 -4.356  -5.096  1.00 0.00 ? 56 LYS A HD3  6  
ATOM 5319  H HE2  . LYS A 1 56 ? -24.832 -5.805  -3.199  1.00 0.00 ? 56 LYS A HE2  6  
ATOM 5320  H HE3  . LYS A 1 56 ? -26.242 -6.366  -4.096  1.00 0.00 ? 56 LYS A HE3  6  
ATOM 5321  H HZ1  . LYS A 1 56 ? -23.567 -6.576  -5.297  1.00 0.00 ? 56 LYS A HZ1  6  
ATOM 5322  H HZ2  . LYS A 1 56 ? -24.949 -7.513  -5.591  1.00 0.00 ? 56 LYS A HZ2  6  
ATOM 5323  H HZ3  . LYS A 1 56 ? -24.066 -7.730  -4.156  1.00 0.00 ? 56 LYS A HZ3  6  
ATOM 5324  N N    . ASN A 1 57 ? -25.419 0.426   -3.287  1.00 0.00 ? 57 ASN A N    6  
ATOM 5325  C CA   . ASN A 1 57 ? -26.294 1.589   -3.397  1.00 0.00 ? 57 ASN A CA   6  
ATOM 5326  C C    . ASN A 1 57 ? -25.528 2.865   -3.067  1.00 0.00 ? 57 ASN A C    6  
ATOM 5327  O O    . ASN A 1 57 ? -24.305 2.916   -3.192  1.00 0.00 ? 57 ASN A O    6  
ATOM 5328  C CB   . ASN A 1 57 ? -27.480 1.443   -2.441  1.00 0.00 ? 57 ASN A CB   6  
ATOM 5329  C CG   . ASN A 1 57 ? -28.110 0.062   -2.599  1.00 0.00 ? 57 ASN A CG   6  
ATOM 5330  O OD1  . ASN A 1 57 ? -27.831 -0.841  -1.810  1.00 0.00 ? 57 ASN A OD1  6  
ATOM 5331  N ND2  . ASN A 1 57 ? -28.946 -0.157  -3.577  1.00 0.00 ? 57 ASN A ND2  6  
ATOM 5332  H H    . ASN A 1 57 ? -24.770 0.380   -2.554  1.00 0.00 ? 57 ASN A H    6  
ATOM 5333  H HA   . ASN A 1 57 ? -26.668 1.656   -4.408  1.00 0.00 ? 57 ASN A HA   6  
ATOM 5334  H HB2  . ASN A 1 57 ? -27.137 1.566   -1.424  1.00 0.00 ? 57 ASN A HB2  6  
ATOM 5335  H HB3  . ASN A 1 57 ? -28.216 2.198   -2.667  1.00 0.00 ? 57 ASN A HB3  6  
ATOM 5336  H HD21 . ASN A 1 57 ? -29.166 0.564   -4.203  1.00 0.00 ? 57 ASN A HD21 6  
ATOM 5337  H HD22 . ASN A 1 57 ? -29.354 -1.041  -3.683  1.00 0.00 ? 57 ASN A HD22 6  
ATOM 5338  N N    . LYS A 1 58 ? -26.255 3.895   -2.646  1.00 0.00 ? 58 LYS A N    6  
ATOM 5339  C CA   . LYS A 1 58 ? -25.631 5.166   -2.301  1.00 0.00 ? 58 LYS A CA   6  
ATOM 5340  C C    . LYS A 1 58 ? -24.653 5.593   -3.391  1.00 0.00 ? 58 LYS A C    6  
ATOM 5341  O O    . LYS A 1 58 ? -23.521 5.983   -3.105  1.00 0.00 ? 58 LYS A O    6  
ATOM 5342  C CB   . LYS A 1 58 ? -24.891 5.037   -0.966  1.00 0.00 ? 58 LYS A CB   6  
ATOM 5343  C CG   . LYS A 1 58 ? -24.650 6.428   -0.373  1.00 0.00 ? 58 LYS A CG   6  
ATOM 5344  C CD   . LYS A 1 58 ? -23.825 6.299   0.909   1.00 0.00 ? 58 LYS A CD   6  
ATOM 5345  C CE   . LYS A 1 58 ? -23.700 7.669   1.579   1.00 0.00 ? 58 LYS A CE   6  
ATOM 5346  N NZ   . LYS A 1 58 ? -23.233 7.496   2.982   1.00 0.00 ? 58 LYS A NZ   6  
ATOM 5347  H H    . LYS A 1 58 ? -27.227 3.798   -2.564  1.00 0.00 ? 58 LYS A H    6  
ATOM 5348  H HA   . LYS A 1 58 ? -26.399 5.919   -2.203  1.00 0.00 ? 58 LYS A HA   6  
ATOM 5349  H HB2  . LYS A 1 58 ? -25.487 4.451   -0.281  1.00 0.00 ? 58 LYS A HB2  6  
ATOM 5350  H HB3  . LYS A 1 58 ? -23.942 4.547   -1.126  1.00 0.00 ? 58 LYS A HB3  6  
ATOM 5351  H HG2  . LYS A 1 58 ? -24.115 7.037   -1.088  1.00 0.00 ? 58 LYS A HG2  6  
ATOM 5352  H HG3  . LYS A 1 58 ? -25.599 6.890   -0.144  1.00 0.00 ? 58 LYS A HG3  6  
ATOM 5353  H HD2  . LYS A 1 58 ? -24.314 5.612   1.584   1.00 0.00 ? 58 LYS A HD2  6  
ATOM 5354  H HD3  . LYS A 1 58 ? -22.841 5.929   0.668   1.00 0.00 ? 58 LYS A HD3  6  
ATOM 5355  H HE2  . LYS A 1 58 ? -22.988 8.273   1.034   1.00 0.00 ? 58 LYS A HE2  6  
ATOM 5356  H HE3  . LYS A 1 58 ? -24.663 8.160   1.578   1.00 0.00 ? 58 LYS A HE3  6  
ATOM 5357  H HZ1  . LYS A 1 58 ? -22.260 7.852   3.071   1.00 0.00 ? 58 LYS A HZ1  6  
ATOM 5358  H HZ2  . LYS A 1 58 ? -23.253 6.486   3.232   1.00 0.00 ? 58 LYS A HZ2  6  
ATOM 5359  H HZ3  . LYS A 1 58 ? -23.858 8.026   3.624   1.00 0.00 ? 58 LYS A HZ3  6  
ATOM 5360  N N    . LYS A 1 59 ? -25.099 5.515   -4.641  1.00 0.00 ? 59 LYS A N    6  
ATOM 5361  C CA   . LYS A 1 59 ? -24.255 5.895   -5.768  1.00 0.00 ? 59 LYS A CA   6  
ATOM 5362  C C    . LYS A 1 59 ? -23.953 7.388   -5.734  1.00 0.00 ? 59 LYS A C    6  
ATOM 5363  O O    . LYS A 1 59 ? -24.788 8.210   -6.110  1.00 0.00 ? 59 LYS A O    6  
ATOM 5364  C CB   . LYS A 1 59 ? -24.954 5.544   -7.084  1.00 0.00 ? 59 LYS A CB   6  
ATOM 5365  C CG   . LYS A 1 59 ? -25.563 4.144   -6.981  1.00 0.00 ? 59 LYS A CG   6  
ATOM 5366  C CD   . LYS A 1 59 ? -26.025 3.683   -8.365  1.00 0.00 ? 59 LYS A CD   6  
ATOM 5367  C CE   . LYS A 1 59 ? -26.916 2.448   -8.223  1.00 0.00 ? 59 LYS A CE   6  
ATOM 5368  N NZ   . LYS A 1 59 ? -27.049 1.777   -9.547  1.00 0.00 ? 59 LYS A NZ   6  
ATOM 5369  H H    . LYS A 1 59 ? -26.011 5.196   -4.807  1.00 0.00 ? 59 LYS A H    6  
ATOM 5370  H HA   . LYS A 1 59 ? -23.326 5.348   -5.710  1.00 0.00 ? 59 LYS A HA   6  
ATOM 5371  H HB2  . LYS A 1 59 ? -25.734 6.264   -7.280  1.00 0.00 ? 59 LYS A HB2  6  
ATOM 5372  H HB3  . LYS A 1 59 ? -24.235 5.562   -7.889  1.00 0.00 ? 59 LYS A HB3  6  
ATOM 5373  H HG2  . LYS A 1 59 ? -24.821 3.455   -6.601  1.00 0.00 ? 59 LYS A HG2  6  
ATOM 5374  H HG3  . LYS A 1 59 ? -26.409 4.168   -6.310  1.00 0.00 ? 59 LYS A HG3  6  
ATOM 5375  H HD2  . LYS A 1 59 ? -26.582 4.479   -8.841  1.00 0.00 ? 59 LYS A HD2  6  
ATOM 5376  H HD3  . LYS A 1 59 ? -25.164 3.436   -8.968  1.00 0.00 ? 59 LYS A HD3  6  
ATOM 5377  H HE2  . LYS A 1 59 ? -26.472 1.764   -7.515  1.00 0.00 ? 59 LYS A HE2  6  
ATOM 5378  H HE3  . LYS A 1 59 ? -27.893 2.748   -7.871  1.00 0.00 ? 59 LYS A HE3  6  
ATOM 5379  H HZ1  . LYS A 1 59 ? -27.959 2.033   -9.975  1.00 0.00 ? 59 LYS A HZ1  6  
ATOM 5380  H HZ2  . LYS A 1 59 ? -27.005 0.746   -9.419  1.00 0.00 ? 59 LYS A HZ2  6  
ATOM 5381  H HZ3  . LYS A 1 59 ? -26.273 2.083   -10.170 1.00 0.00 ? 59 LYS A HZ3  6  
ATOM 5382  N N    . ARG A 1 60 ? -22.752 7.735   -5.281  1.00 0.00 ? 60 ARG A N    6  
ATOM 5383  C CA   . ARG A 1 60 ? -22.348 9.134   -5.202  1.00 0.00 ? 60 ARG A CA   6  
ATOM 5384  C C    . ARG A 1 60 ? -22.044 9.682   -6.592  1.00 0.00 ? 60 ARG A C    6  
ATOM 5385  O O    . ARG A 1 60 ? -22.463 9.063   -7.556  1.00 0.00 ? 60 ARG A O    6  
ATOM 5386  C CB   . ARG A 1 60 ? -21.110 9.271   -4.314  1.00 0.00 ? 60 ARG A CB   6  
ATOM 5387  C CG   . ARG A 1 60 ? -21.503 9.051   -2.852  1.00 0.00 ? 60 ARG A CG   6  
ATOM 5388  C CD   . ARG A 1 60 ? -20.244 8.848   -2.009  1.00 0.00 ? 60 ARG A CD   6  
ATOM 5389  N NE   . ARG A 1 60 ? -20.558 8.980   -0.591  1.00 0.00 ? 60 ARG A NE   6  
ATOM 5390  C CZ   . ARG A 1 60 ? -20.684 10.175  -0.024  1.00 0.00 ? 60 ARG A CZ   6  
ATOM 5391  N NH1  . ARG A 1 60 ? -20.524 11.257  -0.738  1.00 0.00 ? 60 ARG A NH1  6  
ATOM 5392  N NH2  . ARG A 1 60 ? -20.967 10.268  1.247   1.00 0.00 ? 60 ARG A NH2  6  
ATOM 5393  O OXT  . ARG A 1 60 ? -21.394 10.711  -6.673  1.00 0.00 ? 60 ARG A OXT  6  
ATOM 5394  H H    . ARG A 1 60 ? -22.126 7.036   -4.995  1.00 0.00 ? 60 ARG A H    6  
ATOM 5395  H HA   . ARG A 1 60 ? -23.154 9.706   -4.768  1.00 0.00 ? 60 ARG A HA   6  
ATOM 5396  H HB2  . ARG A 1 60 ? -20.375 8.534   -4.605  1.00 0.00 ? 60 ARG A HB2  6  
ATOM 5397  H HB3  . ARG A 1 60 ? -20.693 10.260  -4.428  1.00 0.00 ? 60 ARG A HB3  6  
ATOM 5398  H HG2  . ARG A 1 60 ? -22.043 9.915   -2.491  1.00 0.00 ? 60 ARG A HG2  6  
ATOM 5399  H HG3  . ARG A 1 60 ? -22.131 8.177   -2.776  1.00 0.00 ? 60 ARG A HG3  6  
ATOM 5400  H HD2  . ARG A 1 60 ? -19.844 7.862   -2.194  1.00 0.00 ? 60 ARG A HD2  6  
ATOM 5401  H HD3  . ARG A 1 60 ? -19.506 9.588   -2.284  1.00 0.00 ? 60 ARG A HD3  6  
ATOM 5402  H HE   . ARG A 1 60 ? -20.679 8.174   -0.047  1.00 0.00 ? 60 ARG A HE   6  
ATOM 5403  H HH11 . ARG A 1 60 ? -20.307 11.185  -1.711  1.00 0.00 ? 60 ARG A HH11 6  
ATOM 5404  H HH12 . ARG A 1 60 ? -20.618 12.156  -0.311  1.00 0.00 ? 60 ARG A HH12 6  
ATOM 5405  H HH21 . ARG A 1 60 ? -21.089 9.441   1.793   1.00 0.00 ? 60 ARG A HH21 6  
ATOM 5406  H HH22 . ARG A 1 60 ? -21.060 11.168  1.673   1.00 0.00 ? 60 ARG A HH22 6  
ATOM 5407  N N    . GLY A 1 9  ? 15.377  4.437   16.161  1.00 0.00 ? 9  GLY A N    7  
ATOM 5408  C CA   . GLY A 1 9  ? 15.302  3.960   14.786  1.00 0.00 ? 9  GLY A CA   7  
ATOM 5409  C C    . GLY A 1 9  ? 14.550  4.952   13.904  1.00 0.00 ? 9  GLY A C    7  
ATOM 5410  O O    . GLY A 1 9  ? 13.461  5.406   14.254  1.00 0.00 ? 9  GLY A O    7  
ATOM 5411  H H    . GLY A 1 9  ? 15.203  3.815   16.898  1.00 0.00 ? 9  GLY A H    7  
ATOM 5412  H HA2  . GLY A 1 9  ? 16.303  3.830   14.401  1.00 0.00 ? 9  GLY A HA2  7  
ATOM 5413  H HA3  . GLY A 1 9  ? 14.787  3.011   14.766  1.00 0.00 ? 9  GLY A HA3  7  
ATOM 5414  N N    . THR A 1 10 ? 15.140  5.283   12.760  1.00 0.00 ? 10 THR A N    7  
ATOM 5415  C CA   . THR A 1 10 ? 14.520  6.218   11.835  1.00 0.00 ? 10 THR A CA   7  
ATOM 5416  C C    . THR A 1 10 ? 13.359  5.552   11.100  1.00 0.00 ? 10 THR A C    7  
ATOM 5417  O O    . THR A 1 10 ? 13.098  4.363   11.279  1.00 0.00 ? 10 THR A O    7  
ATOM 5418  C CB   . THR A 1 10 ? 15.562  6.706   10.825  1.00 0.00 ? 10 THR A CB   7  
ATOM 5419  O OG1  . THR A 1 10 ? 16.424  5.630   10.482  1.00 0.00 ? 10 THR A OG1  7  
ATOM 5420  C CG2  . THR A 1 10 ? 16.384  7.843   11.438  1.00 0.00 ? 10 THR A CG2  7  
ATOM 5421  H H    . THR A 1 10 ? 16.007  4.889   12.532  1.00 0.00 ? 10 THR A H    7  
ATOM 5422  H HA   . THR A 1 10 ? 14.144  7.065   12.389  1.00 0.00 ? 10 THR A HA   7  
ATOM 5423  H HB   . THR A 1 10 ? 15.066  7.065   9.940   1.00 0.00 ? 10 THR A HB   7  
ATOM 5424  H HG1  . THR A 1 10 ? 16.017  4.816   10.789  1.00 0.00 ? 10 THR A HG1  7  
ATOM 5425  H HG21 . THR A 1 10 ? 16.722  7.553   12.421  1.00 0.00 ? 10 THR A HG21 7  
ATOM 5426  H HG22 . THR A 1 10 ? 15.770  8.729   11.515  1.00 0.00 ? 10 THR A HG22 7  
ATOM 5427  H HG23 . THR A 1 10 ? 17.237  8.049   10.810  1.00 0.00 ? 10 THR A HG23 7  
ATOM 5428  N N    . LYS A 1 11 ? 12.668  6.327   10.271  1.00 0.00 ? 11 LYS A N    7  
ATOM 5429  C CA   . LYS A 1 11 ? 11.538  5.802   9.513   1.00 0.00 ? 11 LYS A CA   7  
ATOM 5430  C C    . LYS A 1 11 ? 12.000  4.715   8.548   1.00 0.00 ? 11 LYS A C    7  
ATOM 5431  O O    . LYS A 1 11 ? 12.431  5.004   7.432   1.00 0.00 ? 11 LYS A O    7  
ATOM 5432  C CB   . LYS A 1 11 ? 10.864  6.930   8.729   1.00 0.00 ? 11 LYS A CB   7  
ATOM 5433  C CG   . LYS A 1 11 ? 10.382  8.008   9.701   1.00 0.00 ? 11 LYS A CG   7  
ATOM 5434  C CD   . LYS A 1 11 ? 9.799   9.183   8.913   1.00 0.00 ? 11 LYS A CD   7  
ATOM 5435  C CE   . LYS A 1 11 ? 9.150   10.174  9.880   1.00 0.00 ? 11 LYS A CE   7  
ATOM 5436  N NZ   . LYS A 1 11 ? 8.361   11.176  9.109   1.00 0.00 ? 11 LYS A NZ   7  
ATOM 5437  H H    . LYS A 1 11 ? 12.923  7.269   10.166  1.00 0.00 ? 11 LYS A H    7  
ATOM 5438  H HA   . LYS A 1 11 ? 10.822  5.379   10.201  1.00 0.00 ? 11 LYS A HA   7  
ATOM 5439  H HB2  . LYS A 1 11 ? 11.574  7.360   8.037   1.00 0.00 ? 11 LYS A HB2  7  
ATOM 5440  H HB3  . LYS A 1 11 ? 10.020  6.535   8.184   1.00 0.00 ? 11 LYS A HB3  7  
ATOM 5441  H HG2  . LYS A 1 11 ? 9.621   7.596   10.349  1.00 0.00 ? 11 LYS A HG2  7  
ATOM 5442  H HG3  . LYS A 1 11 ? 11.214  8.355   10.298  1.00 0.00 ? 11 LYS A HG3  7  
ATOM 5443  H HD2  . LYS A 1 11 ? 10.588  9.676   8.365   1.00 0.00 ? 11 LYS A HD2  7  
ATOM 5444  H HD3  . LYS A 1 11 ? 9.055   8.818   8.221   1.00 0.00 ? 11 LYS A HD3  7  
ATOM 5445  H HE2  . LYS A 1 11 ? 8.495   9.643   10.554  1.00 0.00 ? 11 LYS A HE2  7  
ATOM 5446  H HE3  . LYS A 1 11 ? 9.918   10.680  10.446  1.00 0.00 ? 11 LYS A HE3  7  
ATOM 5447  H HZ1  . LYS A 1 11 ? 8.633   11.134  8.105   1.00 0.00 ? 11 LYS A HZ1  7  
ATOM 5448  H HZ2  . LYS A 1 11 ? 8.555   12.129  9.476   1.00 0.00 ? 11 LYS A HZ2  7  
ATOM 5449  H HZ3  . LYS A 1 11 ? 7.346   10.966  9.203   1.00 0.00 ? 11 LYS A HZ3  7  
ATOM 5450  N N    . LYS A 1 12 ? 11.907  3.463   8.986   1.00 0.00 ? 12 LYS A N    7  
ATOM 5451  C CA   . LYS A 1 12 ? 12.318  2.339   8.152   1.00 0.00 ? 12 LYS A CA   7  
ATOM 5452  C C    . LYS A 1 12 ? 11.758  2.484   6.741   1.00 0.00 ? 12 LYS A C    7  
ATOM 5453  O O    . LYS A 1 12 ? 12.506  2.673   5.783   1.00 0.00 ? 12 LYS A O    7  
ATOM 5454  C CB   . LYS A 1 12 ? 11.829  1.027   8.767   1.00 0.00 ? 12 LYS A CB   7  
ATOM 5455  C CG   . LYS A 1 12 ? 12.429  0.863   10.167  1.00 0.00 ? 12 LYS A CG   7  
ATOM 5456  C CD   . LYS A 1 12 ? 12.260  -0.587  10.639  1.00 0.00 ? 12 LYS A CD   7  
ATOM 5457  C CE   . LYS A 1 12 ? 13.455  -1.426  10.176  1.00 0.00 ? 12 LYS A CE   7  
ATOM 5458  N NZ   . LYS A 1 12 ? 13.127  -2.873  10.309  1.00 0.00 ? 12 LYS A NZ   7  
ATOM 5459  H H    . LYS A 1 12 ? 11.557  3.293   9.884   1.00 0.00 ? 12 LYS A H    7  
ATOM 5460  H HA   . LYS A 1 12 ? 13.396  2.319   8.100   1.00 0.00 ? 12 LYS A HA   7  
ATOM 5461  H HB2  . LYS A 1 12 ? 10.751  1.043   8.837   1.00 0.00 ? 12 LYS A HB2  7  
ATOM 5462  H HB3  . LYS A 1 12 ? 12.138  0.200   8.146   1.00 0.00 ? 12 LYS A HB3  7  
ATOM 5463  H HG2  . LYS A 1 12 ? 13.479  1.116   10.140  1.00 0.00 ? 12 LYS A HG2  7  
ATOM 5464  H HG3  . LYS A 1 12 ? 11.918  1.524   10.853  1.00 0.00 ? 12 LYS A HG3  7  
ATOM 5465  H HD2  . LYS A 1 12 ? 12.204  -0.610  11.718  1.00 0.00 ? 12 LYS A HD2  7  
ATOM 5466  H HD3  . LYS A 1 12 ? 11.352  -1.000  10.225  1.00 0.00 ? 12 LYS A HD3  7  
ATOM 5467  H HE2  . LYS A 1 12 ? 13.675  -1.201  9.144   1.00 0.00 ? 12 LYS A HE2  7  
ATOM 5468  H HE3  . LYS A 1 12 ? 14.315  -1.194  10.785  1.00 0.00 ? 12 LYS A HE3  7  
ATOM 5469  H HZ1  . LYS A 1 12 ? 13.073  -3.125  11.317  1.00 0.00 ? 12 LYS A HZ1  7  
ATOM 5470  H HZ2  . LYS A 1 12 ? 13.868  -3.441  9.853   1.00 0.00 ? 12 LYS A HZ2  7  
ATOM 5471  H HZ3  . LYS A 1 12 ? 12.211  -3.065  9.853   1.00 0.00 ? 12 LYS A HZ3  7  
ATOM 5472  N N    . TYR A 1 13 ? 10.434  2.393   6.623   1.00 0.00 ? 13 TYR A N    7  
ATOM 5473  C CA   . TYR A 1 13 ? 9.776   2.516   5.326   1.00 0.00 ? 13 TYR A CA   7  
ATOM 5474  C C    . TYR A 1 13 ? 8.665   3.560   5.390   1.00 0.00 ? 13 TYR A C    7  
ATOM 5475  O O    . TYR A 1 13 ? 8.100   3.818   6.453   1.00 0.00 ? 13 TYR A O    7  
ATOM 5476  C CB   . TYR A 1 13 ? 9.187   1.162   4.906   1.00 0.00 ? 13 TYR A CB   7  
ATOM 5477  C CG   . TYR A 1 13 ? 10.228  0.366   4.149   1.00 0.00 ? 13 TYR A CG   7  
ATOM 5478  C CD1  . TYR A 1 13 ? 11.352  -0.133  4.817   1.00 0.00 ? 13 TYR A CD1  7  
ATOM 5479  C CD2  . TYR A 1 13 ? 10.066  0.131   2.779   1.00 0.00 ? 13 TYR A CD2  7  
ATOM 5480  C CE1  . TYR A 1 13 ? 12.315  -0.868  4.114   1.00 0.00 ? 13 TYR A CE1  7  
ATOM 5481  C CE2  . TYR A 1 13 ? 11.028  -0.603  2.076   1.00 0.00 ? 13 TYR A CE2  7  
ATOM 5482  C CZ   . TYR A 1 13 ? 12.152  -1.102  2.743   1.00 0.00 ? 13 TYR A CZ   7  
ATOM 5483  O OH   . TYR A 1 13 ? 13.101  -1.824  2.051   1.00 0.00 ? 13 TYR A OH   7  
ATOM 5484  H H    . TYR A 1 13 ? 9.891   2.242   7.424   1.00 0.00 ? 13 TYR A H    7  
ATOM 5485  H HA   . TYR A 1 13 ? 10.502  2.827   4.587   1.00 0.00 ? 13 TYR A HA   7  
ATOM 5486  H HB2  . TYR A 1 13 ? 8.887   0.614   5.787   1.00 0.00 ? 13 TYR A HB2  7  
ATOM 5487  H HB3  . TYR A 1 13 ? 8.327   1.322   4.271   1.00 0.00 ? 13 TYR A HB3  7  
ATOM 5488  H HD1  . TYR A 1 13 ? 11.476  0.046   5.874   1.00 0.00 ? 13 TYR A HD1  7  
ATOM 5489  H HD2  . TYR A 1 13 ? 9.198   0.515   2.263   1.00 0.00 ? 13 TYR A HD2  7  
ATOM 5490  H HE1  . TYR A 1 13 ? 13.183  -1.251  4.628   1.00 0.00 ? 13 TYR A HE1  7  
ATOM 5491  H HE2  . TYR A 1 13 ? 10.901  -0.784  1.020   1.00 0.00 ? 13 TYR A HE2  7  
ATOM 5492  H HH   . TYR A 1 13 ? 13.300  -1.353  1.239   1.00 0.00 ? 13 TYR A HH   7  
ATOM 5493  N N    . ASP A 1 14 ? 8.358   4.155   4.242   1.00 0.00 ? 14 ASP A N    7  
ATOM 5494  C CA   . ASP A 1 14 ? 7.314   5.170   4.170   1.00 0.00 ? 14 ASP A CA   7  
ATOM 5495  C C    . ASP A 1 14 ? 6.693   5.193   2.777   1.00 0.00 ? 14 ASP A C    7  
ATOM 5496  O O    . ASP A 1 14 ? 7.329   5.610   1.811   1.00 0.00 ? 14 ASP A O    7  
ATOM 5497  C CB   . ASP A 1 14 ? 7.899   6.547   4.494   1.00 0.00 ? 14 ASP A CB   7  
ATOM 5498  C CG   . ASP A 1 14 ? 6.776   7.532   4.798   1.00 0.00 ? 14 ASP A CG   7  
ATOM 5499  O OD1  . ASP A 1 14 ? 6.254   7.484   5.900   1.00 0.00 ? 14 ASP A OD1  7  
ATOM 5500  O OD2  . ASP A 1 14 ? 6.454   8.321   3.924   1.00 0.00 ? 14 ASP A OD2  7  
ATOM 5501  H H    . ASP A 1 14 ? 8.844   3.906   3.429   1.00 0.00 ? 14 ASP A H    7  
ATOM 5502  H HA   . ASP A 1 14 ? 6.546   4.937   4.893   1.00 0.00 ? 14 ASP A HA   7  
ATOM 5503  H HB2  . ASP A 1 14 ? 8.547   6.465   5.354   1.00 0.00 ? 14 ASP A HB2  7  
ATOM 5504  H HB3  . ASP A 1 14 ? 8.467   6.902   3.648   1.00 0.00 ? 14 ASP A HB3  7  
ATOM 5505  N N    . LEU A 1 15 ? 5.445   4.741   2.685   1.00 0.00 ? 15 LEU A N    7  
ATOM 5506  C CA   . LEU A 1 15 ? 4.740   4.708   1.406   1.00 0.00 ? 15 LEU A CA   7  
ATOM 5507  C C    . LEU A 1 15 ? 3.429   5.482   1.502   1.00 0.00 ? 15 LEU A C    7  
ATOM 5508  O O    . LEU A 1 15 ? 2.351   4.917   1.315   1.00 0.00 ? 15 LEU A O    7  
ATOM 5509  C CB   . LEU A 1 15 ? 4.445   3.260   0.999   1.00 0.00 ? 15 LEU A CB   7  
ATOM 5510  C CG   . LEU A 1 15 ? 5.686   2.386   1.211   1.00 0.00 ? 15 LEU A CG   7  
ATOM 5511  C CD1  . LEU A 1 15 ? 5.294   0.913   1.091   1.00 0.00 ? 15 LEU A CD1  7  
ATOM 5512  C CD2  . LEU A 1 15 ? 6.739   2.715   0.149   1.00 0.00 ? 15 LEU A CD2  7  
ATOM 5513  H H    . LEU A 1 15 ? 4.989   4.421   3.491   1.00 0.00 ? 15 LEU A H    7  
ATOM 5514  H HA   . LEU A 1 15 ? 5.358   5.166   0.647   1.00 0.00 ? 15 LEU A HA   7  
ATOM 5515  H HB2  . LEU A 1 15 ? 3.631   2.879   1.599   1.00 0.00 ? 15 LEU A HB2  7  
ATOM 5516  H HB3  . LEU A 1 15 ? 4.162   3.232   -0.043  1.00 0.00 ? 15 LEU A HB3  7  
ATOM 5517  H HG   . LEU A 1 15 ? 6.093   2.569   2.194   1.00 0.00 ? 15 LEU A HG   7  
ATOM 5518  H HD11 . LEU A 1 15 ? 4.934   0.715   0.092   1.00 0.00 ? 15 LEU A HD11 7  
ATOM 5519  H HD12 . LEU A 1 15 ? 4.516   0.688   1.806   1.00 0.00 ? 15 LEU A HD12 7  
ATOM 5520  H HD13 . LEU A 1 15 ? 6.156   0.294   1.291   1.00 0.00 ? 15 LEU A HD13 7  
ATOM 5521  H HD21 . LEU A 1 15 ? 7.143   3.698   0.335   1.00 0.00 ? 15 LEU A HD21 7  
ATOM 5522  H HD22 . LEU A 1 15 ? 6.285   2.691   -0.829  1.00 0.00 ? 15 LEU A HD22 7  
ATOM 5523  H HD23 . LEU A 1 15 ? 7.535   1.984   0.195   1.00 0.00 ? 15 LEU A HD23 7  
ATOM 5524  N N    . SER A 1 16 ? 3.525   6.777   1.797   1.00 0.00 ? 16 SER A N    7  
ATOM 5525  C CA   . SER A 1 16 ? 2.334   7.616   1.913   1.00 0.00 ? 16 SER A CA   7  
ATOM 5526  C C    . SER A 1 16 ? 1.321   7.251   0.833   1.00 0.00 ? 16 SER A C    7  
ATOM 5527  O O    . SER A 1 16 ? 0.147   7.017   1.120   1.00 0.00 ? 16 SER A O    7  
ATOM 5528  C CB   . SER A 1 16 ? 2.719   9.090   1.778   1.00 0.00 ? 16 SER A CB   7  
ATOM 5529  O OG   . SER A 1 16 ? 1.612   9.821   1.265   1.00 0.00 ? 16 SER A OG   7  
ATOM 5530  H H    . SER A 1 16 ? 4.411   7.174   1.935   1.00 0.00 ? 16 SER A H    7  
ATOM 5531  H HA   . SER A 1 16 ? 1.886   7.458   2.883   1.00 0.00 ? 16 SER A HA   7  
ATOM 5532  H HB2  . SER A 1 16 ? 2.990   9.486   2.743   1.00 0.00 ? 16 SER A HB2  7  
ATOM 5533  H HB3  . SER A 1 16 ? 3.565   9.178   1.107   1.00 0.00 ? 16 SER A HB3  7  
ATOM 5534  H HG   . SER A 1 16 ? 1.936   10.666  0.948   1.00 0.00 ? 16 SER A HG   7  
ATOM 5535  N N    . LYS A 1 17 ? 1.792   7.186   -0.407  1.00 0.00 ? 17 LYS A N    7  
ATOM 5536  C CA   . LYS A 1 17 ? 0.932   6.829   -1.527  1.00 0.00 ? 17 LYS A CA   7  
ATOM 5537  C C    . LYS A 1 17 ? 1.788   6.454   -2.731  1.00 0.00 ? 17 LYS A C    7  
ATOM 5538  O O    . LYS A 1 17 ? 2.680   7.203   -3.126  1.00 0.00 ? 17 LYS A O    7  
ATOM 5539  C CB   . LYS A 1 17 ? 0.017   8.012   -1.879  1.00 0.00 ? 17 LYS A CB   7  
ATOM 5540  C CG   . LYS A 1 17 ? -1.249  7.517   -2.605  1.00 0.00 ? 17 LYS A CG   7  
ATOM 5541  C CD   . LYS A 1 17 ? -1.023  7.524   -4.123  1.00 0.00 ? 17 LYS A CD   7  
ATOM 5542  C CE   . LYS A 1 17 ? -1.337  8.912   -4.686  1.00 0.00 ? 17 LYS A CE   7  
ATOM 5543  N NZ   . LYS A 1 17 ? -0.755  9.036   -6.053  1.00 0.00 ? 17 LYS A NZ   7  
ATOM 5544  H H    . LYS A 1 17 ? 2.741   7.370   -0.570  1.00 0.00 ? 17 LYS A H    7  
ATOM 5545  H HA   . LYS A 1 17 ? 0.327   5.982   -1.245  1.00 0.00 ? 17 LYS A HA   7  
ATOM 5546  H HB2  . LYS A 1 17 ? -0.271  8.521   -0.970  1.00 0.00 ? 17 LYS A HB2  7  
ATOM 5547  H HB3  . LYS A 1 17 ? 0.551   8.701   -2.519  1.00 0.00 ? 17 LYS A HB3  7  
ATOM 5548  H HG2  . LYS A 1 17 ? -1.487  6.513   -2.283  1.00 0.00 ? 17 LYS A HG2  7  
ATOM 5549  H HG3  . LYS A 1 17 ? -2.076  8.170   -2.366  1.00 0.00 ? 17 LYS A HG3  7  
ATOM 5550  H HD2  . LYS A 1 17 ? 0.004   7.272   -4.338  1.00 0.00 ? 17 LYS A HD2  7  
ATOM 5551  H HD3  . LYS A 1 17 ? -1.675  6.797   -4.585  1.00 0.00 ? 17 LYS A HD3  7  
ATOM 5552  H HE2  . LYS A 1 17 ? -2.407  9.047   -4.737  1.00 0.00 ? 17 LYS A HE2  7  
ATOM 5553  H HE3  . LYS A 1 17 ? -0.909  9.668   -4.044  1.00 0.00 ? 17 LYS A HE3  7  
ATOM 5554  H HZ1  . LYS A 1 17 ? -1.516  9.209   -6.741  1.00 0.00 ? 17 LYS A HZ1  7  
ATOM 5555  H HZ2  . LYS A 1 17 ? -0.261  8.155   -6.301  1.00 0.00 ? 17 LYS A HZ2  7  
ATOM 5556  H HZ3  . LYS A 1 17 ? -0.083  9.830   -6.074  1.00 0.00 ? 17 LYS A HZ3  7  
ATOM 5557  N N    . TRP A 1 18 ? 1.509   5.288   -3.305  1.00 0.00 ? 18 TRP A N    7  
ATOM 5558  C CA   . TRP A 1 18 ? 2.259   4.806   -4.463  1.00 0.00 ? 18 TRP A CA   7  
ATOM 5559  C C    . TRP A 1 18 ? 1.310   4.555   -5.633  1.00 0.00 ? 18 TRP A C    7  
ATOM 5560  O O    . TRP A 1 18 ? 0.104   4.397   -5.440  1.00 0.00 ? 18 TRP A O    7  
ATOM 5561  C CB   . TRP A 1 18 ? 2.983   3.499   -4.100  1.00 0.00 ? 18 TRP A CB   7  
ATOM 5562  C CG   . TRP A 1 18 ? 4.381   3.777   -3.630  1.00 0.00 ? 18 TRP A CG   7  
ATOM 5563  C CD1  . TRP A 1 18 ? 4.755   4.813   -2.842  1.00 0.00 ? 18 TRP A CD1  7  
ATOM 5564  C CD2  . TRP A 1 18 ? 5.594   3.014   -3.897  1.00 0.00 ? 18 TRP A CD2  7  
ATOM 5565  N NE1  . TRP A 1 18 ? 6.117   4.737   -2.618  1.00 0.00 ? 18 TRP A NE1  7  
ATOM 5566  C CE2  . TRP A 1 18 ? 6.680   3.646   -3.246  1.00 0.00 ? 18 TRP A CE2  7  
ATOM 5567  C CE3  . TRP A 1 18 ? 5.855   1.847   -4.637  1.00 0.00 ? 18 TRP A CE3  7  
ATOM 5568  C CZ2  . TRP A 1 18 ? 7.976   3.137   -3.327  1.00 0.00 ? 18 TRP A CZ2  7  
ATOM 5569  C CZ3  . TRP A 1 18 ? 7.158   1.333   -4.719  1.00 0.00 ? 18 TRP A CZ3  7  
ATOM 5570  C CH2  . TRP A 1 18 ? 8.217   1.977   -4.065  1.00 0.00 ? 18 TRP A CH2  7  
ATOM 5571  H H    . TRP A 1 18 ? 0.785   4.736   -2.941  1.00 0.00 ? 18 TRP A H    7  
ATOM 5572  H HA   . TRP A 1 18 ? 2.991   5.547   -4.753  1.00 0.00 ? 18 TRP A HA   7  
ATOM 5573  H HB2  . TRP A 1 18 ? 2.438   2.998   -3.315  1.00 0.00 ? 18 TRP A HB2  7  
ATOM 5574  H HB3  . TRP A 1 18 ? 3.023   2.858   -4.969  1.00 0.00 ? 18 TRP A HB3  7  
ATOM 5575  H HD1  . TRP A 1 18 ? 4.100   5.574   -2.455  1.00 0.00 ? 18 TRP A HD1  7  
ATOM 5576  H HE1  . TRP A 1 18 ? 6.637   5.370   -2.081  1.00 0.00 ? 18 TRP A HE1  7  
ATOM 5577  H HE3  . TRP A 1 18 ? 5.048   1.341   -5.143  1.00 0.00 ? 18 TRP A HE3  7  
ATOM 5578  H HZ2  . TRP A 1 18 ? 8.789   3.636   -2.819  1.00 0.00 ? 18 TRP A HZ2  7  
ATOM 5579  H HZ3  . TRP A 1 18 ? 7.344   0.437   -5.290  1.00 0.00 ? 18 TRP A HZ3  7  
ATOM 5580  H HH2  . TRP A 1 18 ? 9.217   1.575   -4.132  1.00 0.00 ? 18 TRP A HH2  7  
ATOM 5581  N N    . LYS A 1 19 ? 1.859   4.517   -6.844  1.00 0.00 ? 19 LYS A N    7  
ATOM 5582  C CA   . LYS A 1 19 ? 1.044   4.280   -8.033  1.00 0.00 ? 19 LYS A CA   7  
ATOM 5583  C C    . LYS A 1 19 ? 1.049   2.797   -8.391  1.00 0.00 ? 19 LYS A C    7  
ATOM 5584  O O    . LYS A 1 19 ? 1.888   2.034   -7.908  1.00 0.00 ? 19 LYS A O    7  
ATOM 5585  C CB   . LYS A 1 19 ? 1.578   5.096   -9.218  1.00 0.00 ? 19 LYS A CB   7  
ATOM 5586  C CG   . LYS A 1 19 ? 1.888   6.534   -8.775  1.00 0.00 ? 19 LYS A CG   7  
ATOM 5587  C CD   . LYS A 1 19 ? 0.599   7.372   -8.776  1.00 0.00 ? 19 LYS A CD   7  
ATOM 5588  C CE   . LYS A 1 19 ? 0.447   8.089   -10.121 1.00 0.00 ? 19 LYS A CE   7  
ATOM 5589  N NZ   . LYS A 1 19 ? 0.825   7.163   -11.226 1.00 0.00 ? 19 LYS A NZ   7  
ATOM 5590  H H    . LYS A 1 19 ? 2.826   4.648   -6.939  1.00 0.00 ? 19 LYS A H    7  
ATOM 5591  H HA   . LYS A 1 19 ? 0.029   4.585   -7.830  1.00 0.00 ? 19 LYS A HA   7  
ATOM 5592  H HB2  . LYS A 1 19 ? 2.481   4.636   -9.593  1.00 0.00 ? 19 LYS A HB2  7  
ATOM 5593  H HB3  . LYS A 1 19 ? 0.836   5.115   -10.002 1.00 0.00 ? 19 LYS A HB3  7  
ATOM 5594  H HG2  . LYS A 1 19 ? 2.309   6.525   -7.780  1.00 0.00 ? 19 LYS A HG2  7  
ATOM 5595  H HG3  . LYS A 1 19 ? 2.600   6.973   -9.458  1.00 0.00 ? 19 LYS A HG3  7  
ATOM 5596  H HD2  . LYS A 1 19 ? -0.253  6.729   -8.613  1.00 0.00 ? 19 LYS A HD2  7  
ATOM 5597  H HD3  . LYS A 1 19 ? 0.649   8.107   -7.985  1.00 0.00 ? 19 LYS A HD3  7  
ATOM 5598  H HE2  . LYS A 1 19 ? -0.579  8.400   -10.248 1.00 0.00 ? 19 LYS A HE2  7  
ATOM 5599  H HE3  . LYS A 1 19 ? 1.091   8.956   -10.141 1.00 0.00 ? 19 LYS A HE3  7  
ATOM 5600  H HZ1  . LYS A 1 19 ? 1.708   6.672   -10.980 1.00 0.00 ? 19 LYS A HZ1  7  
ATOM 5601  H HZ2  . LYS A 1 19 ? 0.963   7.706   -12.101 1.00 0.00 ? 19 LYS A HZ2  7  
ATOM 5602  H HZ3  . LYS A 1 19 ? 0.067   6.464   -11.367 1.00 0.00 ? 19 LYS A HZ3  7  
ATOM 5603  N N    . TYR A 1 20 ? 0.109   2.390   -9.236  1.00 0.00 ? 20 TYR A N    7  
ATOM 5604  C CA   . TYR A 1 20 ? 0.015   0.994   -9.646  1.00 0.00 ? 20 TYR A CA   7  
ATOM 5605  C C    . TYR A 1 20 ? 1.225   0.600   -10.488 1.00 0.00 ? 20 TYR A C    7  
ATOM 5606  O O    . TYR A 1 20 ? 1.745   -0.511  -10.366 1.00 0.00 ? 20 TYR A O    7  
ATOM 5607  C CB   . TYR A 1 20 ? -1.265  0.774   -10.455 1.00 0.00 ? 20 TYR A CB   7  
ATOM 5608  C CG   . TYR A 1 20 ? -1.414  1.881   -11.472 1.00 0.00 ? 20 TYR A CG   7  
ATOM 5609  C CD1  . TYR A 1 20 ? -0.807  1.764   -12.728 1.00 0.00 ? 20 TYR A CD1  7  
ATOM 5610  C CD2  . TYR A 1 20 ? -2.160  3.024   -11.158 1.00 0.00 ? 20 TYR A CD2  7  
ATOM 5611  C CE1  . TYR A 1 20 ? -0.945  2.790   -13.671 1.00 0.00 ? 20 TYR A CE1  7  
ATOM 5612  C CE2  . TYR A 1 20 ? -2.298  4.050   -12.101 1.00 0.00 ? 20 TYR A CE2  7  
ATOM 5613  C CZ   . TYR A 1 20 ? -1.690  3.933   -13.357 1.00 0.00 ? 20 TYR A CZ   7  
ATOM 5614  O OH   . TYR A 1 20 ? -1.826  4.945   -14.285 1.00 0.00 ? 20 TYR A OH   7  
ATOM 5615  H H    . TYR A 1 20 ? -0.536  3.040   -9.588  1.00 0.00 ? 20 TYR A H    7  
ATOM 5616  H HA   . TYR A 1 20 ? -0.020  0.371   -8.766  1.00 0.00 ? 20 TYR A HA   7  
ATOM 5617  H HB2  . TYR A 1 20 ? -1.212  -0.177  -10.964 1.00 0.00 ? 20 TYR A HB2  7  
ATOM 5618  H HB3  . TYR A 1 20 ? -2.116  0.780   -9.792  1.00 0.00 ? 20 TYR A HB3  7  
ATOM 5619  H HD1  . TYR A 1 20 ? -0.233  0.882   -12.971 1.00 0.00 ? 20 TYR A HD1  7  
ATOM 5620  H HD2  . TYR A 1 20 ? -2.626  3.114   -10.189 1.00 0.00 ? 20 TYR A HD2  7  
ATOM 5621  H HE1  . TYR A 1 20 ? -0.478  2.700   -14.640 1.00 0.00 ? 20 TYR A HE1  7  
ATOM 5622  H HE2  . TYR A 1 20 ? -2.871  4.932   -11.859 1.00 0.00 ? 20 TYR A HE2  7  
ATOM 5623  H HH   . TYR A 1 20 ? -2.752  4.994   -14.537 1.00 0.00 ? 20 TYR A HH   7  
ATOM 5624  N N    . ALA A 1 21 ? 1.665   1.516   -11.343 1.00 0.00 ? 21 ALA A N    7  
ATOM 5625  C CA   . ALA A 1 21 ? 2.810   1.259   -12.208 1.00 0.00 ? 21 ALA A CA   7  
ATOM 5626  C C    . ALA A 1 21 ? 4.055   0.932   -11.389 1.00 0.00 ? 21 ALA A C    7  
ATOM 5627  O O    . ALA A 1 21 ? 4.673   -0.116  -11.574 1.00 0.00 ? 21 ALA A O    7  
ATOM 5628  C CB   . ALA A 1 21 ? 3.083   2.482   -13.085 1.00 0.00 ? 21 ALA A CB   7  
ATOM 5629  H H    . ALA A 1 21 ? 1.207   2.381   -11.396 1.00 0.00 ? 21 ALA A H    7  
ATOM 5630  H HA   . ALA A 1 21 ? 2.583   0.418   -12.847 1.00 0.00 ? 21 ALA A HA   7  
ATOM 5631  H HB1  . ALA A 1 21 ? 3.956   2.300   -13.696 1.00 0.00 ? 21 ALA A HB1  7  
ATOM 5632  H HB2  . ALA A 1 21 ? 3.256   3.344   -12.459 1.00 0.00 ? 21 ALA A HB2  7  
ATOM 5633  H HB3  . ALA A 1 21 ? 2.231   2.666   -13.723 1.00 0.00 ? 21 ALA A HB3  7  
ATOM 5634  N N    . GLU A 1 22 ? 4.426   1.837   -10.487 1.00 0.00 ? 22 GLU A N    7  
ATOM 5635  C CA   . GLU A 1 22 ? 5.605   1.630   -9.655  1.00 0.00 ? 22 GLU A CA   7  
ATOM 5636  C C    . GLU A 1 22 ? 5.416   0.433   -8.729  1.00 0.00 ? 22 GLU A C    7  
ATOM 5637  O O    . GLU A 1 22 ? 6.351   -0.332  -8.497  1.00 0.00 ? 22 GLU A O    7  
ATOM 5638  C CB   . GLU A 1 22 ? 5.894   2.883   -8.827  1.00 0.00 ? 22 GLU A CB   7  
ATOM 5639  C CG   . GLU A 1 22 ? 4.713   3.165   -7.896  1.00 0.00 ? 22 GLU A CG   7  
ATOM 5640  C CD   . GLU A 1 22 ? 4.891   4.521   -7.224  1.00 0.00 ? 22 GLU A CD   7  
ATOM 5641  O OE1  . GLU A 1 22 ? 4.571   5.519   -7.850  1.00 0.00 ? 22 GLU A OE1  7  
ATOM 5642  O OE2  . GLU A 1 22 ? 5.344   4.544   -6.090  1.00 0.00 ? 22 GLU A OE2  7  
ATOM 5643  H H    . GLU A 1 22 ? 3.899   2.659   -10.383 1.00 0.00 ? 22 GLU A H    7  
ATOM 5644  H HA   . GLU A 1 22 ? 6.452   1.440   -10.298 1.00 0.00 ? 22 GLU A HA   7  
ATOM 5645  H HB2  . GLU A 1 22 ? 6.787   2.730   -8.239  1.00 0.00 ? 22 GLU A HB2  7  
ATOM 5646  H HB3  . GLU A 1 22 ? 6.038   3.726   -9.486  1.00 0.00 ? 22 GLU A HB3  7  
ATOM 5647  H HG2  . GLU A 1 22 ? 3.801   3.167   -8.470  1.00 0.00 ? 22 GLU A HG2  7  
ATOM 5648  H HG3  . GLU A 1 22 ? 4.661   2.397   -7.143  1.00 0.00 ? 22 GLU A HG3  7  
ATOM 5649  N N    . LEU A 1 23 ? 4.208   0.273   -8.198  1.00 0.00 ? 23 LEU A N    7  
ATOM 5650  C CA   . LEU A 1 23 ? 3.930   -0.841  -7.297  1.00 0.00 ? 23 LEU A CA   7  
ATOM 5651  C C    . LEU A 1 23 ? 4.294   -2.165  -7.965  1.00 0.00 ? 23 LEU A C    7  
ATOM 5652  O O    . LEU A 1 23 ? 5.087   -2.942  -7.435  1.00 0.00 ? 23 LEU A O    7  
ATOM 5653  C CB   . LEU A 1 23 ? 2.440   -0.851  -6.916  1.00 0.00 ? 23 LEU A CB   7  
ATOM 5654  C CG   . LEU A 1 23 ? 2.242   -0.217  -5.531  1.00 0.00 ? 23 LEU A CG   7  
ATOM 5655  C CD1  . LEU A 1 23 ? 0.802   0.278   -5.395  1.00 0.00 ? 23 LEU A CD1  7  
ATOM 5656  C CD2  . LEU A 1 23 ? 2.522   -1.259  -4.444  1.00 0.00 ? 23 LEU A CD2  7  
ATOM 5657  H H    . LEU A 1 23 ? 3.494   0.912   -8.413  1.00 0.00 ? 23 LEU A H    7  
ATOM 5658  H HA   . LEU A 1 23 ? 4.525   -0.726  -6.405  1.00 0.00 ? 23 LEU A HA   7  
ATOM 5659  H HB2  . LEU A 1 23 ? 1.885   -0.287  -7.650  1.00 0.00 ? 23 LEU A HB2  7  
ATOM 5660  H HB3  . LEU A 1 23 ? 2.076   -1.869  -6.898  1.00 0.00 ? 23 LEU A HB3  7  
ATOM 5661  H HG   . LEU A 1 23 ? 2.917   0.616   -5.417  1.00 0.00 ? 23 LEU A HG   7  
ATOM 5662  H HD11 . LEU A 1 23 ? 0.122   -0.558  -5.473  1.00 0.00 ? 23 LEU A HD11 7  
ATOM 5663  H HD12 . LEU A 1 23 ? 0.590   0.990   -6.180  1.00 0.00 ? 23 LEU A HD12 7  
ATOM 5664  H HD13 . LEU A 1 23 ? 0.674   0.754   -4.433  1.00 0.00 ? 23 LEU A HD13 7  
ATOM 5665  H HD21 . LEU A 1 23 ? 3.553   -1.578  -4.504  1.00 0.00 ? 23 LEU A HD21 7  
ATOM 5666  H HD22 . LEU A 1 23 ? 1.874   -2.111  -4.586  1.00 0.00 ? 23 LEU A HD22 7  
ATOM 5667  H HD23 . LEU A 1 23 ? 2.335   -0.826  -3.473  1.00 0.00 ? 23 LEU A HD23 7  
ATOM 5668  N N    . ARG A 1 24 ? 3.708   -2.413  -9.132  1.00 0.00 ? 24 ARG A N    7  
ATOM 5669  C CA   . ARG A 1 24 ? 3.976   -3.647  -9.862  1.00 0.00 ? 24 ARG A CA   7  
ATOM 5670  C C    . ARG A 1 24 ? 5.449   -3.741  -10.243 1.00 0.00 ? 24 ARG A C    7  
ATOM 5671  O O    . ARG A 1 24 ? 6.098   -4.762  -10.010 1.00 0.00 ? 24 ARG A O    7  
ATOM 5672  C CB   . ARG A 1 24 ? 3.114   -3.700  -11.125 1.00 0.00 ? 24 ARG A CB   7  
ATOM 5673  C CG   . ARG A 1 24 ? 3.218   -5.090  -11.760 1.00 0.00 ? 24 ARG A CG   7  
ATOM 5674  C CD   . ARG A 1 24 ? 2.140   -5.240  -12.835 1.00 0.00 ? 24 ARG A CD   7  
ATOM 5675  N NE   . ARG A 1 24 ? 2.211   -6.567  -13.439 1.00 0.00 ? 24 ARG A NE   7  
ATOM 5676  C CZ   . ARG A 1 24 ? 3.073   -6.832  -14.416 1.00 0.00 ? 24 ARG A CZ   7  
ATOM 5677  N NH1  . ARG A 1 24 ? 3.876   -5.900  -14.848 1.00 0.00 ? 24 ARG A NH1  7  
ATOM 5678  N NH2  . ARG A 1 24 ? 3.116   -8.026  -14.941 1.00 0.00 ? 24 ARG A NH2  7  
ATOM 5679  H H    . ARG A 1 24 ? 3.085   -1.756  -9.508  1.00 0.00 ? 24 ARG A H    7  
ATOM 5680  H HA   . ARG A 1 24 ? 3.723   -4.486  -9.233  1.00 0.00 ? 24 ARG A HA   7  
ATOM 5681  H HB2  . ARG A 1 24 ? 2.085   -3.497  -10.869 1.00 0.00 ? 24 ARG A HB2  7  
ATOM 5682  H HB3  . ARG A 1 24 ? 3.462   -2.960  -11.832 1.00 0.00 ? 24 ARG A HB3  7  
ATOM 5683  H HG2  . ARG A 1 24 ? 4.193   -5.211  -12.207 1.00 0.00 ? 24 ARG A HG2  7  
ATOM 5684  H HG3  . ARG A 1 24 ? 3.073   -5.845  -11.001 1.00 0.00 ? 24 ARG A HG3  7  
ATOM 5685  H HD2  . ARG A 1 24 ? 1.167   -5.106  -12.387 1.00 0.00 ? 24 ARG A HD2  7  
ATOM 5686  H HD3  . ARG A 1 24 ? 2.287   -4.489  -13.596 1.00 0.00 ? 24 ARG A HD3  7  
ATOM 5687  H HE   . ARG A 1 24 ? 1.610   -7.274  -13.121 1.00 0.00 ? 24 ARG A HE   7  
ATOM 5688  H HH11 . ARG A 1 24 ? 3.843   -4.985  -14.446 1.00 0.00 ? 24 ARG A HH11 7  
ATOM 5689  H HH12 . ARG A 1 24 ? 4.525   -6.100  -15.582 1.00 0.00 ? 24 ARG A HH12 7  
ATOM 5690  H HH21 . ARG A 1 24 ? 2.501   -8.740  -14.609 1.00 0.00 ? 24 ARG A HH21 7  
ATOM 5691  H HH22 . ARG A 1 24 ? 3.766   -8.227  -15.674 1.00 0.00 ? 24 ARG A HH22 7  
ATOM 5692  N N    . ASP A 1 25 ? 5.972   -2.674  -10.834 1.00 0.00 ? 25 ASP A N    7  
ATOM 5693  C CA   . ASP A 1 25 ? 7.368   -2.657  -11.248 1.00 0.00 ? 25 ASP A CA   7  
ATOM 5694  C C    . ASP A 1 25 ? 8.288   -2.944  -10.066 1.00 0.00 ? 25 ASP A C    7  
ATOM 5695  O O    . ASP A 1 25 ? 9.128   -3.841  -10.125 1.00 0.00 ? 25 ASP A O    7  
ATOM 5696  C CB   . ASP A 1 25 ? 7.718   -1.296  -11.850 1.00 0.00 ? 25 ASP A CB   7  
ATOM 5697  C CG   . ASP A 1 25 ? 9.067   -1.370  -12.556 1.00 0.00 ? 25 ASP A CG   7  
ATOM 5698  O OD1  . ASP A 1 25 ? 9.151   -2.051  -13.564 1.00 0.00 ? 25 ASP A OD1  7  
ATOM 5699  O OD2  . ASP A 1 25 ? 9.998   -0.743  -12.078 1.00 0.00 ? 25 ASP A OD2  7  
ATOM 5700  H H    . ASP A 1 25 ? 5.408   -1.890  -10.999 1.00 0.00 ? 25 ASP A H    7  
ATOM 5701  H HA   . ASP A 1 25 ? 7.518   -3.417  -11.998 1.00 0.00 ? 25 ASP A HA   7  
ATOM 5702  H HB2  . ASP A 1 25 ? 6.955   -1.013  -12.562 1.00 0.00 ? 25 ASP A HB2  7  
ATOM 5703  H HB3  . ASP A 1 25 ? 7.765   -0.557  -11.064 1.00 0.00 ? 25 ASP A HB3  7  
ATOM 5704  N N    . THR A 1 26 ? 8.131   -2.173  -8.997  1.00 0.00 ? 26 THR A N    7  
ATOM 5705  C CA   . THR A 1 26 ? 8.963   -2.350  -7.812  1.00 0.00 ? 26 THR A CA   7  
ATOM 5706  C C    . THR A 1 26 ? 8.838   -3.764  -7.252  1.00 0.00 ? 26 THR A C    7  
ATOM 5707  O O    . THR A 1 26 ? 9.810   -4.321  -6.742  1.00 0.00 ? 26 THR A O    7  
ATOM 5708  C CB   . THR A 1 26 ? 8.567   -1.340  -6.736  1.00 0.00 ? 26 THR A CB   7  
ATOM 5709  O OG1  . THR A 1 26 ? 8.392   -0.061  -7.332  1.00 0.00 ? 26 THR A OG1  7  
ATOM 5710  C CG2  . THR A 1 26 ? 9.668   -1.269  -5.678  1.00 0.00 ? 26 THR A CG2  7  
ATOM 5711  H H    . THR A 1 26 ? 7.450   -1.470  -9.007  1.00 0.00 ? 26 THR A H    7  
ATOM 5712  H HA   . THR A 1 26 ? 9.993   -2.174  -8.083  1.00 0.00 ? 26 THR A HA   7  
ATOM 5713  H HB   . THR A 1 26 ? 7.644   -1.651  -6.272  1.00 0.00 ? 26 THR A HB   7  
ATOM 5714  H HG1  . THR A 1 26 ? 8.664   0.602   -6.693  1.00 0.00 ? 26 THR A HG1  7  
ATOM 5715  H HG21 . THR A 1 26 ? 9.853   -2.258  -5.287  1.00 0.00 ? 26 THR A HG21 7  
ATOM 5716  H HG22 . THR A 1 26 ? 9.356   -0.618  -4.876  1.00 0.00 ? 26 THR A HG22 7  
ATOM 5717  H HG23 . THR A 1 26 ? 10.571  -0.884  -6.124  1.00 0.00 ? 26 THR A HG23 7  
ATOM 5718  N N    . ILE A 1 27 ? 7.643   -4.341  -7.334  1.00 0.00 ? 27 ILE A N    7  
ATOM 5719  C CA   . ILE A 1 27 ? 7.431   -5.690  -6.812  1.00 0.00 ? 27 ILE A CA   7  
ATOM 5720  C C    . ILE A 1 27 ? 7.991   -6.737  -7.773  1.00 0.00 ? 27 ILE A C    7  
ATOM 5721  O O    . ILE A 1 27 ? 8.289   -7.860  -7.371  1.00 0.00 ? 27 ILE A O    7  
ATOM 5722  C CB   . ILE A 1 27 ? 5.927   -5.930  -6.559  1.00 0.00 ? 27 ILE A CB   7  
ATOM 5723  C CG1  . ILE A 1 27 ? 5.737   -6.555  -5.169  1.00 0.00 ? 27 ILE A CG1  7  
ATOM 5724  C CG2  . ILE A 1 27 ? 5.339   -6.866  -7.626  1.00 0.00 ? 27 ILE A CG2  7  
ATOM 5725  C CD1  . ILE A 1 27 ? 4.290   -7.029  -5.002  1.00 0.00 ? 27 ILE A CD1  7  
ATOM 5726  H H    . ILE A 1 27 ? 6.894   -3.854  -7.743  1.00 0.00 ? 27 ILE A H    7  
ATOM 5727  H HA   . ILE A 1 27 ? 7.957   -5.774  -5.873  1.00 0.00 ? 27 ILE A HA   7  
ATOM 5728  H HB   . ILE A 1 27 ? 5.409   -4.985  -6.596  1.00 0.00 ? 27 ILE A HB   7  
ATOM 5729  H HG12 . ILE A 1 27 ? 6.405   -7.394  -5.058  1.00 0.00 ? 27 ILE A HG12 7  
ATOM 5730  H HG13 . ILE A 1 27 ? 5.960   -5.817  -4.412  1.00 0.00 ? 27 ILE A HG13 7  
ATOM 5731  H HG21 . ILE A 1 27 ? 5.699   -7.870  -7.462  1.00 0.00 ? 27 ILE A HG21 7  
ATOM 5732  H HG22 . ILE A 1 27 ? 5.638   -6.530  -8.607  1.00 0.00 ? 27 ILE A HG22 7  
ATOM 5733  H HG23 . ILE A 1 27 ? 4.261   -6.854  -7.559  1.00 0.00 ? 27 ILE A HG23 7  
ATOM 5734  H HD11 . ILE A 1 27 ? 4.172   -7.997  -5.469  1.00 0.00 ? 27 ILE A HD11 7  
ATOM 5735  H HD12 . ILE A 1 27 ? 3.621   -6.320  -5.470  1.00 0.00 ? 27 ILE A HD12 7  
ATOM 5736  H HD13 . ILE A 1 27 ? 4.055   -7.104  -3.953  1.00 0.00 ? 27 ILE A HD13 7  
ATOM 5737  N N    . ASN A 1 28 ? 8.128   -6.365  -9.045  1.00 0.00 ? 28 ASN A N    7  
ATOM 5738  C CA   . ASN A 1 28 ? 8.649   -7.291  -10.050 1.00 0.00 ? 28 ASN A CA   7  
ATOM 5739  C C    . ASN A 1 28 ? 10.105  -6.965  -10.390 1.00 0.00 ? 28 ASN A C    7  
ATOM 5740  O O    . ASN A 1 28 ? 10.744  -7.684  -11.157 1.00 0.00 ? 28 ASN A O    7  
ATOM 5741  C CB   . ASN A 1 28 ? 7.777   -7.229  -11.317 1.00 0.00 ? 28 ASN A CB   7  
ATOM 5742  C CG   . ASN A 1 28 ? 8.505   -6.504  -12.445 1.00 0.00 ? 28 ASN A CG   7  
ATOM 5743  O OD1  . ASN A 1 28 ? 8.675   -7.058  -13.531 1.00 0.00 ? 28 ASN A OD1  7  
ATOM 5744  N ND2  . ASN A 1 28 ? 8.945   -5.294  -12.250 1.00 0.00 ? 28 ASN A ND2  7  
ATOM 5745  H H    . ASN A 1 28 ? 7.872   -5.457  -9.312  1.00 0.00 ? 28 ASN A H    7  
ATOM 5746  H HA   . ASN A 1 28 ? 8.608   -8.293  -9.651  1.00 0.00 ? 28 ASN A HA   7  
ATOM 5747  H HB2  . ASN A 1 28 ? 7.538   -8.235  -11.636 1.00 0.00 ? 28 ASN A HB2  7  
ATOM 5748  H HB3  . ASN A 1 28 ? 6.861   -6.703  -11.090 1.00 0.00 ? 28 ASN A HB3  7  
ATOM 5749  H HD21 . ASN A 1 28 ? 8.807   -4.856  -11.384 1.00 0.00 ? 28 ASN A HD21 7  
ATOM 5750  H HD22 . ASN A 1 28 ? 9.412   -4.821  -12.969 1.00 0.00 ? 28 ASN A HD22 7  
ATOM 5751  N N    . THR A 1 29 ? 10.624  -5.883  -9.811  1.00 0.00 ? 29 THR A N    7  
ATOM 5752  C CA   . THR A 1 29 ? 12.010  -5.482  -10.058 1.00 0.00 ? 29 THR A CA   7  
ATOM 5753  C C    . THR A 1 29 ? 12.825  -5.572  -8.774  1.00 0.00 ? 29 THR A C    7  
ATOM 5754  O O    . THR A 1 29 ? 13.918  -6.137  -8.759  1.00 0.00 ? 29 THR A O    7  
ATOM 5755  C CB   . THR A 1 29 ? 12.060  -4.045  -10.595 1.00 0.00 ? 29 THR A CB   7  
ATOM 5756  O OG1  . THR A 1 29 ? 11.327  -3.194  -9.727  1.00 0.00 ? 29 THR A OG1  7  
ATOM 5757  C CG2  . THR A 1 29 ? 11.457  -3.983  -12.006 1.00 0.00 ? 29 THR A CG2  7  
ATOM 5758  H H    . THR A 1 29 ? 10.069  -5.350  -9.202  1.00 0.00 ? 29 THR A H    7  
ATOM 5759  H HA   . THR A 1 29 ? 12.446  -6.143  -10.792 1.00 0.00 ? 29 THR A HA   7  
ATOM 5760  H HB   . THR A 1 29 ? 13.089  -3.716  -10.632 1.00 0.00 ? 29 THR A HB   7  
ATOM 5761  H HG1  . THR A 1 29 ? 11.440  -3.516  -8.830  1.00 0.00 ? 29 THR A HG1  7  
ATOM 5762  H HG21 . THR A 1 29 ? 12.122  -3.435  -12.658 1.00 0.00 ? 29 THR A HG21 7  
ATOM 5763  H HG22 . THR A 1 29 ? 10.502  -3.480  -11.966 1.00 0.00 ? 29 THR A HG22 7  
ATOM 5764  H HG23 . THR A 1 29 ? 11.320  -4.982  -12.392 1.00 0.00 ? 29 THR A HG23 7  
ATOM 5765  N N    . SER A 1 30 ? 12.284  -5.013  -7.696  1.00 0.00 ? 30 SER A N    7  
ATOM 5766  C CA   . SER A 1 30 ? 12.967  -5.039  -6.408  1.00 0.00 ? 30 SER A CA   7  
ATOM 5767  C C    . SER A 1 30 ? 12.505  -6.241  -5.591  1.00 0.00 ? 30 SER A C    7  
ATOM 5768  O O    . SER A 1 30 ? 11.532  -6.906  -5.947  1.00 0.00 ? 30 SER A O    7  
ATOM 5769  C CB   . SER A 1 30 ? 12.681  -3.744  -5.642  1.00 0.00 ? 30 SER A CB   7  
ATOM 5770  O OG   . SER A 1 30 ? 13.782  -2.858  -5.791  1.00 0.00 ? 30 SER A OG   7  
ATOM 5771  H H    . SER A 1 30 ? 11.407  -4.579  -7.768  1.00 0.00 ? 30 SER A H    7  
ATOM 5772  H HA   . SER A 1 30 ? 14.032  -5.117  -6.574  1.00 0.00 ? 30 SER A HA   7  
ATOM 5773  H HB2  . SER A 1 30 ? 11.796  -3.277  -6.039  1.00 0.00 ? 30 SER A HB2  7  
ATOM 5774  H HB3  . SER A 1 30 ? 12.527  -3.968  -4.592  1.00 0.00 ? 30 SER A HB3  7  
ATOM 5775  H HG   . SER A 1 30 ? 14.200  -2.756  -4.933  1.00 0.00 ? 30 SER A HG   7  
ATOM 5776  N N    . CYS A 1 31 ? 13.207  -6.519  -4.497  1.00 0.00 ? 31 CYS A N    7  
ATOM 5777  C CA   . CYS A 1 31 ? 12.850  -7.647  -3.645  1.00 0.00 ? 31 CYS A CA   7  
ATOM 5778  C C    . CYS A 1 31 ? 13.410  -7.464  -2.240  1.00 0.00 ? 31 CYS A C    7  
ATOM 5779  O O    . CYS A 1 31 ? 14.615  -7.293  -2.056  1.00 0.00 ? 31 CYS A O    7  
ATOM 5780  C CB   . CYS A 1 31 ? 13.393  -8.945  -4.247  1.00 0.00 ? 31 CYS A CB   7  
ATOM 5781  S SG   . CYS A 1 31 ? 12.770  -10.356 -3.298  1.00 0.00 ? 31 CYS A SG   7  
ATOM 5782  H H    . CYS A 1 31 ? 13.973  -5.957  -4.259  1.00 0.00 ? 31 CYS A H    7  
ATOM 5783  H HA   . CYS A 1 31 ? 11.773  -7.716  -3.588  1.00 0.00 ? 31 CYS A HA   7  
ATOM 5784  H HB2  . CYS A 1 31 ? 13.070  -9.031  -5.273  1.00 0.00 ? 31 CYS A HB2  7  
ATOM 5785  H HB3  . CYS A 1 31 ? 14.473  -8.935  -4.209  1.00 0.00 ? 31 CYS A HB3  7  
ATOM 5786  H HG   . CYS A 1 31 ? 12.077  -10.777 -3.812  1.00 0.00 ? 31 CYS A HG   7  
ATOM 5787  N N    . ASP A 1 32 ? 12.525  -7.510  -1.251  1.00 0.00 ? 32 ASP A N    7  
ATOM 5788  C CA   . ASP A 1 32 ? 12.930  -7.356  0.141   1.00 0.00 ? 32 ASP A CA   7  
ATOM 5789  C C    . ASP A 1 32 ? 11.736  -7.584  1.061   1.00 0.00 ? 32 ASP A C    7  
ATOM 5790  O O    . ASP A 1 32 ? 10.659  -7.028  0.843   1.00 0.00 ? 32 ASP A O    7  
ATOM 5791  C CB   . ASP A 1 32 ? 13.509  -5.954  0.375   1.00 0.00 ? 32 ASP A CB   7  
ATOM 5792  C CG   . ASP A 1 32 ? 14.615  -6.007  1.426   1.00 0.00 ? 32 ASP A CG   7  
ATOM 5793  O OD1  . ASP A 1 32 ? 14.445  -6.724  2.398   1.00 0.00 ? 32 ASP A OD1  7  
ATOM 5794  O OD2  . ASP A 1 32 ? 15.613  -5.331  1.242   1.00 0.00 ? 32 ASP A OD2  7  
ATOM 5795  H H    . ASP A 1 32 ? 11.579  -7.655  -1.462  1.00 0.00 ? 32 ASP A H    7  
ATOM 5796  H HA   . ASP A 1 32 ? 13.690  -8.091  0.364   1.00 0.00 ? 32 ASP A HA   7  
ATOM 5797  H HB2  . ASP A 1 32 ? 13.916  -5.574  -0.551  1.00 0.00 ? 32 ASP A HB2  7  
ATOM 5798  H HB3  . ASP A 1 32 ? 12.727  -5.293  0.716   1.00 0.00 ? 32 ASP A HB3  7  
ATOM 5799  N N    . ILE A 1 33 ? 11.931  -8.406  2.087   1.00 0.00 ? 33 ILE A N    7  
ATOM 5800  C CA   . ILE A 1 33 ? 10.859  -8.702  3.032   1.00 0.00 ? 33 ILE A CA   7  
ATOM 5801  C C    . ILE A 1 33 ? 10.013  -7.459  3.301   1.00 0.00 ? 33 ILE A C    7  
ATOM 5802  O O    . ILE A 1 33 ? 8.790   -7.540  3.410   1.00 0.00 ? 33 ILE A O    7  
ATOM 5803  C CB   . ILE A 1 33 ? 11.455  -9.211  4.351   1.00 0.00 ? 33 ILE A CB   7  
ATOM 5804  C CG1  . ILE A 1 33 ? 12.710  -8.394  4.699   1.00 0.00 ? 33 ILE A CG1  7  
ATOM 5805  C CG2  . ILE A 1 33 ? 11.828  -10.689 4.209   1.00 0.00 ? 33 ILE A CG2  7  
ATOM 5806  C CD1  . ILE A 1 33 ? 12.871  -8.310  6.219   1.00 0.00 ? 33 ILE A CD1  7  
ATOM 5807  H H    . ILE A 1 33 ? 12.810  -8.822  2.210   1.00 0.00 ? 33 ILE A H    7  
ATOM 5808  H HA   . ILE A 1 33 ? 10.226  -9.471  2.616   1.00 0.00 ? 33 ILE A HA   7  
ATOM 5809  H HB   . ILE A 1 33 ? 10.722  -9.102  5.139   1.00 0.00 ? 33 ILE A HB   7  
ATOM 5810  H HG12 . ILE A 1 33 ? 13.581  -8.871  4.271   1.00 0.00 ? 33 ILE A HG12 7  
ATOM 5811  H HG13 . ILE A 1 33 ? 12.617  -7.397  4.296   1.00 0.00 ? 33 ILE A HG13 7  
ATOM 5812  H HG21 . ILE A 1 33 ? 12.529  -10.805 3.395   1.00 0.00 ? 33 ILE A HG21 7  
ATOM 5813  H HG22 . ILE A 1 33 ? 10.939  -11.266 4.004   1.00 0.00 ? 33 ILE A HG22 7  
ATOM 5814  H HG23 . ILE A 1 33 ? 12.280  -11.036 5.126   1.00 0.00 ? 33 ILE A HG23 7  
ATOM 5815  H HD11 . ILE A 1 33 ? 12.644  -9.271  6.658   1.00 0.00 ? 33 ILE A HD11 7  
ATOM 5816  H HD12 . ILE A 1 33 ? 12.193  -7.566  6.611   1.00 0.00 ? 33 ILE A HD12 7  
ATOM 5817  H HD13 . ILE A 1 33 ? 13.886  -8.036  6.459   1.00 0.00 ? 33 ILE A HD13 7  
ATOM 5818  N N    . GLU A 1 34 ? 10.674  -6.311  3.409   1.00 0.00 ? 34 GLU A N    7  
ATOM 5819  C CA   . GLU A 1 34 ? 9.975   -5.059  3.671   1.00 0.00 ? 34 GLU A CA   7  
ATOM 5820  C C    . GLU A 1 34 ? 9.248   -4.565  2.423   1.00 0.00 ? 34 GLU A C    7  
ATOM 5821  O O    . GLU A 1 34 ? 8.055   -4.268  2.467   1.00 0.00 ? 34 GLU A O    7  
ATOM 5822  C CB   . GLU A 1 34 ? 10.970  -3.996  4.146   1.00 0.00 ? 34 GLU A CB   7  
ATOM 5823  C CG   . GLU A 1 34 ? 12.110  -4.664  4.922   1.00 0.00 ? 34 GLU A CG   7  
ATOM 5824  C CD   . GLU A 1 34 ? 12.767  -3.659  5.862   1.00 0.00 ? 34 GLU A CD   7  
ATOM 5825  O OE1  . GLU A 1 34 ? 12.080  -3.164  6.742   1.00 0.00 ? 34 GLU A OE1  7  
ATOM 5826  O OE2  . GLU A 1 34 ? 13.946  -3.397  5.688   1.00 0.00 ? 34 GLU A OE2  7  
ATOM 5827  H H    . GLU A 1 34 ? 11.649  -6.307  3.314   1.00 0.00 ? 34 GLU A H    7  
ATOM 5828  H HA   . GLU A 1 34 ? 9.248   -5.226  4.452   1.00 0.00 ? 34 GLU A HA   7  
ATOM 5829  H HB2  . GLU A 1 34 ? 11.377  -3.475  3.290   1.00 0.00 ? 34 GLU A HB2  7  
ATOM 5830  H HB3  . GLU A 1 34 ? 10.466  -3.292  4.789   1.00 0.00 ? 34 GLU A HB3  7  
ATOM 5831  H HG2  . GLU A 1 34 ? 11.717  -5.489  5.497   1.00 0.00 ? 34 GLU A HG2  7  
ATOM 5832  H HG3  . GLU A 1 34 ? 12.848  -5.033  4.224   1.00 0.00 ? 34 GLU A HG3  7  
ATOM 5833  N N    . LEU A 1 35 ? 9.974   -4.472  1.311   1.00 0.00 ? 35 LEU A N    7  
ATOM 5834  C CA   . LEU A 1 35 ? 9.375   -4.004  0.065   1.00 0.00 ? 35 LEU A CA   7  
ATOM 5835  C C    . LEU A 1 35 ? 8.136   -4.834  -0.267  1.00 0.00 ? 35 LEU A C    7  
ATOM 5836  O O    . LEU A 1 35 ? 7.059   -4.289  -0.512  1.00 0.00 ? 35 LEU A O    7  
ATOM 5837  C CB   . LEU A 1 35 ? 10.391  -4.117  -1.085  1.00 0.00 ? 35 LEU A CB   7  
ATOM 5838  C CG   . LEU A 1 35 ? 10.219  -2.962  -2.095  1.00 0.00 ? 35 LEU A CG   7  
ATOM 5839  C CD1  . LEU A 1 35 ? 8.733   -2.716  -2.385  1.00 0.00 ? 35 LEU A CD1  7  
ATOM 5840  C CD2  . LEU A 1 35 ? 10.848  -1.676  -1.542  1.00 0.00 ? 35 LEU A CD2  7  
ATOM 5841  H H    . LEU A 1 35 ? 10.922  -4.718  1.332   1.00 0.00 ? 35 LEU A H    7  
ATOM 5842  H HA   . LEU A 1 35 ? 9.088   -2.972  0.186   1.00 0.00 ? 35 LEU A HA   7  
ATOM 5843  H HB2  . LEU A 1 35 ? 11.390  -4.088  -0.680  1.00 0.00 ? 35 LEU A HB2  7  
ATOM 5844  H HB3  . LEU A 1 35 ? 10.248  -5.058  -1.598  1.00 0.00 ? 35 LEU A HB3  7  
ATOM 5845  H HG   . LEU A 1 35 ? 10.716  -3.229  -3.016  1.00 0.00 ? 35 LEU A HG   7  
ATOM 5846  H HD11 . LEU A 1 35 ? 8.300   -2.126  -1.589  1.00 0.00 ? 35 LEU A HD11 7  
ATOM 5847  H HD12 . LEU A 1 35 ? 8.217   -3.658  -2.460  1.00 0.00 ? 35 LEU A HD12 7  
ATOM 5848  H HD13 . LEU A 1 35 ? 8.636   -2.179  -3.317  1.00 0.00 ? 35 LEU A HD13 7  
ATOM 5849  H HD21 . LEU A 1 35 ? 11.653  -1.921  -0.866  1.00 0.00 ? 35 LEU A HD21 7  
ATOM 5850  H HD22 . LEU A 1 35 ? 10.096  -1.104  -1.016  1.00 0.00 ? 35 LEU A HD22 7  
ATOM 5851  H HD23 . LEU A 1 35 ? 11.236  -1.088  -2.360  1.00 0.00 ? 35 LEU A HD23 7  
ATOM 5852  N N    . LEU A 1 36 ? 8.303   -6.153  -0.279  1.00 0.00 ? 36 LEU A N    7  
ATOM 5853  C CA   . LEU A 1 36 ? 7.195   -7.052  -0.591  1.00 0.00 ? 36 LEU A CA   7  
ATOM 5854  C C    . LEU A 1 36 ? 6.100   -6.950  0.466   1.00 0.00 ? 36 LEU A C    7  
ATOM 5855  O O    . LEU A 1 36 ? 4.929   -6.754  0.138   1.00 0.00 ? 36 LEU A O    7  
ATOM 5856  C CB   . LEU A 1 36 ? 7.701   -8.493  -0.675  1.00 0.00 ? 36 LEU A CB   7  
ATOM 5857  C CG   . LEU A 1 36 ? 8.952   -8.549  -1.556  1.00 0.00 ? 36 LEU A CG   7  
ATOM 5858  C CD1  . LEU A 1 36 ? 9.404   -10.004 -1.705  1.00 0.00 ? 36 LEU A CD1  7  
ATOM 5859  C CD2  . LEU A 1 36 ? 8.634   -7.969  -2.940  1.00 0.00 ? 36 LEU A CD2  7  
ATOM 5860  H H    . LEU A 1 36 ? 9.184   -6.528  -0.082  1.00 0.00 ? 36 LEU A H    7  
ATOM 5861  H HA   . LEU A 1 36 ? 6.780   -6.774  -1.548  1.00 0.00 ? 36 LEU A HA   7  
ATOM 5862  H HB2  . LEU A 1 36 ? 7.942   -8.848  0.317   1.00 0.00 ? 36 LEU A HB2  7  
ATOM 5863  H HB3  . LEU A 1 36 ? 6.933   -9.118  -1.104  1.00 0.00 ? 36 LEU A HB3  7  
ATOM 5864  H HG   . LEU A 1 36 ? 9.742   -7.974  -1.095  1.00 0.00 ? 36 LEU A HG   7  
ATOM 5865  H HD11 . LEU A 1 36 ? 9.713   -10.385 -0.744  1.00 0.00 ? 36 LEU A HD11 7  
ATOM 5866  H HD12 . LEU A 1 36 ? 10.233  -10.054 -2.396  1.00 0.00 ? 36 LEU A HD12 7  
ATOM 5867  H HD13 . LEU A 1 36 ? 8.585   -10.598 -2.082  1.00 0.00 ? 36 LEU A HD13 7  
ATOM 5868  H HD21 . LEU A 1 36 ? 7.652   -8.293  -3.250  1.00 0.00 ? 36 LEU A HD21 7  
ATOM 5869  H HD22 . LEU A 1 36 ? 9.368   -8.316  -3.654  1.00 0.00 ? 36 LEU A HD22 7  
ATOM 5870  H HD23 . LEU A 1 36 ? 8.661   -6.891  -2.893  1.00 0.00 ? 36 LEU A HD23 7  
ATOM 5871  N N    . ALA A 1 37 ? 6.481   -7.085  1.733   1.00 0.00 ? 37 ALA A N    7  
ATOM 5872  C CA   . ALA A 1 37 ? 5.508   -7.004  2.816   1.00 0.00 ? 37 ALA A CA   7  
ATOM 5873  C C    . ALA A 1 37 ? 4.697   -5.718  2.706   1.00 0.00 ? 37 ALA A C    7  
ATOM 5874  O O    . ALA A 1 37 ? 3.466   -5.745  2.706   1.00 0.00 ? 37 ALA A O    7  
ATOM 5875  C CB   . ALA A 1 37 ? 6.223   -7.044  4.168   1.00 0.00 ? 37 ALA A CB   7  
ATOM 5876  H H    . ALA A 1 37 ? 7.426   -7.241  1.941   1.00 0.00 ? 37 ALA A H    7  
ATOM 5877  H HA   . ALA A 1 37 ? 4.838   -7.848  2.751   1.00 0.00 ? 37 ALA A HA   7  
ATOM 5878  H HB1  . ALA A 1 37 ? 5.507   -6.871  4.959   1.00 0.00 ? 37 ALA A HB1  7  
ATOM 5879  H HB2  . ALA A 1 37 ? 6.982   -6.277  4.198   1.00 0.00 ? 37 ALA A HB2  7  
ATOM 5880  H HB3  . ALA A 1 37 ? 6.682   -8.012  4.305   1.00 0.00 ? 37 ALA A HB3  7  
ATOM 5881  N N    . ALA A 1 38 ? 5.395   -4.593  2.604   1.00 0.00 ? 38 ALA A N    7  
ATOM 5882  C CA   . ALA A 1 38 ? 4.731   -3.302  2.489   1.00 0.00 ? 38 ALA A CA   7  
ATOM 5883  C C    . ALA A 1 38 ? 3.896   -3.247  1.212   1.00 0.00 ? 38 ALA A C    7  
ATOM 5884  O O    . ALA A 1 38 ? 2.742   -2.816  1.231   1.00 0.00 ? 38 ALA A O    7  
ATOM 5885  C CB   . ALA A 1 38 ? 5.770   -2.178  2.479   1.00 0.00 ? 38 ALA A CB   7  
ATOM 5886  H H    . ALA A 1 38 ? 6.375   -4.633  2.605   1.00 0.00 ? 38 ALA A H    7  
ATOM 5887  H HA   . ALA A 1 38 ? 4.079   -3.168  3.338   1.00 0.00 ? 38 ALA A HA   7  
ATOM 5888  H HB1  . ALA A 1 38 ? 5.310   -1.259  2.811   1.00 0.00 ? 38 ALA A HB1  7  
ATOM 5889  H HB2  . ALA A 1 38 ? 6.153   -2.047  1.477   1.00 0.00 ? 38 ALA A HB2  7  
ATOM 5890  H HB3  . ALA A 1 38 ? 6.583   -2.434  3.143   1.00 0.00 ? 38 ALA A HB3  7  
ATOM 5891  N N    . CYS A 1 39 ? 4.483   -3.691  0.104   1.00 0.00 ? 39 CYS A N    7  
ATOM 5892  C CA   . CYS A 1 39 ? 3.777   -3.691  -1.171  1.00 0.00 ? 39 CYS A CA   7  
ATOM 5893  C C    . CYS A 1 39 ? 2.449   -4.427  -1.039  1.00 0.00 ? 39 CYS A C    7  
ATOM 5894  O O    . CYS A 1 39 ? 1.400   -3.915  -1.433  1.00 0.00 ? 39 CYS A O    7  
ATOM 5895  C CB   . CYS A 1 39 ? 4.630   -4.363  -2.249  1.00 0.00 ? 39 CYS A CB   7  
ATOM 5896  S SG   . CYS A 1 39 ? 3.815   -4.188  -3.856  1.00 0.00 ? 39 CYS A SG   7  
ATOM 5897  H H    . CYS A 1 39 ? 5.403   -4.027  0.146   1.00 0.00 ? 39 CYS A H    7  
ATOM 5898  H HA   . CYS A 1 39 ? 3.585   -2.668  -1.464  1.00 0.00 ? 39 CYS A HA   7  
ATOM 5899  H HB2  . CYS A 1 39 ? 5.603   -3.896  -2.287  1.00 0.00 ? 39 CYS A HB2  7  
ATOM 5900  H HB3  . CYS A 1 39 ? 4.743   -5.412  -2.015  1.00 0.00 ? 39 CYS A HB3  7  
ATOM 5901  H HG   . CYS A 1 39 ? 4.497   -4.142  -4.530  1.00 0.00 ? 39 CYS A HG   7  
ATOM 5902  N N    . ARG A 1 40 ? 2.503   -5.633  -0.480  1.00 0.00 ? 40 ARG A N    7  
ATOM 5903  C CA   . ARG A 1 40 ? 1.298   -6.432  -0.296  1.00 0.00 ? 40 ARG A CA   7  
ATOM 5904  C C    . ARG A 1 40 ? 0.285   -5.674  0.554   1.00 0.00 ? 40 ARG A C    7  
ATOM 5905  O O    . ARG A 1 40 ? -0.899  -5.614  0.220   1.00 0.00 ? 40 ARG A O    7  
ATOM 5906  C CB   . ARG A 1 40 ? 1.645   -7.757  0.385   1.00 0.00 ? 40 ARG A CB   7  
ATOM 5907  C CG   . ARG A 1 40 ? 2.370   -8.673  -0.607  1.00 0.00 ? 40 ARG A CG   7  
ATOM 5908  C CD   . ARG A 1 40 ? 2.532   -10.063 0.009   1.00 0.00 ? 40 ARG A CD   7  
ATOM 5909  N NE   . ARG A 1 40 ? 3.495   -10.845 -0.759  1.00 0.00 ? 40 ARG A NE   7  
ATOM 5910  C CZ   . ARG A 1 40 ? 4.800   -10.749 -0.530  1.00 0.00 ? 40 ARG A CZ   7  
ATOM 5911  N NH1  . ARG A 1 40 ? 5.242   -9.943  0.396   1.00 0.00 ? 40 ARG A NH1  7  
ATOM 5912  N NH2  . ARG A 1 40 ? 5.640   -11.460 -1.232  1.00 0.00 ? 40 ARG A NH2  7  
ATOM 5913  H H    . ARG A 1 40 ? 3.367   -5.987  -0.183  1.00 0.00 ? 40 ARG A H    7  
ATOM 5914  H HA   . ARG A 1 40 ? 0.861   -6.638  -1.262  1.00 0.00 ? 40 ARG A HA   7  
ATOM 5915  H HB2  . ARG A 1 40 ? 2.285   -7.569  1.234   1.00 0.00 ? 40 ARG A HB2  7  
ATOM 5916  H HB3  . ARG A 1 40 ? 0.739   -8.240  0.718   1.00 0.00 ? 40 ARG A HB3  7  
ATOM 5917  H HG2  . ARG A 1 40 ? 1.792   -8.746  -1.517  1.00 0.00 ? 40 ARG A HG2  7  
ATOM 5918  H HG3  . ARG A 1 40 ? 3.343   -8.263  -0.831  1.00 0.00 ? 40 ARG A HG3  7  
ATOM 5919  H HD2  . ARG A 1 40 ? 2.884   -9.966  1.026   1.00 0.00 ? 40 ARG A HD2  7  
ATOM 5920  H HD3  . ARG A 1 40 ? 1.577   -10.567 0.009   1.00 0.00 ? 40 ARG A HD3  7  
ATOM 5921  H HE   . ARG A 1 40 ? 3.172   -11.453 -1.458  1.00 0.00 ? 40 ARG A HE   7  
ATOM 5922  H HH11 . ARG A 1 40 ? 4.599   -9.399  0.934   1.00 0.00 ? 40 ARG A HH11 7  
ATOM 5923  H HH12 . ARG A 1 40 ? 6.224   -9.869  0.569   1.00 0.00 ? 40 ARG A HH12 7  
ATOM 5924  H HH21 . ARG A 1 40 ? 5.301   -12.077 -1.942  1.00 0.00 ? 40 ARG A HH21 7  
ATOM 5925  H HH22 . ARG A 1 40 ? 6.622   -11.387 -1.060  1.00 0.00 ? 40 ARG A HH22 7  
ATOM 5926  N N    . GLU A 1 41 ? 0.756   -5.096  1.654   1.00 0.00 ? 41 GLU A N    7  
ATOM 5927  C CA   . GLU A 1 41 ? -0.120  -4.343  2.543   1.00 0.00 ? 41 GLU A CA   7  
ATOM 5928  C C    . GLU A 1 41 ? -0.860  -3.259  1.764   1.00 0.00 ? 41 GLU A C    7  
ATOM 5929  O O    . GLU A 1 41 ? -2.050  -3.029  1.978   1.00 0.00 ? 41 GLU A O    7  
ATOM 5930  C CB   . GLU A 1 41 ? 0.699   -3.699  3.664   1.00 0.00 ? 41 GLU A CB   7  
ATOM 5931  C CG   . GLU A 1 41 ? 1.151   -4.779  4.650   1.00 0.00 ? 41 GLU A CG   7  
ATOM 5932  C CD   . GLU A 1 41 ? -0.036  -5.260  5.477   1.00 0.00 ? 41 GLU A CD   7  
ATOM 5933  O OE1  . GLU A 1 41 ? -0.671  -4.430  6.105   1.00 0.00 ? 41 GLU A OE1  7  
ATOM 5934  O OE2  . GLU A 1 41 ? -0.291  -6.453  5.472   1.00 0.00 ? 41 GLU A OE2  7  
ATOM 5935  H H    . GLU A 1 41 ? 1.711   -5.177  1.871   1.00 0.00 ? 41 GLU A H    7  
ATOM 5936  H HA   . GLU A 1 41 ? -0.841  -5.017  2.978   1.00 0.00 ? 41 GLU A HA   7  
ATOM 5937  H HB2  . GLU A 1 41 ? 1.564   -3.211  3.243   1.00 0.00 ? 41 GLU A HB2  7  
ATOM 5938  H HB3  . GLU A 1 41 ? 0.090   -2.974  4.183   1.00 0.00 ? 41 GLU A HB3  7  
ATOM 5939  H HG2  . GLU A 1 41 ? 1.568   -5.612  4.102   1.00 0.00 ? 41 GLU A HG2  7  
ATOM 5940  H HG3  . GLU A 1 41 ? 1.903   -4.370  5.307   1.00 0.00 ? 41 GLU A HG3  7  
ATOM 5941  N N    . GLU A 1 42 ? -0.147  -2.601  0.855   1.00 0.00 ? 42 GLU A N    7  
ATOM 5942  C CA   . GLU A 1 42 ? -0.748  -1.545  0.046   1.00 0.00 ? 42 GLU A CA   7  
ATOM 5943  C C    . GLU A 1 42 ? -1.781  -2.131  -0.912  1.00 0.00 ? 42 GLU A C    7  
ATOM 5944  O O    . GLU A 1 42 ? -2.898  -1.626  -1.018  1.00 0.00 ? 42 GLU A O    7  
ATOM 5945  C CB   . GLU A 1 42 ? 0.336   -0.818  -0.752  1.00 0.00 ? 42 GLU A CB   7  
ATOM 5946  C CG   . GLU A 1 42 ? 1.169   0.052   0.191   1.00 0.00 ? 42 GLU A CG   7  
ATOM 5947  C CD   . GLU A 1 42 ? 0.375   1.290   0.597   1.00 0.00 ? 42 GLU A CD   7  
ATOM 5948  O OE1  . GLU A 1 42 ? -0.328  1.219   1.591   1.00 0.00 ? 42 GLU A OE1  7  
ATOM 5949  O OE2  . GLU A 1 42 ? 0.482   2.290   -0.094  1.00 0.00 ? 42 GLU A OE2  7  
ATOM 5950  H H    . GLU A 1 42 ? 0.797   -2.829  0.724   1.00 0.00 ? 42 GLU A H    7  
ATOM 5951  H HA   . GLU A 1 42 ? -1.235  -0.838  0.698   1.00 0.00 ? 42 GLU A HA   7  
ATOM 5952  H HB2  . GLU A 1 42 ? 0.976   -1.543  -1.235  1.00 0.00 ? 42 GLU A HB2  7  
ATOM 5953  H HB3  . GLU A 1 42 ? -0.127  -0.192  -1.501  1.00 0.00 ? 42 GLU A HB3  7  
ATOM 5954  H HG2  . GLU A 1 42 ? 1.420   -0.517  1.073   1.00 0.00 ? 42 GLU A HG2  7  
ATOM 5955  H HG3  . GLU A 1 42 ? 2.075   0.358   -0.309  1.00 0.00 ? 42 GLU A HG3  7  
ATOM 5956  N N    . PHE A 1 43 ? -1.400  -3.200  -1.602  1.00 0.00 ? 43 PHE A N    7  
ATOM 5957  C CA   . PHE A 1 43 ? -2.303  -3.848  -2.548  1.00 0.00 ? 43 PHE A CA   7  
ATOM 5958  C C    . PHE A 1 43 ? -3.541  -4.370  -1.823  1.00 0.00 ? 43 PHE A C    7  
ATOM 5959  O O    . PHE A 1 43 ? -4.671  -4.077  -2.214  1.00 0.00 ? 43 PHE A O    7  
ATOM 5960  C CB   . PHE A 1 43 ? -1.578  -5.009  -3.248  1.00 0.00 ? 43 PHE A CB   7  
ATOM 5961  C CG   . PHE A 1 43 ? -1.464  -4.728  -4.731  1.00 0.00 ? 43 PHE A CG   7  
ATOM 5962  C CD1  . PHE A 1 43 ? -0.853  -3.549  -5.173  1.00 0.00 ? 43 PHE A CD1  7  
ATOM 5963  C CD2  . PHE A 1 43 ? -1.967  -5.647  -5.660  1.00 0.00 ? 43 PHE A CD2  7  
ATOM 5964  C CE1  . PHE A 1 43 ? -0.746  -3.288  -6.545  1.00 0.00 ? 43 PHE A CE1  7  
ATOM 5965  C CE2  . PHE A 1 43 ? -1.861  -5.385  -7.032  1.00 0.00 ? 43 PHE A CE2  7  
ATOM 5966  C CZ   . PHE A 1 43 ? -1.251  -4.207  -7.473  1.00 0.00 ? 43 PHE A CZ   7  
ATOM 5967  H H    . PHE A 1 43 ? -0.497  -3.560  -1.476  1.00 0.00 ? 43 PHE A H    7  
ATOM 5968  H HA   . PHE A 1 43 ? -2.612  -3.125  -3.288  1.00 0.00 ? 43 PHE A HA   7  
ATOM 5969  H HB2  . PHE A 1 43 ? -0.588  -5.117  -2.829  1.00 0.00 ? 43 PHE A HB2  7  
ATOM 5970  H HB3  . PHE A 1 43 ? -2.130  -5.928  -3.098  1.00 0.00 ? 43 PHE A HB3  7  
ATOM 5971  H HD1  . PHE A 1 43 ? -0.465  -2.841  -4.456  1.00 0.00 ? 43 PHE A HD1  7  
ATOM 5972  H HD2  . PHE A 1 43 ? -2.438  -6.557  -5.319  1.00 0.00 ? 43 PHE A HD2  7  
ATOM 5973  H HE1  . PHE A 1 43 ? -0.276  -2.378  -6.886  1.00 0.00 ? 43 PHE A HE1  7  
ATOM 5974  H HE2  . PHE A 1 43 ? -2.250  -6.095  -7.748  1.00 0.00 ? 43 PHE A HE2  7  
ATOM 5975  H HZ   . PHE A 1 43 ? -1.168  -4.004  -8.532  1.00 0.00 ? 43 PHE A HZ   7  
ATOM 5976  N N    . HIS A 1 44 ? -3.320  -5.145  -0.767  1.00 0.00 ? 44 HIS A N    7  
ATOM 5977  C CA   . HIS A 1 44 ? -4.423  -5.703  0.005   1.00 0.00 ? 44 HIS A CA   7  
ATOM 5978  C C    . HIS A 1 44 ? -5.324  -4.592  0.534   1.00 0.00 ? 44 HIS A C    7  
ATOM 5979  O O    . HIS A 1 44 ? -6.549  -4.717  0.527   1.00 0.00 ? 44 HIS A O    7  
ATOM 5980  C CB   . HIS A 1 44 ? -3.879  -6.522  1.177   1.00 0.00 ? 44 HIS A CB   7  
ATOM 5981  C CG   . HIS A 1 44 ? -4.992  -7.326  1.790   1.00 0.00 ? 44 HIS A CG   7  
ATOM 5982  N ND1  . HIS A 1 44 ? -6.272  -6.816  1.946   1.00 0.00 ? 44 HIS A ND1  7  
ATOM 5983  C CD2  . HIS A 1 44 ? -5.035  -8.604  2.289   1.00 0.00 ? 44 HIS A CD2  7  
ATOM 5984  C CE1  . HIS A 1 44 ? -7.023  -7.773  2.519   1.00 0.00 ? 44 HIS A CE1  7  
ATOM 5985  N NE2  . HIS A 1 44 ? -6.319  -8.885  2.748   1.00 0.00 ? 44 HIS A NE2  7  
ATOM 5986  H H    . HIS A 1 44 ? -2.398  -5.345  -0.503  1.00 0.00 ? 44 HIS A H    7  
ATOM 5987  H HA   . HIS A 1 44 ? -5.004  -6.353  -0.632  1.00 0.00 ? 44 HIS A HA   7  
ATOM 5988  H HB2  . HIS A 1 44 ? -3.106  -7.190  0.822   1.00 0.00 ? 44 HIS A HB2  7  
ATOM 5989  H HB3  . HIS A 1 44 ? -3.464  -5.857  1.920   1.00 0.00 ? 44 HIS A HB3  7  
ATOM 5990  H HD2  . HIS A 1 44 ? -4.200  -9.288  2.319   1.00 0.00 ? 44 HIS A HD2  7  
ATOM 5991  H HE1  . HIS A 1 44 ? -8.070  -7.659  2.761   1.00 0.00 ? 44 HIS A HE1  7  
ATOM 5992  H HE2  . HIS A 1 44 ? -6.636  -9.719  3.154   1.00 0.00 ? 44 HIS A HE2  7  
ATOM 5993  N N    . ARG A 1 45 ? -4.710  -3.506  0.993   1.00 0.00 ? 45 ARG A N    7  
ATOM 5994  C CA   . ARG A 1 45 ? -5.471  -2.379  1.523   1.00 0.00 ? 45 ARG A CA   7  
ATOM 5995  C C    . ARG A 1 45 ? -6.379  -1.793  0.447   1.00 0.00 ? 45 ARG A C    7  
ATOM 5996  O O    . ARG A 1 45 ? -7.591  -1.688  0.634   1.00 0.00 ? 45 ARG A O    7  
ATOM 5997  C CB   . ARG A 1 45 ? -4.514  -1.299  2.031   1.00 0.00 ? 45 ARG A CB   7  
ATOM 5998  C CG   . ARG A 1 45 ? -5.318  -0.131  2.606   1.00 0.00 ? 45 ARG A CG   7  
ATOM 5999  C CD   . ARG A 1 45 ? -4.406  0.741   3.471   1.00 0.00 ? 45 ARG A CD   7  
ATOM 6000  N NE   . ARG A 1 45 ? -5.176  1.811   4.096   1.00 0.00 ? 45 ARG A NE   7  
ATOM 6001  C CZ   . ARG A 1 45 ? -4.725  2.443   5.176   1.00 0.00 ? 45 ARG A CZ   7  
ATOM 6002  N NH1  . ARG A 1 45 ? -3.576  2.106   5.697   1.00 0.00 ? 45 ARG A NH1  7  
ATOM 6003  N NH2  . ARG A 1 45 ? -5.432  3.397   5.716   1.00 0.00 ? 45 ARG A NH2  7  
ATOM 6004  H H    . ARG A 1 45 ? -3.732  -3.460  0.975   1.00 0.00 ? 45 ARG A H    7  
ATOM 6005  H HA   . ARG A 1 45 ? -6.079  -2.723  2.346   1.00 0.00 ? 45 ARG A HA   7  
ATOM 6006  H HB2  . ARG A 1 45 ? -3.880  -1.715  2.802   1.00 0.00 ? 45 ARG A HB2  7  
ATOM 6007  H HB3  . ARG A 1 45 ? -3.903  -0.946  1.214   1.00 0.00 ? 45 ARG A HB3  7  
ATOM 6008  H HG2  . ARG A 1 45 ? -5.720  0.461   1.796   1.00 0.00 ? 45 ARG A HG2  7  
ATOM 6009  H HG3  . ARG A 1 45 ? -6.127  -0.512  3.210   1.00 0.00 ? 45 ARG A HG3  7  
ATOM 6010  H HD2  . ARG A 1 45 ? -3.953  0.133   4.239   1.00 0.00 ? 45 ARG A HD2  7  
ATOM 6011  H HD3  . ARG A 1 45 ? -3.630  1.169   2.853   1.00 0.00 ? 45 ARG A HD3  7  
ATOM 6012  H HE   . ARG A 1 45 ? -6.039  2.070   3.713   1.00 0.00 ? 45 ARG A HE   7  
ATOM 6013  H HH11 . ARG A 1 45 ? -3.035  1.373   5.283   1.00 0.00 ? 45 ARG A HH11 7  
ATOM 6014  H HH12 . ARG A 1 45 ? -3.237  2.581   6.509   1.00 0.00 ? 45 ARG A HH12 7  
ATOM 6015  H HH21 . ARG A 1 45 ? -6.312  3.654   5.315   1.00 0.00 ? 45 ARG A HH21 7  
ATOM 6016  H HH22 . ARG A 1 45 ? -5.094  3.871   6.528   1.00 0.00 ? 45 ARG A HH22 7  
ATOM 6017  N N    . ARG A 1 46 ? -5.787  -1.415  -0.681  1.00 0.00 ? 46 ARG A N    7  
ATOM 6018  C CA   . ARG A 1 46 ? -6.551  -0.844  -1.782  1.00 0.00 ? 46 ARG A CA   7  
ATOM 6019  C C    . ARG A 1 46 ? -7.617  -1.825  -2.259  1.00 0.00 ? 46 ARG A C    7  
ATOM 6020  O O    . ARG A 1 46 ? -8.741  -1.433  -2.570  1.00 0.00 ? 46 ARG A O    7  
ATOM 6021  C CB   . ARG A 1 46 ? -5.616  -0.499  -2.944  1.00 0.00 ? 46 ARG A CB   7  
ATOM 6022  C CG   . ARG A 1 46 ? -4.777  0.727   -2.582  1.00 0.00 ? 46 ARG A CG   7  
ATOM 6023  C CD   . ARG A 1 46 ? -3.922  1.133   -3.783  1.00 0.00 ? 46 ARG A CD   7  
ATOM 6024  N NE   . ARG A 1 46 ? -3.313  2.439   -3.552  1.00 0.00 ? 46 ARG A NE   7  
ATOM 6025  C CZ   . ARG A 1 46 ? -2.213  2.563   -2.815  1.00 0.00 ? 46 ARG A CZ   7  
ATOM 6026  N NH1  . ARG A 1 46 ? -1.662  1.508   -2.282  1.00 0.00 ? 46 ARG A NH1  7  
ATOM 6027  N NH2  . ARG A 1 46 ? -1.686  3.742   -2.624  1.00 0.00 ? 46 ARG A NH2  7  
ATOM 6028  H H    . ARG A 1 46 ? -4.818  -1.525  -0.774  1.00 0.00 ? 46 ARG A H    7  
ATOM 6029  H HA   . ARG A 1 46 ? -7.032  0.060   -1.443  1.00 0.00 ? 46 ARG A HA   7  
ATOM 6030  H HB2  . ARG A 1 46 ? -4.963  -1.338  -3.140  1.00 0.00 ? 46 ARG A HB2  7  
ATOM 6031  H HB3  . ARG A 1 46 ? -6.201  -0.285  -3.826  1.00 0.00 ? 46 ARG A HB3  7  
ATOM 6032  H HG2  . ARG A 1 46 ? -5.432  1.544   -2.312  1.00 0.00 ? 46 ARG A HG2  7  
ATOM 6033  H HG3  . ARG A 1 46 ? -4.134  0.491   -1.747  1.00 0.00 ? 46 ARG A HG3  7  
ATOM 6034  H HD2  . ARG A 1 46 ? -3.146  0.400   -3.934  1.00 0.00 ? 46 ARG A HD2  7  
ATOM 6035  H HD3  . ARG A 1 46 ? -4.545  1.179   -4.666  1.00 0.00 ? 46 ARG A HD3  7  
ATOM 6036  H HE   . ARG A 1 46 ? -3.720  3.237   -3.949  1.00 0.00 ? 46 ARG A HE   7  
ATOM 6037  H HH11 . ARG A 1 46 ? -2.066  0.605   -2.427  1.00 0.00 ? 46 ARG A HH11 7  
ATOM 6038  H HH12 . ARG A 1 46 ? -0.834  1.602   -1.728  1.00 0.00 ? 46 ARG A HH12 7  
ATOM 6039  H HH21 . ARG A 1 46 ? -2.109  4.551   -3.033  1.00 0.00 ? 46 ARG A HH21 7  
ATOM 6040  H HH22 . ARG A 1 46 ? -0.860  3.836   -2.070  1.00 0.00 ? 46 ARG A HH22 7  
ATOM 6041  N N    . LEU A 1 47 ? -7.254  -3.102  -2.318  1.00 0.00 ? 47 LEU A N    7  
ATOM 6042  C CA   . LEU A 1 47 ? -8.185  -4.133  -2.762  1.00 0.00 ? 47 LEU A CA   7  
ATOM 6043  C C    . LEU A 1 47 ? -9.419  -4.167  -1.864  1.00 0.00 ? 47 LEU A C    7  
ATOM 6044  O O    . LEU A 1 47 ? -10.546 -4.030  -2.337  1.00 0.00 ? 47 LEU A O    7  
ATOM 6045  C CB   . LEU A 1 47 ? -7.497  -5.501  -2.739  1.00 0.00 ? 47 LEU A CB   7  
ATOM 6046  C CG   . LEU A 1 47 ? -8.314  -6.507  -3.565  1.00 0.00 ? 47 LEU A CG   7  
ATOM 6047  C CD1  . LEU A 1 47 ? -7.893  -6.436  -5.036  1.00 0.00 ? 47 LEU A CD1  7  
ATOM 6048  C CD2  . LEU A 1 47 ? -8.063  -7.923  -3.038  1.00 0.00 ? 47 LEU A CD2  7  
ATOM 6049  H H    . LEU A 1 47 ? -6.342  -3.355  -2.059  1.00 0.00 ? 47 LEU A H    7  
ATOM 6050  H HA   . LEU A 1 47 ? -8.494  -3.913  -3.771  1.00 0.00 ? 47 LEU A HA   7  
ATOM 6051  H HB2  . LEU A 1 47 ? -6.504  -5.410  -3.157  1.00 0.00 ? 47 LEU A HB2  7  
ATOM 6052  H HB3  . LEU A 1 47 ? -7.427  -5.848  -1.720  1.00 0.00 ? 47 LEU A HB3  7  
ATOM 6053  H HG   . LEU A 1 47 ? -9.366  -6.273  -3.481  1.00 0.00 ? 47 LEU A HG   7  
ATOM 6054  H HD11 . LEU A 1 47 ? -8.127  -5.460  -5.433  1.00 0.00 ? 47 LEU A HD11 7  
ATOM 6055  H HD12 . LEU A 1 47 ? -8.426  -7.189  -5.598  1.00 0.00 ? 47 LEU A HD12 7  
ATOM 6056  H HD13 . LEU A 1 47 ? -6.831  -6.613  -5.116  1.00 0.00 ? 47 LEU A HD13 7  
ATOM 6057  H HD21 . LEU A 1 47 ? -8.521  -8.640  -3.702  1.00 0.00 ? 47 LEU A HD21 7  
ATOM 6058  H HD22 . LEU A 1 47 ? -8.491  -8.021  -2.050  1.00 0.00 ? 47 LEU A HD22 7  
ATOM 6059  H HD23 . LEU A 1 47 ? -6.999  -8.106  -2.988  1.00 0.00 ? 47 LEU A HD23 7  
ATOM 6060  N N    . LYS A 1 48 ? -9.195  -4.350  -0.565  1.00 0.00 ? 48 LYS A N    7  
ATOM 6061  C CA   . LYS A 1 48 ? -10.298 -4.400  0.388   1.00 0.00 ? 48 LYS A CA   7  
ATOM 6062  C C    . LYS A 1 48 ? -10.993 -3.045  0.472   1.00 0.00 ? 48 LYS A C    7  
ATOM 6063  O O    . LYS A 1 48 ? -12.222 -2.965  0.446   1.00 0.00 ? 48 LYS A O    7  
ATOM 6064  C CB   . LYS A 1 48 ? -9.774  -4.794  1.772   1.00 0.00 ? 48 LYS A CB   7  
ATOM 6065  C CG   . LYS A 1 48 ? -10.946 -5.200  2.677   1.00 0.00 ? 48 LYS A CG   7  
ATOM 6066  C CD   . LYS A 1 48 ? -11.268 -6.684  2.478   1.00 0.00 ? 48 LYS A CD   7  
ATOM 6067  C CE   . LYS A 1 48 ? -12.361 -7.104  3.463   1.00 0.00 ? 48 LYS A CE   7  
ATOM 6068  N NZ   . LYS A 1 48 ? -13.429 -6.065  3.491   1.00 0.00 ? 48 LYS A NZ   7  
ATOM 6069  H H    . LYS A 1 48 ? -8.275  -4.452  -0.244  1.00 0.00 ? 48 LYS A H    7  
ATOM 6070  H HA   . LYS A 1 48 ? -11.011 -5.139  0.060   1.00 0.00 ? 48 LYS A HA   7  
ATOM 6071  H HB2  . LYS A 1 48 ? -9.087  -5.623  1.673   1.00 0.00 ? 48 LYS A HB2  7  
ATOM 6072  H HB3  . LYS A 1 48 ? -9.257  -3.955  2.212   1.00 0.00 ? 48 LYS A HB3  7  
ATOM 6073  H HG2  . LYS A 1 48 ? -10.678 -5.026  3.709   1.00 0.00 ? 48 LYS A HG2  7  
ATOM 6074  H HG3  . LYS A 1 48 ? -11.815 -4.609  2.428   1.00 0.00 ? 48 LYS A HG3  7  
ATOM 6075  H HD2  . LYS A 1 48 ? -11.612 -6.848  1.468   1.00 0.00 ? 48 LYS A HD2  7  
ATOM 6076  H HD3  . LYS A 1 48 ? -10.381 -7.274  2.657   1.00 0.00 ? 48 LYS A HD3  7  
ATOM 6077  H HE2  . LYS A 1 48 ? -12.785 -8.047  3.150   1.00 0.00 ? 48 LYS A HE2  7  
ATOM 6078  H HE3  . LYS A 1 48 ? -11.936 -7.209  4.450   1.00 0.00 ? 48 LYS A HE3  7  
ATOM 6079  H HZ1  . LYS A 1 48 ? -14.152 -6.330  4.191   1.00 0.00 ? 48 LYS A HZ1  7  
ATOM 6080  H HZ2  . LYS A 1 48 ? -13.870 -5.994  2.552   1.00 0.00 ? 48 LYS A HZ2  7  
ATOM 6081  H HZ3  . LYS A 1 48 ? -13.013 -5.148  3.751   1.00 0.00 ? 48 LYS A HZ3  7  
ATOM 6082  N N    . VAL A 1 49 ? -10.200 -1.983  0.571   1.00 0.00 ? 49 VAL A N    7  
ATOM 6083  C CA   . VAL A 1 49 ? -10.750 -0.635  0.655   1.00 0.00 ? 49 VAL A CA   7  
ATOM 6084  C C    . VAL A 1 49 ? -11.633 -0.345  -0.555  1.00 0.00 ? 49 VAL A C    7  
ATOM 6085  O O    . VAL A 1 49 ? -12.736 0.183   -0.419  1.00 0.00 ? 49 VAL A O    7  
ATOM 6086  C CB   . VAL A 1 49 ? -9.610  0.384   0.728   1.00 0.00 ? 49 VAL A CB   7  
ATOM 6087  C CG1  . VAL A 1 49 ? -10.153 1.795   0.487   1.00 0.00 ? 49 VAL A CG1  7  
ATOM 6088  C CG2  . VAL A 1 49 ? -8.959  0.321   2.113   1.00 0.00 ? 49 VAL A CG2  7  
ATOM 6089  H H    . VAL A 1 49 ? -9.229  -2.109  0.586   1.00 0.00 ? 49 VAL A H    7  
ATOM 6090  H HA   . VAL A 1 49 ? -11.347 -0.555  1.552   1.00 0.00 ? 49 VAL A HA   7  
ATOM 6091  H HB   . VAL A 1 49 ? -8.874  0.152   -0.027  1.00 0.00 ? 49 VAL A HB   7  
ATOM 6092  H HG11 . VAL A 1 49 ? -10.354 1.926   -0.566  1.00 0.00 ? 49 VAL A HG11 7  
ATOM 6093  H HG12 . VAL A 1 49 ? -9.421  2.521   0.807   1.00 0.00 ? 49 VAL A HG12 7  
ATOM 6094  H HG13 . VAL A 1 49 ? -11.065 1.930   1.049   1.00 0.00 ? 49 VAL A HG13 7  
ATOM 6095  H HG21 . VAL A 1 49 ? -8.804  -0.710  2.392   1.00 0.00 ? 49 VAL A HG21 7  
ATOM 6096  H HG22 . VAL A 1 49 ? -9.606  0.796   2.836   1.00 0.00 ? 49 VAL A HG22 7  
ATOM 6097  H HG23 . VAL A 1 49 ? -8.010  0.835   2.088   1.00 0.00 ? 49 VAL A HG23 7  
ATOM 6098  N N    . TYR A 1 50 ? -11.138 -0.695  -1.738  1.00 0.00 ? 50 TYR A N    7  
ATOM 6099  C CA   . TYR A 1 50 ? -11.890 -0.469  -2.967  1.00 0.00 ? 50 TYR A CA   7  
ATOM 6100  C C    . TYR A 1 50 ? -13.128 -1.360  -3.007  1.00 0.00 ? 50 TYR A C    7  
ATOM 6101  O O    . TYR A 1 50 ? -14.217 -0.910  -3.361  1.00 0.00 ? 50 TYR A O    7  
ATOM 6102  C CB   . TYR A 1 50 ? -11.009 -0.760  -4.181  1.00 0.00 ? 50 TYR A CB   7  
ATOM 6103  C CG   . TYR A 1 50 ? -11.714 -0.311  -5.438  1.00 0.00 ? 50 TYR A CG   7  
ATOM 6104  C CD1  . TYR A 1 50 ? -11.724 1.044   -5.787  1.00 0.00 ? 50 TYR A CD1  7  
ATOM 6105  C CD2  . TYR A 1 50 ? -12.359 -1.248  -6.254  1.00 0.00 ? 50 TYR A CD2  7  
ATOM 6106  C CE1  . TYR A 1 50 ? -12.378 1.462   -6.953  1.00 0.00 ? 50 TYR A CE1  7  
ATOM 6107  C CE2  . TYR A 1 50 ? -13.013 -0.832  -7.419  1.00 0.00 ? 50 TYR A CE2  7  
ATOM 6108  C CZ   . TYR A 1 50 ? -13.023 0.525   -7.769  1.00 0.00 ? 50 TYR A CZ   7  
ATOM 6109  O OH   . TYR A 1 50 ? -13.667 0.936   -8.916  1.00 0.00 ? 50 TYR A OH   7  
ATOM 6110  H H    . TYR A 1 50 ? -10.253 -1.113  -1.786  1.00 0.00 ? 50 TYR A H    7  
ATOM 6111  H HA   . TYR A 1 50 ? -12.201 0.565   -3.001  1.00 0.00 ? 50 TYR A HA   7  
ATOM 6112  H HB2  . TYR A 1 50 ? -10.073 -0.227  -4.083  1.00 0.00 ? 50 TYR A HB2  7  
ATOM 6113  H HB3  . TYR A 1 50 ? -10.813 -1.821  -4.239  1.00 0.00 ? 50 TYR A HB3  7  
ATOM 6114  H HD1  . TYR A 1 50 ? -11.226 1.768   -5.158  1.00 0.00 ? 50 TYR A HD1  7  
ATOM 6115  H HD2  . TYR A 1 50 ? -12.351 -2.295  -5.983  1.00 0.00 ? 50 TYR A HD2  7  
ATOM 6116  H HE1  . TYR A 1 50 ? -12.386 2.509   -7.222  1.00 0.00 ? 50 TYR A HE1  7  
ATOM 6117  H HE2  . TYR A 1 50 ? -13.511 -1.554  -8.047  1.00 0.00 ? 50 TYR A HE2  7  
ATOM 6118  H HH   . TYR A 1 50 ? -13.553 1.885   -8.998  1.00 0.00 ? 50 TYR A HH   7  
ATOM 6119  N N    . HIS A 1 51 ? -12.951 -2.625  -2.638  1.00 0.00 ? 51 HIS A N    7  
ATOM 6120  C CA   . HIS A 1 51 ? -14.061 -3.570  -2.633  1.00 0.00 ? 51 HIS A CA   7  
ATOM 6121  C C    . HIS A 1 51 ? -15.045 -3.231  -1.518  1.00 0.00 ? 51 HIS A C    7  
ATOM 6122  O O    . HIS A 1 51 ? -16.243 -3.495  -1.631  1.00 0.00 ? 51 HIS A O    7  
ATOM 6123  C CB   . HIS A 1 51 ? -13.535 -4.994  -2.437  1.00 0.00 ? 51 HIS A CB   7  
ATOM 6124  C CG   . HIS A 1 51 ? -14.692 -5.953  -2.370  1.00 0.00 ? 51 HIS A CG   7  
ATOM 6125  N ND1  . HIS A 1 51 ? -14.788 -6.928  -1.390  1.00 0.00 ? 51 HIS A ND1  7  
ATOM 6126  C CD2  . HIS A 1 51 ? -15.811 -6.097  -3.154  1.00 0.00 ? 51 HIS A CD2  7  
ATOM 6127  C CE1  . HIS A 1 51 ? -15.926 -7.610  -1.607  1.00 0.00 ? 51 HIS A CE1  7  
ATOM 6128  N NE2  . HIS A 1 51 ? -16.588 -7.144  -2.670  1.00 0.00 ? 51 HIS A NE2  7  
ATOM 6129  H H    . HIS A 1 51 ? -12.061 -2.927  -2.363  1.00 0.00 ? 51 HIS A H    7  
ATOM 6130  H HA   . HIS A 1 51 ? -14.574 -3.514  -3.582  1.00 0.00 ? 51 HIS A HA   7  
ATOM 6131  H HB2  . HIS A 1 51 ? -12.896 -5.259  -3.267  1.00 0.00 ? 51 HIS A HB2  7  
ATOM 6132  H HB3  . HIS A 1 51 ? -12.971 -5.045  -1.518  1.00 0.00 ? 51 HIS A HB3  7  
ATOM 6133  H HD2  . HIS A 1 51 ? -16.050 -5.489  -4.014  1.00 0.00 ? 51 HIS A HD2  7  
ATOM 6134  H HE1  . HIS A 1 51 ? -16.264 -8.435  -0.997  1.00 0.00 ? 51 HIS A HE1  7  
ATOM 6135  H HE2  . HIS A 1 51 ? -17.439 -7.470  -3.031  1.00 0.00 ? 51 HIS A HE2  7  
ATOM 6136  N N    . ALA A 1 52 ? -14.532 -2.642  -0.443  1.00 0.00 ? 52 ALA A N    7  
ATOM 6137  C CA   . ALA A 1 52 ? -15.375 -2.266  0.688   1.00 0.00 ? 52 ALA A CA   7  
ATOM 6138  C C    . ALA A 1 52 ? -16.096 -0.955  0.403   1.00 0.00 ? 52 ALA A C    7  
ATOM 6139  O O    . ALA A 1 52 ? -17.319 -0.926  0.259   1.00 0.00 ? 52 ALA A O    7  
ATOM 6140  C CB   . ALA A 1 52 ? -14.521 -2.118  1.949   1.00 0.00 ? 52 ALA A CB   7  
ATOM 6141  H H    . ALA A 1 52 ? -13.571 -2.454  -0.410  1.00 0.00 ? 52 ALA A H    7  
ATOM 6142  H HA   . ALA A 1 52 ? -16.108 -3.042  0.852   1.00 0.00 ? 52 ALA A HA   7  
ATOM 6143  H HB1  . ALA A 1 52 ? -15.161 -1.909  2.793   1.00 0.00 ? 52 ALA A HB1  7  
ATOM 6144  H HB2  . ALA A 1 52 ? -13.821 -1.307  1.817   1.00 0.00 ? 52 ALA A HB2  7  
ATOM 6145  H HB3  . ALA A 1 52 ? -13.978 -3.035  2.126   1.00 0.00 ? 52 ALA A HB3  7  
ATOM 6146  N N    . TRP A 1 53 ? -15.333 0.131   0.319   1.00 0.00 ? 53 TRP A N    7  
ATOM 6147  C CA   . TRP A 1 53 ? -15.911 1.442   0.049   1.00 0.00 ? 53 TRP A CA   7  
ATOM 6148  C C    . TRP A 1 53 ? -16.878 1.365   -1.131  1.00 0.00 ? 53 TRP A C    7  
ATOM 6149  O O    . TRP A 1 53 ? -17.648 2.293   -1.376  1.00 0.00 ? 53 TRP A O    7  
ATOM 6150  C CB   . TRP A 1 53 ? -14.795 2.448   -0.258  1.00 0.00 ? 53 TRP A CB   7  
ATOM 6151  C CG   . TRP A 1 53 ? -15.229 3.819   0.150   1.00 0.00 ? 53 TRP A CG   7  
ATOM 6152  C CD1  . TRP A 1 53 ? -15.552 4.185   1.411   1.00 0.00 ? 53 TRP A CD1  7  
ATOM 6153  C CD2  . TRP A 1 53 ? -15.393 5.008   -0.676  1.00 0.00 ? 53 TRP A CD2  7  
ATOM 6154  N NE1  . TRP A 1 53 ? -15.904 5.524   1.412   1.00 0.00 ? 53 TRP A NE1  7  
ATOM 6155  C CE2  . TRP A 1 53 ? -15.821 6.074   0.149   1.00 0.00 ? 53 TRP A CE2  7  
ATOM 6156  C CE3  . TRP A 1 53 ? -15.213 5.261   -2.047  1.00 0.00 ? 53 TRP A CE3  7  
ATOM 6157  C CZ2  . TRP A 1 53 ? -16.061 7.347   -0.369  1.00 0.00 ? 53 TRP A CZ2  7  
ATOM 6158  C CZ3  . TRP A 1 53 ? -15.454 6.542   -2.572  1.00 0.00 ? 53 TRP A CZ3  7  
ATOM 6159  C CH2  . TRP A 1 53 ? -15.878 7.583   -1.734  1.00 0.00 ? 53 TRP A CH2  7  
ATOM 6160  H H    . TRP A 1 53 ? -14.364 0.049   0.443   1.00 0.00 ? 53 TRP A H    7  
ATOM 6161  H HA   . TRP A 1 53 ? -16.452 1.771   0.924   1.00 0.00 ? 53 TRP A HA   7  
ATOM 6162  H HB2  . TRP A 1 53 ? -13.906 2.175   0.290   1.00 0.00 ? 53 TRP A HB2  7  
ATOM 6163  H HB3  . TRP A 1 53 ? -14.581 2.438   -1.317  1.00 0.00 ? 53 TRP A HB3  7  
ATOM 6164  H HD1  . TRP A 1 53 ? -15.537 3.537   2.276   1.00 0.00 ? 53 TRP A HD1  7  
ATOM 6165  H HE1  . TRP A 1 53 ? -16.179 6.034   2.201   1.00 0.00 ? 53 TRP A HE1  7  
ATOM 6166  H HE3  . TRP A 1 53 ? -14.886 4.467   -2.703  1.00 0.00 ? 53 TRP A HE3  7  
ATOM 6167  H HZ2  . TRP A 1 53 ? -16.388 8.146   0.281   1.00 0.00 ? 53 TRP A HZ2  7  
ATOM 6168  H HZ3  . TRP A 1 53 ? -15.313 6.726   -3.627  1.00 0.00 ? 53 TRP A HZ3  7  
ATOM 6169  H HH2  . TRP A 1 53 ? -16.062 8.565   -2.143  1.00 0.00 ? 53 TRP A HH2  7  
ATOM 6170  N N    . LYS A 1 54 ? -16.828 0.253   -1.857  1.00 0.00 ? 54 LYS A N    7  
ATOM 6171  C CA   . LYS A 1 54 ? -17.701 0.064   -3.010  1.00 0.00 ? 54 LYS A CA   7  
ATOM 6172  C C    . LYS A 1 54 ? -19.137 0.444   -2.667  1.00 0.00 ? 54 LYS A C    7  
ATOM 6173  O O    . LYS A 1 54 ? -19.638 1.477   -3.110  1.00 0.00 ? 54 LYS A O    7  
ATOM 6174  C CB   . LYS A 1 54 ? -17.652 -1.397  -3.463  1.00 0.00 ? 54 LYS A CB   7  
ATOM 6175  C CG   . LYS A 1 54 ? -18.380 -1.542  -4.801  1.00 0.00 ? 54 LYS A CG   7  
ATOM 6176  C CD   . LYS A 1 54 ? -18.414 -3.018  -5.204  1.00 0.00 ? 54 LYS A CD   7  
ATOM 6177  C CE   . LYS A 1 54 ? -19.392 -3.207  -6.365  1.00 0.00 ? 54 LYS A CE   7  
ATOM 6178  N NZ   . LYS A 1 54 ? -18.885 -2.482  -7.565  1.00 0.00 ? 54 LYS A NZ   7  
ATOM 6179  H H    . LYS A 1 54 ? -16.192 -0.452  -1.614  1.00 0.00 ? 54 LYS A H    7  
ATOM 6180  H HA   . LYS A 1 54 ? -17.355 0.691   -3.818  1.00 0.00 ? 54 LYS A HA   7  
ATOM 6181  H HB2  . LYS A 1 54 ? -16.622 -1.703  -3.577  1.00 0.00 ? 54 LYS A HB2  7  
ATOM 6182  H HB3  . LYS A 1 54 ? -18.134 -2.019  -2.725  1.00 0.00 ? 54 LYS A HB3  7  
ATOM 6183  H HG2  . LYS A 1 54 ? -19.389 -1.170  -4.704  1.00 0.00 ? 54 LYS A HG2  7  
ATOM 6184  H HG3  . LYS A 1 54 ? -17.859 -0.976  -5.558  1.00 0.00 ? 54 LYS A HG3  7  
ATOM 6185  H HD2  . LYS A 1 54 ? -17.426 -3.330  -5.509  1.00 0.00 ? 54 LYS A HD2  7  
ATOM 6186  H HD3  . LYS A 1 54 ? -18.737 -3.613  -4.365  1.00 0.00 ? 54 LYS A HD3  7  
ATOM 6187  H HE2  . LYS A 1 54 ? -19.482 -4.258  -6.593  1.00 0.00 ? 54 LYS A HE2  7  
ATOM 6188  H HE3  . LYS A 1 54 ? -20.359 -2.815  -6.090  1.00 0.00 ? 54 LYS A HE3  7  
ATOM 6189  H HZ1  . LYS A 1 54 ? -18.840 -1.463  -7.362  1.00 0.00 ? 54 LYS A HZ1  7  
ATOM 6190  H HZ2  . LYS A 1 54 ? -19.528 -2.645  -8.366  1.00 0.00 ? 54 LYS A HZ2  7  
ATOM 6191  H HZ3  . LYS A 1 54 ? -17.934 -2.831  -7.805  1.00 0.00 ? 54 LYS A HZ3  7  
ATOM 6192  N N    . SER A 1 55 ? -19.796 -0.398  -1.878  1.00 0.00 ? 55 SER A N    7  
ATOM 6193  C CA   . SER A 1 55 ? -21.176 -0.141  -1.484  1.00 0.00 ? 55 SER A CA   7  
ATOM 6194  C C    . SER A 1 55 ? -21.270 1.145   -0.666  1.00 0.00 ? 55 SER A C    7  
ATOM 6195  O O    . SER A 1 55 ? -20.819 1.198   0.478   1.00 0.00 ? 55 SER A O    7  
ATOM 6196  C CB   . SER A 1 55 ? -21.712 -1.311  -0.659  1.00 0.00 ? 55 SER A CB   7  
ATOM 6197  O OG   . SER A 1 55 ? -21.247 -1.194  0.679   1.00 0.00 ? 55 SER A OG   7  
ATOM 6198  H H    . SER A 1 55 ? -19.347 -1.208  -1.557  1.00 0.00 ? 55 SER A H    7  
ATOM 6199  H HA   . SER A 1 55 ? -21.780 -0.035  -2.372  1.00 0.00 ? 55 SER A HA   7  
ATOM 6200  H HB2  . SER A 1 55 ? -22.789 -1.295  -0.664  1.00 0.00 ? 55 SER A HB2  7  
ATOM 6201  H HB3  . SER A 1 55 ? -21.366 -2.242  -1.090  1.00 0.00 ? 55 SER A HB3  7  
ATOM 6202  H HG   . SER A 1 55 ? -21.692 -0.444  1.082   1.00 0.00 ? 55 SER A HG   7  
ATOM 6203  N N    . LYS A 1 56 ? -21.858 2.176   -1.263  1.00 0.00 ? 56 LYS A N    7  
ATOM 6204  C CA   . LYS A 1 56 ? -22.008 3.460   -0.582  1.00 0.00 ? 56 LYS A CA   7  
ATOM 6205  C C    . LYS A 1 56 ? -23.298 3.489   0.231   1.00 0.00 ? 56 LYS A C    7  
ATOM 6206  O O    . LYS A 1 56 ? -23.359 4.102   1.296   1.00 0.00 ? 56 LYS A O    7  
ATOM 6207  C CB   . LYS A 1 56 ? -22.024 4.594   -1.607  1.00 0.00 ? 56 LYS A CB   7  
ATOM 6208  C CG   . LYS A 1 56 ? -20.745 4.542   -2.446  1.00 0.00 ? 56 LYS A CG   7  
ATOM 6209  C CD   . LYS A 1 56 ? -20.785 5.632   -3.523  1.00 0.00 ? 56 LYS A CD   7  
ATOM 6210  C CE   . LYS A 1 56 ? -20.347 6.972   -2.924  1.00 0.00 ? 56 LYS A CE   7  
ATOM 6211  N NZ   . LYS A 1 56 ? -20.247 7.990   -4.006  1.00 0.00 ? 56 LYS A NZ   7  
ATOM 6212  H H    . LYS A 1 56 ? -22.199 2.074   -2.176  1.00 0.00 ? 56 LYS A H    7  
ATOM 6213  H HA   . LYS A 1 56 ? -21.170 3.605   0.084   1.00 0.00 ? 56 LYS A HA   7  
ATOM 6214  H HB2  . LYS A 1 56 ? -22.884 4.484   -2.252  1.00 0.00 ? 56 LYS A HB2  7  
ATOM 6215  H HB3  . LYS A 1 56 ? -22.078 5.542   -1.094  1.00 0.00 ? 56 LYS A HB3  7  
ATOM 6216  H HG2  . LYS A 1 56 ? -19.889 4.696   -1.805  1.00 0.00 ? 56 LYS A HG2  7  
ATOM 6217  H HG3  . LYS A 1 56 ? -20.667 3.576   -2.919  1.00 0.00 ? 56 LYS A HG3  7  
ATOM 6218  H HD2  . LYS A 1 56 ? -20.117 5.365   -4.329  1.00 0.00 ? 56 LYS A HD2  7  
ATOM 6219  H HD3  . LYS A 1 56 ? -21.791 5.724   -3.907  1.00 0.00 ? 56 LYS A HD3  7  
ATOM 6220  H HE2  . LYS A 1 56 ? -21.074 7.295   -2.194  1.00 0.00 ? 56 LYS A HE2  7  
ATOM 6221  H HE3  . LYS A 1 56 ? -19.385 6.857   -2.448  1.00 0.00 ? 56 LYS A HE3  7  
ATOM 6222  H HZ1  . LYS A 1 56 ? -20.453 8.931   -3.619  1.00 0.00 ? 56 LYS A HZ1  7  
ATOM 6223  H HZ2  . LYS A 1 56 ? -20.932 7.768   -4.756  1.00 0.00 ? 56 LYS A HZ2  7  
ATOM 6224  H HZ3  . LYS A 1 56 ? -19.284 7.980   -4.402  1.00 0.00 ? 56 LYS A HZ3  7  
ATOM 6225  N N    . ASN A 1 57 ? -24.328 2.822   -0.280  1.00 0.00 ? 57 ASN A N    7  
ATOM 6226  C CA   . ASN A 1 57 ? -25.614 2.779   0.407   1.00 0.00 ? 57 ASN A CA   7  
ATOM 6227  C C    . ASN A 1 57 ? -25.571 1.787   1.565   1.00 0.00 ? 57 ASN A C    7  
ATOM 6228  O O    . ASN A 1 57 ? -25.901 0.612   1.402   1.00 0.00 ? 57 ASN A O    7  
ATOM 6229  C CB   . ASN A 1 57 ? -26.716 2.373   -0.574  1.00 0.00 ? 57 ASN A CB   7  
ATOM 6230  C CG   . ASN A 1 57 ? -28.085 2.654   0.036   1.00 0.00 ? 57 ASN A CG   7  
ATOM 6231  O OD1  . ASN A 1 57 ? -28.651 3.726   -0.172  1.00 0.00 ? 57 ASN A OD1  7  
ATOM 6232  N ND2  . ASN A 1 57 ? -28.654 1.745   0.780   1.00 0.00 ? 57 ASN A ND2  7  
ATOM 6233  H H    . ASN A 1 57 ? -24.223 2.351   -1.133  1.00 0.00 ? 57 ASN A H    7  
ATOM 6234  H HA   . ASN A 1 57 ? -25.837 3.761   0.795   1.00 0.00 ? 57 ASN A HA   7  
ATOM 6235  H HB2  . ASN A 1 57 ? -26.608 2.940   -1.487  1.00 0.00 ? 57 ASN A HB2  7  
ATOM 6236  H HB3  . ASN A 1 57 ? -26.630 1.319   -0.794  1.00 0.00 ? 57 ASN A HB3  7  
ATOM 6237  H HD21 . ASN A 1 57 ? -28.202 0.891   0.944   1.00 0.00 ? 57 ASN A HD21 7  
ATOM 6238  H HD22 . ASN A 1 57 ? -29.534 1.917   1.176   1.00 0.00 ? 57 ASN A HD22 7  
ATOM 6239  N N    . LYS A 1 58 ? -25.163 2.268   2.734   1.00 0.00 ? 58 LYS A N    7  
ATOM 6240  C CA   . LYS A 1 58 ? -25.081 1.417   3.916   1.00 0.00 ? 58 LYS A CA   7  
ATOM 6241  C C    . LYS A 1 58 ? -26.454 1.272   4.566   1.00 0.00 ? 58 LYS A C    7  
ATOM 6242  O O    . LYS A 1 58 ? -26.608 0.556   5.556   1.00 0.00 ? 58 LYS A O    7  
ATOM 6243  C CB   . LYS A 1 58 ? -24.096 2.013   4.924   1.00 0.00 ? 58 LYS A CB   7  
ATOM 6244  C CG   . LYS A 1 58 ? -22.824 2.451   4.198   1.00 0.00 ? 58 LYS A CG   7  
ATOM 6245  C CD   . LYS A 1 58 ? -21.840 3.049   5.206   1.00 0.00 ? 58 LYS A CD   7  
ATOM 6246  C CE   . LYS A 1 58 ? -20.724 3.781   4.459   1.00 0.00 ? 58 LYS A CE   7  
ATOM 6247  N NZ   . LYS A 1 58 ? -19.840 4.473   5.440   1.00 0.00 ? 58 LYS A NZ   7  
ATOM 6248  H H    . LYS A 1 58 ? -24.913 3.214   2.805   1.00 0.00 ? 58 LYS A H    7  
ATOM 6249  H HA   . LYS A 1 58 ? -24.730 0.440   3.620   1.00 0.00 ? 58 LYS A HA   7  
ATOM 6250  H HB2  . LYS A 1 58 ? -24.549 2.866   5.406   1.00 0.00 ? 58 LYS A HB2  7  
ATOM 6251  H HB3  . LYS A 1 58 ? -23.848 1.269   5.667   1.00 0.00 ? 58 LYS A HB3  7  
ATOM 6252  H HG2  . LYS A 1 58 ? -22.372 1.595   3.716   1.00 0.00 ? 58 LYS A HG2  7  
ATOM 6253  H HG3  . LYS A 1 58 ? -23.070 3.195   3.455   1.00 0.00 ? 58 LYS A HG3  7  
ATOM 6254  H HD2  . LYS A 1 58 ? -22.362 3.742   5.848   1.00 0.00 ? 58 LYS A HD2  7  
ATOM 6255  H HD3  . LYS A 1 58 ? -21.412 2.257   5.803   1.00 0.00 ? 58 LYS A HD3  7  
ATOM 6256  H HE2  . LYS A 1 58 ? -20.143 3.070   3.891   1.00 0.00 ? 58 LYS A HE2  7  
ATOM 6257  H HE3  . LYS A 1 58 ? -21.157 4.510   3.789   1.00 0.00 ? 58 LYS A HE3  7  
ATOM 6258  H HZ1  . LYS A 1 58 ? -19.969 5.501   5.358   1.00 0.00 ? 58 LYS A HZ1  7  
ATOM 6259  H HZ2  . LYS A 1 58 ? -18.849 4.233   5.242   1.00 0.00 ? 58 LYS A HZ2  7  
ATOM 6260  H HZ3  . LYS A 1 58 ? -20.087 4.167   6.403   1.00 0.00 ? 58 LYS A HZ3  7  
ATOM 6261  N N    . LYS A 1 59 ? -27.442 1.957   3.997   1.00 0.00 ? 59 LYS A N    7  
ATOM 6262  C CA   . LYS A 1 59 ? -28.810 1.911   4.514   1.00 0.00 ? 59 LYS A CA   7  
ATOM 6263  C C    . LYS A 1 59 ? -28.822 1.707   6.027   1.00 0.00 ? 59 LYS A C    7  
ATOM 6264  O O    . LYS A 1 59 ? -29.377 0.728   6.527   1.00 0.00 ? 59 LYS A O    7  
ATOM 6265  C CB   . LYS A 1 59 ? -29.591 0.781   3.837   1.00 0.00 ? 59 LYS A CB   7  
ATOM 6266  C CG   . LYS A 1 59 ? -28.775 -0.513  3.886   1.00 0.00 ? 59 LYS A CG   7  
ATOM 6267  C CD   . LYS A 1 59 ? -29.640 -1.681  3.405   1.00 0.00 ? 59 LYS A CD   7  
ATOM 6268  C CE   . LYS A 1 59 ? -28.914 -2.999  3.671   1.00 0.00 ? 59 LYS A CE   7  
ATOM 6269  N NZ   . LYS A 1 59 ? -28.931 -3.290  5.132   1.00 0.00 ? 59 LYS A NZ   7  
ATOM 6270  H H    . LYS A 1 59 ? -27.249 2.506   3.209   1.00 0.00 ? 59 LYS A H    7  
ATOM 6271  H HA   . LYS A 1 59 ? -29.296 2.848   4.288   1.00 0.00 ? 59 LYS A HA   7  
ATOM 6272  H HB2  . LYS A 1 59 ? -30.529 0.634   4.353   1.00 0.00 ? 59 LYS A HB2  7  
ATOM 6273  H HB3  . LYS A 1 59 ? -29.783 1.044   2.808   1.00 0.00 ? 59 LYS A HB3  7  
ATOM 6274  H HG2  . LYS A 1 59 ? -27.910 -0.418  3.245   1.00 0.00 ? 59 LYS A HG2  7  
ATOM 6275  H HG3  . LYS A 1 59 ? -28.455 -0.699  4.899   1.00 0.00 ? 59 LYS A HG3  7  
ATOM 6276  H HD2  . LYS A 1 59 ? -30.581 -1.673  3.937   1.00 0.00 ? 59 LYS A HD2  7  
ATOM 6277  H HD3  . LYS A 1 59 ? -29.824 -1.580  2.346   1.00 0.00 ? 59 LYS A HD3  7  
ATOM 6278  H HE2  . LYS A 1 59 ? -29.409 -3.797  3.139   1.00 0.00 ? 59 LYS A HE2  7  
ATOM 6279  H HE3  . LYS A 1 59 ? -27.891 -2.921  3.332   1.00 0.00 ? 59 LYS A HE3  7  
ATOM 6280  H HZ1  . LYS A 1 59 ? -28.159 -3.946  5.364   1.00 0.00 ? 59 LYS A HZ1  7  
ATOM 6281  H HZ2  . LYS A 1 59 ? -29.840 -3.723  5.388   1.00 0.00 ? 59 LYS A HZ2  7  
ATOM 6282  H HZ3  . LYS A 1 59 ? -28.805 -2.404  5.664   1.00 0.00 ? 59 LYS A HZ3  7  
ATOM 6283  N N    . ARG A 1 60 ? -28.207 2.637   6.751   1.00 0.00 ? 60 ARG A N    7  
ATOM 6284  C CA   . ARG A 1 60 ? -28.156 2.548   8.207   1.00 0.00 ? 60 ARG A CA   7  
ATOM 6285  C C    . ARG A 1 60 ? -29.558 2.654   8.798   1.00 0.00 ? 60 ARG A C    7  
ATOM 6286  O O    . ARG A 1 60 ? -29.803 2.018   9.810   1.00 0.00 ? 60 ARG A O    7  
ATOM 6287  C CB   . ARG A 1 60 ? -27.277 3.666   8.770   1.00 0.00 ? 60 ARG A CB   7  
ATOM 6288  C CG   . ARG A 1 60 ? -25.805 3.351   8.492   1.00 0.00 ? 60 ARG A CG   7  
ATOM 6289  C CD   . ARG A 1 60 ? -24.922 4.407   9.158   1.00 0.00 ? 60 ARG A CD   7  
ATOM 6290  N NE   . ARG A 1 60 ? -23.514 4.070   8.986   1.00 0.00 ? 60 ARG A NE   7  
ATOM 6291  C CZ   . ARG A 1 60 ? -22.938 3.130   9.726   1.00 0.00 ? 60 ARG A CZ   7  
ATOM 6292  N NH1  . ARG A 1 60 ? -23.633 2.489   10.627  1.00 0.00 ? 60 ARG A NH1  7  
ATOM 6293  N NH2  . ARG A 1 60 ? -21.675 2.845   9.554   1.00 0.00 ? 60 ARG A NH2  7  
ATOM 6294  O OXT  . ARG A 1 60 ? -30.367 3.369   8.230   1.00 0.00 ? 60 ARG A OXT  7  
ATOM 6295  H H    . ARG A 1 60 ? -27.784 3.397   6.299   1.00 0.00 ? 60 ARG A H    7  
ATOM 6296  H HA   . ARG A 1 60 ? -27.730 1.596   8.483   1.00 0.00 ? 60 ARG A HA   7  
ATOM 6297  H HB2  . ARG A 1 60 ? -27.541 4.603   8.299   1.00 0.00 ? 60 ARG A HB2  7  
ATOM 6298  H HB3  . ARG A 1 60 ? -27.431 3.745   9.835   1.00 0.00 ? 60 ARG A HB3  7  
ATOM 6299  H HG2  . ARG A 1 60 ? -25.565 2.377   8.891   1.00 0.00 ? 60 ARG A HG2  7  
ATOM 6300  H HG3  . ARG A 1 60 ? -25.630 3.358   7.427   1.00 0.00 ? 60 ARG A HG3  7  
ATOM 6301  H HD2  . ARG A 1 60 ? -25.115 5.370   8.709   1.00 0.00 ? 60 ARG A HD2  7  
ATOM 6302  H HD3  . ARG A 1 60 ? -25.155 4.455   10.213  1.00 0.00 ? 60 ARG A HD3  7  
ATOM 6303  H HE   . ARG A 1 60 ? -22.984 4.547   8.313   1.00 0.00 ? 60 ARG A HE   7  
ATOM 6304  H HH11 . ARG A 1 60 ? -24.600 2.707   10.759  1.00 0.00 ? 60 ARG A HH11 7  
ATOM 6305  H HH12 . ARG A 1 60 ? -23.199 1.782   11.183  1.00 0.00 ? 60 ARG A HH12 7  
ATOM 6306  H HH21 . ARG A 1 60 ? -21.142 3.336   8.863   1.00 0.00 ? 60 ARG A HH21 7  
ATOM 6307  H HH22 . ARG A 1 60 ? -21.241 2.137   10.110  1.00 0.00 ? 60 ARG A HH22 7  
ATOM 6308  N N    . GLY A 1 9  ? 10.309  2.761   17.964  1.00 0.00 ? 9  GLY A N    8  
ATOM 6309  C CA   . GLY A 1 9  ? 9.266   2.916   16.957  1.00 0.00 ? 9  GLY A CA   8  
ATOM 6310  C C    . GLY A 1 9  ? 9.680   3.931   15.897  1.00 0.00 ? 9  GLY A C    8  
ATOM 6311  O O    . GLY A 1 9  ? 9.038   4.969   15.733  1.00 0.00 ? 9  GLY A O    8  
ATOM 6312  H H    . GLY A 1 9  ? 10.879  1.963   17.948  1.00 0.00 ? 9  GLY A H    8  
ATOM 6313  H HA2  . GLY A 1 9  ? 9.085   1.961   16.484  1.00 0.00 ? 9  GLY A HA2  8  
ATOM 6314  H HA3  . GLY A 1 9  ? 8.360   3.254   17.435  1.00 0.00 ? 9  GLY A HA3  8  
ATOM 6315  N N    . THR A 1 10 ? 10.756  3.625   15.178  1.00 0.00 ? 10 THR A N    8  
ATOM 6316  C CA   . THR A 1 10 ? 11.247  4.518   14.135  1.00 0.00 ? 10 THR A CA   8  
ATOM 6317  C C    . THR A 1 10 ? 10.498  4.279   12.827  1.00 0.00 ? 10 THR A C    8  
ATOM 6318  O O    . THR A 1 10 ? 9.746   3.311   12.699  1.00 0.00 ? 10 THR A O    8  
ATOM 6319  C CB   . THR A 1 10 ? 12.744  4.291   13.915  1.00 0.00 ? 10 THR A CB   8  
ATOM 6320  O OG1  . THR A 1 10 ? 13.222  5.204   12.938  1.00 0.00 ? 10 THR A OG1  8  
ATOM 6321  C CG2  . THR A 1 10 ? 12.980  2.858   13.436  1.00 0.00 ? 10 THR A CG2  8  
ATOM 6322  H H    . THR A 1 10 ? 11.227  2.784   15.354  1.00 0.00 ? 10 THR A H    8  
ATOM 6323  H HA   . THR A 1 10 ? 11.093  5.541   14.446  1.00 0.00 ? 10 THR A HA   8  
ATOM 6324  H HB   . THR A 1 10 ? 13.272  4.447   14.844  1.00 0.00 ? 10 THR A HB   8  
ATOM 6325  H HG1  . THR A 1 10 ? 13.656  4.698   12.247  1.00 0.00 ? 10 THR A HG1  8  
ATOM 6326  H HG21 . THR A 1 10 ? 12.458  2.170   14.085  1.00 0.00 ? 10 THR A HG21 8  
ATOM 6327  H HG22 . THR A 1 10 ? 14.037  2.640   13.457  1.00 0.00 ? 10 THR A HG22 8  
ATOM 6328  H HG23 . THR A 1 10 ? 12.611  2.751   12.426  1.00 0.00 ? 10 THR A HG23 8  
ATOM 6329  N N    . LYS A 1 11 ? 10.711  5.165   11.859  1.00 0.00 ? 11 LYS A N    8  
ATOM 6330  C CA   . LYS A 1 11 ? 10.052  5.042   10.560  1.00 0.00 ? 11 LYS A CA   8  
ATOM 6331  C C    . LYS A 1 11 ? 10.979  4.362   9.555   1.00 0.00 ? 11 LYS A C    8  
ATOM 6332  O O    . LYS A 1 11 ? 11.917  4.977   9.047   1.00 0.00 ? 11 LYS A O    8  
ATOM 6333  C CB   . LYS A 1 11 ? 9.659   6.427   10.038  1.00 0.00 ? 11 LYS A CB   8  
ATOM 6334  C CG   . LYS A 1 11 ? 8.786   7.147   11.077  1.00 0.00 ? 11 LYS A CG   8  
ATOM 6335  C CD   . LYS A 1 11 ? 9.661   8.047   11.957  1.00 0.00 ? 11 LYS A CD   8  
ATOM 6336  C CE   . LYS A 1 11 ? 8.880   8.450   13.210  1.00 0.00 ? 11 LYS A CE   8  
ATOM 6337  N NZ   . LYS A 1 11 ? 8.513   7.229   13.982  1.00 0.00 ? 11 LYS A NZ   8  
ATOM 6338  H H    . LYS A 1 11 ? 11.321  5.914   12.018  1.00 0.00 ? 11 LYS A H    8  
ATOM 6339  H HA   . LYS A 1 11 ? 9.159   4.445   10.671  1.00 0.00 ? 11 LYS A HA   8  
ATOM 6340  H HB2  . LYS A 1 11 ? 10.552  7.005   9.848   1.00 0.00 ? 11 LYS A HB2  8  
ATOM 6341  H HB3  . LYS A 1 11 ? 9.103   6.317   9.119   1.00 0.00 ? 11 LYS A HB3  8  
ATOM 6342  H HG2  . LYS A 1 11 ? 8.049   7.754   10.569  1.00 0.00 ? 11 LYS A HG2  8  
ATOM 6343  H HG3  . LYS A 1 11 ? 8.284   6.420   11.697  1.00 0.00 ? 11 LYS A HG3  8  
ATOM 6344  H HD2  . LYS A 1 11 ? 10.552  7.512   12.245  1.00 0.00 ? 11 LYS A HD2  8  
ATOM 6345  H HD3  . LYS A 1 11 ? 9.934   8.934   11.406  1.00 0.00 ? 11 LYS A HD3  8  
ATOM 6346  H HE2  . LYS A 1 11 ? 9.493   9.094   13.824  1.00 0.00 ? 11 LYS A HE2  8  
ATOM 6347  H HE3  . LYS A 1 11 ? 7.983   8.978   12.921  1.00 0.00 ? 11 LYS A HE3  8  
ATOM 6348  H HZ1  . LYS A 1 11 ? 7.654   6.809   13.576  1.00 0.00 ? 11 LYS A HZ1  8  
ATOM 6349  H HZ2  . LYS A 1 11 ? 8.335   7.487   14.974  1.00 0.00 ? 11 LYS A HZ2  8  
ATOM 6350  H HZ3  . LYS A 1 11 ? 9.293   6.543   13.935  1.00 0.00 ? 11 LYS A HZ3  8  
ATOM 6351  N N    . LYS A 1 12 ? 10.711  3.090   9.278   1.00 0.00 ? 12 LYS A N    8  
ATOM 6352  C CA   . LYS A 1 12 ? 11.529  2.331   8.336   1.00 0.00 ? 12 LYS A CA   8  
ATOM 6353  C C    . LYS A 1 12 ? 11.012  2.505   6.912   1.00 0.00 ? 12 LYS A C    8  
ATOM 6354  O O    . LYS A 1 12 ? 11.780  2.803   5.996   1.00 0.00 ? 12 LYS A O    8  
ATOM 6355  C CB   . LYS A 1 12 ? 11.514  0.848   8.708   1.00 0.00 ? 12 LYS A CB   8  
ATOM 6356  C CG   . LYS A 1 12 ? 11.711  0.698   10.218  1.00 0.00 ? 12 LYS A CG   8  
ATOM 6357  C CD   . LYS A 1 12 ? 11.683  -0.787  10.596  1.00 0.00 ? 12 LYS A CD   8  
ATOM 6358  C CE   . LYS A 1 12 ? 12.868  -1.514  9.951   1.00 0.00 ? 12 LYS A CE   8  
ATOM 6359  N NZ   . LYS A 1 12 ? 13.208  -2.718  10.760  1.00 0.00 ? 12 LYS A NZ   8  
ATOM 6360  H H    . LYS A 1 12 ? 9.952   2.652   9.716   1.00 0.00 ? 12 LYS A H    8  
ATOM 6361  H HA   . LYS A 1 12 ? 12.545  2.690   8.382   1.00 0.00 ? 12 LYS A HA   8  
ATOM 6362  H HB2  . LYS A 1 12 ? 10.566  0.414   8.423   1.00 0.00 ? 12 LYS A HB2  8  
ATOM 6363  H HB3  . LYS A 1 12 ? 12.313  0.339   8.190   1.00 0.00 ? 12 LYS A HB3  8  
ATOM 6364  H HG2  . LYS A 1 12 ? 12.664  1.124   10.501  1.00 0.00 ? 12 LYS A HG2  8  
ATOM 6365  H HG3  . LYS A 1 12 ? 10.919  1.213   10.738  1.00 0.00 ? 12 LYS A HG3  8  
ATOM 6366  H HD2  . LYS A 1 12 ? 11.743  -0.883  11.671  1.00 0.00 ? 12 LYS A HD2  8  
ATOM 6367  H HD3  . LYS A 1 12 ? 10.760  -1.228  10.249  1.00 0.00 ? 12 LYS A HD3  8  
ATOM 6368  H HE2  . LYS A 1 12 ? 12.603  -1.818  8.949   1.00 0.00 ? 12 LYS A HE2  8  
ATOM 6369  H HE3  . LYS A 1 12 ? 13.721  -0.852  9.913   1.00 0.00 ? 12 LYS A HE3  8  
ATOM 6370  H HZ1  . LYS A 1 12 ? 13.567  -2.422  11.690  1.00 0.00 ? 12 LYS A HZ1  8  
ATOM 6371  H HZ2  . LYS A 1 12 ? 13.941  -3.268  10.269  1.00 0.00 ? 12 LYS A HZ2  8  
ATOM 6372  H HZ3  . LYS A 1 12 ? 12.358  -3.303  10.884  1.00 0.00 ? 12 LYS A HZ3  8  
ATOM 6373  N N    . TYR A 1 13 ? 9.711   2.309   6.733   1.00 0.00 ? 13 TYR A N    8  
ATOM 6374  C CA   . TYR A 1 13 ? 9.097   2.438   5.415   1.00 0.00 ? 13 TYR A CA   8  
ATOM 6375  C C    . TYR A 1 13 ? 7.916   3.403   5.468   1.00 0.00 ? 13 TYR A C    8  
ATOM 6376  O O    . TYR A 1 13 ? 7.307   3.601   6.519   1.00 0.00 ? 13 TYR A O    8  
ATOM 6377  C CB   . TYR A 1 13 ? 8.621   1.064   4.931   1.00 0.00 ? 13 TYR A CB   8  
ATOM 6378  C CG   . TYR A 1 13 ? 9.749   0.355   4.215   1.00 0.00 ? 13 TYR A CG   8  
ATOM 6379  C CD1  . TYR A 1 13 ? 10.878  -0.068  4.927   1.00 0.00 ? 13 TYR A CD1  8  
ATOM 6380  C CD2  . TYR A 1 13 ? 9.665   0.123   2.836   1.00 0.00 ? 13 TYR A CD2  8  
ATOM 6381  C CE1  . TYR A 1 13 ? 11.921  -0.723  4.261   1.00 0.00 ? 13 TYR A CE1  8  
ATOM 6382  C CE2  . TYR A 1 13 ? 10.707  -0.532  2.171   1.00 0.00 ? 13 TYR A CE2  8  
ATOM 6383  C CZ   . TYR A 1 13 ? 11.836  -0.954  2.883   1.00 0.00 ? 13 TYR A CZ   8  
ATOM 6384  O OH   . TYR A 1 13 ? 12.865  -1.598  2.227   1.00 0.00 ? 13 TYR A OH   8  
ATOM 6385  H H    . TYR A 1 13 ? 9.150   2.069   7.500   1.00 0.00 ? 13 TYR A H    8  
ATOM 6386  H HA   . TYR A 1 13 ? 9.828   2.821   4.717   1.00 0.00 ? 13 TYR A HA   8  
ATOM 6387  H HB2  . TYR A 1 13 ? 8.310   0.473   5.780   1.00 0.00 ? 13 TYR A HB2  8  
ATOM 6388  H HB3  . TYR A 1 13 ? 7.786   1.185   4.255   1.00 0.00 ? 13 TYR A HB3  8  
ATOM 6389  H HD1  . TYR A 1 13 ? 10.944  0.108   5.991   1.00 0.00 ? 13 TYR A HD1  8  
ATOM 6390  H HD2  . TYR A 1 13 ? 8.795   0.449   2.285   1.00 0.00 ? 13 TYR A HD2  8  
ATOM 6391  H HE1  . TYR A 1 13 ? 12.792  -1.050  4.811   1.00 0.00 ? 13 TYR A HE1  8  
ATOM 6392  H HE2  . TYR A 1 13 ? 10.641  -0.712  1.110   1.00 0.00 ? 13 TYR A HE2  8  
ATOM 6393  H HH   . TYR A 1 13 ? 12.656  -2.535  2.194   1.00 0.00 ? 13 TYR A HH   8  
ATOM 6394  N N    . ASP A 1 14 ? 7.600   3.997   4.323   1.00 0.00 ? 14 ASP A N    8  
ATOM 6395  C CA   . ASP A 1 14 ? 6.491   4.940   4.236   1.00 0.00 ? 14 ASP A CA   8  
ATOM 6396  C C    . ASP A 1 14 ? 5.954   4.996   2.810   1.00 0.00 ? 14 ASP A C    8  
ATOM 6397  O O    . ASP A 1 14 ? 6.638   5.461   1.898   1.00 0.00 ? 14 ASP A O    8  
ATOM 6398  C CB   . ASP A 1 14 ? 6.954   6.333   4.666   1.00 0.00 ? 14 ASP A CB   8  
ATOM 6399  C CG   . ASP A 1 14 ? 5.807   7.327   4.529   1.00 0.00 ? 14 ASP A CG   8  
ATOM 6400  O OD1  . ASP A 1 14 ? 4.684   6.887   4.357   1.00 0.00 ? 14 ASP A OD1  8  
ATOM 6401  O OD2  . ASP A 1 14 ? 6.070   8.517   4.598   1.00 0.00 ? 14 ASP A OD2  8  
ATOM 6402  H H    . ASP A 1 14 ? 8.123   3.795   3.519   1.00 0.00 ? 14 ASP A H    8  
ATOM 6403  H HA   . ASP A 1 14 ? 5.700   4.614   4.895   1.00 0.00 ? 14 ASP A HA   8  
ATOM 6404  H HB2  . ASP A 1 14 ? 7.279   6.300   5.696   1.00 0.00 ? 14 ASP A HB2  8  
ATOM 6405  H HB3  . ASP A 1 14 ? 7.776   6.646   4.040   1.00 0.00 ? 14 ASP A HB3  8  
ATOM 6406  N N    . LEU A 1 15 ? 4.729   4.513   2.624   1.00 0.00 ? 15 LEU A N    8  
ATOM 6407  C CA   . LEU A 1 15 ? 4.106   4.507   1.303   1.00 0.00 ? 15 LEU A CA   8  
ATOM 6408  C C    . LEU A 1 15 ? 2.746   5.199   1.352   1.00 0.00 ? 15 LEU A C    8  
ATOM 6409  O O    . LEU A 1 15 ? 1.716   4.579   1.094   1.00 0.00 ? 15 LEU A O    8  
ATOM 6410  C CB   . LEU A 1 15 ? 3.924   3.066   0.811   1.00 0.00 ? 15 LEU A CB   8  
ATOM 6411  C CG   . LEU A 1 15 ? 5.189   2.247   1.091   1.00 0.00 ? 15 LEU A CG   8  
ATOM 6412  C CD1  . LEU A 1 15 ? 4.871   0.758   0.955   1.00 0.00 ? 15 LEU A CD1  8  
ATOM 6413  C CD2  . LEU A 1 15 ? 6.280   2.623   0.085   1.00 0.00 ? 15 LEU A CD2  8  
ATOM 6414  H H    . LEU A 1 15 ? 4.233   4.154   3.389   1.00 0.00 ? 15 LEU A H    8  
ATOM 6415  H HA   . LEU A 1 15 ? 4.741   5.035   0.607   1.00 0.00 ? 15 LEU A HA   8  
ATOM 6416  H HB2  . LEU A 1 15 ? 3.086   2.617   1.323   1.00 0.00 ? 15 LEU A HB2  8  
ATOM 6417  H HB3  . LEU A 1 15 ? 3.731   3.073   -0.252  1.00 0.00 ? 15 LEU A HB3  8  
ATOM 6418  H HG   . LEU A 1 15 ? 5.537   2.447   2.094   1.00 0.00 ? 15 LEU A HG   8  
ATOM 6419  H HD11 . LEU A 1 15 ? 5.777   0.184   1.085   1.00 0.00 ? 15 LEU A HD11 8  
ATOM 6420  H HD12 . LEU A 1 15 ? 4.460   0.566   -0.025  1.00 0.00 ? 15 LEU A HD12 8  
ATOM 6421  H HD13 . LEU A 1 15 ? 4.152   0.474   1.708   1.00 0.00 ? 15 LEU A HD13 8  
ATOM 6422  H HD21 . LEU A 1 15 ? 7.133   1.973   0.221   1.00 0.00 ? 15 LEU A HD21 8  
ATOM 6423  H HD22 . LEU A 1 15 ? 6.580   3.648   0.244   1.00 0.00 ? 15 LEU A HD22 8  
ATOM 6424  H HD23 . LEU A 1 15 ? 5.900   2.508   -0.919  1.00 0.00 ? 15 LEU A HD23 8  
ATOM 6425  N N    . SER A 1 16 ? 2.751   6.487   1.687   1.00 0.00 ? 16 SER A N    8  
ATOM 6426  C CA   . SER A 1 16 ? 1.510   7.252   1.765   1.00 0.00 ? 16 SER A CA   8  
ATOM 6427  C C    . SER A 1 16 ? 0.579   6.874   0.617   1.00 0.00 ? 16 SER A C    8  
ATOM 6428  O O    . SER A 1 16 ? -0.594  6.569   0.828   1.00 0.00 ? 16 SER A O    8  
ATOM 6429  C CB   . SER A 1 16 ? 1.817   8.748   1.708   1.00 0.00 ? 16 SER A CB   8  
ATOM 6430  O OG   . SER A 1 16 ? 0.692   9.439   1.178   1.00 0.00 ? 16 SER A OG   8  
ATOM 6431  H H    . SER A 1 16 ? 3.603   6.930   1.883   1.00 0.00 ? 16 SER A H    8  
ATOM 6432  H HA   . SER A 1 16 ? 1.020   7.030   2.701   1.00 0.00 ? 16 SER A HA   8  
ATOM 6433  H HB2  . SER A 1 16 ? 2.023   9.116   2.700   1.00 0.00 ? 16 SER A HB2  8  
ATOM 6434  H HB3  . SER A 1 16 ? 2.682   8.913   1.080   1.00 0.00 ? 16 SER A HB3  8  
ATOM 6435  H HG   . SER A 1 16 ? -0.096  8.944   1.412   1.00 0.00 ? 16 SER A HG   8  
ATOM 6436  N N    . LYS A 1 17 ? 1.118   6.886   -0.598  1.00 0.00 ? 17 LYS A N    8  
ATOM 6437  C CA   . LYS A 1 17 ? 0.338   6.531   -1.776  1.00 0.00 ? 17 LYS A CA   8  
ATOM 6438  C C    . LYS A 1 17 ? 1.274   6.251   -2.949  1.00 0.00 ? 17 LYS A C    8  
ATOM 6439  O O    . LYS A 1 17 ? 2.141   7.065   -3.269  1.00 0.00 ? 17 LYS A O    8  
ATOM 6440  C CB   . LYS A 1 17 ? -0.623  7.679   -2.129  1.00 0.00 ? 17 LYS A CB   8  
ATOM 6441  C CG   . LYS A 1 17 ? -2.047  7.139   -2.327  1.00 0.00 ? 17 LYS A CG   8  
ATOM 6442  C CD   . LYS A 1 17 ? -2.112  6.290   -3.604  1.00 0.00 ? 17 LYS A CD   8  
ATOM 6443  C CE   . LYS A 1 17 ? -2.351  7.191   -4.820  1.00 0.00 ? 17 LYS A CE   8  
ATOM 6444  N NZ   . LYS A 1 17 ? -2.550  6.346   -6.032  1.00 0.00 ? 17 LYS A NZ   8  
ATOM 6445  H H    . LYS A 1 17 ? 2.062   7.127   -0.703  1.00 0.00 ? 17 LYS A H    8  
ATOM 6446  H HA   . LYS A 1 17 ? -0.232  5.639   -1.564  1.00 0.00 ? 17 LYS A HA   8  
ATOM 6447  H HB2  . LYS A 1 17 ? -0.626  8.400   -1.325  1.00 0.00 ? 17 LYS A HB2  8  
ATOM 6448  H HB3  . LYS A 1 17 ? -0.294  8.161   -3.039  1.00 0.00 ? 17 LYS A HB3  8  
ATOM 6449  H HG2  . LYS A 1 17 ? -2.323  6.532   -1.477  1.00 0.00 ? 17 LYS A HG2  8  
ATOM 6450  H HG3  . LYS A 1 17 ? -2.734  7.968   -2.411  1.00 0.00 ? 17 LYS A HG3  8  
ATOM 6451  H HD2  . LYS A 1 17 ? -1.183  5.754   -3.731  1.00 0.00 ? 17 LYS A HD2  8  
ATOM 6452  H HD3  . LYS A 1 17 ? -2.924  5.581   -3.522  1.00 0.00 ? 17 LYS A HD3  8  
ATOM 6453  H HE2  . LYS A 1 17 ? -3.231  7.795   -4.656  1.00 0.00 ? 17 LYS A HE2  8  
ATOM 6454  H HE3  . LYS A 1 17 ? -1.496  7.834   -4.967  1.00 0.00 ? 17 LYS A HE3  8  
ATOM 6455  H HZ1  . LYS A 1 17 ? -1.778  6.518   -6.706  1.00 0.00 ? 17 LYS A HZ1  8  
ATOM 6456  H HZ2  . LYS A 1 17 ? -3.457  6.588   -6.478  1.00 0.00 ? 17 LYS A HZ2  8  
ATOM 6457  H HZ3  . LYS A 1 17 ? -2.555  5.343   -5.758  1.00 0.00 ? 17 LYS A HZ3  8  
ATOM 6458  N N    . TRP A 1 18 ? 1.091   5.098   -3.584  1.00 0.00 ? 18 TRP A N    8  
ATOM 6459  C CA   . TRP A 1 18 ? 1.922   4.707   -4.719  1.00 0.00 ? 18 TRP A CA   8  
ATOM 6460  C C    . TRP A 1 18 ? 1.050   4.475   -5.953  1.00 0.00 ? 18 TRP A C    8  
ATOM 6461  O O    . TRP A 1 18 ? -0.173  4.391   -5.849  1.00 0.00 ? 18 TRP A O    8  
ATOM 6462  C CB   . TRP A 1 18 ? 2.683   3.414   -4.380  1.00 0.00 ? 18 TRP A CB   8  
ATOM 6463  C CG   . TRP A 1 18 ? 4.047   3.726   -3.839  1.00 0.00 ? 18 TRP A CG   8  
ATOM 6464  C CD1  . TRP A 1 18 ? 4.354   4.769   -3.033  1.00 0.00 ? 18 TRP A CD1  8  
ATOM 6465  C CD2  . TRP A 1 18 ? 5.293   2.997   -4.050  1.00 0.00 ? 18 TRP A CD2  8  
ATOM 6466  N NE1  . TRP A 1 18 ? 5.705   4.728   -2.741  1.00 0.00 ? 18 TRP A NE1  8  
ATOM 6467  C CE2  . TRP A 1 18 ? 6.328   3.655   -3.344  1.00 0.00 ? 18 TRP A CE2  8  
ATOM 6468  C CE3  . TRP A 1 18 ? 5.621   1.841   -4.779  1.00 0.00 ? 18 TRP A CE3  8  
ATOM 6469  C CZ2  . TRP A 1 18 ? 7.640   3.181   -3.360  1.00 0.00 ? 18 TRP A CZ2  8  
ATOM 6470  C CZ3  . TRP A 1 18 ? 6.941   1.363   -4.798  1.00 0.00 ? 18 TRP A CZ3  8  
ATOM 6471  C CH2  . TRP A 1 18 ? 7.949   2.032   -4.089  1.00 0.00 ? 18 TRP A CH2  8  
ATOM 6472  H H    . TRP A 1 18 ? 0.380   4.493   -3.279  1.00 0.00 ? 18 TRP A H    8  
ATOM 6473  H HA   . TRP A 1 18 ? 2.634   5.491   -4.933  1.00 0.00 ? 18 TRP A HA   8  
ATOM 6474  H HB2  . TRP A 1 18 ? 2.127   2.861   -3.638  1.00 0.00 ? 18 TRP A HB2  8  
ATOM 6475  H HB3  . TRP A 1 18 ? 2.782   2.812   -5.271  1.00 0.00 ? 18 TRP A HB3  8  
ATOM 6476  H HD1  . TRP A 1 18 ? 3.661   5.511   -2.676  1.00 0.00 ? 18 TRP A HD1  8  
ATOM 6477  H HE1  . TRP A 1 18 ? 6.181   5.373   -2.176  1.00 0.00 ? 18 TRP A HE1  8  
ATOM 6478  H HE3  . TRP A 1 18 ? 4.854   1.316   -5.327  1.00 0.00 ? 18 TRP A HE3  8  
ATOM 6479  H HZ2  . TRP A 1 18 ? 8.413   3.700   -2.812  1.00 0.00 ? 18 TRP A HZ2  8  
ATOM 6480  H HZ3  . TRP A 1 18 ? 7.179   0.475   -5.362  1.00 0.00 ? 18 TRP A HZ3  8  
ATOM 6481  H HH2  . TRP A 1 18 ? 8.961   1.659   -4.109  1.00 0.00 ? 18 TRP A HH2  8  
ATOM 6482  N N    . LYS A 1 19 ? 1.686   4.369   -7.117  1.00 0.00 ? 19 LYS A N    8  
ATOM 6483  C CA   . LYS A 1 19 ? 0.954   4.141   -8.360  1.00 0.00 ? 19 LYS A CA   8  
ATOM 6484  C C    . LYS A 1 19 ? 1.014   2.666   -8.750  1.00 0.00 ? 19 LYS A C    8  
ATOM 6485  O O    . LYS A 1 19 ? 1.823   1.904   -8.216  1.00 0.00 ? 19 LYS A O    8  
ATOM 6486  C CB   . LYS A 1 19 ? 1.543   4.998   -9.487  1.00 0.00 ? 19 LYS A CB   8  
ATOM 6487  C CG   . LYS A 1 19 ? 1.989   6.350   -8.926  1.00 0.00 ? 19 LYS A CG   8  
ATOM 6488  C CD   . LYS A 1 19 ? 0.788   7.071   -8.310  1.00 0.00 ? 19 LYS A CD   8  
ATOM 6489  C CE   . LYS A 1 19 ? 1.181   8.508   -7.959  1.00 0.00 ? 19 LYS A CE   8  
ATOM 6490  N NZ   . LYS A 1 19 ? 0.130   9.114   -7.095  1.00 0.00 ? 19 LYS A NZ   8  
ATOM 6491  H H    . LYS A 1 19 ? 2.663   4.440   -7.139  1.00 0.00 ? 19 LYS A H    8  
ATOM 6492  H HA   . LYS A 1 19 ? -0.080  4.420   -8.216  1.00 0.00 ? 19 LYS A HA   8  
ATOM 6493  H HB2  . LYS A 1 19 ? 2.391   4.491   -9.922  1.00 0.00 ? 19 LYS A HB2  8  
ATOM 6494  H HB3  . LYS A 1 19 ? 0.792   5.158   -10.247 1.00 0.00 ? 19 LYS A HB3  8  
ATOM 6495  H HG2  . LYS A 1 19 ? 2.746   6.196   -8.170  1.00 0.00 ? 19 LYS A HG2  8  
ATOM 6496  H HG3  . LYS A 1 19 ? 2.397   6.954   -9.724  1.00 0.00 ? 19 LYS A HG3  8  
ATOM 6497  H HD2  . LYS A 1 19 ? -0.026  7.083   -9.019  1.00 0.00 ? 19 LYS A HD2  8  
ATOM 6498  H HD3  . LYS A 1 19 ? 0.481   6.556   -7.413  1.00 0.00 ? 19 LYS A HD3  8  
ATOM 6499  H HE2  . LYS A 1 19 ? 2.123   8.505   -7.432  1.00 0.00 ? 19 LYS A HE2  8  
ATOM 6500  H HE3  . LYS A 1 19 ? 1.279   9.086   -8.867  1.00 0.00 ? 19 LYS A HE3  8  
ATOM 6501  H HZ1  . LYS A 1 19 ? -0.569  8.388   -6.839  1.00 0.00 ? 19 LYS A HZ1  8  
ATOM 6502  H HZ2  . LYS A 1 19 ? -0.344  9.881   -7.610  1.00 0.00 ? 19 LYS A HZ2  8  
ATOM 6503  H HZ3  . LYS A 1 19 ? 0.568   9.493   -6.230  1.00 0.00 ? 19 LYS A HZ3  8  
ATOM 6504  N N    . TYR A 1 20 ? 0.152   2.267   -9.680  1.00 0.00 ? 20 TYR A N    8  
ATOM 6505  C CA   . TYR A 1 20 ? 0.116   0.878   -10.130 1.00 0.00 ? 20 TYR A CA   8  
ATOM 6506  C C    . TYR A 1 20 ? 1.393   0.524   -10.887 1.00 0.00 ? 20 TYR A C    8  
ATOM 6507  O O    . TYR A 1 20 ? 1.966   -0.549  -10.693 1.00 0.00 ? 20 TYR A O    8  
ATOM 6508  C CB   . TYR A 1 20 ? -1.101  0.650   -11.037 1.00 0.00 ? 20 TYR A CB   8  
ATOM 6509  C CG   . TYR A 1 20 ? -2.183  1.646   -10.696 1.00 0.00 ? 20 TYR A CG   8  
ATOM 6510  C CD1  . TYR A 1 20 ? -2.168  2.919   -11.277 1.00 0.00 ? 20 TYR A CD1  8  
ATOM 6511  C CD2  . TYR A 1 20 ? -3.201  1.296   -9.803  1.00 0.00 ? 20 TYR A CD2  8  
ATOM 6512  C CE1  . TYR A 1 20 ? -3.171  3.843   -10.963 1.00 0.00 ? 20 TYR A CE1  8  
ATOM 6513  C CE2  . TYR A 1 20 ? -4.205  2.220   -9.489  1.00 0.00 ? 20 TYR A CE2  8  
ATOM 6514  C CZ   . TYR A 1 20 ? -4.189  3.494   -10.070 1.00 0.00 ? 20 TYR A CZ   8  
ATOM 6515  O OH   . TYR A 1 20 ? -5.179  4.404   -9.762  1.00 0.00 ? 20 TYR A OH   8  
ATOM 6516  H H    . TYR A 1 20 ? -0.471  2.915   -10.070 1.00 0.00 ? 20 TYR A H    8  
ATOM 6517  H HA   . TYR A 1 20 ? 0.032   0.236   -9.266  1.00 0.00 ? 20 TYR A HA   8  
ATOM 6518  H HB2  . TYR A 1 20 ? -0.810  0.775   -12.070 1.00 0.00 ? 20 TYR A HB2  8  
ATOM 6519  H HB3  . TYR A 1 20 ? -1.478  -0.353  -10.890 1.00 0.00 ? 20 TYR A HB3  8  
ATOM 6520  H HD1  . TYR A 1 20 ? -1.381  3.189   -11.967 1.00 0.00 ? 20 TYR A HD1  8  
ATOM 6521  H HD2  . TYR A 1 20 ? -3.213  0.313   -9.355  1.00 0.00 ? 20 TYR A HD2  8  
ATOM 6522  H HE1  . TYR A 1 20 ? -3.159  4.826   -11.412 1.00 0.00 ? 20 TYR A HE1  8  
ATOM 6523  H HE2  . TYR A 1 20 ? -4.991  1.951   -8.800  1.00 0.00 ? 20 TYR A HE2  8  
ATOM 6524  H HH   . TYR A 1 20 ? -4.918  5.257   -10.117 1.00 0.00 ? 20 TYR A HH   8  
ATOM 6525  N N    . ALA A 1 21 ? 1.826   1.431   -11.755 1.00 0.00 ? 21 ALA A N    8  
ATOM 6526  C CA   . ALA A 1 21 ? 3.030   1.208   -12.549 1.00 0.00 ? 21 ALA A CA   8  
ATOM 6527  C C    . ALA A 1 21 ? 4.231   0.909   -11.657 1.00 0.00 ? 21 ALA A C    8  
ATOM 6528  O O    . ALA A 1 21 ? 4.902   -0.110  -11.826 1.00 0.00 ? 21 ALA A O    8  
ATOM 6529  C CB   . ALA A 1 21 ? 3.320   2.443   -13.405 1.00 0.00 ? 21 ALA A CB   8  
ATOM 6530  H H    . ALA A 1 21 ? 1.323   2.264   -11.869 1.00 0.00 ? 21 ALA A H    8  
ATOM 6531  H HA   . ALA A 1 21 ? 2.863   0.365   -13.204 1.00 0.00 ? 21 ALA A HA   8  
ATOM 6532  H HB1  . ALA A 1 21 ? 3.942   2.163   -14.243 1.00 0.00 ? 21 ALA A HB1  8  
ATOM 6533  H HB2  . ALA A 1 21 ? 3.833   3.184   -12.808 1.00 0.00 ? 21 ALA A HB2  8  
ATOM 6534  H HB3  . ALA A 1 21 ? 2.392   2.856   -13.770 1.00 0.00 ? 21 ALA A HB3  8  
ATOM 6535  N N    . GLU A 1 22 ? 4.508   1.807   -10.715 1.00 0.00 ? 22 GLU A N    8  
ATOM 6536  C CA   . GLU A 1 22 ? 5.642   1.626   -9.816  1.00 0.00 ? 22 GLU A CA   8  
ATOM 6537  C C    . GLU A 1 22 ? 5.431   0.425   -8.899  1.00 0.00 ? 22 GLU A C    8  
ATOM 6538  O O    . GLU A 1 22 ? 6.370   -0.317  -8.613  1.00 0.00 ? 22 GLU A O    8  
ATOM 6539  C CB   . GLU A 1 22 ? 5.854   2.886   -8.974  1.00 0.00 ? 22 GLU A CB   8  
ATOM 6540  C CG   . GLU A 1 22 ? 4.622   3.139   -8.107  1.00 0.00 ? 22 GLU A CG   8  
ATOM 6541  C CD   . GLU A 1 22 ? 4.713   4.515   -7.457  1.00 0.00 ? 22 GLU A CD   8  
ATOM 6542  O OE1  . GLU A 1 22 ? 5.089   5.448   -8.147  1.00 0.00 ? 22 GLU A OE1  8  
ATOM 6543  O OE2  . GLU A 1 22 ? 4.407   4.616   -6.282  1.00 0.00 ? 22 GLU A OE2  8  
ATOM 6544  H H    . GLU A 1 22 ? 3.946   2.605   -10.629 1.00 0.00 ? 22 GLU A H    8  
ATOM 6545  H HA   . GLU A 1 22 ? 6.529   1.455   -10.408 1.00 0.00 ? 22 GLU A HA   8  
ATOM 6546  H HB2  . GLU A 1 22 ? 6.720   2.754   -8.341  1.00 0.00 ? 22 GLU A HB2  8  
ATOM 6547  H HB3  . GLU A 1 22 ? 6.013   3.732   -9.627  1.00 0.00 ? 22 GLU A HB3  8  
ATOM 6548  H HG2  . GLU A 1 22 ? 3.737   3.090   -8.722  1.00 0.00 ? 22 GLU A HG2  8  
ATOM 6549  H HG3  . GLU A 1 22 ? 4.564   2.385   -7.338  1.00 0.00 ? 22 GLU A HG3  8  
ATOM 6550  N N    . LEU A 1 23 ? 4.200   0.234   -8.433  1.00 0.00 ? 23 LEU A N    8  
ATOM 6551  C CA   . LEU A 1 23 ? 3.905   -0.888  -7.546  1.00 0.00 ? 23 LEU A CA   8  
ATOM 6552  C C    . LEU A 1 23 ? 4.353   -2.199  -8.187  1.00 0.00 ? 23 LEU A C    8  
ATOM 6553  O O    . LEU A 1 23 ? 5.143   -2.947  -7.608  1.00 0.00 ? 23 LEU A O    8  
ATOM 6554  C CB   . LEU A 1 23 ? 2.397   -0.948  -7.257  1.00 0.00 ? 23 LEU A CB   8  
ATOM 6555  C CG   . LEU A 1 23 ? 2.089   -0.278  -5.910  1.00 0.00 ? 23 LEU A CG   8  
ATOM 6556  C CD1  . LEU A 1 23 ? 0.621   0.154   -5.878  1.00 0.00 ? 23 LEU A CD1  8  
ATOM 6557  C CD2  . LEU A 1 23 ? 2.350   -1.268  -4.772  1.00 0.00 ? 23 LEU A CD2  8  
ATOM 6558  H H    . LEU A 1 23 ? 3.482   0.854   -8.687  1.00 0.00 ? 23 LEU A H    8  
ATOM 6559  H HA   . LEU A 1 23 ? 4.441   -0.751  -6.620  1.00 0.00 ? 23 LEU A HA   8  
ATOM 6560  H HB2  . LEU A 1 23 ? 1.865   -0.433  -8.043  1.00 0.00 ? 23 LEU A HB2  8  
ATOM 6561  H HB3  . LEU A 1 23 ? 2.075   -1.978  -7.224  1.00 0.00 ? 23 LEU A HB3  8  
ATOM 6562  H HG   . LEU A 1 23 ? 2.719   0.589   -5.789  1.00 0.00 ? 23 LEU A HG   8  
ATOM 6563  H HD11 . LEU A 1 23 ? 0.336   0.382   -4.862  1.00 0.00 ? 23 LEU A HD11 8  
ATOM 6564  H HD12 . LEU A 1 23 ? 0.001   -0.647  -6.254  1.00 0.00 ? 23 LEU A HD12 8  
ATOM 6565  H HD13 . LEU A 1 23 ? 0.489   1.030   -6.494  1.00 0.00 ? 23 LEU A HD13 8  
ATOM 6566  H HD21 . LEU A 1 23 ? 1.560   -2.004  -4.745  1.00 0.00 ? 23 LEU A HD21 8  
ATOM 6567  H HD22 . LEU A 1 23 ? 2.376   -0.735  -3.832  1.00 0.00 ? 23 LEU A HD22 8  
ATOM 6568  H HD23 . LEU A 1 23 ? 3.295   -1.762  -4.930  1.00 0.00 ? 23 LEU A HD23 8  
ATOM 6569  N N    . ARG A 1 24 ? 3.847   -2.470  -9.385  1.00 0.00 ? 24 ARG A N    8  
ATOM 6570  C CA   . ARG A 1 24 ? 4.201   -3.694  -10.092 1.00 0.00 ? 24 ARG A CA   8  
ATOM 6571  C C    . ARG A 1 24 ? 5.691   -3.720  -10.412 1.00 0.00 ? 24 ARG A C    8  
ATOM 6572  O O    . ARG A 1 24 ? 6.375   -4.708  -10.149 1.00 0.00 ? 24 ARG A O    8  
ATOM 6573  C CB   . ARG A 1 24 ? 3.396   -3.798  -11.390 1.00 0.00 ? 24 ARG A CB   8  
ATOM 6574  C CG   . ARG A 1 24 ? 3.504   -5.218  -11.946 1.00 0.00 ? 24 ARG A CG   8  
ATOM 6575  C CD   . ARG A 1 24 ? 2.786   -5.296  -13.294 1.00 0.00 ? 24 ARG A CD   8  
ATOM 6576  N NE   . ARG A 1 24 ? 2.589   -6.687  -13.682 1.00 0.00 ? 24 ARG A NE   8  
ATOM 6577  C CZ   . ARG A 1 24 ? 1.900   -7.006  -14.773 1.00 0.00 ? 24 ARG A CZ   8  
ATOM 6578  N NH1  . ARG A 1 24 ? 1.386   -6.065  -15.518 1.00 0.00 ? 24 ARG A NH1  8  
ATOM 6579  N NH2  . ARG A 1 24 ? 1.737   -8.258  -15.099 1.00 0.00 ? 24 ARG A NH2  8  
ATOM 6580  H H    . ARG A 1 24 ? 3.226   -1.835  -9.800  1.00 0.00 ? 24 ARG A H    8  
ATOM 6581  H HA   . ARG A 1 24 ? 3.962   -4.541  -9.467  1.00 0.00 ? 24 ARG A HA   8  
ATOM 6582  H HB2  . ARG A 1 24 ? 2.361   -3.565  -11.191 1.00 0.00 ? 24 ARG A HB2  8  
ATOM 6583  H HB3  . ARG A 1 24 ? 3.791   -3.100  -12.114 1.00 0.00 ? 24 ARG A HB3  8  
ATOM 6584  H HG2  . ARG A 1 24 ? 4.545   -5.477  -12.077 1.00 0.00 ? 24 ARG A HG2  8  
ATOM 6585  H HG3  . ARG A 1 24 ? 3.046   -5.911  -11.255 1.00 0.00 ? 24 ARG A HG3  8  
ATOM 6586  H HD2  . ARG A 1 24 ? 1.826   -4.808  -13.215 1.00 0.00 ? 24 ARG A HD2  8  
ATOM 6587  H HD3  . ARG A 1 24 ? 3.379   -4.793  -14.044 1.00 0.00 ? 24 ARG A HD3  8  
ATOM 6588  H HE   . ARG A 1 24 ? 2.970   -7.401  -13.128 1.00 0.00 ? 24 ARG A HE   8  
ATOM 6589  H HH11 . ARG A 1 24 ? 1.510   -5.105  -15.268 1.00 0.00 ? 24 ARG A HH11 8  
ATOM 6590  H HH12 . ARG A 1 24 ? 0.868   -6.305  -16.338 1.00 0.00 ? 24 ARG A HH12 8  
ATOM 6591  H HH21 . ARG A 1 24 ? 2.130   -8.979  -14.527 1.00 0.00 ? 24 ARG A HH21 8  
ATOM 6592  H HH22 . ARG A 1 24 ? 1.218   -8.498  -15.920 1.00 0.00 ? 24 ARG A HH22 8  
ATOM 6593  N N    . ASP A 1 25 ? 6.188   -2.630  -10.980 1.00 0.00 ? 25 ASP A N    8  
ATOM 6594  C CA   . ASP A 1 25 ? 7.597   -2.548  -11.333 1.00 0.00 ? 25 ASP A CA   8  
ATOM 6595  C C    . ASP A 1 25 ? 8.475   -2.815  -10.114 1.00 0.00 ? 25 ASP A C    8  
ATOM 6596  O O    . ASP A 1 25 ? 9.351   -3.678  -10.146 1.00 0.00 ? 25 ASP A O    8  
ATOM 6597  C CB   . ASP A 1 25 ? 7.914   -1.162  -11.897 1.00 0.00 ? 25 ASP A CB   8  
ATOM 6598  C CG   . ASP A 1 25 ? 9.265   -1.182  -12.604 1.00 0.00 ? 25 ASP A CG   8  
ATOM 6599  O OD1  . ASP A 1 25 ? 9.383   -1.887  -13.593 1.00 0.00 ? 25 ASP A OD1  8  
ATOM 6600  O OD2  . ASP A 1 25 ? 10.161  -0.493  -12.147 1.00 0.00 ? 25 ASP A OD2  8  
ATOM 6601  H H    . ASP A 1 25 ? 5.597   -1.871  -11.169 1.00 0.00 ? 25 ASP A H    8  
ATOM 6602  H HA   . ASP A 1 25 ? 7.812   -3.288  -12.085 1.00 0.00 ? 25 ASP A HA   8  
ATOM 6603  H HB2  . ASP A 1 25 ? 7.145   -0.878  -12.601 1.00 0.00 ? 25 ASP A HB2  8  
ATOM 6604  H HB3  . ASP A 1 25 ? 7.945   -0.444  -11.090 1.00 0.00 ? 25 ASP A HB3  8  
ATOM 6605  N N    . THR A 1 26 ? 8.238   -2.067  -9.043  1.00 0.00 ? 26 THR A N    8  
ATOM 6606  C CA   . THR A 1 26 ? 9.020   -2.227  -7.825  1.00 0.00 ? 26 THR A CA   8  
ATOM 6607  C C    . THR A 1 26 ? 8.914   -3.650  -7.280  1.00 0.00 ? 26 THR A C    8  
ATOM 6608  O O    . THR A 1 26 ? 9.878   -4.180  -6.728  1.00 0.00 ? 26 THR A O    8  
ATOM 6609  C CB   . THR A 1 26 ? 8.544   -1.239  -6.761  1.00 0.00 ? 26 THR A CB   8  
ATOM 6610  O OG1  . THR A 1 26 ? 8.340   0.034   -7.358  1.00 0.00 ? 26 THR A OG1  8  
ATOM 6611  C CG2  . THR A 1 26 ? 9.602   -1.128  -5.663  1.00 0.00 ? 26 THR A CG2  8  
ATOM 6612  H H    . THR A 1 26 ? 7.529   -1.393  -9.076  1.00 0.00 ? 26 THR A H    8  
ATOM 6613  H HA   . THR A 1 26 ? 10.056  -2.019  -8.048  1.00 0.00 ? 26 THR A HA   8  
ATOM 6614  H HB   . THR A 1 26 ? 7.619   -1.590  -6.331  1.00 0.00 ? 26 THR A HB   8  
ATOM 6615  H HG1  . THR A 1 26 ? 9.008   0.155   -8.037  1.00 0.00 ? 26 THR A HG1  8  
ATOM 6616  H HG21 . THR A 1 26 ? 10.500  -0.689  -6.070  1.00 0.00 ? 26 THR A HG21 8  
ATOM 6617  H HG22 . THR A 1 26 ? 9.826   -2.114  -5.279  1.00 0.00 ? 26 THR A HG22 8  
ATOM 6618  H HG23 . THR A 1 26 ? 9.228   -0.508  -4.864  1.00 0.00 ? 26 THR A HG23 8  
ATOM 6619  N N    . ILE A 1 27 ? 7.741   -4.263  -7.422  1.00 0.00 ? 27 ILE A N    8  
ATOM 6620  C CA   . ILE A 1 27 ? 7.550   -5.620  -6.918  1.00 0.00 ? 27 ILE A CA   8  
ATOM 6621  C C    . ILE A 1 27 ? 8.175   -6.646  -7.864  1.00 0.00 ? 27 ILE A C    8  
ATOM 6622  O O    . ILE A 1 27 ? 8.459   -7.775  -7.466  1.00 0.00 ? 27 ILE A O    8  
ATOM 6623  C CB   . ILE A 1 27 ? 6.045   -5.909  -6.721  1.00 0.00 ? 27 ILE A CB   8  
ATOM 6624  C CG1  . ILE A 1 27 ? 5.826   -6.572  -5.354  1.00 0.00 ? 27 ILE A CG1  8  
ATOM 6625  C CG2  . ILE A 1 27 ? 5.518   -6.834  -7.826  1.00 0.00 ? 27 ILE A CG2  8  
ATOM 6626  C CD1  . ILE A 1 27 ? 4.375   -7.046  -5.232  1.00 0.00 ? 27 ILE A CD1  8  
ATOM 6627  H H    . ILE A 1 27 ? 6.997   -3.797  -7.863  1.00 0.00 ? 27 ILE A H    8  
ATOM 6628  H HA   . ILE A 1 27 ? 8.043   -5.700  -5.960  1.00 0.00 ? 27 ILE A HA   8  
ATOM 6629  H HB   . ILE A 1 27 ? 5.501   -4.977  -6.752  1.00 0.00 ? 27 ILE A HB   8  
ATOM 6630  H HG12 . ILE A 1 27 ? 6.490   -7.418  -5.255  1.00 0.00 ? 27 ILE A HG12 8  
ATOM 6631  H HG13 . ILE A 1 27 ? 6.036   -5.859  -4.571  1.00 0.00 ? 27 ILE A HG13 8  
ATOM 6632  H HG21 . ILE A 1 27 ? 5.898   -7.833  -7.672  1.00 0.00 ? 27 ILE A HG21 8  
ATOM 6633  H HG22 . ILE A 1 27 ? 5.840   -6.469  -8.788  1.00 0.00 ? 27 ILE A HG22 8  
ATOM 6634  H HG23 . ILE A 1 27 ? 4.438   -6.852  -7.794  1.00 0.00 ? 27 ILE A HG23 8  
ATOM 6635  H HD11 . ILE A 1 27 ? 3.717   -6.302  -5.655  1.00 0.00 ? 27 ILE A HD11 8  
ATOM 6636  H HD12 . ILE A 1 27 ? 4.131   -7.193  -4.191  1.00 0.00 ? 27 ILE A HD12 8  
ATOM 6637  H HD13 . ILE A 1 27 ? 4.254   -7.977  -5.765  1.00 0.00 ? 27 ILE A HD13 8  
ATOM 6638  N N    . ASN A 1 28 ? 8.386   -6.249  -9.119  1.00 0.00 ? 28 ASN A N    8  
ATOM 6639  C CA   . ASN A 1 28 ? 8.976   -7.151  -10.107 1.00 0.00 ? 28 ASN A CA   8  
ATOM 6640  C C    . ASN A 1 28 ? 10.431  -6.773  -10.394 1.00 0.00 ? 28 ASN A C    8  
ATOM 6641  O O    . ASN A 1 28 ? 11.119  -7.464  -11.145 1.00 0.00 ? 28 ASN A O    8  
ATOM 6642  C CB   . ASN A 1 28 ? 8.148   -7.118  -11.404 1.00 0.00 ? 28 ASN A CB   8  
ATOM 6643  C CG   . ASN A 1 28 ? 8.882   -6.350  -12.498 1.00 0.00 ? 28 ASN A CG   8  
ATOM 6644  O OD1  . ASN A 1 28 ? 9.096   -6.874  -13.590 1.00 0.00 ? 28 ASN A OD1  8  
ATOM 6645  N ND2  . ASN A 1 28 ? 9.284   -5.132  -12.267 1.00 0.00 ? 28 ASN A ND2  8  
ATOM 6646  H H    . ASN A 1 28 ? 8.138   -5.337  -9.384  1.00 0.00 ? 28 ASN A H    8  
ATOM 6647  H HA   . ASN A 1 28 ? 8.957   -8.157  -9.713  1.00 0.00 ? 28 ASN A HA   8  
ATOM 6648  H HB2  . ASN A 1 28 ? 7.969   -8.129  -11.740 1.00 0.00 ? 28 ASN A HB2  8  
ATOM 6649  H HB3  . ASN A 1 28 ? 7.203   -6.636  -11.208 1.00 0.00 ? 28 ASN A HB3  8  
ATOM 6650  H HD21 . ASN A 1 28 ? 9.114   -4.716  -11.396 1.00 0.00 ? 28 ASN A HD21 8  
ATOM 6651  H HD22 . ASN A 1 28 ? 9.756   -4.631  -12.965 1.00 0.00 ? 28 ASN A HD22 8  
ATOM 6652  N N    . THR A 1 29 ? 10.893  -5.680  -9.790  1.00 0.00 ? 29 THR A N    8  
ATOM 6653  C CA   . THR A 1 29 ? 12.273  -5.231  -9.988  1.00 0.00 ? 29 THR A CA   8  
ATOM 6654  C C    . THR A 1 29 ? 13.048  -5.306  -8.678  1.00 0.00 ? 29 THR A C    8  
ATOM 6655  O O    . THR A 1 29 ? 14.155  -5.842  -8.630  1.00 0.00 ? 29 THR A O    8  
ATOM 6656  C CB   . THR A 1 29 ? 12.296  -3.788  -10.510 1.00 0.00 ? 29 THR A CB   8  
ATOM 6657  O OG1  . THR A 1 29 ? 11.507  -2.969  -9.658  1.00 0.00 ? 29 THR A OG1  8  
ATOM 6658  C CG2  . THR A 1 29 ? 11.736  -3.730  -11.940 1.00 0.00 ? 29 THR A CG2  8  
ATOM 6659  H H    . THR A 1 29 ? 10.302  -5.170  -9.196  1.00 0.00 ? 29 THR A H    8  
ATOM 6660  H HA   . THR A 1 29 ? 12.754  -5.872  -10.712 1.00 0.00 ? 29 THR A HA   8  
ATOM 6661  H HB   . THR A 1 29 ? 13.313  -3.427  -10.511 1.00 0.00 ? 29 THR A HB   8  
ATOM 6662  H HG1  . THR A 1 29 ? 12.015  -2.794  -8.863  1.00 0.00 ? 29 THR A HG1  8  
ATOM 6663  H HG21 . THR A 1 29 ? 10.763  -3.264  -11.926 1.00 0.00 ? 29 THR A HG21 8  
ATOM 6664  H HG22 . THR A 1 29 ? 11.650  -4.729  -12.342 1.00 0.00 ? 29 THR A HG22 8  
ATOM 6665  H HG23 . THR A 1 29 ? 12.401  -3.150  -12.563 1.00 0.00 ? 29 THR A HG23 8  
ATOM 6666  N N    . SER A 1 30 ? 12.458  -4.767  -7.617  1.00 0.00 ? 30 SER A N    8  
ATOM 6667  C CA   . SER A 1 30 ? 13.098  -4.779  -6.307  1.00 0.00 ? 30 SER A CA   8  
ATOM 6668  C C    . SER A 1 30 ? 12.660  -6.009  -5.519  1.00 0.00 ? 30 SER A C    8  
ATOM 6669  O O    . SER A 1 30 ? 11.725  -6.708  -5.911  1.00 0.00 ? 30 SER A O    8  
ATOM 6670  C CB   . SER A 1 30 ? 12.730  -3.507  -5.540  1.00 0.00 ? 30 SER A CB   8  
ATOM 6671  O OG   . SER A 1 30 ? 13.781  -2.558  -5.676  1.00 0.00 ? 30 SER A OG   8  
ATOM 6672  H H    . SER A 1 30 ? 11.574  -4.356  -7.716  1.00 0.00 ? 30 SER A H    8  
ATOM 6673  H HA   . SER A 1 30 ? 14.169  -4.809  -6.438  1.00 0.00 ? 30 SER A HA   8  
ATOM 6674  H HB2  . SER A 1 30 ? 11.823  -3.090  -5.947  1.00 0.00 ? 30 SER A HB2  8  
ATOM 6675  H HB3  . SER A 1 30 ? 12.577  -3.743  -4.495  1.00 0.00 ? 30 SER A HB3  8  
ATOM 6676  H HG   . SER A 1 30 ? 13.943  -2.430  -6.613  1.00 0.00 ? 30 SER A HG   8  
ATOM 6677  N N    . CYS A 1 31 ? 13.337  -6.271  -4.406  1.00 0.00 ? 31 CYS A N    8  
ATOM 6678  C CA   . CYS A 1 31 ? 13.001  -7.422  -3.578  1.00 0.00 ? 31 CYS A CA   8  
ATOM 6679  C C    . CYS A 1 31 ? 13.509  -7.232  -2.154  1.00 0.00 ? 31 CYS A C    8  
ATOM 6680  O O    . CYS A 1 31 ? 14.701  -7.016  -1.932  1.00 0.00 ? 31 CYS A O    8  
ATOM 6681  C CB   . CYS A 1 31 ? 13.614  -8.691  -4.174  1.00 0.00 ? 31 CYS A CB   8  
ATOM 6682  S SG   . CYS A 1 31 ? 13.075  -10.130 -3.219  1.00 0.00 ? 31 CYS A SG   8  
ATOM 6683  H H    . CYS A 1 31 ? 14.072  -5.681  -4.138  1.00 0.00 ? 31 CYS A H    8  
ATOM 6684  H HA   . CYS A 1 31 ? 11.927  -7.535  -3.554  1.00 0.00 ? 31 CYS A HA   8  
ATOM 6685  H HB2  . CYS A 1 31 ? 13.291  -8.798  -5.200  1.00 0.00 ? 31 CYS A HB2  8  
ATOM 6686  H HB3  . CYS A 1 31 ? 14.691  -8.619  -4.143  1.00 0.00 ? 31 CYS A HB3  8  
ATOM 6687  H HG   . CYS A 1 31 ? 12.190  -10.363 -3.508  1.00 0.00 ? 31 CYS A HG   8  
ATOM 6688  N N    . ASP A 1 32 ? 12.598  -7.323  -1.194  1.00 0.00 ? 32 ASP A N    8  
ATOM 6689  C CA   . ASP A 1 32 ? 12.954  -7.168  0.211   1.00 0.00 ? 32 ASP A CA   8  
ATOM 6690  C C    . ASP A 1 32 ? 11.743  -7.453  1.093   1.00 0.00 ? 32 ASP A C    8  
ATOM 6691  O O    . ASP A 1 32 ? 10.648  -6.952  0.836   1.00 0.00 ? 32 ASP A O    8  
ATOM 6692  C CB   . ASP A 1 32 ? 13.470  -5.747  0.476   1.00 0.00 ? 32 ASP A CB   8  
ATOM 6693  C CG   . ASP A 1 32 ? 14.539  -5.768  1.566   1.00 0.00 ? 32 ASP A CG   8  
ATOM 6694  O OD1  . ASP A 1 32 ? 15.562  -6.397  1.353   1.00 0.00 ? 32 ASP A OD1  8  
ATOM 6695  O OD2  . ASP A 1 32 ? 14.317  -5.155  2.598   1.00 0.00 ? 32 ASP A OD2  8  
ATOM 6696  H H    . ASP A 1 32 ? 11.664  -7.502  -1.433  1.00 0.00 ? 32 ASP A H    8  
ATOM 6697  H HA   . ASP A 1 32 ? 13.735  -7.876  0.450   1.00 0.00 ? 32 ASP A HA   8  
ATOM 6698  H HB2  . ASP A 1 32 ? 13.895  -5.345  -0.432  1.00 0.00 ? 32 ASP A HB2  8  
ATOM 6699  H HB3  . ASP A 1 32 ? 12.651  -5.120  0.795   1.00 0.00 ? 32 ASP A HB3  8  
ATOM 6700  N N    . ILE A 1 33 ? 11.945  -8.259  2.130   1.00 0.00 ? 33 ILE A N    8  
ATOM 6701  C CA   . ILE A 1 33 ? 10.859  -8.603  3.041   1.00 0.00 ? 33 ILE A CA   8  
ATOM 6702  C C    . ILE A 1 33 ? 9.957   -7.396  3.291   1.00 0.00 ? 33 ILE A C    8  
ATOM 6703  O O    . ILE A 1 33 ? 8.735   -7.526  3.365   1.00 0.00 ? 33 ILE A O    8  
ATOM 6704  C CB   . ILE A 1 33 ? 11.432  -9.097  4.374   1.00 0.00 ? 33 ILE A CB   8  
ATOM 6705  C CG1  . ILE A 1 33 ? 12.648  -8.239  4.759   1.00 0.00 ? 33 ILE A CG1  8  
ATOM 6706  C CG2  . ILE A 1 33 ? 11.862  -10.562 4.235   1.00 0.00 ? 33 ILE A CG2  8  
ATOM 6707  C CD1  . ILE A 1 33 ? 12.755  -8.150  6.285   1.00 0.00 ? 33 ILE A CD1  8  
ATOM 6708  H H    . ILE A 1 33 ? 12.838  -8.630  2.284   1.00 0.00 ? 33 ILE A H    8  
ATOM 6709  H HA   . ILE A 1 33 ? 10.269  -9.393  2.600   1.00 0.00 ? 33 ILE A HA   8  
ATOM 6710  H HB   . ILE A 1 33 ? 10.674  -9.021  5.140   1.00 0.00 ? 33 ILE A HB   8  
ATOM 6711  H HG12 . ILE A 1 33 ? 13.548  -8.686  4.362   1.00 0.00 ? 33 ILE A HG12 8  
ATOM 6712  H HG13 . ILE A 1 33 ? 12.533  -7.246  4.354   1.00 0.00 ? 33 ILE A HG13 8  
ATOM 6713  H HG21 . ILE A 1 33 ? 12.315  -10.893 5.157   1.00 0.00 ? 33 ILE A HG21 8  
ATOM 6714  H HG22 . ILE A 1 33 ? 12.577  -10.652 3.431   1.00 0.00 ? 33 ILE A HG22 8  
ATOM 6715  H HG23 . ILE A 1 33 ? 10.997  -11.171 4.019   1.00 0.00 ? 33 ILE A HG23 8  
ATOM 6716  H HD11 . ILE A 1 33 ? 13.752  -7.839  6.558   1.00 0.00 ? 33 ILE A HD11 8  
ATOM 6717  H HD12 . ILE A 1 33 ? 12.548  -9.117  6.718   1.00 0.00 ? 33 ILE A HD12 8  
ATOM 6718  H HD13 . ILE A 1 33 ? 12.039  -7.429  6.653   1.00 0.00 ? 33 ILE A HD13 8  
ATOM 6719  N N    . GLU A 1 34 ? 10.570  -6.224  3.424   1.00 0.00 ? 34 GLU A N    8  
ATOM 6720  C CA   . GLU A 1 34 ? 9.816   -5.001  3.676   1.00 0.00 ? 34 GLU A CA   8  
ATOM 6721  C C    . GLU A 1 34 ? 9.106   -4.524  2.411   1.00 0.00 ? 34 GLU A C    8  
ATOM 6722  O O    . GLU A 1 34 ? 7.904   -4.266  2.425   1.00 0.00 ? 34 GLU A O    8  
ATOM 6723  C CB   . GLU A 1 34 ? 10.758  -3.904  4.183   1.00 0.00 ? 34 GLU A CB   8  
ATOM 6724  C CG   . GLU A 1 34 ? 11.887  -4.531  5.007   1.00 0.00 ? 34 GLU A CG   8  
ATOM 6725  C CD   . GLU A 1 34 ? 12.453  -3.510  5.987   1.00 0.00 ? 34 GLU A CD   8  
ATOM 6726  O OE1  . GLU A 1 34 ? 11.729  -3.118  6.888   1.00 0.00 ? 34 GLU A OE1  8  
ATOM 6727  O OE2  . GLU A 1 34 ? 13.601  -3.133  5.823   1.00 0.00 ? 34 GLU A OE2  8  
ATOM 6728  H H    . GLU A 1 34 ? 11.547  -6.181  3.359   1.00 0.00 ? 34 GLU A H    8  
ATOM 6729  H HA   . GLU A 1 34 ? 9.075   -5.200  4.436   1.00 0.00 ? 34 GLU A HA   8  
ATOM 6730  H HB2  . GLU A 1 34 ? 11.179  -3.374  3.341   1.00 0.00 ? 34 GLU A HB2  8  
ATOM 6731  H HB3  . GLU A 1 34 ? 10.205  -3.214  4.801   1.00 0.00 ? 34 GLU A HB3  8  
ATOM 6732  H HG2  . GLU A 1 34 ? 11.504  -5.380  5.554   1.00 0.00 ? 34 GLU A HG2  8  
ATOM 6733  H HG3  . GLU A 1 34 ? 12.672  -4.861  4.342   1.00 0.00 ? 34 GLU A HG3  8  
ATOM 6734  N N    . LEU A 1 35 ? 9.858   -4.399  1.320   1.00 0.00 ? 35 LEU A N    8  
ATOM 6735  C CA   . LEU A 1 35 ? 9.277   -3.940  0.061   1.00 0.00 ? 35 LEU A CA   8  
ATOM 6736  C C    . LEU A 1 35 ? 8.070   -4.802  -0.308  1.00 0.00 ? 35 LEU A C    8  
ATOM 6737  O O    . LEU A 1 35 ? 6.988   -4.286  -0.583  1.00 0.00 ? 35 LEU A O    8  
ATOM 6738  C CB   . LEU A 1 35 ? 10.325  -4.013  -1.062  1.00 0.00 ? 35 LEU A CB   8  
ATOM 6739  C CG   . LEU A 1 35 ? 10.145  -2.855  -2.065  1.00 0.00 ? 35 LEU A CG   8  
ATOM 6740  C CD1  . LEU A 1 35 ? 8.660   -2.660  -2.400  1.00 0.00 ? 35 LEU A CD1  8  
ATOM 6741  C CD2  . LEU A 1 35 ? 10.705  -1.553  -1.476  1.00 0.00 ? 35 LEU A CD2  8  
ATOM 6742  H H    . LEU A 1 35 ? 10.813  -4.612  1.364   1.00 0.00 ? 35 LEU A H    8  
ATOM 6743  H HA   . LEU A 1 35 ? 8.957   -2.918  0.181   1.00 0.00 ? 35 LEU A HA   8  
ATOM 6744  H HB2  . LEU A 1 35 ? 11.312  -3.957  -0.629  1.00 0.00 ? 35 LEU A HB2  8  
ATOM 6745  H HB3  . LEU A 1 35 ? 10.225  -4.953  -1.586  1.00 0.00 ? 35 LEU A HB3  8  
ATOM 6746  H HG   . LEU A 1 35 ? 10.679  -3.093  -2.973  1.00 0.00 ? 35 LEU A HG   8  
ATOM 6747  H HD11 . LEU A 1 35 ? 8.180   -2.097  -1.612  1.00 0.00 ? 35 LEU A HD11 8  
ATOM 6748  H HD12 . LEU A 1 35 ? 8.182   -3.622  -2.501  1.00 0.00 ? 35 LEU A HD12 8  
ATOM 6749  H HD13 . LEU A 1 35 ? 8.571   -2.119  -3.329  1.00 0.00 ? 35 LEU A HD13 8  
ATOM 6750  H HD21 . LEU A 1 35 ? 11.499  -1.776  -0.779  1.00 0.00 ? 35 LEU A HD21 8  
ATOM 6751  H HD22 . LEU A 1 35 ? 9.918   -1.017  -0.967  1.00 0.00 ? 35 LEU A HD22 8  
ATOM 6752  H HD23 . LEU A 1 35 ? 11.095  -0.939  -2.276  1.00 0.00 ? 35 LEU A HD23 8  
ATOM 6753  N N    . LEU A 1 36 ? 8.269   -6.116  -0.316  1.00 0.00 ? 36 LEU A N    8  
ATOM 6754  C CA   . LEU A 1 36 ? 7.195   -7.041  -0.660  1.00 0.00 ? 36 LEU A CA   8  
ATOM 6755  C C    . LEU A 1 36 ? 6.079   -6.989  0.381   1.00 0.00 ? 36 LEU A C    8  
ATOM 6756  O O    . LEU A 1 36 ? 4.912   -6.799  0.040   1.00 0.00 ? 36 LEU A O    8  
ATOM 6757  C CB   . LEU A 1 36 ? 7.742   -8.467  -0.760  1.00 0.00 ? 36 LEU A CB   8  
ATOM 6758  C CG   . LEU A 1 36 ? 9.010   -8.472  -1.620  1.00 0.00 ? 36 LEU A CG   8  
ATOM 6759  C CD1  . LEU A 1 36 ? 9.486   -9.913  -1.814  1.00 0.00 ? 36 LEU A CD1  8  
ATOM 6760  C CD2  . LEU A 1 36 ? 8.709   -7.847  -2.987  1.00 0.00 ? 36 LEU A CD2  8  
ATOM 6761  H H    . LEU A 1 36 ? 9.155   -6.471  -0.092  1.00 0.00 ? 36 LEU A H    8  
ATOM 6762  H HA   . LEU A 1 36 ? 6.785   -6.759  -1.619  1.00 0.00 ? 36 LEU A HA   8  
ATOM 6763  H HB2  . LEU A 1 36 ? 7.977   -8.832  0.229   1.00 0.00 ? 36 LEU A HB2  8  
ATOM 6764  H HB3  . LEU A 1 36 ? 6.999   -9.106  -1.213  1.00 0.00 ? 36 LEU A HB3  8  
ATOM 6765  H HG   . LEU A 1 36 ? 9.783   -7.903  -1.125  1.00 0.00 ? 36 LEU A HG   8  
ATOM 6766  H HD11 . LEU A 1 36 ? 9.907   -10.281 -0.889  1.00 0.00 ? 36 LEU A HD11 8  
ATOM 6767  H HD12 . LEU A 1 36 ? 10.239  -9.944  -2.588  1.00 0.00 ? 36 LEU A HD12 8  
ATOM 6768  H HD13 . LEU A 1 36 ? 8.650   -10.534 -2.101  1.00 0.00 ? 36 LEU A HD13 8  
ATOM 6769  H HD21 . LEU A 1 36 ? 9.463   -8.153  -3.699  1.00 0.00 ? 36 LEU A HD21 8  
ATOM 6770  H HD22 . LEU A 1 36 ? 8.717   -6.771  -2.901  1.00 0.00 ? 36 LEU A HD22 8  
ATOM 6771  H HD23 . LEU A 1 36 ? 7.739   -8.175  -3.329  1.00 0.00 ? 36 LEU A HD23 8  
ATOM 6772  N N    . ALA A 1 37 ? 6.441   -7.158  1.650   1.00 0.00 ? 37 ALA A N    8  
ATOM 6773  C CA   . ALA A 1 37 ? 5.448   -7.124  2.720   1.00 0.00 ? 37 ALA A CA   8  
ATOM 6774  C C    . ALA A 1 37 ? 4.621   -5.846  2.635   1.00 0.00 ? 37 ALA A C    8  
ATOM 6775  O O    . ALA A 1 37 ? 3.394   -5.885  2.709   1.00 0.00 ? 37 ALA A O    8  
ATOM 6776  C CB   . ALA A 1 37 ? 6.139   -7.197  4.084   1.00 0.00 ? 37 ALA A CB   8  
ATOM 6777  H H    . ALA A 1 37 ? 7.386   -7.306  1.871   1.00 0.00 ? 37 ALA A H    8  
ATOM 6778  H HA   . ALA A 1 37 ? 4.790   -7.975  2.615   1.00 0.00 ? 37 ALA A HA   8  
ATOM 6779  H HB1  . ALA A 1 37 ? 6.859   -6.396  4.166   1.00 0.00 ? 37 ALA A HB1  8  
ATOM 6780  H HB2  . ALA A 1 37 ? 6.642   -8.147  4.182   1.00 0.00 ? 37 ALA A HB2  8  
ATOM 6781  H HB3  . ALA A 1 37 ? 5.400   -7.100  4.865   1.00 0.00 ? 37 ALA A HB3  8  
ATOM 6782  N N    . ALA A 1 38 ? 5.301   -4.716  2.477   1.00 0.00 ? 38 ALA A N    8  
ATOM 6783  C CA   . ALA A 1 38 ? 4.614   -3.434  2.382   1.00 0.00 ? 38 ALA A CA   8  
ATOM 6784  C C    . ALA A 1 38 ? 3.751   -3.389  1.124   1.00 0.00 ? 38 ALA A C    8  
ATOM 6785  O O    . ALA A 1 38 ? 2.610   -2.927  1.158   1.00 0.00 ? 38 ALA A O    8  
ATOM 6786  C CB   . ALA A 1 38 ? 5.633   -2.292  2.356   1.00 0.00 ? 38 ALA A CB   8  
ATOM 6787  H H    . ALA A 1 38 ? 6.280   -4.744  2.423   1.00 0.00 ? 38 ALA A H    8  
ATOM 6788  H HA   . ALA A 1 38 ? 3.977   -3.315  3.245   1.00 0.00 ? 38 ALA A HA   8  
ATOM 6789  H HB1  . ALA A 1 38 ? 6.453   -2.528  3.018   1.00 0.00 ? 38 ALA A HB1  8  
ATOM 6790  H HB2  . ALA A 1 38 ? 5.158   -1.381  2.683   1.00 0.00 ? 38 ALA A HB2  8  
ATOM 6791  H HB3  . ALA A 1 38 ? 6.006   -2.164  1.350   1.00 0.00 ? 38 ALA A HB3  8  
ATOM 6792  N N    . CYS A 1 39 ? 4.299   -3.877  0.015   1.00 0.00 ? 39 CYS A N    8  
ATOM 6793  C CA   . CYS A 1 39 ? 3.565   -3.893  -1.244  1.00 0.00 ? 39 CYS A CA   8  
ATOM 6794  C C    . CYS A 1 39 ? 2.259   -4.664  -1.081  1.00 0.00 ? 39 CYS A C    8  
ATOM 6795  O O    . CYS A 1 39 ? 1.182   -4.164  -1.408  1.00 0.00 ? 39 CYS A O    8  
ATOM 6796  C CB   . CYS A 1 39 ? 4.410   -4.547  -2.341  1.00 0.00 ? 39 CYS A CB   8  
ATOM 6797  S SG   . CYS A 1 39 ? 3.654   -4.229  -3.954  1.00 0.00 ? 39 CYS A SG   8  
ATOM 6798  H H    . CYS A 1 39 ? 5.211   -4.237  0.046   1.00 0.00 ? 39 CYS A H    8  
ATOM 6799  H HA   . CYS A 1 39 ? 3.340   -2.877  -1.534  1.00 0.00 ? 39 CYS A HA   8  
ATOM 6800  H HB2  . CYS A 1 39 ? 5.407   -4.135  -2.322  1.00 0.00 ? 39 CYS A HB2  8  
ATOM 6801  H HB3  . CYS A 1 39 ? 4.458   -5.612  -2.170  1.00 0.00 ? 39 CYS A HB3  8  
ATOM 6802  H HG   . CYS A 1 39 ? 4.224   -3.623  -4.434  1.00 0.00 ? 39 CYS A HG   8  
ATOM 6803  N N    . ARG A 1 40 ? 2.367   -5.884  -0.564  1.00 0.00 ? 40 ARG A N    8  
ATOM 6804  C CA   . ARG A 1 40 ? 1.194   -6.721  -0.352  1.00 0.00 ? 40 ARG A CA   8  
ATOM 6805  C C    . ARG A 1 40 ? 0.211   -6.027  0.587   1.00 0.00 ? 40 ARG A C    8  
ATOM 6806  O O    . ARG A 1 40 ? -1.001  -6.068  0.374   1.00 0.00 ? 40 ARG A O    8  
ATOM 6807  C CB   . ARG A 1 40 ? 1.626   -8.074  0.236   1.00 0.00 ? 40 ARG A CB   8  
ATOM 6808  C CG   . ARG A 1 40 ? 0.406   -8.834  0.786   1.00 0.00 ? 40 ARG A CG   8  
ATOM 6809  C CD   . ARG A 1 40 ? 0.310   -8.644  2.304   1.00 0.00 ? 40 ARG A CD   8  
ATOM 6810  N NE   . ARG A 1 40 ? 1.172   -9.602  2.989   1.00 0.00 ? 40 ARG A NE   8  
ATOM 6811  C CZ   . ARG A 1 40 ? 0.992   -9.896  4.273   1.00 0.00 ? 40 ARG A CZ   8  
ATOM 6812  N NH1  . ARG A 1 40 ? 0.034   -9.319  4.946   1.00 0.00 ? 40 ARG A NH1  8  
ATOM 6813  N NH2  . ARG A 1 40 ? 1.774   -10.759 4.861   1.00 0.00 ? 40 ARG A NH2  8  
ATOM 6814  H H    . ARG A 1 40 ? 3.252   -6.225  -0.319  1.00 0.00 ? 40 ARG A H    8  
ATOM 6815  H HA   . ARG A 1 40 ? 0.709   -6.895  -1.300  1.00 0.00 ? 40 ARG A HA   8  
ATOM 6816  H HB2  . ARG A 1 40 ? 2.096   -8.662  -0.538  1.00 0.00 ? 40 ARG A HB2  8  
ATOM 6817  H HB3  . ARG A 1 40 ? 2.334   -7.905  1.035   1.00 0.00 ? 40 ARG A HB3  8  
ATOM 6818  H HG2  . ARG A 1 40 ? -0.494  -8.465  0.319   1.00 0.00 ? 40 ARG A HG2  8  
ATOM 6819  H HG3  . ARG A 1 40 ? 0.513   -9.888  0.567   1.00 0.00 ? 40 ARG A HG3  8  
ATOM 6820  H HD2  . ARG A 1 40 ? 0.618   -7.643  2.564   1.00 0.00 ? 40 ARG A HD2  8  
ATOM 6821  H HD3  . ARG A 1 40 ? -0.713  -8.794  2.619   1.00 0.00 ? 40 ARG A HD3  8  
ATOM 6822  H HE   . ARG A 1 40 ? 1.896   -10.039 2.492   1.00 0.00 ? 40 ARG A HE   8  
ATOM 6823  H HH11 . ARG A 1 40 ? -0.565  -8.657  4.497   1.00 0.00 ? 40 ARG A HH11 8  
ATOM 6824  H HH12 . ARG A 1 40 ? -0.101  -9.541  5.912   1.00 0.00 ? 40 ARG A HH12 8  
ATOM 6825  H HH21 . ARG A 1 40 ? 2.509   -11.200 4.346   1.00 0.00 ? 40 ARG A HH21 8  
ATOM 6826  H HH22 . ARG A 1 40 ? 1.640   -10.980 5.826   1.00 0.00 ? 40 ARG A HH22 8  
ATOM 6827  N N    . GLU A 1 41 ? 0.743   -5.387  1.623   1.00 0.00 ? 41 GLU A N    8  
ATOM 6828  C CA   . GLU A 1 41 ? -0.098  -4.682  2.584   1.00 0.00 ? 41 GLU A CA   8  
ATOM 6829  C C    . GLU A 1 41 ? -0.881  -3.569  1.891   1.00 0.00 ? 41 GLU A C    8  
ATOM 6830  O O    . GLU A 1 41 ? -2.069  -3.379  2.148   1.00 0.00 ? 41 GLU A O    8  
ATOM 6831  C CB   . GLU A 1 41 ? 0.766   -4.084  3.698   1.00 0.00 ? 41 GLU A CB   8  
ATOM 6832  C CG   . GLU A 1 41 ? 1.205   -5.192  4.660   1.00 0.00 ? 41 GLU A CG   8  
ATOM 6833  C CD   . GLU A 1 41 ? 0.052   -5.563  5.586   1.00 0.00 ? 41 GLU A CD   8  
ATOM 6834  O OE1  . GLU A 1 41 ? -0.658  -4.666  6.008   1.00 0.00 ? 41 GLU A OE1  8  
ATOM 6835  O OE2  . GLU A 1 41 ? -0.105  -6.743  5.860   1.00 0.00 ? 41 GLU A OE2  8  
ATOM 6836  H H    . GLU A 1 41 ? 1.715   -5.385  1.742   1.00 0.00 ? 41 GLU A H    8  
ATOM 6837  H HA   . GLU A 1 41 ? -0.796  -5.381  3.020   1.00 0.00 ? 41 GLU A HA   8  
ATOM 6838  H HB2  . GLU A 1 41 ? 1.641   -3.619  3.262   1.00 0.00 ? 41 GLU A HB2  8  
ATOM 6839  H HB3  . GLU A 1 41 ? 0.198   -3.344  4.239   1.00 0.00 ? 41 GLU A HB3  8  
ATOM 6840  H HG2  . GLU A 1 41 ? 1.505   -6.061  4.094   1.00 0.00 ? 41 GLU A HG2  8  
ATOM 6841  H HG3  . GLU A 1 41 ? 2.038   -4.843  5.251   1.00 0.00 ? 41 GLU A HG3  8  
ATOM 6842  N N    . GLU A 1 42 ? -0.204  -2.839  1.009   1.00 0.00 ? 42 GLU A N    8  
ATOM 6843  C CA   . GLU A 1 42 ? -0.847  -1.749  0.283   1.00 0.00 ? 42 GLU A CA   8  
ATOM 6844  C C    . GLU A 1 42 ? -1.945  -2.290  -0.627  1.00 0.00 ? 42 GLU A C    8  
ATOM 6845  O O    . GLU A 1 42 ? -3.022  -1.704  -0.731  1.00 0.00 ? 42 GLU A O    8  
ATOM 6846  C CB   . GLU A 1 42 ? 0.190   -0.997  -0.553  1.00 0.00 ? 42 GLU A CB   8  
ATOM 6847  C CG   . GLU A 1 42 ? 1.120   -0.209  0.373   1.00 0.00 ? 42 GLU A CG   8  
ATOM 6848  C CD   . GLU A 1 42 ? 0.369   0.967   0.989   1.00 0.00 ? 42 GLU A CD   8  
ATOM 6849  O OE1  . GLU A 1 42 ? -0.612  1.392   0.401   1.00 0.00 ? 42 GLU A OE1  8  
ATOM 6850  O OE2  . GLU A 1 42 ? 0.786   1.426   2.039   1.00 0.00 ? 42 GLU A OE2  8  
ATOM 6851  H H    . GLU A 1 42 ? 0.740   -3.037  0.844   1.00 0.00 ? 42 GLU A H    8  
ATOM 6852  H HA   . GLU A 1 42 ? -1.285  -1.066  0.994   1.00 0.00 ? 42 GLU A HA   8  
ATOM 6853  H HB2  . GLU A 1 42 ? 0.770   -1.704  -1.130  1.00 0.00 ? 42 GLU A HB2  8  
ATOM 6854  H HB3  . GLU A 1 42 ? -0.313  -0.313  -1.220  1.00 0.00 ? 42 GLU A HB3  8  
ATOM 6855  H HG2  . GLU A 1 42 ? 1.477   -0.859  1.159   1.00 0.00 ? 42 GLU A HG2  8  
ATOM 6856  H HG3  . GLU A 1 42 ? 1.961   0.164   -0.195  1.00 0.00 ? 42 GLU A HG3  8  
ATOM 6857  N N    . PHE A 1 43 ? -1.662  -3.410  -1.285  1.00 0.00 ? 43 PHE A N    8  
ATOM 6858  C CA   . PHE A 1 43 ? -2.636  -4.021  -2.185  1.00 0.00 ? 43 PHE A CA   8  
ATOM 6859  C C    . PHE A 1 43 ? -3.906  -4.391  -1.422  1.00 0.00 ? 43 PHE A C    8  
ATOM 6860  O O    . PHE A 1 43 ? -5.009  -4.011  -1.813  1.00 0.00 ? 43 PHE A O    8  
ATOM 6861  C CB   . PHE A 1 43 ? -2.030  -5.276  -2.833  1.00 0.00 ? 43 PHE A CB   8  
ATOM 6862  C CG   . PHE A 1 43 ? -1.755  -5.017  -4.299  1.00 0.00 ? 43 PHE A CG   8  
ATOM 6863  C CD1  . PHE A 1 43 ? -0.797  -4.067  -4.673  1.00 0.00 ? 43 PHE A CD1  8  
ATOM 6864  C CD2  . PHE A 1 43 ? -2.456  -5.728  -5.281  1.00 0.00 ? 43 PHE A CD2  8  
ATOM 6865  C CE1  . PHE A 1 43 ? -0.542  -3.826  -6.030  1.00 0.00 ? 43 PHE A CE1  8  
ATOM 6866  C CE2  . PHE A 1 43 ? -2.201  -5.489  -6.636  1.00 0.00 ? 43 PHE A CE2  8  
ATOM 6867  C CZ   . PHE A 1 43 ? -1.244  -4.538  -7.010  1.00 0.00 ? 43 PHE A CZ   8  
ATOM 6868  H H    . PHE A 1 43 ? -0.786  -3.833  -1.164  1.00 0.00 ? 43 PHE A H    8  
ATOM 6869  H HA   . PHE A 1 43 ? -2.888  -3.310  -2.959  1.00 0.00 ? 43 PHE A HA   8  
ATOM 6870  H HB2  . PHE A 1 43 ? -1.104  -5.524  -2.335  1.00 0.00 ? 43 PHE A HB2  8  
ATOM 6871  H HB3  . PHE A 1 43 ? -2.718  -6.103  -2.738  1.00 0.00 ? 43 PHE A HB3  8  
ATOM 6872  H HD1  . PHE A 1 43 ? -0.256  -3.519  -3.918  1.00 0.00 ? 43 PHE A HD1  8  
ATOM 6873  H HD2  . PHE A 1 43 ? -3.195  -6.462  -4.993  1.00 0.00 ? 43 PHE A HD2  8  
ATOM 6874  H HE1  . PHE A 1 43 ? 0.196   -3.094  -6.319  1.00 0.00 ? 43 PHE A HE1  8  
ATOM 6875  H HE2  . PHE A 1 43 ? -2.743  -6.037  -7.393  1.00 0.00 ? 43 PHE A HE2  8  
ATOM 6876  H HZ   . PHE A 1 43 ? -1.048  -4.352  -8.056  1.00 0.00 ? 43 PHE A HZ   8  
ATOM 6877  N N    . HIS A 1 44 ? -3.741  -5.136  -0.333  1.00 0.00 ? 44 HIS A N    8  
ATOM 6878  C CA   . HIS A 1 44 ? -4.883  -5.551  0.475   1.00 0.00 ? 44 HIS A CA   8  
ATOM 6879  C C    . HIS A 1 44 ? -5.670  -4.337  0.959   1.00 0.00 ? 44 HIS A C    8  
ATOM 6880  O O    . HIS A 1 44 ? -6.893  -4.292  0.839   1.00 0.00 ? 44 HIS A O    8  
ATOM 6881  C CB   . HIS A 1 44 ? -4.400  -6.367  1.678   1.00 0.00 ? 44 HIS A CB   8  
ATOM 6882  C CG   . HIS A 1 44 ? -4.044  -7.760  1.233   1.00 0.00 ? 44 HIS A CG   8  
ATOM 6883  N ND1  . HIS A 1 44 ? -2.988  -8.015  0.372   1.00 0.00 ? 44 HIS A ND1  8  
ATOM 6884  C CD2  . HIS A 1 44 ? -4.597  -8.984  1.520   1.00 0.00 ? 44 HIS A CD2  8  
ATOM 6885  C CE1  . HIS A 1 44 ? -2.938  -9.345  0.174   1.00 0.00 ? 44 HIS A CE1  8  
ATOM 6886  N NE2  . HIS A 1 44 ? -3.895  -9.983  0.850   1.00 0.00 ? 44 HIS A NE2  8  
ATOM 6887  H H    . HIS A 1 44 ? -2.839  -5.410  -0.069  1.00 0.00 ? 44 HIS A H    8  
ATOM 6888  H HA   . HIS A 1 44 ? -5.531  -6.170  -0.129  1.00 0.00 ? 44 HIS A HA   8  
ATOM 6889  H HB2  . HIS A 1 44 ? -3.530  -5.893  2.108   1.00 0.00 ? 44 HIS A HB2  8  
ATOM 6890  H HB3  . HIS A 1 44 ? -5.186  -6.417  2.417   1.00 0.00 ? 44 HIS A HB3  8  
ATOM 6891  H HD2  . HIS A 1 44 ? -5.446  -9.148  2.167   1.00 0.00 ? 44 HIS A HD2  8  
ATOM 6892  H HE1  . HIS A 1 44 ? -2.212  -9.837  -0.457  1.00 0.00 ? 44 HIS A HE1  8  
ATOM 6893  H HE2  . HIS A 1 44 ? -4.069  -10.948 0.871   1.00 0.00 ? 44 HIS A HE2  8  
ATOM 6894  N N    . ARG A 1 45 ? -4.959  -3.355  1.504   1.00 0.00 ? 45 ARG A N    8  
ATOM 6895  C CA   . ARG A 1 45 ? -5.607  -2.145  2.001   1.00 0.00 ? 45 ARG A CA   8  
ATOM 6896  C C    . ARG A 1 45 ? -6.350  -1.436  0.874   1.00 0.00 ? 45 ARG A C    8  
ATOM 6897  O O    . ARG A 1 45 ? -7.525  -1.094  1.011   1.00 0.00 ? 45 ARG A O    8  
ATOM 6898  C CB   . ARG A 1 45 ? -4.562  -1.203  2.600   1.00 0.00 ? 45 ARG A CB   8  
ATOM 6899  C CG   . ARG A 1 45 ? -5.262  0.021   3.198   1.00 0.00 ? 45 ARG A CG   8  
ATOM 6900  C CD   . ARG A 1 45 ? -4.324  0.720   4.182   1.00 0.00 ? 45 ARG A CD   8  
ATOM 6901  N NE   . ARG A 1 45 ? -4.347  0.040   5.472   1.00 0.00 ? 45 ARG A NE   8  
ATOM 6902  C CZ   . ARG A 1 45 ? -5.349  0.220   6.328   1.00 0.00 ? 45 ARG A CZ   8  
ATOM 6903  N NH1  . ARG A 1 45 ? -6.336  1.016   6.018   1.00 0.00 ? 45 ARG A NH1  8  
ATOM 6904  N NH2  . ARG A 1 45 ? -5.347  -0.400  7.476   1.00 0.00 ? 45 ARG A NH2  8  
ATOM 6905  H H    . ARG A 1 45 ? -3.986  -3.443  1.574   1.00 0.00 ? 45 ARG A H    8  
ATOM 6906  H HA   . ARG A 1 45 ? -6.312  -2.416  2.771   1.00 0.00 ? 45 ARG A HA   8  
ATOM 6907  H HB2  . ARG A 1 45 ? -4.013  -1.720  3.374   1.00 0.00 ? 45 ARG A HB2  8  
ATOM 6908  H HB3  . ARG A 1 45 ? -3.879  -0.883  1.828   1.00 0.00 ? 45 ARG A HB3  8  
ATOM 6909  H HG2  . ARG A 1 45 ? -5.528  0.706   2.406   1.00 0.00 ? 45 ARG A HG2  8  
ATOM 6910  H HG3  . ARG A 1 45 ? -6.156  -0.292  3.717   1.00 0.00 ? 45 ARG A HG3  8  
ATOM 6911  H HD2  . ARG A 1 45 ? -3.319  0.706   3.792   1.00 0.00 ? 45 ARG A HD2  8  
ATOM 6912  H HD3  . ARG A 1 45 ? -4.642  1.744   4.312   1.00 0.00 ? 45 ARG A HD3  8  
ATOM 6913  H HE   . ARG A 1 45 ? -3.611  -0.559  5.714   1.00 0.00 ? 45 ARG A HE   8  
ATOM 6914  H HH11 . ARG A 1 45 ? -6.338  1.492   5.138   1.00 0.00 ? 45 ARG A HH11 8  
ATOM 6915  H HH12 . ARG A 1 45 ? -7.089  1.152   6.660   1.00 0.00 ? 45 ARG A HH12 8  
ATOM 6916  H HH21 . ARG A 1 45 ? -4.591  -1.010  7.713   1.00 0.00 ? 45 ARG A HH21 8  
ATOM 6917  H HH22 . ARG A 1 45 ? -6.101  -0.264  8.118   1.00 0.00 ? 45 ARG A HH22 8  
ATOM 6918  N N    . ARG A 1 46 ? -5.656  -1.218  -0.238  1.00 0.00 ? 46 ARG A N    8  
ATOM 6919  C CA   . ARG A 1 46 ? -6.260  -0.548  -1.385  1.00 0.00 ? 46 ARG A CA   8  
ATOM 6920  C C    . ARG A 1 46 ? -7.528  -1.275  -1.822  1.00 0.00 ? 46 ARG A C    8  
ATOM 6921  O O    . ARG A 1 46 ? -8.551  -0.648  -2.096  1.00 0.00 ? 46 ARG A O    8  
ATOM 6922  C CB   . ARG A 1 46 ? -5.264  -0.504  -2.547  1.00 0.00 ? 46 ARG A CB   8  
ATOM 6923  C CG   . ARG A 1 46 ? -5.720  0.536   -3.572  1.00 0.00 ? 46 ARG A CG   8  
ATOM 6924  C CD   . ARG A 1 46 ? -4.809  0.474   -4.801  1.00 0.00 ? 46 ARG A CD   8  
ATOM 6925  N NE   . ARG A 1 46 ? -4.955  1.686   -5.598  1.00 0.00 ? 46 ARG A NE   8  
ATOM 6926  C CZ   . ARG A 1 46 ? -6.066  1.929   -6.285  1.00 0.00 ? 46 ARG A CZ   8  
ATOM 6927  N NH1  . ARG A 1 46 ? -7.052  1.074   -6.251  1.00 0.00 ? 46 ARG A NH1  8  
ATOM 6928  N NH2  . ARG A 1 46 ? -6.173  3.020   -6.992  1.00 0.00 ? 46 ARG A NH2  8  
ATOM 6929  H H    . ARG A 1 46 ? -4.724  -1.514  -0.290  1.00 0.00 ? 46 ARG A H    8  
ATOM 6930  H HA   . ARG A 1 46 ? -6.514  0.464   -1.104  1.00 0.00 ? 46 ARG A HA   8  
ATOM 6931  H HB2  . ARG A 1 46 ? -4.286  -0.239  -2.172  1.00 0.00 ? 46 ARG A HB2  8  
ATOM 6932  H HB3  . ARG A 1 46 ? -5.219  -1.476  -3.018  1.00 0.00 ? 46 ARG A HB3  8  
ATOM 6933  H HG2  . ARG A 1 46 ? -6.738  0.329   -3.868  1.00 0.00 ? 46 ARG A HG2  8  
ATOM 6934  H HG3  . ARG A 1 46 ? -5.663  1.521   -3.135  1.00 0.00 ? 46 ARG A HG3  8  
ATOM 6935  H HD2  . ARG A 1 46 ? -3.781  0.381   -4.482  1.00 0.00 ? 46 ARG A HD2  8  
ATOM 6936  H HD3  . ARG A 1 46 ? -5.076  -0.384  -5.401  1.00 0.00 ? 46 ARG A HD3  8  
ATOM 6937  H HE   . ARG A 1 46 ? -4.220  2.335   -5.628  1.00 0.00 ? 46 ARG A HE   8  
ATOM 6938  H HH11 . ARG A 1 46 ? -6.972  0.237   -5.709  1.00 0.00 ? 46 ARG A HH11 8  
ATOM 6939  H HH12 . ARG A 1 46 ? -7.889  1.256   -6.767  1.00 0.00 ? 46 ARG A HH12 8  
ATOM 6940  H HH21 . ARG A 1 46 ? -5.418  3.676   -7.017  1.00 0.00 ? 46 ARG A HH21 8  
ATOM 6941  H HH22 . ARG A 1 46 ? -7.010  3.201   -7.508  1.00 0.00 ? 46 ARG A HH22 8  
ATOM 6942  N N    . LEU A 1 47 ? -7.452  -2.601  -1.884  1.00 0.00 ? 47 LEU A N    8  
ATOM 6943  C CA   . LEU A 1 47 ? -8.600  -3.403  -2.289  1.00 0.00 ? 47 LEU A CA   8  
ATOM 6944  C C    . LEU A 1 47 ? -9.676  -3.379  -1.209  1.00 0.00 ? 47 LEU A C    8  
ATOM 6945  O O    . LEU A 1 47 ? -10.866 -3.496  -1.500  1.00 0.00 ? 47 LEU A O    8  
ATOM 6946  C CB   . LEU A 1 47 ? -8.164  -4.849  -2.544  1.00 0.00 ? 47 LEU A CB   8  
ATOM 6947  C CG   . LEU A 1 47 ? -7.243  -4.907  -3.772  1.00 0.00 ? 47 LEU A CG   8  
ATOM 6948  C CD1  . LEU A 1 47 ? -6.355  -6.151  -3.686  1.00 0.00 ? 47 LEU A CD1  8  
ATOM 6949  C CD2  . LEU A 1 47 ? -8.085  -4.979  -5.051  1.00 0.00 ? 47 LEU A CD2  8  
ATOM 6950  H H    . LEU A 1 47 ? -6.610  -3.046  -1.654  1.00 0.00 ? 47 LEU A H    8  
ATOM 6951  H HA   . LEU A 1 47 ? -9.010  -2.995  -3.200  1.00 0.00 ? 47 LEU A HA   8  
ATOM 6952  H HB2  . LEU A 1 47 ? -7.634  -5.219  -1.677  1.00 0.00 ? 47 LEU A HB2  8  
ATOM 6953  H HB3  . LEU A 1 47 ? -9.036  -5.461  -2.719  1.00 0.00 ? 47 LEU A HB3  8  
ATOM 6954  H HG   . LEU A 1 47 ? -6.621  -4.024  -3.797  1.00 0.00 ? 47 LEU A HG   8  
ATOM 6955  H HD11 . LEU A 1 47 ? -5.600  -6.002  -2.929  1.00 0.00 ? 47 LEU A HD11 8  
ATOM 6956  H HD12 . LEU A 1 47 ? -5.879  -6.320  -4.641  1.00 0.00 ? 47 LEU A HD12 8  
ATOM 6957  H HD13 . LEU A 1 47 ? -6.958  -7.008  -3.429  1.00 0.00 ? 47 LEU A HD13 8  
ATOM 6958  H HD21 . LEU A 1 47 ? -8.783  -5.800  -4.980  1.00 0.00 ? 47 LEU A HD21 8  
ATOM 6959  H HD22 . LEU A 1 47 ? -7.436  -5.132  -5.900  1.00 0.00 ? 47 LEU A HD22 8  
ATOM 6960  H HD23 . LEU A 1 47 ? -8.628  -4.056  -5.179  1.00 0.00 ? 47 LEU A HD23 8  
ATOM 6961  N N    . LYS A 1 48 ? -9.249  -3.227  0.041   1.00 0.00 ? 48 LYS A N    8  
ATOM 6962  C CA   . LYS A 1 48 ? -10.185 -3.189  1.159   1.00 0.00 ? 48 LYS A CA   8  
ATOM 6963  C C    . LYS A 1 48 ? -11.092 -1.967  1.058   1.00 0.00 ? 48 LYS A C    8  
ATOM 6964  O O    . LYS A 1 48 ? -12.317 -2.087  1.102   1.00 0.00 ? 48 LYS A O    8  
ATOM 6965  C CB   . LYS A 1 48 ? -9.418  -3.151  2.481   1.00 0.00 ? 48 LYS A CB   8  
ATOM 6966  C CG   . LYS A 1 48 ? -10.383 -3.412  3.640   1.00 0.00 ? 48 LYS A CG   8  
ATOM 6967  C CD   . LYS A 1 48 ? -9.623  -3.329  4.966   1.00 0.00 ? 48 LYS A CD   8  
ATOM 6968  C CE   . LYS A 1 48 ? -10.567 -3.674  6.119   1.00 0.00 ? 48 LYS A CE   8  
ATOM 6969  N NZ   . LYS A 1 48 ? -10.792 -5.147  6.154   1.00 0.00 ? 48 LYS A NZ   8  
ATOM 6970  H H    . LYS A 1 48 ? -8.288  -3.139  0.214   1.00 0.00 ? 48 LYS A H    8  
ATOM 6971  H HA   . LYS A 1 48 ? -10.794 -4.079  1.135   1.00 0.00 ? 48 LYS A HA   8  
ATOM 6972  H HB2  . LYS A 1 48 ? -8.649  -3.910  2.474   1.00 0.00 ? 48 LYS A HB2  8  
ATOM 6973  H HB3  . LYS A 1 48 ? -8.963  -2.180  2.607   1.00 0.00 ? 48 LYS A HB3  8  
ATOM 6974  H HG2  . LYS A 1 48 ? -11.168 -2.670  3.628   1.00 0.00 ? 48 LYS A HG2  8  
ATOM 6975  H HG3  . LYS A 1 48 ? -10.814 -4.396  3.535   1.00 0.00 ? 48 LYS A HG3  8  
ATOM 6976  H HD2  . LYS A 1 48 ? -8.799  -4.029  4.952   1.00 0.00 ? 48 LYS A HD2  8  
ATOM 6977  H HD3  . LYS A 1 48 ? -9.242  -2.329  5.102   1.00 0.00 ? 48 LYS A HD3  8  
ATOM 6978  H HE2  . LYS A 1 48 ? -10.127 -3.357  7.052   1.00 0.00 ? 48 LYS A HE2  8  
ATOM 6979  H HE3  . LYS A 1 48 ? -11.511 -3.170  5.976   1.00 0.00 ? 48 LYS A HE3  8  
ATOM 6980  H HZ1  . LYS A 1 48 ? -10.687 -5.492  7.129   1.00 0.00 ? 48 LYS A HZ1  8  
ATOM 6981  H HZ2  . LYS A 1 48 ? -10.094 -5.620  5.546   1.00 0.00 ? 48 LYS A HZ2  8  
ATOM 6982  H HZ3  . LYS A 1 48 ? -11.751 -5.360  5.812   1.00 0.00 ? 48 LYS A HZ3  8  
ATOM 6983  N N    . VAL A 1 49 ? -10.485 -0.794  0.922   1.00 0.00 ? 49 VAL A N    8  
ATOM 6984  C CA   . VAL A 1 49 ? -11.249 0.443   0.817   1.00 0.00 ? 49 VAL A CA   8  
ATOM 6985  C C    . VAL A 1 49 ? -11.966 0.518   -0.527  1.00 0.00 ? 49 VAL A C    8  
ATOM 6986  O O    . VAL A 1 49 ? -13.100 0.988   -0.611  1.00 0.00 ? 49 VAL A O    8  
ATOM 6987  C CB   . VAL A 1 49 ? -10.318 1.647   0.968   1.00 0.00 ? 49 VAL A CB   8  
ATOM 6988  C CG1  . VAL A 1 49 ? -9.683  1.634   2.360   1.00 0.00 ? 49 VAL A CG1  8  
ATOM 6989  C CG2  . VAL A 1 49 ? -9.218  1.573   -0.094  1.00 0.00 ? 49 VAL A CG2  8  
ATOM 6990  H H    . VAL A 1 49 ? -9.504  -0.759  0.893   1.00 0.00 ? 49 VAL A H    8  
ATOM 6991  H HA   . VAL A 1 49 ? -11.983 0.470   1.609   1.00 0.00 ? 49 VAL A HA   8  
ATOM 6992  H HB   . VAL A 1 49 ? -10.885 2.557   0.839   1.00 0.00 ? 49 VAL A HB   8  
ATOM 6993  H HG11 . VAL A 1 49 ? -8.933  0.858   2.405   1.00 0.00 ? 49 VAL A HG11 8  
ATOM 6994  H HG12 . VAL A 1 49 ? -10.445 1.442   3.100   1.00 0.00 ? 49 VAL A HG12 8  
ATOM 6995  H HG13 . VAL A 1 49 ? -9.224  2.591   2.554   1.00 0.00 ? 49 VAL A HG13 8  
ATOM 6996  H HG21 . VAL A 1 49 ? -8.768  0.592   -0.080  1.00 0.00 ? 49 VAL A HG21 8  
ATOM 6997  H HG22 . VAL A 1 49 ? -8.464  2.319   0.116   1.00 0.00 ? 49 VAL A HG22 8  
ATOM 6998  H HG23 . VAL A 1 49 ? -9.645  1.760   -1.068  1.00 0.00 ? 49 VAL A HG23 8  
ATOM 6999  N N    . TYR A 1 50 ? -11.296 0.053   -1.575  1.00 0.00 ? 50 TYR A N    8  
ATOM 7000  C CA   . TYR A 1 50 ? -11.879 0.073   -2.912  1.00 0.00 ? 50 TYR A CA   8  
ATOM 7001  C C    . TYR A 1 50 ? -13.091 -0.850  -2.984  1.00 0.00 ? 50 TYR A C    8  
ATOM 7002  O O    . TYR A 1 50 ? -14.037 -0.590  -3.728  1.00 0.00 ? 50 TYR A O    8  
ATOM 7003  C CB   . TYR A 1 50 ? -10.839 -0.368  -3.943  1.00 0.00 ? 50 TYR A CB   8  
ATOM 7004  C CG   . TYR A 1 50 ? -11.378 -0.135  -5.334  1.00 0.00 ? 50 TYR A CG   8  
ATOM 7005  C CD1  . TYR A 1 50 ? -11.291 1.136   -5.915  1.00 0.00 ? 50 TYR A CD1  8  
ATOM 7006  C CD2  . TYR A 1 50 ? -11.967 -1.190  -6.043  1.00 0.00 ? 50 TYR A CD2  8  
ATOM 7007  C CE1  . TYR A 1 50 ? -11.791 1.352   -7.205  1.00 0.00 ? 50 TYR A CE1  8  
ATOM 7008  C CE2  . TYR A 1 50 ? -12.468 -0.972  -7.332  1.00 0.00 ? 50 TYR A CE2  8  
ATOM 7009  C CZ   . TYR A 1 50 ? -12.380 0.297   -7.913  1.00 0.00 ? 50 TYR A CZ   8  
ATOM 7010  O OH   . TYR A 1 50 ? -12.874 0.511   -9.184  1.00 0.00 ? 50 TYR A OH   8  
ATOM 7011  H H    . TYR A 1 50 ? -10.394 -0.311  -1.448  1.00 0.00 ? 50 TYR A H    8  
ATOM 7012  H HA   . TYR A 1 50 ? -12.192 1.080   -3.142  1.00 0.00 ? 50 TYR A HA   8  
ATOM 7013  H HB2  . TYR A 1 50 ? -9.932  0.203   -3.808  1.00 0.00 ? 50 TYR A HB2  8  
ATOM 7014  H HB3  . TYR A 1 50 ? -10.626 -1.418  -3.813  1.00 0.00 ? 50 TYR A HB3  8  
ATOM 7015  H HD1  . TYR A 1 50 ? -10.837 1.950   -5.368  1.00 0.00 ? 50 TYR A HD1  8  
ATOM 7016  H HD2  . TYR A 1 50 ? -12.034 -2.170  -5.594  1.00 0.00 ? 50 TYR A HD2  8  
ATOM 7017  H HE1  . TYR A 1 50 ? -11.724 2.333   -7.652  1.00 0.00 ? 50 TYR A HE1  8  
ATOM 7018  H HE2  . TYR A 1 50 ? -12.922 -1.787  -7.878  1.00 0.00 ? 50 TYR A HE2  8  
ATOM 7019  H HH   . TYR A 1 50 ? -13.187 1.417   -9.232  1.00 0.00 ? 50 TYR A HH   8  
ATOM 7020  N N    . HIS A 1 51 ? -13.057 -1.925  -2.205  1.00 0.00 ? 51 HIS A N    8  
ATOM 7021  C CA   . HIS A 1 51 ? -14.159 -2.881  -2.187  1.00 0.00 ? 51 HIS A CA   8  
ATOM 7022  C C    . HIS A 1 51 ? -15.221 -2.456  -1.179  1.00 0.00 ? 51 HIS A C    8  
ATOM 7023  O O    . HIS A 1 51 ? -16.411 -2.703  -1.372  1.00 0.00 ? 51 HIS A O    8  
ATOM 7024  C CB   . HIS A 1 51 ? -13.638 -4.273  -1.825  1.00 0.00 ? 51 HIS A CB   8  
ATOM 7025  C CG   . HIS A 1 51 ? -14.726 -5.288  -2.042  1.00 0.00 ? 51 HIS A CG   8  
ATOM 7026  N ND1  . HIS A 1 51 ? -16.025 -5.083  -1.603  1.00 0.00 ? 51 HIS A ND1  8  
ATOM 7027  C CD2  . HIS A 1 51 ? -14.725 -6.518  -2.651  1.00 0.00 ? 51 HIS A CD2  8  
ATOM 7028  C CE1  . HIS A 1 51 ? -16.746 -6.166  -1.950  1.00 0.00 ? 51 HIS A CE1  8  
ATOM 7029  N NE2  . HIS A 1 51 ? -16.001 -7.071  -2.592  1.00 0.00 ? 51 HIS A NE2  8  
ATOM 7030  H H    . HIS A 1 51 ? -12.277 -2.081  -1.632  1.00 0.00 ? 51 HIS A H    8  
ATOM 7031  H HA   . HIS A 1 51 ? -14.607 -2.922  -3.170  1.00 0.00 ? 51 HIS A HA   8  
ATOM 7032  H HB2  . HIS A 1 51 ? -12.791 -4.514  -2.450  1.00 0.00 ? 51 HIS A HB2  8  
ATOM 7033  H HB3  . HIS A 1 51 ? -13.336 -4.286  -0.789  1.00 0.00 ? 51 HIS A HB3  8  
ATOM 7034  H HD2  . HIS A 1 51 ? -13.864 -6.987  -3.105  1.00 0.00 ? 51 HIS A HD2  8  
ATOM 7035  H HE1  . HIS A 1 51 ? -17.798 -6.287  -1.737  1.00 0.00 ? 51 HIS A HE1  8  
ATOM 7036  H HE2  . HIS A 1 51 ? -16.291 -7.938  -2.945  1.00 0.00 ? 51 HIS A HE2  8  
ATOM 7037  N N    . ALA A 1 52 ? -14.781 -1.816  -0.099  1.00 0.00 ? 52 ALA A N    8  
ATOM 7038  C CA   . ALA A 1 52 ? -15.702 -1.360  0.937   1.00 0.00 ? 52 ALA A CA   8  
ATOM 7039  C C    . ALA A 1 52 ? -16.303 -0.006  0.567   1.00 0.00 ? 52 ALA A C    8  
ATOM 7040  O O    . ALA A 1 52 ? -17.271 0.440   1.180   1.00 0.00 ? 52 ALA A O    8  
ATOM 7041  C CB   . ALA A 1 52 ? -14.968 -1.245  2.274   1.00 0.00 ? 52 ALA A CB   8  
ATOM 7042  H H    . ALA A 1 52 ? -13.822 -1.646  0.003   1.00 0.00 ? 52 ALA A H    8  
ATOM 7043  H HA   . ALA A 1 52 ? -16.500 -2.080  1.040   1.00 0.00 ? 52 ALA A HA   8  
ATOM 7044  H HB1  . ALA A 1 52 ? -14.753 -2.233  2.653   1.00 0.00 ? 52 ALA A HB1  8  
ATOM 7045  H HB2  . ALA A 1 52 ? -15.588 -0.716  2.982   1.00 0.00 ? 52 ALA A HB2  8  
ATOM 7046  H HB3  . ALA A 1 52 ? -14.043 -0.704  2.132   1.00 0.00 ? 52 ALA A HB3  8  
ATOM 7047  N N    . TRP A 1 53 ? -15.720 0.641   -0.437  1.00 0.00 ? 53 TRP A N    8  
ATOM 7048  C CA   . TRP A 1 53 ? -16.206 1.944   -0.875  1.00 0.00 ? 53 TRP A CA   8  
ATOM 7049  C C    . TRP A 1 53 ? -17.723 1.923   -1.043  1.00 0.00 ? 53 TRP A C    8  
ATOM 7050  O O    . TRP A 1 53 ? -18.371 2.970   -1.052  1.00 0.00 ? 53 TRP A O    8  
ATOM 7051  C CB   . TRP A 1 53 ? -15.542 2.332   -2.201  1.00 0.00 ? 53 TRP A CB   8  
ATOM 7052  C CG   . TRP A 1 53 ? -16.186 1.588   -3.330  1.00 0.00 ? 53 TRP A CG   8  
ATOM 7053  C CD1  . TRP A 1 53 ? -16.473 0.266   -3.326  1.00 0.00 ? 53 TRP A CD1  8  
ATOM 7054  C CD2  . TRP A 1 53 ? -16.627 2.100   -4.621  1.00 0.00 ? 53 TRP A CD2  8  
ATOM 7055  N NE1  . TRP A 1 53 ? -17.062 -0.067  -4.534  1.00 0.00 ? 53 TRP A NE1  8  
ATOM 7056  C CE2  . TRP A 1 53 ? -17.178 1.030   -5.365  1.00 0.00 ? 53 TRP A CE2  8  
ATOM 7057  C CE3  . TRP A 1 53 ? -16.603 3.377   -5.213  1.00 0.00 ? 53 TRP A CE3  8  
ATOM 7058  C CZ2  . TRP A 1 53 ? -17.687 1.219   -6.650  1.00 0.00 ? 53 TRP A CZ2  8  
ATOM 7059  C CZ3  . TRP A 1 53 ? -17.114 3.570   -6.508  1.00 0.00 ? 53 TRP A CZ3  8  
ATOM 7060  C CH2  . TRP A 1 53 ? -17.656 2.493   -7.223  1.00 0.00 ? 53 TRP A CH2  8  
ATOM 7061  H H    . TRP A 1 53 ? -14.949 0.237   -0.887  1.00 0.00 ? 53 TRP A H    8  
ATOM 7062  H HA   . TRP A 1 53 ? -15.949 2.682   -0.129  1.00 0.00 ? 53 TRP A HA   8  
ATOM 7063  H HB2  . TRP A 1 53 ? -15.655 3.394   -2.362  1.00 0.00 ? 53 TRP A HB2  8  
ATOM 7064  H HB3  . TRP A 1 53 ? -14.491 2.085   -2.162  1.00 0.00 ? 53 TRP A HB3  8  
ATOM 7065  H HD1  . TRP A 1 53 ? -16.275 -0.418  -2.515  1.00 0.00 ? 53 TRP A HD1  8  
ATOM 7066  H HE1  . TRP A 1 53 ? -17.366 -0.963  -4.787  1.00 0.00 ? 53 TRP A HE1  8  
ATOM 7067  H HE3  . TRP A 1 53 ? -16.189 4.212   -4.669  1.00 0.00 ? 53 TRP A HE3  8  
ATOM 7068  H HZ2  . TRP A 1 53 ? -18.102 0.387   -7.199  1.00 0.00 ? 53 TRP A HZ2  8  
ATOM 7069  H HZ3  . TRP A 1 53 ? -17.091 4.553   -6.952  1.00 0.00 ? 53 TRP A HZ3  8  
ATOM 7070  H HH2  . TRP A 1 53 ? -18.047 2.649   -8.218  1.00 0.00 ? 53 TRP A HH2  8  
ATOM 7071  N N    . LYS A 1 54 ? -18.282 0.724   -1.177  1.00 0.00 ? 54 LYS A N    8  
ATOM 7072  C CA   . LYS A 1 54 ? -19.724 0.578   -1.346  1.00 0.00 ? 54 LYS A CA   8  
ATOM 7073  C C    . LYS A 1 54 ? -20.473 1.461   -0.353  1.00 0.00 ? 54 LYS A C    8  
ATOM 7074  O O    . LYS A 1 54 ? -20.797 2.611   -0.654  1.00 0.00 ? 54 LYS A O    8  
ATOM 7075  C CB   . LYS A 1 54 ? -20.128 -0.884  -1.140  1.00 0.00 ? 54 LYS A CB   8  
ATOM 7076  C CG   . LYS A 1 54 ? -21.643 -1.023  -1.301  1.00 0.00 ? 54 LYS A CG   8  
ATOM 7077  C CD   . LYS A 1 54 ? -22.014 -2.506  -1.386  1.00 0.00 ? 54 LYS A CD   8  
ATOM 7078  C CE   . LYS A 1 54 ? -23.495 -2.642  -1.739  1.00 0.00 ? 54 LYS A CE   8  
ATOM 7079  N NZ   . LYS A 1 54 ? -24.277 -1.605  -1.008  1.00 0.00 ? 54 LYS A NZ   8  
ATOM 7080  H H    . LYS A 1 54 ? -17.716 -0.076  -1.164  1.00 0.00 ? 54 LYS A H    8  
ATOM 7081  H HA   . LYS A 1 54 ? -19.990 0.874   -2.349  1.00 0.00 ? 54 LYS A HA   8  
ATOM 7082  H HB2  . LYS A 1 54 ? -19.628 -1.500  -1.873  1.00 0.00 ? 54 LYS A HB2  8  
ATOM 7083  H HB3  . LYS A 1 54 ? -19.843 -1.201  -0.148  1.00 0.00 ? 54 LYS A HB3  8  
ATOM 7084  H HG2  . LYS A 1 54 ? -22.137 -0.576  -0.450  1.00 0.00 ? 54 LYS A HG2  8  
ATOM 7085  H HG3  . LYS A 1 54 ? -21.957 -0.523  -2.204  1.00 0.00 ? 54 LYS A HG3  8  
ATOM 7086  H HD2  . LYS A 1 54 ? -21.416 -2.981  -2.151  1.00 0.00 ? 54 LYS A HD2  8  
ATOM 7087  H HD3  . LYS A 1 54 ? -21.827 -2.979  -0.435  1.00 0.00 ? 54 LYS A HD3  8  
ATOM 7088  H HE2  . LYS A 1 54 ? -23.627 -2.508  -2.802  1.00 0.00 ? 54 LYS A HE2  8  
ATOM 7089  H HE3  . LYS A 1 54 ? -23.845 -3.623  -1.454  1.00 0.00 ? 54 LYS A HE3  8  
ATOM 7090  H HZ1  . LYS A 1 54 ? -24.100 -1.691  0.013   1.00 0.00 ? 54 LYS A HZ1  8  
ATOM 7091  H HZ2  . LYS A 1 54 ? -25.292 -1.740  -1.193  1.00 0.00 ? 54 LYS A HZ2  8  
ATOM 7092  H HZ3  . LYS A 1 54 ? -23.989 -0.660  -1.333  1.00 0.00 ? 54 LYS A HZ3  8  
ATOM 7093  N N    . SER A 1 55 ? -20.746 0.921   0.830   1.00 0.00 ? 55 SER A N    8  
ATOM 7094  C CA   . SER A 1 55 ? -21.458 1.672   1.856   1.00 0.00 ? 55 SER A CA   8  
ATOM 7095  C C    . SER A 1 55 ? -21.513 0.881   3.159   1.00 0.00 ? 55 SER A C    8  
ATOM 7096  O O    . SER A 1 55 ? -21.863 -0.299  3.164   1.00 0.00 ? 55 SER A O    8  
ATOM 7097  C CB   . SER A 1 55 ? -22.879 1.983   1.385   1.00 0.00 ? 55 SER A CB   8  
ATOM 7098  O OG   . SER A 1 55 ? -23.575 2.670   2.416   1.00 0.00 ? 55 SER A OG   8  
ATOM 7099  H H    . SER A 1 55 ? -20.463 0.001   1.015   1.00 0.00 ? 55 SER A H    8  
ATOM 7100  H HA   . SER A 1 55 ? -20.939 2.603   2.033   1.00 0.00 ? 55 SER A HA   8  
ATOM 7101  H HB2  . SER A 1 55 ? -22.841 2.605   0.507   1.00 0.00 ? 55 SER A HB2  8  
ATOM 7102  H HB3  . SER A 1 55 ? -23.388 1.057   1.147   1.00 0.00 ? 55 SER A HB3  8  
ATOM 7103  H HG   . SER A 1 55 ? -23.354 3.602   2.352   1.00 0.00 ? 55 SER A HG   8  
ATOM 7104  N N    . LYS A 1 56 ? -21.169 1.540   4.260   1.00 0.00 ? 56 LYS A N    8  
ATOM 7105  C CA   . LYS A 1 56 ? -21.185 0.888   5.565   1.00 0.00 ? 56 LYS A CA   8  
ATOM 7106  C C    . LYS A 1 56 ? -22.618 0.599   5.998   1.00 0.00 ? 56 LYS A C    8  
ATOM 7107  O O    . LYS A 1 56 ? -23.567 1.145   5.435   1.00 0.00 ? 56 LYS A O    8  
ATOM 7108  C CB   . LYS A 1 56 ? -20.500 1.783   6.603   1.00 0.00 ? 56 LYS A CB   8  
ATOM 7109  C CG   . LYS A 1 56 ? -20.163 0.963   7.852   1.00 0.00 ? 56 LYS A CG   8  
ATOM 7110  C CD   . LYS A 1 56 ? -19.283 1.794   8.793   1.00 0.00 ? 56 LYS A CD   8  
ATOM 7111  C CE   . LYS A 1 56 ? -17.903 2.019   8.161   1.00 0.00 ? 56 LYS A CE   8  
ATOM 7112  N NZ   . LYS A 1 56 ? -16.881 2.139   9.239   1.00 0.00 ? 56 LYS A NZ   8  
ATOM 7113  H H    . LYS A 1 56 ? -20.900 2.480   4.195   1.00 0.00 ? 56 LYS A H    8  
ATOM 7114  H HA   . LYS A 1 56 ? -20.644 -0.045  5.496   1.00 0.00 ? 56 LYS A HA   8  
ATOM 7115  H HB2  . LYS A 1 56 ? -19.591 2.187   6.181   1.00 0.00 ? 56 LYS A HB2  8  
ATOM 7116  H HB3  . LYS A 1 56 ? -21.162 2.591   6.872   1.00 0.00 ? 56 LYS A HB3  8  
ATOM 7117  H HG2  . LYS A 1 56 ? -21.077 0.694   8.361   1.00 0.00 ? 56 LYS A HG2  8  
ATOM 7118  H HG3  . LYS A 1 56 ? -19.636 0.067   7.566   1.00 0.00 ? 56 LYS A HG3  8  
ATOM 7119  H HD2  . LYS A 1 56 ? -19.754 2.749   8.973   1.00 0.00 ? 56 LYS A HD2  8  
ATOM 7120  H HD3  . LYS A 1 56 ? -19.165 1.269   9.729   1.00 0.00 ? 56 LYS A HD3  8  
ATOM 7121  H HE2  . LYS A 1 56 ? -17.653 1.184   7.522   1.00 0.00 ? 56 LYS A HE2  8  
ATOM 7122  H HE3  . LYS A 1 56 ? -17.916 2.928   7.578   1.00 0.00 ? 56 LYS A HE3  8  
ATOM 7123  H HZ1  . LYS A 1 56 ? -15.940 1.935   8.849   1.00 0.00 ? 56 LYS A HZ1  8  
ATOM 7124  H HZ2  . LYS A 1 56 ? -17.093 1.459   9.996   1.00 0.00 ? 56 LYS A HZ2  8  
ATOM 7125  H HZ3  . LYS A 1 56 ? -16.897 3.105   9.625   1.00 0.00 ? 56 LYS A HZ3  8  
ATOM 7126  N N    . ASN A 1 57 ? -22.768 -0.261  7.002   1.00 0.00 ? 57 ASN A N    8  
ATOM 7127  C CA   . ASN A 1 57 ? -24.092 -0.617  7.504   1.00 0.00 ? 57 ASN A CA   8  
ATOM 7128  C C    . ASN A 1 57 ? -25.004 0.605   7.542   1.00 0.00 ? 57 ASN A C    8  
ATOM 7129  O O    . ASN A 1 57 ? -25.898 0.750   6.707   1.00 0.00 ? 57 ASN A O    8  
ATOM 7130  C CB   . ASN A 1 57 ? -23.973 -1.210  8.909   1.00 0.00 ? 57 ASN A CB   8  
ATOM 7131  C CG   . ASN A 1 57 ? -22.878 -2.271  8.939   1.00 0.00 ? 57 ASN A CG   8  
ATOM 7132  O OD1  . ASN A 1 57 ? -23.081 -3.388  8.464   1.00 0.00 ? 57 ASN A OD1  8  
ATOM 7133  N ND2  . ASN A 1 57 ? -21.722 -1.986  9.473   1.00 0.00 ? 57 ASN A ND2  8  
ATOM 7134  H H    . ASN A 1 57 ? -21.974 -0.665  7.411   1.00 0.00 ? 57 ASN A H    8  
ATOM 7135  H HA   . ASN A 1 57 ? -24.526 -1.359  6.850   1.00 0.00 ? 57 ASN A HA   8  
ATOM 7136  H HB2  . ASN A 1 57 ? -23.731 -0.424  9.610   1.00 0.00 ? 57 ASN A HB2  8  
ATOM 7137  H HB3  . ASN A 1 57 ? -24.915 -1.661  9.188   1.00 0.00 ? 57 ASN A HB3  8  
ATOM 7138  H HD21 . ASN A 1 57 ? -21.563 -1.095  9.851   1.00 0.00 ? 57 ASN A HD21 8  
ATOM 7139  H HD22 . ASN A 1 57 ? -21.013 -2.662  9.494   1.00 0.00 ? 57 ASN A HD22 8  
ATOM 7140  N N    . LYS A 1 58 ? -24.773 1.481   8.513   1.00 0.00 ? 58 LYS A N    8  
ATOM 7141  C CA   . LYS A 1 58 ? -25.580 2.689   8.649   1.00 0.00 ? 58 LYS A CA   8  
ATOM 7142  C C    . LYS A 1 58 ? -27.060 2.368   8.472   1.00 0.00 ? 58 LYS A C    8  
ATOM 7143  O O    . LYS A 1 58 ? -27.563 2.310   7.350   1.00 0.00 ? 58 LYS A O    8  
ATOM 7144  C CB   . LYS A 1 58 ? -25.150 3.723   7.606   1.00 0.00 ? 58 LYS A CB   8  
ATOM 7145  C CG   . LYS A 1 58 ? -23.673 4.089   7.814   1.00 0.00 ? 58 LYS A CG   8  
ATOM 7146  C CD   . LYS A 1 58 ? -23.555 5.238   8.826   1.00 0.00 ? 58 LYS A CD   8  
ATOM 7147  C CE   . LYS A 1 58 ? -23.698 6.580   8.104   1.00 0.00 ? 58 LYS A CE   8  
ATOM 7148  N NZ   . LYS A 1 58 ? -22.417 6.915   7.420   1.00 0.00 ? 58 LYS A NZ   8  
ATOM 7149  H H    . LYS A 1 58 ? -24.047 1.314   9.149   1.00 0.00 ? 58 LYS A H    8  
ATOM 7150  H HA   . LYS A 1 58 ? -25.426 3.102   9.634   1.00 0.00 ? 58 LYS A HA   8  
ATOM 7151  H HB2  . LYS A 1 58 ? -25.282 3.309   6.616   1.00 0.00 ? 58 LYS A HB2  8  
ATOM 7152  H HB3  . LYS A 1 58 ? -25.757 4.608   7.710   1.00 0.00 ? 58 LYS A HB3  8  
ATOM 7153  H HG2  . LYS A 1 58 ? -23.137 3.226   8.186   1.00 0.00 ? 58 LYS A HG2  8  
ATOM 7154  H HG3  . LYS A 1 58 ? -23.244 4.395   6.872   1.00 0.00 ? 58 LYS A HG3  8  
ATOM 7155  H HD2  . LYS A 1 58 ? -24.332 5.145   9.570   1.00 0.00 ? 58 LYS A HD2  8  
ATOM 7156  H HD3  . LYS A 1 58 ? -22.590 5.193   9.307   1.00 0.00 ? 58 LYS A HD3  8  
ATOM 7157  H HE2  . LYS A 1 58 ? -24.490 6.514   7.372   1.00 0.00 ? 58 LYS A HE2  8  
ATOM 7158  H HE3  . LYS A 1 58 ? -23.935 7.352   8.821   1.00 0.00 ? 58 LYS A HE3  8  
ATOM 7159  H HZ1  . LYS A 1 58 ? -22.564 6.919   6.390   1.00 0.00 ? 58 LYS A HZ1  8  
ATOM 7160  H HZ2  . LYS A 1 58 ? -21.698 6.204   7.663   1.00 0.00 ? 58 LYS A HZ2  8  
ATOM 7161  H HZ3  . LYS A 1 58 ? -22.095 7.856   7.730   1.00 0.00 ? 58 LYS A HZ3  8  
ATOM 7162  N N    . LYS A 1 59 ? -27.754 2.162   9.587   1.00 0.00 ? 59 LYS A N    8  
ATOM 7163  C CA   . LYS A 1 59 ? -29.178 1.849   9.544   1.00 0.00 ? 59 LYS A CA   8  
ATOM 7164  C C    . LYS A 1 59 ? -29.914 2.826   8.632   1.00 0.00 ? 59 LYS A C    8  
ATOM 7165  O O    . LYS A 1 59 ? -29.575 4.007   8.570   1.00 0.00 ? 59 LYS A O    8  
ATOM 7166  C CB   . LYS A 1 59 ? -29.771 1.915   10.952  1.00 0.00 ? 59 LYS A CB   8  
ATOM 7167  C CG   . LYS A 1 59 ? -28.967 1.009   11.887  1.00 0.00 ? 59 LYS A CG   8  
ATOM 7168  C CD   . LYS A 1 59 ? -29.549 1.088   13.300  1.00 0.00 ? 59 LYS A CD   8  
ATOM 7169  C CE   . LYS A 1 59 ? -28.586 0.427   14.288  1.00 0.00 ? 59 LYS A CE   8  
ATOM 7170  N NZ   . LYS A 1 59 ? -28.318 -0.975  13.857  1.00 0.00 ? 59 LYS A NZ   8  
ATOM 7171  H H    . LYS A 1 59 ? -27.300 2.222   10.454  1.00 0.00 ? 59 LYS A H    8  
ATOM 7172  H HA   . LYS A 1 59 ? -29.304 0.848   9.159   1.00 0.00 ? 59 LYS A HA   8  
ATOM 7173  H HB2  . LYS A 1 59 ? -29.730 2.932   11.312  1.00 0.00 ? 59 LYS A HB2  8  
ATOM 7174  H HB3  . LYS A 1 59 ? -30.797 1.583   10.926  1.00 0.00 ? 59 LYS A HB3  8  
ATOM 7175  H HG2  . LYS A 1 59 ? -29.019 -0.010  11.532  1.00 0.00 ? 59 LYS A HG2  8  
ATOM 7176  H HG3  . LYS A 1 59 ? -27.938 1.333   11.906  1.00 0.00 ? 59 LYS A HG3  8  
ATOM 7177  H HD2  . LYS A 1 59 ? -29.692 2.123   13.573  1.00 0.00 ? 59 LYS A HD2  8  
ATOM 7178  H HD3  . LYS A 1 59 ? -30.498 0.574   13.328  1.00 0.00 ? 59 LYS A HD3  8  
ATOM 7179  H HE2  . LYS A 1 59 ? -27.658 0.979   14.310  1.00 0.00 ? 59 LYS A HE2  8  
ATOM 7180  H HE3  . LYS A 1 59 ? -29.026 0.423   15.273  1.00 0.00 ? 59 LYS A HE3  8  
ATOM 7181  H HZ1  . LYS A 1 59 ? -28.016 -0.982  12.863  1.00 0.00 ? 59 LYS A HZ1  8  
ATOM 7182  H HZ2  . LYS A 1 59 ? -29.185 -1.541  13.958  1.00 0.00 ? 59 LYS A HZ2  8  
ATOM 7183  H HZ3  . LYS A 1 59 ? -27.567 -1.382  14.452  1.00 0.00 ? 59 LYS A HZ3  8  
ATOM 7184  N N    . ARG A 1 60 ? -30.924 2.325   7.928   1.00 0.00 ? 60 ARG A N    8  
ATOM 7185  C CA   . ARG A 1 60 ? -31.701 3.164   7.024   1.00 0.00 ? 60 ARG A CA   8  
ATOM 7186  C C    . ARG A 1 60 ? -32.512 4.190   7.810   1.00 0.00 ? 60 ARG A C    8  
ATOM 7187  O O    . ARG A 1 60 ? -32.208 4.389   8.975   1.00 0.00 ? 60 ARG A O    8  
ATOM 7188  C CB   . ARG A 1 60 ? -32.648 2.295   6.189   1.00 0.00 ? 60 ARG A CB   8  
ATOM 7189  C CG   . ARG A 1 60 ? -31.844 1.494   5.156   1.00 0.00 ? 60 ARG A CG   8  
ATOM 7190  C CD   . ARG A 1 60 ? -31.676 2.317   3.876   1.00 0.00 ? 60 ARG A CD   8  
ATOM 7191  N NE   . ARG A 1 60 ? -30.911 1.563   2.889   1.00 0.00 ? 60 ARG A NE   8  
ATOM 7192  C CZ   . ARG A 1 60 ? -31.493 0.652   2.117   1.00 0.00 ? 60 ARG A CZ   8  
ATOM 7193  N NH1  . ARG A 1 60 ? -32.773 0.417   2.234   1.00 0.00 ? 60 ARG A NH1  8  
ATOM 7194  N NH2  . ARG A 1 60 ? -30.788 -0.008  1.239   1.00 0.00 ? 60 ARG A NH2  8  
ATOM 7195  O OXT  . ARG A 1 60 ? -33.423 4.762   7.234   1.00 0.00 ? 60 ARG A OXT  8  
ATOM 7196  H H    . ARG A 1 60 ? -31.148 1.376   8.018   1.00 0.00 ? 60 ARG A H    8  
ATOM 7197  H HA   . ARG A 1 60 ? -31.028 3.683   6.360   1.00 0.00 ? 60 ARG A HA   8  
ATOM 7198  H HB2  . ARG A 1 60 ? -33.176 1.613   6.840   1.00 0.00 ? 60 ARG A HB2  8  
ATOM 7199  H HB3  . ARG A 1 60 ? -33.359 2.927   5.679   1.00 0.00 ? 60 ARG A HB3  8  
ATOM 7200  H HG2  . ARG A 1 60 ? -30.869 1.256   5.562   1.00 0.00 ? 60 ARG A HG2  8  
ATOM 7201  H HG3  . ARG A 1 60 ? -32.366 0.578   4.924   1.00 0.00 ? 60 ARG A HG3  8  
ATOM 7202  H HD2  . ARG A 1 60 ? -32.648 2.550   3.471   1.00 0.00 ? 60 ARG A HD2  8  
ATOM 7203  H HD3  . ARG A 1 60 ? -31.157 3.236   4.107   1.00 0.00 ? 60 ARG A HD3  8  
ATOM 7204  H HE   . ARG A 1 60 ? -29.950 1.732   2.792   1.00 0.00 ? 60 ARG A HE   8  
ATOM 7205  H HH11 . ARG A 1 60 ? -33.314 0.924   2.905   1.00 0.00 ? 60 ARG A HH11 8  
ATOM 7206  H HH12 . ARG A 1 60 ? -33.210 -0.268  1.652   1.00 0.00 ? 60 ARG A HH12 8  
ATOM 7207  H HH21 . ARG A 1 60 ? -29.807 0.171   1.151   1.00 0.00 ? 60 ARG A HH21 8  
ATOM 7208  H HH22 . ARG A 1 60 ? -31.226 -0.694  0.659   1.00 0.00 ? 60 ARG A HH22 8  
ATOM 7209  N N    . GLY A 1 9  ? 16.513  10.288  9.291   1.00 0.00 ? 9  GLY A N    9  
ATOM 7210  C CA   . GLY A 1 9  ? 16.177  9.567   10.512  1.00 0.00 ? 9  GLY A CA   9  
ATOM 7211  C C    . GLY A 1 9  ? 14.689  9.236   10.559  1.00 0.00 ? 9  GLY A C    9  
ATOM 7212  O O    . GLY A 1 9  ? 14.082  9.218   11.630  1.00 0.00 ? 9  GLY A O    9  
ATOM 7213  H H    . GLY A 1 9  ? 15.802  10.519  8.657   1.00 0.00 ? 9  GLY A H    9  
ATOM 7214  H HA2  . GLY A 1 9  ? 16.747  8.648   10.549  1.00 0.00 ? 9  GLY A HA2  9  
ATOM 7215  H HA3  . GLY A 1 9  ? 16.430  10.176  11.366  1.00 0.00 ? 9  GLY A HA3  9  
ATOM 7216  N N    . THR A 1 10 ? 14.108  8.977   9.392   1.00 0.00 ? 10 THR A N    9  
ATOM 7217  C CA   . THR A 1 10 ? 12.694  8.648   9.311   1.00 0.00 ? 10 THR A CA   9  
ATOM 7218  C C    . THR A 1 10 ? 12.451  7.213   9.770   1.00 0.00 ? 10 THR A C    9  
ATOM 7219  O O    . THR A 1 10 ? 13.395  6.470   10.039  1.00 0.00 ? 10 THR A O    9  
ATOM 7220  C CB   . THR A 1 10 ? 12.209  8.820   7.867   1.00 0.00 ? 10 THR A CB   9  
ATOM 7221  O OG1  . THR A 1 10 ? 13.234  8.402   6.975   1.00 0.00 ? 10 THR A OG1  9  
ATOM 7222  C CG2  . THR A 1 10 ? 11.875  10.291  7.607   1.00 0.00 ? 10 THR A CG2  9  
ATOM 7223  H H    . THR A 1 10 ? 14.640  9.006   8.571   1.00 0.00 ? 10 THR A H    9  
ATOM 7224  H HA   . THR A 1 10 ? 12.139  9.319   9.949   1.00 0.00 ? 10 THR A HA   9  
ATOM 7225  H HB   . THR A 1 10 ? 11.329  8.223   7.709   1.00 0.00 ? 10 THR A HB   9  
ATOM 7226  H HG1  . THR A 1 10 ? 13.866  7.879   7.474   1.00 0.00 ? 10 THR A HG1  9  
ATOM 7227  H HG21 . THR A 1 10 ? 12.717  10.907  7.886   1.00 0.00 ? 10 THR A HG21 9  
ATOM 7228  H HG22 . THR A 1 10 ? 11.013  10.573  8.192   1.00 0.00 ? 10 THR A HG22 9  
ATOM 7229  H HG23 . THR A 1 10 ? 11.660  10.430  6.557   1.00 0.00 ? 10 THR A HG23 9  
ATOM 7230  N N    . LYS A 1 11 ? 11.182  6.831   9.856   1.00 0.00 ? 11 LYS A N    9  
ATOM 7231  C CA   . LYS A 1 11 ? 10.826  5.483   10.284  1.00 0.00 ? 11 LYS A CA   9  
ATOM 7232  C C    . LYS A 1 11 ? 11.465  4.446   9.364   1.00 0.00 ? 11 LYS A C    9  
ATOM 7233  O O    . LYS A 1 11 ? 12.458  4.725   8.693   1.00 0.00 ? 11 LYS A O    9  
ATOM 7234  C CB   . LYS A 1 11 ? 9.305   5.312   10.270  1.00 0.00 ? 11 LYS A CB   9  
ATOM 7235  C CG   . LYS A 1 11 ? 8.651   6.381   11.155  1.00 0.00 ? 11 LYS A CG   9  
ATOM 7236  C CD   . LYS A 1 11 ? 8.674   5.931   12.620  1.00 0.00 ? 11 LYS A CD   9  
ATOM 7237  C CE   . LYS A 1 11 ? 7.926   6.950   13.479  1.00 0.00 ? 11 LYS A CE   9  
ATOM 7238  N NZ   . LYS A 1 11 ? 6.573   7.187   12.903  1.00 0.00 ? 11 LYS A NZ   9  
ATOM 7239  H H    . LYS A 1 11 ? 10.471  7.467   9.628   1.00 0.00 ? 11 LYS A H    9  
ATOM 7240  H HA   . LYS A 1 11 ? 11.187  5.327   11.288  1.00 0.00 ? 11 LYS A HA   9  
ATOM 7241  H HB2  . LYS A 1 11 ? 8.942   5.413   9.257   1.00 0.00 ? 11 LYS A HB2  9  
ATOM 7242  H HB3  . LYS A 1 11 ? 9.049   4.332   10.644  1.00 0.00 ? 11 LYS A HB3  9  
ATOM 7243  H HG2  . LYS A 1 11 ? 9.191   7.312   11.057  1.00 0.00 ? 11 LYS A HG2  9  
ATOM 7244  H HG3  . LYS A 1 11 ? 7.626   6.526   10.844  1.00 0.00 ? 11 LYS A HG3  9  
ATOM 7245  H HD2  . LYS A 1 11 ? 8.197   4.965   12.707  1.00 0.00 ? 11 LYS A HD2  9  
ATOM 7246  H HD3  . LYS A 1 11 ? 9.696   5.859   12.959  1.00 0.00 ? 11 LYS A HD3  9  
ATOM 7247  H HE2  . LYS A 1 11 ? 7.828   6.570   14.485  1.00 0.00 ? 11 LYS A HE2  9  
ATOM 7248  H HE3  . LYS A 1 11 ? 8.477   7.879   13.498  1.00 0.00 ? 11 LYS A HE3  9  
ATOM 7249  H HZ1  . LYS A 1 11 ? 6.656   7.773   12.048  1.00 0.00 ? 11 LYS A HZ1  9  
ATOM 7250  H HZ2  . LYS A 1 11 ? 5.979   7.679   13.601  1.00 0.00 ? 11 LYS A HZ2  9  
ATOM 7251  H HZ3  . LYS A 1 11 ? 6.135   6.275   12.658  1.00 0.00 ? 11 LYS A HZ3  9  
ATOM 7252  N N    . LYS A 1 12 ? 10.886  3.250   9.338   1.00 0.00 ? 12 LYS A N    9  
ATOM 7253  C CA   . LYS A 1 12 ? 11.406  2.180   8.495   1.00 0.00 ? 12 LYS A CA   9  
ATOM 7254  C C    . LYS A 1 12 ? 10.997  2.398   7.042   1.00 0.00 ? 12 LYS A C    9  
ATOM 7255  O O    . LYS A 1 12 ? 11.828  2.728   6.196   1.00 0.00 ? 12 LYS A O    9  
ATOM 7256  C CB   . LYS A 1 12 ? 10.875  0.829   8.982   1.00 0.00 ? 12 LYS A CB   9  
ATOM 7257  C CG   . LYS A 1 12 ? 11.538  0.460   10.316  1.00 0.00 ? 12 LYS A CG   9  
ATOM 7258  C CD   . LYS A 1 12 ? 12.851  -0.292  10.060  1.00 0.00 ? 12 LYS A CD   9  
ATOM 7259  C CE   . LYS A 1 12 ? 12.568  -1.788  9.900   1.00 0.00 ? 12 LYS A CE   9  
ATOM 7260  N NZ   . LYS A 1 12 ? 12.339  -2.396  11.242  1.00 0.00 ? 12 LYS A NZ   9  
ATOM 7261  H H    . LYS A 1 12 ? 10.096  3.086   9.893   1.00 0.00 ? 12 LYS A H    9  
ATOM 7262  H HA   . LYS A 1 12 ? 12.483  2.175   8.560   1.00 0.00 ? 12 LYS A HA   9  
ATOM 7263  H HB2  . LYS A 1 12 ? 9.804   0.893   9.117   1.00 0.00 ? 12 LYS A HB2  9  
ATOM 7264  H HB3  . LYS A 1 12 ? 11.098  0.069   8.248   1.00 0.00 ? 12 LYS A HB3  9  
ATOM 7265  H HG2  . LYS A 1 12 ? 11.745  1.362   10.876  1.00 0.00 ? 12 LYS A HG2  9  
ATOM 7266  H HG3  . LYS A 1 12 ? 10.871  -0.169  10.887  1.00 0.00 ? 12 LYS A HG3  9  
ATOM 7267  H HD2  . LYS A 1 12 ? 13.314  0.085   9.159   1.00 0.00 ? 12 LYS A HD2  9  
ATOM 7268  H HD3  . LYS A 1 12 ? 13.519  -0.144  10.894  1.00 0.00 ? 12 LYS A HD3  9  
ATOM 7269  H HE2  . LYS A 1 12 ? 11.689  -1.926  9.287   1.00 0.00 ? 12 LYS A HE2  9  
ATOM 7270  H HE3  . LYS A 1 12 ? 13.414  -2.266  9.429   1.00 0.00 ? 12 LYS A HE3  9  
ATOM 7271  H HZ1  . LYS A 1 12 ? 12.151  -3.413  11.134  1.00 0.00 ? 12 LYS A HZ1  9  
ATOM 7272  H HZ2  . LYS A 1 12 ? 11.521  -1.941  11.693  1.00 0.00 ? 12 LYS A HZ2  9  
ATOM 7273  H HZ3  . LYS A 1 12 ? 13.185  -2.259  11.832  1.00 0.00 ? 12 LYS A HZ3  9  
ATOM 7274  N N    . TYR A 1 13 ? 9.709   2.213   6.761   1.00 0.00 ? 13 TYR A N    9  
ATOM 7275  C CA   . TYR A 1 13 ? 9.191   2.392   5.407   1.00 0.00 ? 13 TYR A CA   9  
ATOM 7276  C C    . TYR A 1 13 ? 8.049   3.404   5.410   1.00 0.00 ? 13 TYR A C    9  
ATOM 7277  O O    . TYR A 1 13 ? 7.338   3.551   6.404   1.00 0.00 ? 13 TYR A O    9  
ATOM 7278  C CB   . TYR A 1 13 ? 8.691   1.050   4.856   1.00 0.00 ? 13 TYR A CB   9  
ATOM 7279  C CG   . TYR A 1 13 ? 9.816   0.347   4.128   1.00 0.00 ? 13 TYR A CG   9  
ATOM 7280  C CD1  . TYR A 1 13 ? 10.941  -0.095  4.837   1.00 0.00 ? 13 TYR A CD1  9  
ATOM 7281  C CD2  . TYR A 1 13 ? 9.735   0.142   2.746   1.00 0.00 ? 13 TYR A CD2  9  
ATOM 7282  C CE1  . TYR A 1 13 ? 11.983  -0.743  4.161   1.00 0.00 ? 13 TYR A CE1  9  
ATOM 7283  C CE2  . TYR A 1 13 ? 10.776  -0.506  2.072   1.00 0.00 ? 13 TYR A CE2  9  
ATOM 7284  C CZ   . TYR A 1 13 ? 11.900  -0.947  2.780   1.00 0.00 ? 13 TYR A CZ   9  
ATOM 7285  O OH   . TYR A 1 13 ? 12.928  -1.585  2.114   1.00 0.00 ? 13 TYR A OH   9  
ATOM 7286  H H    . TYR A 1 13 ? 9.096   1.952   7.478   1.00 0.00 ? 13 TYR A H    9  
ATOM 7287  H HA   . TYR A 1 13 ? 9.980   2.763   4.770   1.00 0.00 ? 13 TYR A HA   9  
ATOM 7288  H HB2  . TYR A 1 13 ? 8.350   0.432   5.672   1.00 0.00 ? 13 TYR A HB2  9  
ATOM 7289  H HB3  . TYR A 1 13 ? 7.873   1.222   4.169   1.00 0.00 ? 13 TYR A HB3  9  
ATOM 7290  H HD1  . TYR A 1 13 ? 11.003  0.062   5.902   1.00 0.00 ? 13 TYR A HD1  9  
ATOM 7291  H HD2  . TYR A 1 13 ? 8.868   0.482   2.199   1.00 0.00 ? 13 TYR A HD2  9  
ATOM 7292  H HE1  . TYR A 1 13 ? 12.850  -1.084  4.708   1.00 0.00 ? 13 TYR A HE1  9  
ATOM 7293  H HE2  . TYR A 1 13 ? 10.711  -0.664  1.008   1.00 0.00 ? 13 TYR A HE2  9  
ATOM 7294  H HH   . TYR A 1 13 ? 12.934  -2.505  2.391   1.00 0.00 ? 13 TYR A HH   9  
ATOM 7295  N N    . ASP A 1 14 ? 7.881   4.098   4.290   1.00 0.00 ? 14 ASP A N    9  
ATOM 7296  C CA   . ASP A 1 14 ? 6.823   5.096   4.167   1.00 0.00 ? 14 ASP A CA   9  
ATOM 7297  C C    . ASP A 1 14 ? 6.259   5.105   2.750   1.00 0.00 ? 14 ASP A C    9  
ATOM 7298  O O    . ASP A 1 14 ? 6.928   5.532   1.809   1.00 0.00 ? 14 ASP A O    9  
ATOM 7299  C CB   . ASP A 1 14 ? 7.373   6.482   4.508   1.00 0.00 ? 14 ASP A CB   9  
ATOM 7300  C CG   . ASP A 1 14 ? 6.266   7.525   4.395   1.00 0.00 ? 14 ASP A CG   9  
ATOM 7301  O OD1  . ASP A 1 14 ? 6.047   8.012   3.299   1.00 0.00 ? 14 ASP A OD1  9  
ATOM 7302  O OD2  . ASP A 1 14 ? 5.652   7.821   5.408   1.00 0.00 ? 14 ASP A OD2  9  
ATOM 7303  H H    . ASP A 1 14 ? 8.479   3.936   3.531   1.00 0.00 ? 14 ASP A H    9  
ATOM 7304  H HA   . ASP A 1 14 ? 6.028   4.857   4.858   1.00 0.00 ? 14 ASP A HA   9  
ATOM 7305  H HB2  . ASP A 1 14 ? 7.758   6.476   5.517   1.00 0.00 ? 14 ASP A HB2  9  
ATOM 7306  H HB3  . ASP A 1 14 ? 8.169   6.731   3.822   1.00 0.00 ? 14 ASP A HB3  9  
ATOM 7307  N N    . LEU A 1 15 ? 5.024   4.631   2.609   1.00 0.00 ? 15 LEU A N    9  
ATOM 7308  C CA   . LEU A 1 15 ? 4.371   4.586   1.303   1.00 0.00 ? 15 LEU A CA   9  
ATOM 7309  C C    . LEU A 1 15 ? 3.043   5.336   1.350   1.00 0.00 ? 15 LEU A C    9  
ATOM 7310  O O    . LEU A 1 15 ? 1.986   4.757   1.095   1.00 0.00 ? 15 LEU A O    9  
ATOM 7311  C CB   . LEU A 1 15 ? 4.116   3.134   0.887   1.00 0.00 ? 15 LEU A CB   9  
ATOM 7312  C CG   . LEU A 1 15 ? 5.382   2.294   1.094   1.00 0.00 ? 15 LEU A CG   9  
ATOM 7313  C CD1  . LEU A 1 15 ? 5.033   0.811   0.970   1.00 0.00 ? 15 LEU A CD1  9  
ATOM 7314  C CD2  . LEU A 1 15 ? 6.425   2.654   0.033   1.00 0.00 ? 15 LEU A CD2  9  
ATOM 7315  H H    . LEU A 1 15 ? 4.542   4.306   3.396   1.00 0.00 ? 15 LEU A H    9  
ATOM 7316  H HA   . LEU A 1 15 ? 5.009   5.054   0.569   1.00 0.00 ? 15 LEU A HA   9  
ATOM 7317  H HB2  . LEU A 1 15 ? 3.315   2.726   1.484   1.00 0.00 ? 15 LEU A HB2  9  
ATOM 7318  H HB3  . LEU A 1 15 ? 3.835   3.104   -0.156  1.00 0.00 ? 15 LEU A HB3  9  
ATOM 7319  H HG   . LEU A 1 15 ? 5.785   2.486   2.078   1.00 0.00 ? 15 LEU A HG   9  
ATOM 7320  H HD11 . LEU A 1 15 ? 4.297   0.551   1.717   1.00 0.00 ? 15 LEU A HD11 9  
ATOM 7321  H HD12 . LEU A 1 15 ? 5.923   0.218   1.118   1.00 0.00 ? 15 LEU A HD12 9  
ATOM 7322  H HD13 . LEU A 1 15 ? 4.631   0.617   -0.013  1.00 0.00 ? 15 LEU A HD13 9  
ATOM 7323  H HD21 . LEU A 1 15 ? 7.225   1.928   0.055   1.00 0.00 ? 15 LEU A HD21 9  
ATOM 7324  H HD22 . LEU A 1 15 ? 6.825   3.636   0.238   1.00 0.00 ? 15 LEU A HD22 9  
ATOM 7325  H HD23 . LEU A 1 15 ? 5.963   2.651   -0.943  1.00 0.00 ? 15 LEU A HD23 9  
ATOM 7326  N N    . SER A 1 16 ? 3.104   6.625   1.677   1.00 0.00 ? 16 SER A N    9  
ATOM 7327  C CA   . SER A 1 16 ? 1.895   7.442   1.753   1.00 0.00 ? 16 SER A CA   9  
ATOM 7328  C C    . SER A 1 16 ? 0.937   7.083   0.623   1.00 0.00 ? 16 SER A C    9  
ATOM 7329  O O    . SER A 1 16 ? -0.243  6.817   0.854   1.00 0.00 ? 16 SER A O    9  
ATOM 7330  C CB   . SER A 1 16 ? 2.261   8.925   1.664   1.00 0.00 ? 16 SER A CB   9  
ATOM 7331  O OG   . SER A 1 16 ? 1.144   9.656   1.176   1.00 0.00 ? 16 SER A OG   9  
ATOM 7332  H H    . SER A 1 16 ? 3.973   7.032   1.870   1.00 0.00 ? 16 SER A H    9  
ATOM 7333  H HA   . SER A 1 16 ? 1.407   7.260   2.699   1.00 0.00 ? 16 SER A HA   9  
ATOM 7334  H HB2  . SER A 1 16 ? 2.528   9.293   2.639   1.00 0.00 ? 16 SER A HB2  9  
ATOM 7335  H HB3  . SER A 1 16 ? 3.103   9.045   0.994   1.00 0.00 ? 16 SER A HB3  9  
ATOM 7336  H HG   . SER A 1 16 ? 0.874   9.264   0.342   1.00 0.00 ? 16 SER A HG   9  
ATOM 7337  N N    . LYS A 1 17 ? 1.458   7.064   -0.598  1.00 0.00 ? 17 LYS A N    9  
ATOM 7338  C CA   . LYS A 1 17 ? 0.651   6.722   -1.761  1.00 0.00 ? 17 LYS A CA   9  
ATOM 7339  C C    . LYS A 1 17 ? 1.561   6.403   -2.943  1.00 0.00 ? 17 LYS A C    9  
ATOM 7340  O O    . LYS A 1 17 ? 2.448   7.186   -3.283  1.00 0.00 ? 17 LYS A O    9  
ATOM 7341  C CB   . LYS A 1 17 ? -0.282  7.892   -2.114  1.00 0.00 ? 17 LYS A CB   9  
ATOM 7342  C CG   . LYS A 1 17 ? -1.730  7.397   -2.242  1.00 0.00 ? 17 LYS A CG   9  
ATOM 7343  C CD   . LYS A 1 17 ? -1.870  6.509   -3.486  1.00 0.00 ? 17 LYS A CD   9  
ATOM 7344  C CE   . LYS A 1 17 ? -2.155  7.378   -4.715  1.00 0.00 ? 17 LYS A CE   9  
ATOM 7345  N NZ   . LYS A 1 17 ? -2.361  6.502   -5.904  1.00 0.00 ? 17 LYS A NZ   9  
ATOM 7346  H H    . LYS A 1 17 ? 2.408   7.273   -0.718  1.00 0.00 ? 17 LYS A H    9  
ATOM 7347  H HA   . LYS A 1 17 ? 0.059   5.849   -1.531  1.00 0.00 ? 17 LYS A HA   9  
ATOM 7348  H HB2  . LYS A 1 17 ? -0.229  8.636   -1.331  1.00 0.00 ? 17 LYS A HB2  9  
ATOM 7349  H HB3  . LYS A 1 17 ? 0.027   8.336   -3.048  1.00 0.00 ? 17 LYS A HB3  9  
ATOM 7350  H HG2  . LYS A 1 17 ? -1.994  6.828   -1.362  1.00 0.00 ? 17 LYS A HG2  9  
ATOM 7351  H HG3  . LYS A 1 17 ? -2.392  8.247   -2.329  1.00 0.00 ? 17 LYS A HG3  9  
ATOM 7352  H HD2  . LYS A 1 17 ? -0.956  5.955   -3.642  1.00 0.00 ? 17 LYS A HD2  9  
ATOM 7353  H HD3  . LYS A 1 17 ? -2.687  5.817   -3.343  1.00 0.00 ? 17 LYS A HD3  9  
ATOM 7354  H HE2  . LYS A 1 17 ? -3.046  7.965   -4.545  1.00 0.00 ? 17 LYS A HE2  9  
ATOM 7355  H HE3  . LYS A 1 17 ? -1.319  8.036   -4.894  1.00 0.00 ? 17 LYS A HE3  9  
ATOM 7356  H HZ1  . LYS A 1 17 ? -2.534  5.526   -5.591  1.00 0.00 ? 17 LYS A HZ1  9  
ATOM 7357  H HZ2  . LYS A 1 17 ? -1.510  6.525   -6.503  1.00 0.00 ? 17 LYS A HZ2  9  
ATOM 7358  H HZ3  . LYS A 1 17 ? -3.178  6.845   -6.449  1.00 0.00 ? 17 LYS A HZ3  9  
ATOM 7359  N N    . TRP A 1 18 ? 1.335   5.249   -3.562  1.00 0.00 ? 18 TRP A N    9  
ATOM 7360  C CA   . TRP A 1 18 ? 2.138   4.823   -4.706  1.00 0.00 ? 18 TRP A CA   9  
ATOM 7361  C C    . TRP A 1 18 ? 1.239   4.603   -5.920  1.00 0.00 ? 18 TRP A C    9  
ATOM 7362  O O    . TRP A 1 18 ? 0.015   4.552   -5.794  1.00 0.00 ? 18 TRP A O    9  
ATOM 7363  C CB   . TRP A 1 18 ? 2.867   3.512   -4.364  1.00 0.00 ? 18 TRP A CB   9  
ATOM 7364  C CG   . TRP A 1 18 ? 4.241   3.789   -3.831  1.00 0.00 ? 18 TRP A CG   9  
ATOM 7365  C CD1  . TRP A 1 18 ? 4.577   4.819   -3.020  1.00 0.00 ? 18 TRP A CD1  9  
ATOM 7366  C CD2  . TRP A 1 18 ? 5.468   3.033   -4.053  1.00 0.00 ? 18 TRP A CD2  9  
ATOM 7367  N NE1  . TRP A 1 18 ? 5.929   4.746   -2.736  1.00 0.00 ? 18 TRP A NE1  9  
ATOM 7368  C CE2  . TRP A 1 18 ? 6.521   3.662   -3.349  1.00 0.00 ? 18 TRP A CE2  9  
ATOM 7369  C CE3  . TRP A 1 18 ? 5.764   1.873   -4.791  1.00 0.00 ? 18 TRP A CE3  9  
ATOM 7370  C CZ2  . TRP A 1 18 ? 7.823   3.157   -3.377  1.00 0.00 ? 18 TRP A CZ2  9  
ATOM 7371  C CZ3  . TRP A 1 18 ? 7.072   1.364   -4.820  1.00 0.00 ? 18 TRP A CZ3  9  
ATOM 7372  C CH2  . TRP A 1 18 ? 8.100   2.005   -4.115  1.00 0.00 ? 18 TRP A CH2  9  
ATOM 7373  H H    . TRP A 1 18 ? 0.614   4.668   -3.242  1.00 0.00 ? 18 TRP A H    9  
ATOM 7374  H HA   . TRP A 1 18 ? 2.868   5.584   -4.939  1.00 0.00 ? 18 TRP A HA   9  
ATOM 7375  H HB2  . TRP A 1 18 ? 2.300   2.977   -3.616  1.00 0.00 ? 18 TRP A HB2  9  
ATOM 7376  H HB3  . TRP A 1 18 ? 2.946   2.903   -5.254  1.00 0.00 ? 18 TRP A HB3  9  
ATOM 7377  H HD1  . TRP A 1 18 ? 3.905   5.577   -2.655  1.00 0.00 ? 18 TRP A HD1  9  
ATOM 7378  H HE1  . TRP A 1 18 ? 6.423   5.375   -2.170  1.00 0.00 ? 18 TRP A HE1  9  
ATOM 7379  H HE3  . TRP A 1 18 ? 4.982   1.371   -5.337  1.00 0.00 ? 18 TRP A HE3  9  
ATOM 7380  H HZ2  . TRP A 1 18 ? 8.610   3.655   -2.830  1.00 0.00 ? 18 TRP A HZ2  9  
ATOM 7381  H HZ3  . TRP A 1 18 ? 7.286   0.475   -5.392  1.00 0.00 ? 18 TRP A HZ3  9  
ATOM 7382  H HH2  . TRP A 1 18 ? 9.103   1.608   -4.143  1.00 0.00 ? 18 TRP A HH2  9  
ATOM 7383  N N    . LYS A 1 19 ? 1.849   4.470   -7.094  1.00 0.00 ? 19 LYS A N    9  
ATOM 7384  C CA   . LYS A 1 19 ? 1.088   4.249   -8.320  1.00 0.00 ? 19 LYS A CA   9  
ATOM 7385  C C    . LYS A 1 19 ? 1.111   2.771   -8.700  1.00 0.00 ? 19 LYS A C    9  
ATOM 7386  O O    . LYS A 1 19 ? 1.947   2.009   -8.213  1.00 0.00 ? 19 LYS A O    9  
ATOM 7387  C CB   . LYS A 1 19 ? 1.670   5.087   -9.464  1.00 0.00 ? 19 LYS A CB   9  
ATOM 7388  C CG   . LYS A 1 19 ? 2.105   6.455   -8.930  1.00 0.00 ? 19 LYS A CG   9  
ATOM 7389  C CD   . LYS A 1 19 ? 0.905   7.163   -8.301  1.00 0.00 ? 19 LYS A CD   9  
ATOM 7390  C CE   . LYS A 1 19 ? 1.238   8.640   -8.087  1.00 0.00 ? 19 LYS A CE   9  
ATOM 7391  N NZ   . LYS A 1 19 ? 1.428   9.303   -9.408  1.00 0.00 ? 19 LYS A NZ   9  
ATOM 7392  H H    . LYS A 1 19 ? 2.828   4.515   -7.136  1.00 0.00 ? 19 LYS A H    9  
ATOM 7393  H HA   . LYS A 1 19 ? 0.063   4.550   -8.158  1.00 0.00 ? 19 LYS A HA   9  
ATOM 7394  H HB2  . LYS A 1 19 ? 2.524   4.578   -9.887  1.00 0.00 ? 19 LYS A HB2  9  
ATOM 7395  H HB3  . LYS A 1 19 ? 0.921   5.225   -10.228 1.00 0.00 ? 19 LYS A HB3  9  
ATOM 7396  H HG2  . LYS A 1 19 ? 2.877   6.323   -8.188  1.00 0.00 ? 19 LYS A HG2  9  
ATOM 7397  H HG3  . LYS A 1 19 ? 2.487   7.052   -9.744  1.00 0.00 ? 19 LYS A HG3  9  
ATOM 7398  H HD2  . LYS A 1 19 ? 0.050   7.076   -8.958  1.00 0.00 ? 19 LYS A HD2  9  
ATOM 7399  H HD3  . LYS A 1 19 ? 0.675   6.708   -7.350  1.00 0.00 ? 19 LYS A HD3  9  
ATOM 7400  H HE2  . LYS A 1 19 ? 0.427   9.119   -7.558  1.00 0.00 ? 19 LYS A HE2  9  
ATOM 7401  H HE3  . LYS A 1 19 ? 2.145   8.725   -7.508  1.00 0.00 ? 19 LYS A HE3  9  
ATOM 7402  H HZ1  . LYS A 1 19 ? 0.937   8.757   -10.145 1.00 0.00 ? 19 LYS A HZ1  9  
ATOM 7403  H HZ2  . LYS A 1 19 ? 2.443   9.347   -9.631  1.00 0.00 ? 19 LYS A HZ2  9  
ATOM 7404  H HZ3  . LYS A 1 19 ? 1.037   10.267  -9.373  1.00 0.00 ? 19 LYS A HZ3  9  
ATOM 7405  N N    . TYR A 1 20 ? 0.190   2.370   -9.567  1.00 0.00 ? 20 TYR A N    9  
ATOM 7406  C CA   . TYR A 1 20 ? 0.117   0.979   -9.999  1.00 0.00 ? 20 TYR A CA   9  
ATOM 7407  C C    . TYR A 1 20 ? 1.364   0.598   -10.794 1.00 0.00 ? 20 TYR A C    9  
ATOM 7408  O O    . TYR A 1 20 ? 1.892   -0.506  -10.648 1.00 0.00 ? 20 TYR A O    9  
ATOM 7409  C CB   . TYR A 1 20 ? -1.130  0.768   -10.865 1.00 0.00 ? 20 TYR A CB   9  
ATOM 7410  C CG   . TYR A 1 20 ? -1.329  1.968   -11.760 1.00 0.00 ? 20 TYR A CG   9  
ATOM 7411  C CD1  . TYR A 1 20 ? -0.714  2.015   -13.017 1.00 0.00 ? 20 TYR A CD1  9  
ATOM 7412  C CD2  . TYR A 1 20 ? -2.130  3.033   -11.333 1.00 0.00 ? 20 TYR A CD2  9  
ATOM 7413  C CE1  . TYR A 1 20 ? -0.900  3.127   -13.846 1.00 0.00 ? 20 TYR A CE1  9  
ATOM 7414  C CE2  . TYR A 1 20 ? -2.316  4.145   -12.162 1.00 0.00 ? 20 TYR A CE2  9  
ATOM 7415  C CZ   . TYR A 1 20 ? -1.701  4.193   -13.419 1.00 0.00 ? 20 TYR A CZ   9  
ATOM 7416  O OH   . TYR A 1 20 ? -1.884  5.290   -14.236 1.00 0.00 ? 20 TYR A OH   9  
ATOM 7417  H H    . TYR A 1 20 ? -0.454  3.019   -9.921  1.00 0.00 ? 20 TYR A H    9  
ATOM 7418  H HA   . TYR A 1 20 ? 0.046   0.345   -9.129  1.00 0.00 ? 20 TYR A HA   9  
ATOM 7419  H HB2  . TYR A 1 20 ? -1.005  -0.117  -11.470 1.00 0.00 ? 20 TYR A HB2  9  
ATOM 7420  H HB3  . TYR A 1 20 ? -1.994  0.648   -10.229 1.00 0.00 ? 20 TYR A HB3  9  
ATOM 7421  H HD1  . TYR A 1 20 ? -0.095  1.191   -13.346 1.00 0.00 ? 20 TYR A HD1  9  
ATOM 7422  H HD2  . TYR A 1 20 ? -2.605  2.997   -10.363 1.00 0.00 ? 20 TYR A HD2  9  
ATOM 7423  H HE1  . TYR A 1 20 ? -0.424  3.162   -14.815 1.00 0.00 ? 20 TYR A HE1  9  
ATOM 7424  H HE2  . TYR A 1 20 ? -2.934  4.968   -11.832 1.00 0.00 ? 20 TYR A HE2  9  
ATOM 7425  H HH   . TYR A 1 20 ? -1.836  6.077   -13.690 1.00 0.00 ? 20 TYR A HH   9  
ATOM 7426  N N    . ALA A 1 21 ? 1.822   1.517   -11.635 1.00 0.00 ? 21 ALA A N    9  
ATOM 7427  C CA   . ALA A 1 21 ? 3.003   1.272   -12.457 1.00 0.00 ? 21 ALA A CA   9  
ATOM 7428  C C    . ALA A 1 21 ? 4.218   0.951   -11.591 1.00 0.00 ? 21 ALA A C    9  
ATOM 7429  O O    . ALA A 1 21 ? 4.831   -0.107  -11.735 1.00 0.00 ? 21 ALA A O    9  
ATOM 7430  C CB   . ALA A 1 21 ? 3.301   2.501   -13.317 1.00 0.00 ? 21 ALA A CB   9  
ATOM 7431  H H    . ALA A 1 21 ? 1.356   2.375   -11.709 1.00 0.00 ? 21 ALA A H    9  
ATOM 7432  H HA   . ALA A 1 21 ? 2.807   0.435   -13.107 1.00 0.00 ? 21 ALA A HA   9  
ATOM 7433  H HB1  . ALA A 1 21 ? 4.226   2.350   -13.854 1.00 0.00 ? 21 ALA A HB1  9  
ATOM 7434  H HB2  . ALA A 1 21 ? 3.392   3.371   -12.683 1.00 0.00 ? 21 ALA A HB2  9  
ATOM 7435  H HB3  . ALA A 1 21 ? 2.496   2.651   -14.020 1.00 0.00 ? 21 ALA A HB3  9  
ATOM 7436  N N    . GLU A 1 22 ? 4.572   1.872   -10.700 1.00 0.00 ? 22 GLU A N    9  
ATOM 7437  C CA   . GLU A 1 22 ? 5.725   1.673   -9.830  1.00 0.00 ? 22 GLU A CA   9  
ATOM 7438  C C    . GLU A 1 22 ? 5.513   0.474   -8.909  1.00 0.00 ? 22 GLU A C    9  
ATOM 7439  O O    . GLU A 1 22 ? 6.449   -0.276  -8.631  1.00 0.00 ? 22 GLU A O    9  
ATOM 7440  C CB   . GLU A 1 22 ? 5.978   2.928   -8.992  1.00 0.00 ? 22 GLU A CB   9  
ATOM 7441  C CG   . GLU A 1 22 ? 4.764   3.205   -8.104  1.00 0.00 ? 22 GLU A CG   9  
ATOM 7442  C CD   . GLU A 1 22 ? 4.897   4.577   -7.453  1.00 0.00 ? 22 GLU A CD   9  
ATOM 7443  O OE1  . GLU A 1 22 ? 5.308   5.499   -8.138  1.00 0.00 ? 22 GLU A OE1  9  
ATOM 7444  O OE2  . GLU A 1 22 ? 4.588   4.686   -6.278  1.00 0.00 ? 22 GLU A OE2  9  
ATOM 7445  H H    . GLU A 1 22 ? 4.052   2.701   -10.631 1.00 0.00 ? 22 GLU A H    9  
ATOM 7446  H HA   . GLU A 1 22 ? 6.593   1.488   -10.443 1.00 0.00 ? 22 GLU A HA   9  
ATOM 7447  H HB2  . GLU A 1 22 ? 6.850   2.778   -8.372  1.00 0.00 ? 22 GLU A HB2  9  
ATOM 7448  H HB3  . GLU A 1 22 ? 6.142   3.770   -9.646  1.00 0.00 ? 22 GLU A HB3  9  
ATOM 7449  H HG2  . GLU A 1 22 ? 3.869   3.178   -8.706  1.00 0.00 ? 22 GLU A HG2  9  
ATOM 7450  H HG3  . GLU A 1 22 ? 4.702   2.450   -7.336  1.00 0.00 ? 22 GLU A HG3  9  
ATOM 7451  N N    . LEU A 1 23 ? 4.283   0.294   -8.438  1.00 0.00 ? 23 LEU A N    9  
ATOM 7452  C CA   . LEU A 1 23 ? 3.982   -0.824  -7.549  1.00 0.00 ? 23 LEU A CA   9  
ATOM 7453  C C    . LEU A 1 23 ? 4.390   -2.144  -8.200  1.00 0.00 ? 23 LEU A C    9  
ATOM 7454  O O    . LEU A 1 23 ? 5.169   -2.911  -7.636  1.00 0.00 ? 23 LEU A O    9  
ATOM 7455  C CB   . LEU A 1 23 ? 2.477   -0.853  -7.233  1.00 0.00 ? 23 LEU A CB   9  
ATOM 7456  C CG   . LEU A 1 23 ? 2.205   -0.178  -5.882  1.00 0.00 ? 23 LEU A CG   9  
ATOM 7457  C CD1  . LEU A 1 23 ? 0.751   0.294   -5.829  1.00 0.00 ? 23 LEU A CD1  9  
ATOM 7458  C CD2  . LEU A 1 23 ? 2.454   -1.176  -4.748  1.00 0.00 ? 23 LEU A CD2  9  
ATOM 7459  H H    . LEU A 1 23 ? 3.571   0.918   -8.689  1.00 0.00 ? 23 LEU A H    9  
ATOM 7460  H HA   . LEU A 1 23 ? 4.536   -0.701  -6.631  1.00 0.00 ? 23 LEU A HA   9  
ATOM 7461  H HB2  . LEU A 1 23 ? 1.943   -0.329  -8.010  1.00 0.00 ? 23 LEU A HB2  9  
ATOM 7462  H HB3  . LEU A 1 23 ? 2.135   -1.878  -7.196  1.00 0.00 ? 23 LEU A HB3  9  
ATOM 7463  H HG   . LEU A 1 23 ? 2.861   0.671   -5.766  1.00 0.00 ? 23 LEU A HG   9  
ATOM 7464  H HD11 . LEU A 1 23 ? 0.103   -0.492  -6.188  1.00 0.00 ? 23 LEU A HD11 9  
ATOM 7465  H HD12 . LEU A 1 23 ? 0.633   1.170   -6.450  1.00 0.00 ? 23 LEU A HD12 9  
ATOM 7466  H HD13 . LEU A 1 23 ? 0.489   0.538   -4.809  1.00 0.00 ? 23 LEU A HD13 9  
ATOM 7467  H HD21 . LEU A 1 23 ? 1.638   -1.883  -4.702  1.00 0.00 ? 23 LEU A HD21 9  
ATOM 7468  H HD22 . LEU A 1 23 ? 2.523   -0.646  -3.810  1.00 0.00 ? 23 LEU A HD22 9  
ATOM 7469  H HD23 . LEU A 1 23 ? 3.377   -1.706  -4.928  1.00 0.00 ? 23 LEU A HD23 9  
ATOM 7470  N N    . ARG A 1 24 ? 3.859   -2.398  -9.392  1.00 0.00 ? 24 ARG A N    9  
ATOM 7471  C CA   . ARG A 1 24 ? 4.173   -3.628  -10.108 1.00 0.00 ? 24 ARG A CA   9  
ATOM 7472  C C    . ARG A 1 24 ? 5.662   -3.706  -10.426 1.00 0.00 ? 24 ARG A C    9  
ATOM 7473  O O    . ARG A 1 24 ? 6.314   -4.714  -10.156 1.00 0.00 ? 24 ARG A O    9  
ATOM 7474  C CB   . ARG A 1 24 ? 3.369   -3.694  -11.408 1.00 0.00 ? 24 ARG A CB   9  
ATOM 7475  C CG   . ARG A 1 24 ? 3.510   -5.086  -12.027 1.00 0.00 ? 24 ARG A CG   9  
ATOM 7476  C CD   . ARG A 1 24 ? 2.554   -5.217  -13.214 1.00 0.00 ? 24 ARG A CD   9  
ATOM 7477  N NE   . ARG A 1 24 ? 2.725   -4.091  -14.126 1.00 0.00 ? 24 ARG A NE   9  
ATOM 7478  C CZ   . ARG A 1 24 ? 1.815   -3.817  -15.055 1.00 0.00 ? 24 ARG A CZ   9  
ATOM 7479  N NH1  . ARG A 1 24 ? 0.748   -4.559  -15.163 1.00 0.00 ? 24 ARG A NH1  9  
ATOM 7480  N NH2  . ARG A 1 24 ? 1.990   -2.804  -15.859 1.00 0.00 ? 24 ARG A NH2  9  
ATOM 7481  H H    . ARG A 1 24 ? 3.245   -1.749  -9.795  1.00 0.00 ? 24 ARG A H    9  
ATOM 7482  H HA   . ARG A 1 24 ? 3.903   -4.472  -9.490  1.00 0.00 ? 24 ARG A HA   9  
ATOM 7483  H HB2  . ARG A 1 24 ? 2.328   -3.497  -11.197 1.00 0.00 ? 24 ARG A HB2  9  
ATOM 7484  H HB3  . ARG A 1 24 ? 3.743   -2.956  -12.101 1.00 0.00 ? 24 ARG A HB3  9  
ATOM 7485  H HG2  . ARG A 1 24 ? 4.527   -5.228  -12.365 1.00 0.00 ? 24 ARG A HG2  9  
ATOM 7486  H HG3  . ARG A 1 24 ? 3.269   -5.835  -11.289 1.00 0.00 ? 24 ARG A HG3  9  
ATOM 7487  H HD2  . ARG A 1 24 ? 2.762   -6.135  -13.740 1.00 0.00 ? 24 ARG A HD2  9  
ATOM 7488  H HD3  . ARG A 1 24 ? 1.536   -5.236  -12.852 1.00 0.00 ? 24 ARG A HD3  9  
ATOM 7489  H HE   . ARG A 1 24 ? 3.523   -3.528  -14.051 1.00 0.00 ? 24 ARG A HE   9  
ATOM 7490  H HH11 . ARG A 1 24 ? 0.614   -5.335  -14.547 1.00 0.00 ? 24 ARG A HH11 9  
ATOM 7491  H HH12 . ARG A 1 24 ? 0.064   -4.352  -15.863 1.00 0.00 ? 24 ARG A HH12 9  
ATOM 7492  H HH21 . ARG A 1 24 ? 2.808   -2.234  -15.776 1.00 0.00 ? 24 ARG A HH21 9  
ATOM 7493  H HH22 . ARG A 1 24 ? 1.305   -2.597  -16.559 1.00 0.00 ? 24 ARG A HH22 9  
ATOM 7494  N N    . ASP A 1 25 ? 6.195   -2.638  -11.003 1.00 0.00 ? 25 ASP A N    9  
ATOM 7495  C CA   . ASP A 1 25 ? 7.606   -2.604  -11.358 1.00 0.00 ? 25 ASP A CA   9  
ATOM 7496  C C    . ASP A 1 25 ? 8.478   -2.882  -10.137 1.00 0.00 ? 25 ASP A C    9  
ATOM 7497  O O    . ASP A 1 25 ? 9.328   -3.772  -10.160 1.00 0.00 ? 25 ASP A O    9  
ATOM 7498  C CB   . ASP A 1 25 ? 7.965   -1.238  -11.944 1.00 0.00 ? 25 ASP A CB   9  
ATOM 7499  C CG   . ASP A 1 25 ? 9.317   -1.312  -12.646 1.00 0.00 ? 25 ASP A CG   9  
ATOM 7500  O OD1  . ASP A 1 25 ? 9.342   -1.697  -13.804 1.00 0.00 ? 25 ASP A OD1  9  
ATOM 7501  O OD2  . ASP A 1 25 ? 10.309  -0.981  -12.015 1.00 0.00 ? 25 ASP A OD2  9  
ATOM 7502  H H    . ASP A 1 25 ? 5.628   -1.862  -11.201 1.00 0.00 ? 25 ASP A H    9  
ATOM 7503  H HA   . ASP A 1 25 ? 7.795   -3.362  -12.100 1.00 0.00 ? 25 ASP A HA   9  
ATOM 7504  H HB2  . ASP A 1 25 ? 7.208   -0.943  -12.655 1.00 0.00 ? 25 ASP A HB2  9  
ATOM 7505  H HB3  . ASP A 1 25 ? 8.015   -0.509  -11.149 1.00 0.00 ? 25 ASP A HB3  9  
ATOM 7506  N N    . THR A 1 26 ? 8.269   -2.111  -9.078  1.00 0.00 ? 26 THR A N    9  
ATOM 7507  C CA   . THR A 1 26 ? 9.052   -2.279  -7.859  1.00 0.00 ? 26 THR A CA   9  
ATOM 7508  C C    . THR A 1 26 ? 8.921   -3.694  -7.301  1.00 0.00 ? 26 THR A C    9  
ATOM 7509  O O    . THR A 1 26 ? 9.877   -4.240  -6.752  1.00 0.00 ? 26 THR A O    9  
ATOM 7510  C CB   . THR A 1 26 ? 8.601   -1.273  -6.801  1.00 0.00 ? 26 THR A CB   9  
ATOM 7511  O OG1  . THR A 1 26 ? 8.441   0.005   -7.401  1.00 0.00 ? 26 THR A OG1  9  
ATOM 7512  C CG2  . THR A 1 26 ? 9.655   -1.194  -5.697  1.00 0.00 ? 26 THR A CG2  9  
ATOM 7513  H H    . THR A 1 26 ? 7.581   -1.414  -9.117  1.00 0.00 ? 26 THR A H    9  
ATOM 7514  H HA   . THR A 1 26 ? 10.091  -2.094  -8.088  1.00 0.00 ? 26 THR A HA   9  
ATOM 7515  H HB   . THR A 1 26 ? 7.663   -1.593  -6.376  1.00 0.00 ? 26 THR A HB   9  
ATOM 7516  H HG1  . THR A 1 26 ? 9.035   0.056   -8.154  1.00 0.00 ? 26 THR A HG1  9  
ATOM 7517  H HG21 . THR A 1 26 ? 9.289   -0.574  -4.892  1.00 0.00 ? 26 THR A HG21 9  
ATOM 7518  H HG22 . THR A 1 26 ? 10.563  -0.766  -6.096  1.00 0.00 ? 26 THR A HG22 9  
ATOM 7519  H HG23 . THR A 1 26 ? 9.859   -2.186  -5.324  1.00 0.00 ? 26 THR A HG23 9  
ATOM 7520  N N    . ILE A 1 27 ? 7.734   -4.283  -7.430  1.00 0.00 ? 27 ILE A N    9  
ATOM 7521  C CA   . ILE A 1 27 ? 7.517   -5.633  -6.911  1.00 0.00 ? 27 ILE A CA   9  
ATOM 7522  C C    . ILE A 1 27 ? 8.112   -6.678  -7.854  1.00 0.00 ? 27 ILE A C    9  
ATOM 7523  O O    . ILE A 1 27 ? 8.387   -7.806  -7.445  1.00 0.00 ? 27 ILE A O    9  
ATOM 7524  C CB   . ILE A 1 27 ? 6.010   -5.885  -6.700  1.00 0.00 ? 27 ILE A CB   9  
ATOM 7525  C CG1  . ILE A 1 27 ? 5.789   -6.547  -5.331  1.00 0.00 ? 27 ILE A CG1  9  
ATOM 7526  C CG2  . ILE A 1 27 ? 5.450   -6.798  -7.800  1.00 0.00 ? 27 ILE A CG2  9  
ATOM 7527  C CD1  . ILE A 1 27 ? 4.328   -6.981  -5.192  1.00 0.00 ? 27 ILE A CD1  9  
ATOM 7528  H H    . ILE A 1 27 ? 6.997   -3.804  -7.869  1.00 0.00 ? 27 ILE A H    9  
ATOM 7529  H HA   . ILE A 1 27 ? 8.018   -5.713  -5.957  1.00 0.00 ? 27 ILE A HA   9  
ATOM 7530  H HB   . ILE A 1 27 ? 5.486   -4.942  -6.723  1.00 0.00 ? 27 ILE A HB   9  
ATOM 7531  H HG12 . ILE A 1 27 ? 6.431   -7.410  -5.242  1.00 0.00 ? 27 ILE A HG12 9  
ATOM 7532  H HG13 . ILE A 1 27 ? 6.029   -5.841  -4.549  1.00 0.00 ? 27 ILE A HG13 9  
ATOM 7533  H HG21 . ILE A 1 27 ? 5.804   -7.806  -7.647  1.00 0.00 ? 27 ILE A HG21 9  
ATOM 7534  H HG22 . ILE A 1 27 ? 5.776   -6.443  -8.765  1.00 0.00 ? 27 ILE A HG22 9  
ATOM 7535  H HG23 . ILE A 1 27 ? 4.371   -6.787  -7.761  1.00 0.00 ? 27 ILE A HG23 9  
ATOM 7536  H HD11 . ILE A 1 27 ? 4.082   -7.086  -4.145  1.00 0.00 ? 27 ILE A HD11 9  
ATOM 7537  H HD12 . ILE A 1 27 ? 4.185   -7.928  -5.690  1.00 0.00 ? 27 ILE A HD12 9  
ATOM 7538  H HD13 . ILE A 1 27 ? 3.685   -6.238  -5.639  1.00 0.00 ? 27 ILE A HD13 9  
ATOM 7539  N N    . ASN A 1 28 ? 8.307   -6.300  -9.117  1.00 0.00 ? 28 ASN A N    9  
ATOM 7540  C CA   . ASN A 1 28 ? 8.868   -7.224  -10.102 1.00 0.00 ? 28 ASN A CA   9  
ATOM 7541  C C    . ASN A 1 28 ? 10.327  -6.881  -10.406 1.00 0.00 ? 28 ASN A C    9  
ATOM 7542  O O    . ASN A 1 28 ? 10.991  -7.587  -11.166 1.00 0.00 ? 28 ASN A O    9  
ATOM 7543  C CB   . ASN A 1 28 ? 8.028   -7.184  -11.390 1.00 0.00 ? 28 ASN A CB   9  
ATOM 7544  C CG   . ASN A 1 28 ? 8.775   -6.456  -12.505 1.00 0.00 ? 28 ASN A CG   9  
ATOM 7545  O OD1  . ASN A 1 28 ? 8.966   -7.006  -13.589 1.00 0.00 ? 28 ASN A OD1  9  
ATOM 7546  N ND2  . ASN A 1 28 ? 9.212   -5.246  -12.300 1.00 0.00 ? 28 ASN A ND2  9  
ATOM 7547  H H    . ASN A 1 28 ? 8.068   -5.390  -9.390  1.00 0.00 ? 28 ASN A H    9  
ATOM 7548  H HA   . ASN A 1 28 ? 8.830   -8.226  -9.698  1.00 0.00 ? 28 ASN A HA   9  
ATOM 7549  H HB2  . ASN A 1 28 ? 7.812   -8.193  -11.710 1.00 0.00 ? 28 ASN A HB2  9  
ATOM 7550  H HB3  . ASN A 1 28 ? 7.101   -6.669  -11.192 1.00 0.00 ? 28 ASN A HB3  9  
ATOM 7551  H HD21 . ASN A 1 28 ? 9.059   -4.811  -11.434 1.00 0.00 ? 28 ASN A HD21 9  
ATOM 7552  H HD22 . ASN A 1 28 ? 9.691   -4.772  -13.009 1.00 0.00 ? 28 ASN A HD22 9  
ATOM 7553  N N    . THR A 1 29 ? 10.824  -5.800  -9.805  1.00 0.00 ? 29 THR A N    9  
ATOM 7554  C CA   . THR A 1 29 ? 12.212  -5.385  -10.020 1.00 0.00 ? 29 THR A CA   9  
ATOM 7555  C C    . THR A 1 29 ? 12.995  -5.458  -8.715  1.00 0.00 ? 29 THR A C    9  
ATOM 7556  O O    . THR A 1 29 ? 14.094  -6.012  -8.669  1.00 0.00 ? 29 THR A O    9  
ATOM 7557  C CB   . THR A 1 29 ? 12.262  -3.951  -10.562 1.00 0.00 ? 29 THR A CB   9  
ATOM 7558  O OG1  . THR A 1 29 ? 11.501  -3.102  -9.715  1.00 0.00 ? 29 THR A OG1  9  
ATOM 7559  C CG2  . THR A 1 29 ? 11.692  -3.901  -11.987 1.00 0.00 ? 29 THR A CG2  9  
ATOM 7560  H H    . THR A 1 29 ? 10.251  -5.277  -9.205  1.00 0.00 ? 29 THR A H    9  
ATOM 7561  H HA   . THR A 1 29 ? 12.674  -6.046  -10.737 1.00 0.00 ? 29 THR A HA   9  
ATOM 7562  H HB   . THR A 1 29 ? 13.288  -3.613  -10.578 1.00 0.00 ? 29 THR A HB   9  
ATOM 7563  H HG1  . THR A 1 29 ? 10.803  -3.626  -9.318  1.00 0.00 ? 29 THR A HG1  9  
ATOM 7564  H HG21 . THR A 1 29 ? 10.729  -3.411  -11.971 1.00 0.00 ? 29 THR A HG21 9  
ATOM 7565  H HG22 . THR A 1 29 ? 11.579  -4.904  -12.374 1.00 0.00 ? 29 THR A HG22 9  
ATOM 7566  H HG23 . THR A 1 29 ? 12.363  -3.346  -12.626 1.00 0.00 ? 29 THR A HG23 9  
ATOM 7567  N N    . SER A 1 30 ? 12.423  -4.898  -7.655  1.00 0.00 ? 30 SER A N    9  
ATOM 7568  C CA   . SER A 1 30 ? 13.076  -4.907  -6.350  1.00 0.00 ? 30 SER A CA   9  
ATOM 7569  C C    . SER A 1 30 ? 12.625  -6.123  -5.545  1.00 0.00 ? 30 SER A C    9  
ATOM 7570  O O    . SER A 1 30 ? 11.676  -6.809  -5.921  1.00 0.00 ? 30 SER A O    9  
ATOM 7571  C CB   . SER A 1 30 ? 12.735  -3.621  -5.590  1.00 0.00 ? 30 SER A CB   9  
ATOM 7572  O OG   . SER A 1 30 ? 13.811  -2.701  -5.725  1.00 0.00 ? 30 SER A OG   9  
ATOM 7573  H H    . SER A 1 30 ? 11.544  -4.473  -7.750  1.00 0.00 ? 30 SER A H    9  
ATOM 7574  H HA   . SER A 1 30 ? 14.145  -4.956  -6.491  1.00 0.00 ? 30 SER A HA   9  
ATOM 7575  H HB2  . SER A 1 30 ? 11.843  -3.182  -6.005  1.00 0.00 ? 30 SER A HB2  9  
ATOM 7576  H HB3  . SER A 1 30 ? 12.572  -3.848  -4.546  1.00 0.00 ? 30 SER A HB3  9  
ATOM 7577  H HG   . SER A 1 30 ? 14.009  -2.347  -4.855  1.00 0.00 ? 30 SER A HG   9  
ATOM 7578  N N    . CYS A 1 31 ? 13.311  -6.382  -4.435  1.00 0.00 ? 31 CYS A N    9  
ATOM 7579  C CA   . CYS A 1 31 ? 12.965  -7.520  -3.592  1.00 0.00 ? 31 CYS A CA   9  
ATOM 7580  C C    . CYS A 1 31 ? 13.492  -7.323  -2.175  1.00 0.00 ? 31 CYS A C    9  
ATOM 7581  O O    . CYS A 1 31 ? 14.688  -7.122  -1.967  1.00 0.00 ? 31 CYS A O    9  
ATOM 7582  C CB   . CYS A 1 31 ? 13.553  -8.804  -4.183  1.00 0.00 ? 31 CYS A CB   9  
ATOM 7583  S SG   . CYS A 1 31 ? 12.837  -10.237 -3.342  1.00 0.00 ? 31 CYS A SG   9  
ATOM 7584  H H    . CYS A 1 31 ? 14.058  -5.802  -4.182  1.00 0.00 ? 31 CYS A H    9  
ATOM 7585  H HA   . CYS A 1 31 ? 11.890  -7.616  -3.555  1.00 0.00 ? 31 CYS A HA   9  
ATOM 7586  H HB2  . CYS A 1 31 ? 13.324  -8.853  -5.237  1.00 0.00 ? 31 CYS A HB2  9  
ATOM 7587  H HB3  . CYS A 1 31 ? 14.624  -8.804  -4.047  1.00 0.00 ? 31 CYS A HB3  9  
ATOM 7588  H HG   . CYS A 1 31 ? 13.295  -10.350 -2.505  1.00 0.00 ? 31 CYS A HG   9  
ATOM 7589  N N    . ASP A 1 32 ? 12.588  -7.393  -1.206  1.00 0.00 ? 32 ASP A N    9  
ATOM 7590  C CA   . ASP A 1 32 ? 12.961  -7.230  0.195   1.00 0.00 ? 32 ASP A CA   9  
ATOM 7591  C C    . ASP A 1 32 ? 11.754  -7.490  1.090   1.00 0.00 ? 32 ASP A C    9  
ATOM 7592  O O    . ASP A 1 32 ? 10.664  -6.974  0.841   1.00 0.00 ? 32 ASP A O    9  
ATOM 7593  C CB   . ASP A 1 32 ? 13.497  -5.813  0.442   1.00 0.00 ? 32 ASP A CB   9  
ATOM 7594  C CG   . ASP A 1 32 ? 14.580  -5.840  1.518   1.00 0.00 ? 32 ASP A CG   9  
ATOM 7595  O OD1  . ASP A 1 32 ? 14.253  -6.145  2.653   1.00 0.00 ? 32 ASP A OD1  9  
ATOM 7596  O OD2  . ASP A 1 32 ? 15.721  -5.555  1.190   1.00 0.00 ? 32 ASP A OD2  9  
ATOM 7597  H H    . ASP A 1 32 ? 11.650  -7.561  -1.435  1.00 0.00 ? 32 ASP A H    9  
ATOM 7598  H HA   . ASP A 1 32 ? 13.733  -7.946  0.435   1.00 0.00 ? 32 ASP A HA   9  
ATOM 7599  H HB2  . ASP A 1 32 ? 13.915  -5.423  -0.474  1.00 0.00 ? 32 ASP A HB2  9  
ATOM 7600  H HB3  . ASP A 1 32 ? 12.691  -5.174  0.767   1.00 0.00 ? 32 ASP A HB3  9  
ATOM 7601  N N    . ILE A 1 33 ? 11.953  -8.295  2.129   1.00 0.00 ? 33 ILE A N    9  
ATOM 7602  C CA   . ILE A 1 33 ? 10.871  -8.619  3.052   1.00 0.00 ? 33 ILE A CA   9  
ATOM 7603  C C    . ILE A 1 33 ? 9.989   -7.398  3.302   1.00 0.00 ? 33 ILE A C    9  
ATOM 7604  O O    . ILE A 1 33 ? 8.767   -7.512  3.392   1.00 0.00 ? 33 ILE A O    9  
ATOM 7605  C CB   . ILE A 1 33 ? 11.452  -9.112  4.384   1.00 0.00 ? 33 ILE A CB   9  
ATOM 7606  C CG1  . ILE A 1 33 ? 12.681  -8.265  4.753   1.00 0.00 ? 33 ILE A CG1  9  
ATOM 7607  C CG2  . ILE A 1 33 ? 11.863  -10.581 4.250   1.00 0.00 ? 33 ILE A CG2  9  
ATOM 7608  C CD1  . ILE A 1 33 ? 12.805  -8.174  6.276   1.00 0.00 ? 33 ILE A CD1  9  
ATOM 7609  H H    . ILE A 1 33 ? 12.843  -8.680  2.274   1.00 0.00 ? 33 ILE A H    9  
ATOM 7610  H HA   . ILE A 1 33 ? 10.267  -9.404  2.622   1.00 0.00 ? 33 ILE A HA   9  
ATOM 7611  H HB   . ILE A 1 33 ? 10.702  -9.021  5.157   1.00 0.00 ? 33 ILE A HB   9  
ATOM 7612  H HG12 . ILE A 1 33 ? 13.571  -8.724  4.347   1.00 0.00 ? 33 ILE A HG12 9  
ATOM 7613  H HG13 . ILE A 1 33 ? 12.572  -7.272  4.346   1.00 0.00 ? 33 ILE A HG13 9  
ATOM 7614  H HG21 . ILE A 1 33 ? 10.999  -11.176 3.998   1.00 0.00 ? 33 ILE A HG21 9  
ATOM 7615  H HG22 . ILE A 1 33 ? 12.275  -10.925 5.187   1.00 0.00 ? 33 ILE A HG22 9  
ATOM 7616  H HG23 . ILE A 1 33 ? 12.606  -10.677 3.473   1.00 0.00 ? 33 ILE A HG23 9  
ATOM 7617  H HD11 . ILE A 1 33 ? 13.810  -7.877  6.538   1.00 0.00 ? 33 ILE A HD11 9  
ATOM 7618  H HD12 . ILE A 1 33 ? 12.589  -9.136  6.716   1.00 0.00 ? 33 ILE A HD12 9  
ATOM 7619  H HD13 . ILE A 1 33 ? 12.104  -7.441  6.650   1.00 0.00 ? 33 ILE A HD13 9  
ATOM 7620  N N    . GLU A 1 34 ? 10.618  -6.233  3.419   1.00 0.00 ? 34 GLU A N    9  
ATOM 7621  C CA   . GLU A 1 34 ? 9.881   -4.999  3.667   1.00 0.00 ? 34 GLU A CA   9  
ATOM 7622  C C    . GLU A 1 34 ? 9.166   -4.523  2.403   1.00 0.00 ? 34 GLU A C    9  
ATOM 7623  O O    . GLU A 1 34 ? 7.967   -4.249  2.427   1.00 0.00 ? 34 GLU A O    9  
ATOM 7624  C CB   . GLU A 1 34 ? 10.840  -3.910  4.159   1.00 0.00 ? 34 GLU A CB   9  
ATOM 7625  C CG   . GLU A 1 34 ? 11.980  -4.550  4.957   1.00 0.00 ? 34 GLU A CG   9  
ATOM 7626  C CD   . GLU A 1 34 ? 12.594  -3.528  5.908   1.00 0.00 ? 34 GLU A CD   9  
ATOM 7627  O OE1  . GLU A 1 34 ? 11.906  -3.116  6.828   1.00 0.00 ? 34 GLU A OE1  9  
ATOM 7628  O OE2  . GLU A 1 34 ? 13.743  -3.172  5.703   1.00 0.00 ? 34 GLU A OE2  9  
ATOM 7629  H H    . GLU A 1 34 ? 11.594  -6.203  3.340   1.00 0.00 ? 34 GLU A H    9  
ATOM 7630  H HA   . GLU A 1 34 ? 9.144   -5.183  4.433   1.00 0.00 ? 34 GLU A HA   9  
ATOM 7631  H HB2  . GLU A 1 34 ? 11.250  -3.380  3.311   1.00 0.00 ? 34 GLU A HB2  9  
ATOM 7632  H HB3  . GLU A 1 34 ? 10.306  -3.218  4.792   1.00 0.00 ? 34 GLU A HB3  9  
ATOM 7633  H HG2  . GLU A 1 34 ? 11.596  -5.384  5.527   1.00 0.00 ? 34 GLU A HG2  9  
ATOM 7634  H HG3  . GLU A 1 34 ? 12.740  -4.903  4.275   1.00 0.00 ? 34 GLU A HG3  9  
ATOM 7635  N N    . LEU A 1 35 ? 9.908   -4.421  1.304   1.00 0.00 ? 35 LEU A N    9  
ATOM 7636  C CA   . LEU A 1 35 ? 9.321   -3.969  0.046   1.00 0.00 ? 35 LEU A CA   9  
ATOM 7637  C C    . LEU A 1 35 ? 8.102   -4.819  -0.303  1.00 0.00 ? 35 LEU A C    9  
ATOM 7638  O O    . LEU A 1 35 ? 7.023   -4.294  -0.572  1.00 0.00 ? 35 LEU A O    9  
ATOM 7639  C CB   . LEU A 1 35 ? 10.359  -4.067  -1.086  1.00 0.00 ? 35 LEU A CB   9  
ATOM 7640  C CG   . LEU A 1 35 ? 10.184  -2.916  -2.098  1.00 0.00 ? 35 LEU A CG   9  
ATOM 7641  C CD1  . LEU A 1 35 ? 8.699   -2.707  -2.426  1.00 0.00 ? 35 LEU A CD1  9  
ATOM 7642  C CD2  . LEU A 1 35 ? 10.763  -1.614  -1.528  1.00 0.00 ? 35 LEU A CD2  9  
ATOM 7643  H H    . LEU A 1 35 ? 10.861  -4.648  1.341   1.00 0.00 ? 35 LEU A H    9  
ATOM 7644  H HA   . LEU A 1 35 ? 9.016   -2.941  0.158   1.00 0.00 ? 35 LEU A HA   9  
ATOM 7645  H HB2  . LEU A 1 35 ? 11.350  -4.021  -0.663  1.00 0.00 ? 35 LEU A HB2  9  
ATOM 7646  H HB3  . LEU A 1 35 ? 10.239  -5.009  -1.600  1.00 0.00 ? 35 LEU A HB3  9  
ATOM 7647  H HG   . LEU A 1 35 ? 10.710  -3.168  -3.008  1.00 0.00 ? 35 LEU A HG   9  
ATOM 7648  H HD11 . LEU A 1 35 ? 8.231   -2.125  -1.645  1.00 0.00 ? 35 LEU A HD11 9  
ATOM 7649  H HD12 . LEU A 1 35 ? 8.208   -3.664  -2.508  1.00 0.00 ? 35 LEU A HD12 9  
ATOM 7650  H HD13 . LEU A 1 35 ? 8.612   -2.181  -3.364  1.00 0.00 ? 35 LEU A HD13 9  
ATOM 7651  H HD21 . LEU A 1 35 ? 11.541  -1.841  -0.812  1.00 0.00 ? 35 LEU A HD21 9  
ATOM 7652  H HD22 . LEU A 1 35 ? 9.979   -1.051  -1.042  1.00 0.00 ? 35 LEU A HD22 9  
ATOM 7653  H HD23 . LEU A 1 35 ? 11.178  -1.025  -2.331  1.00 0.00 ? 35 LEU A HD23 9  
ATOM 7654  N N    . LEU A 1 36 ? 8.288   -6.136  -0.304  1.00 0.00 ? 36 LEU A N    9  
ATOM 7655  C CA   . LEU A 1 36 ? 7.203   -7.054  -0.630  1.00 0.00 ? 36 LEU A CA   9  
ATOM 7656  C C    . LEU A 1 36 ? 6.098   -6.984  0.420   1.00 0.00 ? 36 LEU A C    9  
ATOM 7657  O O    . LEU A 1 36 ? 4.928   -6.799  0.086   1.00 0.00 ? 36 LEU A O    9  
ATOM 7658  C CB   . LEU A 1 36 ? 7.737   -8.484  -0.724  1.00 0.00 ? 36 LEU A CB   9  
ATOM 7659  C CG   . LEU A 1 36 ? 8.997   -8.506  -1.593  1.00 0.00 ? 36 LEU A CG   9  
ATOM 7660  C CD1  . LEU A 1 36 ? 9.470   -9.951  -1.768  1.00 0.00 ? 36 LEU A CD1  9  
ATOM 7661  C CD2  . LEU A 1 36 ? 8.687   -7.902  -2.968  1.00 0.00 ? 36 LEU A CD2  9  
ATOM 7662  H H    . LEU A 1 36 ? 9.174   -6.497  -0.087  1.00 0.00 ? 36 LEU A H    9  
ATOM 7663  H HA   . LEU A 1 36 ? 6.788   -6.776  -1.587  1.00 0.00 ? 36 LEU A HA   9  
ATOM 7664  H HB2  . LEU A 1 36 ? 7.975   -8.844  0.267   1.00 0.00 ? 36 LEU A HB2  9  
ATOM 7665  H HB3  . LEU A 1 36 ? 6.986   -9.120  -1.167  1.00 0.00 ? 36 LEU A HB3  9  
ATOM 7666  H HG   . LEU A 1 36 ? 9.775   -7.931  -1.111  1.00 0.00 ? 36 LEU A HG   9  
ATOM 7667  H HD11 . LEU A 1 36 ? 9.877   -10.313 -0.835  1.00 0.00 ? 36 LEU A HD11 9  
ATOM 7668  H HD12 . LEU A 1 36 ? 10.232  -9.991  -2.532  1.00 0.00 ? 36 LEU A HD12 9  
ATOM 7669  H HD13 . LEU A 1 36 ? 8.634   -10.569 -2.060  1.00 0.00 ? 36 LEU A HD13 9  
ATOM 7670  H HD21 . LEU A 1 36 ? 7.712   -8.230  -3.296  1.00 0.00 ? 36 LEU A HD21 9  
ATOM 7671  H HD22 . LEU A 1 36 ? 9.434   -8.221  -3.681  1.00 0.00 ? 36 LEU A HD22 9  
ATOM 7672  H HD23 . LEU A 1 36 ? 8.700   -6.824  -2.898  1.00 0.00 ? 36 LEU A HD23 9  
ATOM 7673  N N    . ALA A 1 37 ? 6.469   -7.136  1.688   1.00 0.00 ? 37 ALA A N    9  
ATOM 7674  C CA   . ALA A 1 37 ? 5.486   -7.088  2.765   1.00 0.00 ? 37 ALA A CA   9  
ATOM 7675  C C    . ALA A 1 37 ? 4.657   -5.811  2.666   1.00 0.00 ? 37 ALA A C    9  
ATOM 7676  O O    . ALA A 1 37 ? 3.427   -5.850  2.721   1.00 0.00 ? 37 ALA A O    9  
ATOM 7677  C CB   . ALA A 1 37 ? 6.185   -7.140  4.122   1.00 0.00 ? 37 ALA A CB   9  
ATOM 7678  H H    . ALA A 1 37 ? 7.415   -7.283  1.902   1.00 0.00 ? 37 ALA A H    9  
ATOM 7679  H HA   . ALA A 1 37 ? 4.828   -7.939  2.678   1.00 0.00 ? 37 ALA A HA   9  
ATOM 7680  H HB1  . ALA A 1 37 ? 6.917   -6.346  4.182   1.00 0.00 ? 37 ALA A HB1  9  
ATOM 7681  H HB2  . ALA A 1 37 ? 6.677   -8.094  4.239   1.00 0.00 ? 37 ALA A HB2  9  
ATOM 7682  H HB3  . ALA A 1 37 ? 5.455   -7.014  4.909   1.00 0.00 ? 37 ALA A HB3  9  
ATOM 7683  N N    . ALA A 1 38 ? 5.341   -4.681  2.519   1.00 0.00 ? 38 ALA A N    9  
ATOM 7684  C CA   . ALA A 1 38 ? 4.658   -3.399  2.411   1.00 0.00 ? 38 ALA A CA   9  
ATOM 7685  C C    . ALA A 1 38 ? 3.787   -3.361  1.159   1.00 0.00 ? 38 ALA A C    9  
ATOM 7686  O O    . ALA A 1 38 ? 2.638   -2.925  1.204   1.00 0.00 ? 38 ALA A O    9  
ATOM 7687  C CB   . ALA A 1 38 ? 5.683   -2.263  2.364   1.00 0.00 ? 38 ALA A CB   9  
ATOM 7688  H H    . ALA A 1 38 ? 6.319   -4.712  2.480   1.00 0.00 ? 38 ALA A H    9  
ATOM 7689  H HA   . ALA A 1 38 ? 4.028   -3.264  3.278   1.00 0.00 ? 38 ALA A HA   9  
ATOM 7690  H HB1  . ALA A 1 38 ? 5.219   -1.345  2.695   1.00 0.00 ? 38 ALA A HB1  9  
ATOM 7691  H HB2  . ALA A 1 38 ? 6.044   -2.141  1.354   1.00 0.00 ? 38 ALA A HB2  9  
ATOM 7692  H HB3  . ALA A 1 38 ? 6.512   -2.500  3.015   1.00 0.00 ? 38 ALA A HB3  9  
ATOM 7693  N N    . CYS A 1 39 ? 4.343   -3.825  0.042   1.00 0.00 ? 39 CYS A N    9  
ATOM 7694  C CA   . CYS A 1 39 ? 3.601   -3.842  -1.214  1.00 0.00 ? 39 CYS A CA   9  
ATOM 7695  C C    . CYS A 1 39 ? 2.287   -4.595  -1.041  1.00 0.00 ? 39 CYS A C    9  
ATOM 7696  O O    . CYS A 1 39 ? 1.217   -4.082  -1.371  1.00 0.00 ? 39 CYS A O    9  
ATOM 7697  C CB   . CYS A 1 39 ? 4.434   -4.514  -2.308  1.00 0.00 ? 39 CYS A CB   9  
ATOM 7698  S SG   . CYS A 1 39 ? 3.692   -4.176  -3.923  1.00 0.00 ? 39 CYS A SG   9  
ATOM 7699  H H    . CYS A 1 39 ? 5.262   -4.163  0.064   1.00 0.00 ? 39 CYS A H    9  
ATOM 7700  H HA   . CYS A 1 39 ? 3.390   -2.825  -1.510  1.00 0.00 ? 39 CYS A HA   9  
ATOM 7701  H HB2  . CYS A 1 39 ? 5.441   -4.126  -2.286  1.00 0.00 ? 39 CYS A HB2  9  
ATOM 7702  H HB3  . CYS A 1 39 ? 4.456   -5.581  -2.140  1.00 0.00 ? 39 CYS A HB3  9  
ATOM 7703  H HG   . CYS A 1 39 ? 3.403   -3.259  -3.930  1.00 0.00 ? 39 CYS A HG   9  
ATOM 7704  N N    . ARG A 1 40 ? 2.376   -5.813  -0.518  1.00 0.00 ? 40 ARG A N    9  
ATOM 7705  C CA   . ARG A 1 40 ? 1.187   -6.630  -0.299  1.00 0.00 ? 40 ARG A CA   9  
ATOM 7706  C C    . ARG A 1 40 ? 0.197   -5.894  0.596   1.00 0.00 ? 40 ARG A C    9  
ATOM 7707  O O    . ARG A 1 40 ? -0.999  -5.845  0.308   1.00 0.00 ? 40 ARG A O    9  
ATOM 7708  C CB   . ARG A 1 40 ? 1.578   -7.958  0.350   1.00 0.00 ? 40 ARG A CB   9  
ATOM 7709  C CG   . ARG A 1 40 ? 2.318   -8.828  -0.670  1.00 0.00 ? 40 ARG A CG   9  
ATOM 7710  C CD   . ARG A 1 40 ? 3.056   -9.954  0.057   1.00 0.00 ? 40 ARG A CD   9  
ATOM 7711  N NE   . ARG A 1 40 ? 2.265   -10.427 1.189   1.00 0.00 ? 40 ARG A NE   9  
ATOM 7712  C CZ   . ARG A 1 40 ? 1.236   -11.248 1.012   1.00 0.00 ? 40 ARG A CZ   9  
ATOM 7713  N NH1  . ARG A 1 40 ? 0.915   -11.645 -0.188  1.00 0.00 ? 40 ARG A NH1  9  
ATOM 7714  N NH2  . ARG A 1 40 ? 0.545   -11.659 2.042   1.00 0.00 ? 40 ARG A NH2  9  
ATOM 7715  H H    . ARG A 1 40 ? 3.255   -6.168  -0.272  1.00 0.00 ? 40 ARG A H    9  
ATOM 7716  H HA   . ARG A 1 40 ? 0.719   -6.829  -1.252  1.00 0.00 ? 40 ARG A HA   9  
ATOM 7717  H HB2  . ARG A 1 40 ? 2.221   -7.768  1.198   1.00 0.00 ? 40 ARG A HB2  9  
ATOM 7718  H HB3  . ARG A 1 40 ? 0.687   -8.473  0.680   1.00 0.00 ? 40 ARG A HB3  9  
ATOM 7719  H HG2  . ARG A 1 40 ? 1.608   -9.252  -1.365  1.00 0.00 ? 40 ARG A HG2  9  
ATOM 7720  H HG3  . ARG A 1 40 ? 3.032   -8.223  -1.209  1.00 0.00 ? 40 ARG A HG3  9  
ATOM 7721  H HD2  . ARG A 1 40 ? 3.222   -10.773 -0.625  1.00 0.00 ? 40 ARG A HD2  9  
ATOM 7722  H HD3  . ARG A 1 40 ? 4.008   -9.587  0.412   1.00 0.00 ? 40 ARG A HD3  9  
ATOM 7723  H HE   . ARG A 1 40 ? 2.497   -10.134 2.095   1.00 0.00 ? 40 ARG A HE   9  
ATOM 7724  H HH11 . ARG A 1 40 ? 1.445   -11.331 -0.976  1.00 0.00 ? 40 ARG A HH11 9  
ATOM 7725  H HH12 . ARG A 1 40 ? 0.141   -12.263 -0.321  1.00 0.00 ? 40 ARG A HH12 9  
ATOM 7726  H HH21 . ARG A 1 40 ? 0.790   -11.353 2.961   1.00 0.00 ? 40 ARG A HH21 9  
ATOM 7727  H HH22 . ARG A 1 40 ? -0.230  -12.276 1.910   1.00 0.00 ? 40 ARG A HH22 9  
ATOM 7728  N N    . GLU A 1 41 ? 0.704   -5.320  1.683   1.00 0.00 ? 41 GLU A N    9  
ATOM 7729  C CA   . GLU A 1 41 ? -0.145  -4.586  2.613   1.00 0.00 ? 41 GLU A CA   9  
ATOM 7730  C C    . GLU A 1 41 ? -0.885  -3.467  1.888   1.00 0.00 ? 41 GLU A C    9  
ATOM 7731  O O    . GLU A 1 41 ? -2.064  -3.221  2.143   1.00 0.00 ? 41 GLU A O    9  
ATOM 7732  C CB   . GLU A 1 41 ? 0.703   -3.995  3.741   1.00 0.00 ? 41 GLU A CB   9  
ATOM 7733  C CG   . GLU A 1 41 ? 1.147   -5.114  4.686   1.00 0.00 ? 41 GLU A CG   9  
ATOM 7734  C CD   . GLU A 1 41 ? -0.029  -5.571  5.541   1.00 0.00 ? 41 GLU A CD   9  
ATOM 7735  O OE1  . GLU A 1 41 ? -1.087  -4.976  5.426   1.00 0.00 ? 41 GLU A OE1  9  
ATOM 7736  O OE2  . GLU A 1 41 ? 0.145   -6.513  6.298   1.00 0.00 ? 41 GLU A OE2  9  
ATOM 7737  H H    . GLU A 1 41 ? 1.666   -5.391  1.861   1.00 0.00 ? 41 GLU A H    9  
ATOM 7738  H HA   . GLU A 1 41 ? -0.868  -5.266  3.039   1.00 0.00 ? 41 GLU A HA   9  
ATOM 7739  H HB2  . GLU A 1 41 ? 1.573   -3.511  3.321   1.00 0.00 ? 41 GLU A HB2  9  
ATOM 7740  H HB3  . GLU A 1 41 ? 0.118   -3.273  4.290   1.00 0.00 ? 41 GLU A HB3  9  
ATOM 7741  H HG2  . GLU A 1 41 ? 1.517   -5.947  4.106   1.00 0.00 ? 41 GLU A HG2  9  
ATOM 7742  H HG3  . GLU A 1 41 ? 1.935   -4.748  5.330   1.00 0.00 ? 41 GLU A HG3  9  
ATOM 7743  N N    . GLU A 1 42 ? -0.184  -2.793  0.981   1.00 0.00 ? 42 GLU A N    9  
ATOM 7744  C CA   . GLU A 1 42 ? -0.786  -1.702  0.223   1.00 0.00 ? 42 GLU A CA   9  
ATOM 7745  C C    . GLU A 1 42 ? -1.913  -2.226  -0.661  1.00 0.00 ? 42 GLU A C    9  
ATOM 7746  O O    . GLU A 1 42 ? -2.999  -1.645  -0.709  1.00 0.00 ? 42 GLU A O    9  
ATOM 7747  C CB   . GLU A 1 42 ? 0.273   -1.022  -0.646  1.00 0.00 ? 42 GLU A CB   9  
ATOM 7748  C CG   . GLU A 1 42 ? 1.229   -0.223  0.242   1.00 0.00 ? 42 GLU A CG   9  
ATOM 7749  C CD   . GLU A 1 42 ? 0.531   1.029   0.764   1.00 0.00 ? 42 GLU A CD   9  
ATOM 7750  O OE1  . GLU A 1 42 ? -0.537  1.340   0.263   1.00 0.00 ? 42 GLU A OE1  9  
ATOM 7751  O OE2  . GLU A 1 42 ? 1.075   1.656   1.658   1.00 0.00 ? 42 GLU A OE2  9  
ATOM 7752  H H    . GLU A 1 42 ? 0.751   -3.034  0.817   1.00 0.00 ? 42 GLU A H    9  
ATOM 7753  H HA   . GLU A 1 42 ? -1.189  -0.977  0.913   1.00 0.00 ? 42 GLU A HA   9  
ATOM 7754  H HB2  . GLU A 1 42 ? 0.829   -1.773  -1.190  1.00 0.00 ? 42 GLU A HB2  9  
ATOM 7755  H HB3  . GLU A 1 42 ? -0.208  -0.354  -1.345  1.00 0.00 ? 42 GLU A HB3  9  
ATOM 7756  H HG2  . GLU A 1 42 ? 1.536   -0.836  1.076   1.00 0.00 ? 42 GLU A HG2  9  
ATOM 7757  H HG3  . GLU A 1 42 ? 2.096   0.064   -0.332  1.00 0.00 ? 42 GLU A HG3  9  
ATOM 7758  N N    . PHE A 1 43 ? -1.651  -3.327  -1.358  1.00 0.00 ? 43 PHE A N    9  
ATOM 7759  C CA   . PHE A 1 43 ? -2.653  -3.919  -2.235  1.00 0.00 ? 43 PHE A CA   9  
ATOM 7760  C C    . PHE A 1 43 ? -3.881  -4.339  -1.431  1.00 0.00 ? 43 PHE A C    9  
ATOM 7761  O O    . PHE A 1 43 ? -5.006  -3.958  -1.752  1.00 0.00 ? 43 PHE A O    9  
ATOM 7762  C CB   . PHE A 1 43 ? -2.060  -5.139  -2.958  1.00 0.00 ? 43 PHE A CB   9  
ATOM 7763  C CG   . PHE A 1 43 ? -1.798  -4.799  -4.409  1.00 0.00 ? 43 PHE A CG   9  
ATOM 7764  C CD1  . PHE A 1 43 ? -0.812  -3.862  -4.740  1.00 0.00 ? 43 PHE A CD1  9  
ATOM 7765  C CD2  . PHE A 1 43 ? -2.542  -5.421  -5.420  1.00 0.00 ? 43 PHE A CD2  9  
ATOM 7766  C CE1  . PHE A 1 43 ? -0.569  -3.548  -6.083  1.00 0.00 ? 43 PHE A CE1  9  
ATOM 7767  C CE2  . PHE A 1 43 ? -2.300  -5.104  -6.762  1.00 0.00 ? 43 PHE A CE2  9  
ATOM 7768  C CZ   . PHE A 1 43 ? -1.314  -4.169  -7.093  1.00 0.00 ? 43 PHE A CZ   9  
ATOM 7769  H H    . PHE A 1 43 ? -0.769  -3.747  -1.281  1.00 0.00 ? 43 PHE A H    9  
ATOM 7770  H HA   . PHE A 1 43 ? -2.953  -3.185  -2.970  1.00 0.00 ? 43 PHE A HA   9  
ATOM 7771  H HB2  . PHE A 1 43 ? -1.130  -5.417  -2.484  1.00 0.00 ? 43 PHE A HB2  9  
ATOM 7772  H HB3  . PHE A 1 43 ? -2.751  -5.968  -2.904  1.00 0.00 ? 43 PHE A HB3  9  
ATOM 7773  H HD1  . PHE A 1 43 ? -0.239  -3.384  -3.961  1.00 0.00 ? 43 PHE A HD1  9  
ATOM 7774  H HD2  . PHE A 1 43 ? -3.304  -6.143  -5.165  1.00 0.00 ? 43 PHE A HD2  9  
ATOM 7775  H HE1  . PHE A 1 43 ? 0.191   -2.826  -6.339  1.00 0.00 ? 43 PHE A HE1  9  
ATOM 7776  H HE2  . PHE A 1 43 ? -2.873  -5.583  -7.542  1.00 0.00 ? 43 PHE A HE2  9  
ATOM 7777  H HZ   . PHE A 1 43 ? -1.127  -3.925  -8.129  1.00 0.00 ? 43 PHE A HZ   9  
ATOM 7778  N N    . HIS A 1 44 ? -3.656  -5.124  -0.383  1.00 0.00 ? 44 HIS A N    9  
ATOM 7779  C CA   . HIS A 1 44 ? -4.753  -5.589  0.458   1.00 0.00 ? 44 HIS A CA   9  
ATOM 7780  C C    . HIS A 1 44 ? -5.583  -4.407  0.949   1.00 0.00 ? 44 HIS A C    9  
ATOM 7781  O O    . HIS A 1 44 ? -6.814  -4.442  0.909   1.00 0.00 ? 44 HIS A O    9  
ATOM 7782  C CB   . HIS A 1 44 ? -4.200  -6.360  1.659   1.00 0.00 ? 44 HIS A CB   9  
ATOM 7783  C CG   . HIS A 1 44 ? -5.312  -7.127  2.320   1.00 0.00 ? 44 HIS A CG   9  
ATOM 7784  N ND1  . HIS A 1 44 ? -5.562  -8.460  2.035   1.00 0.00 ? 44 HIS A ND1  9  
ATOM 7785  C CD2  . HIS A 1 44 ? -6.249  -6.761  3.255   1.00 0.00 ? 44 HIS A CD2  9  
ATOM 7786  C CE1  . HIS A 1 44 ? -6.610  -8.845  2.784   1.00 0.00 ? 44 HIS A CE1  9  
ATOM 7787  N NE2  . HIS A 1 44 ? -7.068  -7.848  3.546   1.00 0.00 ? 44 HIS A NE2  9  
ATOM 7788  H H    . HIS A 1 44 ? -2.738  -5.397  -0.173  1.00 0.00 ? 44 HIS A H    9  
ATOM 7789  H HA   . HIS A 1 44 ? -5.384  -6.246  -0.119  1.00 0.00 ? 44 HIS A HA   9  
ATOM 7790  H HB2  . HIS A 1 44 ? -3.437  -7.048  1.324   1.00 0.00 ? 44 HIS A HB2  9  
ATOM 7791  H HB3  . HIS A 1 44 ? -3.771  -5.666  2.367   1.00 0.00 ? 44 HIS A HB3  9  
ATOM 7792  H HD2  . HIS A 1 44 ? -6.338  -5.779  3.696   1.00 0.00 ? 44 HIS A HD2  9  
ATOM 7793  H HE1  . HIS A 1 44 ? -7.031  -9.841  2.771   1.00 0.00 ? 44 HIS A HE1  9  
ATOM 7794  H HE2  . HIS A 1 44 ? -7.818  -7.875  4.175   1.00 0.00 ? 44 HIS A HE2  9  
ATOM 7795  N N    . ARG A 1 45 ? -4.904  -3.362  1.407   1.00 0.00 ? 45 ARG A N    9  
ATOM 7796  C CA   . ARG A 1 45 ? -5.590  -2.174  1.900   1.00 0.00 ? 45 ARG A CA   9  
ATOM 7797  C C    . ARG A 1 45 ? -6.443  -1.553  0.799   1.00 0.00 ? 45 ARG A C    9  
ATOM 7798  O O    . ARG A 1 45 ? -7.594  -1.183  1.025   1.00 0.00 ? 45 ARG A O    9  
ATOM 7799  C CB   . ARG A 1 45 ? -4.569  -1.148  2.397   1.00 0.00 ? 45 ARG A CB   9  
ATOM 7800  C CG   . ARG A 1 45 ? -5.289  -0.051  3.185   1.00 0.00 ? 45 ARG A CG   9  
ATOM 7801  C CD   . ARG A 1 45 ? -4.267  0.964   3.696   1.00 0.00 ? 45 ARG A CD   9  
ATOM 7802  N NE   . ARG A 1 45 ? -3.798  1.803   2.600   1.00 0.00 ? 45 ARG A NE   9  
ATOM 7803  C CZ   . ARG A 1 45 ? -2.701  2.542   2.721   1.00 0.00 ? 45 ARG A CZ   9  
ATOM 7804  N NH1  . ARG A 1 45 ? -2.021  2.523   3.836   1.00 0.00 ? 45 ARG A NH1  9  
ATOM 7805  N NH2  . ARG A 1 45 ? -2.302  3.287   1.727   1.00 0.00 ? 45 ARG A NH2  9  
ATOM 7806  H H    . ARG A 1 45 ? -3.923  -3.389  1.413   1.00 0.00 ? 45 ARG A H    9  
ATOM 7807  H HA   . ARG A 1 45 ? -6.230  -2.455  2.723   1.00 0.00 ? 45 ARG A HA   9  
ATOM 7808  H HB2  . ARG A 1 45 ? -3.849  -1.639  3.036   1.00 0.00 ? 45 ARG A HB2  9  
ATOM 7809  H HB3  . ARG A 1 45 ? -4.061  -0.708  1.553   1.00 0.00 ? 45 ARG A HB3  9  
ATOM 7810  H HG2  . ARG A 1 45 ? -6.001  0.444   2.542   1.00 0.00 ? 45 ARG A HG2  9  
ATOM 7811  H HG3  . ARG A 1 45 ? -5.807  -0.493  4.024   1.00 0.00 ? 45 ARG A HG3  9  
ATOM 7812  H HD2  . ARG A 1 45 ? -4.727  1.586   4.449   1.00 0.00 ? 45 ARG A HD2  9  
ATOM 7813  H HD3  . ARG A 1 45 ? -3.429  0.439   4.131   1.00 0.00 ? 45 ARG A HD3  9  
ATOM 7814  H HE   . ARG A 1 45 ? -4.302  1.824   1.760   1.00 0.00 ? 45 ARG A HE   9  
ATOM 7815  H HH11 . ARG A 1 45 ? -2.326  1.952   4.597   1.00 0.00 ? 45 ARG A HH11 9  
ATOM 7816  H HH12 . ARG A 1 45 ? -1.194  3.079   3.926   1.00 0.00 ? 45 ARG A HH12 9  
ATOM 7817  H HH21 . ARG A 1 45 ? -2.823  3.301   0.874   1.00 0.00 ? 45 ARG A HH21 9  
ATOM 7818  H HH22 . ARG A 1 45 ? -1.476  3.843   1.818   1.00 0.00 ? 45 ARG A HH22 9  
ATOM 7819  N N    . ARG A 1 46 ? -5.868  -1.443  -0.396  1.00 0.00 ? 46 ARG A N    9  
ATOM 7820  C CA   . ARG A 1 46 ? -6.584  -0.864  -1.526  1.00 0.00 ? 46 ARG A CA   9  
ATOM 7821  C C    . ARG A 1 46 ? -7.885  -1.619  -1.781  1.00 0.00 ? 46 ARG A C    9  
ATOM 7822  O O    . ARG A 1 46 ? -8.952  -1.015  -1.891  1.00 0.00 ? 46 ARG A O    9  
ATOM 7823  C CB   . ARG A 1 46 ? -5.708  -0.914  -2.782  1.00 0.00 ? 46 ARG A CB   9  
ATOM 7824  C CG   . ARG A 1 46 ? -4.574  0.114   -2.666  1.00 0.00 ? 46 ARG A CG   9  
ATOM 7825  C CD   . ARG A 1 46 ? -5.047  1.470   -3.196  1.00 0.00 ? 46 ARG A CD   9  
ATOM 7826  N NE   . ARG A 1 46 ? -5.452  1.354   -4.591  1.00 0.00 ? 46 ARG A NE   9  
ATOM 7827  C CZ   . ARG A 1 46 ? -6.093  2.344   -5.205  1.00 0.00 ? 46 ARG A CZ   9  
ATOM 7828  N NH1  . ARG A 1 46 ? -6.370  3.443   -4.558  1.00 0.00 ? 46 ARG A NH1  9  
ATOM 7829  N NH2  . ARG A 1 46 ? -6.444  2.218   -6.456  1.00 0.00 ? 46 ARG A NH2  9  
ATOM 7830  H H    . ARG A 1 46 ? -4.947  -1.755  -0.517  1.00 0.00 ? 46 ARG A H    9  
ATOM 7831  H HA   . ARG A 1 46 ? -6.816  0.166   -1.304  1.00 0.00 ? 46 ARG A HA   9  
ATOM 7832  H HB2  . ARG A 1 46 ? -5.287  -1.906  -2.883  1.00 0.00 ? 46 ARG A HB2  9  
ATOM 7833  H HB3  . ARG A 1 46 ? -6.310  -0.691  -3.650  1.00 0.00 ? 46 ARG A HB3  9  
ATOM 7834  H HG2  . ARG A 1 46 ? -4.281  0.212   -1.631  1.00 0.00 ? 46 ARG A HG2  9  
ATOM 7835  H HG3  . ARG A 1 46 ? -3.727  -0.220  -3.247  1.00 0.00 ? 46 ARG A HG3  9  
ATOM 7836  H HD2  . ARG A 1 46 ? -5.885  1.812   -2.610  1.00 0.00 ? 46 ARG A HD2  9  
ATOM 7837  H HD3  . ARG A 1 46 ? -4.240  2.186   -3.113  1.00 0.00 ? 46 ARG A HD3  9  
ATOM 7838  H HE   . ARG A 1 46 ? -5.249  0.532   -5.086  1.00 0.00 ? 46 ARG A HE   9  
ATOM 7839  H HH11 . ARG A 1 46 ? -6.101  3.540   -3.600  1.00 0.00 ? 46 ARG A HH11 9  
ATOM 7840  H HH12 . ARG A 1 46 ? -6.852  4.186   -5.020  1.00 0.00 ? 46 ARG A HH12 9  
ATOM 7841  H HH21 . ARG A 1 46 ? -6.231  1.375   -6.952  1.00 0.00 ? 46 ARG A HH21 9  
ATOM 7842  H HH22 . ARG A 1 46 ? -6.925  2.961   -6.918  1.00 0.00 ? 46 ARG A HH22 9  
ATOM 7843  N N    . LEU A 1 47 ? -7.790  -2.941  -1.877  1.00 0.00 ? 47 LEU A N    9  
ATOM 7844  C CA   . LEU A 1 47 ? -8.968  -3.767  -2.119  1.00 0.00 ? 47 LEU A CA   9  
ATOM 7845  C C    . LEU A 1 47 ? -9.916  -3.711  -0.923  1.00 0.00 ? 47 LEU A C    9  
ATOM 7846  O O    . LEU A 1 47 ? -11.126 -3.881  -1.072  1.00 0.00 ? 47 LEU A O    9  
ATOM 7847  C CB   . LEU A 1 47 ? -8.544  -5.218  -2.379  1.00 0.00 ? 47 LEU A CB   9  
ATOM 7848  C CG   . LEU A 1 47 ? -8.204  -5.416  -3.864  1.00 0.00 ? 47 LEU A CG   9  
ATOM 7849  C CD1  . LEU A 1 47 ? -9.481  -5.344  -4.715  1.00 0.00 ? 47 LEU A CD1  9  
ATOM 7850  C CD2  . LEU A 1 47 ? -7.223  -4.327  -4.317  1.00 0.00 ? 47 LEU A CD2  9  
ATOM 7851  H H    . LEU A 1 47 ? -6.913  -3.369  -1.782  1.00 0.00 ? 47 LEU A H    9  
ATOM 7852  H HA   . LEU A 1 47 ? -9.485  -3.390  -2.987  1.00 0.00 ? 47 LEU A HA   9  
ATOM 7853  H HB2  . LEU A 1 47 ? -7.674  -5.447  -1.780  1.00 0.00 ? 47 LEU A HB2  9  
ATOM 7854  H HB3  . LEU A 1 47 ? -9.349  -5.886  -2.104  1.00 0.00 ? 47 LEU A HB3  9  
ATOM 7855  H HG   . LEU A 1 47 ? -7.746  -6.387  -3.995  1.00 0.00 ? 47 LEU A HG   9  
ATOM 7856  H HD11 . LEU A 1 47 ? -9.368  -5.981  -5.582  1.00 0.00 ? 47 LEU A HD11 9  
ATOM 7857  H HD12 . LEU A 1 47 ? -9.647  -4.327  -5.039  1.00 0.00 ? 47 LEU A HD12 9  
ATOM 7858  H HD13 . LEU A 1 47 ? -10.327 -5.679  -4.134  1.00 0.00 ? 47 LEU A HD13 9  
ATOM 7859  H HD21 . LEU A 1 47 ? -6.716  -4.652  -5.213  1.00 0.00 ? 47 LEU A HD21 9  
ATOM 7860  H HD22 . LEU A 1 47 ? -6.498  -4.151  -3.537  1.00 0.00 ? 47 LEU A HD22 9  
ATOM 7861  H HD23 . LEU A 1 47 ? -7.764  -3.414  -4.519  1.00 0.00 ? 47 LEU A HD23 9  
ATOM 7862  N N    . LYS A 1 48 ? -9.360  -3.474  0.260   1.00 0.00 ? 48 LYS A N    9  
ATOM 7863  C CA   . LYS A 1 48 ? -10.171 -3.401  1.470   1.00 0.00 ? 48 LYS A CA   9  
ATOM 7864  C C    . LYS A 1 48 ? -11.004 -2.124  1.484   1.00 0.00 ? 48 LYS A C    9  
ATOM 7865  O O    . LYS A 1 48 ? -12.222 -2.168  1.646   1.00 0.00 ? 48 LYS A O    9  
ATOM 7866  C CB   . LYS A 1 48 ? -9.271  -3.438  2.706   1.00 0.00 ? 48 LYS A CB   9  
ATOM 7867  C CG   . LYS A 1 48 ? -10.129 -3.291  3.966   1.00 0.00 ? 48 LYS A CG   9  
ATOM 7868  C CD   . LYS A 1 48 ? -9.294  -3.633  5.208   1.00 0.00 ? 48 LYS A CD   9  
ATOM 7869  C CE   . LYS A 1 48 ? -9.349  -5.140  5.472   1.00 0.00 ? 48 LYS A CE   9  
ATOM 7870  N NZ   . LYS A 1 48 ? -8.597  -5.453  6.721   1.00 0.00 ? 48 LYS A NZ   9  
ATOM 7871  H H    . LYS A 1 48 ? -8.389  -3.347  0.320   1.00 0.00 ? 48 LYS A H    9  
ATOM 7872  H HA   . LYS A 1 48 ? -10.835 -4.252  1.498   1.00 0.00 ? 48 LYS A HA   9  
ATOM 7873  H HB2  . LYS A 1 48 ? -8.740  -4.379  2.738   1.00 0.00 ? 48 LYS A HB2  9  
ATOM 7874  H HB3  . LYS A 1 48 ? -8.562  -2.625  2.660   1.00 0.00 ? 48 LYS A HB3  9  
ATOM 7875  H HG2  . LYS A 1 48 ? -10.482 -2.271  4.041   1.00 0.00 ? 48 LYS A HG2  9  
ATOM 7876  H HG3  . LYS A 1 48 ? -10.974 -3.959  3.906   1.00 0.00 ? 48 LYS A HG3  9  
ATOM 7877  H HD2  . LYS A 1 48 ? -8.268  -3.332  5.047   1.00 0.00 ? 48 LYS A HD2  9  
ATOM 7878  H HD3  . LYS A 1 48 ? -9.691  -3.107  6.063   1.00 0.00 ? 48 LYS A HD3  9  
ATOM 7879  H HE2  . LYS A 1 48 ? -10.377 -5.450  5.585   1.00 0.00 ? 48 LYS A HE2  9  
ATOM 7880  H HE3  . LYS A 1 48 ? -8.903  -5.669  4.643   1.00 0.00 ? 48 LYS A HE3  9  
ATOM 7881  H HZ1  . LYS A 1 48 ? -7.635  -5.763  6.479   1.00 0.00 ? 48 LYS A HZ1  9  
ATOM 7882  H HZ2  . LYS A 1 48 ? -9.084  -6.210  7.238   1.00 0.00 ? 48 LYS A HZ2  9  
ATOM 7883  H HZ3  . LYS A 1 48 ? -8.547  -4.601  7.317   1.00 0.00 ? 48 LYS A HZ3  9  
ATOM 7884  N N    . VAL A 1 49 ? -10.339 -0.985  1.311   1.00 0.00 ? 49 VAL A N    9  
ATOM 7885  C CA   . VAL A 1 49 ? -11.033 0.297   1.306   1.00 0.00 ? 49 VAL A CA   9  
ATOM 7886  C C    . VAL A 1 49 ? -11.863 0.450   0.036   1.00 0.00 ? 49 VAL A C    9  
ATOM 7887  O O    . VAL A 1 49 ? -12.966 0.997   0.067   1.00 0.00 ? 49 VAL A O    9  
ATOM 7888  C CB   . VAL A 1 49 ? -10.022 1.442   1.399   1.00 0.00 ? 49 VAL A CB   9  
ATOM 7889  C CG1  . VAL A 1 49 ? -9.114  1.224   2.611   1.00 0.00 ? 49 VAL A CG1  9  
ATOM 7890  C CG2  . VAL A 1 49 ? -9.173  1.479   0.126   1.00 0.00 ? 49 VAL A CG2  9  
ATOM 7891  H H    . VAL A 1 49 ? -9.366  -1.008  1.185   1.00 0.00 ? 49 VAL A H    9  
ATOM 7892  H HA   . VAL A 1 49 ? -11.690 0.342   2.161   1.00 0.00 ? 49 VAL A HA   9  
ATOM 7893  H HB   . VAL A 1 49 ? -10.549 2.379   1.509   1.00 0.00 ? 49 VAL A HB   9  
ATOM 7894  H HG11 . VAL A 1 49 ? -9.697  1.299   3.515   1.00 0.00 ? 49 VAL A HG11 9  
ATOM 7895  H HG12 . VAL A 1 49 ? -8.338  1.976   2.619   1.00 0.00 ? 49 VAL A HG12 9  
ATOM 7896  H HG13 . VAL A 1 49 ? -8.665  0.245   2.552   1.00 0.00 ? 49 VAL A HG13 9  
ATOM 7897  H HG21 . VAL A 1 49 ? -8.335  2.145   0.272   1.00 0.00 ? 49 VAL A HG21 9  
ATOM 7898  H HG22 . VAL A 1 49 ? -9.775  1.834   -0.697  1.00 0.00 ? 49 VAL A HG22 9  
ATOM 7899  H HG23 . VAL A 1 49 ? -8.811  0.487   -0.093  1.00 0.00 ? 49 VAL A HG23 9  
ATOM 7900  N N    . TYR A 1 50 ? -11.328 -0.039  -1.078  1.00 0.00 ? 50 TYR A N    9  
ATOM 7901  C CA   . TYR A 1 50 ? -12.031 0.046   -2.352  1.00 0.00 ? 50 TYR A CA   9  
ATOM 7902  C C    . TYR A 1 50 ? -13.298 -0.802  -2.322  1.00 0.00 ? 50 TYR A C    9  
ATOM 7903  O O    . TYR A 1 50 ? -14.387 -0.322  -2.637  1.00 0.00 ? 50 TYR A O    9  
ATOM 7904  C CB   . TYR A 1 50 ? -11.122 -0.433  -3.485  1.00 0.00 ? 50 TYR A CB   9  
ATOM 7905  C CG   . TYR A 1 50 ? -11.882 -0.405  -4.788  1.00 0.00 ? 50 TYR A CG   9  
ATOM 7906  C CD1  . TYR A 1 50 ? -12.646 -1.512  -5.177  1.00 0.00 ? 50 TYR A CD1  9  
ATOM 7907  C CD2  . TYR A 1 50 ? -11.823 0.726   -5.611  1.00 0.00 ? 50 TYR A CD2  9  
ATOM 7908  C CE1  . TYR A 1 50 ? -13.351 -1.488  -6.386  1.00 0.00 ? 50 TYR A CE1  9  
ATOM 7909  C CE2  . TYR A 1 50 ? -12.529 0.752   -6.820  1.00 0.00 ? 50 TYR A CE2  9  
ATOM 7910  C CZ   . TYR A 1 50 ? -13.292 -0.355  -7.208  1.00 0.00 ? 50 TYR A CZ   9  
ATOM 7911  O OH   . TYR A 1 50 ? -13.987 -0.331  -8.399  1.00 0.00 ? 50 TYR A OH   9  
ATOM 7912  H H    . TYR A 1 50 ? -10.446 -0.467  -1.041  1.00 0.00 ? 50 TYR A H    9  
ATOM 7913  H HA   . TYR A 1 50 ? -12.303 1.075   -2.535  1.00 0.00 ? 50 TYR A HA   9  
ATOM 7914  H HB2  . TYR A 1 50 ? -10.261 0.217   -3.555  1.00 0.00 ? 50 TYR A HB2  9  
ATOM 7915  H HB3  . TYR A 1 50 ? -10.795 -1.442  -3.282  1.00 0.00 ? 50 TYR A HB3  9  
ATOM 7916  H HD1  . TYR A 1 50 ? -12.691 -2.385  -4.544  1.00 0.00 ? 50 TYR A HD1  9  
ATOM 7917  H HD2  . TYR A 1 50 ? -11.233 1.581   -5.311  1.00 0.00 ? 50 TYR A HD2  9  
ATOM 7918  H HE1  . TYR A 1 50 ? -13.940 -2.341  -6.685  1.00 0.00 ? 50 TYR A HE1  9  
ATOM 7919  H HE2  . TYR A 1 50 ? -12.483 1.625   -7.453  1.00 0.00 ? 50 TYR A HE2  9  
ATOM 7920  H HH   . TYR A 1 50 ? -14.045 -1.231  -8.728  1.00 0.00 ? 50 TYR A HH   9  
ATOM 7921  N N    . HIS A 1 51 ? -13.147 -2.066  -1.936  1.00 0.00 ? 51 HIS A N    9  
ATOM 7922  C CA   . HIS A 1 51 ? -14.287 -2.972  -1.866  1.00 0.00 ? 51 HIS A CA   9  
ATOM 7923  C C    . HIS A 1 51 ? -15.243 -2.546  -0.757  1.00 0.00 ? 51 HIS A C    9  
ATOM 7924  O O    . HIS A 1 51 ? -16.455 -2.731  -0.862  1.00 0.00 ? 51 HIS A O    9  
ATOM 7925  C CB   . HIS A 1 51 ? -13.802 -4.400  -1.604  1.00 0.00 ? 51 HIS A CB   9  
ATOM 7926  C CG   . HIS A 1 51 ? -14.945 -5.360  -1.786  1.00 0.00 ? 51 HIS A CG   9  
ATOM 7927  N ND1  . HIS A 1 51 ? -16.156 -5.199  -1.133  1.00 0.00 ? 51 HIS A ND1  9  
ATOM 7928  C CD2  . HIS A 1 51 ? -15.076 -6.496  -2.546  1.00 0.00 ? 51 HIS A CD2  9  
ATOM 7929  C CE1  . HIS A 1 51 ? -16.957 -6.213  -1.506  1.00 0.00 ? 51 HIS A CE1  9  
ATOM 7930  N NE2  . HIS A 1 51 ? -16.349 -7.032  -2.367  1.00 0.00 ? 51 HIS A NE2  9  
ATOM 7931  H H    . HIS A 1 51 ? -12.256 -2.392  -1.695  1.00 0.00 ? 51 HIS A H    9  
ATOM 7932  H HA   . HIS A 1 51 ? -14.811 -2.950  -2.809  1.00 0.00 ? 51 HIS A HA   9  
ATOM 7933  H HB2  . HIS A 1 51 ? -13.012 -4.645  -2.299  1.00 0.00 ? 51 HIS A HB2  9  
ATOM 7934  H HB3  . HIS A 1 51 ? -13.428 -4.473  -0.593  1.00 0.00 ? 51 HIS A HB3  9  
ATOM 7935  H HD2  . HIS A 1 51 ? -14.310 -6.910  -3.185  1.00 0.00 ? 51 HIS A HD2  9  
ATOM 7936  H HE1  . HIS A 1 51 ? -17.969 -6.349  -1.155  1.00 0.00 ? 51 HIS A HE1  9  
ATOM 7937  H HE2  . HIS A 1 51 ? -16.717 -7.840  -2.784  1.00 0.00 ? 51 HIS A HE2  9  
ATOM 7938  N N    . ALA A 1 52 ? -14.688 -1.973  0.307   1.00 0.00 ? 52 ALA A N    9  
ATOM 7939  C CA   . ALA A 1 52 ? -15.501 -1.525  1.431   1.00 0.00 ? 52 ALA A CA   9  
ATOM 7940  C C    . ALA A 1 52 ? -16.236 -0.233  1.082   1.00 0.00 ? 52 ALA A C    9  
ATOM 7941  O O    . ALA A 1 52 ? -17.319 0.035   1.602   1.00 0.00 ? 52 ALA A O    9  
ATOM 7942  C CB   . ALA A 1 52 ? -14.616 -1.294  2.656   1.00 0.00 ? 52 ALA A CB   9  
ATOM 7943  H H    . ALA A 1 52 ? -13.715 -1.852  0.337   1.00 0.00 ? 52 ALA A H    9  
ATOM 7944  H HA   . ALA A 1 52 ? -16.228 -2.288  1.665   1.00 0.00 ? 52 ALA A HA   9  
ATOM 7945  H HB1  . ALA A 1 52 ? -14.179 -2.231  2.967   1.00 0.00 ? 52 ALA A HB1  9  
ATOM 7946  H HB2  . ALA A 1 52 ? -15.213 -0.891  3.462   1.00 0.00 ? 52 ALA A HB2  9  
ATOM 7947  H HB3  . ALA A 1 52 ? -13.830 -0.596  2.407   1.00 0.00 ? 52 ALA A HB3  9  
ATOM 7948  N N    . TRP A 1 53 ? -15.640 0.562   0.200   1.00 0.00 ? 53 TRP A N    9  
ATOM 7949  C CA   . TRP A 1 53 ? -16.250 1.823   -0.209  1.00 0.00 ? 53 TRP A CA   9  
ATOM 7950  C C    . TRP A 1 53 ? -17.693 1.596   -0.656  1.00 0.00 ? 53 TRP A C    9  
ATOM 7951  O O    . TRP A 1 53 ? -18.560 2.443   -0.440  1.00 0.00 ? 53 TRP A O    9  
ATOM 7952  C CB   . TRP A 1 53 ? -15.438 2.449   -1.354  1.00 0.00 ? 53 TRP A CB   9  
ATOM 7953  C CG   . TRP A 1 53 ? -15.206 3.903   -1.079  1.00 0.00 ? 53 TRP A CG   9  
ATOM 7954  C CD1  . TRP A 1 53 ? -14.432 4.389   -0.080  1.00 0.00 ? 53 TRP A CD1  9  
ATOM 7955  C CD2  . TRP A 1 53 ? -15.734 5.060   -1.788  1.00 0.00 ? 53 TRP A CD2  9  
ATOM 7956  N NE1  . TRP A 1 53 ? -14.452 5.770   -0.132  1.00 0.00 ? 53 TRP A NE1  9  
ATOM 7957  C CE2  . TRP A 1 53 ? -15.240 6.233   -1.167  1.00 0.00 ? 53 TRP A CE2  9  
ATOM 7958  C CE3  . TRP A 1 53 ? -16.584 5.207   -2.899  1.00 0.00 ? 53 TRP A CE3  9  
ATOM 7959  C CZ2  . TRP A 1 53 ? -15.579 7.504   -1.632  1.00 0.00 ? 53 TRP A CZ2  9  
ATOM 7960  C CZ3  . TRP A 1 53 ? -16.926 6.485   -3.369  1.00 0.00 ? 53 TRP A CZ3  9  
ATOM 7961  C CH2  . TRP A 1 53 ? -16.425 7.631   -2.736  1.00 0.00 ? 53 TRP A CH2  9  
ATOM 7962  H H    . TRP A 1 53 ? -14.778 0.298   -0.183  1.00 0.00 ? 53 TRP A H    9  
ATOM 7963  H HA   . TRP A 1 53 ? -16.248 2.499   0.635   1.00 0.00 ? 53 TRP A HA   9  
ATOM 7964  H HB2  . TRP A 1 53 ? -14.488 1.945   -1.436  1.00 0.00 ? 53 TRP A HB2  9  
ATOM 7965  H HB3  . TRP A 1 53 ? -15.980 2.344   -2.284  1.00 0.00 ? 53 TRP A HB3  9  
ATOM 7966  H HD1  . TRP A 1 53 ? -13.888 3.794   0.639   1.00 0.00 ? 53 TRP A HD1  9  
ATOM 7967  H HE1  . TRP A 1 53 ? -13.972 6.366   0.482   1.00 0.00 ? 53 TRP A HE1  9  
ATOM 7968  H HE3  . TRP A 1 53 ? -16.978 4.331   -3.393  1.00 0.00 ? 53 TRP A HE3  9  
ATOM 7969  H HZ2  . TRP A 1 53 ? -15.188 8.384   -1.141  1.00 0.00 ? 53 TRP A HZ2  9  
ATOM 7970  H HZ3  . TRP A 1 53 ? -17.582 6.586   -4.222  1.00 0.00 ? 53 TRP A HZ3  9  
ATOM 7971  H HH2  . TRP A 1 53 ? -16.692 8.612   -3.103  1.00 0.00 ? 53 TRP A HH2  9  
ATOM 7972  N N    . LYS A 1 54 ? -17.940 0.449   -1.278  1.00 0.00 ? 54 LYS A N    9  
ATOM 7973  C CA   . LYS A 1 54 ? -19.279 0.121   -1.750  1.00 0.00 ? 54 LYS A CA   9  
ATOM 7974  C C    . LYS A 1 54 ? -20.307 0.348   -0.647  1.00 0.00 ? 54 LYS A C    9  
ATOM 7975  O O    . LYS A 1 54 ? -20.734 1.478   -0.407  1.00 0.00 ? 54 LYS A O    9  
ATOM 7976  C CB   . LYS A 1 54 ? -19.329 -1.341  -2.204  1.00 0.00 ? 54 LYS A CB   9  
ATOM 7977  C CG   . LYS A 1 54 ? -18.547 -1.508  -3.513  1.00 0.00 ? 54 LYS A CG   9  
ATOM 7978  C CD   . LYS A 1 54 ? -19.471 -1.245  -4.706  1.00 0.00 ? 54 LYS A CD   9  
ATOM 7979  C CE   . LYS A 1 54 ? -18.680 -1.394  -6.007  1.00 0.00 ? 54 LYS A CE   9  
ATOM 7980  N NZ   . LYS A 1 54 ? -17.805 -0.201  -6.193  1.00 0.00 ? 54 LYS A NZ   9  
ATOM 7981  H H    . LYS A 1 54 ? -17.209 -0.187  -1.421  1.00 0.00 ? 54 LYS A H    9  
ATOM 7982  H HA   . LYS A 1 54 ? -19.521 0.754   -2.590  1.00 0.00 ? 54 LYS A HA   9  
ATOM 7983  H HB2  . LYS A 1 54 ? -18.890 -1.967  -1.440  1.00 0.00 ? 54 LYS A HB2  9  
ATOM 7984  H HB3  . LYS A 1 54 ? -20.357 -1.636  -2.358  1.00 0.00 ? 54 LYS A HB3  9  
ATOM 7985  H HG2  . LYS A 1 54 ? -17.724 -0.807  -3.535  1.00 0.00 ? 54 LYS A HG2  9  
ATOM 7986  H HG3  . LYS A 1 54 ? -18.161 -2.515  -3.575  1.00 0.00 ? 54 LYS A HG3  9  
ATOM 7987  H HD2  . LYS A 1 54 ? -20.283 -1.960  -4.696  1.00 0.00 ? 54 LYS A HD2  9  
ATOM 7988  H HD3  . LYS A 1 54 ? -19.870 -0.245  -4.642  1.00 0.00 ? 54 LYS A HD3  9  
ATOM 7989  H HE2  . LYS A 1 54 ? -18.068 -2.283  -5.958  1.00 0.00 ? 54 LYS A HE2  9  
ATOM 7990  H HE3  . LYS A 1 54 ? -19.364 -1.472  -6.839  1.00 0.00 ? 54 LYS A HE3  9  
ATOM 7991  H HZ1  . LYS A 1 54 ? -17.424 0.098   -5.274  1.00 0.00 ? 54 LYS A HZ1  9  
ATOM 7992  H HZ2  . LYS A 1 54 ? -18.361 0.576   -6.604  1.00 0.00 ? 54 LYS A HZ2  9  
ATOM 7993  H HZ3  . LYS A 1 54 ? -17.021 -0.443  -6.833  1.00 0.00 ? 54 LYS A HZ3  9  
ATOM 7994  N N    . SER A 1 55 ? -20.701 -0.731  0.021   1.00 0.00 ? 55 SER A N    9  
ATOM 7995  C CA   . SER A 1 55 ? -21.680 -0.636  1.098   1.00 0.00 ? 55 SER A CA   9  
ATOM 7996  C C    . SER A 1 55 ? -21.625 -1.877  1.982   1.00 0.00 ? 55 SER A C    9  
ATOM 7997  O O    . SER A 1 55 ? -22.013 -1.836  3.151   1.00 0.00 ? 55 SER A O    9  
ATOM 7998  C CB   . SER A 1 55 ? -23.085 -0.485  0.514   1.00 0.00 ? 55 SER A CB   9  
ATOM 7999  O OG   . SER A 1 55 ? -24.045 -0.752  1.528   1.00 0.00 ? 55 SER A OG   9  
ATOM 8000  H H    . SER A 1 55 ? -20.327 -1.605  -0.215  1.00 0.00 ? 55 SER A H    9  
ATOM 8001  H HA   . SER A 1 55 ? -21.457 0.233   1.698   1.00 0.00 ? 55 SER A HA   9  
ATOM 8002  H HB2  . SER A 1 55 ? -23.221 0.521   0.153   1.00 0.00 ? 55 SER A HB2  9  
ATOM 8003  H HB3  . SER A 1 55 ? -23.209 -1.180  -0.306  1.00 0.00 ? 55 SER A HB3  9  
ATOM 8004  H HG   . SER A 1 55 ? -24.916 -0.730  1.125   1.00 0.00 ? 55 SER A HG   9  
ATOM 8005  N N    . LYS A 1 56 ? -21.141 -2.980  1.419   1.00 0.00 ? 56 LYS A N    9  
ATOM 8006  C CA   . LYS A 1 56 ? -21.040 -4.227  2.164   1.00 0.00 ? 56 LYS A CA   9  
ATOM 8007  C C    . LYS A 1 56 ? -22.417 -4.680  2.640   1.00 0.00 ? 56 LYS A C    9  
ATOM 8008  O O    . LYS A 1 56 ? -22.997 -5.617  2.092   1.00 0.00 ? 56 LYS A O    9  
ATOM 8009  C CB   . LYS A 1 56 ? -20.115 -4.045  3.370   1.00 0.00 ? 56 LYS A CB   9  
ATOM 8010  C CG   . LYS A 1 56 ? -18.857 -3.289  2.937   1.00 0.00 ? 56 LYS A CG   9  
ATOM 8011  C CD   . LYS A 1 56 ? -17.884 -3.186  4.117   1.00 0.00 ? 56 LYS A CD   9  
ATOM 8012  C CE   . LYS A 1 56 ? -17.365 -4.580  4.490   1.00 0.00 ? 56 LYS A CE   9  
ATOM 8013  N NZ   . LYS A 1 56 ? -16.007 -4.457  5.092   1.00 0.00 ? 56 LYS A NZ   9  
ATOM 8014  H H    . LYS A 1 56 ? -20.846 -2.952  0.484   1.00 0.00 ? 56 LYS A H    9  
ATOM 8015  H HA   . LYS A 1 56 ? -20.626 -4.988  1.520   1.00 0.00 ? 56 LYS A HA   9  
ATOM 8016  H HB2  . LYS A 1 56 ? -20.628 -3.485  4.136   1.00 0.00 ? 56 LYS A HB2  9  
ATOM 8017  H HB3  . LYS A 1 56 ? -19.835 -5.013  3.756   1.00 0.00 ? 56 LYS A HB3  9  
ATOM 8018  H HG2  . LYS A 1 56 ? -18.383 -3.814  2.121   1.00 0.00 ? 56 LYS A HG2  9  
ATOM 8019  H HG3  . LYS A 1 56 ? -19.130 -2.295  2.613   1.00 0.00 ? 56 LYS A HG3  9  
ATOM 8020  H HD2  . LYS A 1 56 ? -17.052 -2.555  3.842   1.00 0.00 ? 56 LYS A HD2  9  
ATOM 8021  H HD3  . LYS A 1 56 ? -18.395 -2.756  4.966   1.00 0.00 ? 56 LYS A HD3  9  
ATOM 8022  H HE2  . LYS A 1 56 ? -18.034 -5.036  5.206   1.00 0.00 ? 56 LYS A HE2  9  
ATOM 8023  H HE3  . LYS A 1 56 ? -17.311 -5.198  3.606   1.00 0.00 ? 56 LYS A HE3  9  
ATOM 8024  H HZ1  . LYS A 1 56 ? -15.941 -5.070  5.929   1.00 0.00 ? 56 LYS A HZ1  9  
ATOM 8025  H HZ2  . LYS A 1 56 ? -15.840 -3.470  5.375   1.00 0.00 ? 56 LYS A HZ2  9  
ATOM 8026  H HZ3  . LYS A 1 56 ? -15.291 -4.743  4.393   1.00 0.00 ? 56 LYS A HZ3  9  
ATOM 8027  N N    . ASN A 1 57 ? -22.934 -4.011  3.666   1.00 0.00 ? 57 ASN A N    9  
ATOM 8028  C CA   . ASN A 1 57 ? -24.244 -4.353  4.208   1.00 0.00 ? 57 ASN A CA   9  
ATOM 8029  C C    . ASN A 1 57 ? -25.343 -3.994  3.214   1.00 0.00 ? 57 ASN A C    9  
ATOM 8030  O O    . ASN A 1 57 ? -25.101 -3.900  2.011   1.00 0.00 ? 57 ASN A O    9  
ATOM 8031  C CB   . ASN A 1 57 ? -24.476 -3.607  5.522   1.00 0.00 ? 57 ASN A CB   9  
ATOM 8032  C CG   . ASN A 1 57 ? -23.328 -3.881  6.487   1.00 0.00 ? 57 ASN A CG   9  
ATOM 8033  O OD1  . ASN A 1 57 ? -23.073 -5.032  6.840   1.00 0.00 ? 57 ASN A OD1  9  
ATOM 8034  N ND2  . ASN A 1 57 ? -22.616 -2.884  6.937   1.00 0.00 ? 57 ASN A ND2  9  
ATOM 8035  H H    . ASN A 1 57 ? -22.424 -3.273  4.064   1.00 0.00 ? 57 ASN A H    9  
ATOM 8036  H HA   . ASN A 1 57 ? -24.277 -5.415  4.398   1.00 0.00 ? 57 ASN A HA   9  
ATOM 8037  H HB2  . ASN A 1 57 ? -24.536 -2.546  5.327   1.00 0.00 ? 57 ASN A HB2  9  
ATOM 8038  H HB3  . ASN A 1 57 ? -25.402 -3.942  5.965   1.00 0.00 ? 57 ASN A HB3  9  
ATOM 8039  H HD21 . ASN A 1 57 ? -22.820 -1.969  6.655   1.00 0.00 ? 57 ASN A HD21 9  
ATOM 8040  H HD22 . ASN A 1 57 ? -21.875 -3.052  7.558   1.00 0.00 ? 57 ASN A HD22 9  
ATOM 8041  N N    . LYS A 1 58 ? -26.553 -3.792  3.726   1.00 0.00 ? 58 LYS A N    9  
ATOM 8042  C CA   . LYS A 1 58 ? -27.683 -3.441  2.873   1.00 0.00 ? 58 LYS A CA   9  
ATOM 8043  C C    . LYS A 1 58 ? -27.470 -2.073  2.236   1.00 0.00 ? 58 LYS A C    9  
ATOM 8044  O O    . LYS A 1 58 ? -26.375 -1.759  1.768   1.00 0.00 ? 58 LYS A O    9  
ATOM 8045  C CB   . LYS A 1 58 ? -28.974 -3.430  3.695   1.00 0.00 ? 58 LYS A CB   9  
ATOM 8046  C CG   . LYS A 1 58 ? -29.135 -4.772  4.412   1.00 0.00 ? 58 LYS A CG   9  
ATOM 8047  C CD   . LYS A 1 58 ? -30.433 -4.764  5.223   1.00 0.00 ? 58 LYS A CD   9  
ATOM 8048  C CE   . LYS A 1 58 ? -30.460 -5.979  6.153   1.00 0.00 ? 58 LYS A CE   9  
ATOM 8049  N NZ   . LYS A 1 58 ? -29.396 -5.837  7.188   1.00 0.00 ? 58 LYS A NZ   9  
ATOM 8050  H H    . LYS A 1 58 ? -26.688 -3.879  4.692   1.00 0.00 ? 58 LYS A H    9  
ATOM 8051  H HA   . LYS A 1 58 ? -27.775 -4.181  2.093   1.00 0.00 ? 58 LYS A HA   9  
ATOM 8052  H HB2  . LYS A 1 58 ? -28.928 -2.634  4.425   1.00 0.00 ? 58 LYS A HB2  9  
ATOM 8053  H HB3  . LYS A 1 58 ? -29.817 -3.269  3.040   1.00 0.00 ? 58 LYS A HB3  9  
ATOM 8054  H HG2  . LYS A 1 58 ? -29.171 -5.567  3.681   1.00 0.00 ? 58 LYS A HG2  9  
ATOM 8055  H HG3  . LYS A 1 58 ? -28.299 -4.930  5.075   1.00 0.00 ? 58 LYS A HG3  9  
ATOM 8056  H HD2  . LYS A 1 58 ? -30.484 -3.859  5.811   1.00 0.00 ? 58 LYS A HD2  9  
ATOM 8057  H HD3  . LYS A 1 58 ? -31.277 -4.808  4.553   1.00 0.00 ? 58 LYS A HD3  9  
ATOM 8058  H HE2  . LYS A 1 58 ? -31.424 -6.042  6.635   1.00 0.00 ? 58 LYS A HE2  9  
ATOM 8059  H HE3  . LYS A 1 58 ? -30.286 -6.877  5.578   1.00 0.00 ? 58 LYS A HE3  9  
ATOM 8060  H HZ1  . LYS A 1 58 ? -29.444 -6.640  7.847   1.00 0.00 ? 58 LYS A HZ1  9  
ATOM 8061  H HZ2  . LYS A 1 58 ? -29.537 -4.952  7.712   1.00 0.00 ? 58 LYS A HZ2  9  
ATOM 8062  H HZ3  . LYS A 1 58 ? -28.464 -5.822  6.724   1.00 0.00 ? 58 LYS A HZ3  9  
ATOM 8063  N N    . LYS A 1 59 ? -28.522 -1.260  2.220   1.00 0.00 ? 59 LYS A N    9  
ATOM 8064  C CA   . LYS A 1 59 ? -28.437 0.073   1.634   1.00 0.00 ? 59 LYS A CA   9  
ATOM 8065  C C    . LYS A 1 59 ? -27.756 0.017   0.270   1.00 0.00 ? 59 LYS A C    9  
ATOM 8066  O O    . LYS A 1 59 ? -26.702 0.620   0.067   1.00 0.00 ? 59 LYS A O    9  
ATOM 8067  C CB   . LYS A 1 59 ? -27.650 1.001   2.563   1.00 0.00 ? 59 LYS A CB   9  
ATOM 8068  C CG   . LYS A 1 59 ? -27.852 2.455   2.123   1.00 0.00 ? 59 LYS A CG   9  
ATOM 8069  C CD   . LYS A 1 59 ? -27.012 3.389   3.005   1.00 0.00 ? 59 LYS A CD   9  
ATOM 8070  C CE   . LYS A 1 59 ? -27.797 3.756   4.266   1.00 0.00 ? 59 LYS A CE   9  
ATOM 8071  N NZ   . LYS A 1 59 ? -28.962 4.610   3.897   1.00 0.00 ? 59 LYS A NZ   9  
ATOM 8072  H H    . LYS A 1 59 ? -29.370 -1.564  2.606   1.00 0.00 ? 59 LYS A H    9  
ATOM 8073  H HA   . LYS A 1 59 ? -29.435 0.467   1.512   1.00 0.00 ? 59 LYS A HA   9  
ATOM 8074  H HB2  . LYS A 1 59 ? -28.002 0.877   3.576   1.00 0.00 ? 59 LYS A HB2  9  
ATOM 8075  H HB3  . LYS A 1 59 ? -26.600 0.755   2.512   1.00 0.00 ? 59 LYS A HB3  9  
ATOM 8076  H HG2  . LYS A 1 59 ? -27.547 2.562   1.092   1.00 0.00 ? 59 LYS A HG2  9  
ATOM 8077  H HG3  . LYS A 1 59 ? -28.896 2.716   2.215   1.00 0.00 ? 59 LYS A HG3  9  
ATOM 8078  H HD2  . LYS A 1 59 ? -26.093 2.892   3.284   1.00 0.00 ? 59 LYS A HD2  9  
ATOM 8079  H HD3  . LYS A 1 59 ? -26.780 4.287   2.454   1.00 0.00 ? 59 LYS A HD3  9  
ATOM 8080  H HE2  . LYS A 1 59 ? -28.150 2.855   4.748   1.00 0.00 ? 59 LYS A HE2  9  
ATOM 8081  H HE3  . LYS A 1 59 ? -27.155 4.298   4.944   1.00 0.00 ? 59 LYS A HE3  9  
ATOM 8082  H HZ1  . LYS A 1 59 ? -28.633 5.573   3.690   1.00 0.00 ? 59 LYS A HZ1  9  
ATOM 8083  H HZ2  . LYS A 1 59 ? -29.637 4.638   4.686   1.00 0.00 ? 59 LYS A HZ2  9  
ATOM 8084  H HZ3  . LYS A 1 59 ? -29.428 4.213   3.056   1.00 0.00 ? 59 LYS A HZ3  9  
ATOM 8085  N N    . ARG A 1 60 ? -28.365 -0.712  -0.661  1.00 0.00 ? 60 ARG A N    9  
ATOM 8086  C CA   . ARG A 1 60 ? -27.813 -0.842  -2.002  1.00 0.00 ? 60 ARG A CA   9  
ATOM 8087  C C    . ARG A 1 60 ? -28.415 0.217   -2.924  1.00 0.00 ? 60 ARG A C    9  
ATOM 8088  O O    . ARG A 1 60 ? -27.656 1.004   -3.466  1.00 0.00 ? 60 ARG A O    9  
ATOM 8089  C CB   . ARG A 1 60 ? -28.110 -2.250  -2.539  1.00 0.00 ? 60 ARG A CB   9  
ATOM 8090  C CG   . ARG A 1 60 ? -28.247 -2.217  -4.063  1.00 0.00 ? 60 ARG A CG   9  
ATOM 8091  C CD   . ARG A 1 60 ? -28.139 -3.639  -4.618  1.00 0.00 ? 60 ARG A CD   9  
ATOM 8092  N NE   . ARG A 1 60 ? -28.197 -3.617  -6.075  1.00 0.00 ? 60 ARG A NE   9  
ATOM 8093  C CZ   . ARG A 1 60 ? -27.165 -3.198  -6.798  1.00 0.00 ? 60 ARG A CZ   9  
ATOM 8094  N NH1  . ARG A 1 60 ? -26.074 -2.794  -6.206  1.00 0.00 ? 60 ARG A NH1  9  
ATOM 8095  N NH2  . ARG A 1 60 ? -27.241 -3.188  -8.101  1.00 0.00 ? 60 ARG A NH2  9  
ATOM 8096  O OXT  . ARG A 1 60 ? -29.627 0.226   -3.072  1.00 0.00 ? 60 ARG A OXT  9  
ATOM 8097  H H    . ARG A 1 60 ? -29.203 -1.170  -0.442  1.00 0.00 ? 60 ARG A H    9  
ATOM 8098  H HA   . ARG A 1 60 ? -26.743 -0.702  -1.960  1.00 0.00 ? 60 ARG A HA   9  
ATOM 8099  H HB2  . ARG A 1 60 ? -27.302 -2.915  -2.266  1.00 0.00 ? 60 ARG A HB2  9  
ATOM 8100  H HB3  . ARG A 1 60 ? -29.030 -2.612  -2.106  1.00 0.00 ? 60 ARG A HB3  9  
ATOM 8101  H HG2  . ARG A 1 60 ? -29.208 -1.800  -4.324  1.00 0.00 ? 60 ARG A HG2  9  
ATOM 8102  H HG3  . ARG A 1 60 ? -27.462 -1.607  -4.482  1.00 0.00 ? 60 ARG A HG3  9  
ATOM 8103  H HD2  . ARG A 1 60 ? -27.201 -4.074  -4.306  1.00 0.00 ? 60 ARG A HD2  9  
ATOM 8104  H HD3  . ARG A 1 60 ? -28.953 -4.235  -4.233  1.00 0.00 ? 60 ARG A HD3  9  
ATOM 8105  H HE   . ARG A 1 60 ? -29.012 -3.917  -6.528  1.00 0.00 ? 60 ARG A HE   9  
ATOM 8106  H HH11 . ARG A 1 60 ? -26.014 -2.801  -5.208  1.00 0.00 ? 60 ARG A HH11 9  
ATOM 8107  H HH12 . ARG A 1 60 ? -25.297 -2.478  -6.752  1.00 0.00 ? 60 ARG A HH12 9  
ATOM 8108  H HH21 . ARG A 1 60 ? -28.078 -3.498  -8.555  1.00 0.00 ? 60 ARG A HH21 9  
ATOM 8109  H HH22 . ARG A 1 60 ? -26.464 -2.873  -8.647  1.00 0.00 ? 60 ARG A HH22 9  
ATOM 8110  N N    . GLY A 1 9  ? 12.382  12.623  10.221  1.00 0.00 ? 9  GLY A N    10 
ATOM 8111  C CA   . GLY A 1 9  ? 12.864  11.323  9.767   1.00 0.00 ? 9  GLY A CA   10 
ATOM 8112  C C    . GLY A 1 9  ? 11.744  10.289  9.787   1.00 0.00 ? 9  GLY A C    10 
ATOM 8113  O O    . GLY A 1 9  ? 11.092  10.084  10.811  1.00 0.00 ? 9  GLY A O    10 
ATOM 8114  H H    . GLY A 1 9  ? 12.529  12.892  11.152  1.00 0.00 ? 9  GLY A H    10 
ATOM 8115  H HA2  . GLY A 1 9  ? 13.245  11.417  8.760   1.00 0.00 ? 9  GLY A HA2  10 
ATOM 8116  H HA3  . GLY A 1 9  ? 13.659  10.992  10.417  1.00 0.00 ? 9  GLY A HA3  10 
ATOM 8117  N N    . THR A 1 10 ? 11.524  9.639   8.649   1.00 0.00 ? 10 THR A N    10 
ATOM 8118  C CA   . THR A 1 10 ? 10.483  8.629   8.545   1.00 0.00 ? 10 THR A CA   10 
ATOM 8119  C C    . THR A 1 10 ? 10.918  7.342   9.239   1.00 0.00 ? 10 THR A C    10 
ATOM 8120  O O    . THR A 1 10 ? 12.095  7.160   9.550   1.00 0.00 ? 10 THR A O    10 
ATOM 8121  C CB   . THR A 1 10 ? 10.186  8.347   7.069   1.00 0.00 ? 10 THR A CB   10 
ATOM 8122  O OG1  . THR A 1 10 ? 11.397  8.398   6.329   1.00 0.00 ? 10 THR A OG1  10 
ATOM 8123  C CG2  . THR A 1 10 ? 9.212   9.396   6.529   1.00 0.00 ? 10 THR A CG2  10 
ATOM 8124  H H    . THR A 1 10 ? 12.073  9.841   7.864   1.00 0.00 ? 10 THR A H    10 
ATOM 8125  H HA   . THR A 1 10 ? 9.586   8.998   9.020   1.00 0.00 ? 10 THR A HA   10 
ATOM 8126  H HB   . THR A 1 10 ? 9.747   7.370   6.970   1.00 0.00 ? 10 THR A HB   10 
ATOM 8127  H HG1  . THR A 1 10 ? 11.329  9.122   5.700   1.00 0.00 ? 10 THR A HG1  10 
ATOM 8128  H HG21 . THR A 1 10 ? 9.132   9.295   5.456   1.00 0.00 ? 10 THR A HG21 10 
ATOM 8129  H HG22 . THR A 1 10 ? 9.574   10.384  6.770   1.00 0.00 ? 10 THR A HG22 10 
ATOM 8130  H HG23 . THR A 1 10 ? 8.239   9.249   6.976   1.00 0.00 ? 10 THR A HG23 10 
ATOM 8131  N N    . LYS A 1 11 ? 9.962   6.449   9.474   1.00 0.00 ? 11 LYS A N    10 
ATOM 8132  C CA   . LYS A 1 11 ? 10.258  5.181   10.131  1.00 0.00 ? 11 LYS A CA   10 
ATOM 8133  C C    . LYS A 1 11 ? 10.896  4.206   9.145   1.00 0.00 ? 11 LYS A C    10 
ATOM 8134  O O    . LYS A 1 11 ? 11.492  4.618   8.149   1.00 0.00 ? 11 LYS A O    10 
ATOM 8135  C CB   . LYS A 1 11 ? 8.974   4.571   10.695  1.00 0.00 ? 11 LYS A CB   10 
ATOM 8136  C CG   . LYS A 1 11 ? 8.209   5.634   11.488  1.00 0.00 ? 11 LYS A CG   10 
ATOM 8137  C CD   . LYS A 1 11 ? 6.909   5.036   12.040  1.00 0.00 ? 11 LYS A CD   10 
ATOM 8138  C CE   . LYS A 1 11 ? 7.183   4.343   13.379  1.00 0.00 ? 11 LYS A CE   10 
ATOM 8139  N NZ   . LYS A 1 11 ? 7.737   5.333   14.345  1.00 0.00 ? 11 LYS A NZ   10 
ATOM 8140  H H    . LYS A 1 11 ? 9.041   6.646   9.203   1.00 0.00 ? 11 LYS A H    10 
ATOM 8141  H HA   . LYS A 1 11 ? 10.947  5.359   10.942  1.00 0.00 ? 11 LYS A HA   10 
ATOM 8142  H HB2  . LYS A 1 11 ? 8.357   4.215   9.883   1.00 0.00 ? 11 LYS A HB2  10 
ATOM 8143  H HB3  . LYS A 1 11 ? 9.223   3.748   11.347  1.00 0.00 ? 11 LYS A HB3  10 
ATOM 8144  H HG2  . LYS A 1 11 ? 8.824   5.984   12.306  1.00 0.00 ? 11 LYS A HG2  10 
ATOM 8145  H HG3  . LYS A 1 11 ? 7.973   6.464   10.839  1.00 0.00 ? 11 LYS A HG3  10 
ATOM 8146  H HD2  . LYS A 1 11 ? 6.185   5.824   12.187  1.00 0.00 ? 11 LYS A HD2  10 
ATOM 8147  H HD3  . LYS A 1 11 ? 6.517   4.314   11.339  1.00 0.00 ? 11 LYS A HD3  10 
ATOM 8148  H HE2  . LYS A 1 11 ? 6.263   3.936   13.768  1.00 0.00 ? 11 LYS A HE2  10 
ATOM 8149  H HE3  . LYS A 1 11 ? 7.896   3.546   13.234  1.00 0.00 ? 11 LYS A HE3  10 
ATOM 8150  H HZ1  . LYS A 1 11 ? 7.138   5.362   15.195  1.00 0.00 ? 11 LYS A HZ1  10 
ATOM 8151  H HZ2  . LYS A 1 11 ? 7.755   6.275   13.906  1.00 0.00 ? 11 LYS A HZ2  10 
ATOM 8152  H HZ3  . LYS A 1 11 ? 8.704   5.055   14.611  1.00 0.00 ? 11 LYS A HZ3  10 
ATOM 8153  N N    . LYS A 1 12 ? 10.767  2.915   9.430   1.00 0.00 ? 12 LYS A N    10 
ATOM 8154  C CA   . LYS A 1 12 ? 11.337  1.891   8.562   1.00 0.00 ? 12 LYS A CA   10 
ATOM 8155  C C    . LYS A 1 12 ? 10.932  2.132   7.111   1.00 0.00 ? 12 LYS A C    10 
ATOM 8156  O O    . LYS A 1 12 ? 11.782  2.322   6.242   1.00 0.00 ? 12 LYS A O    10 
ATOM 8157  C CB   . LYS A 1 12 ? 10.859  0.504   9.004   1.00 0.00 ? 12 LYS A CB   10 
ATOM 8158  C CG   . LYS A 1 12 ? 11.515  0.131   10.340  1.00 0.00 ? 12 LYS A CG   10 
ATOM 8159  C CD   . LYS A 1 12 ? 12.871  -0.546  10.087  1.00 0.00 ? 12 LYS A CD   10 
ATOM 8160  C CE   . LYS A 1 12 ? 12.669  -2.049  9.879   1.00 0.00 ? 12 LYS A CE   10 
ATOM 8161  N NZ   . LYS A 1 12 ? 12.448  -2.709  11.197  1.00 0.00 ? 12 LYS A NZ   10 
ATOM 8162  H H    . LYS A 1 12 ? 10.282  2.646   10.238  1.00 0.00 ? 12 LYS A H    10 
ATOM 8163  H HA   . LYS A 1 12 ? 12.413  1.928   8.634   1.00 0.00 ? 12 LYS A HA   10 
ATOM 8164  H HB2  . LYS A 1 12 ? 9.784   0.519   9.123   1.00 0.00 ? 12 LYS A HB2  10 
ATOM 8165  H HB3  . LYS A 1 12 ? 11.127  -0.224  8.253   1.00 0.00 ? 12 LYS A HB3  10 
ATOM 8166  H HG2  . LYS A 1 12 ? 11.664  1.024   10.930  1.00 0.00 ? 12 LYS A HG2  10 
ATOM 8167  H HG3  . LYS A 1 12 ? 10.871  -0.549  10.879  1.00 0.00 ? 12 LYS A HG3  10 
ATOM 8168  H HD2  . LYS A 1 12 ? 13.331  -0.119  9.207   1.00 0.00 ? 12 LYS A HD2  10 
ATOM 8169  H HD3  . LYS A 1 12 ? 13.515  -0.388  10.940  1.00 0.00 ? 12 LYS A HD3  10 
ATOM 8170  H HE2  . LYS A 1 12 ? 11.810  -2.214  9.246   1.00 0.00 ? 12 LYS A HE2  10 
ATOM 8171  H HE3  . LYS A 1 12 ? 13.547  -2.468  9.409   1.00 0.00 ? 12 LYS A HE3  10 
ATOM 8172  H HZ1  . LYS A 1 12 ? 11.634  -2.271  11.671  1.00 0.00 ? 12 LYS A HZ1  10 
ATOM 8173  H HZ2  . LYS A 1 12 ? 13.295  -2.592  11.789  1.00 0.00 ? 12 LYS A HZ2  10 
ATOM 8174  H HZ3  . LYS A 1 12 ? 12.263  -3.722  11.049  1.00 0.00 ? 12 LYS A HZ3  10 
ATOM 8175  N N    . TYR A 1 13 ? 9.625   2.122   6.857   1.00 0.00 ? 13 TYR A N    10 
ATOM 8176  C CA   . TYR A 1 13 ? 9.111   2.341   5.508   1.00 0.00 ? 13 TYR A CA   10 
ATOM 8177  C C    . TYR A 1 13 ? 7.982   3.367   5.529   1.00 0.00 ? 13 TYR A C    10 
ATOM 8178  O O    . TYR A 1 13 ? 7.344   3.582   6.559   1.00 0.00 ? 13 TYR A O    10 
ATOM 8179  C CB   . TYR A 1 13 ? 8.595   1.018   4.924   1.00 0.00 ? 13 TYR A CB   10 
ATOM 8180  C CG   . TYR A 1 13 ? 9.703   0.331   4.156   1.00 0.00 ? 13 TYR A CG   10 
ATOM 8181  C CD1  . TYR A 1 13 ? 10.785  -0.236  4.841   1.00 0.00 ? 13 TYR A CD1  10 
ATOM 8182  C CD2  . TYR A 1 13 ? 9.647   0.263   2.759   1.00 0.00 ? 13 TYR A CD2  10 
ATOM 8183  C CE1  . TYR A 1 13 ? 11.809  -0.870  4.128   1.00 0.00 ? 13 TYR A CE1  10 
ATOM 8184  C CE2  . TYR A 1 13 ? 10.670  -0.372  2.048   1.00 0.00 ? 13 TYR A CE2  10 
ATOM 8185  C CZ   . TYR A 1 13 ? 11.751  -0.938  2.732   1.00 0.00 ? 13 TYR A CZ   10 
ATOM 8186  O OH   . TYR A 1 13 ? 12.761  -1.563  2.029   1.00 0.00 ? 13 TYR A OH   10 
ATOM 8187  H H    . TYR A 1 13 ? 8.996   1.965   7.591   1.00 0.00 ? 13 TYR A H    10 
ATOM 8188  H HA   . TYR A 1 13 ? 9.908   2.715   4.880   1.00 0.00 ? 13 TYR A HA   10 
ATOM 8189  H HB2  . TYR A 1 13 ? 8.266   0.376   5.727   1.00 0.00 ? 13 TYR A HB2  10 
ATOM 8190  H HB3  . TYR A 1 13 ? 7.767   1.213   4.257   1.00 0.00 ? 13 TYR A HB3  10 
ATOM 8191  H HD1  . TYR A 1 13 ? 10.828  -0.186  5.919   1.00 0.00 ? 13 TYR A HD1  10 
ATOM 8192  H HD2  . TYR A 1 13 ? 8.812   0.700   2.230   1.00 0.00 ? 13 TYR A HD2  10 
ATOM 8193  H HE1  . TYR A 1 13 ? 12.644  -1.307  4.657   1.00 0.00 ? 13 TYR A HE1  10 
ATOM 8194  H HE2  . TYR A 1 13 ? 10.626  -0.424  0.971   1.00 0.00 ? 13 TYR A HE2  10 
ATOM 8195  H HH   . TYR A 1 13 ? 12.420  -1.797  1.163   1.00 0.00 ? 13 TYR A HH   10 
ATOM 8196  N N    . ASP A 1 14 ? 7.742   3.993   4.382   1.00 0.00 ? 14 ASP A N    10 
ATOM 8197  C CA   . ASP A 1 14 ? 6.686   4.994   4.273   1.00 0.00 ? 14 ASP A CA   10 
ATOM 8198  C C    . ASP A 1 14 ? 6.134   5.033   2.853   1.00 0.00 ? 14 ASP A C    10 
ATOM 8199  O O    . ASP A 1 14 ? 6.810   5.479   1.925   1.00 0.00 ? 14 ASP A O    10 
ATOM 8200  C CB   . ASP A 1 14 ? 7.235   6.374   4.646   1.00 0.00 ? 14 ASP A CB   10 
ATOM 8201  C CG   . ASP A 1 14 ? 6.142   7.427   4.501   1.00 0.00 ? 14 ASP A CG   10 
ATOM 8202  O OD1  . ASP A 1 14 ? 5.936   7.889   3.391   1.00 0.00 ? 14 ASP A OD1  10 
ATOM 8203  O OD2  . ASP A 1 14 ? 5.527   7.757   5.502   1.00 0.00 ? 14 ASP A OD2  10 
ATOM 8204  H H    . ASP A 1 14 ? 8.282   3.778   3.594   1.00 0.00 ? 14 ASP A H    10 
ATOM 8205  H HA   . ASP A 1 14 ? 5.887   4.741   4.953   1.00 0.00 ? 14 ASP A HA   10 
ATOM 8206  H HB2  . ASP A 1 14 ? 7.581   6.356   5.670   1.00 0.00 ? 14 ASP A HB2  10 
ATOM 8207  H HB3  . ASP A 1 14 ? 8.059   6.621   3.994   1.00 0.00 ? 14 ASP A HB3  10 
ATOM 8208  N N    . LEU A 1 15 ? 4.901   4.560   2.689   1.00 0.00 ? 15 LEU A N    10 
ATOM 8209  C CA   . LEU A 1 15 ? 4.261   4.541   1.377   1.00 0.00 ? 15 LEU A CA   10 
ATOM 8210  C C    . LEU A 1 15 ? 2.918   5.261   1.434   1.00 0.00 ? 15 LEU A C    10 
ATOM 8211  O O    . LEU A 1 15 ? 1.870   4.659   1.193   1.00 0.00 ? 15 LEU A O    10 
ATOM 8212  C CB   . LEU A 1 15 ? 4.041   3.097   0.914   1.00 0.00 ? 15 LEU A CB   10 
ATOM 8213  C CG   . LEU A 1 15 ? 5.309   2.267   1.146   1.00 0.00 ? 15 LEU A CG   10 
ATOM 8214  C CD1  . LEU A 1 15 ? 4.972   0.780   1.022   1.00 0.00 ? 15 LEU A CD1  10 
ATOM 8215  C CD2  . LEU A 1 15 ? 6.366   2.632   0.100   1.00 0.00 ? 15 LEU A CD2  10 
ATOM 8216  H H    . LEU A 1 15 ? 4.412   4.219   3.467   1.00 0.00 ? 15 LEU A H    10 
ATOM 8217  H HA   . LEU A 1 15 ? 4.897   5.044   0.663   1.00 0.00 ? 15 LEU A HA   10 
ATOM 8218  H HB2  . LEU A 1 15 ? 3.223   2.664   1.470   1.00 0.00 ? 15 LEU A HB2  10 
ATOM 8219  H HB3  . LEU A 1 15 ? 3.800   3.091   -0.139  1.00 0.00 ? 15 LEU A HB3  10 
ATOM 8220  H HG   . LEU A 1 15 ? 5.694   2.463   2.136   1.00 0.00 ? 15 LEU A HG   10 
ATOM 8221  H HD11 . LEU A 1 15 ? 4.269   0.505   1.793   1.00 0.00 ? 15 LEU A HD11 10 
ATOM 8222  H HD12 . LEU A 1 15 ? 5.874   0.196   1.130   1.00 0.00 ? 15 LEU A HD12 10 
ATOM 8223  H HD13 . LEU A 1 15 ? 4.534   0.591   0.052   1.00 0.00 ? 15 LEU A HD13 10 
ATOM 8224  H HD21 . LEU A 1 15 ? 7.196   1.944   0.172   1.00 0.00 ? 15 LEU A HD21 10 
ATOM 8225  H HD22 . LEU A 1 15 ? 6.716   3.638   0.278   1.00 0.00 ? 15 LEU A HD22 10 
ATOM 8226  H HD23 . LEU A 1 15 ? 5.935   2.570   -0.887  1.00 0.00 ? 15 LEU A HD23 10 
ATOM 8227  N N    . SER A 1 16 ? 2.954   6.552   1.756   1.00 0.00 ? 16 SER A N    10 
ATOM 8228  C CA   . SER A 1 16 ? 1.731   7.345   1.842   1.00 0.00 ? 16 SER A CA   10 
ATOM 8229  C C    . SER A 1 16 ? 0.770   6.963   0.720   1.00 0.00 ? 16 SER A C    10 
ATOM 8230  O O    . SER A 1 16 ? -0.404  6.683   0.962   1.00 0.00 ? 16 SER A O    10 
ATOM 8231  C CB   . SER A 1 16 ? 2.067   8.834   1.746   1.00 0.00 ? 16 SER A CB   10 
ATOM 8232  O OG   . SER A 1 16 ? 0.952   9.534   1.210   1.00 0.00 ? 16 SER A OG   10 
ATOM 8233  H H    . SER A 1 16 ? 3.818   6.979   1.938   1.00 0.00 ? 16 SER A H    10 
ATOM 8234  H HA   . SER A 1 16 ? 1.255   7.155   2.791   1.00 0.00 ? 16 SER A HA   10 
ATOM 8235  H HB2  . SER A 1 16 ? 2.290   9.219   2.727   1.00 0.00 ? 16 SER A HB2  10 
ATOM 8236  H HB3  . SER A 1 16 ? 2.930   8.964   1.106   1.00 0.00 ? 16 SER A HB3  10 
ATOM 8237  H HG   . SER A 1 16 ? 0.937   10.410  1.602   1.00 0.00 ? 16 SER A HG   10 
ATOM 8238  N N    . LYS A 1 17 ? 1.282   6.944   -0.505  1.00 0.00 ? 17 LYS A N    10 
ATOM 8239  C CA   . LYS A 1 17 ? 0.470   6.582   -1.659  1.00 0.00 ? 17 LYS A CA   10 
ATOM 8240  C C    . LYS A 1 17 ? 1.372   6.270   -2.847  1.00 0.00 ? 17 LYS A C    10 
ATOM 8241  O O    . LYS A 1 17 ? 2.244   7.065   -3.203  1.00 0.00 ? 17 LYS A O    10 
ATOM 8242  C CB   . LYS A 1 17 ? -0.482  7.734   -2.010  1.00 0.00 ? 17 LYS A CB   10 
ATOM 8243  C CG   . LYS A 1 17 ? -1.796  7.176   -2.567  1.00 0.00 ? 17 LYS A CG   10 
ATOM 8244  C CD   . LYS A 1 17 ? -1.508  6.289   -3.782  1.00 0.00 ? 17 LYS A CD   10 
ATOM 8245  C CE   . LYS A 1 17 ? -2.768  6.173   -4.643  1.00 0.00 ? 17 LYS A CE   10 
ATOM 8246  N NZ   . LYS A 1 17 ? -3.954  5.970   -3.764  1.00 0.00 ? 17 LYS A NZ   10 
ATOM 8247  H H    . LYS A 1 17 ? 2.227   7.166   -0.634  1.00 0.00 ? 17 LYS A H    10 
ATOM 8248  H HA   . LYS A 1 17 ? -0.111  5.704   -1.417  1.00 0.00 ? 17 LYS A HA   10 
ATOM 8249  H HB2  . LYS A 1 17 ? -0.687  8.311   -1.119  1.00 0.00 ? 17 LYS A HB2  10 
ATOM 8250  H HB3  . LYS A 1 17 ? -0.022  8.371   -2.749  1.00 0.00 ? 17 LYS A HB3  10 
ATOM 8251  H HG2  . LYS A 1 17 ? -2.289  6.593   -1.803  1.00 0.00 ? 17 LYS A HG2  10 
ATOM 8252  H HG3  . LYS A 1 17 ? -2.435  7.994   -2.863  1.00 0.00 ? 17 LYS A HG3  10 
ATOM 8253  H HD2  . LYS A 1 17 ? -0.710  6.725   -4.366  1.00 0.00 ? 17 LYS A HD2  10 
ATOM 8254  H HD3  . LYS A 1 17 ? -1.213  5.307   -3.447  1.00 0.00 ? 17 LYS A HD3  10 
ATOM 8255  H HE2  . LYS A 1 17 ? -2.896  7.078   -5.217  1.00 0.00 ? 17 LYS A HE2  10 
ATOM 8256  H HE3  . LYS A 1 17 ? -2.669  5.332   -5.313  1.00 0.00 ? 17 LYS A HE3  10 
ATOM 8257  H HZ1  . LYS A 1 17 ? -4.512  6.846   -3.728  1.00 0.00 ? 17 LYS A HZ1  10 
ATOM 8258  H HZ2  . LYS A 1 17 ? -3.637  5.724   -2.805  1.00 0.00 ? 17 LYS A HZ2  10 
ATOM 8259  H HZ3  . LYS A 1 17 ? -4.539  5.199   -4.145  1.00 0.00 ? 17 LYS A HZ3  10 
ATOM 8260  N N    . TRP A 1 18 ? 1.158   5.109   -3.457  1.00 0.00 ? 18 TRP A N    10 
ATOM 8261  C CA   . TRP A 1 18 ? 1.956   4.689   -4.607  1.00 0.00 ? 18 TRP A CA   10 
ATOM 8262  C C    . TRP A 1 18 ? 1.046   4.447   -5.811  1.00 0.00 ? 18 TRP A C    10 
ATOM 8263  O O    . TRP A 1 18 ? -0.171  4.346   -5.665  1.00 0.00 ? 18 TRP A O    10 
ATOM 8264  C CB   . TRP A 1 18 ? 2.714   3.394   -4.267  1.00 0.00 ? 18 TRP A CB   10 
ATOM 8265  C CG   . TRP A 1 18 ? 4.087   3.701   -3.744  1.00 0.00 ? 18 TRP A CG   10 
ATOM 8266  C CD1  . TRP A 1 18 ? 4.403   4.732   -2.924  1.00 0.00 ? 18 TRP A CD1  10 
ATOM 8267  C CD2  . TRP A 1 18 ? 5.330   2.978   -3.983  1.00 0.00 ? 18 TRP A CD2  10 
ATOM 8268  N NE1  . TRP A 1 18 ? 5.759   4.688   -2.651  1.00 0.00 ? 18 TRP A NE1  10 
ATOM 8269  C CE2  . TRP A 1 18 ? 6.373   3.626   -3.282  1.00 0.00 ? 18 TRP A CE2  10 
ATOM 8270  C CE3  . TRP A 1 18 ? 5.650   1.835   -4.737  1.00 0.00 ? 18 TRP A CE3  10 
ATOM 8271  C CZ2  . TRP A 1 18 ? 7.687   3.157   -3.325  1.00 0.00 ? 18 TRP A CZ2  10 
ATOM 8272  C CZ3  . TRP A 1 18 ? 6.970   1.360   -4.783  1.00 0.00 ? 18 TRP A CZ3  10 
ATOM 8273  C CH2  . TRP A 1 18 ? 7.986   2.020   -4.079  1.00 0.00 ? 18 TRP A CH2  10 
ATOM 8274  H H    . TRP A 1 18 ? 0.449   4.519   -3.126  1.00 0.00 ? 18 TRP A H    10 
ATOM 8275  H HA   . TRP A 1 18 ? 2.669   5.462   -4.854  1.00 0.00 ? 18 TRP A HA   10 
ATOM 8276  H HB2  . TRP A 1 18 ? 2.163   2.850   -3.514  1.00 0.00 ? 18 TRP A HB2  10 
ATOM 8277  H HB3  . TRP A 1 18 ? 2.800   2.784   -5.156  1.00 0.00 ? 18 TRP A HB3  10 
ATOM 8278  H HD1  . TRP A 1 18 ? 3.714   5.466   -2.545  1.00 0.00 ? 18 TRP A HD1  10 
ATOM 8279  H HE1  . TRP A 1 18 ? 6.241   5.325   -2.084  1.00 0.00 ? 18 TRP A HE1  10 
ATOM 8280  H HE3  . TRP A 1 18 ? 4.877   1.318   -5.282  1.00 0.00 ? 18 TRP A HE3  10 
ATOM 8281  H HZ2  . TRP A 1 18 ? 8.466   3.668   -2.781  1.00 0.00 ? 18 TRP A HZ2  10 
ATOM 8282  H HZ3  . TRP A 1 18 ? 7.204   0.483   -5.365  1.00 0.00 ? 18 TRP A HZ3  10 
ATOM 8283  H HH2  . TRP A 1 18 ? 9.000   1.649   -4.118  1.00 0.00 ? 18 TRP A HH2  10 
ATOM 8284  N N    . LYS A 1 19 ? 1.642   4.350   -6.995  1.00 0.00 ? 19 LYS A N    10 
ATOM 8285  C CA   . LYS A 1 19 ? 0.872   4.114   -8.212  1.00 0.00 ? 19 LYS A CA   10 
ATOM 8286  C C    . LYS A 1 19 ? 0.954   2.644   -8.615  1.00 0.00 ? 19 LYS A C    10 
ATOM 8287  O O    . LYS A 1 19 ? 1.927   1.959   -8.302  1.00 0.00 ? 19 LYS A O    10 
ATOM 8288  C CB   . LYS A 1 19 ? 1.400   4.991   -9.350  1.00 0.00 ? 19 LYS A CB   10 
ATOM 8289  C CG   . LYS A 1 19 ? 1.727   6.386   -8.812  1.00 0.00 ? 19 LYS A CG   10 
ATOM 8290  C CD   . LYS A 1 19 ? 0.479   6.990   -8.162  1.00 0.00 ? 19 LYS A CD   10 
ATOM 8291  C CE   . LYS A 1 19 ? 0.689   8.489   -7.947  1.00 0.00 ? 19 LYS A CE   10 
ATOM 8292  N NZ   . LYS A 1 19 ? 0.723   9.181   -9.267  1.00 0.00 ? 19 LYS A NZ   10 
ATOM 8293  H H    . LYS A 1 19 ? 2.617   4.434   -7.051  1.00 0.00 ? 19 LYS A H    10 
ATOM 8294  H HA   . LYS A 1 19 ? -0.163  4.367   -8.030  1.00 0.00 ? 19 LYS A HA   10 
ATOM 8295  H HB2  . LYS A 1 19 ? 2.293   4.547   -9.765  1.00 0.00 ? 19 LYS A HB2  10 
ATOM 8296  H HB3  . LYS A 1 19 ? 0.648   5.074   -10.120 1.00 0.00 ? 19 LYS A HB3  10 
ATOM 8297  H HG2  . LYS A 1 19 ? 2.516   6.313   -8.078  1.00 0.00 ? 19 LYS A HG2  10 
ATOM 8298  H HG3  . LYS A 1 19 ? 2.049   7.020   -9.625  1.00 0.00 ? 19 LYS A HG3  10 
ATOM 8299  H HD2  . LYS A 1 19 ? -0.373  6.832   -8.808  1.00 0.00 ? 19 LYS A HD2  10 
ATOM 8300  H HD3  . LYS A 1 19 ? 0.302   6.512   -7.210  1.00 0.00 ? 19 LYS A HD3  10 
ATOM 8301  H HE2  . LYS A 1 19 ? -0.123  8.884   -7.353  1.00 0.00 ? 19 LYS A HE2  10 
ATOM 8302  H HE3  . LYS A 1 19 ? 1.624   8.652   -7.431  1.00 0.00 ? 19 LYS A HE3  10 
ATOM 8303  H HZ1  . LYS A 1 19 ? -0.168  9.004   -9.774  1.00 0.00 ? 19 LYS A HZ1  10 
ATOM 8304  H HZ2  . LYS A 1 19 ? 1.517   8.817   -9.829  1.00 0.00 ? 19 LYS A HZ2  10 
ATOM 8305  H HZ3  . LYS A 1 19 ? 0.841   10.204  -9.118  1.00 0.00 ? 19 LYS A HZ3  10 
ATOM 8306  N N    . TYR A 1 20 ? -0.073  2.166   -9.308  1.00 0.00 ? 20 TYR A N    10 
ATOM 8307  C CA   . TYR A 1 20 ? -0.104  0.776   -9.747  1.00 0.00 ? 20 TYR A CA   10 
ATOM 8308  C C    . TYR A 1 20 ? 1.137   0.444   -10.570 1.00 0.00 ? 20 TYR A C    10 
ATOM 8309  O O    . TYR A 1 20 ? 1.695   -0.649  -10.462 1.00 0.00 ? 20 TYR A O    10 
ATOM 8310  C CB   . TYR A 1 20 ? -1.359  0.524   -10.588 1.00 0.00 ? 20 TYR A CB   10 
ATOM 8311  C CG   . TYR A 1 20 ? -1.342  -0.893  -11.107 1.00 0.00 ? 20 TYR A CG   10 
ATOM 8312  C CD1  . TYR A 1 20 ? -1.737  -1.948  -10.276 1.00 0.00 ? 20 TYR A CD1  10 
ATOM 8313  C CD2  . TYR A 1 20 ? -0.929  -1.154  -12.420 1.00 0.00 ? 20 TYR A CD2  10 
ATOM 8314  C CE1  . TYR A 1 20 ? -1.722  -3.263  -10.757 1.00 0.00 ? 20 TYR A CE1  10 
ATOM 8315  C CE2  . TYR A 1 20 ? -0.913  -2.468  -12.900 1.00 0.00 ? 20 TYR A CE2  10 
ATOM 8316  C CZ   . TYR A 1 20 ? -1.310  -3.522  -12.070 1.00 0.00 ? 20 TYR A CZ   10 
ATOM 8317  O OH   . TYR A 1 20 ? -1.293  -4.818  -12.545 1.00 0.00 ? 20 TYR A OH   10 
ATOM 8318  H H    . TYR A 1 20 ? -0.823  2.758   -9.529  1.00 0.00 ? 20 TYR A H    10 
ATOM 8319  H HA   . TYR A 1 20 ? -0.134  0.134   -8.879  1.00 0.00 ? 20 TYR A HA   10 
ATOM 8320  H HB2  . TYR A 1 20 ? -2.237  0.674   -9.977  1.00 0.00 ? 20 TYR A HB2  10 
ATOM 8321  H HB3  . TYR A 1 20 ? -1.377  1.212   -11.420 1.00 0.00 ? 20 TYR A HB3  10 
ATOM 8322  H HD1  . TYR A 1 20 ? -2.057  -1.749  -9.264  1.00 0.00 ? 20 TYR A HD1  10 
ATOM 8323  H HD2  . TYR A 1 20 ? -0.623  -0.340  -13.061 1.00 0.00 ? 20 TYR A HD2  10 
ATOM 8324  H HE1  . TYR A 1 20 ? -2.029  -4.078  -10.117 1.00 0.00 ? 20 TYR A HE1  10 
ATOM 8325  H HE2  . TYR A 1 20 ? -0.595  -2.669  -13.913 1.00 0.00 ? 20 TYR A HE2  10 
ATOM 8326  H HH   . TYR A 1 20 ? -1.140  -4.786  -13.491 1.00 0.00 ? 20 TYR A HH   10 
ATOM 8327  N N    . ALA A 1 21 ? 1.560   1.396   -11.397 1.00 0.00 ? 21 ALA A N    10 
ATOM 8328  C CA   . ALA A 1 21 ? 2.730   1.201   -12.245 1.00 0.00 ? 21 ALA A CA   10 
ATOM 8329  C C    . ALA A 1 21 ? 3.973   0.899   -11.411 1.00 0.00 ? 21 ALA A C    10 
ATOM 8330  O O    . ALA A 1 21 ? 4.560   -0.178  -11.527 1.00 0.00 ? 21 ALA A O    10 
ATOM 8331  C CB   . ALA A 1 21 ? 2.976   2.453   -13.086 1.00 0.00 ? 21 ALA A CB   10 
ATOM 8332  H H    . ALA A 1 21 ? 1.071   2.244   -11.440 1.00 0.00 ? 21 ALA A H    10 
ATOM 8333  H HA   . ALA A 1 21 ? 2.546   0.370   -12.909 1.00 0.00 ? 21 ALA A HA   10 
ATOM 8334  H HB1  . ALA A 1 21 ? 2.967   3.325   -12.448 1.00 0.00 ? 21 ALA A HB1  10 
ATOM 8335  H HB2  . ALA A 1 21 ? 2.199   2.546   -13.831 1.00 0.00 ? 21 ALA A HB2  10 
ATOM 8336  H HB3  . ALA A 1 21 ? 3.935   2.377   -13.576 1.00 0.00 ? 21 ALA A HB3  10 
ATOM 8337  N N    . GLU A 1 22 ? 4.376   1.855   -10.581 1.00 0.00 ? 22 GLU A N    10 
ATOM 8338  C CA   . GLU A 1 22 ? 5.561   1.673   -9.749  1.00 0.00 ? 22 GLU A CA   10 
ATOM 8339  C C    . GLU A 1 22 ? 5.397   0.471   -8.822  1.00 0.00 ? 22 GLU A C    10 
ATOM 8340  O O    . GLU A 1 22 ? 6.368   -0.220  -8.515  1.00 0.00 ? 22 GLU A O    10 
ATOM 8341  C CB   . GLU A 1 22 ? 5.833   2.936   -8.922  1.00 0.00 ? 22 GLU A CB   10 
ATOM 8342  C CG   . GLU A 1 22 ? 4.679   3.189   -7.951  1.00 0.00 ? 22 GLU A CG   10 
ATOM 8343  C CD   . GLU A 1 22 ? 4.983   4.415   -7.097  1.00 0.00 ? 22 GLU A CD   10 
ATOM 8344  O OE1  . GLU A 1 22 ? 6.146   4.630   -6.798  1.00 0.00 ? 22 GLU A OE1  10 
ATOM 8345  O OE2  . GLU A 1 22 ? 4.049   5.122   -6.754  1.00 0.00 ? 22 GLU A OE2  10 
ATOM 8346  H H    . GLU A 1 22 ? 3.878   2.698   -10.533 1.00 0.00 ? 22 GLU A H    10 
ATOM 8347  H HA   . GLU A 1 22 ? 6.409   1.496   -10.393 1.00 0.00 ? 22 GLU A HA   10 
ATOM 8348  H HB2  . GLU A 1 22 ? 6.749   2.809   -8.366  1.00 0.00 ? 22 GLU A HB2  10 
ATOM 8349  H HB3  . GLU A 1 22 ? 5.930   3.782   -9.585  1.00 0.00 ? 22 GLU A HB3  10 
ATOM 8350  H HG2  . GLU A 1 22 ? 3.771   3.356   -8.508  1.00 0.00 ? 22 GLU A HG2  10 
ATOM 8351  H HG3  . GLU A 1 22 ? 4.553   2.331   -7.309  1.00 0.00 ? 22 GLU A HG3  10 
ATOM 8352  N N    . LEU A 1 23 ? 4.169   0.224   -8.379  1.00 0.00 ? 23 LEU A N    10 
ATOM 8353  C CA   . LEU A 1 23 ? 3.910   -0.902  -7.488  1.00 0.00 ? 23 LEU A CA   10 
ATOM 8354  C C    . LEU A 1 23 ? 4.344   -2.207  -8.149  1.00 0.00 ? 23 LEU A C    10 
ATOM 8355  O O    . LEU A 1 23 ? 5.150   -2.956  -7.599  1.00 0.00 ? 23 LEU A O    10 
ATOM 8356  C CB   . LEU A 1 23 ? 2.412   -0.969  -7.149  1.00 0.00 ? 23 LEU A CB   10 
ATOM 8357  C CG   . LEU A 1 23 ? 2.148   -0.339  -5.776  1.00 0.00 ? 23 LEU A CG   10 
ATOM 8358  C CD1  . LEU A 1 23 ? 0.681   0.087   -5.679  1.00 0.00 ? 23 LEU A CD1  10 
ATOM 8359  C CD2  . LEU A 1 23 ? 2.451   -1.357  -4.672  1.00 0.00 ? 23 LEU A CD2  10 
ATOM 8360  H H    . LEU A 1 23 ? 3.429   0.805   -8.654  1.00 0.00 ? 23 LEU A H    10 
ATOM 8361  H HA   . LEU A 1 23 ? 4.475   -0.766  -6.579  1.00 0.00 ? 23 LEU A HA   10 
ATOM 8362  H HB2  . LEU A 1 23 ? 1.856   -0.431  -7.902  1.00 0.00 ? 23 LEU A HB2  10 
ATOM 8363  H HB3  . LEU A 1 23 ? 2.088   -1.999  -7.136  1.00 0.00 ? 23 LEU A HB3  10 
ATOM 8364  H HG   . LEU A 1 23 ? 2.778   0.529   -5.651  1.00 0.00 ? 23 LEU A HG   10 
ATOM 8365  H HD11 . LEU A 1 23 ? 0.454   0.372   -4.662  1.00 0.00 ? 23 LEU A HD11 10 
ATOM 8366  H HD12 . LEU A 1 23 ? 0.048   -0.737  -5.972  1.00 0.00 ? 23 LEU A HD12 10 
ATOM 8367  H HD13 . LEU A 1 23 ? 0.505   0.926   -6.336  1.00 0.00 ? 23 LEU A HD13 10 
ATOM 8368  H HD21 . LEU A 1 23 ? 1.854   -2.243  -4.826  1.00 0.00 ? 23 LEU A HD21 10 
ATOM 8369  H HD22 . LEU A 1 23 ? 2.212   -0.926  -3.710  1.00 0.00 ? 23 LEU A HD22 10 
ATOM 8370  H HD23 . LEU A 1 23 ? 3.498   -1.619  -4.698  1.00 0.00 ? 23 LEU A HD23 10 
ATOM 8371  N N    . ARG A 1 24 ? 3.803   -2.470  -9.335  1.00 0.00 ? 24 ARG A N    10 
ATOM 8372  C CA   . ARG A 1 24 ? 4.140   -3.687  -10.063 1.00 0.00 ? 24 ARG A CA   10 
ATOM 8373  C C    . ARG A 1 24 ? 5.630   -3.729  -10.387 1.00 0.00 ? 24 ARG A C    10 
ATOM 8374  O O    . ARG A 1 24 ? 6.305   -4.726  -10.130 1.00 0.00 ? 24 ARG A O    10 
ATOM 8375  C CB   . ARG A 1 24 ? 3.332   -3.758  -11.361 1.00 0.00 ? 24 ARG A CB   10 
ATOM 8376  C CG   . ARG A 1 24 ? 3.722   -5.018  -12.138 1.00 0.00 ? 24 ARG A CG   10 
ATOM 8377  C CD   . ARG A 1 24 ? 2.745   -5.224  -13.297 1.00 0.00 ? 24 ARG A CD   10 
ATOM 8378  N NE   . ARG A 1 24 ? 3.143   -6.381  -14.090 1.00 0.00 ? 24 ARG A NE   10 
ATOM 8379  C CZ   . ARG A 1 24 ? 2.468   -6.731  -15.181 1.00 0.00 ? 24 ARG A CZ   10 
ATOM 8380  N NH1  . ARG A 1 24 ? 1.431   -6.033  -15.559 1.00 0.00 ? 24 ARG A NH1  10 
ATOM 8381  N NH2  . ARG A 1 24 ? 2.842   -7.771  -15.877 1.00 0.00 ? 24 ARG A NH2  10 
ATOM 8382  H H    . ARG A 1 24 ? 3.167   -1.833  -9.726  1.00 0.00 ? 24 ARG A H    10 
ATOM 8383  H HA   . ARG A 1 24 ? 3.891   -4.541  -9.451  1.00 0.00 ? 24 ARG A HA   10 
ATOM 8384  H HB2  . ARG A 1 24 ? 2.279   -3.789  -11.127 1.00 0.00 ? 24 ARG A HB2  10 
ATOM 8385  H HB3  . ARG A 1 24 ? 3.543   -2.888  -11.963 1.00 0.00 ? 24 ARG A HB3  10 
ATOM 8386  H HG2  . ARG A 1 24 ? 4.724   -4.907  -12.525 1.00 0.00 ? 24 ARG A HG2  10 
ATOM 8387  H HG3  . ARG A 1 24 ? 3.682   -5.873  -11.480 1.00 0.00 ? 24 ARG A HG3  10 
ATOM 8388  H HD2  . ARG A 1 24 ? 1.753   -5.387  -12.905 1.00 0.00 ? 24 ARG A HD2  10 
ATOM 8389  H HD3  . ARG A 1 24 ? 2.743   -4.343  -13.921 1.00 0.00 ? 24 ARG A HD3  10 
ATOM 8390  H HE   . ARG A 1 24 ? 3.920   -6.911  -13.816 1.00 0.00 ? 24 ARG A HE   10 
ATOM 8391  H HH11 . ARG A 1 24 ? 1.144   -5.238  -15.027 1.00 0.00 ? 24 ARG A HH11 10 
ATOM 8392  H HH12 . ARG A 1 24 ? 0.924   -6.296  -16.378 1.00 0.00 ? 24 ARG A HH12 10 
ATOM 8393  H HH21 . ARG A 1 24 ? 3.637   -8.305  -15.587 1.00 0.00 ? 24 ARG A HH21 10 
ATOM 8394  H HH22 . ARG A 1 24 ? 2.335   -8.033  -16.696 1.00 0.00 ? 24 ARG A HH22 10 
ATOM 8395  N N    . ASP A 1 25 ? 6.135   -2.644  -10.958 1.00 0.00 ? 25 ASP A N    10 
ATOM 8396  C CA   . ASP A 1 25 ? 7.544   -2.575  -11.320 1.00 0.00 ? 25 ASP A CA   10 
ATOM 8397  C C    . ASP A 1 25 ? 8.434   -2.839  -10.109 1.00 0.00 ? 25 ASP A C    10 
ATOM 8398  O O    . ASP A 1 25 ? 9.302   -3.710  -10.143 1.00 0.00 ? 25 ASP A O    10 
ATOM 8399  C CB   . ASP A 1 25 ? 7.867   -1.199  -11.900 1.00 0.00 ? 25 ASP A CB   10 
ATOM 8400  C CG   . ASP A 1 25 ? 9.235   -1.225  -12.575 1.00 0.00 ? 25 ASP A CG   10 
ATOM 8401  O OD1  . ASP A 1 25 ? 9.390   -1.973  -13.526 1.00 0.00 ? 25 ASP A OD1  10 
ATOM 8402  O OD2  . ASP A 1 25 ? 10.106  -0.497  -12.131 1.00 0.00 ? 25 ASP A OD2  10 
ATOM 8403  H H    . ASP A 1 25 ? 5.550   -1.880  -11.145 1.00 0.00 ? 25 ASP A H    10 
ATOM 8404  H HA   . ASP A 1 25 ? 7.745   -3.324  -12.067 1.00 0.00 ? 25 ASP A HA   10 
ATOM 8405  H HB2  . ASP A 1 25 ? 7.114   -0.930  -12.626 1.00 0.00 ? 25 ASP A HB2  10 
ATOM 8406  H HB3  . ASP A 1 25 ? 7.875   -0.468  -11.106 1.00 0.00 ? 25 ASP A HB3  10 
ATOM 8407  N N    . THR A 1 26 ? 8.218   -2.080  -9.040  1.00 0.00 ? 26 THR A N    10 
ATOM 8408  C CA   . THR A 1 26 ? 9.016   -2.238  -7.831  1.00 0.00 ? 26 THR A CA   10 
ATOM 8409  C C    . THR A 1 26 ? 8.918   -3.658  -7.280  1.00 0.00 ? 26 THR A C    10 
ATOM 8410  O O    . THR A 1 26 ? 9.889   -4.186  -6.738  1.00 0.00 ? 26 THR A O    10 
ATOM 8411  C CB   . THR A 1 26 ? 8.554   -1.246  -6.764  1.00 0.00 ? 26 THR A CB   10 
ATOM 8412  O OG1  . THR A 1 26 ? 8.385   0.036   -7.353  1.00 0.00 ? 26 THR A OG1  10 
ATOM 8413  C CG2  . THR A 1 26 ? 9.607   -1.166  -5.658  1.00 0.00 ? 26 THR A CG2  10 
ATOM 8414  H H    . THR A 1 26 ? 7.514   -1.397  -9.069  1.00 0.00 ? 26 THR A H    10 
ATOM 8415  H HA   . THR A 1 26 ? 10.049  -2.030  -8.067  1.00 0.00 ? 26 THR A HA   10 
ATOM 8416  H HB   . THR A 1 26 ? 7.620   -1.579  -6.343  1.00 0.00 ? 26 THR A HB   10 
ATOM 8417  H HG1  . THR A 1 26 ? 8.866   0.673   -6.820  1.00 0.00 ? 26 THR A HG1  10 
ATOM 8418  H HG21 . THR A 1 26 ? 9.238   -0.547  -4.855  1.00 0.00 ? 26 THR A HG21 10 
ATOM 8419  H HG22 . THR A 1 26 ? 10.515  -0.736  -6.055  1.00 0.00 ? 26 THR A HG22 10 
ATOM 8420  H HG23 . THR A 1 26 ? 9.812   -2.157  -5.285  1.00 0.00 ? 26 THR A HG23 10 
ATOM 8421  N N    . ILE A 1 27 ? 7.744   -4.272  -7.407  1.00 0.00 ? 27 ILE A N    10 
ATOM 8422  C CA   . ILE A 1 27 ? 7.558   -5.628  -6.896  1.00 0.00 ? 27 ILE A CA   10 
ATOM 8423  C C    . ILE A 1 27 ? 8.176   -6.655  -7.846  1.00 0.00 ? 27 ILE A C    10 
ATOM 8424  O O    . ILE A 1 27 ? 8.486   -7.776  -7.441  1.00 0.00 ? 27 ILE A O    10 
ATOM 8425  C CB   . ILE A 1 27 ? 6.056   -5.914  -6.685  1.00 0.00 ? 27 ILE A CB   10 
ATOM 8426  C CG1  . ILE A 1 27 ? 5.847   -6.556  -5.306  1.00 0.00 ? 27 ILE A CG1  10 
ATOM 8427  C CG2  . ILE A 1 27 ? 5.522   -6.858  -7.771  1.00 0.00 ? 27 ILE A CG2  10 
ATOM 8428  C CD1  . ILE A 1 27 ? 4.390   -7.005  -5.158  1.00 0.00 ? 27 ILE A CD1  10 
ATOM 8429  H H    . ILE A 1 27 ? 6.995   -3.808  -7.839  1.00 0.00 ? 27 ILE A H    10 
ATOM 8430  H HA   . ILE A 1 27 ? 8.061   -5.704  -5.943  1.00 0.00 ? 27 ILE A HA   10 
ATOM 8431  H HB   . ILE A 1 27 ? 5.511   -4.985  -6.728  1.00 0.00 ? 27 ILE A HB   10 
ATOM 8432  H HG12 . ILE A 1 27 ? 6.499   -7.410  -5.203  1.00 0.00 ? 27 ILE A HG12 10 
ATOM 8433  H HG13 . ILE A 1 27 ? 6.077   -5.834  -4.536  1.00 0.00 ? 27 ILE A HG13 10 
ATOM 8434  H HG21 . ILE A 1 27 ? 5.910   -7.853  -7.608  1.00 0.00 ? 27 ILE A HG21 10 
ATOM 8435  H HG22 . ILE A 1 27 ? 5.832   -6.506  -8.743  1.00 0.00 ? 27 ILE A HG22 10 
ATOM 8436  H HG23 . ILE A 1 27 ? 4.444   -6.882  -7.727  1.00 0.00 ? 27 ILE A HG23 10 
ATOM 8437  H HD11 . ILE A 1 27 ? 3.738   -6.266  -5.599  1.00 0.00 ? 27 ILE A HD11 10 
ATOM 8438  H HD12 . ILE A 1 27 ? 4.153   -7.115  -4.109  1.00 0.00 ? 27 ILE A HD12 10 
ATOM 8439  H HD13 . ILE A 1 27 ? 4.254   -7.952  -5.658  1.00 0.00 ? 27 ILE A HD13 10 
ATOM 8440  N N    . ASN A 1 28 ? 8.347   -6.270  -9.109  1.00 0.00 ? 28 ASN A N    10 
ATOM 8441  C CA   . ASN A 1 28 ? 8.923   -7.176  -10.103 1.00 0.00 ? 28 ASN A CA   10 
ATOM 8442  C C    . ASN A 1 28 ? 10.374  -6.803  -10.407 1.00 0.00 ? 28 ASN A C    10 
ATOM 8443  O O    . ASN A 1 28 ? 11.052  -7.493  -11.167 1.00 0.00 ? 28 ASN A O    10 
ATOM 8444  C CB   . ASN A 1 28 ? 8.080   -7.143  -11.390 1.00 0.00 ? 28 ASN A CB   10 
ATOM 8445  C CG   . ASN A 1 28 ? 8.810   -6.390  -12.498 1.00 0.00 ? 28 ASN A CG   10 
ATOM 8446  O OD1  . ASN A 1 28 ? 9.016   -6.930  -13.585 1.00 0.00 ? 28 ASN A OD1  10 
ATOM 8447  N ND2  . ASN A 1 28 ? 9.214   -5.170  -12.285 1.00 0.00 ? 28 ASN A ND2  10 
ATOM 8448  H H    . ASN A 1 28 ? 8.078   -5.366  -9.379  1.00 0.00 ? 28 ASN A H    10 
ATOM 8449  H HA   . ASN A 1 28 ? 8.906   -8.182  -9.706  1.00 0.00 ? 28 ASN A HA   10 
ATOM 8450  H HB2  . ASN A 1 28 ? 7.886   -8.154  -11.717 1.00 0.00 ? 28 ASN A HB2  10 
ATOM 8451  H HB3  . ASN A 1 28 ? 7.142   -6.649  -11.185 1.00 0.00 ? 28 ASN A HB3  10 
ATOM 8452  H HD21 . ASN A 1 28 ? 9.048   -4.743  -11.419 1.00 0.00 ? 28 ASN A HD21 10 
ATOM 8453  H HD22 . ASN A 1 28 ? 9.682   -4.679  -12.991 1.00 0.00 ? 28 ASN A HD22 10 
ATOM 8454  N N    . THR A 1 29 ? 10.846  -5.712  -9.807  1.00 0.00 ? 29 THR A N    10 
ATOM 8455  C CA   . THR A 1 29 ? 12.223  -5.265  -10.021 1.00 0.00 ? 29 THR A CA   10 
ATOM 8456  C C    . THR A 1 29 ? 13.012  -5.337  -8.720  1.00 0.00 ? 29 THR A C    10 
ATOM 8457  O O    . THR A 1 29 ? 14.118  -5.874  -8.680  1.00 0.00 ? 29 THR A O    10 
ATOM 8458  C CB   . THR A 1 29 ? 12.243  -3.825  -10.547 1.00 0.00 ? 29 THR A CB   10 
ATOM 8459  O OG1  . THR A 1 29 ? 11.464  -3.001  -9.690  1.00 0.00 ? 29 THR A OG1  10 
ATOM 8460  C CG2  . THR A 1 29 ? 11.669  -3.771  -11.972 1.00 0.00 ? 29 THR A CG2  10 
ATOM 8461  H H    . THR A 1 29 ? 10.263  -5.200  -9.206  1.00 0.00 ? 29 THR A H    10 
ATOM 8462  H HA   . THR A 1 29 ? 12.697  -5.909  -10.749 1.00 0.00 ? 29 THR A HA   10 
ATOM 8463  H HB   . THR A 1 29 ? 13.260  -3.464  -10.561 1.00 0.00 ? 29 THR A HB   10 
ATOM 8464  H HG1  . THR A 1 29 ? 11.882  -2.994  -8.827  1.00 0.00 ? 29 THR A HG1  10 
ATOM 8465  H HG21 . THR A 1 29 ? 11.575  -4.771  -12.369 1.00 0.00 ? 29 THR A HG21 10 
ATOM 8466  H HG22 . THR A 1 29 ? 12.327  -3.195  -12.605 1.00 0.00 ? 29 THR A HG22 10 
ATOM 8467  H HG23 . THR A 1 29 ? 10.696  -3.303  -11.949 1.00 0.00 ? 29 THR A HG23 10 
ATOM 8468  N N    . SER A 1 30 ? 12.430  -4.796  -7.654  1.00 0.00 ? 30 SER A N    10 
ATOM 8469  C CA   . SER A 1 30 ? 13.082  -4.808  -6.350  1.00 0.00 ? 30 SER A CA   10 
ATOM 8470  C C    . SER A 1 30 ? 12.652  -6.039  -5.559  1.00 0.00 ? 30 SER A C    10 
ATOM 8471  O O    . SER A 1 30 ? 11.712  -6.735  -5.942  1.00 0.00 ? 30 SER A O    10 
ATOM 8472  C CB   . SER A 1 30 ? 12.723  -3.535  -5.577  1.00 0.00 ? 30 SER A CB   10 
ATOM 8473  O OG   . SER A 1 30 ? 13.787  -2.599  -5.696  1.00 0.00 ? 30 SER A OG   10 
ATOM 8474  H H    . SER A 1 30 ? 11.545  -4.385  -7.745  1.00 0.00 ? 30 SER A H    10 
ATOM 8475  H HA   . SER A 1 30 ? 14.154  -4.839  -6.491  1.00 0.00 ? 30 SER A HA   10 
ATOM 8476  H HB2  . SER A 1 30 ? 11.827  -3.104  -5.989  1.00 0.00 ? 30 SER A HB2  10 
ATOM 8477  H HB3  . SER A 1 30 ? 12.558  -3.777  -4.535  1.00 0.00 ? 30 SER A HB3  10 
ATOM 8478  H HG   . SER A 1 30 ? 14.611  -3.091  -5.730  1.00 0.00 ? 30 SER A HG   10 
ATOM 8479  N N    . CYS A 1 31 ? 13.342  -6.302  -4.456  1.00 0.00 ? 31 CYS A N    10 
ATOM 8480  C CA   . CYS A 1 31 ? 13.015  -7.454  -3.624  1.00 0.00 ? 31 CYS A CA   10 
ATOM 8481  C C    . CYS A 1 31 ? 13.538  -7.264  -2.206  1.00 0.00 ? 31 CYS A C    10 
ATOM 8482  O O    . CYS A 1 31 ? 14.732  -7.049  -1.996  1.00 0.00 ? 31 CYS A O    10 
ATOM 8483  C CB   . CYS A 1 31 ? 13.622  -8.722  -4.228  1.00 0.00 ? 31 CYS A CB   10 
ATOM 8484  S SG   . CYS A 1 31 ? 12.863  -10.177 -3.466  1.00 0.00 ? 31 CYS A SG   10 
ATOM 8485  H H    . CYS A 1 31 ? 14.082  -5.714  -4.196  1.00 0.00 ? 31 CYS A H    10 
ATOM 8486  H HA   . CYS A 1 31 ? 11.942  -7.567  -3.589  1.00 0.00 ? 31 CYS A HA   10 
ATOM 8487  H HB2  . CYS A 1 31 ? 13.440  -8.738  -5.292  1.00 0.00 ? 31 CYS A HB2  10 
ATOM 8488  H HB3  . CYS A 1 31 ? 14.686  -8.733  -4.045  1.00 0.00 ? 31 CYS A HB3  10 
ATOM 8489  H HG   . CYS A 1 31 ? 13.563  -10.710 -3.080  1.00 0.00 ? 31 CYS A HG   10 
ATOM 8490  N N    . ASP A 1 32 ? 12.635  -7.356  -1.237  1.00 0.00 ? 32 ASP A N    10 
ATOM 8491  C CA   . ASP A 1 32 ? 13.006  -7.202  0.164   1.00 0.00 ? 32 ASP A CA   10 
ATOM 8492  C C    . ASP A 1 32 ? 11.803  -7.487  1.057   1.00 0.00 ? 32 ASP A C    10 
ATOM 8493  O O    . ASP A 1 32 ? 10.711  -6.967  0.824   1.00 0.00 ? 32 ASP A O    10 
ATOM 8494  C CB   . ASP A 1 32 ? 13.523  -5.779  0.424   1.00 0.00 ? 32 ASP A CB   10 
ATOM 8495  C CG   . ASP A 1 32 ? 14.631  -5.804  1.473   1.00 0.00 ? 32 ASP A CG   10 
ATOM 8496  O OD1  . ASP A 1 32 ? 14.323  -6.067  2.624   1.00 0.00 ? 32 ASP A OD1  10 
ATOM 8497  O OD2  . ASP A 1 32 ? 15.770  -5.562  1.109   1.00 0.00 ? 32 ASP A OD2  10 
ATOM 8498  H H    . ASP A 1 32 ? 11.699  -7.535  -1.468  1.00 0.00 ? 32 ASP A H    10 
ATOM 8499  H HA   . ASP A 1 32 ? 13.787  -7.909  0.396   1.00 0.00 ? 32 ASP A HA   10 
ATOM 8500  H HB2  . ASP A 1 32 ? 13.911  -5.367  -0.495  1.00 0.00 ? 32 ASP A HB2  10 
ATOM 8501  H HB3  . ASP A 1 32 ? 12.713  -5.160  0.779   1.00 0.00 ? 32 ASP A HB3  10 
ATOM 8502  N N    . ILE A 1 33 ? 12.007  -8.315  2.075   1.00 0.00 ? 33 ILE A N    10 
ATOM 8503  C CA   . ILE A 1 33 ? 10.929  -8.660  2.995   1.00 0.00 ? 33 ILE A CA   10 
ATOM 8504  C C    . ILE A 1 33 ? 10.048  -7.447  3.275   1.00 0.00 ? 33 ILE A C    10 
ATOM 8505  O O    . ILE A 1 33 ? 8.827   -7.564  3.379   1.00 0.00 ? 33 ILE A O    10 
ATOM 8506  C CB   . ILE A 1 33 ? 11.514  -9.181  4.314   1.00 0.00 ? 33 ILE A CB   10 
ATOM 8507  C CG1  . ILE A 1 33 ? 12.740  -8.338  4.700   1.00 0.00 ? 33 ILE A CG1  10 
ATOM 8508  C CG2  . ILE A 1 33 ? 11.933  -10.646 4.147   1.00 0.00 ? 33 ILE A CG2  10 
ATOM 8509  C CD1  . ILE A 1 33 ? 12.872  -8.285  6.225   1.00 0.00 ? 33 ILE A CD1  10 
ATOM 8510  H H    . ILE A 1 33 ? 12.898  -8.700  2.211   1.00 0.00 ? 33 ILE A H    10 
ATOM 8511  H HA   . ILE A 1 33 ? 10.324  -9.437  2.551   1.00 0.00 ? 33 ILE A HA   10 
ATOM 8512  H HB   . ILE A 1 33 ? 10.765  -9.111  5.090   1.00 0.00 ? 33 ILE A HB   10 
ATOM 8513  H HG12 . ILE A 1 33 ? 13.631  -8.778  4.276   1.00 0.00 ? 33 ILE A HG12 10 
ATOM 8514  H HG13 . ILE A 1 33 ? 12.622  -7.333  4.319   1.00 0.00 ? 33 ILE A HG13 10 
ATOM 8515  H HG21 . ILE A 1 33 ? 11.053  -11.272 4.140   1.00 0.00 ? 33 ILE A HG21 10 
ATOM 8516  H HG22 . ILE A 1 33 ? 12.573  -10.932 4.967   1.00 0.00 ? 33 ILE A HG22 10 
ATOM 8517  H HG23 . ILE A 1 33 ? 12.466  -10.763 3.215   1.00 0.00 ? 33 ILE A HG23 10 
ATOM 8518  H HD11 . ILE A 1 33 ? 13.871  -7.967  6.488   1.00 0.00 ? 33 ILE A HD11 10 
ATOM 8519  H HD12 . ILE A 1 33 ? 12.687  -9.265  6.636   1.00 0.00 ? 33 ILE A HD12 10 
ATOM 8520  H HD13 . ILE A 1 33 ? 12.153  -7.585  6.623   1.00 0.00 ? 33 ILE A HD13 10 
ATOM 8521  N N    . GLU A 1 34 ? 10.675  -6.281  3.398   1.00 0.00 ? 34 GLU A N    10 
ATOM 8522  C CA   . GLU A 1 34 ? 9.942   -5.052  3.673   1.00 0.00 ? 34 GLU A CA   10 
ATOM 8523  C C    . GLU A 1 34 ? 9.214   -4.558  2.424   1.00 0.00 ? 34 GLU A C    10 
ATOM 8524  O O    . GLU A 1 34 ? 8.015   -4.286  2.463   1.00 0.00 ? 34 GLU A O    10 
ATOM 8525  C CB   . GLU A 1 34 ? 10.907  -3.970  4.174   1.00 0.00 ? 34 GLU A CB   10 
ATOM 8526  C CG   . GLU A 1 34 ? 12.072  -4.626  4.922   1.00 0.00 ? 34 GLU A CG   10 
ATOM 8527  C CD   . GLU A 1 34 ? 12.725  -3.618  5.862   1.00 0.00 ? 34 GLU A CD   10 
ATOM 8528  O OE1  . GLU A 1 34 ? 12.001  -2.967  6.597   1.00 0.00 ? 34 GLU A OE1  10 
ATOM 8529  O OE2  . GLU A 1 34 ? 13.941  -3.513  5.832   1.00 0.00 ? 34 GLU A OE2  10 
ATOM 8530  H H    . GLU A 1 34 ? 11.651  -6.249  3.307   1.00 0.00 ? 34 GLU A H    10 
ATOM 8531  H HA   . GLU A 1 34 ? 9.212   -5.248  4.444   1.00 0.00 ? 34 GLU A HA   10 
ATOM 8532  H HB2  . GLU A 1 34 ? 11.291  -3.410  3.333   1.00 0.00 ? 34 GLU A HB2  10 
ATOM 8533  H HB3  . GLU A 1 34 ? 10.383  -3.303  4.842   1.00 0.00 ? 34 GLU A HB3  10 
ATOM 8534  H HG2  . GLU A 1 34 ? 11.703  -5.464  5.496   1.00 0.00 ? 34 GLU A HG2  10 
ATOM 8535  H HG3  . GLU A 1 34 ? 12.802  -4.975  4.210   1.00 0.00 ? 34 GLU A HG3  10 
ATOM 8536  N N    . LEU A 1 35 ? 9.944   -4.436  1.319   1.00 0.00 ? 35 LEU A N    10 
ATOM 8537  C CA   . LEU A 1 35 ? 9.345   -3.967  0.073   1.00 0.00 ? 35 LEU A CA   10 
ATOM 8538  C C    . LEU A 1 35 ? 8.125   -4.817  -0.277  1.00 0.00 ? 35 LEU A C    10 
ATOM 8539  O O    . LEU A 1 35 ? 7.040   -4.294  -0.525  1.00 0.00 ? 35 LEU A O    10 
ATOM 8540  C CB   . LEU A 1 35 ? 10.372  -4.045  -1.070  1.00 0.00 ? 35 LEU A CB   10 
ATOM 8541  C CG   . LEU A 1 35 ? 10.175  -2.886  -2.070  1.00 0.00 ? 35 LEU A CG   10 
ATOM 8542  C CD1  . LEU A 1 35 ? 8.687   -2.690  -2.384  1.00 0.00 ? 35 LEU A CD1  10 
ATOM 8543  C CD2  . LEU A 1 35 ? 10.749  -1.582  -1.494  1.00 0.00 ? 35 LEU A CD2  10 
ATOM 8544  H H    . LEU A 1 35 ? 10.898  -4.662  1.342   1.00 0.00 ? 35 LEU A H    10 
ATOM 8545  H HA   . LEU A 1 35 ? 9.035   -2.942  0.204   1.00 0.00 ? 35 LEU A HA   10 
ATOM 8546  H HB2  . LEU A 1 35 ? 11.366  -3.994  -0.655  1.00 0.00 ? 35 LEU A HB2  10 
ATOM 8547  H HB3  . LEU A 1 35 ? 10.256  -4.984  -1.591  1.00 0.00 ? 35 LEU A HB3  10 
ATOM 8548  H HG   . LEU A 1 35 ? 10.696  -3.126  -2.987  1.00 0.00 ? 35 LEU A HG   10 
ATOM 8549  H HD11 . LEU A 1 35 ? 8.206   -3.650  -2.476  1.00 0.00 ? 35 LEU A HD11 10 
ATOM 8550  H HD12 . LEU A 1 35 ? 8.586   -2.150  -3.314  1.00 0.00 ? 35 LEU A HD12 10 
ATOM 8551  H HD13 . LEU A 1 35 ? 8.219   -2.122  -1.591  1.00 0.00 ? 35 LEU A HD13 10 
ATOM 8552  H HD21 . LEU A 1 35 ? 11.242  -1.031  -2.282  1.00 0.00 ? 35 LEU A HD21 10 
ATOM 8553  H HD22 . LEU A 1 35 ? 11.464  -1.806  -0.715  1.00 0.00 ? 35 LEU A HD22 10 
ATOM 8554  H HD23 . LEU A 1 35 ? 9.949   -0.984  -1.086  1.00 0.00 ? 35 LEU A HD23 10 
ATOM 8555  N N    . LEU A 1 36 ? 8.318   -6.134  -0.302  1.00 0.00 ? 36 LEU A N    10 
ATOM 8556  C CA   . LEU A 1 36 ? 7.234   -7.051  -0.630  1.00 0.00 ? 36 LEU A CA   10 
ATOM 8557  C C    . LEU A 1 36 ? 6.135   -6.996  0.425   1.00 0.00 ? 36 LEU A C    10 
ATOM 8558  O O    . LEU A 1 36 ? 4.962   -6.814  0.100   1.00 0.00 ? 36 LEU A O    10 
ATOM 8559  C CB   . LEU A 1 36 ? 7.774   -8.478  -0.741  1.00 0.00 ? 36 LEU A CB   10 
ATOM 8560  C CG   . LEU A 1 36 ? 9.031   -8.487  -1.615  1.00 0.00 ? 36 LEU A CG   10 
ATOM 8561  C CD1  . LEU A 1 36 ? 9.511   -9.928  -1.801  1.00 0.00 ? 36 LEU A CD1  10 
ATOM 8562  C CD2  . LEU A 1 36 ? 8.712   -7.874  -2.984  1.00 0.00 ? 36 LEU A CD2  10 
ATOM 8563  H H    . LEU A 1 36 ? 9.208   -6.492  -0.100  1.00 0.00 ? 36 LEU A H    10 
ATOM 8564  H HA   . LEU A 1 36 ? 6.813   -6.765  -1.583  1.00 0.00 ? 36 LEU A HA   10 
ATOM 8565  H HB2  . LEU A 1 36 ? 8.017   -8.848  0.244   1.00 0.00 ? 36 LEU A HB2  10 
ATOM 8566  H HB3  . LEU A 1 36 ? 7.023   -9.113  -1.189  1.00 0.00 ? 36 LEU A HB3  10 
ATOM 8567  H HG   . LEU A 1 36 ? 9.806   -7.909  -1.132  1.00 0.00 ? 36 LEU A HG   10 
ATOM 8568  H HD11 . LEU A 1 36 ? 10.271  -9.957  -2.570  1.00 0.00 ? 36 LEU A HD11 10 
ATOM 8569  H HD12 . LEU A 1 36 ? 8.679   -10.549 -2.095  1.00 0.00 ? 36 LEU A HD12 10 
ATOM 8570  H HD13 . LEU A 1 36 ? 9.925   -10.292 -0.873  1.00 0.00 ? 36 LEU A HD13 10 
ATOM 8571  H HD21 . LEU A 1 36 ? 8.710   -6.797  -2.906  1.00 0.00 ? 36 LEU A HD21 10 
ATOM 8572  H HD22 . LEU A 1 36 ? 7.741   -8.214  -3.314  1.00 0.00 ? 36 LEU A HD22 10 
ATOM 8573  H HD23 . LEU A 1 36 ? 9.462   -8.180  -3.701  1.00 0.00 ? 36 LEU A HD23 10 
ATOM 8574  N N    . ALA A 1 37 ? 6.515   -7.153  1.690   1.00 0.00 ? 37 ALA A N    10 
ATOM 8575  C CA   . ALA A 1 37 ? 5.538   -7.114  2.773   1.00 0.00 ? 37 ALA A CA   10 
ATOM 8576  C C    . ALA A 1 37 ? 4.704   -5.842  2.683   1.00 0.00 ? 37 ALA A C    10 
ATOM 8577  O O    . ALA A 1 37 ? 3.474   -5.885  2.740   1.00 0.00 ? 37 ALA A O    10 
ATOM 8578  C CB   . ALA A 1 37 ? 6.247   -7.169  4.127   1.00 0.00 ? 37 ALA A CB   10 
ATOM 8579  H H    . ALA A 1 37 ? 7.464   -7.294  1.898   1.00 0.00 ? 37 ALA A H    10 
ATOM 8580  H HA   . ALA A 1 37 ? 4.884   -7.968  2.684   1.00 0.00 ? 37 ALA A HA   10 
ATOM 8581  H HB1  . ALA A 1 37 ? 6.984   -6.382  4.180   1.00 0.00 ? 37 ALA A HB1  10 
ATOM 8582  H HB2  . ALA A 1 37 ? 6.732   -8.127  4.241   1.00 0.00 ? 37 ALA A HB2  10 
ATOM 8583  H HB3  . ALA A 1 37 ? 5.522   -7.039  4.917   1.00 0.00 ? 37 ALA A HB3  10 
ATOM 8584  N N    . ALA A 1 38 ? 5.383   -4.708  2.538   1.00 0.00 ? 38 ALA A N    10 
ATOM 8585  C CA   . ALA A 1 38 ? 4.696   -3.426  2.436   1.00 0.00 ? 38 ALA A CA   10 
ATOM 8586  C C    . ALA A 1 38 ? 3.826   -3.391  1.184   1.00 0.00 ? 38 ALA A C    10 
ATOM 8587  O O    . ALA A 1 38 ? 2.676   -2.954  1.227   1.00 0.00 ? 38 ALA A O    10 
ATOM 8588  C CB   . ALA A 1 38 ? 5.716   -2.287  2.394   1.00 0.00 ? 38 ALA A CB   10 
ATOM 8589  H H    . ALA A 1 38 ? 6.361   -4.733  2.494   1.00 0.00 ? 38 ALA A H    10 
ATOM 8590  H HA   . ALA A 1 38 ? 4.066   -3.298  3.304   1.00 0.00 ? 38 ALA A HA   10 
ATOM 8591  H HB1  . ALA A 1 38 ? 5.255   -1.376  2.748   1.00 0.00 ? 38 ALA A HB1  10 
ATOM 8592  H HB2  . ALA A 1 38 ? 6.060   -2.145  1.380   1.00 0.00 ? 38 ALA A HB2  10 
ATOM 8593  H HB3  . ALA A 1 38 ? 6.558   -2.532  3.026   1.00 0.00 ? 38 ALA A HB3  10 
ATOM 8594  N N    . CYS A 1 39 ? 4.380   -3.859  0.069   1.00 0.00 ? 39 CYS A N    10 
ATOM 8595  C CA   . CYS A 1 39 ? 3.641   -3.880  -1.187  1.00 0.00 ? 39 CYS A CA   10 
ATOM 8596  C C    . CYS A 1 39 ? 2.343   -4.665  -1.021  1.00 0.00 ? 39 CYS A C    10 
ATOM 8597  O O    . CYS A 1 39 ? 1.264   -4.180  -1.359  1.00 0.00 ? 39 CYS A O    10 
ATOM 8598  C CB   . CYS A 1 39 ? 4.487   -4.522  -2.289  1.00 0.00 ? 39 CYS A CB   10 
ATOM 8599  S SG   . CYS A 1 39 ? 3.733   -4.187  -3.899  1.00 0.00 ? 39 CYS A SG   10 
ATOM 8600  H H    . CYS A 1 39 ? 5.299   -4.201  0.094   1.00 0.00 ? 39 CYS A H    10 
ATOM 8601  H HA   . CYS A 1 39 ? 3.405   -2.866  -1.473  1.00 0.00 ? 39 CYS A HA   10 
ATOM 8602  H HB2  . CYS A 1 39 ? 5.484   -4.109  -2.266  1.00 0.00 ? 39 CYS A HB2  10 
ATOM 8603  H HB3  . CYS A 1 39 ? 4.535   -5.589  -2.128  1.00 0.00 ? 39 CYS A HB3  10 
ATOM 8604  H HG   . CYS A 1 39 ? 2.927   -4.703  -3.963  1.00 0.00 ? 39 CYS A HG   10 
ATOM 8605  N N    . ARG A 1 40 ? 2.460   -5.879  -0.492  1.00 0.00 ? 40 ARG A N    10 
ATOM 8606  C CA   . ARG A 1 40 ? 1.290   -6.722  -0.278  1.00 0.00 ? 40 ARG A CA   10 
ATOM 8607  C C    . ARG A 1 40 ? 0.260   -5.991  0.575   1.00 0.00 ? 40 ARG A C    10 
ATOM 8608  O O    . ARG A 1 40 ? -0.919  -5.923  0.221   1.00 0.00 ? 40 ARG A O    10 
ATOM 8609  C CB   . ARG A 1 40 ? 1.703   -8.021  0.416   1.00 0.00 ? 40 ARG A CB   10 
ATOM 8610  C CG   . ARG A 1 40 ? 0.563   -9.037  0.321   1.00 0.00 ? 40 ARG A CG   10 
ATOM 8611  C CD   . ARG A 1 40 ? 1.000   -10.357 0.960   1.00 0.00 ? 40 ARG A CD   10 
ATOM 8612  N NE   . ARG A 1 40 ? 0.070   -11.422 0.602   1.00 0.00 ? 40 ARG A NE   10 
ATOM 8613  C CZ   . ARG A 1 40 ? 0.403   -12.701 0.744   1.00 0.00 ? 40 ARG A CZ   10 
ATOM 8614  N NH1  . ARG A 1 40 ? 1.579   -13.022 1.210   1.00 0.00 ? 40 ARG A NH1  10 
ATOM 8615  N NH2  . ARG A 1 40 ? -0.446  -13.636 0.416   1.00 0.00 ? 40 ARG A NH2  10 
ATOM 8616  H H    . ARG A 1 40 ? 3.345   -6.211  -0.237  1.00 0.00 ? 40 ARG A H    10 
ATOM 8617  H HA   . ARG A 1 40 ? 0.850   -6.961  -1.233  1.00 0.00 ? 40 ARG A HA   10 
ATOM 8618  H HB2  . ARG A 1 40 ? 2.585   -8.423  -0.064  1.00 0.00 ? 40 ARG A HB2  10 
ATOM 8619  H HB3  . ARG A 1 40 ? 1.918   -7.823  1.456   1.00 0.00 ? 40 ARG A HB3  10 
ATOM 8620  H HG2  . ARG A 1 40 ? -0.304  -8.654  0.840   1.00 0.00 ? 40 ARG A HG2  10 
ATOM 8621  H HG3  . ARG A 1 40 ? 0.317   -9.206  -0.717  1.00 0.00 ? 40 ARG A HG3  10 
ATOM 8622  H HD2  . ARG A 1 40 ? 1.987   -10.614 0.610   1.00 0.00 ? 40 ARG A HD2  10 
ATOM 8623  H HD3  . ARG A 1 40 ? 1.020   -10.243 2.034   1.00 0.00 ? 40 ARG A HD3  10 
ATOM 8624  H HE   . ARG A 1 40 ? -0.815  -11.192 0.250   1.00 0.00 ? 40 ARG A HE   10 
ATOM 8625  H HH11 . ARG A 1 40 ? 2.230   -12.306 1.462   1.00 0.00 ? 40 ARG A HH11 10 
ATOM 8626  H HH12 . ARG A 1 40 ? 1.829   -13.984 1.317   1.00 0.00 ? 40 ARG A HH12 10 
ATOM 8627  H HH21 . ARG A 1 40 ? -1.347  -13.391 0.059   1.00 0.00 ? 40 ARG A HH21 10 
ATOM 8628  H HH22 . ARG A 1 40 ? -0.195  -14.599 0.523   1.00 0.00 ? 40 ARG A HH22 10 
ATOM 8629  N N    . GLU A 1 41 ? 0.711   -5.442  1.698   1.00 0.00 ? 41 GLU A N    10 
ATOM 8630  C CA   . GLU A 1 41 ? -0.184  -4.712  2.589   1.00 0.00 ? 41 GLU A CA   10 
ATOM 8631  C C    . GLU A 1 41 ? -0.908  -3.610  1.823   1.00 0.00 ? 41 GLU A C    10 
ATOM 8632  O O    . GLU A 1 41 ? -2.125  -3.455  1.939   1.00 0.00 ? 41 GLU A O    10 
ATOM 8633  C CB   . GLU A 1 41 ? 0.611   -4.099  3.743   1.00 0.00 ? 41 GLU A CB   10 
ATOM 8634  C CG   . GLU A 1 41 ? 1.066   -5.207  4.695   1.00 0.00 ? 41 GLU A CG   10 
ATOM 8635  C CD   . GLU A 1 41 ? -0.131  -5.761  5.460   1.00 0.00 ? 41 GLU A CD   10 
ATOM 8636  O OE1  . GLU A 1 41 ? -0.515  -5.151  6.444   1.00 0.00 ? 41 GLU A OE1  10 
ATOM 8637  O OE2  . GLU A 1 41 ? -0.646  -6.790  5.052   1.00 0.00 ? 41 GLU A OE2  10 
ATOM 8638  H H    . GLU A 1 41 ? 1.660   -5.524  1.929   1.00 0.00 ? 41 GLU A H    10 
ATOM 8639  H HA   . GLU A 1 41 ? -0.914  -5.399  2.993   1.00 0.00 ? 41 GLU A HA   10 
ATOM 8640  H HB2  . GLU A 1 41 ? 1.475   -3.582  3.350   1.00 0.00 ? 41 GLU A HB2  10 
ATOM 8641  H HB3  . GLU A 1 41 ? -0.015  -3.400  4.280   1.00 0.00 ? 41 GLU A HB3  10 
ATOM 8642  H HG2  . GLU A 1 41 ? 1.527   -6.001  4.126   1.00 0.00 ? 41 GLU A HG2  10 
ATOM 8643  H HG3  . GLU A 1 41 ? 1.783   -4.805  5.396   1.00 0.00 ? 41 GLU A HG3  10 
ATOM 8644  N N    . GLU A 1 42 ? -0.153  -2.852  1.036   1.00 0.00 ? 42 GLU A N    10 
ATOM 8645  C CA   . GLU A 1 42 ? -0.735  -1.771  0.248   1.00 0.00 ? 42 GLU A CA   10 
ATOM 8646  C C    . GLU A 1 42 ? -1.834  -2.312  -0.659  1.00 0.00 ? 42 GLU A C    10 
ATOM 8647  O O    . GLU A 1 42 ? -2.898  -1.706  -0.792  1.00 0.00 ? 42 GLU A O    10 
ATOM 8648  C CB   . GLU A 1 42 ? 0.348   -1.099  -0.600  1.00 0.00 ? 42 GLU A CB   10 
ATOM 8649  C CG   . GLU A 1 42 ? 1.251   -0.254  0.301   1.00 0.00 ? 42 GLU A CG   10 
ATOM 8650  C CD   . GLU A 1 42 ? 0.518   1.011   0.736   1.00 0.00 ? 42 GLU A CD   10 
ATOM 8651  O OE1  . GLU A 1 42 ? 0.607   1.997   0.022   1.00 0.00 ? 42 GLU A OE1  10 
ATOM 8652  O OE2  . GLU A 1 42 ? -0.121  0.974   1.774   1.00 0.00 ? 42 GLU A OE2  10 
ATOM 8653  H H    . GLU A 1 42 ? 0.809   -3.025  0.979   1.00 0.00 ? 42 GLU A H    10 
ATOM 8654  H HA   . GLU A 1 42 ? -1.159  -1.039  0.918   1.00 0.00 ? 42 GLU A HA   10 
ATOM 8655  H HB2  . GLU A 1 42 ? 0.938   -1.856  -1.095  1.00 0.00 ? 42 GLU A HB2  10 
ATOM 8656  H HB3  . GLU A 1 42 ? -0.117  -0.463  -1.338  1.00 0.00 ? 42 GLU A HB3  10 
ATOM 8657  H HG2  . GLU A 1 42 ? 1.524   -0.829  1.175   1.00 0.00 ? 42 GLU A HG2  10 
ATOM 8658  H HG3  . GLU A 1 42 ? 2.144   0.019   -0.242  1.00 0.00 ? 42 GLU A HG3  10 
ATOM 8659  N N    . PHE A 1 43 ? -1.572  -3.460  -1.277  1.00 0.00 ? 43 PHE A N    10 
ATOM 8660  C CA   . PHE A 1 43 ? -2.550  -4.076  -2.164  1.00 0.00 ? 43 PHE A CA   10 
ATOM 8661  C C    . PHE A 1 43 ? -3.844  -4.359  -1.404  1.00 0.00 ? 43 PHE A C    10 
ATOM 8662  O O    . PHE A 1 43 ? -4.925  -3.951  -1.827  1.00 0.00 ? 43 PHE A O    10 
ATOM 8663  C CB   . PHE A 1 43 ? -1.984  -5.386  -2.738  1.00 0.00 ? 43 PHE A CB   10 
ATOM 8664  C CG   . PHE A 1 43 ? -1.602  -5.192  -4.189  1.00 0.00 ? 43 PHE A CG   10 
ATOM 8665  C CD1  . PHE A 1 43 ? -0.817  -4.096  -4.565  1.00 0.00 ? 43 PHE A CD1  10 
ATOM 8666  C CD2  . PHE A 1 43 ? -2.034  -6.109  -5.156  1.00 0.00 ? 43 PHE A CD2  10 
ATOM 8667  C CE1  . PHE A 1 43 ? -0.462  -3.917  -5.908  1.00 0.00 ? 43 PHE A CE1  10 
ATOM 8668  C CE2  . PHE A 1 43 ? -1.679  -5.928  -6.498  1.00 0.00 ? 43 PHE A CE2  10 
ATOM 8669  C CZ   . PHE A 1 43 ? -0.894  -4.833  -6.875  1.00 0.00 ? 43 PHE A CZ   10 
ATOM 8670  H H    . PHE A 1 43 ? -0.709  -3.900  -1.131  1.00 0.00 ? 43 PHE A H    10 
ATOM 8671  H HA   . PHE A 1 43 ? -2.764  -3.397  -2.976  1.00 0.00 ? 43 PHE A HA   10 
ATOM 8672  H HB2  . PHE A 1 43 ? -1.109  -5.673  -2.173  1.00 0.00 ? 43 PHE A HB2  10 
ATOM 8673  H HB3  . PHE A 1 43 ? -2.728  -6.168  -2.665  1.00 0.00 ? 43 PHE A HB3  10 
ATOM 8674  H HD1  . PHE A 1 43 ? -0.482  -3.390  -3.819  1.00 0.00 ? 43 PHE A HD1  10 
ATOM 8675  H HD2  . PHE A 1 43 ? -2.639  -6.954  -4.865  1.00 0.00 ? 43 PHE A HD2  10 
ATOM 8676  H HE1  . PHE A 1 43 ? 0.144   -3.071  -6.198  1.00 0.00 ? 43 PHE A HE1  10 
ATOM 8677  H HE2  . PHE A 1 43 ? -2.014  -6.635  -7.244  1.00 0.00 ? 43 PHE A HE2  10 
ATOM 8678  H HZ   . PHE A 1 43 ? -0.621  -4.694  -7.910  1.00 0.00 ? 43 PHE A HZ   10 
ATOM 8679  N N    . HIS A 1 44 ? -3.723  -5.055  -0.280  1.00 0.00 ? 44 HIS A N    10 
ATOM 8680  C CA   . HIS A 1 44 ? -4.891  -5.381  0.531   1.00 0.00 ? 44 HIS A CA   10 
ATOM 8681  C C    . HIS A 1 44 ? -5.676  -4.118  0.861   1.00 0.00 ? 44 HIS A C    10 
ATOM 8682  O O    . HIS A 1 44 ? -6.907  -4.109  0.810   1.00 0.00 ? 44 HIS A O    10 
ATOM 8683  C CB   . HIS A 1 44 ? -4.452  -6.066  1.826   1.00 0.00 ? 44 HIS A CB   10 
ATOM 8684  C CG   . HIS A 1 44 ? -3.936  -7.445  1.516   1.00 0.00 ? 44 HIS A CG   10 
ATOM 8685  N ND1  . HIS A 1 44 ? -3.168  -7.711  0.394   1.00 0.00 ? 44 HIS A ND1  10 
ATOM 8686  C CD2  . HIS A 1 44 ? -4.072  -8.645  2.171   1.00 0.00 ? 44 HIS A CD2  10 
ATOM 8687  C CE1  . HIS A 1 44 ? -2.871  -9.023  0.407   1.00 0.00 ? 44 HIS A CE1  10 
ATOM 8688  N NE2  . HIS A 1 44 ? -3.397  -9.640  1.469   1.00 0.00 ? 44 HIS A NE2  10 
ATOM 8689  H H    . HIS A 1 44 ? -2.836  -5.353  0.010   1.00 0.00 ? 44 HIS A H    10 
ATOM 8690  H HA   . HIS A 1 44 ? -5.525  -6.056  -0.024  1.00 0.00 ? 44 HIS A HA   10 
ATOM 8691  H HB2  . HIS A 1 44 ? -3.671  -5.487  2.294   1.00 0.00 ? 44 HIS A HB2  10 
ATOM 8692  H HB3  . HIS A 1 44 ? -5.295  -6.141  2.497   1.00 0.00 ? 44 HIS A HB3  10 
ATOM 8693  H HD2  . HIS A 1 44 ? -4.617  -8.793  3.091   1.00 0.00 ? 44 HIS A HD2  10 
ATOM 8694  H HE1  . HIS A 1 44 ? -2.280  -9.519  -0.349  1.00 0.00 ? 44 HIS A HE1  10 
ATOM 8695  H HE2  . HIS A 1 44 ? -3.326  -10.588 1.703   1.00 0.00 ? 44 HIS A HE2  10 
ATOM 8696  N N    . ARG A 1 45 ? -4.958  -3.054  1.201   1.00 0.00 ? 45 ARG A N    10 
ATOM 8697  C CA   . ARG A 1 45 ? -5.597  -1.788  1.539   1.00 0.00 ? 45 ARG A CA   10 
ATOM 8698  C C    . ARG A 1 45 ? -6.323  -1.210  0.327   1.00 0.00 ? 45 ARG A C    10 
ATOM 8699  O O    . ARG A 1 45 ? -7.477  -0.793  0.424   1.00 0.00 ? 45 ARG A O    10 
ATOM 8700  C CB   . ARG A 1 45 ? -4.548  -0.789  2.031   1.00 0.00 ? 45 ARG A CB   10 
ATOM 8701  C CG   . ARG A 1 45 ? -5.206  0.572   2.273   1.00 0.00 ? 45 ARG A CG   10 
ATOM 8702  C CD   . ARG A 1 45 ? -4.254  1.470   3.064   1.00 0.00 ? 45 ARG A CD   10 
ATOM 8703  N NE   . ARG A 1 45 ? -4.664  2.864   2.950   1.00 0.00 ? 45 ARG A NE   10 
ATOM 8704  C CZ   . ARG A 1 45 ? -5.785  3.300   3.515   1.00 0.00 ? 45 ARG A CZ   10 
ATOM 8705  N NH1  . ARG A 1 45 ? -6.542  2.476   4.186   1.00 0.00 ? 45 ARG A NH1  10 
ATOM 8706  N NH2  . ARG A 1 45 ? -6.131  4.553   3.398   1.00 0.00 ? 45 ARG A NH2  10 
ATOM 8707  H H    . ARG A 1 45 ? -3.980  -3.121  1.225   1.00 0.00 ? 45 ARG A H    10 
ATOM 8708  H HA   . ARG A 1 45 ? -6.314  -1.957  2.329   1.00 0.00 ? 45 ARG A HA   10 
ATOM 8709  H HB2  . ARG A 1 45 ? -4.116  -1.148  2.954   1.00 0.00 ? 45 ARG A HB2  10 
ATOM 8710  H HB3  . ARG A 1 45 ? -3.774  -0.684  1.288   1.00 0.00 ? 45 ARG A HB3  10 
ATOM 8711  H HG2  . ARG A 1 45 ? -5.433  1.034   1.323   1.00 0.00 ? 45 ARG A HG2  10 
ATOM 8712  H HG3  . ARG A 1 45 ? -6.119  0.436   2.833   1.00 0.00 ? 45 ARG A HG3  10 
ATOM 8713  H HD2  . ARG A 1 45 ? -4.270  1.179   4.104   1.00 0.00 ? 45 ARG A HD2  10 
ATOM 8714  H HD3  . ARG A 1 45 ? -3.252  1.357   2.677   1.00 0.00 ? 45 ARG A HD3  10 
ATOM 8715  H HE   . ARG A 1 45 ? -4.102  3.492   2.449   1.00 0.00 ? 45 ARG A HE   10 
ATOM 8716  H HH11 . ARG A 1 45 ? -6.278  1.515   4.275   1.00 0.00 ? 45 ARG A HH11 10 
ATOM 8717  H HH12 . ARG A 1 45 ? -7.386  2.803   4.610   1.00 0.00 ? 45 ARG A HH12 10 
ATOM 8718  H HH21 . ARG A 1 45 ? -5.552  5.186   2.885   1.00 0.00 ? 45 ARG A HH21 10 
ATOM 8719  H HH22 . ARG A 1 45 ? -6.975  4.882   3.822   1.00 0.00 ? 45 ARG A HH22 10 
ATOM 8720  N N    . ARG A 1 46 ? -5.638  -1.185  -0.812  1.00 0.00 ? 46 ARG A N    10 
ATOM 8721  C CA   . ARG A 1 46 ? -6.228  -0.652  -2.035  1.00 0.00 ? 46 ARG A CA   10 
ATOM 8722  C C    . ARG A 1 46 ? -7.451  -1.469  -2.446  1.00 0.00 ? 46 ARG A C    10 
ATOM 8723  O O    . ARG A 1 46 ? -8.493  -0.913  -2.787  1.00 0.00 ? 46 ARG A O    10 
ATOM 8724  C CB   . ARG A 1 46 ? -5.192  -0.669  -3.166  1.00 0.00 ? 46 ARG A CB   10 
ATOM 8725  C CG   . ARG A 1 46 ? -5.584  0.349   -4.247  1.00 0.00 ? 46 ARG A CG   10 
ATOM 8726  C CD   . ARG A 1 46 ? -5.030  1.732   -3.887  1.00 0.00 ? 46 ARG A CD   10 
ATOM 8727  N NE   . ARG A 1 46 ? -5.838  2.777   -4.506  1.00 0.00 ? 46 ARG A NE   10 
ATOM 8728  C CZ   . ARG A 1 46 ? -5.619  3.167   -5.758  1.00 0.00 ? 46 ARG A CZ   10 
ATOM 8729  N NH1  . ARG A 1 46 ? -4.667  2.611   -6.457  1.00 0.00 ? 46 ARG A NH1  10 
ATOM 8730  N NH2  . ARG A 1 46 ? -6.356  4.104   -6.287  1.00 0.00 ? 46 ARG A NH2  10 
ATOM 8731  H H    . ARG A 1 46 ? -4.720  -1.528  -0.830  1.00 0.00 ? 46 ARG A H    10 
ATOM 8732  H HA   . ARG A 1 46 ? -6.534  0.368   -1.858  1.00 0.00 ? 46 ARG A HA   10 
ATOM 8733  H HB2  . ARG A 1 46 ? -4.221  -0.416  -2.766  1.00 0.00 ? 46 ARG A HB2  10 
ATOM 8734  H HB3  . ARG A 1 46 ? -5.153  -1.656  -3.603  1.00 0.00 ? 46 ARG A HB3  10 
ATOM 8735  H HG2  . ARG A 1 46 ? -5.177  0.036   -5.198  1.00 0.00 ? 46 ARG A HG2  10 
ATOM 8736  H HG3  . ARG A 1 46 ? -6.661  0.403   -4.319  1.00 0.00 ? 46 ARG A HG3  10 
ATOM 8737  H HD2  . ARG A 1 46 ? -5.047  1.860   -2.816  1.00 0.00 ? 46 ARG A HD2  10 
ATOM 8738  H HD3  . ARG A 1 46 ? -4.010  1.811   -4.238  1.00 0.00 ? 46 ARG A HD3  10 
ATOM 8739  H HE   . ARG A 1 46 ? -6.556  3.199   -3.989  1.00 0.00 ? 46 ARG A HE   10 
ATOM 8740  H HH11 . ARG A 1 46 ? -4.102  1.893   -6.051  1.00 0.00 ? 46 ARG A HH11 10 
ATOM 8741  H HH12 . ARG A 1 46 ? -4.502  2.905   -7.399  1.00 0.00 ? 46 ARG A HH12 10 
ATOM 8742  H HH21 . ARG A 1 46 ? -7.085  4.529   -5.752  1.00 0.00 ? 46 ARG A HH21 10 
ATOM 8743  H HH22 . ARG A 1 46 ? -6.192  4.397   -7.229  1.00 0.00 ? 46 ARG A HH22 10 
ATOM 8744  N N    . LEU A 1 47 ? -7.315  -2.790  -2.409  1.00 0.00 ? 47 LEU A N    10 
ATOM 8745  C CA   . LEU A 1 47 ? -8.416  -3.672  -2.780  1.00 0.00 ? 47 LEU A CA   10 
ATOM 8746  C C    . LEU A 1 47 ? -9.547  -3.569  -1.756  1.00 0.00 ? 47 LEU A C    10 
ATOM 8747  O O    . LEU A 1 47 ? -10.715 -3.769  -2.088  1.00 0.00 ? 47 LEU A O    10 
ATOM 8748  C CB   . LEU A 1 47 ? -7.920  -5.122  -2.866  1.00 0.00 ? 47 LEU A CB   10 
ATOM 8749  C CG   . LEU A 1 47 ? -7.456  -5.441  -4.296  1.00 0.00 ? 47 LEU A CG   10 
ATOM 8750  C CD1  . LEU A 1 47 ? -8.662  -5.496  -5.247  1.00 0.00 ? 47 LEU A CD1  10 
ATOM 8751  C CD2  . LEU A 1 47 ? -6.471  -4.364  -4.773  1.00 0.00 ? 47 LEU A CD2  10 
ATOM 8752  H H    . LEU A 1 47 ? -6.459  -3.180  -2.129  1.00 0.00 ? 47 LEU A H    10 
ATOM 8753  H HA   . LEU A 1 47 ? -8.796  -3.371  -3.743  1.00 0.00 ? 47 LEU A HA   10 
ATOM 8754  H HB2  . LEU A 1 47 ? -7.093  -5.255  -2.184  1.00 0.00 ? 47 LEU A HB2  10 
ATOM 8755  H HB3  . LEU A 1 47 ? -8.719  -5.796  -2.591  1.00 0.00 ? 47 LEU A HB3  10 
ATOM 8756  H HG   . LEU A 1 47 ? -6.962  -6.403  -4.299  1.00 0.00 ? 47 LEU A HG   10 
ATOM 8757  H HD11 . LEU A 1 47 ? -8.475  -6.228  -6.019  1.00 0.00 ? 47 LEU A HD11 10 
ATOM 8758  H HD12 . LEU A 1 47 ? -8.812  -4.528  -5.700  1.00 0.00 ? 47 LEU A HD12 10 
ATOM 8759  H HD13 . LEU A 1 47 ? -9.548  -5.775  -4.696  1.00 0.00 ? 47 LEU A HD13 10 
ATOM 8760  H HD21 . LEU A 1 47 ? -7.018  -3.528  -5.182  1.00 0.00 ? 47 LEU A HD21 10 
ATOM 8761  H HD22 . LEU A 1 47 ? -5.827  -4.780  -5.534  1.00 0.00 ? 47 LEU A HD22 10 
ATOM 8762  H HD23 . LEU A 1 47 ? -5.871  -4.028  -3.941  1.00 0.00 ? 47 LEU A HD23 10 
ATOM 8763  N N    . LYS A 1 48 ? -9.190  -3.258  -0.513  1.00 0.00 ? 48 LYS A N    10 
ATOM 8764  C CA   . LYS A 1 48 ? -10.184 -3.134  0.546   1.00 0.00 ? 48 LYS A CA   10 
ATOM 8765  C C    . LYS A 1 48 ? -11.068 -1.912  0.314   1.00 0.00 ? 48 LYS A C    10 
ATOM 8766  O O    . LYS A 1 48 ? -12.296 -2.017  0.295   1.00 0.00 ? 48 LYS A O    10 
ATOM 8767  C CB   . LYS A 1 48 ? -9.487  -3.012  1.904   1.00 0.00 ? 48 LYS A CB   10 
ATOM 8768  C CG   . LYS A 1 48 ? -10.541 -2.864  3.006   1.00 0.00 ? 48 LYS A CG   10 
ATOM 8769  C CD   . LYS A 1 48 ? -9.862  -2.938  4.380   1.00 0.00 ? 48 LYS A CD   10 
ATOM 8770  C CE   . LYS A 1 48 ? -9.312  -4.349  4.621   1.00 0.00 ? 48 LYS A CE   10 
ATOM 8771  N NZ   . LYS A 1 48 ? -9.317  -4.639  6.083   1.00 0.00 ? 48 LYS A NZ   10 
ATOM 8772  H H    . LYS A 1 48 ? -8.244  -3.110  -0.307  1.00 0.00 ? 48 LYS A H    10 
ATOM 8773  H HA   . LYS A 1 48 ? -10.803 -4.018  0.549   1.00 0.00 ? 48 LYS A HA   10 
ATOM 8774  H HB2  . LYS A 1 48 ? -8.897  -3.898  2.083   1.00 0.00 ? 48 LYS A HB2  10 
ATOM 8775  H HB3  . LYS A 1 48 ? -8.846  -2.145  1.903   1.00 0.00 ? 48 LYS A HB3  10 
ATOM 8776  H HG2  . LYS A 1 48 ? -11.037 -1.911  2.903   1.00 0.00 ? 48 LYS A HG2  10 
ATOM 8777  H HG3  . LYS A 1 48 ? -11.266 -3.659  2.922   1.00 0.00 ? 48 LYS A HG3  10 
ATOM 8778  H HD2  . LYS A 1 48 ? -9.052  -2.224  4.419   1.00 0.00 ? 48 LYS A HD2  10 
ATOM 8779  H HD3  . LYS A 1 48 ? -10.585 -2.702  5.148   1.00 0.00 ? 48 LYS A HD3  10 
ATOM 8780  H HE2  . LYS A 1 48 ? -9.927  -5.075  4.111   1.00 0.00 ? 48 LYS A HE2  10 
ATOM 8781  H HE3  . LYS A 1 48 ? -8.299  -4.411  4.248   1.00 0.00 ? 48 LYS A HE3  10 
ATOM 8782  H HZ1  . LYS A 1 48 ? -9.978  -3.995  6.562   1.00 0.00 ? 48 LYS A HZ1  10 
ATOM 8783  H HZ2  . LYS A 1 48 ? -8.362  -4.499  6.468   1.00 0.00 ? 48 LYS A HZ2  10 
ATOM 8784  H HZ3  . LYS A 1 48 ? -9.617  -5.622  6.240   1.00 0.00 ? 48 LYS A HZ3  10 
ATOM 8785  N N    . VAL A 1 49 ? -10.439 -0.755  0.135   1.00 0.00 ? 49 VAL A N    10 
ATOM 8786  C CA   . VAL A 1 49 ? -11.183 0.479   -0.093  1.00 0.00 ? 49 VAL A CA   10 
ATOM 8787  C C    . VAL A 1 49 ? -11.836 0.463   -1.471  1.00 0.00 ? 49 VAL A C    10 
ATOM 8788  O O    . VAL A 1 49 ? -12.959 0.937   -1.642  1.00 0.00 ? 49 VAL A O    10 
ATOM 8789  C CB   . VAL A 1 49 ? -10.246 1.683   0.017   1.00 0.00 ? 49 VAL A CB   10 
ATOM 8790  C CG1  . VAL A 1 49 ? -9.598  1.700   1.402   1.00 0.00 ? 49 VAL A CG1  10 
ATOM 8791  C CG2  . VAL A 1 49 ? -9.157  1.581   -1.053  1.00 0.00 ? 49 VAL A CG2  10 
ATOM 8792  H H    . VAL A 1 49 ? -9.460  -0.730  0.161   1.00 0.00 ? 49 VAL A H    10 
ATOM 8793  H HA   . VAL A 1 49 ? -11.954 0.567   0.658   1.00 0.00 ? 49 VAL A HA   10 
ATOM 8794  H HB   . VAL A 1 49 ? -10.812 2.593   -0.127  1.00 0.00 ? 49 VAL A HB   10 
ATOM 8795  H HG11 . VAL A 1 49 ? -8.913  0.871   1.490   1.00 0.00 ? 49 VAL A HG11 10 
ATOM 8796  H HG12 . VAL A 1 49 ? -10.365 1.616   2.160   1.00 0.00 ? 49 VAL A HG12 10 
ATOM 8797  H HG13 . VAL A 1 49 ? -9.062  2.627   1.537   1.00 0.00 ? 49 VAL A HG13 10 
ATOM 8798  H HG21 . VAL A 1 49 ? -9.596  1.734   -2.028  1.00 0.00 ? 49 VAL A HG21 10 
ATOM 8799  H HG22 . VAL A 1 49 ? -8.702  0.604   -1.011  1.00 0.00 ? 49 VAL A HG22 10 
ATOM 8800  H HG23 . VAL A 1 49 ? -8.405  2.336   -0.873  1.00 0.00 ? 49 VAL A HG23 10 
ATOM 8801  N N    . TYR A 1 50 ? -11.126 -0.086  -2.452  1.00 0.00 ? 50 TYR A N    10 
ATOM 8802  C CA   . TYR A 1 50 ? -11.649 -0.160  -3.811  1.00 0.00 ? 50 TYR A CA   10 
ATOM 8803  C C    . TYR A 1 50 ? -12.896 -1.036  -3.854  1.00 0.00 ? 50 TYR A C    10 
ATOM 8804  O O    . TYR A 1 50 ? -13.878 -0.703  -4.520  1.00 0.00 ? 50 TYR A O    10 
ATOM 8805  C CB   . TYR A 1 50 ? -10.586 -0.733  -4.749  1.00 0.00 ? 50 TYR A CB   10 
ATOM 8806  C CG   . TYR A 1 50 ? -11.158 -0.862  -6.141  1.00 0.00 ? 50 TYR A CG   10 
ATOM 8807  C CD1  . TYR A 1 50 ? -11.367 0.282   -6.920  1.00 0.00 ? 50 TYR A CD1  10 
ATOM 8808  C CD2  . TYR A 1 50 ? -11.480 -2.126  -6.652  1.00 0.00 ? 50 TYR A CD2  10 
ATOM 8809  C CE1  . TYR A 1 50 ? -11.898 0.163   -8.210  1.00 0.00 ? 50 TYR A CE1  10 
ATOM 8810  C CE2  . TYR A 1 50 ? -12.012 -2.245  -7.942  1.00 0.00 ? 50 TYR A CE2  10 
ATOM 8811  C CZ   . TYR A 1 50 ? -12.219 -1.101  -8.722  1.00 0.00 ? 50 TYR A CZ   10 
ATOM 8812  O OH   . TYR A 1 50 ? -12.742 -1.218  -9.993  1.00 0.00 ? 50 TYR A OH   10 
ATOM 8813  H H    . TYR A 1 50 ? -10.237 -0.449  -2.256  1.00 0.00 ? 50 TYR A H    10 
ATOM 8814  H HA   . TYR A 1 50 ? -11.906 0.835   -4.142  1.00 0.00 ? 50 TYR A HA   10 
ATOM 8815  H HB2  . TYR A 1 50 ? -9.732  -0.072  -4.771  1.00 0.00 ? 50 TYR A HB2  10 
ATOM 8816  H HB3  . TYR A 1 50 ? -10.280 -1.706  -4.394  1.00 0.00 ? 50 TYR A HB3  10 
ATOM 8817  H HD1  . TYR A 1 50 ? -11.119 1.256   -6.527  1.00 0.00 ? 50 TYR A HD1  10 
ATOM 8818  H HD2  . TYR A 1 50 ? -11.319 -3.009  -6.051  1.00 0.00 ? 50 TYR A HD2  10 
ATOM 8819  H HE1  . TYR A 1 50 ? -12.058 1.045   -8.813  1.00 0.00 ? 50 TYR A HE1  10 
ATOM 8820  H HE2  . TYR A 1 50 ? -12.259 -3.219  -8.336  1.00 0.00 ? 50 TYR A HE2  10 
ATOM 8821  H HH   . TYR A 1 50 ? -12.681 -2.140  -10.255 1.00 0.00 ? 50 TYR A HH   10 
ATOM 8822  N N    . HIS A 1 51 ? -12.850 -2.157  -3.141  1.00 0.00 ? 51 HIS A N    10 
ATOM 8823  C CA   . HIS A 1 51 ? -13.984 -3.074  -3.106  1.00 0.00 ? 51 HIS A CA   10 
ATOM 8824  C C    . HIS A 1 51 ? -15.128 -2.479  -2.292  1.00 0.00 ? 51 HIS A C    10 
ATOM 8825  O O    . HIS A 1 51 ? -16.296 -2.622  -2.649  1.00 0.00 ? 51 HIS A O    10 
ATOM 8826  C CB   . HIS A 1 51 ? -13.555 -4.408  -2.490  1.00 0.00 ? 51 HIS A CB   10 
ATOM 8827  C CG   . HIS A 1 51 ? -14.737 -5.337  -2.434  1.00 0.00 ? 51 HIS A CG   10 
ATOM 8828  N ND1  . HIS A 1 51 ? -14.966 -6.301  -3.404  1.00 0.00 ? 51 HIS A ND1  10 
ATOM 8829  C CD2  . HIS A 1 51 ? -15.763 -5.463  -1.532  1.00 0.00 ? 51 HIS A CD2  10 
ATOM 8830  C CE1  . HIS A 1 51 ? -16.090 -6.958  -3.066  1.00 0.00 ? 51 HIS A CE1  10 
ATOM 8831  N NE2  . HIS A 1 51 ? -16.617 -6.487  -1.933  1.00 0.00 ? 51 HIS A NE2  10 
ATOM 8832  H H    . HIS A 1 51 ? -12.041 -2.369  -2.631  1.00 0.00 ? 51 HIS A H    10 
ATOM 8833  H HA   . HIS A 1 51 ? -14.325 -3.251  -4.115  1.00 0.00 ? 51 HIS A HA   10 
ATOM 8834  H HB2  . HIS A 1 51 ? -12.778 -4.850  -3.094  1.00 0.00 ? 51 HIS A HB2  10 
ATOM 8835  H HB3  . HIS A 1 51 ? -13.184 -4.240  -1.489  1.00 0.00 ? 51 HIS A HB3  10 
ATOM 8836  H HD2  . HIS A 1 51 ? -15.891 -4.859  -0.646  1.00 0.00 ? 51 HIS A HD2  10 
ATOM 8837  H HE1  . HIS A 1 51 ? -16.513 -7.769  -3.641  1.00 0.00 ? 51 HIS A HE1  10 
ATOM 8838  H HE2  . HIS A 1 51 ? -17.430 -6.797  -1.481  1.00 0.00 ? 51 HIS A HE2  10 
ATOM 8839  N N    . ALA A 1 52 ? -14.782 -1.810  -1.195  1.00 0.00 ? 52 ALA A N    10 
ATOM 8840  C CA   . ALA A 1 52 ? -15.790 -1.197  -0.338  1.00 0.00 ? 52 ALA A CA   10 
ATOM 8841  C C    . ALA A 1 52 ? -16.273 0.121   -0.936  1.00 0.00 ? 52 ALA A C    10 
ATOM 8842  O O    . ALA A 1 52 ? -17.312 0.650   -0.538  1.00 0.00 ? 52 ALA A O    10 
ATOM 8843  C CB   . ALA A 1 52 ? -15.207 -0.945  1.054   1.00 0.00 ? 52 ALA A CB   10 
ATOM 8844  H H    . ALA A 1 52 ? -13.834 -1.729  -0.960  1.00 0.00 ? 52 ALA A H    10 
ATOM 8845  H HA   . ALA A 1 52 ? -16.629 -1.870  -0.248  1.00 0.00 ? 52 ALA A HA   10 
ATOM 8846  H HB1  . ALA A 1 52 ? -14.711 -1.837  1.404   1.00 0.00 ? 52 ALA A HB1  10 
ATOM 8847  H HB2  . ALA A 1 52 ? -16.003 -0.686  1.736   1.00 0.00 ? 52 ALA A HB2  10 
ATOM 8848  H HB3  . ALA A 1 52 ? -14.496 -0.133  1.005   1.00 0.00 ? 52 ALA A HB3  10 
ATOM 8849  N N    . TRP A 1 53 ? -15.514 0.646   -1.891  1.00 0.00 ? 53 TRP A N    10 
ATOM 8850  C CA   . TRP A 1 53 ? -15.875 1.904   -2.535  1.00 0.00 ? 53 TRP A CA   10 
ATOM 8851  C C    . TRP A 1 53 ? -17.345 1.892   -2.945  1.00 0.00 ? 53 TRP A C    10 
ATOM 8852  O O    . TRP A 1 53 ? -18.119 2.762   -2.544  1.00 0.00 ? 53 TRP A O    10 
ATOM 8853  C CB   . TRP A 1 53 ? -14.992 2.125   -3.771  1.00 0.00 ? 53 TRP A CB   10 
ATOM 8854  C CG   . TRP A 1 53 ? -14.700 3.584   -3.931  1.00 0.00 ? 53 TRP A CG   10 
ATOM 8855  C CD1  . TRP A 1 53 ? -13.593 4.206   -3.469  1.00 0.00 ? 53 TRP A CD1  10 
ATOM 8856  C CD2  . TRP A 1 53 ? -15.504 4.607   -4.588  1.00 0.00 ? 53 TRP A CD2  10 
ATOM 8857  N NE1  . TRP A 1 53 ? -13.664 5.548   -3.800  1.00 0.00 ? 53 TRP A NE1  10 
ATOM 8858  C CE2  . TRP A 1 53 ? -14.824 5.844   -4.490  1.00 0.00 ? 53 TRP A CE2  10 
ATOM 8859  C CE3  . TRP A 1 53 ? -16.743 4.582   -5.251  1.00 0.00 ? 53 TRP A CE3  10 
ATOM 8860  C CZ2  . TRP A 1 53 ? -15.355 7.015   -5.031  1.00 0.00 ? 53 TRP A CZ2  10 
ATOM 8861  C CZ3  . TRP A 1 53 ? -17.281 5.760   -5.798  1.00 0.00 ? 53 TRP A CZ3  10 
ATOM 8862  C CH2  . TRP A 1 53 ? -16.588 6.973   -5.688  1.00 0.00 ? 53 TRP A CH2  10 
ATOM 8863  H H    . TRP A 1 53 ? -14.696 0.182   -2.167  1.00 0.00 ? 53 TRP A H    10 
ATOM 8864  H HA   . TRP A 1 53 ? -15.712 2.711   -1.836  1.00 0.00 ? 53 TRP A HA   10 
ATOM 8865  H HB2  . TRP A 1 53 ? -14.064 1.588   -3.648  1.00 0.00 ? 53 TRP A HB2  10 
ATOM 8866  H HB3  . TRP A 1 53 ? -15.501 1.762   -4.651  1.00 0.00 ? 53 TRP A HB3  10 
ATOM 8867  H HD1  . TRP A 1 53 ? -12.785 3.734   -2.930  1.00 0.00 ? 53 TRP A HD1  10 
ATOM 8868  H HE1  . TRP A 1 53 ? -12.987 6.221   -3.582  1.00 0.00 ? 53 TRP A HE1  10 
ATOM 8869  H HE3  . TRP A 1 53 ? -17.286 3.652   -5.340  1.00 0.00 ? 53 TRP A HE3  10 
ATOM 8870  H HZ2  . TRP A 1 53 ? -14.817 7.947   -4.945  1.00 0.00 ? 53 TRP A HZ2  10 
ATOM 8871  H HZ3  . TRP A 1 53 ? -18.235 5.729   -6.304  1.00 0.00 ? 53 TRP A HZ3  10 
ATOM 8872  H HH2  . TRP A 1 53 ? -17.007 7.874   -6.110  1.00 0.00 ? 53 TRP A HH2  10 
ATOM 8873  N N    . LYS A 1 54 ? -17.723 0.900   -3.745  1.00 0.00 ? 54 LYS A N    10 
ATOM 8874  C CA   . LYS A 1 54 ? -19.102 0.783   -4.203  1.00 0.00 ? 54 LYS A CA   10 
ATOM 8875  C C    . LYS A 1 54 ? -19.984 0.206   -3.100  1.00 0.00 ? 54 LYS A C    10 
ATOM 8876  O O    . LYS A 1 54 ? -20.498 0.939   -2.256  1.00 0.00 ? 54 LYS A O    10 
ATOM 8877  C CB   . LYS A 1 54 ? -19.166 -0.115  -5.446  1.00 0.00 ? 54 LYS A CB   10 
ATOM 8878  C CG   . LYS A 1 54 ? -18.059 -1.168  -5.375  1.00 0.00 ? 54 LYS A CG   10 
ATOM 8879  C CD   . LYS A 1 54 ? -18.340 -2.274  -6.398  1.00 0.00 ? 54 LYS A CD   10 
ATOM 8880  C CE   . LYS A 1 54 ? -17.070 -3.097  -6.622  1.00 0.00 ? 54 LYS A CE   10 
ATOM 8881  N NZ   . LYS A 1 54 ? -16.007 -2.221  -7.193  1.00 0.00 ? 54 LYS A NZ   10 
ATOM 8882  H H    . LYS A 1 54 ? -17.062 0.235   -4.032  1.00 0.00 ? 54 LYS A H    10 
ATOM 8883  H HA   . LYS A 1 54 ? -19.468 1.766   -4.464  1.00 0.00 ? 54 LYS A HA   10 
ATOM 8884  H HB2  . LYS A 1 54 ? -20.129 -0.603  -5.490  1.00 0.00 ? 54 LYS A HB2  10 
ATOM 8885  H HB3  . LYS A 1 54 ? -19.030 0.489   -6.332  1.00 0.00 ? 54 LYS A HB3  10 
ATOM 8886  H HG2  . LYS A 1 54 ? -17.109 -0.705  -5.598  1.00 0.00 ? 54 LYS A HG2  10 
ATOM 8887  H HG3  . LYS A 1 54 ? -18.029 -1.595  -4.385  1.00 0.00 ? 54 LYS A HG3  10 
ATOM 8888  H HD2  . LYS A 1 54 ? -19.125 -2.916  -6.024  1.00 0.00 ? 54 LYS A HD2  10 
ATOM 8889  H HD3  . LYS A 1 54 ? -18.650 -1.831  -7.332  1.00 0.00 ? 54 LYS A HD3  10 
ATOM 8890  H HE2  . LYS A 1 54 ? -16.733 -3.504  -5.681  1.00 0.00 ? 54 LYS A HE2  10 
ATOM 8891  H HE3  . LYS A 1 54 ? -17.280 -3.903  -7.310  1.00 0.00 ? 54 LYS A HE3  10 
ATOM 8892  H HZ1  . LYS A 1 54 ? -15.426 -1.833  -6.423  1.00 0.00 ? 54 LYS A HZ1  10 
ATOM 8893  H HZ2  . LYS A 1 54 ? -16.446 -1.442  -7.721  1.00 0.00 ? 54 LYS A HZ2  10 
ATOM 8894  H HZ3  . LYS A 1 54 ? -15.406 -2.780  -7.834  1.00 0.00 ? 54 LYS A HZ3  10 
ATOM 8895  N N    . SER A 1 55 ? -20.156 -1.114  -3.116  1.00 0.00 ? 55 SER A N    10 
ATOM 8896  C CA   . SER A 1 55 ? -20.978 -1.786  -2.115  1.00 0.00 ? 55 SER A CA   10 
ATOM 8897  C C    . SER A 1 55 ? -22.399 -1.231  -2.124  1.00 0.00 ? 55 SER A C    10 
ATOM 8898  O O    . SER A 1 55 ? -22.605 -0.021  -2.038  1.00 0.00 ? 55 SER A O    10 
ATOM 8899  C CB   . SER A 1 55 ? -20.367 -1.608  -0.723  1.00 0.00 ? 55 SER A CB   10 
ATOM 8900  O OG   . SER A 1 55 ? -21.383 -1.762  0.259   1.00 0.00 ? 55 SER A OG   10 
ATOM 8901  H H    . SER A 1 55 ? -19.721 -1.646  -3.814  1.00 0.00 ? 55 SER A H    10 
ATOM 8902  H HA   . SER A 1 55 ? -21.015 -2.841  -2.346  1.00 0.00 ? 55 SER A HA   10 
ATOM 8903  H HB2  . SER A 1 55 ? -19.604 -2.354  -0.564  1.00 0.00 ? 55 SER A HB2  10 
ATOM 8904  H HB3  . SER A 1 55 ? -19.924 -0.624  -0.646  1.00 0.00 ? 55 SER A HB3  10 
ATOM 8905  H HG   . SER A 1 55 ? -21.884 -2.552  0.045   1.00 0.00 ? 55 SER A HG   10 
ATOM 8906  N N    . LYS A 1 56 ? -23.377 -2.126  -2.228  1.00 0.00 ? 56 LYS A N    10 
ATOM 8907  C CA   . LYS A 1 56 ? -24.777 -1.715  -2.247  1.00 0.00 ? 56 LYS A CA   10 
ATOM 8908  C C    . LYS A 1 56 ? -25.234 -1.311  -0.849  1.00 0.00 ? 56 LYS A C    10 
ATOM 8909  O O    . LYS A 1 56 ? -26.423 -1.366  -0.535  1.00 0.00 ? 56 LYS A O    10 
ATOM 8910  C CB   . LYS A 1 56 ? -25.652 -2.861  -2.761  1.00 0.00 ? 56 LYS A CB   10 
ATOM 8911  C CG   . LYS A 1 56 ? -25.488 -3.008  -4.281  1.00 0.00 ? 56 LYS A CG   10 
ATOM 8912  C CD   . LYS A 1 56 ? -24.082 -3.544  -4.616  1.00 0.00 ? 56 LYS A CD   10 
ATOM 8913  C CE   . LYS A 1 56 ? -23.188 -2.402  -5.107  1.00 0.00 ? 56 LYS A CE   10 
ATOM 8914  N NZ   . LYS A 1 56 ? -23.475 -2.127  -6.543  1.00 0.00 ? 56 LYS A NZ   10 
ATOM 8915  H H    . LYS A 1 56 ? -23.153 -3.078  -2.293  1.00 0.00 ? 56 LYS A H    10 
ATOM 8916  H HA   . LYS A 1 56 ? -24.886 -0.869  -2.909  1.00 0.00 ? 56 LYS A HA   10 
ATOM 8917  H HB2  . LYS A 1 56 ? -25.362 -3.781  -2.276  1.00 0.00 ? 56 LYS A HB2  10 
ATOM 8918  H HB3  . LYS A 1 56 ? -26.686 -2.650  -2.536  1.00 0.00 ? 56 LYS A HB3  10 
ATOM 8919  H HG2  . LYS A 1 56 ? -26.231 -3.699  -4.651  1.00 0.00 ? 56 LYS A HG2  10 
ATOM 8920  H HG3  . LYS A 1 56 ? -25.629 -2.046  -4.752  1.00 0.00 ? 56 LYS A HG3  10 
ATOM 8921  H HD2  . LYS A 1 56 ? -23.643 -3.992  -3.737  1.00 0.00 ? 56 LYS A HD2  10 
ATOM 8922  H HD3  . LYS A 1 56 ? -24.161 -4.291  -5.393  1.00 0.00 ? 56 LYS A HD3  10 
ATOM 8923  H HE2  . LYS A 1 56 ? -23.382 -1.514  -4.525  1.00 0.00 ? 56 LYS A HE2  10 
ATOM 8924  H HE3  . LYS A 1 56 ? -22.151 -2.685  -4.996  1.00 0.00 ? 56 LYS A HE3  10 
ATOM 8925  H HZ1  . LYS A 1 56 ? -23.068 -2.882  -7.129  1.00 0.00 ? 56 LYS A HZ1  10 
ATOM 8926  H HZ2  . LYS A 1 56 ? -23.053 -1.215  -6.813  1.00 0.00 ? 56 LYS A HZ2  10 
ATOM 8927  H HZ3  . LYS A 1 56 ? -24.506 -2.091  -6.689  1.00 0.00 ? 56 LYS A HZ3  10 
ATOM 8928  N N    . ASN A 1 57 ? -24.282 -0.905  -0.014  1.00 0.00 ? 57 ASN A N    10 
ATOM 8929  C CA   . ASN A 1 57 ? -24.600 -0.492  1.347   1.00 0.00 ? 57 ASN A CA   10 
ATOM 8930  C C    . ASN A 1 57 ? -23.420 0.246   1.973   1.00 0.00 ? 57 ASN A C    10 
ATOM 8931  O O    . ASN A 1 57 ? -22.292 -0.246  1.963   1.00 0.00 ? 57 ASN A O    10 
ATOM 8932  C CB   . ASN A 1 57 ? -24.947 -1.717  2.197   1.00 0.00 ? 57 ASN A CB   10 
ATOM 8933  C CG   . ASN A 1 57 ? -25.550 -1.273  3.525   1.00 0.00 ? 57 ASN A CG   10 
ATOM 8934  O OD1  . ASN A 1 57 ? -26.689 -1.620  3.838   1.00 0.00 ? 57 ASN A OD1  10 
ATOM 8935  N ND2  . ASN A 1 57 ? -24.851 -0.520  4.329   1.00 0.00 ? 57 ASN A ND2  10 
ATOM 8936  H H    . ASN A 1 57 ? -23.352 -0.881  -0.321  1.00 0.00 ? 57 ASN A H    10 
ATOM 8937  H HA   . ASN A 1 57 ? -25.453 0.168   1.324   1.00 0.00 ? 57 ASN A HA   10 
ATOM 8938  H HB2  . ASN A 1 57 ? -25.660 -2.330  1.666   1.00 0.00 ? 57 ASN A HB2  10 
ATOM 8939  H HB3  . ASN A 1 57 ? -24.051 -2.288  2.386   1.00 0.00 ? 57 ASN A HB3  10 
ATOM 8940  H HD21 . ASN A 1 57 ? -23.944 -0.244  4.078   1.00 0.00 ? 57 ASN A HD21 10 
ATOM 8941  H HD22 . ASN A 1 57 ? -25.231 -0.232  5.185   1.00 0.00 ? 57 ASN A HD22 10 
ATOM 8942  N N    . LYS A 1 58 ? -23.691 1.430   2.516   1.00 0.00 ? 58 LYS A N    10 
ATOM 8943  C CA   . LYS A 1 58 ? -22.645 2.231   3.145   1.00 0.00 ? 58 LYS A CA   10 
ATOM 8944  C C    . LYS A 1 58 ? -22.505 1.868   4.619   1.00 0.00 ? 58 LYS A C    10 
ATOM 8945  O O    . LYS A 1 58 ? -22.573 2.736   5.491   1.00 0.00 ? 58 LYS A O    10 
ATOM 8946  C CB   . LYS A 1 58 ? -22.978 3.721   3.014   1.00 0.00 ? 58 LYS A CB   10 
ATOM 8947  C CG   . LYS A 1 58 ? -23.057 4.114   1.531   1.00 0.00 ? 58 LYS A CG   10 
ATOM 8948  C CD   . LYS A 1 58 ? -24.500 3.982   1.032   1.00 0.00 ? 58 LYS A CD   10 
ATOM 8949  C CE   . LYS A 1 58 ? -24.578 4.441   -0.425  1.00 0.00 ? 58 LYS A CE   10 
ATOM 8950  N NZ   . LYS A 1 58 ? -25.953 4.202   -0.948  1.00 0.00 ? 58 LYS A NZ   10 
ATOM 8951  H H    . LYS A 1 58 ? -24.609 1.770   2.494   1.00 0.00 ? 58 LYS A H    10 
ATOM 8952  H HA   . LYS A 1 58 ? -21.705 2.039   2.646   1.00 0.00 ? 58 LYS A HA   10 
ATOM 8953  H HB2  . LYS A 1 58 ? -23.925 3.920   3.495   1.00 0.00 ? 58 LYS A HB2  10 
ATOM 8954  H HB3  . LYS A 1 58 ? -22.205 4.302   3.497   1.00 0.00 ? 58 LYS A HB3  10 
ATOM 8955  H HG2  . LYS A 1 58 ? -22.729 5.136   1.413   1.00 0.00 ? 58 LYS A HG2  10 
ATOM 8956  H HG3  . LYS A 1 58 ? -22.418 3.464   0.950   1.00 0.00 ? 58 LYS A HG3  10 
ATOM 8957  H HD2  . LYS A 1 58 ? -24.813 2.952   1.103   1.00 0.00 ? 58 LYS A HD2  10 
ATOM 8958  H HD3  . LYS A 1 58 ? -25.147 4.599   1.637   1.00 0.00 ? 58 LYS A HD3  10 
ATOM 8959  H HE2  . LYS A 1 58 ? -24.349 5.495   -0.483  1.00 0.00 ? 58 LYS A HE2  10 
ATOM 8960  H HE3  . LYS A 1 58 ? -23.866 3.886   -1.017  1.00 0.00 ? 58 LYS A HE3  10 
ATOM 8961  H HZ1  . LYS A 1 58 ? -26.359 3.363   -0.486  1.00 0.00 ? 58 LYS A HZ1  10 
ATOM 8962  H HZ2  . LYS A 1 58 ? -25.911 4.044   -1.975  1.00 0.00 ? 58 LYS A HZ2  10 
ATOM 8963  H HZ3  . LYS A 1 58 ? -26.549 5.031   -0.748  1.00 0.00 ? 58 LYS A HZ3  10 
ATOM 8964  N N    . LYS A 1 59 ? -22.308 0.582   4.892   1.00 0.00 ? 59 LYS A N    10 
ATOM 8965  C CA   . LYS A 1 59 ? -22.159 0.119   6.267   1.00 0.00 ? 59 LYS A CA   10 
ATOM 8966  C C    . LYS A 1 59 ? -20.752 0.407   6.781   1.00 0.00 ? 59 LYS A C    10 
ATOM 8967  O O    . LYS A 1 59 ? -19.845 -0.412  6.633   1.00 0.00 ? 59 LYS A O    10 
ATOM 8968  C CB   . LYS A 1 59 ? -22.434 -1.384  6.347   1.00 0.00 ? 59 LYS A CB   10 
ATOM 8969  C CG   . LYS A 1 59 ? -22.413 -1.832  7.809   1.00 0.00 ? 59 LYS A CG   10 
ATOM 8970  C CD   . LYS A 1 59 ? -23.046 -3.220  7.929   1.00 0.00 ? 59 LYS A CD   10 
ATOM 8971  C CE   . LYS A 1 59 ? -22.212 -4.234  7.142   1.00 0.00 ? 59 LYS A CE   10 
ATOM 8972  N NZ   . LYS A 1 59 ? -22.568 -5.615  7.580   1.00 0.00 ? 59 LYS A NZ   10 
ATOM 8973  H H    . LYS A 1 59 ? -22.261 -0.065  4.158   1.00 0.00 ? 59 LYS A H    10 
ATOM 8974  H HA   . LYS A 1 59 ? -22.872 0.637   6.891   1.00 0.00 ? 59 LYS A HA   10 
ATOM 8975  H HB2  . LYS A 1 59 ? -23.404 -1.595  5.919   1.00 0.00 ? 59 LYS A HB2  10 
ATOM 8976  H HB3  . LYS A 1 59 ? -21.675 -1.919  5.797   1.00 0.00 ? 59 LYS A HB3  10 
ATOM 8977  H HG2  . LYS A 1 59 ? -21.390 -1.870  8.158   1.00 0.00 ? 59 LYS A HG2  10 
ATOM 8978  H HG3  . LYS A 1 59 ? -22.972 -1.130  8.410   1.00 0.00 ? 59 LYS A HG3  10 
ATOM 8979  H HD2  . LYS A 1 59 ? -23.080 -3.511  8.969   1.00 0.00 ? 59 LYS A HD2  10 
ATOM 8980  H HD3  . LYS A 1 59 ? -24.048 -3.193  7.529   1.00 0.00 ? 59 LYS A HD3  10 
ATOM 8981  H HE2  . LYS A 1 59 ? -22.416 -4.127  6.088   1.00 0.00 ? 59 LYS A HE2  10 
ATOM 8982  H HE3  . LYS A 1 59 ? -21.162 -4.058  7.326   1.00 0.00 ? 59 LYS A HE3  10 
ATOM 8983  H HZ1  . LYS A 1 59 ? -23.407 -5.579  8.191   1.00 0.00 ? 59 LYS A HZ1  10 
ATOM 8984  H HZ2  . LYS A 1 59 ? -21.772 -6.026  8.109   1.00 0.00 ? 59 LYS A HZ2  10 
ATOM 8985  H HZ3  . LYS A 1 59 ? -22.769 -6.200  6.744   1.00 0.00 ? 59 LYS A HZ3  10 
ATOM 8986  N N    . ARG A 1 60 ? -20.577 1.578   7.387   1.00 0.00 ? 60 ARG A N    10 
ATOM 8987  C CA   . ARG A 1 60 ? -19.277 1.966   7.920   1.00 0.00 ? 60 ARG A CA   10 
ATOM 8988  C C    . ARG A 1 60 ? -19.004 1.250   9.240   1.00 0.00 ? 60 ARG A C    10 
ATOM 8989  O O    . ARG A 1 60 ? -19.938 0.690   9.791   1.00 0.00 ? 60 ARG A O    10 
ATOM 8990  C CB   . ARG A 1 60 ? -19.233 3.480   8.140   1.00 0.00 ? 60 ARG A CB   10 
ATOM 8991  C CG   . ARG A 1 60 ? -19.141 4.189   6.787   1.00 0.00 ? 60 ARG A CG   10 
ATOM 8992  C CD   . ARG A 1 60 ? -19.397 5.686   6.978   1.00 0.00 ? 60 ARG A CD   10 
ATOM 8993  N NE   . ARG A 1 60 ? -20.813 5.928   7.227   1.00 0.00 ? 60 ARG A NE   10 
ATOM 8994  C CZ   . ARG A 1 60 ? -21.344 7.135   7.057   1.00 0.00 ? 60 ARG A CZ   10 
ATOM 8995  N NH1  . ARG A 1 60 ? -20.595 8.129   6.664   1.00 0.00 ? 60 ARG A NH1  10 
ATOM 8996  N NH2  . ARG A 1 60 ? -22.614 7.328   7.286   1.00 0.00 ? 60 ARG A NH2  10 
ATOM 8997  O OXT  . ARG A 1 60 ? -17.866 1.273   9.678   1.00 0.00 ? 60 ARG A OXT  10 
ATOM 8998  H H    . ARG A 1 60 ? -21.337 2.192   7.477   1.00 0.00 ? 60 ARG A H    10 
ATOM 8999  H HA   . ARG A 1 60 ? -18.512 1.694   7.209   1.00 0.00 ? 60 ARG A HA   10 
ATOM 9000  H HB2  . ARG A 1 60 ? -20.130 3.794   8.653   1.00 0.00 ? 60 ARG A HB2  10 
ATOM 9001  H HB3  . ARG A 1 60 ? -18.370 3.732   8.736   1.00 0.00 ? 60 ARG A HB3  10 
ATOM 9002  H HG2  . ARG A 1 60 ? -18.156 4.042   6.370   1.00 0.00 ? 60 ARG A HG2  10 
ATOM 9003  H HG3  . ARG A 1 60 ? -19.882 3.783   6.116   1.00 0.00 ? 60 ARG A HG3  10 
ATOM 9004  H HD2  . ARG A 1 60 ? -18.821 6.044   7.818   1.00 0.00 ? 60 ARG A HD2  10 
ATOM 9005  H HD3  . ARG A 1 60 ? -19.093 6.215   6.085   1.00 0.00 ? 60 ARG A HD3  10 
ATOM 9006  H HE   . ARG A 1 60 ? -21.383 5.189   7.524   1.00 0.00 ? 60 ARG A HE   10 
ATOM 9007  H HH11 . ARG A 1 60 ? -19.621 7.982   6.490   1.00 0.00 ? 60 ARG A HH11 10 
ATOM 9008  H HH12 . ARG A 1 60 ? -20.994 9.036   6.537   1.00 0.00 ? 60 ARG A HH12 10 
ATOM 9009  H HH21 . ARG A 1 60 ? -23.190 6.568   7.589   1.00 0.00 ? 60 ARG A HH21 10 
ATOM 9010  H HH22 . ARG A 1 60 ? -23.014 8.235   7.157   1.00 0.00 ? 60 ARG A HH22 10 
ATOM 9011  N N    . GLY A 1 9  ? 6.384   6.128   16.115  1.00 0.00 ? 9  GLY A N    11 
ATOM 9012  C CA   . GLY A 1 9  ? 6.153   5.694   14.741  1.00 0.00 ? 9  GLY A CA   11 
ATOM 9013  C C    . GLY A 1 9  ? 7.470   5.370   14.044  1.00 0.00 ? 9  GLY A C    11 
ATOM 9014  O O    . GLY A 1 9  ? 8.422   6.147   14.104  1.00 0.00 ? 9  GLY A O    11 
ATOM 9015  H H    . GLY A 1 9  ? 6.288   5.482   16.846  1.00 0.00 ? 9  GLY A H    11 
ATOM 9016  H HA2  . GLY A 1 9  ? 5.528   4.813   14.748  1.00 0.00 ? 9  GLY A HA2  11 
ATOM 9017  H HA3  . GLY A 1 9  ? 5.652   6.482   14.199  1.00 0.00 ? 9  GLY A HA3  11 
ATOM 9018  N N    . THR A 1 10 ? 7.517   4.217   13.384  1.00 0.00 ? 10 THR A N    11 
ATOM 9019  C CA   . THR A 1 10 ? 8.723   3.800   12.680  1.00 0.00 ? 10 THR A CA   11 
ATOM 9020  C C    . THR A 1 10 ? 9.045   4.772   11.548  1.00 0.00 ? 10 THR A C    11 
ATOM 9021  O O    . THR A 1 10 ? 8.291   5.710   11.291  1.00 0.00 ? 10 THR A O    11 
ATOM 9022  C CB   . THR A 1 10 ? 8.534   2.393   12.107  1.00 0.00 ? 10 THR A CB   11 
ATOM 9023  O OG1  . THR A 1 10 ? 9.696   2.022   11.378  1.00 0.00 ? 10 THR A OG1  11 
ATOM 9024  C CG2  . THR A 1 10 ? 7.319   2.377   11.179  1.00 0.00 ? 10 THR A CG2  11 
ATOM 9025  H H    . THR A 1 10 ? 6.726   3.638   13.372  1.00 0.00 ? 10 THR A H    11 
ATOM 9026  H HA   . THR A 1 10 ? 9.549   3.785   13.375  1.00 0.00 ? 10 THR A HA   11 
ATOM 9027  H HB   . THR A 1 10 ? 8.375   1.695   12.913  1.00 0.00 ? 10 THR A HB   11 
ATOM 9028  H HG1  . THR A 1 10 ? 9.431   1.834   10.474  1.00 0.00 ? 10 THR A HG1  11 
ATOM 9029  H HG21 . THR A 1 10 ? 6.489   2.871   11.662  1.00 0.00 ? 10 THR A HG21 11 
ATOM 9030  H HG22 . THR A 1 10 ? 7.049   1.355   10.958  1.00 0.00 ? 10 THR A HG22 11 
ATOM 9031  H HG23 . THR A 1 10 ? 7.560   2.893   10.260  1.00 0.00 ? 10 THR A HG23 11 
ATOM 9032  N N    . LYS A 1 11 ? 10.168  4.539   10.876  1.00 0.00 ? 11 LYS A N    11 
ATOM 9033  C CA   . LYS A 1 11 ? 10.582  5.399   9.773   1.00 0.00 ? 11 LYS A CA   11 
ATOM 9034  C C    . LYS A 1 11 ? 11.373  4.600   8.741   1.00 0.00 ? 11 LYS A C    11 
ATOM 9035  O O    . LYS A 1 11 ? 11.925  5.165   7.796   1.00 0.00 ? 11 LYS A O    11 
ATOM 9036  C CB   . LYS A 1 11 ? 11.444  6.547   10.303  1.00 0.00 ? 11 LYS A CB   11 
ATOM 9037  C CG   . LYS A 1 11 ? 10.587  7.471   11.171  1.00 0.00 ? 11 LYS A CG   11 
ATOM 9038  C CD   . LYS A 1 11 ? 11.361  8.757   11.465  1.00 0.00 ? 11 LYS A CD   11 
ATOM 9039  C CE   . LYS A 1 11 ? 10.471  9.722   12.253  1.00 0.00 ? 11 LYS A CE   11 
ATOM 9040  N NZ   . LYS A 1 11 ? 11.249  10.944  12.600  1.00 0.00 ? 11 LYS A NZ   11 
ATOM 9041  H H    . LYS A 1 11 ? 10.729  3.775   11.127  1.00 0.00 ? 11 LYS A H    11 
ATOM 9042  H HA   . LYS A 1 11 ? 9.705   5.811   9.298   1.00 0.00 ? 11 LYS A HA   11 
ATOM 9043  H HB2  . LYS A 1 11 ? 12.254  6.144   10.895  1.00 0.00 ? 11 LYS A HB2  11 
ATOM 9044  H HB3  . LYS A 1 11 ? 11.847  7.107   9.473   1.00 0.00 ? 11 LYS A HB3  11 
ATOM 9045  H HG2  . LYS A 1 11 ? 9.674   7.712   10.648  1.00 0.00 ? 11 LYS A HG2  11 
ATOM 9046  H HG3  . LYS A 1 11 ? 10.351  6.975   12.100  1.00 0.00 ? 11 LYS A HG3  11 
ATOM 9047  H HD2  . LYS A 1 11 ? 12.243  8.524   12.045  1.00 0.00 ? 11 LYS A HD2  11 
ATOM 9048  H HD3  . LYS A 1 11 ? 11.655  9.222   10.536  1.00 0.00 ? 11 LYS A HD3  11 
ATOM 9049  H HE2  . LYS A 1 11 ? 9.617   9.995   11.653  1.00 0.00 ? 11 LYS A HE2  11 
ATOM 9050  H HE3  . LYS A 1 11 ? 10.135  9.239   13.159  1.00 0.00 ? 11 LYS A HE3  11 
ATOM 9051  H HZ1  . LYS A 1 11 ? 12.031  11.061  11.926  1.00 0.00 ? 11 LYS A HZ1  11 
ATOM 9052  H HZ2  . LYS A 1 11 ? 11.632  10.851  13.561  1.00 0.00 ? 11 LYS A HZ2  11 
ATOM 9053  H HZ3  . LYS A 1 11 ? 10.625  11.775  12.553  1.00 0.00 ? 11 LYS A HZ3  11 
ATOM 9054  N N    . LYS A 1 12 ? 11.422  3.287   8.927   1.00 0.00 ? 12 LYS A N    11 
ATOM 9055  C CA   . LYS A 1 12 ? 12.147  2.420   8.005   1.00 0.00 ? 12 LYS A CA   11 
ATOM 9056  C C    . LYS A 1 12 ? 11.574  2.538   6.598   1.00 0.00 ? 12 LYS A C    11 
ATOM 9057  O O    . LYS A 1 12 ? 12.314  2.693   5.626   1.00 0.00 ? 12 LYS A O    11 
ATOM 9058  C CB   . LYS A 1 12 ? 12.059  0.964   8.472   1.00 0.00 ? 12 LYS A CB   11 
ATOM 9059  C CG   . LYS A 1 12 ? 12.641  0.839   9.887   1.00 0.00 ? 12 LYS A CG   11 
ATOM 9060  C CD   . LYS A 1 12 ? 13.170  -0.581  10.117  1.00 0.00 ? 12 LYS A CD   11 
ATOM 9061  C CE   . LYS A 1 12 ? 11.996  -1.558  10.200  1.00 0.00 ? 12 LYS A CE   11 
ATOM 9062  N NZ   . LYS A 1 12 ? 11.228  -1.306  11.451  1.00 0.00 ? 12 LYS A NZ   11 
ATOM 9063  H H    . LYS A 1 12 ? 10.962  2.891   9.699   1.00 0.00 ? 12 LYS A H    11 
ATOM 9064  H HA   . LYS A 1 12 ? 13.184  2.717   7.985   1.00 0.00 ? 12 LYS A HA   11 
ATOM 9065  H HB2  . LYS A 1 12 ? 11.024  0.655   8.478   1.00 0.00 ? 12 LYS A HB2  11 
ATOM 9066  H HB3  . LYS A 1 12 ? 12.618  0.337   7.795   1.00 0.00 ? 12 LYS A HB3  11 
ATOM 9067  H HG2  . LYS A 1 12 ? 13.451  1.544   10.008  1.00 0.00 ? 12 LYS A HG2  11 
ATOM 9068  H HG3  . LYS A 1 12 ? 11.871  1.053   10.612  1.00 0.00 ? 12 LYS A HG3  11 
ATOM 9069  H HD2  . LYS A 1 12 ? 13.818  -0.862  9.300   1.00 0.00 ? 12 LYS A HD2  11 
ATOM 9070  H HD3  . LYS A 1 12 ? 13.725  -0.611  11.044  1.00 0.00 ? 12 LYS A HD3  11 
ATOM 9071  H HE2  . LYS A 1 12 ? 11.351  -1.416  9.347   1.00 0.00 ? 12 LYS A HE2  11 
ATOM 9072  H HE3  . LYS A 1 12 ? 12.371  -2.569  10.204  1.00 0.00 ? 12 LYS A HE3  11 
ATOM 9073  H HZ1  . LYS A 1 12 ? 10.613  -2.121  11.649  1.00 0.00 ? 12 LYS A HZ1  11 
ATOM 9074  H HZ2  . LYS A 1 12 ? 10.644  -0.455  11.335  1.00 0.00 ? 12 LYS A HZ2  11 
ATOM 9075  H HZ3  . LYS A 1 12 ? 11.889  -1.170  12.242  1.00 0.00 ? 12 LYS A HZ3  11 
ATOM 9076  N N    . TYR A 1 13 ? 10.251  2.460   6.496   1.00 0.00 ? 13 TYR A N    11 
ATOM 9077  C CA   . TYR A 1 13 ? 9.581   2.553   5.202   1.00 0.00 ? 13 TYR A CA   11 
ATOM 9078  C C    . TYR A 1 13 ? 8.440   3.565   5.263   1.00 0.00 ? 13 TYR A C    11 
ATOM 9079  O O    . TYR A 1 13 ? 7.832   3.769   6.314   1.00 0.00 ? 13 TYR A O    11 
ATOM 9080  C CB   . TYR A 1 13 ? 9.033   1.179   4.803   1.00 0.00 ? 13 TYR A CB   11 
ATOM 9081  C CG   . TYR A 1 13 ? 10.109  0.387   4.095   1.00 0.00 ? 13 TYR A CG   11 
ATOM 9082  C CD1  . TYR A 1 13 ? 11.213  -0.096  4.811   1.00 0.00 ? 13 TYR A CD1  11 
ATOM 9083  C CD2  . TYR A 1 13 ? 10.004  0.138   2.721   1.00 0.00 ? 13 TYR A CD2  11 
ATOM 9084  C CE1  . TYR A 1 13 ? 12.208  -0.826  4.152   1.00 0.00 ? 13 TYR A CE1  11 
ATOM 9085  C CE2  . TYR A 1 13 ? 11.000  -0.591  2.063   1.00 0.00 ? 13 TYR A CE2  11 
ATOM 9086  C CZ   . TYR A 1 13 ? 12.102  -1.073  2.777   1.00 0.00 ? 13 TYR A CZ   11 
ATOM 9087  O OH   . TYR A 1 13 ? 13.084  -1.793  2.128   1.00 0.00 ? 13 TYR A OH   11 
ATOM 9088  H H    . TYR A 1 13 ? 9.715   2.332   7.307   1.00 0.00 ? 13 TYR A H    11 
ATOM 9089  H HA   . TYR A 1 13 ? 10.292  2.878   4.457   1.00 0.00 ? 13 TYR A HA   11 
ATOM 9090  H HB2  . TYR A 1 13 ? 8.722   0.646   5.690   1.00 0.00 ? 13 TYR A HB2  11 
ATOM 9091  H HB3  . TYR A 1 13 ? 8.186   1.304   4.142   1.00 0.00 ? 13 TYR A HB3  11 
ATOM 9092  H HD1  . TYR A 1 13 ? 11.294  0.092   5.870   1.00 0.00 ? 13 TYR A HD1  11 
ATOM 9093  H HD2  . TYR A 1 13 ? 9.154   0.511   2.168   1.00 0.00 ? 13 TYR A HD2  11 
ATOM 9094  H HE1  . TYR A 1 13 ? 13.059  -1.198  4.702   1.00 0.00 ? 13 TYR A HE1  11 
ATOM 9095  H HE2  . TYR A 1 13 ? 10.916  -0.784  1.005   1.00 0.00 ? 13 TYR A HE2  11 
ATOM 9096  H HH   . TYR A 1 13 ? 12.656  -2.373  1.493   1.00 0.00 ? 13 TYR A HH   11 
ATOM 9097  N N    . ASP A 1 14 ? 8.154   4.191   4.126   1.00 0.00 ? 14 ASP A N    11 
ATOM 9098  C CA   . ASP A 1 14 ? 7.083   5.179   4.051   1.00 0.00 ? 14 ASP A CA   11 
ATOM 9099  C C    . ASP A 1 14 ? 6.465   5.184   2.657   1.00 0.00 ? 14 ASP A C    11 
ATOM 9100  O O    . ASP A 1 14 ? 7.093   5.617   1.692   1.00 0.00 ? 14 ASP A O    11 
ATOM 9101  C CB   . ASP A 1 14 ? 7.631   6.570   4.375   1.00 0.00 ? 14 ASP A CB   11 
ATOM 9102  C CG   . ASP A 1 14 ? 6.490   7.580   4.426   1.00 0.00 ? 14 ASP A CG   11 
ATOM 9103  O OD1  . ASP A 1 14 ? 5.828   7.645   5.448   1.00 0.00 ? 14 ASP A OD1  11 
ATOM 9104  O OD2  . ASP A 1 14 ? 6.296   8.275   3.442   1.00 0.00 ? 14 ASP A OD2  11 
ATOM 9105  H H    . ASP A 1 14 ? 8.672   3.983   3.321   1.00 0.00 ? 14 ASP A H    11 
ATOM 9106  H HA   . ASP A 1 14 ? 6.320   4.927   4.772   1.00 0.00 ? 14 ASP A HA   11 
ATOM 9107  H HB2  . ASP A 1 14 ? 8.131   6.543   5.332   1.00 0.00 ? 14 ASP A HB2  11 
ATOM 9108  H HB3  . ASP A 1 14 ? 8.335   6.864   3.610   1.00 0.00 ? 14 ASP A HB3  11 
ATOM 9109  N N    . LEU A 1 15 ? 5.230   4.698   2.560   1.00 0.00 ? 15 LEU A N    11 
ATOM 9110  C CA   . LEU A 1 15 ? 4.529   4.646   1.280   1.00 0.00 ? 15 LEU A CA   11 
ATOM 9111  C C    . LEU A 1 15 ? 3.213   5.412   1.362   1.00 0.00 ? 15 LEU A C    11 
ATOM 9112  O O    . LEU A 1 15 ? 2.142   4.844   1.151   1.00 0.00 ? 15 LEU A O    11 
ATOM 9113  C CB   . LEU A 1 15 ? 4.244   3.191   0.890   1.00 0.00 ? 15 LEU A CB   11 
ATOM 9114  C CG   . LEU A 1 15 ? 5.496   2.333   1.104   1.00 0.00 ? 15 LEU A CG   11 
ATOM 9115  C CD1  . LEU A 1 15 ? 5.123   0.855   0.988   1.00 0.00 ? 15 LEU A CD1  11 
ATOM 9116  C CD2  . LEU A 1 15 ? 6.544   2.673   0.039   1.00 0.00 ? 15 LEU A CD2  11 
ATOM 9117  H H    . LEU A 1 15 ? 4.781   4.365   3.366   1.00 0.00 ? 15 LEU A H    11 
ATOM 9118  H HA   . LEU A 1 15 ? 5.149   5.096   0.516   1.00 0.00 ? 15 LEU A HA   11 
ATOM 9119  H HB2  . LEU A 1 15 ? 3.440   2.809   1.503   1.00 0.00 ? 15 LEU A HB2  11 
ATOM 9120  H HB3  . LEU A 1 15 ? 3.954   3.148   -0.148  1.00 0.00 ? 15 LEU A HB3  11 
ATOM 9121  H HG   . LEU A 1 15 ? 5.903   2.523   2.086   1.00 0.00 ? 15 LEU A HG   11 
ATOM 9122  H HD11 . LEU A 1 15 ? 4.695   0.667   0.015   1.00 0.00 ? 15 LEU A HD11 11 
ATOM 9123  H HD12 . LEU A 1 15 ? 4.402   0.605   1.752   1.00 0.00 ? 15 LEU A HD12 11 
ATOM 9124  H HD13 . LEU A 1 15 ? 6.009   0.249   1.116   1.00 0.00 ? 15 LEU A HD13 11 
ATOM 9125  H HD21 . LEU A 1 15 ? 6.957   3.650   0.238   1.00 0.00 ? 15 LEU A HD21 11 
ATOM 9126  H HD22 . LEU A 1 15 ? 6.081   2.667   -0.937  1.00 0.00 ? 15 LEU A HD22 11 
ATOM 9127  H HD23 . LEU A 1 15 ? 7.334   1.936   0.066   1.00 0.00 ? 15 LEU A HD23 11 
ATOM 9128  N N    . SER A 1 16 ? 3.298   6.706   1.664   1.00 0.00 ? 16 SER A N    11 
ATOM 9129  C CA   . SER A 1 16 ? 2.103   7.537   1.767   1.00 0.00 ? 16 SER A CA   11 
ATOM 9130  C C    . SER A 1 16 ? 1.115   7.180   0.662   1.00 0.00 ? 16 SER A C    11 
ATOM 9131  O O    . SER A 1 16 ? -0.063  6.934   0.921   1.00 0.00 ? 16 SER A O    11 
ATOM 9132  C CB   . SER A 1 16 ? 2.483   9.014   1.656   1.00 0.00 ? 16 SER A CB   11 
ATOM 9133  O OG   . SER A 1 16 ? 1.376   9.747   1.150   1.00 0.00 ? 16 SER A OG   11 
ATOM 9134  H H    . SER A 1 16 ? 4.180   7.107   1.820   1.00 0.00 ? 16 SER A H    11 
ATOM 9135  H HA   . SER A 1 16 ? 1.636   7.366   2.726   1.00 0.00 ? 16 SER A HA   11 
ATOM 9136  H HB2  . SER A 1 16 ? 2.746   9.396   2.630   1.00 0.00 ? 16 SER A HB2  11 
ATOM 9137  H HB3  . SER A 1 16 ? 3.332   9.117   0.993   1.00 0.00 ? 16 SER A HB3  11 
ATOM 9138  H HG   . SER A 1 16 ? 0.608   9.172   1.163   1.00 0.00 ? 16 SER A HG   11 
ATOM 9139  N N    . LYS A 1 17 ? 1.612   7.137   -0.570  1.00 0.00 ? 17 LYS A N    11 
ATOM 9140  C CA   . LYS A 1 17 ? 0.777   6.792   -1.712  1.00 0.00 ? 17 LYS A CA   11 
ATOM 9141  C C    . LYS A 1 17 ? 1.662   6.449   -2.906  1.00 0.00 ? 17 LYS A C    11 
ATOM 9142  O O    . LYS A 1 17 ? 2.552   7.217   -3.271  1.00 0.00 ? 17 LYS A O    11 
ATOM 9143  C CB   . LYS A 1 17 ? -0.148  7.970   -2.059  1.00 0.00 ? 17 LYS A CB   11 
ATOM 9144  C CG   . LYS A 1 17 ? -1.580  7.472   -2.288  1.00 0.00 ? 17 LYS A CG   11 
ATOM 9145  C CD   . LYS A 1 17 ? -1.635  6.631   -3.566  1.00 0.00 ? 17 LYS A CD   11 
ATOM 9146  C CE   . LYS A 1 17 ? -3.044  6.062   -3.742  1.00 0.00 ? 17 LYS A CE   11 
ATOM 9147  N NZ   . LYS A 1 17 ? -3.083  5.200   -4.958  1.00 0.00 ? 17 LYS A NZ   11 
ATOM 9148  H H    . LYS A 1 17 ? 2.562   7.329   -0.710  1.00 0.00 ? 17 LYS A H    11 
ATOM 9149  H HA   . LYS A 1 17 ? 0.180   5.929   -1.458  1.00 0.00 ? 17 LYS A HA   11 
ATOM 9150  H HB2  . LYS A 1 17 ? -0.144  8.678   -1.242  1.00 0.00 ? 17 LYS A HB2  11 
ATOM 9151  H HB3  . LYS A 1 17 ? 0.206   8.458   -2.955  1.00 0.00 ? 17 LYS A HB3  11 
ATOM 9152  H HG2  . LYS A 1 17 ? -1.892  6.869   -1.446  1.00 0.00 ? 17 LYS A HG2  11 
ATOM 9153  H HG3  . LYS A 1 17 ? -2.241  8.318   -2.390  1.00 0.00 ? 17 LYS A HG3  11 
ATOM 9154  H HD2  . LYS A 1 17 ? -1.388  7.252   -4.416  1.00 0.00 ? 17 LYS A HD2  11 
ATOM 9155  H HD3  . LYS A 1 17 ? -0.928  5.819   -3.496  1.00 0.00 ? 17 LYS A HD3  11 
ATOM 9156  H HE2  . LYS A 1 17 ? -3.305  5.473   -2.875  1.00 0.00 ? 17 LYS A HE2  11 
ATOM 9157  H HE3  . LYS A 1 17 ? -3.748  6.872   -3.852  1.00 0.00 ? 17 LYS A HE3  11 
ATOM 9158  H HZ1  . LYS A 1 17 ? -2.770  4.240   -4.714  1.00 0.00 ? 17 LYS A HZ1  11 
ATOM 9159  H HZ2  . LYS A 1 17 ? -2.453  5.595   -5.684  1.00 0.00 ? 17 LYS A HZ2  11 
ATOM 9160  H HZ3  . LYS A 1 17 ? -4.057  5.165   -5.324  1.00 0.00 ? 17 LYS A HZ3  11 
ATOM 9161  N N    . TRP A 1 18 ? 1.411   5.291   -3.510  1.00 0.00 ? 18 TRP A N    11 
ATOM 9162  C CA   . TRP A 1 18 ? 2.190   4.842   -4.663  1.00 0.00 ? 18 TRP A CA   11 
ATOM 9163  C C    . TRP A 1 18 ? 1.268   4.624   -5.861  1.00 0.00 ? 18 TRP A C    11 
ATOM 9164  O O    . TRP A 1 18 ? 0.048   4.564   -5.711  1.00 0.00 ? 18 TRP A O    11 
ATOM 9165  C CB   . TRP A 1 18 ? 2.908   3.528   -4.319  1.00 0.00 ? 18 TRP A CB   11 
ATOM 9166  C CG   . TRP A 1 18 ? 4.291   3.794   -3.797  1.00 0.00 ? 18 TRP A CG   11 
ATOM 9167  C CD1  . TRP A 1 18 ? 4.640   4.817   -2.983  1.00 0.00 ? 18 TRP A CD1  11 
ATOM 9168  C CD2  . TRP A 1 18 ? 5.511   3.033   -4.037  1.00 0.00 ? 18 TRP A CD2  11 
ATOM 9169  N NE1  . TRP A 1 18 ? 5.994   4.734   -2.712  1.00 0.00 ? 18 TRP A NE1  11 
ATOM 9170  C CE2  . TRP A 1 18 ? 6.574   3.651   -3.339  1.00 0.00 ? 18 TRP A CE2  11 
ATOM 9171  C CE3  . TRP A 1 18 ? 5.795   1.878   -4.788  1.00 0.00 ? 18 TRP A CE3  11 
ATOM 9172  C CZ2  . TRP A 1 18 ? 7.874   3.141   -3.383  1.00 0.00 ? 18 TRP A CZ2  11 
ATOM 9173  C CZ3  . TRP A 1 18 ? 7.100   1.363   -4.833  1.00 0.00 ? 18 TRP A CZ3  11 
ATOM 9174  C CH2  . TRP A 1 18 ? 8.136   1.993   -4.134  1.00 0.00 ? 18 TRP A CH2  11 
ATOM 9175  H H    . TRP A 1 18 ? 0.688   4.723   -3.171  1.00 0.00 ? 18 TRP A H    11 
ATOM 9176  H HA   . TRP A 1 18 ? 2.924   5.594   -4.915  1.00 0.00 ? 18 TRP A HA   11 
ATOM 9177  H HB2  . TRP A 1 18 ? 2.343   3.003   -3.564  1.00 0.00 ? 18 TRP A HB2  11 
ATOM 9178  H HB3  . TRP A 1 18 ? 2.975   2.913   -5.206  1.00 0.00 ? 18 TRP A HB3  11 
ATOM 9179  H HD1  . TRP A 1 18 ? 3.974   5.573   -2.604  1.00 0.00 ? 18 TRP A HD1  11 
ATOM 9180  H HE1  . TRP A 1 18 ? 6.496   5.356   -2.147  1.00 0.00 ? 18 TRP A HE1  11 
ATOM 9181  H HE3  . TRP A 1 18 ? 5.004   1.384   -5.329  1.00 0.00 ? 18 TRP A HE3  11 
ATOM 9182  H HZ2  . TRP A 1 18 ? 8.668   3.630   -2.841  1.00 0.00 ? 18 TRP A HZ2  11 
ATOM 9183  H HZ3  . TRP A 1 18 ? 7.304   0.476   -5.413  1.00 0.00 ? 18 TRP A HZ3  11 
ATOM 9184  H HH2  . TRP A 1 18 ? 9.138   1.591   -4.174  1.00 0.00 ? 18 TRP A HH2  11 
ATOM 9185  N N    . LYS A 1 19 ? 1.858   4.502   -7.047  1.00 0.00 ? 19 LYS A N    11 
ATOM 9186  C CA   . LYS A 1 19 ? 1.075   4.283   -8.260  1.00 0.00 ? 19 LYS A CA   11 
ATOM 9187  C C    . LYS A 1 19 ? 1.116   2.811   -8.661  1.00 0.00 ? 19 LYS A C    11 
ATOM 9188  O O    . LYS A 1 19 ? 2.067   2.098   -8.343  1.00 0.00 ? 19 LYS A O    11 
ATOM 9189  C CB   . LYS A 1 19 ? 1.625   5.144   -9.403  1.00 0.00 ? 19 LYS A CB   11 
ATOM 9190  C CG   . LYS A 1 19 ? 1.966   6.538   -8.874  1.00 0.00 ? 19 LYS A CG   11 
ATOM 9191  C CD   . LYS A 1 19 ? 0.726   7.159   -8.228  1.00 0.00 ? 19 LYS A CD   11 
ATOM 9192  C CE   . LYS A 1 19 ? 0.935   8.666   -8.063  1.00 0.00 ? 19 LYS A CE   11 
ATOM 9193  N NZ   . LYS A 1 19 ? 1.003   9.309   -9.405  1.00 0.00 ? 19 LYS A NZ   11 
ATOM 9194  H H    . LYS A 1 19 ? 2.834   4.555   -7.106  1.00 0.00 ? 19 LYS A H    11 
ATOM 9195  H HA   . LYS A 1 19 ? 0.049   4.568   -8.074  1.00 0.00 ? 19 LYS A HA   11 
ATOM 9196  H HB2  . LYS A 1 19 ? 2.515   4.683   -9.806  1.00 0.00 ? 19 LYS A HB2  11 
ATOM 9197  H HB3  . LYS A 1 19 ? 0.880   5.229   -10.178 1.00 0.00 ? 19 LYS A HB3  11 
ATOM 9198  H HG2  . LYS A 1 19 ? 2.755   6.461   -8.140  1.00 0.00 ? 19 LYS A HG2  11 
ATOM 9199  H HG3  . LYS A 1 19 ? 2.296   7.162   -9.691  1.00 0.00 ? 19 LYS A HG3  11 
ATOM 9200  H HD2  . LYS A 1 19 ? -0.134  6.981   -8.858  1.00 0.00 ? 19 LYS A HD2  11 
ATOM 9201  H HD3  . LYS A 1 19 ? 0.561   6.712   -7.260  1.00 0.00 ? 19 LYS A HD3  11 
ATOM 9202  H HE2  . LYS A 1 19 ? 0.111   9.085   -7.504  1.00 0.00 ? 19 LYS A HE2  11 
ATOM 9203  H HE3  . LYS A 1 19 ? 1.858   8.844   -7.530  1.00 0.00 ? 19 LYS A HE3  11 
ATOM 9204  H HZ1  . LYS A 1 19 ? 0.758   10.317  -9.321  1.00 0.00 ? 19 LYS A HZ1  11 
ATOM 9205  H HZ2  . LYS A 1 19 ? 0.330   8.844   -10.047 1.00 0.00 ? 19 LYS A HZ2  11 
ATOM 9206  H HZ3  . LYS A 1 19 ? 1.967   9.216   -9.785  1.00 0.00 ? 19 LYS A HZ3  11 
ATOM 9207  N N    . TYR A 1 20 ? 0.077   2.362   -9.354  1.00 0.00 ? 20 TYR A N    11 
ATOM 9208  C CA   . TYR A 1 20 ? 0.005   0.973   -9.789  1.00 0.00 ? 20 TYR A CA   11 
ATOM 9209  C C    . TYR A 1 20 ? 1.236   0.602   -10.614 1.00 0.00 ? 20 TYR A C    11 
ATOM 9210  O O    . TYR A 1 20 ? 1.760   -0.509  -10.505 1.00 0.00 ? 20 TYR A O    11 
ATOM 9211  C CB   . TYR A 1 20 ? -1.256  0.753   -10.628 1.00 0.00 ? 20 TYR A CB   11 
ATOM 9212  C CG   . TYR A 1 20 ? -1.308  -0.682  -11.093 1.00 0.00 ? 20 TYR A CG   11 
ATOM 9213  C CD1  . TYR A 1 20 ? -0.685  -1.054  -12.289 1.00 0.00 ? 20 TYR A CD1  11 
ATOM 9214  C CD2  . TYR A 1 20 ? -1.981  -1.642  -10.326 1.00 0.00 ? 20 TYR A CD2  11 
ATOM 9215  C CE1  . TYR A 1 20 ? -0.734  -2.385  -12.720 1.00 0.00 ? 20 TYR A CE1  11 
ATOM 9216  C CE2  . TYR A 1 20 ? -2.030  -2.973  -10.757 1.00 0.00 ? 20 TYR A CE2  11 
ATOM 9217  C CZ   . TYR A 1 20 ? -1.407  -3.344  -11.953 1.00 0.00 ? 20 TYR A CZ   11 
ATOM 9218  O OH   . TYR A 1 20 ? -1.456  -4.657  -12.379 1.00 0.00 ? 20 TYR A OH   11 
ATOM 9219  H H    . TYR A 1 20 ? -0.655  2.975   -9.578  1.00 0.00 ? 20 TYR A H    11 
ATOM 9220  H HA   . TYR A 1 20 ? -0.042  0.335   -8.920  1.00 0.00 ? 20 TYR A HA   11 
ATOM 9221  H HB2  . TYR A 1 20 ? -2.128  0.970   -10.030 1.00 0.00 ? 20 TYR A HB2  11 
ATOM 9222  H HB3  . TYR A 1 20 ? -1.235  1.408   -11.486 1.00 0.00 ? 20 TYR A HB3  11 
ATOM 9223  H HD1  . TYR A 1 20 ? -0.165  -0.314  -12.880 1.00 0.00 ? 20 TYR A HD1  11 
ATOM 9224  H HD2  . TYR A 1 20 ? -2.462  -1.355  -9.403  1.00 0.00 ? 20 TYR A HD2  11 
ATOM 9225  H HE1  . TYR A 1 20 ? -0.253  -2.672  -13.644 1.00 0.00 ? 20 TYR A HE1  11 
ATOM 9226  H HE2  . TYR A 1 20 ? -2.549  -3.713  -10.167 1.00 0.00 ? 20 TYR A HE2  11 
ATOM 9227  H HH   . TYR A 1 20 ? -0.979  -4.718  -13.211 1.00 0.00 ? 20 TYR A HH   11 
ATOM 9228  N N    . ALA A 1 21 ? 1.687   1.538   -11.441 1.00 0.00 ? 21 ALA A N    11 
ATOM 9229  C CA   . ALA A 1 21 ? 2.849   1.305   -12.290 1.00 0.00 ? 21 ALA A CA   11 
ATOM 9230  C C    . ALA A 1 21 ? 4.083   0.967   -11.455 1.00 0.00 ? 21 ALA A C    11 
ATOM 9231  O O    . ALA A 1 21 ? 4.637   -0.127  -11.567 1.00 0.00 ? 21 ALA A O    11 
ATOM 9232  C CB   . ALA A 1 21 ? 3.133   2.545   -13.137 1.00 0.00 ? 21 ALA A CB   11 
ATOM 9233  H H    . ALA A 1 21 ? 1.225   2.401   -11.487 1.00 0.00 ? 21 ALA A H    11 
ATOM 9234  H HA   . ALA A 1 21 ? 2.639   0.477   -12.950 1.00 0.00 ? 21 ALA A HA   11 
ATOM 9235  H HB1  . ALA A 1 21 ? 2.321   2.701   -13.831 1.00 0.00 ? 21 ALA A HB1  11 
ATOM 9236  H HB2  . ALA A 1 21 ? 4.053   2.405   -13.685 1.00 0.00 ? 21 ALA A HB2  11 
ATOM 9237  H HB3  . ALA A 1 21 ? 3.225   3.407   -12.493 1.00 0.00 ? 21 ALA A HB3  11 
ATOM 9238  N N    . GLU A 1 22 ? 4.517   1.914   -10.628 1.00 0.00 ? 22 GLU A N    11 
ATOM 9239  C CA   . GLU A 1 22 ? 5.696   1.698   -9.795  1.00 0.00 ? 22 GLU A CA   11 
ATOM 9240  C C    . GLU A 1 22 ? 5.495   0.507   -8.864  1.00 0.00 ? 22 GLU A C    11 
ATOM 9241  O O    . GLU A 1 22 ? 6.442   -0.215  -8.556  1.00 0.00 ? 22 GLU A O    11 
ATOM 9242  C CB   . GLU A 1 22 ? 6.004   2.956   -8.975  1.00 0.00 ? 22 GLU A CB   11 
ATOM 9243  C CG   . GLU A 1 22 ? 4.859   3.246   -8.003  1.00 0.00 ? 22 GLU A CG   11 
ATOM 9244  C CD   . GLU A 1 22 ? 5.201   4.467   -7.153  1.00 0.00 ? 22 GLU A CD   11 
ATOM 9245  O OE1  . GLU A 1 22 ? 6.359   4.611   -6.799  1.00 0.00 ? 22 GLU A OE1  11 
ATOM 9246  O OE2  . GLU A 1 22 ? 4.299   5.238   -6.868  1.00 0.00 ? 22 GLU A OE2  11 
ATOM 9247  H H    . GLU A 1 22 ? 4.043   2.770   -10.584 1.00 0.00 ? 22 GLU A H    11 
ATOM 9248  H HA   . GLU A 1 22 ? 6.537   1.493   -10.438 1.00 0.00 ? 22 GLU A HA   11 
ATOM 9249  H HB2  . GLU A 1 22 ? 6.918   2.804   -8.420  1.00 0.00 ? 22 GLU A HB2  11 
ATOM 9250  H HB3  . GLU A 1 22 ? 6.126   3.796   -9.643  1.00 0.00 ? 22 GLU A HB3  11 
ATOM 9251  H HG2  . GLU A 1 22 ? 3.957   3.439   -8.559  1.00 0.00 ? 22 GLU A HG2  11 
ATOM 9252  H HG3  . GLU A 1 22 ? 4.707   2.396   -7.358  1.00 0.00 ? 22 GLU A HG3  11 
ATOM 9253  N N    . LEU A 1 23 ? 4.259   0.304   -8.415  1.00 0.00 ? 23 LEU A N    11 
ATOM 9254  C CA   . LEU A 1 23 ? 3.965   -0.807  -7.518  1.00 0.00 ? 23 LEU A CA   11 
ATOM 9255  C C    . LEU A 1 23 ? 4.354   -2.131  -8.170  1.00 0.00 ? 23 LEU A C    11 
ATOM 9256  O O    . LEU A 1 23 ? 5.136   -2.901  -7.615  1.00 0.00 ? 23 LEU A O    11 
ATOM 9257  C CB   . LEU A 1 23 ? 2.464   -0.821  -7.177  1.00 0.00 ? 23 LEU A CB   11 
ATOM 9258  C CG   . LEU A 1 23 ? 2.226   -0.202  -5.793  1.00 0.00 ? 23 LEU A CG   11 
ATOM 9259  C CD1  . LEU A 1 23 ? 0.768   0.254   -5.682  1.00 0.00 ? 23 LEU A CD1  11 
ATOM 9260  C CD2  . LEU A 1 23 ? 2.512   -1.242  -4.704  1.00 0.00 ? 23 LEU A CD2  11 
ATOM 9261  H H    . LEU A 1 23 ? 3.539   0.909   -8.690  1.00 0.00 ? 23 LEU A H    11 
ATOM 9262  H HA   . LEU A 1 23 ? 4.534   -0.683  -6.608  1.00 0.00 ? 23 LEU A HA   11 
ATOM 9263  H HB2  . LEU A 1 23 ? 1.930   -0.250  -7.920  1.00 0.00 ? 23 LEU A HB2  11 
ATOM 9264  H HB3  . LEU A 1 23 ? 2.101   -1.840  -7.181  1.00 0.00 ? 23 LEU A HB3  11 
ATOM 9265  H HG   . LEU A 1 23 ? 2.877   0.647   -5.661  1.00 0.00 ? 23 LEU A HG   11 
ATOM 9266  H HD11 . LEU A 1 23 ? 0.530   0.449   -4.647  1.00 0.00 ? 23 LEU A HD11 11 
ATOM 9267  H HD12 . LEU A 1 23 ? 0.119   -0.520  -6.061  1.00 0.00 ? 23 LEU A HD12 11 
ATOM 9268  H HD13 . LEU A 1 23 ? 0.629   1.155   -6.260  1.00 0.00 ? 23 LEU A HD13 11 
ATOM 9269  H HD21 . LEU A 1 23 ? 3.560   -1.503  -4.720  1.00 0.00 ? 23 LEU A HD21 11 
ATOM 9270  H HD22 . LEU A 1 23 ? 1.920   -2.128  -4.886  1.00 0.00 ? 23 LEU A HD22 11 
ATOM 9271  H HD23 . LEU A 1 23 ? 2.258   -0.831  -3.739  1.00 0.00 ? 23 LEU A HD23 11 
ATOM 9272  N N    . ARG A 1 24 ? 3.802   -2.384  -9.352  1.00 0.00 ? 24 ARG A N    11 
ATOM 9273  C CA   . ARG A 1 24 ? 4.097   -3.618  -10.071 1.00 0.00 ? 24 ARG A CA   11 
ATOM 9274  C C    . ARG A 1 24 ? 5.582   -3.709  -10.402 1.00 0.00 ? 24 ARG A C    11 
ATOM 9275  O O    . ARG A 1 24 ? 6.228   -4.726  -10.145 1.00 0.00 ? 24 ARG A O    11 
ATOM 9276  C CB   . ARG A 1 24 ? 3.279   -3.679  -11.361 1.00 0.00 ? 24 ARG A CB   11 
ATOM 9277  C CG   . ARG A 1 24 ? 3.354   -5.089  -11.949 1.00 0.00 ? 24 ARG A CG   11 
ATOM 9278  C CD   . ARG A 1 24 ? 2.697   -5.102  -13.330 1.00 0.00 ? 24 ARG A CD   11 
ATOM 9279  N NE   . ARG A 1 24 ? 3.436   -4.246  -14.249 1.00 0.00 ? 24 ARG A NE   11 
ATOM 9280  C CZ   . ARG A 1 24 ? 2.873   -3.780  -15.359 1.00 0.00 ? 24 ARG A CZ   11 
ATOM 9281  N NH1  . ARG A 1 24 ? 1.637   -4.088  -15.642 1.00 0.00 ? 24 ARG A NH1  11 
ATOM 9282  N NH2  . ARG A 1 24 ? 3.555   -3.014  -16.166 1.00 0.00 ? 24 ARG A NH2  11 
ATOM 9283  H H    . ARG A 1 24 ? 3.186   -1.731  -9.747  1.00 0.00 ? 24 ARG A H    11 
ATOM 9284  H HA   . ARG A 1 24 ? 3.826   -4.459  -9.448  1.00 0.00 ? 24 ARG A HA   11 
ATOM 9285  H HB2  . ARG A 1 24 ? 2.249   -3.433  -11.146 1.00 0.00 ? 24 ARG A HB2  11 
ATOM 9286  H HB3  . ARG A 1 24 ? 3.678   -2.973  -12.073 1.00 0.00 ? 24 ARG A HB3  11 
ATOM 9287  H HG2  . ARG A 1 24 ? 4.389   -5.386  -12.039 1.00 0.00 ? 24 ARG A HG2  11 
ATOM 9288  H HG3  . ARG A 1 24 ? 2.836   -5.778  -11.299 1.00 0.00 ? 24 ARG A HG3  11 
ATOM 9289  H HD2  . ARG A 1 24 ? 2.690   -6.110  -13.713 1.00 0.00 ? 24 ARG A HD2  11 
ATOM 9290  H HD3  . ARG A 1 24 ? 1.681   -4.746  -13.244 1.00 0.00 ? 24 ARG A HD3  11 
ATOM 9291  H HE   . ARG A 1 24 ? 4.366   -4.009  -14.045 1.00 0.00 ? 24 ARG A HE   11 
ATOM 9292  H HH11 . ARG A 1 24 ? 1.114   -4.675  -15.024 1.00 0.00 ? 24 ARG A HH11 11 
ATOM 9293  H HH12 . ARG A 1 24 ? 1.212   -3.738  -16.478 1.00 0.00 ? 24 ARG A HH12 11 
ATOM 9294  H HH21 . ARG A 1 24 ? 4.502   -2.778  -15.949 1.00 0.00 ? 24 ARG A HH21 11 
ATOM 9295  H HH22 . ARG A 1 24 ? 3.131   -2.664  -17.001 1.00 0.00 ? 24 ARG A HH22 11 
ATOM 9296  N N    . ASP A 1 25 ? 6.119   -2.645  -10.983 1.00 0.00 ? 25 ASP A N    11 
ATOM 9297  C CA   . ASP A 1 25 ? 7.527   -2.622  -11.352 1.00 0.00 ? 25 ASP A CA   11 
ATOM 9298  C C    . ASP A 1 25 ? 8.413   -2.906  -10.143 1.00 0.00 ? 25 ASP A C    11 
ATOM 9299  O O    . ASP A 1 25 ? 9.254   -3.803  -10.176 1.00 0.00 ? 25 ASP A O    11 
ATOM 9300  C CB   . ASP A 1 25 ? 7.891   -1.259  -11.943 1.00 0.00 ? 25 ASP A CB   11 
ATOM 9301  C CG   . ASP A 1 25 ? 9.236   -1.342  -12.656 1.00 0.00 ? 25 ASP A CG   11 
ATOM 9302  O OD1  . ASP A 1 25 ? 9.298   -1.988  -13.689 1.00 0.00 ? 25 ASP A OD1  11 
ATOM 9303  O OD2  . ASP A 1 25 ? 10.184  -0.757  -12.159 1.00 0.00 ? 25 ASP A OD2  11 
ATOM 9304  H H    . ASP A 1 25 ? 5.558   -1.862  -11.169 1.00 0.00 ? 25 ASP A H    11 
ATOM 9305  H HA   . ASP A 1 25 ? 7.702   -3.380  -12.097 1.00 0.00 ? 25 ASP A HA   11 
ATOM 9306  H HB2  . ASP A 1 25 ? 7.128   -0.960  -12.649 1.00 0.00 ? 25 ASP A HB2  11 
ATOM 9307  H HB3  . ASP A 1 25 ? 7.950   -0.528  -11.151 1.00 0.00 ? 25 ASP A HB3  11 
ATOM 9308  N N    . THR A 1 26 ? 8.223   -2.134  -9.079  1.00 0.00 ? 26 THR A N    11 
ATOM 9309  C CA   . THR A 1 26 ? 9.020   -2.309  -7.871  1.00 0.00 ? 26 THR A CA   11 
ATOM 9310  C C    . THR A 1 26 ? 8.877   -3.721  -7.311  1.00 0.00 ? 26 THR A C    11 
ATOM 9311  O O    . THR A 1 26 ? 9.833   -4.277  -6.768  1.00 0.00 ? 26 THR A O    11 
ATOM 9312  C CB   . THR A 1 26 ? 8.592   -1.297  -6.809  1.00 0.00 ? 26 THR A CB   11 
ATOM 9313  O OG1  . THR A 1 26 ? 8.474   -0.011  -7.402  1.00 0.00 ? 26 THR A OG1  11 
ATOM 9314  C CG2  . THR A 1 26 ? 9.640   -1.254  -5.698  1.00 0.00 ? 26 THR A CG2  11 
ATOM 9315  H H    . THR A 1 26 ? 7.541   -1.432  -9.110  1.00 0.00 ? 26 THR A H    11 
ATOM 9316  H HA   . THR A 1 26 ? 10.058  -2.135  -8.112  1.00 0.00 ? 26 THR A HA   11 
ATOM 9317  H HB   . THR A 1 26 ? 7.643   -1.592  -6.391  1.00 0.00 ? 26 THR A HB   11 
ATOM 9318  H HG1  . THR A 1 26 ? 9.307   0.196   -7.831  1.00 0.00 ? 26 THR A HG1  11 
ATOM 9319  H HG21 . THR A 1 26 ? 10.568  -0.864  -6.092  1.00 0.00 ? 26 THR A HG21 11 
ATOM 9320  H HG22 . THR A 1 26 ? 9.803   -2.251  -5.317  1.00 0.00 ? 26 THR A HG22 11 
ATOM 9321  H HG23 . THR A 1 26 ? 9.294   -0.615  -4.899  1.00 0.00 ? 26 THR A HG23 11 
ATOM 9322  N N    . ILE A 1 27 ? 7.685   -4.298  -7.429  1.00 0.00 ? 27 ILE A N    11 
ATOM 9323  C CA   . ILE A 1 27 ? 7.456   -5.645  -6.910  1.00 0.00 ? 27 ILE A CA   11 
ATOM 9324  C C    . ILE A 1 27 ? 8.043   -6.697  -7.852  1.00 0.00 ? 27 ILE A C    11 
ATOM 9325  O O    . ILE A 1 27 ? 8.318   -7.823  -7.439  1.00 0.00 ? 27 ILE A O    11 
ATOM 9326  C CB   . ILE A 1 27 ? 5.946   -5.883  -6.698  1.00 0.00 ? 27 ILE A CB   11 
ATOM 9327  C CG1  . ILE A 1 27 ? 5.715   -6.503  -5.312  1.00 0.00 ? 27 ILE A CG1  11 
ATOM 9328  C CG2  . ILE A 1 27 ? 5.385   -6.821  -7.776  1.00 0.00 ? 27 ILE A CG2  11 
ATOM 9329  C CD1  . ILE A 1 27 ? 4.244   -6.902  -5.162  1.00 0.00 ? 27 ILE A CD1  11 
ATOM 9330  H H    . ILE A 1 27 ? 6.950   -3.812  -7.863  1.00 0.00 ? 27 ILE A H    11 
ATOM 9331  H HA   . ILE A 1 27 ? 7.956   -5.729  -5.955  1.00 0.00 ? 27 ILE A HA   11 
ATOM 9332  H HB   . ILE A 1 27 ? 5.430   -4.937  -6.752  1.00 0.00 ? 27 ILE A HB   11 
ATOM 9333  H HG12 . ILE A 1 27 ? 6.339   -7.377  -5.202  1.00 0.00 ? 27 ILE A HG12 11 
ATOM 9334  H HG13 . ILE A 1 27 ? 5.969   -5.781  -4.550  1.00 0.00 ? 27 ILE A HG13 11 
ATOM 9335  H HG21 . ILE A 1 27 ? 4.306   -6.815  -7.731  1.00 0.00 ? 27 ILE A HG21 11 
ATOM 9336  H HG22 . ILE A 1 27 ? 5.745   -7.825  -7.604  1.00 0.00 ? 27 ILE A HG22 11 
ATOM 9337  H HG23 . ILE A 1 27 ? 5.705   -6.485  -8.751  1.00 0.00 ? 27 ILE A HG23 11 
ATOM 9338  H HD11 . ILE A 1 27 ? 3.616   -6.127  -5.577  1.00 0.00 ? 27 ILE A HD11 11 
ATOM 9339  H HD12 . ILE A 1 27 ? 4.012   -7.031  -4.115  1.00 0.00 ? 27 ILE A HD12 11 
ATOM 9340  H HD13 . ILE A 1 27 ? 4.068   -7.829  -5.687  1.00 0.00 ? 27 ILE A HD13 11 
ATOM 9341  N N    . ASN A 1 28 ? 8.226   -6.326  -9.118  1.00 0.00 ? 28 ASN A N    11 
ATOM 9342  C CA   . ASN A 1 28 ? 8.775   -7.255  -10.104 1.00 0.00 ? 28 ASN A CA   11 
ATOM 9343  C C    . ASN A 1 28 ? 10.236  -6.927  -10.412 1.00 0.00 ? 28 ASN A C    11 
ATOM 9344  O O    . ASN A 1 28 ? 10.895  -7.645  -11.165 1.00 0.00 ? 28 ASN A O    11 
ATOM 9345  C CB   . ASN A 1 28 ? 7.933   -7.206  -11.391 1.00 0.00 ? 28 ASN A CB   11 
ATOM 9346  C CG   . ASN A 1 28 ? 8.684   -6.485  -12.506 1.00 0.00 ? 28 ASN A CG   11 
ATOM 9347  O OD1  . ASN A 1 28 ? 8.886   -7.043  -13.584 1.00 0.00 ? 28 ASN A OD1  11 
ATOM 9348  N ND2  . ASN A 1 28 ? 9.112   -5.270  -12.308 1.00 0.00 ? 28 ASN A ND2  11 
ATOM 9349  H H    . ASN A 1 28 ? 7.984   -5.416  -9.394  1.00 0.00 ? 28 ASN A H    11 
ATOM 9350  H HA   . ASN A 1 28 ? 8.728   -8.257  -9.701  1.00 0.00 ? 28 ASN A HA   11 
ATOM 9351  H HB2  . ASN A 1 28 ? 7.708   -8.213  -11.711 1.00 0.00 ? 28 ASN A HB2  11 
ATOM 9352  H HB3  . ASN A 1 28 ? 7.010   -6.682  -11.189 1.00 0.00 ? 28 ASN A HB3  11 
ATOM 9353  H HD21 . ASN A 1 28 ? 8.950   -4.827  -11.449 1.00 0.00 ? 28 ASN A HD21 11 
ATOM 9354  H HD22 . ASN A 1 28 ? 9.595   -4.798  -13.019 1.00 0.00 ? 28 ASN A HD22 11 
ATOM 9355  N N    . THR A 1 29 ? 10.742  -5.846  -9.821  1.00 0.00 ? 29 THR A N    11 
ATOM 9356  C CA   . THR A 1 29 ? 12.132  -5.442  -10.039 1.00 0.00 ? 29 THR A CA   11 
ATOM 9357  C C    . THR A 1 29 ? 12.920  -5.521  -8.738  1.00 0.00 ? 29 THR A C    11 
ATOM 9358  O O    . THR A 1 29 ? 14.015  -6.082  -8.696  1.00 0.00 ? 29 THR A O    11 
ATOM 9359  C CB   . THR A 1 29 ? 12.193  -4.010  -10.583 1.00 0.00 ? 29 THR A CB   11 
ATOM 9360  O OG1  . THR A 1 29 ? 11.443  -3.153  -9.735  1.00 0.00 ? 29 THR A OG1  11 
ATOM 9361  C CG2  . THR A 1 29 ? 11.616  -3.956  -12.006 1.00 0.00 ? 29 THR A CG2  11 
ATOM 9362  H H    . THR A 1 29 ? 10.174  -5.311  -9.227  1.00 0.00 ? 29 THR A H    11 
ATOM 9363  H HA   . THR A 1 29 ? 12.586  -6.107  -10.760 1.00 0.00 ? 29 THR A HA   11 
ATOM 9364  H HB   . THR A 1 29 ? 13.221  -3.680  -10.604 1.00 0.00 ? 29 THR A HB   11 
ATOM 9365  H HG1  . THR A 1 29 ? 11.539  -2.254  -10.058 1.00 0.00 ? 29 THR A HG1  11 
ATOM 9366  H HG21 . THR A 1 29 ? 11.488  -4.957  -12.389 1.00 0.00 ? 29 THR A HG21 11 
ATOM 9367  H HG22 . THR A 1 29 ? 12.291  -3.410  -12.649 1.00 0.00 ? 29 THR A HG22 11 
ATOM 9368  H HG23 . THR A 1 29 ? 10.660  -3.455  -11.987 1.00 0.00 ? 29 THR A HG23 11 
ATOM 9369  N N    . SER A 1 30 ? 12.354  -4.959  -7.674  1.00 0.00 ? 30 SER A N    11 
ATOM 9370  C CA   . SER A 1 30 ? 13.011  -4.974  -6.372  1.00 0.00 ? 30 SER A CA   11 
ATOM 9371  C C    . SER A 1 30 ? 12.557  -6.187  -5.566  1.00 0.00 ? 30 SER A C    11 
ATOM 9372  O O    . SER A 1 30 ? 11.593  -6.860  -5.932  1.00 0.00 ? 30 SER A O    11 
ATOM 9373  C CB   . SER A 1 30 ? 12.684  -3.686  -5.609  1.00 0.00 ? 30 SER A CB   11 
ATOM 9374  O OG   . SER A 1 30 ? 13.771  -2.779  -5.735  1.00 0.00 ? 30 SER A OG   11 
ATOM 9375  H H    . SER A 1 30 ? 11.479  -4.528  -7.767  1.00 0.00 ? 30 SER A H    11 
ATOM 9376  H HA   . SER A 1 30 ? 14.080  -5.030  -6.517  1.00 0.00 ? 30 SER A HA   11 
ATOM 9377  H HB2  . SER A 1 30 ? 11.799  -3.236  -6.026  1.00 0.00 ? 30 SER A HB2  11 
ATOM 9378  H HB3  . SER A 1 30 ? 12.511  -3.915  -4.566  1.00 0.00 ? 30 SER A HB3  11 
ATOM 9379  H HG   . SER A 1 30 ? 13.966  -2.678  -6.668  1.00 0.00 ? 30 SER A HG   11 
ATOM 9380  N N    . CYS A 1 31 ? 13.255  -6.461  -4.469  1.00 0.00 ? 31 CYS A N    11 
ATOM 9381  C CA   . CYS A 1 31 ? 12.907  -7.598  -3.624  1.00 0.00 ? 31 CYS A CA   11 
ATOM 9382  C C    . CYS A 1 31 ? 13.455  -7.411  -2.214  1.00 0.00 ? 31 CYS A C    11 
ATOM 9383  O O    . CYS A 1 31 ? 14.657  -7.224  -2.021  1.00 0.00 ? 31 CYS A O    11 
ATOM 9384  C CB   . CYS A 1 31 ? 13.471  -8.885  -4.226  1.00 0.00 ? 31 CYS A CB   11 
ATOM 9385  S SG   . CYS A 1 31 ? 12.884  -10.305 -3.269  1.00 0.00 ? 31 CYS A SG   11 
ATOM 9386  H H    . CYS A 1 31 ? 14.012  -5.891  -4.223  1.00 0.00 ? 31 CYS A H    11 
ATOM 9387  H HA   . CYS A 1 31 ? 11.831  -7.681  -3.573  1.00 0.00 ? 31 CYS A HA   11 
ATOM 9388  H HB2  . CYS A 1 31 ? 13.141  -8.980  -5.250  1.00 0.00 ? 31 CYS A HB2  11 
ATOM 9389  H HB3  . CYS A 1 31 ? 14.551  -8.854  -4.198  1.00 0.00 ? 31 CYS A HB3  11 
ATOM 9390  H HG   . CYS A 1 31 ? 12.510  -9.976  -2.450  1.00 0.00 ? 31 CYS A HG   11 
ATOM 9391  N N    . ASP A 1 32 ? 12.563  -7.470  -1.232  1.00 0.00 ? 32 ASP A N    11 
ATOM 9392  C CA   . ASP A 1 32 ? 12.956  -7.314  0.163   1.00 0.00 ? 32 ASP A CA   11 
ATOM 9393  C C    . ASP A 1 32 ? 11.758  -7.559  1.074   1.00 0.00 ? 32 ASP A C    11 
ATOM 9394  O O    . ASP A 1 32 ? 10.672  -7.032  0.837   1.00 0.00 ? 32 ASP A O    11 
ATOM 9395  C CB   . ASP A 1 32 ? 13.514  -5.905  0.404   1.00 0.00 ? 32 ASP A CB   11 
ATOM 9396  C CG   . ASP A 1 32 ? 14.623  -5.949  1.453   1.00 0.00 ? 32 ASP A CG   11 
ATOM 9397  O OD1  . ASP A 1 32 ? 14.301  -6.105  2.620   1.00 0.00 ? 32 ASP A OD1  11 
ATOM 9398  O OD2  . ASP A 1 32 ? 15.776  -5.825  1.073   1.00 0.00 ? 32 ASP A OD2  11 
ATOM 9399  H H    . ASP A 1 32 ? 11.620  -7.626  -1.450  1.00 0.00 ? 32 ASP A H    11 
ATOM 9400  H HA   . ASP A 1 32 ? 13.722  -8.041  0.391   1.00 0.00 ? 32 ASP A HA   11 
ATOM 9401  H HB2  . ASP A 1 32 ? 13.913  -5.514  -0.520  1.00 0.00 ? 32 ASP A HB2  11 
ATOM 9402  H HB3  . ASP A 1 32 ? 12.723  -5.258  0.751   1.00 0.00 ? 32 ASP A HB3  11 
ATOM 9403  N N    . ILE A 1 33 ? 11.961  -8.364  2.112   1.00 0.00 ? 33 ILE A N    11 
ATOM 9404  C CA   . ILE A 1 33 ? 10.886  -8.674  3.048   1.00 0.00 ? 33 ILE A CA   11 
ATOM 9405  C C    . ILE A 1 33 ? 10.026  -7.439  3.311   1.00 0.00 ? 33 ILE A C    11 
ATOM 9406  O O    . ILE A 1 33 ? 8.802   -7.534  3.409   1.00 0.00 ? 33 ILE A O    11 
ATOM 9407  C CB   . ILE A 1 33 ? 11.476  -9.177  4.371   1.00 0.00 ? 33 ILE A CB   11 
ATOM 9408  C CG1  . ILE A 1 33 ? 12.722  -8.350  4.726   1.00 0.00 ? 33 ILE A CG1  11 
ATOM 9409  C CG2  . ILE A 1 33 ? 11.863  -10.651 4.230   1.00 0.00 ? 33 ILE A CG2  11 
ATOM 9410  C CD1  . ILE A 1 33 ? 12.865  -8.258  6.247   1.00 0.00 ? 33 ILE A CD1  11 
ATOM 9411  H H    . ILE A 1 33 ? 12.847  -8.758  2.249   1.00 0.00 ? 33 ILE A H    11 
ATOM 9412  H HA   . ILE A 1 33 ? 10.265  -9.448  2.625   1.00 0.00 ? 33 ILE A HA   11 
ATOM 9413  H HB   . ILE A 1 33 ? 10.736  -9.075  5.154   1.00 0.00 ? 33 ILE A HB   11 
ATOM 9414  H HG12 . ILE A 1 33 ? 13.601  -8.823  4.311   1.00 0.00 ? 33 ILE A HG12 11 
ATOM 9415  H HG13 . ILE A 1 33 ? 12.626  -7.355  4.318   1.00 0.00 ? 33 ILE A HG13 11 
ATOM 9416  H HG21 . ILE A 1 33 ? 12.317  -10.993 5.148   1.00 0.00 ? 33 ILE A HG21 11 
ATOM 9417  H HG22 . ILE A 1 33 ? 12.565  -10.765 3.418   1.00 0.00 ? 33 ILE A HG22 11 
ATOM 9418  H HG23 . ILE A 1 33 ? 10.978  -11.237 4.026   1.00 0.00 ? 33 ILE A HG23 11 
ATOM 9419  H HD11 . ILE A 1 33 ? 12.176  -7.518  6.630   1.00 0.00 ? 33 ILE A HD11 11 
ATOM 9420  H HD12 . ILE A 1 33 ? 13.876  -7.972  6.497   1.00 0.00 ? 33 ILE A HD12 11 
ATOM 9421  H HD13 . ILE A 1 33 ? 12.644  -9.218  6.690   1.00 0.00 ? 33 ILE A HD13 11 
ATOM 9422  N N    . GLU A 1 34 ? 10.673  -6.284  3.427   1.00 0.00 ? 34 GLU A N    11 
ATOM 9423  C CA   . GLU A 1 34 ? 9.956   -5.041  3.687   1.00 0.00 ? 34 GLU A CA   11 
ATOM 9424  C C    . GLU A 1 34 ? 9.241   -4.546  2.432   1.00 0.00 ? 34 GLU A C    11 
ATOM 9425  O O    . GLU A 1 34 ? 8.046   -4.254  2.464   1.00 0.00 ? 34 GLU A O    11 
ATOM 9426  C CB   . GLU A 1 34 ? 10.934  -3.968  4.179   1.00 0.00 ? 34 GLU A CB   11 
ATOM 9427  C CG   . GLU A 1 34 ? 12.059  -4.625  4.987   1.00 0.00 ? 34 GLU A CG   11 
ATOM 9428  C CD   . GLU A 1 34 ? 12.661  -3.619  5.963   1.00 0.00 ? 34 GLU A CD   11 
ATOM 9429  O OE1  . GLU A 1 34 ? 11.936  -3.156  6.828   1.00 0.00 ? 34 GLU A OE1  11 
ATOM 9430  O OE2  . GLU A 1 34 ? 13.839  -3.326  5.831   1.00 0.00 ? 34 GLU A OE2  11 
ATOM 9431  H H    . GLU A 1 34 ? 11.649  -6.268  3.343   1.00 0.00 ? 34 GLU A H    11 
ATOM 9432  H HA   . GLU A 1 34 ? 9.221   -5.218  4.458   1.00 0.00 ? 34 GLU A HA   11 
ATOM 9433  H HB2  . GLU A 1 34 ? 11.357  -3.450  3.331   1.00 0.00 ? 34 GLU A HB2  11 
ATOM 9434  H HB3  . GLU A 1 34 ? 10.409  -3.262  4.806   1.00 0.00 ? 34 GLU A HB3  11 
ATOM 9435  H HG2  . GLU A 1 34 ? 11.662  -5.465  5.538   1.00 0.00 ? 34 GLU A HG2  11 
ATOM 9436  H HG3  . GLU A 1 34 ? 12.828  -4.970  4.313   1.00 0.00 ? 34 GLU A HG3  11 
ATOM 9437  N N    . LEU A 1 35 ? 9.978   -4.446  1.329   1.00 0.00 ? 35 LEU A N    11 
ATOM 9438  C CA   . LEU A 1 35 ? 9.390   -3.977  0.077   1.00 0.00 ? 35 LEU A CA   11 
ATOM 9439  C C    . LEU A 1 35 ? 8.157   -4.808  -0.270  1.00 0.00 ? 35 LEU A C    11 
ATOM 9440  O O    . LEU A 1 35 ? 7.082   -4.266  -0.528  1.00 0.00 ? 35 LEU A O    11 
ATOM 9441  C CB   . LEU A 1 35 ? 10.418  -4.082  -1.063  1.00 0.00 ? 35 LEU A CB   11 
ATOM 9442  C CG   . LEU A 1 35 ? 10.231  -2.945  -2.087  1.00 0.00 ? 35 LEU A CG   11 
ATOM 9443  C CD1  . LEU A 1 35 ? 8.742   -2.725  -2.387  1.00 0.00 ? 35 LEU A CD1  11 
ATOM 9444  C CD2  . LEU A 1 35 ? 10.831  -1.640  -1.548  1.00 0.00 ? 35 LEU A CD2  11 
ATOM 9445  H H    . LEU A 1 35 ? 10.928  -4.688  1.357   1.00 0.00 ? 35 LEU A H    11 
ATOM 9446  H HA   . LEU A 1 35 ? 9.101   -2.946  0.199   1.00 0.00 ? 35 LEU A HA   11 
ATOM 9447  H HB2  . LEU A 1 35 ? 11.412  -4.028  -0.649  1.00 0.00 ? 35 LEU A HB2  11 
ATOM 9448  H HB3  . LEU A 1 35 ? 10.299  -5.032  -1.565  1.00 0.00 ? 35 LEU A HB3  11 
ATOM 9449  H HG   . LEU A 1 35 ? 10.736  -3.213  -3.005  1.00 0.00 ? 35 LEU A HG   11 
ATOM 9450  H HD11 . LEU A 1 35 ? 8.289   -2.166  -1.581  1.00 0.00 ? 35 LEU A HD11 11 
ATOM 9451  H HD12 . LEU A 1 35 ? 8.249   -3.679  -2.488  1.00 0.00 ? 35 LEU A HD12 11 
ATOM 9452  H HD13 . LEU A 1 35 ? 8.641   -2.171  -3.307  1.00 0.00 ? 35 LEU A HD13 11 
ATOM 9453  H HD21 . LEU A 1 35 ? 11.175  -1.036  -2.375  1.00 0.00 ? 35 LEU A HD21 11 
ATOM 9454  H HD22 . LEU A 1 35 ? 11.665  -1.861  -0.898  1.00 0.00 ? 35 LEU A HD22 11 
ATOM 9455  H HD23 . LEU A 1 35 ? 10.079  -1.097  -0.997  1.00 0.00 ? 35 LEU A HD23 11 
ATOM 9456  N N    . LEU A 1 36 ? 8.324   -6.126  -0.279  1.00 0.00 ? 36 LEU A N    11 
ATOM 9457  C CA   . LEU A 1 36 ? 7.222   -7.027  -0.603  1.00 0.00 ? 36 LEU A CA   11 
ATOM 9458  C C    . LEU A 1 36 ? 6.125   -6.946  0.456   1.00 0.00 ? 36 LEU A C    11 
ATOM 9459  O O    . LEU A 1 36 ? 4.955   -6.749  0.130   1.00 0.00 ? 36 LEU A O    11 
ATOM 9460  C CB   . LEU A 1 36 ? 7.735   -8.465  -0.706  1.00 0.00 ? 36 LEU A CB   11 
ATOM 9461  C CG   . LEU A 1 36 ? 8.980   -8.503  -1.598  1.00 0.00 ? 36 LEU A CG   11 
ATOM 9462  C CD1  . LEU A 1 36 ? 9.445   -9.952  -1.761  1.00 0.00 ? 36 LEU A CD1  11 
ATOM 9463  C CD2  . LEU A 1 36 ? 8.647   -7.915  -2.975  1.00 0.00 ? 36 LEU A CD2  11 
ATOM 9464  H H    . LEU A 1 36 ? 9.205   -6.501  -0.069  1.00 0.00 ? 36 LEU A H    11 
ATOM 9465  H HA   . LEU A 1 36 ? 6.805   -6.738  -1.555  1.00 0.00 ? 36 LEU A HA   11 
ATOM 9466  H HB2  . LEU A 1 36 ? 7.986   -8.828  0.280   1.00 0.00 ? 36 LEU A HB2  11 
ATOM 9467  H HB3  . LEU A 1 36 ? 6.967   -9.091  -1.137  1.00 0.00 ? 36 LEU A HB3  11 
ATOM 9468  H HG   . LEU A 1 36 ? 9.767   -7.923  -1.139  1.00 0.00 ? 36 LEU A HG   11 
ATOM 9469  H HD11 . LEU A 1 36 ? 8.598   -10.576 -2.007  1.00 0.00 ? 36 LEU A HD11 11 
ATOM 9470  H HD12 . LEU A 1 36 ? 9.887   -10.294 -0.838  1.00 0.00 ? 36 LEU A HD12 11 
ATOM 9471  H HD13 . LEU A 1 36 ? 10.176  -10.008 -2.553  1.00 0.00 ? 36 LEU A HD13 11 
ATOM 9472  H HD21 . LEU A 1 36 ? 7.662   -8.239  -3.278  1.00 0.00 ? 36 LEU A HD21 11 
ATOM 9473  H HD22 . LEU A 1 36 ? 9.376   -8.255  -3.698  1.00 0.00 ? 36 LEU A HD22 11 
ATOM 9474  H HD23 . LEU A 1 36 ? 8.672   -6.837  -2.921  1.00 0.00 ? 36 LEU A HD23 11 
ATOM 9475  N N    . ALA A 1 37 ? 6.505   -7.101  1.721   1.00 0.00 ? 37 ALA A N    11 
ATOM 9476  C CA   . ALA A 1 37 ? 5.529   -7.040  2.804   1.00 0.00 ? 37 ALA A CA   11 
ATOM 9477  C C    . ALA A 1 37 ? 4.715   -5.756  2.708   1.00 0.00 ? 37 ALA A C    11 
ATOM 9478  O O    . ALA A 1 37 ? 3.485   -5.782  2.763   1.00 0.00 ? 37 ALA A O    11 
ATOM 9479  C CB   . ALA A 1 37 ? 6.237   -7.097  4.158   1.00 0.00 ? 37 ALA A CB   11 
ATOM 9480  H H    . ALA A 1 37 ? 7.451   -7.257  1.928   1.00 0.00 ? 37 ALA A H    11 
ATOM 9481  H HA   . ALA A 1 37 ? 4.862   -7.885  2.722   1.00 0.00 ? 37 ALA A HA   11 
ATOM 9482  H HB1  . ALA A 1 37 ? 6.711   -8.061  4.277   1.00 0.00 ? 37 ALA A HB1  11 
ATOM 9483  H HB2  . ALA A 1 37 ? 5.516   -6.951  4.948   1.00 0.00 ? 37 ALA A HB2  11 
ATOM 9484  H HB3  . ALA A 1 37 ? 6.986   -6.321  4.207   1.00 0.00 ? 37 ALA A HB3  11 
ATOM 9485  N N    . ALA A 1 38 ? 5.410   -4.633  2.560   1.00 0.00 ? 38 ALA A N    11 
ATOM 9486  C CA   . ALA A 1 38 ? 4.741   -3.343  2.451   1.00 0.00 ? 38 ALA A CA   11 
ATOM 9487  C C    . ALA A 1 38 ? 3.858   -3.308  1.207   1.00 0.00 ? 38 ALA A C    11 
ATOM 9488  O O    . ALA A 1 38 ? 2.704   -2.883  1.266   1.00 0.00 ? 38 ALA A O    11 
ATOM 9489  C CB   . ALA A 1 38 ? 5.779   -2.220  2.384   1.00 0.00 ? 38 ALA A CB   11 
ATOM 9490  H H    . ALA A 1 38 ? 6.388   -4.674  2.518   1.00 0.00 ? 38 ALA A H    11 
ATOM 9491  H HA   . ALA A 1 38 ? 4.124   -3.195  3.324   1.00 0.00 ? 38 ALA A HA   11 
ATOM 9492  H HB1  . ALA A 1 38 ? 6.120   -2.103  1.366   1.00 0.00 ? 38 ALA A HB1  11 
ATOM 9493  H HB2  . ALA A 1 38 ? 6.617   -2.467  3.018   1.00 0.00 ? 38 ALA A HB2  11 
ATOM 9494  H HB3  . ALA A 1 38 ? 5.332   -1.297  2.722   1.00 0.00 ? 38 ALA A HB3  11 
ATOM 9495  N N    . CYS A 1 39 ? 4.406   -3.762  0.085   1.00 0.00 ? 39 CYS A N    11 
ATOM 9496  C CA   . CYS A 1 39 ? 3.653   -3.782  -1.165  1.00 0.00 ? 39 CYS A CA   11 
ATOM 9497  C C    . CYS A 1 39 ? 2.355   -4.561  -0.984  1.00 0.00 ? 39 CYS A C    11 
ATOM 9498  O O    . CYS A 1 39 ? 1.273   -4.072  -1.310  1.00 0.00 ? 39 CYS A O    11 
ATOM 9499  C CB   . CYS A 1 39 ? 4.486   -4.431  -2.273  1.00 0.00 ? 39 CYS A CB   11 
ATOM 9500  S SG   . CYS A 1 39 ? 3.751   -4.050  -3.882  1.00 0.00 ? 39 CYS A SG   11 
ATOM 9501  H H    . CYS A 1 39 ? 5.328   -4.094  0.097   1.00 0.00 ? 39 CYS A H    11 
ATOM 9502  H HA   . CYS A 1 39 ? 3.420   -2.768  -1.451  1.00 0.00 ? 39 CYS A HA   11 
ATOM 9503  H HB2  . CYS A 1 39 ? 5.496   -4.048  -2.238  1.00 0.00 ? 39 CYS A HB2  11 
ATOM 9504  H HB3  . CYS A 1 39 ? 4.504   -5.501  -2.128  1.00 0.00 ? 39 CYS A HB3  11 
ATOM 9505  H HG   . CYS A 1 39 ? 4.341   -4.382  -4.563  1.00 0.00 ? 39 CYS A HG   11 
ATOM 9506  N N    . ARG A 1 40 ? 2.473   -5.776  -0.461  1.00 0.00 ? 40 ARG A N    11 
ATOM 9507  C CA   . ARG A 1 40 ? 1.306   -6.621  -0.236  1.00 0.00 ? 40 ARG A CA   11 
ATOM 9508  C C    . ARG A 1 40 ? 0.278   -5.892  0.621   1.00 0.00 ? 40 ARG A C    11 
ATOM 9509  O O    . ARG A 1 40 ? -0.908  -5.861  0.293   1.00 0.00 ? 40 ARG A O    11 
ATOM 9510  C CB   . ARG A 1 40 ? 1.728   -7.917  0.461   1.00 0.00 ? 40 ARG A CB   11 
ATOM 9511  C CG   . ARG A 1 40 ? 0.578   -8.923  0.413   1.00 0.00 ? 40 ARG A CG   11 
ATOM 9512  C CD   . ARG A 1 40 ? 1.049   -10.262 0.985   1.00 0.00 ? 40 ARG A CD   11 
ATOM 9513  N NE   . ARG A 1 40 ? -0.006  -11.262 0.864   1.00 0.00 ? 40 ARG A NE   11 
ATOM 9514  C CZ   . ARG A 1 40 ? -0.973  -11.356 1.773   1.00 0.00 ? 40 ARG A CZ   11 
ATOM 9515  N NH1  . ARG A 1 40 ? -0.989  -10.544 2.795   1.00 0.00 ? 40 ARG A NH1  11 
ATOM 9516  N NH2  . ARG A 1 40 ? -1.905  -12.259 1.642   1.00 0.00 ? 40 ARG A NH2  11 
ATOM 9517  H H    . ARG A 1 40 ? 3.363   -6.111  -0.220  1.00 0.00 ? 40 ARG A H    11 
ATOM 9518  H HA   . ARG A 1 40 ? 0.861   -6.865  -1.188  1.00 0.00 ? 40 ARG A HA   11 
ATOM 9519  H HB2  . ARG A 1 40 ? 2.591   -8.331  -0.043  1.00 0.00 ? 40 ARG A HB2  11 
ATOM 9520  H HB3  . ARG A 1 40 ? 1.979   -7.708  1.489   1.00 0.00 ? 40 ARG A HB3  11 
ATOM 9521  H HG2  . ARG A 1 40 ? -0.250  -8.552  0.999   1.00 0.00 ? 40 ARG A HG2  11 
ATOM 9522  H HG3  . ARG A 1 40 ? 0.261   -9.063  -0.609  1.00 0.00 ? 40 ARG A HG3  11 
ATOM 9523  H HD2  . ARG A 1 40 ? 1.919   -10.596 0.442   1.00 0.00 ? 40 ARG A HD2  11 
ATOM 9524  H HD3  . ARG A 1 40 ? 1.306   -10.134 2.027   1.00 0.00 ? 40 ARG A HD3  11 
ATOM 9525  H HE   . ARG A 1 40 ? -0.003  -11.876 0.101   1.00 0.00 ? 40 ARG A HE   11 
ATOM 9526  H HH11 . ARG A 1 40 ? -0.274  -9.852  2.894   1.00 0.00 ? 40 ARG A HH11 11 
ATOM 9527  H HH12 . ARG A 1 40 ? -1.715  -10.615 3.477   1.00 0.00 ? 40 ARG A HH12 11 
ATOM 9528  H HH21 . ARG A 1 40 ? -1.893  -12.881 0.859   1.00 0.00 ? 40 ARG A HH21 11 
ATOM 9529  H HH22 . ARG A 1 40 ? -2.632  -12.330 2.325   1.00 0.00 ? 40 ARG A HH22 11 
ATOM 9530  N N    . GLU A 1 41 ? 0.741   -5.307  1.722   1.00 0.00 ? 41 GLU A N    11 
ATOM 9531  C CA   . GLU A 1 41 ? -0.148  -4.579  2.619   1.00 0.00 ? 41 GLU A CA   11 
ATOM 9532  C C    . GLU A 1 41 ? -0.922  -3.509  1.855   1.00 0.00 ? 41 GLU A C    11 
ATOM 9533  O O    . GLU A 1 41 ? -2.138  -3.383  2.000   1.00 0.00 ? 41 GLU A O    11 
ATOM 9534  C CB   . GLU A 1 41 ? 0.661   -3.924  3.739   1.00 0.00 ? 41 GLU A CB   11 
ATOM 9535  C CG   . GLU A 1 41 ? 1.164   -4.999  4.704   1.00 0.00 ? 41 GLU A CG   11 
ATOM 9536  C CD   . GLU A 1 41 ? 0.017   -5.491  5.580   1.00 0.00 ? 41 GLU A CD   11 
ATOM 9537  O OE1  . GLU A 1 41 ? -0.492  -4.698  6.355   1.00 0.00 ? 41 GLU A OE1  11 
ATOM 9538  O OE2  . GLU A 1 41 ? -0.336  -6.653  5.464   1.00 0.00 ? 41 GLU A OE2  11 
ATOM 9539  H H    . GLU A 1 41 ? 1.696   -5.365  1.933   1.00 0.00 ? 41 GLU A H    11 
ATOM 9540  H HA   . GLU A 1 41 ? -0.851  -5.273  3.057   1.00 0.00 ? 41 GLU A HA   11 
ATOM 9541  H HB2  . GLU A 1 41 ? 1.504   -3.399  3.314   1.00 0.00 ? 41 GLU A HB2  11 
ATOM 9542  H HB3  . GLU A 1 41 ? 0.037   -3.226  4.275   1.00 0.00 ? 41 GLU A HB3  11 
ATOM 9543  H HG2  . GLU A 1 41 ? 1.564   -5.829  4.139   1.00 0.00 ? 41 GLU A HG2  11 
ATOM 9544  H HG3  . GLU A 1 41 ? 1.940   -4.585  5.330   1.00 0.00 ? 41 GLU A HG3  11 
ATOM 9545  N N    . GLU A 1 42 ? -0.207  -2.738  1.041   1.00 0.00 ? 42 GLU A N    11 
ATOM 9546  C CA   . GLU A 1 42 ? -0.836  -1.680  0.258   1.00 0.00 ? 42 GLU A CA   11 
ATOM 9547  C C    . GLU A 1 42 ? -1.914  -2.257  -0.654  1.00 0.00 ? 42 GLU A C    11 
ATOM 9548  O O    . GLU A 1 42 ? -3.015  -1.713  -0.749  1.00 0.00 ? 42 GLU A O    11 
ATOM 9549  C CB   . GLU A 1 42 ? 0.218   -0.960  -0.586  1.00 0.00 ? 42 GLU A CB   11 
ATOM 9550  C CG   . GLU A 1 42 ? 1.169   -0.191  0.335   1.00 0.00 ? 42 GLU A CG   11 
ATOM 9551  C CD   . GLU A 1 42 ? 0.442   0.991   0.966   1.00 0.00 ? 42 GLU A CD   11 
ATOM 9552  O OE1  . GLU A 1 42 ? -0.568  1.401   0.419   1.00 0.00 ? 42 GLU A OE1  11 
ATOM 9553  O OE2  . GLU A 1 42 ? 0.906   1.470   1.987   1.00 0.00 ? 42 GLU A OE2  11 
ATOM 9554  H H    . GLU A 1 42 ? 0.760   -2.884  0.965   1.00 0.00 ? 42 GLU A H    11 
ATOM 9555  H HA   . GLU A 1 42 ? -1.290  -0.969  0.931   1.00 0.00 ? 42 GLU A HA   11 
ATOM 9556  H HB2  . GLU A 1 42 ? 0.777   -1.684  -1.159  1.00 0.00 ? 42 GLU A HB2  11 
ATOM 9557  H HB3  . GLU A 1 42 ? -0.270  -0.267  -1.255  1.00 0.00 ? 42 GLU A HB3  11 
ATOM 9558  H HG2  . GLU A 1 42 ? 1.524   -0.851  1.112   1.00 0.00 ? 42 GLU A HG2  11 
ATOM 9559  H HG3  . GLU A 1 42 ? 2.009   0.171   -0.240  1.00 0.00 ? 42 GLU A HG3  11 
ATOM 9560  N N    . PHE A 1 43 ? -1.593  -3.361  -1.321  1.00 0.00 ? 43 PHE A N    11 
ATOM 9561  C CA   . PHE A 1 43 ? -2.547  -4.000  -2.221  1.00 0.00 ? 43 PHE A CA   11 
ATOM 9562  C C    . PHE A 1 43 ? -3.812  -4.393  -1.462  1.00 0.00 ? 43 PHE A C    11 
ATOM 9563  O O    . PHE A 1 43 ? -4.920  -4.032  -1.855  1.00 0.00 ? 43 PHE A O    11 
ATOM 9564  C CB   . PHE A 1 43 ? -1.909  -5.246  -2.858  1.00 0.00 ? 43 PHE A CB   11 
ATOM 9565  C CG   . PHE A 1 43 ? -1.608  -4.982  -4.318  1.00 0.00 ? 43 PHE A CG   11 
ATOM 9566  C CD1  . PHE A 1 43 ? -0.731  -3.949  -4.673  1.00 0.00 ? 43 PHE A CD1  11 
ATOM 9567  C CD2  . PHE A 1 43 ? -2.202  -5.769  -5.311  1.00 0.00 ? 43 PHE A CD2  11 
ATOM 9568  C CE1  . PHE A 1 43 ? -0.451  -3.704  -6.023  1.00 0.00 ? 43 PHE A CE1  11 
ATOM 9569  C CE2  . PHE A 1 43 ? -1.921  -5.524  -6.660  1.00 0.00 ? 43 PHE A CE2  11 
ATOM 9570  C CZ   . PHE A 1 43 ? -1.047  -4.492  -7.016  1.00 0.00 ? 43 PHE A CZ   11 
ATOM 9571  H H    . PHE A 1 43 ? -0.701  -3.752  -1.207  1.00 0.00 ? 43 PHE A H    11 
ATOM 9572  H HA   . PHE A 1 43 ? -2.812  -3.301  -3.001  1.00 0.00 ? 43 PHE A HA   11 
ATOM 9573  H HB2  . PHE A 1 43 ? -0.992  -5.480  -2.339  1.00 0.00 ? 43 PHE A HB2  11 
ATOM 9574  H HB3  . PHE A 1 43 ? -2.588  -6.083  -2.778  1.00 0.00 ? 43 PHE A HB3  11 
ATOM 9575  H HD1  . PHE A 1 43 ? -0.273  -3.343  -3.908  1.00 0.00 ? 43 PHE A HD1  11 
ATOM 9576  H HD2  . PHE A 1 43 ? -2.877  -6.566  -5.036  1.00 0.00 ? 43 PHE A HD2  11 
ATOM 9577  H HE1  . PHE A 1 43 ? 0.224   -2.908  -6.297  1.00 0.00 ? 43 PHE A HE1  11 
ATOM 9578  H HE2  . PHE A 1 43 ? -2.381  -6.131  -7.427  1.00 0.00 ? 43 PHE A HE2  11 
ATOM 9579  H HZ   . PHE A 1 43 ? -0.830  -4.302  -8.057  1.00 0.00 ? 43 PHE A HZ   11 
ATOM 9580  N N    . HIS A 1 44 ? -3.636  -5.132  -0.372  1.00 0.00 ? 44 HIS A N    11 
ATOM 9581  C CA   . HIS A 1 44 ? -4.772  -5.565  0.434   1.00 0.00 ? 44 HIS A CA   11 
ATOM 9582  C C    . HIS A 1 44 ? -5.646  -4.373  0.805   1.00 0.00 ? 44 HIS A C    11 
ATOM 9583  O O    . HIS A 1 44 ? -6.871  -4.424  0.677   1.00 0.00 ? 44 HIS A O    11 
ATOM 9584  C CB   . HIS A 1 44 ? -4.275  -6.254  1.708   1.00 0.00 ? 44 HIS A CB   11 
ATOM 9585  C CG   . HIS A 1 44 ? -3.735  -7.616  1.365   1.00 0.00 ? 44 HIS A CG   11 
ATOM 9586  N ND1  . HIS A 1 44 ? -3.069  -7.869  0.176   1.00 0.00 ? 44 HIS A ND1  11 
ATOM 9587  C CD2  . HIS A 1 44 ? -3.756  -8.809  2.044   1.00 0.00 ? 44 HIS A CD2  11 
ATOM 9588  C CE1  . HIS A 1 44 ? -2.720  -9.169  0.176   1.00 0.00 ? 44 HIS A CE1  11 
ATOM 9589  N NE2  . HIS A 1 44 ? -3.115  -9.787  1.292   1.00 0.00 ? 44 HIS A NE2  11 
ATOM 9590  H H    . HIS A 1 44 ? -2.728  -5.388  -0.104  1.00 0.00 ? 44 HIS A H    11 
ATOM 9591  H HA   . HIS A 1 44 ? -5.359  -6.267  -0.136  1.00 0.00 ? 44 HIS A HA   11 
ATOM 9592  H HB2  . HIS A 1 44 ? -3.493  -5.660  2.158   1.00 0.00 ? 44 HIS A HB2  11 
ATOM 9593  H HB3  . HIS A 1 44 ? -5.095  -6.357  2.403   1.00 0.00 ? 44 HIS A HB3  11 
ATOM 9594  H HD2  . HIS A 1 44 ? -4.202  -8.963  3.014   1.00 0.00 ? 44 HIS A HD2  11 
ATOM 9595  H HE1  . HIS A 1 44 ? -2.185  -9.652  -0.628  1.00 0.00 ? 44 HIS A HE1  11 
ATOM 9596  H HE2  . HIS A 1 44 ? -2.981  -10.728 1.530   1.00 0.00 ? 44 HIS A HE2  11 
ATOM 9597  N N    . ARG A 1 45 ? -5.010  -3.299  1.262   1.00 0.00 ? 45 ARG A N    11 
ATOM 9598  C CA   . ARG A 1 45 ? -5.740  -2.098  1.647   1.00 0.00 ? 45 ARG A CA   11 
ATOM 9599  C C    . ARG A 1 45 ? -6.398  -1.457  0.430   1.00 0.00 ? 45 ARG A C    11 
ATOM 9600  O O    . ARG A 1 45 ? -7.508  -0.929  0.518   1.00 0.00 ? 45 ARG A O    11 
ATOM 9601  C CB   . ARG A 1 45 ? -4.787  -1.096  2.301   1.00 0.00 ? 45 ARG A CB   11 
ATOM 9602  C CG   . ARG A 1 45 ? -5.546  0.192   2.629   1.00 0.00 ? 45 ARG A CG   11 
ATOM 9603  C CD   . ARG A 1 45 ? -4.709  1.047   3.583   1.00 0.00 ? 45 ARG A CD   11 
ATOM 9604  N NE   . ARG A 1 45 ? -5.263  2.394   3.670   1.00 0.00 ? 45 ARG A NE   11 
ATOM 9605  C CZ   . ARG A 1 45 ? -6.408  2.628   4.303   1.00 0.00 ? 45 ARG A CZ   11 
ATOM 9606  N NH1  . ARG A 1 45 ? -7.058  1.643   4.858   1.00 0.00 ? 45 ARG A NH1  11 
ATOM 9607  N NH2  . ARG A 1 45 ? -6.881  3.842   4.368   1.00 0.00 ? 45 ARG A NH2  11 
ATOM 9608  H H    . ARG A 1 45 ? -4.033  -3.315  1.342   1.00 0.00 ? 45 ARG A H    11 
ATOM 9609  H HA   . ARG A 1 45 ? -6.506  -2.366  2.360   1.00 0.00 ? 45 ARG A HA   11 
ATOM 9610  H HB2  . ARG A 1 45 ? -4.386  -1.520  3.209   1.00 0.00 ? 45 ARG A HB2  11 
ATOM 9611  H HB3  . ARG A 1 45 ? -3.979  -0.871  1.621   1.00 0.00 ? 45 ARG A HB3  11 
ATOM 9612  H HG2  . ARG A 1 45 ? -5.731  0.742   1.719   1.00 0.00 ? 45 ARG A HG2  11 
ATOM 9613  H HG3  . ARG A 1 45 ? -6.485  -0.053  3.100   1.00 0.00 ? 45 ARG A HG3  11 
ATOM 9614  H HD2  . ARG A 1 45 ? -4.714  0.597   4.565   1.00 0.00 ? 45 ARG A HD2  11 
ATOM 9615  H HD3  . ARG A 1 45 ? -3.694  1.098   3.220   1.00 0.00 ? 45 ARG A HD3  11 
ATOM 9616  H HE   . ARG A 1 45 ? -4.780  3.140   3.256   1.00 0.00 ? 45 ARG A HE   11 
ATOM 9617  H HH11 . ARG A 1 45 ? -6.696  0.713   4.808   1.00 0.00 ? 45 ARG A HH11 11 
ATOM 9618  H HH12 . ARG A 1 45 ? -7.920  1.819   5.334   1.00 0.00 ? 45 ARG A HH12 11 
ATOM 9619  H HH21 . ARG A 1 45 ? -6.383  4.596   3.941   1.00 0.00 ? 45 ARG A HH21 11 
ATOM 9620  H HH22 . ARG A 1 45 ? -7.744  4.018   4.843   1.00 0.00 ? 45 ARG A HH22 11 
ATOM 9621  N N    . ARG A 1 46 ? -5.709  -1.504  -0.705  1.00 0.00 ? 46 ARG A N    11 
ATOM 9622  C CA   . ARG A 1 46 ? -6.233  -0.922  -1.935  1.00 0.00 ? 46 ARG A CA   11 
ATOM 9623  C C    . ARG A 1 46 ? -7.464  -1.688  -2.413  1.00 0.00 ? 46 ARG A C    11 
ATOM 9624  O O    . ARG A 1 46 ? -8.488  -1.090  -2.745  1.00 0.00 ? 46 ARG A O    11 
ATOM 9625  C CB   . ARG A 1 46 ? -5.159  -0.948  -3.025  1.00 0.00 ? 46 ARG A CB   11 
ATOM 9626  C CG   . ARG A 1 46 ? -5.750  -0.426  -4.338  1.00 0.00 ? 46 ARG A CG   11 
ATOM 9627  C CD   . ARG A 1 46 ? -4.619  -0.083  -5.312  1.00 0.00 ? 46 ARG A CD   11 
ATOM 9628  N NE   . ARG A 1 46 ? -5.114  -0.100  -6.684  1.00 0.00 ? 46 ARG A NE   11 
ATOM 9629  C CZ   . ARG A 1 46 ? -5.990  0.806   -7.111  1.00 0.00 ? 46 ARG A CZ   11 
ATOM 9630  N NH1  . ARG A 1 46 ? -6.418  1.732   -6.299  1.00 0.00 ? 46 ARG A NH1  11 
ATOM 9631  N NH2  . ARG A 1 46 ? -6.420  0.766   -8.343  1.00 0.00 ? 46 ARG A NH2  11 
ATOM 9632  H H    . ARG A 1 46 ? -4.829  -1.937  -0.715  1.00 0.00 ? 46 ARG A H    11 
ATOM 9633  H HA   . ARG A 1 46 ? -6.512  0.103   -1.746  1.00 0.00 ? 46 ARG A HA   11 
ATOM 9634  H HB2  . ARG A 1 46 ? -4.331  -0.321  -2.728  1.00 0.00 ? 46 ARG A HB2  11 
ATOM 9635  H HB3  . ARG A 1 46 ? -4.812  -1.960  -3.165  1.00 0.00 ? 46 ARG A HB3  11 
ATOM 9636  H HG2  . ARG A 1 46 ? -6.383  -1.186  -4.774  1.00 0.00 ? 46 ARG A HG2  11 
ATOM 9637  H HG3  . ARG A 1 46 ? -6.335  0.460   -4.142  1.00 0.00 ? 46 ARG A HG3  11 
ATOM 9638  H HD2  . ARG A 1 46 ? -4.237  0.900   -5.084  1.00 0.00 ? 46 ARG A HD2  11 
ATOM 9639  H HD3  . ARG A 1 46 ? -3.823  -0.808  -5.209  1.00 0.00 ? 46 ARG A HD3  11 
ATOM 9640  H HE   . ARG A 1 46 ? -4.797  -0.791  -7.301  1.00 0.00 ? 46 ARG A HE   11 
ATOM 9641  H HH11 . ARG A 1 46 ? -6.088  1.764   -5.356  1.00 0.00 ? 46 ARG A HH11 11 
ATOM 9642  H HH12 . ARG A 1 46 ? -7.077  2.413   -6.621  1.00 0.00 ? 46 ARG A HH12 11 
ATOM 9643  H HH21 . ARG A 1 46 ? -6.090  0.056   -8.965  1.00 0.00 ? 46 ARG A HH21 11 
ATOM 9644  H HH22 . ARG A 1 46 ? -7.078  1.447   -8.664  1.00 0.00 ? 46 ARG A HH22 11 
ATOM 9645  N N    . LEU A 1 47 ? -7.359  -3.011  -2.448  1.00 0.00 ? 47 LEU A N    11 
ATOM 9646  C CA   . LEU A 1 47 ? -8.473  -3.844  -2.890  1.00 0.00 ? 47 LEU A CA   11 
ATOM 9647  C C    . LEU A 1 47 ? -9.621  -3.772  -1.887  1.00 0.00 ? 47 LEU A C    11 
ATOM 9648  O O    . LEU A 1 47 ? -10.791 -3.869  -2.260  1.00 0.00 ? 47 LEU A O    11 
ATOM 9649  C CB   . LEU A 1 47 ? -8.011  -5.301  -3.044  1.00 0.00 ? 47 LEU A CB   11 
ATOM 9650  C CG   . LEU A 1 47 ? -7.459  -5.529  -4.455  1.00 0.00 ? 47 LEU A CG   11 
ATOM 9651  C CD1  . LEU A 1 47 ? -6.178  -4.715  -4.646  1.00 0.00 ? 47 LEU A CD1  11 
ATOM 9652  C CD2  . LEU A 1 47 ? -7.147  -7.017  -4.642  1.00 0.00 ? 47 LEU A CD2  11 
ATOM 9653  H H    . LEU A 1 47 ? -6.519  -3.436  -2.173  1.00 0.00 ? 47 LEU A H    11 
ATOM 9654  H HA   . LEU A 1 47 ? -8.821  -3.481  -3.844  1.00 0.00 ? 47 LEU A HA   11 
ATOM 9655  H HB2  . LEU A 1 47 ? -7.238  -5.509  -2.319  1.00 0.00 ? 47 LEU A HB2  11 
ATOM 9656  H HB3  . LEU A 1 47 ? -8.846  -5.964  -2.877  1.00 0.00 ? 47 LEU A HB3  11 
ATOM 9657  H HG   . LEU A 1 47 ? -8.193  -5.220  -5.185  1.00 0.00 ? 47 LEU A HG   11 
ATOM 9658  H HD11 . LEU A 1 47 ? -5.778  -4.900  -5.632  1.00 0.00 ? 47 LEU A HD11 11 
ATOM 9659  H HD12 . LEU A 1 47 ? -5.451  -5.007  -3.903  1.00 0.00 ? 47 LEU A HD12 11 
ATOM 9660  H HD13 . LEU A 1 47 ? -6.400  -3.664  -4.540  1.00 0.00 ? 47 LEU A HD13 11 
ATOM 9661  H HD21 . LEU A 1 47 ? -6.643  -7.393  -3.765  1.00 0.00 ? 47 LEU A HD21 11 
ATOM 9662  H HD22 . LEU A 1 47 ? -6.511  -7.146  -5.506  1.00 0.00 ? 47 LEU A HD22 11 
ATOM 9663  H HD23 . LEU A 1 47 ? -8.068  -7.561  -4.791  1.00 0.00 ? 47 LEU A HD23 11 
ATOM 9664  N N    . LYS A 1 48 ? -9.280  -3.604  -0.613  1.00 0.00 ? 48 LYS A N    11 
ATOM 9665  C CA   . LYS A 1 48 ? -10.293 -3.525  0.433   1.00 0.00 ? 48 LYS A CA   11 
ATOM 9666  C C    . LYS A 1 48 ? -11.132 -2.259  0.285   1.00 0.00 ? 48 LYS A C    11 
ATOM 9667  O O    . LYS A 1 48 ? -12.360 -2.321  0.239   1.00 0.00 ? 48 LYS A O    11 
ATOM 9668  C CB   . LYS A 1 48 ? -9.624  -3.538  1.809   1.00 0.00 ? 48 LYS A CB   11 
ATOM 9669  C CG   . LYS A 1 48 ? -10.689 -3.726  2.892   1.00 0.00 ? 48 LYS A CG   11 
ATOM 9670  C CD   . LYS A 1 48 ? -10.010 -3.918  4.250   1.00 0.00 ? 48 LYS A CD   11 
ATOM 9671  C CE   . LYS A 1 48 ? -11.040 -4.400  5.271   1.00 0.00 ? 48 LYS A CE   11 
ATOM 9672  N NZ   . LYS A 1 48 ? -12.330 -3.685  5.052   1.00 0.00 ? 48 LYS A NZ   11 
ATOM 9673  H H    . LYS A 1 48 ? -8.333  -3.536  -0.373  1.00 0.00 ? 48 LYS A H    11 
ATOM 9674  H HA   . LYS A 1 48 ? -10.942 -4.385  0.356   1.00 0.00 ? 48 LYS A HA   11 
ATOM 9675  H HB2  . LYS A 1 48 ? -8.913  -4.350  1.856   1.00 0.00 ? 48 LYS A HB2  11 
ATOM 9676  H HB3  . LYS A 1 48 ? -9.113  -2.601  1.970   1.00 0.00 ? 48 LYS A HB3  11 
ATOM 9677  H HG2  . LYS A 1 48 ? -11.325 -2.853  2.926   1.00 0.00 ? 48 LYS A HG2  11 
ATOM 9678  H HG3  . LYS A 1 48 ? -11.285 -4.598  2.665   1.00 0.00 ? 48 LYS A HG3  11 
ATOM 9679  H HD2  . LYS A 1 48 ? -9.221  -4.650  4.158   1.00 0.00 ? 48 LYS A HD2  11 
ATOM 9680  H HD3  . LYS A 1 48 ? -9.592  -2.977  4.579   1.00 0.00 ? 48 LYS A HD3  11 
ATOM 9681  H HE2  . LYS A 1 48 ? -11.193 -5.463  5.154   1.00 0.00 ? 48 LYS A HE2  11 
ATOM 9682  H HE3  . LYS A 1 48 ? -10.681 -4.196  6.270   1.00 0.00 ? 48 LYS A HE3  11 
ATOM 9683  H HZ1  . LYS A 1 48 ? -12.955 -3.840  5.869   1.00 0.00 ? 48 LYS A HZ1  11 
ATOM 9684  H HZ2  . LYS A 1 48 ? -12.788 -4.052  4.194   1.00 0.00 ? 48 LYS A HZ2  11 
ATOM 9685  H HZ3  . LYS A 1 48 ? -12.147 -2.667  4.942   1.00 0.00 ? 48 LYS A HZ3  11 
ATOM 9686  N N    . VAL A 1 49 ? -10.465 -1.112  0.214   1.00 0.00 ? 49 VAL A N    11 
ATOM 9687  C CA   . VAL A 1 49 ? -11.167 0.159   0.074   1.00 0.00 ? 49 VAL A CA   11 
ATOM 9688  C C    . VAL A 1 49 ? -11.766 0.291   -1.322  1.00 0.00 ? 49 VAL A C    11 
ATOM 9689  O O    . VAL A 1 49 ? -12.859 0.830   -1.490  1.00 0.00 ? 49 VAL A O    11 
ATOM 9690  C CB   . VAL A 1 49 ? -10.210 1.325   0.333   1.00 0.00 ? 49 VAL A CB   11 
ATOM 9691  C CG1  . VAL A 1 49 ? -9.530  1.142   1.693   1.00 0.00 ? 49 VAL A CG1  11 
ATOM 9692  C CG2  . VAL A 1 49 ? -9.146  1.367   -0.768  1.00 0.00 ? 49 VAL A CG2  11 
ATOM 9693  H H    . VAL A 1 49 ? -9.485  -1.120  0.257   1.00 0.00 ? 49 VAL A H    11 
ATOM 9694  H HA   . VAL A 1 49 ? -11.965 0.197   0.800   1.00 0.00 ? 49 VAL A HA   11 
ATOM 9695  H HB   . VAL A 1 49 ? -10.766 2.251   0.334   1.00 0.00 ? 49 VAL A HB   11 
ATOM 9696  H HG11 . VAL A 1 49 ? -9.180  0.124   1.787   1.00 0.00 ? 49 VAL A HG11 11 
ATOM 9697  H HG12 . VAL A 1 49 ? -10.238 1.353   2.479   1.00 0.00 ? 49 VAL A HG12 11 
ATOM 9698  H HG13 . VAL A 1 49 ? -8.693  1.819   1.770   1.00 0.00 ? 49 VAL A HG13 11 
ATOM 9699  H HG21 . VAL A 1 49 ? -8.775  0.369   -0.947  1.00 0.00 ? 49 VAL A HG21 11 
ATOM 9700  H HG22 . VAL A 1 49 ? -8.332  2.004   -0.458  1.00 0.00 ? 49 VAL A HG22 11 
ATOM 9701  H HG23 . VAL A 1 49 ? -9.584  1.757   -1.675  1.00 0.00 ? 49 VAL A HG23 11 
ATOM 9702  N N    . TYR A 1 50 ? -11.042 -0.203  -2.322  1.00 0.00 ? 50 TYR A N    11 
ATOM 9703  C CA   . TYR A 1 50 ? -11.517 -0.131  -3.700  1.00 0.00 ? 50 TYR A CA   11 
ATOM 9704  C C    . TYR A 1 50 ? -12.797 -0.943  -3.870  1.00 0.00 ? 50 TYR A C    11 
ATOM 9705  O O    . TYR A 1 50 ? -13.719 -0.526  -4.570  1.00 0.00 ? 50 TYR A O    11 
ATOM 9706  C CB   . TYR A 1 50 ? -10.442 -0.661  -4.652  1.00 0.00 ? 50 TYR A CB   11 
ATOM 9707  C CG   . TYR A 1 50 ? -10.957 -0.606  -6.071  1.00 0.00 ? 50 TYR A CG   11 
ATOM 9708  C CD1  . TYR A 1 50 ? -10.975 0.612   -6.762  1.00 0.00 ? 50 TYR A CD1  11 
ATOM 9709  C CD2  . TYR A 1 50 ? -11.414 -1.773  -6.696  1.00 0.00 ? 50 TYR A CD2  11 
ATOM 9710  C CE1  . TYR A 1 50 ? -11.452 0.662   -8.077  1.00 0.00 ? 50 TYR A CE1  11 
ATOM 9711  C CE2  . TYR A 1 50 ? -11.890 -1.722  -8.011  1.00 0.00 ? 50 TYR A CE2  11 
ATOM 9712  C CZ   . TYR A 1 50 ? -11.909 -0.504  -8.703  1.00 0.00 ? 50 TYR A CZ   11 
ATOM 9713  O OH   . TYR A 1 50 ? -12.378 -0.454  -9.999  1.00 0.00 ? 50 TYR A OH   11 
ATOM 9714  H H    . TYR A 1 50 ? -10.178 -0.621  -2.131  1.00 0.00 ? 50 TYR A H    11 
ATOM 9715  H HA   . TYR A 1 50 ? -11.721 0.900   -3.946  1.00 0.00 ? 50 TYR A HA   11 
ATOM 9716  H HB2  . TYR A 1 50 ? -9.554  -0.053  -4.567  1.00 0.00 ? 50 TYR A HB2  11 
ATOM 9717  H HB3  . TYR A 1 50 ? -10.206 -1.682  -4.394  1.00 0.00 ? 50 TYR A HB3  11 
ATOM 9718  H HD1  . TYR A 1 50 ? -10.622 1.511   -6.281  1.00 0.00 ? 50 TYR A HD1  11 
ATOM 9719  H HD2  . TYR A 1 50 ? -11.400 -2.712  -6.163  1.00 0.00 ? 50 TYR A HD2  11 
ATOM 9720  H HE1  . TYR A 1 50 ? -11.466 1.601   -8.612  1.00 0.00 ? 50 TYR A HE1  11 
ATOM 9721  H HE2  . TYR A 1 50 ? -12.243 -2.621  -8.493  1.00 0.00 ? 50 TYR A HE2  11 
ATOM 9722  H HH   . TYR A 1 50 ? -12.324 -1.339  -10.369 1.00 0.00 ? 50 TYR A HH   11 
ATOM 9723  N N    . HIS A 1 51 ? -12.846 -2.105  -3.224  1.00 0.00 ? 51 HIS A N    11 
ATOM 9724  C CA   . HIS A 1 51 ? -14.019 -2.967  -3.313  1.00 0.00 ? 51 HIS A CA   11 
ATOM 9725  C C    . HIS A 1 51 ? -15.115 -2.481  -2.368  1.00 0.00 ? 51 HIS A C    11 
ATOM 9726  O O    . HIS A 1 51 ? -16.304 -2.657  -2.640  1.00 0.00 ? 51 HIS A O    11 
ATOM 9727  C CB   . HIS A 1 51 ? -13.640 -4.405  -2.961  1.00 0.00 ? 51 HIS A CB   11 
ATOM 9728  C CG   . HIS A 1 51 ? -14.821 -5.307  -3.188  1.00 0.00 ? 51 HIS A CG   11 
ATOM 9729  N ND1  . HIS A 1 51 ? -14.992 -6.017  -4.366  1.00 0.00 ? 51 HIS A ND1  11 
ATOM 9730  C CD2  . HIS A 1 51 ? -15.900 -5.623  -2.400  1.00 0.00 ? 51 HIS A CD2  11 
ATOM 9731  C CE1  . HIS A 1 51 ? -16.134 -6.720  -4.255  1.00 0.00 ? 51 HIS A CE1  11 
ATOM 9732  N NE2  . HIS A 1 51 ? -16.727 -6.515  -3.076  1.00 0.00 ? 51 HIS A NE2  11 
ATOM 9733  H H    . HIS A 1 51 ? -12.080 -2.387  -2.681  1.00 0.00 ? 51 HIS A H    11 
ATOM 9734  H HA   . HIS A 1 51 ? -14.395 -2.944  -4.325  1.00 0.00 ? 51 HIS A HA   11 
ATOM 9735  H HB2  . HIS A 1 51 ? -12.817 -4.723  -3.586  1.00 0.00 ? 51 HIS A HB2  11 
ATOM 9736  H HB3  . HIS A 1 51 ? -13.343 -4.457  -1.923  1.00 0.00 ? 51 HIS A HB3  11 
ATOM 9737  H HD2  . HIS A 1 51 ? -16.079 -5.238  -1.408  1.00 0.00 ? 51 HIS A HD2  11 
ATOM 9738  H HE1  . HIS A 1 51 ? -16.524 -7.370  -5.024  1.00 0.00 ? 51 HIS A HE1  11 
ATOM 9739  H HE2  . HIS A 1 51 ? -17.565 -6.908  -2.755  1.00 0.00 ? 51 HIS A HE2  11 
ATOM 9740  N N    . ALA A 1 52 ? -14.710 -1.875  -1.257  1.00 0.00 ? 52 ALA A N    11 
ATOM 9741  C CA   . ALA A 1 52 ? -15.667 -1.372  -0.280  1.00 0.00 ? 52 ALA A CA   11 
ATOM 9742  C C    . ALA A 1 52 ? -16.451 -0.193  -0.850  1.00 0.00 ? 52 ALA A C    11 
ATOM 9743  O O    . ALA A 1 52 ? -17.659 -0.081  -0.644  1.00 0.00 ? 52 ALA A O    11 
ATOM 9744  C CB   . ALA A 1 52 ? -14.937 -0.935  0.990   1.00 0.00 ? 52 ALA A CB   11 
ATOM 9745  H H    . ALA A 1 52 ? -13.749 -1.765  -1.092  1.00 0.00 ? 52 ALA A H    11 
ATOM 9746  H HA   . ALA A 1 52 ? -16.359 -2.162  -0.028  1.00 0.00 ? 52 ALA A HA   11 
ATOM 9747  H HB1  . ALA A 1 52 ? -14.349 -1.756  1.370   1.00 0.00 ? 52 ALA A HB1  11 
ATOM 9748  H HB2  . ALA A 1 52 ? -15.659 -0.633  1.736   1.00 0.00 ? 52 ALA A HB2  11 
ATOM 9749  H HB3  . ALA A 1 52 ? -14.287 -0.101  0.763   1.00 0.00 ? 52 ALA A HB3  11 
ATOM 9750  N N    . TRP A 1 53 ? -15.753 0.682   -1.567  1.00 0.00 ? 53 TRP A N    11 
ATOM 9751  C CA   . TRP A 1 53 ? -16.393 1.851   -2.162  1.00 0.00 ? 53 TRP A CA   11 
ATOM 9752  C C    . TRP A 1 53 ? -17.677 1.447   -2.884  1.00 0.00 ? 53 TRP A C    11 
ATOM 9753  O O    . TRP A 1 53 ? -18.656 2.195   -2.893  1.00 0.00 ? 53 TRP A O    11 
ATOM 9754  C CB   . TRP A 1 53 ? -15.438 2.522   -3.152  1.00 0.00 ? 53 TRP A CB   11 
ATOM 9755  C CG   . TRP A 1 53 ? -14.390 3.290   -2.406  1.00 0.00 ? 53 TRP A CG   11 
ATOM 9756  C CD1  . TRP A 1 53 ? -14.067 3.110   -1.103  1.00 0.00 ? 53 TRP A CD1  11 
ATOM 9757  C CD2  . TRP A 1 53 ? -13.522 4.352   -2.898  1.00 0.00 ? 53 TRP A CD2  11 
ATOM 9758  N NE1  . TRP A 1 53 ? -13.059 3.995   -0.766  1.00 0.00 ? 53 TRP A NE1  11 
ATOM 9759  C CE2  . TRP A 1 53 ? -12.688 4.781   -1.838  1.00 0.00 ? 53 TRP A CE2  11 
ATOM 9760  C CE3  . TRP A 1 53 ? -13.379 4.980   -4.149  1.00 0.00 ? 53 TRP A CE3  11 
ATOM 9761  C CZ2  . TRP A 1 53 ? -11.746 5.796   -2.013  1.00 0.00 ? 53 TRP A CZ2  11 
ATOM 9762  C CZ3  . TRP A 1 53 ? -12.431 6.001   -4.328  1.00 0.00 ? 53 TRP A CZ3  11 
ATOM 9763  C CH2  . TRP A 1 53 ? -11.617 6.408   -3.262  1.00 0.00 ? 53 TRP A CH2  11 
ATOM 9764  H H    . TRP A 1 53 ? -14.793 0.541   -1.698  1.00 0.00 ? 53 TRP A H    11 
ATOM 9765  H HA   . TRP A 1 53 ? -16.639 2.553   -1.380  1.00 0.00 ? 53 TRP A HA   11 
ATOM 9766  H HB2  . TRP A 1 53 ? -14.964 1.768   -3.761  1.00 0.00 ? 53 TRP A HB2  11 
ATOM 9767  H HB3  . TRP A 1 53 ? -15.993 3.198   -3.785  1.00 0.00 ? 53 TRP A HB3  11 
ATOM 9768  H HD1  . TRP A 1 53 ? -14.523 2.394   -0.436  1.00 0.00 ? 53 TRP A HD1  11 
ATOM 9769  H HE1  . TRP A 1 53 ? -12.644 4.069   0.119   1.00 0.00 ? 53 TRP A HE1  11 
ATOM 9770  H HE3  . TRP A 1 53 ? -14.001 4.673   -4.976  1.00 0.00 ? 53 TRP A HE3  11 
ATOM 9771  H HZ2  . TRP A 1 53 ? -11.121 6.106   -1.189  1.00 0.00 ? 53 TRP A HZ2  11 
ATOM 9772  H HZ3  . TRP A 1 53 ? -12.330 6.475   -5.293  1.00 0.00 ? 53 TRP A HZ3  11 
ATOM 9773  H HH2  . TRP A 1 53 ? -10.891 7.194   -3.407  1.00 0.00 ? 53 TRP A HH2  11 
ATOM 9774  N N    . LYS A 1 54 ? -17.665 0.264   -3.488  1.00 0.00 ? 54 LYS A N    11 
ATOM 9775  C CA   . LYS A 1 54 ? -18.834 -0.225  -4.209  1.00 0.00 ? 54 LYS A CA   11 
ATOM 9776  C C    . LYS A 1 54 ? -19.931 -0.638  -3.232  1.00 0.00 ? 54 LYS A C    11 
ATOM 9777  O O    . LYS A 1 54 ? -21.115 -0.405  -3.479  1.00 0.00 ? 54 LYS A O    11 
ATOM 9778  C CB   . LYS A 1 54 ? -18.446 -1.421  -5.085  1.00 0.00 ? 54 LYS A CB   11 
ATOM 9779  C CG   . LYS A 1 54 ? -17.770 -0.925  -6.366  1.00 0.00 ? 54 LYS A CG   11 
ATOM 9780  C CD   . LYS A 1 54 ? -16.629 0.029   -6.009  1.00 0.00 ? 54 LYS A CD   11 
ATOM 9781  C CE   . LYS A 1 54 ? -15.737 0.239   -7.235  1.00 0.00 ? 54 LYS A CE   11 
ATOM 9782  N NZ   . LYS A 1 54 ? -16.547 0.811   -8.346  1.00 0.00 ? 54 LYS A NZ   11 
ATOM 9783  H H    . LYS A 1 54 ? -16.856 -0.288  -3.449  1.00 0.00 ? 54 LYS A H    11 
ATOM 9784  H HA   . LYS A 1 54 ? -19.211 0.565   -4.844  1.00 0.00 ? 54 LYS A HA   11 
ATOM 9785  H HB2  . LYS A 1 54 ? -17.763 -2.056  -4.541  1.00 0.00 ? 54 LYS A HB2  11 
ATOM 9786  H HB3  . LYS A 1 54 ? -19.332 -1.983  -5.342  1.00 0.00 ? 54 LYS A HB3  11 
ATOM 9787  H HG2  . LYS A 1 54 ? -17.377 -1.769  -6.915  1.00 0.00 ? 54 LYS A HG2  11 
ATOM 9788  H HG3  . LYS A 1 54 ? -18.494 -0.404  -6.975  1.00 0.00 ? 54 LYS A HG3  11 
ATOM 9789  H HD2  . LYS A 1 54 ? -17.038 0.978   -5.695  1.00 0.00 ? 54 LYS A HD2  11 
ATOM 9790  H HD3  . LYS A 1 54 ? -16.042 -0.394  -5.209  1.00 0.00 ? 54 LYS A HD3  11 
ATOM 9791  H HE2  . LYS A 1 54 ? -14.936 0.920   -6.985  1.00 0.00 ? 54 LYS A HE2  11 
ATOM 9792  H HE3  . LYS A 1 54 ? -15.321 -0.708  -7.543  1.00 0.00 ? 54 LYS A HE3  11 
ATOM 9793  H HZ1  . LYS A 1 54 ? -17.022 0.043   -8.861  1.00 0.00 ? 54 LYS A HZ1  11 
ATOM 9794  H HZ2  . LYS A 1 54 ? -15.925 1.330   -8.998  1.00 0.00 ? 54 LYS A HZ2  11 
ATOM 9795  H HZ3  . LYS A 1 54 ? -17.260 1.461   -7.956  1.00 0.00 ? 54 LYS A HZ3  11 
ATOM 9796  N N    . SER A 1 55 ? -19.530 -1.251  -2.124  1.00 0.00 ? 55 SER A N    11 
ATOM 9797  C CA   . SER A 1 55 ? -20.489 -1.692  -1.117  1.00 0.00 ? 55 SER A CA   11 
ATOM 9798  C C    . SER A 1 55 ? -21.484 -2.677  -1.720  1.00 0.00 ? 55 SER A C    11 
ATOM 9799  O O    . SER A 1 55 ? -22.198 -2.350  -2.668  1.00 0.00 ? 55 SER A O    11 
ATOM 9800  C CB   . SER A 1 55 ? -21.239 -0.488  -0.549  1.00 0.00 ? 55 SER A CB   11 
ATOM 9801  O OG   . SER A 1 55 ? -20.313 0.553   -0.267  1.00 0.00 ? 55 SER A OG   11 
ATOM 9802  H H    . SER A 1 55 ? -18.574 -1.410  -1.981  1.00 0.00 ? 55 SER A H    11 
ATOM 9803  H HA   . SER A 1 55 ? -19.956 -2.180  -0.315  1.00 0.00 ? 55 SER A HA   11 
ATOM 9804  H HB2  . SER A 1 55 ? -21.958 -0.136  -1.270  1.00 0.00 ? 55 SER A HB2  11 
ATOM 9805  H HB3  . SER A 1 55 ? -21.753 -0.781  0.357   1.00 0.00 ? 55 SER A HB3  11 
ATOM 9806  H HG   . SER A 1 55 ? -20.656 1.368   -0.644  1.00 0.00 ? 55 SER A HG   11 
ATOM 9807  N N    . LYS A 1 56 ? -21.529 -3.882  -1.163  1.00 0.00 ? 56 LYS A N    11 
ATOM 9808  C CA   . LYS A 1 56 ? -22.444 -4.907  -1.656  1.00 0.00 ? 56 LYS A CA   11 
ATOM 9809  C C    . LYS A 1 56 ? -23.865 -4.629  -1.178  1.00 0.00 ? 56 LYS A C    11 
ATOM 9810  O O    . LYS A 1 56 ? -24.746 -4.308  -1.975  1.00 0.00 ? 56 LYS A O    11 
ATOM 9811  C CB   . LYS A 1 56 ? -21.997 -6.285  -1.164  1.00 0.00 ? 56 LYS A CB   11 
ATOM 9812  C CG   . LYS A 1 56 ? -20.592 -6.588  -1.698  1.00 0.00 ? 56 LYS A CG   11 
ATOM 9813  C CD   . LYS A 1 56 ? -20.186 -8.016  -1.311  1.00 0.00 ? 56 LYS A CD   11 
ATOM 9814  C CE   . LYS A 1 56 ? -20.664 -9.000  -2.383  1.00 0.00 ? 56 LYS A CE   11 
ATOM 9815  N NZ   . LYS A 1 56 ? -20.668 -10.381 -1.822  1.00 0.00 ? 56 LYS A NZ   11 
ATOM 9816  H H    . LYS A 1 56 ? -20.937 -4.086  -0.409  1.00 0.00 ? 56 LYS A H    11 
ATOM 9817  H HA   . LYS A 1 56 ? -22.428 -4.900  -2.734  1.00 0.00 ? 56 LYS A HA   11 
ATOM 9818  H HB2  . LYS A 1 56 ? -21.982 -6.294  -0.084  1.00 0.00 ? 56 LYS A HB2  11 
ATOM 9819  H HB3  . LYS A 1 56 ? -22.686 -7.035  -1.521  1.00 0.00 ? 56 LYS A HB3  11 
ATOM 9820  H HG2  . LYS A 1 56 ? -20.589 -6.487  -2.774  1.00 0.00 ? 56 LYS A HG2  11 
ATOM 9821  H HG3  . LYS A 1 56 ? -19.889 -5.888  -1.270  1.00 0.00 ? 56 LYS A HG3  11 
ATOM 9822  H HD2  . LYS A 1 56 ? -19.110 -8.072  -1.229  1.00 0.00 ? 56 LYS A HD2  11 
ATOM 9823  H HD3  . LYS A 1 56 ? -20.631 -8.276  -0.362  1.00 0.00 ? 56 LYS A HD3  11 
ATOM 9824  H HE2  . LYS A 1 56 ? -21.664 -8.736  -2.696  1.00 0.00 ? 56 LYS A HE2  11 
ATOM 9825  H HE3  . LYS A 1 56 ? -19.999 -8.958  -3.233  1.00 0.00 ? 56 LYS A HE3  11 
ATOM 9826  H HZ1  . LYS A 1 56 ? -21.509 -10.891 -2.161  1.00 0.00 ? 56 LYS A HZ1  11 
ATOM 9827  H HZ2  . LYS A 1 56 ? -20.688 -10.334 -0.785  1.00 0.00 ? 56 LYS A HZ2  11 
ATOM 9828  H HZ3  . LYS A 1 56 ? -19.809 -10.882 -2.131  1.00 0.00 ? 56 LYS A HZ3  11 
ATOM 9829  N N    . ASN A 1 57 ? -24.082 -4.757  0.127   1.00 0.00 ? 57 ASN A N    11 
ATOM 9830  C CA   . ASN A 1 57 ? -25.402 -4.518  0.699   1.00 0.00 ? 57 ASN A CA   11 
ATOM 9831  C C    . ASN A 1 57 ? -25.311 -4.374  2.214   1.00 0.00 ? 57 ASN A C    11 
ATOM 9832  O O    . ASN A 1 57 ? -24.229 -4.462  2.792   1.00 0.00 ? 57 ASN A O    11 
ATOM 9833  C CB   . ASN A 1 57 ? -26.342 -5.674  0.349   1.00 0.00 ? 57 ASN A CB   11 
ATOM 9834  C CG   . ASN A 1 57 ? -25.896 -6.944  1.068   1.00 0.00 ? 57 ASN A CG   11 
ATOM 9835  O OD1  . ASN A 1 57 ? -26.717 -7.815  1.355   1.00 0.00 ? 57 ASN A OD1  11 
ATOM 9836  N ND2  . ASN A 1 57 ? -24.638 -7.100  1.380   1.00 0.00 ? 57 ASN A ND2  11 
ATOM 9837  H H    . ASN A 1 57 ? -23.343 -5.017  0.715   1.00 0.00 ? 57 ASN A H    11 
ATOM 9838  H HA   . ASN A 1 57 ? -25.803 -3.607  0.283   1.00 0.00 ? 57 ASN A HA   11 
ATOM 9839  H HB2  . ASN A 1 57 ? -27.347 -5.423  0.653   1.00 0.00 ? 57 ASN A HB2  11 
ATOM 9840  H HB3  . ASN A 1 57 ? -26.320 -5.843  -0.717  1.00 0.00 ? 57 ASN A HB3  11 
ATOM 9841  H HD21 . ASN A 1 57 ? -23.988 -6.404  1.151   1.00 0.00 ? 57 ASN A HD21 11 
ATOM 9842  H HD22 . ASN A 1 57 ? -24.346 -7.913  1.843   1.00 0.00 ? 57 ASN A HD22 11 
ATOM 9843  N N    . LYS A 1 58 ? -26.458 -4.153  2.852   1.00 0.00 ? 58 LYS A N    11 
ATOM 9844  C CA   . LYS A 1 58 ? -26.496 -3.999  4.302   1.00 0.00 ? 58 LYS A CA   11 
ATOM 9845  C C    . LYS A 1 58 ? -27.871 -4.383  4.846   1.00 0.00 ? 58 LYS A C    11 
ATOM 9846  O O    . LYS A 1 58 ? -28.337 -5.504  4.642   1.00 0.00 ? 58 LYS A O    11 
ATOM 9847  C CB   . LYS A 1 58 ? -26.173 -2.549  4.686   1.00 0.00 ? 58 LYS A CB   11 
ATOM 9848  C CG   . LYS A 1 58 ? -27.083 -1.583  3.908   1.00 0.00 ? 58 LYS A CG   11 
ATOM 9849  C CD   . LYS A 1 58 ? -26.374 -1.104  2.637   1.00 0.00 ? 58 LYS A CD   11 
ATOM 9850  C CE   . LYS A 1 58 ? -27.244 -0.062  1.931   1.00 0.00 ? 58 LYS A CE   11 
ATOM 9851  N NZ   . LYS A 1 58 ? -27.390 1.135   2.805   1.00 0.00 ? 58 LYS A NZ   11 
ATOM 9852  H H    . LYS A 1 58 ? -27.290 -4.093  2.340   1.00 0.00 ? 58 LYS A H    11 
ATOM 9853  H HA   . LYS A 1 58 ? -25.754 -4.647  4.744   1.00 0.00 ? 58 LYS A HA   11 
ATOM 9854  H HB2  . LYS A 1 58 ? -26.332 -2.418  5.747   1.00 0.00 ? 58 LYS A HB2  11 
ATOM 9855  H HB3  . LYS A 1 58 ? -25.140 -2.339  4.451   1.00 0.00 ? 58 LYS A HB3  11 
ATOM 9856  H HG2  . LYS A 1 58 ? -28.000 -2.086  3.639   1.00 0.00 ? 58 LYS A HG2  11 
ATOM 9857  H HG3  . LYS A 1 58 ? -27.312 -0.730  4.529   1.00 0.00 ? 58 LYS A HG3  11 
ATOM 9858  H HD2  . LYS A 1 58 ? -25.423 -0.662  2.899   1.00 0.00 ? 58 LYS A HD2  11 
ATOM 9859  H HD3  . LYS A 1 58 ? -26.212 -1.942  1.977   1.00 0.00 ? 58 LYS A HD3  11 
ATOM 9860  H HE2  . LYS A 1 58 ? -26.777 0.226   1.001   1.00 0.00 ? 58 LYS A HE2  11 
ATOM 9861  H HE3  . LYS A 1 58 ? -28.218 -0.482  1.730   1.00 0.00 ? 58 LYS A HE3  11 
ATOM 9862  H HZ1  . LYS A 1 58 ? -26.490 1.323   3.293   1.00 0.00 ? 58 LYS A HZ1  11 
ATOM 9863  H HZ2  . LYS A 1 58 ? -28.135 0.963   3.510   1.00 0.00 ? 58 LYS A HZ2  11 
ATOM 9864  H HZ3  . LYS A 1 58 ? -27.647 1.959   2.223   1.00 0.00 ? 58 LYS A HZ3  11 
ATOM 9865  N N    . LYS A 1 59 ? -28.515 -3.448  5.538   1.00 0.00 ? 59 LYS A N    11 
ATOM 9866  C CA   . LYS A 1 59 ? -29.835 -3.703  6.105   1.00 0.00 ? 59 LYS A CA   11 
ATOM 9867  C C    . LYS A 1 59 ? -30.915 -3.554  5.038   1.00 0.00 ? 59 LYS A C    11 
ATOM 9868  O O    . LYS A 1 59 ? -30.625 -3.224  3.889   1.00 0.00 ? 59 LYS A O    11 
ATOM 9869  C CB   . LYS A 1 59 ? -30.108 -2.728  7.252   1.00 0.00 ? 59 LYS A CB   11 
ATOM 9870  C CG   . LYS A 1 59 ? -29.779 -1.304  6.802   1.00 0.00 ? 59 LYS A CG   11 
ATOM 9871  C CD   . LYS A 1 59 ? -30.386 -0.303  7.787   1.00 0.00 ? 59 LYS A CD   11 
ATOM 9872  C CE   . LYS A 1 59 ? -29.891 -0.614  9.202   1.00 0.00 ? 59 LYS A CE   11 
ATOM 9873  N NZ   . LYS A 1 59 ? -28.438 -0.944  9.159   1.00 0.00 ? 59 LYS A NZ   11 
ATOM 9874  H H    . LYS A 1 59 ? -28.096 -2.572  5.670   1.00 0.00 ? 59 LYS A H    11 
ATOM 9875  H HA   . LYS A 1 59 ? -29.861 -4.712  6.491   1.00 0.00 ? 59 LYS A HA   11 
ATOM 9876  H HB2  . LYS A 1 59 ? -31.150 -2.787  7.533   1.00 0.00 ? 59 LYS A HB2  11 
ATOM 9877  H HB3  . LYS A 1 59 ? -29.490 -2.988  8.099   1.00 0.00 ? 59 LYS A HB3  11 
ATOM 9878  H HG2  . LYS A 1 59 ? -28.706 -1.176  6.770   1.00 0.00 ? 59 LYS A HG2  11 
ATOM 9879  H HG3  . LYS A 1 59 ? -30.191 -1.133  5.818   1.00 0.00 ? 59 LYS A HG3  11 
ATOM 9880  H HD2  . LYS A 1 59 ? -30.086 0.698   7.512   1.00 0.00 ? 59 LYS A HD2  11 
ATOM 9881  H HD3  . LYS A 1 59 ? -31.462 -0.378  7.760   1.00 0.00 ? 59 LYS A HD3  11 
ATOM 9882  H HE2  . LYS A 1 59 ? -30.047 0.246   9.834   1.00 0.00 ? 59 LYS A HE2  11 
ATOM 9883  H HE3  . LYS A 1 59 ? -30.440 -1.456  9.596   1.00 0.00 ? 59 LYS A HE3  11 
ATOM 9884  H HZ1  . LYS A 1 59 ? -28.316 -1.974  9.118   1.00 0.00 ? 59 LYS A HZ1  11 
ATOM 9885  H HZ2  . LYS A 1 59 ? -27.974 -0.575  10.013  1.00 0.00 ? 59 LYS A HZ2  11 
ATOM 9886  H HZ3  . LYS A 1 59 ? -28.009 -0.510  8.315   1.00 0.00 ? 59 LYS A HZ3  11 
ATOM 9887  N N    . ARG A 1 60 ? -32.162 -3.797  5.429   1.00 0.00 ? 60 ARG A N    11 
ATOM 9888  C CA   . ARG A 1 60 ? -33.281 -3.689  4.500   1.00 0.00 ? 60 ARG A CA   11 
ATOM 9889  C C    . ARG A 1 60 ? -33.129 -2.452  3.616   1.00 0.00 ? 60 ARG A C    11 
ATOM 9890  O O    . ARG A 1 60 ? -33.186 -1.356  4.149   1.00 0.00 ? 60 ARG A O    11 
ATOM 9891  C CB   . ARG A 1 60 ? -34.598 -3.610  5.285   1.00 0.00 ? 60 ARG A CB   11 
ATOM 9892  C CG   . ARG A 1 60 ? -35.689 -4.388  4.545   1.00 0.00 ? 60 ARG A CG   11 
ATOM 9893  C CD   . ARG A 1 60 ? -37.023 -4.217  5.274   1.00 0.00 ? 60 ARG A CD   11 
ATOM 9894  N NE   . ARG A 1 60 ? -37.016 -4.974  6.521   1.00 0.00 ? 60 ARG A NE   11 
ATOM 9895  C CZ   . ARG A 1 60 ? -37.267 -6.279  6.533   1.00 0.00 ? 60 ARG A CZ   11 
ATOM 9896  N NH1  . ARG A 1 60 ? -37.527 -6.905  5.418   1.00 0.00 ? 60 ARG A NH1  11 
ATOM 9897  N NH2  . ARG A 1 60 ? -37.253 -6.935  7.662   1.00 0.00 ? 60 ARG A NH2  11 
ATOM 9898  O OXT  . ARG A 1 60 ? -32.958 -2.621  2.419   1.00 0.00 ? 60 ARG A OXT  11 
ATOM 9899  H H    . ARG A 1 60 ? -32.334 -4.058  6.357   1.00 0.00 ? 60 ARG A H    11 
ATOM 9900  H HA   . ARG A 1 60 ? -33.298 -4.567  3.872   1.00 0.00 ? 60 ARG A HA   11 
ATOM 9901  H HB2  . ARG A 1 60 ? -34.455 -4.040  6.266   1.00 0.00 ? 60 ARG A HB2  11 
ATOM 9902  H HB3  . ARG A 1 60 ? -34.902 -2.578  5.386   1.00 0.00 ? 60 ARG A HB3  11 
ATOM 9903  H HG2  . ARG A 1 60 ? -35.777 -4.011  3.536   1.00 0.00 ? 60 ARG A HG2  11 
ATOM 9904  H HG3  . ARG A 1 60 ? -35.426 -5.435  4.516   1.00 0.00 ? 60 ARG A HG3  11 
ATOM 9905  H HD2  . ARG A 1 60 ? -37.180 -3.173  5.491   1.00 0.00 ? 60 ARG A HD2  11 
ATOM 9906  H HD3  . ARG A 1 60 ? -37.824 -4.574  4.640   1.00 0.00 ? 60 ARG A HD3  11 
ATOM 9907  H HE   . ARG A 1 60 ? -36.822 -4.512  7.363   1.00 0.00 ? 60 ARG A HE   11 
ATOM 9908  H HH11 . ARG A 1 60 ? -37.536 -6.404  4.554   1.00 0.00 ? 60 ARG A HH11 11 
ATOM 9909  H HH12 . ARG A 1 60 ? -37.715 -7.887  5.429   1.00 0.00 ? 60 ARG A HH12 11 
ATOM 9910  H HH21 . ARG A 1 60 ? -37.054 -6.455  8.516   1.00 0.00 ? 60 ARG A HH21 11 
ATOM 9911  H HH22 . ARG A 1 60 ? -37.441 -7.917  7.673   1.00 0.00 ? 60 ARG A HH22 11 
ATOM 9912  N N    . GLY A 1 9  ? 3.986   2.679   16.847  1.00 0.00 ? 9  GLY A N    12 
ATOM 9913  C CA   . GLY A 1 9  ? 4.808   1.709   16.131  1.00 0.00 ? 9  GLY A CA   12 
ATOM 9914  C C    . GLY A 1 9  ? 6.008   2.387   15.482  1.00 0.00 ? 9  GLY A C    12 
ATOM 9915  O O    . GLY A 1 9  ? 6.061   3.613   15.380  1.00 0.00 ? 9  GLY A O    12 
ATOM 9916  H H    . GLY A 1 9  ? 3.191   3.051   16.411  1.00 0.00 ? 9  GLY A H    12 
ATOM 9917  H HA2  . GLY A 1 9  ? 5.155   0.957   16.824  1.00 0.00 ? 9  GLY A HA2  12 
ATOM 9918  H HA3  . GLY A 1 9  ? 4.212   1.237   15.364  1.00 0.00 ? 9  GLY A HA3  12 
ATOM 9919  N N    . THR A 1 10 ? 6.970   1.582   15.043  1.00 0.00 ? 10 THR A N    12 
ATOM 9920  C CA   . THR A 1 10 ? 8.167   2.114   14.404  1.00 0.00 ? 10 THR A CA   12 
ATOM 9921  C C    . THR A 1 10 ? 7.853   2.592   12.990  1.00 0.00 ? 10 THR A C    12 
ATOM 9922  O O    . THR A 1 10 ? 6.719   2.476   12.524  1.00 0.00 ? 10 THR A O    12 
ATOM 9923  C CB   . THR A 1 10 ? 9.255   1.040   14.350  1.00 0.00 ? 10 THR A CB   12 
ATOM 9924  O OG1  . THR A 1 10 ? 10.364  1.527   13.609  1.00 0.00 ? 10 THR A OG1  12 
ATOM 9925  C CG2  . THR A 1 10 ? 8.700   -0.217  13.677  1.00 0.00 ? 10 THR A CG2  12 
ATOM 9926  H H    . THR A 1 10 ? 6.873   0.612   15.150  1.00 0.00 ? 10 THR A H    12 
ATOM 9927  H HA   . THR A 1 10 ? 8.532   2.951   14.981  1.00 0.00 ? 10 THR A HA   12 
ATOM 9928  H HB   . THR A 1 10 ? 9.570   0.795   15.353  1.00 0.00 ? 10 THR A HB   12 
ATOM 9929  H HG1  . THR A 1 10 ? 10.411  1.033   12.787  1.00 0.00 ? 10 THR A HG1  12 
ATOM 9930  H HG21 . THR A 1 10 ? 7.884   -0.610  14.265  1.00 0.00 ? 10 THR A HG21 12 
ATOM 9931  H HG22 . THR A 1 10 ? 9.480   -0.960  13.601  1.00 0.00 ? 10 THR A HG22 12 
ATOM 9932  H HG23 . THR A 1 10 ? 8.343   0.033   12.689  1.00 0.00 ? 10 THR A HG23 12 
ATOM 9933  N N    . LYS A 1 11 ? 8.864   3.130   12.314  1.00 0.00 ? 11 LYS A N    12 
ATOM 9934  C CA   . LYS A 1 11 ? 8.689   3.626   10.951  1.00 0.00 ? 11 LYS A CA   12 
ATOM 9935  C C    . LYS A 1 11 ? 9.796   3.098   10.043  1.00 0.00 ? 11 LYS A C    12 
ATOM 9936  O O    . LYS A 1 11 ? 10.789  3.783   9.794   1.00 0.00 ? 11 LYS A O    12 
ATOM 9937  C CB   . LYS A 1 11 ? 8.710   5.155   10.944  1.00 0.00 ? 11 LYS A CB   12 
ATOM 9938  C CG   . LYS A 1 11 ? 7.739   5.683   12.001  1.00 0.00 ? 11 LYS A CG   12 
ATOM 9939  C CD   . LYS A 1 11 ? 7.630   7.204   11.880  1.00 0.00 ? 11 LYS A CD   12 
ATOM 9940  C CE   . LYS A 1 11 ? 6.789   7.749   13.036  1.00 0.00 ? 11 LYS A CE   12 
ATOM 9941  N NZ   . LYS A 1 11 ? 5.629   6.845   13.275  1.00 0.00 ? 11 LYS A NZ   12 
ATOM 9942  H H    . LYS A 1 11 ? 9.745   3.197   12.740  1.00 0.00 ? 11 LYS A H    12 
ATOM 9943  H HA   . LYS A 1 11 ? 7.736   3.289   10.570  1.00 0.00 ? 11 LYS A HA   12 
ATOM 9944  H HB2  . LYS A 1 11 ? 9.709   5.502   11.166  1.00 0.00 ? 11 LYS A HB2  12 
ATOM 9945  H HB3  . LYS A 1 11 ? 8.412   5.515   9.971   1.00 0.00 ? 11 LYS A HB3  12 
ATOM 9946  H HG2  . LYS A 1 11 ? 6.765   5.238   11.849  1.00 0.00 ? 11 LYS A HG2  12 
ATOM 9947  H HG3  . LYS A 1 11 ? 8.103   5.428   12.985  1.00 0.00 ? 11 LYS A HG3  12 
ATOM 9948  H HD2  . LYS A 1 11 ? 8.618   7.640   11.915  1.00 0.00 ? 11 LYS A HD2  12 
ATOM 9949  H HD3  . LYS A 1 11 ? 7.156   7.457   10.943  1.00 0.00 ? 11 LYS A HD3  12 
ATOM 9950  H HE2  . LYS A 1 11 ? 7.396   7.800   13.929  1.00 0.00 ? 11 LYS A HE2  12 
ATOM 9951  H HE3  . LYS A 1 11 ? 6.431   8.737   12.787  1.00 0.00 ? 11 LYS A HE3  12 
ATOM 9952  H HZ1  . LYS A 1 11 ? 5.033   6.813   12.425  1.00 0.00 ? 11 LYS A HZ1  12 
ATOM 9953  H HZ2  . LYS A 1 11 ? 5.070   7.204   14.076  1.00 0.00 ? 11 LYS A HZ2  12 
ATOM 9954  H HZ3  . LYS A 1 11 ? 5.976   5.888   13.494  1.00 0.00 ? 11 LYS A HZ3  12 
ATOM 9955  N N    . LYS A 1 12 ? 9.618   1.875   9.554   1.00 0.00 ? 12 LYS A N    12 
ATOM 9956  C CA   . LYS A 1 12 ? 10.607  1.260   8.673   1.00 0.00 ? 12 LYS A CA   12 
ATOM 9957  C C    . LYS A 1 12 ? 10.359  1.663   7.225   1.00 0.00 ? 12 LYS A C    12 
ATOM 9958  O O    . LYS A 1 12 ? 11.289  2.015   6.500   1.00 0.00 ? 12 LYS A O    12 
ATOM 9959  C CB   . LYS A 1 12 ? 10.541  -0.264  8.797   1.00 0.00 ? 12 LYS A CB   12 
ATOM 9960  C CG   . LYS A 1 12 ? 10.518  -0.661  10.279  1.00 0.00 ? 12 LYS A CG   12 
ATOM 9961  C CD   . LYS A 1 12 ? 11.122  -2.058  10.459  1.00 0.00 ? 12 LYS A CD   12 
ATOM 9962  C CE   . LYS A 1 12 ? 10.184  -3.102  9.854   1.00 0.00 ? 12 LYS A CE   12 
ATOM 9963  N NZ   . LYS A 1 12 ? 8.945   -3.194  10.679  1.00 0.00 ? 12 LYS A NZ   12 
ATOM 9964  H H    . LYS A 1 12 ? 8.806   1.377   9.787   1.00 0.00 ? 12 LYS A H    12 
ATOM 9965  H HA   . LYS A 1 12 ? 11.592  1.590   8.962   1.00 0.00 ? 12 LYS A HA   12 
ATOM 9966  H HB2  . LYS A 1 12 ? 9.643   -0.621  8.313   1.00 0.00 ? 12 LYS A HB2  12 
ATOM 9967  H HB3  . LYS A 1 12 ? 11.405  -0.699  8.318   1.00 0.00 ? 12 LYS A HB3  12 
ATOM 9968  H HG2  . LYS A 1 12 ? 11.093  0.050   10.853  1.00 0.00 ? 12 LYS A HG2  12 
ATOM 9969  H HG3  . LYS A 1 12 ? 9.498   -0.667  10.633  1.00 0.00 ? 12 LYS A HG3  12 
ATOM 9970  H HD2  . LYS A 1 12 ? 12.081  -2.104  9.966   1.00 0.00 ? 12 LYS A HD2  12 
ATOM 9971  H HD3  . LYS A 1 12 ? 11.250  -2.261  11.512  1.00 0.00 ? 12 LYS A HD3  12 
ATOM 9972  H HE2  . LYS A 1 12 ? 9.925   -2.813  8.848   1.00 0.00 ? 12 LYS A HE2  12 
ATOM 9973  H HE3  . LYS A 1 12 ? 10.676  -4.063  9.839   1.00 0.00 ? 12 LYS A HE3  12 
ATOM 9974  H HZ1  . LYS A 1 12 ? 9.114   -2.760  11.608  1.00 0.00 ? 12 LYS A HZ1  12 
ATOM 9975  H HZ2  . LYS A 1 12 ? 8.686   -4.192  10.807  1.00 0.00 ? 12 LYS A HZ2  12 
ATOM 9976  H HZ3  . LYS A 1 12 ? 8.170   -2.694  10.196  1.00 0.00 ? 12 LYS A HZ3  12 
ATOM 9977  N N    . TYR A 1 13 ? 9.097   1.600   6.806   1.00 0.00 ? 13 TYR A N    12 
ATOM 9978  C CA   . TYR A 1 13 ? 8.733   1.952   5.436   1.00 0.00 ? 13 TYR A CA   12 
ATOM 9979  C C    . TYR A 1 13 ? 7.578   2.947   5.424   1.00 0.00 ? 13 TYR A C    12 
ATOM 9980  O O    . TYR A 1 13 ? 6.682   2.886   6.267   1.00 0.00 ? 13 TYR A O    12 
ATOM 9981  C CB   . TYR A 1 13 ? 8.337   0.686   4.669   1.00 0.00 ? 13 TYR A CB   12 
ATOM 9982  C CG   . TYR A 1 13 ? 9.560   0.085   4.015   1.00 0.00 ? 13 TYR A CG   12 
ATOM 9983  C CD1  . TYR A 1 13 ? 10.569  -0.485  4.803   1.00 0.00 ? 13 TYR A CD1  12 
ATOM 9984  C CD2  . TYR A 1 13 ? 9.683   0.098   2.622   1.00 0.00 ? 13 TYR A CD2  12 
ATOM 9985  C CE1  . TYR A 1 13 ? 11.702  -1.039  4.193   1.00 0.00 ? 13 TYR A CE1  12 
ATOM 9986  C CE2  . TYR A 1 13 ? 10.815  -0.456  2.014   1.00 0.00 ? 13 TYR A CE2  12 
ATOM 9987  C CZ   . TYR A 1 13 ? 11.824  -1.025  2.800   1.00 0.00 ? 13 TYR A CZ   12 
ATOM 9988  O OH   . TYR A 1 13 ? 12.941  -1.572  2.199   1.00 0.00 ? 13 TYR A OH   12 
ATOM 9989  H H    . TYR A 1 13 ? 8.399   1.307   7.429   1.00 0.00 ? 13 TYR A H    12 
ATOM 9990  H HA   . TYR A 1 13 ? 9.585   2.404   4.947   1.00 0.00 ? 13 TYR A HA   12 
ATOM 9991  H HB2  . TYR A 1 13 ? 7.909   -0.030  5.356   1.00 0.00 ? 13 TYR A HB2  12 
ATOM 9992  H HB3  . TYR A 1 13 ? 7.608   0.934   3.910   1.00 0.00 ? 13 TYR A HB3  12 
ATOM 9993  H HD1  . TYR A 1 13 ? 10.475  -0.497  5.879   1.00 0.00 ? 13 TYR A HD1  12 
ATOM 9994  H HD2  . TYR A 1 13 ? 8.906   0.538   2.014   1.00 0.00 ? 13 TYR A HD2  12 
ATOM 9995  H HE1  . TYR A 1 13 ? 12.479  -1.477  4.800   1.00 0.00 ? 13 TYR A HE1  12 
ATOM 9996  H HE2  . TYR A 1 13 ? 10.909  -0.446  0.939   1.00 0.00 ? 13 TYR A HE2  12 
ATOM 9997  H HH   . TYR A 1 13 ? 12.672  -1.942  1.356   1.00 0.00 ? 13 TYR A HH   12 
ATOM 9998  N N    . ASP A 1 14 ? 7.609   3.863   4.461   1.00 0.00 ? 14 ASP A N    12 
ATOM 9999  C CA   . ASP A 1 14 ? 6.568   4.874   4.334   1.00 0.00 ? 14 ASP A CA   12 
ATOM 10000 C C    . ASP A 1 14 ? 6.065   4.942   2.896   1.00 0.00 ? 14 ASP A C    12 
ATOM 10001 O O    . ASP A 1 14 ? 6.799   5.343   1.992   1.00 0.00 ? 14 ASP A O    12 
ATOM 10002 C CB   . ASP A 1 14 ? 7.120   6.237   4.747   1.00 0.00 ? 14 ASP A CB   12 
ATOM 10003 C CG   . ASP A 1 14 ? 8.473   6.475   4.084   1.00 0.00 ? 14 ASP A CG   12 
ATOM 10004 O OD1  . ASP A 1 14 ? 8.928   5.589   3.381   1.00 0.00 ? 14 ASP A OD1  12 
ATOM 10005 O OD2  . ASP A 1 14 ? 9.033   7.538   4.291   1.00 0.00 ? 14 ASP A OD2  12 
ATOM 10006 H H    . ASP A 1 14 ? 8.350   3.859   3.821   1.00 0.00 ? 14 ASP A H    12 
ATOM 10007 H HA   . ASP A 1 14 ? 5.742   4.620   4.983   1.00 0.00 ? 14 ASP A HA   12 
ATOM 10008 H HB2  . ASP A 1 14 ? 6.431   7.010   4.442   1.00 0.00 ? 14 ASP A HB2  12 
ATOM 10009 H HB3  . ASP A 1 14 ? 7.239   6.265   5.821   1.00 0.00 ? 14 ASP A HB3  12 
ATOM 10010 N N    . LEU A 1 15 ? 4.812   4.549   2.691   1.00 0.00 ? 15 LEU A N    12 
ATOM 10011 C CA   . LEU A 1 15 ? 4.217   4.568   1.357   1.00 0.00 ? 15 LEU A CA   12 
ATOM 10012 C C    . LEU A 1 15 ? 2.887   5.315   1.382   1.00 0.00 ? 15 LEU A C    12 
ATOM 10013 O O    . LEU A 1 15 ? 1.836   4.737   1.106   1.00 0.00 ? 15 LEU A O    12 
ATOM 10014 C CB   . LEU A 1 15 ? 3.982   3.137   0.862   1.00 0.00 ? 15 LEU A CB   12 
ATOM 10015 C CG   . LEU A 1 15 ? 5.255   2.301   1.040   1.00 0.00 ? 15 LEU A CG   12 
ATOM 10016 C CD1  . LEU A 1 15 ? 4.923   0.823   0.838   1.00 0.00 ? 15 LEU A CD1  12 
ATOM 10017 C CD2  . LEU A 1 15 ? 6.306   2.728   0.009   1.00 0.00 ? 15 LEU A CD2  12 
ATOM 10018 H H    . LEU A 1 15 ? 4.276   4.240   3.450   1.00 0.00 ? 15 LEU A H    12 
ATOM 10019 H HA   . LEU A 1 15 ? 4.887   5.067   0.674   1.00 0.00 ? 15 LEU A HA   12 
ATOM 10020 H HB2  . LEU A 1 15 ? 3.180   2.688   1.430   1.00 0.00 ? 15 LEU A HB2  12 
ATOM 10021 H HB3  . LEU A 1 15 ? 3.712   3.158   -0.183  1.00 0.00 ? 15 LEU A HB3  12 
ATOM 10022 H HG   . LEU A 1 15 ? 5.646   2.448   2.036   1.00 0.00 ? 15 LEU A HG   12 
ATOM 10023 H HD11 . LEU A 1 15 ? 5.819   0.233   0.961   1.00 0.00 ? 15 LEU A HD11 12 
ATOM 10024 H HD12 . LEU A 1 15 ? 4.528   0.675   -0.156  1.00 0.00 ? 15 LEU A HD12 12 
ATOM 10025 H HD13 . LEU A 1 15 ? 4.188   0.517   1.568   1.00 0.00 ? 15 LEU A HD13 12 
ATOM 10026 H HD21 . LEU A 1 15 ? 6.730   3.677   0.299   1.00 0.00 ? 15 LEU A HD21 12 
ATOM 10027 H HD22 . LEU A 1 15 ? 5.842   2.819   -0.962  1.00 0.00 ? 15 LEU A HD22 12 
ATOM 10028 H HD23 . LEU A 1 15 ? 7.087   1.982   -0.036  1.00 0.00 ? 15 LEU A HD23 12 
ATOM 10029 N N    . SER A 1 16 ? 2.940   6.604   1.712   1.00 0.00 ? 16 SER A N    12 
ATOM 10030 C CA   . SER A 1 16 ? 1.732   7.421   1.768   1.00 0.00 ? 16 SER A CA   12 
ATOM 10031 C C    . SER A 1 16 ? 0.789   7.054   0.625   1.00 0.00 ? 16 SER A C    12 
ATOM 10032 O O    . SER A 1 16 ? -0.391  6.779   0.843   1.00 0.00 ? 16 SER A O    12 
ATOM 10033 C CB   . SER A 1 16 ? 2.098   8.903   1.674   1.00 0.00 ? 16 SER A CB   12 
ATOM 10034 O OG   . SER A 1 16 ? 1.002   9.624   1.130   1.00 0.00 ? 16 SER A OG   12 
ATOM 10035 H H    . SER A 1 16 ? 3.807   7.011   1.922   1.00 0.00 ? 16 SER A H    12 
ATOM 10036 H HA   . SER A 1 16 ? 1.230   7.243   2.708   1.00 0.00 ? 16 SER A HA   12 
ATOM 10037 H HB2  . SER A 1 16 ? 2.321   9.284   2.657   1.00 0.00 ? 16 SER A HB2  12 
ATOM 10038 H HB3  . SER A 1 16 ? 2.969   9.016   1.042   1.00 0.00 ? 16 SER A HB3  12 
ATOM 10039 H HG   . SER A 1 16 ? 1.270   10.542  1.035   1.00 0.00 ? 16 SER A HG   12 
ATOM 10040 N N    . LYS A 1 17 ? 1.326   7.041   -0.589  1.00 0.00 ? 17 LYS A N    12 
ATOM 10041 C CA   . LYS A 1 17 ? 0.535   6.693   -1.761  1.00 0.00 ? 17 LYS A CA   12 
ATOM 10042 C C    . LYS A 1 17 ? 1.457   6.382   -2.935  1.00 0.00 ? 17 LYS A C    12 
ATOM 10043 O O    . LYS A 1 17 ? 2.338   7.172   -3.270  1.00 0.00 ? 17 LYS A O    12 
ATOM 10044 C CB   . LYS A 1 17 ? -0.400  7.855   -2.123  1.00 0.00 ? 17 LYS A CB   12 
ATOM 10045 C CG   . LYS A 1 17 ? -1.706  7.313   -2.717  1.00 0.00 ? 17 LYS A CG   12 
ATOM 10046 C CD   . LYS A 1 17 ? -1.397  6.432   -3.931  1.00 0.00 ? 17 LYS A CD   12 
ATOM 10047 C CE   . LYS A 1 17 ? -2.636  6.336   -4.824  1.00 0.00 ? 17 LYS A CE   12 
ATOM 10048 N NZ   . LYS A 1 17 ? -3.799  5.876   -4.013  1.00 0.00 ? 17 LYS A NZ   12 
ATOM 10049 H H    . LYS A 1 17 ? 2.275   7.258   -0.699  1.00 0.00 ? 17 LYS A H    12 
ATOM 10050 H HA   . LYS A 1 17 ? -0.059  5.818   -1.538  1.00 0.00 ? 17 LYS A HA   12 
ATOM 10051 H HB2  . LYS A 1 17 ? -0.622  8.425   -1.233  1.00 0.00 ? 17 LYS A HB2  12 
ATOM 10052 H HB3  . LYS A 1 17 ? 0.081   8.496   -2.848  1.00 0.00 ? 17 LYS A HB3  12 
ATOM 10053 H HG2  . LYS A 1 17 ? -2.223  6.728   -1.970  1.00 0.00 ? 17 LYS A HG2  12 
ATOM 10054 H HG3  . LYS A 1 17 ? -2.331  8.139   -3.022  1.00 0.00 ? 17 LYS A HG3  12 
ATOM 10055 H HD2  . LYS A 1 17 ? -0.580  6.864   -4.493  1.00 0.00 ? 17 LYS A HD2  12 
ATOM 10056 H HD3  . LYS A 1 17 ? -1.122  5.444   -3.597  1.00 0.00 ? 17 LYS A HD3  12 
ATOM 10057 H HE2  . LYS A 1 17 ? -2.853  7.306   -5.245  1.00 0.00 ? 17 LYS A HE2  12 
ATOM 10058 H HE3  . LYS A 1 17 ? -2.452  5.631   -5.621  1.00 0.00 ? 17 LYS A HE3  12 
ATOM 10059 H HZ1  . LYS A 1 17 ? -3.893  6.477   -3.170  1.00 0.00 ? 17 LYS A HZ1  12 
ATOM 10060 H HZ2  . LYS A 1 17 ? -3.649  4.891   -3.718  1.00 0.00 ? 17 LYS A HZ2  12 
ATOM 10061 H HZ3  . LYS A 1 17 ? -4.666  5.940   -4.585  1.00 0.00 ? 17 LYS A HZ3  12 
ATOM 10062 N N    . TRP A 1 18 ? 1.247   5.225   -3.557  1.00 0.00 ? 18 TRP A N    12 
ATOM 10063 C CA   . TRP A 1 18 ? 2.062   4.806   -4.694  1.00 0.00 ? 18 TRP A CA   12 
ATOM 10064 C C    . TRP A 1 18 ? 1.170   4.563   -5.910  1.00 0.00 ? 18 TRP A C    12 
ATOM 10065 O O    . TRP A 1 18 ? -0.039  4.378   -5.776  1.00 0.00 ? 18 TRP A O    12 
ATOM 10066 C CB   . TRP A 1 18 ? 2.808   3.508   -4.346  1.00 0.00 ? 18 TRP A CB   12 
ATOM 10067 C CG   . TRP A 1 18 ? 4.181   3.803   -3.820  1.00 0.00 ? 18 TRP A CG   12 
ATOM 10068 C CD1  . TRP A 1 18 ? 4.515   4.847   -3.028  1.00 0.00 ? 18 TRP A CD1  12 
ATOM 10069 C CD2  . TRP A 1 18 ? 5.409   3.045   -4.033  1.00 0.00 ? 18 TRP A CD2  12 
ATOM 10070 N NE1  . TRP A 1 18 ? 5.869   4.782   -2.747  1.00 0.00 ? 18 TRP A NE1  12 
ATOM 10071 C CE2  . TRP A 1 18 ? 6.464   3.689   -3.343  1.00 0.00 ? 18 TRP A CE2  12 
ATOM 10072 C CE3  . TRP A 1 18 ? 5.706   1.876   -4.753  1.00 0.00 ? 18 TRP A CE3  12 
ATOM 10073 C CZ2  . TRP A 1 18 ? 7.766   3.188   -3.369  1.00 0.00 ? 18 TRP A CZ2  12 
ATOM 10074 C CZ3  . TRP A 1 18 ? 7.014   1.370   -4.781  1.00 0.00 ? 18 TRP A CZ3  12 
ATOM 10075 C CH2  . TRP A 1 18 ? 8.043   2.024   -4.090  1.00 0.00 ? 18 TRP A CH2  12 
ATOM 10076 H H    . TRP A 1 18 ? 0.525   4.640   -3.243  1.00 0.00 ? 18 TRP A H    12 
ATOM 10077 H HA   . TRP A 1 18 ? 2.778   5.578   -4.928  1.00 0.00 ? 18 TRP A HA   12 
ATOM 10078 H HB2  . TRP A 1 18 ? 2.250   2.968   -3.595  1.00 0.00 ? 18 TRP A HB2  12 
ATOM 10079 H HB3  . TRP A 1 18 ? 2.892   2.896   -5.234  1.00 0.00 ? 18 TRP A HB3  12 
ATOM 10080 H HD1  . TRP A 1 18 ? 3.841   5.607   -2.672  1.00 0.00 ? 18 TRP A HD1  12 
ATOM 10081 H HE1  . TRP A 1 18 ? 6.363   5.423   -2.194  1.00 0.00 ? 18 TRP A HE1  12 
ATOM 10082 H HE3  . TRP A 1 18 ? 4.923   1.363   -5.288  1.00 0.00 ? 18 TRP A HE3  12 
ATOM 10083 H HZ2  . TRP A 1 18 ? 8.555   3.696   -2.833  1.00 0.00 ? 18 TRP A HZ2  12 
ATOM 10084 H HZ3  . TRP A 1 18 ? 7.229   0.471   -5.337  1.00 0.00 ? 18 TRP A HZ3  12 
ATOM 10085 H HH2  . TRP A 1 18 ? 9.047   1.629   -4.115  1.00 0.00 ? 18 TRP A HH2  12 
ATOM 10086 N N    . LYS A 1 19 ? 1.773   4.556   -7.096  1.00 0.00 ? 19 LYS A N    12 
ATOM 10087 C CA   . LYS A 1 19 ? 1.020   4.326   -8.325  1.00 0.00 ? 19 LYS A CA   12 
ATOM 10088 C C    . LYS A 1 19 ? 1.056   2.845   -8.696  1.00 0.00 ? 19 LYS A C    12 
ATOM 10089 O O    . LYS A 1 19 ? 1.901   2.093   -8.211  1.00 0.00 ? 19 LYS A O    12 
ATOM 10090 C CB   . LYS A 1 19 ? 1.607   5.161   -9.467  1.00 0.00 ? 19 LYS A CB   12 
ATOM 10091 C CG   . LYS A 1 19 ? 1.596   6.648   -9.083  1.00 0.00 ? 19 LYS A CG   12 
ATOM 10092 C CD   . LYS A 1 19 ? 2.944   7.036   -8.470  1.00 0.00 ? 19 LYS A CD   12 
ATOM 10093 C CE   . LYS A 1 19 ? 2.900   8.498   -8.020  1.00 0.00 ? 19 LYS A CE   12 
ATOM 10094 N NZ   . LYS A 1 19 ? 4.206   8.869   -7.409  1.00 0.00 ? 19 LYS A NZ   12 
ATOM 10095 H H    . LYS A 1 19 ? 2.741   4.705   -7.146  1.00 0.00 ? 19 LYS A H    12 
ATOM 10096 H HA   . LYS A 1 19 ? -0.007  4.622   -8.168  1.00 0.00 ? 19 LYS A HA   12 
ATOM 10097 H HB2  . LYS A 1 19 ? 2.620   4.843   -9.663  1.00 0.00 ? 19 LYS A HB2  12 
ATOM 10098 H HB3  . LYS A 1 19 ? 1.010   5.018   -10.355 1.00 0.00 ? 19 LYS A HB3  12 
ATOM 10099 H HG2  . LYS A 1 19 ? 1.422   7.245   -9.967  1.00 0.00 ? 19 LYS A HG2  12 
ATOM 10100 H HG3  . LYS A 1 19 ? 0.811   6.833   -8.366  1.00 0.00 ? 19 LYS A HG3  12 
ATOM 10101 H HD2  . LYS A 1 19 ? 3.148   6.404   -7.619  1.00 0.00 ? 19 LYS A HD2  12 
ATOM 10102 H HD3  . LYS A 1 19 ? 3.724   6.912   -9.205  1.00 0.00 ? 19 LYS A HD3  12 
ATOM 10103 H HE2  . LYS A 1 19 ? 2.708   9.131   -8.873  1.00 0.00 ? 19 LYS A HE2  12 
ATOM 10104 H HE3  . LYS A 1 19 ? 2.112   8.626   -7.292  1.00 0.00 ? 19 LYS A HE3  12 
ATOM 10105 H HZ1  . LYS A 1 19 ? 4.967   8.738   -8.106  1.00 0.00 ? 19 LYS A HZ1  12 
ATOM 10106 H HZ2  . LYS A 1 19 ? 4.388   8.263   -6.583  1.00 0.00 ? 19 LYS A HZ2  12 
ATOM 10107 H HZ3  . LYS A 1 19 ? 4.178   9.865   -7.109  1.00 0.00 ? 19 LYS A HZ3  12 
ATOM 10108 N N    . TYR A 1 20 ? 0.130   2.433   -9.556  1.00 0.00 ? 20 TYR A N    12 
ATOM 10109 C CA   . TYR A 1 20 ? 0.065   1.039   -9.982  1.00 0.00 ? 20 TYR A CA   12 
ATOM 10110 C C    . TYR A 1 20 ? 1.317   0.655   -10.767 1.00 0.00 ? 20 TYR A C    12 
ATOM 10111 O O    . TYR A 1 20 ? 1.855   -0.441  -10.601 1.00 0.00 ? 20 TYR A O    12 
ATOM 10112 C CB   . TYR A 1 20 ? -1.173  0.818   -10.852 1.00 0.00 ? 20 TYR A CB   12 
ATOM 10113 C CG   . TYR A 1 20 ? -1.160  1.795   -12.004 1.00 0.00 ? 20 TYR A CG   12 
ATOM 10114 C CD1  . TYR A 1 20 ? -0.439  1.498   -13.167 1.00 0.00 ? 20 TYR A CD1  12 
ATOM 10115 C CD2  . TYR A 1 20 ? -1.869  2.999   -11.907 1.00 0.00 ? 20 TYR A CD2  12 
ATOM 10116 C CE1  . TYR A 1 20 ? -0.428  2.405   -14.233 1.00 0.00 ? 20 TYR A CE1  12 
ATOM 10117 C CE2  . TYR A 1 20 ? -1.856  3.905   -12.975 1.00 0.00 ? 20 TYR A CE2  12 
ATOM 10118 C CZ   . TYR A 1 20 ? -1.136  3.608   -14.138 1.00 0.00 ? 20 TYR A CZ   12 
ATOM 10119 O OH   . TYR A 1 20 ? -1.125  4.501   -15.189 1.00 0.00 ? 20 TYR A OH   12 
ATOM 10120 H H    . TYR A 1 20 ? -0.520  3.076   -9.910  1.00 0.00 ? 20 TYR A H    12 
ATOM 10121 H HA   . TYR A 1 20 ? -0.009  0.410   -9.108  1.00 0.00 ? 20 TYR A HA   12 
ATOM 10122 H HB2  . TYR A 1 20 ? -1.165  -0.191  -11.237 1.00 0.00 ? 20 TYR A HB2  12 
ATOM 10123 H HB3  . TYR A 1 20 ? -2.062  0.972   -10.261 1.00 0.00 ? 20 TYR A HB3  12 
ATOM 10124 H HD1  . TYR A 1 20 ? 0.107   0.570   -13.241 1.00 0.00 ? 20 TYR A HD1  12 
ATOM 10125 H HD2  . TYR A 1 20 ? -2.424  3.228   -11.010 1.00 0.00 ? 20 TYR A HD2  12 
ATOM 10126 H HE1  . TYR A 1 20 ? 0.128   2.175   -15.130 1.00 0.00 ? 20 TYR A HE1  12 
ATOM 10127 H HE2  . TYR A 1 20 ? -2.403  4.833   -12.901 1.00 0.00 ? 20 TYR A HE2  12 
ATOM 10128 H HH   . TYR A 1 20 ? -1.734  4.179   -15.858 1.00 0.00 ? 20 TYR A HH   12 
ATOM 10129 N N    . ALA A 1 21 ? 1.769   1.564   -11.623 1.00 0.00 ? 21 ALA A N    12 
ATOM 10130 C CA   . ALA A 1 21 ? 2.952   1.314   -12.441 1.00 0.00 ? 21 ALA A CA   12 
ATOM 10131 C C    . ALA A 1 21 ? 4.159   0.965   -11.574 1.00 0.00 ? 21 ALA A C    12 
ATOM 10132 O O    . ALA A 1 21 ? 4.751   -0.103  -11.723 1.00 0.00 ? 21 ALA A O    12 
ATOM 10133 C CB   . ALA A 1 21 ? 3.270   2.549   -13.284 1.00 0.00 ? 21 ALA A CB   12 
ATOM 10134 H H    . ALA A 1 21 ? 1.295   2.416   -11.714 1.00 0.00 ? 21 ALA A H    12 
ATOM 10135 H HA   . ALA A 1 21 ? 2.749   0.486   -13.103 1.00 0.00 ? 21 ALA A HA   12 
ATOM 10136 H HB1  . ALA A 1 21 ? 3.339   3.415   -12.643 1.00 0.00 ? 21 ALA A HB1  12 
ATOM 10137 H HB2  . ALA A 1 21 ? 2.485   2.701   -14.011 1.00 0.00 ? 21 ALA A HB2  12 
ATOM 10138 H HB3  . ALA A 1 21 ? 4.210   2.404   -13.796 1.00 0.00 ? 21 ALA A HB3  12 
ATOM 10139 N N    . GLU A 1 22 ? 4.528   1.876   -10.678 1.00 0.00 ? 22 GLU A N    12 
ATOM 10140 C CA   . GLU A 1 22 ? 5.677   1.650   -9.808  1.00 0.00 ? 22 GLU A CA   12 
ATOM 10141 C C    . GLU A 1 22 ? 5.441   0.457   -8.886  1.00 0.00 ? 22 GLU A C    12 
ATOM 10142 O O    . GLU A 1 22 ? 6.360   -0.317  -8.619  1.00 0.00 ? 22 GLU A O    12 
ATOM 10143 C CB   . GLU A 1 22 ? 5.958   2.899   -8.969  1.00 0.00 ? 22 GLU A CB   12 
ATOM 10144 C CG   . GLU A 1 22 ? 4.761   3.191   -8.067  1.00 0.00 ? 22 GLU A CG   12 
ATOM 10145 C CD   . GLU A 1 22 ? 4.945   4.539   -7.380  1.00 0.00 ? 22 GLU A CD   12 
ATOM 10146 O OE1  . GLU A 1 22 ? 5.543   5.413   -7.986  1.00 0.00 ? 22 GLU A OE1  12 
ATOM 10147 O OE2  . GLU A 1 22 ? 4.483   4.679   -6.260  1.00 0.00 ? 22 GLU A OE2  12 
ATOM 10148 H H    . GLU A 1 22 ? 4.026   2.715   -10.606 1.00 0.00 ? 22 GLU A H    12 
ATOM 10149 H HA   . GLU A 1 22 ? 6.541   1.447   -10.422 1.00 0.00 ? 22 GLU A HA   12 
ATOM 10150 H HB2  . GLU A 1 22 ? 6.836   2.734   -8.362  1.00 0.00 ? 22 GLU A HB2  12 
ATOM 10151 H HB3  . GLU A 1 22 ? 6.126   3.741   -9.624  1.00 0.00 ? 22 GLU A HB3  12 
ATOM 10152 H HG2  . GLU A 1 22 ? 3.862   3.211   -8.664  1.00 0.00 ? 22 GLU A HG2  12 
ATOM 10153 H HG3  . GLU A 1 22 ? 4.679   2.418   -7.319  1.00 0.00 ? 22 GLU A HG3  12 
ATOM 10154 N N    . LEU A 1 23 ? 4.213   0.310   -8.399  1.00 0.00 ? 23 LEU A N    12 
ATOM 10155 C CA   . LEU A 1 23 ? 3.893   -0.800  -7.507  1.00 0.00 ? 23 LEU A CA   12 
ATOM 10156 C C    . LEU A 1 23 ? 4.295   -2.126  -8.149  1.00 0.00 ? 23 LEU A C    12 
ATOM 10157 O O    . LEU A 1 23 ? 5.066   -2.897  -7.575  1.00 0.00 ? 23 LEU A O    12 
ATOM 10158 C CB   . LEU A 1 23 ? 2.387   -0.812  -7.203  1.00 0.00 ? 23 LEU A CB   12 
ATOM 10159 C CG   . LEU A 1 23 ? 2.116   -0.160  -5.841  1.00 0.00 ? 23 LEU A CG   12 
ATOM 10160 C CD1  . LEU A 1 23 ? 0.666   0.326   -5.785  1.00 0.00 ? 23 LEU A CD1  12 
ATOM 10161 C CD2  . LEU A 1 23 ? 2.350   -1.183  -4.725  1.00 0.00 ? 23 LEU A CD2  12 
ATOM 10162 H H    . LEU A 1 23 ? 3.515   0.955   -8.641  1.00 0.00 ? 23 LEU A H    12 
ATOM 10163 H HA   . LEU A 1 23 ? 4.441   -0.677  -6.586  1.00 0.00 ? 23 LEU A HA   12 
ATOM 10164 H HB2  . LEU A 1 23 ? 1.866   -0.262  -7.973  1.00 0.00 ? 23 LEU A HB2  12 
ATOM 10165 H HB3  . LEU A 1 23 ? 2.027   -1.831  -7.189  1.00 0.00 ? 23 LEU A HB3  12 
ATOM 10166 H HG   . LEU A 1 23 ? 2.779   0.679   -5.706  1.00 0.00 ? 23 LEU A HG   12 
ATOM 10167 H HD11 . LEU A 1 23 ? -0.001  -0.514  -5.906  1.00 0.00 ? 23 LEU A HD11 12 
ATOM 10168 H HD12 . LEU A 1 23 ? 0.494   1.040   -6.576  1.00 0.00 ? 23 LEU A HD12 12 
ATOM 10169 H HD13 . LEU A 1 23 ? 0.481   0.796   -4.830  1.00 0.00 ? 23 LEU A HD13 12 
ATOM 10170 H HD21 . LEU A 1 23 ? 2.443   -0.670  -3.779  1.00 0.00 ? 23 LEU A HD21 12 
ATOM 10171 H HD22 . LEU A 1 23 ? 3.257   -1.735  -4.925  1.00 0.00 ? 23 LEU A HD22 12 
ATOM 10172 H HD23 . LEU A 1 23 ? 1.515   -1.868  -4.682  1.00 0.00 ? 23 LEU A HD23 12 
ATOM 10173 N N    . ARG A 1 24 ? 3.771   -2.382  -9.341  1.00 0.00 ? 24 ARG A N    12 
ATOM 10174 C CA   . ARG A 1 24 ? 4.082   -3.619  -10.049 1.00 0.00 ? 24 ARG A CA   12 
ATOM 10175 C C    . ARG A 1 24 ? 5.568   -3.696  -10.376 1.00 0.00 ? 24 ARG A C    12 
ATOM 10176 O O    . ARG A 1 24 ? 6.221   -4.707  -10.119 1.00 0.00 ? 24 ARG A O    12 
ATOM 10177 C CB   . ARG A 1 24 ? 3.265   -3.700  -11.343 1.00 0.00 ? 24 ARG A CB   12 
ATOM 10178 C CG   . ARG A 1 24 ? 3.209   -5.151  -11.825 1.00 0.00 ? 24 ARG A CG   12 
ATOM 10179 C CD   . ARG A 1 24 ? 2.374   -5.236  -13.106 1.00 0.00 ? 24 ARG A CD   12 
ATOM 10180 N NE   . ARG A 1 24 ? 1.890   -6.598  -13.301 1.00 0.00 ? 24 ARG A NE   12 
ATOM 10181 C CZ   . ARG A 1 24 ? 2.724   -7.591  -13.585 1.00 0.00 ? 24 ARG A CZ   12 
ATOM 10182 N NH1  . ARG A 1 24 ? 4.004   -7.359  -13.694 1.00 0.00 ? 24 ARG A NH1  12 
ATOM 10183 N NH2  . ARG A 1 24 ? 2.265   -8.801  -13.752 1.00 0.00 ? 24 ARG A NH2  12 
ATOM 10184 H H    . ARG A 1 24 ? 3.165   -1.730  -9.753  1.00 0.00 ? 24 ARG A H    12 
ATOM 10185 H HA   . ARG A 1 24 ? 3.818   -4.456  -9.420  1.00 0.00 ? 24 ARG A HA   12 
ATOM 10186 H HB2  . ARG A 1 24 ? 2.263   -3.342  -11.157 1.00 0.00 ? 24 ARG A HB2  12 
ATOM 10187 H HB3  . ARG A 1 24 ? 3.731   -3.088  -12.101 1.00 0.00 ? 24 ARG A HB3  12 
ATOM 10188 H HG2  . ARG A 1 24 ? 4.211   -5.502  -12.024 1.00 0.00 ? 24 ARG A HG2  12 
ATOM 10189 H HG3  . ARG A 1 24 ? 2.757   -5.767  -11.063 1.00 0.00 ? 24 ARG A HG3  12 
ATOM 10190 H HD2  . ARG A 1 24 ? 1.532   -4.566  -13.030 1.00 0.00 ? 24 ARG A HD2  12 
ATOM 10191 H HD3  . ARG A 1 24 ? 2.984   -4.948  -13.949 1.00 0.00 ? 24 ARG A HD3  12 
ATOM 10192 H HE   . ARG A 1 24 ? 0.929   -6.783  -13.221 1.00 0.00 ? 24 ARG A HE   12 
ATOM 10193 H HH11 . ARG A 1 24 ? 4.355   -6.431  -13.566 1.00 0.00 ? 24 ARG A HH11 12 
ATOM 10194 H HH12 . ARG A 1 24 ? 4.631   -8.107  -13.907 1.00 0.00 ? 24 ARG A HH12 12 
ATOM 10195 H HH21 . ARG A 1 24 ? 1.285   -8.980  -13.667 1.00 0.00 ? 24 ARG A HH21 12 
ATOM 10196 H HH22 . ARG A 1 24 ? 2.893   -9.550  -13.965 1.00 0.00 ? 24 ARG A HH22 12 
ATOM 10197 N N    . ASP A 1 25 ? 6.099   -2.622  -10.947 1.00 0.00 ? 25 ASP A N    12 
ATOM 10198 C CA   . ASP A 1 25 ? 7.509   -2.590  -11.306 1.00 0.00 ? 25 ASP A CA   12 
ATOM 10199 C C    . ASP A 1 25 ? 8.386   -2.876  -10.092 1.00 0.00 ? 25 ASP A C    12 
ATOM 10200 O O    . ASP A 1 25 ? 9.233   -3.767  -10.122 1.00 0.00 ? 25 ASP A O    12 
ATOM 10201 C CB   . ASP A 1 25 ? 7.868   -1.219  -11.884 1.00 0.00 ? 25 ASP A CB   12 
ATOM 10202 C CG   . ASP A 1 25 ? 9.226   -1.284  -12.577 1.00 0.00 ? 25 ASP A CG   12 
ATOM 10203 O OD1  . ASP A 1 25 ? 10.221  -1.059  -11.909 1.00 0.00 ? 25 ASP A OD1  12 
ATOM 10204 O OD2  . ASP A 1 25 ? 9.250   -1.558  -13.765 1.00 0.00 ? 25 ASP A OD2  12 
ATOM 10205 H H    . ASP A 1 25 ? 5.534   -1.844  -11.132 1.00 0.00 ? 25 ASP A H    12 
ATOM 10206 H HA   . ASP A 1 25 ? 7.695   -3.341  -12.054 1.00 0.00 ? 25 ASP A HA   12 
ATOM 10207 H HB2  . ASP A 1 25 ? 7.115   -0.923  -12.599 1.00 0.00 ? 25 ASP A HB2  12 
ATOM 10208 H HB3  . ASP A 1 25 ? 7.910   -0.493  -11.087 1.00 0.00 ? 25 ASP A HB3  12 
ATOM 10209 N N    . THR A 1 26 ? 8.181   -2.113  -9.026  1.00 0.00 ? 26 THR A N    12 
ATOM 10210 C CA   . THR A 1 26 ? 8.967   -2.292  -7.810  1.00 0.00 ? 26 THR A CA   12 
ATOM 10211 C C    . THR A 1 26 ? 8.826   -3.709  -7.261  1.00 0.00 ? 26 THR A C    12 
ATOM 10212 O O    . THR A 1 26 ? 9.783   -4.264  -6.718  1.00 0.00 ? 26 THR A O    12 
ATOM 10213 C CB   . THR A 1 26 ? 8.521   -1.289  -6.745  1.00 0.00 ? 26 THR A CB   12 
ATOM 10214 O OG1  . THR A 1 26 ? 8.341   -0.014  -7.345  1.00 0.00 ? 26 THR A OG1  12 
ATOM 10215 C CG2  . THR A 1 26 ? 9.591   -1.199  -5.656  1.00 0.00 ? 26 THR A CG2  12 
ATOM 10216 H H    . THR A 1 26 ? 7.495   -1.414  -9.058  1.00 0.00 ? 26 THR A H    12 
ATOM 10217 H HA   . THR A 1 26 ? 10.005  -2.109  -8.038  1.00 0.00 ? 26 THR A HA   12 
ATOM 10218 H HB   . THR A 1 26 ? 7.592   -1.617  -6.306  1.00 0.00 ? 26 THR A HB   12 
ATOM 10219 H HG1  . THR A 1 26 ? 9.208   0.361   -7.510  1.00 0.00 ? 26 THR A HG1  12 
ATOM 10220 H HG21 . THR A 1 26 ? 10.495  -0.783  -6.074  1.00 0.00 ? 26 THR A HG21 12 
ATOM 10221 H HG22 . THR A 1 26 ? 9.794   -2.188  -5.270  1.00 0.00 ? 26 THR A HG22 12 
ATOM 10222 H HG23 . THR A 1 26 ? 9.240   -0.566  -4.856  1.00 0.00 ? 26 THR A HG23 12 
ATOM 10223 N N    . ILE A 1 27 ? 7.637   -4.291  -7.390  1.00 0.00 ? 27 ILE A N    12 
ATOM 10224 C CA   . ILE A 1 27 ? 7.413   -5.641  -6.882  1.00 0.00 ? 27 ILE A CA   12 
ATOM 10225 C C    . ILE A 1 27 ? 8.005   -6.683  -7.833  1.00 0.00 ? 27 ILE A C    12 
ATOM 10226 O O    . ILE A 1 27 ? 8.268   -7.818  -7.432  1.00 0.00 ? 27 ILE A O    12 
ATOM 10227 C CB   . ILE A 1 27 ? 5.904   -5.889  -6.672  1.00 0.00 ? 27 ILE A CB   12 
ATOM 10228 C CG1  . ILE A 1 27 ? 5.681   -6.554  -5.308  1.00 0.00 ? 27 ILE A CG1  12 
ATOM 10229 C CG2  . ILE A 1 27 ? 5.342   -6.796  -7.776  1.00 0.00 ? 27 ILE A CG2  12 
ATOM 10230 C CD1  . ILE A 1 27 ? 4.214   -6.975  -5.168  1.00 0.00 ? 27 ILE A CD1  12 
ATOM 10231 H H    . ILE A 1 27 ? 6.900   -3.805  -7.824  1.00 0.00 ? 27 ILE A H    12 
ATOM 10232 H HA   . ILE A 1 27 ? 7.912   -5.730  -5.928  1.00 0.00 ? 27 ILE A HA   12 
ATOM 10233 H HB   . ILE A 1 27 ? 5.385   -4.944  -6.695  1.00 0.00 ? 27 ILE A HB   12 
ATOM 10234 H HG12 . ILE A 1 27 ? 6.314   -7.424  -5.223  1.00 0.00 ? 27 ILE A HG12 12 
ATOM 10235 H HG13 . ILE A 1 27 ? 5.927   -5.854  -4.523  1.00 0.00 ? 27 ILE A HG13 12 
ATOM 10236 H HG21 . ILE A 1 27 ? 4.263   -6.782  -7.737  1.00 0.00 ? 27 ILE A HG21 12 
ATOM 10237 H HG22 . ILE A 1 27 ? 5.693   -7.806  -7.626  1.00 0.00 ? 27 ILE A HG22 12 
ATOM 10238 H HG23 . ILE A 1 27 ? 5.669   -6.438  -8.740  1.00 0.00 ? 27 ILE A HG23 12 
ATOM 10239 H HD11 . ILE A 1 27 ? 3.975   -7.102  -4.124  1.00 0.00 ? 27 ILE A HD11 12 
ATOM 10240 H HD12 . ILE A 1 27 ? 4.056   -7.907  -5.691  1.00 0.00 ? 27 ILE A HD12 12 
ATOM 10241 H HD13 . ILE A 1 27 ? 3.578   -6.212  -5.593  1.00 0.00 ? 27 ILE A HD13 12 
ATOM 10242 N N    . ASN A 1 28 ? 8.208   -6.296  -9.090  1.00 0.00 ? 28 ASN A N    12 
ATOM 10243 C CA   . ASN A 1 28 ? 8.764   -7.215  -10.082 1.00 0.00 ? 28 ASN A CA   12 
ATOM 10244 C C    . ASN A 1 28 ? 10.224  -6.875  -10.390 1.00 0.00 ? 28 ASN A C    12 
ATOM 10245 O O    . ASN A 1 28 ? 10.882  -7.578  -11.156 1.00 0.00 ? 28 ASN A O    12 
ATOM 10246 C CB   . ASN A 1 28 ? 7.921   -7.169  -11.369 1.00 0.00 ? 28 ASN A CB   12 
ATOM 10247 C CG   . ASN A 1 28 ? 8.664   -6.434  -12.479 1.00 0.00 ? 28 ASN A CG   12 
ATOM 10248 O OD1  . ASN A 1 28 ? 8.845   -6.974  -13.571 1.00 0.00 ? 28 ASN A OD1  12 
ATOM 10249 N ND2  . ASN A 1 28 ? 9.107   -5.227  -12.264 1.00 0.00 ? 28 ASN A ND2  12 
ATOM 10250 H H    . ASN A 1 28 ? 7.975   -5.381  -9.357  1.00 0.00 ? 28 ASN A H    12 
ATOM 10251 H HA   . ASN A 1 28 ? 8.727   -8.220  -9.684  1.00 0.00 ? 28 ASN A HA   12 
ATOM 10252 H HB2  . ASN A 1 28 ? 7.705   -8.176  -11.694 1.00 0.00 ? 28 ASN A HB2  12 
ATOM 10253 H HB3  . ASN A 1 28 ? 6.993   -6.657  -11.165 1.00 0.00 ? 28 ASN A HB3  12 
ATOM 10254 H HD21 . ASN A 1 28 ? 8.962   -4.800  -11.395 1.00 0.00 ? 28 ASN A HD21 12 
ATOM 10255 H HD22 . ASN A 1 28 ? 9.585   -4.747  -12.972 1.00 0.00 ? 28 ASN A HD22 12 
ATOM 10256 N N    . THR A 1 29 ? 10.725  -5.798  -9.786  1.00 0.00 ? 29 THR A N    12 
ATOM 10257 C CA   . THR A 1 29 ? 12.112  -5.385  -10.004 1.00 0.00 ? 29 THR A CA   12 
ATOM 10258 C C    . THR A 1 29 ? 12.901  -5.474  -8.704  1.00 0.00 ? 29 THR A C    12 
ATOM 10259 O O    . THR A 1 29 ? 13.994  -6.037  -8.665  1.00 0.00 ? 29 THR A O    12 
ATOM 10260 C CB   . THR A 1 29 ? 12.166  -3.945  -10.532 1.00 0.00 ? 29 THR A CB   12 
ATOM 10261 O OG1  . THR A 1 29 ? 11.408  -3.103  -9.675  1.00 0.00 ? 29 THR A OG1  12 
ATOM 10262 C CG2  . THR A 1 29 ? 11.591  -3.879  -11.956 1.00 0.00 ? 29 THR A CG2  12 
ATOM 10263 H H    . THR A 1 29 ? 10.157  -5.276  -9.180  1.00 0.00 ? 29 THR A H    12 
ATOM 10264 H HA   . THR A 1 29 ? 12.569  -6.040  -10.732 1.00 0.00 ? 29 THR A HA   12 
ATOM 10265 H HB   . THR A 1 29 ? 13.190  -3.609  -10.548 1.00 0.00 ? 29 THR A HB   12 
ATOM 10266 H HG1  . THR A 1 29 ? 11.090  -3.634  -8.943  1.00 0.00 ? 29 THR A HG1  12 
ATOM 10267 H HG21 . THR A 1 29 ? 12.260  -3.316  -12.589 1.00 0.00 ? 29 THR A HG21 12 
ATOM 10268 H HG22 . THR A 1 29 ? 10.627  -3.393  -11.931 1.00 0.00 ? 29 THR A HG22 12 
ATOM 10269 H HG23 . THR A 1 29 ? 11.477  -4.877  -12.353 1.00 0.00 ? 29 THR A HG23 12 
ATOM 10270 N N    . SER A 1 30 ? 12.335  -4.917  -7.638  1.00 0.00 ? 30 SER A N    12 
ATOM 10271 C CA   . SER A 1 30 ? 12.989  -4.940  -6.335  1.00 0.00 ? 30 SER A CA   12 
ATOM 10272 C C    . SER A 1 30 ? 12.529  -6.157  -5.539  1.00 0.00 ? 30 SER A C    12 
ATOM 10273 O O    . SER A 1 30 ? 11.546  -6.807  -5.894  1.00 0.00 ? 30 SER A O    12 
ATOM 10274 C CB   . SER A 1 30 ? 12.659  -3.656  -5.567  1.00 0.00 ? 30 SER A CB   12 
ATOM 10275 O OG   . SER A 1 30 ? 13.733  -2.736  -5.714  1.00 0.00 ? 30 SER A OG   12 
ATOM 10276 H H    . SER A 1 30 ? 11.459  -4.485  -7.728  1.00 0.00 ? 30 SER A H    12 
ATOM 10277 H HA   . SER A 1 30 ? 14.059  -4.996  -6.478  1.00 0.00 ? 30 SER A HA   12 
ATOM 10278 H HB2  . SER A 1 30 ? 11.761  -3.218  -5.966  1.00 0.00 ? 30 SER A HB2  12 
ATOM 10279 H HB3  . SER A 1 30 ? 12.510  -3.888  -4.521  1.00 0.00 ? 30 SER A HB3  12 
ATOM 10280 H HG   . SER A 1 30 ? 13.555  -1.981  -5.147  1.00 0.00 ? 30 SER A HG   12 
ATOM 10281 N N    . CYS A 1 31 ? 13.245  -6.461  -4.461  1.00 0.00 ? 31 CYS A N    12 
ATOM 10282 C CA   . CYS A 1 31 ? 12.892  -7.605  -3.627  1.00 0.00 ? 31 CYS A CA   12 
ATOM 10283 C C    . CYS A 1 31 ? 13.443  -7.434  -2.218  1.00 0.00 ? 31 CYS A C    12 
ATOM 10284 O O    . CYS A 1 31 ? 14.647  -7.257  -2.025  1.00 0.00 ? 31 CYS A O    12 
ATOM 10285 C CB   . CYS A 1 31 ? 13.449  -8.889  -4.242  1.00 0.00 ? 31 CYS A CB   12 
ATOM 10286 S SG   . CYS A 1 31 ? 12.907  -10.312 -3.261  1.00 0.00 ? 31 CYS A SG   12 
ATOM 10287 H H    . CYS A 1 31 ? 14.018  -5.909  -4.221  1.00 0.00 ? 31 CYS A H    12 
ATOM 10288 H HA   . CYS A 1 31 ? 11.817  -7.682  -3.575  1.00 0.00 ? 31 CYS A HA   12 
ATOM 10289 H HB2  . CYS A 1 31 ? 13.085  -8.991  -5.254  1.00 0.00 ? 31 CYS A HB2  12 
ATOM 10290 H HB3  . CYS A 1 31 ? 14.527  -8.847  -4.250  1.00 0.00 ? 31 CYS A HB3  12 
ATOM 10291 H HG   . CYS A 1 31 ? 12.243  -10.007 -2.638  1.00 0.00 ? 31 CYS A HG   12 
ATOM 10292 N N    . ASP A 1 32 ? 12.553  -7.494  -1.234  1.00 0.00 ? 32 ASP A N    12 
ATOM 10293 C CA   . ASP A 1 32 ? 12.950  -7.352  0.161   1.00 0.00 ? 32 ASP A CA   12 
ATOM 10294 C C    . ASP A 1 32 ? 11.750  -7.594  1.071   1.00 0.00 ? 32 ASP A C    12 
ATOM 10295 O O    . ASP A 1 32 ? 10.677  -7.030  0.859   1.00 0.00 ? 32 ASP A O    12 
ATOM 10296 C CB   . ASP A 1 32 ? 13.520  -5.950  0.414   1.00 0.00 ? 32 ASP A CB   12 
ATOM 10297 C CG   . ASP A 1 32 ? 14.630  -6.012  1.460   1.00 0.00 ? 32 ASP A CG   12 
ATOM 10298 O OD1  . ASP A 1 32 ? 14.522  -6.828  2.360   1.00 0.00 ? 32 ASP A OD1  12 
ATOM 10299 O OD2  . ASP A 1 32 ? 15.570  -5.243  1.344   1.00 0.00 ? 32 ASP A OD2  12 
ATOM 10300 H H    . ASP A 1 32 ? 11.609  -7.640  -1.451  1.00 0.00 ? 32 ASP A H    12 
ATOM 10301 H HA   . ASP A 1 32 ? 13.710  -8.088  0.382   1.00 0.00 ? 32 ASP A HA   12 
ATOM 10302 H HB2  . ASP A 1 32 ? 13.922  -5.556  -0.509  1.00 0.00 ? 32 ASP A HB2  12 
ATOM 10303 H HB3  . ASP A 1 32 ? 12.736  -5.298  0.766   1.00 0.00 ? 32 ASP A HB3  12 
ATOM 10304 N N    . ILE A 1 33 ? 11.937  -8.436  2.083   1.00 0.00 ? 33 ILE A N    12 
ATOM 10305 C CA   . ILE A 1 33 ? 10.861  -8.745  3.016   1.00 0.00 ? 33 ILE A CA   12 
ATOM 10306 C C    . ILE A 1 33 ? 10.025  -7.500  3.310   1.00 0.00 ? 33 ILE A C    12 
ATOM 10307 O O    . ILE A 1 33 ? 8.803   -7.577  3.435   1.00 0.00 ? 33 ILE A O    12 
ATOM 10308 C CB   . ILE A 1 33 ? 11.446  -9.286  4.326   1.00 0.00 ? 33 ILE A CB   12 
ATOM 10309 C CG1  . ILE A 1 33 ? 12.698  -8.479  4.703   1.00 0.00 ? 33 ILE A CG1  12 
ATOM 10310 C CG2  . ILE A 1 33 ? 11.822  -10.760 4.148   1.00 0.00 ? 33 ILE A CG2  12 
ATOM 10311 C CD1  . ILE A 1 33 ? 12.841  -8.425  6.226   1.00 0.00 ? 33 ILE A CD1  12 
ATOM 10312 H H    . ILE A 1 33 ? 12.815  -8.857  2.202   1.00 0.00 ? 33 ILE A H    12 
ATOM 10313 H HA   . ILE A 1 33 ? 10.223  -9.498  2.580   1.00 0.00 ? 33 ILE A HA   12 
ATOM 10314 H HB   . ILE A 1 33 ? 10.707  -9.199  5.111   1.00 0.00 ? 33 ILE A HB   12 
ATOM 10315 H HG12 . ILE A 1 33 ? 13.573  -8.948  4.276   1.00 0.00 ? 33 ILE A HG12 12 
ATOM 10316 H HG13 . ILE A 1 33 ? 12.611  -7.473  4.319   1.00 0.00 ? 33 ILE A HG13 12 
ATOM 10317 H HG21 . ILE A 1 33 ? 12.539  -10.854 3.347   1.00 0.00 ? 33 ILE A HG21 12 
ATOM 10318 H HG22 . ILE A 1 33 ? 10.937  -11.331 3.906   1.00 0.00 ? 33 ILE A HG22 12 
ATOM 10319 H HG23 . ILE A 1 33 ? 12.253  -11.135 5.064   1.00 0.00 ? 33 ILE A HG23 12 
ATOM 10320 H HD11 . ILE A 1 33 ? 13.850  -8.140  6.484   1.00 0.00 ? 33 ILE A HD11 12 
ATOM 10321 H HD12 . ILE A 1 33 ? 12.623  -9.398  6.643   1.00 0.00 ? 33 ILE A HD12 12 
ATOM 10322 H HD13 . ILE A 1 33 ? 12.148  -7.699  6.627   1.00 0.00 ? 33 ILE A HD13 12 
ATOM 10323 N N    . GLU A 1 34 ? 10.695  -6.357  3.421   1.00 0.00 ? 34 GLU A N    12 
ATOM 10324 C CA   . GLU A 1 34 ? 10.007  -5.103  3.706   1.00 0.00 ? 34 GLU A CA   12 
ATOM 10325 C C    . GLU A 1 34 ? 9.283   -4.580  2.466   1.00 0.00 ? 34 GLU A C    12 
ATOM 10326 O O    . GLU A 1 34 ? 8.092   -4.271  2.521   1.00 0.00 ? 34 GLU A O    12 
ATOM 10327 C CB   . GLU A 1 34 ? 11.016  -4.059  4.199   1.00 0.00 ? 34 GLU A CB   12 
ATOM 10328 C CG   . GLU A 1 34 ? 12.143  -4.758  4.968   1.00 0.00 ? 34 GLU A CG   12 
ATOM 10329 C CD   . GLU A 1 34 ? 12.794  -3.785  5.946   1.00 0.00 ? 34 GLU A CD   12 
ATOM 10330 O OE1  . GLU A 1 34 ? 12.224  -3.564  7.001   1.00 0.00 ? 34 GLU A OE1  12 
ATOM 10331 O OE2  . GLU A 1 34 ? 13.855  -3.273  5.625   1.00 0.00 ? 34 GLU A OE2  12 
ATOM 10332 H H    . GLU A 1 34 ? 11.669  -6.359  3.313   1.00 0.00 ? 34 GLU A H    12 
ATOM 10333 H HA   . GLU A 1 34 ? 9.281   -5.276  4.486   1.00 0.00 ? 34 GLU A HA   12 
ATOM 10334 H HB2  . GLU A 1 34 ? 11.431  -3.530  3.353   1.00 0.00 ? 34 GLU A HB2  12 
ATOM 10335 H HB3  . GLU A 1 34 ? 10.517  -3.359  4.853   1.00 0.00 ? 34 GLU A HB3  12 
ATOM 10336 H HG2  . GLU A 1 34 ? 11.740  -5.596  5.515   1.00 0.00 ? 34 GLU A HG2  12 
ATOM 10337 H HG3  . GLU A 1 34 ? 12.887  -5.110  4.268   1.00 0.00 ? 34 GLU A HG3  12 
ATOM 10338 N N    . LEU A 1 35 ? 10.003  -4.481  1.353   1.00 0.00 ? 35 LEU A N    12 
ATOM 10339 C CA   . LEU A 1 35 ? 9.403   -3.990  0.116   1.00 0.00 ? 35 LEU A CA   12 
ATOM 10340 C C    . LEU A 1 35 ? 8.156   -4.803  -0.219  1.00 0.00 ? 35 LEU A C    12 
ATOM 10341 O O    . LEU A 1 35 ? 7.083   -4.246  -0.452  1.00 0.00 ? 35 LEU A O    12 
ATOM 10342 C CB   . LEU A 1 35 ? 10.413  -4.097  -1.040  1.00 0.00 ? 35 LEU A CB   12 
ATOM 10343 C CG   . LEU A 1 35 ? 10.242  -2.933  -2.040  1.00 0.00 ? 35 LEU A CG   12 
ATOM 10344 C CD1  . LEU A 1 35 ? 8.755   -2.672  -2.318  1.00 0.00 ? 35 LEU A CD1  12 
ATOM 10345 C CD2  . LEU A 1 35 ? 10.886  -1.653  -1.486  1.00 0.00 ? 35 LEU A CD2  12 
ATOM 10346 H H    . LEU A 1 35 ? 10.949  -4.739  1.364   1.00 0.00 ? 35 LEU A H    12 
ATOM 10347 H HA   . LEU A 1 35 ? 9.127   -2.956  0.253   1.00 0.00 ? 35 LEU A HA   12 
ATOM 10348 H HB2  . LEU A 1 35 ? 11.414  -4.076  -0.639  1.00 0.00 ? 35 LEU A HB2  12 
ATOM 10349 H HB3  . LEU A 1 35 ? 10.264  -5.032  -1.560  1.00 0.00 ? 35 LEU A HB3  12 
ATOM 10350 H HG   . LEU A 1 35 ? 10.728  -3.197  -2.968  1.00 0.00 ? 35 LEU A HG   12 
ATOM 10351 H HD11 . LEU A 1 35 ? 8.656   -2.127  -3.244  1.00 0.00 ? 35 LEU A HD11 12 
ATOM 10352 H HD12 . LEU A 1 35 ? 8.332   -2.083  -1.515  1.00 0.00 ? 35 LEU A HD12 12 
ATOM 10353 H HD13 . LEU A 1 35 ? 8.232   -3.610  -2.397  1.00 0.00 ? 35 LEU A HD13 12 
ATOM 10354 H HD21 . LEU A 1 35 ? 10.123  -1.021  -1.056  1.00 0.00 ? 35 LEU A HD21 12 
ATOM 10355 H HD22 . LEU A 1 35 ? 11.376  -1.123  -2.289  1.00 0.00 ? 35 LEU A HD22 12 
ATOM 10356 H HD23 . LEU A 1 35 ? 11.613  -1.904  -0.728  1.00 0.00 ? 35 LEU A HD23 12 
ATOM 10357 N N    . LEU A 1 36 ? 8.309   -6.124  -0.247  1.00 0.00 ? 36 LEU A N    12 
ATOM 10358 C CA   . LEU A 1 36 ? 7.194   -7.010  -0.561  1.00 0.00 ? 36 LEU A CA   12 
ATOM 10359 C C    . LEU A 1 36 ? 6.111   -6.923  0.508   1.00 0.00 ? 36 LEU A C    12 
ATOM 10360 O O    . LEU A 1 36 ? 4.933   -6.749  0.194   1.00 0.00 ? 36 LEU A O    12 
ATOM 10361 C CB   . LEU A 1 36 ? 7.691   -8.453  -0.677  1.00 0.00 ? 36 LEU A CB   12 
ATOM 10362 C CG   . LEU A 1 36 ? 8.938   -8.498  -1.564  1.00 0.00 ? 36 LEU A CG   12 
ATOM 10363 C CD1  . LEU A 1 36 ? 9.382   -9.950  -1.744  1.00 0.00 ? 36 LEU A CD1  12 
ATOM 10364 C CD2  . LEU A 1 36 ? 8.620   -7.886  -2.933  1.00 0.00 ? 36 LEU A CD2  12 
ATOM 10365 H H    . LEU A 1 36 ? 9.189   -6.509  -0.056  1.00 0.00 ? 36 LEU A H    12 
ATOM 10366 H HA   . LEU A 1 36 ? 6.771   -6.713  -1.509  1.00 0.00 ? 36 LEU A HA   12 
ATOM 10367 H HB2  . LEU A 1 36 ? 7.932   -8.829  0.307   1.00 0.00 ? 36 LEU A HB2  12 
ATOM 10368 H HB3  . LEU A 1 36 ? 6.917   -9.065  -1.117  1.00 0.00 ? 36 LEU A HB3  12 
ATOM 10369 H HG   . LEU A 1 36 ? 9.732   -7.936  -1.093  1.00 0.00 ? 36 LEU A HG   12 
ATOM 10370 H HD11 . LEU A 1 36 ? 8.668   -10.471 -2.364  1.00 0.00 ? 36 LEU A HD11 12 
ATOM 10371 H HD12 . LEU A 1 36 ? 9.440   -10.433 -0.779  1.00 0.00 ? 36 LEU A HD12 12 
ATOM 10372 H HD13 . LEU A 1 36 ? 10.353  -9.975  -2.216  1.00 0.00 ? 36 LEU A HD13 12 
ATOM 10373 H HD21 . LEU A 1 36 ? 7.636   -8.201  -3.249  1.00 0.00 ? 36 LEU A HD21 12 
ATOM 10374 H HD22 . LEU A 1 36 ? 9.352   -8.218  -3.655  1.00 0.00 ? 36 LEU A HD22 12 
ATOM 10375 H HD23 . LEU A 1 36 ? 8.648   -6.810  -2.862  1.00 0.00 ? 36 LEU A HD23 12 
ATOM 10376 N N    . ALA A 1 37 ? 6.508   -7.040  1.772   1.00 0.00 ? 37 ALA A N    12 
ATOM 10377 C CA   . ALA A 1 37 ? 5.545   -6.970  2.865   1.00 0.00 ? 37 ALA A CA   12 
ATOM 10378 C C    . ALA A 1 37 ? 4.710   -5.701  2.747   1.00 0.00 ? 37 ALA A C    12 
ATOM 10379 O O    . ALA A 1 37 ? 3.481   -5.744  2.813   1.00 0.00 ? 37 ALA A O    12 
ATOM 10380 C CB   . ALA A 1 37 ? 6.272   -6.982  4.211   1.00 0.00 ? 37 ALA A CB   12 
ATOM 10381 H H    . ALA A 1 37 ? 7.458   -7.177  1.971   1.00 0.00 ? 37 ALA A H    12 
ATOM 10382 H HA   . ALA A 1 37 ? 4.891   -7.828  2.814   1.00 0.00 ? 37 ALA A HA   12 
ATOM 10383 H HB1  . ALA A 1 37 ? 5.571   -6.758  5.001   1.00 0.00 ? 37 ALA A HB1  12 
ATOM 10384 H HB2  . ALA A 1 37 ? 7.056   -6.238  4.204   1.00 0.00 ? 37 ALA A HB2  12 
ATOM 10385 H HB3  . ALA A 1 37 ? 6.703   -7.957  4.378   1.00 0.00 ? 37 ALA A HB3  12 
ATOM 10386 N N    . ALA A 1 38 ? 5.387   -4.572  2.567   1.00 0.00 ? 38 ALA A N    12 
ATOM 10387 C CA   . ALA A 1 38 ? 4.698   -3.294  2.435   1.00 0.00 ? 38 ALA A CA   12 
ATOM 10388 C C    . ALA A 1 38 ? 3.839   -3.286  1.173   1.00 0.00 ? 38 ALA A C    12 
ATOM 10389 O O    . ALA A 1 38 ? 2.690   -2.846  1.198   1.00 0.00 ? 38 ALA A O    12 
ATOM 10390 C CB   . ALA A 1 38 ? 5.718   -2.156  2.376   1.00 0.00 ? 38 ALA A CB   12 
ATOM 10391 H H    . ALA A 1 38 ? 6.365   -4.599  2.518   1.00 0.00 ? 38 ALA A H    12 
ATOM 10392 H HA   . ALA A 1 38 ? 4.061   -3.150  3.294   1.00 0.00 ? 38 ALA A HA   12 
ATOM 10393 H HB1  . ALA A 1 38 ? 6.092   -2.055  1.367   1.00 0.00 ? 38 ALA A HB1  12 
ATOM 10394 H HB2  . ALA A 1 38 ? 6.540   -2.375  3.043   1.00 0.00 ? 38 ALA A HB2  12 
ATOM 10395 H HB3  . ALA A 1 38 ? 5.247   -1.233  2.680   1.00 0.00 ? 38 ALA A HB3  12 
ATOM 10396 N N    . CYS A 1 39 ? 4.404   -3.778  0.074   1.00 0.00 ? 39 CYS A N    12 
ATOM 10397 C CA   . CYS A 1 39 ? 3.676   -3.826  -1.188  1.00 0.00 ? 39 CYS A CA   12 
ATOM 10398 C C    . CYS A 1 39 ? 2.369   -4.593  -1.014  1.00 0.00 ? 39 CYS A C    12 
ATOM 10399 O O    . CYS A 1 39 ? 1.301   -4.118  -1.400  1.00 0.00 ? 39 CYS A O    12 
ATOM 10400 C CB   . CYS A 1 39 ? 4.528   -4.506  -2.264  1.00 0.00 ? 39 CYS A CB   12 
ATOM 10401 S SG   . CYS A 1 39 ? 3.834   -4.149  -3.896  1.00 0.00 ? 39 CYS A SG   12 
ATOM 10402 H H    . CYS A 1 39 ? 5.321   -4.120  0.115   1.00 0.00 ? 39 CYS A H    12 
ATOM 10403 H HA   . CYS A 1 39 ? 3.452   -2.818  -1.503  1.00 0.00 ? 39 CYS A HA   12 
ATOM 10404 H HB2  . CYS A 1 39 ? 5.540   -4.132  -2.213  1.00 0.00 ? 39 CYS A HB2  12 
ATOM 10405 H HB3  . CYS A 1 39 ? 4.530   -5.573  -2.099  1.00 0.00 ? 39 CYS A HB3  12 
ATOM 10406 H HG   . CYS A 1 39 ? 4.283   -4.704  -4.537  1.00 0.00 ? 39 CYS A HG   12 
ATOM 10407 N N    . ARG A 1 40 ? 2.464   -5.782  -0.426  1.00 0.00 ? 40 ARG A N    12 
ATOM 10408 C CA   . ARG A 1 40 ? 1.285   -6.608  -0.200  1.00 0.00 ? 40 ARG A CA   12 
ATOM 10409 C C    . ARG A 1 40 ? 0.275   -5.862  0.665   1.00 0.00 ? 40 ARG A C    12 
ATOM 10410 O O    . ARG A 1 40 ? -0.919  -5.838  0.362   1.00 0.00 ? 40 ARG A O    12 
ATOM 10411 C CB   . ARG A 1 40 ? 1.684   -7.914  0.488   1.00 0.00 ? 40 ARG A CB   12 
ATOM 10412 C CG   . ARG A 1 40 ? 0.449   -8.802  0.656   1.00 0.00 ? 40 ARG A CG   12 
ATOM 10413 C CD   . ARG A 1 40 ? 0.883   -10.210 1.065   1.00 0.00 ? 40 ARG A CD   12 
ATOM 10414 N NE   . ARG A 1 40 ? 1.484   -10.902 -0.071  1.00 0.00 ? 40 ARG A NE   12 
ATOM 10415 C CZ   . ARG A 1 40 ? 2.183   -12.019 0.097   1.00 0.00 ? 40 ARG A CZ   12 
ATOM 10416 N NH1  . ARG A 1 40 ? 2.342   -12.516 1.294   1.00 0.00 ? 40 ARG A NH1  12 
ATOM 10417 N NH2  . ARG A 1 40 ? 2.711   -12.620 -0.934  1.00 0.00 ? 40 ARG A NH2  12 
ATOM 10418 H H    . ARG A 1 40 ? 3.343   -6.108  -0.138  1.00 0.00 ? 40 ARG A H    12 
ATOM 10419 H HA   . ARG A 1 40 ? 0.830   -6.839  -1.152  1.00 0.00 ? 40 ARG A HA   12 
ATOM 10420 H HB2  . ARG A 1 40 ? 2.419   -8.428  -0.116  1.00 0.00 ? 40 ARG A HB2  12 
ATOM 10421 H HB3  . ARG A 1 40 ? 2.104   -7.697  1.458   1.00 0.00 ? 40 ARG A HB3  12 
ATOM 10422 H HG2  . ARG A 1 40 ? -0.191  -8.385  1.421   1.00 0.00 ? 40 ARG A HG2  12 
ATOM 10423 H HG3  . ARG A 1 40 ? -0.090  -8.850  -0.279  1.00 0.00 ? 40 ARG A HG3  12 
ATOM 10424 H HD2  . ARG A 1 40 ? 1.606   -10.143 1.864   1.00 0.00 ? 40 ARG A HD2  12 
ATOM 10425 H HD3  . ARG A 1 40 ? 0.022   -10.764 1.409   1.00 0.00 ? 40 ARG A HD3  12 
ATOM 10426 H HE   . ARG A 1 40 ? 1.369   -10.536 -0.973  1.00 0.00 ? 40 ARG A HE   12 
ATOM 10427 H HH11 . ARG A 1 40 ? 1.937   -12.056 2.084   1.00 0.00 ? 40 ARG A HH11 12 
ATOM 10428 H HH12 . ARG A 1 40 ? 2.868   -13.357 1.420   1.00 0.00 ? 40 ARG A HH12 12 
ATOM 10429 H HH21 . ARG A 1 40 ? 2.590   -12.238 -1.851  1.00 0.00 ? 40 ARG A HH21 12 
ATOM 10430 H HH22 . ARG A 1 40 ? 3.238   -13.460 -0.809  1.00 0.00 ? 40 ARG A HH22 12 
ATOM 10431 N N    . GLU A 1 41 ? 0.761   -5.251  1.740   1.00 0.00 ? 41 GLU A N    12 
ATOM 10432 C CA   . GLU A 1 41 ? -0.110  -4.504  2.639   1.00 0.00 ? 41 GLU A CA   12 
ATOM 10433 C C    . GLU A 1 41 ? -0.897  -3.454  1.860   1.00 0.00 ? 41 GLU A C    12 
ATOM 10434 O O    . GLU A 1 41 ? -2.089  -3.257  2.094   1.00 0.00 ? 41 GLU A O    12 
ATOM 10435 C CB   . GLU A 1 41 ? 0.720   -3.821  3.727   1.00 0.00 ? 41 GLU A CB   12 
ATOM 10436 C CG   . GLU A 1 41 ? 1.195   -4.866  4.739   1.00 0.00 ? 41 GLU A CG   12 
ATOM 10437 C CD   . GLU A 1 41 ? 0.031   -5.299  5.627   1.00 0.00 ? 41 GLU A CD   12 
ATOM 10438 O OE1  . GLU A 1 41 ? -0.505  -4.452  6.323   1.00 0.00 ? 41 GLU A OE1  12 
ATOM 10439 O OE2  . GLU A 1 41 ? -0.307  -6.471  5.594   1.00 0.00 ? 41 GLU A OE2  12 
ATOM 10440 H H    . GLU A 1 41 ? 1.722   -5.303  1.931   1.00 0.00 ? 41 GLU A H    12 
ATOM 10441 H HA   . GLU A 1 41 ? -0.804  -5.188  3.105   1.00 0.00 ? 41 GLU A HA   12 
ATOM 10442 H HB2  . GLU A 1 41 ? 1.577   -3.340  3.277   1.00 0.00 ? 41 GLU A HB2  12 
ATOM 10443 H HB3  . GLU A 1 41 ? 0.116   -3.083  4.232   1.00 0.00 ? 41 GLU A HB3  12 
ATOM 10444 H HG2  . GLU A 1 41 ? 1.583   -5.725  4.213   1.00 0.00 ? 41 GLU A HG2  12 
ATOM 10445 H HG3  . GLU A 1 41 ? 1.973   -4.441  5.354   1.00 0.00 ? 41 GLU A HG3  12 
ATOM 10446 N N    . GLU A 1 42 ? -0.220  -2.784  0.932   1.00 0.00 ? 42 GLU A N    12 
ATOM 10447 C CA   . GLU A 1 42 ? -0.866  -1.759  0.122   1.00 0.00 ? 42 GLU A CA   12 
ATOM 10448 C C    . GLU A 1 42 ? -1.948  -2.379  -0.757  1.00 0.00 ? 42 GLU A C    12 
ATOM 10449 O O    . GLU A 1 42 ? -3.080  -1.894  -0.800  1.00 0.00 ? 42 GLU A O    12 
ATOM 10450 C CB   . GLU A 1 42 ? 0.169   -1.057  -0.760  1.00 0.00 ? 42 GLU A CB   12 
ATOM 10451 C CG   . GLU A 1 42 ? 1.118   -0.241  0.120   1.00 0.00 ? 42 GLU A CG   12 
ATOM 10452 C CD   . GLU A 1 42 ? 0.400   0.990   0.661   1.00 0.00 ? 42 GLU A CD   12 
ATOM 10453 O OE1  . GLU A 1 42 ? -0.677  1.285   0.170   1.00 0.00 ? 42 GLU A OE1  12 
ATOM 10454 O OE2  . GLU A 1 42 ? 0.937   1.619   1.558   1.00 0.00 ? 42 GLU A OE2  12 
ATOM 10455 H H    . GLU A 1 42 ? 0.728   -2.985  0.789   1.00 0.00 ? 42 GLU A H    12 
ATOM 10456 H HA   . GLU A 1 42 ? -1.321  -1.030  0.775   1.00 0.00 ? 42 GLU A HA   12 
ATOM 10457 H HB2  . GLU A 1 42 ? 0.733   -1.797  -1.310  1.00 0.00 ? 42 GLU A HB2  12 
ATOM 10458 H HB3  . GLU A 1 42 ? -0.333  -0.399  -1.451  1.00 0.00 ? 42 GLU A HB3  12 
ATOM 10459 H HG2  . GLU A 1 42 ? 1.455   -0.852  0.947   1.00 0.00 ? 42 GLU A HG2  12 
ATOM 10460 H HG3  . GLU A 1 42 ? 1.971   0.070   -0.465  1.00 0.00 ? 42 GLU A HG3  12 
ATOM 10461 N N    . PHE A 1 43 ? -1.596  -3.456  -1.453  1.00 0.00 ? 43 PHE A N    12 
ATOM 10462 C CA   . PHE A 1 43 ? -2.546  -4.135  -2.324  1.00 0.00 ? 43 PHE A CA   12 
ATOM 10463 C C    . PHE A 1 43 ? -3.798  -4.521  -1.540  1.00 0.00 ? 43 PHE A C    12 
ATOM 10464 O O    . PHE A 1 43 ? -4.917  -4.196  -1.938  1.00 0.00 ? 43 PHE A O    12 
ATOM 10465 C CB   . PHE A 1 43 ? -1.898  -5.392  -2.925  1.00 0.00 ? 43 PHE A CB   12 
ATOM 10466 C CG   . PHE A 1 43 ? -1.500  -5.133  -4.361  1.00 0.00 ? 43 PHE A CG   12 
ATOM 10467 C CD1  . PHE A 1 43 ? -0.804  -3.964  -4.695  1.00 0.00 ? 43 PHE A CD1  12 
ATOM 10468 C CD2  . PHE A 1 43 ? -1.829  -6.059  -5.359  1.00 0.00 ? 43 PHE A CD2  12 
ATOM 10469 C CE1  . PHE A 1 43 ? -0.437  -3.723  -6.024  1.00 0.00 ? 43 PHE A CE1  12 
ATOM 10470 C CE2  . PHE A 1 43 ? -1.462  -5.818  -6.687  1.00 0.00 ? 43 PHE A CE2  12 
ATOM 10471 C CZ   . PHE A 1 43 ? -0.766  -4.651  -7.020  1.00 0.00 ? 43 PHE A CZ   12 
ATOM 10472 H H    . PHE A 1 43 ? -0.680  -3.798  -1.377  1.00 0.00 ? 43 PHE A H    12 
ATOM 10473 H HA   . PHE A 1 43 ? -2.829  -3.467  -3.124  1.00 0.00 ? 43 PHE A HA   12 
ATOM 10474 H HB2  . PHE A 1 43 ? -1.019  -5.649  -2.351  1.00 0.00 ? 43 PHE A HB2  12 
ATOM 10475 H HB3  . PHE A 1 43 ? -2.599  -6.215  -2.892  1.00 0.00 ? 43 PHE A HB3  12 
ATOM 10476 H HD1  . PHE A 1 43 ? -0.550  -3.248  -3.927  1.00 0.00 ? 43 PHE A HD1  12 
ATOM 10477 H HD2  . PHE A 1 43 ? -2.366  -6.961  -5.101  1.00 0.00 ? 43 PHE A HD2  12 
ATOM 10478 H HE1  . PHE A 1 43 ? 0.100   -2.823  -6.282  1.00 0.00 ? 43 PHE A HE1  12 
ATOM 10479 H HE2  . PHE A 1 43 ? -1.714  -6.533  -7.456  1.00 0.00 ? 43 PHE A HE2  12 
ATOM 10480 H HZ   . PHE A 1 43 ? -0.482  -4.465  -8.046  1.00 0.00 ? 43 PHE A HZ   12 
ATOM 10481 N N    . HIS A 1 44 ? -3.601  -5.216  -0.424  1.00 0.00 ? 44 HIS A N    12 
ATOM 10482 C CA   . HIS A 1 44 ? -4.720  -5.641  0.409   1.00 0.00 ? 44 HIS A CA   12 
ATOM 10483 C C    . HIS A 1 44 ? -5.576  -4.441  0.803   1.00 0.00 ? 44 HIS A C    12 
ATOM 10484 O O    . HIS A 1 44 ? -6.800  -4.469  0.672   1.00 0.00 ? 44 HIS A O    12 
ATOM 10485 C CB   . HIS A 1 44 ? -4.201  -6.336  1.668   1.00 0.00 ? 44 HIS A CB   12 
ATOM 10486 C CG   . HIS A 1 44 ? -5.353  -6.944  2.417   1.00 0.00 ? 44 HIS A CG   12 
ATOM 10487 N ND1  . HIS A 1 44 ? -6.501  -6.227  2.716   1.00 0.00 ? 44 HIS A ND1  12 
ATOM 10488 C CD2  . HIS A 1 44 ? -5.550  -8.200  2.937   1.00 0.00 ? 44 HIS A CD2  12 
ATOM 10489 C CE1  . HIS A 1 44 ? -7.330  -7.049  3.387   1.00 0.00 ? 44 HIS A CE1  12 
ATOM 10490 N NE2  . HIS A 1 44 ? -6.799  -8.264  3.547   1.00 0.00 ? 44 HIS A NE2  12 
ATOM 10491 H H    . HIS A 1 44 ? -2.687  -5.446  -0.156  1.00 0.00 ? 44 HIS A H    12 
ATOM 10492 H HA   . HIS A 1 44 ? -5.328  -6.336  -0.149  1.00 0.00 ? 44 HIS A HA   12 
ATOM 10493 H HB2  . HIS A 1 44 ? -3.504  -7.113  1.387   1.00 0.00 ? 44 HIS A HB2  12 
ATOM 10494 H HB3  . HIS A 1 44 ? -3.702  -5.615  2.298   1.00 0.00 ? 44 HIS A HB3  12 
ATOM 10495 H HD2  . HIS A 1 44 ? -4.844  -9.015  2.879   1.00 0.00 ? 44 HIS A HD2  12 
ATOM 10496 H HE1  . HIS A 1 44 ? -8.306  -6.760  3.750   1.00 0.00 ? 44 HIS A HE1  12 
ATOM 10497 H HE2  . HIS A 1 44 ? -7.202  -9.034  3.999   1.00 0.00 ? 44 HIS A HE2  12 
ATOM 10498 N N    . ARG A 1 45 ? -4.925  -3.390  1.288   1.00 0.00 ? 45 ARG A N    12 
ATOM 10499 C CA   . ARG A 1 45 ? -5.636  -2.186  1.698   1.00 0.00 ? 45 ARG A CA   12 
ATOM 10500 C C    . ARG A 1 45 ? -6.389  -1.580  0.517   1.00 0.00 ? 45 ARG A C    12 
ATOM 10501 O O    . ARG A 1 45 ? -7.597  -1.351  0.591   1.00 0.00 ? 45 ARG A O    12 
ATOM 10502 C CB   . ARG A 1 45 ? -4.648  -1.159  2.257   1.00 0.00 ? 45 ARG A CB   12 
ATOM 10503 C CG   . ARG A 1 45 ? -5.416  -0.056  2.989   1.00 0.00 ? 45 ARG A CG   12 
ATOM 10504 C CD   . ARG A 1 45 ? -4.447  1.056   3.397   1.00 0.00 ? 45 ARG A CD   12 
ATOM 10505 N NE   . ARG A 1 45 ? -4.011  1.801   2.223   1.00 0.00 ? 45 ARG A NE   12 
ATOM 10506 C CZ   . ARG A 1 45 ? -3.494  3.021   2.335   1.00 0.00 ? 45 ARG A CZ   12 
ATOM 10507 N NH1  . ARG A 1 45 ? -3.370  3.571   3.512   1.00 0.00 ? 45 ARG A NH1  12 
ATOM 10508 N NH2  . ARG A 1 45 ? -3.110  3.668   1.269   1.00 0.00 ? 45 ARG A NH2  12 
ATOM 10509 H H    . ARG A 1 45 ? -3.948  -3.423  1.370   1.00 0.00 ? 45 ARG A H    12 
ATOM 10510 H HA   . ARG A 1 45 ? -6.345  -2.443  2.471   1.00 0.00 ? 45 ARG A HA   12 
ATOM 10511 H HB2  . ARG A 1 45 ? -3.973  -1.646  2.945   1.00 0.00 ? 45 ARG A HB2  12 
ATOM 10512 H HB3  . ARG A 1 45 ? -4.084  -0.724  1.445   1.00 0.00 ? 45 ARG A HB3  12 
ATOM 10513 H HG2  . ARG A 1 45 ? -6.174  0.349   2.335   1.00 0.00 ? 45 ARG A HG2  12 
ATOM 10514 H HG3  . ARG A 1 45 ? -5.882  -0.467  3.871   1.00 0.00 ? 45 ARG A HG3  12 
ATOM 10515 H HD2  . ARG A 1 45 ? -4.943  1.728   4.081   1.00 0.00 ? 45 ARG A HD2  12 
ATOM 10516 H HD3  . ARG A 1 45 ? -3.589  0.619   3.886   1.00 0.00 ? 45 ARG A HD3  12 
ATOM 10517 H HE   . ARG A 1 45 ? -4.098  1.396   1.334   1.00 0.00 ? 45 ARG A HE   12 
ATOM 10518 H HH11 . ARG A 1 45 ? -3.665  3.075   4.329   1.00 0.00 ? 45 ARG A HH11 12 
ATOM 10519 H HH12 . ARG A 1 45 ? -2.983  4.488   3.597   1.00 0.00 ? 45 ARG A HH12 12 
ATOM 10520 H HH21 . ARG A 1 45 ? -3.204  3.247   0.368   1.00 0.00 ? 45 ARG A HH21 12 
ATOM 10521 H HH22 . ARG A 1 45 ? -2.722  4.587   1.354   1.00 0.00 ? 45 ARG A HH22 12 
ATOM 10522 N N    . ARG A 1 46 ? -5.668  -1.327  -0.570  1.00 0.00 ? 46 ARG A N    12 
ATOM 10523 C CA   . ARG A 1 46 ? -6.279  -0.748  -1.761  1.00 0.00 ? 46 ARG A CA   12 
ATOM 10524 C C    . ARG A 1 46 ? -7.530  -1.531  -2.152  1.00 0.00 ? 46 ARG A C    12 
ATOM 10525 O O    . ARG A 1 46 ? -8.544  -0.949  -2.536  1.00 0.00 ? 46 ARG A O    12 
ATOM 10526 C CB   . ARG A 1 46 ? -5.277  -0.766  -2.920  1.00 0.00 ? 46 ARG A CB   12 
ATOM 10527 C CG   . ARG A 1 46 ? -5.887  -0.087  -4.153  1.00 0.00 ? 46 ARG A CG   12 
ATOM 10528 C CD   . ARG A 1 46 ? -6.181  1.386   -3.850  1.00 0.00 ? 46 ARG A CD   12 
ATOM 10529 N NE   . ARG A 1 46 ? -6.116  2.173   -5.076  1.00 0.00 ? 46 ARG A NE   12 
ATOM 10530 C CZ   . ARG A 1 46 ? -6.265  3.494   -5.052  1.00 0.00 ? 46 ARG A CZ   12 
ATOM 10531 N NH1  . ARG A 1 46 ? -6.474  4.107   -3.919  1.00 0.00 ? 46 ARG A NH1  12 
ATOM 10532 N NH2  . ARG A 1 46 ? -6.203  4.178   -6.161  1.00 0.00 ? 46 ARG A NH2  12 
ATOM 10533 H H    . ARG A 1 46 ? -4.710  -1.530  -0.571  1.00 0.00 ? 46 ARG A H    12 
ATOM 10534 H HA   . ARG A 1 46 ? -6.555  0.272   -1.552  1.00 0.00 ? 46 ARG A HA   12 
ATOM 10535 H HB2  . ARG A 1 46 ? -4.380  -0.238  -2.626  1.00 0.00 ? 46 ARG A HB2  12 
ATOM 10536 H HB3  . ARG A 1 46 ? -5.027  -1.788  -3.163  1.00 0.00 ? 46 ARG A HB3  12 
ATOM 10537 H HG2  . ARG A 1 46 ? -5.192  -0.152  -4.977  1.00 0.00 ? 46 ARG A HG2  12 
ATOM 10538 H HG3  . ARG A 1 46 ? -6.806  -0.588  -4.422  1.00 0.00 ? 46 ARG A HG3  12 
ATOM 10539 H HD2  . ARG A 1 46 ? -7.169  1.475   -3.424  1.00 0.00 ? 46 ARG A HD2  12 
ATOM 10540 H HD3  . ARG A 1 46 ? -5.454  1.760   -3.143  1.00 0.00 ? 46 ARG A HD3  12 
ATOM 10541 H HE   . ARG A 1 46 ? -5.959  1.722   -5.931  1.00 0.00 ? 46 ARG A HE   12 
ATOM 10542 H HH11 . ARG A 1 46 ? -6.522  3.584   -3.068  1.00 0.00 ? 46 ARG A HH11 12 
ATOM 10543 H HH12 . ARG A 1 46 ? -6.587  5.101   -3.901  1.00 0.00 ? 46 ARG A HH12 12 
ATOM 10544 H HH21 . ARG A 1 46 ? -6.044  3.708   -7.029  1.00 0.00 ? 46 ARG A HH21 12 
ATOM 10545 H HH22 . ARG A 1 46 ? -6.316  5.171   -6.144  1.00 0.00 ? 46 ARG A HH22 12 
ATOM 10546 N N    . LEU A 1 47 ? -7.450  -2.853  -2.049  1.00 0.00 ? 47 LEU A N    12 
ATOM 10547 C CA   . LEU A 1 47 ? -8.581  -3.707  -2.394  1.00 0.00 ? 47 LEU A CA   12 
ATOM 10548 C C    . LEU A 1 47 ? -9.708  -3.537  -1.379  1.00 0.00 ? 47 LEU A C    12 
ATOM 10549 O O    . LEU A 1 47 ? -10.885 -3.548  -1.736  1.00 0.00 ? 47 LEU A O    12 
ATOM 10550 C CB   . LEU A 1 47 ? -8.141  -5.172  -2.429  1.00 0.00 ? 47 LEU A CB   12 
ATOM 10551 C CG   . LEU A 1 47 ? -7.138  -5.387  -3.572  1.00 0.00 ? 47 LEU A CG   12 
ATOM 10552 C CD1  . LEU A 1 47 ? -6.279  -6.618  -3.276  1.00 0.00 ? 47 LEU A CD1  12 
ATOM 10553 C CD2  . LEU A 1 47 ? -7.889  -5.604  -4.891  1.00 0.00 ? 47 LEU A CD2  12 
ATOM 10554 H H    . LEU A 1 47 ? -6.615  -3.263  -1.737  1.00 0.00 ? 47 LEU A H    12 
ATOM 10555 H HA   . LEU A 1 47 ? -8.946  -3.426  -3.370  1.00 0.00 ? 47 LEU A HA   12 
ATOM 10556 H HB2  . LEU A 1 47 ? -7.674  -5.426  -1.488  1.00 0.00 ? 47 LEU A HB2  12 
ATOM 10557 H HB3  . LEU A 1 47 ? -9.003  -5.804  -2.583  1.00 0.00 ? 47 LEU A HB3  12 
ATOM 10558 H HG   . LEU A 1 47 ? -6.500  -4.519  -3.659  1.00 0.00 ? 47 LEU A HG   12 
ATOM 10559 H HD11 . LEU A 1 47 ? -5.730  -6.895  -4.162  1.00 0.00 ? 47 LEU A HD11 12 
ATOM 10560 H HD12 . LEU A 1 47 ? -6.915  -7.437  -2.976  1.00 0.00 ? 47 LEU A HD12 12 
ATOM 10561 H HD13 . LEU A 1 47 ? -5.587  -6.390  -2.479  1.00 0.00 ? 47 LEU A HD13 12 
ATOM 10562 H HD21 . LEU A 1 47 ? -8.386  -4.690  -5.179  1.00 0.00 ? 47 LEU A HD21 12 
ATOM 10563 H HD22 . LEU A 1 47 ? -8.623  -6.388  -4.764  1.00 0.00 ? 47 LEU A HD22 12 
ATOM 10564 H HD23 . LEU A 1 47 ? -7.189  -5.890  -5.660  1.00 0.00 ? 47 LEU A HD23 12 
ATOM 10565 N N    . LYS A 1 48 ? -9.337  -3.380  -0.112  1.00 0.00 ? 48 LYS A N    12 
ATOM 10566 C CA   . LYS A 1 48 ? -10.325 -3.209  0.947   1.00 0.00 ? 48 LYS A CA   12 
ATOM 10567 C C    . LYS A 1 48 ? -11.170 -1.963  0.700   1.00 0.00 ? 48 LYS A C    12 
ATOM 10568 O O    . LYS A 1 48 ? -12.399 -2.028  0.689   1.00 0.00 ? 48 LYS A O    12 
ATOM 10569 C CB   . LYS A 1 48 ? -9.623  -3.092  2.301   1.00 0.00 ? 48 LYS A CB   12 
ATOM 10570 C CG   . LYS A 1 48 ? -10.649 -3.264  3.425   1.00 0.00 ? 48 LYS A CG   12 
ATOM 10571 C CD   . LYS A 1 48 ? -9.939  -3.259  4.785   1.00 0.00 ? 48 LYS A CD   12 
ATOM 10572 C CE   . LYS A 1 48 ? -9.715  -1.818  5.249   1.00 0.00 ? 48 LYS A CE   12 
ATOM 10573 N NZ   . LYS A 1 48 ? -11.027 -1.116  5.343   1.00 0.00 ? 48 LYS A NZ   12 
ATOM 10574 H H    . LYS A 1 48 ? -8.383  -3.378  0.114   1.00 0.00 ? 48 LYS A H    12 
ATOM 10575 H HA   . LYS A 1 48 ? -10.971 -4.074  0.963   1.00 0.00 ? 48 LYS A HA   12 
ATOM 10576 H HB2  . LYS A 1 48 ? -8.867  -3.861  2.382   1.00 0.00 ? 48 LYS A HB2  12 
ATOM 10577 H HB3  . LYS A 1 48 ? -9.160  -2.120  2.385   1.00 0.00 ? 48 LYS A HB3  12 
ATOM 10578 H HG2  . LYS A 1 48 ? -11.364 -2.454  3.386   1.00 0.00 ? 48 LYS A HG2  12 
ATOM 10579 H HG3  . LYS A 1 48 ? -11.167 -4.203  3.296   1.00 0.00 ? 48 LYS A HG3  12 
ATOM 10580 H HD2  . LYS A 1 48 ? -10.550 -3.778  5.509   1.00 0.00 ? 48 LYS A HD2  12 
ATOM 10581 H HD3  . LYS A 1 48 ? -8.986  -3.760  4.697   1.00 0.00 ? 48 LYS A HD3  12 
ATOM 10582 H HE2  . LYS A 1 48 ? -9.239  -1.823  6.219   1.00 0.00 ? 48 LYS A HE2  12 
ATOM 10583 H HE3  . LYS A 1 48 ? -9.082  -1.305  4.540   1.00 0.00 ? 48 LYS A HE3  12 
ATOM 10584 H HZ1  . LYS A 1 48 ? -10.939 -0.305  5.988   1.00 0.00 ? 48 LYS A HZ1  12 
ATOM 10585 H HZ2  . LYS A 1 48 ? -11.745 -1.772  5.710   1.00 0.00 ? 48 LYS A HZ2  12 
ATOM 10586 H HZ3  . LYS A 1 48 ? -11.309 -0.782  4.399   1.00 0.00 ? 48 LYS A HZ3  12 
ATOM 10587 N N    . VAL A 1 49 ? -10.505 -0.829  0.503   1.00 0.00 ? 49 VAL A N    12 
ATOM 10588 C CA   . VAL A 1 49 ? -11.207 0.425   0.261   1.00 0.00 ? 49 VAL A CA   12 
ATOM 10589 C C    . VAL A 1 49 ? -11.934 0.385   -1.081  1.00 0.00 ? 49 VAL A C    12 
ATOM 10590 O O    . VAL A 1 49 ? -13.040 0.909   -1.213  1.00 0.00 ? 49 VAL A O    12 
ATOM 10591 C CB   . VAL A 1 49 ? -10.217 1.591   0.274   1.00 0.00 ? 49 VAL A CB   12 
ATOM 10592 C CG1  . VAL A 1 49 ? -9.589  1.713   1.663   1.00 0.00 ? 49 VAL A CG1  12 
ATOM 10593 C CG2  . VAL A 1 49 ? -9.118  1.336   -0.760  1.00 0.00 ? 49 VAL A CG2  12 
ATOM 10594 H H    . VAL A 1 49 ? -9.525  -0.837  0.525   1.00 0.00 ? 49 VAL A H    12 
ATOM 10595 H HA   . VAL A 1 49 ? -11.932 0.577   1.046   1.00 0.00 ? 49 VAL A HA   12 
ATOM 10596 H HB   . VAL A 1 49 ? -10.737 2.507   0.032   1.00 0.00 ? 49 VAL A HB   12 
ATOM 10597 H HG11 . VAL A 1 49 ? -10.367 1.707   2.411   1.00 0.00 ? 49 VAL A HG11 12 
ATOM 10598 H HG12 . VAL A 1 49 ? -9.035  2.637   1.727   1.00 0.00 ? 49 VAL A HG12 12 
ATOM 10599 H HG13 . VAL A 1 49 ? -8.922  0.880   1.830   1.00 0.00 ? 49 VAL A HG13 12 
ATOM 10600 H HG21 . VAL A 1 49 ? -9.542  1.374   -1.754  1.00 0.00 ? 49 VAL A HG21 12 
ATOM 10601 H HG22 . VAL A 1 49 ? -8.685  0.361   -0.592  1.00 0.00 ? 49 VAL A HG22 12 
ATOM 10602 H HG23 . VAL A 1 49 ? -8.354  2.092   -0.665  1.00 0.00 ? 49 VAL A HG23 12 
ATOM 10603 N N    . TYR A 1 50 ? -11.306 -0.240  -2.072  1.00 0.00 ? 50 TYR A N    12 
ATOM 10604 C CA   . TYR A 1 50 ? -11.903 -0.340  -3.398  1.00 0.00 ? 50 TYR A CA   12 
ATOM 10605 C C    . TYR A 1 50 ? -13.241 -1.071  -3.332  1.00 0.00 ? 50 TYR A C    12 
ATOM 10606 O O    . TYR A 1 50 ? -14.278 -0.524  -3.707  1.00 0.00 ? 50 TYR A O    12 
ATOM 10607 C CB   . TYR A 1 50 ? -10.960 -1.086  -4.343  1.00 0.00 ? 50 TYR A CB   12 
ATOM 10608 C CG   . TYR A 1 50 ? -11.608 -1.226  -5.700  1.00 0.00 ? 50 TYR A CG   12 
ATOM 10609 C CD1  . TYR A 1 50 ? -11.629 -0.136  -6.579  1.00 0.00 ? 50 TYR A CD1  12 
ATOM 10610 C CD2  . TYR A 1 50 ? -12.188 -2.442  -6.078  1.00 0.00 ? 50 TYR A CD2  12 
ATOM 10611 C CE1  . TYR A 1 50 ? -12.230 -0.264  -7.837  1.00 0.00 ? 50 TYR A CE1  12 
ATOM 10612 C CE2  . TYR A 1 50 ? -12.790 -2.570  -7.336  1.00 0.00 ? 50 TYR A CE2  12 
ATOM 10613 C CZ   . TYR A 1 50 ? -12.811 -1.481  -8.216  1.00 0.00 ? 50 TYR A CZ   12 
ATOM 10614 O OH   . TYR A 1 50 ? -13.403 -1.607  -9.455  1.00 0.00 ? 50 TYR A OH   12 
ATOM 10615 H H    . TYR A 1 50 ? -10.425 -0.638  -1.909  1.00 0.00 ? 50 TYR A H    12 
ATOM 10616 H HA   . TYR A 1 50 ? -12.067 0.655   -3.785  1.00 0.00 ? 50 TYR A HA   12 
ATOM 10617 H HB2  . TYR A 1 50 ? -10.036 -0.535  -4.438  1.00 0.00 ? 50 TYR A HB2  12 
ATOM 10618 H HB3  . TYR A 1 50 ? -10.752 -2.068  -3.942  1.00 0.00 ? 50 TYR A HB3  12 
ATOM 10619 H HD1  . TYR A 1 50 ? -11.183 0.802   -6.287  1.00 0.00 ? 50 TYR A HD1  12 
ATOM 10620 H HD2  . TYR A 1 50 ? -12.171 -3.282  -5.400  1.00 0.00 ? 50 TYR A HD2  12 
ATOM 10621 H HE1  . TYR A 1 50 ? -12.247 0.575   -8.515  1.00 0.00 ? 50 TYR A HE1  12 
ATOM 10622 H HE2  . TYR A 1 50 ? -13.236 -3.509  -7.627  1.00 0.00 ? 50 TYR A HE2  12 
ATOM 10623 H HH   . TYR A 1 50 ? -13.886 -0.798  -9.636  1.00 0.00 ? 50 TYR A HH   12 
ATOM 10624 N N    . HIS A 1 51 ? -13.210 -2.312  -2.855  1.00 0.00 ? 51 HIS A N    12 
ATOM 10625 C CA   . HIS A 1 51 ? -14.426 -3.109  -2.747  1.00 0.00 ? 51 HIS A CA   12 
ATOM 10626 C C    . HIS A 1 51 ? -15.420 -2.444  -1.799  1.00 0.00 ? 51 HIS A C    12 
ATOM 10627 O O    . HIS A 1 51 ? -16.628 -2.462  -2.038  1.00 0.00 ? 51 HIS A O    12 
ATOM 10628 C CB   . HIS A 1 51 ? -14.089 -4.513  -2.236  1.00 0.00 ? 51 HIS A CB   12 
ATOM 10629 C CG   . HIS A 1 51 ? -13.493 -5.325  -3.353  1.00 0.00 ? 51 HIS A CG   12 
ATOM 10630 N ND1  . HIS A 1 51 ? -14.266 -5.851  -4.378  1.00 0.00 ? 51 HIS A ND1  12 
ATOM 10631 C CD2  . HIS A 1 51 ? -12.204 -5.711  -3.621  1.00 0.00 ? 51 HIS A CD2  12 
ATOM 10632 C CE1  . HIS A 1 51 ? -13.441 -6.517  -5.206  1.00 0.00 ? 51 HIS A CE1  12 
ATOM 10633 N NE2  . HIS A 1 51 ? -12.173 -6.464  -4.792  1.00 0.00 ? 51 HIS A NE2  12 
ATOM 10634 H H    . HIS A 1 51 ? -12.355 -2.698  -2.572  1.00 0.00 ? 51 HIS A H    12 
ATOM 10635 H HA   . HIS A 1 51 ? -14.878 -3.192  -3.723  1.00 0.00 ? 51 HIS A HA   12 
ATOM 10636 H HB2  . HIS A 1 51 ? -13.378 -4.439  -1.426  1.00 0.00 ? 51 HIS A HB2  12 
ATOM 10637 H HB3  . HIS A 1 51 ? -14.988 -4.993  -1.882  1.00 0.00 ? 51 HIS A HB3  12 
ATOM 10638 H HD2  . HIS A 1 51 ? -11.343 -5.467  -3.015  1.00 0.00 ? 51 HIS A HD2  12 
ATOM 10639 H HE1  . HIS A 1 51 ? -13.766 -7.032  -6.098  1.00 0.00 ? 51 HIS A HE1  12 
ATOM 10640 H HE2  . HIS A 1 51 ? -11.389 -6.867  -5.220  1.00 0.00 ? 51 HIS A HE2  12 
ATOM 10641 N N    . ALA A 1 52 ? -14.905 -1.860  -0.722  1.00 0.00 ? 52 ALA A N    12 
ATOM 10642 C CA   . ALA A 1 52 ? -15.758 -1.193  0.255   1.00 0.00 ? 52 ALA A CA   12 
ATOM 10643 C C    . ALA A 1 52 ? -16.525 -0.045  -0.396  1.00 0.00 ? 52 ALA A C    12 
ATOM 10644 O O    . ALA A 1 52 ? -17.731 0.096   -0.203  1.00 0.00 ? 52 ALA A O    12 
ATOM 10645 C CB   . ALA A 1 52 ? -14.911 -0.653  1.409   1.00 0.00 ? 52 ALA A CB   12 
ATOM 10646 H H    . ALA A 1 52 ? -13.935 -1.877  -0.581  1.00 0.00 ? 52 ALA A H    12 
ATOM 10647 H HA   . ALA A 1 52 ? -16.466 -1.909  0.648   1.00 0.00 ? 52 ALA A HA   12 
ATOM 10648 H HB1  . ALA A 1 52 ? -14.360 -1.463  1.860   1.00 0.00 ? 52 ALA A HB1  12 
ATOM 10649 H HB2  . ALA A 1 52 ? -15.556 -0.199  2.146   1.00 0.00 ? 52 ALA A HB2  12 
ATOM 10650 H HB3  . ALA A 1 52 ? -14.220 0.086   1.032   1.00 0.00 ? 52 ALA A HB3  12 
ATOM 10651 N N    . TRP A 1 53 ? -15.815 0.770   -1.169  1.00 0.00 ? 53 TRP A N    12 
ATOM 10652 C CA   . TRP A 1 53 ? -16.439 1.901   -1.843  1.00 0.00 ? 53 TRP A CA   12 
ATOM 10653 C C    . TRP A 1 53 ? -17.726 1.465   -2.538  1.00 0.00 ? 53 TRP A C    12 
ATOM 10654 O O    . TRP A 1 53 ? -18.625 2.275   -2.768  1.00 0.00 ? 53 TRP A O    12 
ATOM 10655 C CB   . TRP A 1 53 ? -15.468 2.496   -2.871  1.00 0.00 ? 53 TRP A CB   12 
ATOM 10656 C CG   . TRP A 1 53 ? -15.735 3.959   -3.031  1.00 0.00 ? 53 TRP A CG   12 
ATOM 10657 C CD1  . TRP A 1 53 ? -15.605 4.881   -2.051  1.00 0.00 ? 53 TRP A CD1  12 
ATOM 10658 C CD2  . TRP A 1 53 ? -16.172 4.680   -4.218  1.00 0.00 ? 53 TRP A CD2  12 
ATOM 10659 N NE1  . TRP A 1 53 ? -15.934 6.124   -2.562  1.00 0.00 ? 53 TRP A NE1  12 
ATOM 10660 C CE2  . TRP A 1 53 ? -16.291 6.052   -3.894  1.00 0.00 ? 53 TRP A CE2  12 
ATOM 10661 C CE3  . TRP A 1 53 ? -16.474 4.281   -5.533  1.00 0.00 ? 53 TRP A CE3  12 
ATOM 10662 C CZ2  . TRP A 1 53 ? -16.695 6.995   -4.839  1.00 0.00 ? 53 TRP A CZ2  12 
ATOM 10663 C CZ3  . TRP A 1 53 ? -16.881 5.228   -6.488  1.00 0.00 ? 53 TRP A CZ3  12 
ATOM 10664 C CH2  . TRP A 1 53 ? -16.992 6.582   -6.141  1.00 0.00 ? 53 TRP A CH2  12 
ATOM 10665 H H    . TRP A 1 53 ? -14.856 0.610   -1.286  1.00 0.00 ? 53 TRP A H    12 
ATOM 10666 H HA   . TRP A 1 53 ? -16.677 2.657   -1.108  1.00 0.00 ? 53 TRP A HA   12 
ATOM 10667 H HB2  . TRP A 1 53 ? -14.454 2.352   -2.528  1.00 0.00 ? 53 TRP A HB2  12 
ATOM 10668 H HB3  . TRP A 1 53 ? -15.598 1.999   -3.822  1.00 0.00 ? 53 TRP A HB3  12 
ATOM 10669 H HD1  . TRP A 1 53 ? -15.294 4.681   -1.037  1.00 0.00 ? 53 TRP A HD1  12 
ATOM 10670 H HE1  . TRP A 1 53 ? -15.923 6.965   -2.057  1.00 0.00 ? 53 TRP A HE1  12 
ATOM 10671 H HE3  . TRP A 1 53 ? -16.393 3.241   -5.811  1.00 0.00 ? 53 TRP A HE3  12 
ATOM 10672 H HZ2  . TRP A 1 53 ? -16.778 8.037   -4.568  1.00 0.00 ? 53 TRP A HZ2  12 
ATOM 10673 H HZ3  . TRP A 1 53 ? -17.110 4.911   -7.495  1.00 0.00 ? 53 TRP A HZ3  12 
ATOM 10674 H HH2  . TRP A 1 53 ? -17.304 7.305   -6.879  1.00 0.00 ? 53 TRP A HH2  12 
ATOM 10675 N N    . LYS A 1 54 ? -17.804 0.179   -2.870  1.00 0.00 ? 54 LYS A N    12 
ATOM 10676 C CA   . LYS A 1 54 ? -18.984 -0.365  -3.540  1.00 0.00 ? 54 LYS A CA   12 
ATOM 10677 C C    . LYS A 1 54 ? -19.604 -1.479  -2.701  1.00 0.00 ? 54 LYS A C    12 
ATOM 10678 O O    . LYS A 1 54 ? -19.269 -2.652  -2.863  1.00 0.00 ? 54 LYS A O    12 
ATOM 10679 C CB   . LYS A 1 54 ? -18.593 -0.917  -4.916  1.00 0.00 ? 54 LYS A CB   12 
ATOM 10680 C CG   . LYS A 1 54 ? -18.412 0.238   -5.909  1.00 0.00 ? 54 LYS A CG   12 
ATOM 10681 C CD   . LYS A 1 54 ? -19.757 0.584   -6.556  1.00 0.00 ? 54 LYS A CD   12 
ATOM 10682 C CE   . LYS A 1 54 ? -19.560 1.706   -7.577  1.00 0.00 ? 54 LYS A CE   12 
ATOM 10683 N NZ   . LYS A 1 54 ? -20.813 1.886   -8.365  1.00 0.00 ? 54 LYS A NZ   12 
ATOM 10684 H H    . LYS A 1 54 ? -17.055 -0.417  -2.661  1.00 0.00 ? 54 LYS A H    12 
ATOM 10685 H HA   . LYS A 1 54 ? -19.713 0.420   -3.672  1.00 0.00 ? 54 LYS A HA   12 
ATOM 10686 H HB2  . LYS A 1 54 ? -17.666 -1.467  -4.831  1.00 0.00 ? 54 LYS A HB2  12 
ATOM 10687 H HB3  . LYS A 1 54 ? -19.370 -1.579  -5.272  1.00 0.00 ? 54 LYS A HB3  12 
ATOM 10688 H HG2  . LYS A 1 54 ? -18.031 1.106   -5.389  1.00 0.00 ? 54 LYS A HG2  12 
ATOM 10689 H HG3  . LYS A 1 54 ? -17.713 -0.055  -6.678  1.00 0.00 ? 54 LYS A HG3  12 
ATOM 10690 H HD2  . LYS A 1 54 ? -20.152 -0.291  -7.053  1.00 0.00 ? 54 LYS A HD2  12 
ATOM 10691 H HD3  . LYS A 1 54 ? -20.450 0.909   -5.797  1.00 0.00 ? 54 LYS A HD3  12 
ATOM 10692 H HE2  . LYS A 1 54 ? -19.323 2.624   -7.061  1.00 0.00 ? 54 LYS A HE2  12 
ATOM 10693 H HE3  . LYS A 1 54 ? -18.749 1.447   -8.244  1.00 0.00 ? 54 LYS A HE3  12 
ATOM 10694 H HZ1  . LYS A 1 54 ? -21.614 1.487   -7.838  1.00 0.00 ? 54 LYS A HZ1  12 
ATOM 10695 H HZ2  . LYS A 1 54 ? -20.722 1.396   -9.277  1.00 0.00 ? 54 LYS A HZ2  12 
ATOM 10696 H HZ3  . LYS A 1 54 ? -20.974 2.901   -8.529  1.00 0.00 ? 54 LYS A HZ3  12 
ATOM 10697 N N    . SER A 1 55 ? -20.510 -1.102  -1.805  1.00 0.00 ? 55 SER A N    12 
ATOM 10698 C CA   . SER A 1 55 ? -21.172 -2.075  -0.944  1.00 0.00 ? 55 SER A CA   12 
ATOM 10699 C C    . SER A 1 55 ? -22.329 -2.745  -1.681  1.00 0.00 ? 55 SER A C    12 
ATOM 10700 O O    . SER A 1 55 ? -22.130 -3.389  -2.711  1.00 0.00 ? 55 SER A O    12 
ATOM 10701 C CB   . SER A 1 55 ? -21.695 -1.385  0.316   1.00 0.00 ? 55 SER A CB   12 
ATOM 10702 O OG   . SER A 1 55 ? -22.222 -2.364  1.203   1.00 0.00 ? 55 SER A OG   12 
ATOM 10703 H H    . SER A 1 55 ? -20.737 -0.152  -1.720  1.00 0.00 ? 55 SER A H    12 
ATOM 10704 H HA   . SER A 1 55 ? -20.457 -2.831  -0.655  1.00 0.00 ? 55 SER A HA   12 
ATOM 10705 H HB2  . SER A 1 55 ? -20.890 -0.862  0.803   1.00 0.00 ? 55 SER A HB2  12 
ATOM 10706 H HB3  . SER A 1 55 ? -22.468 -0.678  0.044   1.00 0.00 ? 55 SER A HB3  12 
ATOM 10707 H HG   . SER A 1 55 ? -21.622 -3.114  1.207   1.00 0.00 ? 55 SER A HG   12 
ATOM 10708 N N    . LYS A 1 56 ? -23.537 -2.590  -1.146  1.00 0.00 ? 56 LYS A N    12 
ATOM 10709 C CA   . LYS A 1 56 ? -24.721 -3.185  -1.762  1.00 0.00 ? 56 LYS A CA   12 
ATOM 10710 C C    . LYS A 1 56 ? -25.927 -2.268  -1.593  1.00 0.00 ? 56 LYS A C    12 
ATOM 10711 O O    . LYS A 1 56 ? -26.927 -2.648  -0.983  1.00 0.00 ? 56 LYS A O    12 
ATOM 10712 C CB   . LYS A 1 56 ? -25.017 -4.542  -1.121  1.00 0.00 ? 56 LYS A CB   12 
ATOM 10713 C CG   . LYS A 1 56 ? -23.755 -5.410  -1.154  1.00 0.00 ? 56 LYS A CG   12 
ATOM 10714 C CD   . LYS A 1 56 ? -24.086 -6.826  -0.663  1.00 0.00 ? 56 LYS A CD   12 
ATOM 10715 C CE   . LYS A 1 56 ? -24.556 -7.687  -1.838  1.00 0.00 ? 56 LYS A CE   12 
ATOM 10716 N NZ   . LYS A 1 56 ? -23.425 -7.895  -2.786  1.00 0.00 ? 56 LYS A NZ   12 
ATOM 10717 H H    . LYS A 1 56 ? -23.634 -2.066  -0.324  1.00 0.00 ? 56 LYS A H    12 
ATOM 10718 H HA   . LYS A 1 56 ? -24.536 -3.329  -2.817  1.00 0.00 ? 56 LYS A HA   12 
ATOM 10719 H HB2  . LYS A 1 56 ? -25.327 -4.396  -0.097  1.00 0.00 ? 56 LYS A HB2  12 
ATOM 10720 H HB3  . LYS A 1 56 ? -25.804 -5.033  -1.670  1.00 0.00 ? 56 LYS A HB3  12 
ATOM 10721 H HG2  . LYS A 1 56 ? -23.377 -5.456  -2.167  1.00 0.00 ? 56 LYS A HG2  12 
ATOM 10722 H HG3  . LYS A 1 56 ? -23.004 -4.975  -0.513  1.00 0.00 ? 56 LYS A HG3  12 
ATOM 10723 H HD2  . LYS A 1 56 ? -23.202 -7.269  -0.225  1.00 0.00 ? 56 LYS A HD2  12 
ATOM 10724 H HD3  . LYS A 1 56 ? -24.868 -6.778  0.081   1.00 0.00 ? 56 LYS A HD3  12 
ATOM 10725 H HE2  . LYS A 1 56 ? -24.896 -8.644  -1.470  1.00 0.00 ? 56 LYS A HE2  12 
ATOM 10726 H HE3  . LYS A 1 56 ? -25.366 -7.190  -2.349  1.00 0.00 ? 56 LYS A HE3  12 
ATOM 10727 H HZ1  . LYS A 1 56 ? -23.072 -6.974  -3.113  1.00 0.00 ? 56 LYS A HZ1  12 
ATOM 10728 H HZ2  . LYS A 1 56 ? -23.752 -8.448  -3.604  1.00 0.00 ? 56 LYS A HZ2  12 
ATOM 10729 H HZ3  . LYS A 1 56 ? -22.658 -8.409  -2.303  1.00 0.00 ? 56 LYS A HZ3  12 
ATOM 10730 N N    . ASN A 1 57 ? -25.829 -1.060  -2.138  1.00 0.00 ? 57 ASN A N    12 
ATOM 10731 C CA   . ASN A 1 57 ? -26.920 -0.097  -2.041  1.00 0.00 ? 57 ASN A CA   12 
ATOM 10732 C C    . ASN A 1 57 ? -28.164 -0.624  -2.748  1.00 0.00 ? 57 ASN A C    12 
ATOM 10733 O O    . ASN A 1 57 ? -29.076 -1.151  -2.112  1.00 0.00 ? 57 ASN A O    12 
ATOM 10734 C CB   . ASN A 1 57 ? -26.500 1.234   -2.666  1.00 0.00 ? 57 ASN A CB   12 
ATOM 10735 C CG   . ASN A 1 57 ? -25.371 1.858   -1.854  1.00 0.00 ? 57 ASN A CG   12 
ATOM 10736 O OD1  . ASN A 1 57 ? -24.847 2.910   -2.222  1.00 0.00 ? 57 ASN A OD1  12 
ATOM 10737 N ND2  . ASN A 1 57 ? -24.963 1.271   -0.762  1.00 0.00 ? 57 ASN A ND2  12 
ATOM 10738 H H    . ASN A 1 57 ? -25.008 -0.811  -2.612  1.00 0.00 ? 57 ASN A H    12 
ATOM 10739 H HA   . ASN A 1 57 ? -27.153 0.066   -0.998  1.00 0.00 ? 57 ASN A HA   12 
ATOM 10740 H HB2  . ASN A 1 57 ? -26.161 1.064   -3.678  1.00 0.00 ? 57 ASN A HB2  12 
ATOM 10741 H HB3  . ASN A 1 57 ? -27.345 1.907   -2.679  1.00 0.00 ? 57 ASN A HB3  12 
ATOM 10742 H HD21 . ASN A 1 57 ? -25.381 0.435   -0.471  1.00 0.00 ? 57 ASN A HD21 12 
ATOM 10743 H HD22 . ASN A 1 57 ? -24.238 1.666   -0.235  1.00 0.00 ? 57 ASN A HD22 12 
ATOM 10744 N N    . LYS A 1 58 ? -28.193 -0.479  -4.068  1.00 0.00 ? 58 LYS A N    12 
ATOM 10745 C CA   . LYS A 1 58 ? -29.331 -0.943  -4.854  1.00 0.00 ? 58 LYS A CA   12 
ATOM 10746 C C    . LYS A 1 58 ? -29.384 -2.469  -4.868  1.00 0.00 ? 58 LYS A C    12 
ATOM 10747 O O    . LYS A 1 58 ? -29.170 -3.116  -3.843  1.00 0.00 ? 58 LYS A O    12 
ATOM 10748 C CB   . LYS A 1 58 ? -29.224 -0.420  -6.288  1.00 0.00 ? 58 LYS A CB   12 
ATOM 10749 C CG   . LYS A 1 58 ? -28.987 1.091   -6.264  1.00 0.00 ? 58 LYS A CG   12 
ATOM 10750 C CD   . LYS A 1 58 ? -28.877 1.613   -7.698  1.00 0.00 ? 58 LYS A CD   12 
ATOM 10751 C CE   . LYS A 1 58 ? -28.437 3.078   -7.675  1.00 0.00 ? 58 LYS A CE   12 
ATOM 10752 N NZ   . LYS A 1 58 ? -27.152 3.200   -6.932  1.00 0.00 ? 58 LYS A NZ   12 
ATOM 10753 H H    . LYS A 1 58 ? -27.437 -0.051  -4.523  1.00 0.00 ? 58 LYS A H    12 
ATOM 10754 H HA   . LYS A 1 58 ? -30.240 -0.565  -4.412  1.00 0.00 ? 58 LYS A HA   12 
ATOM 10755 H HB2  . LYS A 1 58 ? -28.399 -0.907  -6.788  1.00 0.00 ? 58 LYS A HB2  12 
ATOM 10756 H HB3  . LYS A 1 58 ? -30.142 -0.631  -6.817  1.00 0.00 ? 58 LYS A HB3  12 
ATOM 10757 H HG2  . LYS A 1 58 ? -29.814 1.576   -5.766  1.00 0.00 ? 58 LYS A HG2  12 
ATOM 10758 H HG3  . LYS A 1 58 ? -28.071 1.304   -5.734  1.00 0.00 ? 58 LYS A HG3  12 
ATOM 10759 H HD2  . LYS A 1 58 ? -28.148 1.027   -8.240  1.00 0.00 ? 58 LYS A HD2  12 
ATOM 10760 H HD3  . LYS A 1 58 ? -29.836 1.535   -8.185  1.00 0.00 ? 58 LYS A HD3  12 
ATOM 10761 H HE2  . LYS A 1 58 ? -28.302 3.429   -8.687  1.00 0.00 ? 58 LYS A HE2  12 
ATOM 10762 H HE3  . LYS A 1 58 ? -29.194 3.673   -7.186  1.00 0.00 ? 58 LYS A HE3  12 
ATOM 10763 H HZ1  . LYS A 1 58 ? -26.775 2.251   -6.731  1.00 0.00 ? 58 LYS A HZ1  12 
ATOM 10764 H HZ2  . LYS A 1 58 ? -27.315 3.700   -6.035  1.00 0.00 ? 58 LYS A HZ2  12 
ATOM 10765 H HZ3  . LYS A 1 58 ? -26.468 3.733   -7.507  1.00 0.00 ? 58 LYS A HZ3  12 
ATOM 10766 N N    . LYS A 1 59 ? -29.673 -3.036  -6.034  1.00 0.00 ? 59 LYS A N    12 
ATOM 10767 C CA   . LYS A 1 59 ? -29.752 -4.486  -6.168  1.00 0.00 ? 59 LYS A CA   12 
ATOM 10768 C C    . LYS A 1 59 ? -30.767 -5.057  -5.179  1.00 0.00 ? 59 LYS A C    12 
ATOM 10769 O O    . LYS A 1 59 ? -30.420 -5.405  -4.051  1.00 0.00 ? 59 LYS A O    12 
ATOM 10770 C CB   . LYS A 1 59 ? -28.372 -5.109  -5.921  1.00 0.00 ? 59 LYS A CB   12 
ATOM 10771 C CG   . LYS A 1 59 ? -28.257 -6.436  -6.677  1.00 0.00 ? 59 LYS A CG   12 
ATOM 10772 C CD   . LYS A 1 59 ? -29.380 -7.380  -6.240  1.00 0.00 ? 59 LYS A CD   12 
ATOM 10773 C CE   . LYS A 1 59 ? -29.034 -8.813  -6.650  1.00 0.00 ? 59 LYS A CE   12 
ATOM 10774 N NZ   . LYS A 1 59 ? -30.256 -9.662  -6.567  1.00 0.00 ? 59 LYS A NZ   12 
ATOM 10775 H H    . LYS A 1 59 ? -29.835 -2.471  -6.817  1.00 0.00 ? 59 LYS A H    12 
ATOM 10776 H HA   . LYS A 1 59 ? -30.070 -4.725  -7.172  1.00 0.00 ? 59 LYS A HA   12 
ATOM 10777 H HB2  . LYS A 1 59 ? -27.607 -4.431  -6.268  1.00 0.00 ? 59 LYS A HB2  12 
ATOM 10778 H HB3  . LYS A 1 59 ? -28.240 -5.287  -4.863  1.00 0.00 ? 59 LYS A HB3  12 
ATOM 10779 H HG2  . LYS A 1 59 ? -28.335 -6.252  -7.739  1.00 0.00 ? 59 LYS A HG2  12 
ATOM 10780 H HG3  . LYS A 1 59 ? -27.302 -6.891  -6.461  1.00 0.00 ? 59 LYS A HG3  12 
ATOM 10781 H HD2  . LYS A 1 59 ? -29.496 -7.330  -5.166  1.00 0.00 ? 59 LYS A HD2  12 
ATOM 10782 H HD3  . LYS A 1 59 ? -30.304 -7.085  -6.716  1.00 0.00 ? 59 LYS A HD3  12 
ATOM 10783 H HE2  . LYS A 1 59 ? -28.662 -8.817  -7.665  1.00 0.00 ? 59 LYS A HE2  12 
ATOM 10784 H HE3  . LYS A 1 59 ? -28.276 -9.204  -5.989  1.00 0.00 ? 59 LYS A HE3  12 
ATOM 10785 H HZ1  . LYS A 1 59 ? -30.535 -9.963  -7.520  1.00 0.00 ? 59 LYS A HZ1  12 
ATOM 10786 H HZ2  . LYS A 1 59 ? -31.028 -9.117  -6.137  1.00 0.00 ? 59 LYS A HZ2  12 
ATOM 10787 H HZ3  . LYS A 1 59 ? -30.054 -10.501 -5.983  1.00 0.00 ? 59 LYS A HZ3  12 
ATOM 10788 N N    . ARG A 1 60 ? -32.019 -5.149  -5.614  1.00 0.00 ? 60 ARG A N    12 
ATOM 10789 C CA   . ARG A 1 60 ? -33.077 -5.680  -4.760  1.00 0.00 ? 60 ARG A CA   12 
ATOM 10790 C C    . ARG A 1 60 ? -33.084 -7.204  -4.798  1.00 0.00 ? 60 ARG A C    12 
ATOM 10791 O O    . ARG A 1 60 ? -32.011 -7.784  -4.767  1.00 0.00 ? 60 ARG A O    12 
ATOM 10792 C CB   . ARG A 1 60 ? -34.435 -5.148  -5.221  1.00 0.00 ? 60 ARG A CB   12 
ATOM 10793 C CG   . ARG A 1 60 ? -34.436 -3.619  -5.151  1.00 0.00 ? 60 ARG A CG   12 
ATOM 10794 C CD   . ARG A 1 60 ? -35.673 -3.076  -5.866  1.00 0.00 ? 60 ARG A CD   12 
ATOM 10795 N NE   . ARG A 1 60 ? -35.655 -1.618  -5.869  1.00 0.00 ? 60 ARG A NE   12 
ATOM 10796 C CZ   . ARG A 1 60 ? -34.881 -0.942  -6.713  1.00 0.00 ? 60 ARG A CZ   12 
ATOM 10797 N NH1  . ARG A 1 60 ? -34.123 -1.584  -7.559  1.00 0.00 ? 60 ARG A NH1  12 
ATOM 10798 N NH2  . ARG A 1 60 ? -34.881 0.363   -6.695  1.00 0.00 ? 60 ARG A NH2  12 
ATOM 10799 O OXT  . ARG A 1 60 ? -34.163 -7.770  -4.858  1.00 0.00 ? 60 ARG A OXT  12 
ATOM 10800 H H    . ARG A 1 60 ? -32.237 -4.857  -6.523  1.00 0.00 ? 60 ARG A H    12 
ATOM 10801 H HA   . ARG A 1 60 ? -32.904 -5.355  -3.743  1.00 0.00 ? 60 ARG A HA   12 
ATOM 10802 H HB2  . ARG A 1 60 ? -34.617 -5.462  -6.239  1.00 0.00 ? 60 ARG A HB2  12 
ATOM 10803 H HB3  . ARG A 1 60 ? -35.211 -5.536  -4.580  1.00 0.00 ? 60 ARG A HB3  12 
ATOM 10804 H HG2  . ARG A 1 60 ? -34.451 -3.309  -4.116  1.00 0.00 ? 60 ARG A HG2  12 
ATOM 10805 H HG3  . ARG A 1 60 ? -33.549 -3.236  -5.630  1.00 0.00 ? 60 ARG A HG3  12 
ATOM 10806 H HD2  . ARG A 1 60 ? -35.685 -3.434  -6.884  1.00 0.00 ? 60 ARG A HD2  12 
ATOM 10807 H HD3  . ARG A 1 60 ? -36.563 -3.424  -5.358  1.00 0.00 ? 60 ARG A HD3  12 
ATOM 10808 H HE   . ARG A 1 60 ? -36.222 -1.127  -5.237  1.00 0.00 ? 60 ARG A HE   12 
ATOM 10809 H HH11 . ARG A 1 60 ? -34.122 -2.583  -7.573  1.00 0.00 ? 60 ARG A HH11 12 
ATOM 10810 H HH12 . ARG A 1 60 ? -33.541 -1.075  -8.193  1.00 0.00 ? 60 ARG A HH12 12 
ATOM 10811 H HH21 . ARG A 1 60 ? -35.462 0.854   -6.047  1.00 0.00 ? 60 ARG A HH21 12 
ATOM 10812 H HH22 . ARG A 1 60 ? -34.299 0.871   -7.330  1.00 0.00 ? 60 ARG A HH22 12 
ATOM 10813 N N    . GLY A 1 9  ? 7.587   6.862   17.544  1.00 0.00 ? 9  GLY A N    13 
ATOM 10814 C CA   . GLY A 1 9  ? 6.906   5.947   16.634  1.00 0.00 ? 9  GLY A CA   13 
ATOM 10815 C C    . GLY A 1 9  ? 7.567   5.951   15.260  1.00 0.00 ? 9  GLY A C    13 
ATOM 10816 O O    . GLY A 1 9  ? 6.994   6.442   14.288  1.00 0.00 ? 9  GLY A O    13 
ATOM 10817 H H    . GLY A 1 9  ? 7.099   7.631   17.907  1.00 0.00 ? 9  GLY A H    13 
ATOM 10818 H HA2  . GLY A 1 9  ? 6.942   4.948   17.044  1.00 0.00 ? 9  GLY A HA2  13 
ATOM 10819 H HA3  . GLY A 1 9  ? 5.875   6.251   16.530  1.00 0.00 ? 9  GLY A HA3  13 
ATOM 10820 N N    . THR A 1 10 ? 8.772   5.396   15.188  1.00 0.00 ? 10 THR A N    13 
ATOM 10821 C CA   . THR A 1 10 ? 9.500   5.340   13.926  1.00 0.00 ? 10 THR A CA   13 
ATOM 10822 C C    . THR A 1 10 ? 8.614   4.765   12.825  1.00 0.00 ? 10 THR A C    13 
ATOM 10823 O O    . THR A 1 10 ? 7.504   4.302   13.088  1.00 0.00 ? 10 THR A O    13 
ATOM 10824 C CB   . THR A 1 10 ? 10.751  4.472   14.084  1.00 0.00 ? 10 THR A CB   13 
ATOM 10825 O OG1  . THR A 1 10 ? 11.542  4.567   12.908  1.00 0.00 ? 10 THR A OG1  13 
ATOM 10826 C CG2  . THR A 1 10 ? 10.338  3.015   14.309  1.00 0.00 ? 10 THR A CG2  13 
ATOM 10827 H H    . THR A 1 10 ? 9.177   5.018   15.995  1.00 0.00 ? 10 THR A H    13 
ATOM 10828 H HA   . THR A 1 10 ? 9.801   6.338   13.649  1.00 0.00 ? 10 THR A HA   13 
ATOM 10829 H HB   . THR A 1 10 ? 11.322  4.815   14.932  1.00 0.00 ? 10 THR A HB   13 
ATOM 10830 H HG1  . THR A 1 10 ? 11.625  5.497   12.680  1.00 0.00 ? 10 THR A HG1  13 
ATOM 10831 H HG21 . THR A 1 10 ? 11.185  2.455   14.678  1.00 0.00 ? 10 THR A HG21 13 
ATOM 10832 H HG22 . THR A 1 10 ? 10.003  2.588   13.376  1.00 0.00 ? 10 THR A HG22 13 
ATOM 10833 H HG23 . THR A 1 10 ? 9.536   2.976   15.031  1.00 0.00 ? 10 THR A HG23 13 
ATOM 10834 N N    . LYS A 1 11 ? 9.111   4.799   11.592  1.00 0.00 ? 11 LYS A N    13 
ATOM 10835 C CA   . LYS A 1 11 ? 8.356   4.280   10.455  1.00 0.00 ? 11 LYS A CA   13 
ATOM 10836 C C    . LYS A 1 11 ? 9.278   3.532   9.498   1.00 0.00 ? 11 LYS A C    13 
ATOM 10837 O O    . LYS A 1 11 ? 9.880   4.129   8.606   1.00 0.00 ? 11 LYS A O    13 
ATOM 10838 C CB   . LYS A 1 11 ? 7.675   5.433   9.715   1.00 0.00 ? 11 LYS A CB   13 
ATOM 10839 C CG   . LYS A 1 11 ? 6.881   6.282   10.710  1.00 0.00 ? 11 LYS A CG   13 
ATOM 10840 C CD   . LYS A 1 11 ? 6.183   7.429   9.970   1.00 0.00 ? 11 LYS A CD   13 
ATOM 10841 C CE   . LYS A 1 11 ? 5.068   6.878   9.074   1.00 0.00 ? 11 LYS A CE   13 
ATOM 10842 N NZ   . LYS A 1 11 ? 5.630   6.525   7.740   1.00 0.00 ? 11 LYS A NZ   13 
ATOM 10843 H H    . LYS A 1 11 ? 10.000  5.183   11.442  1.00 0.00 ? 11 LYS A H    13 
ATOM 10844 H HA   . LYS A 1 11 ? 7.597   3.601   10.814  1.00 0.00 ? 11 LYS A HA   13 
ATOM 10845 H HB2  . LYS A 1 11 ? 8.427   6.046   9.237   1.00 0.00 ? 11 LYS A HB2  13 
ATOM 10846 H HB3  . LYS A 1 11 ? 7.006   5.034   8.969   1.00 0.00 ? 11 LYS A HB3  13 
ATOM 10847 H HG2  . LYS A 1 11 ? 6.142   5.666   11.200  1.00 0.00 ? 11 LYS A HG2  13 
ATOM 10848 H HG3  . LYS A 1 11 ? 7.552   6.693   11.449  1.00 0.00 ? 11 LYS A HG3  13 
ATOM 10849 H HD2  . LYS A 1 11 ? 5.761   8.114   10.690  1.00 0.00 ? 11 LYS A HD2  13 
ATOM 10850 H HD3  . LYS A 1 11 ? 6.905   7.952   9.359   1.00 0.00 ? 11 LYS A HD3  13 
ATOM 10851 H HE2  . LYS A 1 11 ? 4.637   5.997   9.528   1.00 0.00 ? 11 LYS A HE2  13 
ATOM 10852 H HE3  . LYS A 1 11 ? 4.301   7.629   8.952   1.00 0.00 ? 11 LYS A HE3  13 
ATOM 10853 H HZ1  . LYS A 1 11 ? 5.307   7.215   7.033   1.00 0.00 ? 11 LYS A HZ1  13 
ATOM 10854 H HZ2  . LYS A 1 11 ? 5.307   5.575   7.467   1.00 0.00 ? 11 LYS A HZ2  13 
ATOM 10855 H HZ3  . LYS A 1 11 ? 6.671   6.538   7.788   1.00 0.00 ? 11 LYS A HZ3  13 
ATOM 10856 N N    . LYS A 1 12 ? 9.383   2.221   9.690   1.00 0.00 ? 12 LYS A N    13 
ATOM 10857 C CA   . LYS A 1 12 ? 10.234  1.398   8.838   1.00 0.00 ? 12 LYS A CA   13 
ATOM 10858 C C    . LYS A 1 12 ? 10.021  1.744   7.368   1.00 0.00 ? 12 LYS A C    13 
ATOM 10859 O O    . LYS A 1 12 ? 10.975  2.040   6.647   1.00 0.00 ? 12 LYS A O    13 
ATOM 10860 C CB   . LYS A 1 12 ? 9.923   -0.084  9.066   1.00 0.00 ? 12 LYS A CB   13 
ATOM 10861 C CG   . LYS A 1 12 ? 10.455  -0.521  10.438  1.00 0.00 ? 12 LYS A CG   13 
ATOM 10862 C CD   . LYS A 1 12 ? 11.916  -0.972  10.315  1.00 0.00 ? 12 LYS A CD   13 
ATOM 10863 C CE   . LYS A 1 12 ? 11.968  -2.456  9.942   1.00 0.00 ? 12 LYS A CE   13 
ATOM 10864 N NZ   . LYS A 1 12 ? 11.683  -3.283  11.148  1.00 0.00 ? 12 LYS A NZ   13 
ATOM 10865 H H    . LYS A 1 12 ? 8.878   1.799   10.416  1.00 0.00 ? 12 LYS A H    13 
ATOM 10866 H HA   . LYS A 1 12 ? 11.266  1.580   9.094   1.00 0.00 ? 12 LYS A HA   13 
ATOM 10867 H HB2  . LYS A 1 12 ? 8.853   -0.234  9.029   1.00 0.00 ? 12 LYS A HB2  13 
ATOM 10868 H HB3  . LYS A 1 12 ? 10.395  -0.673  8.293   1.00 0.00 ? 12 LYS A HB3  13 
ATOM 10869 H HG2  . LYS A 1 12 ? 10.391  0.310   11.129  1.00 0.00 ? 12 LYS A HG2  13 
ATOM 10870 H HG3  . LYS A 1 12 ? 9.857   -1.340  10.811  1.00 0.00 ? 12 LYS A HG3  13 
ATOM 10871 H HD2  . LYS A 1 12 ? 12.413  -0.391  9.551   1.00 0.00 ? 12 LYS A HD2  13 
ATOM 10872 H HD3  . LYS A 1 12 ? 12.418  -0.826  11.261  1.00 0.00 ? 12 LYS A HD3  13 
ATOM 10873 H HE2  . LYS A 1 12 ? 11.230  -2.663  9.181   1.00 0.00 ? 12 LYS A HE2  13 
ATOM 10874 H HE3  . LYS A 1 12 ? 12.951  -2.698  9.565   1.00 0.00 ? 12 LYS A HE3  13 
ATOM 10875 H HZ1  . LYS A 1 12 ? 12.510  -3.870  11.371  1.00 0.00 ? 12 LYS A HZ1  13 
ATOM 10876 H HZ2  . LYS A 1 12 ? 10.864  -3.896  10.963  1.00 0.00 ? 12 LYS A HZ2  13 
ATOM 10877 H HZ3  . LYS A 1 12 ? 11.472  -2.658  11.955  1.00 0.00 ? 12 LYS A HZ3  13 
ATOM 10878 N N    . TYR A 1 13 ? 8.767   1.699   6.928   1.00 0.00 ? 13 TYR A N    13 
ATOM 10879 C CA   . TYR A 1 13 ? 8.437   2.006   5.538   1.00 0.00 ? 13 TYR A CA   13 
ATOM 10880 C C    . TYR A 1 13 ? 7.286   3.006   5.470   1.00 0.00 ? 13 TYR A C    13 
ATOM 10881 O O    . TYR A 1 13 ? 6.357   2.955   6.276   1.00 0.00 ? 13 TYR A O    13 
ATOM 10882 C CB   . TYR A 1 13 ? 8.051   0.718   4.801   1.00 0.00 ? 13 TYR A CB   13 
ATOM 10883 C CG   . TYR A 1 13 ? 9.268   0.145   4.109   1.00 0.00 ? 13 TYR A CG   13 
ATOM 10884 C CD1  . TYR A 1 13 ? 10.315  -0.397  4.866   1.00 0.00 ? 13 TYR A CD1  13 
ATOM 10885 C CD2  . TYR A 1 13 ? 9.350   0.159   2.712   1.00 0.00 ? 13 TYR A CD2  13 
ATOM 10886 C CE1  . TYR A 1 13 ? 11.443  -0.923  4.225   1.00 0.00 ? 13 TYR A CE1  13 
ATOM 10887 C CE2  . TYR A 1 13 ? 10.478  -0.367  2.072   1.00 0.00 ? 13 TYR A CE2  13 
ATOM 10888 C CZ   . TYR A 1 13 ? 11.524  -0.909  2.827   1.00 0.00 ? 13 TYR A CZ   13 
ATOM 10889 O OH   . TYR A 1 13 ? 12.636  -1.427  2.195   1.00 0.00 ? 13 TYR A OH   13 
ATOM 10890 H H    . TYR A 1 13 ? 8.050   1.454   7.550   1.00 0.00 ? 13 TYR A H    13 
ATOM 10891 H HA   . TYR A 1 13 ? 9.301   2.442   5.056   1.00 0.00 ? 13 TYR A HA   13 
ATOM 10892 H HB2  . TYR A 1 13 ? 7.671   -0.002  5.512   1.00 0.00 ? 13 TYR A HB2  13 
ATOM 10893 H HB3  . TYR A 1 13 ? 7.289   0.933   4.065   1.00 0.00 ? 13 TYR A HB3  13 
ATOM 10894 H HD1  . TYR A 1 13 ? 10.253  -0.409  5.945   1.00 0.00 ? 13 TYR A HD1  13 
ATOM 10895 H HD2  . TYR A 1 13 ? 8.544   0.577   2.128   1.00 0.00 ? 13 TYR A HD2  13 
ATOM 10896 H HE1  . TYR A 1 13 ? 12.249  -1.341  4.808   1.00 0.00 ? 13 TYR A HE1  13 
ATOM 10897 H HE2  . TYR A 1 13 ? 10.540  -0.355  0.994   1.00 0.00 ? 13 TYR A HE2  13 
ATOM 10898 H HH   . TYR A 1 13 ? 13.035  -0.726  1.674   1.00 0.00 ? 13 TYR A HH   13 
ATOM 10899 N N    . ASP A 1 14 ? 7.360   3.916   4.502   1.00 0.00 ? 14 ASP A N    13 
ATOM 10900 C CA   . ASP A 1 14 ? 6.328   4.932   4.329   1.00 0.00 ? 14 ASP A CA   13 
ATOM 10901 C C    . ASP A 1 14 ? 5.848   4.968   2.881   1.00 0.00 ? 14 ASP A C    13 
ATOM 10902 O O    . ASP A 1 14 ? 6.590   5.366   1.983   1.00 0.00 ? 14 ASP A O    13 
ATOM 10903 C CB   . ASP A 1 14 ? 6.885   6.302   4.716   1.00 0.00 ? 14 ASP A CB   13 
ATOM 10904 C CG   . ASP A 1 14 ? 8.242   6.518   4.057   1.00 0.00 ? 14 ASP A CG   13 
ATOM 10905 O OD1  . ASP A 1 14 ? 9.236   6.149   4.659   1.00 0.00 ? 14 ASP A OD1  13 
ATOM 10906 O OD2  . ASP A 1 14 ? 8.267   7.049   2.959   1.00 0.00 ? 14 ASP A OD2  13 
ATOM 10907 H H    . ASP A 1 14 ? 8.127   3.907   3.894   1.00 0.00 ? 14 ASP A H    13 
ATOM 10908 H HA   . ASP A 1 14 ? 5.490   4.701   4.971   1.00 0.00 ? 14 ASP A HA   13 
ATOM 10909 H HB2  . ASP A 1 14 ? 6.201   7.070   4.390   1.00 0.00 ? 14 ASP A HB2  13 
ATOM 10910 H HB3  . ASP A 1 14 ? 6.997   6.353   5.788   1.00 0.00 ? 14 ASP A HB3  13 
ATOM 10911 N N    . LEU A 1 15 ? 4.601   4.560   2.666   1.00 0.00 ? 15 LEU A N    13 
ATOM 10912 C CA   . LEU A 1 15 ? 4.021   4.554   1.324   1.00 0.00 ? 15 LEU A CA   13 
ATOM 10913 C C    . LEU A 1 15 ? 2.722   5.353   1.310   1.00 0.00 ? 15 LEU A C    13 
ATOM 10914 O O    . LEU A 1 15 ? 1.658   4.815   1.003   1.00 0.00 ? 15 LEU A O    13 
ATOM 10915 C CB   . LEU A 1 15 ? 3.736   3.117   0.874   1.00 0.00 ? 15 LEU A CB   13 
ATOM 10916 C CG   . LEU A 1 15 ? 4.980   2.244   1.070   1.00 0.00 ? 15 LEU A CG   13 
ATOM 10917 C CD1  . LEU A 1 15 ? 4.606   0.778   0.845   1.00 0.00 ? 15 LEU A CD1  13 
ATOM 10918 C CD2  . LEU A 1 15 ? 6.065   2.648   0.065   1.00 0.00 ? 15 LEU A CD2  13 
ATOM 10919 H H    . LEU A 1 15 ? 4.056   4.260   3.422   1.00 0.00 ? 15 LEU A H    13 
ATOM 10920 H HA   . LEU A 1 15 ? 4.718   5.006   0.634   1.00 0.00 ? 15 LEU A HA   13 
ATOM 10921 H HB2  . LEU A 1 15 ? 2.921   2.716   1.459   1.00 0.00 ? 15 LEU A HB2  13 
ATOM 10922 H HB3  . LEU A 1 15 ? 3.461   3.118   -0.170  1.00 0.00 ? 15 LEU A HB3  13 
ATOM 10923 H HG   . LEU A 1 15 ? 5.352   2.369   2.077   1.00 0.00 ? 15 LEU A HG   13 
ATOM 10924 H HD11 . LEU A 1 15 ? 4.105   0.675   -0.106  1.00 0.00 ? 15 LEU A HD11 13 
ATOM 10925 H HD12 . LEU A 1 15 ? 3.947   0.448   1.635   1.00 0.00 ? 15 LEU A HD12 13 
ATOM 10926 H HD13 . LEU A 1 15 ? 5.503   0.174   0.846   1.00 0.00 ? 15 LEU A HD13 13 
ATOM 10927 H HD21 . LEU A 1 15 ? 6.531   3.567   0.389   1.00 0.00 ? 15 LEU A HD21 13 
ATOM 10928 H HD22 . LEU A 1 15 ? 5.620   2.792   -0.907  1.00 0.00 ? 15 LEU A HD22 13 
ATOM 10929 H HD23 . LEU A 1 15 ? 6.811   1.868   0.007   1.00 0.00 ? 15 LEU A HD23 13 
ATOM 10930 N N    . SER A 1 16 ? 2.816   6.639   1.648   1.00 0.00 ? 16 SER A N    13 
ATOM 10931 C CA   . SER A 1 16 ? 1.640   7.505   1.672   1.00 0.00 ? 16 SER A CA   13 
ATOM 10932 C C    . SER A 1 16 ? 0.689   7.147   0.533   1.00 0.00 ? 16 SER A C    13 
ATOM 10933 O O    . SER A 1 16 ? -0.501  6.917   0.752   1.00 0.00 ? 16 SER A O    13 
ATOM 10934 C CB   . SER A 1 16 ? 2.066   8.968   1.545   1.00 0.00 ? 16 SER A CB   13 
ATOM 10935 O OG   . SER A 1 16 ? 1.001   9.721   0.978   1.00 0.00 ? 16 SER A OG   13 
ATOM 10936 H H    . SER A 1 16 ? 3.692   7.011   1.884   1.00 0.00 ? 16 SER A H    13 
ATOM 10937 H HA   . SER A 1 16 ? 1.125   7.372   2.612   1.00 0.00 ? 16 SER A HA   13 
ATOM 10938 H HB2  . SER A 1 16 ? 2.303   9.364   2.517   1.00 0.00 ? 16 SER A HB2  13 
ATOM 10939 H HB3  . SER A 1 16 ? 2.942   9.031   0.912   1.00 0.00 ? 16 SER A HB3  13 
ATOM 10940 H HG   . SER A 1 16 ? 1.376   10.508  0.574   1.00 0.00 ? 16 SER A HG   13 
ATOM 10941 N N    . LYS A 1 17 ? 1.228   7.091   -0.679  1.00 0.00 ? 17 LYS A N    13 
ATOM 10942 C CA   . LYS A 1 17 ? 0.429   6.745   -1.846  1.00 0.00 ? 17 LYS A CA   13 
ATOM 10943 C C    . LYS A 1 17 ? 1.344   6.377   -3.010  1.00 0.00 ? 17 LYS A C    13 
ATOM 10944 O O    . LYS A 1 17 ? 2.254   7.131   -3.357  1.00 0.00 ? 17 LYS A O    13 
ATOM 10945 C CB   . LYS A 1 17 ? -0.467  7.934   -2.236  1.00 0.00 ? 17 LYS A CB   13 
ATOM 10946 C CG   . LYS A 1 17 ? -1.927  7.477   -2.373  1.00 0.00 ? 17 LYS A CG   13 
ATOM 10947 C CD   . LYS A 1 17 ? -2.077  6.565   -3.598  1.00 0.00 ? 17 LYS A CD   13 
ATOM 10948 C CE   . LYS A 1 17 ? -2.366  7.410   -4.842  1.00 0.00 ? 17 LYS A CE   13 
ATOM 10949 N NZ   . LYS A 1 17 ? -3.794  7.834   -4.834  1.00 0.00 ? 17 LYS A NZ   13 
ATOM 10950 H H    . LYS A 1 17 ? 2.184   7.273   -0.789  1.00 0.00 ? 17 LYS A H    13 
ATOM 10951 H HA   . LYS A 1 17 ? -0.192  5.894   -1.606  1.00 0.00 ? 17 LYS A HA   13 
ATOM 10952 H HB2  . LYS A 1 17 ? -0.402  8.693   -1.470  1.00 0.00 ? 17 LYS A HB2  13 
ATOM 10953 H HB3  . LYS A 1 17 ? -0.134  8.347   -3.176  1.00 0.00 ? 17 LYS A HB3  13 
ATOM 10954 H HG2  . LYS A 1 17 ? -2.217  6.937   -1.483  1.00 0.00 ? 17 LYS A HG2  13 
ATOM 10955 H HG3  . LYS A 1 17 ? -2.563  8.342   -2.487  1.00 0.00 ? 17 LYS A HG3  13 
ATOM 10956 H HD2  . LYS A 1 17 ? -1.165  6.005   -3.747  1.00 0.00 ? 17 LYS A HD2  13 
ATOM 10957 H HD3  . LYS A 1 17 ? -2.896  5.879   -3.436  1.00 0.00 ? 17 LYS A HD3  13 
ATOM 10958 H HE2  . LYS A 1 17 ? -1.731  8.284   -4.842  1.00 0.00 ? 17 LYS A HE2  13 
ATOM 10959 H HE3  . LYS A 1 17 ? -2.169  6.825   -5.729  1.00 0.00 ? 17 LYS A HE3  13 
ATOM 10960 H HZ1  . LYS A 1 17 ? -3.854  8.851   -4.625  1.00 0.00 ? 17 LYS A HZ1  13 
ATOM 10961 H HZ2  . LYS A 1 17 ? -4.309  7.302   -4.104  1.00 0.00 ? 17 LYS A HZ2  13 
ATOM 10962 H HZ3  . LYS A 1 17 ? -4.217  7.645   -5.765  1.00 0.00 ? 17 LYS A HZ3  13 
ATOM 10963 N N    . TRP A 1 18 ? 1.098   5.214   -3.605  1.00 0.00 ? 18 TRP A N    13 
ATOM 10964 C CA   . TRP A 1 18 ? 1.906   4.742   -4.728  1.00 0.00 ? 18 TRP A CA   13 
ATOM 10965 C C    . TRP A 1 18 ? 1.012   4.488   -5.941  1.00 0.00 ? 18 TRP A C    13 
ATOM 10966 O O    . TRP A 1 18 ? -0.204  4.358   -5.809  1.00 0.00 ? 18 TRP A O    13 
ATOM 10967 C CB   . TRP A 1 18 ? 2.625   3.440   -4.339  1.00 0.00 ? 18 TRP A CB   13 
ATOM 10968 C CG   . TRP A 1 18 ? 3.989   3.732   -3.784  1.00 0.00 ? 18 TRP A CG   13 
ATOM 10969 C CD1  . TRP A 1 18 ? 4.299   4.757   -2.955  1.00 0.00 ? 18 TRP A CD1  13 
ATOM 10970 C CD2  . TRP A 1 18 ? 5.229   2.995   -3.998  1.00 0.00 ? 18 TRP A CD2  13 
ATOM 10971 N NE1  . TRP A 1 18 ? 5.648   4.699   -2.655  1.00 0.00 ? 18 TRP A NE1  13 
ATOM 10972 C CE2  . TRP A 1 18 ? 6.264   3.631   -3.274  1.00 0.00 ? 18 TRP A CE2  13 
ATOM 10973 C CE3  . TRP A 1 18 ? 5.552   1.850   -4.746  1.00 0.00 ? 18 TRP A CE3  13 
ATOM 10974 C CZ2  . TRP A 1 18 ? 7.572   3.147   -3.290  1.00 0.00 ? 18 TRP A CZ2  13 
ATOM 10975 C CZ3  . TRP A 1 18 ? 6.866   1.360   -4.765  1.00 0.00 ? 18 TRP A CZ3  13 
ATOM 10976 C CH2  . TRP A 1 18 ? 7.875   2.007   -4.039  1.00 0.00 ? 18 TRP A CH2  13 
ATOM 10977 H H    . TRP A 1 18 ? 0.359   4.658   -3.281  1.00 0.00 ? 18 TRP A H    13 
ATOM 10978 H HA   . TRP A 1 18 ? 2.641   5.492   -4.983  1.00 0.00 ? 18 TRP A HA   13 
ATOM 10979 H HB2  . TRP A 1 18 ? 2.042   2.925   -3.590  1.00 0.00 ? 18 TRP A HB2  13 
ATOM 10980 H HB3  . TRP A 1 18 ? 2.723   2.809   -5.210  1.00 0.00 ? 18 TRP A HB3  13 
ATOM 10981 H HD1  . TRP A 1 18 ? 3.612   5.497   -2.589  1.00 0.00 ? 18 TRP A HD1  13 
ATOM 10982 H HE1  . TRP A 1 18 ? 6.127   5.329   -2.077  1.00 0.00 ? 18 TRP A HE1  13 
ATOM 10983 H HE3  . TRP A 1 18 ? 4.784   1.342   -5.309  1.00 0.00 ? 18 TRP A HE3  13 
ATOM 10984 H HZ2  . TRP A 1 18 ? 8.347   3.648   -2.728  1.00 0.00 ? 18 TRP A HZ2  13 
ATOM 10985 H HZ3  . TRP A 1 18 ? 7.101   0.480   -5.343  1.00 0.00 ? 18 TRP A HZ3  13 
ATOM 10986 H HH2  . TRP A 1 18 ? 8.884   1.624   -4.056  1.00 0.00 ? 18 TRP A HH2  13 
ATOM 10987 N N    . LYS A 1 19 ? 1.622   4.417   -7.121  1.00 0.00 ? 19 LYS A N    13 
ATOM 10988 C CA   . LYS A 1 19 ? 0.867   4.176   -8.348  1.00 0.00 ? 19 LYS A CA   13 
ATOM 10989 C C    . LYS A 1 19 ? 0.923   2.698   -8.727  1.00 0.00 ? 19 LYS A C    13 
ATOM 10990 O O    . LYS A 1 19 ? 1.757   1.947   -8.222  1.00 0.00 ? 19 LYS A O    13 
ATOM 10991 C CB   . LYS A 1 19 ? 1.436   5.023   -9.492  1.00 0.00 ? 19 LYS A CB   13 
ATOM 10992 C CG   . LYS A 1 19 ? 1.819   6.407   -8.961  1.00 0.00 ? 19 LYS A CG   13 
ATOM 10993 C CD   . LYS A 1 19 ? 0.599   7.062   -8.312  1.00 0.00 ? 19 LYS A CD   13 
ATOM 10994 C CE   . LYS A 1 19 ? 0.877   8.549   -8.089  1.00 0.00 ? 19 LYS A CE   13 
ATOM 10995 N NZ   . LYS A 1 19 ? -0.343  9.207   -7.539  1.00 0.00 ? 19 LYS A NZ   13 
ATOM 10996 H H    . LYS A 1 19 ? 2.594   4.527   -7.169  1.00 0.00 ? 19 LYS A H    13 
ATOM 10997 H HA   . LYS A 1 19 ? -0.164  4.457   -8.189  1.00 0.00 ? 19 LYS A HA   13 
ATOM 10998 H HB2  . LYS A 1 19 ? 2.312   4.539   -9.899  1.00 0.00 ? 19 LYS A HB2  13 
ATOM 10999 H HB3  . LYS A 1 19 ? 0.690   5.130   -10.265 1.00 0.00 ? 19 LYS A HB3  13 
ATOM 11000 H HG2  . LYS A 1 19 ? 2.609   6.307   -8.231  1.00 0.00 ? 19 LYS A HG2  13 
ATOM 11001 H HG3  . LYS A 1 19 ? 2.162   7.022   -9.780  1.00 0.00 ? 19 LYS A HG3  13 
ATOM 11002 H HD2  . LYS A 1 19 ? -0.258  6.948   -8.959  1.00 0.00 ? 19 LYS A HD2  13 
ATOM 11003 H HD3  . LYS A 1 19 ? 0.399   6.589   -7.362  1.00 0.00 ? 19 LYS A HD3  13 
ATOM 11004 H HE2  . LYS A 1 19 ? 1.693   8.662   -7.390  1.00 0.00 ? 19 LYS A HE2  13 
ATOM 11005 H HE3  . LYS A 1 19 ? 1.142   9.012   -9.029  1.00 0.00 ? 19 LYS A HE3  13 
ATOM 11006 H HZ1  . LYS A 1 19 ? -0.741  8.620   -6.780  1.00 0.00 ? 19 LYS A HZ1  13 
ATOM 11007 H HZ2  . LYS A 1 19 ? -1.047  9.317   -8.295  1.00 0.00 ? 19 LYS A HZ2  13 
ATOM 11008 H HZ3  . LYS A 1 19 ? -0.089  10.142  -7.159  1.00 0.00 ? 19 LYS A HZ3  13 
ATOM 11009 N N    . TYR A 1 20 ? 0.026   2.286   -9.617  1.00 0.00 ? 20 TYR A N    13 
ATOM 11010 C CA   . TYR A 1 20 ? -0.020  0.897   -10.056 1.00 0.00 ? 20 TYR A CA   13 
ATOM 11011 C C    . TYR A 1 20 ? 1.239   0.540   -10.843 1.00 0.00 ? 20 TYR A C    13 
ATOM 11012 O O    . TYR A 1 20 ? 1.766   -0.567  -10.725 1.00 0.00 ? 20 TYR A O    13 
ATOM 11013 C CB   . TYR A 1 20 ? -1.251  0.667   -10.934 1.00 0.00 ? 20 TYR A CB   13 
ATOM 11014 C CG   . TYR A 1 20 ? -1.342  1.763   -11.969 1.00 0.00 ? 20 TYR A CG   13 
ATOM 11015 C CD1  . TYR A 1 20 ? -2.024  2.950   -11.675 1.00 0.00 ? 20 TYR A CD1  13 
ATOM 11016 C CD2  . TYR A 1 20 ? -0.742  1.592   -13.223 1.00 0.00 ? 20 TYR A CD2  13 
ATOM 11017 C CE1  . TYR A 1 20 ? -2.108  3.965   -12.636 1.00 0.00 ? 20 TYR A CE1  13 
ATOM 11018 C CE2  . TYR A 1 20 ? -0.826  2.608   -14.183 1.00 0.00 ? 20 TYR A CE2  13 
ATOM 11019 C CZ   . TYR A 1 20 ? -1.508  3.794   -13.889 1.00 0.00 ? 20 TYR A CZ   13 
ATOM 11020 O OH   . TYR A 1 20 ? -1.592  4.796   -14.835 1.00 0.00 ? 20 TYR A OH   13 
ATOM 11021 H H    . TYR A 1 20 ? -0.617  2.928   -9.986  1.00 0.00 ? 20 TYR A H    13 
ATOM 11022 H HA   . TYR A 1 20 ? -0.086  0.257   -9.189  1.00 0.00 ? 20 TYR A HA   13 
ATOM 11023 H HB2  . TYR A 1 20 ? -1.169  -0.290  -11.428 1.00 0.00 ? 20 TYR A HB2  13 
ATOM 11024 H HB3  . TYR A 1 20 ? -2.139  0.681   -10.319 1.00 0.00 ? 20 TYR A HB3  13 
ATOM 11025 H HD1  . TYR A 1 20 ? -2.487  3.081   -10.708 1.00 0.00 ? 20 TYR A HD1  13 
ATOM 11026 H HD2  . TYR A 1 20 ? -0.216  0.678   -13.450 1.00 0.00 ? 20 TYR A HD2  13 
ATOM 11027 H HE1  . TYR A 1 20 ? -2.634  4.881   -12.409 1.00 0.00 ? 20 TYR A HE1  13 
ATOM 11028 H HE2  . TYR A 1 20 ? -0.364  2.477   -15.150 1.00 0.00 ? 20 TYR A HE2  13 
ATOM 11029 H HH   . TYR A 1 20 ? -0.705  5.129   -14.993 1.00 0.00 ? 20 TYR A HH   13 
ATOM 11030 N N    . ALA A 1 21 ? 1.711   1.487   -11.646 1.00 0.00 ? 21 ALA A N    13 
ATOM 11031 C CA   . ALA A 1 21 ? 2.905   1.268   -12.456 1.00 0.00 ? 21 ALA A CA   13 
ATOM 11032 C C    . ALA A 1 21 ? 4.115   0.967   -11.577 1.00 0.00 ? 21 ALA A C    13 
ATOM 11033 O O    . ALA A 1 21 ? 4.764   -0.067  -11.733 1.00 0.00 ? 21 ALA A O    13 
ATOM 11034 C CB   . ALA A 1 21 ? 3.188   2.507   -13.308 1.00 0.00 ? 21 ALA A CB   13 
ATOM 11035 H H    . ALA A 1 21 ? 1.246   2.348   -11.699 1.00 0.00 ? 21 ALA A H    13 
ATOM 11036 H HA   . ALA A 1 21 ? 2.731   0.429   -13.112 1.00 0.00 ? 21 ALA A HA   13 
ATOM 11037 H HB1  . ALA A 1 21 ? 3.305   3.367   -12.666 1.00 0.00 ? 21 ALA A HB1  13 
ATOM 11038 H HB2  . ALA A 1 21 ? 2.363   2.673   -13.985 1.00 0.00 ? 21 ALA A HB2  13 
ATOM 11039 H HB3  . ALA A 1 21 ? 4.094   2.353   -13.875 1.00 0.00 ? 21 ALA A HB3  13 
ATOM 11040 N N    . GLU A 1 22 ? 4.422   1.880   -10.659 1.00 0.00 ? 22 GLU A N    13 
ATOM 11041 C CA   . GLU A 1 22 ? 5.566   1.697   -9.773  1.00 0.00 ? 22 GLU A CA   13 
ATOM 11042 C C    . GLU A 1 22 ? 5.365   0.481   -8.872  1.00 0.00 ? 22 GLU A C    13 
ATOM 11043 O O    . GLU A 1 22 ? 6.314   -0.250  -8.588  1.00 0.00 ? 22 GLU A O    13 
ATOM 11044 C CB   . GLU A 1 22 ? 5.777   2.949   -8.918  1.00 0.00 ? 22 GLU A CB   13 
ATOM 11045 C CG   . GLU A 1 22 ? 4.540   3.201   -8.058  1.00 0.00 ? 22 GLU A CG   13 
ATOM 11046 C CD   . GLU A 1 22 ? 4.639   4.571   -7.397  1.00 0.00 ? 22 GLU A CD   13 
ATOM 11047 O OE1  . GLU A 1 22 ? 4.869   5.535   -8.107  1.00 0.00 ? 22 GLU A OE1  13 
ATOM 11048 O OE2  . GLU A 1 22 ? 4.482   4.637   -6.189  1.00 0.00 ? 22 GLU A OE2  13 
ATOM 11049 H H    . GLU A 1 22 ? 3.875   2.689   -10.581 1.00 0.00 ? 22 GLU A H    13 
ATOM 11050 H HA   . GLU A 1 22 ? 6.447   1.538   -10.376 1.00 0.00 ? 22 GLU A HA   13 
ATOM 11051 H HB2  . GLU A 1 22 ? 6.637   2.808   -8.280  1.00 0.00 ? 22 GLU A HB2  13 
ATOM 11052 H HB3  . GLU A 1 22 ? 5.942   3.799   -9.563  1.00 0.00 ? 22 GLU A HB3  13 
ATOM 11053 H HG2  . GLU A 1 22 ? 3.660   3.165   -8.679  1.00 0.00 ? 22 GLU A HG2  13 
ATOM 11054 H HG3  . GLU A 1 22 ? 4.472   2.440   -7.296  1.00 0.00 ? 22 GLU A HG3  13 
ATOM 11055 N N    . LEU A 1 23 ? 4.132   0.266   -8.425  1.00 0.00 ? 23 LEU A N    13 
ATOM 11056 C CA   . LEU A 1 23 ? 3.839   -0.872  -7.559  1.00 0.00 ? 23 LEU A CA   13 
ATOM 11057 C C    . LEU A 1 23 ? 4.272   -2.170  -8.235  1.00 0.00 ? 23 LEU A C    13 
ATOM 11058 O O    . LEU A 1 23 ? 5.056   -2.940  -7.680  1.00 0.00 ? 23 LEU A O    13 
ATOM 11059 C CB   . LEU A 1 23 ? 2.334   -0.929  -7.253  1.00 0.00 ? 23 LEU A CB   13 
ATOM 11060 C CG   . LEU A 1 23 ? 2.047   -0.299  -5.882  1.00 0.00 ? 23 LEU A CG   13 
ATOM 11061 C CD1  . LEU A 1 23 ? 0.586   0.154   -5.821  1.00 0.00 ? 23 LEU A CD1  13 
ATOM 11062 C CD2  . LEU A 1 23 ? 2.301   -1.332  -4.778  1.00 0.00 ? 23 LEU A CD2  13 
ATOM 11063 H H    . LEU A 1 23 ? 3.409   0.879   -8.680  1.00 0.00 ? 23 LEU A H    13 
ATOM 11064 H HA   . LEU A 1 23 ? 4.387   -0.759  -6.637  1.00 0.00 ? 23 LEU A HA   13 
ATOM 11065 H HB2  . LEU A 1 23 ? 1.796   -0.386  -8.015  1.00 0.00 ? 23 LEU A HB2  13 
ATOM 11066 H HB3  . LEU A 1 23 ? 2.003   -1.958  -7.249  1.00 0.00 ? 23 LEU A HB3  13 
ATOM 11067 H HG   . LEU A 1 23 ? 2.691   0.552   -5.735  1.00 0.00 ? 23 LEU A HG   13 
ATOM 11068 H HD11 . LEU A 1 23 ? -0.062  -0.698  -5.966  1.00 0.00 ? 23 LEU A HD11 13 
ATOM 11069 H HD12 . LEU A 1 23 ? 0.403   0.881   -6.598  1.00 0.00 ? 23 LEU A HD12 13 
ATOM 11070 H HD13 . LEU A 1 23 ? 0.388   0.599   -4.858  1.00 0.00 ? 23 LEU A HD13 13 
ATOM 11071 H HD21 . LEU A 1 23 ? 1.492   -2.048  -4.762  1.00 0.00 ? 23 LEU A HD21 13 
ATOM 11072 H HD22 . LEU A 1 23 ? 2.356   -0.832  -3.823  1.00 0.00 ? 23 LEU A HD22 13 
ATOM 11073 H HD23 . LEU A 1 23 ? 3.231   -1.845  -4.970  1.00 0.00 ? 23 LEU A HD23 13 
ATOM 11074 N N    . ARG A 1 24 ? 3.759   -2.403  -9.439  1.00 0.00 ? 24 ARG A N    13 
ATOM 11075 C CA   . ARG A 1 24 ? 4.098   -3.612  -10.183 1.00 0.00 ? 24 ARG A CA   13 
ATOM 11076 C C    . ARG A 1 24 ? 5.597   -3.676  -10.457 1.00 0.00 ? 24 ARG A C    13 
ATOM 11077 O O    . ARG A 1 24 ? 6.247   -4.685  -10.183 1.00 0.00 ? 24 ARG A O    13 
ATOM 11078 C CB   . ARG A 1 24 ? 3.337   -3.636  -11.512 1.00 0.00 ? 24 ARG A CB   13 
ATOM 11079 C CG   . ARG A 1 24 ? 3.441   -5.030  -12.148 1.00 0.00 ? 24 ARG A CG   13 
ATOM 11080 C CD   . ARG A 1 24 ? 2.233   -5.878  -11.744 1.00 0.00 ? 24 ARG A CD   13 
ATOM 11081 N NE   . ARG A 1 24 ? 1.068   -5.509  -12.541 1.00 0.00 ? 24 ARG A NE   13 
ATOM 11082 C CZ   . ARG A 1 24 ? 1.007   -5.785  -13.839 1.00 0.00 ? 24 ARG A CZ   13 
ATOM 11083 N NH1  . ARG A 1 24 ? 1.999   -6.402  -14.422 1.00 0.00 ? 24 ARG A NH1  13 
ATOM 11084 N NH2  . ARG A 1 24 ? -0.045  -5.442  -14.532 1.00 0.00 ? 24 ARG A NH2  13 
ATOM 11085 H H    . ARG A 1 24 ? 3.142   -1.752  -9.834  1.00 0.00 ? 24 ARG A H    13 
ATOM 11086 H HA   . ARG A 1 24 ? 3.809   -4.475  -9.601  1.00 0.00 ? 24 ARG A HA   13 
ATOM 11087 H HB2  . ARG A 1 24 ? 2.299   -3.393  -11.335 1.00 0.00 ? 24 ARG A HB2  13 
ATOM 11088 H HB3  . ARG A 1 24 ? 3.765   -2.904  -12.182 1.00 0.00 ? 24 ARG A HB3  13 
ATOM 11089 H HG2  . ARG A 1 24 ? 3.466   -4.931  -13.224 1.00 0.00 ? 24 ARG A HG2  13 
ATOM 11090 H HG3  . ARG A 1 24 ? 4.347   -5.516  -11.814 1.00 0.00 ? 24 ARG A HG3  13 
ATOM 11091 H HD2  . ARG A 1 24 ? 2.458   -6.921  -11.906 1.00 0.00 ? 24 ARG A HD2  13 
ATOM 11092 H HD3  . ARG A 1 24 ? 2.019   -5.719  -10.697 1.00 0.00 ? 24 ARG A HD3  13 
ATOM 11093 H HE   . ARG A 1 24 ? 0.318   -5.046  -12.110 1.00 0.00 ? 24 ARG A HE   13 
ATOM 11094 H HH11 . ARG A 1 24 ? 2.805   -6.665  -13.892 1.00 0.00 ? 24 ARG A HH11 13 
ATOM 11095 H HH12 . ARG A 1 24 ? 1.952   -6.610  -15.398 1.00 0.00 ? 24 ARG A HH12 13 
ATOM 11096 H HH21 . ARG A 1 24 ? -0.806  -4.971  -14.084 1.00 0.00 ? 24 ARG A HH21 13 
ATOM 11097 H HH22 . ARG A 1 24 ? -0.091  -5.651  -15.508 1.00 0.00 ? 24 ARG A HH22 13 
ATOM 11098 N N    . ASP A 1 25 ? 6.139   -2.598  -11.007 1.00 0.00 ? 25 ASP A N    13 
ATOM 11099 C CA   . ASP A 1 25 ? 7.560   -2.552  -11.322 1.00 0.00 ? 25 ASP A CA   13 
ATOM 11100 C C    . ASP A 1 25 ? 8.404   -2.837  -10.084 1.00 0.00 ? 25 ASP A C    13 
ATOM 11101 O O    . ASP A 1 25 ? 9.260   -3.721  -10.096 1.00 0.00 ? 25 ASP A O    13 
ATOM 11102 C CB   . ASP A 1 25 ? 7.921   -1.176  -11.885 1.00 0.00 ? 25 ASP A CB   13 
ATOM 11103 C CG   . ASP A 1 25 ? 9.428   -1.080  -12.104 1.00 0.00 ? 25 ASP A CG   13 
ATOM 11104 O OD1  . ASP A 1 25 ? 9.876   -1.455  -13.174 1.00 0.00 ? 25 ASP A OD1  13 
ATOM 11105 O OD2  . ASP A 1 25 ? 10.110  -0.632  -11.197 1.00 0.00 ? 25 ASP A OD2  13 
ATOM 11106 H H    . ASP A 1 25 ? 5.573   -1.824  -11.210 1.00 0.00 ? 25 ASP A H    13 
ATOM 11107 H HA   . ASP A 1 25 ? 7.773   -3.299  -12.068 1.00 0.00 ? 25 ASP A HA   13 
ATOM 11108 H HB2  . ASP A 1 25 ? 7.412   -1.030  -12.827 1.00 0.00 ? 25 ASP A HB2  13 
ATOM 11109 H HB3  . ASP A 1 25 ? 7.612   -0.410  -11.189 1.00 0.00 ? 25 ASP A HB3  13 
ATOM 11110 N N    . THR A 1 26 ? 8.165   -2.078  -9.021  1.00 0.00 ? 26 THR A N    13 
ATOM 11111 C CA   . THR A 1 26 ? 8.924   -2.252  -7.787  1.00 0.00 ? 26 THR A CA   13 
ATOM 11112 C C    . THR A 1 26 ? 8.791   -3.671  -7.242  1.00 0.00 ? 26 THR A C    13 
ATOM 11113 O O    . THR A 1 26 ? 9.737   -4.210  -6.669  1.00 0.00 ? 26 THR A O    13 
ATOM 11114 C CB   . THR A 1 26 ? 8.442   -1.257  -6.731  1.00 0.00 ? 26 THR A CB   13 
ATOM 11115 O OG1  . THR A 1 26 ? 8.296   0.026   -7.323  1.00 0.00 ? 26 THR A OG1  13 
ATOM 11116 C CG2  . THR A 1 26 ? 9.469   -1.187  -5.599  1.00 0.00 ? 26 THR A CG2  13 
ATOM 11117 H H    . THR A 1 26 ? 7.476   -1.385  -9.069  1.00 0.00 ? 26 THR A H    13 
ATOM 11118 H HA   . THR A 1 26 ? 9.966   -2.057  -7.991  1.00 0.00 ? 26 THR A HA   13 
ATOM 11119 H HB   . THR A 1 26 ? 7.495   -1.583  -6.333  1.00 0.00 ? 26 THR A HB   13 
ATOM 11120 H HG1  . THR A 1 26 ? 8.765   0.660   -6.775  1.00 0.00 ? 26 THR A HG1  13 
ATOM 11121 H HG21 . THR A 1 26 ? 9.661   -2.183  -5.228  1.00 0.00 ? 26 THR A HG21 13 
ATOM 11122 H HG22 . THR A 1 26 ? 9.085   -0.572  -4.802  1.00 0.00 ? 26 THR A HG22 13 
ATOM 11123 H HG23 . THR A 1 26 ? 10.388  -0.760  -5.974  1.00 0.00 ? 26 THR A HG23 13 
ATOM 11124 N N    . ILE A 1 27 ? 7.616   -4.273  -7.407  1.00 0.00 ? 27 ILE A N    13 
ATOM 11125 C CA   . ILE A 1 27 ? 7.401   -5.628  -6.903  1.00 0.00 ? 27 ILE A CA   13 
ATOM 11126 C C    . ILE A 1 27 ? 8.019   -6.661  -7.847  1.00 0.00 ? 27 ILE A C    13 
ATOM 11127 O O    . ILE A 1 27 ? 8.292   -7.792  -7.445  1.00 0.00 ? 27 ILE A O    13 
ATOM 11128 C CB   . ILE A 1 27 ? 5.894   -5.894  -6.711  1.00 0.00 ? 27 ILE A CB   13 
ATOM 11129 C CG1  . ILE A 1 27 ? 5.667   -6.598  -5.365  1.00 0.00 ? 27 ILE A CG1  13 
ATOM 11130 C CG2  . ILE A 1 27 ? 5.348   -6.775  -7.842  1.00 0.00 ? 27 ILE A CG2  13 
ATOM 11131 C CD1  . ILE A 1 27 ? 4.205   -7.039  -5.249  1.00 0.00 ? 27 ILE A CD1  13 
ATOM 11132 H H    . ILE A 1 27 ? 6.886   -3.802  -7.864  1.00 0.00 ? 27 ILE A H    13 
ATOM 11133 H HA   . ILE A 1 27 ? 7.891   -5.713  -5.942  1.00 0.00 ? 27 ILE A HA   13 
ATOM 11134 H HB   . ILE A 1 27 ? 5.366   -4.953  -6.711  1.00 0.00 ? 27 ILE A HB   13 
ATOM 11135 H HG12 . ILE A 1 27 ? 6.311   -7.463  -5.299  1.00 0.00 ? 27 ILE A HG12 13 
ATOM 11136 H HG13 . ILE A 1 27 ? 5.898   -5.916  -4.560  1.00 0.00 ? 27 ILE A HG13 13 
ATOM 11137 H HG21 . ILE A 1 27 ? 5.690   -6.398  -8.794  1.00 0.00 ? 27 ILE A HG21 13 
ATOM 11138 H HG22 . ILE A 1 27 ? 4.268   -6.762  -7.819  1.00 0.00 ? 27 ILE A HG22 13 
ATOM 11139 H HG23 . ILE A 1 27 ? 5.697   -7.789  -7.710  1.00 0.00 ? 27 ILE A HG23 13 
ATOM 11140 H HD11 . ILE A 1 27 ? 4.068   -7.974  -5.772  1.00 0.00 ? 27 ILE A HD11 13 
ATOM 11141 H HD12 . ILE A 1 27 ? 3.564   -6.285  -5.683  1.00 0.00 ? 27 ILE A HD12 13 
ATOM 11142 H HD13 . ILE A 1 27 ? 3.951   -7.170  -4.207  1.00 0.00 ? 27 ILE A HD13 13 
ATOM 11143 N N    . ASN A 1 28 ? 8.232   -6.268  -9.101  1.00 0.00 ? 28 ASN A N    13 
ATOM 11144 C CA   . ASN A 1 28 ? 8.814   -7.178  -10.087 1.00 0.00 ? 28 ASN A CA   13 
ATOM 11145 C C    . ASN A 1 28 ? 10.273  -6.815  -10.373 1.00 0.00 ? 28 ASN A C    13 
ATOM 11146 O O    . ASN A 1 28 ? 10.949  -7.500  -11.141 1.00 0.00 ? 28 ASN A O    13 
ATOM 11147 C CB   . ASN A 1 28 ? 7.989   -7.142  -11.385 1.00 0.00 ? 28 ASN A CB   13 
ATOM 11148 C CG   . ASN A 1 28 ? 8.742   -6.406  -12.489 1.00 0.00 ? 28 ASN A CG   13 
ATOM 11149 O OD1  . ASN A 1 28 ? 8.941   -6.949  -13.575 1.00 0.00 ? 28 ASN A OD1  13 
ATOM 11150 N ND2  . ASN A 1 28 ? 9.174   -5.196  -12.273 1.00 0.00 ? 28 ASN A ND2  13 
ATOM 11151 H H    . ASN A 1 28 ? 7.991   -5.356  -9.370  1.00 0.00 ? 28 ASN A H    13 
ATOM 11152 H HA   . ASN A 1 28 ? 8.785   -8.183  -9.689  1.00 0.00 ? 28 ASN A HA   13 
ATOM 11153 H HB2  . ASN A 1 28 ? 7.785   -8.153  -11.708 1.00 0.00 ? 28 ASN A HB2  13 
ATOM 11154 H HB3  . ASN A 1 28 ? 7.054   -6.635  -11.196 1.00 0.00 ? 28 ASN A HB3  13 
ATOM 11155 H HD21 . ASN A 1 28 ? 9.015   -4.766  -11.406 1.00 0.00 ? 28 ASN A HD21 13 
ATOM 11156 H HD22 . ASN A 1 28 ? 9.657   -4.717  -12.976 1.00 0.00 ? 28 ASN A HD22 13 
ATOM 11157 N N    . THR A 1 29 ? 10.757  -5.743  -9.746  1.00 0.00 ? 29 THR A N    13 
ATOM 11158 C CA   . THR A 1 29 ? 12.142  -5.312  -9.942  1.00 0.00 ? 29 THR A CA   13 
ATOM 11159 C C    . THR A 1 29 ? 12.908  -5.375  -8.626  1.00 0.00 ? 29 THR A C    13 
ATOM 11160 O O    . THR A 1 29 ? 14.012  -5.917  -8.564  1.00 0.00 ? 29 THR A O    13 
ATOM 11161 C CB   . THR A 1 29 ? 12.188  -3.878  -10.485 1.00 0.00 ? 29 THR A CB   13 
ATOM 11162 O OG1  . THR A 1 29 ? 11.410  -3.033  -9.649  1.00 0.00 ? 29 THR A OG1  13 
ATOM 11163 C CG2  . THR A 1 29 ? 11.633  -3.833  -11.917 1.00 0.00 ? 29 THR A CG2  13 
ATOM 11164 H H    . THR A 1 29 ? 10.176  -5.237  -9.138  1.00 0.00 ? 29 THR A H    13 
ATOM 11165 H HA   . THR A 1 29 ? 12.622  -5.969  -10.653 1.00 0.00 ? 29 THR A HA   13 
ATOM 11166 H HB   . THR A 1 29 ? 13.210  -3.531  -10.490 1.00 0.00 ? 29 THR A HB   13 
ATOM 11167 H HG1  . THR A 1 29 ? 12.013  -2.502  -9.122  1.00 0.00 ? 29 THR A HG1  13 
ATOM 11168 H HG21 . THR A 1 29 ? 12.302  -3.264  -12.546 1.00 0.00 ? 29 THR A HG21 13 
ATOM 11169 H HG22 . THR A 1 29 ? 10.662  -3.363  -11.911 1.00 0.00 ? 29 THR A HG22 13 
ATOM 11170 H HG23 . THR A 1 29 ? 11.543  -4.837  -12.308 1.00 0.00 ? 29 THR A HG23 13 
ATOM 11171 N N    . SER A 1 30 ? 12.314  -4.820  -7.575  1.00 0.00 ? 30 SER A N    13 
ATOM 11172 C CA   . SER A 1 30 ? 12.949  -4.820  -6.262  1.00 0.00 ? 30 SER A CA   13 
ATOM 11173 C C    . SER A 1 30 ? 12.519  -6.051  -5.471  1.00 0.00 ? 30 SER A C    13 
ATOM 11174 O O    . SER A 1 30 ? 11.575  -6.744  -5.850  1.00 0.00 ? 30 SER A O    13 
ATOM 11175 C CB   . SER A 1 30 ? 12.569  -3.547  -5.501  1.00 0.00 ? 30 SER A CB   13 
ATOM 11176 O OG   . SER A 1 30 ? 13.628  -2.604  -5.610  1.00 0.00 ? 30 SER A OG   13 
ATOM 11177 H H    . SER A 1 30 ? 11.434  -4.405  -7.685  1.00 0.00 ? 30 SER A H    13 
ATOM 11178 H HA   . SER A 1 30 ? 14.021  -4.843  -6.389  1.00 0.00 ? 30 SER A HA   13 
ATOM 11179 H HB2  . SER A 1 30 ? 11.676  -3.124  -5.927  1.00 0.00 ? 30 SER A HB2  13 
ATOM 11180 H HB3  . SER A 1 30 ? 12.391  -3.784  -4.460  1.00 0.00 ? 30 SER A HB3  13 
ATOM 11181 H HG   . SER A 1 30 ? 14.267  -2.794  -4.920  1.00 0.00 ? 30 SER A HG   13 
ATOM 11182 N N    . CYS A 1 31 ? 13.213  -6.315  -4.369  1.00 0.00 ? 31 CYS A N    13 
ATOM 11183 C CA   . CYS A 1 31 ? 12.887  -7.465  -3.536  1.00 0.00 ? 31 CYS A CA   13 
ATOM 11184 C C    . CYS A 1 31 ? 13.419  -7.275  -2.120  1.00 0.00 ? 31 CYS A C    13 
ATOM 11185 O O    . CYS A 1 31 ? 14.614  -7.060  -1.917  1.00 0.00 ? 31 CYS A O    13 
ATOM 11186 C CB   . CYS A 1 31 ? 13.487  -8.735  -4.143  1.00 0.00 ? 31 CYS A CB   13 
ATOM 11187 S SG   . CYS A 1 31 ? 12.888  -10.181 -3.233  1.00 0.00 ? 31 CYS A SG   13 
ATOM 11188 H H    . CYS A 1 31 ? 13.954  -5.727  -4.113  1.00 0.00 ? 31 CYS A H    13 
ATOM 11189 H HA   . CYS A 1 31 ? 11.814  -7.574  -3.495  1.00 0.00 ? 31 CYS A HA   13 
ATOM 11190 H HB2  . CYS A 1 31 ? 13.190  -8.814  -5.179  1.00 0.00 ? 31 CYS A HB2  13 
ATOM 11191 H HB3  . CYS A 1 31 ? 14.564  -8.690  -4.080  1.00 0.00 ? 31 CYS A HB3  13 
ATOM 11192 H HG   . CYS A 1 31 ? 13.122  -10.965 -3.734  1.00 0.00 ? 31 CYS A HG   13 
ATOM 11193 N N    . ASP A 1 32 ? 12.520  -7.361  -1.148  1.00 0.00 ? 32 ASP A N    13 
ATOM 11194 C CA   . ASP A 1 32 ? 12.897  -7.205  0.253   1.00 0.00 ? 32 ASP A CA   13 
ATOM 11195 C C    . ASP A 1 32 ? 11.696  -7.484  1.149   1.00 0.00 ? 32 ASP A C    13 
ATOM 11196 O O    . ASP A 1 32 ? 10.607  -6.961  0.918   1.00 0.00 ? 32 ASP A O    13 
ATOM 11197 C CB   . ASP A 1 32 ? 13.417  -5.783  0.506   1.00 0.00 ? 32 ASP A CB   13 
ATOM 11198 C CG   . ASP A 1 32 ? 14.539  -5.809  1.540   1.00 0.00 ? 32 ASP A CG   13 
ATOM 11199 O OD1  . ASP A 1 32 ? 14.384  -6.494  2.537   1.00 0.00 ? 32 ASP A OD1  13 
ATOM 11200 O OD2  . ASP A 1 32 ? 15.538  -5.143  1.319   1.00 0.00 ? 32 ASP A OD2  13 
ATOM 11201 H H    . ASP A 1 32 ? 11.583  -7.540  -1.374  1.00 0.00 ? 32 ASP A H    13 
ATOM 11202 H HA   . ASP A 1 32 ? 13.679  -7.914  0.484   1.00 0.00 ? 32 ASP A HA   13 
ATOM 11203 H HB2  . ASP A 1 32 ? 13.793  -5.368  -0.417  1.00 0.00 ? 32 ASP A HB2  13 
ATOM 11204 H HB3  . ASP A 1 32 ? 12.612  -5.164  0.873   1.00 0.00 ? 32 ASP A HB3  13 
ATOM 11205 N N    . ILE A 1 33 ? 11.900  -8.309  2.169   1.00 0.00 ? 33 ILE A N    13 
ATOM 11206 C CA   . ILE A 1 33 ? 10.822  -8.646  3.092   1.00 0.00 ? 33 ILE A CA   13 
ATOM 11207 C C    . ILE A 1 33 ? 9.955   -7.423  3.376   1.00 0.00 ? 33 ILE A C    13 
ATOM 11208 O O    . ILE A 1 33 ? 8.735   -7.527  3.489   1.00 0.00 ? 33 ILE A O    13 
ATOM 11209 C CB   . ILE A 1 33 ? 11.406  -9.178  4.404   1.00 0.00 ? 33 ILE A CB   13 
ATOM 11210 C CG1  . ILE A 1 33 ? 12.637  -8.342  4.794   1.00 0.00 ? 33 ILE A CG1  13 
ATOM 11211 C CG2  . ILE A 1 33 ? 11.815  -10.642 4.229   1.00 0.00 ? 33 ILE A CG2  13 
ATOM 11212 C CD1  . ILE A 1 33 ? 12.768  -8.294  6.318   1.00 0.00 ? 33 ILE A CD1  13 
ATOM 11213 H H    . ILE A 1 33 ? 12.790  -8.697  2.304   1.00 0.00 ? 33 ILE A H    13 
ATOM 11214 H HA   . ILE A 1 33 ? 10.208  -9.415  2.645   1.00 0.00 ? 33 ILE A HA   13 
ATOM 11215 H HB   . ILE A 1 33 ? 10.659  -9.107  5.182   1.00 0.00 ? 33 ILE A HB   13 
ATOM 11216 H HG12 . ILE A 1 33 ? 13.527  -8.790  4.372   1.00 0.00 ? 33 ILE A HG12 13 
ATOM 11217 H HG13 . ILE A 1 33 ? 12.529  -7.338  4.414   1.00 0.00 ? 33 ILE A HG13 13 
ATOM 11218 H HG21 . ILE A 1 33 ? 12.227  -11.016 5.155   1.00 0.00 ? 33 ILE A HG21 13 
ATOM 11219 H HG22 . ILE A 1 33 ? 12.557  -10.718 3.448   1.00 0.00 ? 33 ILE A HG22 13 
ATOM 11220 H HG23 . ILE A 1 33 ? 10.949  -11.227 3.959   1.00 0.00 ? 33 ILE A HG23 13 
ATOM 11221 H HD11 . ILE A 1 33 ? 12.062  -7.578  6.716   1.00 0.00 ? 33 ILE A HD11 13 
ATOM 11222 H HD12 . ILE A 1 33 ? 13.771  -7.997  6.585   1.00 0.00 ? 33 ILE A HD12 13 
ATOM 11223 H HD13 . ILE A 1 33 ? 12.558  -9.271  6.729   1.00 0.00 ? 33 ILE A HD13 13 
ATOM 11224 N N    . GLU A 1 34 ? 10.597  -6.264  3.493   1.00 0.00 ? 34 GLU A N    13 
ATOM 11225 C CA   . GLU A 1 34 ? 9.878   -5.027  3.772   1.00 0.00 ? 34 GLU A CA   13 
ATOM 11226 C C    . GLU A 1 34 ? 9.152   -4.525  2.526   1.00 0.00 ? 34 GLU A C    13 
ATOM 11227 O O    . GLU A 1 34 ? 7.954   -4.242  2.570   1.00 0.00 ? 34 GLU A O    13 
ATOM 11228 C CB   . GLU A 1 34 ? 10.858  -3.956  4.269   1.00 0.00 ? 34 GLU A CB   13 
ATOM 11229 C CG   . GLU A 1 34 ? 12.009  -4.624  5.028   1.00 0.00 ? 34 GLU A CG   13 
ATOM 11230 C CD   . GLU A 1 34 ? 12.656  -3.626  5.983   1.00 0.00 ? 34 GLU A CD   13 
ATOM 11231 O OE1  . GLU A 1 34 ? 11.954  -3.112  6.837   1.00 0.00 ? 34 GLU A OE1  13 
ATOM 11232 O OE2  . GLU A 1 34 ? 13.845  -3.392  5.847   1.00 0.00 ? 34 GLU A OE2  13 
ATOM 11233 H H    . GLU A 1 34 ? 11.572  -6.243  3.395   1.00 0.00 ? 34 GLU A H    13 
ATOM 11234 H HA   . GLU A 1 34 ? 9.150   -5.216  4.546   1.00 0.00 ? 34 GLU A HA   13 
ATOM 11235 H HB2  . GLU A 1 34 ? 11.254  -3.410  3.425   1.00 0.00 ? 34 GLU A HB2  13 
ATOM 11236 H HB3  . GLU A 1 34 ? 10.340  -3.275  4.928   1.00 0.00 ? 34 GLU A HB3  13 
ATOM 11237 H HG2  . GLU A 1 34 ? 11.630  -5.464  5.592   1.00 0.00 ? 34 GLU A HG2  13 
ATOM 11238 H HG3  . GLU A 1 34 ? 12.748  -4.971  4.322   1.00 0.00 ? 34 GLU A HG3  13 
ATOM 11239 N N    . LEU A 1 35 ? 9.879   -4.412  1.418   1.00 0.00 ? 35 LEU A N    13 
ATOM 11240 C CA   . LEU A 1 35 ? 9.278   -3.938  0.175   1.00 0.00 ? 35 LEU A CA   13 
ATOM 11241 C C    . LEU A 1 35 ? 8.052   -4.779  -0.172  1.00 0.00 ? 35 LEU A C    13 
ATOM 11242 O O    . LEU A 1 35 ? 6.968   -4.247  -0.412  1.00 0.00 ? 35 LEU A O    13 
ATOM 11243 C CB   . LEU A 1 35 ? 10.298  -4.024  -0.972  1.00 0.00 ? 35 LEU A CB   13 
ATOM 11244 C CG   . LEU A 1 35 ? 10.089  -2.880  -1.985  1.00 0.00 ? 35 LEU A CG   13 
ATOM 11245 C CD1  . LEU A 1 35 ? 8.596   -2.700  -2.295  1.00 0.00 ? 35 LEU A CD1  13 
ATOM 11246 C CD2  . LEU A 1 35 ? 10.655  -1.566  -1.429  1.00 0.00 ? 35 LEU A CD2  13 
ATOM 11247 H H    . LEU A 1 35 ? 10.829  -4.648  1.437   1.00 0.00 ? 35 LEU A H    13 
ATOM 11248 H HA   . LEU A 1 35 ? 8.977   -2.910  0.305   1.00 0.00 ? 35 LEU A HA   13 
ATOM 11249 H HB2  . LEU A 1 35 ? 11.296  -3.961  -0.565  1.00 0.00 ? 35 LEU A HB2  13 
ATOM 11250 H HB3  . LEU A 1 35 ? 10.186  -4.971  -1.481  1.00 0.00 ? 35 LEU A HB3  13 
ATOM 11251 H HG   . LEU A 1 35 ? 10.608  -3.128  -2.902  1.00 0.00 ? 35 LEU A HG   13 
ATOM 11252 H HD11 . LEU A 1 35 ? 8.128   -3.665  -2.394  1.00 0.00 ? 35 LEU A HD11 13 
ATOM 11253 H HD12 . LEU A 1 35 ? 8.488   -2.154  -3.220  1.00 0.00 ? 35 LEU A HD12 13 
ATOM 11254 H HD13 . LEU A 1 35 ? 8.124   -2.146  -1.497  1.00 0.00 ? 35 LEU A HD13 13 
ATOM 11255 H HD21 . LEU A 1 35 ? 11.368  -1.775  -0.644  1.00 0.00 ? 35 LEU A HD21 13 
ATOM 11256 H HD22 . LEU A 1 35 ? 9.850   -0.965  -1.034  1.00 0.00 ? 35 LEU A HD22 13 
ATOM 11257 H HD23 . LEU A 1 35 ? 11.149  -1.026  -2.223  1.00 0.00 ? 35 LEU A HD23 13 
ATOM 11258 N N    . LEU A 1 36 ? 8.238   -6.095  -0.201  1.00 0.00 ? 36 LEU A N    13 
ATOM 11259 C CA   . LEU A 1 36 ? 7.144   -7.005  -0.526  1.00 0.00 ? 36 LEU A CA   13 
ATOM 11260 C C    . LEU A 1 36 ? 6.053   -6.935  0.536   1.00 0.00 ? 36 LEU A C    13 
ATOM 11261 O O    . LEU A 1 36 ? 4.875   -6.772  0.213   1.00 0.00 ? 36 LEU A O    13 
ATOM 11262 C CB   . LEU A 1 36 ? 7.673   -8.437  -0.636  1.00 0.00 ? 36 LEU A CB   13 
ATOM 11263 C CG   . LEU A 1 36 ? 8.928   -8.456  -1.515  1.00 0.00 ? 36 LEU A CG   13 
ATOM 11264 C CD1  . LEU A 1 36 ? 9.391   -9.901  -1.709  1.00 0.00 ? 36 LEU A CD1  13 
ATOM 11265 C CD2  . LEU A 1 36 ? 8.610   -7.836  -2.881  1.00 0.00 ? 36 LEU A CD2  13 
ATOM 11266 H H    . LEU A 1 36 ? 9.125   -6.460  -0.006  1.00 0.00 ? 36 LEU A H    13 
ATOM 11267 H HA   . LEU A 1 36 ? 6.722   -6.716  -1.477  1.00 0.00 ? 36 LEU A HA   13 
ATOM 11268 H HB2  . LEU A 1 36 ? 7.917   -8.805  0.350   1.00 0.00 ? 36 LEU A HB2  13 
ATOM 11269 H HB3  . LEU A 1 36 ? 6.915   -9.067  -1.077  1.00 0.00 ? 36 LEU A HB3  13 
ATOM 11270 H HG   . LEU A 1 36 ? 9.711   -7.889  -1.034  1.00 0.00 ? 36 LEU A HG   13 
ATOM 11271 H HD11 . LEU A 1 36 ? 10.134  -9.938  -2.492  1.00 0.00 ? 36 LEU A HD11 13 
ATOM 11272 H HD12 . LEU A 1 36 ? 8.548   -10.517 -1.984  1.00 0.00 ? 36 LEU A HD12 13 
ATOM 11273 H HD13 . LEU A 1 36 ? 9.819   -10.268 -0.788  1.00 0.00 ? 36 LEU A HD13 13 
ATOM 11274 H HD21 . LEU A 1 36 ? 8.621   -6.758  -2.799  1.00 0.00 ? 36 LEU A HD21 13 
ATOM 11275 H HD22 . LEU A 1 36 ? 7.635   -8.161  -3.209  1.00 0.00 ? 36 LEU A HD22 13 
ATOM 11276 H HD23 . LEU A 1 36 ? 9.354   -8.147  -3.600  1.00 0.00 ? 36 LEU A HD23 13 
ATOM 11277 N N    . ALA A 1 37 ? 6.441   -7.053  1.803   1.00 0.00 ? 37 ALA A N    13 
ATOM 11278 C CA   . ALA A 1 37 ? 5.471   -6.994  2.889   1.00 0.00 ? 37 ALA A CA   13 
ATOM 11279 C C    . ALA A 1 37 ? 4.629   -5.729  2.768   1.00 0.00 ? 37 ALA A C    13 
ATOM 11280 O O    . ALA A 1 37 ? 3.406   -5.768  2.894   1.00 0.00 ? 37 ALA A O    13 
ATOM 11281 C CB   . ALA A 1 37 ? 6.187   -7.005  4.241   1.00 0.00 ? 37 ALA A CB   13 
ATOM 11282 H H    . ALA A 1 37 ? 7.394   -7.177  2.008   1.00 0.00 ? 37 ALA A H    13 
ATOM 11283 H HA   . ALA A 1 37 ? 4.822   -7.855  2.829   1.00 0.00 ? 37 ALA A HA   13 
ATOM 11284 H HB1  . ALA A 1 37 ? 6.952   -6.244  4.250   1.00 0.00 ? 37 ALA A HB1  13 
ATOM 11285 H HB2  . ALA A 1 37 ? 6.639   -7.973  4.400   1.00 0.00 ? 37 ALA A HB2  13 
ATOM 11286 H HB3  . ALA A 1 37 ? 5.474   -6.809  5.027   1.00 0.00 ? 37 ALA A HB3  13 
ATOM 11287 N N    . ALA A 1 38 ? 5.296   -4.607  2.515   1.00 0.00 ? 38 ALA A N    13 
ATOM 11288 C CA   . ALA A 1 38 ? 4.603   -3.334  2.371   1.00 0.00 ? 38 ALA A CA   13 
ATOM 11289 C C    . ALA A 1 38 ? 3.760   -3.333  1.100   1.00 0.00 ? 38 ALA A C    13 
ATOM 11290 O O    . ALA A 1 38 ? 2.632   -2.840  1.092   1.00 0.00 ? 38 ALA A O    13 
ATOM 11291 C CB   . ALA A 1 38 ? 5.619   -2.190  2.322   1.00 0.00 ? 38 ALA A CB   13 
ATOM 11292 H H    . ALA A 1 38 ? 6.271   -4.639  2.421   1.00 0.00 ? 38 ALA A H    13 
ATOM 11293 H HA   . ALA A 1 38 ? 3.955   -3.190  3.221   1.00 0.00 ? 38 ALA A HA   13 
ATOM 11294 H HB1  . ALA A 1 38 ? 5.143   -1.273  2.640   1.00 0.00 ? 38 ALA A HB1  13 
ATOM 11295 H HB2  . ALA A 1 38 ? 5.987   -2.073  1.313   1.00 0.00 ? 38 ALA A HB2  13 
ATOM 11296 H HB3  . ALA A 1 38 ? 6.445   -2.413  2.982   1.00 0.00 ? 38 ALA A HB3  13 
ATOM 11297 N N    . CYS A 1 39 ? 4.314   -3.894  0.028   1.00 0.00 ? 39 CYS A N    13 
ATOM 11298 C CA   . CYS A 1 39 ? 3.600   -3.958  -1.242  1.00 0.00 ? 39 CYS A CA   13 
ATOM 11299 C C    . CYS A 1 39 ? 2.308   -4.751  -1.079  1.00 0.00 ? 39 CYS A C    13 
ATOM 11300 O O    . CYS A 1 39 ? 1.233   -4.293  -1.464  1.00 0.00 ? 39 CYS A O    13 
ATOM 11301 C CB   . CYS A 1 39 ? 4.478   -4.620  -2.306  1.00 0.00 ? 39 CYS A CB   13 
ATOM 11302 S SG   . CYS A 1 39 ? 3.811   -4.256  -3.949  1.00 0.00 ? 39 CYS A SG   13 
ATOM 11303 H H    . CYS A 1 39 ? 5.215   -4.274  0.095   1.00 0.00 ? 39 CYS A H    13 
ATOM 11304 H HA   . CYS A 1 39 ? 3.359   -2.954  -1.561  1.00 0.00 ? 39 CYS A HA   13 
ATOM 11305 H HB2  . CYS A 1 39 ? 5.485   -4.236  -2.235  1.00 0.00 ? 39 CYS A HB2  13 
ATOM 11306 H HB3  . CYS A 1 39 ? 4.488   -5.689  -2.153  1.00 0.00 ? 39 CYS A HB3  13 
ATOM 11307 H HG   . CYS A 1 39 ? 3.319   -3.432  -3.893  1.00 0.00 ? 39 CYS A HG   13 
ATOM 11308 N N    . ARG A 1 40 ? 2.422   -5.941  -0.497  1.00 0.00 ? 40 ARG A N    13 
ATOM 11309 C CA   . ARG A 1 40 ? 1.254   -6.787  -0.281  1.00 0.00 ? 40 ARG A CA   13 
ATOM 11310 C C    . ARG A 1 40 ? 0.231   -6.057  0.582   1.00 0.00 ? 40 ARG A C    13 
ATOM 11311 O O    . ARG A 1 40 ? -0.948  -5.984  0.234   1.00 0.00 ? 40 ARG A O    13 
ATOM 11312 C CB   . ARG A 1 40 ? 1.670   -8.089  0.408   1.00 0.00 ? 40 ARG A CB   13 
ATOM 11313 C CG   . ARG A 1 40 ? 2.348   -9.013  -0.607  1.00 0.00 ? 40 ARG A CG   13 
ATOM 11314 C CD   . ARG A 1 40 ? 3.060   -10.151 0.129   1.00 0.00 ? 40 ARG A CD   13 
ATOM 11315 N NE   . ARG A 1 40 ? 3.338   -11.250 -0.787  1.00 0.00 ? 40 ARG A NE   13 
ATOM 11316 C CZ   . ARG A 1 40 ? 2.422   -12.179 -1.047  1.00 0.00 ? 40 ARG A CZ   13 
ATOM 11317 N NH1  . ARG A 1 40 ? 1.248   -12.114 -0.480  1.00 0.00 ? 40 ARG A NH1  13 
ATOM 11318 N NH2  . ARG A 1 40 ? 2.697   -13.156 -1.868  1.00 0.00 ? 40 ARG A NH2  13 
ATOM 11319 H H    . ARG A 1 40 ? 3.304   -6.253  -0.205  1.00 0.00 ? 40 ARG A H    13 
ATOM 11320 H HA   . ARG A 1 40 ? 0.807   -7.021  -1.235  1.00 0.00 ? 40 ARG A HA   13 
ATOM 11321 H HB2  . ARG A 1 40 ? 2.360   -7.868  1.211   1.00 0.00 ? 40 ARG A HB2  13 
ATOM 11322 H HB3  . ARG A 1 40 ? 0.797   -8.580  0.810   1.00 0.00 ? 40 ARG A HB3  13 
ATOM 11323 H HG2  . ARG A 1 40 ? 1.602   -9.424  -1.272  1.00 0.00 ? 40 ARG A HG2  13 
ATOM 11324 H HG3  . ARG A 1 40 ? 3.071   -8.450  -1.179  1.00 0.00 ? 40 ARG A HG3  13 
ATOM 11325 H HD2  . ARG A 1 40 ? 3.989   -9.786  0.540   1.00 0.00 ? 40 ARG A HD2  13 
ATOM 11326 H HD3  . ARG A 1 40 ? 2.430   -10.503 0.934   1.00 0.00 ? 40 ARG A HD3  13 
ATOM 11327 H HE   . ARG A 1 40 ? 4.216   -11.307 -1.218  1.00 0.00 ? 40 ARG A HE   13 
ATOM 11328 H HH11 . ARG A 1 40 ? 1.038   -11.366 0.150   1.00 0.00 ? 40 ARG A HH11 13 
ATOM 11329 H HH12 . ARG A 1 40 ? 0.561   -12.812 -0.676  1.00 0.00 ? 40 ARG A HH12 13 
ATOM 11330 H HH21 . ARG A 1 40 ? 3.597   -13.206 -2.302  1.00 0.00 ? 40 ARG A HH21 13 
ATOM 11331 H HH22 . ARG A 1 40 ? 2.008   -13.853 -2.062  1.00 0.00 ? 40 ARG A HH22 13 
ATOM 11332 N N    . GLU A 1 41 ? 0.692   -5.510  1.702   1.00 0.00 ? 41 GLU A N    13 
ATOM 11333 C CA   . GLU A 1 41 ? -0.192  -4.782  2.601   1.00 0.00 ? 41 GLU A CA   13 
ATOM 11334 C C    . GLU A 1 41 ? -0.827  -3.601  1.873   1.00 0.00 ? 41 GLU A C    13 
ATOM 11335 O O    . GLU A 1 41 ? -1.987  -3.262  2.110   1.00 0.00 ? 41 GLU A O    13 
ATOM 11336 C CB   . GLU A 1 41 ? 0.594   -4.274  3.812   1.00 0.00 ? 41 GLU A CB   13 
ATOM 11337 C CG   . GLU A 1 41 ? 0.985   -5.457  4.699   1.00 0.00 ? 41 GLU A CG   13 
ATOM 11338 C CD   . GLU A 1 41 ? -0.243  -5.995  5.426   1.00 0.00 ? 41 GLU A CD   13 
ATOM 11339 O OE1  . GLU A 1 41 ? -1.226  -5.278  5.495   1.00 0.00 ? 41 GLU A OE1  13 
ATOM 11340 O OE2  . GLU A 1 41 ? -0.180  -7.116  5.905   1.00 0.00 ? 41 GLU A OE2  13 
ATOM 11341 H H    . GLU A 1 41 ? 1.643   -5.595  1.925   1.00 0.00 ? 41 GLU A H    13 
ATOM 11342 H HA   . GLU A 1 41 ? -0.973  -5.445  2.944   1.00 0.00 ? 41 GLU A HA   13 
ATOM 11343 H HB2  . GLU A 1 41 ? 1.485   -3.764  3.476   1.00 0.00 ? 41 GLU A HB2  13 
ATOM 11344 H HB3  . GLU A 1 41 ? -0.019  -3.589  4.380   1.00 0.00 ? 41 GLU A HB3  13 
ATOM 11345 H HG2  . GLU A 1 41 ? 1.410   -6.239  4.085   1.00 0.00 ? 41 GLU A HG2  13 
ATOM 11346 H HG3  . GLU A 1 41 ? 1.718   -5.135  5.424   1.00 0.00 ? 41 GLU A HG3  13 
ATOM 11347 N N    . GLU A 1 42 ? -0.058  -2.984  0.981   1.00 0.00 ? 42 GLU A N    13 
ATOM 11348 C CA   . GLU A 1 42 ? -0.547  -1.851  0.218   1.00 0.00 ? 42 GLU A CA   13 
ATOM 11349 C C    . GLU A 1 42 ? -1.612  -2.304  -0.777  1.00 0.00 ? 42 GLU A C    13 
ATOM 11350 O O    . GLU A 1 42 ? -2.583  -1.589  -1.030  1.00 0.00 ? 42 GLU A O    13 
ATOM 11351 C CB   . GLU A 1 42 ? 0.622   -1.199  -0.526  1.00 0.00 ? 42 GLU A CB   13 
ATOM 11352 C CG   . GLU A 1 42 ? 0.087   -0.171  -1.522  1.00 0.00 ? 42 GLU A CG   13 
ATOM 11353 C CD   . GLU A 1 42 ? 1.130   0.913   -1.775  1.00 0.00 ? 42 GLU A CD   13 
ATOM 11354 O OE1  . GLU A 1 42 ? 2.291   0.567   -1.925  1.00 0.00 ? 42 GLU A OE1  13 
ATOM 11355 O OE2  . GLU A 1 42 ? 0.753   2.073   -1.815  1.00 0.00 ? 42 GLU A OE2  13 
ATOM 11356 H H    . GLU A 1 42 ? 0.855   -3.299  0.829   1.00 0.00 ? 42 GLU A H    13 
ATOM 11357 H HA   . GLU A 1 42 ? -0.978  -1.130  0.893   1.00 0.00 ? 42 GLU A HA   13 
ATOM 11358 H HB2  . GLU A 1 42 ? 1.271   -0.710  0.187   1.00 0.00 ? 42 GLU A HB2  13 
ATOM 11359 H HB3  . GLU A 1 42 ? 1.178   -1.956  -1.056  1.00 0.00 ? 42 GLU A HB3  13 
ATOM 11360 H HG2  . GLU A 1 42 ? -0.149  -0.666  -2.452  1.00 0.00 ? 42 GLU A HG2  13 
ATOM 11361 H HG3  . GLU A 1 42 ? -0.807  0.279   -1.120  1.00 0.00 ? 42 GLU A HG3  13 
ATOM 11362 N N    . PHE A 1 43 ? -1.426  -3.498  -1.332  1.00 0.00 ? 43 PHE A N    13 
ATOM 11363 C CA   . PHE A 1 43 ? -2.379  -4.039  -2.293  1.00 0.00 ? 43 PHE A CA   13 
ATOM 11364 C C    . PHE A 1 43 ? -3.690  -4.387  -1.592  1.00 0.00 ? 43 PHE A C    13 
ATOM 11365 O O    . PHE A 1 43 ? -4.762  -3.944  -2.005  1.00 0.00 ? 43 PHE A O    13 
ATOM 11366 C CB   . PHE A 1 43 ? -1.792  -5.292  -2.961  1.00 0.00 ? 43 PHE A CB   13 
ATOM 11367 C CG   . PHE A 1 43 ? -1.636  -5.060  -4.447  1.00 0.00 ? 43 PHE A CG   13 
ATOM 11368 C CD1  . PHE A 1 43 ? -0.871  -3.982  -4.909  1.00 0.00 ? 43 PHE A CD1  13 
ATOM 11369 C CD2  . PHE A 1 43 ? -2.257  -5.920  -5.362  1.00 0.00 ? 43 PHE A CD2  13 
ATOM 11370 C CE1  . PHE A 1 43 ? -0.725  -3.763  -6.284  1.00 0.00 ? 43 PHE A CE1  13 
ATOM 11371 C CE2  . PHE A 1 43 ? -2.111  -5.702  -6.737  1.00 0.00 ? 43 PHE A CE2  13 
ATOM 11372 C CZ   . PHE A 1 43 ? -1.346  -4.624  -7.199  1.00 0.00 ? 43 PHE A CZ   13 
ATOM 11373 H H    . PHE A 1 43 ? -0.635  -4.024  -1.089  1.00 0.00 ? 43 PHE A H    13 
ATOM 11374 H HA   . PHE A 1 43 ? -2.576  -3.293  -3.049  1.00 0.00 ? 43 PHE A HA   13 
ATOM 11375 H HB2  . PHE A 1 43 ? -0.824  -5.506  -2.530  1.00 0.00 ? 43 PHE A HB2  13 
ATOM 11376 H HB3  . PHE A 1 43 ? -2.448  -6.135  -2.796  1.00 0.00 ? 43 PHE A HB3  13 
ATOM 11377 H HD1  . PHE A 1 43 ? -0.393  -3.318  -4.203  1.00 0.00 ? 43 PHE A HD1  13 
ATOM 11378 H HD2  . PHE A 1 43 ? -2.846  -6.752  -5.007  1.00 0.00 ? 43 PHE A HD2  13 
ATOM 11379 H HE1  . PHE A 1 43 ? -0.135  -2.933  -6.639  1.00 0.00 ? 43 PHE A HE1  13 
ATOM 11380 H HE2  . PHE A 1 43 ? -2.588  -6.365  -7.443  1.00 0.00 ? 43 PHE A HE2  13 
ATOM 11381 H HZ   . PHE A 1 43 ? -1.233  -4.456  -8.259  1.00 0.00 ? 43 PHE A HZ   13 
ATOM 11382 N N    . HIS A 1 44 ? -3.597  -5.181  -0.530  1.00 0.00 ? 44 HIS A N    13 
ATOM 11383 C CA   . HIS A 1 44 ? -4.783  -5.577  0.219   1.00 0.00 ? 44 HIS A CA   13 
ATOM 11384 C C    . HIS A 1 44 ? -5.502  -4.347  0.761   1.00 0.00 ? 44 HIS A C    13 
ATOM 11385 O O    . HIS A 1 44 ? -6.732  -4.291  0.775   1.00 0.00 ? 44 HIS A O    13 
ATOM 11386 C CB   . HIS A 1 44 ? -4.388  -6.493  1.380   1.00 0.00 ? 44 HIS A CB   13 
ATOM 11387 C CG   . HIS A 1 44 ? -5.622  -7.142  1.944   1.00 0.00 ? 44 HIS A CG   13 
ATOM 11388 N ND1  . HIS A 1 44 ? -6.731  -6.409  2.334   1.00 0.00 ? 44 HIS A ND1  13 
ATOM 11389 C CD2  . HIS A 1 44 ? -5.939  -8.456  2.189   1.00 0.00 ? 44 HIS A CD2  13 
ATOM 11390 C CE1  . HIS A 1 44 ? -7.654  -7.276  2.787   1.00 0.00 ? 44 HIS A CE1  13 
ATOM 11391 N NE2  . HIS A 1 44 ? -7.222  -8.538  2.721   1.00 0.00 ? 44 HIS A NE2  13 
ATOM 11392 H H    . HIS A 1 44 ? -2.716  -5.501  -0.244  1.00 0.00 ? 44 HIS A H    13 
ATOM 11393 H HA   . HIS A 1 44 ? -5.450  -6.113  -0.440  1.00 0.00 ? 44 HIS A HA   13 
ATOM 11394 H HB2  . HIS A 1 44 ? -3.712  -7.254  1.023   1.00 0.00 ? 44 HIS A HB2  13 
ATOM 11395 H HB3  . HIS A 1 44 ? -3.904  -5.910  2.149   1.00 0.00 ? 44 HIS A HB3  13 
ATOM 11396 H HD2  . HIS A 1 44 ? -5.289  -9.298  1.997   1.00 0.00 ? 44 HIS A HD2  13 
ATOM 11397 H HE1  . HIS A 1 44 ? -8.626  -6.988  3.160   1.00 0.00 ? 44 HIS A HE1  13 
ATOM 11398 H HE2  . HIS A 1 44 ? -7.703  -9.349  2.989   1.00 0.00 ? 44 HIS A HE2  13 
ATOM 11399 N N    . ARG A 1 45 ? -4.727  -3.364  1.207   1.00 0.00 ? 45 ARG A N    13 
ATOM 11400 C CA   . ARG A 1 45 ? -5.301  -2.138  1.747   1.00 0.00 ? 45 ARG A CA   13 
ATOM 11401 C C    . ARG A 1 45 ? -6.099  -1.404  0.673   1.00 0.00 ? 45 ARG A C    13 
ATOM 11402 O O    . ARG A 1 45 ? -7.257  -1.046  0.883   1.00 0.00 ? 45 ARG A O    13 
ATOM 11403 C CB   . ARG A 1 45 ? -4.191  -1.227  2.272   1.00 0.00 ? 45 ARG A CB   13 
ATOM 11404 C CG   . ARG A 1 45 ? -4.809  -0.011  2.964   1.00 0.00 ? 45 ARG A CG   13 
ATOM 11405 C CD   . ARG A 1 45 ? -3.731  0.731   3.756   1.00 0.00 ? 45 ARG A CD   13 
ATOM 11406 N NE   . ARG A 1 45 ? -4.327  1.810   4.534   1.00 0.00 ? 45 ARG A NE   13 
ATOM 11407 C CZ   . ARG A 1 45 ? -5.077  1.554   5.601   1.00 0.00 ? 45 ARG A CZ   13 
ATOM 11408 N NH1  . ARG A 1 45 ? -5.290  0.319   5.967   1.00 0.00 ? 45 ARG A NH1  13 
ATOM 11409 N NH2  . ARG A 1 45 ? -5.599  2.536   6.282   1.00 0.00 ? 45 ARG A NH2  13 
ATOM 11410 H H    . ARG A 1 45 ? -3.752  -3.465  1.170   1.00 0.00 ? 45 ARG A H    13 
ATOM 11411 H HA   . ARG A 1 45 ? -5.961  -2.389  2.563   1.00 0.00 ? 45 ARG A HA   13 
ATOM 11412 H HB2  . ARG A 1 45 ? -3.582  -1.775  2.980   1.00 0.00 ? 45 ARG A HB2  13 
ATOM 11413 H HB3  . ARG A 1 45 ? -3.575  -0.898  1.450   1.00 0.00 ? 45 ARG A HB3  13 
ATOM 11414 H HG2  . ARG A 1 45 ? -5.229  0.650   2.218   1.00 0.00 ? 45 ARG A HG2  13 
ATOM 11415 H HG3  . ARG A 1 45 ? -5.587  -0.336  3.637   1.00 0.00 ? 45 ARG A HG3  13 
ATOM 11416 H HD2  . ARG A 1 45 ? -3.240  0.040   4.423   1.00 0.00 ? 45 ARG A HD2  13 
ATOM 11417 H HD3  . ARG A 1 45 ? -3.003  1.140   3.069   1.00 0.00 ? 45 ARG A HD3  13 
ATOM 11418 H HE   . ARG A 1 45 ? -4.172  2.739   4.266   1.00 0.00 ? 45 ARG A HE   13 
ATOM 11419 H HH11 . ARG A 1 45 ? -4.890  -0.434  5.445   1.00 0.00 ? 45 ARG A HH11 13 
ATOM 11420 H HH12 . ARG A 1 45 ? -5.854  0.127   6.770   1.00 0.00 ? 45 ARG A HH12 13 
ATOM 11421 H HH21 . ARG A 1 45 ? -5.436  3.482   6.002   1.00 0.00 ? 45 ARG A HH21 13 
ATOM 11422 H HH22 . ARG A 1 45 ? -6.163  2.343   7.085   1.00 0.00 ? 45 ARG A HH22 13 
ATOM 11423 N N    . ARG A 1 46 ? -5.470  -1.183  -0.477  1.00 0.00 ? 46 ARG A N    13 
ATOM 11424 C CA   . ARG A 1 46 ? -6.132  -0.490  -1.577  1.00 0.00 ? 46 ARG A CA   13 
ATOM 11425 C C    . ARG A 1 46 ? -7.380  -1.249  -2.018  1.00 0.00 ? 46 ARG A C    13 
ATOM 11426 O O    . ARG A 1 46 ? -8.426  -0.651  -2.270  1.00 0.00 ? 46 ARG A O    13 
ATOM 11427 C CB   . ARG A 1 46 ? -5.171  -0.347  -2.760  1.00 0.00 ? 46 ARG A CB   13 
ATOM 11428 C CG   . ARG A 1 46 ? -5.922  0.230   -3.965  1.00 0.00 ? 46 ARG A CG   13 
ATOM 11429 C CD   . ARG A 1 46 ? -4.916  0.755   -4.993  1.00 0.00 ? 46 ARG A CD   13 
ATOM 11430 N NE   . ARG A 1 46 ? -4.421  2.066   -4.591  1.00 0.00 ? 46 ARG A NE   13 
ATOM 11431 C CZ   . ARG A 1 46 ? -5.206  3.138   -4.622  1.00 0.00 ? 46 ARG A CZ   13 
ATOM 11432 N NH1  . ARG A 1 46 ? -6.442  3.027   -5.023  1.00 0.00 ? 46 ARG A NH1  13 
ATOM 11433 N NH2  . ARG A 1 46 ? -4.739  4.300   -4.256  1.00 0.00 ? 46 ARG A NH2  13 
ATOM 11434 H H    . ARG A 1 46 ? -4.546  -1.490  -0.589  1.00 0.00 ? 46 ARG A H    13 
ATOM 11435 H HA   . ARG A 1 46 ? -6.423  0.496   -1.243  1.00 0.00 ? 46 ARG A HA   13 
ATOM 11436 H HB2  . ARG A 1 46 ? -4.362  0.314   -2.487  1.00 0.00 ? 46 ARG A HB2  13 
ATOM 11437 H HB3  . ARG A 1 46 ? -4.774  -1.317  -3.019  1.00 0.00 ? 46 ARG A HB3  13 
ATOM 11438 H HG2  . ARG A 1 46 ? -6.526  -0.543  -4.414  1.00 0.00 ? 46 ARG A HG2  13 
ATOM 11439 H HG3  . ARG A 1 46 ? -6.557  1.041   -3.640  1.00 0.00 ? 46 ARG A HG3  13 
ATOM 11440 H HD2  . ARG A 1 46 ? -4.088  0.067   -5.069  1.00 0.00 ? 46 ARG A HD2  13 
ATOM 11441 H HD3  . ARG A 1 46 ? -5.402  0.834   -5.955  1.00 0.00 ? 46 ARG A HD3  13 
ATOM 11442 H HE   . ARG A 1 46 ? -3.492  2.158   -4.289  1.00 0.00 ? 46 ARG A HE   13 
ATOM 11443 H HH11 . ARG A 1 46 ? -6.799  2.137   -5.305  1.00 0.00 ? 46 ARG A HH11 13 
ATOM 11444 H HH12 . ARG A 1 46 ? -7.034  3.834   -5.047  1.00 0.00 ? 46 ARG A HH12 13 
ATOM 11445 H HH21 . ARG A 1 46 ? -3.792  4.385   -3.950  1.00 0.00 ? 46 ARG A HH21 13 
ATOM 11446 H HH22 . ARG A 1 46 ? -5.332  5.106   -4.281  1.00 0.00 ? 46 ARG A HH22 13 
ATOM 11447 N N    . LEU A 1 47 ? -7.263  -2.570  -2.110  1.00 0.00 ? 47 LEU A N    13 
ATOM 11448 C CA   . LEU A 1 47 ? -8.390  -3.399  -2.524  1.00 0.00 ? 47 LEU A CA   13 
ATOM 11449 C C    . LEU A 1 47 ? -9.460  -3.429  -1.437  1.00 0.00 ? 47 LEU A C    13 
ATOM 11450 O O    . LEU A 1 47 ? -10.650 -3.559  -1.727  1.00 0.00 ? 47 LEU A O    13 
ATOM 11451 C CB   . LEU A 1 47 ? -7.912  -4.825  -2.815  1.00 0.00 ? 47 LEU A CB   13 
ATOM 11452 C CG   . LEU A 1 47 ? -6.853  -4.802  -3.925  1.00 0.00 ? 47 LEU A CG   13 
ATOM 11453 C CD1  . LEU A 1 47 ? -5.984  -6.057  -3.829  1.00 0.00 ? 47 LEU A CD1  13 
ATOM 11454 C CD2  . LEU A 1 47 ? -7.537  -4.767  -5.296  1.00 0.00 ? 47 LEU A CD2  13 
ATOM 11455 H H    . LEU A 1 47 ? -6.406  -2.995  -1.899  1.00 0.00 ? 47 LEU A H    13 
ATOM 11456 H HA   . LEU A 1 47 ? -8.818  -2.984  -3.424  1.00 0.00 ? 47 LEU A HA   13 
ATOM 11457 H HB2  . LEU A 1 47 ? -7.485  -5.247  -1.917  1.00 0.00 ? 47 LEU A HB2  13 
ATOM 11458 H HB3  . LEU A 1 47 ? -8.751  -5.428  -3.130  1.00 0.00 ? 47 LEU A HB3  13 
ATOM 11459 H HG   . LEU A 1 47 ? -6.231  -3.925  -3.810  1.00 0.00 ? 47 LEU A HG   13 
ATOM 11460 H HD11 . LEU A 1 47 ? -5.320  -6.100  -4.681  1.00 0.00 ? 47 LEU A HD11 13 
ATOM 11461 H HD12 . LEU A 1 47 ? -6.615  -6.932  -3.819  1.00 0.00 ? 47 LEU A HD12 13 
ATOM 11462 H HD13 . LEU A 1 47 ? -5.401  -6.022  -2.920  1.00 0.00 ? 47 LEU A HD13 13 
ATOM 11463 H HD21 . LEU A 1 47 ? -8.254  -5.572  -5.363  1.00 0.00 ? 47 LEU A HD21 13 
ATOM 11464 H HD22 . LEU A 1 47 ? -6.794  -4.882  -6.071  1.00 0.00 ? 47 LEU A HD22 13 
ATOM 11465 H HD23 . LEU A 1 47 ? -8.044  -3.821  -5.423  1.00 0.00 ? 47 LEU A HD23 13 
ATOM 11466 N N    . LYS A 1 48 ? -9.030  -3.309  -0.185  1.00 0.00 ? 48 LYS A N    13 
ATOM 11467 C CA   . LYS A 1 48 ? -9.961  -3.324  0.937   1.00 0.00 ? 48 LYS A CA   13 
ATOM 11468 C C    . LYS A 1 48 ? -10.850 -2.085  0.912   1.00 0.00 ? 48 LYS A C    13 
ATOM 11469 O O    . LYS A 1 48 ? -12.076 -2.187  0.952   1.00 0.00 ? 48 LYS A O    13 
ATOM 11470 C CB   . LYS A 1 48 ? -9.189  -3.371  2.257   1.00 0.00 ? 48 LYS A CB   13 
ATOM 11471 C CG   . LYS A 1 48 ? -10.172 -3.312  3.428   1.00 0.00 ? 48 LYS A CG   13 
ATOM 11472 C CD   . LYS A 1 48 ? -9.447  -3.689  4.723   1.00 0.00 ? 48 LYS A CD   13 
ATOM 11473 C CE   . LYS A 1 48 ? -10.303 -3.283  5.924   1.00 0.00 ? 48 LYS A CE   13 
ATOM 11474 N NZ   . LYS A 1 48 ? -10.232 -1.806  6.108   1.00 0.00 ? 48 LYS A NZ   13 
ATOM 11475 H H    . LYS A 1 48 ? -8.071  -3.208  -0.013  1.00 0.00 ? 48 LYS A H    13 
ATOM 11476 H HA   . LYS A 1 48 ? -10.583 -4.203  0.866   1.00 0.00 ? 48 LYS A HA   13 
ATOM 11477 H HB2  . LYS A 1 48 ? -8.621  -4.290  2.308   1.00 0.00 ? 48 LYS A HB2  13 
ATOM 11478 H HB3  . LYS A 1 48 ? -8.516  -2.529  2.311   1.00 0.00 ? 48 LYS A HB3  13 
ATOM 11479 H HG2  . LYS A 1 48 ? -10.569 -2.311  3.513   1.00 0.00 ? 48 LYS A HG2  13 
ATOM 11480 H HG3  . LYS A 1 48 ? -10.980 -4.007  3.255   1.00 0.00 ? 48 LYS A HG3  13 
ATOM 11481 H HD2  . LYS A 1 48 ? -9.279  -4.756  4.744   1.00 0.00 ? 48 LYS A HD2  13 
ATOM 11482 H HD3  . LYS A 1 48 ? -8.500  -3.173  4.767   1.00 0.00 ? 48 LYS A HD3  13 
ATOM 11483 H HE2  . LYS A 1 48 ? -11.328 -3.575  5.752   1.00 0.00 ? 48 LYS A HE2  13 
ATOM 11484 H HE3  . LYS A 1 48 ? -9.933  -3.775  6.812   1.00 0.00 ? 48 LYS A HE3  13 
ATOM 11485 H HZ1  . LYS A 1 48 ? -10.930 -1.346  5.490   1.00 0.00 ? 48 LYS A HZ1  13 
ATOM 11486 H HZ2  . LYS A 1 48 ? -9.280  -1.471  5.862   1.00 0.00 ? 48 LYS A HZ2  13 
ATOM 11487 H HZ3  . LYS A 1 48 ? -10.437 -1.570  7.101   1.00 0.00 ? 48 LYS A HZ3  13 
ATOM 11488 N N    . VAL A 1 49 ? -10.224 -0.915  0.846   1.00 0.00 ? 49 VAL A N    13 
ATOM 11489 C CA   . VAL A 1 49 ? -10.968 0.339   0.815   1.00 0.00 ? 49 VAL A CA   13 
ATOM 11490 C C    . VAL A 1 49 ? -11.717 0.484   -0.505  1.00 0.00 ? 49 VAL A C    13 
ATOM 11491 O O    . VAL A 1 49 ? -12.849 0.968   -0.537  1.00 0.00 ? 49 VAL A O    13 
ATOM 11492 C CB   . VAL A 1 49 ? -10.011 1.519   0.995   1.00 0.00 ? 49 VAL A CB   13 
ATOM 11493 C CG1  . VAL A 1 49 ? -9.269  1.378   2.326   1.00 0.00 ? 49 VAL A CG1  13 
ATOM 11494 C CG2  . VAL A 1 49 ? -8.999  1.533   -0.152  1.00 0.00 ? 49 VAL A CG2  13 
ATOM 11495 H H    . VAL A 1 49 ? -9.243  -0.894  0.817   1.00 0.00 ? 49 VAL A H    13 
ATOM 11496 H HA   . VAL A 1 49 ? -11.680 0.343   1.626   1.00 0.00 ? 49 VAL A HA   13 
ATOM 11497 H HB   . VAL A 1 49 ? -10.574 2.441   0.993   1.00 0.00 ? 49 VAL A HB   13 
ATOM 11498 H HG11 . VAL A 1 49 ? -9.948  1.585   3.139   1.00 0.00 ? 49 VAL A HG11 13 
ATOM 11499 H HG12 . VAL A 1 49 ? -8.448  2.078   2.354   1.00 0.00 ? 49 VAL A HG12 13 
ATOM 11500 H HG13 . VAL A 1 49 ? -8.889  0.372   2.420   1.00 0.00 ? 49 VAL A HG13 13 
ATOM 11501 H HG21 . VAL A 1 49 ? -8.556  0.554   -0.252  1.00 0.00 ? 49 VAL A HG21 13 
ATOM 11502 H HG22 . VAL A 1 49 ? -8.227  2.258   0.058   1.00 0.00 ? 49 VAL A HG22 13 
ATOM 11503 H HG23 . VAL A 1 49 ? -9.500  1.797   -1.071  1.00 0.00 ? 49 VAL A HG23 13 
ATOM 11504 N N    . TYR A 1 50 ? -11.080 0.059   -1.591  1.00 0.00 ? 50 TYR A N    13 
ATOM 11505 C CA   . TYR A 1 50 ? -11.697 0.146   -2.909  1.00 0.00 ? 50 TYR A CA   13 
ATOM 11506 C C    . TYR A 1 50 ? -12.955 -0.712  -2.969  1.00 0.00 ? 50 TYR A C    13 
ATOM 11507 O O    . TYR A 1 50 ? -13.961 -0.319  -3.559  1.00 0.00 ? 50 TYR A O    13 
ATOM 11508 C CB   . TYR A 1 50 ? -10.709 -0.318  -3.981  1.00 0.00 ? 50 TYR A CB   13 
ATOM 11509 C CG   . TYR A 1 50 ? -11.345 -0.191  -5.342  1.00 0.00 ? 50 TYR A CG   13 
ATOM 11510 C CD1  . TYR A 1 50 ? -11.317 1.035   -6.016  1.00 0.00 ? 50 TYR A CD1  13 
ATOM 11511 C CD2  . TYR A 1 50 ? -11.964 -1.300  -5.933  1.00 0.00 ? 50 TYR A CD2  13 
ATOM 11512 C CE1  . TYR A 1 50 ? -11.907 1.153   -7.280  1.00 0.00 ? 50 TYR A CE1  13 
ATOM 11513 C CE2  . TYR A 1 50 ? -12.555 -1.182  -7.197  1.00 0.00 ? 50 TYR A CE2  13 
ATOM 11514 C CZ   . TYR A 1 50 ? -12.526 0.044   -7.871  1.00 0.00 ? 50 TYR A CZ   13 
ATOM 11515 O OH   . TYR A 1 50 ? -13.109 0.160   -9.116  1.00 0.00 ? 50 TYR A OH   13 
ATOM 11516 H H    . TYR A 1 50 ? -10.180 -0.318  -1.505  1.00 0.00 ? 50 TYR A H    13 
ATOM 11517 H HA   . TYR A 1 50 ? -11.964 1.173   -3.104  1.00 0.00 ? 50 TYR A HA   13 
ATOM 11518 H HB2  . TYR A 1 50 ? -9.819  0.293   -3.940  1.00 0.00 ? 50 TYR A HB2  13 
ATOM 11519 H HB3  . TYR A 1 50 ? -10.443 -1.350  -3.802  1.00 0.00 ? 50 TYR A HB3  13 
ATOM 11520 H HD1  . TYR A 1 50 ? -10.840 1.891   -5.562  1.00 0.00 ? 50 TYR A HD1  13 
ATOM 11521 H HD2  . TYR A 1 50 ? -11.985 -2.247  -5.413  1.00 0.00 ? 50 TYR A HD2  13 
ATOM 11522 H HE1  . TYR A 1 50 ? -11.887 2.100   -7.800  1.00 0.00 ? 50 TYR A HE1  13 
ATOM 11523 H HE2  . TYR A 1 50 ? -13.032 -2.039  -7.651  1.00 0.00 ? 50 TYR A HE2  13 
ATOM 11524 H HH   . TYR A 1 50 ? -13.189 -0.720  -9.489  1.00 0.00 ? 50 TYR A HH   13 
ATOM 11525 N N    . HIS A 1 51 ? -12.892 -1.890  -2.354  1.00 0.00 ? 51 HIS A N    13 
ATOM 11526 C CA   . HIS A 1 51 ? -14.033 -2.798  -2.344  1.00 0.00 ? 51 HIS A CA   13 
ATOM 11527 C C    . HIS A 1 51 ? -15.064 -2.351  -1.313  1.00 0.00 ? 51 HIS A C    13 
ATOM 11528 O O    . HIS A 1 51 ? -16.264 -2.571  -1.484  1.00 0.00 ? 51 HIS A O    13 
ATOM 11529 C CB   . HIS A 1 51 ? -13.566 -4.218  -2.019  1.00 0.00 ? 51 HIS A CB   13 
ATOM 11530 C CG   . HIS A 1 51 ? -14.689 -5.186  -2.276  1.00 0.00 ? 51 HIS A CG   13 
ATOM 11531 N ND1  . HIS A 1 51 ? -15.084 -6.126  -1.338  1.00 0.00 ? 51 HIS A ND1  13 
ATOM 11532 C CD2  . HIS A 1 51 ? -15.509 -5.372  -3.362  1.00 0.00 ? 51 HIS A CD2  13 
ATOM 11533 C CE1  . HIS A 1 51 ? -16.099 -6.830  -1.872  1.00 0.00 ? 51 HIS A CE1  13 
ATOM 11534 N NE2  . HIS A 1 51 ? -16.400 -6.412  -3.103  1.00 0.00 ? 51 HIS A NE2  13 
ATOM 11535 H H    . HIS A 1 51 ? -12.064 -2.152  -1.900  1.00 0.00 ? 51 HIS A H    13 
ATOM 11536 H HA   . HIS A 1 51 ? -14.491 -2.797  -3.321  1.00 0.00 ? 51 HIS A HA   13 
ATOM 11537 H HB2  . HIS A 1 51 ? -12.723 -4.471  -2.644  1.00 0.00 ? 51 HIS A HB2  13 
ATOM 11538 H HB3  . HIS A 1 51 ? -13.275 -4.273  -0.981  1.00 0.00 ? 51 HIS A HB3  13 
ATOM 11539 H HD2  . HIS A 1 51 ? -15.470 -4.801  -4.277  1.00 0.00 ? 51 HIS A HD2  13 
ATOM 11540 H HE1  . HIS A 1 51 ? -16.610 -7.636  -1.363  1.00 0.00 ? 51 HIS A HE1  13 
ATOM 11541 H HE2  . HIS A 1 51 ? -17.095 -6.760  -3.698  1.00 0.00 ? 51 HIS A HE2  13 
ATOM 11542 N N    . ALA A 1 52 ? -14.589 -1.725  -0.242  1.00 0.00 ? 52 ALA A N    13 
ATOM 11543 C CA   . ALA A 1 52 ? -15.480 -1.251  0.812   1.00 0.00 ? 52 ALA A CA   13 
ATOM 11544 C C    . ALA A 1 52 ? -16.234 -0.007  0.357   1.00 0.00 ? 52 ALA A C    13 
ATOM 11545 O O    . ALA A 1 52 ? -17.464 0.030   0.384   1.00 0.00 ? 52 ALA A O    13 
ATOM 11546 C CB   . ALA A 1 52 ? -14.674 -0.931  2.073   1.00 0.00 ? 52 ALA A CB   13 
ATOM 11547 H H    . ALA A 1 52 ? -13.624 -1.578  -0.158  1.00 0.00 ? 52 ALA A H    13 
ATOM 11548 H HA   . ALA A 1 52 ? -16.193 -2.029  1.044   1.00 0.00 ? 52 ALA A HA   13 
ATOM 11549 H HB1  . ALA A 1 52 ? -15.349 -0.792  2.904   1.00 0.00 ? 52 ALA A HB1  13 
ATOM 11550 H HB2  . ALA A 1 52 ? -14.106 -0.026  1.915   1.00 0.00 ? 52 ALA A HB2  13 
ATOM 11551 H HB3  . ALA A 1 52 ? -14.000 -1.746  2.287   1.00 0.00 ? 52 ALA A HB3  13 
ATOM 11552 N N    . TRP A 1 53 ? -15.489 1.012   -0.062  1.00 0.00 ? 53 TRP A N    13 
ATOM 11553 C CA   . TRP A 1 53 ? -16.098 2.254   -0.520  1.00 0.00 ? 53 TRP A CA   13 
ATOM 11554 C C    . TRP A 1 53 ? -17.233 1.966   -1.499  1.00 0.00 ? 53 TRP A C    13 
ATOM 11555 O O    . TRP A 1 53 ? -18.214 2.707   -1.561  1.00 0.00 ? 53 TRP A O    13 
ATOM 11556 C CB   . TRP A 1 53 ? -15.038 3.132   -1.197  1.00 0.00 ? 53 TRP A CB   13 
ATOM 11557 C CG   . TRP A 1 53 ? -15.403 4.574   -1.041  1.00 0.00 ? 53 TRP A CG   13 
ATOM 11558 C CD1  . TRP A 1 53 ? -15.568 5.208   0.142   1.00 0.00 ? 53 TRP A CD1  13 
ATOM 11559 C CD2  . TRP A 1 53 ? -15.648 5.568   -2.077  1.00 0.00 ? 53 TRP A CD2  13 
ATOM 11560 N NE1  . TRP A 1 53 ? -15.901 6.529   -0.101  1.00 0.00 ? 53 TRP A NE1  13 
ATOM 11561 C CE2  . TRP A 1 53 ? -15.962 6.800   -1.454  1.00 0.00 ? 53 TRP A CE2  13 
ATOM 11562 C CE3  . TRP A 1 53 ? -15.630 5.523   -3.483  1.00 0.00 ? 53 TRP A CE3  13 
ATOM 11563 C CZ2  . TRP A 1 53 ? -16.246 7.944   -2.198  1.00 0.00 ? 53 TRP A CZ2  13 
ATOM 11564 C CZ3  . TRP A 1 53 ? -15.915 6.673   -4.236  1.00 0.00 ? 53 TRP A CZ3  13 
ATOM 11565 C CH2  . TRP A 1 53 ? -16.224 7.882   -3.595  1.00 0.00 ? 53 TRP A CH2  13 
ATOM 11566 H H    . TRP A 1 53 ? -14.514 0.926   -0.059  1.00 0.00 ? 53 TRP A H    13 
ATOM 11567 H HA   . TRP A 1 53 ? -16.498 2.780   0.335   1.00 0.00 ? 53 TRP A HA   13 
ATOM 11568 H HB2  . TRP A 1 53 ? -14.078 2.955   -0.735  1.00 0.00 ? 53 TRP A HB2  13 
ATOM 11569 H HB3  . TRP A 1 53 ? -14.980 2.886   -2.247  1.00 0.00 ? 53 TRP A HB3  13 
ATOM 11570 H HD1  . TRP A 1 53 ? -15.460 4.754   1.116   1.00 0.00 ? 53 TRP A HD1  13 
ATOM 11571 H HE1  . TRP A 1 53 ? -16.075 7.202   0.588   1.00 0.00 ? 53 TRP A HE1  13 
ATOM 11572 H HE3  . TRP A 1 53 ? -15.394 4.596   -3.986  1.00 0.00 ? 53 TRP A HE3  13 
ATOM 11573 H HZ2  . TRP A 1 53 ? -16.483 8.873   -1.699  1.00 0.00 ? 53 TRP A HZ2  13 
ATOM 11574 H HZ3  . TRP A 1 53 ? -15.898 6.626   -5.314  1.00 0.00 ? 53 TRP A HZ3  13 
ATOM 11575 H HH2  . TRP A 1 53 ? -16.443 8.764   -4.179  1.00 0.00 ? 53 TRP A HH2  13 
ATOM 11576 N N    . LYS A 1 54 ? -17.091 0.886   -2.261  1.00 0.00 ? 54 LYS A N    13 
ATOM 11577 C CA   . LYS A 1 54 ? -18.111 0.511   -3.233  1.00 0.00 ? 54 LYS A CA   13 
ATOM 11578 C C    . LYS A 1 54 ? -19.269 -0.212  -2.549  1.00 0.00 ? 54 LYS A C    13 
ATOM 11579 O O    . LYS A 1 54 ? -20.184 0.422   -2.023  1.00 0.00 ? 54 LYS A O    13 
ATOM 11580 C CB   . LYS A 1 54 ? -17.500 -0.391  -4.309  1.00 0.00 ? 54 LYS A CB   13 
ATOM 11581 C CG   . LYS A 1 54 ? -18.559 -0.719  -5.364  1.00 0.00 ? 54 LYS A CG   13 
ATOM 11582 C CD   . LYS A 1 54 ? -17.886 -1.363  -6.579  1.00 0.00 ? 54 LYS A CD   13 
ATOM 11583 C CE   . LYS A 1 54 ? -18.957 -1.934  -7.512  1.00 0.00 ? 54 LYS A CE   13 
ATOM 11584 N NZ   . LYS A 1 54 ? -18.352 -2.220  -8.844  1.00 0.00 ? 54 LYS A NZ   13 
ATOM 11585 H H    . LYS A 1 54 ? -16.288 0.332   -2.168  1.00 0.00 ? 54 LYS A H    13 
ATOM 11586 H HA   . LYS A 1 54 ? -18.491 1.405   -3.705  1.00 0.00 ? 54 LYS A HA   13 
ATOM 11587 H HB2  . LYS A 1 54 ? -16.671 0.120   -4.777  1.00 0.00 ? 54 LYS A HB2  13 
ATOM 11588 H HB3  . LYS A 1 54 ? -17.149 -1.305  -3.857  1.00 0.00 ? 54 LYS A HB3  13 
ATOM 11589 H HG2  . LYS A 1 54 ? -19.283 -1.403  -4.948  1.00 0.00 ? 54 LYS A HG2  13 
ATOM 11590 H HG3  . LYS A 1 54 ? -19.054 0.189   -5.671  1.00 0.00 ? 54 LYS A HG3  13 
ATOM 11591 H HD2  . LYS A 1 54 ? -17.307 -0.618  -7.107  1.00 0.00 ? 54 LYS A HD2  13 
ATOM 11592 H HD3  . LYS A 1 54 ? -17.236 -2.159  -6.251  1.00 0.00 ? 54 LYS A HD3  13 
ATOM 11593 H HE2  . LYS A 1 54 ? -19.350 -2.848  -7.092  1.00 0.00 ? 54 LYS A HE2  13 
ATOM 11594 H HE3  . LYS A 1 54 ? -19.756 -1.216  -7.625  1.00 0.00 ? 54 LYS A HE3  13 
ATOM 11595 H HZ1  . LYS A 1 54 ? -18.496 -3.223  -9.083  1.00 0.00 ? 54 LYS A HZ1  13 
ATOM 11596 H HZ2  . LYS A 1 54 ? -17.333 -2.015  -8.814  1.00 0.00 ? 54 LYS A HZ2  13 
ATOM 11597 H HZ3  . LYS A 1 54 ? -18.806 -1.623  -9.565  1.00 0.00 ? 54 LYS A HZ3  13 
ATOM 11598 N N    . SER A 1 55 ? -19.221 -1.541  -2.553  1.00 0.00 ? 55 SER A N    13 
ATOM 11599 C CA   . SER A 1 55 ? -20.271 -2.338  -1.925  1.00 0.00 ? 55 SER A CA   13 
ATOM 11600 C C    . SER A 1 55 ? -21.647 -1.751  -2.224  1.00 0.00 ? 55 SER A C    13 
ATOM 11601 O O    . SER A 1 55 ? -22.291 -1.178  -1.345  1.00 0.00 ? 55 SER A O    13 
ATOM 11602 C CB   . SER A 1 55 ? -20.053 -2.389  -0.413  1.00 0.00 ? 55 SER A CB   13 
ATOM 11603 O OG   . SER A 1 55 ? -19.828 -1.073  0.073   1.00 0.00 ? 55 SER A OG   13 
ATOM 11604 H H    . SER A 1 55 ? -18.467 -1.994  -2.984  1.00 0.00 ? 55 SER A H    13 
ATOM 11605 H HA   . SER A 1 55 ? -20.227 -3.344  -2.317  1.00 0.00 ? 55 SER A HA   13 
ATOM 11606 H HB2  . SER A 1 55 ? -20.927 -2.798  0.065   1.00 0.00 ? 55 SER A HB2  13 
ATOM 11607 H HB3  . SER A 1 55 ? -19.199 -3.015  -0.195  1.00 0.00 ? 55 SER A HB3  13 
ATOM 11608 H HG   . SER A 1 55 ? -20.569 -0.832  0.634   1.00 0.00 ? 55 SER A HG   13 
ATOM 11609 N N    . LYS A 1 56 ? -22.093 -1.898  -3.469  1.00 0.00 ? 56 LYS A N    13 
ATOM 11610 C CA   . LYS A 1 56 ? -23.396 -1.378  -3.871  1.00 0.00 ? 56 LYS A CA   13 
ATOM 11611 C C    . LYS A 1 56 ? -24.467 -2.456  -3.738  1.00 0.00 ? 56 LYS A C    13 
ATOM 11612 O O    . LYS A 1 56 ? -24.324 -3.556  -4.271  1.00 0.00 ? 56 LYS A O    13 
ATOM 11613 C CB   . LYS A 1 56 ? -23.339 -0.892  -5.322  1.00 0.00 ? 56 LYS A CB   13 
ATOM 11614 C CG   . LYS A 1 56 ? -22.362 0.281   -5.430  1.00 0.00 ? 56 LYS A CG   13 
ATOM 11615 C CD   . LYS A 1 56 ? -22.542 0.985   -6.782  1.00 0.00 ? 56 LYS A CD   13 
ATOM 11616 C CE   . LYS A 1 56 ? -23.637 2.051   -6.671  1.00 0.00 ? 56 LYS A CE   13 
ATOM 11617 N NZ   . LYS A 1 56 ? -23.756 2.776   -7.967  1.00 0.00 ? 56 LYS A NZ   13 
ATOM 11618 H H    . LYS A 1 56 ? -21.536 -2.363  -4.127  1.00 0.00 ? 56 LYS A H    13 
ATOM 11619 H HA   . LYS A 1 56 ? -23.657 -0.545  -3.237  1.00 0.00 ? 56 LYS A HA   13 
ATOM 11620 H HB2  . LYS A 1 56 ? -23.005 -1.701  -5.958  1.00 0.00 ? 56 LYS A HB2  13 
ATOM 11621 H HB3  . LYS A 1 56 ? -24.321 -0.572  -5.633  1.00 0.00 ? 56 LYS A HB3  13 
ATOM 11622 H HG2  . LYS A 1 56 ? -22.551 0.979   -4.627  1.00 0.00 ? 56 LYS A HG2  13 
ATOM 11623 H HG3  . LYS A 1 56 ? -21.351 -0.088  -5.352  1.00 0.00 ? 56 LYS A HG3  13 
ATOM 11624 H HD2  . LYS A 1 56 ? -21.613 1.456   -7.067  1.00 0.00 ? 56 LYS A HD2  13 
ATOM 11625 H HD3  . LYS A 1 56 ? -22.824 0.260   -7.532  1.00 0.00 ? 56 LYS A HD3  13 
ATOM 11626 H HE2  . LYS A 1 56 ? -24.578 1.578   -6.436  1.00 0.00 ? 56 LYS A HE2  13 
ATOM 11627 H HE3  . LYS A 1 56 ? -23.381 2.750   -5.889  1.00 0.00 ? 56 LYS A HE3  13 
ATOM 11628 H HZ1  . LYS A 1 56 ? -23.516 3.779   -7.827  1.00 0.00 ? 56 LYS A HZ1  13 
ATOM 11629 H HZ2  . LYS A 1 56 ? -24.732 2.702   -8.317  1.00 0.00 ? 56 LYS A HZ2  13 
ATOM 11630 H HZ3  . LYS A 1 56 ? -23.104 2.356   -8.660  1.00 0.00 ? 56 LYS A HZ3  13 
ATOM 11631 N N    . ASN A 1 57 ? -25.540 -2.132  -3.024  1.00 0.00 ? 57 ASN A N    13 
ATOM 11632 C CA   . ASN A 1 57 ? -26.632 -3.081  -2.827  1.00 0.00 ? 57 ASN A CA   13 
ATOM 11633 C C    . ASN A 1 57 ? -27.558 -3.091  -4.038  1.00 0.00 ? 57 ASN A C    13 
ATOM 11634 O O    . ASN A 1 57 ? -27.243 -3.686  -5.069  1.00 0.00 ? 57 ASN A O    13 
ATOM 11635 C CB   . ASN A 1 57 ? -27.427 -2.708  -1.575  1.00 0.00 ? 57 ASN A CB   13 
ATOM 11636 C CG   . ASN A 1 57 ? -26.585 -2.959  -0.328  1.00 0.00 ? 57 ASN A CG   13 
ATOM 11637 O OD1  . ASN A 1 57 ? -27.086 -2.856  0.791   1.00 0.00 ? 57 ASN A OD1  13 
ATOM 11638 N ND2  . ASN A 1 57 ? -25.327 -3.283  -0.457  1.00 0.00 ? 57 ASN A ND2  13 
ATOM 11639 H H    . ASN A 1 57 ? -25.601 -1.240  -2.624  1.00 0.00 ? 57 ASN A H    13 
ATOM 11640 H HA   . ASN A 1 57 ? -26.217 -4.069  -2.695  1.00 0.00 ? 57 ASN A HA   13 
ATOM 11641 H HB2  . ASN A 1 57 ? -27.699 -1.664  -1.620  1.00 0.00 ? 57 ASN A HB2  13 
ATOM 11642 H HB3  . ASN A 1 57 ? -28.323 -3.310  -1.528  1.00 0.00 ? 57 ASN A HB3  13 
ATOM 11643 H HD21 . ASN A 1 57 ? -24.930 -3.364  -1.349  1.00 0.00 ? 57 ASN A HD21 13 
ATOM 11644 H HD22 . ASN A 1 57 ? -24.779 -3.446  0.339   1.00 0.00 ? 57 ASN A HD22 13 
ATOM 11645 N N    . LYS A 1 58 ? -28.702 -2.426  -3.907  1.00 0.00 ? 58 LYS A N    13 
ATOM 11646 C CA   . LYS A 1 58 ? -29.668 -2.365  -4.999  1.00 0.00 ? 58 LYS A CA   13 
ATOM 11647 C C    . LYS A 1 58 ? -30.720 -1.295  -4.726  1.00 0.00 ? 58 LYS A C    13 
ATOM 11648 O O    . LYS A 1 58 ? -31.890 -1.459  -5.072  1.00 0.00 ? 58 LYS A O    13 
ATOM 11649 C CB   . LYS A 1 58 ? -30.351 -3.724  -5.168  1.00 0.00 ? 58 LYS A CB   13 
ATOM 11650 C CG   . LYS A 1 58 ? -30.854 -4.215  -3.809  1.00 0.00 ? 58 LYS A CG   13 
ATOM 11651 C CD   . LYS A 1 58 ? -31.674 -5.493  -4.000  1.00 0.00 ? 58 LYS A CD   13 
ATOM 11652 C CE   . LYS A 1 58 ? -32.226 -5.952  -2.650  1.00 0.00 ? 58 LYS A CE   13 
ATOM 11653 N NZ   . LYS A 1 58 ? -33.028 -7.194  -2.837  1.00 0.00 ? 58 LYS A NZ   13 
ATOM 11654 H H    . LYS A 1 58 ? -28.900 -1.969  -3.064  1.00 0.00 ? 58 LYS A H    13 
ATOM 11655 H HA   . LYS A 1 58 ? -29.148 -2.120  -5.914  1.00 0.00 ? 58 LYS A HA   13 
ATOM 11656 H HB2  . LYS A 1 58 ? -31.185 -3.623  -5.847  1.00 0.00 ? 58 LYS A HB2  13 
ATOM 11657 H HB3  . LYS A 1 58 ? -29.643 -4.435  -5.568  1.00 0.00 ? 58 LYS A HB3  13 
ATOM 11658 H HG2  . LYS A 1 58 ? -30.010 -4.420  -3.167  1.00 0.00 ? 58 LYS A HG2  13 
ATOM 11659 H HG3  . LYS A 1 58 ? -31.474 -3.455  -3.359  1.00 0.00 ? 58 LYS A HG3  13 
ATOM 11660 H HD2  . LYS A 1 58 ? -32.492 -5.296  -4.678  1.00 0.00 ? 58 LYS A HD2  13 
ATOM 11661 H HD3  . LYS A 1 58 ? -31.044 -6.267  -4.411  1.00 0.00 ? 58 LYS A HD3  13 
ATOM 11662 H HE2  . LYS A 1 58 ? -31.408 -6.150  -1.974  1.00 0.00 ? 58 LYS A HE2  13 
ATOM 11663 H HE3  . LYS A 1 58 ? -32.855 -5.178  -2.236  1.00 0.00 ? 58 LYS A HE3  13 
ATOM 11664 H HZ1  . LYS A 1 58 ? -33.977 -6.947  -3.181  1.00 0.00 ? 58 LYS A HZ1  13 
ATOM 11665 H HZ2  . LYS A 1 58 ? -33.110 -7.694  -1.929  1.00 0.00 ? 58 LYS A HZ2  13 
ATOM 11666 H HZ3  . LYS A 1 58 ? -32.556 -7.809  -3.531  1.00 0.00 ? 58 LYS A HZ3  13 
ATOM 11667 N N    . LYS A 1 59 ? -30.296 -0.201  -4.101  1.00 0.00 ? 59 LYS A N    13 
ATOM 11668 C CA   . LYS A 1 59 ? -31.209 0.891   -3.783  1.00 0.00 ? 59 LYS A CA   13 
ATOM 11669 C C    . LYS A 1 59 ? -30.457 2.216   -3.713  1.00 0.00 ? 59 LYS A C    13 
ATOM 11670 O O    . LYS A 1 59 ? -29.397 2.307   -3.095  1.00 0.00 ? 59 LYS A O    13 
ATOM 11671 C CB   . LYS A 1 59 ? -31.898 0.621   -2.445  1.00 0.00 ? 59 LYS A CB   13 
ATOM 11672 C CG   . LYS A 1 59 ? -30.871 0.704   -1.313  1.00 0.00 ? 59 LYS A CG   13 
ATOM 11673 C CD   . LYS A 1 59 ? -31.460 0.091   -0.042  1.00 0.00 ? 59 LYS A CD   13 
ATOM 11674 C CE   . LYS A 1 59 ? -30.408 0.113   1.070   1.00 0.00 ? 59 LYS A CE   13 
ATOM 11675 N NZ   . LYS A 1 59 ? -30.871 -0.730  2.208   1.00 0.00 ? 59 LYS A NZ   13 
ATOM 11676 H H    . LYS A 1 59 ? -29.353 -0.127  -3.848  1.00 0.00 ? 59 LYS A H    13 
ATOM 11677 H HA   . LYS A 1 59 ? -31.962 0.956   -4.555  1.00 0.00 ? 59 LYS A HA   13 
ATOM 11678 H HB2  . LYS A 1 59 ? -32.674 1.356   -2.283  1.00 0.00 ? 59 LYS A HB2  13 
ATOM 11679 H HB3  . LYS A 1 59 ? -32.335 -0.366  -2.458  1.00 0.00 ? 59 LYS A HB3  13 
ATOM 11680 H HG2  . LYS A 1 59 ? -29.980 0.162   -1.597  1.00 0.00 ? 59 LYS A HG2  13 
ATOM 11681 H HG3  . LYS A 1 59 ? -30.621 1.738   -1.130  1.00 0.00 ? 59 LYS A HG3  13 
ATOM 11682 H HD2  . LYS A 1 59 ? -32.323 0.663   0.267   1.00 0.00 ? 59 LYS A HD2  13 
ATOM 11683 H HD3  . LYS A 1 59 ? -31.754 -0.930  -0.236  1.00 0.00 ? 59 LYS A HD3  13 
ATOM 11684 H HE2  . LYS A 1 59 ? -29.475 -0.275  0.691   1.00 0.00 ? 59 LYS A HE2  13 
ATOM 11685 H HE3  . LYS A 1 59 ? -30.265 1.129   1.409   1.00 0.00 ? 59 LYS A HE3  13 
ATOM 11686 H HZ1  . LYS A 1 59 ? -31.648 -0.248  2.704   1.00 0.00 ? 59 LYS A HZ1  13 
ATOM 11687 H HZ2  . LYS A 1 59 ? -30.082 -0.882  2.870   1.00 0.00 ? 59 LYS A HZ2  13 
ATOM 11688 H HZ3  . LYS A 1 59 ? -31.205 -1.647  1.847   1.00 0.00 ? 59 LYS A HZ3  13 
ATOM 11689 N N    . ARG A 1 60 ? -31.013 3.241   -4.352  1.00 0.00 ? 60 ARG A N    13 
ATOM 11690 C CA   . ARG A 1 60 ? -30.384 4.557   -4.355  1.00 0.00 ? 60 ARG A CA   13 
ATOM 11691 C C    . ARG A 1 60 ? -30.395 5.159   -2.954  1.00 0.00 ? 60 ARG A C    13 
ATOM 11692 O O    . ARG A 1 60 ? -31.088 4.624   -2.105  1.00 0.00 ? 60 ARG A O    13 
ATOM 11693 C CB   . ARG A 1 60 ? -31.125 5.486   -5.320  1.00 0.00 ? 60 ARG A CB   13 
ATOM 11694 C CG   . ARG A 1 60 ? -31.464 4.727   -6.604  1.00 0.00 ? 60 ARG A CG   13 
ATOM 11695 C CD   . ARG A 1 60 ? -31.883 5.720   -7.690  1.00 0.00 ? 60 ARG A CD   13 
ATOM 11696 N NE   . ARG A 1 60 ? -30.712 6.404   -8.226  1.00 0.00 ? 60 ARG A NE   13 
ATOM 11697 C CZ   . ARG A 1 60 ? -30.831 7.553   -8.884  1.00 0.00 ? 60 ARG A CZ   13 
ATOM 11698 N NH1  . ARG A 1 60 ? -32.008 8.087   -9.058  1.00 0.00 ? 60 ARG A NH1  13 
ATOM 11699 N NH2  . ARG A 1 60 ? -29.768 8.148   -9.354  1.00 0.00 ? 60 ARG A NH2  13 
ATOM 11700 O OXT  . ARG A 1 60 ? -29.709 6.149   -2.751  1.00 0.00 ? 60 ARG A OXT  13 
ATOM 11701 H H    . ARG A 1 60 ? -31.858 3.109   -4.829  1.00 0.00 ? 60 ARG A H    13 
ATOM 11702 H HA   . ARG A 1 60 ? -29.362 4.457   -4.686  1.00 0.00 ? 60 ARG A HA   13 
ATOM 11703 H HB2  . ARG A 1 60 ? -32.038 5.835   -4.855  1.00 0.00 ? 60 ARG A HB2  13 
ATOM 11704 H HB3  . ARG A 1 60 ? -30.498 6.332   -5.558  1.00 0.00 ? 60 ARG A HB3  13 
ATOM 11705 H HG2  . ARG A 1 60 ? -30.595 4.177   -6.934  1.00 0.00 ? 60 ARG A HG2  13 
ATOM 11706 H HG3  . ARG A 1 60 ? -32.275 4.041   -6.414  1.00 0.00 ? 60 ARG A HG3  13 
ATOM 11707 H HD2  . ARG A 1 60 ? -32.380 5.189   -8.486  1.00 0.00 ? 60 ARG A HD2  13 
ATOM 11708 H HD3  . ARG A 1 60 ? -32.563 6.445   -7.267  1.00 0.00 ? 60 ARG A HD3  13 
ATOM 11709 H HE   . ARG A 1 60 ? -29.824 6.011   -8.099  1.00 0.00 ? 60 ARG A HE   13 
ATOM 11710 H HH11 . ARG A 1 60 ? -32.822 7.632   -8.697  1.00 0.00 ? 60 ARG A HH11 13 
ATOM 11711 H HH12 . ARG A 1 60 ? -32.097 8.951   -9.552  1.00 0.00 ? 60 ARG A HH12 13 
ATOM 11712 H HH21 . ARG A 1 60 ? -28.865 7.739   -9.220  1.00 0.00 ? 60 ARG A HH21 13 
ATOM 11713 H HH22 . ARG A 1 60 ? -29.858 9.013   -9.849  1.00 0.00 ? 60 ARG A HH22 13 
ATOM 11714 N N    . GLY A 1 9  ? 9.809   9.102   15.930  1.00 0.00 ? 9  GLY A N    14 
ATOM 11715 C CA   . GLY A 1 9  ? 8.960   9.730   14.922  1.00 0.00 ? 9  GLY A CA   14 
ATOM 11716 C C    . GLY A 1 9  ? 8.960   8.922   13.628  1.00 0.00 ? 9  GLY A C    14 
ATOM 11717 O O    . GLY A 1 9  ? 7.914   8.465   13.171  1.00 0.00 ? 9  GLY A O    14 
ATOM 11718 H H    . GLY A 1 9  ? 10.769  9.298   15.938  1.00 0.00 ? 9  GLY A H    14 
ATOM 11719 H HA2  . GLY A 1 9  ? 7.949   9.799   15.298  1.00 0.00 ? 9  GLY A HA2  14 
ATOM 11720 H HA3  . GLY A 1 9  ? 9.329   10.723  14.715  1.00 0.00 ? 9  GLY A HA3  14 
ATOM 11721 N N    . THR A 1 10 ? 10.142  8.750   13.045  1.00 0.00 ? 10 THR A N    14 
ATOM 11722 C CA   . THR A 1 10 ? 10.271  7.996   11.806  1.00 0.00 ? 10 THR A CA   14 
ATOM 11723 C C    . THR A 1 10 ? 10.039  6.509   12.057  1.00 0.00 ? 10 THR A C    14 
ATOM 11724 O O    . THR A 1 10 ? 10.203  6.027   13.178  1.00 0.00 ? 10 THR A O    14 
ATOM 11725 C CB   . THR A 1 10 ? 11.668  8.213   11.218  1.00 0.00 ? 10 THR A CB   14 
ATOM 11726 O OG1  . THR A 1 10 ? 12.615  8.291   12.273  1.00 0.00 ? 10 THR A OG1  14 
ATOM 11727 C CG2  . THR A 1 10 ? 11.694  9.512   10.410  1.00 0.00 ? 10 THR A CG2  14 
ATOM 11728 H H    . THR A 1 10 ? 10.943  9.136   13.453  1.00 0.00 ? 10 THR A H    14 
ATOM 11729 H HA   . THR A 1 10 ? 9.533   8.352   11.101  1.00 0.00 ? 10 THR A HA   14 
ATOM 11730 H HB   . THR A 1 10 ? 11.918  7.389   10.572  1.00 0.00 ? 10 THR A HB   14 
ATOM 11731 H HG1  . THR A 1 10 ? 13.481  8.088   11.911  1.00 0.00 ? 10 THR A HG1  14 
ATOM 11732 H HG21 . THR A 1 10 ? 12.683  9.665   10.005  1.00 0.00 ? 10 THR A HG21 14 
ATOM 11733 H HG22 . THR A 1 10 ? 11.437  10.341  11.054  1.00 0.00 ? 10 THR A HG22 14 
ATOM 11734 H HG23 . THR A 1 10 ? 10.979  9.449   9.603   1.00 0.00 ? 10 THR A HG23 14 
ATOM 11735 N N    . LYS A 1 11 ? 9.658   5.789   11.006  1.00 0.00 ? 11 LYS A N    14 
ATOM 11736 C CA   . LYS A 1 11 ? 9.405   4.354   11.116  1.00 0.00 ? 11 LYS A CA   14 
ATOM 11737 C C    . LYS A 1 11 ? 10.332  3.573   10.190  1.00 0.00 ? 11 LYS A C    14 
ATOM 11738 O O    . LYS A 1 11 ? 11.442  4.013   9.892   1.00 0.00 ? 11 LYS A O    14 
ATOM 11739 C CB   . LYS A 1 11 ? 7.948   4.052   10.755  1.00 0.00 ? 11 LYS A CB   14 
ATOM 11740 C CG   . LYS A 1 11 ? 7.022   4.942   11.585  1.00 0.00 ? 11 LYS A CG   14 
ATOM 11741 C CD   . LYS A 1 11 ? 5.589   4.414   11.493  1.00 0.00 ? 11 LYS A CD   14 
ATOM 11742 C CE   . LYS A 1 11 ? 4.668   5.286   12.349  1.00 0.00 ? 11 LYS A CE   14 
ATOM 11743 N NZ   . LYS A 1 11 ? 5.241   5.417   13.719  1.00 0.00 ? 11 LYS A NZ   14 
ATOM 11744 H H    . LYS A 1 11 ? 9.545   6.230   10.138  1.00 0.00 ? 11 LYS A H    14 
ATOM 11745 H HA   . LYS A 1 11 ? 9.583   4.038   12.133  1.00 0.00 ? 11 LYS A HA   14 
ATOM 11746 H HB2  . LYS A 1 11 ? 7.793   4.248   9.703   1.00 0.00 ? 11 LYS A HB2  14 
ATOM 11747 H HB3  . LYS A 1 11 ? 7.732   3.016   10.965  1.00 0.00 ? 11 LYS A HB3  14 
ATOM 11748 H HG2  . LYS A 1 11 ? 7.344   4.936   12.615  1.00 0.00 ? 11 LYS A HG2  14 
ATOM 11749 H HG3  . LYS A 1 11 ? 7.056   5.952   11.204  1.00 0.00 ? 11 LYS A HG3  14 
ATOM 11750 H HD2  . LYS A 1 11 ? 5.260   4.443   10.464  1.00 0.00 ? 11 LYS A HD2  14 
ATOM 11751 H HD3  . LYS A 1 11 ? 5.556   3.397   11.853  1.00 0.00 ? 11 LYS A HD3  14 
ATOM 11752 H HE2  . LYS A 1 11 ? 4.579   6.264   11.901  1.00 0.00 ? 11 LYS A HE2  14 
ATOM 11753 H HE3  . LYS A 1 11 ? 3.692   4.828   12.409  1.00 0.00 ? 11 LYS A HE3  14 
ATOM 11754 H HZ1  . LYS A 1 11 ? 5.554   4.484   14.055  1.00 0.00 ? 11 LYS A HZ1  14 
ATOM 11755 H HZ2  . LYS A 1 11 ? 4.516   5.788   14.365  1.00 0.00 ? 11 LYS A HZ2  14 
ATOM 11756 H HZ3  . LYS A 1 11 ? 6.051   6.068   13.694  1.00 0.00 ? 11 LYS A HZ3  14 
ATOM 11757 N N    . LYS A 1 12 ? 9.868   2.411   9.737   1.00 0.00 ? 12 LYS A N    14 
ATOM 11758 C CA   . LYS A 1 12 ? 10.664  1.573   8.845   1.00 0.00 ? 12 LYS A CA   14 
ATOM 11759 C C    . LYS A 1 12 ? 10.386  1.925   7.388   1.00 0.00 ? 12 LYS A C    14 
ATOM 11760 O O    . LYS A 1 12 ? 11.282  2.354   6.660   1.00 0.00 ? 12 LYS A O    14 
ATOM 11761 C CB   . LYS A 1 12 ? 10.336  0.096   9.086   1.00 0.00 ? 12 LYS A CB   14 
ATOM 11762 C CG   . LYS A 1 12 ? 10.830  -0.330  10.480  1.00 0.00 ? 12 LYS A CG   14 
ATOM 11763 C CD   . LYS A 1 12 ? 12.098  -1.183  10.353  1.00 0.00 ? 12 LYS A CD   14 
ATOM 11764 C CE   . LYS A 1 12 ? 13.243  -0.325  9.812   1.00 0.00 ? 12 LYS A CE   14 
ATOM 11765 N NZ   . LYS A 1 12 ? 14.532  -1.050  9.988   1.00 0.00 ? 12 LYS A NZ   14 
ATOM 11766 H H    . LYS A 1 12 ? 8.976   2.111   10.010  1.00 0.00 ? 12 LYS A H    14 
ATOM 11767 H HA   . LYS A 1 12 ? 11.711  1.735   9.051   1.00 0.00 ? 12 LYS A HA   14 
ATOM 11768 H HB2  . LYS A 1 12 ? 9.265   -0.044  9.025   1.00 0.00 ? 12 LYS A HB2  14 
ATOM 11769 H HB3  . LYS A 1 12 ? 10.818  -0.505  8.331   1.00 0.00 ? 12 LYS A HB3  14 
ATOM 11770 H HG2  . LYS A 1 12 ? 11.046  0.546   11.073  1.00 0.00 ? 12 LYS A HG2  14 
ATOM 11771 H HG3  . LYS A 1 12 ? 10.061  -0.910  10.971  1.00 0.00 ? 12 LYS A HG3  14 
ATOM 11772 H HD2  . LYS A 1 12 ? 12.368  -1.571  11.324  1.00 0.00 ? 12 LYS A HD2  14 
ATOM 11773 H HD3  . LYS A 1 12 ? 11.915  -2.004  9.676   1.00 0.00 ? 12 LYS A HD3  14 
ATOM 11774 H HE2  . LYS A 1 12 ? 13.081  -0.128  8.763   1.00 0.00 ? 12 LYS A HE2  14 
ATOM 11775 H HE3  . LYS A 1 12 ? 13.280  0.610   10.353  1.00 0.00 ? 12 LYS A HE3  14 
ATOM 11776 H HZ1  . LYS A 1 12 ? 14.342  -2.047  10.213  1.00 0.00 ? 12 LYS A HZ1  14 
ATOM 11777 H HZ2  . LYS A 1 12 ? 15.071  -0.618  10.765  1.00 0.00 ? 12 LYS A HZ2  14 
ATOM 11778 H HZ3  . LYS A 1 12 ? 15.085  -0.992  9.108   1.00 0.00 ? 12 LYS A HZ3  14 
ATOM 11779 N N    . TYR A 1 13 ? 9.138   1.738   6.965   1.00 0.00 ? 13 TYR A N    14 
ATOM 11780 C CA   . TYR A 1 13 ? 8.743   2.035   5.592   1.00 0.00 ? 13 TYR A CA   14 
ATOM 11781 C C    . TYR A 1 13 ? 7.582   3.025   5.573   1.00 0.00 ? 13 TYR A C    14 
ATOM 11782 O O    . TYR A 1 13 ? 6.745   3.035   6.477   1.00 0.00 ? 13 TYR A O    14 
ATOM 11783 C CB   . TYR A 1 13 ? 8.331   0.740   4.876   1.00 0.00 ? 13 TYR A CB   14 
ATOM 11784 C CG   . TYR A 1 13 ? 9.520   0.165   4.140   1.00 0.00 ? 13 TYR A CG   14 
ATOM 11785 C CD1  . TYR A 1 13 ? 10.634  -0.292  4.856   1.00 0.00 ? 13 TYR A CD1  14 
ATOM 11786 C CD2  . TYR A 1 13 ? 9.509   0.090   2.742   1.00 0.00 ? 13 TYR A CD2  14 
ATOM 11787 C CE1  . TYR A 1 13 ? 11.735  -0.822  4.174   1.00 0.00 ? 13 TYR A CE1  14 
ATOM 11788 C CE2  . TYR A 1 13 ? 10.611  -0.440  2.062   1.00 0.00 ? 13 TYR A CE2  14 
ATOM 11789 C CZ   . TYR A 1 13 ? 11.724  -0.896  2.777   1.00 0.00 ? 13 TYR A CZ   14 
ATOM 11790 O OH   . TYR A 1 13 ? 12.810  -1.419  2.104   1.00 0.00 ? 13 TYR A OH   14 
ATOM 11791 H H    . TYR A 1 13 ? 8.468   1.393   7.592   1.00 0.00 ? 13 TYR A H    14 
ATOM 11792 H HA   . TYR A 1 13 ? 9.580   2.474   5.068   1.00 0.00 ? 13 TYR A HA   14 
ATOM 11793 H HB2  . TYR A 1 13 ? 7.981   0.026   5.607   1.00 0.00 ? 13 TYR A HB2  14 
ATOM 11794 H HB3  . TYR A 1 13 ? 7.540   0.951   4.171   1.00 0.00 ? 13 TYR A HB3  14 
ATOM 11795 H HD1  . TYR A 1 13 ? 10.643  -0.236  5.935   1.00 0.00 ? 13 TYR A HD1  14 
ATOM 11796 H HD2  . TYR A 1 13 ? 8.652   0.442   2.189   1.00 0.00 ? 13 TYR A HD2  14 
ATOM 11797 H HE1  . TYR A 1 13 ? 12.593  -1.175  4.727   1.00 0.00 ? 13 TYR A HE1  14 
ATOM 11798 H HE2  . TYR A 1 13 ? 10.601  -0.497  0.983   1.00 0.00 ? 13 TYR A HE2  14 
ATOM 11799 H HH   . TYR A 1 13 ? 12.601  -1.429  1.167   1.00 0.00 ? 13 TYR A HH   14 
ATOM 11800 N N    . ASP A 1 14 ? 7.539   3.855   4.535   1.00 0.00 ? 14 ASP A N    14 
ATOM 11801 C CA   . ASP A 1 14 ? 6.479   4.849   4.398   1.00 0.00 ? 14 ASP A CA   14 
ATOM 11802 C C    . ASP A 1 14 ? 6.019   4.938   2.948   1.00 0.00 ? 14 ASP A C    14 
ATOM 11803 O O    . ASP A 1 14 ? 6.761   5.397   2.079   1.00 0.00 ? 14 ASP A O    14 
ATOM 11804 C CB   . ASP A 1 14 ? 6.982   6.216   4.864   1.00 0.00 ? 14 ASP A CB   14 
ATOM 11805 C CG   . ASP A 1 14 ? 5.908   7.274   4.628   1.00 0.00 ? 14 ASP A CG   14 
ATOM 11806 O OD1  . ASP A 1 14 ? 5.556   7.487   3.480   1.00 0.00 ? 14 ASP A OD1  14 
ATOM 11807 O OD2  . ASP A 1 14 ? 5.455   7.855   5.600   1.00 0.00 ? 14 ASP A OD2  14 
ATOM 11808 H H    . ASP A 1 14 ? 8.235   3.797   3.847   1.00 0.00 ? 14 ASP A H    14 
ATOM 11809 H HA   . ASP A 1 14 ? 5.640   4.558   5.014   1.00 0.00 ? 14 ASP A HA   14 
ATOM 11810 H HB2  . ASP A 1 14 ? 7.219   6.172   5.916   1.00 0.00 ? 14 ASP A HB2  14 
ATOM 11811 H HB3  . ASP A 1 14 ? 7.870   6.479   4.307   1.00 0.00 ? 14 ASP A HB3  14 
ATOM 11812 N N    . LEU A 1 15 ? 4.790   4.499   2.694   1.00 0.00 ? 15 LEU A N    14 
ATOM 11813 C CA   . LEU A 1 15 ? 4.231   4.531   1.346   1.00 0.00 ? 15 LEU A CA   14 
ATOM 11814 C C    . LEU A 1 15 ? 2.896   5.271   1.347   1.00 0.00 ? 15 LEU A C    14 
ATOM 11815 O O    . LEU A 1 15 ? 1.858   4.694   1.021   1.00 0.00 ? 15 LEU A O    14 
ATOM 11816 C CB   . LEU A 1 15 ? 4.019   3.104   0.823   1.00 0.00 ? 15 LEU A CB   14 
ATOM 11817 C CG   . LEU A 1 15 ? 5.274   2.257   1.072   1.00 0.00 ? 15 LEU A CG   14 
ATOM 11818 C CD1  . LEU A 1 15 ? 4.925   0.778   0.912   1.00 0.00 ? 15 LEU A CD1  14 
ATOM 11819 C CD2  . LEU A 1 15 ? 6.362   2.631   0.062   1.00 0.00 ? 15 LEU A CD2  14 
ATOM 11820 H H    . LEU A 1 15 ? 4.245   4.146   3.430   1.00 0.00 ? 15 LEU A H    14 
ATOM 11821 H HA   . LEU A 1 15 ? 4.915   5.046   0.688   1.00 0.00 ? 15 LEU A HA   14 
ATOM 11822 H HB2  . LEU A 1 15 ? 3.178   2.660   1.336   1.00 0.00 ? 15 LEU A HB2  14 
ATOM 11823 H HB3  . LEU A 1 15 ? 3.816   3.139   -0.236  1.00 0.00 ? 15 LEU A HB3  14 
ATOM 11824 H HG   . LEU A 1 15 ? 5.635   2.433   2.076   1.00 0.00 ? 15 LEU A HG   14 
ATOM 11825 H HD11 . LEU A 1 15 ? 4.220   0.488   1.676   1.00 0.00 ? 15 LEU A HD11 14 
ATOM 11826 H HD12 . LEU A 1 15 ? 5.823   0.183   1.007   1.00 0.00 ? 15 LEU A HD12 14 
ATOM 11827 H HD13 . LEU A 1 15 ? 4.488   0.614   -0.063  1.00 0.00 ? 15 LEU A HD13 14 
ATOM 11828 H HD21 . LEU A 1 15 ? 5.954   2.594   -0.939  1.00 0.00 ? 15 LEU A HD21 14 
ATOM 11829 H HD22 . LEU A 1 15 ? 7.180   1.929   0.140   1.00 0.00 ? 15 LEU A HD22 14 
ATOM 11830 H HD23 . LEU A 1 15 ? 6.721   3.627   0.269   1.00 0.00 ? 15 LEU A HD23 14 
ATOM 11831 N N    . SER A 1 16 ? 2.932   6.548   1.720   1.00 0.00 ? 16 SER A N    14 
ATOM 11832 C CA   . SER A 1 16 ? 1.720   7.363   1.765   1.00 0.00 ? 16 SER A CA   14 
ATOM 11833 C C    . SER A 1 16 ? 0.782   6.997   0.618   1.00 0.00 ? 16 SER A C    14 
ATOM 11834 O O    . SER A 1 16 ? -0.398  6.723   0.830   1.00 0.00 ? 16 SER A O    14 
ATOM 11835 C CB   . SER A 1 16 ? 2.085   8.845   1.675   1.00 0.00 ? 16 SER A CB   14 
ATOM 11836 O OG   . SER A 1 16 ? 1.002   9.562   1.100   1.00 0.00 ? 16 SER A OG   14 
ATOM 11837 H H    . SER A 1 16 ? 3.789   6.951   1.971   1.00 0.00 ? 16 SER A H    14 
ATOM 11838 H HA   . SER A 1 16 ? 1.212   7.184   2.702   1.00 0.00 ? 16 SER A HA   14 
ATOM 11839 H HB2  . SER A 1 16 ? 2.283   9.231   2.662   1.00 0.00 ? 16 SER A HB2  14 
ATOM 11840 H HB3  . SER A 1 16 ? 2.972   8.957   1.064   1.00 0.00 ? 16 SER A HB3  14 
ATOM 11841 H HG   . SER A 1 16 ? 0.695   9.073   0.334   1.00 0.00 ? 16 SER A HG   14 
ATOM 11842 N N    . LYS A 1 17 ? 1.323   6.982   -0.594  1.00 0.00 ? 17 LYS A N    14 
ATOM 11843 C CA   . LYS A 1 17 ? 0.535   6.635   -1.769  1.00 0.00 ? 17 LYS A CA   14 
ATOM 11844 C C    . LYS A 1 17 ? 1.458   6.317   -2.938  1.00 0.00 ? 17 LYS A C    14 
ATOM 11845 O O    . LYS A 1 17 ? 2.348   7.100   -3.270  1.00 0.00 ? 17 LYS A O    14 
ATOM 11846 C CB   . LYS A 1 17 ? -0.392  7.798   -2.138  1.00 0.00 ? 17 LYS A CB   14 
ATOM 11847 C CG   . LYS A 1 17 ? -1.116  7.499   -3.457  1.00 0.00 ? 17 LYS A CG   14 
ATOM 11848 C CD   . LYS A 1 17 ? -1.850  6.158   -3.354  1.00 0.00 ? 17 LYS A CD   14 
ATOM 11849 C CE   . LYS A 1 17 ? -2.978  6.110   -4.387  1.00 0.00 ? 17 LYS A CE   14 
ATOM 11850 N NZ   . LYS A 1 17 ? -3.458  4.707   -4.534  1.00 0.00 ? 17 LYS A NZ   14 
ATOM 11851 H H    . LYS A 1 17 ? 2.273   7.198   -0.701  1.00 0.00 ? 17 LYS A H    14 
ATOM 11852 H HA   . LYS A 1 17 ? -0.064  5.765   -1.544  1.00 0.00 ? 17 LYS A HA   14 
ATOM 11853 H HB2  . LYS A 1 17 ? -1.120  7.939   -1.352  1.00 0.00 ? 17 LYS A HB2  14 
ATOM 11854 H HB3  . LYS A 1 17 ? 0.193   8.700   -2.249  1.00 0.00 ? 17 LYS A HB3  14 
ATOM 11855 H HG2  . LYS A 1 17 ? -1.831  8.286   -3.657  1.00 0.00 ? 17 LYS A HG2  14 
ATOM 11856 H HG3  . LYS A 1 17 ? -0.399  7.455   -4.262  1.00 0.00 ? 17 LYS A HG3  14 
ATOM 11857 H HD2  . LYS A 1 17 ? -1.157  5.353   -3.543  1.00 0.00 ? 17 LYS A HD2  14 
ATOM 11858 H HD3  . LYS A 1 17 ? -2.268  6.048   -2.364  1.00 0.00 ? 17 LYS A HD3  14 
ATOM 11859 H HE2  . LYS A 1 17 ? -3.795  6.736   -4.059  1.00 0.00 ? 17 LYS A HE2  14 
ATOM 11860 H HE3  . LYS A 1 17 ? -2.611  6.467   -5.338  1.00 0.00 ? 17 LYS A HE3  14 
AT