data_2NDJ
# 
_entry.id   2NDJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.288 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
RCSB104729   RCSB  
2NDJ         PDB   
16621        BMRB  
D_1000104729 WWPDB 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 16602 BMRB '1H, 13C and 15N Chemical Shift Assignment Assignment of Human Membrane Protein KCNE3 in LMPC micelles' 
unspecified 16621 BMRB '1H, 13C, and 15N chemical shift assignment of KCNE3 in isotropic bicelles'                             
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2NDJ 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-09 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sanders, C.R.'   1  
'Van Horn, W.D.'  2  
'Kroncke, B.M.'   3  
'Sisco, N.J.'     4  
'Meiler, J.'      5  
'Vanoye, C.G.'    6  
'Song, Y.'        7  
'Nannemann, D.P.' 8  
'Welch, R.C.'     9  
'Kang, C.'        10 
'Smith, J.'       11 
'George, A.L.'    12 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for KCNE3 modulation of potassium recycling in epithelia.' 
_citation.journal_abbrev            'Sci Adv' 
_citation.journal_volume            2 
_citation.page_first                e1501228 
_citation.page_last                 e1501228 
_citation.year                      2016 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2375-2548 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   27626070 
_citation.pdbx_database_id_DOI      10.1126/sciadv.1501228 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kroncke, B.M.'   1  
primary 'Van Horn, W.D.'  2  
primary 'Smith, J.'       3  
primary 'Kang, C.'        4  
primary 'Welch, R.C.'     5  
primary 'Song, Y.'        6  
primary 'Nannemann, D.P.' 7  
primary 'Taylor, K.C.'    8  
primary 'Sisco, N.J.'     9  
primary 'George, A.L.'    10 
primary 'Meiler, J.'      11 
primary 'Vanoye, C.G.'    12 
primary 'Sanders, C.R.'   13 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Potassium voltage-gated channel subfamily E member 3' 
_entity.formula_weight             12799.581 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'MinK-related peptide 2, Minimum potassium ion channel-related peptide 2, Potassium channel subunit beta MiRP2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGHHHHHHGMETTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVT
VGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHHHHHHGMETTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVT
VGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   GLY n 
1 10  MET n 
1 11  GLU n 
1 12  THR n 
1 13  THR n 
1 14  ASN n 
1 15  GLY n 
1 16  THR n 
1 17  GLU n 
1 18  THR n 
1 19  TRP n 
1 20  TYR n 
1 21  GLU n 
1 22  SER n 
1 23  LEU n 
1 24  HIS n 
1 25  ALA n 
1 26  VAL n 
1 27  LEU n 
1 28  LYS n 
1 29  ALA n 
1 30  LEU n 
1 31  ASN n 
1 32  ALA n 
1 33  THR n 
1 34  LEU n 
1 35  HIS n 
1 36  SER n 
1 37  ASN n 
1 38  LEU n 
1 39  LEU n 
1 40  CYS n 
1 41  ARG n 
1 42  PRO n 
1 43  GLY n 
1 44  PRO n 
1 45  GLY n 
1 46  LEU n 
1 47  GLY n 
1 48  PRO n 
1 49  ASP n 
1 50  ASN n 
1 51  GLN n 
1 52  THR n 
1 53  GLU n 
1 54  GLU n 
1 55  ARG n 
1 56  ARG n 
1 57  ALA n 
1 58  SER n 
1 59  LEU n 
1 60  PRO n 
1 61  GLY n 
1 62  ARG n 
1 63  ASP n 
1 64  ASP n 
1 65  ASN n 
1 66  SER n 
1 67  TYR n 
1 68  MET n 
1 69  TYR n 
1 70  ILE n 
1 71  LEU n 
1 72  PHE n 
1 73  VAL n 
1 74  MET n 
1 75  PHE n 
1 76  LEU n 
1 77  PHE n 
1 78  ALA n 
1 79  VAL n 
1 80  THR n 
1 81  VAL n 
1 82  GLY n 
1 83  SER n 
1 84  LEU n 
1 85  ILE n 
1 86  LEU n 
1 87  GLY n 
1 88  TYR n 
1 89  THR n 
1 90  ARG n 
1 91  SER n 
1 92  ARG n 
1 93  LYS n 
1 94  VAL n 
1 95  ASP n 
1 96  LYS n 
1 97  ARG n 
1 98  SER n 
1 99  ASP n 
1 100 PRO n 
1 101 TYR n 
1 102 HIS n 
1 103 VAL n 
1 104 TYR n 
1 105 ILE n 
1 106 LYS n 
1 107 ASN n 
1 108 ARG n 
1 109 VAL n 
1 110 SER n 
1 111 MET n 
1 112 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'KCNE3, MiRP2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              '(DE3) RP Codon Plus' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET16b 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KCNE3_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y6H6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYT
RSRKVDKRSDPYHVYIKNRVSMI
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2NDJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 10 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 112 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9Y6H6 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  103 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       103 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2NDJ MET A 1 ? UNP Q9Y6H6 ? ? 'EXPRESSION TAG' -8 1 
1 2NDJ GLY A 2 ? UNP Q9Y6H6 ? ? 'EXPRESSION TAG' -7 2 
1 2NDJ HIS A 3 ? UNP Q9Y6H6 ? ? 'EXPRESSION TAG' -6 3 
1 2NDJ HIS A 4 ? UNP Q9Y6H6 ? ? 'EXPRESSION TAG' -5 4 
1 2NDJ HIS A 5 ? UNP Q9Y6H6 ? ? 'EXPRESSION TAG' -4 5 
1 2NDJ HIS A 6 ? UNP Q9Y6H6 ? ? 'EXPRESSION TAG' -3 6 
1 2NDJ HIS A 7 ? UNP Q9Y6H6 ? ? 'EXPRESSION TAG' -2 7 
1 2NDJ HIS A 8 ? UNP Q9Y6H6 ? ? 'EXPRESSION TAG' -1 8 
1 2NDJ GLY A 9 ? UNP Q9Y6H6 ? ? 'EXPRESSION TAG' 0  9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-15N HSQC' 
1 2 1 '3D HNCA'        
1 3 1 '3D HN(CO)CA'    
1 4 1 '3D HNCACB'      
1 5 1 '3D CBCA(CO)NH'  
1 6 1 '3D HNCO'        
1 7 1 '3D HCACO'       
1 8 1 '2D 1H-15N HSQC' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         313 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '0.8 mM [U-100% 13C; U-100% 15N; U-80% 2H] protein, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker Avance 1 'Bruker Avance' 
600 Bruker Avance 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2NDJ 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing, molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    0 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            9764 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2NDJ 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    5.544 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     'Xplor-NIH, Amber' 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2NDJ 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'                     processing                  NMRPipe ? 1  
'Johnson, One Moon Scientific'                                          'chemical shift assignment' NMRView ? 2  
'Johnson, One Moon Scientific'                                          'data analysis'             NMRView ? 3  
'Johnson, One Moon Scientific'                                          'peak picking'              NMRView ? 4  
'Bruker Biospin'                                                        processing                  TOPSPIN ? 5  
'Bruker Biospin'                                                        collection                  TOPSPIN ? 6  
'Cornilescu, Delaglio and Bax'                                          'structure solution'        TALOS   ? 7  
'Schwieters, Kuszewski, Tjandra and Clore'                              'structure solution'        X-PLOR  ? 8  
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Kollman' refinement                  AMBER   ? 9  
'Schwieters, Kuszewski, Tjandra and Clore'                              refinement                  X-PLOR  ? 10 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2NDJ 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2NDJ 
_struct.title                     'Structural Basis for KCNE3 and Estrogen Modulation of the KCNQ1 Channel' 
_struct.pdbx_descriptor           'Potassium voltage-gated channel subfamily E member 3' 
_struct.pdbx_model_details        'closest to the average, model3' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NDJ 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'Estrogen, Membrane protein, Ion channel' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 16 ? LEU A 39 ? THR A 7  LEU A 30 1 ? 24 
HELX_P HELX_P2 2 ASP A 63 ? ARG A 90 ? ASP A 54 ARG A 81 1 ? 28 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2NDJ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 10  ? -14.150 6.757   133.778 1.00 0.00 ?  1   MET A N    1  
ATOM 2     C CA   . MET A 1 10  ? -14.425 6.141   132.484 1.00 0.00 ?  1   MET A CA   1  
ATOM 3     C C    . MET A 1 10  ? -14.622 7.174   131.439 1.00 0.00 ?  1   MET A C    1  
ATOM 4     O O    . MET A 1 10  ? -15.459 8.032   131.682 1.00 0.00 ?  1   MET A O    1  
ATOM 5     C CB   . MET A 1 10  ? -15.576 5.199   132.444 1.00 0.00 ?  1   MET A CB   1  
ATOM 6     C CG   . MET A 1 10  ? -15.574 4.322   131.168 1.00 0.00 ?  1   MET A CG   1  
ATOM 7     S SD   . MET A 1 10  ? -16.935 3.086   131.084 1.00 0.00 ?  1   MET A SD   1  
ATOM 8     C CE   . MET A 1 10  ? -18.228 4.147   130.326 1.00 0.00 ?  1   MET A CE   1  
ATOM 9     H H    . MET A 1 10  ? -14.718 7.580   133.923 1.00 0.00 ?  1   MET A H    1  
ATOM 10    H HA   . MET A 1 10  ? -13.490 5.664   132.190 1.00 0.00 ?  1   MET A HA   1  
ATOM 11    H HB2  . MET A 1 10  ? -15.408 4.599   133.338 1.00 0.00 ?  1   MET A HB2  1  
ATOM 12    H HB3  . MET A 1 10  ? -16.525 5.731   132.507 1.00 0.00 ?  1   MET A HB3  1  
ATOM 13    H HG2  . MET A 1 10  ? -15.765 4.988   130.325 1.00 0.00 ?  1   MET A HG2  1  
ATOM 14    H HG3  . MET A 1 10  ? -14.645 3.793   130.959 1.00 0.00 ?  1   MET A HG3  1  
ATOM 15    H HE1  . MET A 1 10  ? -18.645 4.942   130.943 1.00 0.00 ?  1   MET A HE1  1  
ATOM 16    H HE2  . MET A 1 10  ? -17.756 4.750   129.551 1.00 0.00 ?  1   MET A HE2  1  
ATOM 17    H HE3  . MET A 1 10  ? -18.989 3.636   129.737 1.00 0.00 ?  1   MET A HE3  1  
ATOM 18    N N    . GLU A 1 11  ? -13.821 7.177   130.359 1.00 0.00 ?  2   GLU A N    1  
ATOM 19    C CA   . GLU A 1 11  ? -13.823 8.299   129.369 1.00 0.00 ?  2   GLU A CA   1  
ATOM 20    C C    . GLU A 1 11  ? -15.053 8.284   128.508 1.00 0.00 ?  2   GLU A C    1  
ATOM 21    O O    . GLU A 1 11  ? -15.753 7.257   128.509 1.00 0.00 ?  2   GLU A O    1  
ATOM 22    C CB   . GLU A 1 11  ? -12.553 8.322   128.574 1.00 0.00 ?  2   GLU A CB   1  
ATOM 23    C CG   . GLU A 1 11  ? -11.265 8.660   129.291 1.00 0.00 ?  2   GLU A CG   1  
ATOM 24    C CD   . GLU A 1 11  ? -11.168 10.146  129.608 1.00 0.00 ?  2   GLU A CD   1  
ATOM 25    O OE1  . GLU A 1 11  ? -11.990 11.045  129.261 1.00 0.00 -1 2   GLU A OE1  1  
ATOM 26    O OE2  . GLU A 1 11  ? -10.140 10.526  130.210 1.00 0.00 ?  2   GLU A OE2  1  
ATOM 27    H H    . GLU A 1 11  ? -13.217 6.376   130.248 1.00 0.00 ?  2   GLU A H    1  
ATOM 28    H HA   . GLU A 1 11  ? -13.790 9.179   130.012 1.00 0.00 ?  2   GLU A HA   1  
ATOM 29    H HB2  . GLU A 1 11  ? -12.453 7.364   128.064 1.00 0.00 ?  2   GLU A HB2  1  
ATOM 30    H HB3  . GLU A 1 11  ? -12.632 9.074   127.789 1.00 0.00 ?  2   GLU A HB3  1  
ATOM 31    H HG2  . GLU A 1 11  ? -11.146 8.178   130.262 1.00 0.00 ?  2   GLU A HG2  1  
ATOM 32    H HG3  . GLU A 1 11  ? -10.326 8.347   128.834 1.00 0.00 ?  2   GLU A HG3  1  
ATOM 33    N N    . THR A 1 12  ? -15.390 9.346   127.806 1.00 0.00 ?  3   THR A N    1  
ATOM 34    C CA   . THR A 1 12  ? -16.382 9.421   126.650 1.00 0.00 ?  3   THR A CA   1  
ATOM 35    C C    . THR A 1 12  ? -15.901 8.662   125.404 1.00 0.00 ?  3   THR A C    1  
ATOM 36    O O    . THR A 1 12  ? -14.757 8.111   125.385 1.00 0.00 ?  3   THR A O    1  
ATOM 37    C CB   . THR A 1 12  ? -16.897 10.845  126.316 1.00 0.00 ?  3   THR A CB   1  
ATOM 38    O OG1  . THR A 1 12  ? -18.130 10.679  125.593 1.00 0.00 ?  3   THR A OG1  1  
ATOM 39    C CG2  . THR A 1 12  ? -15.932 11.597  125.503 1.00 0.00 ?  3   THR A CG2  1  
ATOM 40    H H    . THR A 1 12  ? -14.843 10.184  127.945 1.00 0.00 ?  3   THR A H    1  
ATOM 41    H HA   . THR A 1 12  ? -17.205 8.843   127.071 1.00 0.00 ?  3   THR A HA   1  
ATOM 42    H HB   . THR A 1 12  ? -17.122 11.326  127.268 1.00 0.00 ?  3   THR A HB   1  
ATOM 43    H HG1  . THR A 1 12  ? -18.348 11.592  125.389 1.00 0.00 ?  3   THR A HG1  1  
ATOM 44    H HG21 . THR A 1 12  ? -15.979 12.660  125.742 1.00 0.00 ?  3   THR A HG21 1  
ATOM 45    H HG22 . THR A 1 12  ? -14.920 11.242  125.691 1.00 0.00 ?  3   THR A HG22 1  
ATOM 46    H HG23 . THR A 1 12  ? -16.158 11.472  124.443 1.00 0.00 ?  3   THR A HG23 1  
ATOM 47    N N    . THR A 1 13  ? -16.781 8.479   124.424 1.00 0.00 ?  4   THR A N    1  
ATOM 48    C CA   . THR A 1 13  ? -16.572 7.495   123.319 1.00 0.00 ?  4   THR A CA   1  
ATOM 49    C C    . THR A 1 13  ? -15.561 8.056   122.276 1.00 0.00 ?  4   THR A C    1  
ATOM 50    O O    . THR A 1 13  ? -15.429 9.280   122.056 1.00 0.00 ?  4   THR A O    1  
ATOM 51    C CB   . THR A 1 13  ? -17.942 7.085   122.801 1.00 0.00 ?  4   THR A CB   1  
ATOM 52    O OG1  . THR A 1 13  ? -18.368 8.049   121.968 1.00 0.00 ?  4   THR A OG1  1  
ATOM 53    C CG2  . THR A 1 13  ? -19.169 6.807   123.740 1.00 0.00 ?  4   THR A CG2  1  
ATOM 54    H H    . THR A 1 13  ? -17.673 8.940   124.535 1.00 0.00 ?  4   THR A H    1  
ATOM 55    H HA   . THR A 1 13  ? -16.188 6.586   123.784 1.00 0.00 ?  4   THR A HA   1  
ATOM 56    H HB   . THR A 1 13  ? -17.793 6.117   122.325 1.00 0.00 ?  4   THR A HB   1  
ATOM 57    H HG1  . THR A 1 13  ? -19.147 7.674   121.550 1.00 0.00 ?  4   THR A HG1  1  
ATOM 58    H HG21 . THR A 1 13  ? -18.848 6.040   124.443 1.00 0.00 ?  4   THR A HG21 1  
ATOM 59    H HG22 . THR A 1 13  ? -19.466 7.759   124.182 1.00 0.00 ?  4   THR A HG22 1  
ATOM 60    H HG23 . THR A 1 13  ? -19.988 6.487   123.095 1.00 0.00 ?  4   THR A HG23 1  
ATOM 61    N N    . ASN A 1 14  ? -14.823 7.152   121.627 1.00 0.00 ?  5   ASN A N    1  
ATOM 62    C CA   . ASN A 1 14  ? -14.197 7.344   120.246 1.00 0.00 ?  5   ASN A CA   1  
ATOM 63    C C    . ASN A 1 14  ? -15.312 7.476   119.205 1.00 0.00 ?  5   ASN A C    1  
ATOM 64    O O    . ASN A 1 14  ? -15.444 6.634   118.349 1.00 0.00 ?  5   ASN A O    1  
ATOM 65    C CB   . ASN A 1 14  ? -13.176 6.190   120.089 1.00 0.00 ?  5   ASN A CB   1  
ATOM 66    C CG   . ASN A 1 14  ? -11.836 6.541   120.814 1.00 0.00 ?  5   ASN A CG   1  
ATOM 67    O OD1  . ASN A 1 14  ? -10.796 6.918   120.172 1.00 0.00 ?  5   ASN A OD1  1  
ATOM 68    N ND2  . ASN A 1 14  ? -11.783 6.365   122.124 1.00 0.00 ?  5   ASN A ND2  1  
ATOM 69    H H    . ASN A 1 14  ? -14.913 6.204   121.964 1.00 0.00 ?  5   ASN A H    1  
ATOM 70    H HA   . ASN A 1 14  ? -13.694 8.301   120.103 1.00 0.00 ?  5   ASN A HA   1  
ATOM 71    H HB2  . ASN A 1 14  ? -13.549 5.293   120.584 1.00 0.00 ?  5   ASN A HB2  1  
ATOM 72    H HB3  . ASN A 1 14  ? -13.026 5.953   119.035 1.00 0.00 ?  5   ASN A HB3  1  
ATOM 73    H HD21 . ASN A 1 14  ? -12.556 5.892   122.570 1.00 0.00 ?  5   ASN A HD21 1  
ATOM 74    H HD22 . ASN A 1 14  ? -10.907 6.409   122.623 1.00 0.00 ?  5   ASN A HD22 1  
ATOM 75    N N    . GLY A 1 15  ? -16.255 8.415   119.324 1.00 0.00 ?  6   GLY A N    1  
ATOM 76    C CA   . GLY A 1 15  ? -17.536 8.394   118.633 1.00 0.00 ?  6   GLY A CA   1  
ATOM 77    C C    . GLY A 1 15  ? -18.428 9.620   118.722 1.00 0.00 ?  6   GLY A C    1  
ATOM 78    O O    . GLY A 1 15  ? -19.512 9.719   118.055 1.00 0.00 ?  6   GLY A O    1  
ATOM 79    H H    . GLY A 1 15  ? -16.069 9.074   120.066 1.00 0.00 ?  6   GLY A H    1  
ATOM 80    H HA2  . GLY A 1 15  ? -17.399 8.113   117.589 1.00 0.00 ?  6   GLY A HA2  1  
ATOM 81    H HA3  . GLY A 1 15  ? -18.197 7.666   119.104 1.00 0.00 ?  6   GLY A HA3  1  
ATOM 82    N N    . THR A 1 16  ? -18.101 10.671  119.530 1.00 0.00 ?  7   THR A N    1  
ATOM 83    C CA   . THR A 1 16  ? -18.785 11.966  119.501 1.00 0.00 ?  7   THR A CA   1  
ATOM 84    C C    . THR A 1 16  ? -18.553 12.810  118.243 1.00 0.00 ?  7   THR A C    1  
ATOM 85    O O    . THR A 1 16  ? -17.592 12.676  117.465 1.00 0.00 ?  7   THR A O    1  
ATOM 86    C CB   . THR A 1 16  ? -18.524 12.766  120.751 1.00 0.00 ?  7   THR A CB   1  
ATOM 87    O OG1  . THR A 1 16  ? -17.317 13.504  120.635 1.00 0.00 ?  7   THR A OG1  1  
ATOM 88    C CG2  . THR A 1 16  ? -18.525 11.984  122.122 1.00 0.00 ?  7   THR A CG2  1  
ATOM 89    H H    . THR A 1 16  ? -17.456 10.458  120.277 1.00 0.00 ?  7   THR A H    1  
ATOM 90    H HA   . THR A 1 16  ? -19.867 11.843  119.444 1.00 0.00 ?  7   THR A HA   1  
ATOM 91    H HB   . THR A 1 16  ? -19.230 13.587  120.881 1.00 0.00 ?  7   THR A HB   1  
ATOM 92    H HG1  . THR A 1 16  ? -17.200 13.955  121.473 1.00 0.00 ?  7   THR A HG1  1  
ATOM 93    H HG21 . THR A 1 16  ? -18.318 12.666  122.947 1.00 0.00 ?  7   THR A HG21 1  
ATOM 94    H HG22 . THR A 1 16  ? -19.490 11.488  122.223 1.00 0.00 ?  7   THR A HG22 1  
ATOM 95    H HG23 . THR A 1 16  ? -17.790 11.181  122.172 1.00 0.00 ?  7   THR A HG23 1  
ATOM 96    N N    . GLU A 1 17  ? -19.530 13.742  118.025 1.00 0.00 ?  8   GLU A N    1  
ATOM 97    C CA   . GLU A 1 17  ? -19.369 14.716  116.936 1.00 0.00 ?  8   GLU A CA   1  
ATOM 98    C C    . GLU A 1 17  ? -18.200 15.682  117.131 1.00 0.00 ?  8   GLU A C    1  
ATOM 99    O O    . GLU A 1 17  ? -17.579 16.065  116.106 1.00 0.00 ?  8   GLU A O    1  
ATOM 100   C CB   . GLU A 1 17  ? -20.603 15.580  116.678 1.00 0.00 ?  8   GLU A CB   1  
ATOM 101   C CG   . GLU A 1 17  ? -21.887 14.788  116.470 1.00 0.00 ?  8   GLU A CG   1  
ATOM 102   C CD   . GLU A 1 17  ? -22.756 14.341  117.678 1.00 0.00 ?  8   GLU A CD   1  
ATOM 103   O OE1  . GLU A 1 17  ? -22.140 14.370  118.739 1.00 0.00 -1 8   GLU A OE1  1  
ATOM 104   O OE2  . GLU A 1 17  ? -23.940 14.132  117.485 1.00 0.00 ?  8   GLU A OE2  1  
ATOM 105   H H    . GLU A 1 17  ? -20.237 13.846  118.737 1.00 0.00 ?  8   GLU A H    1  
ATOM 106   H HA   . GLU A 1 17  ? -19.188 14.204  115.991 1.00 0.00 ?  8   GLU A HA   1  
ATOM 107   H HB2  . GLU A 1 17  ? -20.845 16.257  117.498 1.00 0.00 ?  8   GLU A HB2  1  
ATOM 108   H HB3  . GLU A 1 17  ? -20.332 16.180  115.810 1.00 0.00 ?  8   GLU A HB3  1  
ATOM 109   H HG2  . GLU A 1 17  ? -22.461 15.484  115.857 1.00 0.00 ?  8   GLU A HG2  1  
ATOM 110   H HG3  . GLU A 1 17  ? -21.807 13.895  115.850 1.00 0.00 ?  8   GLU A HG3  1  
ATOM 111   N N    . THR A 1 18  ? -17.821 16.189  118.363 1.00 0.00 ?  9   THR A N    1  
ATOM 112   C CA   . THR A 1 18  ? -16.695 17.107  118.559 1.00 0.00 ?  9   THR A CA   1  
ATOM 113   C C    . THR A 1 18  ? -15.289 16.467  118.463 1.00 0.00 ?  9   THR A C    1  
ATOM 114   O O    . THR A 1 18  ? -14.355 17.101  118.004 1.00 0.00 ?  9   THR A O    1  
ATOM 115   C CB   . THR A 1 18  ? -16.586 17.874  119.891 1.00 0.00 ?  9   THR A CB   1  
ATOM 116   O OG1  . THR A 1 18  ? -15.885 17.150  120.916 1.00 0.00 ?  9   THR A OG1  1  
ATOM 117   C CG2  . THR A 1 18  ? -17.935 18.190  120.598 1.00 0.00 ?  9   THR A CG2  1  
ATOM 118   H H    . THR A 1 18  ? -18.399 16.058  119.180 1.00 0.00 ?  9   THR A H    1  
ATOM 119   H HA   . THR A 1 18  ? -16.826 17.854  117.775 1.00 0.00 ?  9   THR A HA   1  
ATOM 120   H HB   . THR A 1 18  ? -16.174 18.880  119.810 1.00 0.00 ?  9   THR A HB   1  
ATOM 121   H HG1  . THR A 1 18  ? -15.834 17.705  121.696 1.00 0.00 ?  9   THR A HG1  1  
ATOM 122   H HG21 . THR A 1 18  ? -17.792 18.883  121.428 1.00 0.00 ?  9   THR A HG21 1  
ATOM 123   H HG22 . THR A 1 18  ? -18.544 18.732  119.876 1.00 0.00 ?  9   THR A HG22 1  
ATOM 124   H HG23 . THR A 1 18  ? -18.507 17.283  120.795 1.00 0.00 ?  9   THR A HG23 1  
ATOM 125   N N    . TRP A 1 19  ? -15.190 15.139  118.850 1.00 0.00 ?  10  TRP A N    1  
ATOM 126   C CA   . TRP A 1 19  ? -14.008 14.245  118.708 1.00 0.00 ?  10  TRP A CA   1  
ATOM 127   C C    . TRP A 1 19  ? -13.608 14.066  117.244 1.00 0.00 ?  10  TRP A C    1  
ATOM 128   O O    . TRP A 1 19  ? -12.485 14.087  116.867 1.00 0.00 ?  10  TRP A O    1  
ATOM 129   C CB   . TRP A 1 19  ? -14.395 12.937  119.403 1.00 0.00 ?  10  TRP A CB   1  
ATOM 130   C CG   . TRP A 1 19  ? -13.467 11.699  119.249 1.00 0.00 ?  10  TRP A CG   1  
ATOM 131   C CD1  . TRP A 1 19  ? -12.359 11.436  120.003 1.00 0.00 ?  10  TRP A CD1  1  
ATOM 132   C CD2  . TRP A 1 19  ? -13.450 10.770  118.134 1.00 0.00 ?  10  TRP A CD2  1  
ATOM 133   N NE1  . TRP A 1 19  ? -11.748 10.261  119.536 1.00 0.00 ?  10  TRP A NE1  1  
ATOM 134   C CE2  . TRP A 1 19  ? -12.392 9.860   118.332 1.00 0.00 ?  10  TRP A CE2  1  
ATOM 135   C CE3  . TRP A 1 19  ? -14.349 10.578  117.038 1.00 0.00 ?  10  TRP A CE3  1  
ATOM 136   C CZ2  . TRP A 1 19  ? -12.102 8.920   117.373 1.00 0.00 ?  10  TRP A CZ2  1  
ATOM 137   C CZ3  . TRP A 1 19  ? -14.042 9.573   116.094 1.00 0.00 ?  10  TRP A CZ3  1  
ATOM 138   C CH2  . TRP A 1 19  ? -12.862 8.814   116.212 1.00 0.00 ?  10  TRP A CH2  1  
ATOM 139   H H    . TRP A 1 19  ? -16.000 14.638  119.186 1.00 0.00 ?  10  TRP A H    1  
ATOM 140   H HA   . TRP A 1 19  ? -13.210 14.776  119.227 1.00 0.00 ?  10  TRP A HA   1  
ATOM 141   H HB2  . TRP A 1 19  ? -14.413 13.219  120.456 1.00 0.00 ?  10  TRP A HB2  1  
ATOM 142   H HB3  . TRP A 1 19  ? -15.332 12.553  118.998 1.00 0.00 ?  10  TRP A HB3  1  
ATOM 143   H HD1  . TRP A 1 19  ? -12.048 11.826  120.960 1.00 0.00 ?  10  TRP A HD1  1  
ATOM 144   H HE1  . TRP A 1 19  ? -10.957 9.834   119.995 1.00 0.00 ?  10  TRP A HE1  1  
ATOM 145   H HE3  . TRP A 1 19  ? -15.217 11.217  116.961 1.00 0.00 ?  10  TRP A HE3  1  
ATOM 146   H HZ2  . TRP A 1 19  ? -11.339 8.201   117.630 1.00 0.00 ?  10  TRP A HZ2  1  
ATOM 147   H HZ3  . TRP A 1 19  ? -14.639 9.531   115.195 1.00 0.00 ?  10  TRP A HZ3  1  
ATOM 148   H HH2  . TRP A 1 19  ? -12.676 8.029   115.494 1.00 0.00 ?  10  TRP A HH2  1  
ATOM 149   N N    . TYR A 1 20  ? -14.664 13.771  116.402 1.00 0.00 ?  11  TYR A N    1  
ATOM 150   C CA   . TYR A 1 20  ? -14.546 13.780  114.914 1.00 0.00 ?  11  TYR A CA   1  
ATOM 151   C C    . TYR A 1 20  ? -14.126 15.104  114.261 1.00 0.00 ?  11  TYR A C    1  
ATOM 152   O O    . TYR A 1 20  ? -13.383 15.042  113.311 1.00 0.00 ?  11  TYR A O    1  
ATOM 153   C CB   . TYR A 1 20  ? -15.787 13.235  114.246 1.00 0.00 ?  11  TYR A CB   1  
ATOM 154   C CG   . TYR A 1 20  ? -16.049 13.725  112.884 1.00 0.00 ?  11  TYR A CG   1  
ATOM 155   C CD1  . TYR A 1 20  ? -15.262 13.297  111.802 1.00 0.00 ?  11  TYR A CD1  1  
ATOM 156   C CD2  . TYR A 1 20  ? -17.004 14.776  112.663 1.00 0.00 ?  11  TYR A CD2  1  
ATOM 157   C CE1  . TYR A 1 20  ? -15.357 13.907  110.522 1.00 0.00 ?  11  TYR A CE1  1  
ATOM 158   C CE2  . TYR A 1 20  ? -17.084 15.532  111.443 1.00 0.00 ?  11  TYR A CE2  1  
ATOM 159   C CZ   . TYR A 1 20  ? -16.278 14.995  110.382 1.00 0.00 ?  11  TYR A CZ   1  
ATOM 160   O OH   . TYR A 1 20  ? -16.484 15.441  109.156 1.00 0.00 ?  11  TYR A OH   1  
ATOM 161   H H    . TYR A 1 20  ? -15.516 13.629  116.927 1.00 0.00 ?  11  TYR A H    1  
ATOM 162   H HA   . TYR A 1 20  ? -13.750 13.055  114.738 1.00 0.00 ?  11  TYR A HA   1  
ATOM 163   H HB2  . TYR A 1 20  ? -15.717 12.156  114.106 1.00 0.00 ?  11  TYR A HB2  1  
ATOM 164   H HB3  . TYR A 1 20  ? -16.662 13.383  114.880 1.00 0.00 ?  11  TYR A HB3  1  
ATOM 165   H HD1  . TYR A 1 20  ? -14.583 12.460  111.866 1.00 0.00 ?  11  TYR A HD1  1  
ATOM 166   H HD2  . TYR A 1 20  ? -17.739 14.939  113.438 1.00 0.00 ?  11  TYR A HD2  1  
ATOM 167   H HE1  . TYR A 1 20  ? -14.822 13.561  109.650 1.00 0.00 ?  11  TYR A HE1  1  
ATOM 168   H HE2  . TYR A 1 20  ? -17.860 16.274  111.325 1.00 0.00 ?  11  TYR A HE2  1  
ATOM 169   H HH   . TYR A 1 20  ? -16.647 16.384  109.096 1.00 0.00 ?  11  TYR A HH   1  
ATOM 170   N N    . GLU A 1 21  ? -14.594 16.223  114.765 1.00 0.00 ?  12  GLU A N    1  
ATOM 171   C CA   . GLU A 1 21  ? -14.172 17.598  114.377 1.00 0.00 ?  12  GLU A CA   1  
ATOM 172   C C    . GLU A 1 21  ? -12.766 18.062  114.746 1.00 0.00 ?  12  GLU A C    1  
ATOM 173   O O    . GLU A 1 21  ? -12.151 18.802  113.994 1.00 0.00 ?  12  GLU A O    1  
ATOM 174   C CB   . GLU A 1 21  ? -15.322 18.518  114.835 1.00 0.00 ?  12  GLU A CB   1  
ATOM 175   C CG   . GLU A 1 21  ? -16.559 18.383  113.911 1.00 0.00 ?  12  GLU A CG   1  
ATOM 176   C CD   . GLU A 1 21  ? -16.436 18.961  112.507 1.00 0.00 ?  12  GLU A CD   1  
ATOM 177   O OE1  . GLU A 1 21  ? -15.457 19.733  112.245 1.00 0.00 ?  12  GLU A OE1  1  
ATOM 178   O OE2  . GLU A 1 21  ? -17.309 18.844  111.672 1.00 0.00 -1 12  GLU A OE2  1  
ATOM 179   H H    . GLU A 1 21  ? -15.342 16.249  115.443 1.00 0.00 ?  12  GLU A H    1  
ATOM 180   H HA   . GLU A 1 21  ? -14.165 17.788  113.303 1.00 0.00 ?  12  GLU A HA   1  
ATOM 181   H HB2  . GLU A 1 21  ? -15.541 18.107  115.821 1.00 0.00 ?  12  GLU A HB2  1  
ATOM 182   H HB3  . GLU A 1 21  ? -14.994 19.547  114.986 1.00 0.00 ?  12  GLU A HB3  1  
ATOM 183   H HG2  . GLU A 1 21  ? -16.862 17.344  113.782 1.00 0.00 ?  12  GLU A HG2  1  
ATOM 184   H HG3  . GLU A 1 21  ? -17.383 18.838  114.460 1.00 0.00 ?  12  GLU A HG3  1  
ATOM 185   N N    . SER A 1 22  ? -12.204 17.454  115.772 1.00 0.00 ?  13  SER A N    1  
ATOM 186   C CA   . SER A 1 22  ? -10.853 17.694  116.282 1.00 0.00 ?  13  SER A CA   1  
ATOM 187   C C    . SER A 1 22  ? -9.882  16.802  115.504 1.00 0.00 ?  13  SER A C    1  
ATOM 188   O O    . SER A 1 22  ? -8.843  17.360  115.075 1.00 0.00 ?  13  SER A O    1  
ATOM 189   C CB   . SER A 1 22  ? -10.828 17.384  117.757 1.00 0.00 ?  13  SER A CB   1  
ATOM 190   O OG   . SER A 1 22  ? -9.555  17.222  118.240 1.00 0.00 ?  13  SER A OG   1  
ATOM 191   H H    . SER A 1 22  ? -12.813 16.803  116.245 1.00 0.00 ?  13  SER A H    1  
ATOM 192   H HA   . SER A 1 22  ? -10.486 18.711  116.140 1.00 0.00 ?  13  SER A HA   1  
ATOM 193   H HB2  . SER A 1 22  ? -11.220 18.246  118.297 1.00 0.00 ?  13  SER A HB2  1  
ATOM 194   H HB3  . SER A 1 22  ? -11.450 16.541  118.058 1.00 0.00 ?  13  SER A HB3  1  
ATOM 195   H HG   . SER A 1 22  ? -9.152  18.083  118.364 1.00 0.00 ?  13  SER A HG   1  
ATOM 196   N N    . LEU A 1 23  ? -10.361 15.537  115.149 1.00 0.00 ?  14  LEU A N    1  
ATOM 197   C CA   . LEU A 1 23  ? -9.687  14.669  114.086 1.00 0.00 ?  14  LEU A CA   1  
ATOM 198   C C    . LEU A 1 23  ? -9.796  15.375  112.731 1.00 0.00 ?  14  LEU A C    1  
ATOM 199   O O    . LEU A 1 23  ? -8.821  15.331  111.941 1.00 0.00 ?  14  LEU A O    1  
ATOM 200   C CB   . LEU A 1 23  ? -10.395 13.278  114.173 1.00 0.00 ?  14  LEU A CB   1  
ATOM 201   C CG   . LEU A 1 23  ? -10.155 12.329  113.035 1.00 0.00 ?  14  LEU A CG   1  
ATOM 202   C CD1  . LEU A 1 23  ? -9.649  10.917  113.382 1.00 0.00 ?  14  LEU A CD1  1  
ATOM 203   C CD2  . LEU A 1 23  ? -11.325 12.126  111.971 1.00 0.00 ?  14  LEU A CD2  1  
ATOM 204   H H    . LEU A 1 23  ? -11.202 15.244  115.626 1.00 0.00 ?  14  LEU A H    1  
ATOM 205   H HA   . LEU A 1 23  ? -8.628  14.525  114.297 1.00 0.00 ?  14  LEU A HA   1  
ATOM 206   H HB2  . LEU A 1 23  ? -10.056 12.896  115.135 1.00 0.00 ?  14  LEU A HB2  1  
ATOM 207   H HB3  . LEU A 1 23  ? -11.473 13.425  114.220 1.00 0.00 ?  14  LEU A HB3  1  
ATOM 208   H HG   . LEU A 1 23  ? -9.351  12.657  112.375 1.00 0.00 ?  14  LEU A HG   1  
ATOM 209   H HD11 . LEU A 1 23  ? -10.307 10.416  114.092 1.00 0.00 ?  14  LEU A HD11 1  
ATOM 210   H HD12 . LEU A 1 23  ? -9.663  10.298  112.484 1.00 0.00 ?  14  LEU A HD12 1  
ATOM 211   H HD13 . LEU A 1 23  ? -8.613  10.853  113.715 1.00 0.00 ?  14  LEU A HD13 1  
ATOM 212   H HD21 . LEU A 1 23  ? -11.643 13.088  111.570 1.00 0.00 ?  14  LEU A HD21 1  
ATOM 213   H HD22 . LEU A 1 23  ? -10.923 11.483  111.188 1.00 0.00 ?  14  LEU A HD22 1  
ATOM 214   H HD23 . LEU A 1 23  ? -12.190 11.685  112.467 1.00 0.00 ?  14  LEU A HD23 1  
ATOM 215   N N    . HIS A 1 24  ? -10.888 16.053  112.404 1.00 0.00 ?  15  HIS A N    1  
ATOM 216   C CA   . HIS A 1 24  ? -11.043 16.726  111.098 1.00 0.00 ?  15  HIS A CA   1  
ATOM 217   C C    . HIS A 1 24  ? -10.067 17.857  111.014 1.00 0.00 ?  15  HIS A C    1  
ATOM 218   O O    . HIS A 1 24  ? -9.441  18.115  110.006 1.00 0.00 ?  15  HIS A O    1  
ATOM 219   C CB   . HIS A 1 24  ? -12.500 17.121  110.737 1.00 0.00 ?  15  HIS A CB   1  
ATOM 220   C CG   . HIS A 1 24  ? -12.768 17.539  109.304 1.00 0.00 ?  15  HIS A CG   1  
ATOM 221   N ND1  . HIS A 1 24  ? -13.557 18.583  108.899 1.00 0.00 ?  15  HIS A ND1  1  
ATOM 222   C CD2  . HIS A 1 24  ? -12.162 16.962  108.184 1.00 0.00 ?  15  HIS A CD2  1  
ATOM 223   C CE1  . HIS A 1 24  ? -13.455 18.674  107.584 1.00 0.00 ?  15  HIS A CE1  1  
ATOM 224   N NE2  . HIS A 1 24  ? -12.670 17.702  107.125 1.00 0.00 ?  15  HIS A NE2  1  
ATOM 225   H H    . HIS A 1 24  ? -11.706 16.086  112.995 1.00 0.00 ?  15  HIS A H    1  
ATOM 226   H HA   . HIS A 1 24  ? -10.690 15.976  110.391 1.00 0.00 ?  15  HIS A HA   1  
ATOM 227   H HB2  . HIS A 1 24  ? -13.165 16.297  110.997 1.00 0.00 ?  15  HIS A HB2  1  
ATOM 228   H HB3  . HIS A 1 24  ? -12.755 17.974  111.363 1.00 0.00 ?  15  HIS A HB3  1  
ATOM 229   H HD2  . HIS A 1 24  ? -11.373 16.226  108.194 1.00 0.00 ?  15  HIS A HD2  1  
ATOM 230   H HE1  . HIS A 1 24  ? -14.145 19.281  107.017 1.00 0.00 ?  15  HIS A HE1  1  
ATOM 231   H HE2  . HIS A 1 24  ? -12.475 17.552  106.146 1.00 0.00 ?  15  HIS A HE2  1  
ATOM 232   N N    . ALA A 1 25  ? -9.821  18.617  112.087 1.00 0.00 ?  16  ALA A N    1  
ATOM 233   C CA   . ALA A 1 25  ? -8.851  19.700  112.191 1.00 0.00 ?  16  ALA A CA   1  
ATOM 234   C C    . ALA A 1 25  ? -7.443  19.220  112.029 1.00 0.00 ?  16  ALA A C    1  
ATOM 235   O O    . ALA A 1 25  ? -6.643  19.880  111.348 1.00 0.00 ?  16  ALA A O    1  
ATOM 236   C CB   . ALA A 1 25  ? -9.094  20.508  113.496 1.00 0.00 ?  16  ALA A CB   1  
ATOM 237   H H    . ALA A 1 25  ? -10.318 18.311  112.912 1.00 0.00 ?  16  ALA A H    1  
ATOM 238   H HA   . ALA A 1 25  ? -8.995  20.379  111.350 1.00 0.00 ?  16  ALA A HA   1  
ATOM 239   H HB1  . ALA A 1 25  ? -9.017  19.938  114.422 1.00 0.00 ?  16  ALA A HB1  1  
ATOM 240   H HB2  . ALA A 1 25  ? -8.415  21.358  113.548 1.00 0.00 ?  16  ALA A HB2  1  
ATOM 241   H HB3  . ALA A 1 25  ? -10.122 20.868  113.527 1.00 0.00 ?  16  ALA A HB3  1  
ATOM 242   N N    . VAL A 1 26  ? -7.123  18.112  112.662 1.00 0.00 ?  17  VAL A N    1  
ATOM 243   C CA   . VAL A 1 26  ? -5.763  17.388  112.577 1.00 0.00 ?  17  VAL A CA   1  
ATOM 244   C C    . VAL A 1 26  ? -5.494  16.917  111.183 1.00 0.00 ?  17  VAL A C    1  
ATOM 245   O O    . VAL A 1 26  ? -4.416  17.060  110.683 1.00 0.00 ?  17  VAL A O    1  
ATOM 246   C CB   . VAL A 1 26  ? -5.786  16.152  113.599 1.00 0.00 ?  17  VAL A CB   1  
ATOM 247   C CG1  . VAL A 1 26  ? -4.936  14.915  113.286 1.00 0.00 ?  17  VAL A CG1  1  
ATOM 248   C CG2  . VAL A 1 26  ? -5.506  16.780  114.967 1.00 0.00 ?  17  VAL A CG2  1  
ATOM 249   H H    . VAL A 1 26  ? -7.903  17.766  113.201 1.00 0.00 ?  17  VAL A H    1  
ATOM 250   H HA   . VAL A 1 26  ? -4.916  18.035  112.805 1.00 0.00 ?  17  VAL A HA   1  
ATOM 251   H HB   . VAL A 1 26  ? -6.805  15.763  113.613 1.00 0.00 ?  17  VAL A HB   1  
ATOM 252   H HG11 . VAL A 1 26  ? -4.846  14.292  114.175 1.00 0.00 ?  17  VAL A HG11 1  
ATOM 253   H HG12 . VAL A 1 26  ? -5.337  14.311  112.472 1.00 0.00 ?  17  VAL A HG12 1  
ATOM 254   H HG13 . VAL A 1 26  ? -3.934  15.231  112.995 1.00 0.00 ?  17  VAL A HG13 1  
ATOM 255   H HG21 . VAL A 1 26  ? -6.269  17.538  115.149 1.00 0.00 ?  17  VAL A HG21 1  
ATOM 256   H HG22 . VAL A 1 26  ? -5.623  16.036  115.755 1.00 0.00 ?  17  VAL A HG22 1  
ATOM 257   H HG23 . VAL A 1 26  ? -4.568  17.327  115.059 1.00 0.00 ?  17  VAL A HG23 1  
ATOM 258   N N    . LEU A 1 27  ? -6.533  16.462  110.446 1.00 0.00 ?  18  LEU A N    1  
ATOM 259   C CA   . LEU A 1 27  ? -6.510  16.109  109.018 1.00 0.00 ?  18  LEU A CA   1  
ATOM 260   C C    . LEU A 1 27  ? -6.317  17.309  108.065 1.00 0.00 ?  18  LEU A C    1  
ATOM 261   O O    . LEU A 1 27  ? -5.531  17.258  107.092 1.00 0.00 ?  18  LEU A O    1  
ATOM 262   C CB   . LEU A 1 27  ? -7.799  15.276  108.699 1.00 0.00 ?  18  LEU A CB   1  
ATOM 263   C CG   . LEU A 1 27  ? -7.813  13.828  109.045 1.00 0.00 ?  18  LEU A CG   1  
ATOM 264   C CD1  . LEU A 1 27  ? -9.194  13.333  108.798 1.00 0.00 ?  18  LEU A CD1  1  
ATOM 265   C CD2  . LEU A 1 27  ? -6.661  13.062  108.332 1.00 0.00 ?  18  LEU A CD2  1  
ATOM 266   H H    . LEU A 1 27  ? -7.391  16.374  110.971 1.00 0.00 ?  18  LEU A H    1  
ATOM 267   H HA   . LEU A 1 27  ? -5.600  15.524  108.877 1.00 0.00 ?  18  LEU A HA   1  
ATOM 268   H HB2  . LEU A 1 27  ? -8.641  15.836  109.107 1.00 0.00 ?  18  LEU A HB2  1  
ATOM 269   H HB3  . LEU A 1 27  ? -8.071  15.316  107.644 1.00 0.00 ?  18  LEU A HB3  1  
ATOM 270   H HG   . LEU A 1 27  ? -7.624  13.802  110.117 1.00 0.00 ?  18  LEU A HG   1  
ATOM 271   H HD11 . LEU A 1 27  ? -9.157  12.249  108.908 1.00 0.00 ?  18  LEU A HD11 1  
ATOM 272   H HD12 . LEU A 1 27  ? -9.815  13.730  109.602 1.00 0.00 ?  18  LEU A HD12 1  
ATOM 273   H HD13 . LEU A 1 27  ? -9.477  13.622  107.786 1.00 0.00 ?  18  LEU A HD13 1  
ATOM 274   H HD21 . LEU A 1 27  ? -6.658  11.984  108.485 1.00 0.00 ?  18  LEU A HD21 1  
ATOM 275   H HD22 . LEU A 1 27  ? -6.848  13.147  107.261 1.00 0.00 ?  18  LEU A HD22 1  
ATOM 276   H HD23 . LEU A 1 27  ? -5.703  13.562  108.473 1.00 0.00 ?  18  LEU A HD23 1  
ATOM 277   N N    . LYS A 1 28  ? -7.010  18.405  108.404 1.00 0.00 ?  19  LYS A N    1  
ATOM 278   C CA   . LYS A 1 28  ? -6.834  19.747  107.586 1.00 0.00 ?  19  LYS A CA   1  
ATOM 279   C C    . LYS A 1 28  ? -5.414  20.318  107.718 1.00 0.00 ?  19  LYS A C    1  
ATOM 280   O O    . LYS A 1 28  ? -4.769  20.622  106.707 1.00 0.00 ?  19  LYS A O    1  
ATOM 281   C CB   . LYS A 1 28  ? -7.915  20.833  107.864 1.00 0.00 ?  19  LYS A CB   1  
ATOM 282   C CG   . LYS A 1 28  ? -9.239  20.457  107.114 1.00 0.00 ?  19  LYS A CG   1  
ATOM 283   C CD   . LYS A 1 28  ? -10.623 21.133  107.553 1.00 0.00 ?  19  LYS A CD   1  
ATOM 284   C CE   . LYS A 1 28  ? -10.867 20.892  109.017 1.00 0.00 ?  19  LYS A CE   1  
ATOM 285   N NZ   . LYS A 1 28  ? -12.105 21.425  109.500 1.00 0.00 1  19  LYS A NZ   1  
ATOM 286   H H    . LYS A 1 28  ? -7.661  18.411  109.177 1.00 0.00 ?  19  LYS A H    1  
ATOM 287   H HA   . LYS A 1 28  ? -6.811  19.526  106.518 1.00 0.00 ?  19  LYS A HA   1  
ATOM 288   H HB2  . LYS A 1 28  ? -8.048  20.937  108.940 1.00 0.00 ?  19  LYS A HB2  1  
ATOM 289   H HB3  . LYS A 1 28  ? -7.561  21.715  107.330 1.00 0.00 ?  19  LYS A HB3  1  
ATOM 290   H HG2  . LYS A 1 28  ? -9.213  20.475  106.025 1.00 0.00 ?  19  LYS A HG2  1  
ATOM 291   H HG3  . LYS A 1 28  ? -9.473  19.394  107.191 1.00 0.00 ?  19  LYS A HG3  1  
ATOM 292   H HD2  . LYS A 1 28  ? -10.496 22.198  107.353 1.00 0.00 ?  19  LYS A HD2  1  
ATOM 293   H HD3  . LYS A 1 28  ? -11.454 20.719  106.982 1.00 0.00 ?  19  LYS A HD3  1  
ATOM 294   H HE2  . LYS A 1 28  ? -10.883 19.810  109.154 1.00 0.00 ?  19  LYS A HE2  1  
ATOM 295   H HE3  . LYS A 1 28  ? -10.008 21.265  109.575 1.00 0.00 ?  19  LYS A HE3  1  
ATOM 296   H HZ1  . LYS A 1 28  ? -12.925 21.068  109.032 1.00 0.00 ?  19  LYS A HZ1  1  
ATOM 297   H HZ2  . LYS A 1 28  ? -12.354 21.151  110.439 1.00 0.00 ?  19  LYS A HZ2  1  
ATOM 298   H HZ3  . LYS A 1 28  ? -12.103 22.426  109.364 1.00 0.00 ?  19  LYS A HZ3  1  
ATOM 299   N N    . ALA A 1 29  ? -4.902  20.375  108.937 1.00 0.00 ?  20  ALA A N    1  
ATOM 300   C CA   . ALA A 1 29  ? -3.462  20.615  109.205 1.00 0.00 ?  20  ALA A CA   1  
ATOM 301   C C    . ALA A 1 29  ? -2.495  19.635  108.529 1.00 0.00 ?  20  ALA A C    1  
ATOM 302   O O    . ALA A 1 29  ? -1.486  20.097  107.931 1.00 0.00 ?  20  ALA A O    1  
ATOM 303   C CB   . ALA A 1 29  ? -3.214  20.546  110.709 1.00 0.00 ?  20  ALA A CB   1  
ATOM 304   H H    . ALA A 1 29  ? -5.430  20.316  109.795 1.00 0.00 ?  20  ALA A H    1  
ATOM 305   H HA   . ALA A 1 29  ? -3.245  21.660  108.984 1.00 0.00 ?  20  ALA A HA   1  
ATOM 306   H HB1  . ALA A 1 29  ? -3.558  19.577  111.072 1.00 0.00 ?  20  ALA A HB1  1  
ATOM 307   H HB2  . ALA A 1 29  ? -2.200  20.787  111.024 1.00 0.00 ?  20  ALA A HB2  1  
ATOM 308   H HB3  . ALA A 1 29  ? -3.770  21.327  111.229 1.00 0.00 ?  20  ALA A HB3  1  
ATOM 309   N N    . LEU A 1 30  ? -2.773  18.355  108.522 1.00 0.00 ?  21  LEU A N    1  
ATOM 310   C CA   . LEU A 1 30  ? -1.920  17.338  107.898 1.00 0.00 ?  21  LEU A CA   1  
ATOM 311   C C    . LEU A 1 30  ? -1.903  17.581  106.361 1.00 0.00 ?  21  LEU A C    1  
ATOM 312   O O    . LEU A 1 30  ? -0.876  17.568  105.734 1.00 0.00 ?  21  LEU A O    1  
ATOM 313   C CB   . LEU A 1 30  ? -2.468  15.932  108.349 1.00 0.00 ?  21  LEU A CB   1  
ATOM 314   C CG   . LEU A 1 30  ? -1.662  14.662  107.933 1.00 0.00 ?  21  LEU A CG   1  
ATOM 315   C CD1  . LEU A 1 30  ? -0.219  14.724  108.418 1.00 0.00 ?  21  LEU A CD1  1  
ATOM 316   C CD2  . LEU A 1 30  ? -2.485  13.455  108.295 1.00 0.00 ?  21  LEU A CD2  1  
ATOM 317   H H    . LEU A 1 30  ? -3.584  18.010  109.016 1.00 0.00 ?  21  LEU A H    1  
ATOM 318   H HA   . LEU A 1 30  ? -0.886  17.380  108.242 1.00 0.00 ?  21  LEU A HA   1  
ATOM 319   H HB2  . LEU A 1 30  ? -2.646  16.005  109.421 1.00 0.00 ?  21  LEU A HB2  1  
ATOM 320   H HB3  . LEU A 1 30  ? -3.404  15.676  107.852 1.00 0.00 ?  21  LEU A HB3  1  
ATOM 321   H HG   . LEU A 1 30  ? -1.518  14.568  106.857 1.00 0.00 ?  21  LEU A HG   1  
ATOM 322   H HD11 . LEU A 1 30  ? 0.340   15.460  107.840 1.00 0.00 ?  21  LEU A HD11 1  
ATOM 323   H HD12 . LEU A 1 30  ? -0.019  14.911  109.474 1.00 0.00 ?  21  LEU A HD12 1  
ATOM 324   H HD13 . LEU A 1 30  ? 0.297   13.797  108.168 1.00 0.00 ?  21  LEU A HD13 1  
ATOM 325   H HD21 . LEU A 1 30  ? -2.722  13.424  109.359 1.00 0.00 ?  21  LEU A HD21 1  
ATOM 326   H HD22 . LEU A 1 30  ? -3.428  13.398  107.753 1.00 0.00 ?  21  LEU A HD22 1  
ATOM 327   H HD23 . LEU A 1 30  ? -1.967  12.515  108.105 1.00 0.00 ?  21  LEU A HD23 1  
ATOM 328   N N    . ASN A 1 31  ? -3.043  17.957  105.718 1.00 0.00 ?  22  ASN A N    1  
ATOM 329   C CA   . ASN A 1 31  ? -3.092  18.380  104.297 1.00 0.00 ?  22  ASN A CA   1  
ATOM 330   C C    . ASN A 1 31  ? -2.372  19.654  103.971 1.00 0.00 ?  22  ASN A C    1  
ATOM 331   O O    . ASN A 1 31  ? -1.733  19.734  102.935 1.00 0.00 ?  22  ASN A O    1  
ATOM 332   C CB   . ASN A 1 31  ? -4.593  18.483  104.011 1.00 0.00 ?  22  ASN A CB   1  
ATOM 333   C CG   . ASN A 1 31  ? -4.672  18.968  102.566 1.00 0.00 ?  22  ASN A CG   1  
ATOM 334   O OD1  . ASN A 1 31  ? -4.272  18.295  101.650 1.00 0.00 ?  22  ASN A OD1  1  
ATOM 335   N ND2  . ASN A 1 31  ? -5.452  20.011  102.293 1.00 0.00 ?  22  ASN A ND2  1  
ATOM 336   H H    . ASN A 1 31  ? -3.885  17.898  106.272 1.00 0.00 ?  22  ASN A H    1  
ATOM 337   H HA   . ASN A 1 31  ? -2.673  17.636  103.621 1.00 0.00 ?  22  ASN A HA   1  
ATOM 338   H HB2  . ASN A 1 31  ? -4.990  17.473  104.121 1.00 0.00 ?  22  ASN A HB2  1  
ATOM 339   H HB3  . ASN A 1 31  ? -5.153  19.208  104.602 1.00 0.00 ?  22  ASN A HB3  1  
ATOM 340   H HD21 . ASN A 1 31  ? -5.632  20.741  102.968 1.00 0.00 ?  22  ASN A HD21 1  
ATOM 341   H HD22 . ASN A 1 31  ? -5.591  20.141  101.300 1.00 0.00 ?  22  ASN A HD22 1  
ATOM 342   N N    . ALA A 1 32  ? -2.266  20.623  104.871 1.00 0.00 ?  23  ALA A N    1  
ATOM 343   C CA   . ALA A 1 32  ? -1.511  21.839  104.841 1.00 0.00 ?  23  ALA A CA   1  
ATOM 344   C C    . ALA A 1 32  ? 0.015   21.692  104.927 1.00 0.00 ?  23  ALA A C    1  
ATOM 345   O O    . ALA A 1 32  ? 0.731   22.209  104.072 1.00 0.00 ?  23  ALA A O    1  
ATOM 346   C CB   . ALA A 1 32  ? -2.121  22.759  105.938 1.00 0.00 ?  23  ALA A CB   1  
ATOM 347   H H    . ALA A 1 32  ? -2.765  20.616  105.749 1.00 0.00 ?  23  ALA A H    1  
ATOM 348   H HA   . ALA A 1 32  ? -1.672  22.352  103.893 1.00 0.00 ?  23  ALA A HA   1  
ATOM 349   H HB1  . ALA A 1 32  ? -1.595  23.708  106.045 1.00 0.00 ?  23  ALA A HB1  1  
ATOM 350   H HB2  . ALA A 1 32  ? -3.183  22.895  105.734 1.00 0.00 ?  23  ALA A HB2  1  
ATOM 351   H HB3  . ALA A 1 32  ? -2.054  22.221  106.884 1.00 0.00 ?  23  ALA A HB3  1  
ATOM 352   N N    . THR A 1 33  ? 0.420   20.860  105.863 1.00 0.00 ?  24  THR A N    1  
ATOM 353   C CA   . THR A 1 33  ? 1.859   20.464  106.088 1.00 0.00 ?  24  THR A CA   1  
ATOM 354   C C    . THR A 1 33  ? 2.228   19.725  104.791 1.00 0.00 ?  24  THR A C    1  
ATOM 355   O O    . THR A 1 33  ? 3.335   19.830  104.273 1.00 0.00 ?  24  THR A O    1  
ATOM 356   C CB   . THR A 1 33  ? 1.825   19.672  107.417 1.00 0.00 ?  24  THR A CB   1  
ATOM 357   O OG1  . THR A 1 33  ? 1.431   20.569  108.480 1.00 0.00 ?  24  THR A OG1  1  
ATOM 358   C CG2  . THR A 1 33  ? 3.112   18.976  107.747 1.00 0.00 ?  24  THR A CG2  1  
ATOM 359   H H    . THR A 1 33  ? -0.303  20.494  106.468 1.00 0.00 ?  24  THR A H    1  
ATOM 360   H HA   . THR A 1 33  ? 2.480   21.352  106.206 1.00 0.00 ?  24  THR A HA   1  
ATOM 361   H HB   . THR A 1 33  ? 1.038   18.919  107.402 1.00 0.00 ?  24  THR A HB   1  
ATOM 362   H HG1  . THR A 1 33  ? 0.555   20.235  108.683 1.00 0.00 ?  24  THR A HG1  1  
ATOM 363   H HG21 . THR A 1 33  ? 3.833   19.773  107.935 1.00 0.00 ?  24  THR A HG21 1  
ATOM 364   H HG22 . THR A 1 33  ? 3.011   18.309  108.603 1.00 0.00 ?  24  THR A HG22 1  
ATOM 365   H HG23 . THR A 1 33  ? 3.557   18.317  107.000 1.00 0.00 ?  24  THR A HG23 1  
ATOM 366   N N    . LEU A 1 34  ? 1.377   18.874  104.206 1.00 0.00 ?  25  LEU A N    1  
ATOM 367   C CA   . LEU A 1 34  ? 1.688   18.162  102.954 1.00 0.00 ?  25  LEU A CA   1  
ATOM 368   C C    . LEU A 1 34  ? 1.742   19.090  101.745 1.00 0.00 ?  25  LEU A C    1  
ATOM 369   O O    . LEU A 1 34  ? 2.848   19.087  101.204 1.00 0.00 ?  25  LEU A O    1  
ATOM 370   C CB   . LEU A 1 34  ? 0.711   17.027  102.644 1.00 0.00 ?  25  LEU A CB   1  
ATOM 371   C CG   . LEU A 1 34  ? 1.145   16.186  101.401 1.00 0.00 ?  25  LEU A CG   1  
ATOM 372   C CD1  . LEU A 1 34  ? 0.645   14.756  101.497 1.00 0.00 ?  25  LEU A CD1  1  
ATOM 373   C CD2  . LEU A 1 34  ? 0.740   16.708  99.978  1.00 0.00 ?  25  LEU A CD2  1  
ATOM 374   H H    . LEU A 1 34  ? 0.536   18.622  104.706 1.00 0.00 ?  25  LEU A H    1  
ATOM 375   H HA   . LEU A 1 34  ? 2.679   17.779  103.199 1.00 0.00 ?  25  LEU A HA   1  
ATOM 376   H HB2  . LEU A 1 34  ? 0.531   16.375  103.499 1.00 0.00 ?  25  LEU A HB2  1  
ATOM 377   H HB3  . LEU A 1 34  ? -0.251  17.501  102.455 1.00 0.00 ?  25  LEU A HB3  1  
ATOM 378   H HG   . LEU A 1 34  ? 2.233   16.137  101.462 1.00 0.00 ?  25  LEU A HG   1  
ATOM 379   H HD11 . LEU A 1 34  ? 0.702   14.365  102.513 1.00 0.00 ?  25  LEU A HD11 1  
ATOM 380   H HD12 . LEU A 1 34  ? -0.381  14.758  101.131 1.00 0.00 ?  25  LEU A HD12 1  
ATOM 381   H HD13 . LEU A 1 34  ? 1.237   14.149  100.812 1.00 0.00 ?  25  LEU A HD13 1  
ATOM 382   H HD21 . LEU A 1 34  ? 1.313   17.599  99.722  1.00 0.00 ?  25  LEU A HD21 1  
ATOM 383   H HD22 . LEU A 1 34  ? 0.943   15.927  99.244  1.00 0.00 ?  25  LEU A HD22 1  
ATOM 384   H HD23 . LEU A 1 34  ? -0.331  16.830  99.817  1.00 0.00 ?  25  LEU A HD23 1  
ATOM 385   N N    . HIS A 1 35  ? 0.787   19.820  101.272 1.00 0.00 ?  26  HIS A N    1  
ATOM 386   C CA   . HIS A 1 35  ? 0.853   20.783  100.136 1.00 0.00 ?  26  HIS A CA   1  
ATOM 387   C C    . HIS A 1 35  ? 2.016   21.815  100.292 1.00 0.00 ?  26  HIS A C    1  
ATOM 388   O O    . HIS A 1 35  ? 2.852   22.117  99.439  1.00 0.00 ?  26  HIS A O    1  
ATOM 389   C CB   . HIS A 1 35  ? -0.450  21.465  99.849  1.00 0.00 ?  26  HIS A CB   1  
ATOM 390   C CG   . HIS A 1 35  ? -1.586  20.581  99.217  1.00 0.00 ?  26  HIS A CG   1  
ATOM 391   N ND1  . HIS A 1 35  ? -1.646  20.262  97.861  1.00 0.00 ?  26  HIS A ND1  1  
ATOM 392   C CD2  . HIS A 1 35  ? -2.880  20.535  99.764  1.00 0.00 ?  26  HIS A CD2  1  
ATOM 393   C CE1  . HIS A 1 35  ? -2.911  19.740  97.788  1.00 0.00 ?  26  HIS A CE1  1  
ATOM 394   N NE2  . HIS A 1 35  ? -3.687  19.978  98.872  1.00 0.00 ?  26  HIS A NE2  1  
ATOM 395   H H    . HIS A 1 35  ? 0.007   20.071  101.862 1.00 0.00 ?  26  HIS A H    1  
ATOM 396   H HA   . HIS A 1 35  ? 1.027   20.163  99.256  1.00 0.00 ?  26  HIS A HA   1  
ATOM 397   H HB2  . HIS A 1 35  ? -0.965  21.833  100.736 1.00 0.00 ?  26  HIS A HB2  1  
ATOM 398   H HB3  . HIS A 1 35  ? -0.258  22.085  98.973  1.00 0.00 ?  26  HIS A HB3  1  
ATOM 399   H HD2  . HIS A 1 35  ? -3.194  20.947  100.711 1.00 0.00 ?  26  HIS A HD2  1  
ATOM 400   H HE1  . HIS A 1 35  ? -3.320  19.387  96.852  1.00 0.00 ?  26  HIS A HE1  1  
ATOM 401   H HE2  . HIS A 1 35  ? -4.657  19.713  98.971  1.00 0.00 ?  26  HIS A HE2  1  
ATOM 402   N N    . SER A 1 36  ? 2.072   22.433  101.461 1.00 0.00 ?  27  SER A N    1  
ATOM 403   C CA   . SER A 1 36  ? 3.120   23.386  101.812 1.00 0.00 ?  27  SER A CA   1  
ATOM 404   C C    . SER A 1 36  ? 4.594   22.857  101.704 1.00 0.00 ?  27  SER A C    1  
ATOM 405   O O    . SER A 1 36  ? 5.470   23.552  101.227 1.00 0.00 ?  27  SER A O    1  
ATOM 406   C CB   . SER A 1 36  ? 2.894   24.178  103.084 1.00 0.00 ?  27  SER A CB   1  
ATOM 407   O OG   . SER A 1 36  ? 3.107   23.285  104.085 1.00 0.00 ?  27  SER A OG   1  
ATOM 408   H H    . SER A 1 36  ? 1.464   22.294  102.256 1.00 0.00 ?  27  SER A H    1  
ATOM 409   H HA   . SER A 1 36  ? 3.138   24.126  101.012 1.00 0.00 ?  27  SER A HA   1  
ATOM 410   H HB2  . SER A 1 36  ? 3.663   24.947  103.150 1.00 0.00 ?  27  SER A HB2  1  
ATOM 411   H HB3  . SER A 1 36  ? 1.923   24.673  103.124 1.00 0.00 ?  27  SER A HB3  1  
ATOM 412   H HG   . SER A 1 36  ? 2.228   22.906  104.143 1.00 0.00 ?  27  SER A HG   1  
ATOM 413   N N    . ASN A 1 37  ? 4.771   21.616  102.006 1.00 0.00 ?  28  ASN A N    1  
ATOM 414   C CA   . ASN A 1 37  ? 5.990   20.880  101.745 1.00 0.00 ?  28  ASN A CA   1  
ATOM 415   C C    . ASN A 1 37  ? 6.164   20.569  100.242 1.00 0.00 ?  28  ASN A C    1  
ATOM 416   O O    . ASN A 1 37  ? 7.200   20.954  99.638  1.00 0.00 ?  28  ASN A O    1  
ATOM 417   C CB   . ASN A 1 37  ? 6.146   19.647  102.721 1.00 0.00 ?  28  ASN A CB   1  
ATOM 418   C CG   . ASN A 1 37  ? 6.829   19.830  104.040 1.00 0.00 ?  28  ASN A CG   1  
ATOM 419   O OD1  . ASN A 1 37  ? 8.017   19.592  104.179 1.00 0.00 ?  28  ASN A OD1  1  
ATOM 420   N ND2  . ASN A 1 37  ? 6.040   20.260  105.077 1.00 0.00 ?  28  ASN A ND2  1  
ATOM 421   H H    . ASN A 1 37  ? 3.936   21.123  102.290 1.00 0.00 ?  28  ASN A H    1  
ATOM 422   H HA   . ASN A 1 37  ? 6.839   21.490  102.053 1.00 0.00 ?  28  ASN A HA   1  
ATOM 423   H HB2  . ASN A 1 37  ? 5.174   19.170  102.843 1.00 0.00 ?  28  ASN A HB2  1  
ATOM 424   H HB3  . ASN A 1 37  ? 6.739   18.943  102.135 1.00 0.00 ?  28  ASN A HB3  1  
ATOM 425   H HD21 . ASN A 1 37  ? 5.083   20.443  104.809 1.00 0.00 ?  28  ASN A HD21 1  
ATOM 426   H HD22 . ASN A 1 37  ? 6.506   20.490  105.943 1.00 0.00 ?  28  ASN A HD22 1  
ATOM 427   N N    . LEU A 1 38  ? 5.194   19.931  99.549  1.00 0.00 ?  29  LEU A N    1  
ATOM 428   C CA   . LEU A 1 38  ? 5.241   19.501  98.189  1.00 0.00 ?  29  LEU A CA   1  
ATOM 429   C C    . LEU A 1 38  ? 5.549   20.569  97.153  1.00 0.00 ?  29  LEU A C    1  
ATOM 430   O O    . LEU A 1 38  ? 6.218   20.291  96.158  1.00 0.00 ?  29  LEU A O    1  
ATOM 431   C CB   . LEU A 1 38  ? 3.807   18.945  97.868  1.00 0.00 ?  29  LEU A CB   1  
ATOM 432   C CG   . LEU A 1 38  ? 3.344   18.862  96.366  1.00 0.00 ?  29  LEU A CG   1  
ATOM 433   C CD1  . LEU A 1 38  ? 3.337   17.366  95.897  1.00 0.00 ?  29  LEU A CD1  1  
ATOM 434   C CD2  . LEU A 1 38  ? 2.017   19.500  96.120  1.00 0.00 ?  29  LEU A CD2  1  
ATOM 435   H H    . LEU A 1 38  ? 4.317   19.795  100.032 1.00 0.00 ?  29  LEU A H    1  
ATOM 436   H HA   . LEU A 1 38  ? 5.969   18.691  98.141  1.00 0.00 ?  29  LEU A HA   1  
ATOM 437   H HB2  . LEU A 1 38  ? 3.488   17.968  98.231  1.00 0.00 ?  29  LEU A HB2  1  
ATOM 438   H HB3  . LEU A 1 38  ? 3.096   19.652  98.295  1.00 0.00 ?  29  LEU A HB3  1  
ATOM 439   H HG   . LEU A 1 38  ? 4.088   19.336  95.726  1.00 0.00 ?  29  LEU A HG   1  
ATOM 440   H HD11 . LEU A 1 38  ? 2.634   16.704  96.402  1.00 0.00 ?  29  LEU A HD11 1  
ATOM 441   H HD12 . LEU A 1 38  ? 3.069   17.363  94.841  1.00 0.00 ?  29  LEU A HD12 1  
ATOM 442   H HD13 . LEU A 1 38  ? 4.264   16.833  96.114  1.00 0.00 ?  29  LEU A HD13 1  
ATOM 443   H HD21 . LEU A 1 38  ? 1.261   19.105  96.799  1.00 0.00 ?  29  LEU A HD21 1  
ATOM 444   H HD22 . LEU A 1 38  ? 2.054   20.589  96.128  1.00 0.00 ?  29  LEU A HD22 1  
ATOM 445   H HD23 . LEU A 1 38  ? 1.733   19.182  95.117  1.00 0.00 ?  29  LEU A HD23 1  
ATOM 446   N N    . LEU A 1 39  ? 5.261   21.870  97.393  1.00 0.00 ?  30  LEU A N    1  
ATOM 447   C CA   . LEU A 1 39  ? 5.481   23.002  96.418  1.00 0.00 ?  30  LEU A CA   1  
ATOM 448   C C    . LEU A 1 39  ? 6.915   23.450  96.251  1.00 0.00 ?  30  LEU A C    1  
ATOM 449   O O    . LEU A 1 39  ? 7.198   24.216  95.304  1.00 0.00 ?  30  LEU A O    1  
ATOM 450   C CB   . LEU A 1 39  ? 4.635   24.223  96.899  1.00 0.00 ?  30  LEU A CB   1  
ATOM 451   C CG   . LEU A 1 39  ? 3.121   24.116  96.699  1.00 0.00 ?  30  LEU A CG   1  
ATOM 452   C CD1  . LEU A 1 39  ? 2.279   24.772  97.694  1.00 0.00 ?  30  LEU A CD1  1  
ATOM 453   C CD2  . LEU A 1 39  ? 2.806   24.655  95.353  1.00 0.00 ?  30  LEU A CD2  1  
ATOM 454   H H    . LEU A 1 39  ? 4.782   21.961  98.278  1.00 0.00 ?  30  LEU A H    1  
ATOM 455   H HA   . LEU A 1 39  ? 5.028   22.658  95.489  1.00 0.00 ?  30  LEU A HA   1  
ATOM 456   H HB2  . LEU A 1 39  ? 4.962   24.509  97.899  1.00 0.00 ?  30  LEU A HB2  1  
ATOM 457   H HB3  . LEU A 1 39  ? 5.021   25.142  96.456  1.00 0.00 ?  30  LEU A HB3  1  
ATOM 458   H HG   . LEU A 1 39  ? 2.889   23.051  96.653  1.00 0.00 ?  30  LEU A HG   1  
ATOM 459   H HD11 . LEU A 1 39  ? 2.372   25.840  97.501  1.00 0.00 ?  30  LEU A HD11 1  
ATOM 460   H HD12 . LEU A 1 39  ? 1.279   24.342  97.641  1.00 0.00 ?  30  LEU A HD12 1  
ATOM 461   H HD13 . LEU A 1 39  ? 2.588   24.602  98.726  1.00 0.00 ?  30  LEU A HD13 1  
ATOM 462   H HD21 . LEU A 1 39  ? 2.921   25.735  95.440  1.00 0.00 ?  30  LEU A HD21 1  
ATOM 463   H HD22 . LEU A 1 39  ? 3.507   24.243  94.628  1.00 0.00 ?  30  LEU A HD22 1  
ATOM 464   H HD23 . LEU A 1 39  ? 1.801   24.347  95.060  1.00 0.00 ?  30  LEU A HD23 1  
ATOM 465   N N    . CYS A 1 40  ? 7.795   22.927  97.113  1.00 0.00 ?  31  CYS A N    1  
ATOM 466   C CA   . CYS A 1 40  ? 9.283   23.029  96.910  1.00 0.00 ?  31  CYS A CA   1  
ATOM 467   C C    . CYS A 1 40  ? 9.964   24.417  96.874  1.00 0.00 ?  31  CYS A C    1  
ATOM 468   O O    . CYS A 1 40  ? 10.905  24.649  96.088  1.00 0.00 ?  31  CYS A O    1  
ATOM 469   C CB   . CYS A 1 40  ? 9.633   21.938  95.871  1.00 0.00 ?  31  CYS A CB   1  
ATOM 470   S SG   . CYS A 1 40  ? 9.454   20.323  96.553  1.00 0.00 ?  31  CYS A SG   1  
ATOM 471   H H    . CYS A 1 40  ? 7.494   22.210  97.758  1.00 0.00 ?  31  CYS A H    1  
ATOM 472   H HA   . CYS A 1 40  ? 9.740   22.594  97.799  1.00 0.00 ?  31  CYS A HA   1  
ATOM 473   H HB2  . CYS A 1 40  ? 8.928   22.158  95.070  1.00 0.00 ?  31  CYS A HB2  1  
ATOM 474   H HB3  . CYS A 1 40  ? 10.626  22.088  95.447  1.00 0.00 ?  31  CYS A HB3  1  
ATOM 475   H HG   . CYS A 1 40  ? 8.137   20.425  96.754  1.00 0.00 ?  31  CYS A HG   1  
ATOM 476   N N    . ARG A 1 41  ? 9.632   25.314  97.759  1.00 0.00 ?  32  ARG A N    1  
ATOM 477   C CA   . ARG A 1 41  ? 10.272  26.653  97.889  1.00 0.00 ?  32  ARG A CA   1  
ATOM 478   C C    . ARG A 1 41  ? 11.694  26.439  98.259  1.00 0.00 ?  32  ARG A C    1  
ATOM 479   O O    . ARG A 1 41  ? 11.969  25.688  99.216  1.00 0.00 ?  32  ARG A O    1  
ATOM 480   C CB   . ARG A 1 41  ? 9.544   27.521  98.936  1.00 0.00 ?  32  ARG A CB   1  
ATOM 481   C CG   . ARG A 1 41  ? 9.555   27.003  100.347 1.00 0.00 ?  32  ARG A CG   1  
ATOM 482   C CD   . ARG A 1 41  ? 10.560  27.660  101.291 1.00 0.00 ?  32  ARG A CD   1  
ATOM 483   N NE   . ARG A 1 41  ? 10.650  26.939  102.591 1.00 0.00 ?  32  ARG A NE   1  
ATOM 484   C CZ   . ARG A 1 41  ? 11.563  26.041  102.955 1.00 0.00 ?  32  ARG A CZ   1  
ATOM 485   N NH1  . ARG A 1 41  ? 12.346  25.392  102.147 1.00 0.00 ?  32  ARG A NH1  1  
ATOM 486   N NH2  . ARG A 1 41  ? 11.591  25.767  104.246 1.00 0.00 1  32  ARG A NH2  1  
ATOM 487   H H    . ARG A 1 41  ? 8.982   25.058  98.489  1.00 0.00 ?  32  ARG A H    1  
ATOM 488   H HA   . ARG A 1 41  ? 10.196  27.169  96.932  1.00 0.00 ?  32  ARG A HA   1  
ATOM 489   H HB2  . ARG A 1 41  ? 10.110  28.453  98.944  1.00 0.00 ?  32  ARG A HB2  1  
ATOM 490   H HB3  . ARG A 1 41  ? 8.532   27.864  98.723  1.00 0.00 ?  32  ARG A HB3  1  
ATOM 491   H HG2  . ARG A 1 41  ? 8.539   27.109  100.728 1.00 0.00 ?  32  ARG A HG2  1  
ATOM 492   H HG3  . ARG A 1 41  ? 9.766   25.943  100.484 1.00 0.00 ?  32  ARG A HG3  1  
ATOM 493   H HD2  . ARG A 1 41  ? 11.543  27.637  100.819 1.00 0.00 ?  32  ARG A HD2  1  
ATOM 494   H HD3  . ARG A 1 41  ? 10.465  28.734  101.454 1.00 0.00 ?  32  ARG A HD3  1  
ATOM 495   H HE   . ARG A 1 41  ? 10.128  27.307  103.374 1.00 0.00 ?  32  ARG A HE   1  
ATOM 496   H HH11 . ARG A 1 41  ? 12.238  25.551  101.156 1.00 0.00 ?  32  ARG A HH11 1  
ATOM 497   H HH12 . ARG A 1 41  ? 12.749  24.556  102.547 1.00 0.00 ?  32  ARG A HH12 1  
ATOM 498   H HH21 . ARG A 1 41  ? 10.966  26.367  104.765 1.00 0.00 ?  32  ARG A HH21 1  
ATOM 499   H HH22 . ARG A 1 41  ? 12.371  25.198  104.539 1.00 0.00 ?  32  ARG A HH22 1  
ATOM 500   N N    . PRO A 1 42  ? 12.609  27.231  97.599  1.00 0.00 ?  33  PRO A N    1  
ATOM 501   C CA   . PRO A 1 42  ? 14.041  27.189  98.066  1.00 0.00 ?  33  PRO A CA   1  
ATOM 502   C C    . PRO A 1 42  ? 14.180  27.714  99.464  1.00 0.00 ?  33  PRO A C    1  
ATOM 503   O O    . PRO A 1 42  ? 13.624  28.788  99.781  1.00 0.00 ?  33  PRO A O    1  
ATOM 504   C CB   . PRO A 1 42  ? 14.764  27.993  96.933  1.00 0.00 ?  33  PRO A CB   1  
ATOM 505   C CG   . PRO A 1 42  ? 13.951  27.733  95.661  1.00 0.00 ?  33  PRO A CG   1  
ATOM 506   C CD   . PRO A 1 42  ? 12.470  27.734  96.216  1.00 0.00 ?  33  PRO A CD   1  
ATOM 507   H HA   . PRO A 1 42  ? 14.312  26.133  98.086  1.00 0.00 ?  33  PRO A HA   1  
ATOM 508   H HB2  . PRO A 1 42  ? 14.753  29.068  97.116  1.00 0.00 ?  33  PRO A HB2  1  
ATOM 509   H HB3  . PRO A 1 42  ? 15.768  27.567  96.933  1.00 0.00 ?  33  PRO A HB3  1  
ATOM 510   H HG2  . PRO A 1 42  ? 14.113  28.602  95.024  1.00 0.00 ?  33  PRO A HG2  1  
ATOM 511   H HG3  . PRO A 1 42  ? 14.227  26.805  95.158  1.00 0.00 ?  33  PRO A HG3  1  
ATOM 512   H HD2  . PRO A 1 42  ? 12.188  28.784  96.297  1.00 0.00 ?  33  PRO A HD2  1  
ATOM 513   H HD3  . PRO A 1 42  ? 11.913  27.191  95.453  1.00 0.00 ?  33  PRO A HD3  1  
ATOM 514   N N    . GLY A 1 43  ? 15.039  27.162  100.301 1.00 0.00 ?  34  GLY A N    1  
ATOM 515   C CA   . GLY A 1 43  ? 15.057  27.537  101.699 1.00 0.00 ?  34  GLY A CA   1  
ATOM 516   C C    . GLY A 1 43  ? 15.823  28.856  101.984 1.00 0.00 ?  34  GLY A C    1  
ATOM 517   O O    . GLY A 1 43  ? 16.629  29.337  101.176 1.00 0.00 ?  34  GLY A O    1  
ATOM 518   H H    . GLY A 1 43  ? 15.521  26.341  99.963  1.00 0.00 ?  34  GLY A H    1  
ATOM 519   H HA2  . GLY A 1 43  ? 14.037  27.693  102.050 1.00 0.00 ?  34  GLY A HA2  1  
ATOM 520   H HA3  . GLY A 1 43  ? 15.428  26.693  102.280 1.00 0.00 ?  34  GLY A HA3  1  
ATOM 521   N N    . PRO A 1 44  ? 15.646  29.455  103.171 1.00 0.00 ?  35  PRO A N    1  
ATOM 522   C CA   . PRO A 1 44  ? 16.462  30.586  103.603 1.00 0.00 ?  35  PRO A CA   1  
ATOM 523   C C    . PRO A 1 44  ? 17.953  30.462  103.802 1.00 0.00 ?  35  PRO A C    1  
ATOM 524   O O    . PRO A 1 44  ? 18.477  29.468  104.326 1.00 0.00 ?  35  PRO A O    1  
ATOM 525   C CB   . PRO A 1 44  ? 15.955  30.949  105.007 1.00 0.00 ?  35  PRO A CB   1  
ATOM 526   C CG   . PRO A 1 44  ? 14.496  30.679  104.908 1.00 0.00 ?  35  PRO A CG   1  
ATOM 527   C CD   . PRO A 1 44  ? 14.560  29.316  104.083 1.00 0.00 ?  35  PRO A CD   1  
ATOM 528   H HA   . PRO A 1 44  ? 16.151  31.313  102.854 1.00 0.00 ?  35  PRO A HA   1  
ATOM 529   H HB2  . PRO A 1 44  ? 16.439  30.299  105.735 1.00 0.00 ?  35  PRO A HB2  1  
ATOM 530   H HB3  . PRO A 1 44  ? 16.164  31.983  105.281 1.00 0.00 ?  35  PRO A HB3  1  
ATOM 531   H HG2  . PRO A 1 44  ? 14.037  30.564  105.891 1.00 0.00 ?  35  PRO A HG2  1  
ATOM 532   H HG3  . PRO A 1 44  ? 14.177  31.492  104.257 1.00 0.00 ?  35  PRO A HG3  1  
ATOM 533   H HD2  . PRO A 1 44  ? 14.959  28.446  104.605 1.00 0.00 ?  35  PRO A HD2  1  
ATOM 534   H HD3  . PRO A 1 44  ? 13.558  29.162  103.684 1.00 0.00 ?  35  PRO A HD3  1  
ATOM 535   N N    . GLY A 1 45  ? 18.636  31.491  103.396 1.00 0.00 ?  36  GLY A N    1  
ATOM 536   C CA   . GLY A 1 45  ? 20.106  31.472  103.282 1.00 0.00 ?  36  GLY A CA   1  
ATOM 537   C C    . GLY A 1 45  ? 20.629  30.893  101.932 1.00 0.00 ?  36  GLY A C    1  
ATOM 538   O O    . GLY A 1 45  ? 21.681  30.267  101.903 1.00 0.00 ?  36  GLY A O    1  
ATOM 539   H H    . GLY A 1 45  ? 18.108  32.237  102.967 1.00 0.00 ?  36  GLY A H    1  
ATOM 540   H HA2  . GLY A 1 45  ? 20.528  32.472  103.387 1.00 0.00 ?  36  GLY A HA2  1  
ATOM 541   H HA3  . GLY A 1 45  ? 20.388  30.792  104.086 1.00 0.00 ?  36  GLY A HA3  1  
ATOM 542   N N    . LEU A 1 46  ? 19.931  31.261  100.824 1.00 0.00 ?  37  LEU A N    1  
ATOM 543   C CA   . LEU A 1 46  ? 20.411  30.983  99.419  1.00 0.00 ?  37  LEU A CA   1  
ATOM 544   C C    . LEU A 1 46  ? 21.475  31.962  98.973  1.00 0.00 ?  37  LEU A C    1  
ATOM 545   O O    . LEU A 1 46  ? 22.446  31.545  98.424  1.00 0.00 ?  37  LEU A O    1  
ATOM 546   C CB   . LEU A 1 46  ? 19.095  31.055  98.563  1.00 0.00 ?  37  LEU A CB   1  
ATOM 547   C CG   . LEU A 1 46  ? 19.301  30.902  97.034  1.00 0.00 ?  37  LEU A CG   1  
ATOM 548   C CD1  . LEU A 1 46  ? 20.021  29.575  96.690  1.00 0.00 ?  37  LEU A CD1  1  
ATOM 549   C CD2  . LEU A 1 46  ? 18.044  30.958  96.220  1.00 0.00 ?  37  LEU A CD2  1  
ATOM 550   H H    . LEU A 1 46  ? 19.148  31.871  101.014 1.00 0.00 ?  37  LEU A H    1  
ATOM 551   H HA   . LEU A 1 46  ? 20.940  30.031  99.360  1.00 0.00 ?  37  LEU A HA   1  
ATOM 552   H HB2  . LEU A 1 46  ? 18.507  30.160  98.765  1.00 0.00 ?  37  LEU A HB2  1  
ATOM 553   H HB3  . LEU A 1 46  ? 18.560  31.989  98.738  1.00 0.00 ?  37  LEU A HB3  1  
ATOM 554   H HG   . LEU A 1 46  ? 19.890  31.743  96.666  1.00 0.00 ?  37  LEU A HG   1  
ATOM 555   H HD11 . LEU A 1 46  ? 20.276  29.656  95.633  1.00 0.00 ?  37  LEU A HD11 1  
ATOM 556   H HD12 . LEU A 1 46  ? 20.937  29.433  97.263  1.00 0.00 ?  37  LEU A HD12 1  
ATOM 557   H HD13 . LEU A 1 46  ? 19.309  28.781  96.919  1.00 0.00 ?  37  LEU A HD13 1  
ATOM 558   H HD21 . LEU A 1 46  ? 17.432  30.096  96.487  1.00 0.00 ?  37  LEU A HD21 1  
ATOM 559   H HD22 . LEU A 1 46  ? 17.501  31.894  96.360  1.00 0.00 ?  37  LEU A HD22 1  
ATOM 560   H HD23 . LEU A 1 46  ? 18.319  30.906  95.167  1.00 0.00 ?  37  LEU A HD23 1  
ATOM 561   N N    . GLY A 1 47  ? 21.355  33.264  99.361  1.00 0.00 ?  38  GLY A N    1  
ATOM 562   C CA   . GLY A 1 47  ? 22.446  34.209  99.350  1.00 0.00 ?  38  GLY A CA   1  
ATOM 563   C C    . GLY A 1 47  ? 23.078  34.298  100.724 1.00 0.00 ?  38  GLY A C    1  
ATOM 564   O O    . GLY A 1 47  ? 22.580  33.765  101.713 1.00 0.00 ?  38  GLY A O    1  
ATOM 565   H H    . GLY A 1 47  ? 20.523  33.533  99.869  1.00 0.00 ?  38  GLY A H    1  
ATOM 566   H HA2  . GLY A 1 47  ? 23.123  33.854  98.573  1.00 0.00 ?  38  GLY A HA2  1  
ATOM 567   H HA3  . GLY A 1 47  ? 22.096  35.192  99.034  1.00 0.00 ?  38  GLY A HA3  1  
ATOM 568   N N    . PRO A 1 48  ? 24.125  35.049  100.821 1.00 0.00 ?  39  PRO A N    1  
ATOM 569   C CA   . PRO A 1 48  ? 24.805  35.258  102.084 1.00 0.00 ?  39  PRO A CA   1  
ATOM 570   C C    . PRO A 1 48  ? 23.877  35.906  103.120 1.00 0.00 ?  39  PRO A C    1  
ATOM 571   O O    . PRO A 1 48  ? 23.261  36.962  102.880 1.00 0.00 ?  39  PRO A O    1  
ATOM 572   C CB   . PRO A 1 48  ? 25.986  36.143  101.753 1.00 0.00 ?  39  PRO A CB   1  
ATOM 573   C CG   . PRO A 1 48  ? 26.213  36.159  100.237 1.00 0.00 ?  39  PRO A CG   1  
ATOM 574   C CD   . PRO A 1 48  ? 24.851  35.754  99.740  1.00 0.00 ?  39  PRO A CD   1  
ATOM 575   H HA   . PRO A 1 48  ? 25.165  34.293  102.439 1.00 0.00 ?  39  PRO A HA   1  
ATOM 576   H HB2  . PRO A 1 48  ? 25.891  37.205  101.979 1.00 0.00 ?  39  PRO A HB2  1  
ATOM 577   H HB3  . PRO A 1 48  ? 26.806  35.733  102.343 1.00 0.00 ?  39  PRO A HB3  1  
ATOM 578   H HG2  . PRO A 1 48  ? 26.497  37.159  99.908  1.00 0.00 ?  39  PRO A HG2  1  
ATOM 579   H HG3  . PRO A 1 48  ? 26.950  35.385  100.026 1.00 0.00 ?  39  PRO A HG3  1  
ATOM 580   H HD2  . PRO A 1 48  ? 24.219  36.625  99.560  1.00 0.00 ?  39  PRO A HD2  1  
ATOM 581   H HD3  . PRO A 1 48  ? 25.076  35.150  98.861  1.00 0.00 ?  39  PRO A HD3  1  
ATOM 582   N N    . ASP A 1 49  ? 23.833  35.409  104.343 1.00 0.00 ?  40  ASP A N    1  
ATOM 583   C CA   . ASP A 1 49  ? 23.082  36.111  105.479 1.00 0.00 ?  40  ASP A CA   1  
ATOM 584   C C    . ASP A 1 49  ? 23.705  37.440  105.939 1.00 0.00 ?  40  ASP A C    1  
ATOM 585   O O    . ASP A 1 49  ? 22.976  38.354  106.340 1.00 0.00 ?  40  ASP A O    1  
ATOM 586   C CB   . ASP A 1 49  ? 22.620  35.233  106.613 1.00 0.00 ?  40  ASP A CB   1  
ATOM 587   C CG   . ASP A 1 49  ? 23.572  34.234  107.304 1.00 0.00 ?  40  ASP A CG   1  
ATOM 588   O OD1  . ASP A 1 49  ? 24.844  34.404  107.116 1.00 0.00 ?  40  ASP A OD1  1  
ATOM 589   O OD2  . ASP A 1 49  ? 23.122  33.383  108.030 1.00 0.00 -1 40  ASP A OD2  1  
ATOM 590   H H    . ASP A 1 49  ? 24.524  34.710  104.576 1.00 0.00 ?  40  ASP A H    1  
ATOM 591   H HA   . ASP A 1 49  ? 22.081  36.363  105.130 1.00 0.00 ?  40  ASP A HA   1  
ATOM 592   H HB2  . ASP A 1 49  ? 22.265  35.785  107.484 1.00 0.00 ?  40  ASP A HB2  1  
ATOM 593   H HB3  . ASP A 1 49  ? 21.743  34.688  106.262 1.00 0.00 ?  40  ASP A HB3  1  
ATOM 594   N N    . ASN A 1 50  ? 25.038  37.548  105.797 1.00 0.00 ?  41  ASN A N    1  
ATOM 595   C CA   . ASN A 1 50  ? 25.651  38.875  105.749 1.00 0.00 ?  41  ASN A CA   1  
ATOM 596   C C    . ASN A 1 50  ? 25.381  39.721  104.437 1.00 0.00 ?  41  ASN A C    1  
ATOM 597   O O    . ASN A 1 50  ? 26.072  40.735  104.312 1.00 0.00 ?  41  ASN A O    1  
ATOM 598   C CB   . ASN A 1 50  ? 27.184  38.658  106.097 1.00 0.00 ?  41  ASN A CB   1  
ATOM 599   C CG   . ASN A 1 50  ? 27.907  38.042  104.844 1.00 0.00 ?  41  ASN A CG   1  
ATOM 600   O OD1  . ASN A 1 50  ? 27.423  37.805  103.726 1.00 0.00 ?  41  ASN A OD1  1  
ATOM 601   N ND2  . ASN A 1 50  ? 29.185  37.787  105.037 1.00 0.00 ?  41  ASN A ND2  1  
ATOM 602   H H    . ASN A 1 50  ? 25.462  36.791  105.280 1.00 0.00 ?  41  ASN A H    1  
ATOM 603   H HA   . ASN A 1 50  ? 25.184  39.473  106.531 1.00 0.00 ?  41  ASN A HA   1  
ATOM 604   H HB2  . ASN A 1 50  ? 27.581  39.621  106.420 1.00 0.00 ?  41  ASN A HB2  1  
ATOM 605   H HB3  . ASN A 1 50  ? 27.335  37.979  106.936 1.00 0.00 ?  41  ASN A HB3  1  
ATOM 606   H HD21 . ASN A 1 50  ? 29.561  37.990  105.952 1.00 0.00 ?  41  ASN A HD21 1  
ATOM 607   H HD22 . ASN A 1 50  ? 29.716  37.441  104.251 1.00 0.00 ?  41  ASN A HD22 1  
ATOM 608   N N    . GLN A 1 51  ? 24.502  39.361  103.436 1.00 0.00 ?  42  GLN A N    1  
ATOM 609   C CA   . GLN A 1 51  ? 24.239  40.238  102.294 1.00 0.00 ?  42  GLN A CA   1  
ATOM 610   C C    . GLN A 1 51  ? 23.498  41.555  102.563 1.00 0.00 ?  42  GLN A C    1  
ATOM 611   O O    . GLN A 1 51  ? 22.243  41.621  102.707 1.00 0.00 ?  42  GLN A O    1  
ATOM 612   C CB   . GLN A 1 51  ? 23.520  39.543  101.194 1.00 0.00 ?  42  GLN A CB   1  
ATOM 613   C CG   . GLN A 1 51  ? 23.254  40.384  99.921  1.00 0.00 ?  42  GLN A CG   1  
ATOM 614   C CD   . GLN A 1 51  ? 22.895  39.429  98.791  1.00 0.00 ?  42  GLN A CD   1  
ATOM 615   O OE1  . GLN A 1 51  ? 21.776  38.985  98.710  1.00 0.00 ?  42  GLN A OE1  1  
ATOM 616   N NE2  . GLN A 1 51  ? 23.857  38.803  98.180  1.00 0.00 ?  42  GLN A NE2  1  
ATOM 617   H H    . GLN A 1 51  ? 24.175  38.405  103.436 1.00 0.00 ?  42  GLN A H    1  
ATOM 618   H HA   . GLN A 1 51  ? 25.192  40.480  101.823 1.00 0.00 ?  42  GLN A HA   1  
ATOM 619   H HB2  . GLN A 1 51  ? 24.042  38.605  101.008 1.00 0.00 ?  42  GLN A HB2  1  
ATOM 620   H HB3  . GLN A 1 51  ? 22.552  39.218  101.576 1.00 0.00 ?  42  GLN A HB3  1  
ATOM 621   H HG2  . GLN A 1 51  ? 22.401  41.029  100.133 1.00 0.00 ?  42  GLN A HG2  1  
ATOM 622   H HG3  . GLN A 1 51  ? 24.145  40.977  99.712  1.00 0.00 ?  42  GLN A HG3  1  
ATOM 623   H HE21 . GLN A 1 51  ? 24.809  39.139  98.179  1.00 0.00 ?  42  GLN A HE21 1  
ATOM 624   H HE22 . GLN A 1 51  ? 23.569  37.986  97.661  1.00 0.00 ?  42  GLN A HE22 1  
ATOM 625   N N    . THR A 1 52  ? 24.267  42.624  102.894 1.00 0.00 ?  43  THR A N    1  
ATOM 626   C CA   . THR A 1 52  ? 23.603  43.879  103.443 1.00 0.00 ?  43  THR A CA   1  
ATOM 627   C C    . THR A 1 52  ? 22.679  44.533  102.411 1.00 0.00 ?  43  THR A C    1  
ATOM 628   O O    . THR A 1 52  ? 22.905  44.522  101.202 1.00 0.00 ?  43  THR A O    1  
ATOM 629   C CB   . THR A 1 52  ? 24.677  44.814  104.063 1.00 0.00 ?  43  THR A CB   1  
ATOM 630   O OG1  . THR A 1 52  ? 25.559  43.959  104.839 1.00 0.00 ?  43  THR A OG1  1  
ATOM 631   C CG2  . THR A 1 52  ? 24.175  45.923  105.005 1.00 0.00 ?  43  THR A CG2  1  
ATOM 632   H H    . THR A 1 52  ? 25.269  42.519  102.959 1.00 0.00 ?  43  THR A H    1  
ATOM 633   H HA   . THR A 1 52  ? 22.990  43.483  104.252 1.00 0.00 ?  43  THR A HA   1  
ATOM 634   H HB   . THR A 1 52  ? 25.425  45.174  103.357 1.00 0.00 ?  43  THR A HB   1  
ATOM 635   H HG1  . THR A 1 52  ? 26.385  44.413  105.020 1.00 0.00 ?  43  THR A HG1  1  
ATOM 636   H HG21 . THR A 1 52  ? 25.111  46.389  105.311 1.00 0.00 ?  43  THR A HG21 1  
ATOM 637   H HG22 . THR A 1 52  ? 23.526  46.617  104.472 1.00 0.00 ?  43  THR A HG22 1  
ATOM 638   H HG23 . THR A 1 52  ? 23.728  45.495  105.903 1.00 0.00 ?  43  THR A HG23 1  
ATOM 639   N N    . GLU A 1 53  ? 21.607  45.245  102.825 1.00 0.00 ?  44  GLU A N    1  
ATOM 640   C CA   . GLU A 1 53  ? 20.997  46.378  102.002 1.00 0.00 ?  44  GLU A CA   1  
ATOM 641   C C    . GLU A 1 53  ? 22.031  47.202  101.178 1.00 0.00 ?  44  GLU A C    1  
ATOM 642   O O    . GLU A 1 53  ? 23.062  47.610  101.700 1.00 0.00 ?  44  GLU A O    1  
ATOM 643   C CB   . GLU A 1 53  ? 20.137  47.204  102.976 1.00 0.00 ?  44  GLU A CB   1  
ATOM 644   C CG   . GLU A 1 53  ? 20.770  47.825  104.222 1.00 0.00 ?  44  GLU A CG   1  
ATOM 645   C CD   . GLU A 1 53  ? 19.815  48.516  105.161 1.00 0.00 ?  44  GLU A CD   1  
ATOM 646   O OE1  . GLU A 1 53  ? 18.590  48.342  104.975 1.00 0.00 ?  44  GLU A OE1  1  
ATOM 647   O OE2  . GLU A 1 53  ? 20.173  49.047  106.217 1.00 0.00 -1 44  GLU A OE2  1  
ATOM 648   H H    . GLU A 1 53  ? 21.522  45.357  103.825 1.00 0.00 ?  44  GLU A H    1  
ATOM 649   H HA   . GLU A 1 53  ? 20.387  45.933  101.216 1.00 0.00 ?  44  GLU A HA   1  
ATOM 650   H HB2  . GLU A 1 53  ? 19.767  48.016  102.351 1.00 0.00 ?  44  GLU A HB2  1  
ATOM 651   H HB3  . GLU A 1 53  ? 19.316  46.600  103.363 1.00 0.00 ?  44  GLU A HB3  1  
ATOM 652   H HG2  . GLU A 1 53  ? 21.335  47.042  104.727 1.00 0.00 ?  44  GLU A HG2  1  
ATOM 653   H HG3  . GLU A 1 53  ? 21.516  48.582  103.980 1.00 0.00 ?  44  GLU A HG3  1  
ATOM 654   N N    . GLU A 1 54  ? 21.671  47.586  99.939  1.00 0.00 ?  45  GLU A N    1  
ATOM 655   C CA   . GLU A 1 54  ? 22.413  48.534  99.069  1.00 0.00 ?  45  GLU A CA   1  
ATOM 656   C C    . GLU A 1 54  ? 21.615  49.768  98.555  1.00 0.00 ?  45  GLU A C    1  
ATOM 657   O O    . GLU A 1 54  ? 20.469  49.957  99.002  1.00 0.00 ?  45  GLU A O    1  
ATOM 658   C CB   . GLU A 1 54  ? 22.912  47.738  97.880  1.00 0.00 ?  45  GLU A CB   1  
ATOM 659   C CG   . GLU A 1 54  ? 23.727  46.539  98.276  1.00 0.00 ?  45  GLU A CG   1  
ATOM 660   C CD   . GLU A 1 54  ? 25.184  46.940  98.589  1.00 0.00 ?  45  GLU A CD   1  
ATOM 661   O OE1  . GLU A 1 54  ? 25.511  48.141  98.776  1.00 0.00 ?  45  GLU A OE1  1  
ATOM 662   O OE2  . GLU A 1 54  ? 25.984  46.017  98.834  1.00 0.00 -1 45  GLU A OE2  1  
ATOM 663   H H    . GLU A 1 54  ? 20.734  47.386  99.621  1.00 0.00 ?  45  GLU A H    1  
ATOM 664   H HA   . GLU A 1 54  ? 23.288  48.929  99.586  1.00 0.00 ?  45  GLU A HA   1  
ATOM 665   H HB2  . GLU A 1 54  ? 22.111  47.443  97.202  1.00 0.00 ?  45  GLU A HB2  1  
ATOM 666   H HB3  . GLU A 1 54  ? 23.542  48.446  97.340  1.00 0.00 ?  45  GLU A HB3  1  
ATOM 667   H HG2  . GLU A 1 54  ? 23.417  46.018  99.181  1.00 0.00 ?  45  GLU A HG2  1  
ATOM 668   H HG3  . GLU A 1 54  ? 23.783  45.774  97.502  1.00 0.00 ?  45  GLU A HG3  1  
ATOM 669   N N    . ARG A 1 55  ? 22.259  50.631  97.814  1.00 0.00 ?  46  ARG A N    1  
ATOM 670   C CA   . ARG A 1 55  ? 21.697  51.740  96.982  1.00 0.00 ?  46  ARG A CA   1  
ATOM 671   C C    . ARG A 1 55  ? 21.686  51.343  95.538  1.00 0.00 ?  46  ARG A C    1  
ATOM 672   O O    . ARG A 1 55  ? 22.429  50.424  95.162  1.00 0.00 ?  46  ARG A O    1  
ATOM 673   C CB   . ARG A 1 55  ? 22.381  53.023  97.441  1.00 0.00 ?  46  ARG A CB   1  
ATOM 674   C CG   . ARG A 1 55  ? 21.937  54.345  96.741  1.00 0.00 ?  46  ARG A CG   1  
ATOM 675   C CD   . ARG A 1 55  ? 22.684  55.515  97.334  1.00 0.00 ?  46  ARG A CD   1  
ATOM 676   N NE   . ARG A 1 55  ? 22.090  56.793  96.762  1.00 0.00 ?  46  ARG A NE   1  
ATOM 677   C CZ   . ARG A 1 55  ? 22.641  57.688  95.958  1.00 0.00 ?  46  ARG A CZ   1  
ATOM 678   N NH1  . ARG A 1 55  ? 23.735  57.429  95.257  1.00 0.00 ?  46  ARG A NH1  1  
ATOM 679   N NH2  . ARG A 1 55  ? 22.142  58.873  95.755  1.00 0.00 1  46  ARG A NH2  1  
ATOM 680   H H    . ARG A 1 55  ? 23.103  50.299  97.369  1.00 0.00 ?  46  ARG A H    1  
ATOM 681   H HA   . ARG A 1 55  ? 20.634  51.814  97.214  1.00 0.00 ?  46  ARG A HA   1  
ATOM 682   H HB2  . ARG A 1 55  ? 22.250  53.131  98.518  1.00 0.00 ?  46  ARG A HB2  1  
ATOM 683   H HB3  . ARG A 1 55  ? 23.456  52.986  97.267  1.00 0.00 ?  46  ARG A HB3  1  
ATOM 684   H HG2  . ARG A 1 55  ? 22.186  54.352  95.680  1.00 0.00 ?  46  ARG A HG2  1  
ATOM 685   H HG3  . ARG A 1 55  ? 20.863  54.454  96.891  1.00 0.00 ?  46  ARG A HG3  1  
ATOM 686   H HD2  . ARG A 1 55  ? 22.684  55.478  98.423  1.00 0.00 ?  46  ARG A HD2  1  
ATOM 687   H HD3  . ARG A 1 55  ? 23.751  55.533  97.112  1.00 0.00 ?  46  ARG A HD3  1  
ATOM 688   H HE   . ARG A 1 55  ? 21.292  57.169  97.254  1.00 0.00 ?  46  ARG A HE   1  
ATOM 689   H HH11 . ARG A 1 55  ? 24.031  56.463  95.238  1.00 0.00 ?  46  ARG A HH11 1  
ATOM 690   H HH12 . ARG A 1 55  ? 24.153  58.152  94.690  1.00 0.00 ?  46  ARG A HH12 1  
ATOM 691   H HH21 . ARG A 1 55  ? 21.304  59.083  96.278  1.00 0.00 ?  46  ARG A HH21 1  
ATOM 692   H HH22 . ARG A 1 55  ? 22.699  59.592  95.318  1.00 0.00 ?  46  ARG A HH22 1  
ATOM 693   N N    . ARG A 1 56  ? 21.067  52.114  94.544  1.00 0.00 ?  47  ARG A N    1  
ATOM 694   C CA   . ARG A 1 56  ? 21.274  52.086  93.103  1.00 0.00 ?  47  ARG A CA   1  
ATOM 695   C C    . ARG A 1 56  ? 22.653  52.478  92.641  1.00 0.00 ?  47  ARG A C    1  
ATOM 696   O O    . ARG A 1 56  ? 23.379  53.082  93.447  1.00 0.00 ?  47  ARG A O    1  
ATOM 697   C CB   . ARG A 1 56  ? 20.268  52.999  92.399  1.00 0.00 ?  47  ARG A CB   1  
ATOM 698   C CG   . ARG A 1 56  ? 20.415  54.465  92.865  1.00 0.00 ?  47  ARG A CG   1  
ATOM 699   C CD   . ARG A 1 56  ? 19.591  55.272  91.928  1.00 0.00 ?  47  ARG A CD   1  
ATOM 700   N NE   . ARG A 1 56  ? 19.531  56.746  92.292  1.00 0.00 ?  47  ARG A NE   1  
ATOM 701   C CZ   . ARG A 1 56  ? 20.359  57.662  92.040  1.00 0.00 ?  47  ARG A CZ   1  
ATOM 702   N NH1  . ARG A 1 56  ? 21.582  57.482  91.681  1.00 0.00 ?  47  ARG A NH1  1  
ATOM 703   N NH2  . ARG A 1 56  ? 20.074  58.932  92.222  1.00 0.00 1  47  ARG A NH2  1  
ATOM 704   H H    . ARG A 1 56  ? 20.491  52.908  94.789  1.00 0.00 ?  47  ARG A H    1  
ATOM 705   H HA   . ARG A 1 56  ? 21.059  51.079  92.748  1.00 0.00 ?  47  ARG A HA   1  
ATOM 706   H HB2  . ARG A 1 56  ? 20.430  52.953  91.322  1.00 0.00 ?  47  ARG A HB2  1  
ATOM 707   H HB3  . ARG A 1 56  ? 19.273  52.613  92.624  1.00 0.00 ?  47  ARG A HB3  1  
ATOM 708   H HG2  . ARG A 1 56  ? 20.091  54.576  93.899  1.00 0.00 ?  47  ARG A HG2  1  
ATOM 709   H HG3  . ARG A 1 56  ? 21.447  54.806  92.950  1.00 0.00 ?  47  ARG A HG3  1  
ATOM 710   H HD2  . ARG A 1 56  ? 19.959  55.139  90.911  1.00 0.00 ?  47  ARG A HD2  1  
ATOM 711   H HD3  . ARG A 1 56  ? 18.567  54.904  91.996  1.00 0.00 ?  47  ARG A HD3  1  
ATOM 712   H HE   . ARG A 1 56  ? 18.633  57.027  92.658  1.00 0.00 ?  47  ARG A HE   1  
ATOM 713   H HH11 . ARG A 1 56  ? 21.958  56.549  91.588  1.00 0.00 ?  47  ARG A HH11 1  
ATOM 714   H HH12 . ARG A 1 56  ? 22.190  58.281  91.790  1.00 0.00 ?  47  ARG A HH12 1  
ATOM 715   H HH21 . ARG A 1 56  ? 19.152  59.136  92.579  1.00 0.00 ?  47  ARG A HH21 1  
ATOM 716   H HH22 . ARG A 1 56  ? 20.691  59.710  92.038  1.00 0.00 ?  47  ARG A HH22 1  
ATOM 717   N N    . ALA A 1 57  ? 23.041  52.162  91.417  1.00 0.00 ?  48  ALA A N    1  
ATOM 718   C CA   . ALA A 1 57  ? 24.049  52.854  90.610  1.00 0.00 ?  48  ALA A CA   1  
ATOM 719   C C    . ALA A 1 57  ? 23.950  54.442  90.677  1.00 0.00 ?  48  ALA A C    1  
ATOM 720   O O    . ALA A 1 57  ? 22.868  54.972  90.866  1.00 0.00 ?  48  ALA A O    1  
ATOM 721   C CB   . ALA A 1 57  ? 23.954  52.253  89.168  1.00 0.00 ?  48  ALA A CB   1  
ATOM 722   H H    . ALA A 1 57  ? 22.323  51.655  90.919  1.00 0.00 ?  48  ALA A H    1  
ATOM 723   H HA   . ALA A 1 57  ? 25.010  52.568  91.035  1.00 0.00 ?  48  ALA A HA   1  
ATOM 724   H HB1  . ALA A 1 57  ? 24.359  52.895  88.385  1.00 0.00 ?  48  ALA A HB1  1  
ATOM 725   H HB2  . ALA A 1 57  ? 24.339  51.234  89.198  1.00 0.00 ?  48  ALA A HB2  1  
ATOM 726   H HB3  . ALA A 1 57  ? 22.913  52.115  88.876  1.00 0.00 ?  48  ALA A HB3  1  
ATOM 727   N N    . SER A 1 58  ? 25.114  55.105  90.680  1.00 0.00 ?  49  SER A N    1  
ATOM 728   C CA   . SER A 1 58  ? 25.307  56.594  90.842  1.00 0.00 ?  49  SER A CA   1  
ATOM 729   C C    . SER A 1 58  ? 26.532  57.027  90.049  1.00 0.00 ?  49  SER A C    1  
ATOM 730   O O    . SER A 1 58  ? 27.579  57.219  90.631  1.00 0.00 ?  49  SER A O    1  
ATOM 731   C CB   . SER A 1 58  ? 25.500  56.931  92.389  1.00 0.00 ?  49  SER A CB   1  
ATOM 732   O OG   . SER A 1 58  ? 25.458  58.349  92.516  1.00 0.00 ?  49  SER A OG   1  
ATOM 733   H H    . SER A 1 58  ? 25.951  54.542  90.620  1.00 0.00 ?  49  SER A H    1  
ATOM 734   H HA   . SER A 1 58  ? 24.467  57.203  90.509  1.00 0.00 ?  49  SER A HA   1  
ATOM 735   H HB2  . SER A 1 58  ? 24.664  56.529  92.959  1.00 0.00 ?  49  SER A HB2  1  
ATOM 736   H HB3  . SER A 1 58  ? 26.452  56.551  92.758  1.00 0.00 ?  49  SER A HB3  1  
ATOM 737   H HG   . SER A 1 58  ? 24.647  58.673  92.116  1.00 0.00 ?  49  SER A HG   1  
ATOM 738   N N    . LEU A 1 59  ? 26.508  57.153  88.729  1.00 0.00 ?  50  LEU A N    1  
ATOM 739   C CA   . LEU A 1 59  ? 27.662  57.257  87.756  1.00 0.00 ?  50  LEU A CA   1  
ATOM 740   C C    . LEU A 1 59  ? 28.383  58.630  87.852  1.00 0.00 ?  50  LEU A C    1  
ATOM 741   O O    . LEU A 1 59  ? 27.792  59.575  88.311  1.00 0.00 ?  50  LEU A O    1  
ATOM 742   C CB   . LEU A 1 59  ? 27.134  56.881  86.351  1.00 0.00 ?  50  LEU A CB   1  
ATOM 743   C CG   . LEU A 1 59  ? 26.825  55.422  86.176  1.00 0.00 ?  50  LEU A CG   1  
ATOM 744   C CD1  . LEU A 1 59  ? 26.128  55.202  84.821  1.00 0.00 ?  50  LEU A CD1  1  
ATOM 745   C CD2  . LEU A 1 59  ? 28.020  54.471  86.310  1.00 0.00 ?  50  LEU A CD2  1  
ATOM 746   H H    . LEU A 1 59  ? 25.614  56.963  88.298  1.00 0.00 ?  50  LEU A H    1  
ATOM 747   H HA   . LEU A 1 59  ? 28.303  56.423  88.040  1.00 0.00 ?  50  LEU A HA   1  
ATOM 748   H HB2  . LEU A 1 59  ? 26.203  57.430  86.214  1.00 0.00 ?  50  LEU A HB2  1  
ATOM 749   H HB3  . LEU A 1 59  ? 27.835  57.195  85.578  1.00 0.00 ?  50  LEU A HB3  1  
ATOM 750   H HG   . LEU A 1 59  ? 26.102  55.144  86.943  1.00 0.00 ?  50  LEU A HG   1  
ATOM 751   H HD11 . LEU A 1 59  ? 25.355  55.965  84.724  1.00 0.00 ?  50  LEU A HD11 1  
ATOM 752   H HD12 . LEU A 1 59  ? 26.868  55.214  84.020  1.00 0.00 ?  50  LEU A HD12 1  
ATOM 753   H HD13 . LEU A 1 59  ? 25.711  54.195  84.833  1.00 0.00 ?  50  LEU A HD13 1  
ATOM 754   H HD21 . LEU A 1 59  ? 28.146  54.386  87.389  1.00 0.00 ?  50  LEU A HD21 1  
ATOM 755   H HD22 . LEU A 1 59  ? 27.773  53.540  85.801  1.00 0.00 ?  50  LEU A HD22 1  
ATOM 756   H HD23 . LEU A 1 59  ? 28.982  54.783  85.904  1.00 0.00 ?  50  LEU A HD23 1  
ATOM 757   N N    . PRO A 1 60  ? 29.725  58.644  87.515  1.00 0.00 ?  51  PRO A N    1  
ATOM 758   C CA   . PRO A 1 60  ? 30.557  59.847  87.743  1.00 0.00 ?  51  PRO A CA   1  
ATOM 759   C C    . PRO A 1 60  ? 30.014  61.193  87.394  1.00 0.00 ?  51  PRO A C    1  
ATOM 760   O O    . PRO A 1 60  ? 29.377  61.319  86.382  1.00 0.00 ?  51  PRO A O    1  
ATOM 761   C CB   . PRO A 1 60  ? 31.915  59.448  87.161  1.00 0.00 ?  51  PRO A CB   1  
ATOM 762   C CG   . PRO A 1 60  ? 32.017  57.962  87.271  1.00 0.00 ?  51  PRO A CG   1  
ATOM 763   C CD   . PRO A 1 60  ? 30.558  57.612  86.902  1.00 0.00 ?  51  PRO A CD   1  
ATOM 764   H HA   . PRO A 1 60  ? 30.812  59.894  88.802  1.00 0.00 ?  51  PRO A HA   1  
ATOM 765   H HB2  . PRO A 1 60  ? 31.871  59.701  86.102  1.00 0.00 ?  51  PRO A HB2  1  
ATOM 766   H HB3  . PRO A 1 60  ? 32.743  59.986  87.621  1.00 0.00 ?  51  PRO A HB3  1  
ATOM 767   H HG2  . PRO A 1 60  ? 32.781  57.546  86.614  1.00 0.00 ?  51  PRO A HG2  1  
ATOM 768   H HG3  . PRO A 1 60  ? 32.212  57.738  88.320  1.00 0.00 ?  51  PRO A HG3  1  
ATOM 769   H HD2  . PRO A 1 60  ? 30.561  57.627  85.813  1.00 0.00 ?  51  PRO A HD2  1  
ATOM 770   H HD3  . PRO A 1 60  ? 30.281  56.619  87.259  1.00 0.00 ?  51  PRO A HD3  1  
ATOM 771   N N    . GLY A 1 61  ? 30.359  62.249  88.191  1.00 0.00 ?  52  GLY A N    1  
ATOM 772   C CA   . GLY A 1 61  ? 30.112  63.636  87.851  1.00 0.00 ?  52  GLY A CA   1  
ATOM 773   C C    . GLY A 1 61  ? 31.367  64.338  87.350  1.00 0.00 ?  52  GLY A C    1  
ATOM 774   O O    . GLY A 1 61  ? 32.467  63.815  87.204  1.00 0.00 ?  52  GLY A O    1  
ATOM 775   H H    . GLY A 1 61  ? 30.926  62.068  89.005  1.00 0.00 ?  52  GLY A H    1  
ATOM 776   H HA2  . GLY A 1 61  ? 29.310  63.709  87.117  1.00 0.00 ?  52  GLY A HA2  1  
ATOM 777   H HA3  . GLY A 1 61  ? 29.842  64.168  88.763  1.00 0.00 ?  52  GLY A HA3  1  
ATOM 778   N N    . ARG A 1 62  ? 31.131  65.575  86.994  1.00 0.00 ?  53  ARG A N    1  
ATOM 779   C CA   . ARG A 1 62  ? 32.124  66.452  86.470  1.00 0.00 ?  53  ARG A CA   1  
ATOM 780   C C    . ARG A 1 62  ? 33.192  66.818  87.496  1.00 0.00 ?  53  ARG A C    1  
ATOM 781   O O    . ARG A 1 62  ? 32.846  67.007  88.645  1.00 0.00 ?  53  ARG A O    1  
ATOM 782   C CB   . ARG A 1 62  ? 31.431  67.741  85.923  1.00 0.00 ?  53  ARG A CB   1  
ATOM 783   C CG   . ARG A 1 62  ? 32.491  68.766  85.393  1.00 0.00 ?  53  ARG A CG   1  
ATOM 784   C CD   . ARG A 1 62  ? 31.774  69.987  84.771  1.00 0.00 ?  53  ARG A CD   1  
ATOM 785   N NE   . ARG A 1 62  ? 30.368  70.242  85.376  1.00 0.00 ?  53  ARG A NE   1  
ATOM 786   C CZ   . ARG A 1 62  ? 29.928  71.470  85.474  1.00 0.00 ?  53  ARG A CZ   1  
ATOM 787   N NH1  . ARG A 1 62  ? 30.346  72.424  84.809  1.00 0.00 ?  53  ARG A NH1  1  
ATOM 788   N NH2  . ARG A 1 62  ? 28.989  71.619  86.264  1.00 0.00 1  53  ARG A NH2  1  
ATOM 789   H H    . ARG A 1 62  ? 30.204  65.971  87.059  1.00 0.00 ?  53  ARG A H    1  
ATOM 790   H HA   . ARG A 1 62  ? 32.708  65.993  85.671  1.00 0.00 ?  53  ARG A HA   1  
ATOM 791   H HB2  . ARG A 1 62  ? 30.824  67.420  85.078  1.00 0.00 ?  53  ARG A HB2  1  
ATOM 792   H HB3  . ARG A 1 62  ? 30.762  68.102  86.704  1.00 0.00 ?  53  ARG A HB3  1  
ATOM 793   H HG2  . ARG A 1 62  ? 33.103  69.147  86.211  1.00 0.00 ?  53  ARG A HG2  1  
ATOM 794   H HG3  . ARG A 1 62  ? 33.163  68.348  84.643  1.00 0.00 ?  53  ARG A HG3  1  
ATOM 795   H HD2  . ARG A 1 62  ? 32.484  70.811  84.857  1.00 0.00 ?  53  ARG A HD2  1  
ATOM 796   H HD3  . ARG A 1 62  ? 31.590  69.679  83.742  1.00 0.00 ?  53  ARG A HD3  1  
ATOM 797   H HE   . ARG A 1 62  ? 29.977  69.586  86.037  1.00 0.00 ?  53  ARG A HE   1  
ATOM 798   H HH11 . ARG A 1 62  ? 31.244  72.476  84.349  1.00 0.00 ?  53  ARG A HH11 1  
ATOM 799   H HH12 . ARG A 1 62  ? 29.994  73.291  85.190  1.00 0.00 ?  53  ARG A HH12 1  
ATOM 800   H HH21 . ARG A 1 62  ? 28.547  70.867  86.774  1.00 0.00 ?  53  ARG A HH21 1  
ATOM 801   H HH22 . ARG A 1 62  ? 28.668  72.571  86.363  1.00 0.00 ?  53  ARG A HH22 1  
ATOM 802   N N    . ASP A 1 63  ? 34.493  66.910  87.159  1.00 0.00 ?  54  ASP A N    1  
ATOM 803   C CA   . ASP A 1 63  ? 35.672  67.374  87.913  1.00 0.00 ?  54  ASP A CA   1  
ATOM 804   C C    . ASP A 1 63  ? 36.524  68.120  86.879  1.00 0.00 ?  54  ASP A C    1  
ATOM 805   O O    . ASP A 1 63  ? 36.305  68.226  85.718  1.00 0.00 ?  54  ASP A O    1  
ATOM 806   C CB   . ASP A 1 63  ? 36.392  66.104  88.444  1.00 0.00 ?  54  ASP A CB   1  
ATOM 807   C CG   . ASP A 1 63  ? 37.374  65.428  87.424  1.00 0.00 ?  54  ASP A CG   1  
ATOM 808   O OD1  . ASP A 1 63  ? 36.846  64.950  86.427  1.00 0.00 -1 54  ASP A OD1  1  
ATOM 809   O OD2  . ASP A 1 63  ? 38.604  65.447  87.655  1.00 0.00 ?  54  ASP A OD2  1  
ATOM 810   H H    . ASP A 1 63  ? 34.725  66.721  86.194  1.00 0.00 ?  54  ASP A H    1  
ATOM 811   H HA   . ASP A 1 63  ? 35.265  68.000  88.707  1.00 0.00 ?  54  ASP A HA   1  
ATOM 812   H HB2  . ASP A 1 63  ? 37.064  66.451  89.229  1.00 0.00 ?  54  ASP A HB2  1  
ATOM 813   H HB3  . ASP A 1 63  ? 35.648  65.355  88.716  1.00 0.00 ?  54  ASP A HB3  1  
ATOM 814   N N    . ASP A 1 64  ? 37.640  68.657  87.368  1.00 0.00 ?  55  ASP A N    1  
ATOM 815   C CA   . ASP A 1 64  ? 38.734  69.399  86.659  1.00 0.00 ?  55  ASP A CA   1  
ATOM 816   C C    . ASP A 1 64  ? 39.239  68.634  85.416  1.00 0.00 ?  55  ASP A C    1  
ATOM 817   O O    . ASP A 1 64  ? 39.241  69.229  84.369  1.00 0.00 ?  55  ASP A O    1  
ATOM 818   C CB   . ASP A 1 64  ? 39.852  69.797  87.635  1.00 0.00 ?  55  ASP A CB   1  
ATOM 819   C CG   . ASP A 1 64  ? 39.345  70.828  88.621  1.00 0.00 ?  55  ASP A CG   1  
ATOM 820   O OD1  . ASP A 1 64  ? 38.360  71.573  88.361  1.00 0.00 ?  55  ASP A OD1  1  
ATOM 821   O OD2  . ASP A 1 64  ? 39.922  71.044  89.682  1.00 0.00 -1 55  ASP A OD2  1  
ATOM 822   H H    . ASP A 1 64  ? 37.829  68.411  88.329  1.00 0.00 ?  55  ASP A H    1  
ATOM 823   H HA   . ASP A 1 64  ? 38.292  70.289  86.210  1.00 0.00 ?  55  ASP A HA   1  
ATOM 824   H HB2  . ASP A 1 64  ? 40.185  68.913  88.178  1.00 0.00 ?  55  ASP A HB2  1  
ATOM 825   H HB3  . ASP A 1 64  ? 40.682  70.161  87.029  1.00 0.00 ?  55  ASP A HB3  1  
ATOM 826   N N    . ASN A 1 65  ? 39.611  67.348  85.610  1.00 0.00 ?  56  ASN A N    1  
ATOM 827   C CA   . ASN A 1 65  ? 40.164  66.520  84.517  1.00 0.00 ?  56  ASN A CA   1  
ATOM 828   C C    . ASN A 1 65  ? 39.102  66.203  83.426  1.00 0.00 ?  56  ASN A C    1  
ATOM 829   O O    . ASN A 1 65  ? 39.343  66.392  82.263  1.00 0.00 ?  56  ASN A O    1  
ATOM 830   C CB   . ASN A 1 65  ? 40.794  65.266  85.014  1.00 0.00 ?  56  ASN A CB   1  
ATOM 831   C CG   . ASN A 1 65  ? 41.860  65.428  86.089  1.00 0.00 ?  56  ASN A CG   1  
ATOM 832   O OD1  . ASN A 1 65  ? 42.983  65.668  85.840  1.00 0.00 ?  56  ASN A OD1  1  
ATOM 833   N ND2  . ASN A 1 65  ? 41.545  65.228  87.313  1.00 0.00 ?  56  ASN A ND2  1  
ATOM 834   H H    . ASN A 1 65  ? 39.577  66.850  86.488  1.00 0.00 ?  56  ASN A H    1  
ATOM 835   H HA   . ASN A 1 65  ? 40.902  67.094  83.956  1.00 0.00 ?  56  ASN A HA   1  
ATOM 836   H HB2  . ASN A 1 65  ? 40.018  64.621  85.426  1.00 0.00 ?  56  ASN A HB2  1  
ATOM 837   H HB3  . ASN A 1 65  ? 41.366  64.789  84.219  1.00 0.00 ?  56  ASN A HB3  1  
ATOM 838   H HD21 . ASN A 1 65  ? 40.546  65.164  87.452  1.00 0.00 ?  56  ASN A HD21 1  
ATOM 839   H HD22 . ASN A 1 65  ? 42.298  65.360  87.972  1.00 0.00 ?  56  ASN A HD22 1  
ATOM 840   N N    . SER A 1 66  ? 37.844  65.998  83.821  1.00 0.00 ?  57  SER A N    1  
ATOM 841   C CA   . SER A 1 66  ? 36.676  65.764  82.889  1.00 0.00 ?  57  SER A CA   1  
ATOM 842   C C    . SER A 1 66  ? 36.048  66.964  82.257  1.00 0.00 ?  57  SER A C    1  
ATOM 843   O O    . SER A 1 66  ? 35.619  66.866  81.118  1.00 0.00 ?  57  SER A O    1  
ATOM 844   C CB   . SER A 1 66  ? 35.565  64.995  83.527  1.00 0.00 ?  57  SER A CB   1  
ATOM 845   O OG   . SER A 1 66  ? 35.108  65.776  84.585  1.00 0.00 ?  57  SER A OG   1  
ATOM 846   H H    . SER A 1 66  ? 37.693  65.952  84.818  1.00 0.00 ?  57  SER A H    1  
ATOM 847   H HA   . SER A 1 66  ? 37.003  65.117  82.074  1.00 0.00 ?  57  SER A HA   1  
ATOM 848   H HB2  . SER A 1 66  ? 34.800  64.816  82.771  1.00 0.00 ?  57  SER A HB2  1  
ATOM 849   H HB3  . SER A 1 66  ? 35.917  64.018  83.855  1.00 0.00 ?  57  SER A HB3  1  
ATOM 850   H HG   . SER A 1 66  ? 35.761  65.711  85.286  1.00 0.00 ?  57  SER A HG   1  
ATOM 851   N N    . TYR A 1 67  ? 36.221  68.176  82.891  1.00 0.00 ?  58  TYR A N    1  
ATOM 852   C CA   . TYR A 1 67  ? 36.323  69.555  82.341  1.00 0.00 ?  58  TYR A CA   1  
ATOM 853   C C    . TYR A 1 67  ? 37.394  69.909  81.309  1.00 0.00 ?  58  TYR A C    1  
ATOM 854   O O    . TYR A 1 67  ? 37.116  70.635  80.354  1.00 0.00 ?  58  TYR A O    1  
ATOM 855   C CB   . TYR A 1 67  ? 36.214  70.541  83.489  1.00 0.00 ?  58  TYR A CB   1  
ATOM 856   C CG   . TYR A 1 67  ? 36.528  71.996  83.180  1.00 0.00 ?  58  TYR A CG   1  
ATOM 857   C CD1  . TYR A 1 67  ? 35.841  72.731  82.228  1.00 0.00 ?  58  TYR A CD1  1  
ATOM 858   C CD2  . TYR A 1 67  ? 37.714  72.578  83.767  1.00 0.00 ?  58  TYR A CD2  1  
ATOM 859   C CE1  . TYR A 1 67  ? 36.215  74.018  81.879  1.00 0.00 ?  58  TYR A CE1  1  
ATOM 860   C CE2  . TYR A 1 67  ? 38.086  73.888  83.464  1.00 0.00 ?  58  TYR A CE2  1  
ATOM 861   C CZ   . TYR A 1 67  ? 37.378  74.638  82.506  1.00 0.00 ?  58  TYR A CZ   1  
ATOM 862   O OH   . TYR A 1 67  ? 37.634  75.962  82.352  1.00 0.00 ?  58  TYR A OH   1  
ATOM 863   H H    . TYR A 1 67  ? 36.524  68.075  83.849  1.00 0.00 ?  58  TYR A H    1  
ATOM 864   H HA   . TYR A 1 67  ? 35.410  69.703  81.763  1.00 0.00 ?  58  TYR A HA   1  
ATOM 865   H HB2  . TYR A 1 67  ? 35.210  70.379  83.883  1.00 0.00 ?  58  TYR A HB2  1  
ATOM 866   H HB3  . TYR A 1 67  ? 36.893  70.169  84.257  1.00 0.00 ?  58  TYR A HB3  1  
ATOM 867   H HD1  . TYR A 1 67  ? 34.993  72.253  81.759  1.00 0.00 ?  58  TYR A HD1  1  
ATOM 868   H HD2  . TYR A 1 67  ? 38.314  72.032  84.478  1.00 0.00 ?  58  TYR A HD2  1  
ATOM 869   H HE1  . TYR A 1 67  ? 35.647  74.463  81.076  1.00 0.00 ?  58  TYR A HE1  1  
ATOM 870   H HE2  . TYR A 1 67  ? 38.911  74.284  84.036  1.00 0.00 ?  58  TYR A HE2  1  
ATOM 871   H HH   . TYR A 1 67  ? 38.147  76.302  83.089  1.00 0.00 ?  58  TYR A HH   1  
ATOM 872   N N    . MET A 1 68  ? 38.582  69.439  81.433  1.00 0.00 ?  59  MET A N    1  
ATOM 873   C CA   . MET A 1 68  ? 39.648  69.692  80.515  1.00 0.00 ?  59  MET A CA   1  
ATOM 874   C C    . MET A 1 68  ? 39.534  68.684  79.267  1.00 0.00 ?  59  MET A C    1  
ATOM 875   O O    . MET A 1 68  ? 39.724  69.028  78.138  1.00 0.00 ?  59  MET A O    1  
ATOM 876   C CB   . MET A 1 68  ? 41.036  69.525  81.133  1.00 0.00 ?  59  MET A CB   1  
ATOM 877   C CG   . MET A 1 68  ? 41.389  70.696  82.049  1.00 0.00 ?  59  MET A CG   1  
ATOM 878   S SD   . MET A 1 68  ? 43.103  70.786  82.691  1.00 0.00 ?  59  MET A SD   1  
ATOM 879   C CE   . MET A 1 68  ? 42.912  69.390  83.942  1.00 0.00 ?  59  MET A CE   1  
ATOM 880   H H    . MET A 1 68  ? 38.773  68.852  82.233  1.00 0.00 ?  59  MET A H    1  
ATOM 881   H HA   . MET A 1 68  ? 39.652  70.692  80.083  1.00 0.00 ?  59  MET A HA   1  
ATOM 882   H HB2  . MET A 1 68  ? 40.991  68.555  81.629  1.00 0.00 ?  59  MET A HB2  1  
ATOM 883   H HB3  . MET A 1 68  ? 41.724  69.444  80.293  1.00 0.00 ?  59  MET A HB3  1  
ATOM 884   H HG2  . MET A 1 68  ? 41.230  71.598  81.461  1.00 0.00 ?  59  MET A HG2  1  
ATOM 885   H HG3  . MET A 1 68  ? 40.697  70.794  82.886  1.00 0.00 ?  59  MET A HG3  1  
ATOM 886   H HE1  . MET A 1 68  ? 42.111  69.539  84.666  1.00 0.00 ?  59  MET A HE1  1  
ATOM 887   H HE2  . MET A 1 68  ? 42.651  68.479  83.403  1.00 0.00 ?  59  MET A HE2  1  
ATOM 888   H HE3  . MET A 1 68  ? 43.892  69.376  84.420  1.00 0.00 ?  59  MET A HE3  1  
ATOM 889   N N    . TYR A 1 69  ? 39.085  67.442  79.457  1.00 0.00 ?  60  TYR A N    1  
ATOM 890   C CA   . TYR A 1 69  ? 38.546  66.656  78.393  1.00 0.00 ?  60  TYR A CA   1  
ATOM 891   C C    . TYR A 1 69  ? 37.385  67.277  77.683  1.00 0.00 ?  60  TYR A C    1  
ATOM 892   O O    . TYR A 1 69  ? 37.353  67.321  76.434  1.00 0.00 ?  60  TYR A O    1  
ATOM 893   C CB   . TYR A 1 69  ? 38.306  65.227  78.789  1.00 0.00 ?  60  TYR A CB   1  
ATOM 894   C CG   . TYR A 1 69  ? 37.371  64.385  77.928  1.00 0.00 ?  60  TYR A CG   1  
ATOM 895   C CD1  . TYR A 1 69  ? 35.995  64.492  78.326  1.00 0.00 ?  60  TYR A CD1  1  
ATOM 896   C CD2  . TYR A 1 69  ? 37.741  63.544  76.913  1.00 0.00 ?  60  TYR A CD2  1  
ATOM 897   C CE1  . TYR A 1 69  ? 34.988  63.810  77.642  1.00 0.00 ?  60  TYR A CE1  1  
ATOM 898   C CE2  . TYR A 1 69  ? 36.735  62.801  76.277  1.00 0.00 ?  60  TYR A CE2  1  
ATOM 899   C CZ   . TYR A 1 69  ? 35.379  62.955  76.636  1.00 0.00 ?  60  TYR A CZ   1  
ATOM 900   O OH   . TYR A 1 69  ? 34.504  62.159  76.019  1.00 0.00 ?  60  TYR A OH   1  
ATOM 901   H H    . TYR A 1 69  ? 39.039  67.121  80.414  1.00 0.00 ?  60  TYR A H    1  
ATOM 902   H HA   . TYR A 1 69  ? 39.390  66.552  77.712  1.00 0.00 ?  60  TYR A HA   1  
ATOM 903   H HB2  . TYR A 1 69  ? 39.304  64.794  78.716  1.00 0.00 ?  60  TYR A HB2  1  
ATOM 904   H HB3  . TYR A 1 69  ? 38.103  65.109  79.854  1.00 0.00 ?  60  TYR A HB3  1  
ATOM 905   H HD1  . TYR A 1 69  ? 35.710  65.105  79.169  1.00 0.00 ?  60  TYR A HD1  1  
ATOM 906   H HD2  . TYR A 1 69  ? 38.784  63.435  76.657  1.00 0.00 ?  60  TYR A HD2  1  
ATOM 907   H HE1  . TYR A 1 69  ? 33.984  63.967  78.006  1.00 0.00 ?  60  TYR A HE1  1  
ATOM 908   H HE2  . TYR A 1 69  ? 37.003  62.047  75.551  1.00 0.00 ?  60  TYR A HE2  1  
ATOM 909   H HH   . TYR A 1 69  ? 34.783  61.630  75.268  1.00 0.00 ?  60  TYR A HH   1  
ATOM 910   N N    . ILE A 1 70  ? 36.598  68.116  78.424  1.00 0.00 ?  61  ILE A N    1  
ATOM 911   C CA   . ILE A 1 70  ? 35.529  68.894  77.789  1.00 0.00 ?  61  ILE A CA   1  
ATOM 912   C C    . ILE A 1 70  ? 35.878  70.145  76.917  1.00 0.00 ?  61  ILE A C    1  
ATOM 913   O O    . ILE A 1 70  ? 35.203  70.464  75.965  1.00 0.00 ?  61  ILE A O    1  
ATOM 914   C CB   . ILE A 1 70  ? 34.518  69.221  78.906  1.00 0.00 ?  61  ILE A CB   1  
ATOM 915   C CG1  . ILE A 1 70  ? 33.326  68.208  78.787  1.00 0.00 ?  61  ILE A CG1  1  
ATOM 916   C CG2  . ILE A 1 70  ? 34.083  70.676  79.065  1.00 0.00 ?  61  ILE A CG2  1  
ATOM 917   C CD1  . ILE A 1 70  ? 32.670  68.153  80.195  1.00 0.00 ?  61  ILE A CD1  1  
ATOM 918   H H    . ILE A 1 70  ? 36.698  68.050  79.427  1.00 0.00 ?  61  ILE A H    1  
ATOM 919   H HA   . ILE A 1 70  ? 34.956  68.305  77.072  1.00 0.00 ?  61  ILE A HA   1  
ATOM 920   H HB   . ILE A 1 70  ? 35.069  68.898  79.789  1.00 0.00 ?  61  ILE A HB   1  
ATOM 921   H HG12 . ILE A 1 70  ? 32.581  68.424  78.022  1.00 0.00 ?  61  ILE A HG12 1  
ATOM 922   H HG13 . ILE A 1 70  ? 33.659  67.192  78.575  1.00 0.00 ?  61  ILE A HG13 1  
ATOM 923   H HG21 . ILE A 1 70  ? 33.629  70.744  80.053  1.00 0.00 ?  61  ILE A HG21 1  
ATOM 924   H HG22 . ILE A 1 70  ? 34.915  71.373  79.158  1.00 0.00 ?  61  ILE A HG22 1  
ATOM 925   H HG23 . ILE A 1 70  ? 33.476  71.042  78.236  1.00 0.00 ?  61  ILE A HG23 1  
ATOM 926   H HD11 . ILE A 1 70  ? 31.938  68.936  80.393  1.00 0.00 ?  61  ILE A HD11 1  
ATOM 927   H HD12 . ILE A 1 70  ? 32.048  67.270  80.051  1.00 0.00 ?  61  ILE A HD12 1  
ATOM 928   H HD13 . ILE A 1 70  ? 33.318  68.098  81.070  1.00 0.00 ?  61  ILE A HD13 1  
ATOM 929   N N    . LEU A 1 71  ? 36.956  70.804  77.323  1.00 0.00 ?  62  LEU A N    1  
ATOM 930   C CA   . LEU A 1 71  ? 37.648  71.819  76.516  1.00 0.00 ?  62  LEU A CA   1  
ATOM 931   C C    . LEU A 1 71  ? 38.366  71.249  75.215  1.00 0.00 ?  62  LEU A C    1  
ATOM 932   O O    . LEU A 1 71  ? 38.280  71.763  74.087  1.00 0.00 ?  62  LEU A O    1  
ATOM 933   C CB   . LEU A 1 71  ? 38.655  72.607  77.323  1.00 0.00 ?  62  LEU A CB   1  
ATOM 934   C CG   . LEU A 1 71  ? 38.002  73.470  78.418  1.00 0.00 ?  62  LEU A CG   1  
ATOM 935   C CD1  . LEU A 1 71  ? 39.049  74.140  79.300  1.00 0.00 ?  62  LEU A CD1  1  
ATOM 936   C CD2  . LEU A 1 71  ? 37.066  74.556  77.822  1.00 0.00 ?  62  LEU A CD2  1  
ATOM 937   H H    . LEU A 1 71  ? 37.432  70.287  78.047  1.00 0.00 ?  62  LEU A H    1  
ATOM 938   H HA   . LEU A 1 71  ? 36.922  72.537  76.137  1.00 0.00 ?  62  LEU A HA   1  
ATOM 939   H HB2  . LEU A 1 71  ? 39.385  71.954  77.801  1.00 0.00 ?  62  LEU A HB2  1  
ATOM 940   H HB3  . LEU A 1 71  ? 39.231  73.291  76.699  1.00 0.00 ?  62  LEU A HB3  1  
ATOM 941   H HG   . LEU A 1 71  ? 37.343  72.770  78.931  1.00 0.00 ?  62  LEU A HG   1  
ATOM 942   H HD11 . LEU A 1 71  ? 38.658  74.811  80.064  1.00 0.00 ?  62  LEU A HD11 1  
ATOM 943   H HD12 . LEU A 1 71  ? 39.581  73.322  79.785  1.00 0.00 ?  62  LEU A HD12 1  
ATOM 944   H HD13 . LEU A 1 71  ? 39.652  74.676  78.566  1.00 0.00 ?  62  LEU A HD13 1  
ATOM 945   H HD21 . LEU A 1 71  ? 36.619  75.132  78.633  1.00 0.00 ?  62  LEU A HD21 1  
ATOM 946   H HD22 . LEU A 1 71  ? 37.598  75.330  77.268  1.00 0.00 ?  62  LEU A HD22 1  
ATOM 947   H HD23 . LEU A 1 71  ? 36.255  74.116  77.243  1.00 0.00 ?  62  LEU A HD23 1  
ATOM 948   N N    . PHE A 1 72  ? 38.955  70.016  75.366  1.00 0.00 ?  63  PHE A N    1  
ATOM 949   C CA   . PHE A 1 72  ? 39.364  69.209  74.208  1.00 0.00 ?  63  PHE A CA   1  
ATOM 950   C C    . PHE A 1 72  ? 38.255  68.519  73.395  1.00 0.00 ?  63  PHE A C    1  
ATOM 951   O O    . PHE A 1 72  ? 38.397  68.456  72.175  1.00 0.00 ?  63  PHE A O    1  
ATOM 952   C CB   . PHE A 1 72  ? 40.411  68.160  74.616  1.00 0.00 ?  63  PHE A CB   1  
ATOM 953   C CG   . PHE A 1 72  ? 41.872  68.568  74.725  1.00 0.00 ?  63  PHE A CG   1  
ATOM 954   C CD1  . PHE A 1 72  ? 42.329  69.406  75.781  1.00 0.00 ?  63  PHE A CD1  1  
ATOM 955   C CD2  . PHE A 1 72  ? 42.775  68.261  73.669  1.00 0.00 ?  63  PHE A CD2  1  
ATOM 956   C CE1  . PHE A 1 72  ? 43.683  69.779  75.847  1.00 0.00 ?  63  PHE A CE1  1  
ATOM 957   C CE2  . PHE A 1 72  ? 44.057  68.751  73.642  1.00 0.00 ?  63  PHE A CE2  1  
ATOM 958   C CZ   . PHE A 1 72  ? 44.577  69.482  74.754  1.00 0.00 ?  63  PHE A CZ   1  
ATOM 959   H H    . PHE A 1 72  ? 38.845  69.654  76.302  1.00 0.00 ?  63  PHE A H    1  
ATOM 960   H HA   . PHE A 1 72  ? 39.936  69.801  73.494  1.00 0.00 ?  63  PHE A HA   1  
ATOM 961   H HB2  . PHE A 1 72  ? 40.025  67.671  75.511  1.00 0.00 ?  63  PHE A HB2  1  
ATOM 962   H HB3  . PHE A 1 72  ? 40.420  67.362  73.874  1.00 0.00 ?  63  PHE A HB3  1  
ATOM 963   H HD1  . PHE A 1 72  ? 41.578  69.697  76.500  1.00 0.00 ?  63  PHE A HD1  1  
ATOM 964   H HD2  . PHE A 1 72  ? 42.558  67.655  72.801  1.00 0.00 ?  63  PHE A HD2  1  
ATOM 965   H HE1  . PHE A 1 72  ? 44.042  70.314  76.714  1.00 0.00 ?  63  PHE A HE1  1  
ATOM 966   H HE2  . PHE A 1 72  ? 44.708  68.586  72.797  1.00 0.00 ?  63  PHE A HE2  1  
ATOM 967   H HZ   . PHE A 1 72  ? 45.602  69.825  74.776  1.00 0.00 ?  63  PHE A HZ   1  
ATOM 968   N N    . VAL A 1 73  ? 37.112  68.333  73.972  1.00 0.00 ?  64  VAL A N    1  
ATOM 969   C CA   . VAL A 1 73  ? 35.874  67.932  73.251  1.00 0.00 ?  64  VAL A CA   1  
ATOM 970   C C    . VAL A 1 73  ? 35.378  69.091  72.445  1.00 0.00 ?  64  VAL A C    1  
ATOM 971   O O    . VAL A 1 73  ? 34.964  68.939  71.314  1.00 0.00 ?  64  VAL A O    1  
ATOM 972   C CB   . VAL A 1 73  ? 34.784  67.326  74.212  1.00 0.00 ?  64  VAL A CB   1  
ATOM 973   C CG1  . VAL A 1 73  ? 33.345  67.494  73.725  1.00 0.00 ?  64  VAL A CG1  1  
ATOM 974   C CG2  . VAL A 1 73  ? 34.999  65.870  74.560  1.00 0.00 ?  64  VAL A CG2  1  
ATOM 975   H H    . VAL A 1 73  ? 37.195  68.450  74.971  1.00 0.00 ?  64  VAL A H    1  
ATOM 976   H HA   . VAL A 1 73  ? 36.147  67.194  72.497  1.00 0.00 ?  64  VAL A HA   1  
ATOM 977   H HB   . VAL A 1 73  ? 34.983  67.837  75.154  1.00 0.00 ?  64  VAL A HB   1  
ATOM 978   H HG11 . VAL A 1 73  ? 32.603  66.873  74.226  1.00 0.00 ?  64  VAL A HG11 1  
ATOM 979   H HG12 . VAL A 1 73  ? 32.960  68.503  73.876  1.00 0.00 ?  64  VAL A HG12 1  
ATOM 980   H HG13 . VAL A 1 73  ? 33.499  67.325  72.659  1.00 0.00 ?  64  VAL A HG13 1  
ATOM 981   H HG21 . VAL A 1 73  ? 35.983  65.823  75.027  1.00 0.00 ?  64  VAL A HG21 1  
ATOM 982   H HG22 . VAL A 1 73  ? 34.303  65.527  75.325  1.00 0.00 ?  64  VAL A HG22 1  
ATOM 983   H HG23 . VAL A 1 73  ? 34.819  65.169  73.745  1.00 0.00 ?  64  VAL A HG23 1  
ATOM 984   N N    . MET A 1 74  ? 35.350  70.296  72.974  1.00 0.00 ?  65  MET A N    1  
ATOM 985   C CA   . MET A 1 74  ? 35.102  71.550  72.216  1.00 0.00 ?  65  MET A CA   1  
ATOM 986   C C    . MET A 1 74  ? 36.095  71.766  71.041  1.00 0.00 ?  65  MET A C    1  
ATOM 987   O O    . MET A 1 74  ? 35.783  72.348  69.990  1.00 0.00 ?  65  MET A O    1  
ATOM 988   C CB   . MET A 1 74  ? 35.144  72.735  73.167  1.00 0.00 ?  65  MET A CB   1  
ATOM 989   C CG   . MET A 1 74  ? 35.188  74.143  72.609  1.00 0.00 ?  65  MET A CG   1  
ATOM 990   S SD   . MET A 1 74  ? 35.409  75.394  73.831  1.00 0.00 ?  65  MET A SD   1  
ATOM 991   C CE   . MET A 1 74  ? 37.121  75.125  74.421  1.00 0.00 ?  65  MET A CE   1  
ATOM 992   H H    . MET A 1 74  ? 35.581  70.374  73.955  1.00 0.00 ?  65  MET A H    1  
ATOM 993   H HA   . MET A 1 74  ? 34.157  71.401  71.693  1.00 0.00 ?  65  MET A HA   1  
ATOM 994   H HB2  . MET A 1 74  ? 34.383  72.738  73.947  1.00 0.00 ?  65  MET A HB2  1  
ATOM 995   H HB3  . MET A 1 74  ? 36.079  72.527  73.688  1.00 0.00 ?  65  MET A HB3  1  
ATOM 996   H HG2  . MET A 1 74  ? 35.937  74.146  71.817  1.00 0.00 ?  65  MET A HG2  1  
ATOM 997   H HG3  . MET A 1 74  ? 34.197  74.282  72.176  1.00 0.00 ?  65  MET A HG3  1  
ATOM 998   H HE1  . MET A 1 74  ? 37.373  75.950  75.087  1.00 0.00 ?  65  MET A HE1  1  
ATOM 999   H HE2  . MET A 1 74  ? 37.279  74.190  74.959  1.00 0.00 ?  65  MET A HE2  1  
ATOM 1000  H HE3  . MET A 1 74  ? 37.764  75.129  73.541  1.00 0.00 ?  65  MET A HE3  1  
ATOM 1001  N N    . PHE A 1 75  ? 37.340  71.362  71.138  1.00 0.00 ?  66  PHE A N    1  
ATOM 1002  C CA   . PHE A 1 75  ? 38.375  71.244  70.047  1.00 0.00 ?  66  PHE A CA   1  
ATOM 1003  C C    . PHE A 1 75  ? 38.123  70.172  68.954  1.00 0.00 ?  66  PHE A C    1  
ATOM 1004  O O    . PHE A 1 75  ? 38.062  70.414  67.754  1.00 0.00 ?  66  PHE A O    1  
ATOM 1005  C CB   . PHE A 1 75  ? 39.783  71.226  70.567  1.00 0.00 ?  66  PHE A CB   1  
ATOM 1006  C CG   . PHE A 1 75  ? 40.861  70.715  69.631  1.00 0.00 ?  66  PHE A CG   1  
ATOM 1007  C CD1  . PHE A 1 75  ? 41.126  71.431  68.443  1.00 0.00 ?  66  PHE A CD1  1  
ATOM 1008  C CD2  . PHE A 1 75  ? 41.494  69.479  69.948  1.00 0.00 ?  66  PHE A CD2  1  
ATOM 1009  C CE1  . PHE A 1 75  ? 42.043  70.957  67.535  1.00 0.00 ?  66  PHE A CE1  1  
ATOM 1010  C CE2  . PHE A 1 75  ? 42.548  69.034  69.050  1.00 0.00 ?  66  PHE A CE2  1  
ATOM 1011  C CZ   . PHE A 1 75  ? 42.694  69.723  67.795  1.00 0.00 ?  66  PHE A CZ   1  
ATOM 1012  H H    . PHE A 1 75  ? 37.613  70.924  72.006  1.00 0.00 ?  66  PHE A H    1  
ATOM 1013  H HA   . PHE A 1 75  ? 38.218  72.192  69.532  1.00 0.00 ?  66  PHE A HA   1  
ATOM 1014  H HB2  . PHE A 1 75  ? 40.020  72.252  70.849  1.00 0.00 ?  66  PHE A HB2  1  
ATOM 1015  H HB3  . PHE A 1 75  ? 39.772  70.557  71.428  1.00 0.00 ?  66  PHE A HB3  1  
ATOM 1016  H HD1  . PHE A 1 75  ? 40.731  72.414  68.234  1.00 0.00 ?  66  PHE A HD1  1  
ATOM 1017  H HD2  . PHE A 1 75  ? 41.218  68.840  70.775  1.00 0.00 ?  66  PHE A HD2  1  
ATOM 1018  H HE1  . PHE A 1 75  ? 42.159  71.412  66.562  1.00 0.00 ?  66  PHE A HE1  1  
ATOM 1019  H HE2  . PHE A 1 75  ? 43.006  68.073  69.229  1.00 0.00 ?  66  PHE A HE2  1  
ATOM 1020  H HZ   . PHE A 1 75  ? 43.437  69.256  67.166  1.00 0.00 ?  66  PHE A HZ   1  
ATOM 1021  N N    . LEU A 1 76  ? 37.876  68.949  69.426  1.00 0.00 ?  67  LEU A N    1  
ATOM 1022  C CA   . LEU A 1 76  ? 37.485  67.808  68.658  1.00 0.00 ?  67  LEU A CA   1  
ATOM 1023  C C    . LEU A 1 76  ? 36.162  68.166  68.050  1.00 0.00 ?  67  LEU A C    1  
ATOM 1024  O O    . LEU A 1 76  ? 36.030  67.815  66.904  1.00 0.00 ?  67  LEU A O    1  
ATOM 1025  C CB   . LEU A 1 76  ? 37.475  66.533  69.686  1.00 0.00 ?  67  LEU A CB   1  
ATOM 1026  C CG   . LEU A 1 76  ? 38.899  66.076  69.969  1.00 0.00 ?  67  LEU A CG   1  
ATOM 1027  C CD1  . LEU A 1 76  ? 38.903  65.149  71.203  1.00 0.00 ?  67  LEU A CD1  1  
ATOM 1028  C CD2  . LEU A 1 76  ? 39.527  65.368  68.806  1.00 0.00 ?  67  LEU A CD2  1  
ATOM 1029  H H    . LEU A 1 76  ? 37.841  68.810  70.426  1.00 0.00 ?  67  LEU A H    1  
ATOM 1030  H HA   . LEU A 1 76  ? 38.174  67.660  67.827  1.00 0.00 ?  67  LEU A HA   1  
ATOM 1031  H HB2  . LEU A 1 76  ? 36.895  66.852  70.551  1.00 0.00 ?  67  LEU A HB2  1  
ATOM 1032  H HB3  . LEU A 1 76  ? 36.960  65.742  69.138  1.00 0.00 ?  67  LEU A HB3  1  
ATOM 1033  H HG   . LEU A 1 76  ? 39.473  66.938  70.309  1.00 0.00 ?  67  LEU A HG   1  
ATOM 1034  H HD11 . LEU A 1 76  ? 38.431  64.192  70.983  1.00 0.00 ?  67  LEU A HD11 1  
ATOM 1035  H HD12 . LEU A 1 76  ? 39.937  64.906  71.446  1.00 0.00 ?  67  LEU A HD12 1  
ATOM 1036  H HD13 . LEU A 1 76  ? 38.323  65.595  72.012  1.00 0.00 ?  67  LEU A HD13 1  
ATOM 1037  H HD21 . LEU A 1 76  ? 39.422  65.933  67.879  1.00 0.00 ?  67  LEU A HD21 1  
ATOM 1038  H HD22 . LEU A 1 76  ? 40.528  65.042  69.091  1.00 0.00 ?  67  LEU A HD22 1  
ATOM 1039  H HD23 . LEU A 1 76  ? 38.971  64.452  68.607  1.00 0.00 ?  67  LEU A HD23 1  
ATOM 1040  N N    . PHE A 1 77  ? 35.253  69.005  68.564  1.00 0.00 ?  68  PHE A N    1  
ATOM 1041  C CA   . PHE A 1 77  ? 34.109  69.558  67.874  1.00 0.00 ?  68  PHE A CA   1  
ATOM 1042  C C    . PHE A 1 77  ? 34.358  70.457  66.644  1.00 0.00 ?  68  PHE A C    1  
ATOM 1043  O O    . PHE A 1 77  ? 33.817  70.028  65.607  1.00 0.00 ?  68  PHE A O    1  
ATOM 1044  C CB   . PHE A 1 77  ? 33.030  70.083  68.797  1.00 0.00 ?  68  PHE A CB   1  
ATOM 1045  C CG   . PHE A 1 77  ? 32.118  71.125  68.132  1.00 0.00 ?  68  PHE A CG   1  
ATOM 1046  C CD1  . PHE A 1 77  ? 30.974  70.631  67.426  1.00 0.00 ?  68  PHE A CD1  1  
ATOM 1047  C CD2  . PHE A 1 77  ? 32.341  72.492  68.236  1.00 0.00 ?  68  PHE A CD2  1  
ATOM 1048  C CE1  . PHE A 1 77  ? 30.233  71.562  66.673  1.00 0.00 ?  68  PHE A CE1  1  
ATOM 1049  C CE2  . PHE A 1 77  ? 31.547  73.429  67.544  1.00 0.00 ?  68  PHE A CE2  1  
ATOM 1050  C CZ   . PHE A 1 77  ? 30.535  72.946  66.718  1.00 0.00 ?  68  PHE A CZ   1  
ATOM 1051  H H    . PHE A 1 77  ? 35.265  69.088  69.570  1.00 0.00 ?  68  PHE A H    1  
ATOM 1052  H HA   . PHE A 1 77  ? 33.695  68.661  67.416  1.00 0.00 ?  68  PHE A HA   1  
ATOM 1053  H HB2  . PHE A 1 77  ? 32.307  69.326  69.101  1.00 0.00 ?  68  PHE A HB2  1  
ATOM 1054  H HB3  . PHE A 1 77  ? 33.510  70.615  69.618  1.00 0.00 ?  68  PHE A HB3  1  
ATOM 1055  H HD1  . PHE A 1 77  ? 30.649  69.609  67.299  1.00 0.00 ?  68  PHE A HD1  1  
ATOM 1056  H HD2  . PHE A 1 77  ? 33.147  72.925  68.809  1.00 0.00 ?  68  PHE A HD2  1  
ATOM 1057  H HE1  . PHE A 1 77  ? 29.405  71.169  66.102  1.00 0.00 ?  68  PHE A HE1  1  
ATOM 1058  H HE2  . PHE A 1 77  ? 31.806  74.477  67.552  1.00 0.00 ?  68  PHE A HE2  1  
ATOM 1059  H HZ   . PHE A 1 77  ? 29.934  73.557  66.062  1.00 0.00 ?  68  PHE A HZ   1  
ATOM 1060  N N    . ALA A 1 78  ? 35.267  71.500  66.667  1.00 0.00 ?  69  ALA A N    1  
ATOM 1061  C CA   . ALA A 1 78  ? 35.578  72.183  65.362  1.00 0.00 ?  69  ALA A CA   1  
ATOM 1062  C C    . ALA A 1 78  ? 36.224  71.218  64.268  1.00 0.00 ?  69  ALA A C    1  
ATOM 1063  O O    . ALA A 1 78  ? 35.784  71.288  63.079  1.00 0.00 ?  69  ALA A O    1  
ATOM 1064  C CB   . ALA A 1 78  ? 36.561  73.347  65.818  1.00 0.00 ?  69  ALA A CB   1  
ATOM 1065  H H    . ALA A 1 78  ? 35.755  71.798  67.500  1.00 0.00 ?  69  ALA A H    1  
ATOM 1066  H HA   . ALA A 1 78  ? 34.735  72.661  64.864  1.00 0.00 ?  69  ALA A HA   1  
ATOM 1067  H HB1  . ALA A 1 78  ? 36.027  74.012  66.495  1.00 0.00 ?  69  ALA A HB1  1  
ATOM 1068  H HB2  . ALA A 1 78  ? 37.531  73.019  66.195  1.00 0.00 ?  69  ALA A HB2  1  
ATOM 1069  H HB3  . ALA A 1 78  ? 36.858  73.890  64.921  1.00 0.00 ?  69  ALA A HB3  1  
ATOM 1070  N N    . VAL A 1 79  ? 36.936  70.158  64.642  1.00 0.00 ?  70  VAL A N    1  
ATOM 1071  C CA   . VAL A 1 79  ? 37.343  69.147  63.656  1.00 0.00 ?  70  VAL A CA   1  
ATOM 1072  C C    . VAL A 1 79  ? 36.219  68.229  63.379  1.00 0.00 ?  70  VAL A C    1  
ATOM 1073  O O    . VAL A 1 79  ? 36.085  67.877  62.226  1.00 0.00 ?  70  VAL A O    1  
ATOM 1074  C CB   . VAL A 1 79  ? 38.548  68.370  64.211  1.00 0.00 ?  70  VAL A CB   1  
ATOM 1075  C CG1  . VAL A 1 79  ? 38.850  67.019  63.626  1.00 0.00 ?  70  VAL A CG1  1  
ATOM 1076  C CG2  . VAL A 1 79  ? 39.793  69.170  64.035  1.00 0.00 ?  70  VAL A CG2  1  
ATOM 1077  H H    . VAL A 1 79  ? 36.963  69.937  65.627  1.00 0.00 ?  70  VAL A H    1  
ATOM 1078  H HA   . VAL A 1 79  ? 37.662  69.755  62.809  1.00 0.00 ?  70  VAL A HA   1  
ATOM 1079  H HB   . VAL A 1 79  ? 38.441  68.286  65.293  1.00 0.00 ?  70  VAL A HB   1  
ATOM 1080  H HG11 . VAL A 1 79  ? 38.999  67.203  62.562  1.00 0.00 ?  70  VAL A HG11 1  
ATOM 1081  H HG12 . VAL A 1 79  ? 39.778  66.581  63.994  1.00 0.00 ?  70  VAL A HG12 1  
ATOM 1082  H HG13 . VAL A 1 79  ? 37.992  66.389  63.863  1.00 0.00 ?  70  VAL A HG13 1  
ATOM 1083  H HG21 . VAL A 1 79  ? 40.648  68.698  64.519  1.00 0.00 ?  70  VAL A HG21 1  
ATOM 1084  H HG22 . VAL A 1 79  ? 40.070  69.292  62.988  1.00 0.00 ?  70  VAL A HG22 1  
ATOM 1085  H HG23 . VAL A 1 79  ? 39.679  70.179  64.431  1.00 0.00 ?  70  VAL A HG23 1  
ATOM 1086  N N    . THR A 1 80  ? 35.278  67.978  64.278  1.00 0.00 ?  71  THR A N    1  
ATOM 1087  C CA   . THR A 1 80  ? 34.032  67.286  63.867  1.00 0.00 ?  71  THR A CA   1  
ATOM 1088  C C    . THR A 1 80  ? 33.153  67.948  62.871  1.00 0.00 ?  71  THR A C    1  
ATOM 1089  O O    . THR A 1 80  ? 32.535  67.279  62.096  1.00 0.00 ?  71  THR A O    1  
ATOM 1090  C CB   . THR A 1 80  ? 33.278  66.834  65.128  1.00 0.00 ?  71  THR A CB   1  
ATOM 1091  O OG1  . THR A 1 80  ? 34.169  66.263  65.972  1.00 0.00 ?  71  THR A OG1  1  
ATOM 1092  C CG2  . THR A 1 80  ? 32.298  65.745  64.832  1.00 0.00 ?  71  THR A CG2  1  
ATOM 1093  H H    . THR A 1 80  ? 35.483  68.113  65.258  1.00 0.00 ?  71  THR A H    1  
ATOM 1094  H HA   . THR A 1 80  ? 34.322  66.380  63.334  1.00 0.00 ?  71  THR A HA   1  
ATOM 1095  H HB   . THR A 1 80  ? 32.746  67.692  65.540  1.00 0.00 ?  71  THR A HB   1  
ATOM 1096  H HG1  . THR A 1 80  ? 34.593  66.990  66.434  1.00 0.00 ?  71  THR A HG1  1  
ATOM 1097  H HG21 . THR A 1 80  ? 31.404  66.272  64.495  1.00 0.00 ?  71  THR A HG21 1  
ATOM 1098  H HG22 . THR A 1 80  ? 32.649  65.182  63.968  1.00 0.00 ?  71  THR A HG22 1  
ATOM 1099  H HG23 . THR A 1 80  ? 32.150  65.123  65.715  1.00 0.00 ?  71  THR A HG23 1  
ATOM 1100  N N    . VAL A 1 81  ? 33.248  69.327  62.814  1.00 0.00 ?  72  VAL A N    1  
ATOM 1101  C CA   . VAL A 1 81  ? 32.673  70.079  61.754  1.00 0.00 ?  72  VAL A CA   1  
ATOM 1102  C C    . VAL A 1 81  ? 33.331  69.759  60.422  1.00 0.00 ?  72  VAL A C    1  
ATOM 1103  O O    . VAL A 1 81  ? 32.625  69.527  59.438  1.00 0.00 ?  72  VAL A O    1  
ATOM 1104  C CB   . VAL A 1 81  ? 32.506  71.592  61.959  1.00 0.00 ?  72  VAL A CB   1  
ATOM 1105  C CG1  . VAL A 1 81  ? 31.846  72.316  60.803  1.00 0.00 ?  72  VAL A CG1  1  
ATOM 1106  C CG2  . VAL A 1 81  ? 31.540  71.956  63.067  1.00 0.00 ?  72  VAL A CG2  1  
ATOM 1107  H H    . VAL A 1 81  ? 33.776  69.692  63.594  1.00 0.00 ?  72  VAL A H    1  
ATOM 1108  H HA   . VAL A 1 81  ? 31.669  69.666  61.648  1.00 0.00 ?  72  VAL A HA   1  
ATOM 1109  H HB   . VAL A 1 81  ? 33.459  72.020  62.274  1.00 0.00 ?  72  VAL A HB   1  
ATOM 1110  H HG11 . VAL A 1 81  ? 32.408  72.185  59.879  1.00 0.00 ?  72  VAL A HG11 1  
ATOM 1111  H HG12 . VAL A 1 81  ? 30.921  71.852  60.459  1.00 0.00 ?  72  VAL A HG12 1  
ATOM 1112  H HG13 . VAL A 1 81  ? 31.724  73.371  61.043  1.00 0.00 ?  72  VAL A HG13 1  
ATOM 1113  H HG21 . VAL A 1 81  ? 30.628  71.362  63.001  1.00 0.00 ?  72  VAL A HG21 1  
ATOM 1114  H HG22 . VAL A 1 81  ? 32.014  71.749  64.027  1.00 0.00 ?  72  VAL A HG22 1  
ATOM 1115  H HG23 . VAL A 1 81  ? 31.422  73.036  63.151  1.00 0.00 ?  72  VAL A HG23 1  
ATOM 1116  N N    . GLY A 1 82  ? 34.646  69.590  60.392  1.00 0.00 ?  73  GLY A N    1  
ATOM 1117  C CA   . GLY A 1 82  ? 35.362  69.110  59.264  1.00 0.00 ?  73  GLY A CA   1  
ATOM 1118  C C    . GLY A 1 82  ? 34.841  67.602  58.950  1.00 0.00 ?  73  GLY A C    1  
ATOM 1119  O O    . GLY A 1 82  ? 34.395  67.315  57.771  1.00 0.00 ?  73  GLY A O    1  
ATOM 1120  H H    . GLY A 1 82  ? 35.212  69.864  61.184  1.00 0.00 ?  73  GLY A H    1  
ATOM 1121  H HA2  . GLY A 1 82  ? 35.108  69.725  58.401  1.00 0.00 ?  73  GLY A HA2  1  
ATOM 1122  H HA3  . GLY A 1 82  ? 36.448  69.038  59.331  1.00 0.00 ?  73  GLY A HA3  1  
ATOM 1123  N N    . SER A 1 83  ? 34.781  66.741  59.904  1.00 0.00 ?  74  SER A N    1  
ATOM 1124  C CA   . SER A 1 83  ? 34.529  65.302  59.797  1.00 0.00 ?  74  SER A CA   1  
ATOM 1125  C C    . SER A 1 83  ? 33.085  65.176  59.422  1.00 0.00 ?  74  SER A C    1  
ATOM 1126  O O    . SER A 1 83  ? 32.794  64.207  58.804  1.00 0.00 ?  74  SER A O    1  
ATOM 1127  C CB   . SER A 1 83  ? 34.813  64.457  61.043  1.00 0.00 ?  74  SER A CB   1  
ATOM 1128  O OG   . SER A 1 83  ? 36.252  64.303  61.070  1.00 0.00 ?  74  SER A OG   1  
ATOM 1129  H H    . SER A 1 83  ? 35.213  66.974  60.787  1.00 0.00 ?  74  SER A H    1  
ATOM 1130  H HA   . SER A 1 83  ? 35.135  64.916  58.978  1.00 0.00 ?  74  SER A HA   1  
ATOM 1131  H HB2  . SER A 1 83  ? 34.397  64.989  61.899  1.00 0.00 ?  74  SER A HB2  1  
ATOM 1132  H HB3  . SER A 1 83  ? 34.342  63.474  61.020  1.00 0.00 ?  74  SER A HB3  1  
ATOM 1133  H HG   . SER A 1 83  ? 36.533  63.454  60.721  1.00 0.00 ?  74  SER A HG   1  
ATOM 1134  N N    . LEU A 1 84  ? 32.119  66.106  59.664  1.00 0.00 ?  75  LEU A N    1  
ATOM 1135  C CA   . LEU A 1 84  ? 30.739  66.188  59.167  1.00 0.00 ?  75  LEU A CA   1  
ATOM 1136  C C    . LEU A 1 84  ? 30.611  66.475  57.626  1.00 0.00 ?  75  LEU A C    1  
ATOM 1137  O O    . LEU A 1 84  ? 30.066  65.645  56.887  1.00 0.00 ?  75  LEU A O    1  
ATOM 1138  C CB   . LEU A 1 84  ? 30.003  67.153  60.108  1.00 0.00 ?  75  LEU A CB   1  
ATOM 1139  C CG   . LEU A 1 84  ? 28.550  67.573  59.746  1.00 0.00 ?  75  LEU A CG   1  
ATOM 1140  C CD1  . LEU A 1 84  ? 27.564  66.373  59.850  1.00 0.00 ?  75  LEU A CD1  1  
ATOM 1141  C CD2  . LEU A 1 84  ? 28.125  68.715  60.742  1.00 0.00 ?  75  LEU A CD2  1  
ATOM 1142  H H    . LEU A 1 84  ? 32.430  66.860  60.258  1.00 0.00 ?  75  LEU A H    1  
ATOM 1143  H HA   . LEU A 1 84  ? 30.273  65.210  59.281  1.00 0.00 ?  75  LEU A HA   1  
ATOM 1144  H HB2  . LEU A 1 84  ? 29.915  66.559  61.017  1.00 0.00 ?  75  LEU A HB2  1  
ATOM 1145  H HB3  . LEU A 1 84  ? 30.628  68.045  60.148  1.00 0.00 ?  75  LEU A HB3  1  
ATOM 1146  H HG   . LEU A 1 84  ? 28.635  67.866  58.700  1.00 0.00 ?  75  LEU A HG   1  
ATOM 1147  H HD11 . LEU A 1 84  ? 26.561  66.692  59.567  1.00 0.00 ?  75  LEU A HD11 1  
ATOM 1148  H HD12 . LEU A 1 84  ? 27.926  65.749  59.033  1.00 0.00 ?  75  LEU A HD12 1  
ATOM 1149  H HD13 . LEU A 1 84  ? 27.711  65.881  60.811  1.00 0.00 ?  75  LEU A HD13 1  
ATOM 1150  H HD21 . LEU A 1 84  ? 28.801  69.566  60.646  1.00 0.00 ?  75  LEU A HD21 1  
ATOM 1151  H HD22 . LEU A 1 84  ? 27.136  69.115  60.521  1.00 0.00 ?  75  LEU A HD22 1  
ATOM 1152  H HD23 . LEU A 1 84  ? 28.139  68.516  61.813  1.00 0.00 ?  75  LEU A HD23 1  
ATOM 1153  N N    . ILE A 1 85  ? 31.294  67.574  57.144  1.00 0.00 ?  76  ILE A N    1  
ATOM 1154  C CA   . ILE A 1 85  ? 31.390  67.918  55.748  1.00 0.00 ?  76  ILE A CA   1  
ATOM 1155  C C    . ILE A 1 85  ? 31.969  66.816  54.877  1.00 0.00 ?  76  ILE A C    1  
ATOM 1156  O O    . ILE A 1 85  ? 31.402  66.473  53.860  1.00 0.00 ?  76  ILE A O    1  
ATOM 1157  C CB   . ILE A 1 85  ? 31.991  69.364  55.625  1.00 0.00 ?  76  ILE A CB   1  
ATOM 1158  C CG1  . ILE A 1 85  ? 31.090  70.479  56.239  1.00 0.00 ?  76  ILE A CG1  1  
ATOM 1159  C CG2  . ILE A 1 85  ? 32.139  69.731  54.096  1.00 0.00 ?  76  ILE A CG2  1  
ATOM 1160  C CD1  . ILE A 1 85  ? 31.956  71.507  56.863  1.00 0.00 ?  76  ILE A CD1  1  
ATOM 1161  H H    . ILE A 1 85  ? 31.838  68.214  57.708  1.00 0.00 ?  76  ILE A H    1  
ATOM 1162  H HA   . ILE A 1 85  ? 30.365  68.115  55.435  1.00 0.00 ?  76  ILE A HA   1  
ATOM 1163  H HB   . ILE A 1 85  ? 32.984  69.310  56.071  1.00 0.00 ?  76  ILE A HB   1  
ATOM 1164  H HG12 . ILE A 1 85  ? 30.602  70.929  55.373  1.00 0.00 ?  76  ILE A HG12 1  
ATOM 1165  H HG13 . ILE A 1 85  ? 30.310  69.994  56.824  1.00 0.00 ?  76  ILE A HG13 1  
ATOM 1166  H HG21 . ILE A 1 85  ? 32.725  68.997  53.542  1.00 0.00 ?  76  ILE A HG21 1  
ATOM 1167  H HG22 . ILE A 1 85  ? 31.130  69.721  53.684  1.00 0.00 ?  76  ILE A HG22 1  
ATOM 1168  H HG23 . ILE A 1 85  ? 32.513  70.737  53.911  1.00 0.00 ?  76  ILE A HG23 1  
ATOM 1169  H HD11 . ILE A 1 85  ? 32.914  71.211  57.288  1.00 0.00 ?  76  ILE A HD11 1  
ATOM 1170  H HD12 . ILE A 1 85  ? 32.114  72.298  56.128  1.00 0.00 ?  76  ILE A HD12 1  
ATOM 1171  H HD13 . ILE A 1 85  ? 31.481  71.858  57.779  1.00 0.00 ?  76  ILE A HD13 1  
ATOM 1172  N N    . LEU A 1 86  ? 32.982  66.191  55.382  1.00 0.00 ?  77  LEU A N    1  
ATOM 1173  C CA   . LEU A 1 86  ? 33.575  64.981  54.788  1.00 0.00 ?  77  LEU A CA   1  
ATOM 1174  C C    . LEU A 1 86  ? 32.741  63.689  55.111  1.00 0.00 ?  77  LEU A C    1  
ATOM 1175  O O    . LEU A 1 86  ? 32.658  62.833  54.230  1.00 0.00 ?  77  LEU A O    1  
ATOM 1176  C CB   . LEU A 1 86  ? 34.969  64.789  55.408  1.00 0.00 ?  77  LEU A CB   1  
ATOM 1177  C CG   . LEU A 1 86  ? 35.734  63.538  55.060  1.00 0.00 ?  77  LEU A CG   1  
ATOM 1178  C CD1  . LEU A 1 86  ? 35.993  63.297  53.534  1.00 0.00 ?  77  LEU A CD1  1  
ATOM 1179  C CD2  . LEU A 1 86  ? 37.083  63.659  55.636  1.00 0.00 ?  77  LEU A CD2  1  
ATOM 1180  H H    . LEU A 1 86  ? 33.402  66.517  56.241  1.00 0.00 ?  77  LEU A H    1  
ATOM 1181  H HA   . LEU A 1 86  ? 33.695  65.185  53.724  1.00 0.00 ?  77  LEU A HA   1  
ATOM 1182  H HB2  . LEU A 1 86  ? 35.503  65.649  55.001  1.00 0.00 ?  77  LEU A HB2  1  
ATOM 1183  H HB3  . LEU A 1 86  ? 34.863  64.960  56.479  1.00 0.00 ?  77  LEU A HB3  1  
ATOM 1184  H HG   . LEU A 1 86  ? 35.279  62.687  55.567  1.00 0.00 ?  77  LEU A HG   1  
ATOM 1185  H HD11 . LEU A 1 86  ? 36.408  64.212  53.112  1.00 0.00 ?  77  LEU A HD11 1  
ATOM 1186  H HD12 . LEU A 1 86  ? 36.598  62.406  53.367  1.00 0.00 ?  77  LEU A HD12 1  
ATOM 1187  H HD13 . LEU A 1 86  ? 35.030  63.101  53.061  1.00 0.00 ?  77  LEU A HD13 1  
ATOM 1188  H HD21 . LEU A 1 86  ? 36.960  63.862  56.699  1.00 0.00 ?  77  LEU A HD21 1  
ATOM 1189  H HD22 . LEU A 1 86  ? 37.512  62.686  55.398  1.00 0.00 ?  77  LEU A HD22 1  
ATOM 1190  H HD23 . LEU A 1 86  ? 37.768  64.342  55.133  1.00 0.00 ?  77  LEU A HD23 1  
ATOM 1191  N N    . GLY A 1 87  ? 32.061  63.593  56.288  1.00 0.00 ?  78  GLY A N    1  
ATOM 1192  C CA   . GLY A 1 87  ? 30.856  62.763  56.471  1.00 0.00 ?  78  GLY A CA   1  
ATOM 1193  C C    . GLY A 1 87  ? 29.870  62.647  55.284  1.00 0.00 ?  78  GLY A C    1  
ATOM 1194  O O    . GLY A 1 87  ? 29.497  61.566  54.825  1.00 0.00 ?  78  GLY A O    1  
ATOM 1195  H H    . GLY A 1 87  ? 32.219  64.400  56.873  1.00 0.00 ?  78  GLY A H    1  
ATOM 1196  H HA2  . GLY A 1 87  ? 31.246  61.792  56.777  1.00 0.00 ?  78  GLY A HA2  1  
ATOM 1197  H HA3  . GLY A 1 87  ? 30.287  63.167  57.308  1.00 0.00 ?  78  GLY A HA3  1  
ATOM 1198  N N    . TYR A 1 88  ? 29.408  63.824  54.798  1.00 0.00 ?  79  TYR A N    1  
ATOM 1199  C CA   . TYR A 1 88  ? 28.730  64.009  53.456  1.00 0.00 ?  79  TYR A CA   1  
ATOM 1200  C C    . TYR A 1 88  ? 29.501  63.627  52.188  1.00 0.00 ?  79  TYR A C    1  
ATOM 1201  O O    . TYR A 1 88  ? 28.885  62.965  51.313  1.00 0.00 ?  79  TYR A O    1  
ATOM 1202  C CB   . TYR A 1 88  ? 28.074  65.350  53.322  1.00 0.00 ?  79  TYR A CB   1  
ATOM 1203  C CG   . TYR A 1 88  ? 26.709  65.522  53.937  1.00 0.00 ?  79  TYR A CG   1  
ATOM 1204  C CD1  . TYR A 1 88  ? 26.614  65.584  55.359  1.00 0.00 ?  79  TYR A CD1  1  
ATOM 1205  C CD2  . TYR A 1 88  ? 25.577  65.522  53.115  1.00 0.00 ?  79  TYR A CD2  1  
ATOM 1206  C CE1  . TYR A 1 88  ? 25.357  65.658  55.915  1.00 0.00 ?  79  TYR A CE1  1  
ATOM 1207  C CE2  . TYR A 1 88  ? 24.295  65.487  53.730  1.00 0.00 ?  79  TYR A CE2  1  
ATOM 1208  C CZ   . TYR A 1 88  ? 24.166  65.640  55.122  1.00 0.00 ?  79  TYR A CZ   1  
ATOM 1209  O OH   . TYR A 1 88  ? 22.936  65.614  55.655  1.00 0.00 ?  79  TYR A OH   1  
ATOM 1210  H H    . TYR A 1 88  ? 29.618  64.645  55.347  1.00 0.00 ?  79  TYR A H    1  
ATOM 1211  H HA   . TYR A 1 88  ? 27.941  63.259  53.418  1.00 0.00 ?  79  TYR A HA   1  
ATOM 1212  H HB2  . TYR A 1 88  ? 28.672  66.130  53.793  1.00 0.00 ?  79  TYR A HB2  1  
ATOM 1213  H HB3  . TYR A 1 88  ? 27.979  65.564  52.257  1.00 0.00 ?  79  TYR A HB3  1  
ATOM 1214  H HD1  . TYR A 1 88  ? 27.429  65.686  56.061  1.00 0.00 ?  79  TYR A HD1  1  
ATOM 1215  H HD2  . TYR A 1 88  ? 25.731  65.407  52.053  1.00 0.00 ?  79  TYR A HD2  1  
ATOM 1216  H HE1  . TYR A 1 88  ? 25.141  65.734  56.970  1.00 0.00 ?  79  TYR A HE1  1  
ATOM 1217  H HE2  . TYR A 1 88  ? 23.422  65.316  53.118  1.00 0.00 ?  79  TYR A HE2  1  
ATOM 1218  H HH   . TYR A 1 88  ? 22.307  65.771  54.946  1.00 0.00 ?  79  TYR A HH   1  
ATOM 1219  N N    . THR A 1 89  ? 30.706  64.097  52.023  1.00 0.00 ?  80  THR A N    1  
ATOM 1220  C CA   . THR A 1 89  ? 31.511  63.790  50.903  1.00 0.00 ?  80  THR A CA   1  
ATOM 1221  C C    . THR A 1 89  ? 31.892  62.260  50.784  1.00 0.00 ?  80  THR A C    1  
ATOM 1222  O O    . THR A 1 89  ? 32.077  61.808  49.657  1.00 0.00 ?  80  THR A O    1  
ATOM 1223  C CB   . THR A 1 89  ? 32.667  64.818  50.791  1.00 0.00 ?  80  THR A CB   1  
ATOM 1224  O OG1  . THR A 1 89  ? 32.190  66.144  50.582  1.00 0.00 ?  80  THR A OG1  1  
ATOM 1225  C CG2  . THR A 1 89  ? 33.583  64.430  49.636  1.00 0.00 ?  80  THR A CG2  1  
ATOM 1226  H H    . THR A 1 89  ? 31.085  64.668  52.765  1.00 0.00 ?  80  THR A H    1  
ATOM 1227  H HA   . THR A 1 89  ? 30.879  63.999  50.040  1.00 0.00 ?  80  THR A HA   1  
ATOM 1228  H HB   . THR A 1 89  ? 33.259  64.782  51.706  1.00 0.00 ?  80  THR A HB   1  
ATOM 1229  H HG1  . THR A 1 89  ? 33.001  66.657  50.595  1.00 0.00 ?  80  THR A HG1  1  
ATOM 1230  H HG21 . THR A 1 89  ? 32.872  64.170  48.852  1.00 0.00 ?  80  THR A HG21 1  
ATOM 1231  H HG22 . THR A 1 89  ? 34.129  65.358  49.468  1.00 0.00 ?  80  THR A HG22 1  
ATOM 1232  H HG23 . THR A 1 89  ? 34.297  63.624  49.798  1.00 0.00 ?  80  THR A HG23 1  
ATOM 1233  N N    . ARG A 1 90  ? 32.139  61.591  51.918  1.00 0.00 ?  81  ARG A N    1  
ATOM 1234  C CA   . ARG A 1 90  ? 32.731  60.232  51.878  1.00 0.00 ?  81  ARG A CA   1  
ATOM 1235  C C    . ARG A 1 90  ? 32.030  59.021  52.682  1.00 0.00 ?  81  ARG A C    1  
ATOM 1236  O O    . ARG A 1 90  ? 31.838  57.966  52.076  1.00 0.00 ?  81  ARG A O    1  
ATOM 1237  C CB   . ARG A 1 90  ? 34.259  60.356  52.397  1.00 0.00 ?  81  ARG A CB   1  
ATOM 1238  C CG   . ARG A 1 90  ? 34.958  59.055  52.875  1.00 0.00 ?  81  ARG A CG   1  
ATOM 1239  C CD   . ARG A 1 90  ? 36.427  59.149  53.322  1.00 0.00 ?  81  ARG A CD   1  
ATOM 1240  N NE   . ARG A 1 90  ? 36.962  57.793  53.677  1.00 0.00 ?  81  ARG A NE   1  
ATOM 1241  C CZ   . ARG A 1 90  ? 37.964  57.725  54.555  1.00 0.00 ?  81  ARG A CZ   1  
ATOM 1242  N NH1  . ARG A 1 90  ? 38.711  58.687  54.997  1.00 0.00 ?  81  ARG A NH1  1  
ATOM 1243  N NH2  . ARG A 1 90  ? 38.384  56.626  55.017  1.00 0.00 1  81  ARG A NH2  1  
ATOM 1244  H H    . ARG A 1 90  ? 32.109  62.044  52.821  1.00 0.00 ?  81  ARG A H    1  
ATOM 1245  H HA   . ARG A 1 90  ? 32.754  59.889  50.844  1.00 0.00 ?  81  ARG A HA   1  
ATOM 1246  H HB2  . ARG A 1 90  ? 34.857  60.713  51.558  1.00 0.00 ?  81  ARG A HB2  1  
ATOM 1247  H HB3  . ARG A 1 90  ? 34.285  61.141  53.152  1.00 0.00 ?  81  ARG A HB3  1  
ATOM 1248  H HG2  . ARG A 1 90  ? 34.399  58.651  53.719  1.00 0.00 ?  81  ARG A HG2  1  
ATOM 1249  H HG3  . ARG A 1 90  ? 34.947  58.336  52.057  1.00 0.00 ?  81  ARG A HG3  1  
ATOM 1250  H HD2  . ARG A 1 90  ? 37.024  59.576  52.516  1.00 0.00 ?  81  ARG A HD2  1  
ATOM 1251  H HD3  . ARG A 1 90  ? 36.442  59.890  54.122  1.00 0.00 ?  81  ARG A HD3  1  
ATOM 1252  H HE   . ARG A 1 90  ? 36.565  56.966  53.255  1.00 0.00 ?  81  ARG A HE   1  
ATOM 1253  H HH11 . ARG A 1 90  ? 38.728  59.588  54.540  1.00 0.00 ?  81  ARG A HH11 1  
ATOM 1254  H HH12 . ARG A 1 90  ? 39.380  58.373  55.686  1.00 0.00 ?  81  ARG A HH12 1  
ATOM 1255  H HH21 . ARG A 1 90  ? 37.871  55.806  54.726  1.00 0.00 ?  81  ARG A HH21 1  
ATOM 1256  H HH22 . ARG A 1 90  ? 39.149  56.565  55.672  1.00 0.00 ?  81  ARG A HH22 1  
ATOM 1257  N N    . SER A 1 91  ? 31.406  59.298  53.867  1.00 0.00 ?  82  SER A N    1  
ATOM 1258  C CA   . SER A 1 91  ? 30.686  58.238  54.612  1.00 0.00 ?  82  SER A CA   1  
ATOM 1259  C C    . SER A 1 91  ? 29.293  58.056  54.035  1.00 0.00 ?  82  SER A C    1  
ATOM 1260  O O    . SER A 1 91  ? 28.897  56.859  54.008  1.00 0.00 ?  82  SER A O    1  
ATOM 1261  C CB   . SER A 1 91  ? 30.711  58.590  56.093  1.00 0.00 ?  82  SER A CB   1  
ATOM 1262  O OG   . SER A 1 91  ? 29.587  58.058  56.723  1.00 0.00 ?  82  SER A OG   1  
ATOM 1263  H H    . SER A 1 91  ? 31.374  60.243  54.220  1.00 0.00 ?  82  SER A H    1  
ATOM 1264  H HA   . SER A 1 91  ? 31.281  57.346  54.416  1.00 0.00 ?  82  SER A HA   1  
ATOM 1265  H HB2  . SER A 1 91  ? 31.607  58.091  56.465  1.00 0.00 ?  82  SER A HB2  1  
ATOM 1266  H HB3  . SER A 1 91  ? 30.659  59.678  56.122  1.00 0.00 ?  82  SER A HB3  1  
ATOM 1267  H HG   . SER A 1 91  ? 29.820  57.797  57.617  1.00 0.00 ?  82  SER A HG   1  
ATOM 1268  N N    . ARG A 1 92  ? 28.598  59.115  53.670  1.00 0.00 ?  83  ARG A N    1  
ATOM 1269  C CA   . ARG A 1 92  ? 27.367  59.052  52.919  1.00 0.00 ?  83  ARG A CA   1  
ATOM 1270  C C    . ARG A 1 92  ? 27.640  58.519  51.472  1.00 0.00 ?  83  ARG A C    1  
ATOM 1271  O O    . ARG A 1 92  ? 28.259  59.209  50.643  1.00 0.00 ?  83  ARG A O    1  
ATOM 1272  C CB   . ARG A 1 92  ? 26.920  60.546  52.910  1.00 0.00 ?  83  ARG A CB   1  
ATOM 1273  C CG   . ARG A 1 92  ? 25.739  60.793  52.026  1.00 0.00 ?  83  ARG A CG   1  
ATOM 1274  C CD   . ARG A 1 92  ? 25.284  62.245  52.189  1.00 0.00 ?  83  ARG A CD   1  
ATOM 1275  N NE   . ARG A 1 92  ? 24.076  62.650  51.498  1.00 0.00 ?  83  ARG A NE   1  
ATOM 1276  C CZ   . ARG A 1 92  ? 22.873  62.839  51.915  1.00 0.00 ?  83  ARG A CZ   1  
ATOM 1277  N NH1  . ARG A 1 92  ? 22.514  62.622  53.183  1.00 0.00 ?  83  ARG A NH1  1  
ATOM 1278  N NH2  . ARG A 1 92  ? 21.952  63.094  51.068  1.00 0.00 1  83  ARG A NH2  1  
ATOM 1279  H H    . ARG A 1 92  ? 29.022  60.017  53.835  1.00 0.00 ?  83  ARG A H    1  
ATOM 1280  H HA   . ARG A 1 92  ? 26.723  58.330  53.422  1.00 0.00 ?  83  ARG A HA   1  
ATOM 1281  H HB2  . ARG A 1 92  ? 26.733  60.720  53.970  1.00 0.00 ?  83  ARG A HB2  1  
ATOM 1282  H HB3  . ARG A 1 92  ? 27.793  61.119  52.598  1.00 0.00 ?  83  ARG A HB3  1  
ATOM 1283  H HG2  . ARG A 1 92  ? 25.978  60.515  50.999  1.00 0.00 ?  83  ARG A HG2  1  
ATOM 1284  H HG3  . ARG A 1 92  ? 24.906  60.164  52.340  1.00 0.00 ?  83  ARG A HG3  1  
ATOM 1285  H HD2  . ARG A 1 92  ? 25.164  62.438  53.254  1.00 0.00 ?  83  ARG A HD2  1  
ATOM 1286  H HD3  . ARG A 1 92  ? 26.110  62.926  51.986  1.00 0.00 ?  83  ARG A HD3  1  
ATOM 1287  H HE   . ARG A 1 92  ? 24.229  62.784  50.509  1.00 0.00 ?  83  ARG A HE   1  
ATOM 1288  H HH11 . ARG A 1 92  ? 23.183  62.265  53.850  1.00 0.00 ?  83  ARG A HH11 1  
ATOM 1289  H HH12 . ARG A 1 92  ? 21.550  62.433  53.413  1.00 0.00 ?  83  ARG A HH12 1  
ATOM 1290  H HH21 . ARG A 1 92  ? 22.214  63.241  50.103  1.00 0.00 ?  83  ARG A HH21 1  
ATOM 1291  H HH22 . ARG A 1 92  ? 20.981  63.131  51.342  1.00 0.00 ?  83  ARG A HH22 1  
ATOM 1292  N N    . LYS A 1 93  ? 27.088  57.365  51.122  1.00 0.00 ?  84  LYS A N    1  
ATOM 1293  C CA   . LYS A 1 93  ? 27.210  56.768  49.709  1.00 0.00 ?  84  LYS A CA   1  
ATOM 1294  C C    . LYS A 1 93  ? 25.867  56.685  48.923  1.00 0.00 ?  84  LYS A C    1  
ATOM 1295  O O    . LYS A 1 93  ? 25.336  55.576  48.706  1.00 0.00 ?  84  LYS A O    1  
ATOM 1296  C CB   . LYS A 1 93  ? 28.067  55.465  49.722  1.00 0.00 ?  84  LYS A CB   1  
ATOM 1297  C CG   . LYS A 1 93  ? 29.590  55.658  50.096  1.00 0.00 ?  84  LYS A CG   1  
ATOM 1298  C CD   . LYS A 1 93  ? 30.430  54.358  49.980  1.00 0.00 ?  84  LYS A CD   1  
ATOM 1299  C CE   . LYS A 1 93  ? 30.677  53.967  48.506  1.00 0.00 ?  84  LYS A CE   1  
ATOM 1300  N NZ   . LYS A 1 93  ? 31.592  54.881  47.840  1.00 0.00 1  84  LYS A NZ   1  
ATOM 1301  H H    . LYS A 1 93  ? 26.511  56.831  51.757  1.00 0.00 ?  84  LYS A H    1  
ATOM 1302  H HA   . LYS A 1 93  ? 27.863  57.448  49.161  1.00 0.00 ?  84  LYS A HA   1  
ATOM 1303  H HB2  . LYS A 1 93  ? 27.695  54.682  50.384  1.00 0.00 ?  84  LYS A HB2  1  
ATOM 1304  H HB3  . LYS A 1 93  ? 28.058  55.096  48.696  1.00 0.00 ?  84  LYS A HB3  1  
ATOM 1305  H HG2  . LYS A 1 93  ? 30.012  56.465  49.497  1.00 0.00 ?  84  LYS A HG2  1  
ATOM 1306  H HG3  . LYS A 1 93  ? 29.809  55.905  51.135  1.00 0.00 ?  84  LYS A HG3  1  
ATOM 1307  H HD2  . LYS A 1 93  ? 31.389  54.506  50.475  1.00 0.00 ?  84  LYS A HD2  1  
ATOM 1308  H HD3  . LYS A 1 93  ? 29.847  53.573  50.460  1.00 0.00 ?  84  LYS A HD3  1  
ATOM 1309  H HE2  . LYS A 1 93  ? 31.197  53.010  48.478  1.00 0.00 ?  84  LYS A HE2  1  
ATOM 1310  H HE3  . LYS A 1 93  ? 29.739  53.785  47.980  1.00 0.00 ?  84  LYS A HE3  1  
ATOM 1311  H HZ1  . LYS A 1 93  ? 31.402  55.845  48.077  1.00 0.00 ?  84  LYS A HZ1  1  
ATOM 1312  H HZ2  . LYS A 1 93  ? 32.561  54.647  48.003  1.00 0.00 ?  84  LYS A HZ2  1  
ATOM 1313  H HZ3  . LYS A 1 93  ? 31.560  54.767  46.837  1.00 0.00 ?  84  LYS A HZ3  1  
ATOM 1314  N N    . VAL A 1 94  ? 25.252  57.845  48.781  1.00 0.00 ?  85  VAL A N    1  
ATOM 1315  C CA   . VAL A 1 94  ? 23.918  58.042  48.164  1.00 0.00 ?  85  VAL A CA   1  
ATOM 1316  C C    . VAL A 1 94  ? 24.174  58.500  46.732  1.00 0.00 ?  85  VAL A C    1  
ATOM 1317  O O    . VAL A 1 94  ? 24.919  59.457  46.584  1.00 0.00 ?  85  VAL A O    1  
ATOM 1318  C CB   . VAL A 1 94  ? 23.102  59.082  48.925  1.00 0.00 ?  85  VAL A CB   1  
ATOM 1319  C CG1  . VAL A 1 94  ? 21.722  59.375  48.361  1.00 0.00 ?  85  VAL A CG1  1  
ATOM 1320  C CG2  . VAL A 1 94  ? 22.728  58.715  50.379  1.00 0.00 ?  85  VAL A CG2  1  
ATOM 1321  H H    . VAL A 1 94  ? 25.674  58.686  49.148  1.00 0.00 ?  85  VAL A H    1  
ATOM 1322  H HA   . VAL A 1 94  ? 23.273  57.165  48.110  1.00 0.00 ?  85  VAL A HA   1  
ATOM 1323  H HB   . VAL A 1 94  ? 23.657  60.019  48.874  1.00 0.00 ?  85  VAL A HB   1  
ATOM 1324  H HG11 . VAL A 1 94  ? 21.786  59.785  47.353  1.00 0.00 ?  85  VAL A HG11 1  
ATOM 1325  H HG12 . VAL A 1 94  ? 21.087  58.489  48.337  1.00 0.00 ?  85  VAL A HG12 1  
ATOM 1326  H HG13 . VAL A 1 94  ? 21.157  59.988  49.062  1.00 0.00 ?  85  VAL A HG13 1  
ATOM 1327  H HG21 . VAL A 1 94  ? 21.985  57.926  50.494  1.00 0.00 ?  85  VAL A HG21 1  
ATOM 1328  H HG22 . VAL A 1 94  ? 23.701  58.480  50.811  1.00 0.00 ?  85  VAL A HG22 1  
ATOM 1329  H HG23 . VAL A 1 94  ? 22.281  59.579  50.870  1.00 0.00 ?  85  VAL A HG23 1  
ATOM 1330  N N    . ASP A 1 95  ? 23.566  57.854  45.719  1.00 0.00 ?  86  ASP A N    1  
ATOM 1331  C CA   . ASP A 1 95  ? 23.811  58.316  44.337  1.00 0.00 ?  86  ASP A CA   1  
ATOM 1332  C C    . ASP A 1 95  ? 23.124  59.669  43.898  1.00 0.00 ?  86  ASP A C    1  
ATOM 1333  O O    . ASP A 1 95  ? 22.035  60.018  44.497  1.00 0.00 ?  86  ASP A O    1  
ATOM 1334  C CB   . ASP A 1 95  ? 23.451  57.170  43.366  1.00 0.00 ?  86  ASP A CB   1  
ATOM 1335  C CG   . ASP A 1 95  ? 24.497  56.043  43.449  1.00 0.00 ?  86  ASP A CG   1  
ATOM 1336  O OD1  . ASP A 1 95  ? 25.750  56.211  43.440  1.00 0.00 -1 86  ASP A OD1  1  
ATOM 1337  O OD2  . ASP A 1 95  ? 23.969  54.917  43.527  1.00 0.00 ?  86  ASP A OD2  1  
ATOM 1338  H H    . ASP A 1 95  ? 22.899  57.109  45.858  1.00 0.00 ?  86  ASP A H    1  
ATOM 1339  H HA   . ASP A 1 95  ? 24.846  58.625  44.194  1.00 0.00 ?  86  ASP A HA   1  
ATOM 1340  H HB2  . ASP A 1 95  ? 22.496  56.763  43.696  1.00 0.00 ?  86  ASP A HB2  1  
ATOM 1341  H HB3  . ASP A 1 95  ? 23.373  57.513  42.334  1.00 0.00 ?  86  ASP A HB3  1  
ATOM 1342  N N    . LYS A 1 96  ? 23.703  60.457  43.040  1.00 0.00 ?  87  LYS A N    1  
ATOM 1343  C CA   . LYS A 1 96  ? 23.068  61.685  42.532  1.00 0.00 ?  87  LYS A CA   1  
ATOM 1344  C C    . LYS A 1 96  ? 21.580  61.482  41.986  1.00 0.00 ?  87  LYS A C    1  
ATOM 1345  O O    . LYS A 1 96  ? 21.222  60.375  41.596  1.00 0.00 ?  87  LYS A O    1  
ATOM 1346  C CB   . LYS A 1 96  ? 23.920  62.279  41.437  1.00 0.00 ?  87  LYS A CB   1  
ATOM 1347  C CG   . LYS A 1 96  ? 24.211  61.421  40.164  1.00 0.00 ?  87  LYS A CG   1  
ATOM 1348  C CD   . LYS A 1 96  ? 25.028  62.179  39.132  1.00 0.00 ?  87  LYS A CD   1  
ATOM 1349  C CE   . LYS A 1 96  ? 26.040  61.306  38.415  1.00 0.00 ?  87  LYS A CE   1  
ATOM 1350  N NZ   . LYS A 1 96  ? 25.308  60.450  37.422  1.00 0.00 1  87  LYS A NZ   1  
ATOM 1351  H H    . LYS A 1 96  ? 24.595  60.178  42.655  1.00 0.00 ?  87  LYS A H    1  
ATOM 1352  H HA   . LYS A 1 96  ? 23.032  62.380  43.371  1.00 0.00 ?  87  LYS A HA   1  
ATOM 1353  H HB2  . LYS A 1 96  ? 23.426  63.186  41.090  1.00 0.00 ?  87  LYS A HB2  1  
ATOM 1354  H HB3  . LYS A 1 96  ? 24.887  62.701  41.709  1.00 0.00 ?  87  LYS A HB3  1  
ATOM 1355  H HG2  . LYS A 1 96  ? 24.779  60.568  40.532  1.00 0.00 ?  87  LYS A HG2  1  
ATOM 1356  H HG3  . LYS A 1 96  ? 23.323  60.939  39.756  1.00 0.00 ?  87  LYS A HG3  1  
ATOM 1357  H HD2  . LYS A 1 96  ? 24.351  62.606  38.392  1.00 0.00 ?  87  LYS A HD2  1  
ATOM 1358  H HD3  . LYS A 1 96  ? 25.442  63.043  39.649  1.00 0.00 ?  87  LYS A HD3  1  
ATOM 1359  H HE2  . LYS A 1 96  ? 26.870  61.855  37.970  1.00 0.00 ?  87  LYS A HE2  1  
ATOM 1360  H HE3  . LYS A 1 96  ? 26.480  60.637  39.155  1.00 0.00 ?  87  LYS A HE3  1  
ATOM 1361  H HZ1  . LYS A 1 96  ? 24.575  59.839  37.755  1.00 0.00 ?  87  LYS A HZ1  1  
ATOM 1362  H HZ2  . LYS A 1 96  ? 24.870  60.983  36.683  1.00 0.00 ?  87  LYS A HZ2  1  
ATOM 1363  H HZ3  . LYS A 1 96  ? 25.998  59.902  36.927  1.00 0.00 ?  87  LYS A HZ3  1  
ATOM 1364  N N    . ARG A 1 97  ? 20.757  62.516  42.015  1.00 0.00 ?  88  ARG A N    1  
ATOM 1365  C CA   . ARG A 1 97  ? 19.534  62.642  41.265  1.00 0.00 ?  88  ARG A CA   1  
ATOM 1366  C C    . ARG A 1 97  ? 19.741  62.931  39.733  1.00 0.00 ?  88  ARG A C    1  
ATOM 1367  O O    . ARG A 1 97  ? 18.997  62.413  38.935  1.00 0.00 ?  88  ARG A O    1  
ATOM 1368  C CB   . ARG A 1 97  ? 18.440  63.572  41.910  1.00 0.00 ?  88  ARG A CB   1  
ATOM 1369  C CG   . ARG A 1 97  ? 17.995  63.169  43.308  1.00 0.00 ?  88  ARG A CG   1  
ATOM 1370  C CD   . ARG A 1 97  ? 16.692  63.885  43.801  1.00 0.00 ?  88  ARG A CD   1  
ATOM 1371  N NE   . ARG A 1 97  ? 16.960  65.285  44.215  1.00 0.00 ?  88  ARG A NE   1  
ATOM 1372  C CZ   . ARG A 1 97  ? 16.097  66.286  44.396  1.00 0.00 ?  88  ARG A CZ   1  
ATOM 1373  N NH1  . ARG A 1 97  ? 14.784  66.295  43.998  1.00 0.00 ?  88  ARG A NH1  1  
ATOM 1374  N NH2  . ARG A 1 97  ? 16.507  67.323  45.025  1.00 0.00 1  88  ARG A NH2  1  
ATOM 1375  H H    . ARG A 1 97  ? 21.161  63.382  42.341  1.00 0.00 ?  88  ARG A H    1  
ATOM 1376  H HA   . ARG A 1 97  ? 19.060  61.663  41.341  1.00 0.00 ?  88  ARG A HA   1  
ATOM 1377  H HB2  . ARG A 1 97  ? 18.845  64.575  42.044  1.00 0.00 ?  88  ARG A HB2  1  
ATOM 1378  H HB3  . ARG A 1 97  ? 17.559  63.639  41.272  1.00 0.00 ?  88  ARG A HB3  1  
ATOM 1379  H HG2  . ARG A 1 97  ? 17.802  62.097  43.336  1.00 0.00 ?  88  ARG A HG2  1  
ATOM 1380  H HG3  . ARG A 1 97  ? 18.783  63.214  44.059  1.00 0.00 ?  88  ARG A HG3  1  
ATOM 1381  H HD2  . ARG A 1 97  ? 15.988  63.817  42.971  1.00 0.00 ?  88  ARG A HD2  1  
ATOM 1382  H HD3  . ARG A 1 97  ? 16.318  63.449  44.727  1.00 0.00 ?  88  ARG A HD3  1  
ATOM 1383  H HE   . ARG A 1 97  ? 17.894  65.498  44.534  1.00 0.00 ?  88  ARG A HE   1  
ATOM 1384  H HH11 . ARG A 1 97  ? 14.297  65.438  43.775  1.00 0.00 ?  88  ARG A HH11 1  
ATOM 1385  H HH12 . ARG A 1 97  ? 14.239  67.040  44.407  1.00 0.00 ?  88  ARG A HH12 1  
ATOM 1386  H HH21 . ARG A 1 97  ? 17.451  67.443  45.364  1.00 0.00 ?  88  ARG A HH21 1  
ATOM 1387  H HH22 . ARG A 1 97  ? 15.958  68.129  45.286  1.00 0.00 ?  88  ARG A HH22 1  
ATOM 1388  N N    . SER A 1 98  ? 20.658  63.785  39.340  1.00 0.00 ?  89  SER A N    1  
ATOM 1389  C CA   . SER A 1 98  ? 20.939  64.364  38.064  1.00 0.00 ?  89  SER A CA   1  
ATOM 1390  C C    . SER A 1 98  ? 22.326  64.909  37.940  1.00 0.00 ?  89  SER A C    1  
ATOM 1391  O O    . SER A 1 98  ? 23.018  65.048  38.901  1.00 0.00 ?  89  SER A O    1  
ATOM 1392  C CB   . SER A 1 98  ? 19.869  65.427  37.616  1.00 0.00 ?  89  SER A CB   1  
ATOM 1393  O OG   . SER A 1 98  ? 19.983  66.594  38.492  1.00 0.00 ?  89  SER A OG   1  
ATOM 1394  H H    . SER A 1 98  ? 21.126  64.347  40.036  1.00 0.00 ?  89  SER A H    1  
ATOM 1395  H HA   . SER A 1 98  ? 20.740  63.530  37.392  1.00 0.00 ?  89  SER A HA   1  
ATOM 1396  H HB2  . SER A 1 98  ? 19.973  65.496  36.533  1.00 0.00 ?  89  SER A HB2  1  
ATOM 1397  H HB3  . SER A 1 98  ? 18.923  64.953  37.880  1.00 0.00 ?  89  SER A HB3  1  
ATOM 1398  H HG   . SER A 1 98  ? 19.468  67.322  38.137  1.00 0.00 ?  89  SER A HG   1  
ATOM 1399  N N    . ASP A 1 99  ? 22.806  65.004  36.712  1.00 0.00 ?  90  ASP A N    1  
ATOM 1400  C CA   . ASP A 1 99  ? 24.222  65.409  36.402  1.00 0.00 ?  90  ASP A CA   1  
ATOM 1401  C C    . ASP A 1 99  ? 24.735  66.816  36.685  1.00 0.00 ?  90  ASP A C    1  
ATOM 1402  O O    . ASP A 1 99  ? 24.008  67.758  36.398  1.00 0.00 ?  90  ASP A O    1  
ATOM 1403  C CB   . ASP A 1 99  ? 24.588  64.832  35.014  1.00 0.00 ?  90  ASP A CB   1  
ATOM 1404  C CG   . ASP A 1 99  ? 25.698  65.614  34.301  1.00 0.00 ?  90  ASP A CG   1  
ATOM 1405  O OD1  . ASP A 1 99  ? 25.580  66.815  34.005  1.00 0.00 ?  90  ASP A OD1  1  
ATOM 1406  O OD2  . ASP A 1 99  ? 26.811  65.093  34.211  1.00 0.00 -1 90  ASP A OD2  1  
ATOM 1407  H H    . ASP A 1 99  ? 22.237  64.801  35.903  1.00 0.00 ?  90  ASP A H    1  
ATOM 1408  H HA   . ASP A 1 99  ? 24.821  64.820  37.097  1.00 0.00 ?  90  ASP A HA   1  
ATOM 1409  H HB2  . ASP A 1 99  ? 24.972  63.812  35.038  1.00 0.00 ?  90  ASP A HB2  1  
ATOM 1410  H HB3  . ASP A 1 99  ? 23.696  64.926  34.395  1.00 0.00 ?  90  ASP A HB3  1  
ATOM 1411  N N    . PRO A 1 100 ? 25.991  67.037  37.132  1.00 0.00 ?  91  PRO A N    1  
ATOM 1412  C CA   . PRO A 1 100 ? 26.398  68.346  37.614  1.00 0.00 ?  91  PRO A CA   1  
ATOM 1413  C C    . PRO A 1 100 ? 26.172  69.556  36.703  1.00 0.00 ?  91  PRO A C    1  
ATOM 1414  O O    . PRO A 1 100 ? 26.309  70.700  37.159  1.00 0.00 ?  91  PRO A O    1  
ATOM 1415  C CB   . PRO A 1 100 ? 27.870  68.161  38.090  1.00 0.00 ?  91  PRO A CB   1  
ATOM 1416  C CG   . PRO A 1 100 ? 27.985  66.641  38.350  1.00 0.00 ?  91  PRO A CG   1  
ATOM 1417  C CD   . PRO A 1 100 ? 26.946  66.045  37.506  1.00 0.00 ?  91  PRO A CD   1  
ATOM 1418  H HA   . PRO A 1 100 ? 25.861  68.649  38.513  1.00 0.00 ?  91  PRO A HA   1  
ATOM 1419  H HB2  . PRO A 1 100 ? 28.485  68.323  37.205  1.00 0.00 ?  91  PRO A HB2  1  
ATOM 1420  H HB3  . PRO A 1 100 ? 28.207  68.723  38.961  1.00 0.00 ?  91  PRO A HB3  1  
ATOM 1421  H HG2  . PRO A 1 100 ? 28.938  66.236  38.010  1.00 0.00 ?  91  PRO A HG2  1  
ATOM 1422  H HG3  . PRO A 1 100 ? 27.922  66.387  39.409  1.00 0.00 ?  91  PRO A HG3  1  
ATOM 1423  H HD2  . PRO A 1 100 ? 27.326  65.466  36.665  1.00 0.00 ?  91  PRO A HD2  1  
ATOM 1424  H HD3  . PRO A 1 100 ? 26.527  65.421  38.295  1.00 0.00 ?  91  PRO A HD3  1  
ATOM 1425  N N    . TYR A 1 101 ? 26.160  69.340  35.411  1.00 0.00 ?  92  TYR A N    1  
ATOM 1426  C CA   . TYR A 1 101 ? 25.915  70.339  34.377  1.00 0.00 ?  92  TYR A CA   1  
ATOM 1427  C C    . TYR A 1 101 ? 24.434  70.430  33.869  1.00 0.00 ?  92  TYR A C    1  
ATOM 1428  O O    . TYR A 1 101 ? 24.032  71.530  33.439  1.00 0.00 ?  92  TYR A O    1  
ATOM 1429  C CB   . TYR A 1 101 ? 26.854  70.117  33.133  1.00 0.00 ?  92  TYR A CB   1  
ATOM 1430  C CG   . TYR A 1 101 ? 28.302  70.325  33.621  1.00 0.00 ?  92  TYR A CG   1  
ATOM 1431  C CD1  . TYR A 1 101 ? 29.104  69.307  34.189  1.00 0.00 ?  92  TYR A CD1  1  
ATOM 1432  C CD2  . TYR A 1 101 ? 28.838  71.527  33.574  1.00 0.00 ?  92  TYR A CD2  1  
ATOM 1433  C CE1  . TYR A 1 101 ? 30.480  69.530  34.472  1.00 0.00 ?  92  TYR A CE1  1  
ATOM 1434  C CE2  . TYR A 1 101 ? 30.158  71.857  34.009  1.00 0.00 ?  92  TYR A CE2  1  
ATOM 1435  C CZ   . TYR A 1 101 ? 30.954  70.857  34.502  1.00 0.00 ?  92  TYR A CZ   1  
ATOM 1436  O OH   . TYR A 1 101 ? 32.143  71.267  35.015  1.00 0.00 ?  92  TYR A OH   1  
ATOM 1437  H H    . TYR A 1 101 ? 26.269  68.382  35.109  1.00 0.00 ?  92  TYR A H    1  
ATOM 1438  H HA   . TYR A 1 101 ? 26.225  71.306  34.771  1.00 0.00 ?  92  TYR A HA   1  
ATOM 1439  H HB2  . TYR A 1 101 ? 26.815  69.091  32.766  1.00 0.00 ?  92  TYR A HB2  1  
ATOM 1440  H HB3  . TYR A 1 101 ? 26.483  70.750  32.326  1.00 0.00 ?  92  TYR A HB3  1  
ATOM 1441  H HD1  . TYR A 1 101 ? 28.695  68.316  34.319  1.00 0.00 ?  92  TYR A HD1  1  
ATOM 1442  H HD2  . TYR A 1 101 ? 28.182  72.311  33.226  1.00 0.00 ?  92  TYR A HD2  1  
ATOM 1443  H HE1  . TYR A 1 101 ? 31.056  68.737  34.928  1.00 0.00 ?  92  TYR A HE1  1  
ATOM 1444  H HE2  . TYR A 1 101 ? 30.394  72.910  34.051  1.00 0.00 ?  92  TYR A HE2  1  
ATOM 1445  H HH   . TYR A 1 101 ? 32.405  72.176  34.853  1.00 0.00 ?  92  TYR A HH   1  
ATOM 1446  N N    . HIS A 1 102 ? 23.754  69.291  33.806  1.00 0.00 ?  93  HIS A N    1  
ATOM 1447  C CA   . HIS A 1 102 ? 22.342  69.048  33.520  1.00 0.00 ?  93  HIS A CA   1  
ATOM 1448  C C    . HIS A 1 102 ? 21.529  69.737  34.602  1.00 0.00 ?  93  HIS A C    1  
ATOM 1449  O O    . HIS A 1 102 ? 20.497  70.312  34.266  1.00 0.00 ?  93  HIS A O    1  
ATOM 1450  C CB   . HIS A 1 102 ? 22.059  67.585  33.390  1.00 0.00 ?  93  HIS A CB   1  
ATOM 1451  C CG   . HIS A 1 102 ? 20.631  67.163  33.275  1.00 0.00 ?  93  HIS A CG   1  
ATOM 1452  N ND1  . HIS A 1 102 ? 19.724  67.078  34.325  1.00 0.00 ?  93  HIS A ND1  1  
ATOM 1453  C CD2  . HIS A 1 102 ? 20.047  66.581  32.107  1.00 0.00 ?  93  HIS A CD2  1  
ATOM 1454  C CE1  . HIS A 1 102 ? 18.631  66.472  33.848  1.00 0.00 ?  93  HIS A CE1  1  
ATOM 1455  N NE2  . HIS A 1 102 ? 18.791  66.177  32.515  1.00 0.00 ?  93  HIS A NE2  1  
ATOM 1456  H H    . HIS A 1 102 ? 24.254  68.447  34.045  1.00 0.00 ?  93  HIS A H    1  
ATOM 1457  H HA   . HIS A 1 102 ? 22.070  69.532  32.582  1.00 0.00 ?  93  HIS A HA   1  
ATOM 1458  H HB2  . HIS A 1 102 ? 22.579  67.096  32.566  1.00 0.00 ?  93  HIS A HB2  1  
ATOM 1459  H HB3  . HIS A 1 102 ? 22.447  67.096  34.284  1.00 0.00 ?  93  HIS A HB3  1  
ATOM 1460  H HD2  . HIS A 1 102 ? 20.448  66.391  31.122  1.00 0.00 ?  93  HIS A HD2  1  
ATOM 1461  H HE1  . HIS A 1 102 ? 17.650  66.446  34.298  1.00 0.00 ?  93  HIS A HE1  1  
ATOM 1462  H HE2  . HIS A 1 102 ? 18.103  65.854  31.849  1.00 0.00 ?  93  HIS A HE2  1  
ATOM 1463  N N    . VAL A 1 103 ? 21.900  69.777  35.880  1.00 0.00 ?  94  VAL A N    1  
ATOM 1464  C CA   . VAL A 1 103 ? 21.058  70.353  36.974  1.00 0.00 ?  94  VAL A CA   1  
ATOM 1465  C C    . VAL A 1 103 ? 20.935  71.904  36.881  1.00 0.00 ?  94  VAL A C    1  
ATOM 1466  O O    . VAL A 1 103 ? 19.845  72.442  37.097  1.00 0.00 ?  94  VAL A O    1  
ATOM 1467  C CB   . VAL A 1 103 ? 21.578  69.730  38.319  1.00 0.00 ?  94  VAL A CB   1  
ATOM 1468  C CG1  . VAL A 1 103 ? 23.022  70.189  38.606  1.00 0.00 ?  94  VAL A CG1  1  
ATOM 1469  C CG2  . VAL A 1 103 ? 20.602  69.965  39.488  1.00 0.00 ?  94  VAL A CG2  1  
ATOM 1470  H H    . VAL A 1 103 ? 22.676  69.178  36.126  1.00 0.00 ?  94  VAL A H    1  
ATOM 1471  H HA   . VAL A 1 103 ? 20.072  69.934  36.770  1.00 0.00 ?  94  VAL A HA   1  
ATOM 1472  H HB   . VAL A 1 103 ? 21.713  68.675  38.078  1.00 0.00 ?  94  VAL A HB   1  
ATOM 1473  H HG11 . VAL A 1 103 ? 23.639  70.096  37.712  1.00 0.00 ?  94  VAL A HG11 1  
ATOM 1474  H HG12 . VAL A 1 103 ? 23.156  71.197  38.999  1.00 0.00 ?  94  VAL A HG12 1  
ATOM 1475  H HG13 . VAL A 1 103 ? 23.451  69.516  39.349  1.00 0.00 ?  94  VAL A HG13 1  
ATOM 1476  H HG21 . VAL A 1 103 ? 20.473  71.044  39.574  1.00 0.00 ?  94  VAL A HG21 1  
ATOM 1477  H HG22 . VAL A 1 103 ? 19.687  69.496  39.126  1.00 0.00 ?  94  VAL A HG22 1  
ATOM 1478  H HG23 . VAL A 1 103 ? 21.053  69.360  40.274  1.00 0.00 ?  94  VAL A HG23 1  
ATOM 1479  N N    . TYR A 1 104 ? 21.884  72.497  36.162  1.00 0.00 ?  95  TYR A N    1  
ATOM 1480  C CA   . TYR A 1 104 ? 21.925  73.906  35.842  1.00 0.00 ?  95  TYR A CA   1  
ATOM 1481  C C    . TYR A 1 104 ? 21.289  74.370  34.523  1.00 0.00 ?  95  TYR A C    1  
ATOM 1482  O O    . TYR A 1 104 ? 21.354  75.534  34.216  1.00 0.00 ?  95  TYR A O    1  
ATOM 1483  C CB   . TYR A 1 104 ? 23.335  74.451  36.078  1.00 0.00 ?  95  TYR A CB   1  
ATOM 1484  C CG   . TYR A 1 104 ? 23.775  74.276  37.569  1.00 0.00 ?  95  TYR A CG   1  
ATOM 1485  C CD1  . TYR A 1 104 ? 23.163  74.904  38.677  1.00 0.00 ?  95  TYR A CD1  1  
ATOM 1486  C CD2  . TYR A 1 104 ? 24.831  73.385  37.782  1.00 0.00 ?  95  TYR A CD2  1  
ATOM 1487  C CE1  . TYR A 1 104 ? 23.487  74.515  40.044  1.00 0.00 ?  95  TYR A CE1  1  
ATOM 1488  C CE2  . TYR A 1 104 ? 25.250  73.114  39.087  1.00 0.00 ?  95  TYR A CE2  1  
ATOM 1489  C CZ   . TYR A 1 104 ? 24.584  73.707  40.194  1.00 0.00 ?  95  TYR A CZ   1  
ATOM 1490  O OH   . TYR A 1 104 ? 24.908  73.146  41.430  1.00 0.00 ?  95  TYR A OH   1  
ATOM 1491  H H    . TYR A 1 104 ? 22.739  71.977  36.025  1.00 0.00 ?  95  TYR A H    1  
ATOM 1492  H HA   . TYR A 1 104 ? 21.299  74.316  36.635  1.00 0.00 ?  95  TYR A HA   1  
ATOM 1493  H HB2  . TYR A 1 104 ? 23.878  73.960  35.270  1.00 0.00 ?  95  TYR A HB2  1  
ATOM 1494  H HB3  . TYR A 1 104 ? 23.401  75.506  35.810  1.00 0.00 ?  95  TYR A HB3  1  
ATOM 1495  H HD1  . TYR A 1 104 ? 22.244  75.443  38.494  1.00 0.00 ?  95  TYR A HD1  1  
ATOM 1496  H HD2  . TYR A 1 104 ? 25.301  72.803  37.003  1.00 0.00 ?  95  TYR A HD2  1  
ATOM 1497  H HE1  . TYR A 1 104 ? 22.898  74.889  40.868  1.00 0.00 ?  95  TYR A HE1  1  
ATOM 1498  H HE2  . TYR A 1 104 ? 26.051  72.411  39.259  1.00 0.00 ?  95  TYR A HE2  1  
ATOM 1499  H HH   . TYR A 1 104 ? 25.785  72.759  41.382  1.00 0.00 ?  95  TYR A HH   1  
ATOM 1500  N N    . ILE A 1 105 ? 20.561  73.555  33.811  1.00 0.00 ?  96  ILE A N    1  
ATOM 1501  C CA   . ILE A 1 105 ? 19.833  73.934  32.580  1.00 0.00 ?  96  ILE A CA   1  
ATOM 1502  C C    . ILE A 1 105 ? 18.750  74.874  33.048  1.00 0.00 ?  96  ILE A C    1  
ATOM 1503  O O    . ILE A 1 105 ? 17.894  74.466  33.881  1.00 0.00 ?  96  ILE A O    1  
ATOM 1504  C CB   . ILE A 1 105 ? 19.307  72.687  31.940  1.00 0.00 ?  96  ILE A CB   1  
ATOM 1505  C CG1  . ILE A 1 105 ? 20.495  72.110  31.191  1.00 0.00 ?  96  ILE A CG1  1  
ATOM 1506  C CG2  . ILE A 1 105 ? 17.991  72.782  31.093  1.00 0.00 ?  96  ILE A CG2  1  
ATOM 1507  C CD1  . ILE A 1 105 ? 20.275  70.656  30.854  1.00 0.00 ?  96  ILE A CD1  1  
ATOM 1508  H H    . ILE A 1 105 ? 20.492  72.649  34.251  1.00 0.00 ?  96  ILE A H    1  
ATOM 1509  H HA   . ILE A 1 105 ? 20.514  74.438  31.893  1.00 0.00 ?  96  ILE A HA   1  
ATOM 1510  H HB   . ILE A 1 105 ? 19.210  71.928  32.716  1.00 0.00 ?  96  ILE A HB   1  
ATOM 1511  H HG12 . ILE A 1 105 ? 20.721  72.649  30.270  1.00 0.00 ?  96  ILE A HG12 1  
ATOM 1512  H HG13 . ILE A 1 105 ? 21.380  72.079  31.826  1.00 0.00 ?  96  ILE A HG13 1  
ATOM 1513  H HG21 . ILE A 1 105 ? 17.074  73.182  31.525  1.00 0.00 ?  96  ILE A HG21 1  
ATOM 1514  H HG22 . ILE A 1 105 ? 18.234  73.474  30.285  1.00 0.00 ?  96  ILE A HG22 1  
ATOM 1515  H HG23 . ILE A 1 105 ? 17.639  71.829  30.698  1.00 0.00 ?  96  ILE A HG23 1  
ATOM 1516  H HD11 . ILE A 1 105 ? 19.460  70.621  30.130  1.00 0.00 ?  96  ILE A HD11 1  
ATOM 1517  H HD12 . ILE A 1 105 ? 21.115  70.207  30.324  1.00 0.00 ?  96  ILE A HD12 1  
ATOM 1518  H HD13 . ILE A 1 105 ? 20.119  70.031  31.733  1.00 0.00 ?  96  ILE A HD13 1  
ATOM 1519  N N    . LYS A 1 106 ? 18.847  76.142  32.558  1.00 0.00 ?  97  LYS A N    1  
ATOM 1520  C CA   . LYS A 1 106 ? 18.145  77.314  33.110  1.00 0.00 ?  97  LYS A CA   1  
ATOM 1521  C C    . LYS A 1 106 ? 16.597  77.246  33.117  1.00 0.00 ?  97  LYS A C    1  
ATOM 1522  O O    . LYS A 1 106 ? 15.958  77.940  33.850  1.00 0.00 ?  97  LYS A O    1  
ATOM 1523  C CB   . LYS A 1 106 ? 18.695  78.468  32.335  1.00 0.00 ?  97  LYS A CB   1  
ATOM 1524  C CG   . LYS A 1 106 ? 18.164  78.736  30.892  1.00 0.00 ?  97  LYS A CG   1  
ATOM 1525  C CD   . LYS A 1 106 ? 18.573  80.093  30.381  1.00 0.00 ?  97  LYS A CD   1  
ATOM 1526  C CE   . LYS A 1 106 ? 18.113  80.504  28.939  1.00 0.00 ?  97  LYS A CE   1  
ATOM 1527  N NZ   . LYS A 1 106 ? 16.676  80.114  28.730  1.00 0.00 1  97  LYS A NZ   1  
ATOM 1528  H H    . LYS A 1 106 ? 19.616  76.340  31.933  1.00 0.00 ?  97  LYS A H    1  
ATOM 1529  H HA   . LYS A 1 106 ? 18.330  77.371  34.183  1.00 0.00 ?  97  LYS A HA   1  
ATOM 1530  H HB2  . LYS A 1 106 ? 18.409  79.376  32.866  1.00 0.00 ?  97  LYS A HB2  1  
ATOM 1531  H HB3  . LYS A 1 106 ? 19.781  78.454  32.420  1.00 0.00 ?  97  LYS A HB3  1  
ATOM 1532  H HG2  . LYS A 1 106 ? 18.417  77.867  30.286  1.00 0.00 ?  97  LYS A HG2  1  
ATOM 1533  H HG3  . LYS A 1 106 ? 17.078  78.709  30.978  1.00 0.00 ?  97  LYS A HG3  1  
ATOM 1534  H HD2  . LYS A 1 106 ? 18.172  80.825  31.081  1.00 0.00 ?  97  LYS A HD2  1  
ATOM 1535  H HD3  . LYS A 1 106 ? 19.660  80.151  30.433  1.00 0.00 ?  97  LYS A HD3  1  
ATOM 1536  H HE2  . LYS A 1 106 ? 18.298  81.534  28.635  1.00 0.00 ?  97  LYS A HE2  1  
ATOM 1537  H HE3  . LYS A 1 106 ? 18.664  79.960  28.173  1.00 0.00 ?  97  LYS A HE3  1  
ATOM 1538  H HZ1  . LYS A 1 106 ? 16.022  80.434  29.429  1.00 0.00 ?  97  LYS A HZ1  1  
ATOM 1539  H HZ2  . LYS A 1 106 ? 16.243  80.380  27.857  1.00 0.00 ?  97  LYS A HZ2  1  
ATOM 1540  H HZ3  . LYS A 1 106 ? 16.622  79.107  28.664  1.00 0.00 ?  97  LYS A HZ3  1  
ATOM 1541  N N    . ASN A 1 107 ? 15.840  76.528  32.171  1.00 0.00 ?  98  ASN A N    1  
ATOM 1542  C CA   . ASN A 1 107 ? 14.341  76.518  32.178  1.00 0.00 ?  98  ASN A CA   1  
ATOM 1543  C C    . ASN A 1 107 ? 13.753  75.451  33.187  1.00 0.00 ?  98  ASN A C    1  
ATOM 1544  O O    . ASN A 1 107 ? 12.610  74.944  33.105  1.00 0.00 ?  98  ASN A O    1  
ATOM 1545  C CB   . ASN A 1 107 ? 13.923  76.304  30.649  1.00 0.00 ?  98  ASN A CB   1  
ATOM 1546  C CG   . ASN A 1 107 ? 14.294  77.455  29.721  1.00 0.00 ?  98  ASN A CG   1  
ATOM 1547  O OD1  . ASN A 1 107 ? 15.421  77.439  29.127  1.00 0.00 ?  98  ASN A OD1  1  
ATOM 1548  N ND2  . ASN A 1 107 ? 13.374  78.409  29.619  1.00 0.00 ?  98  ASN A ND2  1  
ATOM 1549  H H    . ASN A 1 107 ? 16.377  75.884  31.607  1.00 0.00 ?  98  ASN A H    1  
ATOM 1550  H HA   . ASN A 1 107 ? 13.969  77.518  32.399  1.00 0.00 ?  98  ASN A HA   1  
ATOM 1551  H HB2  . ASN A 1 107 ? 14.301  75.395  30.181  1.00 0.00 ?  98  ASN A HB2  1  
ATOM 1552  H HB3  . ASN A 1 107 ? 12.881  75.992  30.585  1.00 0.00 ?  98  ASN A HB3  1  
ATOM 1553  H HD21 . ASN A 1 107 ? 12.627  78.476  30.295  1.00 0.00 ?  98  ASN A HD21 1  
ATOM 1554  H HD22 . ASN A 1 107 ? 13.460  79.022  28.820  1.00 0.00 ?  98  ASN A HD22 1  
ATOM 1555  N N    . ARG A 1 108 ? 14.562  75.035  34.176  1.00 0.00 ?  99  ARG A N    1  
ATOM 1556  C CA   . ARG A 1 108 ? 14.079  74.369  35.397  1.00 0.00 ?  99  ARG A CA   1  
ATOM 1557  C C    . ARG A 1 108 ? 15.002  74.652  36.560  1.00 0.00 ?  99  ARG A C    1  
ATOM 1558  O O    . ARG A 1 108 ? 16.088  75.245  36.407  1.00 0.00 ?  99  ARG A O    1  
ATOM 1559  C CB   . ARG A 1 108 ? 13.965  72.858  35.118  1.00 0.00 ?  99  ARG A CB   1  
ATOM 1560  C CG   . ARG A 1 108 ? 15.107  72.217  34.292  1.00 0.00 ?  99  ARG A CG   1  
ATOM 1561  C CD   . ARG A 1 108 ? 14.923  70.736  34.283  1.00 0.00 ?  99  ARG A CD   1  
ATOM 1562  N NE   . ARG A 1 108 ? 15.729  70.024  33.303  1.00 0.00 ?  99  ARG A NE   1  
ATOM 1563  C CZ   . ARG A 1 108 ? 16.972  69.611  33.411  1.00 0.00 ?  99  ARG A CZ   1  
ATOM 1564  N NH1  . ARG A 1 108 ? 17.662  69.835  34.517  1.00 0.00 ?  99  ARG A NH1  1  
ATOM 1565  N NH2  . ARG A 1 108 ? 17.674  69.126  32.473  1.00 0.00 1  99  ARG A NH2  1  
ATOM 1566  H H    . ARG A 1 108 ? 15.547  75.262  34.159  1.00 0.00 ?  99  ARG A H    1  
ATOM 1567  H HA   . ARG A 1 108 ? 13.173  74.916  35.662  1.00 0.00 ?  99  ARG A HA   1  
ATOM 1568  H HB2  . ARG A 1 108 ? 13.783  72.278  36.022  1.00 0.00 ?  99  ARG A HB2  1  
ATOM 1569  H HB3  . ARG A 1 108 ? 13.021  72.655  34.612  1.00 0.00 ?  99  ARG A HB3  1  
ATOM 1570  H HG2  . ARG A 1 108 ? 15.184  72.619  33.282  1.00 0.00 ?  99  ARG A HG2  1  
ATOM 1571  H HG3  . ARG A 1 108 ? 16.075  72.459  34.730  1.00 0.00 ?  99  ARG A HG3  1  
ATOM 1572  H HD2  . ARG A 1 108 ? 15.202  70.299  35.242  1.00 0.00 ?  99  ARG A HD2  1  
ATOM 1573  H HD3  . ARG A 1 108 ? 13.894  70.580  33.961  1.00 0.00 ?  99  ARG A HD3  1  
ATOM 1574  H HE   . ARG A 1 108 ? 15.369  69.981  32.360  1.00 0.00 ?  99  ARG A HE   1  
ATOM 1575  H HH11 . ARG A 1 108 ? 17.201  70.314  35.278  1.00 0.00 ?  99  ARG A HH11 1  
ATOM 1576  H HH12 . ARG A 1 108 ? 18.668  69.757  34.522  1.00 0.00 ?  99  ARG A HH12 1  
ATOM 1577  H HH21 . ARG A 1 108 ? 17.275  68.887  31.577  1.00 0.00 ?  99  ARG A HH21 1  
ATOM 1578  H HH22 . ARG A 1 108 ? 18.556  68.665  32.648  1.00 0.00 ?  99  ARG A HH22 1  
ATOM 1579  N N    . VAL A 1 109 ? 14.411  74.420  37.728  1.00 0.00 ?  100 VAL A N    1  
ATOM 1580  C CA   . VAL A 1 109 ? 15.082  74.744  39.024  1.00 0.00 ?  100 VAL A CA   1  
ATOM 1581  C C    . VAL A 1 109 ? 16.254  73.769  39.224  1.00 0.00 ?  100 VAL A C    1  
ATOM 1582  O O    . VAL A 1 109 ? 16.145  72.537  38.998  1.00 0.00 ?  100 VAL A O    1  
ATOM 1583  C CB   . VAL A 1 109 ? 14.101  74.751  40.258  1.00 0.00 ?  100 VAL A CB   1  
ATOM 1584  C CG1  . VAL A 1 109 ? 13.635  73.396  40.630  1.00 0.00 ?  100 VAL A CG1  1  
ATOM 1585  C CG2  . VAL A 1 109 ? 14.864  75.188  41.469  1.00 0.00 ?  100 VAL A CG2  1  
ATOM 1586  H H    . VAL A 1 109 ? 13.451  74.121  37.631  1.00 0.00 ?  100 VAL A H    1  
ATOM 1587  H HA   . VAL A 1 109 ? 15.474  75.758  38.942  1.00 0.00 ?  100 VAL A HA   1  
ATOM 1588  H HB   . VAL A 1 109 ? 13.297  75.444  40.012  1.00 0.00 ?  100 VAL A HB   1  
ATOM 1589  H HG11 . VAL A 1 109 ? 13.203  73.010  39.706  1.00 0.00 ?  100 VAL A HG11 1  
ATOM 1590  H HG12 . VAL A 1 109 ? 14.483  72.782  40.934  1.00 0.00 ?  100 VAL A HG12 1  
ATOM 1591  H HG13 . VAL A 1 109 ? 12.935  73.398  41.465  1.00 0.00 ?  100 VAL A HG13 1  
ATOM 1592  H HG21 . VAL A 1 109 ? 15.211  76.207  41.299  1.00 0.00 ?  100 VAL A HG21 1  
ATOM 1593  H HG22 . VAL A 1 109 ? 14.241  75.323  42.355  1.00 0.00 ?  100 VAL A HG22 1  
ATOM 1594  H HG23 . VAL A 1 109 ? 15.682  74.517  41.730  1.00 0.00 ?  100 VAL A HG23 1  
ATOM 1595  N N    . SER A 1 110 ? 17.428  74.222  39.640  1.00 0.00 ?  101 SER A N    1  
ATOM 1596  C CA   . SER A 1 110 ? 18.511  73.348  39.964  1.00 0.00 ?  101 SER A CA   1  
ATOM 1597  C C    . SER A 1 110 ? 18.260  72.658  41.286  1.00 0.00 ?  101 SER A C    1  
ATOM 1598  O O    . SER A 1 110 ? 17.924  73.287  42.257  1.00 0.00 ?  101 SER A O    1  
ATOM 1599  C CB   . SER A 1 110 ? 19.882  74.104  39.978  1.00 0.00 ?  101 SER A CB   1  
ATOM 1600  O OG   . SER A 1 110 ? 20.868  73.470  40.739  1.00 0.00 ?  101 SER A OG   1  
ATOM 1601  H H    . SER A 1 110 ? 17.531  75.208  39.836  1.00 0.00 ?  101 SER A H    1  
ATOM 1602  H HA   . SER A 1 110 ? 18.620  72.591  39.186  1.00 0.00 ?  101 SER A HA   1  
ATOM 1603  H HB2  . SER A 1 110 ? 20.318  74.366  39.015  1.00 0.00 ?  101 SER A HB2  1  
ATOM 1604  H HB3  . SER A 1 110 ? 19.707  75.101  40.381  1.00 0.00 ?  101 SER A HB3  1  
ATOM 1605  H HG   . SER A 1 110 ? 21.571  73.130  40.182  1.00 0.00 ?  101 SER A HG   1  
ATOM 1606  N N    . MET A 1 111 ? 18.381  71.341  41.335  1.00 0.00 ?  102 MET A N    1  
ATOM 1607  C CA   . MET A 1 111 ? 18.007  70.464  42.485  1.00 0.00 ?  102 MET A CA   1  
ATOM 1608  C C    . MET A 1 111 ? 19.048  69.396  42.910  1.00 0.00 ?  102 MET A C    1  
ATOM 1609  O O    . MET A 1 111 ? 19.066  68.260  42.423  1.00 0.00 ?  102 MET A O    1  
ATOM 1610  C CB   . MET A 1 111 ? 16.643  69.859  42.080  1.00 0.00 ?  102 MET A CB   1  
ATOM 1611  C CG   . MET A 1 111 ? 16.715  69.177  40.676  1.00 0.00 ?  102 MET A CG   1  
ATOM 1612  S SD   . MET A 1 111 ? 15.312  68.029  40.370  1.00 0.00 ?  102 MET A SD   1  
ATOM 1613  C CE   . MET A 1 111 ? 13.869  69.075  40.356  1.00 0.00 ?  102 MET A CE   1  
ATOM 1614  H H    . MET A 1 111 ? 18.660  70.921  40.460  1.00 0.00 ?  102 MET A H    1  
ATOM 1615  H HA   . MET A 1 111 ? 17.705  70.915  43.430  1.00 0.00 ?  102 MET A HA   1  
ATOM 1616  H HB2  . MET A 1 111 ? 16.505  69.061  42.810  1.00 0.00 ?  102 MET A HB2  1  
ATOM 1617  H HB3  . MET A 1 111 ? 15.871  70.629  42.104  1.00 0.00 ?  102 MET A HB3  1  
ATOM 1618  H HG2  . MET A 1 111 ? 16.801  69.970  39.932  1.00 0.00 ?  102 MET A HG2  1  
ATOM 1619  H HG3  . MET A 1 111 ? 17.627  68.583  40.720  1.00 0.00 ?  102 MET A HG3  1  
ATOM 1620  H HE1  . MET A 1 111 ? 12.949  68.547  40.110  1.00 0.00 ?  102 MET A HE1  1  
ATOM 1621  H HE2  . MET A 1 111 ? 13.770  69.601  41.306  1.00 0.00 ?  102 MET A HE2  1  
ATOM 1622  H HE3  . MET A 1 111 ? 13.974  69.850  39.597  1.00 0.00 ?  102 MET A HE3  1  
ATOM 1623  N N    . ILE A 1 112 ? 19.918  69.713  43.865  1.00 0.00 ?  103 ILE A N    1  
ATOM 1624  C CA   . ILE A 1 112 ? 20.758  68.694  44.406  1.00 0.00 ?  103 ILE A CA   1  
ATOM 1625  C C    . ILE A 1 112 ? 19.773  67.736  45.156  1.00 0.00 ?  103 ILE A C    1  
ATOM 1626  O O    . ILE A 1 112 ? 19.753  66.502  44.930  1.00 0.00 ?  103 ILE A O    1  
ATOM 1627  C CB   . ILE A 1 112 ? 21.837  69.275  45.207  1.00 0.00 ?  103 ILE A CB   1  
ATOM 1628  C CG1  . ILE A 1 112 ? 22.833  70.176  44.385  1.00 0.00 ?  103 ILE A CG1  1  
ATOM 1629  C CG2  . ILE A 1 112 ? 22.596  68.086  45.818  1.00 0.00 ?  103 ILE A CG2  1  
ATOM 1630  C CD1  . ILE A 1 112 ? 23.167  69.722  42.987  1.00 0.00 ?  103 ILE A CD1  1  
ATOM 1631  O OXT  . ILE A 1 112 ? 19.104  68.259  46.086  1.00 0.00 -1 103 ILE A OXT  1  
ATOM 1632  H H    . ILE A 1 112 ? 19.883  70.593  44.359  1.00 0.00 ?  103 ILE A H    1  
ATOM 1633  H HA   . ILE A 1 112 ? 21.142  68.090  43.584  1.00 0.00 ?  103 ILE A HA   1  
ATOM 1634  H HB   . ILE A 1 112 ? 21.528  69.754  46.136  1.00 0.00 ?  103 ILE A HB   1  
ATOM 1635  H HG12 . ILE A 1 112 ? 22.332  71.143  44.358  1.00 0.00 ?  103 ILE A HG12 1  
ATOM 1636  H HG13 . ILE A 1 112 ? 23.777  70.247  44.926  1.00 0.00 ?  103 ILE A HG13 1  
ATOM 1637  H HG21 . ILE A 1 112 ? 23.674  68.248  45.852  1.00 0.00 ?  103 ILE A HG21 1  
ATOM 1638  H HG22 . ILE A 1 112 ? 22.184  68.084  46.826  1.00 0.00 ?  103 ILE A HG22 1  
ATOM 1639  H HG23 . ILE A 1 112 ? 22.463  67.133  45.308  1.00 0.00 ?  103 ILE A HG23 1  
ATOM 1640  H HD11 . ILE A 1 112 ? 23.725  68.791  43.087  1.00 0.00 ?  103 ILE A HD11 1  
ATOM 1641  H HD12 . ILE A 1 112 ? 22.235  69.520  42.460  1.00 0.00 ?  103 ILE A HD12 1  
ATOM 1642  H HD13 . ILE A 1 112 ? 23.623  70.524  42.406  1.00 0.00 ?  103 ILE A HD13 1  
ATOM 1643  N N    . MET A 1 10  ? 18.771  58.547  85.886  1.00 0.00 ?  1   MET A N    2  
ATOM 1644  C CA   . MET A 1 10  ? 19.362  57.182  85.989  1.00 0.00 ?  1   MET A CA   2  
ATOM 1645  C C    . MET A 1 10  ? 20.555  57.242  86.935  1.00 0.00 ?  1   MET A C    2  
ATOM 1646  O O    . MET A 1 10  ? 21.042  58.317  87.209  1.00 0.00 ?  1   MET A O    2  
ATOM 1647  C CB   . MET A 1 10  ? 19.965  56.800  84.621  1.00 0.00 ?  1   MET A CB   2  
ATOM 1648  C CG   . MET A 1 10  ? 19.075  56.821  83.352  1.00 0.00 ?  1   MET A CG   2  
ATOM 1649  S SD   . MET A 1 10  ? 17.727  55.722  83.328  1.00 0.00 ?  1   MET A SD   2  
ATOM 1650  C CE   . MET A 1 10  ? 16.898  56.452  81.907  1.00 0.00 ?  1   MET A CE   2  
ATOM 1651  H H    . MET A 1 10  ? 18.537  58.918  86.795  1.00 0.00 ?  1   MET A H    2  
ATOM 1652  H HA   . MET A 1 10  ? 18.612  56.504  86.398  1.00 0.00 ?  1   MET A HA   2  
ATOM 1653  H HB2  . MET A 1 10  ? 20.787  57.497  84.462  1.00 0.00 ?  1   MET A HB2  2  
ATOM 1654  H HB3  . MET A 1 10  ? 20.387  55.795  84.631  1.00 0.00 ?  1   MET A HB3  2  
ATOM 1655  H HG2  . MET A 1 10  ? 18.720  57.819  83.093  1.00 0.00 ?  1   MET A HG2  2  
ATOM 1656  H HG3  . MET A 1 10  ? 19.749  56.605  82.523  1.00 0.00 ?  1   MET A HG3  2  
ATOM 1657  H HE1  . MET A 1 10  ? 17.559  56.674  81.069  1.00 0.00 ?  1   MET A HE1  2  
ATOM 1658  H HE2  . MET A 1 10  ? 16.127  55.767  81.554  1.00 0.00 ?  1   MET A HE2  2  
ATOM 1659  H HE3  . MET A 1 10  ? 16.633  57.454  82.245  1.00 0.00 ?  1   MET A HE3  2  
ATOM 1660  N N    . GLU A 1 11  ? 21.007  56.061  87.421  1.00 0.00 ?  2   GLU A N    2  
ATOM 1661  C CA   . GLU A 1 11  ? 22.242  55.865  88.216  1.00 0.00 ?  2   GLU A CA   2  
ATOM 1662  C C    . GLU A 1 11  ? 22.852  54.446  88.153  1.00 0.00 ?  2   GLU A C    2  
ATOM 1663  O O    . GLU A 1 11  ? 22.186  53.532  88.591  1.00 0.00 ?  2   GLU A O    2  
ATOM 1664  C CB   . GLU A 1 11  ? 21.927  56.230  89.716  1.00 0.00 ?  2   GLU A CB   2  
ATOM 1665  C CG   . GLU A 1 11  ? 23.220  56.068  90.674  1.00 0.00 ?  2   GLU A CG   2  
ATOM 1666  C CD   . GLU A 1 11  ? 22.817  56.580  92.078  1.00 0.00 ?  2   GLU A CD   2  
ATOM 1667  O OE1  . GLU A 1 11  ? 22.829  57.819  92.301  1.00 0.00 ?  2   GLU A OE1  2  
ATOM 1668  O OE2  . GLU A 1 11  ? 22.426  55.742  92.951  1.00 0.00 -1 2   GLU A OE2  2  
ATOM 1669  H H    . GLU A 1 11  ? 20.516  55.205  87.203  1.00 0.00 ?  2   GLU A H    2  
ATOM 1670  H HA   . GLU A 1 11  ? 23.046  56.558  87.969  1.00 0.00 ?  2   GLU A HA   2  
ATOM 1671  H HB2  . GLU A 1 11  ? 21.533  57.241  89.813  1.00 0.00 ?  2   GLU A HB2  2  
ATOM 1672  H HB3  . GLU A 1 11  ? 21.121  55.592  90.078  1.00 0.00 ?  2   GLU A HB3  2  
ATOM 1673  H HG2  . GLU A 1 11  ? 23.592  55.044  90.672  1.00 0.00 ?  2   GLU A HG2  2  
ATOM 1674  H HG3  . GLU A 1 11  ? 23.954  56.808  90.355  1.00 0.00 ?  2   GLU A HG3  2  
ATOM 1675  N N    . THR A 1 12  ? 24.116  54.217  87.757  1.00 0.00 ?  3   THR A N    2  
ATOM 1676  C CA   . THR A 1 12  ? 24.852  52.998  88.126  1.00 0.00 ?  3   THR A CA   2  
ATOM 1677  C C    . THR A 1 12  ? 26.337  53.082  88.553  1.00 0.00 ?  3   THR A C    2  
ATOM 1678  O O    . THR A 1 12  ? 26.865  52.152  89.226  1.00 0.00 ?  3   THR A O    2  
ATOM 1679  C CB   . THR A 1 12  ? 24.664  51.843  87.125  1.00 0.00 ?  3   THR A CB   2  
ATOM 1680  O OG1  . THR A 1 12  ? 25.051  50.613  87.747  1.00 0.00 ?  3   THR A OG1  2  
ATOM 1681  C CG2  . THR A 1 12  ? 25.400  51.859  85.772  1.00 0.00 ?  3   THR A CG2  2  
ATOM 1682  H H    . THR A 1 12  ? 24.593  55.073  87.510  1.00 0.00 ?  3   THR A H    2  
ATOM 1683  H HA   . THR A 1 12  ? 24.314  52.673  89.017  1.00 0.00 ?  3   THR A HA   2  
ATOM 1684  H HB   . THR A 1 12  ? 23.618  51.723  86.841  1.00 0.00 ?  3   THR A HB   2  
ATOM 1685  H HG1  . THR A 1 12  ? 24.711  49.888  87.217  1.00 0.00 ?  3   THR A HG1  2  
ATOM 1686  H HG21 . THR A 1 12  ? 26.448  51.660  85.998  1.00 0.00 ?  3   THR A HG21 2  
ATOM 1687  H HG22 . THR A 1 12  ? 24.967  51.010  85.244  1.00 0.00 ?  3   THR A HG22 2  
ATOM 1688  H HG23 . THR A 1 12  ? 25.143  52.770  85.232  1.00 0.00 ?  3   THR A HG23 2  
ATOM 1689  N N    . THR A 1 13  ? 27.034  54.173  88.164  1.00 0.00 ?  4   THR A N    2  
ATOM 1690  C CA   . THR A 1 13  ? 28.498  54.282  88.287  1.00 0.00 ?  4   THR A CA   2  
ATOM 1691  C C    . THR A 1 13  ? 28.988  54.557  89.693  1.00 0.00 ?  4   THR A C    2  
ATOM 1692  O O    . THR A 1 13  ? 29.487  55.672  89.900  1.00 0.00 ?  4   THR A O    2  
ATOM 1693  C CB   . THR A 1 13  ? 29.223  55.134  87.219  1.00 0.00 ?  4   THR A CB   2  
ATOM 1694  O OG1  . THR A 1 13  ? 28.430  54.947  86.044  1.00 0.00 ?  4   THR A OG1  2  
ATOM 1695  C CG2  . THR A 1 13  ? 30.644  54.748  86.851  1.00 0.00 ?  4   THR A CG2  2  
ATOM 1696  H H    . THR A 1 13  ? 26.529  54.839  87.597  1.00 0.00 ?  4   THR A H    2  
ATOM 1697  H HA   . THR A 1 13  ? 28.789  53.234  88.221  1.00 0.00 ?  4   THR A HA   2  
ATOM 1698  H HB   . THR A 1 13  ? 29.230  56.217  87.342  1.00 0.00 ?  4   THR A HB   2  
ATOM 1699  H HG1  . THR A 1 13  ? 27.516  55.233  86.113  1.00 0.00 ?  4   THR A HG1  2  
ATOM 1700  H HG21 . THR A 1 13  ? 30.580  53.741  86.439  1.00 0.00 ?  4   THR A HG21 2  
ATOM 1701  H HG22 . THR A 1 13  ? 30.950  55.458  86.083  1.00 0.00 ?  4   THR A HG22 2  
ATOM 1702  H HG23 . THR A 1 13  ? 31.317  54.969  87.680  1.00 0.00 ?  4   THR A HG23 2  
ATOM 1703  N N    . ASN A 1 14  ? 28.758  53.690  90.609  1.00 0.00 ?  5   ASN A N    2  
ATOM 1704  C CA   . ASN A 1 14  ? 28.596  53.987  92.055  1.00 0.00 ?  5   ASN A CA   2  
ATOM 1705  C C    . ASN A 1 14  ? 29.875  53.951  92.911  1.00 0.00 ?  5   ASN A C    2  
ATOM 1706  O O    . ASN A 1 14  ? 30.780  53.158  92.650  1.00 0.00 ?  5   ASN A O    2  
ATOM 1707  C CB   . ASN A 1 14  ? 27.469  53.056  92.657  1.00 0.00 ?  5   ASN A CB   2  
ATOM 1708  C CG   . ASN A 1 14  ? 26.133  53.529  92.199  1.00 0.00 ?  5   ASN A CG   2  
ATOM 1709  O OD1  . ASN A 1 14  ? 25.942  54.645  91.720  1.00 0.00 ?  5   ASN A OD1  2  
ATOM 1710  N ND2  . ASN A 1 14  ? 25.153  52.671  92.367  1.00 0.00 ?  5   ASN A ND2  2  
ATOM 1711  H H    . ASN A 1 14  ? 28.332  52.837  90.276  1.00 0.00 ?  5   ASN A H    2  
ATOM 1712  H HA   . ASN A 1 14  ? 28.230  55.005  92.186  1.00 0.00 ?  5   ASN A HA   2  
ATOM 1713  H HB2  . ASN A 1 14  ? 27.588  52.024  92.328  1.00 0.00 ?  5   ASN A HB2  2  
ATOM 1714  H HB3  . ASN A 1 14  ? 27.437  53.004  93.746  1.00 0.00 ?  5   ASN A HB3  2  
ATOM 1715  H HD21 . ASN A 1 14  ? 25.367  51.826  92.877  1.00 0.00 ?  5   ASN A HD21 2  
ATOM 1716  H HD22 . ASN A 1 14  ? 24.227  52.918  92.047  1.00 0.00 ?  5   ASN A HD22 2  
ATOM 1717  N N    . GLY A 1 15  ? 29.951  54.756  93.993  1.00 0.00 ?  6   GLY A N    2  
ATOM 1718  C CA   . GLY A 1 15  ? 30.953  54.688  95.051  1.00 0.00 ?  6   GLY A CA   2  
ATOM 1719  C C    . GLY A 1 15  ? 32.358  54.963  94.617  1.00 0.00 ?  6   GLY A C    2  
ATOM 1720  O O    . GLY A 1 15  ? 33.288  54.314  95.077  1.00 0.00 ?  6   GLY A O    2  
ATOM 1721  H H    . GLY A 1 15  ? 29.156  55.346  94.195  1.00 0.00 ?  6   GLY A H    2  
ATOM 1722  H HA2  . GLY A 1 15  ? 30.796  55.334  95.915  1.00 0.00 ?  6   GLY A HA2  2  
ATOM 1723  H HA3  . GLY A 1 15  ? 30.908  53.687  95.479  1.00 0.00 ?  6   GLY A HA3  2  
ATOM 1724  N N    . THR A 1 16  ? 32.570  55.748  93.480  1.00 0.00 ?  7   THR A N    2  
ATOM 1725  C CA   . THR A 1 16  ? 33.858  55.790  92.812  1.00 0.00 ?  7   THR A CA   2  
ATOM 1726  C C    . THR A 1 16  ? 35.012  56.531  93.440  1.00 0.00 ?  7   THR A C    2  
ATOM 1727  O O    . THR A 1 16  ? 34.705  57.435  94.236  1.00 0.00 ?  7   THR A O    2  
ATOM 1728  C CB   . THR A 1 16  ? 33.805  56.189  91.311  1.00 0.00 ?  7   THR A CB   2  
ATOM 1729  O OG1  . THR A 1 16  ? 33.707  57.563  91.325  1.00 0.00 ?  7   THR A OG1  2  
ATOM 1730  C CG2  . THR A 1 16  ? 32.620  55.608  90.604  1.00 0.00 ?  7   THR A CG2  2  
ATOM 1731  H H    . THR A 1 16  ? 31.777  56.324  93.237  1.00 0.00 ?  7   THR A H    2  
ATOM 1732  H HA   . THR A 1 16  ? 34.061  54.723  92.722  1.00 0.00 ?  7   THR A HA   2  
ATOM 1733  H HB   . THR A 1 16  ? 34.776  55.977  90.863  1.00 0.00 ?  7   THR A HB   2  
ATOM 1734  H HG1  . THR A 1 16  ? 34.077  57.866  90.493  1.00 0.00 ?  7   THR A HG1  2  
ATOM 1735  H HG21 . THR A 1 16  ? 32.762  55.880  89.558  1.00 0.00 ?  7   THR A HG21 2  
ATOM 1736  H HG22 . THR A 1 16  ? 32.609  54.520  90.672  1.00 0.00 ?  7   THR A HG22 2  
ATOM 1737  H HG23 . THR A 1 16  ? 31.680  56.030  90.959  1.00 0.00 ?  7   THR A HG23 2  
ATOM 1738  N N    . GLU A 1 17  ? 36.289  56.169  93.306  1.00 0.00 ?  8   GLU A N    2  
ATOM 1739  C CA   . GLU A 1 17  ? 37.356  57.092  93.742  1.00 0.00 ?  8   GLU A CA   2  
ATOM 1740  C C    . GLU A 1 17  ? 37.411  58.373  93.056  1.00 0.00 ?  8   GLU A C    2  
ATOM 1741  O O    . GLU A 1 17  ? 37.879  59.374  93.638  1.00 0.00 ?  8   GLU A O    2  
ATOM 1742  C CB   . GLU A 1 17  ? 38.685  56.472  93.428  1.00 0.00 ?  8   GLU A CB   2  
ATOM 1743  C CG   . GLU A 1 17  ? 38.980  55.063  93.872  1.00 0.00 ?  8   GLU A CG   2  
ATOM 1744  C CD   . GLU A 1 17  ? 39.273  54.782  95.304  1.00 0.00 ?  8   GLU A CD   2  
ATOM 1745  O OE1  . GLU A 1 17  ? 38.982  55.653  96.150  1.00 0.00 ?  8   GLU A OE1  2  
ATOM 1746  O OE2  . GLU A 1 17  ? 39.874  53.747  95.657  1.00 0.00 -1 8   GLU A OE2  2  
ATOM 1747  H H    . GLU A 1 17  ? 36.465  55.316  92.794  1.00 0.00 ?  8   GLU A H    2  
ATOM 1748  H HA   . GLU A 1 17  ? 37.285  57.285  94.812  1.00 0.00 ?  8   GLU A HA   2  
ATOM 1749  H HB2  . GLU A 1 17  ? 38.874  56.549  92.358  1.00 0.00 ?  8   GLU A HB2  2  
ATOM 1750  H HB3  . GLU A 1 17  ? 39.468  57.159  93.749  1.00 0.00 ?  8   GLU A HB3  2  
ATOM 1751  H HG2  . GLU A 1 17  ? 38.176  54.458  93.453  1.00 0.00 ?  8   GLU A HG2  2  
ATOM 1752  H HG3  . GLU A 1 17  ? 39.846  54.772  93.277  1.00 0.00 ?  8   GLU A HG3  2  
ATOM 1753  N N    . THR A 1 18  ? 36.969  58.398  91.845  1.00 0.00 ?  9   THR A N    2  
ATOM 1754  C CA   . THR A 1 18  ? 36.789  59.585  90.999  1.00 0.00 ?  9   THR A CA   2  
ATOM 1755  C C    . THR A 1 18  ? 35.644  60.500  91.508  1.00 0.00 ?  9   THR A C    2  
ATOM 1756  O O    . THR A 1 18  ? 35.677  61.725  91.363  1.00 0.00 ?  9   THR A O    2  
ATOM 1757  C CB   . THR A 1 18  ? 36.649  59.221  89.506  1.00 0.00 ?  9   THR A CB   2  
ATOM 1758  O OG1  . THR A 1 18  ? 35.430  58.499  89.355  1.00 0.00 ?  9   THR A OG1  2  
ATOM 1759  C CG2  . THR A 1 18  ? 37.739  58.389  88.945  1.00 0.00 ?  9   THR A CG2  2  
ATOM 1760  H H    . THR A 1 18  ? 36.597  57.504  91.561  1.00 0.00 ?  9   THR A H    2  
ATOM 1761  H HA   . THR A 1 18  ? 37.733  60.129  91.003  1.00 0.00 ?  9   THR A HA   2  
ATOM 1762  H HB   . THR A 1 18  ? 36.564  60.130  88.910  1.00 0.00 ?  9   THR A HB   2  
ATOM 1763  H HG1  . THR A 1 18  ? 35.561  57.849  88.661  1.00 0.00 ?  9   THR A HG1  2  
ATOM 1764  H HG21 . THR A 1 18  ? 37.592  57.346  89.225  1.00 0.00 ?  9   THR A HG21 2  
ATOM 1765  H HG22 . THR A 1 18  ? 37.644  58.472  87.862  1.00 0.00 ?  9   THR A HG22 2  
ATOM 1766  H HG23 . THR A 1 18  ? 38.715  58.821  89.165  1.00 0.00 ?  9   THR A HG23 2  
ATOM 1767  N N    . TRP A 1 19  ? 34.632  59.983  92.213  1.00 0.00 ?  10  TRP A N    2  
ATOM 1768  C CA   . TRP A 1 19  ? 33.664  60.809  92.845  1.00 0.00 ?  10  TRP A CA   2  
ATOM 1769  C C    . TRP A 1 19  ? 34.224  61.245  94.176  1.00 0.00 ?  10  TRP A C    2  
ATOM 1770  O O    . TRP A 1 19  ? 33.980  62.402  94.565  1.00 0.00 ?  10  TRP A O    2  
ATOM 1771  C CB   . TRP A 1 19  ? 32.267  60.097  92.943  1.00 0.00 ?  10  TRP A CB   2  
ATOM 1772  C CG   . TRP A 1 19  ? 31.071  60.642  93.582  1.00 0.00 ?  10  TRP A CG   2  
ATOM 1773  C CD1  . TRP A 1 19  ? 30.073  61.323  92.897  1.00 0.00 ?  10  TRP A CD1  2  
ATOM 1774  C CD2  . TRP A 1 19  ? 30.635  60.577  94.995  1.00 0.00 ?  10  TRP A CD2  2  
ATOM 1775  N NE1  . TRP A 1 19  ? 28.998  61.572  93.744  1.00 0.00 ?  10  TRP A NE1  2  
ATOM 1776  C CE2  . TRP A 1 19  ? 29.336  61.228  95.008  1.00 0.00 ?  10  TRP A CE2  2  
ATOM 1777  C CE3  . TRP A 1 19  ? 31.300  60.164  96.162  1.00 0.00 ?  10  TRP A CE3  2  
ATOM 1778  C CZ2  . TRP A 1 19  ? 28.792  61.541  96.233  1.00 0.00 ?  10  TRP A CZ2  2  
ATOM 1779  C CZ3  . TRP A 1 19  ? 30.591  60.382  97.371  1.00 0.00 ?  10  TRP A CZ3  2  
ATOM 1780  C CH2  . TRP A 1 19  ? 29.445  61.157  97.364  1.00 0.00 ?  10  TRP A CH2  2  
ATOM 1781  H H    . TRP A 1 19  ? 34.643  58.990  92.396  1.00 0.00 ?  10  TRP A H    2  
ATOM 1782  H HA   . TRP A 1 19  ? 33.501  61.687  92.220  1.00 0.00 ?  10  TRP A HA   2  
ATOM 1783  H HB2  . TRP A 1 19  ? 32.050  59.902  91.893  1.00 0.00 ?  10  TRP A HB2  2  
ATOM 1784  H HB3  . TRP A 1 19  ? 32.435  59.083  93.305  1.00 0.00 ?  10  TRP A HB3  2  
ATOM 1785  H HD1  . TRP A 1 19  ? 30.120  61.599  91.854  1.00 0.00 ?  10  TRP A HD1  2  
ATOM 1786  H HE1  . TRP A 1 19  ? 28.161  62.045  93.436  1.00 0.00 ?  10  TRP A HE1  2  
ATOM 1787  H HE3  . TRP A 1 19  ? 32.279  59.708  96.142  1.00 0.00 ?  10  TRP A HE3  2  
ATOM 1788  H HZ2  . TRP A 1 19  ? 27.929  62.190  96.224  1.00 0.00 ?  10  TRP A HZ2  2  
ATOM 1789  H HZ3  . TRP A 1 19  ? 30.909  59.946  98.307  1.00 0.00 ?  10  TRP A HZ3  2  
ATOM 1790  H HH2  . TRP A 1 19  ? 28.932  61.262  98.308  1.00 0.00 ?  10  TRP A HH2  2  
ATOM 1791  N N    . TYR A 1 20  ? 35.003  60.410  94.963  1.00 0.00 ?  11  TYR A N    2  
ATOM 1792  C CA   . TYR A 1 20  ? 35.699  60.752  96.141  1.00 0.00 ?  11  TYR A CA   2  
ATOM 1793  C C    . TYR A 1 20  ? 36.687  62.030  96.012  1.00 0.00 ?  11  TYR A C    2  
ATOM 1794  O O    . TYR A 1 20  ? 36.659  62.966  96.816  1.00 0.00 ?  11  TYR A O    2  
ATOM 1795  C CB   . TYR A 1 20  ? 36.259  59.511  96.810  1.00 0.00 ?  11  TYR A CB   2  
ATOM 1796  C CG   . TYR A 1 20  ? 37.429  59.675  97.771  1.00 0.00 ?  11  TYR A CG   2  
ATOM 1797  C CD1  . TYR A 1 20  ? 37.269  59.965  99.134  1.00 0.00 ?  11  TYR A CD1  2  
ATOM 1798  C CD2  . TYR A 1 20  ? 38.724  59.763  97.315  1.00 0.00 ?  11  TYR A CD2  2  
ATOM 1799  C CE1  . TYR A 1 20  ? 38.301  60.213  99.988  1.00 0.00 ?  11  TYR A CE1  2  
ATOM 1800  C CE2  . TYR A 1 20  ? 39.784  60.054  98.172  1.00 0.00 ?  11  TYR A CE2  2  
ATOM 1801  C CZ   . TYR A 1 20  ? 39.571  60.341  99.480  1.00 0.00 ?  11  TYR A CZ   2  
ATOM 1802  O OH   . TYR A 1 20  ? 40.630  60.582  100.229 1.00 0.00 ?  11  TYR A OH   2  
ATOM 1803  H H    . TYR A 1 20  ? 35.108  59.446  94.680  1.00 0.00 ?  11  TYR A H    2  
ATOM 1804  H HA   . TYR A 1 20  ? 34.944  61.132  96.830  1.00 0.00 ?  11  TYR A HA   2  
ATOM 1805  H HB2  . TYR A 1 20  ? 35.495  59.040  97.428  1.00 0.00 ?  11  TYR A HB2  2  
ATOM 1806  H HB3  . TYR A 1 20  ? 36.557  58.743  96.097  1.00 0.00 ?  11  TYR A HB3  2  
ATOM 1807  H HD1  . TYR A 1 20  ? 36.264  59.942  99.527  1.00 0.00 ?  11  TYR A HD1  2  
ATOM 1808  H HD2  . TYR A 1 20  ? 38.965  59.491  96.298  1.00 0.00 ?  11  TYR A HD2  2  
ATOM 1809  H HE1  . TYR A 1 20  ? 38.142  60.271  101.055 1.00 0.00 ?  11  TYR A HE1  2  
ATOM 1810  H HE2  . TYR A 1 20  ? 40.748  59.990  97.689  1.00 0.00 ?  11  TYR A HE2  2  
ATOM 1811  H HH   . TYR A 1 20  ? 40.388  60.875  101.111 1.00 0.00 ?  11  TYR A HH   2  
ATOM 1812  N N    . GLU A 1 21  ? 37.410  62.002  94.869  1.00 0.00 ?  12  GLU A N    2  
ATOM 1813  C CA   . GLU A 1 21  ? 38.206  63.114  94.441  1.00 0.00 ?  12  GLU A CA   2  
ATOM 1814  C C    . GLU A 1 21  ? 37.493  64.345  93.991  1.00 0.00 ?  12  GLU A C    2  
ATOM 1815  O O    . GLU A 1 21  ? 37.879  65.464  94.292  1.00 0.00 ?  12  GLU A O    2  
ATOM 1816  C CB   . GLU A 1 21  ? 39.109  62.779  93.306  1.00 0.00 ?  12  GLU A CB   2  
ATOM 1817  C CG   . GLU A 1 21  ? 40.428  62.183  93.758  1.00 0.00 ?  12  GLU A CG   2  
ATOM 1818  C CD   . GLU A 1 21  ? 41.453  62.832  94.683  1.00 0.00 ?  12  GLU A CD   2  
ATOM 1819  O OE1  . GLU A 1 21  ? 41.509  64.098  94.759  1.00 0.00 -1 12  GLU A OE1  2  
ATOM 1820  O OE2  . GLU A 1 21  ? 42.323  62.059  95.146  1.00 0.00 ?  12  GLU A OE2  2  
ATOM 1821  H H    . GLU A 1 21  ? 37.441  61.159  94.314  1.00 0.00 ?  12  GLU A H    2  
ATOM 1822  H HA   . GLU A 1 21  ? 38.843  63.340  95.296  1.00 0.00 ?  12  GLU A HA   2  
ATOM 1823  H HB2  . GLU A 1 21  ? 38.648  62.069  92.620  1.00 0.00 ?  12  GLU A HB2  2  
ATOM 1824  H HB3  . GLU A 1 21  ? 39.486  63.684  92.830  1.00 0.00 ?  12  GLU A HB3  2  
ATOM 1825  H HG2  . GLU A 1 21  ? 40.151  61.161  94.015  1.00 0.00 ?  12  GLU A HG2  2  
ATOM 1826  H HG3  . GLU A 1 21  ? 40.965  61.900  92.853  1.00 0.00 ?  12  GLU A HG3  2  
ATOM 1827  N N    . SER A 1 22  ? 36.230  64.230  93.565  1.00 0.00 ?  13  SER A N    2  
ATOM 1828  C CA   . SER A 1 22  ? 35.349  65.395  93.281  1.00 0.00 ?  13  SER A CA   2  
ATOM 1829  C C    . SER A 1 22  ? 34.792  65.985  94.571  1.00 0.00 ?  13  SER A C    2  
ATOM 1830  O O    . SER A 1 22  ? 34.940  67.160  94.922  1.00 0.00 ?  13  SER A O    2  
ATOM 1831  C CB   . SER A 1 22  ? 34.156  64.876  92.415  1.00 0.00 ?  13  SER A CB   2  
ATOM 1832  O OG   . SER A 1 22  ? 33.265  65.919  92.031  1.00 0.00 ?  13  SER A OG   2  
ATOM 1833  H H    . SER A 1 22  ? 35.778  63.328  93.576  1.00 0.00 ?  13  SER A H    2  
ATOM 1834  H HA   . SER A 1 22  ? 35.873  66.184  92.740  1.00 0.00 ?  13  SER A HA   2  
ATOM 1835  H HB2  . SER A 1 22  ? 34.516  64.365  91.522  1.00 0.00 ?  13  SER A HB2  2  
ATOM 1836  H HB3  . SER A 1 22  ? 33.650  64.147  93.047  1.00 0.00 ?  13  SER A HB3  2  
ATOM 1837  H HG   . SER A 1 22  ? 32.816  65.799  91.192  1.00 0.00 ?  13  SER A HG   2  
ATOM 1838  N N    . LEU A 1 23  ? 34.278  65.153  95.497  1.00 0.00 ?  14  LEU A N    2  
ATOM 1839  C CA   . LEU A 1 23  ? 33.937  65.482  96.889  1.00 0.00 ?  14  LEU A CA   2  
ATOM 1840  C C    . LEU A 1 23  ? 35.043  66.123  97.773  1.00 0.00 ?  14  LEU A C    2  
ATOM 1841  O O    . LEU A 1 23  ? 34.817  67.055  98.514  1.00 0.00 ?  14  LEU A O    2  
ATOM 1842  C CB   . LEU A 1 23  ? 33.345  64.157  97.432  1.00 0.00 ?  14  LEU A CB   2  
ATOM 1843  C CG   . LEU A 1 23  ? 33.081  64.120  98.936  1.00 0.00 ?  14  LEU A CG   2  
ATOM 1844  C CD1  . LEU A 1 23  ? 32.138  65.269  99.371  1.00 0.00 ?  14  LEU A CD1  2  
ATOM 1845  C CD2  . LEU A 1 23  ? 32.401  62.795  99.297  1.00 0.00 ?  14  LEU A CD2  2  
ATOM 1846  H H    . LEU A 1 23  ? 34.136  64.195  95.211  1.00 0.00 ?  14  LEU A H    2  
ATOM 1847  H HA   . LEU A 1 23  ? 33.088  66.165  96.860  1.00 0.00 ?  14  LEU A HA   2  
ATOM 1848  H HB2  . LEU A 1 23  ? 32.373  64.008  96.962  1.00 0.00 ?  14  LEU A HB2  2  
ATOM 1849  H HB3  . LEU A 1 23  ? 33.984  63.316  97.163  1.00 0.00 ?  14  LEU A HB3  2  
ATOM 1850  H HG   . LEU A 1 23  ? 34.011  64.301  99.474  1.00 0.00 ?  14  LEU A HG   2  
ATOM 1851  H HD11 . LEU A 1 23  ? 31.950  65.107  100.432 1.00 0.00 ?  14  LEU A HD11 2  
ATOM 1852  H HD12 . LEU A 1 23  ? 32.645  66.208  99.150  1.00 0.00 ?  14  LEU A HD12 2  
ATOM 1853  H HD13 . LEU A 1 23  ? 31.146  65.120  98.945  1.00 0.00 ?  14  LEU A HD13 2  
ATOM 1854  H HD21 . LEU A 1 23  ? 33.047  62.008  98.908  1.00 0.00 ?  14  LEU A HD21 2  
ATOM 1855  H HD22 . LEU A 1 23  ? 32.375  62.781  100.387 1.00 0.00 ?  14  LEU A HD22 2  
ATOM 1856  H HD23 . LEU A 1 23  ? 31.395  62.795  98.878  1.00 0.00 ?  14  LEU A HD23 2  
ATOM 1857  N N    . HIS A 1 24  ? 36.271  65.662  97.536  1.00 0.00 ?  15  HIS A N    2  
ATOM 1858  C CA   . HIS A 1 24  ? 37.438  66.325  98.156  1.00 0.00 ?  15  HIS A CA   2  
ATOM 1859  C C    . HIS A 1 24  ? 37.645  67.691  97.600  1.00 0.00 ?  15  HIS A C    2  
ATOM 1860  O O    . HIS A 1 24  ? 37.766  68.694  98.341  1.00 0.00 ?  15  HIS A O    2  
ATOM 1861  C CB   . HIS A 1 24  ? 38.747  65.552  98.083  1.00 0.00 ?  15  HIS A CB   2  
ATOM 1862  C CG   . HIS A 1 24  ? 39.245  65.000  99.368  1.00 0.00 ?  15  HIS A CG   2  
ATOM 1863  N ND1  . HIS A 1 24  ? 40.250  65.641  100.150 1.00 0.00 ?  15  HIS A ND1  2  
ATOM 1864  C CD2  . HIS A 1 24  ? 38.754  63.954  100.093 1.00 0.00 ?  15  HIS A CD2  2  
ATOM 1865  C CE1  . HIS A 1 24  ? 40.305  64.949  101.295 1.00 0.00 ?  15  HIS A CE1  2  
ATOM 1866  N NE2  . HIS A 1 24  ? 39.421  63.948  101.265 1.00 0.00 ?  15  HIS A NE2  2  
ATOM 1867  H H    . HIS A 1 24  ? 36.420  64.928  96.858  1.00 0.00 ?  15  HIS A H    2  
ATOM 1868  H HA   . HIS A 1 24  ? 37.245  66.475  99.218  1.00 0.00 ?  15  HIS A HA   2  
ATOM 1869  H HB2  . HIS A 1 24  ? 38.565  64.707  97.419  1.00 0.00 ?  15  HIS A HB2  2  
ATOM 1870  H HB3  . HIS A 1 24  ? 39.500  66.170  97.594  1.00 0.00 ?  15  HIS A HB3  2  
ATOM 1871  H HD2  . HIS A 1 24  ? 37.988  63.268  99.764  1.00 0.00 ?  15  HIS A HD2  2  
ATOM 1872  H HE1  . HIS A 1 24  ? 41.009  65.076  102.103 1.00 0.00 ?  15  HIS A HE1  2  
ATOM 1873  H HE2  . HIS A 1 24  ? 39.284  63.320  102.044 1.00 0.00 ?  15  HIS A HE2  2  
ATOM 1874  N N    . ALA A 1 25  ? 37.539  67.843  96.267  1.00 0.00 ?  16  ALA A N    2  
ATOM 1875  C CA   . ALA A 1 25  ? 37.617  69.118  95.638  1.00 0.00 ?  16  ALA A CA   2  
ATOM 1876  C C    . ALA A 1 25  ? 36.552  70.134  95.975  1.00 0.00 ?  16  ALA A C    2  
ATOM 1877  O O    . ALA A 1 25  ? 36.813  71.348  96.042  1.00 0.00 ?  16  ALA A O    2  
ATOM 1878  C CB   . ALA A 1 25  ? 37.807  69.052  94.060  1.00 0.00 ?  16  ALA A CB   2  
ATOM 1879  H H    . ALA A 1 25  ? 37.554  67.031  95.666  1.00 0.00 ?  16  ALA A H    2  
ATOM 1880  H HA   . ALA A 1 25  ? 38.571  69.569  95.913  1.00 0.00 ?  16  ALA A HA   2  
ATOM 1881  H HB1  . ALA A 1 25  ? 36.848  68.857  93.580  1.00 0.00 ?  16  ALA A HB1  2  
ATOM 1882  H HB2  . ALA A 1 25  ? 37.912  70.027  93.583  1.00 0.00 ?  16  ALA A HB2  2  
ATOM 1883  H HB3  . ALA A 1 25  ? 38.546  68.398  93.598  1.00 0.00 ?  16  ALA A HB3  2  
ATOM 1884  N N    . VAL A 1 26  ? 35.300  69.687  96.137  1.00 0.00 ?  17  VAL A N    2  
ATOM 1885  C CA   . VAL A 1 26  ? 34.267  70.612  96.575  1.00 0.00 ?  17  VAL A CA   2  
ATOM 1886  C C    . VAL A 1 26  ? 34.391  70.922  98.066  1.00 0.00 ?  17  VAL A C    2  
ATOM 1887  O O    . VAL A 1 26  ? 34.096  72.080  98.412  1.00 0.00 ?  17  VAL A O    2  
ATOM 1888  C CB   . VAL A 1 26  ? 32.859  70.112  96.074  1.00 0.00 ?  17  VAL A CB   2  
ATOM 1889  C CG1  . VAL A 1 26  ? 32.341  68.996  96.875  1.00 0.00 ?  17  VAL A CG1  2  
ATOM 1890  C CG2  . VAL A 1 26  ? 31.819  71.282  95.955  1.00 0.00 ?  17  VAL A CG2  2  
ATOM 1891  H H    . VAL A 1 26  ? 35.027  68.748  95.884  1.00 0.00 ?  17  VAL A H    2  
ATOM 1892  H HA   . VAL A 1 26  ? 34.410  71.572  96.078  1.00 0.00 ?  17  VAL A HA   2  
ATOM 1893  H HB   . VAL A 1 26  ? 33.056  69.664  95.100  1.00 0.00 ?  17  VAL A HB   2  
ATOM 1894  H HG11 . VAL A 1 26  ? 32.194  69.444  97.858  1.00 0.00 ?  17  VAL A HG11 2  
ATOM 1895  H HG12 . VAL A 1 26  ? 31.395  68.734  96.401  1.00 0.00 ?  17  VAL A HG12 2  
ATOM 1896  H HG13 . VAL A 1 26  ? 32.967  68.104  96.893  1.00 0.00 ?  17  VAL A HG13 2  
ATOM 1897  H HG21 . VAL A 1 26  ? 31.454  71.579  96.938  1.00 0.00 ?  17  VAL A HG21 2  
ATOM 1898  H HG22 . VAL A 1 26  ? 32.315  72.098  95.428  1.00 0.00 ?  17  VAL A HG22 2  
ATOM 1899  H HG23 . VAL A 1 26  ? 30.990  70.876  95.374  1.00 0.00 ?  17  VAL A HG23 2  
ATOM 1900  N N    . LEU A 1 27  ? 34.925  70.052  98.943  1.00 0.00 ?  18  LEU A N    2  
ATOM 1901  C CA   . LEU A 1 27  ? 35.057  70.390  100.318 1.00 0.00 ?  18  LEU A CA   2  
ATOM 1902  C C    . LEU A 1 27  ? 36.339  71.238  100.575 1.00 0.00 ?  18  LEU A C    2  
ATOM 1903  O O    . LEU A 1 27  ? 36.252  72.156  101.381 1.00 0.00 ?  18  LEU A O    2  
ATOM 1904  C CB   . LEU A 1 27  ? 35.159  69.053  101.158 1.00 0.00 ?  18  LEU A CB   2  
ATOM 1905  C CG   . LEU A 1 27  ? 33.839  68.268  101.382 1.00 0.00 ?  18  LEU A CG   2  
ATOM 1906  C CD1  . LEU A 1 27  ? 34.231  66.916  101.955 1.00 0.00 ?  18  LEU A CD1  2  
ATOM 1907  C CD2  . LEU A 1 27  ? 32.879  68.888  102.332 1.00 0.00 ?  18  LEU A CD2  2  
ATOM 1908  H H    . LEU A 1 27  ? 35.264  69.124  98.732  1.00 0.00 ?  18  LEU A H    2  
ATOM 1909  H HA   . LEU A 1 27  ? 34.224  71.008  100.652 1.00 0.00 ?  18  LEU A HA   2  
ATOM 1910  H HB2  . LEU A 1 27  ? 35.862  68.295  100.814 1.00 0.00 ?  18  LEU A HB2  2  
ATOM 1911  H HB3  . LEU A 1 27  ? 35.532  69.299  102.152 1.00 0.00 ?  18  LEU A HB3  2  
ATOM 1912  H HG   . LEU A 1 27  ? 33.373  68.127  100.407 1.00 0.00 ?  18  LEU A HG   2  
ATOM 1913  H HD11 . LEU A 1 27  ? 34.993  66.405  101.366 1.00 0.00 ?  18  LEU A HD11 2  
ATOM 1914  H HD12 . LEU A 1 27  ? 34.676  67.043  102.941 1.00 0.00 ?  18  LEU A HD12 2  
ATOM 1915  H HD13 . LEU A 1 27  ? 33.431  66.178  102.015 1.00 0.00 ?  18  LEU A HD13 2  
ATOM 1916  H HD21 . LEU A 1 27  ? 31.937  68.347  102.414 1.00 0.00 ?  18  LEU A HD21 2  
ATOM 1917  H HD22 . LEU A 1 27  ? 33.344  68.927  103.317 1.00 0.00 ?  18  LEU A HD22 2  
ATOM 1918  H HD23 . LEU A 1 27  ? 32.576  69.859  101.941 1.00 0.00 ?  18  LEU A HD23 2  
ATOM 1919  N N    . LYS A 1 28  ? 37.392  71.068  99.760  1.00 0.00 ?  19  LYS A N    2  
ATOM 1920  C CA   . LYS A 1 28  ? 38.528  72.069  99.689  1.00 0.00 ?  19  LYS A CA   2  
ATOM 1921  C C    . LYS A 1 28  ? 38.121  73.543  99.437  1.00 0.00 ?  19  LYS A C    2  
ATOM 1922  O O    . LYS A 1 28  ? 38.610  74.521  99.966  1.00 0.00 ?  19  LYS A O    2  
ATOM 1923  C CB   . LYS A 1 28  ? 39.569  71.485  98.589  1.00 0.00 ?  19  LYS A CB   2  
ATOM 1924  C CG   . LYS A 1 28  ? 40.718  72.350  98.178  1.00 0.00 ?  19  LYS A CG   2  
ATOM 1925  C CD   . LYS A 1 28  ? 41.799  71.449  97.497  1.00 0.00 ?  19  LYS A CD   2  
ATOM 1926  C CE   . LYS A 1 28  ? 42.820  72.349  96.739  1.00 0.00 ?  19  LYS A CE   2  
ATOM 1927  N NZ   . LYS A 1 28  ? 43.446  73.353  97.539  1.00 0.00 1  19  LYS A NZ   2  
ATOM 1928  H H    . LYS A 1 28  ? 37.439  70.225  99.206  1.00 0.00 ?  19  LYS A H    2  
ATOM 1929  H HA   . LYS A 1 28  ? 39.084  72.120  100.625 1.00 0.00 ?  19  LYS A HA   2  
ATOM 1930  H HB2  . LYS A 1 28  ? 39.996  70.539  98.922  1.00 0.00 ?  19  LYS A HB2  2  
ATOM 1931  H HB3  . LYS A 1 28  ? 38.955  71.104  97.772  1.00 0.00 ?  19  LYS A HB3  2  
ATOM 1932  H HG2  . LYS A 1 28  ? 40.301  73.146  97.560  1.00 0.00 ?  19  LYS A HG2  2  
ATOM 1933  H HG3  . LYS A 1 28  ? 41.129  72.669  99.136  1.00 0.00 ?  19  LYS A HG3  2  
ATOM 1934  H HD2  . LYS A 1 28  ? 42.307  70.958  98.327  1.00 0.00 ?  19  LYS A HD2  2  
ATOM 1935  H HD3  . LYS A 1 28  ? 41.364  70.738  96.794  1.00 0.00 ?  19  LYS A HD3  2  
ATOM 1936  H HE2  . LYS A 1 28  ? 43.527  71.569  96.456  1.00 0.00 ?  19  LYS A HE2  2  
ATOM 1937  H HE3  . LYS A 1 28  ? 42.237  72.716  95.894  1.00 0.00 ?  19  LYS A HE3  2  
ATOM 1938  H HZ1  . LYS A 1 28  ? 42.818  74.013  97.975  1.00 0.00 ?  19  LYS A HZ1  2  
ATOM 1939  H HZ2  . LYS A 1 28  ? 44.118  72.914  98.151  1.00 0.00 ?  19  LYS A HZ2  2  
ATOM 1940  H HZ3  . LYS A 1 28  ? 44.018  74.011  97.029  1.00 0.00 ?  19  LYS A HZ3  2  
ATOM 1941  N N    . ALA A 1 29  ? 37.094  73.628  98.546  1.00 0.00 ?  20  ALA A N    2  
ATOM 1942  C CA   . ALA A 1 29  ? 36.561  74.864  98.051  1.00 0.00 ?  20  ALA A CA   2  
ATOM 1943  C C    . ALA A 1 29  ? 35.466  75.399  99.049  1.00 0.00 ?  20  ALA A C    2  
ATOM 1944  O O    . ALA A 1 29  ? 35.408  76.610  99.189  1.00 0.00 ?  20  ALA A O    2  
ATOM 1945  C CB   . ALA A 1 29  ? 35.973  74.585  96.603  1.00 0.00 ?  20  ALA A CB   2  
ATOM 1946  H H    . ALA A 1 29  ? 36.998  72.854  97.905  1.00 0.00 ?  20  ALA A H    2  
ATOM 1947  H HA   . ALA A 1 29  ? 37.260  75.692  97.935  1.00 0.00 ?  20  ALA A HA   2  
ATOM 1948  H HB1  . ALA A 1 29  ? 35.202  73.829  96.752  1.00 0.00 ?  20  ALA A HB1  2  
ATOM 1949  H HB2  . ALA A 1 29  ? 35.576  75.461  96.091  1.00 0.00 ?  20  ALA A HB2  2  
ATOM 1950  H HB3  . ALA A 1 29  ? 36.688  74.050  95.977  1.00 0.00 ?  20  ALA A HB3  2  
ATOM 1951  N N    . LEU A 1 30  ? 34.689  74.533  99.707  1.00 0.00 ?  21  LEU A N    2  
ATOM 1952  C CA   . LEU A 1 30  ? 33.779  74.938  100.728 1.00 0.00 ?  21  LEU A CA   2  
ATOM 1953  C C    . LEU A 1 30  ? 34.582  75.500  101.873 1.00 0.00 ?  21  LEU A C    2  
ATOM 1954  O O    . LEU A 1 30  ? 34.315  76.661  102.231 1.00 0.00 ?  21  LEU A O    2  
ATOM 1955  C CB   . LEU A 1 30  ? 32.935  73.749  101.203 1.00 0.00 ?  21  LEU A CB   2  
ATOM 1956  C CG   . LEU A 1 30  ? 31.729  73.461  100.291 1.00 0.00 ?  21  LEU A CG   2  
ATOM 1957  C CD1  . LEU A 1 30  ? 31.289  71.937  100.403 1.00 0.00 ?  21  LEU A CD1  2  
ATOM 1958  C CD2  . LEU A 1 30  ? 30.516  74.335  100.603 1.00 0.00 ?  21  LEU A CD2  2  
ATOM 1959  H H    . LEU A 1 30  ? 34.676  73.566  99.414  1.00 0.00 ?  21  LEU A H    2  
ATOM 1960  H HA   . LEU A 1 30  ? 33.192  75.749  100.296 1.00 0.00 ?  21  LEU A HA   2  
ATOM 1961  H HB2  . LEU A 1 30  ? 33.579  72.886  101.369 1.00 0.00 ?  21  LEU A HB2  2  
ATOM 1962  H HB3  . LEU A 1 30  ? 32.514  73.953  102.187 1.00 0.00 ?  21  LEU A HB3  2  
ATOM 1963  H HG   . LEU A 1 30  ? 31.948  73.695  99.249  1.00 0.00 ?  21  LEU A HG   2  
ATOM 1964  H HD11 . LEU A 1 30  ? 32.157  71.369  100.069 1.00 0.00 ?  21  LEU A HD11 2  
ATOM 1965  H HD12 . LEU A 1 30  ? 31.017  71.827  101.453 1.00 0.00 ?  21  LEU A HD12 2  
ATOM 1966  H HD13 . LEU A 1 30  ? 30.519  71.688  99.673  1.00 0.00 ?  21  LEU A HD13 2  
ATOM 1967  H HD21 . LEU A 1 30  ? 30.790  75.386  100.521 1.00 0.00 ?  21  LEU A HD21 2  
ATOM 1968  H HD22 . LEU A 1 30  ? 29.830  74.032  99.812  1.00 0.00 ?  21  LEU A HD22 2  
ATOM 1969  H HD23 . LEU A 1 30  ? 29.918  74.087  101.480 1.00 0.00 ?  21  LEU A HD23 2  
ATOM 1970  N N    . ASN A 1 31  ? 35.635  74.797  102.367 1.00 0.00 ?  22  ASN A N    2  
ATOM 1971  C CA   . ASN A 1 31  ? 36.704  75.275  103.271 1.00 0.00 ?  22  ASN A CA   2  
ATOM 1972  C C    . ASN A 1 31  ? 37.394  76.625  102.915 1.00 0.00 ?  22  ASN A C    2  
ATOM 1973  O O    . ASN A 1 31  ? 37.718  77.484  103.762 1.00 0.00 ?  22  ASN A O    2  
ATOM 1974  C CB   . ASN A 1 31  ? 37.702  74.118  103.642 1.00 0.00 ?  22  ASN A CB   2  
ATOM 1975  C CG   . ASN A 1 31  ? 37.090  73.048  104.565 1.00 0.00 ?  22  ASN A CG   2  
ATOM 1976  O OD1  . ASN A 1 31  ? 35.940  73.007  104.976 1.00 0.00 ?  22  ASN A OD1  2  
ATOM 1977  N ND2  . ASN A 1 31  ? 37.917  72.074  104.884 1.00 0.00 ?  22  ASN A ND2  2  
ATOM 1978  H H    . ASN A 1 31  ? 35.658  73.803  102.194 1.00 0.00 ?  22  ASN A H    2  
ATOM 1979  H HA   . ASN A 1 31  ? 36.291  75.518  104.250 1.00 0.00 ?  22  ASN A HA   2  
ATOM 1980  H HB2  . ASN A 1 31  ? 38.055  73.659  102.719 1.00 0.00 ?  22  ASN A HB2  2  
ATOM 1981  H HB3  . ASN A 1 31  ? 38.560  74.581  104.130 1.00 0.00 ?  22  ASN A HB3  2  
ATOM 1982  H HD21 . ASN A 1 31  ? 38.862  72.061  104.528 1.00 0.00 ?  22  ASN A HD21 2  
ATOM 1983  H HD22 . ASN A 1 31  ? 37.626  71.515  105.672 1.00 0.00 ?  22  ASN A HD22 2  
ATOM 1984  N N    . ALA A 1 32  ? 37.516  76.962  101.588 1.00 0.00 ?  23  ALA A N    2  
ATOM 1985  C CA   . ALA A 1 32  ? 38.170  78.212  101.108 1.00 0.00 ?  23  ALA A CA   2  
ATOM 1986  C C    . ALA A 1 32  ? 37.210  79.352  101.174 1.00 0.00 ?  23  ALA A C    2  
ATOM 1987  O O    . ALA A 1 32  ? 37.460  80.279  101.913 1.00 0.00 ?  23  ALA A O    2  
ATOM 1988  C CB   . ALA A 1 32  ? 38.764  78.060  99.735  1.00 0.00 ?  23  ALA A CB   2  
ATOM 1989  H H    . ALA A 1 32  ? 37.195  76.303  100.894 1.00 0.00 ?  23  ALA A H    2  
ATOM 1990  H HA   . ALA A 1 32  ? 38.983  78.549  101.751 1.00 0.00 ?  23  ALA A HA   2  
ATOM 1991  H HB1  . ALA A 1 32  ? 39.265  78.984  99.445  1.00 0.00 ?  23  ALA A HB1  2  
ATOM 1992  H HB2  . ALA A 1 32  ? 39.545  77.311  99.864  1.00 0.00 ?  23  ALA A HB2  2  
ATOM 1993  H HB3  . ALA A 1 32  ? 38.065  77.623  99.021  1.00 0.00 ?  23  ALA A HB3  2  
ATOM 1994  N N    . THR A 1 33  ? 35.931  79.148  100.693 1.00 0.00 ?  24  THR A N    2  
ATOM 1995  C CA   . THR A 1 33  ? 34.931  80.123  100.939 1.00 0.00 ?  24  THR A CA   2  
ATOM 1996  C C    . THR A 1 33  ? 34.637  80.392  102.380 1.00 0.00 ?  24  THR A C    2  
ATOM 1997  O O    . THR A 1 33  ? 34.310  81.512  102.762 1.00 0.00 ?  24  THR A O    2  
ATOM 1998  C CB   . THR A 1 33  ? 33.603  79.743  100.223 1.00 0.00 ?  24  THR A CB   2  
ATOM 1999  O OG1  . THR A 1 33  ? 33.603  78.797  99.211  1.00 0.00 ?  24  THR A OG1  2  
ATOM 2000  C CG2  . THR A 1 33  ? 33.068  81.052  99.690  1.00 0.00 ?  24  THR A CG2  2  
ATOM 2001  H H    . THR A 1 33  ? 35.702  78.304  100.186 1.00 0.00 ?  24  THR A H    2  
ATOM 2002  H HA   . THR A 1 33  ? 35.413  80.957  100.431 1.00 0.00 ?  24  THR A HA   2  
ATOM 2003  H HB   . THR A 1 33  ? 32.944  79.372  101.008 1.00 0.00 ?  24  THR A HB   2  
ATOM 2004  H HG1  . THR A 1 33  ? 33.810  77.910  99.515  1.00 0.00 ?  24  THR A HG1  2  
ATOM 2005  H HG21 . THR A 1 33  ? 33.089  81.750  100.527 1.00 0.00 ?  24  THR A HG21 2  
ATOM 2006  H HG22 . THR A 1 33  ? 33.779  81.413  98.947  1.00 0.00 ?  24  THR A HG22 2  
ATOM 2007  H HG23 . THR A 1 33  ? 32.076  81.173  99.256  1.00 0.00 ?  24  THR A HG23 2  
ATOM 2008  N N    . LEU A 1 34  ? 34.932  79.397  103.226 1.00 0.00 ?  25  LEU A N    2  
ATOM 2009  C CA   . LEU A 1 34  ? 34.796  79.491  104.644 1.00 0.00 ?  25  LEU A CA   2  
ATOM 2010  C C    . LEU A 1 34  ? 35.828  80.404  105.226 1.00 0.00 ?  25  LEU A C    2  
ATOM 2011  O O    . LEU A 1 34  ? 35.456  81.282  106.046 1.00 0.00 ?  25  LEU A O    2  
ATOM 2012  C CB   . LEU A 1 34  ? 34.659  78.037  105.143 1.00 0.00 ?  25  LEU A CB   2  
ATOM 2013  C CG   . LEU A 1 34  ? 34.617  77.813  106.690 1.00 0.00 ?  25  LEU A CG   2  
ATOM 2014  C CD1  . LEU A 1 34  ? 33.452  78.584  107.145 1.00 0.00 ?  25  LEU A CD1  2  
ATOM 2015  C CD2  . LEU A 1 34  ? 34.499  76.331  106.999 1.00 0.00 ?  25  LEU A CD2  2  
ATOM 2016  H H    . LEU A 1 34  ? 35.175  78.521  102.785 1.00 0.00 ?  25  LEU A H    2  
ATOM 2017  H HA   . LEU A 1 34  ? 33.821  79.962  104.771 1.00 0.00 ?  25  LEU A HA   2  
ATOM 2018  H HB2  . LEU A 1 34  ? 33.726  77.633  104.749 1.00 0.00 ?  25  LEU A HB2  2  
ATOM 2019  H HB3  . LEU A 1 34  ? 35.517  77.470  104.779 1.00 0.00 ?  25  LEU A HB3  2  
ATOM 2020  H HG   . LEU A 1 34  ? 35.580  78.104  107.111 1.00 0.00 ?  25  LEU A HG   2  
ATOM 2021  H HD11 . LEU A 1 34  ? 32.541  78.442  106.562 1.00 0.00 ?  25  LEU A HD11 2  
ATOM 2022  H HD12 . LEU A 1 34  ? 33.270  78.572  108.219 1.00 0.00 ?  25  LEU A HD12 2  
ATOM 2023  H HD13 . LEU A 1 34  ? 33.618  79.660  107.087 1.00 0.00 ?  25  LEU A HD13 2  
ATOM 2024  H HD21 . LEU A 1 34  ? 35.276  75.797  106.453 1.00 0.00 ?  25  LEU A HD21 2  
ATOM 2025  H HD22 . LEU A 1 34  ? 34.670  76.199  108.067 1.00 0.00 ?  25  LEU A HD22 2  
ATOM 2026  H HD23 . LEU A 1 34  ? 33.521  75.966  106.682 1.00 0.00 ?  25  LEU A HD23 2  
ATOM 2027  N N    . HIS A 1 35  ? 37.060  80.325  104.822 1.00 0.00 ?  26  HIS A N    2  
ATOM 2028  C CA   . HIS A 1 35  ? 38.147  81.199  105.260 1.00 0.00 ?  26  HIS A CA   2  
ATOM 2029  C C    . HIS A 1 35  ? 37.912  82.656  104.807 1.00 0.00 ?  26  HIS A C    2  
ATOM 2030  O O    . HIS A 1 35  ? 38.121  83.532  105.590 1.00 0.00 ?  26  HIS A O    2  
ATOM 2031  C CB   . HIS A 1 35  ? 39.496  80.758  104.733 1.00 0.00 ?  26  HIS A CB   2  
ATOM 2032  C CG   . HIS A 1 35  ? 40.623  81.651  105.035 1.00 0.00 ?  26  HIS A CG   2  
ATOM 2033  N ND1  . HIS A 1 35  ? 40.996  82.790  104.287 1.00 0.00 ?  26  HIS A ND1  2  
ATOM 2034  C CD2  . HIS A 1 35  ? 41.470  81.509  106.081 1.00 0.00 ?  26  HIS A CD2  2  
ATOM 2035  C CE1  . HIS A 1 35  ? 42.033  83.395  105.004 1.00 0.00 ?  26  HIS A CE1  2  
ATOM 2036  N NE2  . HIS A 1 35  ? 42.361  82.545  105.967 1.00 0.00 ?  26  HIS A NE2  2  
ATOM 2037  H H    . HIS A 1 35  ? 37.245  79.755  104.009 1.00 0.00 ?  26  HIS A H    2  
ATOM 2038  H HA   . HIS A 1 35  ? 38.280  81.152  106.341 1.00 0.00 ?  26  HIS A HA   2  
ATOM 2039  H HB2  . HIS A 1 35  ? 39.642  79.798  105.229 1.00 0.00 ?  26  HIS A HB2  2  
ATOM 2040  H HB3  . HIS A 1 35  ? 39.610  80.566  103.666 1.00 0.00 ?  26  HIS A HB3  2  
ATOM 2041  H HD2  . HIS A 1 35  ? 41.502  80.708  106.805 1.00 0.00 ?  26  HIS A HD2  2  
ATOM 2042  H HE1  . HIS A 1 35  ? 42.475  84.361  104.814 1.00 0.00 ?  26  HIS A HE1  2  
ATOM 2043  H HE2  . HIS A 1 35  ? 43.020  82.817  106.683 1.00 0.00 ?  26  HIS A HE2  2  
ATOM 2044  N N    . SER A 1 36  ? 37.360  82.885  103.559 1.00 0.00 ?  27  SER A N    2  
ATOM 2045  C CA   . SER A 1 36  ? 36.961  84.244  103.265 1.00 0.00 ?  27  SER A CA   2  
ATOM 2046  C C    . SER A 1 36  ? 35.625  84.650  103.961 1.00 0.00 ?  27  SER A C    2  
ATOM 2047  O O    . SER A 1 36  ? 35.421  85.890  104.140 1.00 0.00 ?  27  SER A O    2  
ATOM 2048  C CB   . SER A 1 36  ? 37.080  84.477  101.761 1.00 0.00 ?  27  SER A CB   2  
ATOM 2049  O OG   . SER A 1 36  ? 36.086  83.795  100.985 1.00 0.00 ?  27  SER A OG   2  
ATOM 2050  H H    . SER A 1 36  ? 37.131  82.099  102.968 1.00 0.00 ?  27  SER A H    2  
ATOM 2051  H HA   . SER A 1 36  ? 37.737  84.870  103.706 1.00 0.00 ?  27  SER A HA   2  
ATOM 2052  H HB2  . SER A 1 36  ? 36.795  85.493  101.488 1.00 0.00 ?  27  SER A HB2  2  
ATOM 2053  H HB3  . SER A 1 36  ? 38.097  84.243  101.444 1.00 0.00 ?  27  SER A HB3  2  
ATOM 2054  H HG   . SER A 1 36  ? 36.605  83.267  100.374 1.00 0.00 ?  27  SER A HG   2  
ATOM 2055  N N    . ASN A 1 37  ? 34.733  83.746  104.311 1.00 0.00 ?  28  ASN A N    2  
ATOM 2056  C CA   . ASN A 1 37  ? 33.503  83.963  105.002 1.00 0.00 ?  28  ASN A CA   2  
ATOM 2057  C C    . ASN A 1 37  ? 33.628  84.455  106.476 1.00 0.00 ?  28  ASN A C    2  
ATOM 2058  O O    . ASN A 1 37  ? 33.014  85.436  106.939 1.00 0.00 ?  28  ASN A O    2  
ATOM 2059  C CB   . ASN A 1 37  ? 32.562  82.680  104.819 1.00 0.00 ?  28  ASN A CB   2  
ATOM 2060  C CG   . ASN A 1 37  ? 31.091  82.776  105.317 1.00 0.00 ?  28  ASN A CG   2  
ATOM 2061  O OD1  . ASN A 1 37  ? 30.801  83.666  106.078 1.00 0.00 ?  28  ASN A OD1  2  
ATOM 2062  N ND2  . ASN A 1 37  ? 30.178  81.877  104.941 1.00 0.00 ?  28  ASN A ND2  2  
ATOM 2063  H H    . ASN A 1 37  ? 34.951  82.806  104.011 1.00 0.00 ?  28  ASN A H    2  
ATOM 2064  H HA   . ASN A 1 37  ? 33.056  84.811  104.483 1.00 0.00 ?  28  ASN A HA   2  
ATOM 2065  H HB2  . ASN A 1 37  ? 32.433  82.471  103.757 1.00 0.00 ?  28  ASN A HB2  2  
ATOM 2066  H HB3  . ASN A 1 37  ? 33.120  81.806  105.155 1.00 0.00 ?  28  ASN A HB3  2  
ATOM 2067  H HD21 . ASN A 1 37  ? 30.474  81.271  104.189 1.00 0.00 ?  28  ASN A HD21 2  
ATOM 2068  H HD22 . ASN A 1 37  ? 29.221  81.925  105.259 1.00 0.00 ?  28  ASN A HD22 2  
ATOM 2069  N N    . LEU A 1 38  ? 34.574  83.758  107.154 1.00 0.00 ?  29  LEU A N    2  
ATOM 2070  C CA   . LEU A 1 38  ? 35.217  84.128  108.450 1.00 0.00 ?  29  LEU A CA   2  
ATOM 2071  C C    . LEU A 1 38  ? 36.045  85.451  108.421 1.00 0.00 ?  29  LEU A C    2  
ATOM 2072  O O    . LEU A 1 38  ? 36.539  85.932  109.465 1.00 0.00 ?  29  LEU A O    2  
ATOM 2073  C CB   . LEU A 1 38  ? 36.026  82.908  109.034 1.00 0.00 ?  29  LEU A CB   2  
ATOM 2074  C CG   . LEU A 1 38  ? 35.206  81.779  109.661 1.00 0.00 ?  29  LEU A CG   2  
ATOM 2075  C CD1  . LEU A 1 38  ? 36.049  80.517  110.007 1.00 0.00 ?  29  LEU A CD1  2  
ATOM 2076  C CD2  . LEU A 1 38  ? 34.588  82.192  111.008 1.00 0.00 ?  29  LEU A CD2  2  
ATOM 2077  H H    . LEU A 1 38  ? 34.925  82.954  106.653 1.00 0.00 ?  29  LEU A H    2  
ATOM 2078  H HA   . LEU A 1 38  ? 34.337  84.253  109.082 1.00 0.00 ?  29  LEU A HA   2  
ATOM 2079  H HB2  . LEU A 1 38  ? 36.588  82.568  108.164 1.00 0.00 ?  29  LEU A HB2  2  
ATOM 2080  H HB3  . LEU A 1 38  ? 36.825  83.250  109.691 1.00 0.00 ?  29  LEU A HB3  2  
ATOM 2081  H HG   . LEU A 1 38  ? 34.425  81.417  108.993 1.00 0.00 ?  29  LEU A HG   2  
ATOM 2082  H HD11 . LEU A 1 38  ? 35.334  79.726  110.234 1.00 0.00 ?  29  LEU A HD11 2  
ATOM 2083  H HD12 . LEU A 1 38  ? 36.703  80.295  109.164 1.00 0.00 ?  29  LEU A HD12 2  
ATOM 2084  H HD13 . LEU A 1 38  ? 36.652  80.688  110.899 1.00 0.00 ?  29  LEU A HD13 2  
ATOM 2085  H HD21 . LEU A 1 38  ? 35.343  82.431  111.757 1.00 0.00 ?  29  LEU A HD21 2  
ATOM 2086  H HD22 . LEU A 1 38  ? 33.868  83.007  110.935 1.00 0.00 ?  29  LEU A HD22 2  
ATOM 2087  H HD23 . LEU A 1 38  ? 34.079  81.347  111.472 1.00 0.00 ?  29  LEU A HD23 2  
ATOM 2088  N N    . LEU A 1 39  ? 36.143  85.982  107.195 1.00 0.00 ?  30  LEU A N    2  
ATOM 2089  C CA   . LEU A 1 39  ? 36.588  87.383  106.897 1.00 0.00 ?  30  LEU A CA   2  
ATOM 2090  C C    . LEU A 1 39  ? 35.534  88.392  106.316 1.00 0.00 ?  30  LEU A C    2  
ATOM 2091  O O    . LEU A 1 39  ? 35.484  89.563  106.594 1.00 0.00 ?  30  LEU A O    2  
ATOM 2092  C CB   . LEU A 1 39  ? 37.810  87.236  106.047 1.00 0.00 ?  30  LEU A CB   2  
ATOM 2093  C CG   . LEU A 1 39  ? 38.974  86.582  106.821 1.00 0.00 ?  30  LEU A CG   2  
ATOM 2094  C CD1  . LEU A 1 39  ? 40.092  86.242  105.844 1.00 0.00 ?  30  LEU A CD1  2  
ATOM 2095  C CD2  . LEU A 1 39  ? 39.530  87.533  107.825 1.00 0.00 ?  30  LEU A CD2  2  
ATOM 2096  H H    . LEU A 1 39  ? 35.711  85.403  106.490 1.00 0.00 ?  30  LEU A H    2  
ATOM 2097  H HA   . LEU A 1 39  ? 36.842  87.715  107.903 1.00 0.00 ?  30  LEU A HA   2  
ATOM 2098  H HB2  . LEU A 1 39  ? 37.585  86.716  105.116 1.00 0.00 ?  30  LEU A HB2  2  
ATOM 2099  H HB3  . LEU A 1 39  ? 38.171  88.242  105.834 1.00 0.00 ?  30  LEU A HB3  2  
ATOM 2100  H HG   . LEU A 1 39  ? 38.613  85.676  107.307 1.00 0.00 ?  30  LEU A HG   2  
ATOM 2101  H HD11 . LEU A 1 39  ? 40.677  87.059  105.423 1.00 0.00 ?  30  LEU A HD11 2  
ATOM 2102  H HD12 . LEU A 1 39  ? 40.836  85.678  106.406 1.00 0.00 ?  30  LEU A HD12 2  
ATOM 2103  H HD13 . LEU A 1 39  ? 39.650  85.535  105.142 1.00 0.00 ?  30  LEU A HD13 2  
ATOM 2104  H HD21 . LEU A 1 39  ? 39.832  88.434  107.290 1.00 0.00 ?  30  LEU A HD21 2  
ATOM 2105  H HD22 . LEU A 1 39  ? 38.828  87.773  108.623 1.00 0.00 ?  30  LEU A HD22 2  
ATOM 2106  H HD23 . LEU A 1 39  ? 40.456  87.169  108.270 1.00 0.00 ?  30  LEU A HD23 2  
ATOM 2107  N N    . CYS A 1 40  ? 34.454  87.887  105.662 1.00 0.00 ?  31  CYS A N    2  
ATOM 2108  C CA   . CYS A 1 40  ? 33.313  88.679  105.182 1.00 0.00 ?  31  CYS A CA   2  
ATOM 2109  C C    . CYS A 1 40  ? 32.203  87.802  104.792 1.00 0.00 ?  31  CYS A C    2  
ATOM 2110  O O    . CYS A 1 40  ? 32.444  87.017  103.846 1.00 0.00 ?  31  CYS A O    2  
ATOM 2111  C CB   . CYS A 1 40  ? 33.642  89.517  103.967 1.00 0.00 ?  31  CYS A CB   2  
ATOM 2112  S SG   . CYS A 1 40  ? 32.433  90.863  103.438 1.00 0.00 ?  31  CYS A SG   2  
ATOM 2113  H H    . CYS A 1 40  ? 34.625  86.924  105.412 1.00 0.00 ?  31  CYS A H    2  
ATOM 2114  H HA   . CYS A 1 40  ? 33.043  89.382  105.969 1.00 0.00 ?  31  CYS A HA   2  
ATOM 2115  H HB2  . CYS A 1 40  ? 34.635  89.918  104.168 1.00 0.00 ?  31  CYS A HB2  2  
ATOM 2116  H HB3  . CYS A 1 40  ? 33.941  88.952  103.084 1.00 0.00 ?  31  CYS A HB3  2  
ATOM 2117  H HG   . CYS A 1 40  ? 32.224  90.508  102.167 1.00 0.00 ?  31  CYS A HG   2  
ATOM 2118  N N    . ARG A 1 41  ? 31.108  87.802  105.533 1.00 0.00 ?  32  ARG A N    2  
ATOM 2119  C CA   . ARG A 1 41  ? 29.981  86.827  105.506 1.00 0.00 ?  32  ARG A CA   2  
ATOM 2120  C C    . ARG A 1 41  ? 29.042  87.304  104.321 1.00 0.00 ?  32  ARG A C    2  
ATOM 2121  O O    . ARG A 1 41  ? 28.787  88.531  104.182 1.00 0.00 ?  32  ARG A O    2  
ATOM 2122  C CB   . ARG A 1 41  ? 29.311  86.760  106.860 1.00 0.00 ?  32  ARG A CB   2  
ATOM 2123  C CG   . ARG A 1 41  ? 28.235  85.684  106.781 1.00 0.00 ?  32  ARG A CG   2  
ATOM 2124  C CD   . ARG A 1 41  ? 27.877  85.305  108.203 1.00 0.00 ?  32  ARG A CD   2  
ATOM 2125  N NE   . ARG A 1 41  ? 27.245  83.959  108.299 1.00 0.00 ?  32  ARG A NE   2  
ATOM 2126  C CZ   . ARG A 1 41  ? 27.854  82.762  108.408 1.00 0.00 ?  32  ARG A CZ   2  
ATOM 2127  N NH1  . ARG A 1 41  ? 29.077  82.513  108.258 1.00 0.00 ?  32  ARG A NH1  2  
ATOM 2128  N NH2  . ARG A 1 41  ? 27.209  81.741  108.755 1.00 0.00 1  32  ARG A NH2  2  
ATOM 2129  H H    . ARG A 1 41  ? 31.180  88.469  106.288 1.00 0.00 ?  32  ARG A H    2  
ATOM 2130  H HA   . ARG A 1 41  ? 30.559  85.923  105.309 1.00 0.00 ?  32  ARG A HA   2  
ATOM 2131  H HB2  . ARG A 1 41  ? 30.069  86.600  107.626 1.00 0.00 ?  32  ARG A HB2  2  
ATOM 2132  H HB3  . ARG A 1 41  ? 28.753  87.687  106.993 1.00 0.00 ?  32  ARG A HB3  2  
ATOM 2133  H HG2  . ARG A 1 41  ? 27.347  86.081  106.289 1.00 0.00 ?  32  ARG A HG2  2  
ATOM 2134  H HG3  . ARG A 1 41  ? 28.625  84.778  106.317 1.00 0.00 ?  32  ARG A HG3  2  
ATOM 2135  H HD2  . ARG A 1 41  ? 28.747  85.130  108.836 1.00 0.00 ?  32  ARG A HD2  2  
ATOM 2136  H HD3  . ARG A 1 41  ? 27.279  86.092  108.662 1.00 0.00 ?  32  ARG A HD3  2  
ATOM 2137  H HE   . ARG A 1 41  ? 26.285  83.946  108.612 1.00 0.00 ?  32  ARG A HE   2  
ATOM 2138  H HH11 . ARG A 1 41  ? 29.708  83.137  107.775 1.00 0.00 ?  32  ARG A HH11 2  
ATOM 2139  H HH12 . ARG A 1 41  ? 29.230  81.516  108.307 1.00 0.00 ?  32  ARG A HH12 2  
ATOM 2140  H HH21 . ARG A 1 41  ? 26.261  81.802  109.098 1.00 0.00 ?  32  ARG A HH21 2  
ATOM 2141  H HH22 . ARG A 1 41  ? 27.730  80.945  109.095 1.00 0.00 ?  32  ARG A HH22 2  
ATOM 2142  N N    . PRO A 1 42  ? 28.529  86.348  103.554 1.00 0.00 ?  33  PRO A N    2  
ATOM 2143  C CA   . PRO A 1 42  ? 27.723  86.583  102.368 1.00 0.00 ?  33  PRO A CA   2  
ATOM 2144  C C    . PRO A 1 42  ? 26.337  87.303  102.497 1.00 0.00 ?  33  PRO A C    2  
ATOM 2145  O O    . PRO A 1 42  ? 25.623  87.275  103.514 1.00 0.00 ?  33  PRO A O    2  
ATOM 2146  C CB   . PRO A 1 42  ? 27.483  85.206  101.742 1.00 0.00 ?  33  PRO A CB   2  
ATOM 2147  C CG   . PRO A 1 42  ? 28.700  84.500  102.122 1.00 0.00 ?  33  PRO A CG   2  
ATOM 2148  C CD   . PRO A 1 42  ? 28.942  84.963  103.545 1.00 0.00 ?  33  PRO A CD   2  
ATOM 2149  H HA   . PRO A 1 42  ? 28.349  87.042  101.603 1.00 0.00 ?  33  PRO A HA   2  
ATOM 2150  H HB2  . PRO A 1 42  ? 26.686  84.719  102.303 1.00 0.00 ?  33  PRO A HB2  2  
ATOM 2151  H HB3  . PRO A 1 42  ? 27.355  85.325  100.666 1.00 0.00 ?  33  PRO A HB3  2  
ATOM 2152  H HG2  . PRO A 1 42  ? 28.399  83.452  102.144 1.00 0.00 ?  33  PRO A HG2  2  
ATOM 2153  H HG3  . PRO A 1 42  ? 29.576  84.742  101.519 1.00 0.00 ?  33  PRO A HG3  2  
ATOM 2154  H HD2  . PRO A 1 42  ? 28.351  84.344  104.219 1.00 0.00 ?  33  PRO A HD2  2  
ATOM 2155  H HD3  . PRO A 1 42  ? 30.028  84.995  103.636 1.00 0.00 ?  33  PRO A HD3  2  
ATOM 2156  N N    . GLY A 1 43  ? 25.916  87.875  101.382 1.00 0.00 ?  34  GLY A N    2  
ATOM 2157  C CA   . GLY A 1 43  ? 24.472  88.319  101.129 1.00 0.00 ?  34  GLY A CA   2  
ATOM 2158  C C    . GLY A 1 43  ? 23.599  87.233  100.692 1.00 0.00 ?  34  GLY A C    2  
ATOM 2159  O O    . GLY A 1 43  ? 24.072  86.110  100.524 1.00 0.00 ?  34  GLY A O    2  
ATOM 2160  H H    . GLY A 1 43  ? 26.575  87.894  100.618 1.00 0.00 ?  34  GLY A H    2  
ATOM 2161  H HA2  . GLY A 1 43  ? 24.038  88.677  102.062 1.00 0.00 ?  34  GLY A HA2  2  
ATOM 2162  H HA3  . GLY A 1 43  ? 24.504  89.102  100.372 1.00 0.00 ?  34  GLY A HA3  2  
ATOM 2163  N N    . PRO A 1 44  ? 22.255  87.492  100.492 1.00 0.00 ?  35  PRO A N    2  
ATOM 2164  C CA   . PRO A 1 44  ? 21.332  86.540  99.802  1.00 0.00 ?  35  PRO A CA   2  
ATOM 2165  C C    . PRO A 1 44  ? 21.520  86.475  98.240  1.00 0.00 ?  35  PRO A C    2  
ATOM 2166  O O    . PRO A 1 44  ? 21.695  87.477  97.543  1.00 0.00 ?  35  PRO A O    2  
ATOM 2167  C CB   . PRO A 1 44  ? 19.957  87.239  100.095 1.00 0.00 ?  35  PRO A CB   2  
ATOM 2168  C CG   . PRO A 1 44  ? 20.247  88.705  100.296 1.00 0.00 ?  35  PRO A CG   2  
ATOM 2169  C CD   . PRO A 1 44  ? 21.652  88.728  100.913 1.00 0.00 ?  35  PRO A CD   2  
ATOM 2170  H HA   . PRO A 1 44  ? 21.531  85.566  100.249 1.00 0.00 ?  35  PRO A HA   2  
ATOM 2171  H HB2  . PRO A 1 44  ? 19.234  87.177  99.282  1.00 0.00 ?  35  PRO A HB2  2  
ATOM 2172  H HB3  . PRO A 1 44  ? 19.487  86.863  101.004 1.00 0.00 ?  35  PRO A HB3  2  
ATOM 2173  H HG2  . PRO A 1 44  ? 20.359  89.146  99.305  1.00 0.00 ?  35  PRO A HG2  2  
ATOM 2174  H HG3  . PRO A 1 44  ? 19.447  89.160  100.880 1.00 0.00 ?  35  PRO A HG3  2  
ATOM 2175  H HD2  . PRO A 1 44  ? 22.103  89.600  100.439 1.00 0.00 ?  35  PRO A HD2  2  
ATOM 2176  H HD3  . PRO A 1 44  ? 21.639  88.766  102.002 1.00 0.00 ?  35  PRO A HD3  2  
ATOM 2177  N N    . GLY A 1 45  ? 21.569  85.288  97.649  1.00 0.00 ?  36  GLY A N    2  
ATOM 2178  C CA   . GLY A 1 45  ? 21.691  85.071  96.233  1.00 0.00 ?  36  GLY A CA   2  
ATOM 2179  C C    . GLY A 1 45  ? 22.871  84.225  95.750  1.00 0.00 ?  36  GLY A C    2  
ATOM 2180  O O    . GLY A 1 45  ? 23.459  83.508  96.477  1.00 0.00 ?  36  GLY A O    2  
ATOM 2181  H H    . GLY A 1 45  ? 21.523  84.432  98.183  1.00 0.00 ?  36  GLY A H    2  
ATOM 2182  H HA2  . GLY A 1 45  ? 20.818  84.523  95.877  1.00 0.00 ?  36  GLY A HA2  2  
ATOM 2183  H HA3  . GLY A 1 45  ? 21.753  86.014  95.690  1.00 0.00 ?  36  GLY A HA3  2  
ATOM 2184  N N    . LEU A 1 46  ? 23.267  84.527  94.570  1.00 0.00 ?  37  LEU A N    2  
ATOM 2185  C CA   . LEU A 1 46  ? 24.283  83.826  93.788  1.00 0.00 ?  37  LEU A CA   2  
ATOM 2186  C C    . LEU A 1 46  ? 25.714  84.191  94.281  1.00 0.00 ?  37  LEU A C    2  
ATOM 2187  O O    . LEU A 1 46  ? 25.917  85.347  94.626  1.00 0.00 ?  37  LEU A O    2  
ATOM 2188  C CB   . LEU A 1 46  ? 24.017  84.271  92.320  1.00 0.00 ?  37  LEU A CB   2  
ATOM 2189  C CG   . LEU A 1 46  ? 25.066  83.941  91.321  1.00 0.00 ?  37  LEU A CG   2  
ATOM 2190  C CD1  . LEU A 1 46  ? 25.092  82.423  91.104  1.00 0.00 ?  37  LEU A CD1  2  
ATOM 2191  C CD2  . LEU A 1 46  ? 24.679  84.557  89.944  1.00 0.00 ?  37  LEU A CD2  2  
ATOM 2192  H H    . LEU A 1 46  ? 22.809  85.348  94.202  1.00 0.00 ?  37  LEU A H    2  
ATOM 2193  H HA   . LEU A 1 46  ? 24.029  82.769  93.868  1.00 0.00 ?  37  LEU A HA   2  
ATOM 2194  H HB2  . LEU A 1 46  ? 23.043  83.854  92.063  1.00 0.00 ?  37  LEU A HB2  2  
ATOM 2195  H HB3  . LEU A 1 46  ? 23.985  85.356  92.227  1.00 0.00 ?  37  LEU A HB3  2  
ATOM 2196  H HG   . LEU A 1 46  ? 26.056  84.314  91.582  1.00 0.00 ?  37  LEU A HG   2  
ATOM 2197  H HD11 . LEU A 1 46  ? 24.239  82.002  90.571  1.00 0.00 ?  37  LEU A HD11 2  
ATOM 2198  H HD12 . LEU A 1 46  ? 25.904  82.217  90.407  1.00 0.00 ?  37  LEU A HD12 2  
ATOM 2199  H HD13 . LEU A 1 46  ? 25.267  81.871  92.028  1.00 0.00 ?  37  LEU A HD13 2  
ATOM 2200  H HD21 . LEU A 1 46  ? 24.501  85.626  90.069  1.00 0.00 ?  37  LEU A HD21 2  
ATOM 2201  H HD22 . LEU A 1 46  ? 25.466  84.364  89.216  1.00 0.00 ?  37  LEU A HD22 2  
ATOM 2202  H HD23 . LEU A 1 46  ? 23.789  84.012  89.630  1.00 0.00 ?  37  LEU A HD23 2  
ATOM 2203  N N    . GLY A 1 47  ? 26.535  83.197  94.382  1.00 0.00 ?  38  GLY A N    2  
ATOM 2204  C CA   . GLY A 1 47  ? 27.838  83.097  95.040  1.00 0.00 ?  38  GLY A CA   2  
ATOM 2205  C C    . GLY A 1 47  ? 28.683  82.114  94.329  1.00 0.00 ?  38  GLY A C    2  
ATOM 2206  O O    . GLY A 1 47  ? 28.370  81.609  93.282  1.00 0.00 ?  38  GLY A O    2  
ATOM 2207  H H    . GLY A 1 47  ? 26.121  82.298  94.184  1.00 0.00 ?  38  GLY A H    2  
ATOM 2208  H HA2  . GLY A 1 47  ? 28.271  84.087  94.894  1.00 0.00 ?  38  GLY A HA2  2  
ATOM 2209  H HA3  . GLY A 1 47  ? 27.694  82.705  96.047  1.00 0.00 ?  38  GLY A HA3  2  
ATOM 2210  N N    . PRO A 1 48  ? 29.884  81.767  94.861  1.00 0.00 ?  39  PRO A N    2  
ATOM 2211  C CA   . PRO A 1 48  ? 30.797  80.794  94.174  1.00 0.00 ?  39  PRO A CA   2  
ATOM 2212  C C    . PRO A 1 48  ? 30.212  79.432  94.076  1.00 0.00 ?  39  PRO A C    2  
ATOM 2213  O O    . PRO A 1 48  ? 29.401  79.055  94.967  1.00 0.00 ?  39  PRO A O    2  
ATOM 2214  C CB   . PRO A 1 48  ? 32.089  80.806  95.076  1.00 0.00 ?  39  PRO A CB   2  
ATOM 2215  C CG   . PRO A 1 48  ? 31.956  81.978  96.015  1.00 0.00 ?  39  PRO A CG   2  
ATOM 2216  C CD   . PRO A 1 48  ? 30.491  82.371  96.002  1.00 0.00 ?  39  PRO A CD   2  
ATOM 2217  H HA   . PRO A 1 48  ? 31.026  81.138  93.165  1.00 0.00 ?  39  PRO A HA   2  
ATOM 2218  H HB2  . PRO A 1 48  ? 31.917  79.927  95.696  1.00 0.00 ?  39  PRO A HB2  2  
ATOM 2219  H HB3  . PRO A 1 48  ? 32.995  80.736  94.474  1.00 0.00 ?  39  PRO A HB3  2  
ATOM 2220  H HG2  . PRO A 1 48  ? 32.290  81.781  97.033  1.00 0.00 ?  39  PRO A HG2  2  
ATOM 2221  H HG3  . PRO A 1 48  ? 32.553  82.817  95.659  1.00 0.00 ?  39  PRO A HG3  2  
ATOM 2222  H HD2  . PRO A 1 48  ? 29.862  82.062  96.837  1.00 0.00 ?  39  PRO A HD2  2  
ATOM 2223  H HD3  . PRO A 1 48  ? 30.486  83.461  95.977  1.00 0.00 ?  39  PRO A HD3  2  
ATOM 2224  N N    . ASP A 1 49  ? 30.735  78.661  93.124  1.00 0.00 ?  40  ASP A N    2  
ATOM 2225  C CA   . ASP A 1 49  ? 29.975  77.478  92.693  1.00 0.00 ?  40  ASP A CA   2  
ATOM 2226  C C    . ASP A 1 49  ? 29.952  76.194  93.463  1.00 0.00 ?  40  ASP A C    2  
ATOM 2227  O O    . ASP A 1 49  ? 29.209  75.233  93.201  1.00 0.00 ?  40  ASP A O    2  
ATOM 2228  C CB   . ASP A 1 49  ? 30.148  77.145  91.207  1.00 0.00 ?  40  ASP A CB   2  
ATOM 2229  C CG   . ASP A 1 49  ? 31.576  77.109  90.813  1.00 0.00 ?  40  ASP A CG   2  
ATOM 2230  O OD1  . ASP A 1 49  ? 32.438  76.564  91.545  1.00 0.00 -1 40  ASP A OD1  2  
ATOM 2231  O OD2  . ASP A 1 49  ? 31.894  77.405  89.651  1.00 0.00 ?  40  ASP A OD2  2  
ATOM 2232  H H    . ASP A 1 49  ? 31.209  79.151  92.379  1.00 0.00 ?  40  ASP A H    2  
ATOM 2233  H HA   . ASP A 1 49  ? 28.959  77.869  92.750  1.00 0.00 ?  40  ASP A HA   2  
ATOM 2234  H HB2  . ASP A 1 49  ? 29.768  76.159  90.941  1.00 0.00 ?  40  ASP A HB2  2  
ATOM 2235  H HB3  . ASP A 1 49  ? 29.707  77.871  90.524  1.00 0.00 ?  40  ASP A HB3  2  
ATOM 2236  N N    . ASN A 1 50  ? 30.786  76.166  94.493  1.00 0.00 ?  41  ASN A N    2  
ATOM 2237  C CA   . ASN A 1 50  ? 30.811  75.049  95.497  1.00 0.00 ?  41  ASN A CA   2  
ATOM 2238  C C    . ASN A 1 50  ? 29.587  74.971  96.474  1.00 0.00 ?  41  ASN A C    2  
ATOM 2239  O O    . ASN A 1 50  ? 29.264  73.892  96.966  1.00 0.00 ?  41  ASN A O    2  
ATOM 2240  C CB   . ASN A 1 50  ? 32.133  75.208  96.329  1.00 0.00 ?  41  ASN A CB   2  
ATOM 2241  C CG   . ASN A 1 50  ? 32.168  76.546  97.042  1.00 0.00 ?  41  ASN A CG   2  
ATOM 2242  O OD1  . ASN A 1 50  ? 31.433  76.739  97.952  1.00 0.00 ?  41  ASN A OD1  2  
ATOM 2243  N ND2  . ASN A 1 50  ? 33.128  77.400  96.734  1.00 0.00 ?  41  ASN A ND2  2  
ATOM 2244  H H    . ASN A 1 50  ? 31.246  77.039  94.706  1.00 0.00 ?  41  ASN A H    2  
ATOM 2245  H HA   . ASN A 1 50  ? 30.823  74.117  94.932  1.00 0.00 ?  41  ASN A HA   2  
ATOM 2246  H HB2  . ASN A 1 50  ? 32.103  74.489  97.147  1.00 0.00 ?  41  ASN A HB2  2  
ATOM 2247  H HB3  . ASN A 1 50  ? 33.009  75.069  95.695  1.00 0.00 ?  41  ASN A HB3  2  
ATOM 2248  H HD21 . ASN A 1 50  ? 33.733  77.238  95.942  1.00 0.00 ?  41  ASN A HD21 2  
ATOM 2249  H HD22 . ASN A 1 50  ? 33.293  78.195  97.334  1.00 0.00 ?  41  ASN A HD22 2  
ATOM 2250  N N    . GLN A 1 51  ? 28.919  76.111  96.740  1.00 0.00 ?  42  GLN A N    2  
ATOM 2251  C CA   . GLN A 1 51  ? 27.668  76.187  97.436  1.00 0.00 ?  42  GLN A CA   2  
ATOM 2252  C C    . GLN A 1 51  ? 26.589  75.335  96.623  1.00 0.00 ?  42  GLN A C    2  
ATOM 2253  O O    . GLN A 1 51  ? 26.798  75.124  95.458  1.00 0.00 ?  42  GLN A O    2  
ATOM 2254  C CB   . GLN A 1 51  ? 27.198  77.646  97.334  1.00 0.00 ?  42  GLN A CB   2  
ATOM 2255  C CG   . GLN A 1 51  ? 28.108  78.610  98.062  1.00 0.00 ?  42  GLN A CG   2  
ATOM 2256  C CD   . GLN A 1 51  ? 28.333  78.227  99.550  1.00 0.00 ?  42  GLN A CD   2  
ATOM 2257  O OE1  . GLN A 1 51  ? 27.476  78.350  100.416 1.00 0.00 ?  42  GLN A OE1  2  
ATOM 2258  N NE2  . GLN A 1 51  ? 29.580  77.893  99.960  1.00 0.00 ?  42  GLN A NE2  2  
ATOM 2259  H H    . GLN A 1 51  ? 29.220  76.988  96.340  1.00 0.00 ?  42  GLN A H    2  
ATOM 2260  H HA   . GLN A 1 51  ? 27.876  75.766  98.420  1.00 0.00 ?  42  GLN A HA   2  
ATOM 2261  H HB2  . GLN A 1 51  ? 27.219  77.893  96.272  1.00 0.00 ?  42  GLN A HB2  2  
ATOM 2262  H HB3  . GLN A 1 51  ? 26.219  77.658  97.813  1.00 0.00 ?  42  GLN A HB3  2  
ATOM 2263  H HG2  . GLN A 1 51  ? 29.069  78.778  97.576  1.00 0.00 ?  42  GLN A HG2  2  
ATOM 2264  H HG3  . GLN A 1 51  ? 27.524  79.526  98.150  1.00 0.00 ?  42  GLN A HG3  2  
ATOM 2265  H HE21 . GLN A 1 51  ? 30.264  78.027  99.229  1.00 0.00 ?  42  GLN A HE21 2  
ATOM 2266  H HE22 . GLN A 1 51  ? 29.797  77.617  100.907 1.00 0.00 ?  42  GLN A HE22 2  
ATOM 2267  N N    . THR A 1 52  ? 25.541  74.832  97.265  1.00 0.00 ?  43  THR A N    2  
ATOM 2268  C CA   . THR A 1 52  ? 24.619  74.027  96.559  1.00 0.00 ?  43  THR A CA   2  
ATOM 2269  C C    . THR A 1 52  ? 23.431  74.776  95.978  1.00 0.00 ?  43  THR A C    2  
ATOM 2270  O O    . THR A 1 52  ? 22.644  75.376  96.787  1.00 0.00 ?  43  THR A O    2  
ATOM 2271  C CB   . THR A 1 52  ? 24.279  72.720  97.341  1.00 0.00 ?  43  THR A CB   2  
ATOM 2272  O OG1  . THR A 1 52  ? 25.435  72.269  98.089  1.00 0.00 ?  43  THR A OG1  2  
ATOM 2273  C CG2  . THR A 1 52  ? 23.676  71.617  96.431  1.00 0.00 ?  43  THR A CG2  2  
ATOM 2274  H H    . THR A 1 52  ? 25.425  75.085  98.236  1.00 0.00 ?  43  THR A H    2  
ATOM 2275  H HA   . THR A 1 52  ? 25.227  73.525  95.806  1.00 0.00 ?  43  THR A HA   2  
ATOM 2276  H HB   . THR A 1 52  ? 23.455  72.941  98.020  1.00 0.00 ?  43  THR A HB   2  
ATOM 2277  H HG1  . THR A 1 52  ? 25.441  72.648  98.971  1.00 0.00 ?  43  THR A HG1  2  
ATOM 2278  H HG21 . THR A 1 52  ? 22.809  71.940  95.855  1.00 0.00 ?  43  THR A HG21 2  
ATOM 2279  H HG22 . THR A 1 52  ? 24.463  71.259  95.767  1.00 0.00 ?  43  THR A HG22 2  
ATOM 2280  H HG23 . THR A 1 52  ? 23.340  70.886  97.166  1.00 0.00 ?  43  THR A HG23 2  
ATOM 2281  N N    . GLU A 1 53  ? 23.407  74.807  94.642  1.00 0.00 ?  44  GLU A N    2  
ATOM 2282  C CA   . GLU A 1 53  ? 22.375  75.441  93.846  1.00 0.00 ?  44  GLU A CA   2  
ATOM 2283  C C    . GLU A 1 53  ? 22.066  74.586  92.612  1.00 0.00 ?  44  GLU A C    2  
ATOM 2284  O O    . GLU A 1 53  ? 22.966  74.001  91.978  1.00 0.00 ?  44  GLU A O    2  
ATOM 2285  C CB   . GLU A 1 53  ? 22.735  76.900  93.438  1.00 0.00 ?  44  GLU A CB   2  
ATOM 2286  C CG   . GLU A 1 53  ? 22.681  77.888  94.609  1.00 0.00 ?  44  GLU A CG   2  
ATOM 2287  C CD   . GLU A 1 53  ? 22.877  79.369  94.209  1.00 0.00 ?  44  GLU A CD   2  
ATOM 2288  O OE1  . GLU A 1 53  ? 23.189  79.678  93.061  1.00 0.00 ?  44  GLU A OE1  2  
ATOM 2289  O OE2  . GLU A 1 53  ? 22.629  80.221  95.003  1.00 0.00 -1 44  GLU A OE2  2  
ATOM 2290  H H    . GLU A 1 53  ? 24.113  74.258  94.172  1.00 0.00 ?  44  GLU A H    2  
ATOM 2291  H HA   . GLU A 1 53  ? 21.430  75.483  94.388  1.00 0.00 ?  44  GLU A HA   2  
ATOM 2292  H HB2  . GLU A 1 53  ? 23.733  76.914  93.000  1.00 0.00 ?  44  GLU A HB2  2  
ATOM 2293  H HB3  . GLU A 1 53  ? 22.038  77.264  92.683  1.00 0.00 ?  44  GLU A HB3  2  
ATOM 2294  H HG2  . GLU A 1 53  ? 21.686  77.852  95.055  1.00 0.00 ?  44  GLU A HG2  2  
ATOM 2295  H HG3  . GLU A 1 53  ? 23.405  77.500  95.326  1.00 0.00 ?  44  GLU A HG3  2  
ATOM 2296  N N    . GLU A 1 54  ? 20.809  74.428  92.197  1.00 0.00 ?  45  GLU A N    2  
ATOM 2297  C CA   . GLU A 1 54  ? 20.388  73.896  90.904  1.00 0.00 ?  45  GLU A CA   2  
ATOM 2298  C C    . GLU A 1 54  ? 20.753  74.847  89.817  1.00 0.00 ?  45  GLU A C    2  
ATOM 2299  O O    . GLU A 1 54  ? 20.605  76.055  89.957  1.00 0.00 ?  45  GLU A O    2  
ATOM 2300  C CB   . GLU A 1 54  ? 18.889  73.553  90.930  1.00 0.00 ?  45  GLU A CB   2  
ATOM 2301  C CG   . GLU A 1 54  ? 18.471  72.493  91.977  1.00 0.00 ?  45  GLU A CG   2  
ATOM 2302  C CD   . GLU A 1 54  ? 18.657  71.136  91.271  1.00 0.00 ?  45  GLU A CD   2  
ATOM 2303  O OE1  . GLU A 1 54  ? 19.787  70.766  90.875  1.00 0.00 ?  45  GLU A OE1  2  
ATOM 2304  O OE2  . GLU A 1 54  ? 17.748  70.347  91.132  1.00 0.00 -1 45  GLU A OE2  2  
ATOM 2305  H H    . GLU A 1 54  ? 20.072  74.722  92.823  1.00 0.00 ?  45  GLU A H    2  
ATOM 2306  H HA   . GLU A 1 54  ? 20.921  72.966  90.707  1.00 0.00 ?  45  GLU A HA   2  
ATOM 2307  H HB2  . GLU A 1 54  ? 18.494  74.528  91.218  1.00 0.00 ?  45  GLU A HB2  2  
ATOM 2308  H HB3  . GLU A 1 54  ? 18.511  73.124  90.002  1.00 0.00 ?  45  GLU A HB3  2  
ATOM 2309  H HG2  . GLU A 1 54  ? 19.013  72.506  92.923  1.00 0.00 ?  45  GLU A HG2  2  
ATOM 2310  H HG3  . GLU A 1 54  ? 17.433  72.617  92.286  1.00 0.00 ?  45  GLU A HG3  2  
ATOM 2311  N N    . ARG A 1 55  ? 21.439  74.400  88.712  1.00 0.00 ?  46  ARG A N    2  
ATOM 2312  C CA   . ARG A 1 55  ? 22.060  75.176  87.536  1.00 0.00 ?  46  ARG A CA   2  
ATOM 2313  C C    . ARG A 1 55  ? 21.953  74.489  86.190  1.00 0.00 ?  46  ARG A C    2  
ATOM 2314  O O    . ARG A 1 55  ? 21.648  73.318  86.144  1.00 0.00 ?  46  ARG A O    2  
ATOM 2315  C CB   . ARG A 1 55  ? 23.537  75.324  87.869  1.00 0.00 ?  46  ARG A CB   2  
ATOM 2316  C CG   . ARG A 1 55  ? 24.026  76.110  89.096  1.00 0.00 ?  46  ARG A CG   2  
ATOM 2317  C CD   . ARG A 1 55  ? 25.574  76.197  89.316  1.00 0.00 ?  46  ARG A CD   2  
ATOM 2318  N NE   . ARG A 1 55  ? 25.852  76.803  90.688  1.00 0.00 ?  46  ARG A NE   2  
ATOM 2319  C CZ   . ARG A 1 55  ? 26.248  76.144  91.760  1.00 0.00 ?  46  ARG A CZ   2  
ATOM 2320  N NH1  . ARG A 1 55  ? 26.387  74.917  91.676  1.00 0.00 ?  46  ARG A NH1  2  
ATOM 2321  N NH2  . ARG A 1 55  ? 26.564  76.825  92.874  1.00 0.00 1  46  ARG A NH2  2  
ATOM 2322  H H    . ARG A 1 55  ? 21.493  73.392  88.671  1.00 0.00 ?  46  ARG A H    2  
ATOM 2323  H HA   . ARG A 1 55  ? 21.654  76.174  87.375  1.00 0.00 ?  46  ARG A HA   2  
ATOM 2324  H HB2  . ARG A 1 55  ? 23.911  74.320  88.068  1.00 0.00 ?  46  ARG A HB2  2  
ATOM 2325  H HB3  . ARG A 1 55  ? 24.066  75.916  87.121  1.00 0.00 ?  46  ARG A HB3  2  
ATOM 2326  H HG2  . ARG A 1 55  ? 23.648  77.126  88.991  1.00 0.00 ?  46  ARG A HG2  2  
ATOM 2327  H HG3  . ARG A 1 55  ? 23.518  75.651  89.944  1.00 0.00 ?  46  ARG A HG3  2  
ATOM 2328  H HD2  . ARG A 1 55  ? 26.068  75.226  89.292  1.00 0.00 ?  46  ARG A HD2  2  
ATOM 2329  H HD3  . ARG A 1 55  ? 25.994  76.841  88.544  1.00 0.00 ?  46  ARG A HD3  2  
ATOM 2330  H HE   . ARG A 1 55  ? 25.796  77.810  90.741  1.00 0.00 ?  46  ARG A HE   2  
ATOM 2331  H HH11 . ARG A 1 55  ? 26.316  74.504  90.758  1.00 0.00 ?  46  ARG A HH11 2  
ATOM 2332  H HH12 . ARG A 1 55  ? 26.740  74.292  92.387  1.00 0.00 ?  46  ARG A HH12 2  
ATOM 2333  H HH21 . ARG A 1 55  ? 26.444  77.819  93.006  1.00 0.00 ?  46  ARG A HH21 2  
ATOM 2334  H HH22 . ARG A 1 55  ? 26.983  76.184  93.533  1.00 0.00 ?  46  ARG A HH22 2  
ATOM 2335  N N    . ARG A 1 56  ? 22.196  75.153  85.058  1.00 0.00 ?  47  ARG A N    2  
ATOM 2336  C CA   . ARG A 1 56  ? 22.222  74.523  83.739  1.00 0.00 ?  47  ARG A CA   2  
ATOM 2337  C C    . ARG A 1 56  ? 23.142  73.278  83.635  1.00 0.00 ?  47  ARG A C    2  
ATOM 2338  O O    . ARG A 1 56  ? 24.169  73.115  84.228  1.00 0.00 ?  47  ARG A O    2  
ATOM 2339  C CB   . ARG A 1 56  ? 22.480  75.558  82.587  1.00 0.00 ?  47  ARG A CB   2  
ATOM 2340  C CG   . ARG A 1 56  ? 21.376  76.658  82.475  1.00 0.00 ?  47  ARG A CG   2  
ATOM 2341  C CD   . ARG A 1 56  ? 21.673  77.700  81.307  1.00 0.00 ?  47  ARG A CD   2  
ATOM 2342  N NE   . ARG A 1 56  ? 20.560  78.680  81.159  1.00 0.00 ?  47  ARG A NE   2  
ATOM 2343  C CZ   . ARG A 1 56  ? 20.497  79.963  81.355  1.00 0.00 ?  47  ARG A CZ   2  
ATOM 2344  N NH1  . ARG A 1 56  ? 21.477  80.587  81.885  1.00 0.00 ?  47  ARG A NH1  2  
ATOM 2345  N NH2  . ARG A 1 56  ? 19.426  80.544  81.114  1.00 0.00 1  47  ARG A NH2  2  
ATOM 2346  H H    . ARG A 1 56  ? 22.483  76.120  85.110  1.00 0.00 ?  47  ARG A H    2  
ATOM 2347  H HA   . ARG A 1 56  ? 21.190  74.202  83.597  1.00 0.00 ?  47  ARG A HA   2  
ATOM 2348  H HB2  . ARG A 1 56  ? 23.346  76.123  82.931  1.00 0.00 ?  47  ARG A HB2  2  
ATOM 2349  H HB3  . ARG A 1 56  ? 22.648  75.056  81.634  1.00 0.00 ?  47  ARG A HB3  2  
ATOM 2350  H HG2  . ARG A 1 56  ? 20.415  76.172  82.304  1.00 0.00 ?  47  ARG A HG2  2  
ATOM 2351  H HG3  . ARG A 1 56  ? 21.286  77.248  83.387  1.00 0.00 ?  47  ARG A HG3  2  
ATOM 2352  H HD2  . ARG A 1 56  ? 22.635  78.167  81.518  1.00 0.00 ?  47  ARG A HD2  2  
ATOM 2353  H HD3  . ARG A 1 56  ? 21.668  77.194  80.342  1.00 0.00 ?  47  ARG A HD3  2  
ATOM 2354  H HE   . ARG A 1 56  ? 19.777  78.301  80.646  1.00 0.00 ?  47  ARG A HE   2  
ATOM 2355  H HH11 . ARG A 1 56  ? 22.134  80.086  82.466  1.00 0.00 ?  47  ARG A HH11 2  
ATOM 2356  H HH12 . ARG A 1 56  ? 21.484  81.597  81.880  1.00 0.00 ?  47  ARG A HH12 2  
ATOM 2357  H HH21 . ARG A 1 56  ? 18.572  80.128  80.771  1.00 0.00 ?  47  ARG A HH21 2  
ATOM 2358  H HH22 . ARG A 1 56  ? 19.439  81.520  81.374  1.00 0.00 ?  47  ARG A HH22 2  
ATOM 2359  N N    . ALA A 1 57  ? 22.712  72.290  82.842  1.00 0.00 ?  48  ALA A N    2  
ATOM 2360  C CA   . ALA A 1 57  ? 23.377  70.992  82.680  1.00 0.00 ?  48  ALA A CA   2  
ATOM 2361  C C    . ALA A 1 57  ? 24.680  71.156  81.838  1.00 0.00 ?  48  ALA A C    2  
ATOM 2362  O O    . ALA A 1 57  ? 25.758  70.576  82.105  1.00 0.00 ?  48  ALA A O    2  
ATOM 2363  C CB   . ALA A 1 57  ? 22.308  70.191  81.938  1.00 0.00 ?  48  ALA A CB   2  
ATOM 2364  H H    . ALA A 1 57  ? 21.925  72.421  82.223  1.00 0.00 ?  48  ALA A H    2  
ATOM 2365  H HA   . ALA A 1 57  ? 23.669  70.437  83.572  1.00 0.00 ?  48  ALA A HA   2  
ATOM 2366  H HB1  . ALA A 1 57  ? 21.957  70.735  81.061  1.00 0.00 ?  48  ALA A HB1  2  
ATOM 2367  H HB2  . ALA A 1 57  ? 22.720  69.189  81.817  1.00 0.00 ?  48  ALA A HB2  2  
ATOM 2368  H HB3  . ALA A 1 57  ? 21.438  70.170  82.593  1.00 0.00 ?  48  ALA A HB3  2  
ATOM 2369  N N    . SER A 1 58  ? 24.584  72.053  80.786  1.00 0.00 ?  49  SER A N    2  
ATOM 2370  C CA   . SER A 1 58  ? 25.653  72.224  79.798  1.00 0.00 ?  49  SER A CA   2  
ATOM 2371  C C    . SER A 1 58  ? 26.834  73.069  80.196  1.00 0.00 ?  49  SER A C    2  
ATOM 2372  O O    . SER A 1 58  ? 27.476  73.740  79.373  1.00 0.00 ?  49  SER A O    2  
ATOM 2373  C CB   . SER A 1 58  ? 25.052  72.679  78.476  1.00 0.00 ?  49  SER A CB   2  
ATOM 2374  O OG   . SER A 1 58  ? 23.992  71.805  78.048  1.00 0.00 ?  49  SER A OG   2  
ATOM 2375  H H    . SER A 1 58  ? 23.707  72.504  80.570  1.00 0.00 ?  49  SER A H    2  
ATOM 2376  H HA   . SER A 1 58  ? 26.061  71.228  79.630  1.00 0.00 ?  49  SER A HA   2  
ATOM 2377  H HB2  . SER A 1 58  ? 24.769  73.717  78.651  1.00 0.00 ?  49  SER A HB2  2  
ATOM 2378  H HB3  . SER A 1 58  ? 25.879  72.552  77.778  1.00 0.00 ?  49  SER A HB3  2  
ATOM 2379  H HG   . SER A 1 58  ? 23.438  72.328  77.463  1.00 0.00 ?  49  SER A HG   2  
ATOM 2380  N N    . LEU A 1 59  ? 27.195  73.087  81.492  1.00 0.00 ?  50  LEU A N    2  
ATOM 2381  C CA   . LEU A 1 59  ? 28.310  73.815  82.044  1.00 0.00 ?  50  LEU A CA   2  
ATOM 2382  C C    . LEU A 1 59  ? 29.341  72.769  82.647  1.00 0.00 ?  50  LEU A C    2  
ATOM 2383  O O    . LEU A 1 59  ? 28.982  71.634  82.984  1.00 0.00 ?  50  LEU A O    2  
ATOM 2384  C CB   . LEU A 1 59  ? 27.918  74.702  83.252  1.00 0.00 ?  50  LEU A CB   2  
ATOM 2385  C CG   . LEU A 1 59  ? 27.088  75.923  82.845  1.00 0.00 ?  50  LEU A CG   2  
ATOM 2386  C CD1  . LEU A 1 59  ? 26.162  76.474  84.008  1.00 0.00 ?  50  LEU A CD1  2  
ATOM 2387  C CD2  . LEU A 1 59  ? 28.104  77.052  82.412  1.00 0.00 ?  50  LEU A CD2  2  
ATOM 2388  H H    . LEU A 1 59  ? 26.656  72.419  82.025  1.00 0.00 ?  50  LEU A H    2  
ATOM 2389  H HA   . LEU A 1 59  ? 28.825  74.397  81.279  1.00 0.00 ?  50  LEU A HA   2  
ATOM 2390  H HB2  . LEU A 1 59  ? 27.385  74.087  83.977  1.00 0.00 ?  50  LEU A HB2  2  
ATOM 2391  H HB3  . LEU A 1 59  ? 28.723  74.987  83.931  1.00 0.00 ?  50  LEU A HB3  2  
ATOM 2392  H HG   . LEU A 1 59  ? 26.478  75.597  82.002  1.00 0.00 ?  50  LEU A HG   2  
ATOM 2393  H HD11 . LEU A 1 59  ? 26.829  76.988  84.700  1.00 0.00 ?  50  LEU A HD11 2  
ATOM 2394  H HD12 . LEU A 1 59  ? 25.474  77.153  83.505  1.00 0.00 ?  50  LEU A HD12 2  
ATOM 2395  H HD13 . LEU A 1 59  ? 25.609  75.693  84.530  1.00 0.00 ?  50  LEU A HD13 2  
ATOM 2396  H HD21 . LEU A 1 59  ? 28.674  76.668  81.566  1.00 0.00 ?  50  LEU A HD21 2  
ATOM 2397  H HD22 . LEU A 1 59  ? 27.525  77.934  82.136  1.00 0.00 ?  50  LEU A HD22 2  
ATOM 2398  H HD23 . LEU A 1 59  ? 28.744  77.298  83.260  1.00 0.00 ?  50  LEU A HD23 2  
ATOM 2399  N N    . PRO A 1 60  ? 30.597  73.090  82.840  1.00 0.00 ?  51  PRO A N    2  
ATOM 2400  C CA   . PRO A 1 60  ? 31.539  72.162  83.403  1.00 0.00 ?  51  PRO A CA   2  
ATOM 2401  C C    . PRO A 1 60  ? 31.279  71.673  84.815  1.00 0.00 ?  51  PRO A C    2  
ATOM 2402  O O    . PRO A 1 60  ? 31.057  72.420  85.743  1.00 0.00 ?  51  PRO A O    2  
ATOM 2403  C CB   . PRO A 1 60  ? 32.964  72.834  83.411  1.00 0.00 ?  51  PRO A CB   2  
ATOM 2404  C CG   . PRO A 1 60  ? 32.672  74.243  82.903  1.00 0.00 ?  51  PRO A CG   2  
ATOM 2405  C CD   . PRO A 1 60  ? 31.267  74.350  82.399  1.00 0.00 ?  51  PRO A CD   2  
ATOM 2406  H HA   . PRO A 1 60  ? 31.624  71.244  82.822  1.00 0.00 ?  51  PRO A HA   2  
ATOM 2407  H HB2  . PRO A 1 60  ? 33.548  72.848  84.331  1.00 0.00 ?  51  PRO A HB2  2  
ATOM 2408  H HB3  . PRO A 1 60  ? 33.615  72.218  82.791  1.00 0.00 ?  51  PRO A HB3  2  
ATOM 2409  H HG2  . PRO A 1 60  ? 32.671  74.961  83.723  1.00 0.00 ?  51  PRO A HG2  2  
ATOM 2410  H HG3  . PRO A 1 60  ? 33.396  74.465  82.119  1.00 0.00 ?  51  PRO A HG3  2  
ATOM 2411  H HD2  . PRO A 1 60  ? 30.816  75.249  82.819  1.00 0.00 ?  51  PRO A HD2  2  
ATOM 2412  H HD3  . PRO A 1 60  ? 31.218  74.410  81.311  1.00 0.00 ?  51  PRO A HD3  2  
ATOM 2413  N N    . GLY A 1 61  ? 31.476  70.364  84.960  1.00 0.00 ?  52  GLY A N    2  
ATOM 2414  C CA   . GLY A 1 61  ? 31.367  69.686  86.288  1.00 0.00 ?  52  GLY A CA   2  
ATOM 2415  C C    . GLY A 1 61  ? 32.577  69.977  87.196  1.00 0.00 ?  52  GLY A C    2  
ATOM 2416  O O    . GLY A 1 61  ? 33.566  70.591  86.824  1.00 0.00 ?  52  GLY A O    2  
ATOM 2417  H H    . GLY A 1 61  ? 31.750  69.890  84.112  1.00 0.00 ?  52  GLY A H    2  
ATOM 2418  H HA2  . GLY A 1 61  ? 30.504  70.062  86.838  1.00 0.00 ?  52  GLY A HA2  2  
ATOM 2419  H HA3  . GLY A 1 61  ? 31.240  68.621  86.093  1.00 0.00 ?  52  GLY A HA3  2  
ATOM 2420  N N    . ARG A 1 62  ? 32.348  69.575  88.422  1.00 0.00 ?  53  ARG A N    2  
ATOM 2421  C CA   . ARG A 1 62  ? 33.374  69.626  89.513  1.00 0.00 ?  53  ARG A CA   2  
ATOM 2422  C C    . ARG A 1 62  ? 34.791  69.156  89.241  1.00 0.00 ?  53  ARG A C    2  
ATOM 2423  O O    . ARG A 1 62  ? 35.753  69.784  89.728  1.00 0.00 ?  53  ARG A O    2  
ATOM 2424  C CB   . ARG A 1 62  ? 32.712  69.259  90.828  1.00 0.00 ?  53  ARG A CB   2  
ATOM 2425  C CG   . ARG A 1 62  ? 33.512  69.295  92.039  1.00 0.00 ?  53  ARG A CG   2  
ATOM 2426  C CD   . ARG A 1 62  ? 34.052  70.648  92.531  1.00 0.00 ?  53  ARG A CD   2  
ATOM 2427  N NE   . ARG A 1 62  ? 33.053  71.687  92.543  1.00 0.00 ?  53  ARG A NE   2  
ATOM 2428  C CZ   . ARG A 1 62  ? 33.191  72.994  92.305  1.00 0.00 ?  53  ARG A CZ   2  
ATOM 2429  N NH1  . ARG A 1 62  ? 34.434  73.461  92.287  1.00 0.00 ?  53  ARG A NH1  2  
ATOM 2430  N NH2  . ARG A 1 62  ? 32.195  73.835  92.337  1.00 0.00 1  53  ARG A NH2  2  
ATOM 2431  H H    . ARG A 1 62  ? 31.504  69.063  88.634  1.00 0.00 ?  53  ARG A H    2  
ATOM 2432  H HA   . ARG A 1 62  ? 33.442  70.707  89.628  1.00 0.00 ?  53  ARG A HA   2  
ATOM 2433  H HB2  . ARG A 1 62  ? 31.872  69.920  91.044  1.00 0.00 ?  53  ARG A HB2  2  
ATOM 2434  H HB3  . ARG A 1 62  ? 32.322  68.241  90.804  1.00 0.00 ?  53  ARG A HB3  2  
ATOM 2435  H HG2  . ARG A 1 62  ? 33.012  68.900  92.923  1.00 0.00 ?  53  ARG A HG2  2  
ATOM 2436  H HG3  . ARG A 1 62  ? 34.414  68.705  91.877  1.00 0.00 ?  53  ARG A HG3  2  
ATOM 2437  H HD2  . ARG A 1 62  ? 34.417  70.521  93.550  1.00 0.00 ?  53  ARG A HD2  2  
ATOM 2438  H HD3  . ARG A 1 62  ? 34.883  70.946  91.892  1.00 0.00 ?  53  ARG A HD3  2  
ATOM 2439  H HE   . ARG A 1 62  ? 32.092  71.440  92.728  1.00 0.00 ?  53  ARG A HE   2  
ATOM 2440  H HH11 . ARG A 1 62  ? 35.223  72.845  92.423  1.00 0.00 ?  53  ARG A HH11 2  
ATOM 2441  H HH12 . ARG A 1 62  ? 34.602  74.406  91.973  1.00 0.00 ?  53  ARG A HH12 2  
ATOM 2442  H HH21 . ARG A 1 62  ? 31.291  73.397  92.444  1.00 0.00 ?  53  ARG A HH21 2  
ATOM 2443  H HH22 . ARG A 1 62  ? 32.288  74.834  92.216  1.00 0.00 ?  53  ARG A HH22 2  
ATOM 2444  N N    . ASP A 1 63  ? 35.010  68.113  88.487  1.00 0.00 ?  54  ASP A N    2  
ATOM 2445  C CA   . ASP A 1 63  ? 36.426  67.563  88.361  1.00 0.00 ?  54  ASP A CA   2  
ATOM 2446  C C    . ASP A 1 63  ? 37.444  68.177  87.352  1.00 0.00 ?  54  ASP A C    2  
ATOM 2447  O O    . ASP A 1 63  ? 37.036  68.333  86.254  1.00 0.00 ?  54  ASP A O    2  
ATOM 2448  C CB   . ASP A 1 63  ? 36.228  66.036  88.051  1.00 0.00 ?  54  ASP A CB   2  
ATOM 2449  C CG   . ASP A 1 63  ? 37.406  65.330  87.553  1.00 0.00 ?  54  ASP A CG   2  
ATOM 2450  O OD1  . ASP A 1 63  ? 38.502  65.390  88.243  1.00 0.00 ?  54  ASP A OD1  2  
ATOM 2451  O OD2  . ASP A 1 63  ? 37.341  64.679  86.469  1.00 0.00 -1 54  ASP A OD2  2  
ATOM 2452  H H    . ASP A 1 63  ? 34.293  67.555  88.046  1.00 0.00 ?  54  ASP A H    2  
ATOM 2453  H HA   . ASP A 1 63  ? 37.005  67.723  89.271  1.00 0.00 ?  54  ASP A HA   2  
ATOM 2454  H HB2  . ASP A 1 63  ? 35.850  65.552  88.951  1.00 0.00 ?  54  ASP A HB2  2  
ATOM 2455  H HB3  . ASP A 1 63  ? 35.485  65.988  87.255  1.00 0.00 ?  54  ASP A HB3  2  
ATOM 2456  N N    . ASP A 1 64  ? 38.643  68.512  87.759  1.00 0.00 ?  55  ASP A N    2  
ATOM 2457  C CA   . ASP A 1 64  ? 39.626  69.193  86.948  1.00 0.00 ?  55  ASP A CA   2  
ATOM 2458  C C    . ASP A 1 64  ? 40.106  68.443  85.664  1.00 0.00 ?  55  ASP A C    2  
ATOM 2459  O O    . ASP A 1 64  ? 40.373  69.098  84.612  1.00 0.00 ?  55  ASP A O    2  
ATOM 2460  C CB   . ASP A 1 64  ? 40.912  69.581  87.743  1.00 0.00 ?  55  ASP A CB   2  
ATOM 2461  C CG   . ASP A 1 64  ? 40.750  70.815  88.631  1.00 0.00 ?  55  ASP A CG   2  
ATOM 2462  O OD1  . ASP A 1 64  ? 39.927  71.687  88.175  1.00 0.00 -1 55  ASP A OD1  2  
ATOM 2463  O OD2  . ASP A 1 64  ? 41.457  70.903  89.716  1.00 0.00 ?  55  ASP A OD2  2  
ATOM 2464  H H    . ASP A 1 64  ? 38.747  68.385  88.755  1.00 0.00 ?  55  ASP A H    2  
ATOM 2465  H HA   . ASP A 1 64  ? 39.114  70.068  86.549  1.00 0.00 ?  55  ASP A HA   2  
ATOM 2466  H HB2  . ASP A 1 64  ? 41.256  68.735  88.338  1.00 0.00 ?  55  ASP A HB2  2  
ATOM 2467  H HB3  . ASP A 1 64  ? 41.763  69.782  87.093  1.00 0.00 ?  55  ASP A HB3  2  
ATOM 2468  N N    . ASN A 1 65  ? 39.958  67.133  85.742  1.00 0.00 ?  56  ASN A N    2  
ATOM 2469  C CA   . ASN A 1 65  ? 40.402  66.218  84.667  1.00 0.00 ?  56  ASN A CA   2  
ATOM 2470  C C    . ASN A 1 65  ? 39.442  66.150  83.552  1.00 0.00 ?  56  ASN A C    2  
ATOM 2471  O O    . ASN A 1 65  ? 39.789  66.270  82.365  1.00 0.00 ?  56  ASN A O    2  
ATOM 2472  C CB   . ASN A 1 65  ? 40.903  64.893  85.262  1.00 0.00 ?  56  ASN A CB   2  
ATOM 2473  C CG   . ASN A 1 65  ? 41.627  64.056  84.247  1.00 0.00 ?  56  ASN A CG   2  
ATOM 2474  O OD1  . ASN A 1 65  ? 42.702  64.377  83.827  1.00 0.00 ?  56  ASN A OD1  2  
ATOM 2475  N ND2  . ASN A 1 65  ? 41.037  63.029  83.717  1.00 0.00 ?  56  ASN A ND2  2  
ATOM 2476  H H    . ASN A 1 65  ? 39.616  66.702  86.589  1.00 0.00 ?  56  ASN A H    2  
ATOM 2477  H HA   . ASN A 1 65  ? 41.302  66.674  84.255  1.00 0.00 ?  56  ASN A HA   2  
ATOM 2478  H HB2  . ASN A 1 65  ? 41.618  64.904  86.084  1.00 0.00 ?  56  ASN A HB2  2  
ATOM 2479  H HB3  . ASN A 1 65  ? 40.068  64.243  85.526  1.00 0.00 ?  56  ASN A HB3  2  
ATOM 2480  H HD21 . ASN A 1 65  ? 40.091  62.830  84.011  1.00 0.00 ?  56  ASN A HD21 2  
ATOM 2481  H HD22 . ASN A 1 65  ? 41.565  62.378  83.153  1.00 0.00 ?  56  ASN A HD22 2  
ATOM 2482  N N    . SER A 1 66  ? 38.163  65.969  83.915  1.00 0.00 ?  57  SER A N    2  
ATOM 2483  C CA   . SER A 1 66  ? 37.062  65.768  82.951  1.00 0.00 ?  57  SER A CA   2  
ATOM 2484  C C    . SER A 1 66  ? 36.600  67.073  82.255  1.00 0.00 ?  57  SER A C    2  
ATOM 2485  O O    . SER A 1 66  ? 36.436  67.075  81.093  1.00 0.00 ?  57  SER A O    2  
ATOM 2486  C CB   . SER A 1 66  ? 35.832  65.069  83.547  1.00 0.00 ?  57  SER A CB   2  
ATOM 2487  O OG   . SER A 1 66  ? 35.338  65.758  84.715  1.00 0.00 ?  57  SER A OG   2  
ATOM 2488  H H    . SER A 1 66  ? 37.913  65.967  84.894  1.00 0.00 ?  57  SER A H    2  
ATOM 2489  H HA   . SER A 1 66  ? 37.525  65.091  82.233  1.00 0.00 ?  57  SER A HA   2  
ATOM 2490  H HB2  . SER A 1 66  ? 34.947  65.074  82.910  1.00 0.00 ?  57  SER A HB2  2  
ATOM 2491  H HB3  . SER A 1 66  ? 36.213  64.098  83.863  1.00 0.00 ?  57  SER A HB3  2  
ATOM 2492  H HG   . SER A 1 66  ? 35.840  65.257  85.363  1.00 0.00 ?  57  SER A HG   2  
ATOM 2493  N N    . TYR A 1 67  ? 36.625  68.184  82.935  1.00 0.00 ?  58  TYR A N    2  
ATOM 2494  C CA   . TYR A 1 67  ? 36.664  69.499  82.427  1.00 0.00 ?  58  TYR A CA   2  
ATOM 2495  C C    . TYR A 1 67  ? 37.714  69.750  81.303  1.00 0.00 ?  58  TYR A C    2  
ATOM 2496  O O    . TYR A 1 67  ? 37.456  70.373  80.318  1.00 0.00 ?  58  TYR A O    2  
ATOM 2497  C CB   . TYR A 1 67  ? 36.670  70.627  83.469  1.00 0.00 ?  58  TYR A CB   2  
ATOM 2498  C CG   . TYR A 1 67  ? 36.925  72.027  82.929  1.00 0.00 ?  58  TYR A CG   2  
ATOM 2499  C CD1  . TYR A 1 67  ? 36.114  72.612  81.863  1.00 0.00 ?  58  TYR A CD1  2  
ATOM 2500  C CD2  . TYR A 1 67  ? 37.891  72.875  83.550  1.00 0.00 ?  58  TYR A CD2  2  
ATOM 2501  C CE1  . TYR A 1 67  ? 36.350  73.920  81.466  1.00 0.00 ?  58  TYR A CE1  2  
ATOM 2502  C CE2  . TYR A 1 67  ? 38.209  74.167  83.069  1.00 0.00 ?  58  TYR A CE2  2  
ATOM 2503  C CZ   . TYR A 1 67  ? 37.455  74.703  82.028  1.00 0.00 ?  58  TYR A CZ   2  
ATOM 2504  O OH   . TYR A 1 67  ? 37.692  75.959  81.624  1.00 0.00 ?  58  TYR A OH   2  
ATOM 2505  H H    . TYR A 1 67  ? 36.693  68.121  83.940  1.00 0.00 ?  58  TYR A H    2  
ATOM 2506  H HA   . TYR A 1 67  ? 35.746  69.670  81.865  1.00 0.00 ?  58  TYR A HA   2  
ATOM 2507  H HB2  . TYR A 1 67  ? 35.771  70.707  84.079  1.00 0.00 ?  58  TYR A HB2  2  
ATOM 2508  H HB3  . TYR A 1 67  ? 37.471  70.306  84.135  1.00 0.00 ?  58  TYR A HB3  2  
ATOM 2509  H HD1  . TYR A 1 67  ? 35.344  72.009  81.405  1.00 0.00 ?  58  TYR A HD1  2  
ATOM 2510  H HD2  . TYR A 1 67  ? 38.477  72.418  84.333  1.00 0.00 ?  58  TYR A HD2  2  
ATOM 2511  H HE1  . TYR A 1 67  ? 35.853  74.261  80.569  1.00 0.00 ?  58  TYR A HE1  2  
ATOM 2512  H HE2  . TYR A 1 67  ? 39.019  74.696  83.549  1.00 0.00 ?  58  TYR A HE2  2  
ATOM 2513  H HH   . TYR A 1 67  ? 38.520  76.379  81.869  1.00 0.00 ?  58  TYR A HH   2  
ATOM 2514  N N    . MET A 1 68  ? 38.945  69.270  81.491  1.00 0.00 ?  59  MET A N    2  
ATOM 2515  C CA   . MET A 1 68  ? 39.979  69.418  80.439  1.00 0.00 ?  59  MET A CA   2  
ATOM 2516  C C    . MET A 1 68  ? 39.592  68.651  79.190  1.00 0.00 ?  59  MET A C    2  
ATOM 2517  O O    . MET A 1 68  ? 39.740  69.103  78.047  1.00 0.00 ?  59  MET A O    2  
ATOM 2518  C CB   . MET A 1 68  ? 41.366  69.075  81.061  1.00 0.00 ?  59  MET A CB   2  
ATOM 2519  C CG   . MET A 1 68  ? 42.529  69.195  80.099  1.00 0.00 ?  59  MET A CG   2  
ATOM 2520  S SD   . MET A 1 68  ? 44.109  68.556  80.715  1.00 0.00 ?  59  MET A SD   2  
ATOM 2521  C CE   . MET A 1 68  ? 43.648  66.830  80.849  1.00 0.00 ?  59  MET A CE   2  
ATOM 2522  H H    . MET A 1 68  ? 39.159  68.569  82.186  1.00 0.00 ?  59  MET A H    2  
ATOM 2523  H HA   . MET A 1 68  ? 39.868  70.468  80.169  1.00 0.00 ?  59  MET A HA   2  
ATOM 2524  H HB2  . MET A 1 68  ? 41.506  69.705  81.939  1.00 0.00 ?  59  MET A HB2  2  
ATOM 2525  H HB3  . MET A 1 68  ? 41.276  68.075  81.486  1.00 0.00 ?  59  MET A HB3  2  
ATOM 2526  H HG2  . MET A 1 68  ? 42.401  68.726  79.123  1.00 0.00 ?  59  MET A HG2  2  
ATOM 2527  H HG3  . MET A 1 68  ? 42.664  70.271  79.988  1.00 0.00 ?  59  MET A HG3  2  
ATOM 2528  H HE1  . MET A 1 68  ? 44.517  66.216  81.087  1.00 0.00 ?  59  MET A HE1  2  
ATOM 2529  H HE2  . MET A 1 68  ? 42.960  66.648  81.675  1.00 0.00 ?  59  MET A HE2  2  
ATOM 2530  H HE3  . MET A 1 68  ? 43.177  66.572  79.901  1.00 0.00 ?  59  MET A HE3  2  
ATOM 2531  N N    . TYR A 1 69  ? 39.187  67.356  79.326  1.00 0.00 ?  60  TYR A N    2  
ATOM 2532  C CA   . TYR A 1 69  ? 38.485  66.615  78.289  1.00 0.00 ?  60  TYR A CA   2  
ATOM 2533  C C    . TYR A 1 69  ? 37.216  67.271  77.647  1.00 0.00 ?  60  TYR A C    2  
ATOM 2534  O O    . TYR A 1 69  ? 37.023  67.123  76.415  1.00 0.00 ?  60  TYR A O    2  
ATOM 2535  C CB   . TYR A 1 69  ? 38.248  65.049  78.674  1.00 0.00 ?  60  TYR A CB   2  
ATOM 2536  C CG   . TYR A 1 69  ? 39.558  64.304  78.550  1.00 0.00 ?  60  TYR A CG   2  
ATOM 2537  C CD1  . TYR A 1 69  ? 40.012  63.881  77.312  1.00 0.00 ?  60  TYR A CD1  2  
ATOM 2538  C CD2  . TYR A 1 69  ? 40.260  64.034  79.734  1.00 0.00 ?  60  TYR A CD2  2  
ATOM 2539  C CE1  . TYR A 1 69  ? 41.165  63.044  77.175  1.00 0.00 ?  60  TYR A CE1  2  
ATOM 2540  C CE2  . TYR A 1 69  ? 41.455  63.335  79.633  1.00 0.00 ?  60  TYR A CE2  2  
ATOM 2541  C CZ   . TYR A 1 69  ? 41.917  62.847  78.377  1.00 0.00 ?  60  TYR A CZ   2  
ATOM 2542  O OH   . TYR A 1 69  ? 43.073  62.153  78.204  1.00 0.00 ?  60  TYR A OH   2  
ATOM 2543  H H    . TYR A 1 69  ? 39.177  67.079  80.297  1.00 0.00 ?  60  TYR A H    2  
ATOM 2544  H HA   . TYR A 1 69  ? 39.130  66.600  77.411  1.00 0.00 ?  60  TYR A HA   2  
ATOM 2545  H HB2  . TYR A 1 69  ? 37.795  64.913  79.656  1.00 0.00 ?  60  TYR A HB2  2  
ATOM 2546  H HB3  . TYR A 1 69  ? 37.659  64.641  77.854  1.00 0.00 ?  60  TYR A HB3  2  
ATOM 2547  H HD1  . TYR A 1 69  ? 39.536  64.100  76.368  1.00 0.00 ?  60  TYR A HD1  2  
ATOM 2548  H HD2  . TYR A 1 69  ? 39.853  64.285  80.702  1.00 0.00 ?  60  TYR A HD2  2  
ATOM 2549  H HE1  . TYR A 1 69  ? 41.505  62.766  76.188  1.00 0.00 ?  60  TYR A HE1  2  
ATOM 2550  H HE2  . TYR A 1 69  ? 41.983  62.997  80.512  1.00 0.00 ?  60  TYR A HE2  2  
ATOM 2551  H HH   . TYR A 1 69  ? 43.475  61.963  79.055  1.00 0.00 ?  60  TYR A HH   2  
ATOM 2552  N N    . ILE A 1 70  ? 36.661  68.197  78.363  1.00 0.00 ?  61  ILE A N    2  
ATOM 2553  C CA   . ILE A 1 70  ? 35.608  69.062  77.852  1.00 0.00 ?  61  ILE A CA   2  
ATOM 2554  C C    . ILE A 1 70  ? 36.142  70.203  76.956  1.00 0.00 ?  61  ILE A C    2  
ATOM 2555  O O    . ILE A 1 70  ? 35.617  70.483  75.923  1.00 0.00 ?  61  ILE A O    2  
ATOM 2556  C CB   . ILE A 1 70  ? 34.584  69.525  78.902  1.00 0.00 ?  61  ILE A CB   2  
ATOM 2557  C CG1  . ILE A 1 70  ? 33.230  68.839  78.895  1.00 0.00 ?  61  ILE A CG1  2  
ATOM 2558  C CG2  . ILE A 1 70  ? 34.241  71.039  78.839  1.00 0.00 ?  61  ILE A CG2  2  
ATOM 2559  C CD1  . ILE A 1 70  ? 33.315  67.358  79.205  1.00 0.00 ?  61  ILE A CD1  2  
ATOM 2560  H H    . ILE A 1 70  ? 36.967  68.248  79.324  1.00 0.00 ?  61  ILE A H    2  
ATOM 2561  H HA   . ILE A 1 70  ? 34.975  68.395  77.265  1.00 0.00 ?  61  ILE A HA   2  
ATOM 2562  H HB   . ILE A 1 70  ? 35.009  69.385  79.896  1.00 0.00 ?  61  ILE A HB   2  
ATOM 2563  H HG12 . ILE A 1 70  ? 32.624  69.331  79.657  1.00 0.00 ?  61  ILE A HG12 2  
ATOM 2564  H HG13 . ILE A 1 70  ? 32.739  69.062  77.948  1.00 0.00 ?  61  ILE A HG13 2  
ATOM 2565  H HG21 . ILE A 1 70  ? 33.581  71.313  78.016  1.00 0.00 ?  61  ILE A HG21 2  
ATOM 2566  H HG22 . ILE A 1 70  ? 33.713  71.302  79.756  1.00 0.00 ?  61  ILE A HG22 2  
ATOM 2567  H HG23 . ILE A 1 70  ? 35.094  71.706  78.708  1.00 0.00 ?  61  ILE A HG23 2  
ATOM 2568  H HD11 . ILE A 1 70  ? 32.294  67.068  79.455  1.00 0.00 ?  61  ILE A HD11 2  
ATOM 2569  H HD12 . ILE A 1 70  ? 33.693  66.807  78.344  1.00 0.00 ?  61  ILE A HD12 2  
ATOM 2570  H HD13 . ILE A 1 70  ? 34.020  67.204  80.021  1.00 0.00 ?  61  ILE A HD13 2  
ATOM 2571  N N    . LEU A 1 71  ? 37.278  70.781  77.320  1.00 0.00 ?  62  LEU A N    2  
ATOM 2572  C CA   . LEU A 1 71  ? 38.010  71.731  76.486  1.00 0.00 ?  62  LEU A CA   2  
ATOM 2573  C C    . LEU A 1 71  ? 38.640  71.019  75.254  1.00 0.00 ?  62  LEU A C    2  
ATOM 2574  O O    . LEU A 1 71  ? 38.573  71.516  74.156  1.00 0.00 ?  62  LEU A O    2  
ATOM 2575  C CB   . LEU A 1 71  ? 39.076  72.461  77.313  1.00 0.00 ?  62  LEU A CB   2  
ATOM 2576  C CG   . LEU A 1 71  ? 38.600  73.386  78.447  1.00 0.00 ?  62  LEU A CG   2  
ATOM 2577  C CD1  . LEU A 1 71  ? 39.641  74.463  78.759  1.00 0.00 ?  62  LEU A CD1  2  
ATOM 2578  C CD2  . LEU A 1 71  ? 37.362  74.177  78.092  1.00 0.00 ?  62  LEU A CD2  2  
ATOM 2579  H H    . LEU A 1 71  ? 37.683  70.545  78.214  1.00 0.00 ?  62  LEU A H    2  
ATOM 2580  H HA   . LEU A 1 71  ? 37.347  72.451  76.007  1.00 0.00 ?  62  LEU A HA   2  
ATOM 2581  H HB2  . LEU A 1 71  ? 39.713  71.718  77.791  1.00 0.00 ?  62  LEU A HB2  2  
ATOM 2582  H HB3  . LEU A 1 71  ? 39.649  73.073  76.616  1.00 0.00 ?  62  LEU A HB3  2  
ATOM 2583  H HG   . LEU A 1 71  ? 38.458  72.754  79.324  1.00 0.00 ?  62  LEU A HG   2  
ATOM 2584  H HD11 . LEU A 1 71  ? 40.614  74.022  78.976  1.00 0.00 ?  62  LEU A HD11 2  
ATOM 2585  H HD12 . LEU A 1 71  ? 39.688  75.154  77.917  1.00 0.00 ?  62  LEU A HD12 2  
ATOM 2586  H HD13 . LEU A 1 71  ? 39.373  75.037  79.647  1.00 0.00 ?  62  LEU A HD13 2  
ATOM 2587  H HD21 . LEU A 1 71  ? 37.230  75.115  78.631  1.00 0.00 ?  62  LEU A HD21 2  
ATOM 2588  H HD22 . LEU A 1 71  ? 37.497  74.569  77.084  1.00 0.00 ?  62  LEU A HD22 2  
ATOM 2589  H HD23 . LEU A 1 71  ? 36.458  73.574  78.171  1.00 0.00 ?  62  LEU A HD23 2  
ATOM 2590  N N    . PHE A 1 72  ? 39.093  69.766  75.320  1.00 0.00 ?  63  PHE A N    2  
ATOM 2591  C CA   . PHE A 1 72  ? 39.358  68.930  74.215  1.00 0.00 ?  63  PHE A CA   2  
ATOM 2592  C C    . PHE A 1 72  ? 38.149  68.443  73.386  1.00 0.00 ?  63  PHE A C    2  
ATOM 2593  O O    . PHE A 1 72  ? 38.292  68.239  72.182  1.00 0.00 ?  63  PHE A O    2  
ATOM 2594  C CB   . PHE A 1 72  ? 40.263  67.766  74.697  1.00 0.00 ?  63  PHE A CB   2  
ATOM 2595  C CG   . PHE A 1 72  ? 41.717  68.169  74.863  1.00 0.00 ?  63  PHE A CG   2  
ATOM 2596  C CD1  . PHE A 1 72  ? 42.528  68.600  73.805  1.00 0.00 ?  63  PHE A CD1  2  
ATOM 2597  C CD2  . PHE A 1 72  ? 42.267  68.159  76.178  1.00 0.00 ?  63  PHE A CD2  2  
ATOM 2598  C CE1  . PHE A 1 72  ? 43.855  69.048  73.959  1.00 0.00 ?  63  PHE A CE1  2  
ATOM 2599  C CE2  . PHE A 1 72  ? 43.656  68.581  76.330  1.00 0.00 ?  63  PHE A CE2  2  
ATOM 2600  C CZ   . PHE A 1 72  ? 44.422  68.939  75.223  1.00 0.00 ?  63  PHE A CZ   2  
ATOM 2601  H H    . PHE A 1 72  ? 39.159  69.395  76.257  1.00 0.00 ?  63  PHE A H    2  
ATOM 2602  H HA   . PHE A 1 72  ? 39.901  69.453  73.428  1.00 0.00 ?  63  PHE A HA   2  
ATOM 2603  H HB2  . PHE A 1 72  ? 39.987  67.365  75.672  1.00 0.00 ?  63  PHE A HB2  2  
ATOM 2604  H HB3  . PHE A 1 72  ? 40.275  66.919  74.010  1.00 0.00 ?  63  PHE A HB3  2  
ATOM 2605  H HD1  . PHE A 1 72  ? 42.127  68.626  72.802  1.00 0.00 ?  63  PHE A HD1  2  
ATOM 2606  H HD2  . PHE A 1 72  ? 41.751  67.793  77.053  1.00 0.00 ?  63  PHE A HD2  2  
ATOM 2607  H HE1  . PHE A 1 72  ? 44.394  69.311  73.061  1.00 0.00 ?  63  PHE A HE1  2  
ATOM 2608  H HE2  . PHE A 1 72  ? 44.075  68.602  77.326  1.00 0.00 ?  63  PHE A HE2  2  
ATOM 2609  H HZ   . PHE A 1 72  ? 45.495  69.040  75.286  1.00 0.00 ?  63  PHE A HZ   2  
ATOM 2610  N N    . VAL A 1 73  ? 36.950  68.504  73.915  1.00 0.00 ?  64  VAL A N    2  
ATOM 2611  C CA   . VAL A 1 73  ? 35.717  68.173  73.264  1.00 0.00 ?  64  VAL A CA   2  
ATOM 2612  C C    . VAL A 1 73  ? 35.157  69.339  72.502  1.00 0.00 ?  64  VAL A C    2  
ATOM 2613  O O    . VAL A 1 73  ? 34.568  69.216  71.456  1.00 0.00 ?  64  VAL A O    2  
ATOM 2614  C CB   . VAL A 1 73  ? 34.790  67.683  74.341  1.00 0.00 ?  64  VAL A CB   2  
ATOM 2615  C CG1  . VAL A 1 73  ? 33.353  68.005  74.039  1.00 0.00 ?  64  VAL A CG1  2  
ATOM 2616  C CG2  . VAL A 1 73  ? 35.008  66.176  74.472  1.00 0.00 ?  64  VAL A CG2  2  
ATOM 2617  H H    . VAL A 1 73  ? 36.959  68.801  74.881  1.00 0.00 ?  64  VAL A H    2  
ATOM 2618  H HA   . VAL A 1 73  ? 35.913  67.355  72.571  1.00 0.00 ?  64  VAL A HA   2  
ATOM 2619  H HB   . VAL A 1 73  ? 34.909  68.177  75.305  1.00 0.00 ?  64  VAL A HB   2  
ATOM 2620  H HG11 . VAL A 1 73  ? 33.139  69.049  74.266  1.00 0.00 ?  64  VAL A HG11 2  
ATOM 2621  H HG12 . VAL A 1 73  ? 33.143  67.544  73.074  1.00 0.00 ?  64  VAL A HG12 2  
ATOM 2622  H HG13 . VAL A 1 73  ? 32.845  67.379  74.773  1.00 0.00 ?  64  VAL A HG13 2  
ATOM 2623  H HG21 . VAL A 1 73  ? 36.003  65.792  74.243  1.00 0.00 ?  64  VAL A HG21 2  
ATOM 2624  H HG22 . VAL A 1 73  ? 34.805  65.980  75.525  1.00 0.00 ?  64  VAL A HG22 2  
ATOM 2625  H HG23 . VAL A 1 73  ? 34.353  65.603  73.816  1.00 0.00 ?  64  VAL A HG23 2  
ATOM 2626  N N    . MET A 1 74  ? 35.395  70.571  72.983  1.00 0.00 ?  65  MET A N    2  
ATOM 2627  C CA   . MET A 1 74  ? 35.317  71.873  72.319  1.00 0.00 ?  65  MET A CA   2  
ATOM 2628  C C    . MET A 1 74  ? 36.240  71.868  71.107  1.00 0.00 ?  65  MET A C    2  
ATOM 2629  O O    . MET A 1 74  ? 35.817  72.382  70.068  1.00 0.00 ?  65  MET A O    2  
ATOM 2630  C CB   . MET A 1 74  ? 35.635  73.065  73.196  1.00 0.00 ?  65  MET A CB   2  
ATOM 2631  C CG   . MET A 1 74  ? 35.321  74.435  72.601  1.00 0.00 ?  65  MET A CG   2  
ATOM 2632  S SD   . MET A 1 74  ? 35.664  75.940  73.510  1.00 0.00 ?  65  MET A SD   2  
ATOM 2633  C CE   . MET A 1 74  ? 34.891  75.612  75.068  1.00 0.00 ?  65  MET A CE   2  
ATOM 2634  H H    . MET A 1 74  ? 35.708  70.741  73.928  1.00 0.00 ?  65  MET A H    2  
ATOM 2635  H HA   . MET A 1 74  ? 34.343  71.955  71.836  1.00 0.00 ?  65  MET A HA   2  
ATOM 2636  H HB2  . MET A 1 74  ? 35.000  72.932  74.072  1.00 0.00 ?  65  MET A HB2  2  
ATOM 2637  H HB3  . MET A 1 74  ? 36.628  73.110  73.644  1.00 0.00 ?  65  MET A HB3  2  
ATOM 2638  H HG2  . MET A 1 74  ? 35.975  74.508  71.732  1.00 0.00 ?  65  MET A HG2  2  
ATOM 2639  H HG3  . MET A 1 74  ? 34.301  74.517  72.225  1.00 0.00 ?  65  MET A HG3  2  
ATOM 2640  H HE1  . MET A 1 74  ? 35.380  74.814  75.627  1.00 0.00 ?  65  MET A HE1  2  
ATOM 2641  H HE2  . MET A 1 74  ? 34.787  76.468  75.735  1.00 0.00 ?  65  MET A HE2  2  
ATOM 2642  H HE3  . MET A 1 74  ? 33.835  75.382  74.925  1.00 0.00 ?  65  MET A HE3  2  
ATOM 2643  N N    . PHE A 1 75  ? 37.451  71.390  71.246  1.00 0.00 ?  66  PHE A N    2  
ATOM 2644  C CA   . PHE A 1 75  ? 38.273  71.139  70.044  1.00 0.00 ?  66  PHE A CA   2  
ATOM 2645  C C    . PHE A 1 75  ? 37.838  70.052  69.061  1.00 0.00 ?  66  PHE A C    2  
ATOM 2646  O O    . PHE A 1 75  ? 37.840  70.191  67.897  1.00 0.00 ?  66  PHE A O    2  
ATOM 2647  C CB   . PHE A 1 75  ? 39.698  70.983  70.489  1.00 0.00 ?  66  PHE A CB   2  
ATOM 2648  C CG   . PHE A 1 75  ? 40.782  70.636  69.447  1.00 0.00 ?  66  PHE A CG   2  
ATOM 2649  C CD1  . PHE A 1 75  ? 40.840  69.349  68.874  1.00 0.00 ?  66  PHE A CD1  2  
ATOM 2650  C CD2  . PHE A 1 75  ? 41.564  71.731  68.980  1.00 0.00 ?  66  PHE A CD2  2  
ATOM 2651  C CE1  . PHE A 1 75  ? 41.755  69.187  67.796  1.00 0.00 ?  66  PHE A CE1  2  
ATOM 2652  C CE2  . PHE A 1 75  ? 42.537  71.503  67.992  1.00 0.00 ?  66  PHE A CE2  2  
ATOM 2653  C CZ   . PHE A 1 75  ? 42.672  70.212  67.404  1.00 0.00 ?  66  PHE A CZ   2  
ATOM 2654  H H    . PHE A 1 75  ? 37.713  71.025  72.151  1.00 0.00 ?  66  PHE A H    2  
ATOM 2655  H HA   . PHE A 1 75  ? 38.116  72.026  69.431  1.00 0.00 ?  66  PHE A HA   2  
ATOM 2656  H HB2  . PHE A 1 75  ? 39.910  71.923  70.998  1.00 0.00 ?  66  PHE A HB2  2  
ATOM 2657  H HB3  . PHE A 1 75  ? 39.715  70.154  71.197  1.00 0.00 ?  66  PHE A HB3  2  
ATOM 2658  H HD1  . PHE A 1 75  ? 40.139  68.576  69.153  1.00 0.00 ?  66  PHE A HD1  2  
ATOM 2659  H HD2  . PHE A 1 75  ? 41.442  72.735  69.356  1.00 0.00 ?  66  PHE A HD2  2  
ATOM 2660  H HE1  . PHE A 1 75  ? 41.892  68.264  67.253  1.00 0.00 ?  66  PHE A HE1  2  
ATOM 2661  H HE2  . PHE A 1 75  ? 43.207  72.302  67.711  1.00 0.00 ?  66  PHE A HE2  2  
ATOM 2662  H HZ   . PHE A 1 75  ? 43.374  70.074  66.595  1.00 0.00 ?  66  PHE A HZ   2  
ATOM 2663  N N    . LEU A 1 76  ? 37.295  68.948  69.557  1.00 0.00 ?  67  LEU A N    2  
ATOM 2664  C CA   . LEU A 1 76  ? 36.583  67.924  68.698  1.00 0.00 ?  67  LEU A CA   2  
ATOM 2665  C C    . LEU A 1 76  ? 35.297  68.455  68.075  1.00 0.00 ?  67  LEU A C    2  
ATOM 2666  O O    . LEU A 1 76  ? 35.007  67.968  66.968  1.00 0.00 ?  67  LEU A O    2  
ATOM 2667  C CB   . LEU A 1 76  ? 36.476  66.715  69.624  1.00 0.00 ?  67  LEU A CB   2  
ATOM 2668  C CG   . LEU A 1 76  ? 35.763  65.457  69.084  1.00 0.00 ?  67  LEU A CG   2  
ATOM 2669  C CD1  . LEU A 1 76  ? 36.524  64.907  67.881  1.00 0.00 ?  67  LEU A CD1  2  
ATOM 2670  C CD2  . LEU A 1 76  ? 35.388  64.444  70.125  1.00 0.00 ?  67  LEU A CD2  2  
ATOM 2671  H H    . LEU A 1 76  ? 37.368  68.851  70.559  1.00 0.00 ?  67  LEU A H    2  
ATOM 2672  H HA   . LEU A 1 76  ? 37.312  67.631  67.943  1.00 0.00 ?  67  LEU A HA   2  
ATOM 2673  H HB2  . LEU A 1 76  ? 37.459  66.336  69.904  1.00 0.00 ?  67  LEU A HB2  2  
ATOM 2674  H HB3  . LEU A 1 76  ? 35.877  66.988  70.492  1.00 0.00 ?  67  LEU A HB3  2  
ATOM 2675  H HG   . LEU A 1 76  ? 34.840  65.810  68.623  1.00 0.00 ?  67  LEU A HG   2  
ATOM 2676  H HD11 . LEU A 1 76  ? 35.858  64.175  67.425  1.00 0.00 ?  67  LEU A HD11 2  
ATOM 2677  H HD12 . LEU A 1 76  ? 36.733  65.704  67.168  1.00 0.00 ?  67  LEU A HD12 2  
ATOM 2678  H HD13 . LEU A 1 76  ? 37.465  64.595  68.333  1.00 0.00 ?  67  LEU A HD13 2  
ATOM 2679  H HD21 . LEU A 1 76  ? 36.319  63.948  70.402  1.00 0.00 ?  67  LEU A HD21 2  
ATOM 2680  H HD22 . LEU A 1 76  ? 34.940  64.984  70.959  1.00 0.00 ?  67  LEU A HD22 2  
ATOM 2681  H HD23 . LEU A 1 76  ? 34.667  63.785  69.643  1.00 0.00 ?  67  LEU A HD23 2  
ATOM 2682  N N    . PHE A 1 77  ? 34.570  69.424  68.682  1.00 0.00 ?  68  PHE A N    2  
ATOM 2683  C CA   . PHE A 1 77  ? 33.456  70.108  68.006  1.00 0.00 ?  68  PHE A CA   2  
ATOM 2684  C C    . PHE A 1 77  ? 33.987  70.741  66.703  1.00 0.00 ?  68  PHE A C    2  
ATOM 2685  O O    . PHE A 1 77  ? 33.485  70.313  65.632  1.00 0.00 ?  68  PHE A O    2  
ATOM 2686  C CB   . PHE A 1 77  ? 32.720  71.111  68.895  1.00 0.00 ?  68  PHE A CB   2  
ATOM 2687  C CG   . PHE A 1 77  ? 31.736  71.864  68.049  1.00 0.00 ?  68  PHE A CG   2  
ATOM 2688  C CD1  . PHE A 1 77  ? 30.535  71.284  67.544  1.00 0.00 ?  68  PHE A CD1  2  
ATOM 2689  C CD2  . PHE A 1 77  ? 32.121  73.121  67.647  1.00 0.00 ?  68  PHE A CD2  2  
ATOM 2690  C CE1  . PHE A 1 77  ? 29.787  72.002  66.607  1.00 0.00 ?  68  PHE A CE1  2  
ATOM 2691  C CE2  . PHE A 1 77  ? 31.274  73.845  66.796  1.00 0.00 ?  68  PHE A CE2  2  
ATOM 2692  C CZ   . PHE A 1 77  ? 30.093  73.323  66.284  1.00 0.00 ?  68  PHE A CZ   2  
ATOM 2693  H H    . PHE A 1 77  ? 34.735  69.479  69.677  1.00 0.00 ?  68  PHE A H    2  
ATOM 2694  H HA   . PHE A 1 77  ? 32.763  69.350  67.641  1.00 0.00 ?  68  PHE A HA   2  
ATOM 2695  H HB2  . PHE A 1 77  ? 32.325  70.763  69.850  1.00 0.00 ?  68  PHE A HB2  2  
ATOM 2696  H HB3  . PHE A 1 77  ? 33.415  71.860  69.274  1.00 0.00 ?  68  PHE A HB3  2  
ATOM 2697  H HD1  . PHE A 1 77  ? 30.224  70.350  67.988  1.00 0.00 ?  68  PHE A HD1  2  
ATOM 2698  H HD2  . PHE A 1 77  ? 33.084  73.500  67.957  1.00 0.00 ?  68  PHE A HD2  2  
ATOM 2699  H HE1  . PHE A 1 77  ? 28.844  71.606  66.261  1.00 0.00 ?  68  PHE A HE1  2  
ATOM 2700  H HE2  . PHE A 1 77  ? 31.725  74.735  66.384  1.00 0.00 ?  68  PHE A HE2  2  
ATOM 2701  H HZ   . PHE A 1 77  ? 29.537  73.940  65.594  1.00 0.00 ?  68  PHE A HZ   2  
ATOM 2702  N N    . ALA A 1 78  ? 35.060  71.573  66.656  1.00 0.00 ?  69  ALA A N    2  
ATOM 2703  C CA   . ALA A 1 78  ? 35.635  72.122  65.406  1.00 0.00 ?  69  ALA A CA   2  
ATOM 2704  C C    . ALA A 1 78  ? 36.121  71.033  64.419  1.00 0.00 ?  69  ALA A C    2  
ATOM 2705  O O    . ALA A 1 78  ? 35.782  71.124  63.232  1.00 0.00 ?  69  ALA A O    2  
ATOM 2706  C CB   . ALA A 1 78  ? 36.681  73.174  65.889  1.00 0.00 ?  69  ALA A CB   2  
ATOM 2707  H H    . ALA A 1 78  ? 35.515  71.766  67.537  1.00 0.00 ?  69  ALA A H    2  
ATOM 2708  H HA   . ALA A 1 78  ? 34.841  72.674  64.903  1.00 0.00 ?  69  ALA A HA   2  
ATOM 2709  H HB1  . ALA A 1 78  ? 36.232  73.747  66.701  1.00 0.00 ?  69  ALA A HB1  2  
ATOM 2710  H HB2  . ALA A 1 78  ? 37.572  72.651  66.237  1.00 0.00 ?  69  ALA A HB2  2  
ATOM 2711  H HB3  . ALA A 1 78  ? 36.963  73.871  65.101  1.00 0.00 ?  69  ALA A HB3  2  
ATOM 2712  N N    . VAL A 1 79  ? 36.611  69.923  64.907  1.00 0.00 ?  70  VAL A N    2  
ATOM 2713  C CA   . VAL A 1 79  ? 37.069  68.744  64.142  1.00 0.00 ?  70  VAL A CA   2  
ATOM 2714  C C    . VAL A 1 79  ? 35.937  67.940  63.616  1.00 0.00 ?  70  VAL A C    2  
ATOM 2715  O O    . VAL A 1 79  ? 35.936  67.455  62.452  1.00 0.00 ?  70  VAL A O    2  
ATOM 2716  C CB   . VAL A 1 79  ? 38.122  67.893  64.949  1.00 0.00 ?  70  VAL A CB   2  
ATOM 2717  C CG1  . VAL A 1 79  ? 38.676  66.608  64.250  1.00 0.00 ?  70  VAL A CG1  2  
ATOM 2718  C CG2  . VAL A 1 79  ? 39.477  68.572  65.322  1.00 0.00 ?  70  VAL A CG2  2  
ATOM 2719  H H    . VAL A 1 79  ? 36.521  69.703  65.889  1.00 0.00 ?  70  VAL A H    2  
ATOM 2720  H HA   . VAL A 1 79  ? 37.501  69.120  63.215  1.00 0.00 ?  70  VAL A HA   2  
ATOM 2721  H HB   . VAL A 1 79  ? 37.623  67.554  65.857  1.00 0.00 ?  70  VAL A HB   2  
ATOM 2722  H HG11 . VAL A 1 79  ? 37.835  66.037  63.855  1.00 0.00 ?  70  VAL A HG11 2  
ATOM 2723  H HG12 . VAL A 1 79  ? 39.305  66.837  63.389  1.00 0.00 ?  70  VAL A HG12 2  
ATOM 2724  H HG13 . VAL A 1 79  ? 39.189  66.067  65.046  1.00 0.00 ?  70  VAL A HG13 2  
ATOM 2725  H HG21 . VAL A 1 79  ? 39.246  69.444  65.934  1.00 0.00 ?  70  VAL A HG21 2  
ATOM 2726  H HG22 . VAL A 1 79  ? 40.155  67.971  65.927  1.00 0.00 ?  70  VAL A HG22 2  
ATOM 2727  H HG23 . VAL A 1 79  ? 40.080  68.801  64.444  1.00 0.00 ?  70  VAL A HG23 2  
ATOM 2728  N N    . THR A 1 80  ? 34.789  67.832  64.334  1.00 0.00 ?  71  THR A N    2  
ATOM 2729  C CA   . THR A 1 80  ? 33.514  67.223  63.896  1.00 0.00 ?  71  THR A CA   2  
ATOM 2730  C C    . THR A 1 80  ? 32.786  68.099  62.922  1.00 0.00 ?  71  THR A C    2  
ATOM 2731  O O    . THR A 1 80  ? 32.099  67.533  62.092  1.00 0.00 ?  71  THR A O    2  
ATOM 2732  C CB   . THR A 1 80  ? 32.582  66.889  65.110  1.00 0.00 ?  71  THR A CB   2  
ATOM 2733  O OG1  . THR A 1 80  ? 33.337  66.070  65.970  1.00 0.00 ?  71  THR A OG1  2  
ATOM 2734  C CG2  . THR A 1 80  ? 31.301  66.133  64.722  1.00 0.00 ?  71  THR A CG2  2  
ATOM 2735  H H    . THR A 1 80  ? 34.748  68.316  65.219  1.00 0.00 ?  71  THR A H    2  
ATOM 2736  H HA   . THR A 1 80  ? 33.679  66.241  63.455  1.00 0.00 ?  71  THR A HA   2  
ATOM 2737  H HB   . THR A 1 80  ? 32.412  67.832  65.629  1.00 0.00 ?  71  THR A HB   2  
ATOM 2738  H HG1  . THR A 1 80  ? 33.952  66.655  66.418  1.00 0.00 ?  71  THR A HG1  2  
ATOM 2739  H HG21 . THR A 1 80  ? 30.378  66.710  64.765  1.00 0.00 ?  71  THR A HG21 2  
ATOM 2740  H HG22 . THR A 1 80  ? 31.409  65.691  63.731  1.00 0.00 ?  71  THR A HG22 2  
ATOM 2741  H HG23 . THR A 1 80  ? 31.193  65.268  65.376  1.00 0.00 ?  71  THR A HG23 2  
ATOM 2742  N N    . VAL A 1 81  ? 32.943  69.449  62.846  1.00 0.00 ?  72  VAL A N    2  
ATOM 2743  C CA   . VAL A 1 81  ? 32.401  70.280  61.767  1.00 0.00 ?  72  VAL A CA   2  
ATOM 2744  C C    . VAL A 1 81  ? 33.089  69.836  60.455  1.00 0.00 ?  72  VAL A C    2  
ATOM 2745  O O    . VAL A 1 81  ? 32.424  69.515  59.435  1.00 0.00 ?  72  VAL A O    2  
ATOM 2746  C CB   . VAL A 1 81  ? 32.635  71.800  62.086  1.00 0.00 ?  72  VAL A CB   2  
ATOM 2747  C CG1  . VAL A 1 81  ? 32.702  72.768  60.888  1.00 0.00 ?  72  VAL A CG1  2  
ATOM 2748  C CG2  . VAL A 1 81  ? 31.613  72.418  63.007  1.00 0.00 ?  72  VAL A CG2  2  
ATOM 2749  H H    . VAL A 1 81  ? 33.585  69.915  63.471  1.00 0.00 ?  72  VAL A H    2  
ATOM 2750  H HA   . VAL A 1 81  ? 31.357  70.044  61.561  1.00 0.00 ?  72  VAL A HA   2  
ATOM 2751  H HB   . VAL A 1 81  ? 33.647  71.897  62.478  1.00 0.00 ?  72  VAL A HB   2  
ATOM 2752  H HG11 . VAL A 1 81  ? 31.761  72.737  60.337  1.00 0.00 ?  72  VAL A HG11 2  
ATOM 2753  H HG12 . VAL A 1 81  ? 32.814  73.753  61.340  1.00 0.00 ?  72  VAL A HG12 2  
ATOM 2754  H HG13 . VAL A 1 81  ? 33.598  72.497  60.330  1.00 0.00 ?  72  VAL A HG13 2  
ATOM 2755  H HG21 . VAL A 1 81  ? 31.946  73.402  63.336  1.00 0.00 ?  72  VAL A HG21 2  
ATOM 2756  H HG22 . VAL A 1 81  ? 30.611  72.514  62.591  1.00 0.00 ?  72  VAL A HG22 2  
ATOM 2757  H HG23 . VAL A 1 81  ? 31.480  71.839  63.921  1.00 0.00 ?  72  VAL A HG23 2  
ATOM 2758  N N    . GLY A 1 82  ? 34.420  69.583  60.513  1.00 0.00 ?  73  GLY A N    2  
ATOM 2759  C CA   . GLY A 1 82  ? 35.227  69.170  59.341  1.00 0.00 ?  73  GLY A CA   2  
ATOM 2760  C C    . GLY A 1 82  ? 35.121  67.691  59.004  1.00 0.00 ?  73  GLY A C    2  
ATOM 2761  O O    . GLY A 1 82  ? 34.900  67.366  57.833  1.00 0.00 ?  73  GLY A O    2  
ATOM 2762  H H    . GLY A 1 82  ? 34.878  69.765  61.395  1.00 0.00 ?  73  GLY A H    2  
ATOM 2763  H HA2  . GLY A 1 82  ? 34.972  69.713  58.431  1.00 0.00 ?  73  GLY A HA2  2  
ATOM 2764  H HA3  . GLY A 1 82  ? 36.285  69.320  59.558  1.00 0.00 ?  73  GLY A HA3  2  
ATOM 2765  N N    . SER A 1 83  ? 34.998  66.848  60.030  1.00 0.00 ?  74  SER A N    2  
ATOM 2766  C CA   . SER A 1 83  ? 34.386  65.548  59.844  1.00 0.00 ?  74  SER A CA   2  
ATOM 2767  C C    . SER A 1 83  ? 32.967  65.537  59.215  1.00 0.00 ?  74  SER A C    2  
ATOM 2768  O O    . SER A 1 83  ? 32.639  64.604  58.460  1.00 0.00 ?  74  SER A O    2  
ATOM 2769  C CB   . SER A 1 83  ? 34.270  64.831  61.161  1.00 0.00 ?  74  SER A CB   2  
ATOM 2770  O OG   . SER A 1 83  ? 35.601  64.747  61.699  1.00 0.00 ?  74  SER A OG   2  
ATOM 2771  H H    . SER A 1 83  ? 35.074  67.177  60.981  1.00 0.00 ?  74  SER A H    2  
ATOM 2772  H HA   . SER A 1 83  ? 35.043  64.931  59.230  1.00 0.00 ?  74  SER A HA   2  
ATOM 2773  H HB2  . SER A 1 83  ? 33.595  65.391  61.808  1.00 0.00 ?  74  SER A HB2  2  
ATOM 2774  H HB3  . SER A 1 83  ? 33.781  63.875  60.979  1.00 0.00 ?  74  SER A HB3  2  
ATOM 2775  H HG   . SER A 1 83  ? 35.907  65.646  61.839  1.00 0.00 ?  74  SER A HG   2  
ATOM 2776  N N    . LEU A 1 84  ? 32.050  66.493  59.531  1.00 0.00 ?  75  LEU A N    2  
ATOM 2777  C CA   . LEU A 1 84  ? 30.634  66.463  59.003  1.00 0.00 ?  75  LEU A CA   2  
ATOM 2778  C C    . LEU A 1 84  ? 30.645  66.748  57.503  1.00 0.00 ?  75  LEU A C    2  
ATOM 2779  O O    . LEU A 1 84  ? 29.919  66.062  56.717  1.00 0.00 ?  75  LEU A O    2  
ATOM 2780  C CB   . LEU A 1 84  ? 29.640  67.268  59.828  1.00 0.00 ?  75  LEU A CB   2  
ATOM 2781  C CG   . LEU A 1 84  ? 29.131  66.650  61.116  1.00 0.00 ?  75  LEU A CG   2  
ATOM 2782  C CD1  . LEU A 1 84  ? 28.589  67.674  62.170  1.00 0.00 ?  75  LEU A CD1  2  
ATOM 2783  C CD2  . LEU A 1 84  ? 28.046  65.695  60.708  1.00 0.00 ?  75  LEU A CD2  2  
ATOM 2784  H H    . LEU A 1 84  ? 32.230  67.168  60.261  1.00 0.00 ?  75  LEU A H    2  
ATOM 2785  H HA   . LEU A 1 84  ? 30.343  65.414  59.048  1.00 0.00 ?  75  LEU A HA   2  
ATOM 2786  H HB2  . LEU A 1 84  ? 30.108  68.218  60.088  1.00 0.00 ?  75  LEU A HB2  2  
ATOM 2787  H HB3  . LEU A 1 84  ? 28.762  67.507  59.227  1.00 0.00 ?  75  LEU A HB3  2  
ATOM 2788  H HG   . LEU A 1 84  ? 29.905  66.027  61.565  1.00 0.00 ?  75  LEU A HG   2  
ATOM 2789  H HD11 . LEU A 1 84  ? 29.353  68.339  62.575  1.00 0.00 ?  75  LEU A HD11 2  
ATOM 2790  H HD12 . LEU A 1 84  ? 27.868  68.367  61.736  1.00 0.00 ?  75  LEU A HD12 2  
ATOM 2791  H HD13 . LEU A 1 84  ? 28.196  67.048  62.971  1.00 0.00 ?  75  LEU A HD13 2  
ATOM 2792  H HD21 . LEU A 1 84  ? 28.422  64.908  60.054  1.00 0.00 ?  75  LEU A HD21 2  
ATOM 2793  H HD22 . LEU A 1 84  ? 27.713  65.165  61.600  1.00 0.00 ?  75  LEU A HD22 2  
ATOM 2794  H HD23 . LEU A 1 84  ? 27.201  66.209  60.249  1.00 0.00 ?  75  LEU A HD23 2  
ATOM 2795  N N    . ILE A 1 85  ? 31.408  67.745  56.990  1.00 0.00 ?  76  ILE A N    2  
ATOM 2796  C CA   . ILE A 1 85  ? 31.700  67.874  55.609  1.00 0.00 ?  76  ILE A CA   2  
ATOM 2797  C C    . ILE A 1 85  ? 32.288  66.621  54.910  1.00 0.00 ?  76  ILE A C    2  
ATOM 2798  O O    . ILE A 1 85  ? 31.652  66.098  54.014  1.00 0.00 ?  76  ILE A O    2  
ATOM 2799  C CB   . ILE A 1 85  ? 32.504  69.141  55.467  1.00 0.00 ?  76  ILE A CB   2  
ATOM 2800  C CG1  . ILE A 1 85  ? 32.189  70.440  56.240  1.00 0.00 ?  76  ILE A CG1  2  
ATOM 2801  C CG2  . ILE A 1 85  ? 32.613  69.471  53.936  1.00 0.00 ?  76  ILE A CG2  2  
ATOM 2802  C CD1  . ILE A 1 85  ? 33.307  71.537  56.170  1.00 0.00 ?  76  ILE A CD1  2  
ATOM 2803  H H    . ILE A 1 85  ? 32.012  68.271  57.605  1.00 0.00 ?  76  ILE A H    2  
ATOM 2804  H HA   . ILE A 1 85  ? 30.723  68.076  55.170  1.00 0.00 ?  76  ILE A HA   2  
ATOM 2805  H HB   . ILE A 1 85  ? 33.525  68.850  55.718  1.00 0.00 ?  76  ILE A HB   2  
ATOM 2806  H HG12 . ILE A 1 85  ? 31.287  70.803  55.748  1.00 0.00 ?  76  ILE A HG12 2  
ATOM 2807  H HG13 . ILE A 1 85  ? 31.866  70.273  57.268  1.00 0.00 ?  76  ILE A HG13 2  
ATOM 2808  H HG21 . ILE A 1 85  ? 32.932  68.586  53.386  1.00 0.00 ?  76  ILE A HG21 2  
ATOM 2809  H HG22 . ILE A 1 85  ? 31.645  69.758  53.525  1.00 0.00 ?  76  ILE A HG22 2  
ATOM 2810  H HG23 . ILE A 1 85  ? 33.439  70.098  53.602  1.00 0.00 ?  76  ILE A HG23 2  
ATOM 2811  H HD11 . ILE A 1 85  ? 34.267  71.087  56.425  1.00 0.00 ?  76  ILE A HD11 2  
ATOM 2812  H HD12 . ILE A 1 85  ? 33.293  71.864  55.131  1.00 0.00 ?  76  ILE A HD12 2  
ATOM 2813  H HD13 . ILE A 1 85  ? 33.137  72.377  56.844  1.00 0.00 ?  76  ILE A HD13 2  
ATOM 2814  N N    . LEU A 1 86  ? 33.423  66.040  55.337  1.00 0.00 ?  77  LEU A N    2  
ATOM 2815  C CA   . LEU A 1 86  ? 33.989  64.819  54.720  1.00 0.00 ?  77  LEU A CA   2  
ATOM 2816  C C    . LEU A 1 86  ? 33.117  63.486  54.928  1.00 0.00 ?  77  LEU A C    2  
ATOM 2817  O O    . LEU A 1 86  ? 33.167  62.620  54.120  1.00 0.00 ?  77  LEU A O    2  
ATOM 2818  C CB   . LEU A 1 86  ? 35.438  64.542  55.238  1.00 0.00 ?  77  LEU A CB   2  
ATOM 2819  C CG   . LEU A 1 86  ? 36.510  65.487  54.816  1.00 0.00 ?  77  LEU A CG   2  
ATOM 2820  C CD1  . LEU A 1 86  ? 37.869  65.431  55.556  1.00 0.00 ?  77  LEU A CD1  2  
ATOM 2821  C CD2  . LEU A 1 86  ? 36.916  65.445  53.377  1.00 0.00 ?  77  LEU A CD2  2  
ATOM 2822  H H    . LEU A 1 86  ? 33.857  66.419  56.167  1.00 0.00 ?  77  LEU A H    2  
ATOM 2823  H HA   . LEU A 1 86  ? 33.964  64.997  53.644  1.00 0.00 ?  77  LEU A HA   2  
ATOM 2824  H HB2  . LEU A 1 86  ? 35.459  64.644  56.323  1.00 0.00 ?  77  LEU A HB2  2  
ATOM 2825  H HB3  . LEU A 1 86  ? 35.784  63.574  54.878  1.00 0.00 ?  77  LEU A HB3  2  
ATOM 2826  H HG   . LEU A 1 86  ? 36.111  66.481  55.018  1.00 0.00 ?  77  LEU A HG   2  
ATOM 2827  H HD11 . LEU A 1 86  ? 38.246  64.409  55.524  1.00 0.00 ?  77  LEU A HD11 2  
ATOM 2828  H HD12 . LEU A 1 86  ? 38.552  66.260  55.371  1.00 0.00 ?  77  LEU A HD12 2  
ATOM 2829  H HD13 . LEU A 1 86  ? 37.693  65.625  56.614  1.00 0.00 ?  77  LEU A HD13 2  
ATOM 2830  H HD21 . LEU A 1 86  ? 37.348  64.469  53.155  1.00 0.00 ?  77  LEU A HD21 2  
ATOM 2831  H HD22 . LEU A 1 86  ? 36.074  65.599  52.702  1.00 0.00 ?  77  LEU A HD22 2  
ATOM 2832  H HD23 . LEU A 1 86  ? 37.742  66.114  53.141  1.00 0.00 ?  77  LEU A HD23 2  
ATOM 2833  N N    . GLY A 1 87  ? 32.283  63.407  55.972  1.00 0.00 ?  78  GLY A N    2  
ATOM 2834  C CA   . GLY A 1 87  ? 31.185  62.449  56.049  1.00 0.00 ?  78  GLY A CA   2  
ATOM 2835  C C    . GLY A 1 87  ? 30.154  62.600  54.875  1.00 0.00 ?  78  GLY A C    2  
ATOM 2836  O O    . GLY A 1 87  ? 29.778  61.616  54.217  1.00 0.00 ?  78  GLY A O    2  
ATOM 2837  H H    . GLY A 1 87  ? 32.394  64.140  56.659  1.00 0.00 ?  78  GLY A H    2  
ATOM 2838  H HA2  . GLY A 1 87  ? 31.647  61.474  55.894  1.00 0.00 ?  78  GLY A HA2  2  
ATOM 2839  H HA3  . GLY A 1 87  ? 30.728  62.487  57.037  1.00 0.00 ?  78  GLY A HA3  2  
ATOM 2840  N N    . TYR A 1 88  ? 29.785  63.862  54.607  1.00 0.00 ?  79  TYR A N    2  
ATOM 2841  C CA   . TYR A 1 88  ? 29.008  64.182  53.393  1.00 0.00 ?  79  TYR A CA   2  
ATOM 2842  C C    . TYR A 1 88  ? 29.632  63.810  52.041  1.00 0.00 ?  79  TYR A C    2  
ATOM 2843  O O    . TYR A 1 88  ? 28.996  63.477  51.067  1.00 0.00 ?  79  TYR A O    2  
ATOM 2844  C CB   . TYR A 1 88  ? 28.503  65.602  53.479  1.00 0.00 ?  79  TYR A CB   2  
ATOM 2845  C CG   . TYR A 1 88  ? 28.124  66.254  52.171  1.00 0.00 ?  79  TYR A CG   2  
ATOM 2846  C CD1  . TYR A 1 88  ? 26.980  65.800  51.491  1.00 0.00 ?  79  TYR A CD1  2  
ATOM 2847  C CD2  . TYR A 1 88  ? 28.886  67.285  51.685  1.00 0.00 ?  79  TYR A CD2  2  
ATOM 2848  C CE1  . TYR A 1 88  ? 26.601  66.453  50.287  1.00 0.00 ?  79  TYR A CE1  2  
ATOM 2849  C CE2  . TYR A 1 88  ? 28.509  68.004  50.499  1.00 0.00 ?  79  TYR A CE2  2  
ATOM 2850  C CZ   . TYR A 1 88  ? 27.321  67.551  49.842  1.00 0.00 ?  79  TYR A CZ   2  
ATOM 2851  O OH   . TYR A 1 88  ? 26.856  68.272  48.756  1.00 0.00 ?  79  TYR A OH   2  
ATOM 2852  H H    . TYR A 1 88  ? 30.078  64.632  55.190  1.00 0.00 ?  79  TYR A H    2  
ATOM 2853  H HA   . TYR A 1 88  ? 28.067  63.634  53.444  1.00 0.00 ?  79  TYR A HA   2  
ATOM 2854  H HB2  . TYR A 1 88  ? 27.675  65.748  54.173  1.00 0.00 ?  79  TYR A HB2  2  
ATOM 2855  H HB3  . TYR A 1 88  ? 29.188  66.217  54.062  1.00 0.00 ?  79  TYR A HB3  2  
ATOM 2856  H HD1  . TYR A 1 88  ? 26.358  64.979  51.818  1.00 0.00 ?  79  TYR A HD1  2  
ATOM 2857  H HD2  . TYR A 1 88  ? 29.876  67.399  52.102  1.00 0.00 ?  79  TYR A HD2  2  
ATOM 2858  H HE1  . TYR A 1 88  ? 25.762  66.084  49.716  1.00 0.00 ?  79  TYR A HE1  2  
ATOM 2859  H HE2  . TYR A 1 88  ? 29.147  68.760  50.068  1.00 0.00 ?  79  TYR A HE2  2  
ATOM 2860  H HH   . TYR A 1 88  ? 26.521  67.673  48.085  1.00 0.00 ?  79  TYR A HH   2  
ATOM 2861  N N    . THR A 1 89  ? 30.997  63.822  51.956  1.00 0.00 ?  80  THR A N    2  
ATOM 2862  C CA   . THR A 1 89  ? 31.740  63.320  50.770  1.00 0.00 ?  80  THR A CA   2  
ATOM 2863  C C    . THR A 1 89  ? 31.987  61.859  50.775  1.00 0.00 ?  80  THR A C    2  
ATOM 2864  O O    . THR A 1 89  ? 31.782  61.185  49.750  1.00 0.00 ?  80  THR A O    2  
ATOM 2865  C CB   . THR A 1 89  ? 32.978  64.115  50.403  1.00 0.00 ?  80  THR A CB   2  
ATOM 2866  O OG1  . THR A 1 89  ? 33.985  63.734  51.266  1.00 0.00 ?  80  THR A OG1  2  
ATOM 2867  C CG2  . THR A 1 89  ? 32.749  65.648  50.532  1.00 0.00 ?  80  THR A CG2  2  
ATOM 2868  H H    . THR A 1 89  ? 31.548  63.971  52.790  1.00 0.00 ?  80  THR A H    2  
ATOM 2869  H HA   . THR A 1 89  ? 31.078  63.320  49.904  1.00 0.00 ?  80  THR A HA   2  
ATOM 2870  H HB   . THR A 1 89  ? 33.304  63.833  49.402  1.00 0.00 ?  80  THR A HB   2  
ATOM 2871  H HG1  . THR A 1 89  ? 34.788  64.149  50.943  1.00 0.00 ?  80  THR A HG1  2  
ATOM 2872  H HG21 . THR A 1 89  ? 31.841  66.076  50.107  1.00 0.00 ?  80  THR A HG21 2  
ATOM 2873  H HG22 . THR A 1 89  ? 32.753  65.881  51.597  1.00 0.00 ?  80  THR A HG22 2  
ATOM 2874  H HG23 . THR A 1 89  ? 33.618  66.184  50.153  1.00 0.00 ?  80  THR A HG23 2  
ATOM 2875  N N    . ARG A 1 90  ? 32.433  61.203  51.802  1.00 0.00 ?  81  ARG A N    2  
ATOM 2876  C CA   . ARG A 1 90  ? 32.955  59.856  51.848  1.00 0.00 ?  81  ARG A CA   2  
ATOM 2877  C C    . ARG A 1 90  ? 32.062  58.869  52.488  1.00 0.00 ?  81  ARG A C    2  
ATOM 2878  O O    . ARG A 1 90  ? 31.761  57.840  51.872  1.00 0.00 ?  81  ARG A O    2  
ATOM 2879  C CB   . ARG A 1 90  ? 34.345  59.872  52.411  1.00 0.00 ?  81  ARG A CB   2  
ATOM 2880  C CG   . ARG A 1 90  ? 35.332  60.633  51.463  1.00 0.00 ?  81  ARG A CG   2  
ATOM 2881  C CD   . ARG A 1 90  ? 36.316  61.275  52.375  1.00 0.00 ?  81  ARG A CD   2  
ATOM 2882  N NE   . ARG A 1 90  ? 37.137  62.206  51.675  1.00 0.00 ?  81  ARG A NE   2  
ATOM 2883  C CZ   . ARG A 1 90  ? 38.433  62.125  51.459  1.00 0.00 ?  81  ARG A CZ   2  
ATOM 2884  N NH1  . ARG A 1 90  ? 39.096  61.013  51.713  1.00 0.00 ?  81  ARG A NH1  2  
ATOM 2885  N NH2  . ARG A 1 90  ? 39.081  62.974  50.705  1.00 0.00 1  81  ARG A NH2  2  
ATOM 2886  H H    . ARG A 1 90  ? 32.455  61.723  52.668  1.00 0.00 ?  81  ARG A H    2  
ATOM 2887  H HA   . ARG A 1 90  ? 33.082  59.494  50.827  1.00 0.00 ?  81  ARG A HA   2  
ATOM 2888  H HB2  . ARG A 1 90  ? 34.243  60.376  53.372  1.00 0.00 ?  81  ARG A HB2  2  
ATOM 2889  H HB3  . ARG A 1 90  ? 34.759  58.868  52.498  1.00 0.00 ?  81  ARG A HB3  2  
ATOM 2890  H HG2  . ARG A 1 90  ? 35.708  59.820  50.842  1.00 0.00 ?  81  ARG A HG2  2  
ATOM 2891  H HG3  . ARG A 1 90  ? 34.879  61.355  50.784  1.00 0.00 ?  81  ARG A HG3  2  
ATOM 2892  H HD2  . ARG A 1 90  ? 35.772  61.834  53.136  1.00 0.00 ?  81  ARG A HD2  2  
ATOM 2893  H HD3  . ARG A 1 90  ? 36.885  60.520  52.917  1.00 0.00 ?  81  ARG A HD3  2  
ATOM 2894  H HE   . ARG A 1 90  ? 36.716  63.020  51.250  1.00 0.00 ?  81  ARG A HE   2  
ATOM 2895  H HH11 . ARG A 1 90  ? 38.530  60.195  51.539  1.00 0.00 ?  81  ARG A HH11 2  
ATOM 2896  H HH12 . ARG A 1 90  ? 40.031  61.093  51.341  1.00 0.00 ?  81  ARG A HH12 2  
ATOM 2897  H HH21 . ARG A 1 90  ? 38.743  63.847  50.327  1.00 0.00 ?  81  ARG A HH21 2  
ATOM 2898  H HH22 . ARG A 1 90  ? 39.975  62.736  50.298  1.00 0.00 ?  81  ARG A HH22 2  
ATOM 2899  N N    . SER A 1 91  ? 31.548  59.109  53.696  1.00 0.00 ?  82  SER A N    2  
ATOM 2900  C CA   . SER A 1 91  ? 30.943  58.061  54.434  1.00 0.00 ?  82  SER A CA   2  
ATOM 2901  C C    . SER A 1 91  ? 29.485  57.909  54.035  1.00 0.00 ?  82  SER A C    2  
ATOM 2902  O O    . SER A 1 91  ? 29.038  56.842  53.673  1.00 0.00 ?  82  SER A O    2  
ATOM 2903  C CB   . SER A 1 91  ? 31.150  58.193  55.908  1.00 0.00 ?  82  SER A CB   2  
ATOM 2904  O OG   . SER A 1 91  ? 30.378  59.189  56.606  1.00 0.00 ?  82  SER A OG   2  
ATOM 2905  H H    . SER A 1 91  ? 31.673  59.992  54.170  1.00 0.00 ?  82  SER A H    2  
ATOM 2906  H HA   . SER A 1 91  ? 31.438  57.113  54.222  1.00 0.00 ?  82  SER A HA   2  
ATOM 2907  H HB2  . SER A 1 91  ? 30.977  57.198  56.319  1.00 0.00 ?  82  SER A HB2  2  
ATOM 2908  H HB3  . SER A 1 91  ? 32.201  58.375  56.127  1.00 0.00 ?  82  SER A HB3  2  
ATOM 2909  H HG   . SER A 1 91  ? 30.288  58.815  57.486  1.00 0.00 ?  82  SER A HG   2  
ATOM 2910  N N    . ARG A 1 92  ? 28.705  59.039  53.888  1.00 0.00 ?  83  ARG A N    2  
ATOM 2911  C CA   . ARG A 1 92  ? 27.283  58.884  53.565  1.00 0.00 ?  83  ARG A CA   2  
ATOM 2912  C C    . ARG A 1 92  ? 27.108  58.376  52.135  1.00 0.00 ?  83  ARG A C    2  
ATOM 2913  O O    . ARG A 1 92  ? 26.186  57.620  51.902  1.00 0.00 ?  83  ARG A O    2  
ATOM 2914  C CB   . ARG A 1 92  ? 26.585  60.257  53.866  1.00 0.00 ?  83  ARG A CB   2  
ATOM 2915  C CG   . ARG A 1 92  ? 26.422  60.598  55.375  1.00 0.00 ?  83  ARG A CG   2  
ATOM 2916  C CD   . ARG A 1 92  ? 25.775  61.922  55.577  1.00 0.00 ?  83  ARG A CD   2  
ATOM 2917  N NE   . ARG A 1 92  ? 24.324  61.831  55.262  1.00 0.00 ?  83  ARG A NE   2  
ATOM 2918  C CZ   . ARG A 1 92  ? 23.548  62.529  54.461  1.00 0.00 ?  83  ARG A CZ   2  
ATOM 2919  N NH1  . ARG A 1 92  ? 24.043  63.474  53.688  1.00 0.00 ?  83  ARG A NH1  2  
ATOM 2920  N NH2  . ARG A 1 92  ? 22.262  62.391  54.444  1.00 0.00 1  83  ARG A NH2  2  
ATOM 2921  H H    . ARG A 1 92  ? 28.982  59.976  54.143  1.00 0.00 ?  83  ARG A H    2  
ATOM 2922  H HA   . ARG A 1 92  ? 26.862  58.016  54.071  1.00 0.00 ?  83  ARG A HA   2  
ATOM 2923  H HB2  . ARG A 1 92  ? 27.258  61.038  53.512  1.00 0.00 ?  83  ARG A HB2  2  
ATOM 2924  H HB3  . ARG A 1 92  ? 25.648  60.256  53.308  1.00 0.00 ?  83  ARG A HB3  2  
ATOM 2925  H HG2  . ARG A 1 92  ? 25.812  59.840  55.867  1.00 0.00 ?  83  ARG A HG2  2  
ATOM 2926  H HG3  . ARG A 1 92  ? 27.363  60.789  55.891  1.00 0.00 ?  83  ARG A HG3  2  
ATOM 2927  H HD2  . ARG A 1 92  ? 25.883  62.309  56.590  1.00 0.00 ?  83  ARG A HD2  2  
ATOM 2928  H HD3  . ARG A 1 92  ? 26.233  62.640  54.897  1.00 0.00 ?  83  ARG A HD3  2  
ATOM 2929  H HE   . ARG A 1 92  ? 23.776  61.060  55.619  1.00 0.00 ?  83  ARG A HE   2  
ATOM 2930  H HH11 . ARG A 1 92  ? 25.048  63.571  53.690  1.00 0.00 ?  83  ARG A HH11 2  
ATOM 2931  H HH12 . ARG A 1 92  ? 23.442  64.107  53.180  1.00 0.00 ?  83  ARG A HH12 2  
ATOM 2932  H HH21 . ARG A 1 92  ? 21.859  61.681  55.038  1.00 0.00 ?  83  ARG A HH21 2  
ATOM 2933  H HH22 . ARG A 1 92  ? 21.628  62.945  53.885  1.00 0.00 ?  83  ARG A HH22 2  
ATOM 2934  N N    . LYS A 1 93  ? 27.967  58.734  51.157  1.00 0.00 ?  84  LYS A N    2  
ATOM 2935  C CA   . LYS A 1 93  ? 27.921  58.502  49.718  1.00 0.00 ?  84  LYS A CA   2  
ATOM 2936  C C    . LYS A 1 93  ? 28.229  57.073  49.294  1.00 0.00 ?  84  LYS A C    2  
ATOM 2937  O O    . LYS A 1 93  ? 28.587  56.885  48.145  1.00 0.00 ?  84  LYS A O    2  
ATOM 2938  C CB   . LYS A 1 93  ? 28.857  59.614  49.043  1.00 0.00 ?  84  LYS A CB   2  
ATOM 2939  C CG   . LYS A 1 93  ? 28.295  60.052  47.736  1.00 0.00 ?  84  LYS A CG   2  
ATOM 2940  C CD   . LYS A 1 93  ? 29.366  60.867  47.021  1.00 0.00 ?  84  LYS A CD   2  
ATOM 2941  C CE   . LYS A 1 93  ? 29.003  61.523  45.638  1.00 0.00 ?  84  LYS A CE   2  
ATOM 2942  N NZ   . LYS A 1 93  ? 28.074  62.733  45.833  1.00 0.00 1  84  LYS A NZ   2  
ATOM 2943  H H    . LYS A 1 93  ? 28.678  59.298  51.598  1.00 0.00 ?  84  LYS A H    2  
ATOM 2944  H HA   . LYS A 1 93  ? 26.917  58.719  49.353  1.00 0.00 ?  84  LYS A HA   2  
ATOM 2945  H HB2  . LYS A 1 93  ? 28.727  60.495  49.672  1.00 0.00 ?  84  LYS A HB2  2  
ATOM 2946  H HB3  . LYS A 1 93  ? 29.920  59.378  49.079  1.00 0.00 ?  84  LYS A HB3  2  
ATOM 2947  H HG2  . LYS A 1 93  ? 28.002  59.208  47.111  1.00 0.00 ?  84  LYS A HG2  2  
ATOM 2948  H HG3  . LYS A 1 93  ? 27.300  60.496  47.781  1.00 0.00 ?  84  LYS A HG3  2  
ATOM 2949  H HD2  . LYS A 1 93  ? 29.668  61.704  47.650  1.00 0.00 ?  84  LYS A HD2  2  
ATOM 2950  H HD3  . LYS A 1 93  ? 30.258  60.270  46.836  1.00 0.00 ?  84  LYS A HD3  2  
ATOM 2951  H HE2  . LYS A 1 93  ? 29.911  61.804  45.104  1.00 0.00 ?  84  LYS A HE2  2  
ATOM 2952  H HE3  . LYS A 1 93  ? 28.543  60.734  45.043  1.00 0.00 ?  84  LYS A HE3  2  
ATOM 2953  H HZ1  . LYS A 1 93  ? 28.023  63.352  45.037  1.00 0.00 ?  84  LYS A HZ1  2  
ATOM 2954  H HZ2  . LYS A 1 93  ? 27.119  62.458  46.015  1.00 0.00 ?  84  LYS A HZ2  2  
ATOM 2955  H HZ3  . LYS A 1 93  ? 28.386  63.220  46.661  1.00 0.00 ?  84  LYS A HZ3  2  
ATOM 2956  N N    . VAL A 1 94  ? 28.164  56.103  50.193  1.00 0.00 ?  85  VAL A N    2  
ATOM 2957  C CA   . VAL A 1 94  ? 28.363  54.633  49.966  1.00 0.00 ?  85  VAL A CA   2  
ATOM 2958  C C    . VAL A 1 94  ? 27.119  53.862  49.517  1.00 0.00 ?  85  VAL A C    2  
ATOM 2959  O O    . VAL A 1 94  ? 26.040  54.133  49.965  1.00 0.00 ?  85  VAL A O    2  
ATOM 2960  C CB   . VAL A 1 94  ? 29.118  53.893  51.056  1.00 0.00 ?  85  VAL A CB   2  
ATOM 2961  C CG1  . VAL A 1 94  ? 30.379  54.575  51.531  1.00 0.00 ?  85  VAL A CG1  2  
ATOM 2962  C CG2  . VAL A 1 94  ? 28.284  53.580  52.313  1.00 0.00 ?  85  VAL A CG2  2  
ATOM 2963  H H    . VAL A 1 94  ? 27.762  56.426  51.061  1.00 0.00 ?  85  VAL A H    2  
ATOM 2964  H HA   . VAL A 1 94  ? 28.968  54.633  49.058  1.00 0.00 ?  85  VAL A HA   2  
ATOM 2965  H HB   . VAL A 1 94  ? 29.345  52.939  50.580  1.00 0.00 ?  85  VAL A HB   2  
ATOM 2966  H HG11 . VAL A 1 94  ? 30.963  53.934  52.190  1.00 0.00 ?  85  VAL A HG11 2  
ATOM 2967  H HG12 . VAL A 1 94  ? 30.980  54.695  50.629  1.00 0.00 ?  85  VAL A HG12 2  
ATOM 2968  H HG13 . VAL A 1 94  ? 30.210  55.564  51.957  1.00 0.00 ?  85  VAL A HG13 2  
ATOM 2969  H HG21 . VAL A 1 94  ? 27.490  52.867  52.091  1.00 0.00 ?  85  VAL A HG21 2  
ATOM 2970  H HG22 . VAL A 1 94  ? 28.836  53.214  53.179  1.00 0.00 ?  85  VAL A HG22 2  
ATOM 2971  H HG23 . VAL A 1 94  ? 27.930  54.582  52.557  1.00 0.00 ?  85  VAL A HG23 2  
ATOM 2972  N N    . ASP A 1 95  ? 27.287  52.859  48.630  1.00 0.00 ?  86  ASP A N    2  
ATOM 2973  C CA   . ASP A 1 95  ? 26.180  52.005  48.066  1.00 0.00 ?  86  ASP A CA   2  
ATOM 2974  C C    . ASP A 1 95  ? 25.371  51.301  49.202  1.00 0.00 ?  86  ASP A C    2  
ATOM 2975  O O    . ASP A 1 95  ? 25.898  50.397  49.895  1.00 0.00 ?  86  ASP A O    2  
ATOM 2976  C CB   . ASP A 1 95  ? 26.773  51.067  46.949  1.00 0.00 ?  86  ASP A CB   2  
ATOM 2977  C CG   . ASP A 1 95  ? 27.202  51.764  45.606  1.00 0.00 ?  86  ASP A CG   2  
ATOM 2978  O OD1  . ASP A 1 95  ? 27.117  52.981  45.578  1.00 0.00 ?  86  ASP A OD1  2  
ATOM 2979  O OD2  . ASP A 1 95  ? 27.953  51.214  44.747  1.00 0.00 -1 86  ASP A OD2  2  
ATOM 2980  H H    . ASP A 1 95  ? 28.167  52.732  48.152  1.00 0.00 ?  86  ASP A H    2  
ATOM 2981  H HA   . ASP A 1 95  ? 25.548  52.781  47.633  1.00 0.00 ?  86  ASP A HA   2  
ATOM 2982  H HB2  . ASP A 1 95  ? 27.656  50.596  47.380  1.00 0.00 ?  86  ASP A HB2  2  
ATOM 2983  H HB3  . ASP A 1 95  ? 26.010  50.303  46.798  1.00 0.00 ?  86  ASP A HB3  2  
ATOM 2984  N N    . LYS A 1 96  ? 24.109  51.609  49.378  1.00 0.00 ?  87  LYS A N    2  
ATOM 2985  C CA   . LYS A 1 96  ? 23.192  50.745  50.166  1.00 0.00 ?  87  LYS A CA   2  
ATOM 2986  C C    . LYS A 1 96  ? 23.121  49.286  49.585  1.00 0.00 ?  87  LYS A C    2  
ATOM 2987  O O    . LYS A 1 96  ? 23.289  49.084  48.364  1.00 0.00 ?  87  LYS A O    2  
ATOM 2988  C CB   . LYS A 1 96  ? 21.762  51.433  50.198  1.00 0.00 ?  87  LYS A CB   2  
ATOM 2989  C CG   . LYS A 1 96  ? 21.646  52.928  50.589  1.00 0.00 ?  87  LYS A CG   2  
ATOM 2990  C CD   . LYS A 1 96  ? 20.159  53.178  50.942  1.00 0.00 ?  87  LYS A CD   2  
ATOM 2991  C CE   . LYS A 1 96  ? 19.646  52.729  52.298  1.00 0.00 ?  87  LYS A CE   2  
ATOM 2992  N NZ   . LYS A 1 96  ? 18.136  52.945  52.298  1.00 0.00 1  87  LYS A NZ   2  
ATOM 2993  H H    . LYS A 1 96  ? 23.753  52.355  48.796  1.00 0.00 ?  87  LYS A H    2  
ATOM 2994  H HA   . LYS A 1 96  ? 23.466  50.690  51.219  1.00 0.00 ?  87  LYS A HA   2  
ATOM 2995  H HB2  . LYS A 1 96  ? 21.252  51.343  49.239  1.00 0.00 ?  87  LYS A HB2  2  
ATOM 2996  H HB3  . LYS A 1 96  ? 21.314  50.860  51.010  1.00 0.00 ?  87  LYS A HB3  2  
ATOM 2997  H HG2  . LYS A 1 96  ? 22.379  53.108  51.375  1.00 0.00 ?  87  LYS A HG2  2  
ATOM 2998  H HG3  . LYS A 1 96  ? 22.076  53.462  49.742  1.00 0.00 ?  87  LYS A HG3  2  
ATOM 2999  H HD2  . LYS A 1 96  ? 20.032  54.251  50.798  1.00 0.00 ?  87  LYS A HD2  2  
ATOM 3000  H HD3  . LYS A 1 96  ? 19.543  52.682  50.191  1.00 0.00 ?  87  LYS A HD3  2  
ATOM 3001  H HE2  . LYS A 1 96  ? 19.828  51.661  52.413  1.00 0.00 ?  87  LYS A HE2  2  
ATOM 3002  H HE3  . LYS A 1 96  ? 20.233  53.307  53.012  1.00 0.00 ?  87  LYS A HE3  2  
ATOM 3003  H HZ1  . LYS A 1 96  ? 17.882  52.844  51.326  1.00 0.00 ?  87  LYS A HZ1  2  
ATOM 3004  H HZ2  . LYS A 1 96  ? 17.561  52.298  52.820  1.00 0.00 ?  87  LYS A HZ2  2  
ATOM 3005  H HZ3  . LYS A 1 96  ? 17.941  53.812  52.777  1.00 0.00 ?  87  LYS A HZ3  2  
ATOM 3006  N N    . ARG A 1 97  ? 22.900  48.259  50.406  1.00 0.00 ?  88  ARG A N    2  
ATOM 3007  C CA   . ARG A 1 97  ? 22.483  46.954  49.978  1.00 0.00 ?  88  ARG A CA   2  
ATOM 3008  C C    . ARG A 1 97  ? 21.100  47.087  49.334  1.00 0.00 ?  88  ARG A C    2  
ATOM 3009  O O    . ARG A 1 97  ? 20.828  46.344  48.316  1.00 0.00 ?  88  ARG A O    2  
ATOM 3010  C CB   . ARG A 1 97  ? 22.314  46.041  51.202  1.00 0.00 ?  88  ARG A CB   2  
ATOM 3011  C CG   . ARG A 1 97  ? 22.123  44.556  50.945  1.00 0.00 ?  88  ARG A CG   2  
ATOM 3012  C CD   . ARG A 1 97  ? 22.474  43.732  52.204  1.00 0.00 ?  88  ARG A CD   2  
ATOM 3013  N NE   . ARG A 1 97  ? 22.163  42.341  52.086  1.00 0.00 ?  88  ARG A NE   2  
ATOM 3014  C CZ   . ARG A 1 97  ? 20.947  41.830  52.253  1.00 0.00 ?  88  ARG A CZ   2  
ATOM 3015  N NH1  . ARG A 1 97  ? 19.942  42.568  52.655  1.00 0.00 ?  88  ARG A NH1  2  
ATOM 3016  N NH2  . ARG A 1 97  ? 20.671  40.546  51.943  1.00 0.00 1  88  ARG A NH2  2  
ATOM 3017  H H    . ARG A 1 97  ? 22.648  48.392  51.376  1.00 0.00 ?  88  ARG A H    2  
ATOM 3018  H HA   . ARG A 1 97  ? 23.184  46.461  49.304  1.00 0.00 ?  88  ARG A HA   2  
ATOM 3019  H HB2  . ARG A 1 97  ? 23.142  46.116  51.907  1.00 0.00 ?  88  ARG A HB2  2  
ATOM 3020  H HB3  . ARG A 1 97  ? 21.481  46.456  51.769  1.00 0.00 ?  88  ARG A HB3  2  
ATOM 3021  H HG2  . ARG A 1 97  ? 21.126  44.389  50.536  1.00 0.00 ?  88  ARG A HG2  2  
ATOM 3022  H HG3  . ARG A 1 97  ? 22.888  44.279  50.219  1.00 0.00 ?  88  ARG A HG3  2  
ATOM 3023  H HD2  . ARG A 1 97  ? 23.526  43.860  52.457  1.00 0.00 ?  88  ARG A HD2  2  
ATOM 3024  H HD3  . ARG A 1 97  ? 21.904  44.204  53.005  1.00 0.00 ?  88  ARG A HD3  2  
ATOM 3025  H HE   . ARG A 1 97  ? 22.962  41.758  51.881  1.00 0.00 ?  88  ARG A HE   2  
ATOM 3026  H HH11 . ARG A 1 97  ? 20.155  43.548  52.541  1.00 0.00 ?  88  ARG A HH11 2  
ATOM 3027  H HH12 . ARG A 1 97  ? 18.990  42.230  52.667  1.00 0.00 ?  88  ARG A HH12 2  
ATOM 3028  H HH21 . ARG A 1 97  ? 21.401  39.882  51.730  1.00 0.00 ?  88  ARG A HH21 2  
ATOM 3029  H HH22 . ARG A 1 97  ? 19.696  40.288  52.010  1.00 0.00 ?  88  ARG A HH22 2  
ATOM 3030  N N    . SER A 1 98  ? 20.143  47.862  49.910  1.00 0.00 ?  89  SER A N    2  
ATOM 3031  C CA   . SER A 1 98  ? 18.744  48.147  49.394  1.00 0.00 ?  89  SER A CA   2  
ATOM 3032  C C    . SER A 1 98  ? 18.628  48.984  48.115  1.00 0.00 ?  89  SER A C    2  
ATOM 3033  O O    . SER A 1 98  ? 19.465  49.788  47.840  1.00 0.00 ?  89  SER A O    2  
ATOM 3034  C CB   . SER A 1 98  ? 17.925  48.890  50.501  1.00 0.00 ?  89  SER A CB   2  
ATOM 3035  O OG   . SER A 1 98  ? 18.574  49.937  51.137  1.00 0.00 ?  89  SER A OG   2  
ATOM 3036  H H    . SER A 1 98  ? 20.471  48.461  50.654  1.00 0.00 ?  89  SER A H    2  
ATOM 3037  H HA   . SER A 1 98  ? 18.230  47.216  49.152  1.00 0.00 ?  89  SER A HA   2  
ATOM 3038  H HB2  . SER A 1 98  ? 16.997  49.213  50.029  1.00 0.00 ?  89  SER A HB2  2  
ATOM 3039  H HB3  . SER A 1 98  ? 17.563  48.192  51.256  1.00 0.00 ?  89  SER A HB3  2  
ATOM 3040  H HG   . SER A 1 98  ? 18.481  49.853  52.088  1.00 0.00 ?  89  SER A HG   2  
ATOM 3041  N N    . ASP A 1 99  ? 17.709  48.518  47.269  1.00 0.00 ?  90  ASP A N    2  
ATOM 3042  C CA   . ASP A 1 99  ? 17.557  49.051  45.868  1.00 0.00 ?  90  ASP A CA   2  
ATOM 3043  C C    . ASP A 1 99  ? 16.970  50.468  45.719  1.00 0.00 ?  90  ASP A C    2  
ATOM 3044  O O    . ASP A 1 99  ? 15.927  50.653  46.337  1.00 0.00 ?  90  ASP A O    2  
ATOM 3045  C CB   . ASP A 1 99  ? 16.908  47.980  44.908  1.00 0.00 ?  90  ASP A CB   2  
ATOM 3046  C CG   . ASP A 1 99  ? 16.320  48.573  43.655  1.00 0.00 ?  90  ASP A CG   2  
ATOM 3047  O OD1  . ASP A 1 99  ? 17.031  49.348  43.018  1.00 0.00 ?  90  ASP A OD1  2  
ATOM 3048  O OD2  . ASP A 1 99  ? 15.225  48.172  43.336  1.00 0.00 -1 90  ASP A OD2  2  
ATOM 3049  H H    . ASP A 1 99  ? 17.144  47.766  47.636  1.00 0.00 ?  90  ASP A H    2  
ATOM 3050  H HA   . ASP A 1 99  ? 18.564  49.090  45.454  1.00 0.00 ?  90  ASP A HA   2  
ATOM 3051  H HB2  . ASP A 1 99  ? 17.663  47.271  44.567  1.00 0.00 ?  90  ASP A HB2  2  
ATOM 3052  H HB3  . ASP A 1 99  ? 16.167  47.359  45.411  1.00 0.00 ?  90  ASP A HB3  2  
ATOM 3053  N N    . PRO A 1 100 ? 17.703  51.485  45.176  1.00 0.00 ?  91  PRO A N    2  
ATOM 3054  C CA   . PRO A 1 100 ? 17.196  52.818  45.098  1.00 0.00 ?  91  PRO A CA   2  
ATOM 3055  C C    . PRO A 1 100 ? 16.002  52.978  44.191  1.00 0.00 ?  91  PRO A C    2  
ATOM 3056  O O    . PRO A 1 100 ? 15.056  53.730  44.527  1.00 0.00 ?  91  PRO A O    2  
ATOM 3057  C CB   . PRO A 1 100 ? 18.267  53.786  44.580  1.00 0.00 ?  91  PRO A CB   2  
ATOM 3058  C CG   . PRO A 1 100 ? 19.528  52.884  44.674  1.00 0.00 ?  91  PRO A CG   2  
ATOM 3059  C CD   . PRO A 1 100 ? 18.941  51.471  44.458  1.00 0.00 ?  91  PRO A CD   2  
ATOM 3060  H HA   . PRO A 1 100 ? 16.895  53.121  46.101  1.00 0.00 ?  91  PRO A HA   2  
ATOM 3061  H HB2  . PRO A 1 100 ? 18.150  53.991  43.516  1.00 0.00 ?  91  PRO A HB2  2  
ATOM 3062  H HB3  . PRO A 1 100 ? 18.207  54.592  45.311  1.00 0.00 ?  91  PRO A HB3  2  
ATOM 3063  H HG2  . PRO A 1 100 ? 20.237  52.975  43.851  1.00 0.00 ?  91  PRO A HG2  2  
ATOM 3064  H HG3  . PRO A 1 100 ? 20.072  53.069  45.600  1.00 0.00 ?  91  PRO A HG3  2  
ATOM 3065  H HD2  . PRO A 1 100 ? 18.697  51.350  43.403  1.00 0.00 ?  91  PRO A HD2  2  
ATOM 3066  H HD3  . PRO A 1 100 ? 19.734  50.797  44.785  1.00 0.00 ?  91  PRO A HD3  2  
ATOM 3067  N N    . TYR A 1 101 ? 15.819  52.118  43.218  1.00 0.00 ?  92  TYR A N    2  
ATOM 3068  C CA   . TYR A 1 101 ? 14.691  52.100  42.266  1.00 0.00 ?  92  TYR A CA   2  
ATOM 3069  C C    . TYR A 1 101 ? 13.335  51.896  42.960  1.00 0.00 ?  92  TYR A C    2  
ATOM 3070  O O    . TYR A 1 101 ? 12.342  52.602  42.519  1.00 0.00 ?  92  TYR A O    2  
ATOM 3071  C CB   . TYR A 1 101 ? 14.923  51.102  41.112  1.00 0.00 ?  92  TYR A CB   2  
ATOM 3072  C CG   . TYR A 1 101 ? 13.668  50.837  40.304  1.00 0.00 ?  92  TYR A CG   2  
ATOM 3073  C CD1  . TYR A 1 101 ? 13.097  51.751  39.350  1.00 0.00 ?  92  TYR A CD1  2  
ATOM 3074  C CD2  . TYR A 1 101 ? 13.108  49.558  40.319  1.00 0.00 ?  92  TYR A CD2  2  
ATOM 3075  C CE1  . TYR A 1 101 ? 11.963  51.415  38.581  1.00 0.00 ?  92  TYR A CE1  2  
ATOM 3076  C CE2  . TYR A 1 101 ? 12.013  49.192  39.637  1.00 0.00 ?  92  TYR A CE2  2  
ATOM 3077  C CZ   . TYR A 1 101 ? 11.486  50.142  38.747  1.00 0.00 ?  92  TYR A CZ   2  
ATOM 3078  O OH   . TYR A 1 101 ? 10.367  49.771  38.016  1.00 0.00 ?  92  TYR A OH   2  
ATOM 3079  H H    . TYR A 1 101 ? 16.415  51.307  43.131  1.00 0.00 ?  92  TYR A H    2  
ATOM 3080  H HA   . TYR A 1 101 ? 14.502  53.076  41.820  1.00 0.00 ?  92  TYR A HA   2  
ATOM 3081  H HB2  . TYR A 1 101 ? 15.664  51.472  40.403  1.00 0.00 ?  92  TYR A HB2  2  
ATOM 3082  H HB3  . TYR A 1 101 ? 15.250  50.125  41.466  1.00 0.00 ?  92  TYR A HB3  2  
ATOM 3083  H HD1  . TYR A 1 101 ? 13.676  52.663  39.334  1.00 0.00 ?  92  TYR A HD1  2  
ATOM 3084  H HD2  . TYR A 1 101 ? 13.650  48.757  40.801  1.00 0.00 ?  92  TYR A HD2  2  
ATOM 3085  H HE1  . TYR A 1 101 ? 11.502  52.056  37.844  1.00 0.00 ?  92  TYR A HE1  2  
ATOM 3086  H HE2  . TYR A 1 101 ? 11.595  48.196  39.659  1.00 0.00 ?  92  TYR A HE2  2  
ATOM 3087  H HH   . TYR A 1 101 ? 9.948   48.948  38.275  1.00 0.00 ?  92  TYR A HH   2  
ATOM 3088  N N    . HIS A 1 102 ? 13.208  51.057  43.977  1.00 0.00 ?  93  HIS A N    2  
ATOM 3089  C CA   . HIS A 1 102 ? 11.940  50.890  44.723  1.00 0.00 ?  93  HIS A CA   2  
ATOM 3090  C C    . HIS A 1 102 ? 11.356  52.176  45.210  1.00 0.00 ?  93  HIS A C    2  
ATOM 3091  O O    . HIS A 1 102 ? 10.142  52.308  45.266  1.00 0.00 ?  93  HIS A O    2  
ATOM 3092  C CB   . HIS A 1 102 ? 12.116  49.858  45.914  1.00 0.00 ?  93  HIS A CB   2  
ATOM 3093  C CG   . HIS A 1 102 ? 11.404  50.304  47.228  1.00 0.00 ?  93  HIS A CG   2  
ATOM 3094  N ND1  . HIS A 1 102 ? 11.935  51.198  48.103  1.00 0.00 ?  93  HIS A ND1  2  
ATOM 3095  C CD2  . HIS A 1 102 ? 10.177  49.836  47.598  1.00 0.00 ?  93  HIS A CD2  2  
ATOM 3096  C CE1  . HIS A 1 102 ? 10.962  51.336  48.981  1.00 0.00 ?  93  HIS A CE1  2  
ATOM 3097  N NE2  . HIS A 1 102 ? 9.863   50.600  48.656  1.00 0.00 ?  93  HIS A NE2  2  
ATOM 3098  H H    . HIS A 1 102 ? 14.053  50.664  44.366  1.00 0.00 ?  93  HIS A H    2  
ATOM 3099  H HA   . HIS A 1 102 ? 11.211  50.488  44.019  1.00 0.00 ?  93  HIS A HA   2  
ATOM 3100  H HB2  . HIS A 1 102 ? 11.640  48.878  45.932  1.00 0.00 ?  93  HIS A HB2  2  
ATOM 3101  H HB3  . HIS A 1 102 ? 13.200  49.794  46.012  1.00 0.00 ?  93  HIS A HB3  2  
ATOM 3102  H HD2  . HIS A 1 102 ? 9.439   49.383  46.952  1.00 0.00 ?  93  HIS A HD2  2  
ATOM 3103  H HE1  . HIS A 1 102 ? 11.023  51.918  49.889  1.00 0.00 ?  93  HIS A HE1  2  
ATOM 3104  H HE2  . HIS A 1 102 ? 8.971   50.640  49.127  1.00 0.00 ?  93  HIS A HE2  2  
ATOM 3105  N N    . VAL A 1 103 ? 12.243  53.174  45.491  1.00 0.00 ?  94  VAL A N    2  
ATOM 3106  C CA   . VAL A 1 103 ? 11.730  54.423  46.045  1.00 0.00 ?  94  VAL A CA   2  
ATOM 3107  C C    . VAL A 1 103 ? 11.143  55.250  44.970  1.00 0.00 ?  94  VAL A C    2  
ATOM 3108  O O    . VAL A 1 103 ? 10.245  56.106  45.266  1.00 0.00 ?  94  VAL A O    2  
ATOM 3109  C CB   . VAL A 1 103 ? 12.803  55.170  46.891  1.00 0.00 ?  94  VAL A CB   2  
ATOM 3110  C CG1  . VAL A 1 103 ? 12.265  56.298  47.791  1.00 0.00 ?  94  VAL A CG1  2  
ATOM 3111  C CG2  . VAL A 1 103 ? 13.560  54.269  47.873  1.00 0.00 ?  94  VAL A CG2  2  
ATOM 3112  H H    . VAL A 1 103 ? 13.223  52.979  45.351  1.00 0.00 ?  94  VAL A H    2  
ATOM 3113  H HA   . VAL A 1 103 ? 10.934  54.072  46.703  1.00 0.00 ?  94  VAL A HA   2  
ATOM 3114  H HB   . VAL A 1 103 ? 13.599  55.643  46.315  1.00 0.00 ?  94  VAL A HB   2  
ATOM 3115  H HG11 . VAL A 1 103 ? 11.599  55.870  48.540  1.00 0.00 ?  94  VAL A HG11 2  
ATOM 3116  H HG12 . VAL A 1 103 ? 13.066  56.669  48.431  1.00 0.00 ?  94  VAL A HG12 2  
ATOM 3117  H HG13 . VAL A 1 103 ? 11.891  57.096  47.148  1.00 0.00 ?  94  VAL A HG13 2  
ATOM 3118  H HG21 . VAL A 1 103 ? 14.153  53.495  47.386  1.00 0.00 ?  94  VAL A HG21 2  
ATOM 3119  H HG22 . VAL A 1 103 ? 14.314  54.851  48.403  1.00 0.00 ?  94  VAL A HG22 2  
ATOM 3120  H HG23 . VAL A 1 103 ? 12.977  53.652  48.557  1.00 0.00 ?  94  VAL A HG23 2  
ATOM 3121  N N    . TYR A 1 104 ? 11.653  55.136  43.720  1.00 0.00 ?  95  TYR A N    2  
ATOM 3122  C CA   . TYR A 1 104 ? 11.169  55.953  42.624  1.00 0.00 ?  95  TYR A CA   2  
ATOM 3123  C C    . TYR A 1 104 ? 9.721   55.719  42.133  1.00 0.00 ?  95  TYR A C    2  
ATOM 3124  O O    . TYR A 1 104 ? 8.956   56.683  41.979  1.00 0.00 ?  95  TYR A O    2  
ATOM 3125  C CB   . TYR A 1 104 ? 12.271  56.025  41.541  1.00 0.00 ?  95  TYR A CB   2  
ATOM 3126  C CG   . TYR A 1 104 ? 11.828  56.366  40.089  1.00 0.00 ?  95  TYR A CG   2  
ATOM 3127  C CD1  . TYR A 1 104 ? 11.314  57.699  39.866  1.00 0.00 ?  95  TYR A CD1  2  
ATOM 3128  C CD2  . TYR A 1 104 ? 11.945  55.394  39.028  1.00 0.00 ?  95  TYR A CD2  2  
ATOM 3129  C CE1  . TYR A 1 104 ? 10.879  57.993  38.566  1.00 0.00 ?  95  TYR A CE1  2  
ATOM 3130  C CE2  . TYR A 1 104 ? 11.573  55.761  37.745  1.00 0.00 ?  95  TYR A CE2  2  
ATOM 3131  C CZ   . TYR A 1 104 ? 11.080  57.051  37.529  1.00 0.00 ?  95  TYR A CZ   2  
ATOM 3132  O OH   . TYR A 1 104 ? 10.816  57.515  36.321  1.00 0.00 ?  95  TYR A OH   2  
ATOM 3133  H H    . TYR A 1 104 ? 12.249  54.332  43.586  1.00 0.00 ?  95  TYR A H    2  
ATOM 3134  H HA   . TYR A 1 104 ? 11.055  56.997  42.917  1.00 0.00 ?  95  TYR A HA   2  
ATOM 3135  H HB2  . TYR A 1 104 ? 12.980  56.825  41.751  1.00 0.00 ?  95  TYR A HB2  2  
ATOM 3136  H HB3  . TYR A 1 104 ? 12.760  55.053  41.481  1.00 0.00 ?  95  TYR A HB3  2  
ATOM 3137  H HD1  . TYR A 1 104 ? 11.385  58.460  40.629  1.00 0.00 ?  95  TYR A HD1  2  
ATOM 3138  H HD2  . TYR A 1 104 ? 12.321  54.429  39.331  1.00 0.00 ?  95  TYR A HD2  2  
ATOM 3139  H HE1  . TYR A 1 104 ? 10.582  58.987  38.268  1.00 0.00 ?  95  TYR A HE1  2  
ATOM 3140  H HE2  . TYR A 1 104 ? 11.629  55.064  36.922  1.00 0.00 ?  95  TYR A HE2  2  
ATOM 3141  H HH   . TYR A 1 104 ? 11.175  57.010  35.587  1.00 0.00 ?  95  TYR A HH   2  
ATOM 3142  N N    . ILE A 1 105 ? 9.295   54.459  42.051  1.00 0.00 ?  96  ILE A N    2  
ATOM 3143  C CA   . ILE A 1 105 ? 7.914   54.100  41.621  1.00 0.00 ?  96  ILE A CA   2  
ATOM 3144  C C    . ILE A 1 105 ? 6.742   54.370  42.654  1.00 0.00 ?  96  ILE A C    2  
ATOM 3145  O O    . ILE A 1 105 ? 6.946   54.248  43.848  1.00 0.00 ?  96  ILE A O    2  
ATOM 3146  C CB   . ILE A 1 105 ? 7.817   52.620  41.223  1.00 0.00 ?  96  ILE A CB   2  
ATOM 3147  C CG1  . ILE A 1 105 ? 8.698   51.614  41.948  1.00 0.00 ?  96  ILE A CG1  2  
ATOM 3148  C CG2  . ILE A 1 105 ? 8.090   52.628  39.700  1.00 0.00 ?  96  ILE A CG2  2  
ATOM 3149  C CD1  . ILE A 1 105 ? 8.327   50.104  41.541  1.00 0.00 ?  96  ILE A CD1  2  
ATOM 3150  H H    . ILE A 1 105 ? 10.025  53.780  42.211  1.00 0.00 ?  96  ILE A H    2  
ATOM 3151  H HA   . ILE A 1 105 ? 7.589   54.681  40.758  1.00 0.00 ?  96  ILE A HA   2  
ATOM 3152  H HB   . ILE A 1 105 ? 6.771   52.337  41.342  1.00 0.00 ?  96  ILE A HB   2  
ATOM 3153  H HG12 . ILE A 1 105 ? 9.759   51.801  41.779  1.00 0.00 ?  96  ILE A HG12 2  
ATOM 3154  H HG13 . ILE A 1 105 ? 8.642   51.645  43.036  1.00 0.00 ?  96  ILE A HG13 2  
ATOM 3155  H HG21 . ILE A 1 105 ? 8.945   53.261  39.464  1.00 0.00 ?  96  ILE A HG21 2  
ATOM 3156  H HG22 . ILE A 1 105 ? 8.381   51.667  39.275  1.00 0.00 ?  96  ILE A HG22 2  
ATOM 3157  H HG23 . ILE A 1 105 ? 7.137   52.765  39.190  1.00 0.00 ?  96  ILE A HG23 2  
ATOM 3158  H HD11 . ILE A 1 105 ? 8.559   49.998  40.481  1.00 0.00 ?  96  ILE A HD11 2  
ATOM 3159  H HD12 . ILE A 1 105 ? 8.978   49.496  42.169  1.00 0.00 ?  96  ILE A HD12 2  
ATOM 3160  H HD13 . ILE A 1 105 ? 7.284   49.825  41.691  1.00 0.00 ?  96  ILE A HD13 2  
ATOM 3161  N N    . LYS A 1 106 ? 5.621   54.807  42.111  1.00 0.00 ?  97  LYS A N    2  
ATOM 3162  C CA   . LYS A 1 106 ? 4.674   55.583  42.878  1.00 0.00 ?  97  LYS A CA   2  
ATOM 3163  C C    . LYS A 1 106 ? 3.834   54.900  43.872  1.00 0.00 ?  97  LYS A C    2  
ATOM 3164  O O    . LYS A 1 106 ? 4.103   55.109  45.057  1.00 0.00 ?  97  LYS A O    2  
ATOM 3165  C CB   . LYS A 1 106 ? 3.912   56.388  41.952  1.00 0.00 ?  97  LYS A CB   2  
ATOM 3166  C CG   . LYS A 1 106 ? 3.007   57.475  42.579  1.00 0.00 ?  97  LYS A CG   2  
ATOM 3167  C CD   . LYS A 1 106 ? 2.401   58.474  41.585  1.00 0.00 ?  97  LYS A CD   2  
ATOM 3168  C CE   . LYS A 1 106 ? 1.571   57.708  40.537  1.00 0.00 ?  97  LYS A CE   2  
ATOM 3169  N NZ   . LYS A 1 106 ? 0.528   58.564  39.926  1.00 0.00 1  97  LYS A NZ   2  
ATOM 3170  H H    . LYS A 1 106 ? 5.633   54.883  41.103  1.00 0.00 ?  97  LYS A H    2  
ATOM 3171  H HA   . LYS A 1 106 ? 5.299   56.337  43.357  1.00 0.00 ?  97  LYS A HA   2  
ATOM 3172  H HB2  . LYS A 1 106 ? 4.488   56.916  41.192  1.00 0.00 ?  97  LYS A HB2  2  
ATOM 3173  H HB3  . LYS A 1 106 ? 3.261   55.726  41.380  1.00 0.00 ?  97  LYS A HB3  2  
ATOM 3174  H HG2  . LYS A 1 106 ? 2.103   57.025  42.990  1.00 0.00 ?  97  LYS A HG2  2  
ATOM 3175  H HG3  . LYS A 1 106 ? 3.561   58.044  43.326  1.00 0.00 ?  97  LYS A HG3  2  
ATOM 3176  H HD2  . LYS A 1 106 ? 1.833   59.217  42.145  1.00 0.00 ?  97  LYS A HD2  2  
ATOM 3177  H HD3  . LYS A 1 106 ? 3.237   58.899  41.030  1.00 0.00 ?  97  LYS A HD3  2  
ATOM 3178  H HE2  . LYS A 1 106 ? 2.276   57.301  39.813  1.00 0.00 ?  97  LYS A HE2  2  
ATOM 3179  H HE3  . LYS A 1 106 ? 1.106   56.900  41.102  1.00 0.00 ?  97  LYS A HE3  2  
ATOM 3180  H HZ1  . LYS A 1 106 ? 0.762   59.327  39.307  1.00 0.00 ?  97  LYS A HZ1  2  
ATOM 3181  H HZ2  . LYS A 1 106 ? -0.174  57.996  39.475  1.00 0.00 ?  97  LYS A HZ2  2  
ATOM 3182  H HZ3  . LYS A 1 106 ? 0.072   59.011  40.709  1.00 0.00 ?  97  LYS A HZ3  2  
ATOM 3183  N N    . ASN A 1 107 ? 3.069   53.908  43.481  1.00 0.00 ?  98  ASN A N    2  
ATOM 3184  C CA   . ASN A 1 107 ? 2.388   52.939  44.389  1.00 0.00 ?  98  ASN A CA   2  
ATOM 3185  C C    . ASN A 1 107 ? 3.346   51.779  44.844  1.00 0.00 ?  98  ASN A C    2  
ATOM 3186  O O    . ASN A 1 107 ? 3.072   50.606  44.761  1.00 0.00 ?  98  ASN A O    2  
ATOM 3187  C CB   . ASN A 1 107 ? 1.100   52.425  43.742  1.00 0.00 ?  98  ASN A CB   2  
ATOM 3188  C CG   . ASN A 1 107 ? 0.051   53.527  43.537  1.00 0.00 ?  98  ASN A CG   2  
ATOM 3189  O OD1  . ASN A 1 107 ? 0.367   54.679  43.186  1.00 0.00 ?  98  ASN A OD1  2  
ATOM 3190  N ND2  . ASN A 1 107 ? -1.219  53.183  43.565  1.00 0.00 ?  98  ASN A ND2  2  
ATOM 3191  H H    . ASN A 1 107 ? 2.984   53.690  42.499  1.00 0.00 ?  98  ASN A H    2  
ATOM 3192  H HA   . ASN A 1 107 ? 2.109   53.549  45.248  1.00 0.00 ?  98  ASN A HA   2  
ATOM 3193  H HB2  . ASN A 1 107 ? 1.266   51.984  42.759  1.00 0.00 ?  98  ASN A HB2  2  
ATOM 3194  H HB3  . ASN A 1 107 ? 0.673   51.680  44.414  1.00 0.00 ?  98  ASN A HB3  2  
ATOM 3195  H HD21 . ASN A 1 107 ? -1.479  52.213  43.679  1.00 0.00 ?  98  ASN A HD21 2  
ATOM 3196  H HD22 . ASN A 1 107 ? -1.922  53.846  43.271  1.00 0.00 ?  98  ASN A HD22 2  
ATOM 3197  N N    . ARG A 1 108 ? 4.560   52.097  45.327  1.00 0.00 ?  99  ARG A N    2  
ATOM 3198  C CA   . ARG A 1 108 ? 5.546   51.153  45.839  1.00 0.00 ?  99  ARG A CA   2  
ATOM 3199  C C    . ARG A 1 108 ? 5.150   50.501  47.158  1.00 0.00 ?  99  ARG A C    2  
ATOM 3200  O O    . ARG A 1 108 ? 4.158   50.771  47.839  1.00 0.00 ?  99  ARG A O    2  
ATOM 3201  C CB   . ARG A 1 108 ? 6.945   51.803  46.081  1.00 0.00 ?  99  ARG A CB   2  
ATOM 3202  C CG   . ARG A 1 108 ? 6.919   52.952  47.112  1.00 0.00 ?  99  ARG A CG   2  
ATOM 3203  C CD   . ARG A 1 108 ? 8.176   53.757  47.117  1.00 0.00 ?  99  ARG A CD   2  
ATOM 3204  N NE   . ARG A 1 108 ? 8.003   55.059  47.821  1.00 0.00 ?  99  ARG A NE   2  
ATOM 3205  C CZ   . ARG A 1 108 ? 7.702   56.189  47.269  1.00 0.00 ?  99  ARG A CZ   2  
ATOM 3206  N NH1  . ARG A 1 108 ? 7.384   56.385  46.039  1.00 0.00 ?  99  ARG A NH1  2  
ATOM 3207  N NH2  . ARG A 1 108 ? 7.768   57.313  47.930  1.00 0.00 1  99  ARG A NH2  2  
ATOM 3208  H H    . ARG A 1 108 ? 4.888   53.048  45.414  1.00 0.00 ?  99  ARG A H    2  
ATOM 3209  H HA   . ARG A 1 108 ? 5.743   50.441  45.038  1.00 0.00 ?  99  ARG A HA   2  
ATOM 3210  H HB2  . ARG A 1 108 ? 7.763   51.129  46.335  1.00 0.00 ?  99  ARG A HB2  2  
ATOM 3211  H HB3  . ARG A 1 108 ? 7.197   52.162  45.083  1.00 0.00 ?  99  ARG A HB3  2  
ATOM 3212  H HG2  . ARG A 1 108 ? 6.049   53.568  46.882  1.00 0.00 ?  99  ARG A HG2  2  
ATOM 3213  H HG3  . ARG A 1 108 ? 6.627   52.574  48.092  1.00 0.00 ?  99  ARG A HG3  2  
ATOM 3214  H HD2  . ARG A 1 108 ? 8.901   53.075  47.560  1.00 0.00 ?  99  ARG A HD2  2  
ATOM 3215  H HD3  . ARG A 1 108 ? 8.448   53.945  46.079  1.00 0.00 ?  99  ARG A HD3  2  
ATOM 3216  H HE   . ARG A 1 108 ? 8.248   55.075  48.801  1.00 0.00 ?  99  ARG A HE   2  
ATOM 3217  H HH11 . ARG A 1 108 ? 7.477   55.645  45.358  1.00 0.00 ?  99  ARG A HH11 2  
ATOM 3218  H HH12 . ARG A 1 108 ? 6.820   57.186  45.795  1.00 0.00 ?  99  ARG A HH12 2  
ATOM 3219  H HH21 . ARG A 1 108 ? 7.687   57.181  48.928  1.00 0.00 ?  99  ARG A HH21 2  
ATOM 3220  H HH22 . ARG A 1 108 ? 7.548   58.156  47.418  1.00 0.00 ?  99  ARG A HH22 2  
ATOM 3221  N N    . VAL A 1 109 ? 5.868   49.453  47.498  1.00 0.00 ?  100 VAL A N    2  
ATOM 3222  C CA   . VAL A 1 109 ? 5.618   48.731  48.752  1.00 0.00 ?  100 VAL A CA   2  
ATOM 3223  C C    . VAL A 1 109 ? 6.224   49.480  49.928  1.00 0.00 ?  100 VAL A C    2  
ATOM 3224  O O    . VAL A 1 109 ? 7.277   50.108  49.941  1.00 0.00 ?  100 VAL A O    2  
ATOM 3225  C CB   . VAL A 1 109 ? 6.151   47.312  48.607  1.00 0.00 ?  100 VAL A CB   2  
ATOM 3226  C CG1  . VAL A 1 109 ? 5.808   46.617  47.257  1.00 0.00 ?  100 VAL A CG1  2  
ATOM 3227  C CG2  . VAL A 1 109 ? 7.679   47.252  48.659  1.00 0.00 ?  100 VAL A CG2  2  
ATOM 3228  H H    . VAL A 1 109 ? 6.653   49.147  46.940  1.00 0.00 ?  100 VAL A H    2  
ATOM 3229  H HA   . VAL A 1 109 ? 4.529   48.755  48.711  1.00 0.00 ?  100 VAL A HA   2  
ATOM 3230  H HB   . VAL A 1 109 ? 5.803   46.747  49.472  1.00 0.00 ?  100 VAL A HB   2  
ATOM 3231  H HG11 . VAL A 1 109 ? 6.316   47.157  46.458  1.00 0.00 ?  100 VAL A HG11 2  
ATOM 3232  H HG12 . VAL A 1 109 ? 6.138   45.602  47.477  1.00 0.00 ?  100 VAL A HG12 2  
ATOM 3233  H HG13 . VAL A 1 109 ? 4.730   46.663  47.103  1.00 0.00 ?  100 VAL A HG13 2  
ATOM 3234  H HG21 . VAL A 1 109 ? 8.046   47.631  49.613  1.00 0.00 ?  100 VAL A HG21 2  
ATOM 3235  H HG22 . VAL A 1 109 ? 7.973   46.204  48.691  1.00 0.00 ?  100 VAL A HG22 2  
ATOM 3236  H HG23 . VAL A 1 109 ? 8.082   47.741  47.772  1.00 0.00 ?  100 VAL A HG23 2  
ATOM 3237  N N    . SER A 1 110 ? 5.446   49.566  50.987  1.00 0.00 ?  101 SER A N    2  
ATOM 3238  C CA   . SER A 1 110 ? 5.731   50.115  52.319  1.00 0.00 ?  101 SER A CA   2  
ATOM 3239  C C    . SER A 1 110 ? 6.742   49.231  53.050  1.00 0.00 ?  101 SER A C    2  
ATOM 3240  O O    . SER A 1 110 ? 7.161   48.174  52.539  1.00 0.00 ?  101 SER A O    2  
ATOM 3241  C CB   . SER A 1 110 ? 4.407   50.195  53.151  1.00 0.00 ?  101 SER A CB   2  
ATOM 3242  O OG   . SER A 1 110 ? 3.541   51.228  52.717  1.00 0.00 ?  101 SER A OG   2  
ATOM 3243  H H    . SER A 1 110 ? 4.677   48.911  51.013  1.00 0.00 ?  101 SER A H    2  
ATOM 3244  H HA   . SER A 1 110 ? 6.107   51.133  52.220  1.00 0.00 ?  101 SER A HA   2  
ATOM 3245  H HB2  . SER A 1 110 ? 3.936   49.212  53.112  1.00 0.00 ?  101 SER A HB2  2  
ATOM 3246  H HB3  . SER A 1 110 ? 4.794   50.485  54.127  1.00 0.00 ?  101 SER A HB3  2  
ATOM 3247  H HG   . SER A 1 110 ? 2.653   50.978  52.983  1.00 0.00 ?  101 SER A HG   2  
ATOM 3248  N N    . MET A 1 111 ? 7.164   49.739  54.207  1.00 0.00 ?  102 MET A N    2  
ATOM 3249  C CA   . MET A 1 111 ? 8.057   49.028  55.161  1.00 0.00 ?  102 MET A CA   2  
ATOM 3250  C C    . MET A 1 111 ? 7.476   47.794  55.763  1.00 0.00 ?  102 MET A C    2  
ATOM 3251  O O    . MET A 1 111 ? 6.285   47.803  56.010  1.00 0.00 ?  102 MET A O    2  
ATOM 3252  C CB   . MET A 1 111 ? 8.618   50.066  56.192  1.00 0.00 ?  102 MET A CB   2  
ATOM 3253  C CG   . MET A 1 111 ? 7.586   50.690  57.172  1.00 0.00 ?  102 MET A CG   2  
ATOM 3254  S SD   . MET A 1 111 ? 8.314   51.821  58.418  1.00 0.00 ?  102 MET A SD   2  
ATOM 3255  C CE   . MET A 1 111 ? 9.834   50.921  58.927  1.00 0.00 ?  102 MET A CE   2  
ATOM 3256  H H    . MET A 1 111 ? 6.876   50.652  54.531  1.00 0.00 ?  102 MET A H    2  
ATOM 3257  H HA   . MET A 1 111 ? 8.965   48.849  54.586  1.00 0.00 ?  102 MET A HA   2  
ATOM 3258  H HB2  . MET A 1 111 ? 9.383   49.512  56.736  1.00 0.00 ?  102 MET A HB2  2  
ATOM 3259  H HB3  . MET A 1 111 ? 9.063   50.855  55.586  1.00 0.00 ?  102 MET A HB3  2  
ATOM 3260  H HG2  . MET A 1 111 ? 6.831   51.215  56.588  1.00 0.00 ?  102 MET A HG2  2  
ATOM 3261  H HG3  . MET A 1 111 ? 7.174   49.887  57.783  1.00 0.00 ?  102 MET A HG3  2  
ATOM 3262  H HE1  . MET A 1 111 ? 10.616  50.962  58.168  1.00 0.00 ?  102 MET A HE1  2  
ATOM 3263  H HE2  . MET A 1 111 ? 10.253  51.206  59.892  1.00 0.00 ?  102 MET A HE2  2  
ATOM 3264  H HE3  . MET A 1 111 ? 9.628   49.864  59.093  1.00 0.00 ?  102 MET A HE3  2  
ATOM 3265  N N    . ILE A 1 112 ? 8.283   46.761  56.006  1.00 0.00 ?  103 ILE A N    2  
ATOM 3266  C CA   . ILE A 1 112 ? 7.957   45.557  56.710  1.00 0.00 ?  103 ILE A CA   2  
ATOM 3267  C C    . ILE A 1 112 ? 6.781   44.878  55.873  1.00 0.00 ?  103 ILE A C    2  
ATOM 3268  O O    . ILE A 1 112 ? 7.190   44.433  54.804  1.00 0.00 ?  103 ILE A O    2  
ATOM 3269  C CB   . ILE A 1 112 ? 7.673   45.743  58.214  1.00 0.00 ?  103 ILE A CB   2  
ATOM 3270  C CG1  . ILE A 1 112 ? 8.745   46.517  59.002  1.00 0.00 ?  103 ILE A CG1  2  
ATOM 3271  C CG2  . ILE A 1 112 ? 7.457   44.429  58.883  1.00 0.00 ?  103 ILE A CG2  2  
ATOM 3272  C CD1  . ILE A 1 112 ? 8.133   47.578  59.898  1.00 0.00 ?  103 ILE A CD1  2  
ATOM 3273  O OXT  . ILE A 1 112 ? 5.643   44.738  56.395  1.00 0.00 -1 103 ILE A OXT  2  
ATOM 3274  H H    . ILE A 1 112 ? 9.232   46.807  55.665  1.00 0.00 ?  103 ILE A H    2  
ATOM 3275  H HA   . ILE A 1 112 ? 8.856   44.952  56.591  1.00 0.00 ?  103 ILE A HA   2  
ATOM 3276  H HB   . ILE A 1 112 ? 6.747   46.306  58.327  1.00 0.00 ?  103 ILE A HB   2  
ATOM 3277  H HG12 . ILE A 1 112 ? 9.206   45.804  59.686  1.00 0.00 ?  103 ILE A HG12 2  
ATOM 3278  H HG13 . ILE A 1 112 ? 9.513   46.969  58.374  1.00 0.00 ?  103 ILE A HG13 2  
ATOM 3279  H HG21 . ILE A 1 112 ? 7.247   44.618  59.936  1.00 0.00 ?  103 ILE A HG21 2  
ATOM 3280  H HG22 . ILE A 1 112 ? 6.512   44.151  58.416  1.00 0.00 ?  103 ILE A HG22 2  
ATOM 3281  H HG23 . ILE A 1 112 ? 8.289   43.750  58.697  1.00 0.00 ?  103 ILE A HG23 2  
ATOM 3282  H HD11 . ILE A 1 112 ? 7.353   47.060  60.456  1.00 0.00 ?  103 ILE A HD11 2  
ATOM 3283  H HD12 . ILE A 1 112 ? 8.813   47.999  60.638  1.00 0.00 ?  103 ILE A HD12 2  
ATOM 3284  H HD13 . ILE A 1 112 ? 7.746   48.399  59.295  1.00 0.00 ?  103 ILE A HD13 2  
ATOM 3285  N N    . MET A 1 10  ? 24.134  67.429  108.130 1.00 0.00 ?  1   MET A N    3  
ATOM 3286  C CA   . MET A 1 10  ? 23.284  67.816  109.300 1.00 0.00 ?  1   MET A CA   3  
ATOM 3287  C C    . MET A 1 10  ? 23.188  66.636  110.267 1.00 0.00 ?  1   MET A C    3  
ATOM 3288  O O    . MET A 1 10  ? 23.088  65.533  109.715 1.00 0.00 ?  1   MET A O    3  
ATOM 3289  C CB   . MET A 1 10  ? 21.986  68.390  108.937 1.00 0.00 ?  1   MET A CB   3  
ATOM 3290  C CG   . MET A 1 10  ? 21.875  69.732  108.034 1.00 0.00 ?  1   MET A CG   3  
ATOM 3291  S SD   . MET A 1 10  ? 22.740  71.080  108.821 1.00 0.00 ?  1   MET A SD   3  
ATOM 3292  C CE   . MET A 1 10  ? 21.614  71.337  110.245 1.00 0.00 ?  1   MET A CE   3  
ATOM 3293  H H    . MET A 1 10  ? 24.098  68.226  107.511 1.00 0.00 ?  1   MET A H    3  
ATOM 3294  H HA   . MET A 1 10  ? 23.874  68.578  109.811 1.00 0.00 ?  1   MET A HA   3  
ATOM 3295  H HB2  . MET A 1 10  ? 21.565  67.611  108.302 1.00 0.00 ?  1   MET A HB2  3  
ATOM 3296  H HB3  . MET A 1 10  ? 21.416  68.538  109.854 1.00 0.00 ?  1   MET A HB3  3  
ATOM 3297  H HG2  . MET A 1 10  ? 22.456  69.587  107.123 1.00 0.00 ?  1   MET A HG2  3  
ATOM 3298  H HG3  . MET A 1 10  ? 20.817  69.985  107.975 1.00 0.00 ?  1   MET A HG3  3  
ATOM 3299  H HE1  . MET A 1 10  ? 20.828  72.044  109.979 1.00 0.00 ?  1   MET A HE1  3  
ATOM 3300  H HE2  . MET A 1 10  ? 21.193  70.354  110.456 1.00 0.00 ?  1   MET A HE2  3  
ATOM 3301  H HE3  . MET A 1 10  ? 22.109  71.750  111.124 1.00 0.00 ?  1   MET A HE3  3  
ATOM 3302  N N    . GLU A 1 11  ? 23.067  66.882  111.595 1.00 0.00 ?  2   GLU A N    3  
ATOM 3303  C CA   . GLU A 1 11  ? 22.714  65.816  112.534 1.00 0.00 ?  2   GLU A CA   3  
ATOM 3304  C C    . GLU A 1 11  ? 21.241  65.707  112.733 1.00 0.00 ?  2   GLU A C    3  
ATOM 3305  O O    . GLU A 1 11  ? 20.551  66.763  112.685 1.00 0.00 ?  2   GLU A O    3  
ATOM 3306  C CB   . GLU A 1 11  ? 23.390  66.093  113.877 1.00 0.00 ?  2   GLU A CB   3  
ATOM 3307  C CG   . GLU A 1 11  ? 24.879  66.228  113.844 1.00 0.00 ?  2   GLU A CG   3  
ATOM 3308  C CD   . GLU A 1 11  ? 25.675  64.978  113.707 1.00 0.00 ?  2   GLU A CD   3  
ATOM 3309  O OE1  . GLU A 1 11  ? 25.086  63.985  113.169 1.00 0.00 ?  2   GLU A OE1  3  
ATOM 3310  O OE2  . GLU A 1 11  ? 26.856  64.853  114.133 1.00 0.00 -1 2   GLU A OE2  3  
ATOM 3311  H H    . GLU A 1 11  ? 23.176  67.779  112.046 1.00 0.00 ?  2   GLU A H    3  
ATOM 3312  H HA   . GLU A 1 11  ? 23.062  64.840  112.197 1.00 0.00 ?  2   GLU A HA   3  
ATOM 3313  H HB2  . GLU A 1 11  ? 23.014  67.047  114.246 1.00 0.00 ?  2   GLU A HB2  3  
ATOM 3314  H HB3  . GLU A 1 11  ? 23.094  65.274  114.534 1.00 0.00 ?  2   GLU A HB3  3  
ATOM 3315  H HG2  . GLU A 1 11  ? 25.184  67.002  113.141 1.00 0.00 ?  2   GLU A HG2  3  
ATOM 3316  H HG3  . GLU A 1 11  ? 25.064  66.543  114.871 1.00 0.00 ?  2   GLU A HG3  3  
ATOM 3317  N N    . THR A 1 12  ? 20.751  64.490  113.104 1.00 0.00 ?  3   THR A N    3  
ATOM 3318  C CA   . THR A 1 12  ? 19.379  64.220  113.265 1.00 0.00 ?  3   THR A CA   3  
ATOM 3319  C C    . THR A 1 12  ? 18.923  63.704  114.660 1.00 0.00 ?  3   THR A C    3  
ATOM 3320  O O    . THR A 1 12  ? 17.760  63.650  115.078 1.00 0.00 ?  3   THR A O    3  
ATOM 3321  C CB   . THR A 1 12  ? 18.822  63.412  112.063 1.00 0.00 ?  3   THR A CB   3  
ATOM 3322  O OG1  . THR A 1 12  ? 18.913  62.080  112.416 1.00 0.00 ?  3   THR A OG1  3  
ATOM 3323  C CG2  . THR A 1 12  ? 19.515  63.586  110.719 1.00 0.00 ?  3   THR A CG2  3  
ATOM 3324  H H    . THR A 1 12  ? 21.455  63.766  113.135 1.00 0.00 ?  3   THR A H    3  
ATOM 3325  H HA   . THR A 1 12  ? 18.836  65.164  113.315 1.00 0.00 ?  3   THR A HA   3  
ATOM 3326  H HB   . THR A 1 12  ? 17.750  63.590  111.977 1.00 0.00 ?  3   THR A HB   3  
ATOM 3327  H HG1  . THR A 1 12  ? 18.814  61.541  111.628 1.00 0.00 ?  3   THR A HG1  3  
ATOM 3328  H HG21 . THR A 1 12  ? 18.919  63.065  109.969 1.00 0.00 ?  3   THR A HG21 3  
ATOM 3329  H HG22 . THR A 1 12  ? 19.493  64.663  110.551 1.00 0.00 ?  3   THR A HG22 3  
ATOM 3330  H HG23 . THR A 1 12  ? 20.512  63.147  110.707 1.00 0.00 ?  3   THR A HG23 3  
ATOM 3331  N N    . THR A 1 13  ? 19.893  63.375  115.567 1.00 0.00 ?  4   THR A N    3  
ATOM 3332  C CA   . THR A 1 13  ? 19.643  63.071  117.033 1.00 0.00 ?  4   THR A CA   3  
ATOM 3333  C C    . THR A 1 13  ? 18.671  63.959  117.742 1.00 0.00 ?  4   THR A C    3  
ATOM 3334  O O    . THR A 1 13  ? 18.668  65.182  117.610 1.00 0.00 ?  4   THR A O    3  
ATOM 3335  C CB   . THR A 1 13  ? 20.927  62.826  117.877 1.00 0.00 ?  4   THR A CB   3  
ATOM 3336  O OG1  . THR A 1 13  ? 22.001  62.324  117.067 1.00 0.00 ?  4   THR A OG1  3  
ATOM 3337  C CG2  . THR A 1 13  ? 20.670  61.951  119.094 1.00 0.00 ?  4   THR A CG2  3  
ATOM 3338  H H    . THR A 1 13  ? 20.825  63.638  115.279 1.00 0.00 ?  4   THR A H    3  
ATOM 3339  H HA   . THR A 1 13  ? 19.188  62.083  116.976 1.00 0.00 ?  4   THR A HA   3  
ATOM 3340  H HB   . THR A 1 13  ? 21.288  63.789  118.239 1.00 0.00 ?  4   THR A HB   3  
ATOM 3341  H HG1  . THR A 1 13  ? 22.782  62.879  117.120 1.00 0.00 ?  4   THR A HG1  3  
ATOM 3342  H HG21 . THR A 1 13  ? 20.271  60.990  118.769 1.00 0.00 ?  4   THR A HG21 3  
ATOM 3343  H HG22 . THR A 1 13  ? 21.525  61.857  119.764 1.00 0.00 ?  4   THR A HG22 3  
ATOM 3344  H HG23 . THR A 1 13  ? 19.910  62.385  119.742 1.00 0.00 ?  4   THR A HG23 3  
ATOM 3345  N N    . ASN A 1 14  ? 17.754  63.422  118.512 1.00 0.00 ?  5   ASN A N    3  
ATOM 3346  C CA   . ASN A 1 14  ? 16.823  64.092  119.391 1.00 0.00 ?  5   ASN A CA   3  
ATOM 3347  C C    . ASN A 1 14  ? 17.637  64.749  120.594 1.00 0.00 ?  5   ASN A C    3  
ATOM 3348  O O    . ASN A 1 14  ? 18.630  64.151  121.096 1.00 0.00 ?  5   ASN A O    3  
ATOM 3349  C CB   . ASN A 1 14  ? 15.841  63.030  119.931 1.00 0.00 ?  5   ASN A CB   3  
ATOM 3350  C CG   . ASN A 1 14  ? 14.830  63.648  120.898 1.00 0.00 ?  5   ASN A CG   3  
ATOM 3351  O OD1  . ASN A 1 14  ? 14.521  64.771  120.854 1.00 0.00 ?  5   ASN A OD1  3  
ATOM 3352  N ND2  . ASN A 1 14  ? 14.395  62.835  121.827 1.00 0.00 ?  5   ASN A ND2  3  
ATOM 3353  H H    . ASN A 1 14  ? 17.523  62.478  118.237 1.00 0.00 ?  5   ASN A H    3  
ATOM 3354  H HA   . ASN A 1 14  ? 16.300  64.916  118.907 1.00 0.00 ?  5   ASN A HA   3  
ATOM 3355  H HB2  . ASN A 1 14  ? 15.404  62.500  119.085 1.00 0.00 ?  5   ASN A HB2  3  
ATOM 3356  H HB3  . ASN A 1 14  ? 16.502  62.347  120.465 1.00 0.00 ?  5   ASN A HB3  3  
ATOM 3357  H HD21 . ASN A 1 14  ? 14.655  61.859  121.794 1.00 0.00 ?  5   ASN A HD21 3  
ATOM 3358  H HD22 . ASN A 1 14  ? 13.624  63.062  122.439 1.00 0.00 ?  5   ASN A HD22 3  
ATOM 3359  N N    . GLY A 1 15  ? 17.255  65.926  121.081 1.00 0.00 ?  6   GLY A N    3  
ATOM 3360  C CA   . GLY A 1 15  ? 17.835  66.547  122.361 1.00 0.00 ?  6   GLY A CA   3  
ATOM 3361  C C    . GLY A 1 15  ? 16.905  67.672  122.837 1.00 0.00 ?  6   GLY A C    3  
ATOM 3362  O O    . GLY A 1 15  ? 15.795  67.843  122.425 1.00 0.00 ?  6   GLY A O    3  
ATOM 3363  H H    . GLY A 1 15  ? 16.682  66.543  120.522 1.00 0.00 ?  6   GLY A H    3  
ATOM 3364  H HA2  . GLY A 1 15  ? 17.887  65.804  123.158 1.00 0.00 ?  6   GLY A HA2  3  
ATOM 3365  H HA3  . GLY A 1 15  ? 18.815  66.963  122.132 1.00 0.00 ?  6   GLY A HA3  3  
ATOM 3366  N N    . THR A 1 16  ? 17.499  68.432  123.781 1.00 0.00 ?  7   THR A N    3  
ATOM 3367  C CA   . THR A 1 16  ? 16.877  69.678  124.328 1.00 0.00 ?  7   THR A CA   3  
ATOM 3368  C C    . THR A 1 16  ? 16.448  70.728  123.295 1.00 0.00 ?  7   THR A C    3  
ATOM 3369  O O    . THR A 1 16  ? 16.952  70.749  122.187 1.00 0.00 ?  7   THR A O    3  
ATOM 3370  C CB   . THR A 1 16  ? 17.666  70.387  125.463 1.00 0.00 ?  7   THR A CB   3  
ATOM 3371  O OG1  . THR A 1 16  ? 18.756  71.124  124.949 1.00 0.00 ?  7   THR A OG1  3  
ATOM 3372  C CG2  . THR A 1 16  ? 18.317  69.373  126.419 1.00 0.00 ?  7   THR A CG2  3  
ATOM 3373  H H    . THR A 1 16  ? 18.408  68.184  124.147 1.00 0.00 ?  7   THR A H    3  
ATOM 3374  H HA   . THR A 1 16  ? 15.984  69.426  124.901 1.00 0.00 ?  7   THR A HA   3  
ATOM 3375  H HB   . THR A 1 16  ? 16.999  70.958  126.109 1.00 0.00 ?  7   THR A HB   3  
ATOM 3376  H HG1  . THR A 1 16  ? 19.145  71.774  125.538 1.00 0.00 ?  7   THR A HG1  3  
ATOM 3377  H HG21 . THR A 1 16  ? 18.558  69.950  127.311 1.00 0.00 ?  7   THR A HG21 3  
ATOM 3378  H HG22 . THR A 1 16  ? 17.607  68.614  126.748 1.00 0.00 ?  7   THR A HG22 3  
ATOM 3379  H HG23 . THR A 1 16  ? 19.188  68.891  125.974 1.00 0.00 ?  7   THR A HG23 3  
ATOM 3380  N N    . GLU A 1 17  ? 15.531  71.589  123.799 1.00 0.00 ?  8   GLU A N    3  
ATOM 3381  C CA   . GLU A 1 17  ? 15.269  72.868  123.201 1.00 0.00 ?  8   GLU A CA   3  
ATOM 3382  C C    . GLU A 1 17  ? 16.571  73.649  122.828 1.00 0.00 ?  8   GLU A C    3  
ATOM 3383  O O    . GLU A 1 17  ? 16.643  74.192  121.740 1.00 0.00 ?  8   GLU A O    3  
ATOM 3384  C CB   . GLU A 1 17  ? 14.386  73.705  124.123 1.00 0.00 ?  8   GLU A CB   3  
ATOM 3385  C CG   . GLU A 1 17  ? 14.223  75.119  123.690 1.00 0.00 ?  8   GLU A CG   3  
ATOM 3386  C CD   . GLU A 1 17  ? 13.094  75.772  124.525 1.00 0.00 ?  8   GLU A CD   3  
ATOM 3387  O OE1  . GLU A 1 17  ? 12.327  75.060  125.167 1.00 0.00 -1 8   GLU A OE1  3  
ATOM 3388  O OE2  . GLU A 1 17  ? 13.006  77.026  124.547 1.00 0.00 ?  8   GLU A OE2  3  
ATOM 3389  H H    . GLU A 1 17  ? 15.009  71.377  124.637 1.00 0.00 ?  8   GLU A H    3  
ATOM 3390  H HA   . GLU A 1 17  ? 14.754  72.672  122.260 1.00 0.00 ?  8   GLU A HA   3  
ATOM 3391  H HB2  . GLU A 1 17  ? 13.412  73.226  124.221 1.00 0.00 ?  8   GLU A HB2  3  
ATOM 3392  H HB3  . GLU A 1 17  ? 14.823  73.761  125.119 1.00 0.00 ?  8   GLU A HB3  3  
ATOM 3393  H HG2  . GLU A 1 17  ? 15.161  75.674  123.736 1.00 0.00 ?  8   GLU A HG2  3  
ATOM 3394  H HG3  . GLU A 1 17  ? 13.999  75.030  122.627 1.00 0.00 ?  8   GLU A HG3  3  
ATOM 3395  N N    . THR A 1 18  ? 17.556  73.801  123.741 1.00 0.00 ?  9   THR A N    3  
ATOM 3396  C CA   . THR A 1 18  ? 18.888  74.394  123.331 1.00 0.00 ?  9   THR A CA   3  
ATOM 3397  C C    . THR A 1 18  ? 19.795  73.536  122.473 1.00 0.00 ?  9   THR A C    3  
ATOM 3398  O O    . THR A 1 18  ? 20.582  74.094  121.686 1.00 0.00 ?  9   THR A O    3  
ATOM 3399  C CB   . THR A 1 18  ? 19.647  74.951  124.463 1.00 0.00 ?  9   THR A CB   3  
ATOM 3400  O OG1  . THR A 1 18  ? 18.846  75.438  125.511 1.00 0.00 ?  9   THR A OG1  3  
ATOM 3401  C CG2  . THR A 1 18  ? 20.683  76.065  124.138 1.00 0.00 ?  9   THR A CG2  3  
ATOM 3402  H H    . THR A 1 18  ? 17.487  73.420  124.674 1.00 0.00 ?  9   THR A H    3  
ATOM 3403  H HA   . THR A 1 18  ? 18.649  75.267  122.724 1.00 0.00 ?  9   THR A HA   3  
ATOM 3404  H HB   . THR A 1 18  ? 20.131  74.037  124.807 1.00 0.00 ?  9   THR A HB   3  
ATOM 3405  H HG1  . THR A 1 18  ? 18.242  74.808  125.909 1.00 0.00 ?  9   THR A HG1  3  
ATOM 3406  H HG21 . THR A 1 18  ? 21.308  75.732  123.309 1.00 0.00 ?  9   THR A HG21 3  
ATOM 3407  H HG22 . THR A 1 18  ? 20.095  76.941  123.864 1.00 0.00 ?  9   THR A HG22 3  
ATOM 3408  H HG23 . THR A 1 18  ? 21.308  76.199  125.021 1.00 0.00 ?  9   THR A HG23 3  
ATOM 3409  N N    . TRP A 1 19  ? 19.671  72.203  122.516 1.00 0.00 ?  10  TRP A N    3  
ATOM 3410  C CA   . TRP A 1 19  ? 20.172  71.419  121.387 1.00 0.00 ?  10  TRP A CA   3  
ATOM 3411  C C    . TRP A 1 19  ? 19.645  71.872  120.046 1.00 0.00 ?  10  TRP A C    3  
ATOM 3412  O O    . TRP A 1 19  ? 20.443  72.087  119.117 1.00 0.00 ?  10  TRP A O    3  
ATOM 3413  C CB   . TRP A 1 19  ? 20.185  69.910  121.592 1.00 0.00 ?  10  TRP A CB   3  
ATOM 3414  C CG   . TRP A 1 19  ? 20.320  69.080  120.372 1.00 0.00 ?  10  TRP A CG   3  
ATOM 3415  C CD1  . TRP A 1 19  ? 19.252  68.516  119.760 1.00 0.00 ?  10  TRP A CD1  3  
ATOM 3416  C CD2  . TRP A 1 19  ? 21.469  68.860  119.576 1.00 0.00 ?  10  TRP A CD2  3  
ATOM 3417  N NE1  . TRP A 1 19  ? 19.672  67.748  118.685 1.00 0.00 ?  10  TRP A NE1  3  
ATOM 3418  C CE2  . TRP A 1 19  ? 21.069  68.042  118.498 1.00 0.00 ?  10  TRP A CE2  3  
ATOM 3419  C CE3  . TRP A 1 19  ? 22.765  69.326  119.695 1.00 0.00 ?  10  TRP A CE3  3  
ATOM 3420  C CZ2  . TRP A 1 19  ? 22.010  67.798  117.514 1.00 0.00 ?  10  TRP A CZ2  3  
ATOM 3421  C CZ3  . TRP A 1 19  ? 23.747  69.032  118.721 1.00 0.00 ?  10  TRP A CZ3  3  
ATOM 3422  C CH2  . TRP A 1 19  ? 23.319  68.317  117.597 1.00 0.00 ?  10  TRP A CH2  3  
ATOM 3423  H H    . TRP A 1 19  ? 19.098  71.773  123.228 1.00 0.00 ?  10  TRP A H    3  
ATOM 3424  H HA   . TRP A 1 19  ? 21.213  71.711  121.248 1.00 0.00 ?  10  TRP A HA   3  
ATOM 3425  H HB2  . TRP A 1 19  ? 20.878  69.593  122.371 1.00 0.00 ?  10  TRP A HB2  3  
ATOM 3426  H HB3  . TRP A 1 19  ? 19.182  69.661  121.938 1.00 0.00 ?  10  TRP A HB3  3  
ATOM 3427  H HD1  . TRP A 1 19  ? 18.196  68.526  119.984 1.00 0.00 ?  10  TRP A HD1  3  
ATOM 3428  H HE1  . TRP A 1 19  ? 19.048  67.146  118.165 1.00 0.00 ?  10  TRP A HE1  3  
ATOM 3429  H HE3  . TRP A 1 19  ? 23.134  69.838  120.571 1.00 0.00 ?  10  TRP A HE3  3  
ATOM 3430  H HZ2  . TRP A 1 19  ? 21.733  67.121  116.719 1.00 0.00 ?  10  TRP A HZ2  3  
ATOM 3431  H HZ3  . TRP A 1 19  ? 24.740  69.424  118.882 1.00 0.00 ?  10  TRP A HZ3  3  
ATOM 3432  H HH2  . TRP A 1 19  ? 23.935  67.995  116.770 1.00 0.00 ?  10  TRP A HH2  3  
ATOM 3433  N N    . TYR A 1 20  ? 18.349  71.960  119.846 1.00 0.00 ?  11  TYR A N    3  
ATOM 3434  C CA   . TYR A 1 20  ? 17.775  72.378  118.572 1.00 0.00 ?  11  TYR A CA   3  
ATOM 3435  C C    . TYR A 1 20  ? 18.154  73.849  118.211 1.00 0.00 ?  11  TYR A C    3  
ATOM 3436  O O    . TYR A 1 20  ? 18.206  74.168  117.037 1.00 0.00 ?  11  TYR A O    3  
ATOM 3437  C CB   . TYR A 1 20  ? 16.344  72.029  118.526 1.00 0.00 ?  11  TYR A CB   3  
ATOM 3438  C CG   . TYR A 1 20  ? 16.118  70.583  118.311 1.00 0.00 ?  11  TYR A CG   3  
ATOM 3439  C CD1  . TYR A 1 20  ? 16.249  69.927  117.058 1.00 0.00 ?  11  TYR A CD1  3  
ATOM 3440  C CD2  . TYR A 1 20  ? 15.662  69.744  119.366 1.00 0.00 ?  11  TYR A CD2  3  
ATOM 3441  C CE1  . TYR A 1 20  ? 15.783  68.601  116.849 1.00 0.00 ?  11  TYR A CE1  3  
ATOM 3442  C CE2  . TYR A 1 20  ? 15.378  68.345  119.259 1.00 0.00 ?  11  TYR A CE2  3  
ATOM 3443  C CZ   . TYR A 1 20  ? 15.386  67.781  117.915 1.00 0.00 ?  11  TYR A CZ   3  
ATOM 3444  O OH   . TYR A 1 20  ? 15.023  66.539  117.605 1.00 0.00 ?  11  TYR A OH   3  
ATOM 3445  H H    . TYR A 1 20  ? 17.832  71.610  120.640 1.00 0.00 ?  11  TYR A H    3  
ATOM 3446  H HA   . TYR A 1 20  ? 18.268  71.820  117.776 1.00 0.00 ?  11  TYR A HA   3  
ATOM 3447  H HB2  . TYR A 1 20  ? 15.872  72.382  119.442 1.00 0.00 ?  11  TYR A HB2  3  
ATOM 3448  H HB3  . TYR A 1 20  ? 15.767  72.396  117.677 1.00 0.00 ?  11  TYR A HB3  3  
ATOM 3449  H HD1  . TYR A 1 20  ? 16.671  70.478  116.230 1.00 0.00 ?  11  TYR A HD1  3  
ATOM 3450  H HD2  . TYR A 1 20  ? 15.504  70.016  120.399 1.00 0.00 ?  11  TYR A HD2  3  
ATOM 3451  H HE1  . TYR A 1 20  ? 15.714  68.224  115.838 1.00 0.00 ?  11  TYR A HE1  3  
ATOM 3452  H HE2  . TYR A 1 20  ? 15.170  67.804  120.169 1.00 0.00 ?  11  TYR A HE2  3  
ATOM 3453  H HH   . TYR A 1 20  ? 14.994  66.393  116.656 1.00 0.00 ?  11  TYR A HH   3  
ATOM 3454  N N    . GLU A 1 21  ? 18.458  74.677  119.232 1.00 0.00 ?  12  GLU A N    3  
ATOM 3455  C CA   . GLU A 1 21  ? 19.049  75.985  119.111 1.00 0.00 ?  12  GLU A CA   3  
ATOM 3456  C C    . GLU A 1 21  ? 20.497  76.056  118.591 1.00 0.00 ?  12  GLU A C    3  
ATOM 3457  O O    . GLU A 1 21  ? 20.881  76.909  117.868 1.00 0.00 ?  12  GLU A O    3  
ATOM 3458  C CB   . GLU A 1 21  ? 18.711  76.875  120.326 1.00 0.00 ?  12  GLU A CB   3  
ATOM 3459  C CG   . GLU A 1 21  ? 19.072  78.365  120.247 1.00 0.00 ?  12  GLU A CG   3  
ATOM 3460  C CD   . GLU A 1 21  ? 18.094  79.250  119.472 1.00 0.00 ?  12  GLU A CD   3  
ATOM 3461  O OE1  . GLU A 1 21  ? 16.906  79.310  119.910 1.00 0.00 -1 12  GLU A OE1  3  
ATOM 3462  O OE2  . GLU A 1 21  ? 18.586  79.987  118.560 1.00 0.00 ?  12  GLU A OE2  3  
ATOM 3463  H H    . GLU A 1 21  ? 18.168  74.327  120.133 1.00 0.00 ?  12  GLU A H    3  
ATOM 3464  H HA   . GLU A 1 21  ? 18.521  76.495  118.304 1.00 0.00 ?  12  GLU A HA   3  
ATOM 3465  H HB2  . GLU A 1 21  ? 17.661  76.868  120.620 1.00 0.00 ?  12  GLU A HB2  3  
ATOM 3466  H HB3  . GLU A 1 21  ? 19.262  76.474  121.177 1.00 0.00 ?  12  GLU A HB3  3  
ATOM 3467  H HG2  . GLU A 1 21  ? 19.209  78.671  121.285 1.00 0.00 ?  12  GLU A HG2  3  
ATOM 3468  H HG3  . GLU A 1 21  ? 20.080  78.427  119.837 1.00 0.00 ?  12  GLU A HG3  3  
ATOM 3469  N N    . SER A 1 22  ? 21.149  74.966  118.954 1.00 0.00 ?  13  SER A N    3  
ATOM 3470  C CA   . SER A 1 22  ? 22.543  74.659  118.414 1.00 0.00 ?  13  SER A CA   3  
ATOM 3471  C C    . SER A 1 22  ? 22.422  74.255  116.974 1.00 0.00 ?  13  SER A C    3  
ATOM 3472  O O    . SER A 1 22  ? 23.229  74.691  116.154 1.00 0.00 ?  13  SER A O    3  
ATOM 3473  C CB   . SER A 1 22  ? 23.287  73.621  119.272 1.00 0.00 ?  13  SER A CB   3  
ATOM 3474  O OG   . SER A 1 22  ? 23.231  74.010  120.621 1.00 0.00 ?  13  SER A OG   3  
ATOM 3475  H H    . SER A 1 22  ? 20.706  74.288  119.557 1.00 0.00 ?  13  SER A H    3  
ATOM 3476  H HA   . SER A 1 22  ? 23.056  75.609  118.567 1.00 0.00 ?  13  SER A HA   3  
ATOM 3477  H HB2  . SER A 1 22  ? 22.810  72.659  119.085 1.00 0.00 ?  13  SER A HB2  3  
ATOM 3478  H HB3  . SER A 1 22  ? 24.274  73.444  118.846 1.00 0.00 ?  13  SER A HB3  3  
ATOM 3479  H HG   . SER A 1 22  ? 22.324  74.077  120.929 1.00 0.00 ?  13  SER A HG   3  
ATOM 3480  N N    . LEU A 1 23  ? 21.461  73.388  116.606 1.00 0.00 ?  14  LEU A N    3  
ATOM 3481  C CA   . LEU A 1 23  ? 21.192  73.098  115.170 1.00 0.00 ?  14  LEU A CA   3  
ATOM 3482  C C    . LEU A 1 23  ? 20.554  74.283  114.380 1.00 0.00 ?  14  LEU A C    3  
ATOM 3483  O O    . LEU A 1 23  ? 20.800  74.312  113.218 1.00 0.00 ?  14  LEU A O    3  
ATOM 3484  C CB   . LEU A 1 23  ? 20.283  71.856  115.001 1.00 0.00 ?  14  LEU A CB   3  
ATOM 3485  C CG   . LEU A 1 23  ? 20.848  70.529  115.428 1.00 0.00 ?  14  LEU A CG   3  
ATOM 3486  C CD1  . LEU A 1 23  ? 19.663  69.534  115.711 1.00 0.00 ?  14  LEU A CD1  3  
ATOM 3487  C CD2  . LEU A 1 23  ? 21.776  70.004  114.326 1.00 0.00 ?  14  LEU A CD2  3  
ATOM 3488  H H    . LEU A 1 23  ? 20.796  73.109  117.315 1.00 0.00 ?  14  LEU A H    3  
ATOM 3489  H HA   . LEU A 1 23  ? 22.067  72.719  114.641 1.00 0.00 ?  14  LEU A HA   3  
ATOM 3490  H HB2  . LEU A 1 23  ? 19.482  72.090  115.702 1.00 0.00 ?  14  LEU A HB2  3  
ATOM 3491  H HB3  . LEU A 1 23  ? 19.913  71.675  113.992 1.00 0.00 ?  14  LEU A HB3  3  
ATOM 3492  H HG   . LEU A 1 23  ? 21.400  70.766  116.337 1.00 0.00 ?  14  LEU A HG   3  
ATOM 3493  H HD11 . LEU A 1 23  ? 19.002  69.962  116.465 1.00 0.00 ?  14  LEU A HD11 3  
ATOM 3494  H HD12 . LEU A 1 23  ? 19.165  69.382  114.753 1.00 0.00 ?  14  LEU A HD12 3  
ATOM 3495  H HD13 . LEU A 1 23  ? 20.070  68.549  115.941 1.00 0.00 ?  14  LEU A HD13 3  
ATOM 3496  H HD21 . LEU A 1 23  ? 22.775  70.424  114.437 1.00 0.00 ?  14  LEU A HD21 3  
ATOM 3497  H HD22 . LEU A 1 23  ? 21.854  68.922  114.433 1.00 0.00 ?  14  LEU A HD22 3  
ATOM 3498  H HD23 . LEU A 1 23  ? 21.380  70.254  113.342 1.00 0.00 ?  14  LEU A HD23 3  
ATOM 3499  N N    . HIS A 1 24  ? 20.039  75.315  115.091 1.00 0.00 ?  15  HIS A N    3  
ATOM 3500  C CA   . HIS A 1 24  ? 19.641  76.520  114.443 1.00 0.00 ?  15  HIS A CA   3  
ATOM 3501  C C    . HIS A 1 24  ? 20.816  77.500  114.174 1.00 0.00 ?  15  HIS A C    3  
ATOM 3502  O O    . HIS A 1 24  ? 20.885  78.046  113.122 1.00 0.00 ?  15  HIS A O    3  
ATOM 3503  C CB   . HIS A 1 24  ? 18.516  77.233  115.232 1.00 0.00 ?  15  HIS A CB   3  
ATOM 3504  C CG   . HIS A 1 24  ? 17.980  78.533  114.688 1.00 0.00 ?  15  HIS A CG   3  
ATOM 3505  N ND1  . HIS A 1 24  ? 18.645  79.721  114.428 1.00 0.00 ?  15  HIS A ND1  3  
ATOM 3506  C CD2  . HIS A 1 24  ? 16.666  78.718  114.406 1.00 0.00 ?  15  HIS A CD2  3  
ATOM 3507  C CE1  . HIS A 1 24  ? 17.671  80.587  114.036 1.00 0.00 ?  15  HIS A CE1  3  
ATOM 3508  N NE2  . HIS A 1 24  ? 16.487  79.967  113.893 1.00 0.00 ?  15  HIS A NE2  3  
ATOM 3509  H H    . HIS A 1 24  ? 19.782  75.166  116.056 1.00 0.00 ?  15  HIS A H    3  
ATOM 3510  H HA   . HIS A 1 24  ? 19.218  76.295  113.464 1.00 0.00 ?  15  HIS A HA   3  
ATOM 3511  H HB2  . HIS A 1 24  ? 17.690  76.527  115.309 1.00 0.00 ?  15  HIS A HB2  3  
ATOM 3512  H HB3  . HIS A 1 24  ? 18.845  77.406  116.256 1.00 0.00 ?  15  HIS A HB3  3  
ATOM 3513  H HD2  . HIS A 1 24  ? 15.944  77.957  114.666 1.00 0.00 ?  15  HIS A HD2  3  
ATOM 3514  H HE1  . HIS A 1 24  ? 17.892  81.541  113.579 1.00 0.00 ?  15  HIS A HE1  3  
ATOM 3515  H HE2  . HIS A 1 24  ? 15.627  80.408  113.599 1.00 0.00 ?  15  HIS A HE2  3  
ATOM 3516  N N    . ALA A 1 25  ? 21.822  77.603  115.049 1.00 0.00 ?  16  ALA A N    3  
ATOM 3517  C CA   . ALA A 1 25  ? 23.060  78.357  114.731 1.00 0.00 ?  16  ALA A CA   3  
ATOM 3518  C C    . ALA A 1 25  ? 23.891  77.739  113.558 1.00 0.00 ?  16  ALA A C    3  
ATOM 3519  O O    . ALA A 1 25  ? 24.379  78.461  112.678 1.00 0.00 ?  16  ALA A O    3  
ATOM 3520  C CB   . ALA A 1 25  ? 23.862  78.509  116.002 1.00 0.00 ?  16  ALA A CB   3  
ATOM 3521  H H    . ALA A 1 25  ? 21.760  77.240  115.989 1.00 0.00 ?  16  ALA A H    3  
ATOM 3522  H HA   . ALA A 1 25  ? 22.826  79.360  114.375 1.00 0.00 ?  16  ALA A HA   3  
ATOM 3523  H HB1  . ALA A 1 25  ? 24.764  79.085  115.793 1.00 0.00 ?  16  ALA A HB1  3  
ATOM 3524  H HB2  . ALA A 1 25  ? 23.326  79.212  116.639 1.00 0.00 ?  16  ALA A HB2  3  
ATOM 3525  H HB3  . ALA A 1 25  ? 24.108  77.516  116.380 1.00 0.00 ?  16  ALA A HB3  3  
ATOM 3526  N N    . VAL A 1 26  ? 24.016  76.403  113.460 1.00 0.00 ?  17  VAL A N    3  
ATOM 3527  C CA   . VAL A 1 26  ? 24.731  75.810  112.405 1.00 0.00 ?  17  VAL A CA   3  
ATOM 3528  C C    . VAL A 1 26  ? 24.147  75.991  110.951 1.00 0.00 ?  17  VAL A C    3  
ATOM 3529  O O    . VAL A 1 26  ? 24.850  76.289  110.023 1.00 0.00 ?  17  VAL A O    3  
ATOM 3530  C CB   . VAL A 1 26  ? 25.184  74.410  112.866 1.00 0.00 ?  17  VAL A CB   3  
ATOM 3531  C CG1  . VAL A 1 26  ? 24.356  73.196  112.486 1.00 0.00 ?  17  VAL A CG1  3  
ATOM 3532  C CG2  . VAL A 1 26  ? 26.634  74.267  112.429 1.00 0.00 ?  17  VAL A CG2  3  
ATOM 3533  H H    . VAL A 1 26  ? 23.654  75.820  114.201 1.00 0.00 ?  17  VAL A H    3  
ATOM 3534  H HA   . VAL A 1 26  ? 25.703  76.298  112.329 1.00 0.00 ?  17  VAL A HA   3  
ATOM 3535  H HB   . VAL A 1 26  ? 25.264  74.348  113.951 1.00 0.00 ?  17  VAL A HB   3  
ATOM 3536  H HG11 . VAL A 1 26  ? 24.654  72.337  113.086 1.00 0.00 ?  17  VAL A HG11 3  
ATOM 3537  H HG12 . VAL A 1 26  ? 23.285  73.287  112.669 1.00 0.00 ?  17  VAL A HG12 3  
ATOM 3538  H HG13 . VAL A 1 26  ? 24.411  72.977  111.419 1.00 0.00 ?  17  VAL A HG13 3  
ATOM 3539  H HG21 . VAL A 1 26  ? 26.918  73.255  112.717 1.00 0.00 ?  17  VAL A HG21 3  
ATOM 3540  H HG22 . VAL A 1 26  ? 26.692  74.391  111.348 1.00 0.00 ?  17  VAL A HG22 3  
ATOM 3541  H HG23 . VAL A 1 26  ? 27.260  74.954  112.998 1.00 0.00 ?  17  VAL A HG23 3  
ATOM 3542  N N    . LEU A 1 27  ? 22.807  75.843  110.882 1.00 0.00 ?  18  LEU A N    3  
ATOM 3543  C CA   . LEU A 1 27  ? 22.075  76.097  109.732 1.00 0.00 ?  18  LEU A CA   3  
ATOM 3544  C C    . LEU A 1 27  ? 22.304  77.434  109.044 1.00 0.00 ?  18  LEU A C    3  
ATOM 3545  O O    . LEU A 1 27  ? 22.559  77.550  107.895 1.00 0.00 ?  18  LEU A O    3  
ATOM 3546  C CB   . LEU A 1 27  ? 20.554  75.862  110.080 1.00 0.00 ?  18  LEU A CB   3  
ATOM 3547  C CG   . LEU A 1 27  ? 19.465  76.347  109.055 1.00 0.00 ?  18  LEU A CG   3  
ATOM 3548  C CD1  . LEU A 1 27  ? 19.512  75.627  107.741 1.00 0.00 ?  18  LEU A CD1  3  
ATOM 3549  C CD2  . LEU A 1 27  ? 18.019  76.418  109.473 1.00 0.00 ?  18  LEU A CD2  3  
ATOM 3550  H H    . LEU A 1 27  ? 22.249  75.436  111.620 1.00 0.00 ?  18  LEU A H    3  
ATOM 3551  H HA   . LEU A 1 27  ? 22.257  75.298  109.013 1.00 0.00 ?  18  LEU A HA   3  
ATOM 3552  H HB2  . LEU A 1 27  ? 20.508  74.826  110.419 1.00 0.00 ?  18  LEU A HB2  3  
ATOM 3553  H HB3  . LEU A 1 27  ? 20.296  76.454  110.957 1.00 0.00 ?  18  LEU A HB3  3  
ATOM 3554  H HG   . LEU A 1 27  ? 19.573  77.421  108.908 1.00 0.00 ?  18  LEU A HG   3  
ATOM 3555  H HD11 . LEU A 1 27  ? 18.584  75.676  107.171 1.00 0.00 ?  18  LEU A HD11 3  
ATOM 3556  H HD12 . LEU A 1 27  ? 20.315  76.200  107.277 1.00 0.00 ?  18  LEU A HD12 3  
ATOM 3557  H HD13 . LEU A 1 27  ? 19.826  74.597  107.911 1.00 0.00 ?  18  LEU A HD13 3  
ATOM 3558  H HD21 . LEU A 1 27  ? 17.841  77.040  110.350 1.00 0.00 ?  18  LEU A HD21 3  
ATOM 3559  H HD22 . LEU A 1 27  ? 17.373  76.668  108.631 1.00 0.00 ?  18  LEU A HD22 3  
ATOM 3560  H HD23 . LEU A 1 27  ? 17.846  75.389  109.787 1.00 0.00 ?  18  LEU A HD23 3  
ATOM 3561  N N    . LYS A 1 28  ? 22.222  78.480  109.909 1.00 0.00 ?  19  LYS A N    3  
ATOM 3562  C CA   . LYS A 1 28  ? 22.433  79.858  109.510 1.00 0.00 ?  19  LYS A CA   3  
ATOM 3563  C C    . LYS A 1 28  ? 23.863  80.079  108.969 1.00 0.00 ?  19  LYS A C    3  
ATOM 3564  O O    . LYS A 1 28  ? 23.987  80.723  107.924 1.00 0.00 ?  19  LYS A O    3  
ATOM 3565  C CB   . LYS A 1 28  ? 22.061  80.721  110.775 1.00 0.00 ?  19  LYS A CB   3  
ATOM 3566  C CG   . LYS A 1 28  ? 22.151  82.185  110.542 1.00 0.00 ?  19  LYS A CG   3  
ATOM 3567  C CD   . LYS A 1 28  ? 21.676  83.031  111.770 1.00 0.00 ?  19  LYS A CD   3  
ATOM 3568  C CE   . LYS A 1 28  ? 21.677  84.558  111.522 1.00 0.00 ?  19  LYS A CE   3  
ATOM 3569  N NZ   . LYS A 1 28  ? 21.306  85.167  112.813 1.00 0.00 1  19  LYS A NZ   3  
ATOM 3570  H H    . LYS A 1 28  ? 22.160  78.268  110.895 1.00 0.00 ?  19  LYS A H    3  
ATOM 3571  H HA   . LYS A 1 28  ? 21.757  80.245  108.747 1.00 0.00 ?  19  LYS A HA   3  
ATOM 3572  H HB2  . LYS A 1 28  ? 21.034  80.544  111.096 1.00 0.00 ?  19  LYS A HB2  3  
ATOM 3573  H HB3  . LYS A 1 28  ? 22.622  80.461  111.673 1.00 0.00 ?  19  LYS A HB3  3  
ATOM 3574  H HG2  . LYS A 1 28  ? 23.138  82.485  110.188 1.00 0.00 ?  19  LYS A HG2  3  
ATOM 3575  H HG3  . LYS A 1 28  ? 21.455  82.530  109.777 1.00 0.00 ?  19  LYS A HG3  3  
ATOM 3576  H HD2  . LYS A 1 28  ? 20.632  82.750  111.910 1.00 0.00 ?  19  LYS A HD2  3  
ATOM 3577  H HD3  . LYS A 1 28  ? 22.275  82.805  112.652 1.00 0.00 ?  19  LYS A HD3  3  
ATOM 3578  H HE2  . LYS A 1 28  ? 22.665  84.917  111.236 1.00 0.00 ?  19  LYS A HE2  3  
ATOM 3579  H HE3  . LYS A 1 28  ? 20.971  84.921  110.775 1.00 0.00 ?  19  LYS A HE3  3  
ATOM 3580  H HZ1  . LYS A 1 28  ? 20.317  84.977  112.890 1.00 0.00 ?  19  LYS A HZ1  3  
ATOM 3581  H HZ2  . LYS A 1 28  ? 21.843  84.785  113.578 1.00 0.00 ?  19  LYS A HZ2  3  
ATOM 3582  H HZ3  . LYS A 1 28  ? 21.385  86.164  112.669 1.00 0.00 ?  19  LYS A HZ3  3  
ATOM 3583  N N    . ALA A 1 29  ? 24.830  79.414  109.619 1.00 0.00 ?  20  ALA A N    3  
ATOM 3584  C CA   . ALA A 1 29  ? 26.150  79.487  109.076 1.00 0.00 ?  20  ALA A CA   3  
ATOM 3585  C C    . ALA A 1 29  ? 26.345  78.713  107.736 1.00 0.00 ?  20  ALA A C    3  
ATOM 3586  O O    . ALA A 1 29  ? 27.037  79.199  106.863 1.00 0.00 ?  20  ALA A O    3  
ATOM 3587  C CB   . ALA A 1 29  ? 27.128  78.888  110.099 1.00 0.00 ?  20  ALA A CB   3  
ATOM 3588  H H    . ALA A 1 29  ? 24.726  78.763  110.385 1.00 0.00 ?  20  ALA A H    3  
ATOM 3589  H HA   . ALA A 1 29  ? 26.328  80.555  108.957 1.00 0.00 ?  20  ALA A HA   3  
ATOM 3590  H HB1  . ALA A 1 29  ? 27.122  79.654  110.874 1.00 0.00 ?  20  ALA A HB1  3  
ATOM 3591  H HB2  . ALA A 1 29  ? 26.823  77.888  110.409 1.00 0.00 ?  20  ALA A HB2  3  
ATOM 3592  H HB3  . ALA A 1 29  ? 28.124  78.851  109.660 1.00 0.00 ?  20  ALA A HB3  3  
ATOM 3593  N N    . LEU A 1 30  ? 25.815  77.430  107.688 1.00 0.00 ?  21  LEU A N    3  
ATOM 3594  C CA   . LEU A 1 30  ? 25.925  76.679  106.464 1.00 0.00 ?  21  LEU A CA   3  
ATOM 3595  C C    . LEU A 1 30  ? 25.223  77.309  105.299 1.00 0.00 ?  21  LEU A C    3  
ATOM 3596  O O    . LEU A 1 30  ? 25.752  77.353  104.231 1.00 0.00 ?  21  LEU A O    3  
ATOM 3597  C CB   . LEU A 1 30  ? 25.455  75.232  106.821 1.00 0.00 ?  21  LEU A CB   3  
ATOM 3598  C CG   . LEU A 1 30  ? 26.418  74.234  107.550 1.00 0.00 ?  21  LEU A CG   3  
ATOM 3599  C CD1  . LEU A 1 30  ? 25.712  72.989  108.183 1.00 0.00 ?  21  LEU A CD1  3  
ATOM 3600  C CD2  . LEU A 1 30  ? 27.467  73.576  106.652 1.00 0.00 ?  21  LEU A CD2  3  
ATOM 3601  H H    . LEU A 1 30  ? 25.276  77.013  108.434 1.00 0.00 ?  21  LEU A H    3  
ATOM 3602  H HA   . LEU A 1 30  ? 26.954  76.594  106.117 1.00 0.00 ?  21  LEU A HA   3  
ATOM 3603  H HB2  . LEU A 1 30  ? 24.503  75.374  107.330 1.00 0.00 ?  21  LEU A HB2  3  
ATOM 3604  H HB3  . LEU A 1 30  ? 25.210  74.730  105.885 1.00 0.00 ?  21  LEU A HB3  3  
ATOM 3605  H HG   . LEU A 1 30  ? 26.987  74.780  108.303 1.00 0.00 ?  21  LEU A HG   3  
ATOM 3606  H HD11 . LEU A 1 30  ? 25.240  72.478  107.344 1.00 0.00 ?  21  LEU A HD11 3  
ATOM 3607  H HD12 . LEU A 1 30  ? 26.395  72.393  108.788 1.00 0.00 ?  21  LEU A HD12 3  
ATOM 3608  H HD13 . LEU A 1 30  ? 24.864  73.288  108.799 1.00 0.00 ?  21  LEU A HD13 3  
ATOM 3609  H HD21 . LEU A 1 30  ? 28.142  73.085  107.354 1.00 0.00 ?  21  LEU A HD21 3  
ATOM 3610  H HD22 . LEU A 1 30  ? 27.088  72.790  106.000 1.00 0.00 ?  21  LEU A HD22 3  
ATOM 3611  H HD23 . LEU A 1 30  ? 27.997  74.367  106.121 1.00 0.00 ?  21  LEU A HD23 3  
ATOM 3612  N N    . ASN A 1 31  ? 24.093  77.922  105.512 1.00 0.00 ?  22  ASN A N    3  
ATOM 3613  C CA   . ASN A 1 31  ? 23.276  78.560  104.480 1.00 0.00 ?  22  ASN A CA   3  
ATOM 3614  C C    . ASN A 1 31  ? 23.985  79.829  103.909 1.00 0.00 ?  22  ASN A C    3  
ATOM 3615  O O    . ASN A 1 31  ? 24.066  80.016  102.704 1.00 0.00 ?  22  ASN A O    3  
ATOM 3616  C CB   . ASN A 1 31  ? 21.882  78.914  105.040 1.00 0.00 ?  22  ASN A CB   3  
ATOM 3617  C CG   . ASN A 1 31  ? 21.106  79.725  104.069 1.00 0.00 ?  22  ASN A CG   3  
ATOM 3618  O OD1  . ASN A 1 31  ? 20.446  79.172  103.256 1.00 0.00 ?  22  ASN A OD1  3  
ATOM 3619  N ND2  . ASN A 1 31  ? 21.088  80.972  104.302 1.00 0.00 ?  22  ASN A ND2  3  
ATOM 3620  H H    . ASN A 1 31  ? 23.701  77.800  106.435 1.00 0.00 ?  22  ASN A H    3  
ATOM 3621  H HA   . ASN A 1 31  ? 23.157  77.888  103.630 1.00 0.00 ?  22  ASN A HA   3  
ATOM 3622  H HB2  . ASN A 1 31  ? 21.254  78.043  105.229 1.00 0.00 ?  22  ASN A HB2  3  
ATOM 3623  H HB3  . ASN A 1 31  ? 22.000  79.487  105.961 1.00 0.00 ?  22  ASN A HB3  3  
ATOM 3624  H HD21 . ASN A 1 31  ? 21.634  81.441  105.010 1.00 0.00 ?  22  ASN A HD21 3  
ATOM 3625  H HD22 . ASN A 1 31  ? 20.652  81.466  103.536 1.00 0.00 ?  22  ASN A HD22 3  
ATOM 3626  N N    . ALA A 1 32  ? 24.585  80.687  104.854 1.00 0.00 ?  23  ALA A N    3  
ATOM 3627  C CA   . ALA A 1 32  ? 25.339  81.924  104.381 1.00 0.00 ?  23  ALA A CA   3  
ATOM 3628  C C    . ALA A 1 32  ? 26.590  81.581  103.531 1.00 0.00 ?  23  ALA A C    3  
ATOM 3629  O O    . ALA A 1 32  ? 26.840  82.224  102.537 1.00 0.00 ?  23  ALA A O    3  
ATOM 3630  C CB   . ALA A 1 32  ? 25.653  82.778  105.598 1.00 0.00 ?  23  ALA A CB   3  
ATOM 3631  H H    . ALA A 1 32  ? 24.625  80.450  105.835 1.00 0.00 ?  23  ALA A H    3  
ATOM 3632  H HA   . ALA A 1 32  ? 24.671  82.420  103.678 1.00 0.00 ?  23  ALA A HA   3  
ATOM 3633  H HB1  . ALA A 1 32  ? 24.763  83.117  106.128 1.00 0.00 ?  23  ALA A HB1  3  
ATOM 3634  H HB2  . ALA A 1 32  ? 26.273  82.224  106.302 1.00 0.00 ?  23  ALA A HB2  3  
ATOM 3635  H HB3  . ALA A 1 32  ? 26.184  83.640  105.193 1.00 0.00 ?  23  ALA A HB3  3  
ATOM 3636  N N    . THR A 1 33  ? 27.345  80.618  104.079 1.00 0.00 ?  24  THR A N    3  
ATOM 3637  C CA   . THR A 1 33  ? 28.380  79.821  103.388 1.00 0.00 ?  24  THR A CA   3  
ATOM 3638  C C    . THR A 1 33  ? 27.911  79.156  102.083 1.00 0.00 ?  24  THR A C    3  
ATOM 3639  O O    . THR A 1 33  ? 28.732  79.051  101.176 1.00 0.00 ?  24  THR A O    3  
ATOM 3640  C CB   . THR A 1 33  ? 29.230  78.863  104.273 1.00 0.00 ?  24  THR A CB   3  
ATOM 3641  O OG1  . THR A 1 33  ? 29.247  79.257  105.616 1.00 0.00 ?  24  THR A OG1  3  
ATOM 3642  C CG2  . THR A 1 33  ? 30.690  78.723  103.754 1.00 0.00 ?  24  THR A CG2  3  
ATOM 3643  H H    . THR A 1 33  ? 27.170  80.375  105.044 1.00 0.00 ?  24  THR A H    3  
ATOM 3644  H HA   . THR A 1 33  ? 29.113  80.611  103.224 1.00 0.00 ?  24  THR A HA   3  
ATOM 3645  H HB   . THR A 1 33  ? 28.797  77.863  104.258 1.00 0.00 ?  24  THR A HB   3  
ATOM 3646  H HG1  . THR A 1 33  ? 28.438  79.046  106.087 1.00 0.00 ?  24  THR A HG1  3  
ATOM 3647  H HG21 . THR A 1 33  ? 31.314  79.533  104.134 1.00 0.00 ?  24  THR A HG21 3  
ATOM 3648  H HG22 . THR A 1 33  ? 31.150  77.861  104.238 1.00 0.00 ?  24  THR A HG22 3  
ATOM 3649  H HG23 . THR A 1 33  ? 30.716  78.814  102.669 1.00 0.00 ?  24  THR A HG23 3  
ATOM 3650  N N    . LEU A 1 34  ? 26.635  78.737  101.916 1.00 0.00 ?  25  LEU A N    3  
ATOM 3651  C CA   . LEU A 1 34  ? 26.134  78.209  100.654 1.00 0.00 ?  25  LEU A CA   3  
ATOM 3652  C C    . LEU A 1 34  ? 25.750  79.350  99.679  1.00 0.00 ?  25  LEU A C    3  
ATOM 3653  O O    . LEU A 1 34  ? 26.092  79.290  98.474  1.00 0.00 ?  25  LEU A O    3  
ATOM 3654  C CB   . LEU A 1 34  ? 24.916  77.260  100.955 1.00 0.00 ?  25  LEU A CB   3  
ATOM 3655  C CG   . LEU A 1 34  ? 24.348  76.572  99.676  1.00 0.00 ?  25  LEU A CG   3  
ATOM 3656  C CD1  . LEU A 1 34  ? 25.423  75.712  98.957  1.00 0.00 ?  25  LEU A CD1  3  
ATOM 3657  C CD2  . LEU A 1 34  ? 23.144  75.724  100.095 1.00 0.00 ?  25  LEU A CD2  3  
ATOM 3658  H H    . LEU A 1 34  ? 26.043  78.674  102.732 1.00 0.00 ?  25  LEU A H    3  
ATOM 3659  H HA   . LEU A 1 34  ? 26.943  77.710  100.120 1.00 0.00 ?  25  LEU A HA   3  
ATOM 3660  H HB2  . LEU A 1 34  ? 25.189  76.566  101.750 1.00 0.00 ?  25  LEU A HB2  3  
ATOM 3661  H HB3  . LEU A 1 34  ? 24.110  77.832  101.413 1.00 0.00 ?  25  LEU A HB3  3  
ATOM 3662  H HG   . LEU A 1 34  ? 23.805  77.201  98.970  1.00 0.00 ?  25  LEU A HG   3  
ATOM 3663  H HD11 . LEU A 1 34  ? 24.901  75.187  98.157  1.00 0.00 ?  25  LEU A HD11 3  
ATOM 3664  H HD12 . LEU A 1 34  ? 26.125  76.349  98.419  1.00 0.00 ?  25  LEU A HD12 3  
ATOM 3665  H HD13 . LEU A 1 34  ? 25.946  75.040  99.636  1.00 0.00 ?  25  LEU A HD13 3  
ATOM 3666  H HD21 . LEU A 1 34  ? 23.326  75.057  100.938 1.00 0.00 ?  25  LEU A HD21 3  
ATOM 3667  H HD22 . LEU A 1 34  ? 22.268  76.308  100.374 1.00 0.00 ?  25  LEU A HD22 3  
ATOM 3668  H HD23 . LEU A 1 34  ? 22.820  75.148  99.228  1.00 0.00 ?  25  LEU A HD23 3  
ATOM 3669  N N    . HIS A 1 35  ? 25.092  80.410  100.159 1.00 0.00 ?  26  HIS A N    3  
ATOM 3670  C CA   . HIS A 1 35  ? 24.853  81.694  99.352  1.00 0.00 ?  26  HIS A CA   3  
ATOM 3671  C C    . HIS A 1 35  ? 26.153  82.376  98.975  1.00 0.00 ?  26  HIS A C    3  
ATOM 3672  O O    . HIS A 1 35  ? 26.181  83.079  97.958  1.00 0.00 ?  26  HIS A O    3  
ATOM 3673  C CB   . HIS A 1 35  ? 23.985  82.612  100.130 1.00 0.00 ?  26  HIS A CB   3  
ATOM 3674  C CG   . HIS A 1 35  ? 22.561  82.218  100.068 1.00 0.00 ?  26  HIS A CG   3  
ATOM 3675  N ND1  . HIS A 1 35  ? 21.808  82.298  98.904  1.00 0.00 ?  26  HIS A ND1  3  
ATOM 3676  C CD2  . HIS A 1 35  ? 21.688  82.087  101.167 1.00 0.00 ?  26  HIS A CD2  3  
ATOM 3677  C CE1  . HIS A 1 35  ? 20.518  81.981  99.344  1.00 0.00 ?  26  HIS A CE1  3  
ATOM 3678  N NE2  . HIS A 1 35  ? 20.438  81.844  100.621 1.00 0.00 ?  26  HIS A NE2  3  
ATOM 3679  H H    . HIS A 1 35  ? 24.773  80.313  101.112 1.00 0.00 ?  26  HIS A H    3  
ATOM 3680  H HA   . HIS A 1 35  ? 24.319  81.453  98.434  1.00 0.00 ?  26  HIS A HA   3  
ATOM 3681  H HB2  . HIS A 1 35  ? 24.384  82.599  101.145 1.00 0.00 ?  26  HIS A HB2  3  
ATOM 3682  H HB3  . HIS A 1 35  ? 24.068  83.538  99.562  1.00 0.00 ?  26  HIS A HB3  3  
ATOM 3683  H HD2  . HIS A 1 35  ? 21.897  82.257  102.213 1.00 0.00 ?  26  HIS A HD2  3  
ATOM 3684  H HE1  . HIS A 1 35  ? 19.713  82.032  98.626  1.00 0.00 ?  26  HIS A HE1  3  
ATOM 3685  H HE2  . HIS A 1 35  ? 19.559  81.797  101.114 1.00 0.00 ?  26  HIS A HE2  3  
ATOM 3686  N N    . SER A 1 36  ? 27.273  82.008  99.567  1.00 0.00 ?  27  SER A N    3  
ATOM 3687  C CA   . SER A 1 36  ? 28.570  82.351  98.991  1.00 0.00 ?  27  SER A CA   3  
ATOM 3688  C C    . SER A 1 36  ? 28.900  81.429  97.768  1.00 0.00 ?  27  SER A C    3  
ATOM 3689  O O    . SER A 1 36  ? 29.174  81.889  96.687  1.00 0.00 ?  27  SER A O    3  
ATOM 3690  C CB   . SER A 1 36  ? 29.576  82.274  100.143 1.00 0.00 ?  27  SER A CB   3  
ATOM 3691  O OG   . SER A 1 36  ? 30.822  82.648  99.651  1.00 0.00 ?  27  SER A OG   3  
ATOM 3692  H H    . SER A 1 36  ? 27.165  81.345  100.320 1.00 0.00 ?  27  SER A H    3  
ATOM 3693  H HA   . SER A 1 36  ? 28.572  83.381  98.634  1.00 0.00 ?  27  SER A HA   3  
ATOM 3694  H HB2  . SER A 1 36  ? 29.328  83.022  100.895 1.00 0.00 ?  27  SER A HB2  3  
ATOM 3695  H HB3  . SER A 1 36  ? 29.631  81.305  100.641 1.00 0.00 ?  27  SER A HB3  3  
ATOM 3696  H HG   . SER A 1 36  ? 31.330  81.838  99.566  1.00 0.00 ?  27  SER A HG   3  
ATOM 3697  N N    . ASN A 1 37  ? 28.797  80.118  97.969  1.00 0.00 ?  28  ASN A N    3  
ATOM 3698  C CA   . ASN A 1 37  ? 29.209  79.198  96.931  1.00 0.00 ?  28  ASN A CA   3  
ATOM 3699  C C    . ASN A 1 37  ? 28.281  79.326  95.736  1.00 0.00 ?  28  ASN A C    3  
ATOM 3700  O O    . ASN A 1 37  ? 28.803  79.163  94.668  1.00 0.00 ?  28  ASN A O    3  
ATOM 3701  C CB   . ASN A 1 37  ? 29.088  77.713  97.505  1.00 0.00 ?  28  ASN A CB   3  
ATOM 3702  C CG   . ASN A 1 37  ? 29.171  76.535  96.580  1.00 0.00 ?  28  ASN A CG   3  
ATOM 3703  O OD1  . ASN A 1 37  ? 28.357  75.604  96.514  1.00 0.00 ?  28  ASN A OD1  3  
ATOM 3704  N ND2  . ASN A 1 37  ? 30.227  76.399  95.799  1.00 0.00 ?  28  ASN A ND2  3  
ATOM 3705  H H    . ASN A 1 37  ? 28.598  79.811  98.910  1.00 0.00 ?  28  ASN A H    3  
ATOM 3706  H HA   . ASN A 1 37  ? 30.242  79.406  96.655  1.00 0.00 ?  28  ASN A HA   3  
ATOM 3707  H HB2  . ASN A 1 37  ? 29.954  77.756  98.165  1.00 0.00 ?  28  ASN A HB2  3  
ATOM 3708  H HB3  . ASN A 1 37  ? 28.153  77.567  98.047  1.00 0.00 ?  28  ASN A HB3  3  
ATOM 3709  H HD21 . ASN A 1 37  ? 30.872  77.140  95.563  1.00 0.00 ?  28  ASN A HD21 3  
ATOM 3710  H HD22 . ASN A 1 37  ? 30.203  75.478  95.386  1.00 0.00 ?  28  ASN A HD22 3  
ATOM 3711  N N    . LEU A 1 38  ? 26.994  79.676  95.844  1.00 0.00 ?  29  LEU A N    3  
ATOM 3712  C CA   . LEU A 1 38  ? 26.008  79.759  94.774  1.00 0.00 ?  29  LEU A CA   3  
ATOM 3713  C C    . LEU A 1 38  ? 26.199  80.989  93.895  1.00 0.00 ?  29  LEU A C    3  
ATOM 3714  O O    . LEU A 1 38  ? 25.813  81.070  92.735  1.00 0.00 ?  29  LEU A O    3  
ATOM 3715  C CB   . LEU A 1 38  ? 24.591  79.638  95.352  1.00 0.00 ?  29  LEU A CB   3  
ATOM 3716  C CG   . LEU A 1 38  ? 24.273  78.250  95.907  1.00 0.00 ?  29  LEU A CG   3  
ATOM 3717  C CD1  . LEU A 1 38  ? 22.883  78.306  96.516  1.00 0.00 ?  29  LEU A CD1  3  
ATOM 3718  C CD2  . LEU A 1 38  ? 24.459  77.151  94.836  1.00 0.00 ?  29  LEU A CD2  3  
ATOM 3719  H H    . LEU A 1 38  ? 26.656  79.956  96.754  1.00 0.00 ?  29  LEU A H    3  
ATOM 3720  H HA   . LEU A 1 38  ? 26.266  78.978  94.060  1.00 0.00 ?  29  LEU A HA   3  
ATOM 3721  H HB2  . LEU A 1 38  ? 24.426  80.434  96.079  1.00 0.00 ?  29  LEU A HB2  3  
ATOM 3722  H HB3  . LEU A 1 38  ? 23.829  79.611  94.574  1.00 0.00 ?  29  LEU A HB3  3  
ATOM 3723  H HG   . LEU A 1 38  ? 25.041  78.083  96.663  1.00 0.00 ?  29  LEU A HG   3  
ATOM 3724  H HD11 . LEU A 1 38  ? 22.098  78.457  95.774  1.00 0.00 ?  29  LEU A HD11 3  
ATOM 3725  H HD12 . LEU A 1 38  ? 22.616  77.424  97.097  1.00 0.00 ?  29  LEU A HD12 3  
ATOM 3726  H HD13 . LEU A 1 38  ? 22.715  79.158  97.176  1.00 0.00 ?  29  LEU A HD13 3  
ATOM 3727  H HD21 . LEU A 1 38  ? 25.493  76.838  94.688  1.00 0.00 ?  29  LEU A HD21 3  
ATOM 3728  H HD22 . LEU A 1 38  ? 23.923  76.286  95.227  1.00 0.00 ?  29  LEU A HD22 3  
ATOM 3729  H HD23 . LEU A 1 38  ? 23.958  77.513  93.937  1.00 0.00 ?  29  LEU A HD23 3  
ATOM 3730  N N    . LEU A 1 39  ? 26.751  82.011  94.457  1.00 0.00 ?  30  LEU A N    3  
ATOM 3731  C CA   . LEU A 1 39  ? 27.155  83.277  93.761  1.00 0.00 ?  30  LEU A CA   3  
ATOM 3732  C C    . LEU A 1 39  ? 28.492  82.969  93.054  1.00 0.00 ?  30  LEU A C    3  
ATOM 3733  O O    . LEU A 1 39  ? 28.720  83.529  92.031  1.00 0.00 ?  30  LEU A O    3  
ATOM 3734  C CB   . LEU A 1 39  ? 27.044  84.449  94.746  1.00 0.00 ?  30  LEU A CB   3  
ATOM 3735  C CG   . LEU A 1 39  ? 27.165  85.911  94.246  1.00 0.00 ?  30  LEU A CG   3  
ATOM 3736  C CD1  . LEU A 1 39  ? 28.630  86.208  93.899  1.00 0.00 ?  30  LEU A CD1  3  
ATOM 3737  C CD2  . LEU A 1 39  ? 26.265  86.054  93.015  1.00 0.00 ?  30  LEU A CD2  3  
ATOM 3738  H H    . LEU A 1 39  ? 27.164  81.880  95.370  1.00 0.00 ?  30  LEU A H    3  
ATOM 3739  H HA   . LEU A 1 39  ? 26.364  83.532  93.056  1.00 0.00 ?  30  LEU A HA   3  
ATOM 3740  H HB2  . LEU A 1 39  ? 26.084  84.319  95.244  1.00 0.00 ?  30  LEU A HB2  3  
ATOM 3741  H HB3  . LEU A 1 39  ? 27.802  84.263  95.507  1.00 0.00 ?  30  LEU A HB3  3  
ATOM 3742  H HG   . LEU A 1 39  ? 27.006  86.596  95.080  1.00 0.00 ?  30  LEU A HG   3  
ATOM 3743  H HD11 . LEU A 1 39  ? 28.928  85.926  92.889  1.00 0.00 ?  30  LEU A HD11 3  
ATOM 3744  H HD12 . LEU A 1 39  ? 28.637  87.297  93.943  1.00 0.00 ?  30  LEU A HD12 3  
ATOM 3745  H HD13 . LEU A 1 39  ? 29.321  85.776  94.622  1.00 0.00 ?  30  LEU A HD13 3  
ATOM 3746  H HD21 . LEU A 1 39  ? 26.634  85.332  92.286  1.00 0.00 ?  30  LEU A HD21 3  
ATOM 3747  H HD22 . LEU A 1 39  ? 25.236  85.852  93.310  1.00 0.00 ?  30  LEU A HD22 3  
ATOM 3748  H HD23 . LEU A 1 39  ? 26.480  87.030  92.579  1.00 0.00 ?  30  LEU A HD23 3  
ATOM 3749  N N    . CYS A 1 40  ? 29.328  82.036  93.591  1.00 0.00 ?  31  CYS A N    3  
ATOM 3750  C CA   . CYS A 1 40  ? 30.538  81.595  93.035  1.00 0.00 ?  31  CYS A CA   3  
ATOM 3751  C C    . CYS A 1 40  ? 30.332  80.460  91.932  1.00 0.00 ?  31  CYS A C    3  
ATOM 3752  O O    . CYS A 1 40  ? 29.288  79.782  91.881  1.00 0.00 ?  31  CYS A O    3  
ATOM 3753  C CB   . CYS A 1 40  ? 31.461  81.086  94.128  1.00 0.00 ?  31  CYS A CB   3  
ATOM 3754  S SG   . CYS A 1 40  ? 31.965  82.265  95.392  1.00 0.00 ?  31  CYS A SG   3  
ATOM 3755  H H    . CYS A 1 40  ? 29.105  81.686  94.511  1.00 0.00 ?  31  CYS A H    3  
ATOM 3756  H HA   . CYS A 1 40  ? 30.959  82.447  92.502  1.00 0.00 ?  31  CYS A HA   3  
ATOM 3757  H HB2  . CYS A 1 40  ? 30.928  80.183  94.427  1.00 0.00 ?  31  CYS A HB2  3  
ATOM 3758  H HB3  . CYS A 1 40  ? 32.339  80.742  93.583  1.00 0.00 ?  31  CYS A HB3  3  
ATOM 3759  H HG   . CYS A 1 40  ? 30.800  82.306  96.045  1.00 0.00 ?  31  CYS A HG   3  
ATOM 3760  N N    . ARG A 1 41  ? 31.312  80.247  91.101  1.00 0.00 ?  32  ARG A N    3  
ATOM 3761  C CA   . ARG A 1 41  ? 31.382  79.267  90.041  1.00 0.00 ?  32  ARG A CA   3  
ATOM 3762  C C    . ARG A 1 41  ? 31.730  77.889  90.624  1.00 0.00 ?  32  ARG A C    3  
ATOM 3763  O O    . ARG A 1 41  ? 32.596  77.757  91.547  1.00 0.00 ?  32  ARG A O    3  
ATOM 3764  C CB   . ARG A 1 41  ? 32.151  79.735  88.685  1.00 0.00 ?  32  ARG A CB   3  
ATOM 3765  C CG   . ARG A 1 41  ? 33.601  79.834  88.965  1.00 0.00 ?  32  ARG A CG   3  
ATOM 3766  C CD   . ARG A 1 41  ? 34.421  80.500  87.853  1.00 0.00 ?  32  ARG A CD   3  
ATOM 3767  N NE   . ARG A 1 41  ? 34.726  79.580  86.741  1.00 0.00 ?  32  ARG A NE   3  
ATOM 3768  C CZ   . ARG A 1 41  ? 35.050  79.924  85.477  1.00 0.00 ?  32  ARG A CZ   3  
ATOM 3769  N NH1  . ARG A 1 41  ? 35.305  81.142  85.071  1.00 0.00 ?  32  ARG A NH1  3  
ATOM 3770  N NH2  . ARG A 1 41  ? 35.098  78.999  84.581  1.00 0.00 1  32  ARG A NH2  3  
ATOM 3771  H H    . ARG A 1 41  ? 32.172  80.732  91.314  1.00 0.00 ?  32  ARG A H    3  
ATOM 3772  H HA   . ARG A 1 41  ? 30.359  79.190  89.670  1.00 0.00 ?  32  ARG A HA   3  
ATOM 3773  H HB2  . ARG A 1 41  ? 31.986  79.101  87.814  1.00 0.00 ?  32  ARG A HB2  3  
ATOM 3774  H HB3  . ARG A 1 41  ? 31.879  80.743  88.370  1.00 0.00 ?  32  ARG A HB3  3  
ATOM 3775  H HG2  . ARG A 1 41  ? 33.843  80.441  89.837  1.00 0.00 ?  32  ARG A HG2  3  
ATOM 3776  H HG3  . ARG A 1 41  ? 33.986  78.819  89.070  1.00 0.00 ?  32  ARG A HG3  3  
ATOM 3777  H HD2  . ARG A 1 41  ? 33.802  81.332  87.522  1.00 0.00 ?  32  ARG A HD2  3  
ATOM 3778  H HD3  . ARG A 1 41  ? 35.365  80.905  88.221  1.00 0.00 ?  32  ARG A HD3  3  
ATOM 3779  H HE   . ARG A 1 41  ? 34.705  78.578  86.868  1.00 0.00 ?  32  ARG A HE   3  
ATOM 3780  H HH11 . ARG A 1 41  ? 35.016  81.907  85.664  1.00 0.00 ?  32  ARG A HH11 3  
ATOM 3781  H HH12 . ARG A 1 41  ? 35.696  81.313  84.156  1.00 0.00 ?  32  ARG A HH12 3  
ATOM 3782  H HH21 . ARG A 1 41  ? 35.134  78.023  84.836  1.00 0.00 ?  32  ARG A HH21 3  
ATOM 3783  H HH22 . ARG A 1 41  ? 35.117  79.236  83.599  1.00 0.00 ?  32  ARG A HH22 3  
ATOM 3784  N N    . PRO A 1 42  ? 31.019  76.815  90.139  1.00 0.00 ?  33  PRO A N    3  
ATOM 3785  C CA   . PRO A 1 42  ? 31.150  75.494  90.736  1.00 0.00 ?  33  PRO A CA   3  
ATOM 3786  C C    . PRO A 1 42  ? 32.384  74.723  90.311  1.00 0.00 ?  33  PRO A C    3  
ATOM 3787  O O    . PRO A 1 42  ? 33.228  75.219  89.566  1.00 0.00 ?  33  PRO A O    3  
ATOM 3788  C CB   . PRO A 1 42  ? 29.926  74.765  90.258  1.00 0.00 ?  33  PRO A CB   3  
ATOM 3789  C CG   . PRO A 1 42  ? 29.795  75.327  88.864  1.00 0.00 ?  33  PRO A CG   3  
ATOM 3790  C CD   . PRO A 1 42  ? 30.155  76.777  88.972  1.00 0.00 ?  33  PRO A CD   3  
ATOM 3791  H HA   . PRO A 1 42  ? 31.320  75.625  91.806  1.00 0.00 ?  33  PRO A HA   3  
ATOM 3792  H HB2  . PRO A 1 42  ? 30.095  73.689  90.216  1.00 0.00 ?  33  PRO A HB2  3  
ATOM 3793  H HB3  . PRO A 1 42  ? 29.071  74.935  90.914  1.00 0.00 ?  33  PRO A HB3  3  
ATOM 3794  H HG2  . PRO A 1 42  ? 30.509  74.823  88.211  1.00 0.00 ?  33  PRO A HG2  3  
ATOM 3795  H HG3  . PRO A 1 42  ? 28.829  75.200  88.375  1.00 0.00 ?  33  PRO A HG3  3  
ATOM 3796  H HD2  . PRO A 1 42  ? 30.667  77.107  88.068  1.00 0.00 ?  33  PRO A HD2  3  
ATOM 3797  H HD3  . PRO A 1 42  ? 29.240  77.361  89.074  1.00 0.00 ?  33  PRO A HD3  3  
ATOM 3798  N N    . GLY A 1 43  ? 32.606  73.575  90.915  1.00 0.00 ?  34  GLY A N    3  
ATOM 3799  C CA   . GLY A 1 43  ? 33.824  72.826  90.936  1.00 0.00 ?  34  GLY A CA   3  
ATOM 3800  C C    . GLY A 1 43  ? 33.608  71.294  91.251  1.00 0.00 ?  34  GLY A C    3  
ATOM 3801  O O    . GLY A 1 43  ? 32.419  70.873  91.379  1.00 0.00 ?  34  GLY A O    3  
ATOM 3802  H H    . GLY A 1 43  ? 31.787  73.111  91.284  1.00 0.00 ?  34  GLY A H    3  
ATOM 3803  H HA2  . GLY A 1 43  ? 34.417  72.890  90.023  1.00 0.00 ?  34  GLY A HA2  3  
ATOM 3804  H HA3  . GLY A 1 43  ? 34.558  73.199  91.652  1.00 0.00 ?  34  GLY A HA3  3  
ATOM 3805  N N    . PRO A 1 44  ? 34.624  70.507  91.442  1.00 0.00 ?  35  PRO A N    3  
ATOM 3806  C CA   . PRO A 1 44  ? 34.574  69.022  91.671  1.00 0.00 ?  35  PRO A CA   3  
ATOM 3807  C C    . PRO A 1 44  ? 33.745  68.526  92.836  1.00 0.00 ?  35  PRO A C    3  
ATOM 3808  O O    . PRO A 1 44  ? 33.568  69.284  93.774  1.00 0.00 ?  35  PRO A O    3  
ATOM 3809  C CB   . PRO A 1 44  ? 36.041  68.594  91.563  1.00 0.00 ?  35  PRO A CB   3  
ATOM 3810  C CG   . PRO A 1 44  ? 36.761  69.709  90.855  1.00 0.00 ?  35  PRO A CG   3  
ATOM 3811  C CD   . PRO A 1 44  ? 35.954  70.970  91.387  1.00 0.00 ?  35  PRO A CD   3  
ATOM 3812  H HA   . PRO A 1 44  ? 34.116  68.640  90.758  1.00 0.00 ?  35  PRO A HA   3  
ATOM 3813  H HB2  . PRO A 1 44  ? 36.484  68.266  92.503  1.00 0.00 ?  35  PRO A HB2  3  
ATOM 3814  H HB3  . PRO A 1 44  ? 36.082  67.661  91.001  1.00 0.00 ?  35  PRO A HB3  3  
ATOM 3815  H HG2  . PRO A 1 44  ? 37.827  69.834  91.039  1.00 0.00 ?  35  PRO A HG2  3  
ATOM 3816  H HG3  . PRO A 1 44  ? 36.592  69.630  89.781  1.00 0.00 ?  35  PRO A HG3  3  
ATOM 3817  H HD2  . PRO A 1 44  ? 36.375  71.325  92.328  1.00 0.00 ?  35  PRO A HD2  3  
ATOM 3818  H HD3  . PRO A 1 44  ? 36.155  71.731  90.633  1.00 0.00 ?  35  PRO A HD3  3  
ATOM 3819  N N    . GLY A 1 45  ? 33.317  67.277  92.868  1.00 0.00 ?  36  GLY A N    3  
ATOM 3820  C CA   . GLY A 1 45  ? 32.596  66.505  93.936  1.00 0.00 ?  36  GLY A CA   3  
ATOM 3821  C C    . GLY A 1 45  ? 31.099  66.228  93.572  1.00 0.00 ?  36  GLY A C    3  
ATOM 3822  O O    . GLY A 1 45  ? 30.584  66.781  92.600  1.00 0.00 ?  36  GLY A O    3  
ATOM 3823  H H    . GLY A 1 45  ? 33.525  66.778  92.014  1.00 0.00 ?  36  GLY A H    3  
ATOM 3824  H HA2  . GLY A 1 45  ? 33.178  65.600  94.109  1.00 0.00 ?  36  GLY A HA2  3  
ATOM 3825  H HA3  . GLY A 1 45  ? 32.587  66.990  94.912  1.00 0.00 ?  36  GLY A HA3  3  
ATOM 3826  N N    . LEU A 1 46  ? 30.364  65.491  94.433  1.00 0.00 ?  37  LEU A N    3  
ATOM 3827  C CA   . LEU A 1 46  ? 29.056  64.964  94.139  1.00 0.00 ?  37  LEU A CA   3  
ATOM 3828  C C    . LEU A 1 46  ? 27.936  65.888  94.727  1.00 0.00 ?  37  LEU A C    3  
ATOM 3829  O O    . LEU A 1 46  ? 26.769  65.675  94.476  1.00 0.00 ?  37  LEU A O    3  
ATOM 3830  C CB   . LEU A 1 46  ? 28.998  63.579  94.840  1.00 0.00 ?  37  LEU A CB   3  
ATOM 3831  C CG   . LEU A 1 46  ? 27.820  62.592  94.479  1.00 0.00 ?  37  LEU A CG   3  
ATOM 3832  C CD1  . LEU A 1 46  ? 27.751  62.369  92.976  1.00 0.00 ?  37  LEU A CD1  3  
ATOM 3833  C CD2  . LEU A 1 46  ? 28.252  61.251  94.987  1.00 0.00 ?  37  LEU A CD2  3  
ATOM 3834  H H    . LEU A 1 46  ? 30.806  65.225  95.301  1.00 0.00 ?  37  LEU A H    3  
ATOM 3835  H HA   . LEU A 1 46  ? 28.969  64.863  93.057  1.00 0.00 ?  37  LEU A HA   3  
ATOM 3836  H HB2  . LEU A 1 46  ? 29.915  63.074  94.538  1.00 0.00 ?  37  LEU A HB2  3  
ATOM 3837  H HB3  . LEU A 1 46  ? 29.070  63.631  95.927  1.00 0.00 ?  37  LEU A HB3  3  
ATOM 3838  H HG   . LEU A 1 46  ? 26.819  62.857  94.819  1.00 0.00 ?  37  LEU A HG   3  
ATOM 3839  H HD11 . LEU A 1 46  ? 27.625  63.368  92.560  1.00 0.00 ?  37  LEU A HD11 3  
ATOM 3840  H HD12 . LEU A 1 46  ? 28.598  61.857  92.521  1.00 0.00 ?  37  LEU A HD12 3  
ATOM 3841  H HD13 . LEU A 1 46  ? 26.842  61.805  92.769  1.00 0.00 ?  37  LEU A HD13 3  
ATOM 3842  H HD21 . LEU A 1 46  ? 27.582  60.403  94.843  1.00 0.00 ?  37  LEU A HD21 3  
ATOM 3843  H HD22 . LEU A 1 46  ? 29.192  60.924  94.539  1.00 0.00 ?  37  LEU A HD22 3  
ATOM 3844  H HD23 . LEU A 1 46  ? 28.377  61.412  96.057  1.00 0.00 ?  37  LEU A HD23 3  
ATOM 3845  N N    . GLY A 1 47  ? 28.304  66.849  95.543  1.00 0.00 ?  38  GLY A N    3  
ATOM 3846  C CA   . GLY A 1 47  ? 27.389  67.923  96.005  1.00 0.00 ?  38  GLY A CA   3  
ATOM 3847  C C    . GLY A 1 47  ? 28.005  69.081  96.850  1.00 0.00 ?  38  GLY A C    3  
ATOM 3848  O O    . GLY A 1 47  ? 28.961  68.853  97.568  1.00 0.00 ?  38  GLY A O    3  
ATOM 3849  H H    . GLY A 1 47  ? 29.233  66.918  95.935  1.00 0.00 ?  38  GLY A H    3  
ATOM 3850  H HA2  . GLY A 1 47  ? 26.937  68.456  95.170  1.00 0.00 ?  38  GLY A HA2  3  
ATOM 3851  H HA3  . GLY A 1 47  ? 26.596  67.385  96.525  1.00 0.00 ?  38  GLY A HA3  3  
ATOM 3852  N N    . PRO A 1 48  ? 27.456  70.319  96.924  1.00 0.00 ?  39  PRO A N    3  
ATOM 3853  C CA   . PRO A 1 48  ? 28.229  71.390  97.515  1.00 0.00 ?  39  PRO A CA   3  
ATOM 3854  C C    . PRO A 1 48  ? 28.183  71.226  99.037  1.00 0.00 ?  39  PRO A C    3  
ATOM 3855  O O    . PRO A 1 48  ? 27.200  70.742  99.695  1.00 0.00 ?  39  PRO A O    3  
ATOM 3856  C CB   . PRO A 1 48  ? 27.572  72.656  97.090  1.00 0.00 ?  39  PRO A CB   3  
ATOM 3857  C CG   . PRO A 1 48  ? 26.136  72.204  96.682  1.00 0.00 ?  39  PRO A CG   3  
ATOM 3858  C CD   . PRO A 1 48  ? 26.397  70.775  96.178  1.00 0.00 ?  39  PRO A CD   3  
ATOM 3859  H HA   . PRO A 1 48  ? 29.263  71.483  97.183  1.00 0.00 ?  39  PRO A HA   3  
ATOM 3860  H HB2  . PRO A 1 48  ? 27.588  73.388  97.897  1.00 0.00 ?  39  PRO A HB2  3  
ATOM 3861  H HB3  . PRO A 1 48  ? 27.973  73.171  96.217  1.00 0.00 ?  39  PRO A HB3  3  
ATOM 3862  H HG2  . PRO A 1 48  ? 25.611  72.125  97.634  1.00 0.00 ?  39  PRO A HG2  3  
ATOM 3863  H HG3  . PRO A 1 48  ? 25.580  72.875  96.027  1.00 0.00 ?  39  PRO A HG3  3  
ATOM 3864  H HD2  . PRO A 1 48  ? 25.460  70.294  96.459  1.00 0.00 ?  39  PRO A HD2  3  
ATOM 3865  H HD3  . PRO A 1 48  ? 26.407  70.772  95.089  1.00 0.00 ?  39  PRO A HD3  3  
ATOM 3866  N N    . ASP A 1 49  ? 29.368  71.575  99.636  1.00 0.00 ?  40  ASP A N    3  
ATOM 3867  C CA   . ASP A 1 49  ? 29.801  71.173  101.056 1.00 0.00 ?  40  ASP A CA   3  
ATOM 3868  C C    . ASP A 1 49  ? 28.923  71.625  102.183 1.00 0.00 ?  40  ASP A C    3  
ATOM 3869  O O    . ASP A 1 49  ? 28.956  71.087  103.279 1.00 0.00 ?  40  ASP A O    3  
ATOM 3870  C CB   . ASP A 1 49  ? 31.285  71.431  101.238 1.00 0.00 ?  40  ASP A CB   3  
ATOM 3871  C CG   . ASP A 1 49  ? 32.281  70.422  100.631 1.00 0.00 ?  40  ASP A CG   3  
ATOM 3872  O OD1  . ASP A 1 49  ? 31.906  69.466  99.950  1.00 0.00 ?  40  ASP A OD1  3  
ATOM 3873  O OD2  . ASP A 1 49  ? 33.480  70.666  100.757 1.00 0.00 -1 40  ASP A OD2  3  
ATOM 3874  H H    . ASP A 1 49  ? 30.090  71.770  98.958  1.00 0.00 ?  40  ASP A H    3  
ATOM 3875  H HA   . ASP A 1 49  ? 29.767  70.087  101.144 1.00 0.00 ?  40  ASP A HA   3  
ATOM 3876  H HB2  . ASP A 1 49  ? 31.505  72.427  100.853 1.00 0.00 ?  40  ASP A HB2  3  
ATOM 3877  H HB3  . ASP A 1 49  ? 31.615  71.300  102.269 1.00 0.00 ?  40  ASP A HB3  3  
ATOM 3878  N N    . ASN A 1 50  ? 28.054  72.582  101.902 1.00 0.00 ?  41  ASN A N    3  
ATOM 3879  C CA   . ASN A 1 50  ? 27.280  73.254  102.992 1.00 0.00 ?  41  ASN A CA   3  
ATOM 3880  C C    . ASN A 1 50  ? 25.817  72.967  102.877 1.00 0.00 ?  41  ASN A C    3  
ATOM 3881  O O    . ASN A 1 50  ? 24.999  73.565  103.649 1.00 0.00 ?  41  ASN A O    3  
ATOM 3882  C CB   . ASN A 1 50  ? 27.539  74.819  102.827 1.00 0.00 ?  41  ASN A CB   3  
ATOM 3883  C CG   . ASN A 1 50  ? 29.011  75.227  103.119 1.00 0.00 ?  41  ASN A CG   3  
ATOM 3884  O OD1  . ASN A 1 50  ? 29.390  75.286  104.285 1.00 0.00 ?  41  ASN A OD1  3  
ATOM 3885  N ND2  . ASN A 1 50  ? 29.792  75.713  102.197 1.00 0.00 ?  41  ASN A ND2  3  
ATOM 3886  H H    . ASN A 1 50  ? 28.160  73.059  101.018 1.00 0.00 ?  41  ASN A H    3  
ATOM 3887  H HA   . ASN A 1 50  ? 27.522  72.828  103.965 1.00 0.00 ?  41  ASN A HA   3  
ATOM 3888  H HB2  . ASN A 1 50  ? 27.270  75.207  101.845 1.00 0.00 ?  41  ASN A HB2  3  
ATOM 3889  H HB3  . ASN A 1 50  ? 26.888  75.270  103.575 1.00 0.00 ?  41  ASN A HB3  3  
ATOM 3890  H HD21 . ASN A 1 50  ? 29.541  75.505  101.241 1.00 0.00 ?  41  ASN A HD21 3  
ATOM 3891  H HD22 . ASN A 1 50  ? 30.777  75.777  102.406 1.00 0.00 ?  41  ASN A HD22 3  
ATOM 3892  N N    . GLN A 1 51  ? 25.411  72.156  101.996 1.00 0.00 ?  42  GLN A N    3  
ATOM 3893  C CA   . GLN A 1 51  ? 23.988  71.987  101.697 1.00 0.00 ?  42  GLN A CA   3  
ATOM 3894  C C    . GLN A 1 51  ? 23.340  71.387  102.873 1.00 0.00 ?  42  GLN A C    3  
ATOM 3895  O O    . GLN A 1 51  ? 23.734  70.292  103.343 1.00 0.00 ?  42  GLN A O    3  
ATOM 3896  C CB   . GLN A 1 51  ? 23.750  70.989  100.544 1.00 0.00 ?  42  GLN A CB   3  
ATOM 3897  C CG   . GLN A 1 51  ? 22.430  71.169  99.883  1.00 0.00 ?  42  GLN A CG   3  
ATOM 3898  C CD   . GLN A 1 51  ? 22.356  72.044  98.659  1.00 0.00 ?  42  GLN A CD   3  
ATOM 3899  O OE1  . GLN A 1 51  ? 21.770  73.096  98.730  1.00 0.00 ?  42  GLN A OE1  3  
ATOM 3900  N NE2  . GLN A 1 51  ? 23.089  71.683  97.603  1.00 0.00 ?  42  GLN A NE2  3  
ATOM 3901  H H    . GLN A 1 51  ? 26.091  71.669  101.431 1.00 0.00 ?  42  GLN A H    3  
ATOM 3902  H HA   . GLN A 1 51  ? 23.622  72.965  101.386 1.00 0.00 ?  42  GLN A HA   3  
ATOM 3903  H HB2  . GLN A 1 51  ? 24.505  71.173  99.780  1.00 0.00 ?  42  GLN A HB2  3  
ATOM 3904  H HB3  . GLN A 1 51  ? 23.851  69.948  100.850 1.00 0.00 ?  42  GLN A HB3  3  
ATOM 3905  H HG2  . GLN A 1 51  ? 22.184  70.148  99.590  1.00 0.00 ?  42  GLN A HG2  3  
ATOM 3906  H HG3  . GLN A 1 51  ? 21.706  71.538  100.609 1.00 0.00 ?  42  GLN A HG3  3  
ATOM 3907  H HE21 . GLN A 1 51  ? 23.572  70.801  97.503  1.00 0.00 ?  42  GLN A HE21 3  
ATOM 3908  H HE22 . GLN A 1 51  ? 22.894  72.267  96.803  1.00 0.00 ?  42  GLN A HE22 3  
ATOM 3909  N N    . THR A 1 52  ? 22.442  72.069  103.464 1.00 0.00 ?  43  THR A N    3  
ATOM 3910  C CA   . THR A 1 52  ? 21.619  71.720  104.652 1.00 0.00 ?  43  THR A CA   3  
ATOM 3911  C C    . THR A 1 52  ? 20.410  70.823  104.347 1.00 0.00 ?  43  THR A C    3  
ATOM 3912  O O    . THR A 1 52  ? 19.902  70.098  105.193 1.00 0.00 ?  43  THR A O    3  
ATOM 3913  C CB   . THR A 1 52  ? 21.363  72.851  105.595 1.00 0.00 ?  43  THR A CB   3  
ATOM 3914  O OG1  . THR A 1 52  ? 20.154  73.556  105.122 1.00 0.00 ?  43  THR A OG1  3  
ATOM 3915  C CG2  . THR A 1 52  ? 22.582  73.897  105.614 1.00 0.00 ?  43  THR A CG2  3  
ATOM 3916  H H    . THR A 1 52  ? 22.069  72.856  102.951 1.00 0.00 ?  43  THR A H    3  
ATOM 3917  H HA   . THR A 1 52  ? 22.287  71.126  105.275 1.00 0.00 ?  43  THR A HA   3  
ATOM 3918  H HB   . THR A 1 52  ? 21.101  72.535  106.605 1.00 0.00 ?  43  THR A HB   3  
ATOM 3919  H HG1  . THR A 1 52  ? 20.385  74.380  104.687 1.00 0.00 ?  43  THR A HG1  3  
ATOM 3920  H HG21 . THR A 1 52  ? 23.436  73.410  106.085 1.00 0.00 ?  43  THR A HG21 3  
ATOM 3921  H HG22 . THR A 1 52  ? 22.782  74.379  104.658 1.00 0.00 ?  43  THR A HG22 3  
ATOM 3922  H HG23 . THR A 1 52  ? 22.320  74.684  106.321 1.00 0.00 ?  43  THR A HG23 3  
ATOM 3923  N N    . GLU A 1 53  ? 19.941  70.946  103.066 1.00 0.00 ?  44  GLU A N    3  
ATOM 3924  C CA   . GLU A 1 53  ? 18.994  69.935  102.477 1.00 0.00 ?  44  GLU A CA   3  
ATOM 3925  C C    . GLU A 1 53  ? 19.766  68.712  102.039 1.00 0.00 ?  44  GLU A C    3  
ATOM 3926  O O    . GLU A 1 53  ? 20.848  68.788  101.536 1.00 0.00 ?  44  GLU A O    3  
ATOM 3927  C CB   . GLU A 1 53  ? 18.364  70.600  101.216 1.00 0.00 ?  44  GLU A CB   3  
ATOM 3928  C CG   . GLU A 1 53  ? 17.590  71.943  101.342 1.00 0.00 ?  44  GLU A CG   3  
ATOM 3929  C CD   . GLU A 1 53  ? 16.066  71.833  101.473 1.00 0.00 ?  44  GLU A CD   3  
ATOM 3930  O OE1  . GLU A 1 53  ? 15.475  70.816  101.964 1.00 0.00 -1 44  GLU A OE1  3  
ATOM 3931  O OE2  . GLU A 1 53  ? 15.333  72.827  101.107 1.00 0.00 ?  44  GLU A OE2  3  
ATOM 3932  H H    . GLU A 1 53  ? 20.333  71.632  102.436 1.00 0.00 ?  44  GLU A H    3  
ATOM 3933  H HA   . GLU A 1 53  ? 18.287  69.615  103.242 1.00 0.00 ?  44  GLU A HA   3  
ATOM 3934  H HB2  . GLU A 1 53  ? 19.103  70.801  100.440 1.00 0.00 ?  44  GLU A HB2  3  
ATOM 3935  H HB3  . GLU A 1 53  ? 17.750  69.849  100.717 1.00 0.00 ?  44  GLU A HB3  3  
ATOM 3936  H HG2  . GLU A 1 53  ? 18.097  72.409  102.187 1.00 0.00 ?  44  GLU A HG2  3  
ATOM 3937  H HG3  . GLU A 1 53  ? 17.710  72.406  100.363 1.00 0.00 ?  44  GLU A HG3  3  
ATOM 3938  N N    . GLU A 1 54  ? 19.018  67.602  102.024 1.00 0.00 ?  45  GLU A N    3  
ATOM 3939  C CA   . GLU A 1 54  ? 19.336  66.378  101.519 1.00 0.00 ?  45  GLU A CA   3  
ATOM 3940  C C    . GLU A 1 54  ? 18.970  66.177  100.112 1.00 0.00 ?  45  GLU A C    3  
ATOM 3941  O O    . GLU A 1 54  ? 17.899  65.597  99.757  1.00 0.00 ?  45  GLU A O    3  
ATOM 3942  C CB   . GLU A 1 54  ? 18.785  65.366  102.560 1.00 0.00 ?  45  GLU A CB   3  
ATOM 3943  C CG   . GLU A 1 54  ? 19.101  63.923  102.243 1.00 0.00 ?  45  GLU A CG   3  
ATOM 3944  C CD   . GLU A 1 54  ? 20.529  63.606  102.104 1.00 0.00 ?  45  GLU A CD   3  
ATOM 3945  O OE1  . GLU A 1 54  ? 21.295  64.272  102.827 1.00 0.00 ?  45  GLU A OE1  3  
ATOM 3946  O OE2  . GLU A 1 54  ? 20.920  62.717  101.335 1.00 0.00 -1 45  GLU A OE2  3  
ATOM 3947  H H    . GLU A 1 54  ? 18.066  67.628  102.360 1.00 0.00 ?  45  GLU A H    3  
ATOM 3948  H HA   . GLU A 1 54  ? 20.422  66.298  101.571 1.00 0.00 ?  45  GLU A HA   3  
ATOM 3949  H HB2  . GLU A 1 54  ? 19.226  65.722  103.492 1.00 0.00 ?  45  GLU A HB2  3  
ATOM 3950  H HB3  . GLU A 1 54  ? 17.705  65.492  102.619 1.00 0.00 ?  45  GLU A HB3  3  
ATOM 3951  H HG2  . GLU A 1 54  ? 18.744  63.317  103.075 1.00 0.00 ?  45  GLU A HG2  3  
ATOM 3952  H HG3  . GLU A 1 54  ? 18.527  63.629  101.364 1.00 0.00 ?  45  GLU A HG3  3  
ATOM 3953  N N    . ARG A 1 55  ? 19.714  66.728  99.136  1.00 0.00 ?  46  ARG A N    3  
ATOM 3954  C CA   . ARG A 1 55  ? 19.505  66.541  97.709  1.00 0.00 ?  46  ARG A CA   3  
ATOM 3955  C C    . ARG A 1 55  ? 20.059  65.162  97.195  1.00 0.00 ?  46  ARG A C    3  
ATOM 3956  O O    . ARG A 1 55  ? 20.897  64.608  97.840  1.00 0.00 ?  46  ARG A O    3  
ATOM 3957  C CB   . ARG A 1 55  ? 20.198  67.741  96.993  1.00 0.00 ?  46  ARG A CB   3  
ATOM 3958  C CG   . ARG A 1 55  ? 19.625  69.144  97.256  1.00 0.00 ?  46  ARG A CG   3  
ATOM 3959  C CD   . ARG A 1 55  ? 18.200  69.384  96.758  1.00 0.00 ?  46  ARG A CD   3  
ATOM 3960  N NE   . ARG A 1 55  ? 17.955  69.037  95.367  1.00 0.00 ?  46  ARG A NE   3  
ATOM 3961  C CZ   . ARG A 1 55  ? 17.760  69.904  94.334  1.00 0.00 ?  46  ARG A CZ   3  
ATOM 3962  N NH1  . ARG A 1 55  ? 17.778  71.184  94.479  1.00 0.00 ?  46  ARG A NH1  3  
ATOM 3963  N NH2  . ARG A 1 55  ? 17.550  69.405  93.178  1.00 0.00 1  46  ARG A NH2  3  
ATOM 3964  H H    . ARG A 1 55  ? 20.566  67.190  99.419  1.00 0.00 ?  46  ARG A H    3  
ATOM 3965  H HA   . ARG A 1 55  ? 18.434  66.632  97.528  1.00 0.00 ?  46  ARG A HA   3  
ATOM 3966  H HB2  . ARG A 1 55  ? 21.254  67.705  97.263  1.00 0.00 ?  46  ARG A HB2  3  
ATOM 3967  H HB3  . ARG A 1 55  ? 20.127  67.498  95.933  1.00 0.00 ?  46  ARG A HB3  3  
ATOM 3968  H HG2  . ARG A 1 55  ? 19.656  69.382  98.320  1.00 0.00 ?  46  ARG A HG2  3  
ATOM 3969  H HG3  . ARG A 1 55  ? 20.278  69.885  96.796  1.00 0.00 ?  46  ARG A HG3  3  
ATOM 3970  H HD2  . ARG A 1 55  ? 17.599  68.693  97.350  1.00 0.00 ?  46  ARG A HD2  3  
ATOM 3971  H HD3  . ARG A 1 55  ? 17.822  70.394  96.911  1.00 0.00 ?  46  ARG A HD3  3  
ATOM 3972  H HE   . ARG A 1 55  ? 17.912  68.049  95.162  1.00 0.00 ?  46  ARG A HE   3  
ATOM 3973  H HH11 . ARG A 1 55  ? 18.138  71.565  95.342  1.00 0.00 ?  46  ARG A HH11 3  
ATOM 3974  H HH12 . ARG A 1 55  ? 17.610  71.716  93.637  1.00 0.00 ?  46  ARG A HH12 3  
ATOM 3975  H HH21 . ARG A 1 55  ? 17.294  68.434  93.069  1.00 0.00 ?  46  ARG A HH21 3  
ATOM 3976  H HH22 . ARG A 1 55  ? 17.290  70.086  92.479  1.00 0.00 ?  46  ARG A HH22 3  
ATOM 3977  N N    . ARG A 1 56  ? 19.442  64.633  96.102  1.00 0.00 ?  47  ARG A N    3  
ATOM 3978  C CA   . ARG A 1 56  ? 19.589  63.220  95.652  1.00 0.00 ?  47  ARG A CA   3  
ATOM 3979  C C    . ARG A 1 56  ? 20.179  63.086  94.223  1.00 0.00 ?  47  ARG A C    3  
ATOM 3980  O O    . ARG A 1 56  ? 19.537  63.505  93.245  1.00 0.00 ?  47  ARG A O    3  
ATOM 3981  C CB   . ARG A 1 56  ? 18.186  62.613  95.844  1.00 0.00 ?  47  ARG A CB   3  
ATOM 3982  C CG   . ARG A 1 56  ? 17.876  61.297  95.129  1.00 0.00 ?  47  ARG A CG   3  
ATOM 3983  C CD   . ARG A 1 56  ? 16.514  60.778  95.551  1.00 0.00 ?  47  ARG A CD   3  
ATOM 3984  N NE   . ARG A 1 56  ? 16.485  60.130  96.797  1.00 0.00 ?  47  ARG A NE   3  
ATOM 3985  C CZ   . ARG A 1 56  ? 15.378  59.976  97.533  1.00 0.00 ?  47  ARG A CZ   3  
ATOM 3986  N NH1  . ARG A 1 56  ? 14.202  60.255  97.110  1.00 0.00 ?  47  ARG A NH1  3  
ATOM 3987  N NH2  . ARG A 1 56  ? 15.449  59.687  98.792  1.00 0.00 1  47  ARG A NH2  3  
ATOM 3988  H H    . ARG A 1 56  ? 18.715  65.219  95.715  1.00 0.00 ?  47  ARG A H    3  
ATOM 3989  H HA   . ARG A 1 56  ? 20.299  62.672  96.269  1.00 0.00 ?  47  ARG A HA   3  
ATOM 3990  H HB2  . ARG A 1 56  ? 18.075  62.363  96.899  1.00 0.00 ?  47  ARG A HB2  3  
ATOM 3991  H HB3  . ARG A 1 56  ? 17.397  63.315  95.577  1.00 0.00 ?  47  ARG A HB3  3  
ATOM 3992  H HG2  . ARG A 1 56  ? 17.990  61.503  94.065  1.00 0.00 ?  47  ARG A HG2  3  
ATOM 3993  H HG3  . ARG A 1 56  ? 18.732  60.652  95.326  1.00 0.00 ?  47  ARG A HG3  3  
ATOM 3994  H HD2  . ARG A 1 56  ? 15.881  61.665  95.533  1.00 0.00 ?  47  ARG A HD2  3  
ATOM 3995  H HD3  . ARG A 1 56  ? 16.231  60.049  94.792  1.00 0.00 ?  47  ARG A HD3  3  
ATOM 3996  H HE   . ARG A 1 56  ? 17.368  59.846  97.195  1.00 0.00 ?  47  ARG A HE   3  
ATOM 3997  H HH11 . ARG A 1 56  ? 14.149  60.480  96.126  1.00 0.00 ?  47  ARG A HH11 3  
ATOM 3998  H HH12 . ARG A 1 56  ? 13.365  60.166  97.668  1.00 0.00 ?  47  ARG A HH12 3  
ATOM 3999  H HH21 . ARG A 1 56  ? 16.365  59.694  99.217  1.00 0.00 ?  47  ARG A HH21 3  
ATOM 4000  H HH22 . ARG A 1 56  ? 14.607  59.791  99.340  1.00 0.00 ?  47  ARG A HH22 3  
ATOM 4001  N N    . ALA A 1 57  ? 21.442  62.587  94.114  1.00 0.00 ?  48  ALA A N    3  
ATOM 4002  C CA   . ALA A 1 57  ? 22.225  62.438  92.844  1.00 0.00 ?  48  ALA A CA   3  
ATOM 4003  C C    . ALA A 1 57  ? 21.640  61.455  91.819  1.00 0.00 ?  48  ALA A C    3  
ATOM 4004  O O    . ALA A 1 57  ? 20.740  60.738  92.190  1.00 0.00 ?  48  ALA A O    3  
ATOM 4005  C CB   . ALA A 1 57  ? 23.609  61.959  93.309  1.00 0.00 ?  48  ALA A CB   3  
ATOM 4006  H H    . ALA A 1 57  ? 21.866  62.125  94.907  1.00 0.00 ?  48  ALA A H    3  
ATOM 4007  H HA   . ALA A 1 57  ? 22.338  63.405  92.353  1.00 0.00 ?  48  ALA A HA   3  
ATOM 4008  H HB1  . ALA A 1 57  ? 24.215  62.155  92.425  1.00 0.00 ?  48  ALA A HB1  3  
ATOM 4009  H HB2  . ALA A 1 57  ? 24.021  62.514  94.151  1.00 0.00 ?  48  ALA A HB2  3  
ATOM 4010  H HB3  . ALA A 1 57  ? 23.770  60.909  93.553  1.00 0.00 ?  48  ALA A HB3  3  
ATOM 4011  N N    . SER A 1 58  ? 22.163  61.410  90.591  1.00 0.00 ?  49  SER A N    3  
ATOM 4012  C CA   . SER A 1 58  ? 21.882  60.425  89.588  1.00 0.00 ?  49  SER A CA   3  
ATOM 4013  C C    . SER A 1 58  ? 23.235  60.044  88.974  1.00 0.00 ?  49  SER A C    3  
ATOM 4014  O O    . SER A 1 58  ? 23.714  58.915  89.179  1.00 0.00 ?  49  SER A O    3  
ATOM 4015  C CB   . SER A 1 58  ? 20.854  60.895  88.506  1.00 0.00 ?  49  SER A CB   3  
ATOM 4016  O OG   . SER A 1 58  ? 21.258  61.950  87.663  1.00 0.00 ?  49  SER A OG   3  
ATOM 4017  H H    . SER A 1 58  ? 22.787  62.142  90.284  1.00 0.00 ?  49  SER A H    3  
ATOM 4018  H HA   . SER A 1 58  ? 21.582  59.573  90.199  1.00 0.00 ?  49  SER A HA   3  
ATOM 4019  H HB2  . SER A 1 58  ? 20.571  59.965  88.012  1.00 0.00 ?  49  SER A HB2  3  
ATOM 4020  H HB3  . SER A 1 58  ? 19.878  61.160  88.911  1.00 0.00 ?  49  SER A HB3  3  
ATOM 4021  H HG   . SER A 1 58  ? 21.001  62.707  88.194  1.00 0.00 ?  49  SER A HG   3  
ATOM 4022  N N    . LEU A 1 59  ? 23.858  60.901  88.270  1.00 0.00 ?  50  LEU A N    3  
ATOM 4023  C CA   . LEU A 1 59  ? 25.178  60.725  87.618  1.00 0.00 ?  50  LEU A CA   3  
ATOM 4024  C C    . LEU A 1 59  ? 26.460  60.897  88.538  1.00 0.00 ?  50  LEU A C    3  
ATOM 4025  O O    . LEU A 1 59  ? 26.339  61.530  89.583  1.00 0.00 ?  50  LEU A O    3  
ATOM 4026  C CB   . LEU A 1 59  ? 25.200  61.749  86.419  1.00 0.00 ?  50  LEU A CB   3  
ATOM 4027  C CG   . LEU A 1 59  ? 24.128  61.437  85.383  1.00 0.00 ?  50  LEU A CG   3  
ATOM 4028  C CD1  . LEU A 1 59  ? 23.795  62.657  84.531  1.00 0.00 ?  50  LEU A CD1  3  
ATOM 4029  C CD2  . LEU A 1 59  ? 24.694  60.419  84.388  1.00 0.00 ?  50  LEU A CD2  3  
ATOM 4030  H H    . LEU A 1 59  ? 23.430  61.814  88.226  1.00 0.00 ?  50  LEU A H    3  
ATOM 4031  H HA   . LEU A 1 59  ? 25.182  59.737  87.157  1.00 0.00 ?  50  LEU A HA   3  
ATOM 4032  H HB2  . LEU A 1 59  ? 25.090  62.754  86.825  1.00 0.00 ?  50  LEU A HB2  3  
ATOM 4033  H HB3  . LEU A 1 59  ? 26.186  61.645  85.965  1.00 0.00 ?  50  LEU A HB3  3  
ATOM 4034  H HG   . LEU A 1 59  ? 23.199  61.077  85.826  1.00 0.00 ?  50  LEU A HG   3  
ATOM 4035  H HD11 . LEU A 1 59  ? 23.671  63.572  85.108  1.00 0.00 ?  50  LEU A HD11 3  
ATOM 4036  H HD12 . LEU A 1 59  ? 24.552  62.914  83.789  1.00 0.00 ?  50  LEU A HD12 3  
ATOM 4037  H HD13 . LEU A 1 59  ? 22.832  62.386  84.094  1.00 0.00 ?  50  LEU A HD13 3  
ATOM 4038  H HD21 . LEU A 1 59  ? 25.726  60.649  84.122  1.00 0.00 ?  50  LEU A HD21 3  
ATOM 4039  H HD22 . LEU A 1 59  ? 24.622  59.427  84.834  1.00 0.00 ?  50  LEU A HD22 3  
ATOM 4040  H HD23 . LEU A 1 59  ? 24.201  60.372  83.418  1.00 0.00 ?  50  LEU A HD23 3  
ATOM 4041  N N    . PRO A 1 60  ? 27.593  60.319  88.225  1.00 0.00 ?  51  PRO A N    3  
ATOM 4042  C CA   . PRO A 1 60  ? 28.806  60.644  88.922  1.00 0.00 ?  51  PRO A CA   3  
ATOM 4043  C C    . PRO A 1 60  ? 29.228  62.130  89.036  1.00 0.00 ?  51  PRO A C    3  
ATOM 4044  O O    . PRO A 1 60  ? 28.863  62.976  88.180  1.00 0.00 ?  51  PRO A O    3  
ATOM 4045  C CB   . PRO A 1 60  ? 29.971  59.875  88.248  1.00 0.00 ?  51  PRO A CB   3  
ATOM 4046  C CG   . PRO A 1 60  ? 29.240  58.796  87.396  1.00 0.00 ?  51  PRO A CG   3  
ATOM 4047  C CD   . PRO A 1 60  ? 27.866  59.312  87.182  1.00 0.00 ?  51  PRO A CD   3  
ATOM 4048  H HA   . PRO A 1 60  ? 28.622  60.343  89.953  1.00 0.00 ?  51  PRO A HA   3  
ATOM 4049  H HB2  . PRO A 1 60  ? 30.629  60.506  87.649  1.00 0.00 ?  51  PRO A HB2  3  
ATOM 4050  H HB3  . PRO A 1 60  ? 30.617  59.384  88.976  1.00 0.00 ?  51  PRO A HB3  3  
ATOM 4051  H HG2  . PRO A 1 60  ? 29.861  58.802  86.500  1.00 0.00 ?  51  PRO A HG2  3  
ATOM 4052  H HG3  . PRO A 1 60  ? 29.230  57.802  87.843  1.00 0.00 ?  51  PRO A HG3  3  
ATOM 4053  H HD2  . PRO A 1 60  ? 27.868  59.953  86.300  1.00 0.00 ?  51  PRO A HD2  3  
ATOM 4054  H HD3  . PRO A 1 60  ? 27.094  58.544  87.133  1.00 0.00 ?  51  PRO A HD3  3  
ATOM 4055  N N    . GLY A 1 61  ? 29.968  62.533  90.084  1.00 0.00 ?  52  GLY A N    3  
ATOM 4056  C CA   . GLY A 1 61  ? 30.345  63.864  90.501  1.00 0.00 ?  52  GLY A CA   3  
ATOM 4057  C C    . GLY A 1 61  ? 31.199  64.583  89.482  1.00 0.00 ?  52  GLY A C    3  
ATOM 4058  O O    . GLY A 1 61  ? 31.498  64.054  88.375  1.00 0.00 ?  52  GLY A O    3  
ATOM 4059  H H    . GLY A 1 61  ? 30.219  61.758  90.681  1.00 0.00 ?  52  GLY A H    3  
ATOM 4060  H HA2  . GLY A 1 61  ? 29.421  64.440  90.546  1.00 0.00 ?  52  GLY A HA2  3  
ATOM 4061  H HA3  . GLY A 1 61  ? 30.885  63.973  91.441  1.00 0.00 ?  52  GLY A HA3  3  
ATOM 4062  N N    . ARG A 1 62  ? 31.380  65.845  89.751  1.00 0.00 ?  53  ARG A N    3  
ATOM 4063  C CA   . ARG A 1 62  ? 32.098  66.834  88.873  1.00 0.00 ?  53  ARG A CA   3  
ATOM 4064  C C    . ARG A 1 62  ? 33.636  66.638  89.155  1.00 0.00 ?  53  ARG A C    3  
ATOM 4065  O O    . ARG A 1 62  ? 34.106  66.446  90.287  1.00 0.00 ?  53  ARG A O    3  
ATOM 4066  C CB   . ARG A 1 62  ? 31.559  68.251  89.207  1.00 0.00 ?  53  ARG A CB   3  
ATOM 4067  C CG   . ARG A 1 62  ? 31.869  69.302  88.153  1.00 0.00 ?  53  ARG A CG   3  
ATOM 4068  C CD   . ARG A 1 62  ? 30.874  70.477  88.165  1.00 0.00 ?  53  ARG A CD   3  
ATOM 4069  N NE   . ARG A 1 62  ? 31.560  71.534  87.358  1.00 0.00 ?  53  ARG A NE   3  
ATOM 4070  C CZ   . ARG A 1 62  ? 30.951  72.326  86.491  1.00 0.00 ?  53  ARG A CZ   3  
ATOM 4071  N NH1  . ARG A 1 62  ? 29.625  72.334  86.281  1.00 0.00 ?  53  ARG A NH1  3  
ATOM 4072  N NH2  . ARG A 1 62  ? 31.628  73.168  85.833  1.00 0.00 1  53  ARG A NH2  3  
ATOM 4073  H H    . ARG A 1 62  ? 30.956  66.157  90.612  1.00 0.00 ?  53  ARG A H    3  
ATOM 4074  H HA   . ARG A 1 62  ? 31.917  66.584  87.827  1.00 0.00 ?  53  ARG A HA   3  
ATOM 4075  H HB2  . ARG A 1 62  ? 30.478  68.122  89.177  1.00 0.00 ?  53  ARG A HB2  3  
ATOM 4076  H HB3  . ARG A 1 62  ? 31.883  68.650  90.168  1.00 0.00 ?  53  ARG A HB3  3  
ATOM 4077  H HG2  . ARG A 1 62  ? 32.881  69.616  88.409  1.00 0.00 ?  53  ARG A HG2  3  
ATOM 4078  H HG3  . ARG A 1 62  ? 31.833  68.977  87.113  1.00 0.00 ?  53  ARG A HG3  3  
ATOM 4079  H HD2  . ARG A 1 62  ? 29.928  70.101  87.775  1.00 0.00 ?  53  ARG A HD2  3  
ATOM 4080  H HD3  . ARG A 1 62  ? 30.759  70.848  89.183  1.00 0.00 ?  53  ARG A HD3  3  
ATOM 4081  H HE   . ARG A 1 62  ? 32.506  71.765  87.633  1.00 0.00 ?  53  ARG A HE   3  
ATOM 4082  H HH11 . ARG A 1 62  ? 29.066  71.635  86.749  1.00 0.00 ?  53  ARG A HH11 3  
ATOM 4083  H HH12 . ARG A 1 62  ? 29.174  72.831  85.524  1.00 0.00 ?  53  ARG A HH12 3  
ATOM 4084  H HH21 . ARG A 1 62  ? 32.638  73.140  85.818  1.00 0.00 ?  53  ARG A HH21 3  
ATOM 4085  H HH22 . ARG A 1 62  ? 31.113  73.631  85.098  1.00 0.00 ?  53  ARG A HH22 3  
ATOM 4086  N N    . ASP A 1 63  ? 34.453  66.883  88.184  1.00 0.00 ?  54  ASP A N    3  
ATOM 4087  C CA   . ASP A 1 63  ? 35.825  66.603  88.082  1.00 0.00 ?  54  ASP A CA   3  
ATOM 4088  C C    . ASP A 1 63  ? 36.580  67.571  87.186  1.00 0.00 ?  54  ASP A C    3  
ATOM 4089  O O    . ASP A 1 63  ? 36.408  67.657  85.974  1.00 0.00 ?  54  ASP A O    3  
ATOM 4090  C CB   . ASP A 1 63  ? 36.016  65.152  87.736  1.00 0.00 ?  54  ASP A CB   3  
ATOM 4091  C CG   . ASP A 1 63  ? 37.473  64.872  87.480  1.00 0.00 ?  54  ASP A CG   3  
ATOM 4092  O OD1  . ASP A 1 63  ? 38.350  65.081  88.340  1.00 0.00 -1 54  ASP A OD1  3  
ATOM 4093  O OD2  . ASP A 1 63  ? 37.780  64.476  86.376  1.00 0.00 ?  54  ASP A OD2  3  
ATOM 4094  H H    . ASP A 1 63  ? 34.030  67.004  87.275  1.00 0.00 ?  54  ASP A H    3  
ATOM 4095  H HA   . ASP A 1 63  ? 36.284  66.768  89.057  1.00 0.00 ?  54  ASP A HA   3  
ATOM 4096  H HB2  . ASP A 1 63  ? 35.647  64.541  88.562  1.00 0.00 ?  54  ASP A HB2  3  
ATOM 4097  H HB3  . ASP A 1 63  ? 35.347  64.956  86.898  1.00 0.00 ?  54  ASP A HB3  3  
ATOM 4098  N N    . ASP A 1 64  ? 37.580  68.404  87.608  1.00 0.00 ?  55  ASP A N    3  
ATOM 4099  C CA   . ASP A 1 64  ? 38.346  69.277  86.730  1.00 0.00 ?  55  ASP A CA   3  
ATOM 4100  C C    . ASP A 1 64  ? 39.268  68.678  85.634  1.00 0.00 ?  55  ASP A C    3  
ATOM 4101  O O    . ASP A 1 64  ? 39.371  69.354  84.633  1.00 0.00 ?  55  ASP A O    3  
ATOM 4102  C CB   . ASP A 1 64  ? 39.132  70.318  87.554  1.00 0.00 ?  55  ASP A CB   3  
ATOM 4103  C CG   . ASP A 1 64  ? 38.237  71.349  88.235  1.00 0.00 ?  55  ASP A CG   3  
ATOM 4104  O OD1  . ASP A 1 64  ? 37.029  71.486  87.932  1.00 0.00 ?  55  ASP A OD1  3  
ATOM 4105  O OD2  . ASP A 1 64  ? 38.688  71.921  89.241  1.00 0.00 -1 55  ASP A OD2  3  
ATOM 4106  H H    . ASP A 1 64  ? 37.813  68.451  88.590  1.00 0.00 ?  55  ASP A H    3  
ATOM 4107  H HA   . ASP A 1 64  ? 37.643  69.919  86.199  1.00 0.00 ?  55  ASP A HA   3  
ATOM 4108  H HB2  . ASP A 1 64  ? 39.740  69.749  88.257  1.00 0.00 ?  55  ASP A HB2  3  
ATOM 4109  H HB3  . ASP A 1 64  ? 39.688  70.913  86.830  1.00 0.00 ?  55  ASP A HB3  3  
ATOM 4110  N N    . ASN A 1 65  ? 39.817  67.492  85.848  1.00 0.00 ?  56  ASN A N    3  
ATOM 4111  C CA   . ASN A 1 65  ? 40.441  66.778  84.681  1.00 0.00 ?  56  ASN A CA   3  
ATOM 4112  C C    . ASN A 1 65  ? 39.441  66.458  83.559  1.00 0.00 ?  56  ASN A C    3  
ATOM 4113  O O    . ASN A 1 65  ? 39.762  66.602  82.401  1.00 0.00 ?  56  ASN A O    3  
ATOM 4114  C CB   . ASN A 1 65  ? 41.138  65.455  85.185  1.00 0.00 ?  56  ASN A CB   3  
ATOM 4115  C CG   . ASN A 1 65  ? 42.202  65.842  86.243  1.00 0.00 ?  56  ASN A CG   3  
ATOM 4116  O OD1  . ASN A 1 65  ? 43.247  66.403  86.004  1.00 0.00 ?  56  ASN A OD1  3  
ATOM 4117  N ND2  . ASN A 1 65  ? 41.974  65.397  87.443  1.00 0.00 ?  56  ASN A ND2  3  
ATOM 4118  H H    . ASN A 1 65  ? 39.744  67.023  86.739  1.00 0.00 ?  56  ASN A H    3  
ATOM 4119  H HA   . ASN A 1 65  ? 41.142  67.456  84.195  1.00 0.00 ?  56  ASN A HA   3  
ATOM 4120  H HB2  . ASN A 1 65  ? 40.318  64.889  85.630  1.00 0.00 ?  56  ASN A HB2  3  
ATOM 4121  H HB3  . ASN A 1 65  ? 41.516  64.928  84.308  1.00 0.00 ?  56  ASN A HB3  3  
ATOM 4122  H HD21 . ASN A 1 65  ? 41.263  64.692  87.565  1.00 0.00 ?  56  ASN A HD21 3  
ATOM 4123  H HD22 . ASN A 1 65  ? 42.773  65.555  88.042  1.00 0.00 ?  56  ASN A HD22 3  
ATOM 4124  N N    . SER A 1 66  ? 38.179  66.082  83.925  1.00 0.00 ?  57  SER A N    3  
ATOM 4125  C CA   . SER A 1 66  ? 37.142  65.790  82.984  1.00 0.00 ?  57  SER A CA   3  
ATOM 4126  C C    . SER A 1 66  ? 36.569  66.966  82.327  1.00 0.00 ?  57  SER A C    3  
ATOM 4127  O O    . SER A 1 66  ? 36.294  66.930  81.162  1.00 0.00 ?  57  SER A O    3  
ATOM 4128  C CB   . SER A 1 66  ? 35.956  65.082  83.685  1.00 0.00 ?  57  SER A CB   3  
ATOM 4129  O OG   . SER A 1 66  ? 36.320  63.827  84.203  1.00 0.00 ?  57  SER A OG   3  
ATOM 4130  H H    . SER A 1 66  ? 38.054  66.035  84.927  1.00 0.00 ?  57  SER A H    3  
ATOM 4131  H HA   . SER A 1 66  ? 37.513  65.060  82.264  1.00 0.00 ?  57  SER A HA   3  
ATOM 4132  H HB2  . SER A 1 66  ? 35.544  65.626  84.536  1.00 0.00 ?  57  SER A HB2  3  
ATOM 4133  H HB3  . SER A 1 66  ? 35.109  64.968  83.007  1.00 0.00 ?  57  SER A HB3  3  
ATOM 4134  H HG   . SER A 1 66  ? 37.035  63.938  84.833  1.00 0.00 ?  57  SER A HG   3  
ATOM 4135  N N    . TYR A 1 67  ? 36.569  68.157  82.990  1.00 0.00 ?  58  TYR A N    3  
ATOM 4136  C CA   . TYR A 1 67  ? 36.407  69.444  82.428  1.00 0.00 ?  58  TYR A CA   3  
ATOM 4137  C C    . TYR A 1 67  ? 37.511  70.036  81.546  1.00 0.00 ?  58  TYR A C    3  
ATOM 4138  O O    . TYR A 1 67  ? 37.261  70.765  80.658  1.00 0.00 ?  58  TYR A O    3  
ATOM 4139  C CB   . TYR A 1 67  ? 35.806  70.370  83.368  1.00 0.00 ?  58  TYR A CB   3  
ATOM 4140  C CG   . TYR A 1 67  ? 34.302  70.331  83.407  1.00 0.00 ?  58  TYR A CG   3  
ATOM 4141  C CD1  . TYR A 1 67  ? 33.554  69.392  84.166  1.00 0.00 ?  58  TYR A CD1  3  
ATOM 4142  C CD2  . TYR A 1 67  ? 33.573  71.261  82.625  1.00 0.00 ?  58  TYR A CD2  3  
ATOM 4143  C CE1  . TYR A 1 67  ? 32.160  69.351  84.235  1.00 0.00 ?  58  TYR A CE1  3  
ATOM 4144  C CE2  . TYR A 1 67  ? 32.135  71.223  82.668  1.00 0.00 ?  58  TYR A CE2  3  
ATOM 4145  C CZ   . TYR A 1 67  ? 31.485  70.277  83.465  1.00 0.00 ?  58  TYR A CZ   3  
ATOM 4146  O OH   . TYR A 1 67  ? 30.123  70.241  83.500  1.00 0.00 ?  58  TYR A OH   3  
ATOM 4147  H H    . TYR A 1 67  ? 36.948  68.075  83.922  1.00 0.00 ?  58  TYR A H    3  
ATOM 4148  H HA   . TYR A 1 67  ? 35.632  69.384  81.663  1.00 0.00 ?  58  TYR A HA   3  
ATOM 4149  H HB2  . TYR A 1 67  ? 36.228  70.157  84.351  1.00 0.00 ?  58  TYR A HB2  3  
ATOM 4150  H HB3  . TYR A 1 67  ? 36.183  71.348  83.070  1.00 0.00 ?  58  TYR A HB3  3  
ATOM 4151  H HD1  . TYR A 1 67  ? 34.178  68.687  84.695  1.00 0.00 ?  58  TYR A HD1  3  
ATOM 4152  H HD2  . TYR A 1 67  ? 34.191  71.955  82.076  1.00 0.00 ?  58  TYR A HD2  3  
ATOM 4153  H HE1  . TYR A 1 67  ? 31.661  68.587  84.814  1.00 0.00 ?  58  TYR A HE1  3  
ATOM 4154  H HE2  . TYR A 1 67  ? 31.516  71.879  82.073  1.00 0.00 ?  58  TYR A HE2  3  
ATOM 4155  H HH   . TYR A 1 67  ? 29.680  69.511  83.938  1.00 0.00 ?  58  TYR A HH   3  
ATOM 4156  N N    . MET A 1 68  ? 38.711  69.605  81.812  1.00 0.00 ?  59  MET A N    3  
ATOM 4157  C CA   . MET A 1 68  ? 39.807  69.767  80.854  1.00 0.00 ?  59  MET A CA   3  
ATOM 4158  C C    . MET A 1 68  ? 39.664  68.849  79.639  1.00 0.00 ?  59  MET A C    3  
ATOM 4159  O O    . MET A 1 68  ? 39.918  69.375  78.537  1.00 0.00 ?  59  MET A O    3  
ATOM 4160  C CB   . MET A 1 68  ? 41.140  69.670  81.539  1.00 0.00 ?  59  MET A CB   3  
ATOM 4161  C CG   . MET A 1 68  ? 41.360  70.831  82.493  1.00 0.00 ?  59  MET A CG   3  
ATOM 4162  S SD   . MET A 1 68  ? 42.496  72.223  81.846  1.00 0.00 ?  59  MET A SD   3  
ATOM 4163  C CE   . MET A 1 68  ? 44.028  71.654  82.607  1.00 0.00 ?  59  MET A CE   3  
ATOM 4164  H H    . MET A 1 68  ? 38.823  68.905  82.531  1.00 0.00 ?  59  MET A H    3  
ATOM 4165  H HA   . MET A 1 68  ? 39.715  70.764  80.425  1.00 0.00 ?  59  MET A HA   3  
ATOM 4166  H HB2  . MET A 1 68  ? 41.032  68.763  82.133  1.00 0.00 ?  59  MET A HB2  3  
ATOM 4167  H HB3  . MET A 1 68  ? 41.961  69.609  80.824  1.00 0.00 ?  59  MET A HB3  3  
ATOM 4168  H HG2  . MET A 1 68  ? 40.371  71.213  82.745  1.00 0.00 ?  59  MET A HG2  3  
ATOM 4169  H HG3  . MET A 1 68  ? 41.870  70.387  83.347  1.00 0.00 ?  59  MET A HG3  3  
ATOM 4170  H HE1  . MET A 1 68  ? 43.968  71.680  83.696  1.00 0.00 ?  59  MET A HE1  3  
ATOM 4171  H HE2  . MET A 1 68  ? 44.142  70.583  82.442  1.00 0.00 ?  59  MET A HE2  3  
ATOM 4172  H HE3  . MET A 1 68  ? 44.891  72.245  82.301  1.00 0.00 ?  59  MET A HE3  3  
ATOM 4173  N N    . TYR A 1 69  ? 39.219  67.608  79.733  1.00 0.00 ?  60  TYR A N    3  
ATOM 4174  C CA   . TYR A 1 69  ? 38.680  66.911  78.522  1.00 0.00 ?  60  TYR A CA   3  
ATOM 4175  C C    . TYR A 1 69  ? 37.564  67.585  77.798  1.00 0.00 ?  60  TYR A C    3  
ATOM 4176  O O    . TYR A 1 69  ? 37.446  67.372  76.603  1.00 0.00 ?  60  TYR A O    3  
ATOM 4177  C CB   . TYR A 1 69  ? 38.357  65.453  78.833  1.00 0.00 ?  60  TYR A CB   3  
ATOM 4178  C CG   . TYR A 1 69  ? 37.345  64.805  77.925  1.00 0.00 ?  60  TYR A CG   3  
ATOM 4179  C CD1  . TYR A 1 69  ? 37.708  64.305  76.678  1.00 0.00 ?  60  TYR A CD1  3  
ATOM 4180  C CD2  . TYR A 1 69  ? 36.021  64.827  78.310  1.00 0.00 ?  60  TYR A CD2  3  
ATOM 4181  C CE1  . TYR A 1 69  ? 36.769  63.794  75.811  1.00 0.00 ?  60  TYR A CE1  3  
ATOM 4182  C CE2  . TYR A 1 69  ? 35.001  64.268  77.474  1.00 0.00 ?  60  TYR A CE2  3  
ATOM 4183  C CZ   . TYR A 1 69  ? 35.380  63.742  76.196  1.00 0.00 ?  60  TYR A CZ   3  
ATOM 4184  O OH   . TYR A 1 69  ? 34.383  63.245  75.415  1.00 0.00 ?  60  TYR A OH   3  
ATOM 4185  H H    . TYR A 1 69  ? 39.113  67.147  80.625  1.00 0.00 ?  60  TYR A H    3  
ATOM 4186  H HA   . TYR A 1 69  ? 39.469  66.725  77.794  1.00 0.00 ?  60  TYR A HA   3  
ATOM 4187  H HB2  . TYR A 1 69  ? 39.274  64.871  78.751  1.00 0.00 ?  60  TYR A HB2  3  
ATOM 4188  H HB3  . TYR A 1 69  ? 38.086  65.290  79.876  1.00 0.00 ?  60  TYR A HB3  3  
ATOM 4189  H HD1  . TYR A 1 69  ? 38.711  64.188  76.295  1.00 0.00 ?  60  TYR A HD1  3  
ATOM 4190  H HD2  . TYR A 1 69  ? 35.728  65.321  79.225  1.00 0.00 ?  60  TYR A HD2  3  
ATOM 4191  H HE1  . TYR A 1 69  ? 36.966  63.508  74.788  1.00 0.00 ?  60  TYR A HE1  3  
ATOM 4192  H HE2  . TYR A 1 69  ? 34.000  64.210  77.875  1.00 0.00 ?  60  TYR A HE2  3  
ATOM 4193  H HH   . TYR A 1 69  ? 34.771  63.217  74.538  1.00 0.00 ?  60  TYR A HH   3  
ATOM 4194  N N    . ILE A 1 70  ? 36.729  68.399  78.468  1.00 0.00 ?  61  ILE A N    3  
ATOM 4195  C CA   . ILE A 1 70  ? 35.627  69.255  77.809  1.00 0.00 ?  61  ILE A CA   3  
ATOM 4196  C C    . ILE A 1 70  ? 36.200  70.476  77.049  1.00 0.00 ?  61  ILE A C    3  
ATOM 4197  O O    . ILE A 1 70  ? 35.636  70.829  76.098  1.00 0.00 ?  61  ILE A O    3  
ATOM 4198  C CB   . ILE A 1 70  ? 34.455  69.586  78.758  1.00 0.00 ?  61  ILE A CB   3  
ATOM 4199  C CG1  . ILE A 1 70  ? 33.748  68.268  79.130  1.00 0.00 ?  61  ILE A CG1  3  
ATOM 4200  C CG2  . ILE A 1 70  ? 33.349  70.578  78.223  1.00 0.00 ?  61  ILE A CG2  3  
ATOM 4201  C CD1  . ILE A 1 70  ? 32.947  68.296  80.440  1.00 0.00 ?  61  ILE A CD1  3  
ATOM 4202  H H    . ILE A 1 70  ? 36.825  68.601  79.453  1.00 0.00 ?  61  ILE A H    3  
ATOM 4203  H HA   . ILE A 1 70  ? 35.220  68.741  76.938  1.00 0.00 ?  61  ILE A HA   3  
ATOM 4204  H HB   . ILE A 1 70  ? 34.967  70.032  79.611  1.00 0.00 ?  61  ILE A HB   3  
ATOM 4205  H HG12 . ILE A 1 70  ? 33.043  67.991  78.347  1.00 0.00 ?  61  ILE A HG12 3  
ATOM 4206  H HG13 . ILE A 1 70  ? 34.490  67.479  79.257  1.00 0.00 ?  61  ILE A HG13 3  
ATOM 4207  H HG21 . ILE A 1 70  ? 32.900  70.222  77.295  1.00 0.00 ?  61  ILE A HG21 3  
ATOM 4208  H HG22 . ILE A 1 70  ? 32.557  70.537  78.972  1.00 0.00 ?  61  ILE A HG22 3  
ATOM 4209  H HG23 . ILE A 1 70  ? 33.736  71.596  78.190  1.00 0.00 ?  61  ILE A HG23 3  
ATOM 4210  H HD11 . ILE A 1 70  ? 32.201  69.089  80.441  1.00 0.00 ?  61  ILE A HD11 3  
ATOM 4211  H HD12 . ILE A 1 70  ? 32.544  67.321  80.713  1.00 0.00 ?  61  ILE A HD12 3  
ATOM 4212  H HD13 . ILE A 1 70  ? 33.679  68.568  81.201  1.00 0.00 ?  61  ILE A HD13 3  
ATOM 4213  N N    . LEU A 1 71  ? 37.387  71.003  77.395  1.00 0.00 ?  62  LEU A N    3  
ATOM 4214  C CA   . LEU A 1 71  ? 38.132  71.890  76.542  1.00 0.00 ?  62  LEU A CA   3  
ATOM 4215  C C    . LEU A 1 71  ? 38.533  71.168  75.277  1.00 0.00 ?  62  LEU A C    3  
ATOM 4216  O O    . LEU A 1 71  ? 38.374  71.750  74.193  1.00 0.00 ?  62  LEU A O    3  
ATOM 4217  C CB   . LEU A 1 71  ? 39.427  72.311  77.246  1.00 0.00 ?  62  LEU A CB   3  
ATOM 4218  C CG   . LEU A 1 71  ? 39.036  73.189  78.448  1.00 0.00 ?  62  LEU A CG   3  
ATOM 4219  C CD1  . LEU A 1 71  ? 40.326  73.616  79.024  1.00 0.00 ?  62  LEU A CD1  3  
ATOM 4220  C CD2  . LEU A 1 71  ? 38.197  74.394  77.955  1.00 0.00 ?  62  LEU A CD2  3  
ATOM 4221  H H    . LEU A 1 71  ? 37.986  70.576  78.086  1.00 0.00 ?  62  LEU A H    3  
ATOM 4222  H HA   . LEU A 1 71  ? 37.514  72.741  76.258  1.00 0.00 ?  62  LEU A HA   3  
ATOM 4223  H HB2  . LEU A 1 71  ? 39.954  71.386  77.478  1.00 0.00 ?  62  LEU A HB2  3  
ATOM 4224  H HB3  . LEU A 1 71  ? 40.047  72.859  76.536  1.00 0.00 ?  62  LEU A HB3  3  
ATOM 4225  H HG   . LEU A 1 71  ? 38.461  72.608  79.170  1.00 0.00 ?  62  LEU A HG   3  
ATOM 4226  H HD11 . LEU A 1 71  ? 40.938  74.058  78.238  1.00 0.00 ?  62  LEU A HD11 3  
ATOM 4227  H HD12 . LEU A 1 71  ? 40.178  74.422  79.743  1.00 0.00 ?  62  LEU A HD12 3  
ATOM 4228  H HD13 . LEU A 1 71  ? 40.876  72.779  79.455  1.00 0.00 ?  62  LEU A HD13 3  
ATOM 4229  H HD21 . LEU A 1 71  ? 38.212  75.094  78.789  1.00 0.00 ?  62  LEU A HD21 3  
ATOM 4230  H HD22 . LEU A 1 71  ? 38.729  74.816  77.104  1.00 0.00 ?  62  LEU A HD22 3  
ATOM 4231  H HD23 . LEU A 1 71  ? 37.168  74.088  77.760  1.00 0.00 ?  62  LEU A HD23 3  
ATOM 4232  N N    . PHE A 1 72  ? 39.002  69.920  75.473  1.00 0.00 ?  63  PHE A N    3  
ATOM 4233  C CA   . PHE A 1 72  ? 39.363  68.991  74.370  1.00 0.00 ?  63  PHE A CA   3  
ATOM 4234  C C    . PHE A 1 72  ? 38.191  68.613  73.518  1.00 0.00 ?  63  PHE A C    3  
ATOM 4235  O O    . PHE A 1 72  ? 38.289  68.367  72.352  1.00 0.00 ?  63  PHE A O    3  
ATOM 4236  C CB   . PHE A 1 72  ? 40.147  67.726  74.709  1.00 0.00 ?  63  PHE A CB   3  
ATOM 4237  C CG   . PHE A 1 72  ? 40.369  66.751  73.550  1.00 0.00 ?  63  PHE A CG   3  
ATOM 4238  C CD1  . PHE A 1 72  ? 39.280  65.843  73.323  1.00 0.00 ?  63  PHE A CD1  3  
ATOM 4239  C CD2  . PHE A 1 72  ? 41.678  66.549  73.019  1.00 0.00 ?  63  PHE A CD2  3  
ATOM 4240  C CE1  . PHE A 1 72  ? 39.454  64.877  72.355  1.00 0.00 ?  63  PHE A CE1  3  
ATOM 4241  C CE2  . PHE A 1 72  ? 41.817  65.497  72.086  1.00 0.00 ?  63  PHE A CE2  3  
ATOM 4242  C CZ   . PHE A 1 72  ? 40.666  64.723  71.701  1.00 0.00 ?  63  PHE A CZ   3  
ATOM 4243  H H    . PHE A 1 72  ? 39.045  69.611  76.433  1.00 0.00 ?  63  PHE A H    3  
ATOM 4244  H HA   . PHE A 1 72  ? 39.985  69.602  73.714  1.00 0.00 ?  63  PHE A HA   3  
ATOM 4245  H HB2  . PHE A 1 72  ? 41.146  67.994  75.051  1.00 0.00 ?  63  PHE A HB2  3  
ATOM 4246  H HB3  . PHE A 1 72  ? 39.666  67.143  75.496  1.00 0.00 ?  63  PHE A HB3  3  
ATOM 4247  H HD1  . PHE A 1 72  ? 38.301  65.980  73.755  1.00 0.00 ?  63  PHE A HD1  3  
ATOM 4248  H HD2  . PHE A 1 72  ? 42.616  67.040  73.233  1.00 0.00 ?  63  PHE A HD2  3  
ATOM 4249  H HE1  . PHE A 1 72  ? 38.596  64.262  72.123  1.00 0.00 ?  63  PHE A HE1  3  
ATOM 4250  H HE2  . PHE A 1 72  ? 42.796  65.245  71.706  1.00 0.00 ?  63  PHE A HE2  3  
ATOM 4251  H HZ   . PHE A 1 72  ? 40.789  63.986  70.920  1.00 0.00 ?  63  PHE A HZ   3  
ATOM 4252  N N    . VAL A 1 73  ? 36.928  68.729  74.040  1.00 0.00 ?  64  VAL A N    3  
ATOM 4253  C CA   . VAL A 1 73  ? 35.678  68.420  73.317  1.00 0.00 ?  64  VAL A CA   3  
ATOM 4254  C C    . VAL A 1 73  ? 34.970  69.618  72.608  1.00 0.00 ?  64  VAL A C    3  
ATOM 4255  O O    . VAL A 1 73  ? 34.374  69.407  71.523  1.00 0.00 ?  64  VAL A O    3  
ATOM 4256  C CB   . VAL A 1 73  ? 34.750  67.421  74.130  1.00 0.00 ?  64  VAL A CB   3  
ATOM 4257  C CG1  . VAL A 1 73  ? 33.569  68.126  74.746  1.00 0.00 ?  64  VAL A CG1  3  
ATOM 4258  C CG2  . VAL A 1 73  ? 34.170  66.257  73.333  1.00 0.00 ?  64  VAL A CG2  3  
ATOM 4259  H H    . VAL A 1 73  ? 36.881  69.212  74.925  1.00 0.00 ?  64  VAL A H    3  
ATOM 4260  H HA   . VAL A 1 73  ? 36.044  67.820  72.485  1.00 0.00 ?  64  VAL A HA   3  
ATOM 4261  H HB   . VAL A 1 73  ? 35.340  67.026  74.958  1.00 0.00 ?  64  VAL A HB   3  
ATOM 4262  H HG11 . VAL A 1 73  ? 32.767  68.170  74.010  1.00 0.00 ?  64  VAL A HG11 3  
ATOM 4263  H HG12 . VAL A 1 73  ? 33.147  67.478  75.514  1.00 0.00 ?  64  VAL A HG12 3  
ATOM 4264  H HG13 . VAL A 1 73  ? 33.824  69.065  75.239  1.00 0.00 ?  64  VAL A HG13 3  
ATOM 4265  H HG21 . VAL A 1 73  ? 34.992  65.564  73.152  1.00 0.00 ?  64  VAL A HG21 3  
ATOM 4266  H HG22 . VAL A 1 73  ? 33.437  65.689  73.906  1.00 0.00 ?  64  VAL A HG22 3  
ATOM 4267  H HG23 . VAL A 1 73  ? 33.614  66.541  72.440  1.00 0.00 ?  64  VAL A HG23 3  
ATOM 4268  N N    . MET A 1 74  ? 35.278  70.883  72.979  1.00 0.00 ?  65  MET A N    3  
ATOM 4269  C CA   . MET A 1 74  ? 35.144  72.035  72.127  1.00 0.00 ?  65  MET A CA   3  
ATOM 4270  C C    . MET A 1 74  ? 36.167  71.969  70.896  1.00 0.00 ?  65  MET A C    3  
ATOM 4271  O O    . MET A 1 74  ? 35.711  72.120  69.742  1.00 0.00 ?  65  MET A O    3  
ATOM 4272  C CB   . MET A 1 74  ? 35.115  73.402  72.825  1.00 0.00 ?  65  MET A CB   3  
ATOM 4273  C CG   . MET A 1 74  ? 34.058  73.718  73.822  1.00 0.00 ?  65  MET A CG   3  
ATOM 4274  S SD   . MET A 1 74  ? 34.158  75.226  74.883  1.00 0.00 ?  65  MET A SD   3  
ATOM 4275  C CE   . MET A 1 74  ? 34.453  74.667  76.590  1.00 0.00 ?  65  MET A CE   3  
ATOM 4276  H H    . MET A 1 74  ? 35.874  71.008  73.784  1.00 0.00 ?  65  MET A H    3  
ATOM 4277  H HA   . MET A 1 74  ? 34.166  71.935  71.658  1.00 0.00 ?  65  MET A HA   3  
ATOM 4278  H HB2  . MET A 1 74  ? 36.090  73.570  73.281  1.00 0.00 ?  65  MET A HB2  3  
ATOM 4279  H HB3  . MET A 1 74  ? 35.196  74.200  72.086  1.00 0.00 ?  65  MET A HB3  3  
ATOM 4280  H HG2  . MET A 1 74  ? 33.070  73.830  73.377  1.00 0.00 ?  65  MET A HG2  3  
ATOM 4281  H HG3  . MET A 1 74  ? 34.020  72.841  74.470  1.00 0.00 ?  65  MET A HG3  3  
ATOM 4282  H HE1  . MET A 1 74  ? 33.463  74.552  77.031  1.00 0.00 ?  65  MET A HE1  3  
ATOM 4283  H HE2  . MET A 1 74  ? 35.081  73.781  76.692  1.00 0.00 ?  65  MET A HE2  3  
ATOM 4284  H HE3  . MET A 1 74  ? 35.049  75.468  77.027  1.00 0.00 ?  65  MET A HE3  3  
ATOM 4285  N N    . PHE A 1 75  ? 37.456  71.580  71.158  1.00 0.00 ?  66  PHE A N    3  
ATOM 4286  C CA   . PHE A 1 75  ? 38.358  71.290  70.068  1.00 0.00 ?  66  PHE A CA   3  
ATOM 4287  C C    . PHE A 1 75  ? 37.835  70.121  69.123  1.00 0.00 ?  66  PHE A C    3  
ATOM 4288  O O    . PHE A 1 75  ? 37.801  70.261  67.919  1.00 0.00 ?  66  PHE A O    3  
ATOM 4289  C CB   . PHE A 1 75  ? 39.756  71.046  70.584  1.00 0.00 ?  66  PHE A CB   3  
ATOM 4290  C CG   . PHE A 1 75  ? 40.808  70.451  69.645  1.00 0.00 ?  66  PHE A CG   3  
ATOM 4291  C CD1  . PHE A 1 75  ? 41.352  71.181  68.515  1.00 0.00 ?  66  PHE A CD1  3  
ATOM 4292  C CD2  . PHE A 1 75  ? 41.048  68.998  69.676  1.00 0.00 ?  66  PHE A CD2  3  
ATOM 4293  C CE1  . PHE A 1 75  ? 42.035  70.502  67.560  1.00 0.00 ?  66  PHE A CE1  3  
ATOM 4294  C CE2  . PHE A 1 75  ? 41.827  68.374  68.678  1.00 0.00 ?  66  PHE A CE2  3  
ATOM 4295  C CZ   . PHE A 1 75  ? 42.325  69.139  67.640  1.00 0.00 ?  66  PHE A CZ   3  
ATOM 4296  H H    . PHE A 1 75  ? 37.697  71.447  72.129  1.00 0.00 ?  66  PHE A H    3  
ATOM 4297  H HA   . PHE A 1 75  ? 38.367  72.171  69.427  1.00 0.00 ?  66  PHE A HA   3  
ATOM 4298  H HB2  . PHE A 1 75  ? 40.133  71.901  71.145  1.00 0.00 ?  66  PHE A HB2  3  
ATOM 4299  H HB3  . PHE A 1 75  ? 39.695  70.342  71.413  1.00 0.00 ?  66  PHE A HB3  3  
ATOM 4300  H HD1  . PHE A 1 75  ? 41.156  72.242  68.480  1.00 0.00 ?  66  PHE A HD1  3  
ATOM 4301  H HD2  . PHE A 1 75  ? 40.683  68.481  70.551  1.00 0.00 ?  66  PHE A HD2  3  
ATOM 4302  H HE1  . PHE A 1 75  ? 42.353  71.097  66.717  1.00 0.00 ?  66  PHE A HE1  3  
ATOM 4303  H HE2  . PHE A 1 75  ? 42.087  67.346  68.880  1.00 0.00 ?  66  PHE A HE2  3  
ATOM 4304  H HZ   . PHE A 1 75  ? 42.932  68.708  66.858  1.00 0.00 ?  66  PHE A HZ   3  
ATOM 4305  N N    . LEU A 1 76  ? 37.399  68.896  69.667  1.00 0.00 ?  67  LEU A N    3  
ATOM 4306  C CA   . LEU A 1 76  ? 36.888  67.803  68.859  1.00 0.00 ?  67  LEU A CA   3  
ATOM 4307  C C    . LEU A 1 76  ? 35.665  68.213  68.069  1.00 0.00 ?  67  LEU A C    3  
ATOM 4308  O O    . LEU A 1 76  ? 35.373  67.701  67.026  1.00 0.00 ?  67  LEU A O    3  
ATOM 4309  C CB   . LEU A 1 76  ? 36.732  66.521  69.728  1.00 0.00 ?  67  LEU A CB   3  
ATOM 4310  C CG   . LEU A 1 76  ? 36.560  65.148  69.020  1.00 0.00 ?  67  LEU A CG   3  
ATOM 4311  C CD1  . LEU A 1 76  ? 37.720  64.684  68.132  1.00 0.00 ?  67  LEU A CD1  3  
ATOM 4312  C CD2  . LEU A 1 76  ? 36.238  64.091  70.088  1.00 0.00 ?  67  LEU A CD2  3  
ATOM 4313  H H    . LEU A 1 76  ? 37.515  68.710  70.653  1.00 0.00 ?  67  LEU A H    3  
ATOM 4314  H HA   . LEU A 1 76  ? 37.557  67.422  68.087  1.00 0.00 ?  67  LEU A HA   3  
ATOM 4315  H HB2  . LEU A 1 76  ? 37.502  66.363  70.482  1.00 0.00 ?  67  LEU A HB2  3  
ATOM 4316  H HB3  . LEU A 1 76  ? 35.802  66.670  70.278  1.00 0.00 ?  67  LEU A HB3  3  
ATOM 4317  H HG   . LEU A 1 76  ? 35.677  65.306  68.402  1.00 0.00 ?  67  LEU A HG   3  
ATOM 4318  H HD11 . LEU A 1 76  ? 37.547  63.734  67.624  1.00 0.00 ?  67  LEU A HD11 3  
ATOM 4319  H HD12 . LEU A 1 76  ? 37.960  65.346  67.300  1.00 0.00 ?  67  LEU A HD12 3  
ATOM 4320  H HD13 . LEU A 1 76  ? 38.600  64.687  68.774  1.00 0.00 ?  67  LEU A HD13 3  
ATOM 4321  H HD21 . LEU A 1 76  ? 35.594  64.519  70.856  1.00 0.00 ?  67  LEU A HD21 3  
ATOM 4322  H HD22 . LEU A 1 76  ? 35.629  63.300  69.652  1.00 0.00 ?  67  LEU A HD22 3  
ATOM 4323  H HD23 . LEU A 1 76  ? 37.110  63.720  70.627  1.00 0.00 ?  67  LEU A HD23 3  
ATOM 4324  N N    . PHE A 1 77  ? 34.821  69.008  68.682  1.00 0.00 ?  68  PHE A N    3  
ATOM 4325  C CA   . PHE A 1 77  ? 33.722  69.568  67.966  1.00 0.00 ?  68  PHE A CA   3  
ATOM 4326  C C    . PHE A 1 77  ? 34.016  70.213  66.591  1.00 0.00 ?  68  PHE A C    3  
ATOM 4327  O O    . PHE A 1 77  ? 33.452  69.752  65.586  1.00 0.00 ?  68  PHE A O    3  
ATOM 4328  C CB   . PHE A 1 77  ? 32.825  70.367  68.846  1.00 0.00 ?  68  PHE A CB   3  
ATOM 4329  C CG   . PHE A 1 77  ? 31.843  71.137  68.013  1.00 0.00 ?  68  PHE A CG   3  
ATOM 4330  C CD1  . PHE A 1 77  ? 30.711  70.530  67.357  1.00 0.00 ?  68  PHE A CD1  3  
ATOM 4331  C CD2  . PHE A 1 77  ? 32.094  72.521  67.898  1.00 0.00 ?  68  PHE A CD2  3  
ATOM 4332  C CE1  . PHE A 1 77  ? 29.863  71.361  66.548  1.00 0.00 ?  68  PHE A CE1  3  
ATOM 4333  C CE2  . PHE A 1 77  ? 31.197  73.293  67.231  1.00 0.00 ?  68  PHE A CE2  3  
ATOM 4334  C CZ   . PHE A 1 77  ? 30.021  72.738  66.590  1.00 0.00 ?  68  PHE A CZ   3  
ATOM 4335  H H    . PHE A 1 77  ? 35.115  69.421  69.555  1.00 0.00 ?  68  PHE A H    3  
ATOM 4336  H HA   . PHE A 1 77  ? 33.194  68.620  67.860  1.00 0.00 ?  68  PHE A HA   3  
ATOM 4337  H HB2  . PHE A 1 77  ? 32.374  69.636  69.515  1.00 0.00 ?  68  PHE A HB2  3  
ATOM 4338  H HB3  . PHE A 1 77  ? 33.434  71.009  69.482  1.00 0.00 ?  68  PHE A HB3  3  
ATOM 4339  H HD1  . PHE A 1 77  ? 30.484  69.475  67.417  1.00 0.00 ?  68  PHE A HD1  3  
ATOM 4340  H HD2  . PHE A 1 77  ? 33.010  72.958  68.268  1.00 0.00 ?  68  PHE A HD2  3  
ATOM 4341  H HE1  . PHE A 1 77  ? 29.011  70.885  66.083  1.00 0.00 ?  68  PHE A HE1  3  
ATOM 4342  H HE2  . PHE A 1 77  ? 31.305  74.365  67.161  1.00 0.00 ?  68  PHE A HE2  3  
ATOM 4343  H HZ   . PHE A 1 77  ? 29.307  73.434  66.175  1.00 0.00 ?  68  PHE A HZ   3  
ATOM 4344  N N    . ALA A 1 78  ? 34.970  71.096  66.584  1.00 0.00 ?  69  ALA A N    3  
ATOM 4345  C CA   . ALA A 1 78  ? 35.522  71.730  65.348  1.00 0.00 ?  69  ALA A CA   3  
ATOM 4346  C C    . ALA A 1 78  ? 36.114  70.679  64.361  1.00 0.00 ?  69  ALA A C    3  
ATOM 4347  O O    . ALA A 1 78  ? 35.987  70.779  63.157  1.00 0.00 ?  69  ALA A O    3  
ATOM 4348  C CB   . ALA A 1 78  ? 36.581  72.656  65.837  1.00 0.00 ?  69  ALA A CB   3  
ATOM 4349  H H    . ALA A 1 78  ? 35.518  71.241  67.420  1.00 0.00 ?  69  ALA A H    3  
ATOM 4350  H HA   . ALA A 1 78  ? 34.769  72.302  64.806  1.00 0.00 ?  69  ALA A HA   3  
ATOM 4351  H HB1  . ALA A 1 78  ? 37.478  72.111  66.133  1.00 0.00 ?  69  ALA A HB1  3  
ATOM 4352  H HB2  . ALA A 1 78  ? 36.877  73.327  65.030  1.00 0.00 ?  69  ALA A HB2  3  
ATOM 4353  H HB3  . ALA A 1 78  ? 36.181  73.265  66.648  1.00 0.00 ?  69  ALA A HB3  3  
ATOM 4354  N N    . VAL A 1 79  ? 36.766  69.576  64.893  1.00 0.00 ?  70  VAL A N    3  
ATOM 4355  C CA   . VAL A 1 79  ? 37.242  68.404  64.180  1.00 0.00 ?  70  VAL A CA   3  
ATOM 4356  C C    . VAL A 1 79  ? 36.090  67.528  63.652  1.00 0.00 ?  70  VAL A C    3  
ATOM 4357  O O    . VAL A 1 79  ? 36.131  67.040  62.526  1.00 0.00 ?  70  VAL A O    3  
ATOM 4358  C CB   . VAL A 1 79  ? 38.145  67.487  65.051  1.00 0.00 ?  70  VAL A CB   3  
ATOM 4359  C CG1  . VAL A 1 79  ? 38.502  65.963  64.706  1.00 0.00 ?  70  VAL A CG1  3  
ATOM 4360  C CG2  . VAL A 1 79  ? 39.433  68.194  65.235  1.00 0.00 ?  70  VAL A CG2  3  
ATOM 4361  H H    . VAL A 1 79  ? 36.826  69.567  65.902  1.00 0.00 ?  70  VAL A H    3  
ATOM 4362  H HA   . VAL A 1 79  ? 37.896  68.672  63.351  1.00 0.00 ?  70  VAL A HA   3  
ATOM 4363  H HB   . VAL A 1 79  ? 37.649  67.371  66.014  1.00 0.00 ?  70  VAL A HB   3  
ATOM 4364  H HG11 . VAL A 1 79  ? 39.260  65.661  65.428  1.00 0.00 ?  70  VAL A HG11 3  
ATOM 4365  H HG12 . VAL A 1 79  ? 37.689  65.264  64.903  1.00 0.00 ?  70  VAL A HG12 3  
ATOM 4366  H HG13 . VAL A 1 79  ? 38.845  65.946  63.671  1.00 0.00 ?  70  VAL A HG13 3  
ATOM 4367  H HG21 . VAL A 1 79  ? 40.076  68.110  64.360  1.00 0.00 ?  70  VAL A HG21 3  
ATOM 4368  H HG22 . VAL A 1 79  ? 39.251  69.223  65.545  1.00 0.00 ?  70  VAL A HG22 3  
ATOM 4369  H HG23 . VAL A 1 79  ? 40.041  67.774  66.037  1.00 0.00 ?  70  VAL A HG23 3  
ATOM 4370  N N    . THR A 1 80  ? 35.012  67.392  64.412  1.00 0.00 ?  71  THR A N    3  
ATOM 4371  C CA   . THR A 1 80  ? 33.722  66.864  63.921  1.00 0.00 ?  71  THR A CA   3  
ATOM 4372  C C    . THR A 1 80  ? 32.840  67.675  63.044  1.00 0.00 ?  71  THR A C    3  
ATOM 4373  O O    . THR A 1 80  ? 32.042  67.190  62.208  1.00 0.00 ?  71  THR A O    3  
ATOM 4374  C CB   . THR A 1 80  ? 32.765  66.579  65.133  1.00 0.00 ?  71  THR A CB   3  
ATOM 4375  O OG1  . THR A 1 80  ? 33.396  66.145  66.281  1.00 0.00 ?  71  THR A OG1  3  
ATOM 4376  C CG2  . THR A 1 80  ? 31.809  65.430  64.905  1.00 0.00 ?  71  THR A CG2  3  
ATOM 4377  H H    . THR A 1 80  ? 35.077  67.589  65.401  1.00 0.00 ?  71  THR A H    3  
ATOM 4378  H HA   . THR A 1 80  ? 33.790  65.890  63.436  1.00 0.00 ?  71  THR A HA   3  
ATOM 4379  H HB   . THR A 1 80  ? 32.189  67.472  65.378  1.00 0.00 ?  71  THR A HB   3  
ATOM 4380  H HG1  . THR A 1 80  ? 33.849  66.867  66.721  1.00 0.00 ?  71  THR A HG1  3  
ATOM 4381  H HG21 . THR A 1 80  ? 31.132  65.673  64.086  1.00 0.00 ?  71  THR A HG21 3  
ATOM 4382  H HG22 . THR A 1 80  ? 32.242  64.441  64.748  1.00 0.00 ?  71  THR A HG22 3  
ATOM 4383  H HG23 . THR A 1 80  ? 31.167  65.247  65.767  1.00 0.00 ?  71  THR A HG23 3  
ATOM 4384  N N    . VAL A 1 81  ? 33.136  68.988  63.011  1.00 0.00 ?  72  VAL A N    3  
ATOM 4385  C CA   . VAL A 1 81  ? 32.614  69.873  61.994  1.00 0.00 ?  72  VAL A CA   3  
ATOM 4386  C C    . VAL A 1 81  ? 33.189  69.359  60.690  1.00 0.00 ?  72  VAL A C    3  
ATOM 4387  O O    . VAL A 1 81  ? 32.450  69.253  59.727  1.00 0.00 ?  72  VAL A O    3  
ATOM 4388  C CB   . VAL A 1 81  ? 32.887  71.309  62.305  1.00 0.00 ?  72  VAL A CB   3  
ATOM 4389  C CG1  . VAL A 1 81  ? 32.873  72.140  61.064  1.00 0.00 ?  72  VAL A CG1  3  
ATOM 4390  C CG2  . VAL A 1 81  ? 31.903  71.936  63.368  1.00 0.00 ?  72  VAL A CG2  3  
ATOM 4391  H H    . VAL A 1 81  ? 33.702  69.377  63.752  1.00 0.00 ?  72  VAL A H    3  
ATOM 4392  H HA   . VAL A 1 81  ? 31.526  69.833  61.935  1.00 0.00 ?  72  VAL A HA   3  
ATOM 4393  H HB   . VAL A 1 81  ? 33.886  71.529  62.681  1.00 0.00 ?  72  VAL A HB   3  
ATOM 4394  H HG11 . VAL A 1 81  ? 31.896  72.094  60.581  1.00 0.00 ?  72  VAL A HG11 3  
ATOM 4395  H HG12 . VAL A 1 81  ? 32.978  73.184  61.359  1.00 0.00 ?  72  VAL A HG12 3  
ATOM 4396  H HG13 . VAL A 1 81  ? 33.655  71.860  60.359  1.00 0.00 ?  72  VAL A HG13 3  
ATOM 4397  H HG21 . VAL A 1 81  ? 30.871  71.700  63.109  1.00 0.00 ?  72  VAL A HG21 3  
ATOM 4398  H HG22 . VAL A 1 81  ? 31.953  71.484  64.359  1.00 0.00 ?  72  VAL A HG22 3  
ATOM 4399  H HG23 . VAL A 1 81  ? 32.026  73.019  63.409  1.00 0.00 ?  72  VAL A HG23 3  
ATOM 4400  N N    . GLY A 1 82  ? 34.476  69.128  60.593  1.00 0.00 ?  73  GLY A N    3  
ATOM 4401  C CA   . GLY A 1 82  ? 35.152  68.865  59.314  1.00 0.00 ?  73  GLY A CA   3  
ATOM 4402  C C    . GLY A 1 82  ? 34.944  67.451  58.899  1.00 0.00 ?  73  GLY A C    3  
ATOM 4403  O O    . GLY A 1 82  ? 34.820  67.186  57.711  1.00 0.00 ?  73  GLY A O    3  
ATOM 4404  H H    . GLY A 1 82  ? 34.983  69.208  61.462  1.00 0.00 ?  73  GLY A H    3  
ATOM 4405  H HA2  . GLY A 1 82  ? 34.886  69.595  58.550  1.00 0.00 ?  73  GLY A HA2  3  
ATOM 4406  H HA3  . GLY A 1 82  ? 36.205  69.108  59.461  1.00 0.00 ?  73  GLY A HA3  3  
ATOM 4407  N N    . SER A 1 83  ? 34.849  66.582  59.861  1.00 0.00 ?  74  SER A N    3  
ATOM 4408  C CA   . SER A 1 83  ? 34.366  65.185  59.574  1.00 0.00 ?  74  SER A CA   3  
ATOM 4409  C C    . SER A 1 83  ? 32.912  65.127  59.005  1.00 0.00 ?  74  SER A C    3  
ATOM 4410  O O    . SER A 1 83  ? 32.485  64.138  58.435  1.00 0.00 ?  74  SER A O    3  
ATOM 4411  C CB   . SER A 1 83  ? 34.467  64.419  60.859  1.00 0.00 ?  74  SER A CB   3  
ATOM 4412  O OG   . SER A 1 83  ? 33.911  63.137  60.911  1.00 0.00 ?  74  SER A OG   3  
ATOM 4413  H H    . SER A 1 83  ? 35.031  66.876  60.810  1.00 0.00 ?  74  SER A H    3  
ATOM 4414  H HA   . SER A 1 83  ? 35.003  64.641  58.876  1.00 0.00 ?  74  SER A HA   3  
ATOM 4415  H HB2  . SER A 1 83  ? 35.514  64.426  61.159  1.00 0.00 ?  74  SER A HB2  3  
ATOM 4416  H HB3  . SER A 1 83  ? 33.891  65.012  61.570  1.00 0.00 ?  74  SER A HB3  3  
ATOM 4417  H HG   . SER A 1 83  ? 34.513  62.489  61.283  1.00 0.00 ?  74  SER A HG   3  
ATOM 4418  N N    . LEU A 1 84  ? 32.020  66.106  59.412  1.00 0.00 ?  75  LEU A N    3  
ATOM 4419  C CA   . LEU A 1 84  ? 30.671  66.151  58.874  1.00 0.00 ?  75  LEU A CA   3  
ATOM 4420  C C    . LEU A 1 84  ? 30.703  66.496  57.396  1.00 0.00 ?  75  LEU A C    3  
ATOM 4421  O O    . LEU A 1 84  ? 30.071  65.851  56.554  1.00 0.00 ?  75  LEU A O    3  
ATOM 4422  C CB   . LEU A 1 84  ? 29.782  67.045  59.753  1.00 0.00 ?  75  LEU A CB   3  
ATOM 4423  C CG   . LEU A 1 84  ? 28.319  67.080  59.345  1.00 0.00 ?  75  LEU A CG   3  
ATOM 4424  C CD1  . LEU A 1 84  ? 27.520  65.728  59.132  1.00 0.00 ?  75  LEU A CD1  3  
ATOM 4425  C CD2  . LEU A 1 84  ? 27.556  67.918  60.362  1.00 0.00 ?  75  LEU A CD2  3  
ATOM 4426  H H    . LEU A 1 84  ? 32.252  66.839  60.066  1.00 0.00 ?  75  LEU A H    3  
ATOM 4427  H HA   . LEU A 1 84  ? 30.247  65.158  59.029  1.00 0.00 ?  75  LEU A HA   3  
ATOM 4428  H HB2  . LEU A 1 84  ? 29.789  66.634  60.762  1.00 0.00 ?  75  LEU A HB2  3  
ATOM 4429  H HB3  . LEU A 1 84  ? 30.144  68.074  59.728  1.00 0.00 ?  75  LEU A HB3  3  
ATOM 4430  H HG   . LEU A 1 84  ? 28.248  67.608  58.395  1.00 0.00 ?  75  LEU A HG   3  
ATOM 4431  H HD11 . LEU A 1 84  ? 27.576  64.997  59.939  1.00 0.00 ?  75  LEU A HD11 3  
ATOM 4432  H HD12 . LEU A 1 84  ? 26.448  65.924  59.087  1.00 0.00 ?  75  LEU A HD12 3  
ATOM 4433  H HD13 . LEU A 1 84  ? 28.033  65.332  58.256  1.00 0.00 ?  75  LEU A HD13 3  
ATOM 4434  H HD21 . LEU A 1 84  ? 26.590  68.103  59.892  1.00 0.00 ?  75  LEU A HD21 3  
ATOM 4435  H HD22 . LEU A 1 84  ? 27.590  67.414  61.327  1.00 0.00 ?  75  LEU A HD22 3  
ATOM 4436  H HD23 . LEU A 1 84  ? 27.983  68.918  60.431  1.00 0.00 ?  75  LEU A HD23 3  
ATOM 4437  N N    . ILE A 1 85  ? 31.398  67.606  57.060  1.00 0.00 ?  76  ILE A N    3  
ATOM 4438  C CA   . ILE A 1 85  ? 31.558  68.020  55.673  1.00 0.00 ?  76  ILE A CA   3  
ATOM 4439  C C    . ILE A 1 85  ? 32.220  66.881  54.793  1.00 0.00 ?  76  ILE A C    3  
ATOM 4440  O O    . ILE A 1 85  ? 31.715  66.507  53.725  1.00 0.00 ?  76  ILE A O    3  
ATOM 4441  C CB   . ILE A 1 85  ? 32.504  69.233  55.581  1.00 0.00 ?  76  ILE A CB   3  
ATOM 4442  C CG1  . ILE A 1 85  ? 32.181  70.439  56.463  1.00 0.00 ?  76  ILE A CG1  3  
ATOM 4443  C CG2  . ILE A 1 85  ? 32.363  69.651  54.136  1.00 0.00 ?  76  ILE A CG2  3  
ATOM 4444  C CD1  . ILE A 1 85  ? 33.230  71.475  56.649  1.00 0.00 ?  76  ILE A CD1  3  
ATOM 4445  H H    . ILE A 1 85  ? 31.919  67.981  57.841  1.00 0.00 ?  76  ILE A H    3  
ATOM 4446  H HA   . ILE A 1 85  ? 30.577  68.128  55.211  1.00 0.00 ?  76  ILE A HA   3  
ATOM 4447  H HB   . ILE A 1 85  ? 33.531  68.882  55.686  1.00 0.00 ?  76  ILE A HB   3  
ATOM 4448  H HG12 . ILE A 1 85  ? 31.220  70.879  56.194  1.00 0.00 ?  76  ILE A HG12 3  
ATOM 4449  H HG13 . ILE A 1 85  ? 31.929  69.989  57.422  1.00 0.00 ?  76  ILE A HG13 3  
ATOM 4450  H HG21 . ILE A 1 85  ? 32.493  68.869  53.389  1.00 0.00 ?  76  ILE A HG21 3  
ATOM 4451  H HG22 . ILE A 1 85  ? 31.429  70.212  54.073  1.00 0.00 ?  76  ILE A HG22 3  
ATOM 4452  H HG23 . ILE A 1 85  ? 33.178  70.344  53.932  1.00 0.00 ?  76  ILE A HG23 3  
ATOM 4453  H HD11 . ILE A 1 85  ? 32.813  72.049  57.476  1.00 0.00 ?  76  ILE A HD11 3  
ATOM 4454  H HD12 . ILE A 1 85  ? 34.121  70.896  56.889  1.00 0.00 ?  76  ILE A HD12 3  
ATOM 4455  H HD13 . ILE A 1 85  ? 33.462  72.064  55.761  1.00 0.00 ?  76  ILE A HD13 3  
ATOM 4456  N N    . LEU A 1 86  ? 33.340  66.290  55.256  1.00 0.00 ?  77  LEU A N    3  
ATOM 4457  C CA   . LEU A 1 86  ? 33.795  65.025  54.755  1.00 0.00 ?  77  LEU A CA   3  
ATOM 4458  C C    . LEU A 1 86  ? 32.794  63.916  54.794  1.00 0.00 ?  77  LEU A C    3  
ATOM 4459  O O    . LEU A 1 86  ? 32.657  63.268  53.778  1.00 0.00 ?  77  LEU A O    3  
ATOM 4460  C CB   . LEU A 1 86  ? 35.123  64.682  55.485  1.00 0.00 ?  77  LEU A CB   3  
ATOM 4461  C CG   . LEU A 1 86  ? 36.284  65.325  54.679  1.00 0.00 ?  77  LEU A CG   3  
ATOM 4462  C CD1  . LEU A 1 86  ? 37.502  65.352  55.668  1.00 0.00 ?  77  LEU A CD1  3  
ATOM 4463  C CD2  . LEU A 1 86  ? 36.904  64.592  53.509  1.00 0.00 ?  77  LEU A CD2  3  
ATOM 4464  H H    . LEU A 1 86  ? 33.726  66.599  56.137  1.00 0.00 ?  77  LEU A H    3  
ATOM 4465  H HA   . LEU A 1 86  ? 33.891  65.136  53.674  1.00 0.00 ?  77  LEU A HA   3  
ATOM 4466  H HB2  . LEU A 1 86  ? 35.109  65.010  56.524  1.00 0.00 ?  77  LEU A HB2  3  
ATOM 4467  H HB3  . LEU A 1 86  ? 35.225  63.597  55.496  1.00 0.00 ?  77  LEU A HB3  3  
ATOM 4468  H HG   . LEU A 1 86  ? 36.094  66.354  54.371  1.00 0.00 ?  77  LEU A HG   3  
ATOM 4469  H HD11 . LEU A 1 86  ? 37.750  64.375  56.082  1.00 0.00 ?  77  LEU A HD11 3  
ATOM 4470  H HD12 . LEU A 1 86  ? 38.395  65.858  55.303  1.00 0.00 ?  77  LEU A HD12 3  
ATOM 4471  H HD13 . LEU A 1 86  ? 37.351  65.992  56.538  1.00 0.00 ?  77  LEU A HD13 3  
ATOM 4472  H HD21 . LEU A 1 86  ? 37.562  65.239  52.927  1.00 0.00 ?  77  LEU A HD21 3  
ATOM 4473  H HD22 . LEU A 1 86  ? 37.331  63.613  53.721  1.00 0.00 ?  77  LEU A HD22 3  
ATOM 4474  H HD23 . LEU A 1 86  ? 36.057  64.354  52.864  1.00 0.00 ?  77  LEU A HD23 3  
ATOM 4475  N N    . GLY A 1 87  ? 31.987  63.835  55.841  1.00 0.00 ?  78  GLY A N    3  
ATOM 4476  C CA   . GLY A 1 87  ? 30.968  62.829  55.906  1.00 0.00 ?  78  GLY A CA   3  
ATOM 4477  C C    . GLY A 1 87  ? 30.092  62.687  54.642  1.00 0.00 ?  78  GLY A C    3  
ATOM 4478  O O    . GLY A 1 87  ? 30.100  61.590  54.019  1.00 0.00 ?  78  GLY A O    3  
ATOM 4479  H H    . GLY A 1 87  ? 32.059  64.474  56.620  1.00 0.00 ?  78  GLY A H    3  
ATOM 4480  H HA2  . GLY A 1 87  ? 31.477  61.909  56.197  1.00 0.00 ?  78  GLY A HA2  3  
ATOM 4481  H HA3  . GLY A 1 87  ? 30.293  63.102  56.716  1.00 0.00 ?  78  GLY A HA3  3  
ATOM 4482  N N    . TYR A 1 88  ? 29.460  63.865  54.296  1.00 0.00 ?  79  TYR A N    3  
ATOM 4483  C CA   . TYR A 1 88  ? 28.747  64.119  53.075  1.00 0.00 ?  79  TYR A CA   3  
ATOM 4484  C C    . TYR A 1 88  ? 29.519  63.923  51.721  1.00 0.00 ?  79  TYR A C    3  
ATOM 4485  O O    . TYR A 1 88  ? 28.916  63.338  50.807  1.00 0.00 ?  79  TYR A O    3  
ATOM 4486  C CB   . TYR A 1 88  ? 28.173  65.550  53.193  1.00 0.00 ?  79  TYR A CB   3  
ATOM 4487  C CG   . TYR A 1 88  ? 26.999  65.715  54.147  1.00 0.00 ?  79  TYR A CG   3  
ATOM 4488  C CD1  . TYR A 1 88  ? 25.723  65.230  53.791  1.00 0.00 ?  79  TYR A CD1  3  
ATOM 4489  C CD2  . TYR A 1 88  ? 27.122  66.441  55.356  1.00 0.00 ?  79  TYR A CD2  3  
ATOM 4490  C CE1  . TYR A 1 88  ? 24.640  65.351  54.722  1.00 0.00 ?  79  TYR A CE1  3  
ATOM 4491  C CE2  . TYR A 1 88  ? 26.032  66.527  56.281  1.00 0.00 ?  79  TYR A CE2  3  
ATOM 4492  C CZ   . TYR A 1 88  ? 24.814  66.064  55.886  1.00 0.00 ?  79  TYR A CZ   3  
ATOM 4493  O OH   . TYR A 1 88  ? 23.798  66.412  56.747  1.00 0.00 ?  79  TYR A OH   3  
ATOM 4494  H H    . TYR A 1 88  ? 29.572  64.594  54.987  1.00 0.00 ?  79  TYR A H    3  
ATOM 4495  H HA   . TYR A 1 88  ? 27.918  63.413  53.067  1.00 0.00 ?  79  TYR A HA   3  
ATOM 4496  H HB2  . TYR A 1 88  ? 29.023  66.195  53.412  1.00 0.00 ?  79  TYR A HB2  3  
ATOM 4497  H HB3  . TYR A 1 88  ? 27.846  65.929  52.225  1.00 0.00 ?  79  TYR A HB3  3  
ATOM 4498  H HD1  . TYR A 1 88  ? 25.573  64.697  52.864  1.00 0.00 ?  79  TYR A HD1  3  
ATOM 4499  H HD2  . TYR A 1 88  ? 28.052  66.913  55.633  1.00 0.00 ?  79  TYR A HD2  3  
ATOM 4500  H HE1  . TYR A 1 88  ? 23.643  65.033  54.455  1.00 0.00 ?  79  TYR A HE1  3  
ATOM 4501  H HE2  . TYR A 1 88  ? 26.059  67.095  57.198  1.00 0.00 ?  79  TYR A HE2  3  
ATOM 4502  H HH   . TYR A 1 88  ? 23.015  65.940  56.457  1.00 0.00 ?  79  TYR A HH   3  
ATOM 4503  N N    . THR A 1 89  ? 30.797  64.383  51.665  1.00 0.00 ?  80  THR A N    3  
ATOM 4504  C CA   . THR A 1 89  ? 31.697  64.203  50.472  1.00 0.00 ?  80  THR A CA   3  
ATOM 4505  C C    . THR A 1 89  ? 32.198  62.732  50.298  1.00 0.00 ?  80  THR A C    3  
ATOM 4506  O O    . THR A 1 89  ? 32.081  62.180  49.185  1.00 0.00 ?  80  THR A O    3  
ATOM 4507  C CB   . THR A 1 89  ? 32.914  65.186  50.427  1.00 0.00 ?  80  THR A CB   3  
ATOM 4508  O OG1  . THR A 1 89  ? 32.590  66.488  50.840  1.00 0.00 ?  80  THR A OG1  3  
ATOM 4509  C CG2  . THR A 1 89  ? 33.666  65.165  49.035  1.00 0.00 ?  80  THR A CG2  3  
ATOM 4510  H H    . THR A 1 89  ? 31.173  64.719  52.540  1.00 0.00 ?  80  THR A H    3  
ATOM 4511  H HA   . THR A 1 89  ? 30.996  64.331  49.648  1.00 0.00 ?  80  THR A HA   3  
ATOM 4512  H HB   . THR A 1 89  ? 33.590  64.876  51.224  1.00 0.00 ?  80  THR A HB   3  
ATOM 4513  H HG1  . THR A 1 89  ? 32.417  66.561  51.781  1.00 0.00 ?  80  THR A HG1  3  
ATOM 4514  H HG21 . THR A 1 89  ? 34.453  65.915  49.113  1.00 0.00 ?  80  THR A HG21 3  
ATOM 4515  H HG22 . THR A 1 89  ? 34.057  64.152  48.931  1.00 0.00 ?  80  THR A HG22 3  
ATOM 4516  H HG23 . THR A 1 89  ? 32.979  65.496  48.257  1.00 0.00 ?  80  THR A HG23 3  
ATOM 4517  N N    . ARG A 1 90  ? 32.703  62.038  51.343  1.00 0.00 ?  81  ARG A N    3  
ATOM 4518  C CA   . ARG A 1 90  ? 33.254  60.652  51.301  1.00 0.00 ?  81  ARG A CA   3  
ATOM 4519  C C    . ARG A 1 90  ? 32.877  59.701  52.486  1.00 0.00 ?  81  ARG A C    3  
ATOM 4520  O O    . ARG A 1 90  ? 32.666  58.506  52.243  1.00 0.00 ?  81  ARG A O    3  
ATOM 4521  C CB   . ARG A 1 90  ? 34.804  60.766  51.193  1.00 0.00 ?  81  ARG A CB   3  
ATOM 4522  C CG   . ARG A 1 90  ? 35.539  59.400  51.502  1.00 0.00 ?  81  ARG A CG   3  
ATOM 4523  C CD   . ARG A 1 90  ? 35.489  58.235  50.462  1.00 0.00 ?  81  ARG A CD   3  
ATOM 4524  N NE   . ARG A 1 90  ? 36.715  57.520  50.538  1.00 0.00 ?  81  ARG A NE   3  
ATOM 4525  C CZ   . ARG A 1 90  ? 37.463  57.132  51.557  1.00 0.00 ?  81  ARG A CZ   3  
ATOM 4526  N NH1  . ARG A 1 90  ? 37.076  56.880  52.748  1.00 0.00 ?  81  ARG A NH1  3  
ATOM 4527  N NH2  . ARG A 1 90  ? 38.778  57.020  51.426  1.00 0.00 1  81  ARG A NH2  3  
ATOM 4528  H H    . ARG A 1 90  ? 32.430  62.452  52.223  1.00 0.00 ?  81  ARG A H    3  
ATOM 4529  H HA   . ARG A 1 90  ? 32.988  60.154  50.368  1.00 0.00 ?  81  ARG A HA   3  
ATOM 4530  H HB2  . ARG A 1 90  ? 34.981  61.306  50.263  1.00 0.00 ?  81  ARG A HB2  3  
ATOM 4531  H HB3  . ARG A 1 90  ? 35.246  61.498  51.868  1.00 0.00 ?  81  ARG A HB3  3  
ATOM 4532  H HG2  . ARG A 1 90  ? 36.593  59.661  51.603  1.00 0.00 ?  81  ARG A HG2  3  
ATOM 4533  H HG3  . ARG A 1 90  ? 35.268  59.007  52.481  1.00 0.00 ?  81  ARG A HG3  3  
ATOM 4534  H HD2  . ARG A 1 90  ? 34.726  57.521  50.772  1.00 0.00 ?  81  ARG A HD2  3  
ATOM 4535  H HD3  . ARG A 1 90  ? 35.337  58.711  49.494  1.00 0.00 ?  81  ARG A HD3  3  
ATOM 4536  H HE   . ARG A 1 90  ? 37.251  57.569  49.684  1.00 0.00 ?  81  ARG A HE   3  
ATOM 4537  H HH11 . ARG A 1 90  ? 36.100  56.754  52.977  1.00 0.00 ?  81  ARG A HH11 3  
ATOM 4538  H HH12 . ARG A 1 90  ? 37.779  56.625  53.426  1.00 0.00 ?  81  ARG A HH12 3  
ATOM 4539  H HH21 . ARG A 1 90  ? 39.230  57.300  50.568  1.00 0.00 ?  81  ARG A HH21 3  
ATOM 4540  H HH22 . ARG A 1 90  ? 39.370  56.826  52.222  1.00 0.00 ?  81  ARG A HH22 3  
ATOM 4541  N N    . SER A 1 91  ? 32.857  60.083  53.752  1.00 0.00 ?  82  SER A N    3  
ATOM 4542  C CA   . SER A 1 91  ? 32.970  59.138  54.878  1.00 0.00 ?  82  SER A CA   3  
ATOM 4543  C C    . SER A 1 91  ? 31.717  58.290  55.318  1.00 0.00 ?  82  SER A C    3  
ATOM 4544  O O    . SER A 1 91  ? 31.834  57.145  55.802  1.00 0.00 ?  82  SER A O    3  
ATOM 4545  C CB   . SER A 1 91  ? 33.421  59.905  56.185  1.00 0.00 ?  82  SER A CB   3  
ATOM 4546  O OG   . SER A 1 91  ? 34.270  61.037  55.903  1.00 0.00 ?  82  SER A OG   3  
ATOM 4547  H H    . SER A 1 91  ? 33.017  61.045  54.017  1.00 0.00 ?  82  SER A H    3  
ATOM 4548  H HA   . SER A 1 91  ? 33.820  58.463  54.765  1.00 0.00 ?  82  SER A HA   3  
ATOM 4549  H HB2  . SER A 1 91  ? 32.581  60.113  56.846  1.00 0.00 ?  82  SER A HB2  3  
ATOM 4550  H HB3  . SER A 1 91  ? 34.057  59.150  56.648  1.00 0.00 ?  82  SER A HB3  3  
ATOM 4551  H HG   . SER A 1 91  ? 34.380  61.623  56.655  1.00 0.00 ?  82  SER A HG   3  
ATOM 4552  N N    . ARG A 1 92  ? 30.524  58.810  54.969  1.00 0.00 ?  83  ARG A N    3  
ATOM 4553  C CA   . ARG A 1 92  ? 29.215  58.055  55.081  1.00 0.00 ?  83  ARG A CA   3  
ATOM 4554  C C    . ARG A 1 92  ? 28.510  57.889  53.756  1.00 0.00 ?  83  ARG A C    3  
ATOM 4555  O O    . ARG A 1 92  ? 28.481  58.896  52.976  1.00 0.00 ?  83  ARG A O    3  
ATOM 4556  C CB   . ARG A 1 92  ? 28.381  58.722  56.146  1.00 0.00 ?  83  ARG A CB   3  
ATOM 4557  C CG   . ARG A 1 92  ? 26.891  58.374  56.306  1.00 0.00 ?  83  ARG A CG   3  
ATOM 4558  C CD   . ARG A 1 92  ? 26.691  57.106  57.051  1.00 0.00 ?  83  ARG A CD   3  
ATOM 4559  N NE   . ARG A 1 92  ? 25.256  56.816  57.100  1.00 0.00 ?  83  ARG A NE   3  
ATOM 4560  C CZ   . ARG A 1 92  ? 24.620  55.770  56.660  1.00 0.00 ?  83  ARG A CZ   3  
ATOM 4561  N NH1  . ARG A 1 92  ? 25.153  54.710  56.144  1.00 0.00 ?  83  ARG A NH1  3  
ATOM 4562  N NH2  . ARG A 1 92  ? 23.369  55.782  56.944  1.00 0.00 1  83  ARG A NH2  3  
ATOM 4563  H H    . ARG A 1 92  ? 30.491  59.729  54.551  1.00 0.00 ?  83  ARG A H    3  
ATOM 4564  H HA   . ARG A 1 92  ? 29.369  57.030  55.418  1.00 0.00 ?  83  ARG A HA   3  
ATOM 4565  H HB2  . ARG A 1 92  ? 28.840  58.561  57.122  1.00 0.00 ?  83  ARG A HB2  3  
ATOM 4566  H HB3  . ARG A 1 92  ? 28.285  59.793  55.967  1.00 0.00 ?  83  ARG A HB3  3  
ATOM 4567  H HG2  . ARG A 1 92  ? 26.548  59.253  56.852  1.00 0.00 ?  83  ARG A HG2  3  
ATOM 4568  H HG3  . ARG A 1 92  ? 26.358  58.407  55.355  1.00 0.00 ?  83  ARG A HG3  3  
ATOM 4569  H HD2  . ARG A 1 92  ? 27.264  56.359  56.504  1.00 0.00 ?  83  ARG A HD2  3  
ATOM 4570  H HD3  . ARG A 1 92  ? 27.121  57.250  58.043  1.00 0.00 ?  83  ARG A HD3  3  
ATOM 4571  H HE   . ARG A 1 92  ? 24.588  57.532  57.346  1.00 0.00 ?  83  ARG A HE   3  
ATOM 4572  H HH11 . ARG A 1 92  ? 26.117  54.733  55.841  1.00 0.00 ?  83  ARG A HH11 3  
ATOM 4573  H HH12 . ARG A 1 92  ? 24.473  53.998  55.921  1.00 0.00 ?  83  ARG A HH12 3  
ATOM 4574  H HH21 . ARG A 1 92  ? 22.972  56.667  57.226  1.00 0.00 ?  83  ARG A HH21 3  
ATOM 4575  H HH22 . ARG A 1 92  ? 22.764  55.028  56.650  1.00 0.00 ?  83  ARG A HH22 3  
ATOM 4576  N N    . LYS A 1 93  ? 28.067  56.655  53.369  1.00 0.00 ?  84  LYS A N    3  
ATOM 4577  C CA   . LYS A 1 93  ? 27.315  56.411  52.095  1.00 0.00 ?  84  LYS A CA   3  
ATOM 4578  C C    . LYS A 1 93  ? 27.940  56.916  50.769  1.00 0.00 ?  84  LYS A C    3  
ATOM 4579  O O    . LYS A 1 93  ? 27.288  57.655  50.001  1.00 0.00 ?  84  LYS A O    3  
ATOM 4580  C CB   . LYS A 1 93  ? 25.838  56.857  52.276  1.00 0.00 ?  84  LYS A CB   3  
ATOM 4581  C CG   . LYS A 1 93  ? 24.814  56.335  51.287  1.00 0.00 ?  84  LYS A CG   3  
ATOM 4582  C CD   . LYS A 1 93  ? 24.222  55.072  51.819  1.00 0.00 ?  84  LYS A CD   3  
ATOM 4583  C CE   . LYS A 1 93  ? 23.399  55.220  53.051  1.00 0.00 ?  84  LYS A CE   3  
ATOM 4584  N NZ   . LYS A 1 93  ? 22.292  56.197  52.928  1.00 0.00 1  84  LYS A NZ   3  
ATOM 4585  H H    . LYS A 1 93  ? 28.235  55.954  54.076  1.00 0.00 ?  84  LYS A H    3  
ATOM 4586  H HA   . LYS A 1 93  ? 27.254  55.327  51.998  1.00 0.00 ?  84  LYS A HA   3  
ATOM 4587  H HB2  . LYS A 1 93  ? 25.475  56.604  53.272  1.00 0.00 ?  84  LYS A HB2  3  
ATOM 4588  H HB3  . LYS A 1 93  ? 25.777  57.922  52.051  1.00 0.00 ?  84  LYS A HB3  3  
ATOM 4589  H HG2  . LYS A 1 93  ? 24.047  57.058  51.006  1.00 0.00 ?  84  LYS A HG2  3  
ATOM 4590  H HG3  . LYS A 1 93  ? 25.324  56.069  50.361  1.00 0.00 ?  84  LYS A HG3  3  
ATOM 4591  H HD2  . LYS A 1 93  ? 23.514  54.720  51.069  1.00 0.00 ?  84  LYS A HD2  3  
ATOM 4592  H HD3  . LYS A 1 93  ? 24.973  54.289  51.930  1.00 0.00 ?  84  LYS A HD3  3  
ATOM 4593  H HE2  . LYS A 1 93  ? 22.994  54.241  53.303  1.00 0.00 ?  84  LYS A HE2  3  
ATOM 4594  H HE3  . LYS A 1 93  ? 24.026  55.496  53.898  1.00 0.00 ?  84  LYS A HE3  3  
ATOM 4595  H HZ1  . LYS A 1 93  ? 21.740  55.869  52.148  1.00 0.00 ?  84  LYS A HZ1  3  
ATOM 4596  H HZ2  . LYS A 1 93  ? 21.746  56.149  53.776  1.00 0.00 ?  84  LYS A HZ2  3  
ATOM 4597  H HZ3  . LYS A 1 93  ? 22.638  57.123  52.724  1.00 0.00 ?  84  LYS A HZ3  3  
ATOM 4598  N N    . VAL A 1 94  ? 29.160  56.513  50.563  1.00 0.00 ?  85  VAL A N    3  
ATOM 4599  C CA   . VAL A 1 94  ? 30.056  56.943  49.395  1.00 0.00 ?  85  VAL A CA   3  
ATOM 4600  C C    . VAL A 1 94  ? 29.446  56.807  47.986  1.00 0.00 ?  85  VAL A C    3  
ATOM 4601  O O    . VAL A 1 94  ? 28.723  55.833  47.693  1.00 0.00 ?  85  VAL A O    3  
ATOM 4602  C CB   . VAL A 1 94  ? 31.452  56.328  49.532  1.00 0.00 ?  85  VAL A CB   3  
ATOM 4603  C CG1  . VAL A 1 94  ? 31.411  54.867  49.099  1.00 0.00 ?  85  VAL A CG1  3  
ATOM 4604  C CG2  . VAL A 1 94  ? 32.471  57.065  48.613  1.00 0.00 ?  85  VAL A CG2  3  
ATOM 4605  H H    . VAL A 1 94  ? 29.441  55.875  51.293  1.00 0.00 ?  85  VAL A H    3  
ATOM 4606  H HA   . VAL A 1 94  ? 30.167  58.027  49.430  1.00 0.00 ?  85  VAL A HA   3  
ATOM 4607  H HB   . VAL A 1 94  ? 31.875  56.458  50.528  1.00 0.00 ?  85  VAL A HB   3  
ATOM 4608  H HG11 . VAL A 1 94  ? 30.851  54.323  49.861  1.00 0.00 ?  85  VAL A HG11 3  
ATOM 4609  H HG12 . VAL A 1 94  ? 30.863  54.697  48.173  1.00 0.00 ?  85  VAL A HG12 3  
ATOM 4610  H HG13 . VAL A 1 94  ? 32.434  54.497  49.042  1.00 0.00 ?  85  VAL A HG13 3  
ATOM 4611  H HG21 . VAL A 1 94  ? 32.330  57.068  47.531  1.00 0.00 ?  85  VAL A HG21 3  
ATOM 4612  H HG22 . VAL A 1 94  ? 32.508  58.095  48.967  1.00 0.00 ?  85  VAL A HG22 3  
ATOM 4613  H HG23 . VAL A 1 94  ? 33.479  56.668  48.730  1.00 0.00 ?  85  VAL A HG23 3  
ATOM 4614  N N    . ASP A 1 95  ? 29.668  57.831  47.129  1.00 0.00 ?  86  ASP A N    3  
ATOM 4615  C CA   . ASP A 1 95  ? 29.268  57.949  45.775  1.00 0.00 ?  86  ASP A CA   3  
ATOM 4616  C C    . ASP A 1 95  ? 30.027  57.039  44.736  1.00 0.00 ?  86  ASP A C    3  
ATOM 4617  O O    . ASP A 1 95  ? 29.364  56.384  43.864  1.00 0.00 ?  86  ASP A O    3  
ATOM 4618  C CB   . ASP A 1 95  ? 29.565  59.408  45.413  1.00 0.00 ?  86  ASP A CB   3  
ATOM 4619  C CG   . ASP A 1 95  ? 30.937  59.937  45.569  1.00 0.00 ?  86  ASP A CG   3  
ATOM 4620  O OD1  . ASP A 1 95  ? 31.756  59.219  46.199  1.00 0.00 ?  86  ASP A OD1  3  
ATOM 4621  O OD2  . ASP A 1 95  ? 31.255  61.005  45.007  1.00 0.00 -1 86  ASP A OD2  3  
ATOM 4622  H H    . ASP A 1 95  ? 30.439  58.423  47.407  1.00 0.00 ?  86  ASP A H    3  
ATOM 4623  H HA   . ASP A 1 95  ? 28.210  57.699  45.697  1.00 0.00 ?  86  ASP A HA   3  
ATOM 4624  H HB2  . ASP A 1 95  ? 29.302  59.478  44.357  1.00 0.00 ?  86  ASP A HB2  3  
ATOM 4625  H HB3  . ASP A 1 95  ? 28.746  59.908  45.930  1.00 0.00 ?  86  ASP A HB3  3  
ATOM 4626  N N    . LYS A 1 96  ? 31.358  56.842  44.929  1.00 0.00 ?  87  LYS A N    3  
ATOM 4627  C CA   . LYS A 1 96  ? 32.248  55.994  44.131  1.00 0.00 ?  87  LYS A CA   3  
ATOM 4628  C C    . LYS A 1 96  ? 31.839  54.484  44.351  1.00 0.00 ?  87  LYS A C    3  
ATOM 4629  O O    . LYS A 1 96  ? 31.108  54.109  45.213  1.00 0.00 ?  87  LYS A O    3  
ATOM 4630  C CB   . LYS A 1 96  ? 33.725  56.117  44.657  1.00 0.00 ?  87  LYS A CB   3  
ATOM 4631  C CG   . LYS A 1 96  ? 34.314  57.508  44.870  1.00 0.00 ?  87  LYS A CG   3  
ATOM 4632  C CD   . LYS A 1 96  ? 34.055  58.525  43.789  1.00 0.00 ?  87  LYS A CD   3  
ATOM 4633  C CE   . LYS A 1 96  ? 34.626  59.951  44.016  1.00 0.00 ?  87  LYS A CE   3  
ATOM 4634  N NZ   . LYS A 1 96  ? 34.088  60.696  45.204  1.00 0.00 1  87  LYS A NZ   3  
ATOM 4635  H H    . LYS A 1 96  ? 31.766  57.380  45.680  1.00 0.00 ?  87  LYS A H    3  
ATOM 4636  H HA   . LYS A 1 96  ? 32.066  56.430  43.148  1.00 0.00 ?  87  LYS A HA   3  
ATOM 4637  H HB2  . LYS A 1 96  ? 33.882  55.492  45.536  1.00 0.00 ?  87  LYS A HB2  3  
ATOM 4638  H HB3  . LYS A 1 96  ? 34.246  55.684  43.803  1.00 0.00 ?  87  LYS A HB3  3  
ATOM 4639  H HG2  . LYS A 1 96  ? 33.971  57.989  45.785  1.00 0.00 ?  87  LYS A HG2  3  
ATOM 4640  H HG3  . LYS A 1 96  ? 35.390  57.400  45.009  1.00 0.00 ?  87  LYS A HG3  3  
ATOM 4641  H HD2  . LYS A 1 96  ? 34.468  58.149  42.853  1.00 0.00 ?  87  LYS A HD2  3  
ATOM 4642  H HD3  . LYS A 1 96  ? 32.980  58.540  43.611  1.00 0.00 ?  87  LYS A HD3  3  
ATOM 4643  H HE2  . LYS A 1 96  ? 35.681  59.758  44.215  1.00 0.00 ?  87  LYS A HE2  3  
ATOM 4644  H HE3  . LYS A 1 96  ? 34.508  60.620  43.164  1.00 0.00 ?  87  LYS A HE3  3  
ATOM 4645  H HZ1  . LYS A 1 96  ? 34.677  61.509  45.309  1.00 0.00 ?  87  LYS A HZ1  3  
ATOM 4646  H HZ2  . LYS A 1 96  ? 33.096  60.854  45.095  1.00 0.00 ?  87  LYS A HZ2  3  
ATOM 4647  H HZ3  . LYS A 1 96  ? 34.292  60.184  46.051  1.00 0.00 ?  87  LYS A HZ3  3  
ATOM 4648  N N    . ARG A 1 97  ? 32.189  53.613  43.386  1.00 0.00 ?  88  ARG A N    3  
ATOM 4649  C CA   . ARG A 1 97  ? 32.022  52.118  43.444  1.00 0.00 ?  88  ARG A CA   3  
ATOM 4650  C C    . ARG A 1 97  ? 33.285  51.481  42.875  1.00 0.00 ?  88  ARG A C    3  
ATOM 4651  O O    . ARG A 1 97  ? 33.241  50.407  42.246  1.00 0.00 ?  88  ARG A O    3  
ATOM 4652  C CB   . ARG A 1 97  ? 30.699  51.737  42.814  1.00 0.00 ?  88  ARG A CB   3  
ATOM 4653  C CG   . ARG A 1 97  ? 30.481  51.826  41.358  1.00 0.00 ?  88  ARG A CG   3  
ATOM 4654  C CD   . ARG A 1 97  ? 29.027  51.357  41.175  1.00 0.00 ?  88  ARG A CD   3  
ATOM 4655  N NE   . ARG A 1 97  ? 28.430  51.651  39.791  1.00 0.00 ?  88  ARG A NE   3  
ATOM 4656  C CZ   . ARG A 1 97  ? 27.531  52.528  39.437  1.00 0.00 ?  88  ARG A CZ   3  
ATOM 4657  N NH1  . ARG A 1 97  ? 27.023  53.393  40.238  1.00 0.00 ?  88  ARG A NH1  3  
ATOM 4658  N NH2  . ARG A 1 97  ? 27.153  52.441  38.169  1.00 0.00 1  88  ARG A NH2  3  
ATOM 4659  H H    . ARG A 1 97  ? 32.716  53.978  42.605  1.00 0.00 ?  88  ARG A H    3  
ATOM 4660  H HA   . ARG A 1 97  ? 32.053  51.886  44.508  1.00 0.00 ?  88  ARG A HA   3  
ATOM 4661  H HB2  . ARG A 1 97  ? 30.479  50.748  43.218  1.00 0.00 ?  88  ARG A HB2  3  
ATOM 4662  H HB3  . ARG A 1 97  ? 29.968  52.394  43.285  1.00 0.00 ?  88  ARG A HB3  3  
ATOM 4663  H HG2  . ARG A 1 97  ? 30.502  52.887  41.111  1.00 0.00 ?  88  ARG A HG2  3  
ATOM 4664  H HG3  . ARG A 1 97  ? 30.997  51.224  40.610  1.00 0.00 ?  88  ARG A HG3  3  
ATOM 4665  H HD2  . ARG A 1 97  ? 29.032  50.299  41.438  1.00 0.00 ?  88  ARG A HD2  3  
ATOM 4666  H HD3  . ARG A 1 97  ? 28.383  51.887  41.877  1.00 0.00 ?  88  ARG A HD3  3  
ATOM 4667  H HE   . ARG A 1 97  ? 28.570  50.923  39.105  1.00 0.00 ?  88  ARG A HE   3  
ATOM 4668  H HH11 . ARG A 1 97  ? 27.413  53.449  41.168  1.00 0.00 ?  88  ARG A HH11 3  
ATOM 4669  H HH12 . ARG A 1 97  ? 26.472  54.117  39.799  1.00 0.00 ?  88  ARG A HH12 3  
ATOM 4670  H HH21 . ARG A 1 97  ? 27.664  51.817  37.562  1.00 0.00 ?  88  ARG A HH21 3  
ATOM 4671  H HH22 . ARG A 1 97  ? 26.550  53.154  37.783  1.00 0.00 ?  88  ARG A HH22 3  
ATOM 4672  N N    . SER A 1 98  ? 34.440  52.148  43.052  1.00 0.00 ?  89  SER A N    3  
ATOM 4673  C CA   . SER A 1 98  ? 35.712  51.728  42.455  1.00 0.00 ?  89  SER A CA   3  
ATOM 4674  C C    . SER A 1 98  ? 36.745  51.614  43.505  1.00 0.00 ?  89  SER A C    3  
ATOM 4675  O O    . SER A 1 98  ? 36.915  52.515  44.289  1.00 0.00 ?  89  SER A O    3  
ATOM 4676  C CB   . SER A 1 98  ? 36.130  52.638  41.415  1.00 0.00 ?  89  SER A CB   3  
ATOM 4677  O OG   . SER A 1 98  ? 35.299  52.448  40.260  1.00 0.00 ?  89  SER A OG   3  
ATOM 4678  H H    . SER A 1 98  ? 34.493  52.872  43.754  1.00 0.00 ?  89  SER A H    3  
ATOM 4679  H HA   . SER A 1 98  ? 35.666  50.764  41.949  1.00 0.00 ?  89  SER A HA   3  
ATOM 4680  H HB2  . SER A 1 98  ? 36.093  53.634  41.858  1.00 0.00 ?  89  SER A HB2  3  
ATOM 4681  H HB3  . SER A 1 98  ? 37.139  52.376  41.096  1.00 0.00 ?  89  SER A HB3  3  
ATOM 4682  H HG   . SER A 1 98  ? 35.841  51.945  39.648  1.00 0.00 ?  89  SER A HG   3  
ATOM 4683  N N    . ASP A 1 99  ? 37.480  50.532  43.586  1.00 0.00 ?  90  ASP A N    3  
ATOM 4684  C CA   . ASP A 1 99  ? 38.746  50.269  44.261  1.00 0.00 ?  90  ASP A CA   3  
ATOM 4685  C C    . ASP A 1 99  ? 39.975  50.816  43.484  1.00 0.00 ?  90  ASP A C    3  
ATOM 4686  O O    . ASP A 1 99  ? 39.922  50.945  42.268  1.00 0.00 ?  90  ASP A O    3  
ATOM 4687  C CB   . ASP A 1 99  ? 38.781  48.835  44.778  1.00 0.00 ?  90  ASP A CB   3  
ATOM 4688  C CG   . ASP A 1 99  ? 38.341  47.705  43.811  1.00 0.00 ?  90  ASP A CG   3  
ATOM 4689  O OD1  . ASP A 1 99  ? 38.166  47.967  42.577  1.00 0.00 ?  90  ASP A OD1  3  
ATOM 4690  O OD2  . ASP A 1 99  ? 38.100  46.569  44.380  1.00 0.00 -1 90  ASP A OD2  3  
ATOM 4691  H H    . ASP A 1 99  ? 37.310  49.837  42.874  1.00 0.00 ?  90  ASP A H    3  
ATOM 4692  H HA   . ASP A 1 99  ? 38.726  51.071  44.998  1.00 0.00 ?  90  ASP A HA   3  
ATOM 4693  H HB2  . ASP A 1 99  ? 39.767  48.724  45.228  1.00 0.00 ?  90  ASP A HB2  3  
ATOM 4694  H HB3  . ASP A 1 99  ? 38.087  48.786  45.618  1.00 0.00 ?  90  ASP A HB3  3  
ATOM 4695  N N    . PRO A 1 100 ? 41.147  50.993  44.133  1.00 0.00 ?  91  PRO A N    3  
ATOM 4696  C CA   . PRO A 1 100 ? 42.416  51.273  43.409  1.00 0.00 ?  91  PRO A CA   3  
ATOM 4697  C C    . PRO A 1 100 ? 42.867  50.171  42.440  1.00 0.00 ?  91  PRO A C    3  
ATOM 4698  O O    . PRO A 1 100 ? 43.547  50.385  41.412  1.00 0.00 ?  91  PRO A O    3  
ATOM 4699  C CB   . PRO A 1 100 ? 43.465  51.464  44.556  1.00 0.00 ?  91  PRO A CB   3  
ATOM 4700  C CG   . PRO A 1 100 ? 42.647  51.986  45.739  1.00 0.00 ?  91  PRO A CG   3  
ATOM 4701  C CD   . PRO A 1 100 ? 41.380  51.106  45.608  1.00 0.00 ?  91  PRO A CD   3  
ATOM 4702  H HA   . PRO A 1 100 ? 42.307  52.238  42.912  1.00 0.00 ?  91  PRO A HA   3  
ATOM 4703  H HB2  . PRO A 1 100 ? 44.045  50.565  44.768  1.00 0.00 ?  91  PRO A HB2  3  
ATOM 4704  H HB3  . PRO A 1 100 ? 44.208  52.191  44.229  1.00 0.00 ?  91  PRO A HB3  3  
ATOM 4705  H HG2  . PRO A 1 100 ? 43.113  51.768  46.699  1.00 0.00 ?  91  PRO A HG2  3  
ATOM 4706  H HG3  . PRO A 1 100 ? 42.314  53.021  45.662  1.00 0.00 ?  91  PRO A HG3  3  
ATOM 4707  H HD2  . PRO A 1 100 ? 41.367  50.230  46.257  1.00 0.00 ?  91  PRO A HD2  3  
ATOM 4708  H HD3  . PRO A 1 100 ? 40.600  51.704  46.078  1.00 0.00 ?  91  PRO A HD3  3  
ATOM 4709  N N    . TYR A 1 101 ? 42.381  48.914  42.638  1.00 0.00 ?  92  TYR A N    3  
ATOM 4710  C CA   . TYR A 1 101 ? 42.513  47.898  41.544  1.00 0.00 ?  92  TYR A CA   3  
ATOM 4711  C C    . TYR A 1 101 ? 41.818  48.179  40.143  1.00 0.00 ?  92  TYR A C    3  
ATOM 4712  O O    . TYR A 1 101 ? 42.479  47.937  39.156  1.00 0.00 ?  92  TYR A O    3  
ATOM 4713  C CB   . TYR A 1 101 ? 42.287  46.460  42.084  1.00 0.00 ?  92  TYR A CB   3  
ATOM 4714  C CG   . TYR A 1 101 ? 43.558  45.787  42.748  1.00 0.00 ?  92  TYR A CG   3  
ATOM 4715  C CD1  . TYR A 1 101 ? 44.454  46.509  43.611  1.00 0.00 ?  92  TYR A CD1  3  
ATOM 4716  C CD2  . TYR A 1 101 ? 43.688  44.413  42.550  1.00 0.00 ?  92  TYR A CD2  3  
ATOM 4717  C CE1  . TYR A 1 101 ? 45.626  45.836  44.102  1.00 0.00 ?  92  TYR A CE1  3  
ATOM 4718  C CE2  . TYR A 1 101 ? 44.816  43.766  43.070  1.00 0.00 ?  92  TYR A CE2  3  
ATOM 4719  C CZ   . TYR A 1 101 ? 45.827  44.560  43.716  1.00 0.00 ?  92  TYR A CZ   3  
ATOM 4720  O OH   . TYR A 1 101 ? 47.021  43.915  44.007  1.00 0.00 ?  92  TYR A OH   3  
ATOM 4721  H H    . TYR A 1 101 ? 41.870  48.712  43.485  1.00 0.00 ?  92  TYR A H    3  
ATOM 4722  H HA   . TYR A 1 101 ? 43.581  48.072  41.416  1.00 0.00 ?  92  TYR A HA   3  
ATOM 4723  H HB2  . TYR A 1 101 ? 41.584  46.577  42.908  1.00 0.00 ?  92  TYR A HB2  3  
ATOM 4724  H HB3  . TYR A 1 101 ? 41.893  45.810  41.303  1.00 0.00 ?  92  TYR A HB3  3  
ATOM 4725  H HD1  . TYR A 1 101 ? 44.233  47.508  43.957  1.00 0.00 ?  92  TYR A HD1  3  
ATOM 4726  H HD2  . TYR A 1 101 ? 42.905  43.871  42.040  1.00 0.00 ?  92  TYR A HD2  3  
ATOM 4727  H HE1  . TYR A 1 101 ? 46.383  46.326  44.697  1.00 0.00 ?  92  TYR A HE1  3  
ATOM 4728  H HE2  . TYR A 1 101 ? 44.990  42.749  42.747  1.00 0.00 ?  92  TYR A HE2  3  
ATOM 4729  H HH   . TYR A 1 101 ? 47.454  44.259  44.793  1.00 0.00 ?  92  TYR A HH   3  
ATOM 4730  N N    . HIS A 1 102 ? 40.663  48.764  40.083  1.00 0.00 ?  93  HIS A N    3  
ATOM 4731  C CA   . HIS A 1 102 ? 40.084  49.311  38.819  1.00 0.00 ?  93  HIS A CA   3  
ATOM 4732  C C    . HIS A 1 102 ? 41.013  50.147  37.992  1.00 0.00 ?  93  HIS A C    3  
ATOM 4733  O O    . HIS A 1 102 ? 40.889  50.175  36.786  1.00 0.00 ?  93  HIS A O    3  
ATOM 4734  C CB   . HIS A 1 102 ? 38.879  50.213  39.119  1.00 0.00 ?  93  HIS A CB   3  
ATOM 4735  C CG   . HIS A 1 102 ? 37.814  50.248  38.071  1.00 0.00 ?  93  HIS A CG   3  
ATOM 4736  N ND1  . HIS A 1 102 ? 36.657  51.149  38.132  1.00 0.00 ?  93  HIS A ND1  3  
ATOM 4737  C CD2  . HIS A 1 102 ? 37.732  49.477  36.921  1.00 0.00 ?  93  HIS A CD2  3  
ATOM 4738  C CE1  . HIS A 1 102 ? 35.989  50.882  36.987  1.00 0.00 ?  93  HIS A CE1  3  
ATOM 4739  N NE2  . HIS A 1 102 ? 36.601  49.906  36.272  1.00 0.00 ?  93  HIS A NE2  3  
ATOM 4740  H H    . HIS A 1 102 ? 40.153  48.928  40.940  1.00 0.00 ?  93  HIS A H    3  
ATOM 4741  H HA   . HIS A 1 102 ? 39.631  48.521  38.222  1.00 0.00 ?  93  HIS A HA   3  
ATOM 4742  H HB2  . HIS A 1 102 ? 38.450  49.634  39.938  1.00 0.00 ?  93  HIS A HB2  3  
ATOM 4743  H HB3  . HIS A 1 102 ? 39.274  51.191  39.391  1.00 0.00 ?  93  HIS A HB3  3  
ATOM 4744  H HD2  . HIS A 1 102 ? 38.374  48.669  36.601  1.00 0.00 ?  93  HIS A HD2  3  
ATOM 4745  H HE1  . HIS A 1 102 ? 35.056  51.318  36.660  1.00 0.00 ?  93  HIS A HE1  3  
ATOM 4746  H HE2  . HIS A 1 102 ? 36.233  49.582  35.390  1.00 0.00 ?  93  HIS A HE2  3  
ATOM 4747  N N    . VAL A 1 103 ? 41.912  50.919  38.600  1.00 0.00 ?  94  VAL A N    3  
ATOM 4748  C CA   . VAL A 1 103 ? 42.772  51.845  37.896  1.00 0.00 ?  94  VAL A CA   3  
ATOM 4749  C C    . VAL A 1 103 ? 43.763  51.178  36.945  1.00 0.00 ?  94  VAL A C    3  
ATOM 4750  O O    . VAL A 1 103 ? 44.114  51.742  35.938  1.00 0.00 ?  94  VAL A O    3  
ATOM 4751  C CB   . VAL A 1 103 ? 43.641  52.632  38.860  1.00 0.00 ?  94  VAL A CB   3  
ATOM 4752  C CG1  . VAL A 1 103 ? 44.413  53.752  38.097  1.00 0.00 ?  94  VAL A CG1  3  
ATOM 4753  C CG2  . VAL A 1 103 ? 42.769  53.333  39.965  1.00 0.00 ?  94  VAL A CG2  3  
ATOM 4754  H H    . VAL A 1 103 ? 42.192  50.720  39.549  1.00 0.00 ?  94  VAL A H    3  
ATOM 4755  H HA   . VAL A 1 103 ? 42.144  52.474  37.264  1.00 0.00 ?  94  VAL A HA   3  
ATOM 4756  H HB   . VAL A 1 103 ? 44.406  52.026  39.344  1.00 0.00 ?  94  VAL A HB   3  
ATOM 4757  H HG11 . VAL A 1 103 ? 44.602  54.508  38.860  1.00 0.00 ?  94  VAL A HG11 3  
ATOM 4758  H HG12 . VAL A 1 103 ? 45.336  53.416  37.623  1.00 0.00 ?  94  VAL A HG12 3  
ATOM 4759  H HG13 . VAL A 1 103 ? 43.794  54.187  37.312  1.00 0.00 ?  94  VAL A HG13 3  
ATOM 4760  H HG21 . VAL A 1 103 ? 43.487  53.920  40.539  1.00 0.00 ?  94  VAL A HG21 3  
ATOM 4761  H HG22 . VAL A 1 103 ? 41.977  53.985  39.595  1.00 0.00 ?  94  VAL A HG22 3  
ATOM 4762  H HG23 . VAL A 1 103 ? 42.298  52.596  40.615  1.00 0.00 ?  94  VAL A HG23 3  
ATOM 4763  N N    . TYR A 1 104 ? 44.132  49.964  37.314  1.00 0.00 ?  95  TYR A N    3  
ATOM 4764  C CA   . TYR A 1 104 ? 44.998  48.992  36.657  1.00 0.00 ?  95  TYR A CA   3  
ATOM 4765  C C    . TYR A 1 104 ? 44.369  48.012  35.640  1.00 0.00 ?  95  TYR A C    3  
ATOM 4766  O O    . TYR A 1 104 ? 45.013  47.497  34.707  1.00 0.00 ?  95  TYR A O    3  
ATOM 4767  C CB   . TYR A 1 104 ? 45.850  48.308  37.729  1.00 0.00 ?  95  TYR A CB   3  
ATOM 4768  C CG   . TYR A 1 104 ? 47.034  49.181  38.094  1.00 0.00 ?  95  TYR A CG   3  
ATOM 4769  C CD1  . TYR A 1 104 ? 48.247  49.192  37.420  1.00 0.00 ?  95  TYR A CD1  3  
ATOM 4770  C CD2  . TYR A 1 104 ? 46.849  50.022  39.239  1.00 0.00 ?  95  TYR A CD2  3  
ATOM 4771  C CE1  . TYR A 1 104 ? 49.297  50.004  37.841  1.00 0.00 ?  95  TYR A CE1  3  
ATOM 4772  C CE2  . TYR A 1 104 ? 47.907  50.895  39.632  1.00 0.00 ?  95  TYR A CE2  3  
ATOM 4773  C CZ   . TYR A 1 104 ? 49.120  50.875  38.922  1.00 0.00 ?  95  TYR A CZ   3  
ATOM 4774  O OH   . TYR A 1 104 ? 50.081  51.704  39.391  1.00 0.00 ?  95  TYR A OH   3  
ATOM 4775  H H    . TYR A 1 104 ? 43.720  49.633  38.175  1.00 0.00 ?  95  TYR A H    3  
ATOM 4776  H HA   . TYR A 1 104 ? 45.700  49.590  36.076  1.00 0.00 ?  95  TYR A HA   3  
ATOM 4777  H HB2  . TYR A 1 104 ? 45.209  47.906  38.514  1.00 0.00 ?  95  TYR A HB2  3  
ATOM 4778  H HB3  . TYR A 1 104 ? 46.303  47.421  37.286  1.00 0.00 ?  95  TYR A HB3  3  
ATOM 4779  H HD1  . TYR A 1 104 ? 48.367  48.508  36.593  1.00 0.00 ?  95  TYR A HD1  3  
ATOM 4780  H HD2  . TYR A 1 104 ? 45.908  50.034  39.768  1.00 0.00 ?  95  TYR A HD2  3  
ATOM 4781  H HE1  . TYR A 1 104 ? 50.245  50.083  37.329  1.00 0.00 ?  95  TYR A HE1  3  
ATOM 4782  H HE2  . TYR A 1 104 ? 47.748  51.711  40.322  1.00 0.00 ?  95  TYR A HE2  3  
ATOM 4783  H HH   . TYR A 1 104 ? 50.953  51.709  38.989  1.00 0.00 ?  95  TYR A HH   3  
ATOM 4784  N N    . ILE A 1 105 ? 43.084  47.638  35.870  1.00 0.00 ?  96  ILE A N    3  
ATOM 4785  C CA   . ILE A 1 105 ? 42.346  46.812  34.899  1.00 0.00 ?  96  ILE A CA   3  
ATOM 4786  C C    . ILE A 1 105 ? 40.908  47.280  34.707  1.00 0.00 ?  96  ILE A C    3  
ATOM 4787  O O    . ILE A 1 105 ? 40.101  47.488  35.657  1.00 0.00 ?  96  ILE A O    3  
ATOM 4788  C CB   . ILE A 1 105 ? 42.494  45.306  35.295  1.00 0.00 ?  96  ILE A CB   3  
ATOM 4789  C CG1  . ILE A 1 105 ? 41.609  44.368  34.402  1.00 0.00 ?  96  ILE A CG1  3  
ATOM 4790  C CG2  . ILE A 1 105 ? 42.235  45.046  36.816  1.00 0.00 ?  96  ILE A CG2  3  
ATOM 4791  C CD1  . ILE A 1 105 ? 42.128  42.917  34.317  1.00 0.00 ?  96  ILE A CD1  3  
ATOM 4792  H H    . ILE A 1 105 ? 42.605  47.972  36.695  1.00 0.00 ?  96  ILE A H    3  
ATOM 4793  H HA   . ILE A 1 105 ? 42.725  46.880  33.879  1.00 0.00 ?  96  ILE A HA   3  
ATOM 4794  H HB   . ILE A 1 105 ? 43.533  45.137  35.010  1.00 0.00 ?  96  ILE A HB   3  
ATOM 4795  H HG12 . ILE A 1 105 ? 40.586  44.416  34.774  1.00 0.00 ?  96  ILE A HG12 3  
ATOM 4796  H HG13 . ILE A 1 105 ? 41.640  44.614  33.340  1.00 0.00 ?  96  ILE A HG13 3  
ATOM 4797  H HG21 . ILE A 1 105 ? 41.362  45.658  37.044  1.00 0.00 ?  96  ILE A HG21 3  
ATOM 4798  H HG22 . ILE A 1 105 ? 41.999  43.996  36.995  1.00 0.00 ?  96  ILE A HG22 3  
ATOM 4799  H HG23 . ILE A 1 105 ? 43.073  45.436  37.393  1.00 0.00 ?  96  ILE A HG23 3  
ATOM 4800  H HD11 . ILE A 1 105 ? 42.061  42.407  35.278  1.00 0.00 ?  96  ILE A HD11 3  
ATOM 4801  H HD12 . ILE A 1 105 ? 41.500  42.345  33.634  1.00 0.00 ?  96  ILE A HD12 3  
ATOM 4802  H HD13 . ILE A 1 105 ? 43.150  42.994  33.948  1.00 0.00 ?  96  ILE A HD13 3  
ATOM 4803  N N    . LYS A 1 106 ? 40.518  47.551  33.439  1.00 0.00 ?  97  LYS A N    3  
ATOM 4804  C CA   . LYS A 1 106 ? 39.176  48.235  33.084  1.00 0.00 ?  97  LYS A CA   3  
ATOM 4805  C C    . LYS A 1 106 ? 37.994  47.344  33.303  1.00 0.00 ?  97  LYS A C    3  
ATOM 4806  O O    . LYS A 1 106 ? 36.887  47.684  33.545  1.00 0.00 ?  97  LYS A O    3  
ATOM 4807  C CB   . LYS A 1 106 ? 39.164  48.607  31.635  1.00 0.00 ?  97  LYS A CB   3  
ATOM 4808  C CG   . LYS A 1 106 ? 40.086  49.777  31.296  1.00 0.00 ?  97  LYS A CG   3  
ATOM 4809  C CD   . LYS A 1 106 ? 40.024  50.103  29.800  1.00 0.00 ?  97  LYS A CD   3  
ATOM 4810  C CE   . LYS A 1 106 ? 40.563  51.560  29.661  1.00 0.00 ?  97  LYS A CE   3  
ATOM 4811  N NZ   . LYS A 1 106 ? 40.612  51.996  28.248  1.00 0.00 1  97  LYS A NZ   3  
ATOM 4812  H H    . LYS A 1 106 ? 41.180  47.331  32.708  1.00 0.00 ?  97  LYS A H    3  
ATOM 4813  H HA   . LYS A 1 106 ? 39.024  49.130  33.688  1.00 0.00 ?  97  LYS A HA   3  
ATOM 4814  H HB2  . LYS A 1 106 ? 39.455  47.758  31.015  1.00 0.00 ?  97  LYS A HB2  3  
ATOM 4815  H HB3  . LYS A 1 106 ? 38.129  48.751  31.322  1.00 0.00 ?  97  LYS A HB3  3  
ATOM 4816  H HG2  . LYS A 1 106 ? 39.830  50.680  31.849  1.00 0.00 ?  97  LYS A HG2  3  
ATOM 4817  H HG3  . LYS A 1 106 ? 41.108  49.462  31.511  1.00 0.00 ?  97  LYS A HG3  3  
ATOM 4818  H HD2  . LYS A 1 106 ? 40.694  49.484  29.203  1.00 0.00 ?  97  LYS A HD2  3  
ATOM 4819  H HD3  . LYS A 1 106 ? 38.993  49.927  29.492  1.00 0.00 ?  97  LYS A HD3  3  
ATOM 4820  H HE2  . LYS A 1 106 ? 39.848  52.132  30.251  1.00 0.00 ?  97  LYS A HE2  3  
ATOM 4821  H HE3  . LYS A 1 106 ? 41.525  51.652  30.165  1.00 0.00 ?  97  LYS A HE3  3  
ATOM 4822  H HZ1  . LYS A 1 106 ? 39.691  52.084  27.842  1.00 0.00 ?  97  LYS A HZ1  3  
ATOM 4823  H HZ2  . LYS A 1 106 ? 41.175  52.821  28.097  1.00 0.00 ?  97  LYS A HZ2  3  
ATOM 4824  H HZ3  . LYS A 1 106 ? 41.026  51.242  27.719  1.00 0.00 ?  97  LYS A HZ3  3  
ATOM 4825  N N    . ASN A 1 107 ? 38.253  46.030  33.319  1.00 0.00 ?  98  ASN A N    3  
ATOM 4826  C CA   . ASN A 1 107 ? 37.324  44.864  33.537  1.00 0.00 ?  98  ASN A CA   3  
ATOM 4827  C C    . ASN A 1 107 ? 36.980  44.637  35.024  1.00 0.00 ?  98  ASN A C    3  
ATOM 4828  O O    . ASN A 1 107 ? 35.992  43.951  35.282  1.00 0.00 ?  98  ASN A O    3  
ATOM 4829  C CB   . ASN A 1 107 ? 38.023  43.577  32.899  1.00 0.00 ?  98  ASN A CB   3  
ATOM 4830  C CG   . ASN A 1 107 ? 37.303  42.249  33.142  1.00 0.00 ?  98  ASN A CG   3  
ATOM 4831  O OD1  . ASN A 1 107 ? 37.794  41.291  33.655  1.00 0.00 ?  98  ASN A OD1  3  
ATOM 4832  N ND2  . ASN A 1 107 ? 36.060  42.195  32.655  1.00 0.00 ?  98  ASN A ND2  3  
ATOM 4833  H H    . ASN A 1 107 ? 39.206  45.814  33.064  1.00 0.00 ?  98  ASN A H    3  
ATOM 4834  H HA   . ASN A 1 107 ? 36.383  45.106  33.043  1.00 0.00 ?  98  ASN A HA   3  
ATOM 4835  H HB2  . ASN A 1 107 ? 38.125  43.775  31.832  1.00 0.00 ?  98  ASN A HB2  3  
ATOM 4836  H HB3  . ASN A 1 107 ? 39.013  43.504  33.350  1.00 0.00 ?  98  ASN A HB3  3  
ATOM 4837  H HD21 . ASN A 1 107 ? 35.567  42.944  32.190  1.00 0.00 ?  98  ASN A HD21 3  
ATOM 4838  H HD22 . ASN A 1 107 ? 35.681  41.273  32.818  1.00 0.00 ?  98  ASN A HD22 3  
ATOM 4839  N N    . ARG A 1 108 ? 37.652  45.206  36.005  1.00 0.00 ?  99  ARG A N    3  
ATOM 4840  C CA   . ARG A 1 108 ? 37.425  44.914  37.460  1.00 0.00 ?  99  ARG A CA   3  
ATOM 4841  C C    . ARG A 1 108 ? 35.958  45.120  37.955  1.00 0.00 ?  99  ARG A C    3  
ATOM 4842  O O    . ARG A 1 108 ? 35.363  46.108  37.651  1.00 0.00 ?  99  ARG A O    3  
ATOM 4843  C CB   . ARG A 1 108 ? 38.489  45.725  38.211  1.00 0.00 ?  99  ARG A CB   3  
ATOM 4844  C CG   . ARG A 1 108 ? 38.304  45.869  39.735  1.00 0.00 ?  99  ARG A CG   3  
ATOM 4845  C CD   . ARG A 1 108 ? 38.760  44.722  40.471  1.00 0.00 ?  99  ARG A CD   3  
ATOM 4846  N NE   . ARG A 1 108 ? 38.892  44.919  41.934  1.00 0.00 ?  99  ARG A NE   3  
ATOM 4847  C CZ   . ARG A 1 108 ? 39.530  44.095  42.760  1.00 0.00 ?  99  ARG A CZ   3  
ATOM 4848  N NH1  . ARG A 1 108 ? 40.044  42.967  42.323  1.00 0.00 ?  99  ARG A NH1  3  
ATOM 4849  N NH2  . ARG A 1 108 ? 39.619  44.338  44.041  1.00 0.00 1  99  ARG A NH2  3  
ATOM 4850  H H    . ARG A 1 108 ? 38.227  46.018  35.826  1.00 0.00 ?  99  ARG A H    3  
ATOM 4851  H HA   . ARG A 1 108 ? 37.651  43.856  37.594  1.00 0.00 ?  99  ARG A HA   3  
ATOM 4852  H HB2  . ARG A 1 108 ? 39.467  45.398  37.861  1.00 0.00 ?  99  ARG A HB2  3  
ATOM 4853  H HB3  . ARG A 1 108 ? 38.359  46.736  37.827  1.00 0.00 ?  99  ARG A HB3  3  
ATOM 4854  H HG2  . ARG A 1 108 ? 38.872  46.737  40.070  1.00 0.00 ?  99  ARG A HG2  3  
ATOM 4855  H HG3  . ARG A 1 108 ? 37.253  46.001  39.989  1.00 0.00 ?  99  ARG A HG3  3  
ATOM 4856  H HD2  . ARG A 1 108 ? 38.142  43.841  40.298  1.00 0.00 ?  99  ARG A HD2  3  
ATOM 4857  H HD3  . ARG A 1 108 ? 39.718  44.406  40.058  1.00 0.00 ?  99  ARG A HD3  3  
ATOM 4858  H HE   . ARG A 1 108 ? 38.661  45.812  42.345  1.00 0.00 ?  99  ARG A HE   3  
ATOM 4859  H HH11 . ARG A 1 108 ? 39.878  42.755  41.349  1.00 0.00 ?  99  ARG A HH11 3  
ATOM 4860  H HH12 . ARG A 1 108 ? 40.657  42.414  42.904  1.00 0.00 ?  99  ARG A HH12 3  
ATOM 4861  H HH21 . ARG A 1 108 ? 38.838  44.837  44.443  1.00 0.00 ?  99  ARG A HH21 3  
ATOM 4862  H HH22 . ARG A 1 108 ? 40.378  44.063  44.648  1.00 0.00 ?  99  ARG A HH22 3  
ATOM 4863  N N    . VAL A 1 109 ? 35.526  44.137  38.789  1.00 0.00 ?  100 VAL A N    3  
ATOM 4864  C CA   . VAL A 1 109 ? 34.201  44.094  39.473  1.00 0.00 ?  100 VAL A CA   3  
ATOM 4865  C C    . VAL A 1 109 ? 33.980  45.340  40.429  1.00 0.00 ?  100 VAL A C    3  
ATOM 4866  O O    . VAL A 1 109 ? 34.940  45.956  40.789  1.00 0.00 ?  100 VAL A O    3  
ATOM 4867  C CB   . VAL A 1 109 ? 34.047  42.724  40.236  1.00 0.00 ?  100 VAL A CB   3  
ATOM 4868  C CG1  . VAL A 1 109 ? 35.054  42.591  41.502  1.00 0.00 ?  100 VAL A CG1  3  
ATOM 4869  C CG2  . VAL A 1 109 ? 32.627  42.463  40.784  1.00 0.00 ?  100 VAL A CG2  3  
ATOM 4870  H H    . VAL A 1 109 ? 36.193  43.420  39.034  1.00 0.00 ?  100 VAL A H    3  
ATOM 4871  H HA   . VAL A 1 109 ? 33.396  43.996  38.744  1.00 0.00 ?  100 VAL A HA   3  
ATOM 4872  H HB   . VAL A 1 109 ? 34.250  41.958  39.487  1.00 0.00 ?  100 VAL A HB   3  
ATOM 4873  H HG11 . VAL A 1 109 ? 34.725  43.278  42.282  1.00 0.00 ?  100 VAL A HG11 3  
ATOM 4874  H HG12 . VAL A 1 109 ? 34.988  41.543  41.793  1.00 0.00 ?  100 VAL A HG12 3  
ATOM 4875  H HG13 . VAL A 1 109 ? 36.098  42.805  41.270  1.00 0.00 ?  100 VAL A HG13 3  
ATOM 4876  H HG21 . VAL A 1 109 ? 31.951  42.347  39.937  1.00 0.00 ?  100 VAL A HG21 3  
ATOM 4877  H HG22 . VAL A 1 109 ? 32.481  41.553  41.365  1.00 0.00 ?  100 VAL A HG22 3  
ATOM 4878  H HG23 . VAL A 1 109 ? 32.136  43.244  41.364  1.00 0.00 ?  100 VAL A HG23 3  
ATOM 4879  N N    . SER A 1 110 ? 32.813  45.867  40.623  1.00 0.00 ?  101 SER A N    3  
ATOM 4880  C CA   . SER A 1 110 ? 32.644  47.157  41.388  1.00 0.00 ?  101 SER A CA   3  
ATOM 4881  C C    . SER A 1 110 ? 32.863  46.878  42.898  1.00 0.00 ?  101 SER A C    3  
ATOM 4882  O O    . SER A 1 110 ? 32.671  45.730  43.412  1.00 0.00 ?  101 SER A O    3  
ATOM 4883  C CB   . SER A 1 110 ? 31.253  47.734  41.251  1.00 0.00 ?  101 SER A CB   3  
ATOM 4884  O OG   . SER A 1 110 ? 30.280  47.034  42.011  1.00 0.00 ?  101 SER A OG   3  
ATOM 4885  H H    . SER A 1 110 ? 31.949  45.418  40.353  1.00 0.00 ?  101 SER A H    3  
ATOM 4886  H HA   . SER A 1 110 ? 33.297  47.940  41.000  1.00 0.00 ?  101 SER A HA   3  
ATOM 4887  H HB2  . SER A 1 110 ? 31.288  48.796  41.493  1.00 0.00 ?  101 SER A HB2  3  
ATOM 4888  H HB3  . SER A 1 110 ? 30.998  47.736  40.191  1.00 0.00 ?  101 SER A HB3  3  
ATOM 4889  H HG   . SER A 1 110 ? 29.486  46.955  41.478  1.00 0.00 ?  101 SER A HG   3  
ATOM 4890  N N    . MET A 1 111 ? 33.259  47.919  43.624  1.00 0.00 ?  102 MET A N    3  
ATOM 4891  C CA   . MET A 1 111 ? 33.579  47.983  44.992  1.00 0.00 ?  102 MET A CA   3  
ATOM 4892  C C    . MET A 1 111 ? 32.449  47.625  45.958  1.00 0.00 ?  102 MET A C    3  
ATOM 4893  O O    . MET A 1 111 ? 31.299  47.999  45.654  1.00 0.00 ?  102 MET A O    3  
ATOM 4894  C CB   . MET A 1 111 ? 34.195  49.275  45.412  1.00 0.00 ?  102 MET A CB   3  
ATOM 4895  C CG   . MET A 1 111 ? 34.846  49.315  46.860  1.00 0.00 ?  102 MET A CG   3  
ATOM 4896  S SD   . MET A 1 111 ? 36.028  50.687  47.224  1.00 0.00 ?  102 MET A SD   3  
ATOM 4897  C CE   . MET A 1 111 ? 36.633  50.055  48.824  1.00 0.00 ?  102 MET A CE   3  
ATOM 4898  H H    . MET A 1 111 ? 33.191  48.773  43.089  1.00 0.00 ?  102 MET A H    3  
ATOM 4899  H HA   . MET A 1 111 ? 34.223  47.108  45.077  1.00 0.00 ?  102 MET A HA   3  
ATOM 4900  H HB2  . MET A 1 111 ? 35.089  49.468  44.819  1.00 0.00 ?  102 MET A HB2  3  
ATOM 4901  H HB3  . MET A 1 111 ? 33.414  50.024  45.272  1.00 0.00 ?  102 MET A HB3  3  
ATOM 4902  H HG2  . MET A 1 111 ? 34.077  49.457  47.618  1.00 0.00 ?  102 MET A HG2  3  
ATOM 4903  H HG3  . MET A 1 111 ? 35.440  48.419  47.043  1.00 0.00 ?  102 MET A HG3  3  
ATOM 4904  H HE1  . MET A 1 111 ? 36.771  48.975  48.788  1.00 0.00 ?  102 MET A HE1  3  
ATOM 4905  H HE2  . MET A 1 111 ? 37.599  50.464  49.124  1.00 0.00 ?  102 MET A HE2  3  
ATOM 4906  H HE3  . MET A 1 111 ? 35.872  50.202  49.590  1.00 0.00 ?  102 MET A HE3  3  
ATOM 4907  N N    . ILE A 1 112 ? 32.792  46.999  47.061  1.00 0.00 ?  103 ILE A N    3  
ATOM 4908  C CA   . ILE A 1 112 ? 32.072  47.091  48.354  1.00 0.00 ?  103 ILE A CA   3  
ATOM 4909  C C    . ILE A 1 112 ? 32.927  47.269  49.598  1.00 0.00 ?  103 ILE A C    3  
ATOM 4910  O O    . ILE A 1 112 ? 34.096  46.877  49.661  1.00 0.00 ?  103 ILE A O    3  
ATOM 4911  C CB   . ILE A 1 112 ? 31.208  45.816  48.608  1.00 0.00 ?  103 ILE A CB   3  
ATOM 4912  C CG1  . ILE A 1 112 ? 31.472  44.599  47.655  1.00 0.00 ?  103 ILE A CG1  3  
ATOM 4913  C CG2  . ILE A 1 112 ? 29.775  46.315  48.475  1.00 0.00 ?  103 ILE A CG2  3  
ATOM 4914  C CD1  . ILE A 1 112 ? 30.678  43.327  47.953  1.00 0.00 ?  103 ILE A CD1  3  
ATOM 4915  O OXT  . ILE A 1 112 ? 32.447  47.970  50.485  1.00 0.00 -1 103 ILE A OXT  3  
ATOM 4916  H H    . ILE A 1 112 ? 33.789  46.843  47.012  1.00 0.00 ?  103 ILE A H    3  
ATOM 4917  H HA   . ILE A 1 112 ? 31.416  47.960  48.311  1.00 0.00 ?  103 ILE A HA   3  
ATOM 4918  H HB   . ILE A 1 112 ? 31.492  45.474  49.604  1.00 0.00 ?  103 ILE A HB   3  
ATOM 4919  H HG12 . ILE A 1 112 ? 31.363  44.850  46.599  1.00 0.00 ?  103 ILE A HG12 3  
ATOM 4920  H HG13 . ILE A 1 112 ? 32.525  44.406  47.865  1.00 0.00 ?  103 ILE A HG13 3  
ATOM 4921  H HG21 . ILE A 1 112 ? 29.088  45.563  48.863  1.00 0.00 ?  103 ILE A HG21 3  
ATOM 4922  H HG22 . ILE A 1 112 ? 29.665  47.294  48.940  1.00 0.00 ?  103 ILE A HG22 3  
ATOM 4923  H HG23 . ILE A 1 112 ? 29.602  46.516  47.418  1.00 0.00 ?  103 ILE A HG23 3  
ATOM 4924  H HD11 . ILE A 1 112 ? 31.128  42.569  47.311  1.00 0.00 ?  103 ILE A HD11 3  
ATOM 4925  H HD12 . ILE A 1 112 ? 30.621  43.112  49.021  1.00 0.00 ?  103 ILE A HD12 3  
ATOM 4926  H HD13 . ILE A 1 112 ? 29.684  43.493  47.539  1.00 0.00 ?  103 ILE A HD13 3  
ATOM 4927  N N    . MET A 1 10  ? 37.054  38.270  61.655  1.00 0.00 ?  1   MET A N    4  
ATOM 4928  C CA   . MET A 1 10  ? 38.244  38.908  62.194  1.00 0.00 ?  1   MET A CA   4  
ATOM 4929  C C    . MET A 1 10  ? 39.413  37.913  62.066  1.00 0.00 ?  1   MET A C    4  
ATOM 4930  O O    . MET A 1 10  ? 39.415  36.932  62.742  1.00 0.00 ?  1   MET A O    4  
ATOM 4931  C CB   . MET A 1 10  ? 38.085  39.501  63.602  1.00 0.00 ?  1   MET A CB   4  
ATOM 4932  C CG   . MET A 1 10  ? 39.356  40.221  64.086  1.00 0.00 ?  1   MET A CG   4  
ATOM 4933  S SD   . MET A 1 10  ? 39.223  41.401  65.410  1.00 0.00 ?  1   MET A SD   4  
ATOM 4934  C CE   . MET A 1 10  ? 38.809  42.822  64.356  1.00 0.00 ?  1   MET A CE   4  
ATOM 4935  H H    . MET A 1 10  ? 36.300  38.934  61.551  1.00 0.00 ?  1   MET A H    4  
ATOM 4936  H HA   . MET A 1 10  ? 38.457  39.759  61.547  1.00 0.00 ?  1   MET A HA   4  
ATOM 4937  H HB2  . MET A 1 10  ? 37.316  40.273  63.621  1.00 0.00 ?  1   MET A HB2  4  
ATOM 4938  H HB3  . MET A 1 10  ? 37.882  38.688  64.299  1.00 0.00 ?  1   MET A HB3  4  
ATOM 4939  H HG2  . MET A 1 10  ? 40.068  39.402  64.196  1.00 0.00 ?  1   MET A HG2  4  
ATOM 4940  H HG3  . MET A 1 10  ? 39.680  40.942  63.336  1.00 0.00 ?  1   MET A HG3  4  
ATOM 4941  H HE1  . MET A 1 10  ? 39.726  43.072  63.823  1.00 0.00 ?  1   MET A HE1  4  
ATOM 4942  H HE2  . MET A 1 10  ? 38.036  42.629  63.614  1.00 0.00 ?  1   MET A HE2  4  
ATOM 4943  H HE3  . MET A 1 10  ? 38.573  43.649  65.026  1.00 0.00 ?  1   MET A HE3  4  
ATOM 4944  N N    . GLU A 1 11  ? 40.284  38.166  61.111  1.00 0.00 ?  2   GLU A N    4  
ATOM 4945  C CA   . GLU A 1 11  ? 41.194  37.255  60.361  1.00 0.00 ?  2   GLU A CA   4  
ATOM 4946  C C    . GLU A 1 11  ? 42.464  37.815  59.805  1.00 0.00 ?  2   GLU A C    4  
ATOM 4947  O O    . GLU A 1 11  ? 43.038  37.253  58.894  1.00 0.00 ?  2   GLU A O    4  
ATOM 4948  C CB   . GLU A 1 11  ? 40.376  36.730  59.174  1.00 0.00 ?  2   GLU A CB   4  
ATOM 4949  C CG   . GLU A 1 11  ? 40.137  37.693  57.972  1.00 0.00 ?  2   GLU A CG   4  
ATOM 4950  C CD   . GLU A 1 11  ? 38.879  38.487  58.165  1.00 0.00 ?  2   GLU A CD   4  
ATOM 4951  O OE1  . GLU A 1 11  ? 38.119  38.270  59.058  1.00 0.00 -1 2   GLU A OE1  4  
ATOM 4952  O OE2  . GLU A 1 11  ? 38.607  39.383  57.323  1.00 0.00 ?  2   GLU A OE2  4  
ATOM 4953  H H    . GLU A 1 11  ? 40.085  39.042  60.650  1.00 0.00 ?  2   GLU A H    4  
ATOM 4954  H HA   . GLU A 1 11  ? 41.305  36.381  61.002  1.00 0.00 ?  2   GLU A HA   4  
ATOM 4955  H HB2  . GLU A 1 11  ? 40.855  35.815  58.828  1.00 0.00 ?  2   GLU A HB2  4  
ATOM 4956  H HB3  . GLU A 1 11  ? 39.410  36.360  59.515  1.00 0.00 ?  2   GLU A HB3  4  
ATOM 4957  H HG2  . GLU A 1 11  ? 40.930  38.402  57.733  1.00 0.00 ?  2   GLU A HG2  4  
ATOM 4958  H HG3  . GLU A 1 11  ? 40.048  37.034  57.109  1.00 0.00 ?  2   GLU A HG3  4  
ATOM 4959  N N    . THR A 1 12  ? 42.797  39.082  60.133  1.00 0.00 ?  3   THR A N    4  
ATOM 4960  C CA   . THR A 1 12  ? 44.102  39.776  59.884  1.00 0.00 ?  3   THR A CA   4  
ATOM 4961  C C    . THR A 1 12  ? 44.281  41.042  60.700  1.00 0.00 ?  3   THR A C    4  
ATOM 4962  O O    . THR A 1 12  ? 43.317  41.609  61.194  1.00 0.00 ?  3   THR A O    4  
ATOM 4963  C CB   . THR A 1 12  ? 44.171  39.986  58.406  1.00 0.00 ?  3   THR A CB   4  
ATOM 4964  O OG1  . THR A 1 12  ? 45.469  40.414  58.209  1.00 0.00 ?  3   THR A OG1  4  
ATOM 4965  C CG2  . THR A 1 12  ? 43.117  40.960  57.836  1.00 0.00 ?  3   THR A CG2  4  
ATOM 4966  H H    . THR A 1 12  ? 42.102  39.521  60.722  1.00 0.00 ?  3   THR A H    4  
ATOM 4967  H HA   . THR A 1 12  ? 44.902  39.061  60.074  1.00 0.00 ?  3   THR A HA   4  
ATOM 4968  H HB   . THR A 1 12  ? 44.162  39.042  57.863  1.00 0.00 ?  3   THR A HB   4  
ATOM 4969  H HG1  . THR A 1 12  ? 45.720  40.270  57.294  1.00 0.00 ?  3   THR A HG1  4  
ATOM 4970  H HG21 . THR A 1 12  ? 42.207  40.363  57.777  1.00 0.00 ?  3   THR A HG21 4  
ATOM 4971  H HG22 . THR A 1 12  ? 42.930  41.871  58.404  1.00 0.00 ?  3   THR A HG22 4  
ATOM 4972  H HG23 . THR A 1 12  ? 43.381  41.215  56.809  1.00 0.00 ?  3   THR A HG23 4  
ATOM 4973  N N    . THR A 1 13  ? 45.500  41.594  60.766  1.00 0.00 ?  4   THR A N    4  
ATOM 4974  C CA   . THR A 1 13  ? 45.997  42.717  61.577  1.00 0.00 ?  4   THR A CA   4  
ATOM 4975  C C    . THR A 1 13  ? 45.943  44.042  60.932  1.00 0.00 ?  4   THR A C    4  
ATOM 4976  O O    . THR A 1 13  ? 46.918  44.663  60.526  1.00 0.00 ?  4   THR A O    4  
ATOM 4977  C CB   . THR A 1 13  ? 47.332  42.565  62.373  1.00 0.00 ?  4   THR A CB   4  
ATOM 4978  O OG1  . THR A 1 13  ? 47.476  41.197  62.775  1.00 0.00 ?  4   THR A OG1  4  
ATOM 4979  C CG2  . THR A 1 13  ? 47.497  43.499  63.598  1.00 0.00 ?  4   THR A CG2  4  
ATOM 4980  H H    . THR A 1 13  ? 46.186  41.136  60.182  1.00 0.00 ?  4   THR A H    4  
ATOM 4981  H HA   . THR A 1 13  ? 45.333  42.711  62.442  1.00 0.00 ?  4   THR A HA   4  
ATOM 4982  H HB   . THR A 1 13  ? 48.175  42.691  61.694  1.00 0.00 ?  4   THR A HB   4  
ATOM 4983  H HG1  . THR A 1 13  ? 47.900  40.687  62.081  1.00 0.00 ?  4   THR A HG1  4  
ATOM 4984  H HG21 . THR A 1 13  ? 46.753  43.526  64.394  1.00 0.00 ?  4   THR A HG21 4  
ATOM 4985  H HG22 . THR A 1 13  ? 48.477  43.319  64.038  1.00 0.00 ?  4   THR A HG22 4  
ATOM 4986  H HG23 . THR A 1 13  ? 47.554  44.502  63.175  1.00 0.00 ?  4   THR A HG23 4  
ATOM 4987  N N    . ASN A 1 14  ? 44.686  44.523  60.786  1.00 0.00 ?  5   ASN A N    4  
ATOM 4988  C CA   . ASN A 1 14  ? 44.391  45.926  60.397  1.00 0.00 ?  5   ASN A CA   4  
ATOM 4989  C C    . ASN A 1 14  ? 44.739  46.909  61.557  1.00 0.00 ?  5   ASN A C    4  
ATOM 4990  O O    . ASN A 1 14  ? 44.250  46.749  62.673  1.00 0.00 ?  5   ASN A O    4  
ATOM 4991  C CB   . ASN A 1 14  ? 42.903  46.084  59.943  1.00 0.00 ?  5   ASN A CB   4  
ATOM 4992  C CG   . ASN A 1 14  ? 42.526  45.326  58.689  1.00 0.00 ?  5   ASN A CG   4  
ATOM 4993  O OD1  . ASN A 1 14  ? 43.056  45.728  57.674  1.00 0.00 ?  5   ASN A OD1  4  
ATOM 4994  N ND2  . ASN A 1 14  ? 41.646  44.406  58.689  1.00 0.00 ?  5   ASN A ND2  4  
ATOM 4995  H H    . ASN A 1 14  ? 43.880  43.971  61.043  1.00 0.00 ?  5   ASN A H    4  
ATOM 4996  H HA   . ASN A 1 14  ? 45.009  46.160  59.530  1.00 0.00 ?  5   ASN A HA   4  
ATOM 4997  H HB2  . ASN A 1 14  ? 42.179  45.731  60.677  1.00 0.00 ?  5   ASN A HB2  4  
ATOM 4998  H HB3  . ASN A 1 14  ? 42.651  47.120  59.718  1.00 0.00 ?  5   ASN A HB3  4  
ATOM 4999  H HD21 . ASN A 1 14  ? 41.080  44.355  59.524  1.00 0.00 ?  5   ASN A HD21 4  
ATOM 5000  H HD22 . ASN A 1 14  ? 41.542  43.840  57.858  1.00 0.00 ?  5   ASN A HD22 4  
ATOM 5001  N N    . GLY A 1 15  ? 45.570  47.903  61.400  1.00 0.00 ?  6   GLY A N    4  
ATOM 5002  C CA   . GLY A 1 15  ? 46.053  48.824  62.531  1.00 0.00 ?  6   GLY A CA   4  
ATOM 5003  C C    . GLY A 1 15  ? 47.257  49.743  62.199  1.00 0.00 ?  6   GLY A C    4  
ATOM 5004  O O    . GLY A 1 15  ? 47.815  49.735  61.109  1.00 0.00 ?  6   GLY A O    4  
ATOM 5005  H H    . GLY A 1 15  ? 45.964  48.013  60.476  1.00 0.00 ?  6   GLY A H    4  
ATOM 5006  H HA2  . GLY A 1 15  ? 45.235  49.369  63.003  1.00 0.00 ?  6   GLY A HA2  4  
ATOM 5007  H HA3  . GLY A 1 15  ? 46.409  48.123  63.287  1.00 0.00 ?  6   GLY A HA3  4  
ATOM 5008  N N    . THR A 1 16  ? 47.715  50.537  63.132  1.00 0.00 ?  7   THR A N    4  
ATOM 5009  C CA   . THR A 1 16  ? 48.898  51.362  63.060  1.00 0.00 ?  7   THR A CA   4  
ATOM 5010  C C    . THR A 1 16  ? 49.696  51.424  64.324  1.00 0.00 ?  7   THR A C    4  
ATOM 5011  O O    . THR A 1 16  ? 49.181  51.089  65.440  1.00 0.00 ?  7   THR A O    4  
ATOM 5012  C CB   . THR A 1 16  ? 48.485  52.776  62.635  1.00 0.00 ?  7   THR A CB   4  
ATOM 5013  O OG1  . THR A 1 16  ? 48.167  53.658  63.698  1.00 0.00 ?  7   THR A OG1  4  
ATOM 5014  C CG2  . THR A 1 16  ? 47.220  52.858  61.734  1.00 0.00 ?  7   THR A CG2  4  
ATOM 5015  H H    . THR A 1 16  ? 47.283  50.420  64.038  1.00 0.00 ?  7   THR A H    4  
ATOM 5016  H HA   . THR A 1 16  ? 49.564  50.981  62.286  1.00 0.00 ?  7   THR A HA   4  
ATOM 5017  H HB   . THR A 1 16  ? 49.405  53.229  62.266  1.00 0.00 ?  7   THR A HB   4  
ATOM 5018  H HG1  . THR A 1 16  ? 48.164  54.562  63.372  1.00 0.00 ?  7   THR A HG1  4  
ATOM 5019  H HG21 . THR A 1 16  ? 47.432  52.546  60.711  1.00 0.00 ?  7   THR A HG21 4  
ATOM 5020  H HG22 . THR A 1 16  ? 46.391  52.381  62.255  1.00 0.00 ?  7   THR A HG22 4  
ATOM 5021  H HG23 . THR A 1 16  ? 46.946  53.906  61.616  1.00 0.00 ?  7   THR A HG23 4  
ATOM 5022  N N    . GLU A 1 17  ? 50.870  52.045  64.307  1.00 0.00 ?  8   GLU A N    4  
ATOM 5023  C CA   . GLU A 1 17  ? 51.572  52.364  65.539  1.00 0.00 ?  8   GLU A CA   4  
ATOM 5024  C C    . GLU A 1 17  ? 50.809  53.412  66.427  1.00 0.00 ?  8   GLU A C    4  
ATOM 5025  O O    . GLU A 1 17  ? 50.744  53.147  67.616  1.00 0.00 ?  8   GLU A O    4  
ATOM 5026  C CB   . GLU A 1 17  ? 53.019  52.797  65.326  1.00 0.00 ?  8   GLU A CB   4  
ATOM 5027  C CG   . GLU A 1 17  ? 53.093  54.270  64.856  1.00 0.00 ?  8   GLU A CG   4  
ATOM 5028  C CD   . GLU A 1 17  ? 52.287  54.586  63.488  1.00 0.00 ?  8   GLU A CD   4  
ATOM 5029  O OE1  . GLU A 1 17  ? 52.811  54.389  62.402  1.00 0.00 ?  8   GLU A OE1  4  
ATOM 5030  O OE2  . GLU A 1 17  ? 51.101  55.002  63.482  1.00 0.00 -1 8   GLU A OE2  4  
ATOM 5031  H H    . GLU A 1 17  ? 51.208  52.470  63.455  1.00 0.00 ?  8   GLU A H    4  
ATOM 5032  H HA   . GLU A 1 17  ? 51.601  51.404  66.056  1.00 0.00 ?  8   GLU A HA   4  
ATOM 5033  H HB2  . GLU A 1 17  ? 53.494  52.732  66.305  1.00 0.00 ?  8   GLU A HB2  4  
ATOM 5034  H HB3  . GLU A 1 17  ? 53.645  52.233  64.634  1.00 0.00 ?  8   GLU A HB3  4  
ATOM 5035  H HG2  . GLU A 1 17  ? 52.865  55.017  65.617  1.00 0.00 ?  8   GLU A HG2  4  
ATOM 5036  H HG3  . GLU A 1 17  ? 54.147  54.477  64.667  1.00 0.00 ?  8   GLU A HG3  4  
ATOM 5037  N N    . THR A 1 18  ? 50.085  54.371  65.876  1.00 0.00 ?  9   THR A N    4  
ATOM 5038  C CA   . THR A 1 18  ? 49.400  55.376  66.647  1.00 0.00 ?  9   THR A CA   4  
ATOM 5039  C C    . THR A 1 18  ? 48.099  54.909  67.279  1.00 0.00 ?  9   THR A C    4  
ATOM 5040  O O    . THR A 1 18  ? 47.666  55.281  68.324  1.00 0.00 ?  9   THR A O    4  
ATOM 5041  C CB   . THR A 1 18  ? 49.110  56.614  65.741  1.00 0.00 ?  9   THR A CB   4  
ATOM 5042  O OG1  . THR A 1 18  ? 50.322  56.930  65.128  1.00 0.00 ?  9   THR A OG1  4  
ATOM 5043  C CG2  . THR A 1 18  ? 48.602  57.831  66.487  1.00 0.00 ?  9   THR A CG2  4  
ATOM 5044  H H    . THR A 1 18  ? 50.044  54.501  64.875  1.00 0.00 ?  9   THR A H    4  
ATOM 5045  H HA   . THR A 1 18  ? 49.945  55.726  67.524  1.00 0.00 ?  9   THR A HA   4  
ATOM 5046  H HB   . THR A 1 18  ? 48.443  56.289  64.943  1.00 0.00 ?  9   THR A HB   4  
ATOM 5047  H HG1  . THR A 1 18  ? 50.654  56.241  64.549  1.00 0.00 ?  9   THR A HG1  4  
ATOM 5048  H HG21 . THR A 1 18  ? 47.850  57.578  67.234  1.00 0.00 ?  9   THR A HG21 4  
ATOM 5049  H HG22 . THR A 1 18  ? 49.425  58.157  67.124  1.00 0.00 ?  9   THR A HG22 4  
ATOM 5050  H HG23 . THR A 1 18  ? 48.204  58.562  65.783  1.00 0.00 ?  9   THR A HG23 4  
ATOM 5051  N N    . TRP A 1 19  ? 47.430  53.975  66.542  1.00 0.00 ?  10  TRP A N    4  
ATOM 5052  C CA   . TRP A 1 19  ? 46.460  53.017  67.063  1.00 0.00 ?  10  TRP A CA   4  
ATOM 5053  C C    . TRP A 1 19  ? 47.113  52.075  68.087  1.00 0.00 ?  10  TRP A C    4  
ATOM 5054  O O    . TRP A 1 19  ? 46.544  52.103  69.232  1.00 0.00 ?  10  TRP A O    4  
ATOM 5055  C CB   . TRP A 1 19  ? 45.864  52.311  65.828  1.00 0.00 ?  10  TRP A CB   4  
ATOM 5056  C CG   . TRP A 1 19  ? 45.051  51.166  65.932  1.00 0.00 ?  10  TRP A CG   4  
ATOM 5057  C CD1  . TRP A 1 19  ? 43.688  51.259  66.229  1.00 0.00 ?  10  TRP A CD1  4  
ATOM 5058  C CD2  . TRP A 1 19  ? 45.388  49.765  65.999  1.00 0.00 ?  10  TRP A CD2  4  
ATOM 5059  N NE1  . TRP A 1 19  ? 43.196  49.950  66.372  1.00 0.00 ?  10  TRP A NE1  4  
ATOM 5060  C CE2  . TRP A 1 19  ? 44.193  49.022  66.193  1.00 0.00 ?  10  TRP A CE2  4  
ATOM 5061  C CE3  . TRP A 1 19  ? 46.593  49.041  65.968  1.00 0.00 ?  10  TRP A CE3  4  
ATOM 5062  C CZ2  . TRP A 1 19  ? 44.146  47.619  66.161  1.00 0.00 ?  10  TRP A CZ2  4  
ATOM 5063  C CZ3  . TRP A 1 19  ? 46.602  47.679  66.076  1.00 0.00 ?  10  TRP A CZ3  4  
ATOM 5064  C CH2  . TRP A 1 19  ? 45.378  46.990  66.081  1.00 0.00 ?  10  TRP A CH2  4  
ATOM 5065  H H    . TRP A 1 19  ? 47.684  53.840  65.573  1.00 0.00 ?  10  TRP A H    4  
ATOM 5066  H HA   . TRP A 1 19  ? 45.674  53.587  67.557  1.00 0.00 ?  10  TRP A HA   4  
ATOM 5067  H HB2  . TRP A 1 19  ? 45.559  53.115  65.160  1.00 0.00 ?  10  TRP A HB2  4  
ATOM 5068  H HB3  . TRP A 1 19  ? 46.737  51.901  65.320  1.00 0.00 ?  10  TRP A HB3  4  
ATOM 5069  H HD1  . TRP A 1 19  ? 43.100  52.161  66.320  1.00 0.00 ?  10  TRP A HD1  4  
ATOM 5070  H HE1  . TRP A 1 19  ? 42.222  49.746  66.544  1.00 0.00 ?  10  TRP A HE1  4  
ATOM 5071  H HE3  . TRP A 1 19  ? 47.521  49.594  65.964  1.00 0.00 ?  10  TRP A HE3  4  
ATOM 5072  H HZ2  . TRP A 1 19  ? 43.222  47.081  66.007  1.00 0.00 ?  10  TRP A HZ2  4  
ATOM 5073  H HZ3  . TRP A 1 19  ? 47.472  47.095  66.339  1.00 0.00 ?  10  TRP A HZ3  4  
ATOM 5074  H HH2  . TRP A 1 19  ? 45.411  45.911  66.118  1.00 0.00 ?  10  TRP A HH2  4  
ATOM 5075  N N    . TYR A 1 20  ? 48.226  51.400  67.984  1.00 0.00 ?  11  TYR A N    4  
ATOM 5076  C CA   . TYR A 1 20  ? 48.813  50.608  69.071  1.00 0.00 ?  11  TYR A CA   4  
ATOM 5077  C C    . TYR A 1 20  ? 49.084  51.381  70.369  1.00 0.00 ?  11  TYR A C    4  
ATOM 5078  O O    . TYR A 1 20  ? 48.658  50.950  71.427  1.00 0.00 ?  11  TYR A O    4  
ATOM 5079  C CB   . TYR A 1 20  ? 49.948  49.704  68.606  1.00 0.00 ?  11  TYR A CB   4  
ATOM 5080  C CG   . TYR A 1 20  ? 50.740  49.096  69.729  1.00 0.00 ?  11  TYR A CG   4  
ATOM 5081  C CD1  . TYR A 1 20  ? 51.889  49.757  70.298  1.00 0.00 ?  11  TYR A CD1  4  
ATOM 5082  C CD2  . TYR A 1 20  ? 50.263  47.924  70.343  1.00 0.00 ?  11  TYR A CD2  4  
ATOM 5083  C CE1  . TYR A 1 20  ? 52.634  49.182  71.331  1.00 0.00 ?  11  TYR A CE1  4  
ATOM 5084  C CE2  . TYR A 1 20  ? 51.089  47.309  71.360  1.00 0.00 ?  11  TYR A CE2  4  
ATOM 5085  C CZ   . TYR A 1 20  ? 52.250  47.941  71.881  1.00 0.00 ?  11  TYR A CZ   4  
ATOM 5086  O OH   . TYR A 1 20  ? 52.876  47.405  72.995  1.00 0.00 ?  11  TYR A OH   4  
ATOM 5087  H H    . TYR A 1 20  ? 48.779  51.447  67.140  1.00 0.00 ?  11  TYR A H    4  
ATOM 5088  H HA   . TYR A 1 20  ? 48.044  49.909  69.401  1.00 0.00 ?  11  TYR A HA   4  
ATOM 5089  H HB2  . TYR A 1 20  ? 49.447  48.983  67.962  1.00 0.00 ?  11  TYR A HB2  4  
ATOM 5090  H HB3  . TYR A 1 20  ? 50.667  50.310  68.054  1.00 0.00 ?  11  TYR A HB3  4  
ATOM 5091  H HD1  . TYR A 1 20  ? 52.203  50.708  69.892  1.00 0.00 ?  11  TYR A HD1  4  
ATOM 5092  H HD2  . TYR A 1 20  ? 49.344  47.392  70.146  1.00 0.00 ?  11  TYR A HD2  4  
ATOM 5093  H HE1  . TYR A 1 20  ? 53.458  49.790  71.674  1.00 0.00 ?  11  TYR A HE1  4  
ATOM 5094  H HE2  . TYR A 1 20  ? 50.718  46.400  71.811  1.00 0.00 ?  11  TYR A HE2  4  
ATOM 5095  H HH   . TYR A 1 20  ? 53.354  48.116  73.428  1.00 0.00 ?  11  TYR A HH   4  
ATOM 5096  N N    . GLU A 1 21  ? 49.776  52.498  70.188  1.00 0.00 ?  12  GLU A N    4  
ATOM 5097  C CA   . GLU A 1 21  ? 50.027  53.323  71.381  1.00 0.00 ?  12  GLU A CA   4  
ATOM 5098  C C    . GLU A 1 21  ? 48.813  53.876  72.078  1.00 0.00 ?  12  GLU A C    4  
ATOM 5099  O O    . GLU A 1 21  ? 48.830  54.138  73.299  1.00 0.00 ?  12  GLU A O    4  
ATOM 5100  C CB   . GLU A 1 21  ? 51.028  54.399  70.988  1.00 0.00 ?  12  GLU A CB   4  
ATOM 5101  C CG   . GLU A 1 21  ? 52.518  53.967  70.789  1.00 0.00 ?  12  GLU A CG   4  
ATOM 5102  C CD   . GLU A 1 21  ? 53.351  53.845  72.090  1.00 0.00 ?  12  GLU A CD   4  
ATOM 5103  O OE1  . GLU A 1 21  ? 52.894  54.498  73.094  1.00 0.00 -1 12  GLU A OE1  4  
ATOM 5104  O OE2  . GLU A 1 21  ? 54.428  53.254  72.177  1.00 0.00 ?  12  GLU A OE2  4  
ATOM 5105  H H    . GLU A 1 21  ? 50.307  52.643  69.341  1.00 0.00 ?  12  GLU A H    4  
ATOM 5106  H HA   . GLU A 1 21  ? 50.498  52.708  72.147  1.00 0.00 ?  12  GLU A HA   4  
ATOM 5107  H HB2  . GLU A 1 21  ? 50.678  54.844  70.057  1.00 0.00 ?  12  GLU A HB2  4  
ATOM 5108  H HB3  . GLU A 1 21  ? 51.052  55.105  71.819  1.00 0.00 ?  12  GLU A HB3  4  
ATOM 5109  H HG2  . GLU A 1 21  ? 52.566  53.071  70.169  1.00 0.00 ?  12  GLU A HG2  4  
ATOM 5110  H HG3  . GLU A 1 21  ? 53.018  54.665  70.118  1.00 0.00 ?  12  GLU A HG3  4  
ATOM 5111  N N    . SER A 1 22  ? 47.676  54.071  71.374  1.00 0.00 ?  13  SER A N    4  
ATOM 5112  C CA   . SER A 1 22  ? 46.432  54.614  71.956  1.00 0.00 ?  13  SER A CA   4  
ATOM 5113  C C    . SER A 1 22  ? 45.634  53.557  72.642  1.00 0.00 ?  13  SER A C    4  
ATOM 5114  O O    . SER A 1 22  ? 45.254  53.798  73.796  1.00 0.00 ?  13  SER A O    4  
ATOM 5115  C CB   . SER A 1 22  ? 45.556  55.254  70.937  1.00 0.00 ?  13  SER A CB   4  
ATOM 5116  O OG   . SER A 1 22  ? 46.247  56.425  70.517  1.00 0.00 ?  13  SER A OG   4  
ATOM 5117  H H    . SER A 1 22  ? 47.737  53.767  70.413  1.00 0.00 ?  13  SER A H    4  
ATOM 5118  H HA   . SER A 1 22  ? 46.677  55.409  72.660  1.00 0.00 ?  13  SER A HA   4  
ATOM 5119  H HB2  . SER A 1 22  ? 45.422  54.643  70.045  1.00 0.00 ?  13  SER A HB2  4  
ATOM 5120  H HB3  . SER A 1 22  ? 44.575  55.562  71.302  1.00 0.00 ?  13  SER A HB3  4  
ATOM 5121  H HG   . SER A 1 22  ? 46.848  56.145  69.822  1.00 0.00 ?  13  SER A HG   4  
ATOM 5122  N N    . LEU A 1 23  ? 45.655  52.376  72.090  1.00 0.00 ?  14  LEU A N    4  
ATOM 5123  C CA   . LEU A 1 23  ? 45.194  51.125  72.767  1.00 0.00 ?  14  LEU A CA   4  
ATOM 5124  C C    . LEU A 1 23  ? 46.080  50.653  73.976  1.00 0.00 ?  14  LEU A C    4  
ATOM 5125  O O    . LEU A 1 23  ? 45.535  50.265  74.996  1.00 0.00 ?  14  LEU A O    4  
ATOM 5126  C CB   . LEU A 1 23  ? 45.156  49.952  71.833  1.00 0.00 ?  14  LEU A CB   4  
ATOM 5127  C CG   . LEU A 1 23  ? 43.883  49.934  70.918  1.00 0.00 ?  14  LEU A CG   4  
ATOM 5128  C CD1  . LEU A 1 23  ? 44.059  49.024  69.742  1.00 0.00 ?  14  LEU A CD1  4  
ATOM 5129  C CD2  . LEU A 1 23  ? 42.562  49.552  71.713  1.00 0.00 ?  14  LEU A CD2  4  
ATOM 5130  H H    . LEU A 1 23  ? 45.866  52.374  71.102  1.00 0.00 ?  14  LEU A H    4  
ATOM 5131  H HA   . LEU A 1 23  ? 44.170  51.260  73.114  1.00 0.00 ?  14  LEU A HA   4  
ATOM 5132  H HB2  . LEU A 1 23  ? 45.996  49.745  71.170  1.00 0.00 ?  14  LEU A HB2  4  
ATOM 5133  H HB3  . LEU A 1 23  ? 45.089  49.040  72.425  1.00 0.00 ?  14  LEU A HB3  4  
ATOM 5134  H HG   . LEU A 1 23  ? 43.667  50.943  70.569  1.00 0.00 ?  14  LEU A HG   4  
ATOM 5135  H HD11 . LEU A 1 23  ? 43.212  49.222  69.085  1.00 0.00 ?  14  LEU A HD11 4  
ATOM 5136  H HD12 . LEU A 1 23  ? 44.982  49.383  69.286  1.00 0.00 ?  14  LEU A HD12 4  
ATOM 5137  H HD13 . LEU A 1 23  ? 44.223  47.995  70.060  1.00 0.00 ?  14  LEU A HD13 4  
ATOM 5138  H HD21 . LEU A 1 23  ? 42.733  48.600  72.217  1.00 0.00 ?  14  LEU A HD21 4  
ATOM 5139  H HD22 . LEU A 1 23  ? 42.390  50.354  72.432  1.00 0.00 ?  14  LEU A HD22 4  
ATOM 5140  H HD23 . LEU A 1 23  ? 41.753  49.515  70.983  1.00 0.00 ?  14  LEU A HD23 4  
ATOM 5141  N N    . HIS A 1 24  ? 47.392  50.857  73.968  1.00 0.00 ?  15  HIS A N    4  
ATOM 5142  C CA   . HIS A 1 24  ? 48.214  50.775  75.262  1.00 0.00 ?  15  HIS A CA   4  
ATOM 5143  C C    . HIS A 1 24  ? 47.696  51.886  76.256  1.00 0.00 ?  15  HIS A C    4  
ATOM 5144  O O    . HIS A 1 24  ? 47.399  51.495  77.400  1.00 0.00 ?  15  HIS A O    4  
ATOM 5145  C CB   . HIS A 1 24  ? 49.660  51.067  74.819  1.00 0.00 ?  15  HIS A CB   4  
ATOM 5146  C CG   . HIS A 1 24  ? 50.857  50.879  75.798  1.00 0.00 ?  15  HIS A CG   4  
ATOM 5147  N ND1  . HIS A 1 24  ? 51.104  51.708  76.943  1.00 0.00 ?  15  HIS A ND1  4  
ATOM 5148  C CD2  . HIS A 1 24  ? 51.933  50.140  75.598  1.00 0.00 ?  15  HIS A CD2  4  
ATOM 5149  C CE1  . HIS A 1 24  ? 52.286  51.355  77.411  1.00 0.00 ?  15  HIS A CE1  4  
ATOM 5150  N NE2  . HIS A 1 24  ? 52.818  50.393  76.608  1.00 0.00 ?  15  HIS A NE2  4  
ATOM 5151  H H    . HIS A 1 24  ? 47.794  51.332  73.173  1.00 0.00 ?  15  HIS A H    4  
ATOM 5152  H HA   . HIS A 1 24  ? 48.116  49.802  75.745  1.00 0.00 ?  15  HIS A HA   4  
ATOM 5153  H HB2  . HIS A 1 24  ? 49.851  50.505  73.904  1.00 0.00 ?  15  HIS A HB2  4  
ATOM 5154  H HB3  . HIS A 1 24  ? 49.597  52.105  74.492  1.00 0.00 ?  15  HIS A HB3  4  
ATOM 5155  H HD2  . HIS A 1 24  ? 52.010  49.440  74.780  1.00 0.00 ?  15  HIS A HD2  4  
ATOM 5156  H HE1  . HIS A 1 24  ? 52.746  51.826  78.267  1.00 0.00 ?  15  HIS A HE1  4  
ATOM 5157  H HE2  . HIS A 1 24  ? 53.711  49.924  76.655  1.00 0.00 ?  15  HIS A HE2  4  
ATOM 5158  N N    . ALA A 1 25  ? 47.568  53.149  75.894  1.00 0.00 ?  16  ALA A N    4  
ATOM 5159  C CA   . ALA A 1 25  ? 47.065  54.221  76.845  1.00 0.00 ?  16  ALA A CA   4  
ATOM 5160  C C    . ALA A 1 25  ? 45.658  53.866  77.475  1.00 0.00 ?  16  ALA A C    4  
ATOM 5161  O O    . ALA A 1 25  ? 45.516  53.932  78.706  1.00 0.00 ?  16  ALA A O    4  
ATOM 5162  C CB   . ALA A 1 25  ? 47.148  55.473  76.033  1.00 0.00 ?  16  ALA A CB   4  
ATOM 5163  H H    . ALA A 1 25  ? 47.873  53.490  74.992  1.00 0.00 ?  16  ALA A H    4  
ATOM 5164  H HA   . ALA A 1 25  ? 47.830  54.363  77.609  1.00 0.00 ?  16  ALA A HA   4  
ATOM 5165  H HB1  . ALA A 1 25  ? 48.157  55.580  75.636  1.00 0.00 ?  16  ALA A HB1  4  
ATOM 5166  H HB2  . ALA A 1 25  ? 46.446  55.527  75.200  1.00 0.00 ?  16  ALA A HB2  4  
ATOM 5167  H HB3  . ALA A 1 25  ? 46.888  56.255  76.746  1.00 0.00 ?  16  ALA A HB3  4  
ATOM 5168  N N    . VAL A 1 26  ? 44.705  53.682  76.629  1.00 0.00 ?  17  VAL A N    4  
ATOM 5169  C CA   . VAL A 1 26  ? 43.365  53.383  77.121  1.00 0.00 ?  17  VAL A CA   4  
ATOM 5170  C C    . VAL A 1 26  ? 43.252  52.118  78.030  1.00 0.00 ?  17  VAL A C    4  
ATOM 5171  O O    . VAL A 1 26  ? 42.429  52.011  78.933  1.00 0.00 ?  17  VAL A O    4  
ATOM 5172  C CB   . VAL A 1 26  ? 42.207  53.451  76.056  1.00 0.00 ?  17  VAL A CB   4  
ATOM 5173  C CG1  . VAL A 1 26  ? 41.960  52.057  75.460  1.00 0.00 ?  17  VAL A CG1  4  
ATOM 5174  C CG2  . VAL A 1 26  ? 40.947  53.985  76.737  1.00 0.00 ?  17  VAL A CG2  4  
ATOM 5175  H H    . VAL A 1 26  ? 44.917  53.714  75.643  1.00 0.00 ?  17  VAL A H    4  
ATOM 5176  H HA   . VAL A 1 26  ? 43.189  54.144  77.881  1.00 0.00 ?  17  VAL A HA   4  
ATOM 5177  H HB   . VAL A 1 26  ? 42.502  54.071  75.209  1.00 0.00 ?  17  VAL A HB   4  
ATOM 5178  H HG11 . VAL A 1 26  ? 41.348  52.210  74.571  1.00 0.00 ?  17  VAL A HG11 4  
ATOM 5179  H HG12 . VAL A 1 26  ? 42.864  51.553  75.120  1.00 0.00 ?  17  VAL A HG12 4  
ATOM 5180  H HG13 . VAL A 1 26  ? 41.404  51.446  76.171  1.00 0.00 ?  17  VAL A HG13 4  
ATOM 5181  H HG21 . VAL A 1 26  ? 40.037  53.765  76.180  1.00 0.00 ?  17  VAL A HG21 4  
ATOM 5182  H HG22 . VAL A 1 26  ? 40.906  53.603  77.757  1.00 0.00 ?  17  VAL A HG22 4  
ATOM 5183  H HG23 . VAL A 1 26  ? 40.969  55.064  76.886  1.00 0.00 ?  17  VAL A HG23 4  
ATOM 5184  N N    . LEU A 1 27  ? 44.044  51.054  77.714  1.00 0.00 ?  18  LEU A N    4  
ATOM 5185  C CA   . LEU A 1 27  ? 44.070  49.813  78.505  1.00 0.00 ?  18  LEU A CA   4  
ATOM 5186  C C    . LEU A 1 27  ? 44.792  49.918  79.803  1.00 0.00 ?  18  LEU A C    4  
ATOM 5187  O O    . LEU A 1 27  ? 44.349  49.259  80.773  1.00 0.00 ?  18  LEU A O    4  
ATOM 5188  C CB   . LEU A 1 27  ? 44.746  48.675  77.728  1.00 0.00 ?  18  LEU A CB   4  
ATOM 5189  C CG   . LEU A 1 27  ? 43.809  47.934  76.778  1.00 0.00 ?  18  LEU A CG   4  
ATOM 5190  C CD1  . LEU A 1 27  ? 44.624  47.046  75.825  1.00 0.00 ?  18  LEU A CD1  4  
ATOM 5191  C CD2  . LEU A 1 27  ? 42.784  46.963  77.444  1.00 0.00 ?  18  LEU A CD2  4  
ATOM 5192  H H    . LEU A 1 27  ? 44.608  51.151  76.882  1.00 0.00 ?  18  LEU A H    4  
ATOM 5193  H HA   . LEU A 1 27  ? 43.036  49.520  78.690  1.00 0.00 ?  18  LEU A HA   4  
ATOM 5194  H HB2  . LEU A 1 27  ? 45.616  49.011  77.164  1.00 0.00 ?  18  LEU A HB2  4  
ATOM 5195  H HB3  . LEU A 1 27  ? 45.228  47.923  78.353  1.00 0.00 ?  18  LEU A HB3  4  
ATOM 5196  H HG   . LEU A 1 27  ? 43.329  48.716  76.191  1.00 0.00 ?  18  LEU A HG   4  
ATOM 5197  H HD11 . LEU A 1 27  ? 45.464  47.626  75.443  1.00 0.00 ?  18  LEU A HD11 4  
ATOM 5198  H HD12 . LEU A 1 27  ? 45.100  46.283  76.441  1.00 0.00 ?  18  LEU A HD12 4  
ATOM 5199  H HD13 . LEU A 1 27  ? 43.984  46.633  75.045  1.00 0.00 ?  18  LEU A HD13 4  
ATOM 5200  H HD21 . LEU A 1 27  ? 43.051  46.450  78.367  1.00 0.00 ?  18  LEU A HD21 4  
ATOM 5201  H HD22 . LEU A 1 27  ? 41.809  47.445  77.510  1.00 0.00 ?  18  LEU A HD22 4  
ATOM 5202  H HD23 . LEU A 1 27  ? 42.482  46.164  76.767  1.00 0.00 ?  18  LEU A HD23 4  
ATOM 5203  N N    . LYS A 1 28  ? 45.816  50.773  79.801  1.00 0.00 ?  19  LYS A N    4  
ATOM 5204  C CA   . LYS A 1 28  ? 46.379  51.172  81.078  1.00 0.00 ?  19  LYS A CA   4  
ATOM 5205  C C    . LYS A 1 28  ? 45.413  51.934  81.984  1.00 0.00 ?  19  LYS A C    4  
ATOM 5206  O O    . LYS A 1 28  ? 45.332  51.597  83.158  1.00 0.00 ?  19  LYS A O    4  
ATOM 5207  C CB   . LYS A 1 28  ? 47.670  51.923  80.962  1.00 0.00 ?  19  LYS A CB   4  
ATOM 5208  C CG   . LYS A 1 28  ? 48.857  51.124  80.571  1.00 0.00 ?  19  LYS A CG   4  
ATOM 5209  C CD   . LYS A 1 28  ? 50.114  51.958  80.415  1.00 0.00 ?  19  LYS A CD   4  
ATOM 5210  C CE   . LYS A 1 28  ? 50.101  53.210  79.633  1.00 0.00 ?  19  LYS A CE   4  
ATOM 5211  N NZ   . LYS A 1 28  ? 51.097  54.246  80.086  1.00 0.00 1  19  LYS A NZ   4  
ATOM 5212  H H    . LYS A 1 28  ? 46.209  51.227  78.989  1.00 0.00 ?  19  LYS A H    4  
ATOM 5213  H HA   . LYS A 1 28  ? 46.529  50.260  81.655  1.00 0.00 ?  19  LYS A HA   4  
ATOM 5214  H HB2  . LYS A 1 28  ? 47.442  52.707  80.239  1.00 0.00 ?  19  LYS A HB2  4  
ATOM 5215  H HB3  . LYS A 1 28  ? 47.883  52.459  81.887  1.00 0.00 ?  19  LYS A HB3  4  
ATOM 5216  H HG2  . LYS A 1 28  ? 49.063  50.220  81.145  1.00 0.00 ?  19  LYS A HG2  4  
ATOM 5217  H HG3  . LYS A 1 28  ? 48.574  50.810  79.566  1.00 0.00 ?  19  LYS A HG3  4  
ATOM 5218  H HD2  . LYS A 1 28  ? 50.494  52.234  81.399  1.00 0.00 ?  19  LYS A HD2  4  
ATOM 5219  H HD3  . LYS A 1 28  ? 50.870  51.272  80.033  1.00 0.00 ?  19  LYS A HD3  4  
ATOM 5220  H HE2  . LYS A 1 28  ? 50.307  52.856  78.623  1.00 0.00 ?  19  LYS A HE2  4  
ATOM 5221  H HE3  . LYS A 1 28  ? 49.084  53.580  79.762  1.00 0.00 ?  19  LYS A HE3  4  
ATOM 5222  H HZ1  . LYS A 1 28  ? 51.073  54.972  79.384  1.00 0.00 ?  19  LYS A HZ1  4  
ATOM 5223  H HZ2  . LYS A 1 28  ? 50.813  54.632  80.975  1.00 0.00 ?  19  LYS A HZ2  4  
ATOM 5224  H HZ3  . LYS A 1 28  ? 52.031  53.867  80.147  1.00 0.00 ?  19  LYS A HZ3  4  
ATOM 5225  N N    . ALA A 1 29  ? 44.549  52.685  81.366  1.00 0.00 ?  20  ALA A N    4  
ATOM 5226  C CA   . ALA A 1 29  ? 43.450  53.316  82.100  1.00 0.00 ?  20  ALA A CA   4  
ATOM 5227  C C    . ALA A 1 29  ? 42.382  52.286  82.527  1.00 0.00 ?  20  ALA A C    4  
ATOM 5228  O O    . ALA A 1 29  ? 41.859  52.305  83.665  1.00 0.00 ?  20  ALA A O    4  
ATOM 5229  C CB   . ALA A 1 29  ? 42.833  54.519  81.422  1.00 0.00 ?  20  ALA A CB   4  
ATOM 5230  H H    . ALA A 1 29  ? 44.680  52.731  80.365  1.00 0.00 ?  20  ALA A H    4  
ATOM 5231  H HA   . ALA A 1 29  ? 43.882  53.658  83.041  1.00 0.00 ?  20  ALA A HA   4  
ATOM 5232  H HB1  . ALA A 1 29  ? 43.534  55.293  81.733  1.00 0.00 ?  20  ALA A HB1  4  
ATOM 5233  H HB2  . ALA A 1 29  ? 42.648  54.342  80.362  1.00 0.00 ?  20  ALA A HB2  4  
ATOM 5234  H HB3  . ALA A 1 29  ? 41.877  54.606  81.939  1.00 0.00 ?  20  ALA A HB3  4  
ATOM 5235  N N    . LEU A 1 30  ? 42.174  51.231  81.725  1.00 0.00 ?  21  LEU A N    4  
ATOM 5236  C CA   . LEU A 1 30  ? 41.258  50.127  82.029  1.00 0.00 ?  21  LEU A CA   4  
ATOM 5237  C C    . LEU A 1 30  ? 41.787  49.365  83.323  1.00 0.00 ?  21  LEU A C    4  
ATOM 5238  O O    . LEU A 1 30  ? 40.989  48.955  84.219  1.00 0.00 ?  21  LEU A O    4  
ATOM 5239  C CB   . LEU A 1 30  ? 40.995  49.159  80.880  1.00 0.00 ?  21  LEU A CB   4  
ATOM 5240  C CG   . LEU A 1 30  ? 39.898  48.120  81.088  1.00 0.00 ?  21  LEU A CG   4  
ATOM 5241  C CD1  . LEU A 1 30  ? 38.441  48.650  81.263  1.00 0.00 ?  21  LEU A CD1  4  
ATOM 5242  C CD2  . LEU A 1 30  ? 39.851  47.178  79.881  1.00 0.00 ?  21  LEU A CD2  4  
ATOM 5243  H H    . LEU A 1 30  ? 42.458  51.289  80.757  1.00 0.00 ?  21  LEU A H    4  
ATOM 5244  H HA   . LEU A 1 30  ? 40.352  50.661  82.316  1.00 0.00 ?  21  LEU A HA   4  
ATOM 5245  H HB2  . LEU A 1 30  ? 40.657  49.664  79.976  1.00 0.00 ?  21  LEU A HB2  4  
ATOM 5246  H HB3  . LEU A 1 30  ? 41.903  48.632  80.588  1.00 0.00 ?  21  LEU A HB3  4  
ATOM 5247  H HG   . LEU A 1 30  ? 40.162  47.655  82.037  1.00 0.00 ?  21  LEU A HG   4  
ATOM 5248  H HD11 . LEU A 1 30  ? 38.359  49.397  80.474  1.00 0.00 ?  21  LEU A HD11 4  
ATOM 5249  H HD12 . LEU A 1 30  ? 37.842  47.739  81.262  1.00 0.00 ?  21  LEU A HD12 4  
ATOM 5250  H HD13 . LEU A 1 30  ? 38.388  49.253  82.169  1.00 0.00 ?  21  LEU A HD13 4  
ATOM 5251  H HD21 . LEU A 1 30  ? 39.052  46.439  79.942  1.00 0.00 ?  21  LEU A HD21 4  
ATOM 5252  H HD22 . LEU A 1 30  ? 39.775  47.709  78.932  1.00 0.00 ?  21  LEU A HD22 4  
ATOM 5253  H HD23 . LEU A 1 30  ? 40.830  46.703  79.813  1.00 0.00 ?  21  LEU A HD23 4  
ATOM 5254  N N    . ASN A 1 31  ? 43.110  49.048  83.323  1.00 0.00 ?  22  ASN A N    4  
ATOM 5255  C CA   . ASN A 1 31  ? 43.769  48.367  84.427  1.00 0.00 ?  22  ASN A CA   4  
ATOM 5256  C C    . ASN A 1 31  ? 43.675  49.197  85.724  1.00 0.00 ?  22  ASN A C    4  
ATOM 5257  O O    . ASN A 1 31  ? 43.711  48.722  86.809  1.00 0.00 ?  22  ASN A O    4  
ATOM 5258  C CB   . ASN A 1 31  ? 45.273  48.298  84.031  1.00 0.00 ?  22  ASN A CB   4  
ATOM 5259  C CG   . ASN A 1 31  ? 46.104  47.722  85.164  1.00 0.00 ?  22  ASN A CG   4  
ATOM 5260  O OD1  . ASN A 1 31  ? 46.021  46.574  85.493  1.00 0.00 ?  22  ASN A OD1  4  
ATOM 5261  N ND2  . ASN A 1 31  ? 47.107  48.391  85.695  1.00 0.00 ?  22  ASN A ND2  4  
ATOM 5262  H H    . ASN A 1 31  ? 43.691  49.177  82.508  1.00 0.00 ?  22  ASN A H    4  
ATOM 5263  H HA   . ASN A 1 31  ? 43.405  47.344  84.519  1.00 0.00 ?  22  ASN A HA   4  
ATOM 5264  H HB2  . ASN A 1 31  ? 45.298  47.595  83.198  1.00 0.00 ?  22  ASN A HB2  4  
ATOM 5265  H HB3  . ASN A 1 31  ? 45.685  49.281  83.801  1.00 0.00 ?  22  ASN A HB3  4  
ATOM 5266  H HD21 . ASN A 1 31  ? 47.370  49.325  85.416  1.00 0.00 ?  22  ASN A HD21 4  
ATOM 5267  H HD22 . ASN A 1 31  ? 47.808  47.970  86.288  1.00 0.00 ?  22  ASN A HD22 4  
ATOM 5268  N N    . ALA A 1 32  ? 43.576  50.542  85.675  1.00 0.00 ?  23  ALA A N    4  
ATOM 5269  C CA   . ALA A 1 32  ? 43.729  51.480  86.723  1.00 0.00 ?  23  ALA A CA   4  
ATOM 5270  C C    . ALA A 1 32  ? 42.302  51.858  87.327  1.00 0.00 ?  23  ALA A C    4  
ATOM 5271  O O    . ALA A 1 32  ? 42.206  52.063  88.555  1.00 0.00 ?  23  ALA A O    4  
ATOM 5272  C CB   . ALA A 1 32  ? 44.494  52.731  86.320  1.00 0.00 ?  23  ALA A CB   4  
ATOM 5273  H H    . ALA A 1 32  ? 43.581  51.024  84.787  1.00 0.00 ?  23  ALA A H    4  
ATOM 5274  H HA   . ALA A 1 32  ? 44.309  51.019  87.521  1.00 0.00 ?  23  ALA A HA   4  
ATOM 5275  H HB1  . ALA A 1 32  ? 45.474  52.498  85.904  1.00 0.00 ?  23  ALA A HB1  4  
ATOM 5276  H HB2  . ALA A 1 32  ? 43.934  53.159  85.488  1.00 0.00 ?  23  ALA A HB2  4  
ATOM 5277  H HB3  . ALA A 1 32  ? 44.546  53.423  87.161  1.00 0.00 ?  23  ALA A HB3  4  
ATOM 5278  N N    . THR A 1 33  ? 41.281  51.808  86.509  1.00 0.00 ?  24  THR A N    4  
ATOM 5279  C CA   . THR A 1 33  ? 39.856  51.724  86.965  1.00 0.00 ?  24  THR A CA   4  
ATOM 5280  C C    . THR A 1 33  ? 39.604  50.423  87.732  1.00 0.00 ?  24  THR A C    4  
ATOM 5281  O O    . THR A 1 33  ? 38.788  50.299  88.651  1.00 0.00 ?  24  THR A O    4  
ATOM 5282  C CB   . THR A 1 33  ? 38.786  52.004  85.911  1.00 0.00 ?  24  THR A CB   4  
ATOM 5283  O OG1  . THR A 1 33  ? 37.596  52.533  86.537  1.00 0.00 ?  24  THR A OG1  4  
ATOM 5284  C CG2  . THR A 1 33  ? 38.435  50.777  85.117  1.00 0.00 ?  24  THR A CG2  4  
ATOM 5285  H H    . THR A 1 33  ? 41.465  51.711  85.521  1.00 0.00 ?  24  THR A H    4  
ATOM 5286  H HA   . THR A 1 33  ? 39.728  52.514  87.705  1.00 0.00 ?  24  THR A HA   4  
ATOM 5287  H HB   . THR A 1 33  ? 39.297  52.659  85.205  1.00 0.00 ?  24  THR A HB   4  
ATOM 5288  H HG1  . THR A 1 33  ? 37.131  52.943  85.803  1.00 0.00 ?  24  THR A HG1  4  
ATOM 5289  H HG21 . THR A 1 33  ? 37.568  50.880  84.464  1.00 0.00 ?  24  THR A HG21 4  
ATOM 5290  H HG22 . THR A 1 33  ? 39.255  50.636  84.414  1.00 0.00 ?  24  THR A HG22 4  
ATOM 5291  H HG23 . THR A 1 33  ? 38.281  49.852  85.673  1.00 0.00 ?  24  THR A HG23 4  
ATOM 5292  N N    . LEU A 1 34  ? 40.306  49.321  87.318  1.00 0.00 ?  25  LEU A N    4  
ATOM 5293  C CA   . LEU A 1 34  ? 40.244  48.033  87.988  1.00 0.00 ?  25  LEU A CA   4  
ATOM 5294  C C    . LEU A 1 34  ? 40.955  47.978  89.323  1.00 0.00 ?  25  LEU A C    4  
ATOM 5295  O O    . LEU A 1 34  ? 40.411  47.387  90.241  1.00 0.00 ?  25  LEU A O    4  
ATOM 5296  C CB   . LEU A 1 34  ? 40.714  46.973  86.931  1.00 0.00 ?  25  LEU A CB   4  
ATOM 5297  C CG   . LEU A 1 34  ? 40.722  45.530  87.588  1.00 0.00 ?  25  LEU A CG   4  
ATOM 5298  C CD1  . LEU A 1 34  ? 39.350  45.027  87.914  1.00 0.00 ?  25  LEU A CD1  4  
ATOM 5299  C CD2  . LEU A 1 34  ? 41.297  44.437  86.597  1.00 0.00 ?  25  LEU A CD2  4  
ATOM 5300  H H    . LEU A 1 34  ? 40.826  49.381  86.455  1.00 0.00 ?  25  LEU A H    4  
ATOM 5301  H HA   . LEU A 1 34  ? 39.199  47.867  88.245  1.00 0.00 ?  25  LEU A HA   4  
ATOM 5302  H HB2  . LEU A 1 34  ? 40.031  46.995  86.081  1.00 0.00 ?  25  LEU A HB2  4  
ATOM 5303  H HB3  . LEU A 1 34  ? 41.761  47.176  86.708  1.00 0.00 ?  25  LEU A HB3  4  
ATOM 5304  H HG   . LEU A 1 34  ? 41.272  45.543  88.529  1.00 0.00 ?  25  LEU A HG   4  
ATOM 5305  H HD11 . LEU A 1 34  ? 38.934  45.555  88.772  1.00 0.00 ?  25  LEU A HD11 4  
ATOM 5306  H HD12 . LEU A 1 34  ? 38.613  45.083  87.112  1.00 0.00 ?  25  LEU A HD12 4  
ATOM 5307  H HD13 . LEU A 1 34  ? 39.300  43.971  88.181  1.00 0.00 ?  25  LEU A HD13 4  
ATOM 5308  H HD21 . LEU A 1 34  ? 40.640  44.267  85.744  1.00 0.00 ?  25  LEU A HD21 4  
ATOM 5309  H HD22 . LEU A 1 34  ? 42.323  44.765  86.428  1.00 0.00 ?  25  LEU A HD22 4  
ATOM 5310  H HD23 . LEU A 1 34  ? 41.449  43.492  87.119  1.00 0.00 ?  25  LEU A HD23 4  
ATOM 5311  N N    . HIS A 1 35  ? 42.110  48.683  89.386  1.00 0.00 ?  26  HIS A N    4  
ATOM 5312  C CA   . HIS A 1 35  ? 42.721  49.078  90.701  1.00 0.00 ?  26  HIS A CA   4  
ATOM 5313  C C    . HIS A 1 35  ? 41.817  50.058  91.490  1.00 0.00 ?  26  HIS A C    4  
ATOM 5314  O O    . HIS A 1 35  ? 41.646  49.745  92.635  1.00 0.00 ?  26  HIS A O    4  
ATOM 5315  C CB   . HIS A 1 35  ? 44.068  49.755  90.464  1.00 0.00 ?  26  HIS A CB   4  
ATOM 5316  C CG   . HIS A 1 35  ? 45.326  48.917  90.360  1.00 0.00 ?  26  HIS A CG   4  
ATOM 5317  N ND1  . HIS A 1 35  ? 45.943  48.288  91.444  1.00 0.00 ?  26  HIS A ND1  4  
ATOM 5318  C CD2  . HIS A 1 35  ? 46.216  48.885  89.332  1.00 0.00 ?  26  HIS A CD2  4  
ATOM 5319  C CE1  . HIS A 1 35  ? 47.087  47.784  91.062  1.00 0.00 ?  26  HIS A CE1  4  
ATOM 5320  N NE2  . HIS A 1 35  ? 47.318  48.156  89.769  1.00 0.00 ?  26  HIS A NE2  4  
ATOM 5321  H H    . HIS A 1 35  ? 42.543  49.074  88.561  1.00 0.00 ?  26  HIS A H    4  
ATOM 5322  H HA   . HIS A 1 35  ? 42.829  48.195  91.331  1.00 0.00 ?  26  HIS A HA   4  
ATOM 5323  H HB2  . HIS A 1 35  ? 44.011  50.369  89.565  1.00 0.00 ?  26  HIS A HB2  4  
ATOM 5324  H HB3  . HIS A 1 35  ? 44.316  50.331  91.356  1.00 0.00 ?  26  HIS A HB3  4  
ATOM 5325  H HD2  . HIS A 1 35  ? 46.038  49.304  88.352  1.00 0.00 ?  26  HIS A HD2  4  
ATOM 5326  H HE1  . HIS A 1 35  ? 47.716  47.085  91.592  1.00 0.00 ?  26  HIS A HE1  4  
ATOM 5327  H HE2  . HIS A 1 35  ? 48.138  47.885  89.247  1.00 0.00 ?  26  HIS A HE2  4  
ATOM 5328  N N    . SER A 1 36  ? 41.242  51.136  90.929  1.00 0.00 ?  27  SER A N    4  
ATOM 5329  C CA   . SER A 1 36  ? 40.234  51.862  91.648  1.00 0.00 ?  27  SER A CA   4  
ATOM 5330  C C    . SER A 1 36  ? 39.030  51.049  92.143  1.00 0.00 ?  27  SER A C    4  
ATOM 5331  O O    . SER A 1 36  ? 38.681  51.212  93.292  1.00 0.00 ?  27  SER A O    4  
ATOM 5332  C CB   . SER A 1 36  ? 39.766  52.958  90.756  1.00 0.00 ?  27  SER A CB   4  
ATOM 5333  O OG   . SER A 1 36  ? 40.583  53.998  91.044  1.00 0.00 ?  27  SER A OG   4  
ATOM 5334  H H    . SER A 1 36  ? 41.576  51.402  90.013  1.00 0.00 ?  27  SER A H    4  
ATOM 5335  H HA   . SER A 1 36  ? 40.803  52.168  92.526  1.00 0.00 ?  27  SER A HA   4  
ATOM 5336  H HB2  . SER A 1 36  ? 39.596  52.697  89.712  1.00 0.00 ?  27  SER A HB2  4  
ATOM 5337  H HB3  . SER A 1 36  ? 38.887  53.438  91.186  1.00 0.00 ?  27  SER A HB3  4  
ATOM 5338  H HG   . SER A 1 36  ? 40.265  54.745  90.531  1.00 0.00 ?  27  SER A HG   4  
ATOM 5339  N N    . ASN A 1 37  ? 38.578  50.040  91.401  1.00 0.00 ?  28  ASN A N    4  
ATOM 5340  C CA   . ASN A 1 37  ? 37.532  49.152  91.929  1.00 0.00 ?  28  ASN A CA   4  
ATOM 5341  C C    . ASN A 1 37  ? 37.970  48.147  92.967  1.00 0.00 ?  28  ASN A C    4  
ATOM 5342  O O    . ASN A 1 37  ? 37.450  48.202  94.083  1.00 0.00 ?  28  ASN A O    4  
ATOM 5343  C CB   . ASN A 1 37  ? 36.860  48.560  90.649  1.00 0.00 ?  28  ASN A CB   4  
ATOM 5344  C CG   . ASN A 1 37  ? 35.461  48.024  90.922  1.00 0.00 ?  28  ASN A CG   4  
ATOM 5345  O OD1  . ASN A 1 37  ? 34.882  47.910  91.990  1.00 0.00 ?  28  ASN A OD1  4  
ATOM 5346  N ND2  . ASN A 1 37  ? 34.934  47.407  89.878  1.00 0.00 ?  28  ASN A ND2  4  
ATOM 5347  H H    . ASN A 1 37  ? 38.817  50.084  90.420  1.00 0.00 ?  28  ASN A H    4  
ATOM 5348  H HA   . ASN A 1 37  ? 36.762  49.765  92.395  1.00 0.00 ?  28  ASN A HA   4  
ATOM 5349  H HB2  . ASN A 1 37  ? 36.738  49.315  89.872  1.00 0.00 ?  28  ASN A HB2  4  
ATOM 5350  H HB3  . ASN A 1 37  ? 37.579  47.777  90.406  1.00 0.00 ?  28  ASN A HB3  4  
ATOM 5351  H HD21 . ASN A 1 37  ? 35.496  47.368  89.040  1.00 0.00 ?  28  ASN A HD21 4  
ATOM 5352  H HD22 . ASN A 1 37  ? 34.038  46.955  89.992  1.00 0.00 ?  28  ASN A HD22 4  
ATOM 5353  N N    . LEU A 1 38  ? 38.969  47.350  92.742  1.00 0.00 ?  29  LEU A N    4  
ATOM 5354  C CA   . LEU A 1 38  ? 39.504  46.335  93.677  1.00 0.00 ?  29  LEU A CA   4  
ATOM 5355  C C    . LEU A 1 38  ? 40.139  46.907  94.982  1.00 0.00 ?  29  LEU A C    4  
ATOM 5356  O O    . LEU A 1 38  ? 40.257  46.149  95.928  1.00 0.00 ?  29  LEU A O    4  
ATOM 5357  C CB   . LEU A 1 38  ? 40.669  45.642  92.849  1.00 0.00 ?  29  LEU A CB   4  
ATOM 5358  C CG   . LEU A 1 38  ? 40.229  44.652  91.738  1.00 0.00 ?  29  LEU A CG   4  
ATOM 5359  C CD1  . LEU A 1 38  ? 41.399  43.901  91.081  1.00 0.00 ?  29  LEU A CD1  4  
ATOM 5360  C CD2  . LEU A 1 38  ? 39.305  43.506  92.275  1.00 0.00 ?  29  LEU A CD2  4  
ATOM 5361  H H    . LEU A 1 38  ? 39.324  47.362  91.797  1.00 0.00 ?  29  LEU A H    4  
ATOM 5362  H HA   . LEU A 1 38  ? 38.684  45.650  93.893  1.00 0.00 ?  29  LEU A HA   4  
ATOM 5363  H HB2  . LEU A 1 38  ? 41.298  46.438  92.454  1.00 0.00 ?  29  LEU A HB2  4  
ATOM 5364  H HB3  . LEU A 1 38  ? 41.270  45.062  93.550  1.00 0.00 ?  29  LEU A HB3  4  
ATOM 5365  H HG   . LEU A 1 38  ? 39.557  45.170  91.054  1.00 0.00 ?  29  LEU A HG   4  
ATOM 5366  H HD11 . LEU A 1 38  ? 41.810  43.205  91.812  1.00 0.00 ?  29  LEU A HD11 4  
ATOM 5367  H HD12 . LEU A 1 38  ? 41.077  43.431  90.152  1.00 0.00 ?  29  LEU A HD12 4  
ATOM 5368  H HD13 . LEU A 1 38  ? 42.184  44.565  90.719  1.00 0.00 ?  29  LEU A HD13 4  
ATOM 5369  H HD21 . LEU A 1 38  ? 39.099  42.802  91.470  1.00 0.00 ?  29  LEU A HD21 4  
ATOM 5370  H HD22 . LEU A 1 38  ? 39.843  42.935  93.032  1.00 0.00 ?  29  LEU A HD22 4  
ATOM 5371  H HD23 . LEU A 1 38  ? 38.331  43.855  92.616  1.00 0.00 ?  29  LEU A HD23 4  
ATOM 5372  N N    . LEU A 1 39  ? 40.595  48.174  95.006  1.00 0.00 ?  30  LEU A N    4  
ATOM 5373  C CA   . LEU A 1 39  ? 41.092  48.832  96.194  1.00 0.00 ?  30  LEU A CA   4  
ATOM 5374  C C    . LEU A 1 39  ? 40.001  49.833  96.741  1.00 0.00 ?  30  LEU A C    4  
ATOM 5375  O O    . LEU A 1 39  ? 40.337  50.746  97.463  1.00 0.00 ?  30  LEU A O    4  
ATOM 5376  C CB   . LEU A 1 39  ? 42.415  49.662  95.905  1.00 0.00 ?  30  LEU A CB   4  
ATOM 5377  C CG   . LEU A 1 39  ? 43.602  48.924  95.303  1.00 0.00 ?  30  LEU A CG   4  
ATOM 5378  C CD1  . LEU A 1 39  ? 44.706  49.949  95.049  1.00 0.00 ?  30  LEU A CD1  4  
ATOM 5379  C CD2  . LEU A 1 39  ? 44.170  47.984  96.371  1.00 0.00 ?  30  LEU A CD2  4  
ATOM 5380  H H    . LEU A 1 39  ? 40.170  48.753  94.296  1.00 0.00 ?  30  LEU A H    4  
ATOM 5381  H HA   . LEU A 1 39  ? 41.323  48.087  96.954  1.00 0.00 ?  30  LEU A HA   4  
ATOM 5382  H HB2  . LEU A 1 39  ? 42.164  50.318  95.071  1.00 0.00 ?  30  LEU A HB2  4  
ATOM 5383  H HB3  . LEU A 1 39  ? 42.738  50.167  96.814  1.00 0.00 ?  30  LEU A HB3  4  
ATOM 5384  H HG   . LEU A 1 39  ? 43.235  48.375  94.435  1.00 0.00 ?  30  LEU A HG   4  
ATOM 5385  H HD11 . LEU A 1 39  ? 44.879  50.592  95.912  1.00 0.00 ?  30  LEU A HD11 4  
ATOM 5386  H HD12 . LEU A 1 39  ? 45.630  49.407  94.853  1.00 0.00 ?  30  LEU A HD12 4  
ATOM 5387  H HD13 . LEU A 1 39  ? 44.494  50.518  94.143  1.00 0.00 ?  30  LEU A HD13 4  
ATOM 5388  H HD21 . LEU A 1 39  ? 44.491  48.588  97.219  1.00 0.00 ?  30  LEU A HD21 4  
ATOM 5389  H HD22 . LEU A 1 39  ? 43.408  47.442  96.932  1.00 0.00 ?  30  LEU A HD22 4  
ATOM 5390  H HD23 . LEU A 1 39  ? 44.892  47.343  95.866  1.00 0.00 ?  30  LEU A HD23 4  
ATOM 5391  N N    . CYS A 1 40  ? 38.746  49.596  96.365  1.00 0.00 ?  31  CYS A N    4  
ATOM 5392  C CA   . CYS A 1 40  ? 37.696  50.448  96.881  1.00 0.00 ?  31  CYS A CA   4  
ATOM 5393  C C    . CYS A 1 40  ? 37.190  50.095  98.328  1.00 0.00 ?  31  CYS A C    4  
ATOM 5394  O O    . CYS A 1 40  ? 37.447  49.030  98.785  1.00 0.00 ?  31  CYS A O    4  
ATOM 5395  C CB   . CYS A 1 40  ? 36.566  50.528  95.871  1.00 0.00 ?  31  CYS A CB   4  
ATOM 5396  S SG   . CYS A 1 40  ? 35.611  51.966  96.326  1.00 0.00 ?  31  CYS A SG   4  
ATOM 5397  H H    . CYS A 1 40  ? 38.503  48.958  95.621  1.00 0.00 ?  31  CYS A H    4  
ATOM 5398  H HA   . CYS A 1 40  ? 38.150  51.434  96.974  1.00 0.00 ?  31  CYS A HA   4  
ATOM 5399  H HB2  . CYS A 1 40  ? 36.957  50.659  94.862  1.00 0.00 ?  31  CYS A HB2  4  
ATOM 5400  H HB3  . CYS A 1 40  ? 35.855  49.703  95.903  1.00 0.00 ?  31  CYS A HB3  4  
ATOM 5401  H HG   . CYS A 1 40  ? 36.259  52.745  95.454  1.00 0.00 ?  31  CYS A HG   4  
ATOM 5402  N N    . ARG A 1 41  ? 36.468  51.025  98.991  1.00 0.00 ?  32  ARG A N    4  
ATOM 5403  C CA   . ARG A 1 41  ? 35.883  50.797  100.388 1.00 0.00 ?  32  ARG A CA   4  
ATOM 5404  C C    . ARG A 1 41  ? 34.707  49.780  100.445 1.00 0.00 ?  32  ARG A C    4  
ATOM 5405  O O    . ARG A 1 41  ? 33.753  50.135  99.799  1.00 0.00 ?  32  ARG A O    4  
ATOM 5406  C CB   . ARG A 1 41  ? 35.718  52.151  101.101 1.00 0.00 ?  32  ARG A CB   4  
ATOM 5407  C CG   . ARG A 1 41  ? 37.077  52.760  101.656 1.00 0.00 ?  32  ARG A CG   4  
ATOM 5408  C CD   . ARG A 1 41  ? 38.089  53.083  100.595 1.00 0.00 ?  32  ARG A CD   4  
ATOM 5409  N NE   . ARG A 1 41  ? 39.194  53.856  101.265 1.00 0.00 ?  32  ARG A NE   4  
ATOM 5410  C CZ   . ARG A 1 41  ? 40.390  54.127  100.885 1.00 0.00 ?  32  ARG A CZ   4  
ATOM 5411  N NH1  . ARG A 1 41  ? 40.811  53.826  99.670  1.00 0.00 ?  32  ARG A NH1  4  
ATOM 5412  N NH2  . ARG A 1 41  ? 41.216  54.748  101.711 1.00 0.00 1  32  ARG A NH2  4  
ATOM 5413  H H    . ARG A 1 41  ? 36.279  51.841  98.429  1.00 0.00 ?  32  ARG A H    4  
ATOM 5414  H HA   . ARG A 1 41  ? 36.604  50.360  101.078 1.00 0.00 ?  32  ARG A HA   4  
ATOM 5415  H HB2  . ARG A 1 41  ? 35.118  52.871  100.543 1.00 0.00 ?  32  ARG A HB2  4  
ATOM 5416  H HB3  . ARG A 1 41  ? 35.106  52.004  101.989 1.00 0.00 ?  32  ARG A HB3  4  
ATOM 5417  H HG2  . ARG A 1 41  ? 36.799  53.694  102.144 1.00 0.00 ?  32  ARG A HG2  4  
ATOM 5418  H HG3  . ARG A 1 41  ? 37.594  52.149  102.395 1.00 0.00 ?  32  ARG A HG3  4  
ATOM 5419  H HD2  . ARG A 1 41  ? 38.375  52.122  100.166 1.00 0.00 ?  32  ARG A HD2  4  
ATOM 5420  H HD3  . ARG A 1 41  ? 37.597  53.761  99.897  1.00 0.00 ?  32  ARG A HD3  4  
ATOM 5421  H HE   . ARG A 1 41  ? 39.048  54.210  102.200 1.00 0.00 ?  32  ARG A HE   4  
ATOM 5422  H HH11 . ARG A 1 41  ? 40.129  53.790  98.925  1.00 0.00 ?  32  ARG A HH11 4  
ATOM 5423  H HH12 . ARG A 1 41  ? 41.753  54.113  99.443  1.00 0.00 ?  32  ARG A HH12 4  
ATOM 5424  H HH21 . ARG A 1 41  ? 40.859  55.009  102.619 1.00 0.00 ?  32  ARG A HH21 4  
ATOM 5425  H HH22 . ARG A 1 41  ? 42.201  54.761  101.488 1.00 0.00 ?  32  ARG A HH22 4  
ATOM 5426  N N    . PRO A 1 42  ? 34.748  48.623  101.112 1.00 0.00 ?  33  PRO A N    4  
ATOM 5427  C CA   . PRO A 1 42  ? 33.530  47.916  101.355 1.00 0.00 ?  33  PRO A CA   4  
ATOM 5428  C C    . PRO A 1 42  ? 32.521  48.677  102.276 1.00 0.00 ?  33  PRO A C    4  
ATOM 5429  O O    . PRO A 1 42  ? 32.904  49.298  103.287 1.00 0.00 ?  33  PRO A O    4  
ATOM 5430  C CB   . PRO A 1 42  ? 33.979  46.605  102.074 1.00 0.00 ?  33  PRO A CB   4  
ATOM 5431  C CG   . PRO A 1 42  ? 35.194  47.005  102.779 1.00 0.00 ?  33  PRO A CG   4  
ATOM 5432  C CD   . PRO A 1 42  ? 35.832  48.033  101.877 1.00 0.00 ?  33  PRO A CD   4  
ATOM 5433  H HA   . PRO A 1 42  ? 33.082  47.670  100.393 1.00 0.00 ?  33  PRO A HA   4  
ATOM 5434  H HB2  . PRO A 1 42  ? 33.110  46.237  102.620 1.00 0.00 ?  33  PRO A HB2  4  
ATOM 5435  H HB3  . PRO A 1 42  ? 34.313  45.962  101.260 1.00 0.00 ?  33  PRO A HB3  4  
ATOM 5436  H HG2  . PRO A 1 42  ? 34.881  47.421  103.737 1.00 0.00 ?  33  PRO A HG2  4  
ATOM 5437  H HG3  . PRO A 1 42  ? 35.902  46.213  103.024 1.00 0.00 ?  33  PRO A HG3  4  
ATOM 5438  H HD2  . PRO A 1 42  ? 36.397  48.735  102.490 1.00 0.00 ?  33  PRO A HD2  4  
ATOM 5439  H HD3  . PRO A 1 42  ? 36.546  47.569  101.196 1.00 0.00 ?  33  PRO A HD3  4  
ATOM 5440  N N    . GLY A 1 43  ? 31.237  48.678  101.936 1.00 0.00 ?  34  GLY A N    4  
ATOM 5441  C CA   . GLY A 1 43  ? 30.323  49.610  102.530 1.00 0.00 ?  34  GLY A CA   4  
ATOM 5442  C C    . GLY A 1 43  ? 29.709  50.618  101.480 1.00 0.00 ?  34  GLY A C    4  
ATOM 5443  O O    . GLY A 1 43  ? 30.225  50.662  100.362 1.00 0.00 ?  34  GLY A O    4  
ATOM 5444  H H    . GLY A 1 43  ? 31.033  48.322  101.012 1.00 0.00 ?  34  GLY A H    4  
ATOM 5445  H HA2  . GLY A 1 43  ? 29.519  49.105  103.066 1.00 0.00 ?  34  GLY A HA2  4  
ATOM 5446  H HA3  . GLY A 1 43  ? 30.740  50.115  103.401 1.00 0.00 ?  34  GLY A HA3  4  
ATOM 5447  N N    . PRO A 1 44  ? 28.614  51.354  101.728 1.00 0.00 ?  35  PRO A N    4  
ATOM 5448  C CA   . PRO A 1 44  ? 27.850  52.073  100.722 1.00 0.00 ?  35  PRO A CA   4  
ATOM 5449  C C    . PRO A 1 44  ? 28.716  53.215  100.141 1.00 0.00 ?  35  PRO A C    4  
ATOM 5450  O O    . PRO A 1 44  ? 28.424  53.823  99.099  1.00 0.00 ?  35  PRO A O    4  
ATOM 5451  C CB   . PRO A 1 44  ? 26.669  52.704  101.504 1.00 0.00 ?  35  PRO A CB   4  
ATOM 5452  C CG   . PRO A 1 44  ? 27.218  52.735  102.934 1.00 0.00 ?  35  PRO A CG   4  
ATOM 5453  C CD   . PRO A 1 44  ? 28.000  51.446  103.032 1.00 0.00 ?  35  PRO A CD   4  
ATOM 5454  H HA   . PRO A 1 44  ? 27.471  51.339  100.010 1.00 0.00 ?  35  PRO A HA   4  
ATOM 5455  H HB2  . PRO A 1 44  ? 26.360  53.698  101.181 1.00 0.00 ?  35  PRO A HB2  4  
ATOM 5456  H HB3  . PRO A 1 44  ? 25.873  51.964  101.427 1.00 0.00 ?  35  PRO A HB3  4  
ATOM 5457  H HG2  . PRO A 1 44  ? 27.820  53.612  103.175 1.00 0.00 ?  35  PRO A HG2  4  
ATOM 5458  H HG3  . PRO A 1 44  ? 26.351  52.743  103.596 1.00 0.00 ?  35  PRO A HG3  4  
ATOM 5459  H HD2  . PRO A 1 44  ? 28.698  51.400  103.869 1.00 0.00 ?  35  PRO A HD2  4  
ATOM 5460  H HD3  . PRO A 1 44  ? 27.267  50.640  103.050 1.00 0.00 ?  35  PRO A HD3  4  
ATOM 5461  N N    . GLY A 1 45  ? 29.670  53.819  100.935 1.00 0.00 ?  36  GLY A N    4  
ATOM 5462  C CA   . GLY A 1 45  ? 30.458  54.949  100.516 1.00 0.00 ?  36  GLY A CA   4  
ATOM 5463  C C    . GLY A 1 45  ? 31.469  54.555  99.414  1.00 0.00 ?  36  GLY A C    4  
ATOM 5464  O O    . GLY A 1 45  ? 32.194  53.604  99.537  1.00 0.00 ?  36  GLY A O    4  
ATOM 5465  H H    . GLY A 1 45  ? 29.867  53.280  101.766 1.00 0.00 ?  36  GLY A H    4  
ATOM 5466  H HA2  . GLY A 1 45  ? 29.782  55.712  100.128 1.00 0.00 ?  36  GLY A HA2  4  
ATOM 5467  H HA3  . GLY A 1 45  ? 31.028  55.473  101.283 1.00 0.00 ?  36  GLY A HA3  4  
ATOM 5468  N N    . LEU A 1 46  ? 31.661  55.376  98.464  1.00 0.00 ?  37  LEU A N    4  
ATOM 5469  C CA   . LEU A 1 46  ? 32.304  55.019  97.206  1.00 0.00 ?  37  LEU A CA   4  
ATOM 5470  C C    . LEU A 1 46  ? 33.803  55.551  97.238  1.00 0.00 ?  37  LEU A C    4  
ATOM 5471  O O    . LEU A 1 46  ? 34.358  55.802  96.191  1.00 0.00 ?  37  LEU A O    4  
ATOM 5472  C CB   . LEU A 1 46  ? 31.474  55.545  95.967  1.00 0.00 ?  37  LEU A CB   4  
ATOM 5473  C CG   . LEU A 1 46  ? 29.958  55.272  95.893  1.00 0.00 ?  37  LEU A CG   4  
ATOM 5474  C CD1  . LEU A 1 46  ? 29.171  55.843  94.693  1.00 0.00 ?  37  LEU A CD1  4  
ATOM 5475  C CD2  . LEU A 1 46  ? 29.828  53.779  95.895  1.00 0.00 ?  37  LEU A CD2  4  
ATOM 5476  H H    . LEU A 1 46  ? 31.391  56.335  98.628  1.00 0.00 ?  37  LEU A H    4  
ATOM 5477  H HA   . LEU A 1 46  ? 32.315  53.931  97.152  1.00 0.00 ?  37  LEU A HA   4  
ATOM 5478  H HB2  . LEU A 1 46  ? 31.559  56.625  96.083  1.00 0.00 ?  37  LEU A HB2  4  
ATOM 5479  H HB3  . LEU A 1 46  ? 32.051  55.149  95.132  1.00 0.00 ?  37  LEU A HB3  4  
ATOM 5480  H HG   . LEU A 1 46  ? 29.528  55.761  96.767  1.00 0.00 ?  37  LEU A HG   4  
ATOM 5481  H HD11 . LEU A 1 46  ? 29.697  55.450  93.822  1.00 0.00 ?  37  LEU A HD11 4  
ATOM 5482  H HD12 . LEU A 1 46  ? 28.128  55.535  94.765  1.00 0.00 ?  37  LEU A HD12 4  
ATOM 5483  H HD13 . LEU A 1 46  ? 29.361  56.909  94.572  1.00 0.00 ?  37  LEU A HD13 4  
ATOM 5484  H HD21 . LEU A 1 46  ? 28.816  53.446  95.664  1.00 0.00 ?  37  LEU A HD21 4  
ATOM 5485  H HD22 . LEU A 1 46  ? 30.477  53.445  95.086  1.00 0.00 ?  37  LEU A HD22 4  
ATOM 5486  H HD23 . LEU A 1 46  ? 30.027  53.350  96.877  1.00 0.00 ?  37  LEU A HD23 4  
ATOM 5487  N N    . GLY A 1 47  ? 34.337  55.599  98.428  1.00 0.00 ?  38  GLY A N    4  
ATOM 5488  C CA   . GLY A 1 47  ? 35.684  56.128  98.641  1.00 0.00 ?  38  GLY A CA   4  
ATOM 5489  C C    . GLY A 1 47  ? 36.027  56.220  100.141 1.00 0.00 ?  38  GLY A C    4  
ATOM 5490  O O    . GLY A 1 47  ? 35.273  55.646  100.933 1.00 0.00 ?  38  GLY A O    4  
ATOM 5491  H H    . GLY A 1 47  ? 33.792  55.400  99.255  1.00 0.00 ?  38  GLY A H    4  
ATOM 5492  H HA2  . GLY A 1 47  ? 36.397  55.497  98.111  1.00 0.00 ?  38  GLY A HA2  4  
ATOM 5493  H HA3  . GLY A 1 47  ? 35.690  57.138  98.231  1.00 0.00 ?  38  GLY A HA3  4  
ATOM 5494  N N    . PRO A 1 48  ? 37.087  56.926  100.504 1.00 0.00 ?  39  PRO A N    4  
ATOM 5495  C CA   . PRO A 1 48  ? 37.616  56.972  101.847 1.00 0.00 ?  39  PRO A CA   4  
ATOM 5496  C C    . PRO A 1 48  ? 36.514  57.402  102.864 1.00 0.00 ?  39  PRO A C    4  
ATOM 5497  O O    . PRO A 1 48  ? 35.583  58.182  102.569 1.00 0.00 ?  39  PRO A O    4  
ATOM 5498  C CB   . PRO A 1 48  ? 38.783  57.903  101.899 1.00 0.00 ?  39  PRO A CB   4  
ATOM 5499  C CG   . PRO A 1 48  ? 39.262  57.850  100.502 1.00 0.00 ?  39  PRO A CG   4  
ATOM 5500  C CD   . PRO A 1 48  ? 38.011  57.701  99.683  1.00 0.00 ?  39  PRO A CD   4  
ATOM 5501  H HA   . PRO A 1 48  ? 37.972  55.965  102.062 1.00 0.00 ?  39  PRO A HA   4  
ATOM 5502  H HB2  . PRO A 1 48  ? 38.446  58.921  102.094 1.00 0.00 ?  39  PRO A HB2  4  
ATOM 5503  H HB3  . PRO A 1 48  ? 39.551  57.563  102.593 1.00 0.00 ?  39  PRO A HB3  4  
ATOM 5504  H HG2  . PRO A 1 48  ? 39.753  58.803  100.304 1.00 0.00 ?  39  PRO A HG2  4  
ATOM 5505  H HG3  . PRO A 1 48  ? 39.933  57.013  100.307 1.00 0.00 ?  39  PRO A HG3  4  
ATOM 5506  H HD2  . PRO A 1 48  ? 37.708  58.748  99.659  1.00 0.00 ?  39  PRO A HD2  4  
ATOM 5507  H HD3  . PRO A 1 48  ? 38.219  57.285  98.697  1.00 0.00 ?  39  PRO A HD3  4  
ATOM 5508  N N    . ASP A 1 49  ? 36.592  56.878  104.099 1.00 0.00 ?  40  ASP A N    4  
ATOM 5509  C CA   . ASP A 1 49  ? 35.503  56.937  105.104 1.00 0.00 ?  40  ASP A CA   4  
ATOM 5510  C C    . ASP A 1 49  ? 34.927  58.357  105.493 1.00 0.00 ?  40  ASP A C    4  
ATOM 5511  O O    . ASP A 1 49  ? 33.781  58.417  105.940 1.00 0.00 ?  40  ASP A O    4  
ATOM 5512  C CB   . ASP A 1 49  ? 35.601  55.874  106.216 1.00 0.00 ?  40  ASP A CB   4  
ATOM 5513  C CG   . ASP A 1 49  ? 37.078  55.643  106.661 1.00 0.00 ?  40  ASP A CG   4  
ATOM 5514  O OD1  . ASP A 1 49  ? 37.899  56.576  106.530 1.00 0.00 -1 40  ASP A OD1  4  
ATOM 5515  O OD2  . ASP A 1 49  ? 37.528  54.495  106.993 1.00 0.00 ?  40  ASP A OD2  4  
ATOM 5516  H H    . ASP A 1 49  ? 37.432  56.361  104.321 1.00 0.00 ?  40  ASP A H    4  
ATOM 5517  H HA   . ASP A 1 49  ? 34.650  56.567  104.535 1.00 0.00 ?  40  ASP A HA   4  
ATOM 5518  H HB2  . ASP A 1 49  ? 34.988  56.174  107.066 1.00 0.00 ?  40  ASP A HB2  4  
ATOM 5519  H HB3  . ASP A 1 49  ? 35.165  54.960  105.812 1.00 0.00 ?  40  ASP A HB3  4  
ATOM 5520  N N    . ASN A 1 50  ? 35.751  59.361  105.258 1.00 0.00 ?  41  ASN A N    4  
ATOM 5521  C CA   . ASN A 1 50  ? 35.427  60.699  105.746 1.00 0.00 ?  41  ASN A CA   4  
ATOM 5522  C C    . ASN A 1 50  ? 34.629  61.715  104.847 1.00 0.00 ?  41  ASN A C    4  
ATOM 5523  O O    . ASN A 1 50  ? 34.313  62.877  105.142 1.00 0.00 ?  41  ASN A O    4  
ATOM 5524  C CB   . ASN A 1 50  ? 36.775  61.336  106.249 1.00 0.00 ?  41  ASN A CB   4  
ATOM 5525  C CG   . ASN A 1 50  ? 37.894  61.241  105.237 1.00 0.00 ?  41  ASN A CG   4  
ATOM 5526  O OD1  . ASN A 1 50  ? 37.756  61.593  104.079 1.00 0.00 ?  41  ASN A OD1  4  
ATOM 5527  N ND2  . ASN A 1 50  ? 39.006  60.728  105.536 1.00 0.00 ?  41  ASN A ND2  4  
ATOM 5528  H H    . ASN A 1 50  ? 36.694  59.035  105.100 1.00 0.00 ?  41  ASN A H    4  
ATOM 5529  H HA   . ASN A 1 50  ? 34.724  60.533  106.562 1.00 0.00 ?  41  ASN A HA   4  
ATOM 5530  H HB2  . ASN A 1 50  ? 36.688  62.411  106.410 1.00 0.00 ?  41  ASN A HB2  4  
ATOM 5531  H HB3  . ASN A 1 50  ? 36.984  60.790  107.169 1.00 0.00 ?  41  ASN A HB3  4  
ATOM 5532  H HD21 . ASN A 1 50  ? 39.285  60.470  106.471 1.00 0.00 ?  41  ASN A HD21 4  
ATOM 5533  H HD22 . ASN A 1 50  ? 39.745  60.842  104.857 1.00 0.00 ?  41  ASN A HD22 4  
ATOM 5534  N N    . GLN A 1 51  ? 34.185  61.236  103.645 1.00 0.00 ?  42  GLN A N    4  
ATOM 5535  C CA   . GLN A 1 51  ? 33.600  61.984  102.562 1.00 0.00 ?  42  GLN A CA   4  
ATOM 5536  C C    . GLN A 1 51  ? 32.505  61.140  101.837 1.00 0.00 ?  42  GLN A C    4  
ATOM 5537  O O    . GLN A 1 51  ? 32.211  59.971  102.197 1.00 0.00 ?  42  GLN A O    4  
ATOM 5538  C CB   . GLN A 1 51  ? 34.692  62.454  101.606 1.00 0.00 ?  42  GLN A CB   4  
ATOM 5539  C CG   . GLN A 1 51  ? 35.591  61.357  100.968 1.00 0.00 ?  42  GLN A CG   4  
ATOM 5540  C CD   . GLN A 1 51  ? 34.773  60.486  99.976  1.00 0.00 ?  42  GLN A CD   4  
ATOM 5541  O OE1  . GLN A 1 51  ? 34.218  61.015  99.034  1.00 0.00 ?  42  GLN A OE1  4  
ATOM 5542  N NE2  . GLN A 1 51  ? 34.635  59.139  100.156 1.00 0.00 ?  42  GLN A NE2  4  
ATOM 5543  H H    . GLN A 1 51  ? 34.512  60.294  103.484 1.00 0.00 ?  42  GLN A H    4  
ATOM 5544  H HA   . GLN A 1 51  ? 33.110  62.819  103.064 1.00 0.00 ?  42  GLN A HA   4  
ATOM 5545  H HB2  . GLN A 1 51  ? 34.205  63.142  100.916 1.00 0.00 ?  42  GLN A HB2  4  
ATOM 5546  H HB3  . GLN A 1 51  ? 35.301  63.106  102.232 1.00 0.00 ?  42  GLN A HB3  4  
ATOM 5547  H HG2  . GLN A 1 51  ? 36.407  61.795  100.395 1.00 0.00 ?  42  GLN A HG2  4  
ATOM 5548  H HG3  . GLN A 1 51  ? 36.012  60.712  101.739 1.00 0.00 ?  42  GLN A HG3  4  
ATOM 5549  H HE21 . GLN A 1 51  ? 35.095  58.710  100.945 1.00 0.00 ?  42  GLN A HE21 4  
ATOM 5550  H HE22 . GLN A 1 51  ? 33.910  58.637  99.663  1.00 0.00 ?  42  GLN A HE22 4  
ATOM 5551  N N    . THR A 1 52  ? 31.716  61.816  100.979 1.00 0.00 ?  43  THR A N    4  
ATOM 5552  C CA   . THR A 1 52  ? 30.598  61.190  100.157 1.00 0.00 ?  43  THR A CA   4  
ATOM 5553  C C    . THR A 1 52  ? 30.410  61.999  98.880  1.00 0.00 ?  43  THR A C    4  
ATOM 5554  O O    . THR A 1 52  ? 30.626  63.202  98.829  1.00 0.00 ?  43  THR A O    4  
ATOM 5555  C CB   . THR A 1 52  ? 29.190  61.206  100.868 1.00 0.00 ?  43  THR A CB   4  
ATOM 5556  O OG1  . THR A 1 52  ? 28.232  60.593  100.107 1.00 0.00 ?  43  THR A OG1  4  
ATOM 5557  C CG2  . THR A 1 52  ? 28.629  62.583  101.157 1.00 0.00 ?  43  THR A CG2  4  
ATOM 5558  H H    . THR A 1 52  ? 31.919  62.759  100.684 1.00 0.00 ?  43  THR A H    4  
ATOM 5559  H HA   . THR A 1 52  ? 30.728  60.125  99.963  1.00 0.00 ?  43  THR A HA   4  
ATOM 5560  H HB   . THR A 1 52  ? 29.307  60.697  101.825 1.00 0.00 ?  43  THR A HB   4  
ATOM 5561  H HG1  . THR A 1 52  ? 27.474  60.594  100.696 1.00 0.00 ?  43  THR A HG1  4  
ATOM 5562  H HG21 . THR A 1 52  ? 27.720  62.573  101.759 1.00 0.00 ?  43  THR A HG21 4  
ATOM 5563  H HG22 . THR A 1 52  ? 29.396  63.159  101.675 1.00 0.00 ?  43  THR A HG22 4  
ATOM 5564  H HG23 . THR A 1 52  ? 28.442  63.066  100.198 1.00 0.00 ?  43  THR A HG23 4  
ATOM 5565  N N    . GLU A 1 53  ? 29.949  61.284  97.886  1.00 0.00 ?  44  GLU A N    4  
ATOM 5566  C CA   . GLU A 1 53  ? 29.608  61.838  96.566  1.00 0.00 ?  44  GLU A CA   4  
ATOM 5567  C C    . GLU A 1 53  ? 28.805  63.133  96.570  1.00 0.00 ?  44  GLU A C    4  
ATOM 5568  O O    . GLU A 1 53  ? 27.601  63.073  96.955  1.00 0.00 ?  44  GLU A O    4  
ATOM 5569  C CB   . GLU A 1 53  ? 28.835  60.768  95.807  1.00 0.00 ?  44  GLU A CB   4  
ATOM 5570  C CG   . GLU A 1 53  ? 29.837  59.970  94.878  1.00 0.00 ?  44  GLU A CG   4  
ATOM 5571  C CD   . GLU A 1 53  ? 30.543  60.902  93.819  1.00 0.00 ?  44  GLU A CD   4  
ATOM 5572  O OE1  . GLU A 1 53  ? 29.872  61.830  93.342  1.00 0.00 ?  44  GLU A OE1  4  
ATOM 5573  O OE2  . GLU A 1 53  ? 31.711  60.658  93.515  1.00 0.00 -1 44  GLU A OE2  4  
ATOM 5574  H H    . GLU A 1 53  ? 29.781  60.315  98.117  1.00 0.00 ?  44  GLU A H    4  
ATOM 5575  H HA   . GLU A 1 53  ? 30.570  62.086  96.118  1.00 0.00 ?  44  GLU A HA   4  
ATOM 5576  H HB2  . GLU A 1 53  ? 28.354  60.053  96.476  1.00 0.00 ?  44  GLU A HB2  4  
ATOM 5577  H HB3  . GLU A 1 53  ? 28.046  61.272  95.249  1.00 0.00 ?  44  GLU A HB3  4  
ATOM 5578  H HG2  . GLU A 1 53  ? 30.479  59.317  95.469  1.00 0.00 ?  44  GLU A HG2  4  
ATOM 5579  H HG3  . GLU A 1 53  ? 29.182  59.286  94.337  1.00 0.00 ?  44  GLU A HG3  4  
ATOM 5580  N N    . GLU A 1 54  ? 29.245  64.313  96.238  1.00 0.00 ?  45  GLU A N    4  
ATOM 5581  C CA   . GLU A 1 54  ? 28.535  65.585  95.998  1.00 0.00 ?  45  GLU A CA   4  
ATOM 5582  C C    . GLU A 1 54  ? 27.724  65.498  94.699  1.00 0.00 ?  45  GLU A C    4  
ATOM 5583  O O    . GLU A 1 54  ? 28.203  65.044  93.669  1.00 0.00 ?  45  GLU A O    4  
ATOM 5584  C CB   . GLU A 1 54  ? 29.472  66.803  96.031  1.00 0.00 ?  45  GLU A CB   4  
ATOM 5585  C CG   . GLU A 1 54  ? 28.877  68.099  95.378  1.00 0.00 ?  45  GLU A CG   4  
ATOM 5586  C CD   . GLU A 1 54  ? 27.856  68.832  96.241  1.00 0.00 ?  45  GLU A CD   4  
ATOM 5587  O OE1  . GLU A 1 54  ? 27.288  68.300  97.219  1.00 0.00 ?  45  GLU A OE1  4  
ATOM 5588  O OE2  . GLU A 1 54  ? 27.570  69.930  95.894  1.00 0.00 -1 45  GLU A OE2  4  
ATOM 5589  H H    . GLU A 1 54  ? 30.199  64.347  95.912  1.00 0.00 ?  45  GLU A H    4  
ATOM 5590  H HA   . GLU A 1 54  ? 27.775  65.822  96.742  1.00 0.00 ?  45  GLU A HA   4  
ATOM 5591  H HB2  . GLU A 1 54  ? 29.842  66.933  97.047  1.00 0.00 ?  45  GLU A HB2  4  
ATOM 5592  H HB3  . GLU A 1 54  ? 30.345  66.590  95.413  1.00 0.00 ?  45  GLU A HB3  4  
ATOM 5593  H HG2  . GLU A 1 54  ? 29.632  68.874  95.251  1.00 0.00 ?  45  GLU A HG2  4  
ATOM 5594  H HG3  . GLU A 1 54  ? 28.455  67.829  94.409  1.00 0.00 ?  45  GLU A HG3  4  
ATOM 5595  N N    . ARG A 1 55  ? 26.462  65.900  94.851  1.00 0.00 ?  46  ARG A N    4  
ATOM 5596  C CA   . ARG A 1 55  ? 25.551  65.877  93.746  1.00 0.00 ?  46  ARG A CA   4  
ATOM 5597  C C    . ARG A 1 55  ? 26.072  66.679  92.556  1.00 0.00 ?  46  ARG A C    4  
ATOM 5598  O O    . ARG A 1 55  ? 26.523  67.805  92.694  1.00 0.00 ?  46  ARG A O    4  
ATOM 5599  C CB   . ARG A 1 55  ? 24.119  66.294  94.176  1.00 0.00 ?  46  ARG A CB   4  
ATOM 5600  C CG   . ARG A 1 55  ? 23.098  66.168  92.996  1.00 0.00 ?  46  ARG A CG   4  
ATOM 5601  C CD   . ARG A 1 55  ? 21.764  66.975  93.273  1.00 0.00 ?  46  ARG A CD   4  
ATOM 5602  N NE   . ARG A 1 55  ? 20.867  66.841  92.091  1.00 0.00 ?  46  ARG A NE   4  
ATOM 5603  C CZ   . ARG A 1 55  ? 20.794  67.791  91.187  1.00 0.00 ?  46  ARG A CZ   4  
ATOM 5604  N NH1  . ARG A 1 55  ? 21.658  68.803  90.918  1.00 0.00 ?  46  ARG A NH1  4  
ATOM 5605  N NH2  . ARG A 1 55  ? 19.809  67.646  90.385  1.00 0.00 1  46  ARG A NH2  4  
ATOM 5606  H H    . ARG A 1 55  ? 26.068  66.078  95.764  1.00 0.00 ?  46  ARG A H    4  
ATOM 5607  H HA   . ARG A 1 55  ? 25.529  64.826  93.459  1.00 0.00 ?  46  ARG A HA   4  
ATOM 5608  H HB2  . ARG A 1 55  ? 23.814  65.625  94.982  1.00 0.00 ?  46  ARG A HB2  4  
ATOM 5609  H HB3  . ARG A 1 55  ? 24.067  67.334  94.499  1.00 0.00 ?  46  ARG A HB3  4  
ATOM 5610  H HG2  . ARG A 1 55  ? 23.577  66.508  92.079  1.00 0.00 ?  46  ARG A HG2  4  
ATOM 5611  H HG3  . ARG A 1 55  ? 22.857  65.123  92.797  1.00 0.00 ?  46  ARG A HG3  4  
ATOM 5612  H HD2  . ARG A 1 55  ? 21.245  66.493  94.102  1.00 0.00 ?  46  ARG A HD2  4  
ATOM 5613  H HD3  . ARG A 1 55  ? 22.006  68.012  93.506  1.00 0.00 ?  46  ARG A HD3  4  
ATOM 5614  H HE   . ARG A 1 55  ? 20.163  66.117  92.106  1.00 0.00 ?  46  ARG A HE   4  
ATOM 5615  H HH11 . ARG A 1 55  ? 22.583  68.888  91.313  1.00 0.00 ?  46  ARG A HH11 4  
ATOM 5616  H HH12 . ARG A 1 55  ? 21.492  69.298  90.053  1.00 0.00 ?  46  ARG A HH12 4  
ATOM 5617  H HH21 . ARG A 1 55  ? 19.134  66.975  90.720  1.00 0.00 ?  46  ARG A HH21 4  
ATOM 5618  H HH22 . ARG A 1 55  ? 19.709  68.203  89.548  1.00 0.00 ?  46  ARG A HH22 4  
ATOM 5619  N N    . ARG A 1 56  ? 25.970  66.123  91.327  1.00 0.00 ?  47  ARG A N    4  
ATOM 5620  C CA   . ARG A 1 56  ? 26.180  66.847  90.039  1.00 0.00 ?  47  ARG A CA   4  
ATOM 5621  C C    . ARG A 1 56  ? 24.976  67.072  89.217  1.00 0.00 ?  47  ARG A C    4  
ATOM 5622  O O    . ARG A 1 56  ? 23.875  66.567  89.502  1.00 0.00 ?  47  ARG A O    4  
ATOM 5623  C CB   . ARG A 1 56  ? 27.402  66.169  89.370  1.00 0.00 ?  47  ARG A CB   4  
ATOM 5624  C CG   . ARG A 1 56  ? 28.684  66.874  89.737  1.00 0.00 ?  47  ARG A CG   4  
ATOM 5625  C CD   . ARG A 1 56  ? 29.214  66.258  91.068  1.00 0.00 ?  47  ARG A CD   4  
ATOM 5626  N NE   . ARG A 1 56  ? 30.573  66.754  91.367  1.00 0.00 ?  47  ARG A NE   4  
ATOM 5627  C CZ   . ARG A 1 56  ? 31.425  66.139  92.131  1.00 0.00 ?  47  ARG A CZ   4  
ATOM 5628  N NH1  . ARG A 1 56  ? 30.963  65.213  92.948  1.00 0.00 ?  47  ARG A NH1  4  
ATOM 5629  N NH2  . ARG A 1 56  ? 32.626  66.567  92.387  1.00 0.00 1  47  ARG A NH2  4  
ATOM 5630  H H    . ARG A 1 56  ? 25.711  65.148  91.268  1.00 0.00 ?  47  ARG A H    4  
ATOM 5631  H HA   . ARG A 1 56  ? 26.454  67.857  90.343  1.00 0.00 ?  47  ARG A HA   4  
ATOM 5632  H HB2  . ARG A 1 56  ? 27.533  65.102  89.552  1.00 0.00 ?  47  ARG A HB2  4  
ATOM 5633  H HB3  . ARG A 1 56  ? 27.424  66.382  88.302  1.00 0.00 ?  47  ARG A HB3  4  
ATOM 5634  H HG2  . ARG A 1 56  ? 29.487  66.731  89.013  1.00 0.00 ?  47  ARG A HG2  4  
ATOM 5635  H HG3  . ARG A 1 56  ? 28.581  67.949  89.886  1.00 0.00 ?  47  ARG A HG3  4  
ATOM 5636  H HD2  . ARG A 1 56  ? 28.645  66.493  91.967  1.00 0.00 ?  47  ARG A HD2  4  
ATOM 5637  H HD3  . ARG A 1 56  ? 29.306  65.179  90.953  1.00 0.00 ?  47  ARG A HD3  4  
ATOM 5638  H HE   . ARG A 1 56  ? 30.955  67.529  90.842  1.00 0.00 ?  47  ARG A HE   4  
ATOM 5639  H HH11 . ARG A 1 56  ? 29.997  64.920  92.993  1.00 0.00 ?  47  ARG A HH11 4  
ATOM 5640  H HH12 . ARG A 1 56  ? 31.516  64.844  93.708  1.00 0.00 ?  47  ARG A HH12 4  
ATOM 5641  H HH21 . ARG A 1 56  ? 33.050  67.196  91.721  1.00 0.00 ?  47  ARG A HH21 4  
ATOM 5642  H HH22 . ARG A 1 56  ? 33.151  66.100  93.113  1.00 0.00 ?  47  ARG A HH22 4  
ATOM 5643  N N    . ALA A 1 57  ? 25.066  67.837  88.140  1.00 0.00 ?  48  ALA A N    4  
ATOM 5644  C CA   . ALA A 1 57  ? 24.072  67.948  87.090  1.00 0.00 ?  48  ALA A CA   4  
ATOM 5645  C C    . ALA A 1 57  ? 24.011  66.785  86.038  1.00 0.00 ?  48  ALA A C    4  
ATOM 5646  O O    . ALA A 1 57  ? 24.825  65.865  86.126  1.00 0.00 ?  48  ALA A O    4  
ATOM 5647  C CB   . ALA A 1 57  ? 24.535  69.117  86.217  1.00 0.00 ?  48  ALA A CB   4  
ATOM 5648  H H    . ALA A 1 57  ? 25.906  68.352  87.918  1.00 0.00 ?  48  ALA A H    4  
ATOM 5649  H HA   . ALA A 1 57  ? 23.062  68.081  87.479  1.00 0.00 ?  48  ALA A HA   4  
ATOM 5650  H HB1  . ALA A 1 57  ? 23.772  69.291  85.459  1.00 0.00 ?  48  ALA A HB1  4  
ATOM 5651  H HB2  . ALA A 1 57  ? 24.622  70.046  86.782  1.00 0.00 ?  48  ALA A HB2  4  
ATOM 5652  H HB3  . ALA A 1 57  ? 25.532  69.083  85.779  1.00 0.00 ?  48  ALA A HB3  4  
ATOM 5653  N N    . SER A 1 58  ? 22.917  66.753  85.249  1.00 0.00 ?  49  SER A N    4  
ATOM 5654  C CA   . SER A 1 58  ? 22.581  65.625  84.289  1.00 0.00 ?  49  SER A CA   4  
ATOM 5655  C C    . SER A 1 58  ? 23.276  65.636  82.907  1.00 0.00 ?  49  SER A C    4  
ATOM 5656  O O    . SER A 1 58  ? 22.722  65.502  81.801  1.00 0.00 ?  49  SER A O    4  
ATOM 5657  C CB   . SER A 1 58  ? 21.072  65.492  84.048  1.00 0.00 ?  49  SER A CB   4  
ATOM 5658  O OG   . SER A 1 58  ? 20.413  65.156  85.297  1.00 0.00 ?  49  SER A OG   4  
ATOM 5659  H H    . SER A 1 58  ? 22.192  67.441  85.398  1.00 0.00 ?  49  SER A H    4  
ATOM 5660  H HA   . SER A 1 58  ? 22.820  64.732  84.867  1.00 0.00 ?  49  SER A HA   4  
ATOM 5661  H HB2  . SER A 1 58  ? 20.578  66.375  83.643  1.00 0.00 ?  49  SER A HB2  4  
ATOM 5662  H HB3  . SER A 1 58  ? 20.871  64.654  83.381  1.00 0.00 ?  49  SER A HB3  4  
ATOM 5663  H HG   . SER A 1 58  ? 20.393  65.970  85.804  1.00 0.00 ?  49  SER A HG   4  
ATOM 5664  N N    . LEU A 1 59  ? 24.615  65.911  83.079  1.00 0.00 ?  50  LEU A N    4  
ATOM 5665  C CA   . LEU A 1 59  ? 25.585  66.320  81.976  1.00 0.00 ?  50  LEU A CA   4  
ATOM 5666  C C    . LEU A 1 59  ? 27.033  65.829  82.227  1.00 0.00 ?  50  LEU A C    4  
ATOM 5667  O O    . LEU A 1 59  ? 27.360  65.625  83.399  1.00 0.00 ?  50  LEU A O    4  
ATOM 5668  C CB   . LEU A 1 59  ? 25.483  67.837  81.697  1.00 0.00 ?  50  LEU A CB   4  
ATOM 5669  C CG   . LEU A 1 59  ? 24.438  68.157  80.601  1.00 0.00 ?  50  LEU A CG   4  
ATOM 5670  C CD1  . LEU A 1 59  ? 23.762  69.430  81.036  1.00 0.00 ?  50  LEU A CD1  4  
ATOM 5671  C CD2  . LEU A 1 59  ? 25.174  68.400  79.270  1.00 0.00 ?  50  LEU A CD2  4  
ATOM 5672  H H    . LEU A 1 59  ? 24.931  65.891  84.038  1.00 0.00 ?  50  LEU A H    4  
ATOM 5673  H HA   . LEU A 1 59  ? 25.307  65.853  81.032  1.00 0.00 ?  50  LEU A HA   4  
ATOM 5674  H HB2  . LEU A 1 59  ? 25.261  68.288  82.665  1.00 0.00 ?  50  LEU A HB2  4  
ATOM 5675  H HB3  . LEU A 1 59  ? 26.493  68.108  81.391  1.00 0.00 ?  50  LEU A HB3  4  
ATOM 5676  H HG   . LEU A 1 59  ? 23.647  67.434  80.401  1.00 0.00 ?  50  LEU A HG   4  
ATOM 5677  H HD11 . LEU A 1 59  ? 23.069  69.623  80.217  1.00 0.00 ?  50  LEU A HD11 4  
ATOM 5678  H HD12 . LEU A 1 59  ? 23.184  69.268  81.945  1.00 0.00 ?  50  LEU A HD12 4  
ATOM 5679  H HD13 . LEU A 1 59  ? 24.404  70.305  81.129  1.00 0.00 ?  50  LEU A HD13 4  
ATOM 5680  H HD21 . LEU A 1 59  ? 25.778  67.553  78.945  1.00 0.00 ?  50  LEU A HD21 4  
ATOM 5681  H HD22 . LEU A 1 59  ? 24.425  68.565  78.496  1.00 0.00 ?  50  LEU A HD22 4  
ATOM 5682  H HD23 . LEU A 1 59  ? 25.941  69.175  79.287  1.00 0.00 ?  50  LEU A HD23 4  
ATOM 5683  N N    . PRO A 1 60  ? 27.905  65.590  81.164  1.00 0.00 ?  51  PRO A N    4  
ATOM 5684  C CA   . PRO A 1 60  ? 29.284  65.246  81.320  1.00 0.00 ?  51  PRO A CA   4  
ATOM 5685  C C    . PRO A 1 60  ? 30.085  66.273  82.110  1.00 0.00 ?  51  PRO A C    4  
ATOM 5686  O O    . PRO A 1 60  ? 29.794  67.437  81.998  1.00 0.00 ?  51  PRO A O    4  
ATOM 5687  C CB   . PRO A 1 60  ? 29.860  65.314  79.835  1.00 0.00 ?  51  PRO A CB   4  
ATOM 5688  C CG   . PRO A 1 60  ? 28.669  65.113  78.918  1.00 0.00 ?  51  PRO A CG   4  
ATOM 5689  C CD   . PRO A 1 60  ? 27.530  65.742  79.701  1.00 0.00 ?  51  PRO A CD   4  
ATOM 5690  H HA   . PRO A 1 60  ? 29.510  64.309  81.830  1.00 0.00 ?  51  PRO A HA   4  
ATOM 5691  H HB2  . PRO A 1 60  ? 30.373  66.268  79.706  1.00 0.00 ?  51  PRO A HB2  4  
ATOM 5692  H HB3  . PRO A 1 60  ? 30.518  64.503  79.526  1.00 0.00 ?  51  PRO A HB3  4  
ATOM 5693  H HG2  . PRO A 1 60  ? 28.796  65.748  78.043  1.00 0.00 ?  51  PRO A HG2  4  
ATOM 5694  H HG3  . PRO A 1 60  ? 28.460  64.062  78.719  1.00 0.00 ?  51  PRO A HG3  4  
ATOM 5695  H HD2  . PRO A 1 60  ? 27.453  66.813  79.511  1.00 0.00 ?  51  PRO A HD2  4  
ATOM 5696  H HD3  . PRO A 1 60  ? 26.577  65.240  79.533  1.00 0.00 ?  51  PRO A HD3  4  
ATOM 5697  N N    . GLY A 1 61  ? 31.084  65.843  82.810  1.00 0.00 ?  52  GLY A N    4  
ATOM 5698  C CA   . GLY A 1 61  ? 31.914  66.623  83.717  1.00 0.00 ?  52  GLY A CA   4  
ATOM 5699  C C    . GLY A 1 61  ? 31.444  66.524  85.233  1.00 0.00 ?  52  GLY A C    4  
ATOM 5700  O O    . GLY A 1 61  ? 30.244  66.799  85.477  1.00 0.00 ?  52  GLY A O    4  
ATOM 5701  H H    . GLY A 1 61  ? 31.236  64.851  82.690  1.00 0.00 ?  52  GLY A H    4  
ATOM 5702  H HA2  . GLY A 1 61  ? 32.926  66.259  83.534  1.00 0.00 ?  52  GLY A HA2  4  
ATOM 5703  H HA3  . GLY A 1 61  ? 31.943  67.685  83.474  1.00 0.00 ?  52  GLY A HA3  4  
ATOM 5704  N N    . ARG A 1 62  ? 32.356  66.292  86.189  1.00 0.00 ?  53  ARG A N    4  
ATOM 5705  C CA   . ARG A 1 62  ? 32.172  66.380  87.685  1.00 0.00 ?  53  ARG A CA   4  
ATOM 5706  C C    . ARG A 1 62  ? 33.499  66.671  88.420  1.00 0.00 ?  53  ARG A C    4  
ATOM 5707  O O    . ARG A 1 62  ? 33.503  66.662  89.640  1.00 0.00 ?  53  ARG A O    4  
ATOM 5708  C CB   . ARG A 1 62  ? 31.477  65.166  88.225  1.00 0.00 ?  53  ARG A CB   4  
ATOM 5709  C CG   . ARG A 1 62  ? 32.374  63.908  88.082  1.00 0.00 ?  53  ARG A CG   4  
ATOM 5710  C CD   . ARG A 1 62  ? 31.578  62.618  87.949  1.00 0.00 ?  53  ARG A CD   4  
ATOM 5711  N NE   . ARG A 1 62  ? 30.397  62.433  88.802  1.00 0.00 ?  53  ARG A NE   4  
ATOM 5712  C CZ   . ARG A 1 62  ? 30.401  62.303  90.120  1.00 0.00 ?  53  ARG A CZ   4  
ATOM 5713  N NH1  . ARG A 1 62  ? 31.415  61.870  90.825  1.00 0.00 ?  53  ARG A NH1  4  
ATOM 5714  N NH2  . ARG A 1 62  ? 29.322  62.672  90.740  1.00 0.00 1  53  ARG A NH2  4  
ATOM 5715  H H    . ARG A 1 62  ? 33.196  65.906  85.782  1.00 0.00 ?  53  ARG A H    4  
ATOM 5716  H HA   . ARG A 1 62  ? 31.511  67.246  87.734  1.00 0.00 ?  53  ARG A HA   4  
ATOM 5717  H HB2  . ARG A 1 62  ? 31.343  65.337  89.293  1.00 0.00 ?  53  ARG A HB2  4  
ATOM 5718  H HB3  . ARG A 1 62  ? 30.590  65.063  87.602  1.00 0.00 ?  53  ARG A HB3  4  
ATOM 5719  H HG2  . ARG A 1 62  ? 33.078  63.990  87.254  1.00 0.00 ?  53  ARG A HG2  4  
ATOM 5720  H HG3  . ARG A 1 62  ? 33.037  63.879  88.948  1.00 0.00 ?  53  ARG A HG3  4  
ATOM 5721  H HD2  . ARG A 1 62  ? 31.167  62.731  86.946  1.00 0.00 ?  53  ARG A HD2  4  
ATOM 5722  H HD3  . ARG A 1 62  ? 32.303  61.805  87.941  1.00 0.00 ?  53  ARG A HD3  4  
ATOM 5723  H HE   . ARG A 1 62  ? 29.473  62.578  88.419  1.00 0.00 ?  53  ARG A HE   4  
ATOM 5724  H HH11 . ARG A 1 62  ? 32.156  61.436  90.292  1.00 0.00 ?  53  ARG A HH11 4  
ATOM 5725  H HH12 . ARG A 1 62  ? 31.317  61.604  91.794  1.00 0.00 ?  53  ARG A HH12 4  
ATOM 5726  H HH21 . ARG A 1 62  ? 28.584  62.732  90.053  1.00 0.00 ?  53  ARG A HH21 4  
ATOM 5727  H HH22 . ARG A 1 62  ? 29.196  62.537  91.732  1.00 0.00 ?  53  ARG A HH22 4  
ATOM 5728  N N    . ASP A 1 63  ? 34.625  66.701  87.720  1.00 0.00 ?  54  ASP A N    4  
ATOM 5729  C CA   . ASP A 1 63  ? 35.958  66.967  88.339  1.00 0.00 ?  54  ASP A CA   4  
ATOM 5730  C C    . ASP A 1 63  ? 36.762  67.798  87.319  1.00 0.00 ?  54  ASP A C    4  
ATOM 5731  O O    . ASP A 1 63  ? 36.346  67.756  86.169  1.00 0.00 ?  54  ASP A O    4  
ATOM 5732  C CB   . ASP A 1 63  ? 36.642  65.634  88.694  1.00 0.00 ?  54  ASP A CB   4  
ATOM 5733  C CG   . ASP A 1 63  ? 37.061  64.696  87.527  1.00 0.00 ?  54  ASP A CG   4  
ATOM 5734  O OD1  . ASP A 1 63  ? 36.530  64.728  86.381  1.00 0.00 ?  54  ASP A OD1  4  
ATOM 5735  O OD2  . ASP A 1 63  ? 38.046  63.927  87.751  1.00 0.00 -1 54  ASP A OD2  4  
ATOM 5736  H H    . ASP A 1 63  ? 34.604  66.569  86.720  1.00 0.00 ?  54  ASP A H    4  
ATOM 5737  H HA   . ASP A 1 63  ? 35.875  67.635  89.196  1.00 0.00 ?  54  ASP A HA   4  
ATOM 5738  H HB2  . ASP A 1 63  ? 37.612  65.850  89.143  1.00 0.00 ?  54  ASP A HB2  4  
ATOM 5739  H HB3  . ASP A 1 63  ? 35.977  65.106  89.376  1.00 0.00 ?  54  ASP A HB3  4  
ATOM 5740  N N    . ASP A 1 64  ? 37.923  68.371  87.673  1.00 0.00 ?  55  ASP A N    4  
ATOM 5741  C CA   . ASP A 1 64  ? 38.693  69.259  86.819  1.00 0.00 ?  55  ASP A CA   4  
ATOM 5742  C C    . ASP A 1 64  ? 39.336  68.517  85.652  1.00 0.00 ?  55  ASP A C    4  
ATOM 5743  O O    . ASP A 1 64  ? 39.826  69.241  84.789  1.00 0.00 ?  55  ASP A O    4  
ATOM 5744  C CB   . ASP A 1 64  ? 39.798  70.078  87.636  1.00 0.00 ?  55  ASP A CB   4  
ATOM 5745  C CG   . ASP A 1 64  ? 39.262  71.322  88.428  1.00 0.00 ?  55  ASP A CG   4  
ATOM 5746  O OD1  . ASP A 1 64  ? 38.143  71.262  89.032  1.00 0.00 -1 55  ASP A OD1  4  
ATOM 5747  O OD2  . ASP A 1 64  ? 40.059  72.317  88.390  1.00 0.00 ?  55  ASP A OD2  4  
ATOM 5748  H H    . ASP A 1 64  ? 38.170  68.183  88.633  1.00 0.00 ?  55  ASP A H    4  
ATOM 5749  H HA   . ASP A 1 64  ? 38.053  70.044  86.417  1.00 0.00 ?  55  ASP A HA   4  
ATOM 5750  H HB2  . ASP A 1 64  ? 40.241  69.416  88.381  1.00 0.00 ?  55  ASP A HB2  4  
ATOM 5751  H HB3  . ASP A 1 64  ? 40.530  70.510  86.956  1.00 0.00 ?  55  ASP A HB3  4  
ATOM 5752  N N    . ASN A 1 65  ? 39.369  67.198  85.672  1.00 0.00 ?  56  ASN A N    4  
ATOM 5753  C CA   . ASN A 1 65  ? 39.990  66.457  84.540  1.00 0.00 ?  56  ASN A CA   4  
ATOM 5754  C C    . ASN A 1 65  ? 39.065  66.110  83.359  1.00 0.00 ?  56  ASN A C    4  
ATOM 5755  O O    . ASN A 1 65  ? 39.373  66.373  82.225  1.00 0.00 ?  56  ASN A O    4  
ATOM 5756  C CB   . ASN A 1 65  ? 40.628  65.199  85.114  1.00 0.00 ?  56  ASN A CB   4  
ATOM 5757  C CG   . ASN A 1 65  ? 41.148  64.329  84.080  1.00 0.00 ?  56  ASN A CG   4  
ATOM 5758  O OD1  . ASN A 1 65  ? 40.571  63.318  83.637  1.00 0.00 ?  56  ASN A OD1  4  
ATOM 5759  N ND2  . ASN A 1 65  ? 42.410  64.504  83.698  1.00 0.00 ?  56  ASN A ND2  4  
ATOM 5760  H H    . ASN A 1 65  ? 39.060  66.688  86.487  1.00 0.00 ?  56  ASN A H    4  
ATOM 5761  H HA   . ASN A 1 65  ? 40.751  67.106  84.109  1.00 0.00 ?  56  ASN A HA   4  
ATOM 5762  H HB2  . ASN A 1 65  ? 41.493  65.605  85.639  1.00 0.00 ?  56  ASN A HB2  4  
ATOM 5763  H HB3  . ASN A 1 65  ? 39.886  64.688  85.726  1.00 0.00 ?  56  ASN A HB3  4  
ATOM 5764  H HD21 . ASN A 1 65  ? 43.072  65.164  84.079  1.00 0.00 ?  56  ASN A HD21 4  
ATOM 5765  H HD22 . ASN A 1 65  ? 42.802  63.771  83.124  1.00 0.00 ?  56  ASN A HD22 4  
ATOM 5766  N N    . SER A 1 66  ? 37.916  65.587  83.679  1.00 0.00 ?  57  SER A N    4  
ATOM 5767  C CA   . SER A 1 66  ? 36.747  65.454  82.766  1.00 0.00 ?  57  SER A CA   4  
ATOM 5768  C C    . SER A 1 66  ? 36.436  66.807  82.135  1.00 0.00 ?  57  SER A C    4  
ATOM 5769  O O    . SER A 1 66  ? 36.340  66.967  80.937  1.00 0.00 ?  57  SER A O    4  
ATOM 5770  C CB   . SER A 1 66  ? 35.505  64.825  83.476  1.00 0.00 ?  57  SER A CB   4  
ATOM 5771  O OG   . SER A 1 66  ? 35.064  65.530  84.588  1.00 0.00 ?  57  SER A OG   4  
ATOM 5772  H H    . SER A 1 66  ? 37.789  65.232  84.617  1.00 0.00 ?  57  SER A H    4  
ATOM 5773  H HA   . SER A 1 66  ? 36.923  64.760  81.945  1.00 0.00 ?  57  SER A HA   4  
ATOM 5774  H HB2  . SER A 1 66  ? 34.725  64.833  82.715  1.00 0.00 ?  57  SER A HB2  4  
ATOM 5775  H HB3  . SER A 1 66  ? 35.566  63.762  83.708  1.00 0.00 ?  57  SER A HB3  4  
ATOM 5776  H HG   . SER A 1 66  ? 35.649  65.261  85.301  1.00 0.00 ?  57  SER A HG   4  
ATOM 5777  N N    . TYR A 1 67  ? 36.493  67.942  82.937  1.00 0.00 ?  58  TYR A N    4  
ATOM 5778  C CA   . TYR A 1 67  ? 36.292  69.329  82.376  1.00 0.00 ?  58  TYR A CA   4  
ATOM 5779  C C    . TYR A 1 67  ? 37.416  69.889  81.498  1.00 0.00 ?  58  TYR A C    4  
ATOM 5780  O O    . TYR A 1 67  ? 37.057  70.667  80.602  1.00 0.00 ?  58  TYR A O    4  
ATOM 5781  C CB   . TYR A 1 67  ? 35.980  70.271  83.543  1.00 0.00 ?  58  TYR A CB   4  
ATOM 5782  C CG   . TYR A 1 67  ? 34.572  70.095  84.058  1.00 0.00 ?  58  TYR A CG   4  
ATOM 5783  C CD1  . TYR A 1 67  ? 33.542  70.410  83.117  1.00 0.00 ?  58  TYR A CD1  4  
ATOM 5784  C CD2  . TYR A 1 67  ? 34.320  69.848  85.382  1.00 0.00 ?  58  TYR A CD2  4  
ATOM 5785  C CE1  . TYR A 1 67  ? 32.166  70.492  83.539  1.00 0.00 ?  58  TYR A CE1  4  
ATOM 5786  C CE2  . TYR A 1 67  ? 33.045  70.024  85.825  1.00 0.00 ?  58  TYR A CE2  4  
ATOM 5787  C CZ   . TYR A 1 67  ? 31.947  70.293  84.935  1.00 0.00 ?  58  TYR A CZ   4  
ATOM 5788  O OH   . TYR A 1 67  ? 30.677  70.227  85.344  1.00 0.00 ?  58  TYR A OH   4  
ATOM 5789  H H    . TYR A 1 67  ? 36.529  67.831  83.940  1.00 0.00 ?  58  TYR A H    4  
ATOM 5790  H HA   . TYR A 1 67  ? 35.428  69.313  81.711  1.00 0.00 ?  58  TYR A HA   4  
ATOM 5791  H HB2  . TYR A 1 67  ? 36.668  69.991  84.341  1.00 0.00 ?  58  TYR A HB2  4  
ATOM 5792  H HB3  . TYR A 1 67  ? 36.060  71.338  83.332  1.00 0.00 ?  58  TYR A HB3  4  
ATOM 5793  H HD1  . TYR A 1 67  ? 33.725  70.779  82.120  1.00 0.00 ?  58  TYR A HD1  4  
ATOM 5794  H HD2  . TYR A 1 67  ? 35.087  69.575  86.091  1.00 0.00 ?  58  TYR A HD2  4  
ATOM 5795  H HE1  . TYR A 1 67  ? 31.420  70.723  82.793  1.00 0.00 ?  58  TYR A HE1  4  
ATOM 5796  H HE2  . TYR A 1 67  ? 32.848  69.744  86.850  1.00 0.00 ?  58  TYR A HE2  4  
ATOM 5797  H HH   . TYR A 1 67  ? 30.026  70.506  84.696  1.00 0.00 ?  58  TYR A HH   4  
ATOM 5798  N N    . MET A 1 68  ? 38.691  69.482  81.722  1.00 0.00 ?  59  MET A N    4  
ATOM 5799  C CA   . MET A 1 68  ? 39.772  69.753  80.807  1.00 0.00 ?  59  MET A CA   4  
ATOM 5800  C C    . MET A 1 68  ? 39.528  68.966  79.528  1.00 0.00 ?  59  MET A C    4  
ATOM 5801  O O    . MET A 1 68  ? 39.675  69.494  78.435  1.00 0.00 ?  59  MET A O    4  
ATOM 5802  C CB   . MET A 1 68  ? 41.166  69.565  81.562  1.00 0.00 ?  59  MET A CB   4  
ATOM 5803  C CG   . MET A 1 68  ? 42.428  69.914  80.786  1.00 0.00 ?  59  MET A CG   4  
ATOM 5804  S SD   . MET A 1 68  ? 42.299  71.473  79.904  1.00 0.00 ?  59  MET A SD   4  
ATOM 5805  C CE   . MET A 1 68  ? 43.753  71.417  78.850  1.00 0.00 ?  59  MET A CE   4  
ATOM 5806  H H    . MET A 1 68  ? 38.838  68.693  82.333  1.00 0.00 ?  59  MET A H    4  
ATOM 5807  H HA   . MET A 1 68  ? 39.638  70.808  80.571  1.00 0.00 ?  59  MET A HA   4  
ATOM 5808  H HB2  . MET A 1 68  ? 41.108  70.180  82.461  1.00 0.00 ?  59  MET A HB2  4  
ATOM 5809  H HB3  . MET A 1 68  ? 41.295  68.541  81.912  1.00 0.00 ?  59  MET A HB3  4  
ATOM 5810  H HG2  . MET A 1 68  ? 43.265  70.032  81.474  1.00 0.00 ?  59  MET A HG2  4  
ATOM 5811  H HG3  . MET A 1 68  ? 42.552  69.117  80.053  1.00 0.00 ?  59  MET A HG3  4  
ATOM 5812  H HE1  . MET A 1 68  ? 43.830  70.427  78.399  1.00 0.00 ?  59  MET A HE1  4  
ATOM 5813  H HE2  . MET A 1 68  ? 43.457  72.040  78.007  1.00 0.00 ?  59  MET A HE2  4  
ATOM 5814  H HE3  . MET A 1 68  ? 44.568  71.895  79.392  1.00 0.00 ?  59  MET A HE3  4  
ATOM 5815  N N    . TYR A 1 69  ? 39.190  67.687  79.666  1.00 0.00 ?  60  TYR A N    4  
ATOM 5816  C CA   . TYR A 1 69  ? 38.759  66.819  78.548  1.00 0.00 ?  60  TYR A CA   4  
ATOM 5817  C C    . TYR A 1 69  ? 37.622  67.482  77.834  1.00 0.00 ?  60  TYR A C    4  
ATOM 5818  O O    . TYR A 1 69  ? 37.560  67.392  76.617  1.00 0.00 ?  60  TYR A O    4  
ATOM 5819  C CB   . TYR A 1 69  ? 38.558  65.366  79.037  1.00 0.00 ?  60  TYR A CB   4  
ATOM 5820  C CG   . TYR A 1 69  ? 39.721  64.469  79.023  1.00 0.00 ?  60  TYR A CG   4  
ATOM 5821  C CD1  . TYR A 1 69  ? 40.346  64.211  77.811  1.00 0.00 ?  60  TYR A CD1  4  
ATOM 5822  C CD2  . TYR A 1 69  ? 40.233  63.835  80.201  1.00 0.00 ?  60  TYR A CD2  4  
ATOM 5823  C CE1  . TYR A 1 69  ? 41.483  63.351  77.747  1.00 0.00 ?  60  TYR A CE1  4  
ATOM 5824  C CE2  . TYR A 1 69  ? 41.327  62.954  80.179  1.00 0.00 ?  60  TYR A CE2  4  
ATOM 5825  C CZ   . TYR A 1 69  ? 41.982  62.705  78.936  1.00 0.00 ?  60  TYR A CZ   4  
ATOM 5826  O OH   . TYR A 1 69  ? 43.189  62.057  78.882  1.00 0.00 ?  60  TYR A OH   4  
ATOM 5827  H H    . TYR A 1 69  ? 39.009  67.310  80.586  1.00 0.00 ?  60  TYR A H    4  
ATOM 5828  H HA   . TYR A 1 69  ? 39.516  66.842  77.764  1.00 0.00 ?  60  TYR A HA   4  
ATOM 5829  H HB2  . TYR A 1 69  ? 38.162  65.448  80.050  1.00 0.00 ?  60  TYR A HB2  4  
ATOM 5830  H HB3  . TYR A 1 69  ? 37.741  65.000  78.415  1.00 0.00 ?  60  TYR A HB3  4  
ATOM 5831  H HD1  . TYR A 1 69  ? 39.958  64.602  76.883  1.00 0.00 ?  60  TYR A HD1  4  
ATOM 5832  H HD2  . TYR A 1 69  ? 39.778  63.914  81.177  1.00 0.00 ?  60  TYR A HD2  4  
ATOM 5833  H HE1  . TYR A 1 69  ? 41.926  63.125  76.789  1.00 0.00 ?  60  TYR A HE1  4  
ATOM 5834  H HE2  . TYR A 1 69  ? 41.754  62.550  81.084  1.00 0.00 ?  60  TYR A HE2  4  
ATOM 5835  H HH   . TYR A 1 69  ? 43.358  61.673  79.746  1.00 0.00 ?  60  TYR A HH   4  
ATOM 5836  N N    . ILE A 1 70  ? 36.721  68.249  78.547  1.00 0.00 ?  61  ILE A N    4  
ATOM 5837  C CA   . ILE A 1 70  ? 35.701  68.998  77.798  1.00 0.00 ?  61  ILE A CA   4  
ATOM 5838  C C    . ILE A 1 70  ? 36.201  70.171  77.000  1.00 0.00 ?  61  ILE A C    4  
ATOM 5839  O O    . ILE A 1 70  ? 35.697  70.500  75.940  1.00 0.00 ?  61  ILE A O    4  
ATOM 5840  C CB   . ILE A 1 70  ? 34.619  69.423  78.765  1.00 0.00 ?  61  ILE A CB   4  
ATOM 5841  C CG1  . ILE A 1 70  ? 33.550  68.268  78.879  1.00 0.00 ?  61  ILE A CG1  4  
ATOM 5842  C CG2  . ILE A 1 70  ? 34.020  70.813  78.542  1.00 0.00 ?  61  ILE A CG2  4  
ATOM 5843  C CD1  . ILE A 1 70  ? 32.805  68.275  80.183  1.00 0.00 ?  61  ILE A CD1  4  
ATOM 5844  H H    . ILE A 1 70  ? 36.801  68.218  79.553  1.00 0.00 ?  61  ILE A H    4  
ATOM 5845  H HA   . ILE A 1 70  ? 35.310  68.305  77.053  1.00 0.00 ?  61  ILE A HA   4  
ATOM 5846  H HB   . ILE A 1 70  ? 35.084  69.453  79.750  1.00 0.00 ?  61  ILE A HB   4  
ATOM 5847  H HG12 . ILE A 1 70  ? 32.880  68.389  78.028  1.00 0.00 ?  61  ILE A HG12 4  
ATOM 5848  H HG13 . ILE A 1 70  ? 34.059  67.306  78.947  1.00 0.00 ?  61  ILE A HG13 4  
ATOM 5849  H HG21 . ILE A 1 70  ? 33.310  71.062  79.332  1.00 0.00 ?  61  ILE A HG21 4  
ATOM 5850  H HG22 . ILE A 1 70  ? 34.729  71.641  78.531  1.00 0.00 ?  61  ILE A HG22 4  
ATOM 5851  H HG23 . ILE A 1 70  ? 33.467  70.908  77.607  1.00 0.00 ?  61  ILE A HG23 4  
ATOM 5852  H HD11 . ILE A 1 70  ? 32.052  69.061  80.245  1.00 0.00 ?  61  ILE A HD11 4  
ATOM 5853  H HD12 . ILE A 1 70  ? 32.267  67.337  80.319  1.00 0.00 ?  61  ILE A HD12 4  
ATOM 5854  H HD13 . ILE A 1 70  ? 33.469  68.458  81.028  1.00 0.00 ?  61  ILE A HD13 4  
ATOM 5855  N N    . LEU A 1 71  ? 37.157  70.906  77.523  1.00 0.00 ?  62  LEU A N    4  
ATOM 5856  C CA   . LEU A 1 71  ? 37.904  71.887  76.796  1.00 0.00 ?  62  LEU A CA   4  
ATOM 5857  C C    . LEU A 1 71  ? 38.422  71.230  75.527  1.00 0.00 ?  62  LEU A C    4  
ATOM 5858  O O    . LEU A 1 71  ? 38.311  71.817  74.442  1.00 0.00 ?  62  LEU A O    4  
ATOM 5859  C CB   . LEU A 1 71  ? 39.074  72.593  77.565  1.00 0.00 ?  62  LEU A CB   4  
ATOM 5860  C CG   . LEU A 1 71  ? 39.625  73.774  76.756  1.00 0.00 ?  62  LEU A CG   4  
ATOM 5861  C CD1  . LEU A 1 71  ? 38.488  74.791  76.564  1.00 0.00 ?  62  LEU A CD1  4  
ATOM 5862  C CD2  . LEU A 1 71  ? 40.778  74.450  77.468  1.00 0.00 ?  62  LEU A CD2  4  
ATOM 5863  H H    . LEU A 1 71  ? 37.511  70.597  78.416  1.00 0.00 ?  62  LEU A H    4  
ATOM 5864  H HA   . LEU A 1 71  ? 37.142  72.622  76.538  1.00 0.00 ?  62  LEU A HA   4  
ATOM 5865  H HB2  . LEU A 1 71  ? 38.778  72.922  78.560  1.00 0.00 ?  62  LEU A HB2  4  
ATOM 5866  H HB3  . LEU A 1 71  ? 39.879  71.874  77.716  1.00 0.00 ?  62  LEU A HB3  4  
ATOM 5867  H HG   . LEU A 1 71  ? 39.996  73.368  75.814  1.00 0.00 ?  62  LEU A HG   4  
ATOM 5868  H HD11 . LEU A 1 71  ? 38.792  75.709  76.062  1.00 0.00 ?  62  LEU A HD11 4  
ATOM 5869  H HD12 . LEU A 1 71  ? 37.808  74.280  75.883  1.00 0.00 ?  62  LEU A HD12 4  
ATOM 5870  H HD13 . LEU A 1 71  ? 38.028  75.002  77.531  1.00 0.00 ?  62  LEU A HD13 4  
ATOM 5871  H HD21 . LEU A 1 71  ? 40.308  75.154  78.154  1.00 0.00 ?  62  LEU A HD21 4  
ATOM 5872  H HD22 . LEU A 1 71  ? 41.487  73.715  77.849  1.00 0.00 ?  62  LEU A HD22 4  
ATOM 5873  H HD23 . LEU A 1 71  ? 41.309  74.989  76.684  1.00 0.00 ?  62  LEU A HD23 4  
ATOM 5874  N N    . PHE A 1 72  ? 38.939  70.040  75.541  1.00 0.00 ?  63  PHE A N    4  
ATOM 5875  C CA   . PHE A 1 72  ? 39.256  69.258  74.304  1.00 0.00 ?  63  PHE A CA   4  
ATOM 5876  C C    . PHE A 1 72  ? 38.098  68.782  73.514  1.00 0.00 ?  63  PHE A C    4  
ATOM 5877  O O    . PHE A 1 72  ? 38.282  68.625  72.310  1.00 0.00 ?  63  PHE A O    4  
ATOM 5878  C CB   . PHE A 1 72  ? 40.346  68.176  74.702  1.00 0.00 ?  63  PHE A CB   4  
ATOM 5879  C CG   . PHE A 1 72  ? 40.484  66.962  73.840  1.00 0.00 ?  63  PHE A CG   4  
ATOM 5880  C CD1  . PHE A 1 72  ? 39.497  65.947  73.925  1.00 0.00 ?  63  PHE A CD1  4  
ATOM 5881  C CD2  . PHE A 1 72  ? 41.573  66.860  72.883  1.00 0.00 ?  63  PHE A CD2  4  
ATOM 5882  C CE1  . PHE A 1 72  ? 39.486  64.856  73.014  1.00 0.00 ?  63  PHE A CE1  4  
ATOM 5883  C CE2  . PHE A 1 72  ? 41.562  65.801  71.959  1.00 0.00 ?  63  PHE A CE2  4  
ATOM 5884  C CZ   . PHE A 1 72  ? 40.523  64.804  72.089  1.00 0.00 ?  63  PHE A CZ   4  
ATOM 5885  H H    . PHE A 1 72  ? 39.004  69.567  76.431  1.00 0.00 ?  63  PHE A H    4  
ATOM 5886  H HA   . PHE A 1 72  ? 39.816  69.960  73.686  1.00 0.00 ?  63  PHE A HA   4  
ATOM 5887  H HB2  . PHE A 1 72  ? 41.305  68.677  74.835  1.00 0.00 ?  63  PHE A HB2  4  
ATOM 5888  H HB3  . PHE A 1 72  ? 39.960  67.728  75.618  1.00 0.00 ?  63  PHE A HB3  4  
ATOM 5889  H HD1  . PHE A 1 72  ? 38.739  66.033  74.690  1.00 0.00 ?  63  PHE A HD1  4  
ATOM 5890  H HD2  . PHE A 1 72  ? 42.323  67.631  72.789  1.00 0.00 ?  63  PHE A HD2  4  
ATOM 5891  H HE1  . PHE A 1 72  ? 38.696  64.141  72.835  1.00 0.00 ?  63  PHE A HE1  4  
ATOM 5892  H HE2  . PHE A 1 72  ? 42.353  65.702  71.229  1.00 0.00 ?  63  PHE A HE2  4  
ATOM 5893  H HZ   . PHE A 1 72  ? 40.445  63.987  71.387  1.00 0.00 ?  63  PHE A HZ   4  
ATOM 5894  N N    . VAL A 1 73  ? 36.987  68.666  74.162  1.00 0.00 ?  64  VAL A N    4  
ATOM 5895  C CA   . VAL A 1 73  ? 35.692  68.270  73.415  1.00 0.00 ?  64  VAL A CA   4  
ATOM 5896  C C    . VAL A 1 73  ? 35.023  69.393  72.637  1.00 0.00 ?  64  VAL A C    4  
ATOM 5897  O O    . VAL A 1 73  ? 34.500  69.178  71.535  1.00 0.00 ?  64  VAL A O    4  
ATOM 5898  C CB   . VAL A 1 73  ? 34.694  67.480  74.327  1.00 0.00 ?  64  VAL A CB   4  
ATOM 5899  C CG1  . VAL A 1 73  ? 33.569  68.293  74.888  1.00 0.00 ?  64  VAL A CG1  4  
ATOM 5900  C CG2  . VAL A 1 73  ? 33.926  66.315  73.537  1.00 0.00 ?  64  VAL A CG2  4  
ATOM 5901  H H    . VAL A 1 73  ? 36.927  69.036  75.100  1.00 0.00 ?  64  VAL A H    4  
ATOM 5902  H HA   . VAL A 1 73  ? 36.016  67.621  72.601  1.00 0.00 ?  64  VAL A HA   4  
ATOM 5903  H HB   . VAL A 1 73  ? 35.217  67.024  75.167  1.00 0.00 ?  64  VAL A HB   4  
ATOM 5904  H HG11 . VAL A 1 73  ? 33.796  69.129  75.550  1.00 0.00 ?  64  VAL A HG11 4  
ATOM 5905  H HG12 . VAL A 1 73  ? 33.007  68.549  73.990  1.00 0.00 ?  64  VAL A HG12 4  
ATOM 5906  H HG13 . VAL A 1 73  ? 32.875  67.661  75.445  1.00 0.00 ?  64  VAL A HG13 4  
ATOM 5907  H HG21 . VAL A 1 73  ? 34.718  65.652  73.190  1.00 0.00 ?  64  VAL A HG21 4  
ATOM 5908  H HG22 . VAL A 1 73  ? 33.315  65.720  74.217  1.00 0.00 ?  64  VAL A HG22 4  
ATOM 5909  H HG23 . VAL A 1 73  ? 33.371  66.562  72.632  1.00 0.00 ?  64  VAL A HG23 4  
ATOM 5910  N N    . MET A 1 74  ? 35.242  70.649  73.061  1.00 0.00 ?  65  MET A N    4  
ATOM 5911  C CA   . MET A 1 74  ? 34.986  71.873  72.239  1.00 0.00 ?  65  MET A CA   4  
ATOM 5912  C C    . MET A 1 74  ? 35.914  71.938  71.041  1.00 0.00 ?  65  MET A C    4  
ATOM 5913  O O    . MET A 1 74  ? 35.488  72.272  69.926  1.00 0.00 ?  65  MET A O    4  
ATOM 5914  C CB   . MET A 1 74  ? 35.127  73.107  73.114  1.00 0.00 ?  65  MET A CB   4  
ATOM 5915  C CG   . MET A 1 74  ? 34.759  74.394  72.393  1.00 0.00 ?  65  MET A CG   4  
ATOM 5916  S SD   . MET A 1 74  ? 34.488  75.965  73.401  1.00 0.00 ?  65  MET A SD   4  
ATOM 5917  C CE   . MET A 1 74  ? 36.131  76.255  74.142  1.00 0.00 ?  65  MET A CE   4  
ATOM 5918  H H    . MET A 1 74  ? 35.724  70.800  73.935  1.00 0.00 ?  65  MET A H    4  
ATOM 5919  H HA   . MET A 1 74  ? 33.980  71.792  71.827  1.00 0.00 ?  65  MET A HA   4  
ATOM 5920  H HB2  . MET A 1 74  ? 34.367  72.896  73.866  1.00 0.00 ?  65  MET A HB2  4  
ATOM 5921  H HB3  . MET A 1 74  ? 36.132  73.266  73.505  1.00 0.00 ?  65  MET A HB3  4  
ATOM 5922  H HG2  . MET A 1 74  ? 35.488  74.563  71.601  1.00 0.00 ?  65  MET A HG2  4  
ATOM 5923  H HG3  . MET A 1 74  ? 33.755  74.197  72.019  1.00 0.00 ?  65  MET A HG3  4  
ATOM 5924  H HE1  . MET A 1 74  ? 36.435  75.552  74.917  1.00 0.00 ?  65  MET A HE1  4  
ATOM 5925  H HE2  . MET A 1 74  ? 37.001  76.394  73.501  1.00 0.00 ?  65  MET A HE2  4  
ATOM 5926  H HE3  . MET A 1 74  ? 36.135  77.249  74.592  1.00 0.00 ?  65  MET A HE3  4  
ATOM 5927  N N    . PHE A 1 75  ? 37.191  71.710  71.258  1.00 0.00 ?  66  PHE A N    4  
ATOM 5928  C CA   . PHE A 1 75  ? 38.193  71.406  70.138  1.00 0.00 ?  66  PHE A CA   4  
ATOM 5929  C C    . PHE A 1 75  ? 37.815  70.262  69.120  1.00 0.00 ?  66  PHE A C    4  
ATOM 5930  O O    . PHE A 1 75  ? 37.598  70.476  67.933  1.00 0.00 ?  66  PHE A O    4  
ATOM 5931  C CB   . PHE A 1 75  ? 39.681  71.390  70.646  1.00 0.00 ?  66  PHE A CB   4  
ATOM 5932  C CG   . PHE A 1 75  ? 40.692  70.677  69.728  1.00 0.00 ?  66  PHE A CG   4  
ATOM 5933  C CD1  . PHE A 1 75  ? 40.856  69.248  69.833  1.00 0.00 ?  66  PHE A CD1  4  
ATOM 5934  C CD2  . PHE A 1 75  ? 41.281  71.290  68.586  1.00 0.00 ?  66  PHE A CD2  4  
ATOM 5935  C CE1  . PHE A 1 75  ? 41.691  68.468  68.976  1.00 0.00 ?  66  PHE A CE1  4  
ATOM 5936  C CE2  . PHE A 1 75  ? 42.130  70.540  67.720  1.00 0.00 ?  66  PHE A CE2  4  
ATOM 5937  C CZ   . PHE A 1 75  ? 42.274  69.116  67.913  1.00 0.00 ?  66  PHE A CZ   4  
ATOM 5938  H H    . PHE A 1 75  ? 37.395  71.579  72.239  1.00 0.00 ?  66  PHE A H    4  
ATOM 5939  H HA   . PHE A 1 75  ? 38.215  72.349  69.593  1.00 0.00 ?  66  PHE A HA   4  
ATOM 5940  H HB2  . PHE A 1 75  ? 39.995  72.401  70.906  1.00 0.00 ?  66  PHE A HB2  4  
ATOM 5941  H HB3  . PHE A 1 75  ? 39.642  70.760  71.535  1.00 0.00 ?  66  PHE A HB3  4  
ATOM 5942  H HD1  . PHE A 1 75  ? 40.344  68.698  70.608  1.00 0.00 ?  66  PHE A HD1  4  
ATOM 5943  H HD2  . PHE A 1 75  ? 41.058  72.317  68.340  1.00 0.00 ?  66  PHE A HD2  4  
ATOM 5944  H HE1  . PHE A 1 75  ? 41.811  67.404  69.119  1.00 0.00 ?  66  PHE A HE1  4  
ATOM 5945  H HE2  . PHE A 1 75  ? 42.684  71.120  66.998  1.00 0.00 ?  66  PHE A HE2  4  
ATOM 5946  H HZ   . PHE A 1 75  ? 42.907  68.619  67.192  1.00 0.00 ?  66  PHE A HZ   4  
ATOM 5947  N N    . LEU A 1 76  ? 37.560  69.055  69.664  1.00 0.00 ?  67  LEU A N    4  
ATOM 5948  C CA   . LEU A 1 76  ? 37.122  67.821  68.916  1.00 0.00 ?  67  LEU A CA   4  
ATOM 5949  C C    . LEU A 1 76  ? 35.896  68.199  68.066  1.00 0.00 ?  67  LEU A C    4  
ATOM 5950  O O    . LEU A 1 76  ? 35.779  67.751  66.911  1.00 0.00 ?  67  LEU A O    4  
ATOM 5951  C CB   . LEU A 1 76  ? 36.960  66.629  69.908  1.00 0.00 ?  67  LEU A CB   4  
ATOM 5952  C CG   . LEU A 1 76  ? 36.400  65.396  69.228  1.00 0.00 ?  67  LEU A CG   4  
ATOM 5953  C CD1  . LEU A 1 76  ? 37.462  64.688  68.379  1.00 0.00 ?  67  LEU A CD1  4  
ATOM 5954  C CD2  . LEU A 1 76  ? 35.890  64.406  70.324  1.00 0.00 ?  67  LEU A CD2  4  
ATOM 5955  H H    . LEU A 1 76  ? 37.794  69.006  70.645  1.00 0.00 ?  67  LEU A H    4  
ATOM 5956  H HA   . LEU A 1 76  ? 37.838  67.559  68.137  1.00 0.00 ?  67  LEU A HA   4  
ATOM 5957  H HB2  . LEU A 1 76  ? 37.913  66.473  70.414  1.00 0.00 ?  67  LEU A HB2  4  
ATOM 5958  H HB3  . LEU A 1 76  ? 36.255  66.973  70.664  1.00 0.00 ?  67  LEU A HB3  4  
ATOM 5959  H HG   . LEU A 1 76  ? 35.644  65.611  68.474  1.00 0.00 ?  67  LEU A HG   4  
ATOM 5960  H HD11 . LEU A 1 76  ? 37.756  65.394  67.602  1.00 0.00 ?  67  LEU A HD11 4  
ATOM 5961  H HD12 . LEU A 1 76  ? 38.257  64.667  69.124  1.00 0.00 ?  67  LEU A HD12 4  
ATOM 5962  H HD13 . LEU A 1 76  ? 37.194  63.695  68.017  1.00 0.00 ?  67  LEU A HD13 4  
ATOM 5963  H HD21 . LEU A 1 76  ? 35.569  63.498  69.815  1.00 0.00 ?  67  LEU A HD21 4  
ATOM 5964  H HD22 . LEU A 1 76  ? 36.647  64.219  71.087  1.00 0.00 ?  67  LEU A HD22 4  
ATOM 5965  H HD23 . LEU A 1 76  ? 34.961  64.744  70.784  1.00 0.00 ?  67  LEU A HD23 4  
ATOM 5966  N N    . PHE A 1 77  ? 34.970  69.083  68.578  1.00 0.00 ?  68  PHE A N    4  
ATOM 5967  C CA   . PHE A 1 77  ? 33.917  69.675  67.763  1.00 0.00 ?  68  PHE A CA   4  
ATOM 5968  C C    . PHE A 1 77  ? 34.282  70.469  66.544  1.00 0.00 ?  68  PHE A C    4  
ATOM 5969  O O    . PHE A 1 77  ? 33.647  70.290  65.534  1.00 0.00 ?  68  PHE A O    4  
ATOM 5970  C CB   . PHE A 1 77  ? 32.852  70.379  68.674  1.00 0.00 ?  68  PHE A CB   4  
ATOM 5971  C CG   . PHE A 1 77  ? 31.913  71.484  68.077  1.00 0.00 ?  68  PHE A CG   4  
ATOM 5972  C CD1  . PHE A 1 77  ? 30.812  71.106  67.225  1.00 0.00 ?  68  PHE A CD1  4  
ATOM 5973  C CD2  . PHE A 1 77  ? 32.368  72.804  68.117  1.00 0.00 ?  68  PHE A CD2  4  
ATOM 5974  C CE1  . PHE A 1 77  ? 30.162  72.069  66.452  1.00 0.00 ?  68  PHE A CE1  4  
ATOM 5975  C CE2  . PHE A 1 77  ? 31.741  73.727  67.280  1.00 0.00 ?  68  PHE A CE2  4  
ATOM 5976  C CZ   . PHE A 1 77  ? 30.616  73.427  66.479  1.00 0.00 ?  68  PHE A CZ   4  
ATOM 5977  H H    . PHE A 1 77  ? 34.960  69.325  69.558  1.00 0.00 ?  68  PHE A H    4  
ATOM 5978  H HA   . PHE A 1 77  ? 33.387  68.835  67.318  1.00 0.00 ?  68  PHE A HA   4  
ATOM 5979  H HB2  . PHE A 1 77  ? 32.340  69.578  69.208  1.00 0.00 ?  68  PHE A HB2  4  
ATOM 5980  H HB3  . PHE A 1 77  ? 33.467  70.882  69.421  1.00 0.00 ?  68  PHE A HB3  4  
ATOM 5981  H HD1  . PHE A 1 77  ? 30.559  70.067  67.069  1.00 0.00 ?  68  PHE A HD1  4  
ATOM 5982  H HD2  . PHE A 1 77  ? 33.184  73.213  68.696  1.00 0.00 ?  68  PHE A HD2  4  
ATOM 5983  H HE1  . PHE A 1 77  ? 29.372  71.819  65.761  1.00 0.00 ?  68  PHE A HE1  4  
ATOM 5984  H HE2  . PHE A 1 77  ? 32.037  74.765  67.290  1.00 0.00 ?  68  PHE A HE2  4  
ATOM 5985  H HZ   . PHE A 1 77  ? 30.120  74.244  65.975  1.00 0.00 ?  68  PHE A HZ   4  
ATOM 5986  N N    . ALA A 1 78  ? 35.329  71.274  66.535  1.00 0.00 ?  69  ALA A N    4  
ATOM 5987  C CA   . ALA A 1 78  ? 35.720  71.851  65.190  1.00 0.00 ?  69  ALA A CA   4  
ATOM 5988  C C    . ALA A 1 78  ? 36.319  70.823  64.211  1.00 0.00 ?  69  ALA A C    4  
ATOM 5989  O O    . ALA A 1 78  ? 36.128  70.962  63.004  1.00 0.00 ?  69  ALA A O    4  
ATOM 5990  C CB   . ALA A 1 78  ? 36.657  73.014  65.449  1.00 0.00 ?  69  ALA A CB   4  
ATOM 5991  H H    . ALA A 1 78  ? 35.809  71.410  67.414  1.00 0.00 ?  69  ALA A H    4  
ATOM 5992  H HA   . ALA A 1 78  ? 34.868  72.385  64.772  1.00 0.00 ?  69  ALA A HA   4  
ATOM 5993  H HB1  . ALA A 1 78  ? 36.298  73.684  66.230  1.00 0.00 ?  69  ALA A HB1  4  
ATOM 5994  H HB2  . ALA A 1 78  ? 37.619  72.622  65.780  1.00 0.00 ?  69  ALA A HB2  4  
ATOM 5995  H HB3  . ALA A 1 78  ? 36.772  73.634  64.558  1.00 0.00 ?  69  ALA A HB3  4  
ATOM 5996  N N    . VAL A 1 79  ? 36.954  69.793  64.768  1.00 0.00 ?  70  VAL A N    4  
ATOM 5997  C CA   . VAL A 1 79  ? 37.406  68.645  63.992  1.00 0.00 ?  70  VAL A CA   4  
ATOM 5998  C C    . VAL A 1 79  ? 36.277  67.842  63.426  1.00 0.00 ?  70  VAL A C    4  
ATOM 5999  O O    . VAL A 1 79  ? 36.312  67.512  62.226  1.00 0.00 ?  70  VAL A O    4  
ATOM 6000  C CB   . VAL A 1 79  ? 38.401  67.710  64.781  1.00 0.00 ?  70  VAL A CB   4  
ATOM 6001  C CG1  . VAL A 1 79  ? 39.095  66.675  63.855  1.00 0.00 ?  70  VAL A CG1  4  
ATOM 6002  C CG2  . VAL A 1 79  ? 39.518  68.484  65.448  1.00 0.00 ?  70  VAL A CG2  4  
ATOM 6003  H H    . VAL A 1 79  ? 36.891  69.714  65.773  1.00 0.00 ?  70  VAL A H    4  
ATOM 6004  H HA   . VAL A 1 79  ? 38.070  69.028  63.218  1.00 0.00 ?  70  VAL A HA   4  
ATOM 6005  H HB   . VAL A 1 79  ? 37.787  67.196  65.521  1.00 0.00 ?  70  VAL A HB   4  
ATOM 6006  H HG11 . VAL A 1 79  ? 38.456  65.859  63.515  1.00 0.00 ?  70  VAL A HG11 4  
ATOM 6007  H HG12 . VAL A 1 79  ? 39.449  67.128  62.928  1.00 0.00 ?  70  VAL A HG12 4  
ATOM 6008  H HG13 . VAL A 1 79  ? 39.861  66.105  64.382  1.00 0.00 ?  70  VAL A HG13 4  
ATOM 6009  H HG21 . VAL A 1 79  ? 40.292  67.750  65.668  1.00 0.00 ?  70  VAL A HG21 4  
ATOM 6010  H HG22 . VAL A 1 79  ? 39.959  69.227  64.784  1.00 0.00 ?  70  VAL A HG22 4  
ATOM 6011  H HG23 . VAL A 1 79  ? 39.079  69.036  66.280  1.00 0.00 ?  70  VAL A HG23 4  
ATOM 6012  N N    . THR A 1 80  ? 35.206  67.750  64.207  1.00 0.00 ?  71  THR A N    4  
ATOM 6013  C CA   . THR A 1 80  ? 33.944  67.196  63.786  1.00 0.00 ?  71  THR A CA   4  
ATOM 6014  C C    . THR A 1 80  ? 33.227  68.026  62.763  1.00 0.00 ?  71  THR A C    4  
ATOM 6015  O O    . THR A 1 80  ? 32.479  67.504  61.933  1.00 0.00 ?  71  THR A O    4  
ATOM 6016  C CB   . THR A 1 80  ? 33.059  66.919  64.995  1.00 0.00 ?  71  THR A CB   4  
ATOM 6017  O OG1  . THR A 1 80  ? 33.815  66.250  65.954  1.00 0.00 ?  71  THR A OG1  4  
ATOM 6018  C CG2  . THR A 1 80  ? 31.906  65.958  64.762  1.00 0.00 ?  71  THR A CG2  4  
ATOM 6019  H H    . THR A 1 80  ? 35.175  68.043  65.174  1.00 0.00 ?  71  THR A H    4  
ATOM 6020  H HA   . THR A 1 80  ? 34.111  66.206  63.364  1.00 0.00 ?  71  THR A HA   4  
ATOM 6021  H HB   . THR A 1 80  ? 32.614  67.841  65.368  1.00 0.00 ?  71  THR A HB   4  
ATOM 6022  H HG1  . THR A 1 80  ? 34.532  66.819  66.243  1.00 0.00 ?  71  THR A HG1  4  
ATOM 6023  H HG21 . THR A 1 80  ? 31.329  66.426  63.966  1.00 0.00 ?  71  THR A HG21 4  
ATOM 6024  H HG22 . THR A 1 80  ? 32.366  65.025  64.435  1.00 0.00 ?  71  THR A HG22 4  
ATOM 6025  H HG23 . THR A 1 80  ? 31.476  65.768  65.745  1.00 0.00 ?  71  THR A HG23 4  
ATOM 6026  N N    . VAL A 1 81  ? 33.409  69.390  62.714  1.00 0.00 ?  72  VAL A N    4  
ATOM 6027  C CA   . VAL A 1 81  ? 32.758  70.164  61.659  1.00 0.00 ?  72  VAL A CA   4  
ATOM 6028  C C    . VAL A 1 81  ? 33.393  69.854  60.242  1.00 0.00 ?  72  VAL A C    4  
ATOM 6029  O O    . VAL A 1 81  ? 32.746  69.743  59.231  1.00 0.00 ?  72  VAL A O    4  
ATOM 6030  C CB   . VAL A 1 81  ? 32.795  71.670  61.938  1.00 0.00 ?  72  VAL A CB   4  
ATOM 6031  C CG1  . VAL A 1 81  ? 32.311  72.530  60.771  1.00 0.00 ?  72  VAL A CG1  4  
ATOM 6032  C CG2  . VAL A 1 81  ? 31.736  71.921  63.054  1.00 0.00 ?  72  VAL A CG2  4  
ATOM 6033  H H    . VAL A 1 81  ? 34.086  69.878  63.282  1.00 0.00 ?  72  VAL A H    4  
ATOM 6034  H HA   . VAL A 1 81  ? 31.711  69.879  61.773  1.00 0.00 ?  72  VAL A HA   4  
ATOM 6035  H HB   . VAL A 1 81  ? 33.727  72.176  62.188  1.00 0.00 ?  72  VAL A HB   4  
ATOM 6036  H HG11 . VAL A 1 81  ? 33.050  72.665  59.981  1.00 0.00 ?  72  VAL A HG11 4  
ATOM 6037  H HG12 . VAL A 1 81  ? 31.418  72.087  60.332  1.00 0.00 ?  72  VAL A HG12 4  
ATOM 6038  H HG13 . VAL A 1 81  ? 32.010  73.504  61.156  1.00 0.00 ?  72  VAL A HG13 4  
ATOM 6039  H HG21 . VAL A 1 81  ? 31.547  72.976  63.244  1.00 0.00 ?  72  VAL A HG21 4  
ATOM 6040  H HG22 . VAL A 1 81  ? 30.786  71.464  62.778  1.00 0.00 ?  72  VAL A HG22 4  
ATOM 6041  H HG23 . VAL A 1 81  ? 32.009  71.593  64.058  1.00 0.00 ?  72  VAL A HG23 4  
ATOM 6042  N N    . GLY A 1 82  ? 34.720  69.831  60.206  1.00 0.00 ?  73  GLY A N    4  
ATOM 6043  C CA   . GLY A 1 82  ? 35.394  69.271  59.049  1.00 0.00 ?  73  GLY A CA   4  
ATOM 6044  C C    . GLY A 1 82  ? 34.967  67.828  58.700  1.00 0.00 ?  73  GLY A C    4  
ATOM 6045  O O    . GLY A 1 82  ? 34.672  67.596  57.562  1.00 0.00 ?  73  GLY A O    4  
ATOM 6046  H H    . GLY A 1 82  ? 35.290  70.126  60.986  1.00 0.00 ?  73  GLY A H    4  
ATOM 6047  H HA2  . GLY A 1 82  ? 35.411  69.909  58.166  1.00 0.00 ?  73  GLY A HA2  4  
ATOM 6048  H HA3  . GLY A 1 82  ? 36.444  69.176  59.326  1.00 0.00 ?  73  GLY A HA3  4  
ATOM 6049  N N    . SER A 1 83  ? 35.158  66.875  59.625  1.00 0.00 ?  74  SER A N    4  
ATOM 6050  C CA   . SER A 1 83  ? 34.682  65.456  59.540  1.00 0.00 ?  74  SER A CA   4  
ATOM 6051  C C    . SER A 1 83  ? 33.223  65.351  59.084  1.00 0.00 ?  74  SER A C    4  
ATOM 6052  O O    . SER A 1 83  ? 32.863  64.384  58.351  1.00 0.00 ?  74  SER A O    4  
ATOM 6053  C CB   . SER A 1 83  ? 35.061  64.550  60.685  1.00 0.00 ?  74  SER A CB   4  
ATOM 6054  O OG   . SER A 1 83  ? 36.363  64.643  61.045  1.00 0.00 ?  74  SER A OG   4  
ATOM 6055  H H    . SER A 1 83  ? 35.478  67.281  60.493  1.00 0.00 ?  74  SER A H    4  
ATOM 6056  H HA   . SER A 1 83  ? 35.247  65.089  58.682  1.00 0.00 ?  74  SER A HA   4  
ATOM 6057  H HB2  . SER A 1 83  ? 34.520  64.950  61.543  1.00 0.00 ?  74  SER A HB2  4  
ATOM 6058  H HB3  . SER A 1 83  ? 34.652  63.544  60.576  1.00 0.00 ?  74  SER A HB3  4  
ATOM 6059  H HG   . SER A 1 83  ? 36.645  65.493  61.392  1.00 0.00 ?  74  SER A HG   4  
ATOM 6060  N N    . LEU A 1 84  ? 32.286  66.286  59.444  1.00 0.00 ?  75  LEU A N    4  
ATOM 6061  C CA   . LEU A 1 84  ? 30.880  66.254  59.023  1.00 0.00 ?  75  LEU A CA   4  
ATOM 6062  C C    . LEU A 1 84  ? 30.681  66.577  57.605  1.00 0.00 ?  75  LEU A C    4  
ATOM 6063  O O    . LEU A 1 84  ? 29.860  65.970  56.890  1.00 0.00 ?  75  LEU A O    4  
ATOM 6064  C CB   . LEU A 1 84  ? 30.071  67.113  59.993  1.00 0.00 ?  75  LEU A CB   4  
ATOM 6065  C CG   . LEU A 1 84  ? 28.524  67.311  59.548  1.00 0.00 ?  75  LEU A CG   4  
ATOM 6066  C CD1  . LEU A 1 84  ? 27.679  66.019  59.723  1.00 0.00 ?  75  LEU A CD1  4  
ATOM 6067  C CD2  . LEU A 1 84  ? 27.975  68.434  60.438  1.00 0.00 ?  75  LEU A CD2  4  
ATOM 6068  H H    . LEU A 1 84  ? 32.555  66.978  60.129  1.00 0.00 ?  75  LEU A H    4  
ATOM 6069  H HA   . LEU A 1 84  ? 30.570  65.212  58.933  1.00 0.00 ?  75  LEU A HA   4  
ATOM 6070  H HB2  . LEU A 1 84  ? 29.999  66.576  60.938  1.00 0.00 ?  75  LEU A HB2  4  
ATOM 6071  H HB3  . LEU A 1 84  ? 30.575  68.069  60.136  1.00 0.00 ?  75  LEU A HB3  4  
ATOM 6072  H HG   . LEU A 1 84  ? 28.547  67.675  58.521  1.00 0.00 ?  75  LEU A HG   4  
ATOM 6073  H HD11 . LEU A 1 84  ? 28.003  65.283  58.987  1.00 0.00 ?  75  LEU A HD11 4  
ATOM 6074  H HD12 . LEU A 1 84  ? 27.754  65.593  60.723  1.00 0.00 ?  75  LEU A HD12 4  
ATOM 6075  H HD13 . LEU A 1 84  ? 26.625  66.213  59.529  1.00 0.00 ?  75  LEU A HD13 4  
ATOM 6076  H HD21 . LEU A 1 84  ? 28.548  69.361  60.393  1.00 0.00 ?  75  LEU A HD21 4  
ATOM 6077  H HD22 . LEU A 1 84  ? 26.895  68.539  60.342  1.00 0.00 ?  75  LEU A HD22 4  
ATOM 6078  H HD23 . LEU A 1 84  ? 28.114  68.163  61.484  1.00 0.00 ?  75  LEU A HD23 4  
ATOM 6079  N N    . ILE A 1 85  ? 31.426  67.608  57.087  1.00 0.00 ?  76  ILE A N    4  
ATOM 6080  C CA   . ILE A 1 85  ? 31.397  67.969  55.681  1.00 0.00 ?  76  ILE A CA   4  
ATOM 6081  C C    . ILE A 1 85  ? 31.960  66.760  54.833  1.00 0.00 ?  76  ILE A C    4  
ATOM 6082  O O    . ILE A 1 85  ? 31.365  66.468  53.748  1.00 0.00 ?  76  ILE A O    4  
ATOM 6083  C CB   . ILE A 1 85  ? 32.251  69.277  55.281  1.00 0.00 ?  76  ILE A CB   4  
ATOM 6084  C CG1  . ILE A 1 85  ? 31.935  70.424  56.255  1.00 0.00 ?  76  ILE A CG1  4  
ATOM 6085  C CG2  . ILE A 1 85  ? 32.072  69.742  53.814  1.00 0.00 ?  76  ILE A CG2  4  
ATOM 6086  C CD1  . ILE A 1 85  ? 33.117  71.346  56.416  1.00 0.00 ?  76  ILE A CD1  4  
ATOM 6087  H H    . ILE A 1 85  ? 31.998  68.155  57.714  1.00 0.00 ?  76  ILE A H    4  
ATOM 6088  H HA   . ILE A 1 85  ? 30.341  68.148  55.474  1.00 0.00 ?  76  ILE A HA   4  
ATOM 6089  H HB   . ILE A 1 85  ? 33.276  68.907  55.308  1.00 0.00 ?  76  ILE A HB   4  
ATOM 6090  H HG12 . ILE A 1 85  ? 31.081  70.997  55.896  1.00 0.00 ?  76  ILE A HG12 4  
ATOM 6091  H HG13 . ILE A 1 85  ? 31.668  70.008  57.227  1.00 0.00 ?  76  ILE A HG13 4  
ATOM 6092  H HG21 . ILE A 1 85  ? 31.016  69.968  53.666  1.00 0.00 ?  76  ILE A HG21 4  
ATOM 6093  H HG22 . ILE A 1 85  ? 32.669  70.575  53.444  1.00 0.00 ?  76  ILE A HG22 4  
ATOM 6094  H HG23 . ILE A 1 85  ? 32.391  68.896  53.204  1.00 0.00 ?  76  ILE A HG23 4  
ATOM 6095  H HD11 . ILE A 1 85  ? 33.447  71.595  55.408  1.00 0.00 ?  76  ILE A HD11 4  
ATOM 6096  H HD12 . ILE A 1 85  ? 32.795  72.243  56.946  1.00 0.00 ?  76  ILE A HD12 4  
ATOM 6097  H HD13 . ILE A 1 85  ? 33.848  70.814  57.025  1.00 0.00 ?  76  ILE A HD13 4  
ATOM 6098  N N    . LEU A 1 86  ? 33.047  66.135  55.233  1.00 0.00 ?  77  LEU A N    4  
ATOM 6099  C CA   . LEU A 1 86  ? 33.653  64.951  54.644  1.00 0.00 ?  77  LEU A CA   4  
ATOM 6100  C C    . LEU A 1 86  ? 32.736  63.704  54.748  1.00 0.00 ?  77  LEU A C    4  
ATOM 6101  O O    . LEU A 1 86  ? 32.582  63.013  53.753  1.00 0.00 ?  77  LEU A O    4  
ATOM 6102  C CB   . LEU A 1 86  ? 35.012  64.743  55.407  1.00 0.00 ?  77  LEU A CB   4  
ATOM 6103  C CG   . LEU A 1 86  ? 35.776  63.375  54.997  1.00 0.00 ?  77  LEU A CG   4  
ATOM 6104  C CD1  . LEU A 1 86  ? 35.954  63.080  53.503  1.00 0.00 ?  77  LEU A CD1  4  
ATOM 6105  C CD2  . LEU A 1 86  ? 37.113  63.457  55.769  1.00 0.00 ?  77  LEU A CD2  4  
ATOM 6106  H H    . LEU A 1 86  ? 33.364  66.300  56.177  1.00 0.00 ?  77  LEU A H    4  
ATOM 6107  H HA   . LEU A 1 86  ? 33.848  65.145  53.589  1.00 0.00 ?  77  LEU A HA   4  
ATOM 6108  H HB2  . LEU A 1 86  ? 35.647  65.609  55.215  1.00 0.00 ?  77  LEU A HB2  4  
ATOM 6109  H HB3  . LEU A 1 86  ? 34.796  64.700  56.473  1.00 0.00 ?  77  LEU A HB3  4  
ATOM 6110  H HG   . LEU A 1 86  ? 35.213  62.514  55.357  1.00 0.00 ?  77  LEU A HG   4  
ATOM 6111  H HD11 . LEU A 1 86  ? 34.971  63.009  53.038  1.00 0.00 ?  77  LEU A HD11 4  
ATOM 6112  H HD12 . LEU A 1 86  ? 36.535  63.896  53.071  1.00 0.00 ?  77  LEU A HD12 4  
ATOM 6113  H HD13 . LEU A 1 86  ? 36.568  62.190  53.360  1.00 0.00 ?  77  LEU A HD13 4  
ATOM 6114  H HD21 . LEU A 1 86  ? 37.680  64.376  55.623  1.00 0.00 ?  77  LEU A HD21 4  
ATOM 6115  H HD22 . LEU A 1 86  ? 36.726  63.361  56.784  1.00 0.00 ?  77  LEU A HD22 4  
ATOM 6116  H HD23 . LEU A 1 86  ? 37.712  62.575  55.539  1.00 0.00 ?  77  LEU A HD23 4  
ATOM 6117  N N    . GLY A 1 87  ? 32.040  63.410  55.855  1.00 0.00 ?  78  GLY A N    4  
ATOM 6118  C CA   . GLY A 1 87  ? 31.148  62.291  55.879  1.00 0.00 ?  78  GLY A CA   4  
ATOM 6119  C C    . GLY A 1 87  ? 29.909  62.597  55.081  1.00 0.00 ?  78  GLY A C    4  
ATOM 6120  O O    . GLY A 1 87  ? 29.271  61.649  54.571  1.00 0.00 ?  78  GLY A O    4  
ATOM 6121  H H    . GLY A 1 87  ? 32.142  63.898  56.733  1.00 0.00 ?  78  GLY A H    4  
ATOM 6122  H HA2  . GLY A 1 87  ? 31.652  61.382  55.551  1.00 0.00 ?  78  GLY A HA2  4  
ATOM 6123  H HA3  . GLY A 1 87  ? 30.791  62.092  56.890  1.00 0.00 ?  78  GLY A HA3  4  
ATOM 6124  N N    . TYR A 1 88  ? 29.497  63.853  54.891  1.00 0.00 ?  79  TYR A N    4  
ATOM 6125  C CA   . TYR A 1 88  ? 28.609  64.229  53.756  1.00 0.00 ?  79  TYR A CA   4  
ATOM 6126  C C    . TYR A 1 88  ? 29.120  63.988  52.377  1.00 0.00 ?  79  TYR A C    4  
ATOM 6127  O O    . TYR A 1 88  ? 28.385  63.676  51.465  1.00 0.00 ?  79  TYR A O    4  
ATOM 6128  C CB   . TYR A 1 88  ? 27.909  65.604  53.945  1.00 0.00 ?  79  TYR A CB   4  
ATOM 6129  C CG   . TYR A 1 88  ? 26.678  65.553  54.726  1.00 0.00 ?  79  TYR A CG   4  
ATOM 6130  C CD1  . TYR A 1 88  ? 26.654  65.152  56.074  1.00 0.00 ?  79  TYR A CD1  4  
ATOM 6131  C CD2  . TYR A 1 88  ? 25.428  65.859  54.065  1.00 0.00 ?  79  TYR A CD2  4  
ATOM 6132  C CE1  . TYR A 1 88  ? 25.452  64.983  56.722  1.00 0.00 ?  79  TYR A CE1  4  
ATOM 6133  C CE2  . TYR A 1 88  ? 24.211  65.750  54.754  1.00 0.00 ?  79  TYR A CE2  4  
ATOM 6134  C CZ   . TYR A 1 88  ? 24.197  65.252  56.117  1.00 0.00 ?  79  TYR A CZ   4  
ATOM 6135  O OH   . TYR A 1 88  ? 23.094  65.081  56.910  1.00 0.00 ?  79  TYR A OH   4  
ATOM 6136  H H    . TYR A 1 88  ? 29.796  64.649  55.434  1.00 0.00 ?  79  TYR A H    4  
ATOM 6137  H HA   . TYR A 1 88  ? 27.734  63.579  53.747  1.00 0.00 ?  79  TYR A HA   4  
ATOM 6138  H HB2  . TYR A 1 88  ? 28.563  66.317  54.445  1.00 0.00 ?  79  TYR A HB2  4  
ATOM 6139  H HB3  . TYR A 1 88  ? 27.753  66.024  52.952  1.00 0.00 ?  79  TYR A HB3  4  
ATOM 6140  H HD1  . TYR A 1 88  ? 27.584  64.851  56.532  1.00 0.00 ?  79  TYR A HD1  4  
ATOM 6141  H HD2  . TYR A 1 88  ? 25.408  66.151  53.024  1.00 0.00 ?  79  TYR A HD2  4  
ATOM 6142  H HE1  . TYR A 1 88  ? 25.473  64.563  57.717  1.00 0.00 ?  79  TYR A HE1  4  
ATOM 6143  H HE2  . TYR A 1 88  ? 23.239  65.854  54.296  1.00 0.00 ?  79  TYR A HE2  4  
ATOM 6144  H HH   . TYR A 1 88  ? 22.274  65.372  56.504  1.00 0.00 ?  79  TYR A HH   4  
ATOM 6145  N N    . THR A 1 89  ? 30.443  63.942  52.185  1.00 0.00 ?  80  THR A N    4  
ATOM 6146  C CA   . THR A 1 89  ? 31.068  63.615  50.867  1.00 0.00 ?  80  THR A CA   4  
ATOM 6147  C C    . THR A 1 89  ? 31.487  62.225  50.618  1.00 0.00 ?  80  THR A C    4  
ATOM 6148  O O    . THR A 1 89  ? 31.919  61.892  49.521  1.00 0.00 ?  80  THR A O    4  
ATOM 6149  C CB   . THR A 1 89  ? 32.109  64.637  50.300  1.00 0.00 ?  80  THR A CB   4  
ATOM 6150  O OG1  . THR A 1 89  ? 31.769  65.957  50.791  1.00 0.00 ?  80  THR A OG1  4  
ATOM 6151  C CG2  . THR A 1 89  ? 32.212  64.712  48.822  1.00 0.00 ?  80  THR A CG2  4  
ATOM 6152  H H    . THR A 1 89  ? 30.983  64.182  53.004  1.00 0.00 ?  80  THR A H    4  
ATOM 6153  H HA   . THR A 1 89  ? 30.272  63.789  50.142  1.00 0.00 ?  80  THR A HA   4  
ATOM 6154  H HB   . THR A 1 89  ? 33.058  64.365  50.760  1.00 0.00 ?  80  THR A HB   4  
ATOM 6155  H HG1  . THR A 1 89  ? 31.741  65.936  51.752  1.00 0.00 ?  80  THR A HG1  4  
ATOM 6156  H HG21 . THR A 1 89  ? 31.349  64.275  48.320  1.00 0.00 ?  80  THR A HG21 4  
ATOM 6157  H HG22 . THR A 1 89  ? 32.336  65.723  48.434  1.00 0.00 ?  80  THR A HG22 4  
ATOM 6158  H HG23 . THR A 1 89  ? 33.187  64.229  48.752  1.00 0.00 ?  80  THR A HG23 4  
ATOM 6159  N N    . ARG A 1 90  ? 31.218  61.305  51.540  1.00 0.00 ?  81  ARG A N    4  
ATOM 6160  C CA   . ARG A 1 90  ? 31.887  59.949  51.544  1.00 0.00 ?  81  ARG A CA   4  
ATOM 6161  C C    . ARG A 1 90  ? 31.038  58.955  52.370  1.00 0.00 ?  81  ARG A C    4  
ATOM 6162  O O    . ARG A 1 90  ? 30.678  57.885  51.842  1.00 0.00 ?  81  ARG A O    4  
ATOM 6163  C CB   . ARG A 1 90  ? 33.415  60.023  51.927  1.00 0.00 ?  81  ARG A CB   4  
ATOM 6164  C CG   . ARG A 1 90  ? 34.085  58.687  52.241  1.00 0.00 ?  81  ARG A CG   4  
ATOM 6165  C CD   . ARG A 1 90  ? 33.902  57.666  51.149  1.00 0.00 ?  81  ARG A CD   4  
ATOM 6166  N NE   . ARG A 1 90  ? 34.304  56.331  51.689  1.00 0.00 ?  81  ARG A NE   4  
ATOM 6167  C CZ   . ARG A 1 90  ? 33.605  55.626  52.555  1.00 0.00 ?  81  ARG A CZ   4  
ATOM 6168  N NH1  . ARG A 1 90  ? 32.419  55.901  52.965  1.00 0.00 ?  81  ARG A NH1  4  
ATOM 6169  N NH2  . ARG A 1 90  ? 34.186  54.607  53.123  1.00 0.00 1  81  ARG A NH2  4  
ATOM 6170  H H    . ARG A 1 90  ? 30.867  61.594  52.441  1.00 0.00 ?  81  ARG A H    4  
ATOM 6171  H HA   . ARG A 1 90  ? 31.795  59.625  50.508  1.00 0.00 ?  81  ARG A HA   4  
ATOM 6172  H HB2  . ARG A 1 90  ? 33.938  60.633  51.190  1.00 0.00 ?  81  ARG A HB2  4  
ATOM 6173  H HB3  . ARG A 1 90  ? 33.386  60.634  52.829  1.00 0.00 ?  81  ARG A HB3  4  
ATOM 6174  H HG2  . ARG A 1 90  ? 35.122  58.756  52.568  1.00 0.00 ?  81  ARG A HG2  4  
ATOM 6175  H HG3  . ARG A 1 90  ? 33.624  58.424  53.193  1.00 0.00 ?  81  ARG A HG3  4  
ATOM 6176  H HD2  . ARG A 1 90  ? 32.862  57.604  50.825  1.00 0.00 ?  81  ARG A HD2  4  
ATOM 6177  H HD3  . ARG A 1 90  ? 34.619  57.884  50.358  1.00 0.00 ?  81  ARG A HD3  4  
ATOM 6178  H HE   . ARG A 1 90  ? 35.058  55.787  51.296  1.00 0.00 ?  81  ARG A HE   4  
ATOM 6179  H HH11 . ARG A 1 90  ? 31.863  56.641  52.563  1.00 0.00 ?  81  ARG A HH11 4  
ATOM 6180  H HH12 . ARG A 1 90  ? 31.974  55.169  53.501  1.00 0.00 ?  81  ARG A HH12 4  
ATOM 6181  H HH21 . ARG A 1 90  ? 35.028  54.208  52.734  1.00 0.00 ?  81  ARG A HH21 4  
ATOM 6182  H HH22 . ARG A 1 90  ? 33.742  54.032  53.825  1.00 0.00 ?  81  ARG A HH22 4  
ATOM 6183  N N    . SER A 1 91  ? 30.814  59.255  53.676  1.00 0.00 ?  82  SER A N    4  
ATOM 6184  C CA   . SER A 1 91  ? 30.109  58.308  54.566  1.00 0.00 ?  82  SER A CA   4  
ATOM 6185  C C    . SER A 1 91  ? 28.645  58.178  54.069  1.00 0.00 ?  82  SER A C    4  
ATOM 6186  O O    . SER A 1 91  ? 28.154  57.073  53.979  1.00 0.00 ?  82  SER A O    4  
ATOM 6187  C CB   . SER A 1 91  ? 30.185  58.725  56.086  1.00 0.00 ?  82  SER A CB   4  
ATOM 6188  O OG   . SER A 1 91  ? 31.447  59.080  56.322  1.00 0.00 ?  82  SER A OG   4  
ATOM 6189  H H    . SER A 1 91  ? 31.346  59.964  54.160  1.00 0.00 ?  82  SER A H    4  
ATOM 6190  H HA   . SER A 1 91  ? 30.503  57.293  54.637  1.00 0.00 ?  82  SER A HA   4  
ATOM 6191  H HB2  . SER A 1 91  ? 29.476  59.525  56.303  1.00 0.00 ?  82  SER A HB2  4  
ATOM 6192  H HB3  . SER A 1 91  ? 29.810  57.916  56.714  1.00 0.00 ?  82  SER A HB3  4  
ATOM 6193  H HG   . SER A 1 91  ? 32.020  58.354  56.063  1.00 0.00 ?  82  SER A HG   4  
ATOM 6194  N N    . ARG A 1 92  ? 28.075  59.324  53.624  1.00 0.00 ?  83  ARG A N    4  
ATOM 6195  C CA   . ARG A 1 92  ? 26.821  59.450  52.929  1.00 0.00 ?  83  ARG A CA   4  
ATOM 6196  C C    . ARG A 1 92  ? 26.791  58.616  51.618  1.00 0.00 ?  83  ARG A C    4  
ATOM 6197  O O    . ARG A 1 92  ? 27.543  58.877  50.678  1.00 0.00 ?  83  ARG A O    4  
ATOM 6198  C CB   . ARG A 1 92  ? 26.397  60.900  52.862  1.00 0.00 ?  83  ARG A CB   4  
ATOM 6199  C CG   . ARG A 1 92  ? 25.129  61.081  52.056  1.00 0.00 ?  83  ARG A CG   4  
ATOM 6200  C CD   . ARG A 1 92  ? 24.576  62.504  52.225  1.00 0.00 ?  83  ARG A CD   4  
ATOM 6201  N NE   . ARG A 1 92  ? 23.321  62.615  51.431  1.00 0.00 ?  83  ARG A NE   4  
ATOM 6202  C CZ   . ARG A 1 92  ? 22.793  63.664  50.922  1.00 0.00 ?  83  ARG A CZ   4  
ATOM 6203  N NH1  . ARG A 1 92  ? 23.482  64.732  50.897  1.00 0.00 ?  83  ARG A NH1  4  
ATOM 6204  N NH2  . ARG A 1 92  ? 21.620  63.585  50.417  1.00 0.00 1  83  ARG A NH2  4  
ATOM 6205  H H    . ARG A 1 92  ? 28.414  60.252  53.834  1.00 0.00 ?  83  ARG A H    4  
ATOM 6206  H HA   . ARG A 1 92  ? 26.047  59.043  53.581  1.00 0.00 ?  83  ARG A HA   4  
ATOM 6207  H HB2  . ARG A 1 92  ? 26.105  61.250  53.852  1.00 0.00 ?  83  ARG A HB2  4  
ATOM 6208  H HB3  . ARG A 1 92  ? 27.207  61.483  52.426  1.00 0.00 ?  83  ARG A HB3  4  
ATOM 6209  H HG2  . ARG A 1 92  ? 25.342  60.983  50.992  1.00 0.00 ?  83  ARG A HG2  4  
ATOM 6210  H HG3  . ARG A 1 92  ? 24.383  60.321  52.286  1.00 0.00 ?  83  ARG A HG3  4  
ATOM 6211  H HD2  . ARG A 1 92  ? 24.286  62.686  53.260  1.00 0.00 ?  83  ARG A HD2  4  
ATOM 6212  H HD3  . ARG A 1 92  ? 25.316  63.239  51.906  1.00 0.00 ?  83  ARG A HD3  4  
ATOM 6213  H HE   . ARG A 1 92  ? 22.987  61.750  51.032  1.00 0.00 ?  83  ARG A HE   4  
ATOM 6214  H HH11 . ARG A 1 92  ? 24.477  64.666  51.058  1.00 0.00 ?  83  ARG A HH11 4  
ATOM 6215  H HH12 . ARG A 1 92  ? 23.078  65.526  50.421  1.00 0.00 ?  83  ARG A HH12 4  
ATOM 6216  H HH21 . ARG A 1 92  ? 21.235  62.654  50.488  1.00 0.00 ?  83  ARG A HH21 4  
ATOM 6217  H HH22 . ARG A 1 92  ? 21.173  64.374  49.971  1.00 0.00 ?  83  ARG A HH22 4  
ATOM 6218  N N    . LYS A 1 93  ? 25.721  57.809  51.532  1.00 0.00 ?  84  LYS A N    4  
ATOM 6219  C CA   . LYS A 1 93  ? 25.612  56.969  50.369  1.00 0.00 ?  84  LYS A CA   4  
ATOM 6220  C C    . LYS A 1 93  ? 25.302  57.644  49.020  1.00 0.00 ?  84  LYS A C    4  
ATOM 6221  O O    . LYS A 1 93  ? 26.040  57.533  48.100  1.00 0.00 ?  84  LYS A O    4  
ATOM 6222  C CB   . LYS A 1 93  ? 24.643  55.887  50.670  1.00 0.00 ?  84  LYS A CB   4  
ATOM 6223  C CG   . LYS A 1 93  ? 24.458  54.834  49.596  1.00 0.00 ?  84  LYS A CG   4  
ATOM 6224  C CD   . LYS A 1 93  ? 23.368  53.773  49.920  1.00 0.00 ?  84  LYS A CD   4  
ATOM 6225  C CE   . LYS A 1 93  ? 23.105  52.754  48.772  1.00 0.00 ?  84  LYS A CE   4  
ATOM 6226  N NZ   . LYS A 1 93  ? 22.162  51.650  48.967  1.00 0.00 1  84  LYS A NZ   4  
ATOM 6227  H H    . LYS A 1 93  ? 25.068  57.800  52.302  1.00 0.00 ?  84  LYS A H    4  
ATOM 6228  H HA   . LYS A 1 93  ? 26.557  56.479  50.134  1.00 0.00 ?  84  LYS A HA   4  
ATOM 6229  H HB2  . LYS A 1 93  ? 25.039  55.416  51.570  1.00 0.00 ?  84  LYS A HB2  4  
ATOM 6230  H HB3  . LYS A 1 93  ? 23.686  56.324  50.956  1.00 0.00 ?  84  LYS A HB3  4  
ATOM 6231  H HG2  . LYS A 1 93  ? 24.329  55.301  48.619  1.00 0.00 ?  84  LYS A HG2  4  
ATOM 6232  H HG3  . LYS A 1 93  ? 25.380  54.268  49.456  1.00 0.00 ?  84  LYS A HG3  4  
ATOM 6233  H HD2  . LYS A 1 93  ? 23.610  53.196  50.812  1.00 0.00 ?  84  LYS A HD2  4  
ATOM 6234  H HD3  . LYS A 1 93  ? 22.434  54.230  50.247  1.00 0.00 ?  84  LYS A HD3  4  
ATOM 6235  H HE2  . LYS A 1 93  ? 22.777  53.482  48.030  1.00 0.00 ?  84  LYS A HE2  4  
ATOM 6236  H HE3  . LYS A 1 93  ? 24.038  52.287  48.457  1.00 0.00 ?  84  LYS A HE3  4  
ATOM 6237  H HZ1  . LYS A 1 93  ? 21.237  52.046  48.876  1.00 0.00 ?  84  LYS A HZ1  4  
ATOM 6238  H HZ2  . LYS A 1 93  ? 22.380  50.974  48.249  1.00 0.00 ?  84  LYS A HZ2  4  
ATOM 6239  H HZ3  . LYS A 1 93  ? 22.141  51.211  49.876  1.00 0.00 ?  84  LYS A HZ3  4  
ATOM 6240  N N    . VAL A 1 94  ? 24.145  58.318  48.984  1.00 0.00 ?  85  VAL A N    4  
ATOM 6241  C CA   . VAL A 1 94  ? 23.562  58.931  47.739  1.00 0.00 ?  85  VAL A CA   4  
ATOM 6242  C C    . VAL A 1 94  ? 23.665  60.475  47.687  1.00 0.00 ?  85  VAL A C    4  
ATOM 6243  O O    . VAL A 1 94  ? 24.220  61.049  48.639  1.00 0.00 ?  85  VAL A O    4  
ATOM 6244  C CB   . VAL A 1 94  ? 22.120  58.343  47.422  1.00 0.00 ?  85  VAL A CB   4  
ATOM 6245  C CG1  . VAL A 1 94  ? 22.021  56.827  47.723  1.00 0.00 ?  85  VAL A CG1  4  
ATOM 6246  C CG2  . VAL A 1 94  ? 21.115  59.053  48.314  1.00 0.00 ?  85  VAL A CG2  4  
ATOM 6247  H H    . VAL A 1 94  ? 23.591  58.343  49.828  1.00 0.00 ?  85  VAL A H    4  
ATOM 6248  H HA   . VAL A 1 94  ? 24.129  58.584  46.875  1.00 0.00 ?  85  VAL A HA   4  
ATOM 6249  H HB   . VAL A 1 94  ? 21.868  58.482  46.370  1.00 0.00 ?  85  VAL A HB   4  
ATOM 6250  H HG11 . VAL A 1 94  ? 22.247  56.626  48.770  1.00 0.00 ?  85  VAL A HG11 4  
ATOM 6251  H HG12 . VAL A 1 94  ? 21.043  56.523  47.346  1.00 0.00 ?  85  VAL A HG12 4  
ATOM 6252  H HG13 . VAL A 1 94  ? 22.828  56.272  47.245  1.00 0.00 ?  85  VAL A HG13 4  
ATOM 6253  H HG21 . VAL A 1 94  ? 21.044  60.132  48.172  1.00 0.00 ?  85  VAL A HG21 4  
ATOM 6254  H HG22 . VAL A 1 94  ? 20.112  58.683  48.105  1.00 0.00 ?  85  VAL A HG22 4  
ATOM 6255  H HG23 . VAL A 1 94  ? 21.303  58.768  49.349  1.00 0.00 ?  85  VAL A HG23 4  
ATOM 6256  N N    . ASP A 1 95  ? 23.184  61.129  46.663  1.00 0.00 ?  86  ASP A N    4  
ATOM 6257  C CA   . ASP A 1 95  ? 23.051  62.569  46.551  1.00 0.00 ?  86  ASP A CA   4  
ATOM 6258  C C    . ASP A 1 95  ? 21.749  63.014  45.809  1.00 0.00 ?  86  ASP A C    4  
ATOM 6259  O O    . ASP A 1 95  ? 20.935  62.196  45.446  1.00 0.00 ?  86  ASP A O    4  
ATOM 6260  C CB   . ASP A 1 95  ? 24.265  63.070  45.783  1.00 0.00 ?  86  ASP A CB   4  
ATOM 6261  C CG   . ASP A 1 95  ? 24.536  62.573  44.365  1.00 0.00 ?  86  ASP A CG   4  
ATOM 6262  O OD1  . ASP A 1 95  ? 23.527  62.279  43.669  1.00 0.00 -1 86  ASP A OD1  4  
ATOM 6263  O OD2  . ASP A 1 95  ? 25.667  62.548  43.843  1.00 0.00 ?  86  ASP A OD2  4  
ATOM 6264  H H    . ASP A 1 95  ? 22.813  60.643  45.859  1.00 0.00 ?  86  ASP A H    4  
ATOM 6265  H HA   . ASP A 1 95  ? 23.124  63.041  47.531  1.00 0.00 ?  86  ASP A HA   4  
ATOM 6266  H HB2  . ASP A 1 95  ? 24.293  64.160  45.772  1.00 0.00 ?  86  ASP A HB2  4  
ATOM 6267  H HB3  . ASP A 1 95  ? 25.127  62.760  46.373  1.00 0.00 ?  86  ASP A HB3  4  
ATOM 6268  N N    . LYS A 1 96  ? 21.594  64.340  45.604  1.00 0.00 ?  87  LYS A N    4  
ATOM 6269  C CA   . LYS A 1 96  ? 20.525  65.048  44.831  1.00 0.00 ?  87  LYS A CA   4  
ATOM 6270  C C    . LYS A 1 96  ? 20.317  64.386  43.460  1.00 0.00 ?  87  LYS A C    4  
ATOM 6271  O O    . LYS A 1 96  ? 19.352  64.905  42.924  1.00 0.00 ?  87  LYS A O    4  
ATOM 6272  C CB   . LYS A 1 96  ? 20.820  66.563  44.792  1.00 0.00 ?  87  LYS A CB   4  
ATOM 6273  C CG   . LYS A 1 96  ? 22.078  67.096  44.038  1.00 0.00 ?  87  LYS A CG   4  
ATOM 6274  C CD   . LYS A 1 96  ? 23.424  67.044  44.802  1.00 0.00 ?  87  LYS A CD   4  
ATOM 6275  C CE   . LYS A 1 96  ? 24.402  67.914  44.030  1.00 0.00 ?  87  LYS A CE   4  
ATOM 6276  N NZ   . LYS A 1 96  ? 25.637  68.203  44.829  1.00 0.00 1  87  LYS A NZ   4  
ATOM 6277  H H    . LYS A 1 96  ? 22.361  64.875  45.986  1.00 0.00 ?  87  LYS A H    4  
ATOM 6278  H HA   . LYS A 1 96  ? 19.631  65.028  45.454  1.00 0.00 ?  87  LYS A HA   4  
ATOM 6279  H HB2  . LYS A 1 96  ? 20.004  67.116  44.325  1.00 0.00 ?  87  LYS A HB2  4  
ATOM 6280  H HB3  . LYS A 1 96  ? 20.903  66.844  45.841  1.00 0.00 ?  87  LYS A HB3  4  
ATOM 6281  H HG2  . LYS A 1 96  ? 22.227  66.550  43.106  1.00 0.00 ?  87  LYS A HG2  4  
ATOM 6282  H HG3  . LYS A 1 96  ? 21.834  68.123  43.768  1.00 0.00 ?  87  LYS A HG3  4  
ATOM 6283  H HD2  . LYS A 1 96  ? 23.298  67.575  45.745  1.00 0.00 ?  87  LYS A HD2  4  
ATOM 6284  H HD3  . LYS A 1 96  ? 23.794  66.036  44.988  1.00 0.00 ?  87  LYS A HD3  4  
ATOM 6285  H HE2  . LYS A 1 96  ? 24.643  67.330  43.142  1.00 0.00 ?  87  LYS A HE2  4  
ATOM 6286  H HE3  . LYS A 1 96  ? 23.924  68.869  43.808  1.00 0.00 ?  87  LYS A HE3  4  
ATOM 6287  H HZ1  . LYS A 1 96  ? 25.379  68.883  45.529  1.00 0.00 ?  87  LYS A HZ1  4  
ATOM 6288  H HZ2  . LYS A 1 96  ? 25.893  67.379  45.355  1.00 0.00 ?  87  LYS A HZ2  4  
ATOM 6289  H HZ3  . LYS A 1 96  ? 26.479  68.377  44.299  1.00 0.00 ?  87  LYS A HZ3  4  
ATOM 6290  N N    . ARG A 1 97  ? 21.057  63.437  42.919  1.00 0.00 ?  88  ARG A N    4  
ATOM 6291  C CA   . ARG A 1 97  ? 20.612  62.851  41.619  1.00 0.00 ?  88  ARG A CA   4  
ATOM 6292  C C    . ARG A 1 97  ? 19.610  61.735  41.875  1.00 0.00 ?  88  ARG A C    4  
ATOM 6293  O O    . ARG A 1 97  ? 18.792  61.507  40.957  1.00 0.00 ?  88  ARG A O    4  
ATOM 6294  C CB   . ARG A 1 97  ? 21.841  62.235  40.937  1.00 0.00 ?  88  ARG A CB   4  
ATOM 6295  C CG   . ARG A 1 97  ? 22.883  63.159  40.333  1.00 0.00 ?  88  ARG A CG   4  
ATOM 6296  C CD   . ARG A 1 97  ? 24.254  62.580  39.854  1.00 0.00 ?  88  ARG A CD   4  
ATOM 6297  N NE   . ARG A 1 97  ? 25.017  62.027  40.981  1.00 0.00 ?  88  ARG A NE   4  
ATOM 6298  C CZ   . ARG A 1 97  ? 26.079  61.221  40.883  1.00 0.00 ?  88  ARG A CZ   4  
ATOM 6299  N NH1  . ARG A 1 97  ? 26.646  60.802  39.786  1.00 0.00 ?  88  ARG A NH1  4  
ATOM 6300  N NH2  . ARG A 1 97  ? 26.627  60.823  41.988  1.00 0.00 1  88  ARG A NH2  4  
ATOM 6301  H H    . ARG A 1 97  ? 21.856  63.065  43.413  1.00 0.00 ?  88  ARG A H    4  
ATOM 6302  H HA   . ARG A 1 97  ? 20.033  63.539  41.002  1.00 0.00 ?  88  ARG A HA   4  
ATOM 6303  H HB2  . ARG A 1 97  ? 22.295  61.522  41.626  1.00 0.00 ?  88  ARG A HB2  4  
ATOM 6304  H HB3  . ARG A 1 97  ? 21.548  61.563  40.131  1.00 0.00 ?  88  ARG A HB3  4  
ATOM 6305  H HG2  . ARG A 1 97  ? 22.569  63.700  39.440  1.00 0.00 ?  88  ARG A HG2  4  
ATOM 6306  H HG3  . ARG A 1 97  ? 23.108  63.889  41.109  1.00 0.00 ?  88  ARG A HG3  4  
ATOM 6307  H HD2  . ARG A 1 97  ? 24.128  61.820  39.083  1.00 0.00 ?  88  ARG A HD2  4  
ATOM 6308  H HD3  . ARG A 1 97  ? 24.785  63.379  39.337  1.00 0.00 ?  88  ARG A HD3  4  
ATOM 6309  H HE   . ARG A 1 97  ? 24.817  62.279  41.938  1.00 0.00 ?  88  ARG A HE   4  
ATOM 6310  H HH11 . ARG A 1 97  ? 26.427  61.243  38.904  1.00 0.00 ?  88  ARG A HH11 4  
ATOM 6311  H HH12 . ARG A 1 97  ? 27.402  60.133  39.808  1.00 0.00 ?  88  ARG A HH12 4  
ATOM 6312  H HH21 . ARG A 1 97  ? 26.326  61.314  42.817  1.00 0.00 ?  88  ARG A HH21 4  
ATOM 6313  H HH22 . ARG A 1 97  ? 27.371  60.140  41.973  1.00 0.00 ?  88  ARG A HH22 4  
ATOM 6314  N N    . SER A 1 98  ? 19.615  61.056  42.975  1.00 0.00 ?  89  SER A N    4  
ATOM 6315  C CA   . SER A 1 98  ? 18.751  59.922  43.271  1.00 0.00 ?  89  SER A CA   4  
ATOM 6316  C C    . SER A 1 98  ? 17.370  60.239  43.686  1.00 0.00 ?  89  SER A C    4  
ATOM 6317  O O    . SER A 1 98  ? 17.113  61.134  44.431  1.00 0.00 ?  89  SER A O    4  
ATOM 6318  C CB   . SER A 1 98  ? 19.386  59.042  44.359  1.00 0.00 ?  89  SER A CB   4  
ATOM 6319  O OG   . SER A 1 98  ? 19.648  59.657  45.608  1.00 0.00 ?  89  SER A OG   4  
ATOM 6320  H H    . SER A 1 98  ? 20.193  61.422  43.716  1.00 0.00 ?  89  SER A H    4  
ATOM 6321  H HA   . SER A 1 98  ? 18.663  59.371  42.334  1.00 0.00 ?  89  SER A HA   4  
ATOM 6322  H HB2  . SER A 1 98  ? 18.645  58.272  44.572  1.00 0.00 ?  89  SER A HB2  4  
ATOM 6323  H HB3  . SER A 1 98  ? 20.264  58.494  44.016  1.00 0.00 ?  89  SER A HB3  4  
ATOM 6324  H HG   . SER A 1 98  ? 20.150  60.473  45.553  1.00 0.00 ?  89  SER A HG   4  
ATOM 6325  N N    . ASP A 1 99  ? 16.371  59.575  43.136  1.00 0.00 ?  90  ASP A N    4  
ATOM 6326  C CA   . ASP A 1 99  ? 14.927  59.755  43.404  1.00 0.00 ?  90  ASP A CA   4  
ATOM 6327  C C    . ASP A 1 99  ? 14.486  59.419  44.805  1.00 0.00 ?  90  ASP A C    4  
ATOM 6328  O O    . ASP A 1 99  ? 14.949  58.493  45.444  1.00 0.00 ?  90  ASP A O    4  
ATOM 6329  C CB   . ASP A 1 99  ? 14.154  59.132  42.230  1.00 0.00 ?  90  ASP A CB   4  
ATOM 6330  C CG   . ASP A 1 99  ? 12.648  58.825  42.359  1.00 0.00 ?  90  ASP A CG   4  
ATOM 6331  O OD1  . ASP A 1 99  ? 12.346  58.054  43.272  1.00 0.00 ?  90  ASP A OD1  4  
ATOM 6332  O OD2  . ASP A 1 99  ? 11.836  59.317  41.544  1.00 0.00 -1 90  ASP A OD2  4  
ATOM 6333  H H    . ASP A 1 99  ? 16.678  58.834  42.523  1.00 0.00 ?  90  ASP A H    4  
ATOM 6334  H HA   . ASP A 1 99  ? 14.656  60.811  43.376  1.00 0.00 ?  90  ASP A HA   4  
ATOM 6335  H HB2  . ASP A 1 99  ? 14.289  59.747  41.341  1.00 0.00 ?  90  ASP A HB2  4  
ATOM 6336  H HB3  . ASP A 1 99  ? 14.615  58.181  41.960  1.00 0.00 ?  90  ASP A HB3  4  
ATOM 6337  N N    . PRO A 1 100 ? 13.573  60.278  45.420  1.00 0.00 ?  91  PRO A N    4  
ATOM 6338  C CA   . PRO A 1 100 ? 13.130  60.020  46.839  1.00 0.00 ?  91  PRO A CA   4  
ATOM 6339  C C    . PRO A 1 100 ? 12.340  58.755  47.232  1.00 0.00 ?  91  PRO A C    4  
ATOM 6340  O O    . PRO A 1 100 ? 12.176  58.616  48.420  1.00 0.00 ?  91  PRO A O    4  
ATOM 6341  C CB   . PRO A 1 100 ? 12.221  61.244  47.232  1.00 0.00 ?  91  PRO A CB   4  
ATOM 6342  C CG   . PRO A 1 100 ? 11.614  61.632  45.969  1.00 0.00 ?  91  PRO A CG   4  
ATOM 6343  C CD   . PRO A 1 100 ? 12.655  61.250  44.876  1.00 0.00 ?  91  PRO A CD   4  
ATOM 6344  H HA   . PRO A 1 100 ? 14.053  59.953  47.414  1.00 0.00 ?  91  PRO A HA   4  
ATOM 6345  H HB2  . PRO A 1 100 ? 11.383  61.079  47.911  1.00 0.00 ?  91  PRO A HB2  4  
ATOM 6346  H HB3  . PRO A 1 100 ? 12.843  61.967  47.762  1.00 0.00 ?  91  PRO A HB3  4  
ATOM 6347  H HG2  . PRO A 1 100 ? 10.622  61.208  45.822  1.00 0.00 ?  91  PRO A HG2  4  
ATOM 6348  H HG3  . PRO A 1 100 ? 11.459  62.711  45.972  1.00 0.00 ?  91  PRO A HG3  4  
ATOM 6349  H HD2  . PRO A 1 100 ? 12.178  60.898  43.961  1.00 0.00 ?  91  PRO A HD2  4  
ATOM 6350  H HD3  . PRO A 1 100 ? 13.199  62.176  44.692  1.00 0.00 ?  91  PRO A HD3  4  
ATOM 6351  N N    . TYR A 1 101 ? 11.984  57.848  46.321  1.00 0.00 ?  92  TYR A N    4  
ATOM 6352  C CA   . TYR A 1 101 ? 11.583  56.479  46.682  1.00 0.00 ?  92  TYR A CA   4  
ATOM 6353  C C    . TYR A 1 101 ? 12.357  55.372  46.070  1.00 0.00 ?  92  TYR A C    4  
ATOM 6354  O O    . TYR A 1 101 ? 12.580  54.336  46.754  1.00 0.00 ?  92  TYR A O    4  
ATOM 6355  C CB   . TYR A 1 101 ? 9.978   56.298  46.628  1.00 0.00 ?  92  TYR A CB   4  
ATOM 6356  C CG   . TYR A 1 101 ? 9.428   54.915  46.673  1.00 0.00 ?  92  TYR A CG   4  
ATOM 6357  C CD1  . TYR A 1 101 ? 9.228   54.153  45.437  1.00 0.00 ?  92  TYR A CD1  4  
ATOM 6358  C CD2  . TYR A 1 101 ? 9.129   54.420  47.962  1.00 0.00 ?  92  TYR A CD2  4  
ATOM 6359  C CE1  . TYR A 1 101 ? 8.721   52.903  45.584  1.00 0.00 ?  92  TYR A CE1  4  
ATOM 6360  C CE2  . TYR A 1 101 ? 8.603   53.102  48.018  1.00 0.00 ?  92  TYR A CE2  4  
ATOM 6361  C CZ   . TYR A 1 101 ? 8.505   52.337  46.818  1.00 0.00 ?  92  TYR A CZ   4  
ATOM 6362  O OH   . TYR A 1 101 ? 8.000   51.084  46.887  1.00 0.00 ?  92  TYR A OH   4  
ATOM 6363  H H    . TYR A 1 101 ? 12.006  58.119  45.348  1.00 0.00 ?  92  TYR A H    4  
ATOM 6364  H HA   . TYR A 1 101 ? 11.908  56.339  47.713  1.00 0.00 ?  92  TYR A HA   4  
ATOM 6365  H HB2  . TYR A 1 101 ? 9.454   56.877  47.389  1.00 0.00 ?  92  TYR A HB2  4  
ATOM 6366  H HB3  . TYR A 1 101 ? 9.536   56.657  45.699  1.00 0.00 ?  92  TYR A HB3  4  
ATOM 6367  H HD1  . TYR A 1 101 ? 9.365   54.682  44.506  1.00 0.00 ?  92  TYR A HD1  4  
ATOM 6368  H HD2  . TYR A 1 101 ? 9.069   55.101  48.798  1.00 0.00 ?  92  TYR A HD2  4  
ATOM 6369  H HE1  . TYR A 1 101 ? 8.461   52.345  44.697  1.00 0.00 ?  92  TYR A HE1  4  
ATOM 6370  H HE2  . TYR A 1 101 ? 8.281   52.661  48.951  1.00 0.00 ?  92  TYR A HE2  4  
ATOM 6371  H HH   . TYR A 1 101 ? 8.024   50.614  46.051  1.00 0.00 ?  92  TYR A HH   4  
ATOM 6372  N N    . HIS A 1 102 ? 13.063  55.673  44.952  1.00 0.00 ?  93  HIS A N    4  
ATOM 6373  C CA   . HIS A 1 102 ? 14.091  54.784  44.316  1.00 0.00 ?  93  HIS A CA   4  
ATOM 6374  C C    . HIS A 1 102 ? 15.170  54.402  45.355  1.00 0.00 ?  93  HIS A C    4  
ATOM 6375  O O    . HIS A 1 102 ? 15.616  53.230  45.442  1.00 0.00 ?  93  HIS A O    4  
ATOM 6376  C CB   . HIS A 1 102 ? 14.694  55.472  43.064  1.00 0.00 ?  93  HIS A CB   4  
ATOM 6377  C CG   . HIS A 1 102 ? 15.983  54.827  42.644  1.00 0.00 ?  93  HIS A CG   4  
ATOM 6378  N ND1  . HIS A 1 102 ? 16.175  53.505  42.161  1.00 0.00 ?  93  HIS A ND1  4  
ATOM 6379  C CD2  . HIS A 1 102 ? 17.163  55.505  42.727  1.00 0.00 ?  93  HIS A CD2  4  
ATOM 6380  C CE1  . HIS A 1 102 ? 17.542  53.449  42.011  1.00 0.00 ?  93  HIS A CE1  4  
ATOM 6381  N NE2  . HIS A 1 102 ? 18.182  54.589  42.468  1.00 0.00 ?  93  HIS A NE2  4  
ATOM 6382  H H    . HIS A 1 102 ? 12.894  56.569  44.516  1.00 0.00 ?  93  HIS A H    4  
ATOM 6383  H HA   . HIS A 1 102 ? 13.732  53.834  43.922  1.00 0.00 ?  93  HIS A HA   4  
ATOM 6384  H HB2  . HIS A 1 102 ? 14.004  55.423  42.221  1.00 0.00 ?  93  HIS A HB2  4  
ATOM 6385  H HB3  . HIS A 1 102 ? 14.961  56.483  43.369  1.00 0.00 ?  93  HIS A HB3  4  
ATOM 6386  H HD2  . HIS A 1 102 ? 17.299  56.550  42.965  1.00 0.00 ?  93  HIS A HD2  4  
ATOM 6387  H HE1  . HIS A 1 102 ? 18.066  52.568  41.672  1.00 0.00 ?  93  HIS A HE1  4  
ATOM 6388  H HE2  . HIS A 1 102 ? 19.175  54.767  42.404  1.00 0.00 ?  93  HIS A HE2  4  
ATOM 6389  N N    . VAL A 1 103 ? 15.614  55.304  46.274  1.00 0.00 ?  94  VAL A N    4  
ATOM 6390  C CA   . VAL A 1 103 ? 16.558  55.019  47.366  1.00 0.00 ?  94  VAL A CA   4  
ATOM 6391  C C    . VAL A 1 103 ? 16.077  54.107  48.433  1.00 0.00 ?  94  VAL A C    4  
ATOM 6392  O O    . VAL A 1 103 ? 16.975  53.494  49.053  1.00 0.00 ?  94  VAL A O    4  
ATOM 6393  C CB   . VAL A 1 103 ? 17.118  56.279  48.052  1.00 0.00 ?  94  VAL A CB   4  
ATOM 6394  C CG1  . VAL A 1 103 ? 17.741  57.133  46.928  1.00 0.00 ?  94  VAL A CG1  4  
ATOM 6395  C CG2  . VAL A 1 103 ? 16.006  57.207  48.611  1.00 0.00 ?  94  VAL A CG2  4  
ATOM 6396  H H    . VAL A 1 103 ? 15.198  56.223  46.230  1.00 0.00 ?  94  VAL A H    4  
ATOM 6397  H HA   . VAL A 1 103 ? 17.340  54.442  46.872  1.00 0.00 ?  94  VAL A HA   4  
ATOM 6398  H HB   . VAL A 1 103 ? 17.860  56.071  48.824  1.00 0.00 ?  94  VAL A HB   4  
ATOM 6399  H HG11 . VAL A 1 103 ? 17.134  57.296  46.038  1.00 0.00 ?  94  VAL A HG11 4  
ATOM 6400  H HG12 . VAL A 1 103 ? 18.132  58.076  47.311  1.00 0.00 ?  94  VAL A HG12 4  
ATOM 6401  H HG13 . VAL A 1 103 ? 18.660  56.583  46.728  1.00 0.00 ?  94  VAL A HG13 4  
ATOM 6402  H HG21 . VAL A 1 103 ? 16.456  57.889  49.332  1.00 0.00 ?  94  VAL A HG21 4  
ATOM 6403  H HG22 . VAL A 1 103 ? 15.439  57.788  47.884  1.00 0.00 ?  94  VAL A HG22 4  
ATOM 6404  H HG23 . VAL A 1 103 ? 15.378  56.622  49.282  1.00 0.00 ?  94  VAL A HG23 4  
ATOM 6405  N N    . TYR A 1 104 ? 14.776  53.939  48.541  1.00 0.00 ?  95  TYR A N    4  
ATOM 6406  C CA   . TYR A 1 104 ? 14.152  52.956  49.480  1.00 0.00 ?  95  TYR A CA   4  
ATOM 6407  C C    . TYR A 1 104 ? 14.160  51.481  48.929  1.00 0.00 ?  95  TYR A C    4  
ATOM 6408  O O    . TYR A 1 104 ? 13.826  50.474  49.600  1.00 0.00 ?  95  TYR A O    4  
ATOM 6409  C CB   . TYR A 1 104 ? 12.872  53.474  50.104  1.00 0.00 ?  95  TYR A CB   4  
ATOM 6410  C CG   . TYR A 1 104 ? 12.968  54.521  51.192  1.00 0.00 ?  95  TYR A CG   4  
ATOM 6411  C CD1  . TYR A 1 104 ? 13.285  54.090  52.482  1.00 0.00 ?  95  TYR A CD1  4  
ATOM 6412  C CD2  . TYR A 1 104 ? 12.897  55.880  50.875  1.00 0.00 ?  95  TYR A CD2  4  
ATOM 6413  C CE1  . TYR A 1 104 ? 13.527  55.020  53.451  1.00 0.00 ?  95  TYR A CE1  4  
ATOM 6414  C CE2  . TYR A 1 104 ? 12.955  56.875  51.812  1.00 0.00 ?  95  TYR A CE2  4  
ATOM 6415  C CZ   . TYR A 1 104 ? 13.412  56.461  53.120  1.00 0.00 ?  95  TYR A CZ   4  
ATOM 6416  O OH   . TYR A 1 104 ? 13.577  57.370  54.124  1.00 0.00 ?  95  TYR A OH   4  
ATOM 6417  H H    . TYR A 1 104 ? 14.148  54.264  47.821  1.00 0.00 ?  95  TYR A H    4  
ATOM 6418  H HA   . TYR A 1 104 ? 14.848  52.887  50.317  1.00 0.00 ?  95  TYR A HA   4  
ATOM 6419  H HB2  . TYR A 1 104 ? 12.175  53.845  49.353  1.00 0.00 ?  95  TYR A HB2  4  
ATOM 6420  H HB3  . TYR A 1 104 ? 12.395  52.575  50.495  1.00 0.00 ?  95  TYR A HB3  4  
ATOM 6421  H HD1  . TYR A 1 104 ? 13.391  53.019  52.574  1.00 0.00 ?  95  TYR A HD1  4  
ATOM 6422  H HD2  . TYR A 1 104 ? 12.745  56.134  49.836  1.00 0.00 ?  95  TYR A HD2  4  
ATOM 6423  H HE1  . TYR A 1 104 ? 13.637  54.762  54.494  1.00 0.00 ?  95  TYR A HE1  4  
ATOM 6424  H HE2  . TYR A 1 104 ? 12.796  57.934  51.669  1.00 0.00 ?  95  TYR A HE2  4  
ATOM 6425  H HH   . TYR A 1 104 ? 13.383  57.018  54.996  1.00 0.00 ?  95  TYR A HH   4  
ATOM 6426  N N    . ILE A 1 105 ? 14.597  51.346  47.660  1.00 0.00 ?  96  ILE A N    4  
ATOM 6427  C CA   . ILE A 1 105 ? 14.582  50.111  46.844  1.00 0.00 ?  96  ILE A CA   4  
ATOM 6428  C C    . ILE A 1 105 ? 15.941  49.616  46.922  1.00 0.00 ?  96  ILE A C    4  
ATOM 6429  O O    . ILE A 1 105 ? 16.879  50.171  46.315  1.00 0.00 ?  96  ILE A O    4  
ATOM 6430  C CB   . ILE A 1 105 ? 14.168  50.403  45.377  1.00 0.00 ?  96  ILE A CB   4  
ATOM 6431  C CG1  . ILE A 1 105 ? 12.896  51.211  45.068  1.00 0.00 ?  96  ILE A CG1  4  
ATOM 6432  C CG2  . ILE A 1 105 ? 14.123  49.113  44.512  1.00 0.00 ?  96  ILE A CG2  4  
ATOM 6433  C CD1  . ILE A 1 105 ? 11.649  50.897  45.875  1.00 0.00 ?  96  ILE A CD1  4  
ATOM 6434  H H    . ILE A 1 105 ? 14.912  52.185  47.197  1.00 0.00 ?  96  ILE A H    4  
ATOM 6435  H HA   . ILE A 1 105 ? 13.891  49.351  47.208  1.00 0.00 ?  96  ILE A HA   4  
ATOM 6436  H HB   . ILE A 1 105 ? 14.872  51.025  44.824  1.00 0.00 ?  96  ILE A HB   4  
ATOM 6437  H HG12 . ILE A 1 105 ? 13.138  52.274  45.089  1.00 0.00 ?  96  ILE A HG12 4  
ATOM 6438  H HG13 . ILE A 1 105 ? 12.555  51.131  44.036  1.00 0.00 ?  96  ILE A HG13 4  
ATOM 6439  H HG21 . ILE A 1 105 ? 13.853  49.554  43.552  1.00 0.00 ?  96  ILE A HG21 4  
ATOM 6440  H HG22 . ILE A 1 105 ? 15.112  48.681  44.358  1.00 0.00 ?  96  ILE A HG22 4  
ATOM 6441  H HG23 . ILE A 1 105 ? 13.584  48.281  44.965  1.00 0.00 ?  96  ILE A HG23 4  
ATOM 6442  H HD11 . ILE A 1 105 ? 11.732  51.017  46.955  1.00 0.00 ?  96  ILE A HD11 4  
ATOM 6443  H HD12 . ILE A 1 105 ? 10.980  51.690  45.540  1.00 0.00 ?  96  ILE A HD12 4  
ATOM 6444  H HD13 . ILE A 1 105 ? 11.151  49.984  45.548  1.00 0.00 ?  96  ILE A HD13 4  
ATOM 6445  N N    . LYS A 1 106 ? 16.177  48.579  47.807  1.00 0.00 ?  97  LYS A N    4  
ATOM 6446  C CA   . LYS A 1 106 ? 17.603  48.113  48.056  1.00 0.00 ?  97  LYS A CA   4  
ATOM 6447  C C    . LYS A 1 106 ? 18.190  47.237  46.964  1.00 0.00 ?  97  LYS A C    4  
ATOM 6448  O O    . LYS A 1 106 ? 19.430  47.280  46.743  1.00 0.00 ?  97  LYS A O    4  
ATOM 6449  C CB   . LYS A 1 106 ? 17.562  47.361  49.444  1.00 0.00 ?  97  LYS A CB   4  
ATOM 6450  C CG   . LYS A 1 106 ? 17.274  48.209  50.652  1.00 0.00 ?  97  LYS A CG   4  
ATOM 6451  C CD   . LYS A 1 106 ? 16.901  47.389  51.947  1.00 0.00 ?  97  LYS A CD   4  
ATOM 6452  C CE   . LYS A 1 106 ? 16.537  48.464  53.039  1.00 0.00 ?  97  LYS A CE   4  
ATOM 6453  N NZ   . LYS A 1 106 ? 16.481  47.831  54.404  1.00 0.00 1  97  LYS A NZ   4  
ATOM 6454  H H    . LYS A 1 106 ? 15.357  48.220  48.276  1.00 0.00 ?  97  LYS A H    4  
ATOM 6455  H HA   . LYS A 1 106 ? 18.230  48.989  48.222  1.00 0.00 ?  97  LYS A HA   4  
ATOM 6456  H HB2  . LYS A 1 106 ? 16.799  46.594  49.309  1.00 0.00 ?  97  LYS A HB2  4  
ATOM 6457  H HB3  . LYS A 1 106 ? 18.463  46.766  49.596  1.00 0.00 ?  97  LYS A HB3  4  
ATOM 6458  H HG2  . LYS A 1 106 ? 18.144  48.840  50.835  1.00 0.00 ?  97  LYS A HG2  4  
ATOM 6459  H HG3  . LYS A 1 106 ? 16.400  48.795  50.369  1.00 0.00 ?  97  LYS A HG3  4  
ATOM 6460  H HD2  . LYS A 1 106 ? 16.009  46.776  51.817  1.00 0.00 ?  97  LYS A HD2  4  
ATOM 6461  H HD3  . LYS A 1 106 ? 17.731  46.779  52.305  1.00 0.00 ?  97  LYS A HD3  4  
ATOM 6462  H HE2  . LYS A 1 106 ? 17.269  49.259  53.180  1.00 0.00 ?  97  LYS A HE2  4  
ATOM 6463  H HE3  . LYS A 1 106 ? 15.629  48.957  52.693  1.00 0.00 ?  97  LYS A HE3  4  
ATOM 6464  H HZ1  . LYS A 1 106 ? 17.370  47.461  54.711  1.00 0.00 ?  97  LYS A HZ1  4  
ATOM 6465  H HZ2  . LYS A 1 106 ? 16.221  48.443  55.164  1.00 0.00 ?  97  LYS A HZ2  4  
ATOM 6466  H HZ3  . LYS A 1 106 ? 15.817  47.070  54.435  1.00 0.00 ?  97  LYS A HZ3  4  
ATOM 6467  N N    . ASN A 1 107 ? 17.362  46.533  46.241  1.00 0.00 ?  98  ASN A N    4  
ATOM 6468  C CA   . ASN A 1 107 ? 17.643  45.585  45.118  1.00 0.00 ?  98  ASN A CA   4  
ATOM 6469  C C    . ASN A 1 107 ? 18.133  46.344  43.824  1.00 0.00 ?  98  ASN A C    4  
ATOM 6470  O O    . ASN A 1 107 ? 17.663  45.959  42.734  1.00 0.00 ?  98  ASN A O    4  
ATOM 6471  C CB   . ASN A 1 107 ? 16.511  44.598  44.832  1.00 0.00 ?  98  ASN A CB   4  
ATOM 6472  C CG   . ASN A 1 107 ? 16.343  43.533  45.878  1.00 0.00 ?  98  ASN A CG   4  
ATOM 6473  O OD1  . ASN A 1 107 ? 16.931  43.425  46.871  1.00 0.00 ?  98  ASN A OD1  4  
ATOM 6474  N ND2  . ASN A 1 107 ? 15.459  42.630  45.649  1.00 0.00 ?  98  ASN A ND2  4  
ATOM 6475  H H    . ASN A 1 107 ? 16.391  46.542  46.519  1.00 0.00 ?  98  ASN A H    4  
ATOM 6476  H HA   . ASN A 1 107 ? 18.513  45.003  45.421  1.00 0.00 ?  98  ASN A HA   4  
ATOM 6477  H HB2  . ASN A 1 107 ? 15.704  45.313  44.672  1.00 0.00 ?  98  ASN A HB2  4  
ATOM 6478  H HB3  . ASN A 1 107 ? 16.704  44.105  43.878  1.00 0.00 ?  98  ASN A HB3  4  
ATOM 6479  H HD21 . ASN A 1 107 ? 15.081  42.489  44.723  1.00 0.00 ?  98  ASN A HD21 4  
ATOM 6480  H HD22 . ASN A 1 107 ? 15.248  41.947  46.363  1.00 0.00 ?  98  ASN A HD22 4  
ATOM 6481  N N    . ARG A 1 108 ? 19.035  47.312  43.888  1.00 0.00 ?  99  ARG A N    4  
ATOM 6482  C CA   . ARG A 1 108 ? 19.679  48.201  42.925  1.00 0.00 ?  99  ARG A CA   4  
ATOM 6483  C C    . ARG A 1 108 ? 21.107  48.428  43.397  1.00 0.00 ?  99  ARG A C    4  
ATOM 6484  O O    . ARG A 1 108 ? 21.356  48.724  44.552  1.00 0.00 ?  99  ARG A O    4  
ATOM 6485  C CB   . ARG A 1 108 ? 18.866  49.516  42.765  1.00 0.00 ?  99  ARG A CB   4  
ATOM 6486  C CG   . ARG A 1 108 ? 17.324  49.448  42.568  1.00 0.00 ?  99  ARG A CG   4  
ATOM 6487  C CD   . ARG A 1 108 ? 16.925  48.827  41.214  1.00 0.00 ?  99  ARG A CD   4  
ATOM 6488  N NE   . ARG A 1 108 ? 15.496  48.599  41.016  1.00 0.00 ?  99  ARG A NE   4  
ATOM 6489  C CZ   . ARG A 1 108 ? 14.804  47.459  40.993  1.00 0.00 ?  99  ARG A CZ   4  
ATOM 6490  N NH1  . ARG A 1 108 ? 15.272  46.299  41.267  1.00 0.00 ?  99  ARG A NH1  4  
ATOM 6491  N NH2  . ARG A 1 108 ? 13.521  47.481  40.796  1.00 0.00 1  99  ARG A NH2  4  
ATOM 6492  H H    . ARG A 1 108 ? 19.422  47.553  44.789  1.00 0.00 ?  99  ARG A H    4  
ATOM 6493  H HA   . ARG A 1 108 ? 19.742  47.690  41.963  1.00 0.00 ?  99  ARG A HA   4  
ATOM 6494  H HB2  . ARG A 1 108 ? 19.231  50.157  43.568  1.00 0.00 ?  99  ARG A HB2  4  
ATOM 6495  H HB3  . ARG A 1 108 ? 19.223  50.030  41.872  1.00 0.00 ?  99  ARG A HB3  4  
ATOM 6496  H HG2  . ARG A 1 108 ? 16.930  48.992  43.476  1.00 0.00 ?  99  ARG A HG2  4  
ATOM 6497  H HG3  . ARG A 1 108 ? 16.913  50.457  42.610  1.00 0.00 ?  99  ARG A HG3  4  
ATOM 6498  H HD2  . ARG A 1 108 ? 17.308  49.410  40.377  1.00 0.00 ?  99  ARG A HD2  4  
ATOM 6499  H HD3  . ARG A 1 108 ? 17.455  47.883  41.088  1.00 0.00 ?  99  ARG A HD3  4  
ATOM 6500  H HE   . ARG A 1 108 ? 14.860  49.360  40.824  1.00 0.00 ?  99  ARG A HE   4  
ATOM 6501  H HH11 . ARG A 1 108 ? 16.159  46.122  41.714  1.00 0.00 ?  99  ARG A HH11 4  
ATOM 6502  H HH12 . ARG A 1 108 ? 14.621  45.529  41.326  1.00 0.00 ?  99  ARG A HH12 4  
ATOM 6503  H HH21 . ARG A 1 108 ? 13.232  48.388  40.456  1.00 0.00 ?  99  ARG A HH21 4  
ATOM 6504  H HH22 . ARG A 1 108 ? 12.875  46.719  40.948  1.00 0.00 ?  99  ARG A HH22 4  
ATOM 6505  N N    . VAL A 1 109 ? 22.097  48.314  42.494  1.00 0.00 ?  100 VAL A N    4  
ATOM 6506  C CA   . VAL A 1 109 ? 23.471  48.748  42.782  1.00 0.00 ?  100 VAL A CA   4  
ATOM 6507  C C    . VAL A 1 109 ? 23.744  50.271  42.757  1.00 0.00 ?  100 VAL A C    4  
ATOM 6508  O O    . VAL A 1 109 ? 23.141  50.958  41.969  1.00 0.00 ?  100 VAL A O    4  
ATOM 6509  C CB   . VAL A 1 109 ? 24.448  48.014  41.844  1.00 0.00 ?  100 VAL A CB   4  
ATOM 6510  C CG1  . VAL A 1 109 ? 24.670  48.497  40.392  1.00 0.00 ?  100 VAL A CG1  4  
ATOM 6511  C CG2  . VAL A 1 109 ? 25.873  47.930  42.421  1.00 0.00 ?  100 VAL A CG2  4  
ATOM 6512  H H    . VAL A 1 109 ? 21.894  48.136  41.521  1.00 0.00 ?  100 VAL A H    4  
ATOM 6513  H HA   . VAL A 1 109 ? 23.693  48.401  43.791  1.00 0.00 ?  100 VAL A HA   4  
ATOM 6514  H HB   . VAL A 1 109 ? 24.088  46.989  41.748  1.00 0.00 ?  100 VAL A HB   4  
ATOM 6515  H HG11 . VAL A 1 109 ? 23.682  48.571  39.939  1.00 0.00 ?  100 VAL A HG11 4  
ATOM 6516  H HG12 . VAL A 1 109 ? 25.173  49.461  40.312  1.00 0.00 ?  100 VAL A HG12 4  
ATOM 6517  H HG13 . VAL A 1 109 ? 25.277  47.774  39.848  1.00 0.00 ?  100 VAL A HG13 4  
ATOM 6518  H HG21 . VAL A 1 109 ? 26.342  48.910  42.332  1.00 0.00 ?  100 VAL A HG21 4  
ATOM 6519  H HG22 . VAL A 1 109 ? 25.673  47.601  43.441  1.00 0.00 ?  100 VAL A HG22 4  
ATOM 6520  H HG23 . VAL A 1 109 ? 26.572  47.207  42.002  1.00 0.00 ?  100 VAL A HG23 4  
ATOM 6521  N N    . SER A 1 110 ? 24.352  50.784  43.823  1.00 0.00 ?  101 SER A N    4  
ATOM 6522  C CA   . SER A 1 110 ? 24.652  52.172  43.980  1.00 0.00 ?  101 SER A CA   4  
ATOM 6523  C C    . SER A 1 110 ? 25.281  52.961  42.767  1.00 0.00 ?  101 SER A C    4  
ATOM 6524  O O    . SER A 1 110 ? 26.100  52.405  41.944  1.00 0.00 ?  101 SER A O    4  
ATOM 6525  C CB   . SER A 1 110 ? 25.499  52.364  45.212  1.00 0.00 ?  101 SER A CB   4  
ATOM 6526  O OG   . SER A 1 110 ? 25.442  53.754  45.634  1.00 0.00 ?  101 SER A OG   4  
ATOM 6527  H H    . SER A 1 110 ? 24.752  50.145  44.495  1.00 0.00 ?  101 SER A H    4  
ATOM 6528  H HA   . SER A 1 110 ? 23.741  52.723  44.213  1.00 0.00 ?  101 SER A HA   4  
ATOM 6529  H HB2  . SER A 1 110 ? 24.856  51.854  45.930  1.00 0.00 ?  101 SER A HB2  4  
ATOM 6530  H HB3  . SER A 1 110 ? 26.468  51.866  45.212  1.00 0.00 ?  101 SER A HB3  4  
ATOM 6531  H HG   . SER A 1 110 ? 26.056  53.828  46.368  1.00 0.00 ?  101 SER A HG   4  
ATOM 6532  N N    . MET A 1 111 ? 24.873  54.213  42.465  1.00 0.00 ?  102 MET A N    4  
ATOM 6533  C CA   . MET A 1 111 ? 25.345  54.957  41.296  1.00 0.00 ?  102 MET A CA   4  
ATOM 6534  C C    . MET A 1 111 ? 26.694  55.659  41.569  1.00 0.00 ?  102 MET A C    4  
ATOM 6535  O O    . MET A 1 111 ? 26.941  56.165  42.661  1.00 0.00 ?  102 MET A O    4  
ATOM 6536  C CB   . MET A 1 111 ? 24.347  56.042  41.040  1.00 0.00 ?  102 MET A CB   4  
ATOM 6537  C CG   . MET A 1 111 ? 22.920  55.527  40.818  1.00 0.00 ?  102 MET A CG   4  
ATOM 6538  S SD   . MET A 1 111 ? 21.784  56.667  40.063  1.00 0.00 ?  102 MET A SD   4  
ATOM 6539  C CE   . MET A 1 111 ? 21.638  58.059  41.257  1.00 0.00 ?  102 MET A CE   4  
ATOM 6540  H H    . MET A 1 111 ? 24.427  54.757  43.190  1.00 0.00 ?  102 MET A H    4  
ATOM 6541  H HA   . MET A 1 111 ? 25.377  54.334  40.404  1.00 0.00 ?  102 MET A HA   4  
ATOM 6542  H HB2  . MET A 1 111 ? 24.204  56.774  41.835  1.00 0.00 ?  102 MET A HB2  4  
ATOM 6543  H HB3  . MET A 1 111 ? 24.719  56.542  40.145  1.00 0.00 ?  102 MET A HB3  4  
ATOM 6544  H HG2  . MET A 1 111 ? 22.942  54.635  40.193  1.00 0.00 ?  102 MET A HG2  4  
ATOM 6545  H HG3  . MET A 1 111 ? 22.446  55.354  41.784  1.00 0.00 ?  102 MET A HG3  4  
ATOM 6546  H HE1  . MET A 1 111 ? 20.780  58.661  40.959  1.00 0.00 ?  102 MET A HE1  4  
ATOM 6547  H HE2  . MET A 1 111 ? 21.335  57.565  42.181  1.00 0.00 ?  102 MET A HE2  4  
ATOM 6548  H HE3  . MET A 1 111 ? 22.590  58.591  41.264  1.00 0.00 ?  102 MET A HE3  4  
ATOM 6549  N N    . ILE A 1 112 ? 27.570  55.780  40.551  1.00 0.00 ?  103 ILE A N    4  
ATOM 6550  C CA   . ILE A 1 112 ? 28.870  56.493  40.705  1.00 0.00 ?  103 ILE A CA   4  
ATOM 6551  C C    . ILE A 1 112 ? 28.745  58.040  40.928  1.00 0.00 ?  103 ILE A C    4  
ATOM 6552  O O    . ILE A 1 112 ? 28.701  58.886  39.995  1.00 0.00 ?  103 ILE A O    4  
ATOM 6553  C CB   . ILE A 1 112 ? 29.863  56.208  39.523  1.00 0.00 ?  103 ILE A CB   4  
ATOM 6554  C CG1  . ILE A 1 112 ? 29.174  56.000  38.116  1.00 0.00 ?  103 ILE A CG1  4  
ATOM 6555  C CG2  . ILE A 1 112 ? 30.622  54.898  39.825  1.00 0.00 ?  103 ILE A CG2  4  
ATOM 6556  C CD1  . ILE A 1 112 ? 30.015  56.478  36.883  1.00 0.00 ?  103 ILE A CD1  4  
ATOM 6557  O OXT  . ILE A 1 112 ? 28.491  58.456  42.123  1.00 0.00 -1 103 ILE A OXT  4  
ATOM 6558  H H    . ILE A 1 112 ? 27.309  55.479  39.622  1.00 0.00 ?  103 ILE A H    4  
ATOM 6559  H HA   . ILE A 1 112 ? 29.421  56.174  41.591  1.00 0.00 ?  103 ILE A HA   4  
ATOM 6560  H HB   . ILE A 1 112 ? 30.580  57.020  39.400  1.00 0.00 ?  103 ILE A HB   4  
ATOM 6561  H HG12 . ILE A 1 112 ? 28.960  54.932  38.063  1.00 0.00 ?  103 ILE A HG12 4  
ATOM 6562  H HG13 . ILE A 1 112 ? 28.308  56.660  38.131  1.00 0.00 ?  103 ILE A HG13 4  
ATOM 6563  H HG21 . ILE A 1 112 ? 31.197  54.537  38.972  1.00 0.00 ?  103 ILE A HG21 4  
ATOM 6564  H HG22 . ILE A 1 112 ? 31.381  55.108  40.579  1.00 0.00 ?  103 ILE A HG22 4  
ATOM 6565  H HG23 . ILE A 1 112 ? 29.977  54.074  40.126  1.00 0.00 ?  103 ILE A HG23 4  
ATOM 6566  H HD11 . ILE A 1 112 ? 30.817  55.756  36.735  1.00 0.00 ?  103 ILE A HD11 4  
ATOM 6567  H HD12 . ILE A 1 112 ? 29.442  56.558  35.960  1.00 0.00 ?  103 ILE A HD12 4  
ATOM 6568  H HD13 . ILE A 1 112 ? 30.434  57.443  37.169  1.00 0.00 ?  103 ILE A HD13 4  
ATOM 6569  N N    . MET A 1 10  ? -19.497 115.881 115.662 1.00 0.00 ?  1   MET A N    5  
ATOM 6570  C CA   . MET A 1 10  ? -19.275 115.882 114.135 1.00 0.00 ?  1   MET A CA   5  
ATOM 6571  C C    . MET A 1 10  ? -20.518 116.385 113.357 1.00 0.00 ?  1   MET A C    5  
ATOM 6572  O O    . MET A 1 10  ? -21.177 115.644 112.590 1.00 0.00 ?  1   MET A O    5  
ATOM 6573  C CB   . MET A 1 10  ? -18.663 114.573 113.649 1.00 0.00 ?  1   MET A CB   5  
ATOM 6574  C CG   . MET A 1 10  ? -17.202 114.388 114.156 1.00 0.00 ?  1   MET A CG   5  
ATOM 6575  S SD   . MET A 1 10  ? -16.272 115.848 113.644 1.00 0.00 ?  1   MET A SD   5  
ATOM 6576  C CE   . MET A 1 10  ? -14.645 115.008 113.271 1.00 0.00 ?  1   MET A CE   5  
ATOM 6577  H H    . MET A 1 10  ? -20.259 115.317 116.011 1.00 0.00 ?  1   MET A H    5  
ATOM 6578  H HA   . MET A 1 10  ? -18.558 116.694 114.011 1.00 0.00 ?  1   MET A HA   5  
ATOM 6579  H HB2  . MET A 1 10  ? -19.256 113.704 113.933 1.00 0.00 ?  1   MET A HB2  5  
ATOM 6580  H HB3  . MET A 1 10  ? -18.625 114.582 112.559 1.00 0.00 ?  1   MET A HB3  5  
ATOM 6581  H HG2  . MET A 1 10  ? -17.310 114.376 115.241 1.00 0.00 ?  1   MET A HG2  5  
ATOM 6582  H HG3  . MET A 1 10  ? -16.782 113.459 113.772 1.00 0.00 ?  1   MET A HG3  5  
ATOM 6583  H HE1  . MET A 1 10  ? -14.386 114.366 114.114 1.00 0.00 ?  1   MET A HE1  5  
ATOM 6584  H HE2  . MET A 1 10  ? -14.750 114.455 112.339 1.00 0.00 ?  1   MET A HE2  5  
ATOM 6585  H HE3  . MET A 1 10  ? -13.844 115.747 113.251 1.00 0.00 ?  1   MET A HE3  5  
ATOM 6586  N N    . GLU A 1 11  ? -20.836 117.671 113.582 1.00 0.00 ?  2   GLU A N    5  
ATOM 6587  C CA   . GLU A 1 11  ? -21.877 118.456 112.914 1.00 0.00 ?  2   GLU A CA   5  
ATOM 6588  C C    . GLU A 1 11  ? -21.228 119.438 111.858 1.00 0.00 ?  2   GLU A C    5  
ATOM 6589  O O    . GLU A 1 11  ? -20.241 120.061 112.181 1.00 0.00 ?  2   GLU A O    5  
ATOM 6590  C CB   . GLU A 1 11  ? -22.777 119.065 113.991 1.00 0.00 ?  2   GLU A CB   5  
ATOM 6591  C CG   . GLU A 1 11  ? -23.768 120.188 113.564 1.00 0.00 ?  2   GLU A CG   5  
ATOM 6592  C CD   . GLU A 1 11  ? -24.909 120.438 114.533 1.00 0.00 ?  2   GLU A CD   5  
ATOM 6593  O OE1  . GLU A 1 11  ? -25.058 119.850 115.609 1.00 0.00 -1 2   GLU A OE1  5  
ATOM 6594  O OE2  . GLU A 1 11  ? -25.701 121.343 114.186 1.00 0.00 ?  2   GLU A OE2  5  
ATOM 6595  H H    . GLU A 1 11  ? -20.213 118.125 114.235 1.00 0.00 ?  2   GLU A H    5  
ATOM 6596  H HA   . GLU A 1 11  ? -22.416 117.703 112.338 1.00 0.00 ?  2   GLU A HA   5  
ATOM 6597  H HB2  . GLU A 1 11  ? -23.251 118.253 114.541 1.00 0.00 ?  2   GLU A HB2  5  
ATOM 6598  H HB3  . GLU A 1 11  ? -22.077 119.513 114.695 1.00 0.00 ?  2   GLU A HB3  5  
ATOM 6599  H HG2  . GLU A 1 11  ? -23.299 121.120 113.249 1.00 0.00 ?  2   GLU A HG2  5  
ATOM 6600  H HG3  . GLU A 1 11  ? -24.293 119.854 112.669 1.00 0.00 ?  2   GLU A HG3  5  
ATOM 6601  N N    . THR A 1 12  ? -21.970 119.798 110.842 1.00 0.00 ?  3   THR A N    5  
ATOM 6602  C CA   . THR A 1 12  ? -21.682 120.906 109.855 1.00 0.00 ?  3   THR A CA   5  
ATOM 6603  C C    . THR A 1 12  ? -21.602 122.310 110.563 1.00 0.00 ?  3   THR A C    5  
ATOM 6604  O O    . THR A 1 12  ? -22.401 122.665 111.418 1.00 0.00 ?  3   THR A O    5  
ATOM 6605  C CB   . THR A 1 12  ? -22.720 120.820 108.741 1.00 0.00 ?  3   THR A CB   5  
ATOM 6606  O OG1  . THR A 1 12  ? -22.645 119.576 108.167 1.00 0.00 ?  3   THR A OG1  5  
ATOM 6607  C CG2  . THR A 1 12  ? -22.586 121.814 107.537 1.00 0.00 ?  3   THR A CG2  5  
ATOM 6608  H H    . THR A 1 12  ? -22.660 119.097 110.618 1.00 0.00 ?  3   THR A H    5  
ATOM 6609  H HA   . THR A 1 12  ? -20.693 120.772 109.416 1.00 0.00 ?  3   THR A HA   5  
ATOM 6610  H HB   . THR A 1 12  ? -23.642 120.999 109.293 1.00 0.00 ?  3   THR A HB   5  
ATOM 6611  H HG1  . THR A 1 12  ? -23.543 119.330 107.933 1.00 0.00 ?  3   THR A HG1  5  
ATOM 6612  H HG21 . THR A 1 12  ? -21.521 121.788 107.303 1.00 0.00 ?  3   THR A HG21 5  
ATOM 6613  H HG22 . THR A 1 12  ? -23.240 121.517 106.718 1.00 0.00 ?  3   THR A HG22 5  
ATOM 6614  H HG23 . THR A 1 12  ? -22.833 122.810 107.905 1.00 0.00 ?  3   THR A HG23 5  
ATOM 6615  N N    . THR A 1 13  ? -20.626 123.131 110.103 1.00 0.00 ?  4   THR A N    5  
ATOM 6616  C CA   . THR A 1 13  ? -20.306 124.384 110.738 1.00 0.00 ?  4   THR A CA   5  
ATOM 6617  C C    . THR A 1 13  ? -19.718 125.461 109.843 1.00 0.00 ?  4   THR A C    5  
ATOM 6618  O O    . THR A 1 13  ? -19.128 125.225 108.792 1.00 0.00 ?  4   THR A O    5  
ATOM 6619  C CB   . THR A 1 13  ? -19.507 124.173 112.010 1.00 0.00 ?  4   THR A CB   5  
ATOM 6620  O OG1  . THR A 1 13  ? -19.816 125.154 112.910 1.00 0.00 ?  4   THR A OG1  5  
ATOM 6621  C CG2  . THR A 1 13  ? -17.978 124.100 111.802 1.00 0.00 ?  4   THR A CG2  5  
ATOM 6622  H H    . THR A 1 13  ? -19.928 122.796 109.455 1.00 0.00 ?  4   THR A H    5  
ATOM 6623  H HA   . THR A 1 13  ? -21.253 124.768 111.119 1.00 0.00 ?  4   THR A HA   5  
ATOM 6624  H HB   . THR A 1 13  ? -19.776 123.250 112.523 1.00 0.00 ?  4   THR A HB   5  
ATOM 6625  H HG1  . THR A 1 13  ? -20.502 124.706 113.409 1.00 0.00 ?  4   THR A HG1  5  
ATOM 6626  H HG21 . THR A 1 13  ? -17.682 123.292 111.134 1.00 0.00 ?  4   THR A HG21 5  
ATOM 6627  H HG22 . THR A 1 13  ? -17.584 125.045 111.427 1.00 0.00 ?  4   THR A HG22 5  
ATOM 6628  H HG23 . THR A 1 13  ? -17.538 124.065 112.798 1.00 0.00 ?  4   THR A HG23 5  
ATOM 6629  N N    . ASN A 1 14  ? -19.760 126.711 110.390 1.00 0.00 ?  5   ASN A N    5  
ATOM 6630  C CA   . ASN A 1 14  ? -19.066 127.919 109.900 1.00 0.00 ?  5   ASN A CA   5  
ATOM 6631  C C    . ASN A 1 14  ? -18.065 128.396 110.957 1.00 0.00 ?  5   ASN A C    5  
ATOM 6632  O O    . ASN A 1 14  ? -18.331 128.493 112.122 1.00 0.00 ?  5   ASN A O    5  
ATOM 6633  C CB   . ASN A 1 14  ? -20.071 128.980 109.507 1.00 0.00 ?  5   ASN A CB   5  
ATOM 6634  C CG   . ASN A 1 14  ? -19.472 130.180 108.933 1.00 0.00 ?  5   ASN A CG   5  
ATOM 6635  O OD1  . ASN A 1 14  ? -19.084 130.208 107.817 1.00 0.00 ?  5   ASN A OD1  5  
ATOM 6636  N ND2  . ASN A 1 14  ? -19.486 131.287 109.635 1.00 0.00 ?  5   ASN A ND2  5  
ATOM 6637  H H    . ASN A 1 14  ? -20.162 126.720 111.317 1.00 0.00 ?  5   ASN A H    5  
ATOM 6638  H HA   . ASN A 1 14  ? -18.401 127.684 109.068 1.00 0.00 ?  5   ASN A HA   5  
ATOM 6639  H HB2  . ASN A 1 14  ? -20.785 128.591 108.781 1.00 0.00 ?  5   ASN A HB2  5  
ATOM 6640  H HB3  . ASN A 1 14  ? -20.722 129.137 110.366 1.00 0.00 ?  5   ASN A HB3  5  
ATOM 6641  H HD21 . ASN A 1 14  ? -19.764 131.202 110.602 1.00 0.00 ?  5   ASN A HD21 5  
ATOM 6642  H HD22 . ASN A 1 14  ? -19.018 132.034 109.144 1.00 0.00 ?  5   ASN A HD22 5  
ATOM 6643  N N    . GLY A 1 15  ? -16.962 128.845 110.381 1.00 0.00 ?  6   GLY A N    5  
ATOM 6644  C CA   . GLY A 1 15  ? -15.860 129.399 111.141 1.00 0.00 ?  6   GLY A CA   5  
ATOM 6645  C C    . GLY A 1 15  ? -15.099 130.453 110.340 1.00 0.00 ?  6   GLY A C    5  
ATOM 6646  O O    . GLY A 1 15  ? -15.505 131.126 109.346 1.00 0.00 ?  6   GLY A O    5  
ATOM 6647  H H    . GLY A 1 15  ? -16.917 128.820 109.373 1.00 0.00 ?  6   GLY A H    5  
ATOM 6648  H HA2  . GLY A 1 15  ? -16.359 130.068 111.842 1.00 0.00 ?  6   GLY A HA2  5  
ATOM 6649  H HA3  . GLY A 1 15  ? -15.254 128.585 111.538 1.00 0.00 ?  6   GLY A HA3  5  
ATOM 6650  N N    . THR A 1 16  ? -13.817 130.620 110.781 1.00 0.00 ?  7   THR A N    5  
ATOM 6651  C CA   . THR A 1 16  ? -12.726 131.396 110.212 1.00 0.00 ?  7   THR A CA   5  
ATOM 6652  C C    . THR A 1 16  ? -12.289 131.052 108.815 1.00 0.00 ?  7   THR A C    5  
ATOM 6653  O O    . THR A 1 16  ? -12.448 129.915 108.405 1.00 0.00 ?  7   THR A O    5  
ATOM 6654  C CB   . THR A 1 16  ? -11.515 131.635 111.160 1.00 0.00 ?  7   THR A CB   5  
ATOM 6655  O OG1  . THR A 1 16  ? -10.661 130.551 110.935 1.00 0.00 ?  7   THR A OG1  5  
ATOM 6656  C CG2  . THR A 1 16  ? -11.870 131.773 112.617 1.00 0.00 ?  7   THR A CG2  5  
ATOM 6657  H H    . THR A 1 16  ? -13.600 130.152 111.649 1.00 0.00 ?  7   THR A H    5  
ATOM 6658  H HA   . THR A 1 16  ? -13.234 132.343 110.027 1.00 0.00 ?  7   THR A HA   5  
ATOM 6659  H HB   . THR A 1 16  ? -10.889 132.471 110.847 1.00 0.00 ?  7   THR A HB   5  
ATOM 6660  H HG1  . THR A 1 16  ? -9.756  130.684 111.228 1.00 0.00 ?  7   THR A HG1  5  
ATOM 6661  H HG21 . THR A 1 16  ? -12.650 132.532 112.667 1.00 0.00 ?  7   THR A HG21 5  
ATOM 6662  H HG22 . THR A 1 16  ? -12.173 130.827 113.065 1.00 0.00 ?  7   THR A HG22 5  
ATOM 6663  H HG23 . THR A 1 16  ? -10.928 132.076 113.074 1.00 0.00 ?  7   THR A HG23 5  
ATOM 6664  N N    . GLU A 1 17  ? -11.732 131.978 108.110 1.00 0.00 ?  8   GLU A N    5  
ATOM 6665  C CA   . GLU A 1 17  ? -11.131 131.664 106.798 1.00 0.00 ?  8   GLU A CA   5  
ATOM 6666  C C    . GLU A 1 17  ? -9.930  130.688 106.834 1.00 0.00 ?  8   GLU A C    5  
ATOM 6667  O O    . GLU A 1 17  ? -9.517  130.000 105.900 1.00 0.00 ?  8   GLU A O    5  
ATOM 6668  C CB   . GLU A 1 17  ? -10.705 132.911 105.958 1.00 0.00 ?  8   GLU A CB   5  
ATOM 6669  C CG   . GLU A 1 17  ? -11.772 133.919 105.462 1.00 0.00 ?  8   GLU A CG   5  
ATOM 6670  C CD   . GLU A 1 17  ? -12.776 133.468 104.437 1.00 0.00 ?  8   GLU A CD   5  
ATOM 6671  O OE1  . GLU A 1 17  ? -13.251 132.288 104.476 1.00 0.00 ?  8   GLU A OE1  5  
ATOM 6672  O OE2  . GLU A 1 17  ? -13.337 134.230 103.618 1.00 0.00 -1 8   GLU A OE2  5  
ATOM 6673  H H    . GLU A 1 17  ? -11.703 132.940 108.416 1.00 0.00 ?  8   GLU A H    5  
ATOM 6674  H HA   . GLU A 1 17  ? -11.907 131.164 106.219 1.00 0.00 ?  8   GLU A HA   5  
ATOM 6675  H HB2  . GLU A 1 17  ? -10.112 133.525 106.636 1.00 0.00 ?  8   GLU A HB2  5  
ATOM 6676  H HB3  . GLU A 1 17  ? -10.190 132.482 105.099 1.00 0.00 ?  8   GLU A HB3  5  
ATOM 6677  H HG2  . GLU A 1 17  ? -12.301 134.328 106.322 1.00 0.00 ?  8   GLU A HG2  5  
ATOM 6678  H HG3  . GLU A 1 17  ? -11.270 134.810 105.085 1.00 0.00 ?  8   GLU A HG3  5  
ATOM 6679  N N    . THR A 1 18  ? -9.252  130.675 108.004 1.00 0.00 ?  9   THR A N    5  
ATOM 6680  C CA   . THR A 1 18  ? -8.119  129.749 108.192 1.00 0.00 ?  9   THR A CA   5  
ATOM 6681  C C    . THR A 1 18  ? -8.665  128.417 108.516 1.00 0.00 ?  9   THR A C    5  
ATOM 6682  O O    . THR A 1 18  ? -8.132  127.385 108.087 1.00 0.00 ?  9   THR A O    5  
ATOM 6683  C CB   . THR A 1 18  ? -7.216  130.181 109.377 1.00 0.00 ?  9   THR A CB   5  
ATOM 6684  O OG1  . THR A 1 18  ? -7.897  130.572 110.573 1.00 0.00 ?  9   THR A OG1  5  
ATOM 6685  C CG2  . THR A 1 18  ? -6.453  131.320 109.001 1.00 0.00 ?  9   THR A CG2  5  
ATOM 6686  H H    . THR A 1 18  ? -9.568  131.279 108.749 1.00 0.00 ?  9   THR A H    5  
ATOM 6687  H HA   . THR A 1 18  ? -7.543  129.619 107.276 1.00 0.00 ?  9   THR A HA   5  
ATOM 6688  H HB   . THR A 1 18  ? -6.469  129.420 109.599 1.00 0.00 ?  9   THR A HB   5  
ATOM 6689  H HG1  . THR A 1 18  ? -7.299  130.227 111.241 1.00 0.00 ?  9   THR A HG1  5  
ATOM 6690  H HG21 . THR A 1 18  ? -5.983  131.255 108.021 1.00 0.00 ?  9   THR A HG21 5  
ATOM 6691  H HG22 . THR A 1 18  ? -7.019  132.246 109.104 1.00 0.00 ?  9   THR A HG22 5  
ATOM 6692  H HG23 . THR A 1 18  ? -5.597  131.407 109.670 1.00 0.00 ?  9   THR A HG23 5  
ATOM 6693  N N    . TRP A 1 19  ? -9.791  128.282 109.261 1.00 0.00 ?  10  TRP A N    5  
ATOM 6694  C CA   . TRP A 1 19  ? -10.538 126.983 109.456 1.00 0.00 ?  10  TRP A CA   5  
ATOM 6695  C C    . TRP A 1 19  ? -11.074 126.406 108.152 1.00 0.00 ?  10  TRP A C    5  
ATOM 6696  O O    . TRP A 1 19  ? -10.844 125.230 107.944 1.00 0.00 ?  10  TRP A O    5  
ATOM 6697  C CB   . TRP A 1 19  ? -11.673 127.255 110.450 1.00 0.00 ?  10  TRP A CB   5  
ATOM 6698  C CG   . TRP A 1 19  ? -12.800 126.281 110.425 1.00 0.00 ?  10  TRP A CG   5  
ATOM 6699  C CD1  . TRP A 1 19  ? -12.783 125.083 111.021 1.00 0.00 ?  10  TRP A CD1  5  
ATOM 6700  C CD2  . TRP A 1 19  ? -13.931 126.278 109.524 1.00 0.00 ?  10  TRP A CD2  5  
ATOM 6701  N NE1  . TRP A 1 19  ? -13.874 124.348 110.601 1.00 0.00 ?  10  TRP A NE1  5  
ATOM 6702  C CE2  . TRP A 1 19  ? -14.534 124.996 109.584 1.00 0.00 ?  10  TRP A CE2  5  
ATOM 6703  C CE3  . TRP A 1 19  ? -14.460 127.238 108.696 1.00 0.00 ?  10  TRP A CE3  5  
ATOM 6704  C CZ2  . TRP A 1 19  ? -15.752 124.776 108.747 1.00 0.00 ?  10  TRP A CZ2  5  
ATOM 6705  C CZ3  . TRP A 1 19  ? -15.569 126.978 107.975 1.00 0.00 ?  10  TRP A CZ3  5  
ATOM 6706  C CH2  . TRP A 1 19  ? -16.214 125.748 107.871 1.00 0.00 ?  10  TRP A CH2  5  
ATOM 6707  H H    . TRP A 1 19  ? -10.283 129.117 109.544 1.00 0.00 ?  10  TRP A H    5  
ATOM 6708  H HA   . TRP A 1 19  ? -9.921  126.214 109.923 1.00 0.00 ?  10  TRP A HA   5  
ATOM 6709  H HB2  . TRP A 1 19  ? -11.218 127.202 111.439 1.00 0.00 ?  10  TRP A HB2  5  
ATOM 6710  H HB3  . TRP A 1 19  ? -12.101 128.250 110.329 1.00 0.00 ?  10  TRP A HB3  5  
ATOM 6711  H HD1  . TRP A 1 19  ? -11.973 124.710 111.630 1.00 0.00 ?  10  TRP A HD1  5  
ATOM 6712  H HE1  . TRP A 1 19  ? -13.911 123.399 110.943 1.00 0.00 ?  10  TRP A HE1  5  
ATOM 6713  H HE3  . TRP A 1 19  ? -14.013 128.216 108.593 1.00 0.00 ?  10  TRP A HE3  5  
ATOM 6714  H HZ2  . TRP A 1 19  ? -16.177 123.783 108.781 1.00 0.00 ?  10  TRP A HZ2  5  
ATOM 6715  H HZ3  . TRP A 1 19  ? -15.902 127.836 107.409 1.00 0.00 ?  10  TRP A HZ3  5  
ATOM 6716  H HH2  . TRP A 1 19  ? -16.913 125.585 107.064 1.00 0.00 ?  10  TRP A HH2  5  
ATOM 6717  N N    . TYR A 1 20  ? -11.587 127.141 107.181 1.00 0.00 ?  11  TYR A N    5  
ATOM 6718  C CA   . TYR A 1 20  ? -11.991 126.634 105.810 1.00 0.00 ?  11  TYR A CA   5  
ATOM 6719  C C    . TYR A 1 20  ? -10.823 126.017 105.022 1.00 0.00 ?  11  TYR A C    5  
ATOM 6720  O O    . TYR A 1 20  ? -10.959 124.928 104.380 1.00 0.00 ?  11  TYR A O    5  
ATOM 6721  C CB   . TYR A 1 20  ? -12.883 127.745 105.141 1.00 0.00 ?  11  TYR A CB   5  
ATOM 6722  C CG   . TYR A 1 20  ? -13.183 127.661 103.697 1.00 0.00 ?  11  TYR A CG   5  
ATOM 6723  C CD1  . TYR A 1 20  ? -12.183 127.966 102.744 1.00 0.00 ?  11  TYR A CD1  5  
ATOM 6724  C CD2  . TYR A 1 20  ? -14.408 127.111 103.158 1.00 0.00 ?  11  TYR A CD2  5  
ATOM 6725  C CE1  . TYR A 1 20  ? -12.367 127.706 101.380 1.00 0.00 ?  11  TYR A CE1  5  
ATOM 6726  C CE2  . TYR A 1 20  ? -14.599 126.980 101.751 1.00 0.00 ?  11  TYR A CE2  5  
ATOM 6727  C CZ   . TYR A 1 20  ? -13.567 127.224 100.855 1.00 0.00 ?  11  TYR A CZ   5  
ATOM 6728  O OH   . TYR A 1 20  ? -13.700 127.023 99.521  1.00 0.00 ?  11  TYR A OH   5  
ATOM 6729  H H    . TYR A 1 20  ? -11.755 128.121 107.362 1.00 0.00 ?  11  TYR A H    5  
ATOM 6730  H HA   . TYR A 1 20  ? -12.710 125.843 106.024 1.00 0.00 ?  11  TYR A HA   5  
ATOM 6731  H HB2  . TYR A 1 20  ? -13.825 127.756 105.689 1.00 0.00 ?  11  TYR A HB2  5  
ATOM 6732  H HB3  . TYR A 1 20  ? -12.415 128.719 105.284 1.00 0.00 ?  11  TYR A HB3  5  
ATOM 6733  H HD1  . TYR A 1 20  ? -11.234 128.353 103.085 1.00 0.00 ?  11  TYR A HD1  5  
ATOM 6734  H HD2  . TYR A 1 20  ? -15.184 126.971 103.895 1.00 0.00 ?  11  TYR A HD2  5  
ATOM 6735  H HE1  . TYR A 1 20  ? -11.621 127.962 100.642 1.00 0.00 ?  11  TYR A HE1  5  
ATOM 6736  H HE2  . TYR A 1 20  ? -15.524 126.687 101.278 1.00 0.00 ?  11  TYR A HE2  5  
ATOM 6737  H HH   . TYR A 1 20  ? -14.292 126.283 99.363  1.00 0.00 ?  11  TYR A HH   5  
ATOM 6738  N N    . GLU A 1 21  ? -9.635  126.677 105.089 1.00 0.00 ?  12  GLU A N    5  
ATOM 6739  C CA   . GLU A 1 21  ? -8.358  126.253 104.362 1.00 0.00 ?  12  GLU A CA   5  
ATOM 6740  C C    . GLU A 1 21  ? -7.623  125.164 105.156 1.00 0.00 ?  12  GLU A C    5  
ATOM 6741  O O    . GLU A 1 21  ? -6.676  124.545 104.753 1.00 0.00 ?  12  GLU A O    5  
ATOM 6742  C CB   . GLU A 1 21  ? -7.399  127.438 104.144 1.00 0.00 ?  12  GLU A CB   5  
ATOM 6743  C CG   . GLU A 1 21  ? -7.779  128.355 103.039 1.00 0.00 ?  12  GLU A CG   5  
ATOM 6744  C CD   . GLU A 1 21  ? -7.857  127.839 101.614 1.00 0.00 ?  12  GLU A CD   5  
ATOM 6745  O OE1  . GLU A 1 21  ? -8.429  126.776 101.434 1.00 0.00 -1 12  GLU A OE1  5  
ATOM 6746  O OE2  . GLU A 1 21  ? -7.378  128.449 100.683 1.00 0.00 ?  12  GLU A OE2  5  
ATOM 6747  H H    . GLU A 1 21  ? -9.733  127.610 105.462 1.00 0.00 ?  12  GLU A H    5  
ATOM 6748  H HA   . GLU A 1 21  ? -8.632  125.807 103.405 1.00 0.00 ?  12  GLU A HA   5  
ATOM 6749  H HB2  . GLU A 1 21  ? -7.149  128.002 105.042 1.00 0.00 ?  12  GLU A HB2  5  
ATOM 6750  H HB3  . GLU A 1 21  ? -6.485  126.945 103.813 1.00 0.00 ?  12  GLU A HB3  5  
ATOM 6751  H HG2  . GLU A 1 21  ? -8.736  128.847 103.209 1.00 0.00 ?  12  GLU A HG2  5  
ATOM 6752  H HG3  . GLU A 1 21  ? -7.165  129.254 103.083 1.00 0.00 ?  12  GLU A HG3  5  
ATOM 6753  N N    . SER A 1 22  ? -8.063  124.946 106.456 1.00 0.00 ?  13  SER A N    5  
ATOM 6754  C CA   . SER A 1 22  ? -7.681  123.773 107.291 1.00 0.00 ?  13  SER A CA   5  
ATOM 6755  C C    . SER A 1 22  ? -8.474  122.456 106.971 1.00 0.00 ?  13  SER A C    5  
ATOM 6756  O O    . SER A 1 22  ? -7.963  121.321 106.701 1.00 0.00 ?  13  SER A O    5  
ATOM 6757  C CB   . SER A 1 22  ? -7.697  124.150 108.781 1.00 0.00 ?  13  SER A CB   5  
ATOM 6758  O OG   . SER A 1 22  ? -7.349  123.095 109.617 1.00 0.00 ?  13  SER A OG   5  
ATOM 6759  H H    . SER A 1 22  ? -8.969  125.351 106.644 1.00 0.00 ?  13  SER A H    5  
ATOM 6760  H HA   . SER A 1 22  ? -6.614  123.660 107.103 1.00 0.00 ?  13  SER A HA   5  
ATOM 6761  H HB2  . SER A 1 22  ? -6.985  124.951 108.985 1.00 0.00 ?  13  SER A HB2  5  
ATOM 6762  H HB3  . SER A 1 22  ? -8.690  124.523 109.032 1.00 0.00 ?  13  SER A HB3  5  
ATOM 6763  H HG   . SER A 1 22  ? -7.409  123.325 110.547 1.00 0.00 ?  13  SER A HG   5  
ATOM 6764  N N    . LEU A 1 23  ? -9.794  122.650 106.768 1.00 0.00 ?  14  LEU A N    5  
ATOM 6765  C CA   . LEU A 1 23  ? -10.728 121.666 106.213 1.00 0.00 ?  14  LEU A CA   5  
ATOM 6766  C C    . LEU A 1 23  ? -10.245 121.274 104.843 1.00 0.00 ?  14  LEU A C    5  
ATOM 6767  O O    . LEU A 1 23  ? -10.120 120.105 104.458 1.00 0.00 ?  14  LEU A O    5  
ATOM 6768  C CB   . LEU A 1 23  ? -12.192 122.218 106.223 1.00 0.00 ?  14  LEU A CB   5  
ATOM 6769  C CG   . LEU A 1 23  ? -13.284 121.441 105.469 1.00 0.00 ?  14  LEU A CG   5  
ATOM 6770  C CD1  . LEU A 1 23  ? -13.427 119.963 105.983 1.00 0.00 ?  14  LEU A CD1  5  
ATOM 6771  C CD2  . LEU A 1 23  ? -14.623 122.066 105.786 1.00 0.00 ?  14  LEU A CD2  5  
ATOM 6772  H H    . LEU A 1 23  ? -10.199 123.559 106.938 1.00 0.00 ?  14  LEU A H    5  
ATOM 6773  H HA   . LEU A 1 23  ? -10.685 120.722 106.757 1.00 0.00 ?  14  LEU A HA   5  
ATOM 6774  H HB2  . LEU A 1 23  ? -12.599 122.374 107.222 1.00 0.00 ?  14  LEU A HB2  5  
ATOM 6775  H HB3  . LEU A 1 23  ? -12.191 123.250 105.871 1.00 0.00 ?  14  LEU A HB3  5  
ATOM 6776  H HG   . LEU A 1 23  ? -13.251 121.494 104.380 1.00 0.00 ?  14  LEU A HG   5  
ATOM 6777  H HD11 . LEU A 1 23  ? -14.129 119.423 105.348 1.00 0.00 ?  14  LEU A HD11 5  
ATOM 6778  H HD12 . LEU A 1 23  ? -12.428 119.533 105.899 1.00 0.00 ?  14  LEU A HD12 5  
ATOM 6779  H HD13 . LEU A 1 23  ? -13.682 119.964 107.043 1.00 0.00 ?  14  LEU A HD13 5  
ATOM 6780  H HD21 . LEU A 1 23  ? -14.951 122.096 106.826 1.00 0.00 ?  14  LEU A HD21 5  
ATOM 6781  H HD22 . LEU A 1 23  ? -14.515 123.085 105.412 1.00 0.00 ?  14  LEU A HD22 5  
ATOM 6782  H HD23 . LEU A 1 23  ? -15.419 121.762 105.106 1.00 0.00 ?  14  LEU A HD23 5  
ATOM 6783  N N    . HIS A 1 24  ? -10.063 122.228 103.957 1.00 0.00 ?  15  HIS A N    5  
ATOM 6784  C CA   . HIS A 1 24  ? -9.568  121.998 102.597 1.00 0.00 ?  15  HIS A CA   5  
ATOM 6785  C C    . HIS A 1 24  ? -8.078  121.504 102.469 1.00 0.00 ?  15  HIS A C    5  
ATOM 6786  O O    . HIS A 1 24  ? -7.848  120.751 101.471 1.00 0.00 ?  15  HIS A O    5  
ATOM 6787  C CB   . HIS A 1 24  ? -9.782  123.186 101.648 1.00 0.00 ?  15  HIS A CB   5  
ATOM 6788  C CG   . HIS A 1 24  ? -11.172 123.213 101.169 1.00 0.00 ?  15  HIS A CG   5  
ATOM 6789  N ND1  . HIS A 1 24  ? -11.653 122.295 100.253 1.00 0.00 ?  15  HIS A ND1  5  
ATOM 6790  C CD2  . HIS A 1 24  ? -12.021 124.216 101.554 1.00 0.00 ?  15  HIS A CD2  5  
ATOM 6791  C CE1  . HIS A 1 24  ? -12.924 122.760 100.148 1.00 0.00 ?  15  HIS A CE1  5  
ATOM 6792  N NE2  . HIS A 1 24  ? -13.176 123.862 100.888 1.00 0.00 ?  15  HIS A NE2  5  
ATOM 6793  H H    . HIS A 1 24  ? -10.248 123.159 104.301 1.00 0.00 ?  15  HIS A H    5  
ATOM 6794  H HA   . HIS A 1 24  ? -10.197 121.314 102.028 1.00 0.00 ?  15  HIS A HA   5  
ATOM 6795  H HB2  . HIS A 1 24  ? -9.442  124.079 102.173 1.00 0.00 ?  15  HIS A HB2  5  
ATOM 6796  H HB3  . HIS A 1 24  ? -9.114  122.995 100.809 1.00 0.00 ?  15  HIS A HB3  5  
ATOM 6797  H HD2  . HIS A 1 24  ? -11.815 125.004 102.263 1.00 0.00 ?  15  HIS A HD2  5  
ATOM 6798  H HE1  . HIS A 1 24  ? -13.643 122.212 99.558  1.00 0.00 ?  15  HIS A HE1  5  
ATOM 6799  H HE2  . HIS A 1 24  ? -14.095 124.268 100.981 1.00 0.00 ?  15  HIS A HE2  5  
ATOM 6800  N N    . ALA A 1 25  ? -7.304  121.709 103.503 1.00 0.00 ?  16  ALA A N    5  
ATOM 6801  C CA   . ALA A 1 25  ? -6.024  120.995 103.535 1.00 0.00 ?  16  ALA A CA   5  
ATOM 6802  C C    . ALA A 1 25  ? -6.090  119.487 103.952 1.00 0.00 ?  16  ALA A C    5  
ATOM 6803  O O    . ALA A 1 25  ? -5.438  118.621 103.336 1.00 0.00 ?  16  ALA A O    5  
ATOM 6804  C CB   . ALA A 1 25  ? -4.926  121.754 104.269 1.00 0.00 ?  16  ALA A CB   5  
ATOM 6805  H H    . ALA A 1 25  ? -7.485  122.324 104.283 1.00 0.00 ?  16  ALA A H    5  
ATOM 6806  H HA   . ALA A 1 25  ? -5.679  120.822 102.516 1.00 0.00 ?  16  ALA A HA   5  
ATOM 6807  H HB1  . ALA A 1 25  ? -5.432  121.932 105.217 1.00 0.00 ?  16  ALA A HB1  5  
ATOM 6808  H HB2  . ALA A 1 25  ? -4.029  121.134 104.252 1.00 0.00 ?  16  ALA A HB2  5  
ATOM 6809  H HB3  . ALA A 1 25  ? -4.733  122.728 103.821 1.00 0.00 ?  16  ALA A HB3  5  
ATOM 6810  N N    . VAL A 1 26  ? -6.795  119.194 105.056 1.00 0.00 ?  17  VAL A N    5  
ATOM 6811  C CA   . VAL A 1 26  ? -7.006  117.811 105.500 1.00 0.00 ?  17  VAL A CA   5  
ATOM 6812  C C    . VAL A 1 26  ? -7.821  116.892 104.585 1.00 0.00 ?  17  VAL A C    5  
ATOM 6813  O O    . VAL A 1 26  ? -7.667  115.683 104.510 1.00 0.00 ?  17  VAL A O    5  
ATOM 6814  C CB   . VAL A 1 26  ? -7.369  117.796 106.990 1.00 0.00 ?  17  VAL A CB   5  
ATOM 6815  C CG1  . VAL A 1 26  ? -8.892  118.135 107.264 1.00 0.00 ?  17  VAL A CG1  5  
ATOM 6816  C CG2  . VAL A 1 26  ? -7.094  116.475 107.778 1.00 0.00 ?  17  VAL A CG2  5  
ATOM 6817  H H    . VAL A 1 26  ? -7.124  119.946 105.646 1.00 0.00 ?  17  VAL A H    5  
ATOM 6818  H HA   . VAL A 1 26  ? -5.955  117.538 105.583 1.00 0.00 ?  17  VAL A HA   5  
ATOM 6819  H HB   . VAL A 1 26  ? -6.749  118.553 107.470 1.00 0.00 ?  17  VAL A HB   5  
ATOM 6820  H HG11 . VAL A 1 26  ? -9.140  117.763 108.259 1.00 0.00 ?  17  VAL A HG11 5  
ATOM 6821  H HG12 . VAL A 1 26  ? -9.011  119.218 107.246 1.00 0.00 ?  17  VAL A HG12 5  
ATOM 6822  H HG13 . VAL A 1 26  ? -9.441  117.567 106.514 1.00 0.00 ?  17  VAL A HG13 5  
ATOM 6823  H HG21 . VAL A 1 26  ? -6.188  115.915 107.544 1.00 0.00 ?  17  VAL A HG21 5  
ATOM 6824  H HG22 . VAL A 1 26  ? -7.082  116.740 108.835 1.00 0.00 ?  17  VAL A HG22 5  
ATOM 6825  H HG23 . VAL A 1 26  ? -7.965  115.837 107.622 1.00 0.00 ?  17  VAL A HG23 5  
ATOM 6826  N N    . LEU A 1 27  ? -8.713  117.498 103.841 1.00 0.00 ?  18  LEU A N    5  
ATOM 6827  C CA   . LEU A 1 27  ? -9.485  116.831 102.737 1.00 0.00 ?  18  LEU A CA   5  
ATOM 6828  C C    . LEU A 1 27  ? -8.567  116.440 101.615 1.00 0.00 ?  18  LEU A C    5  
ATOM 6829  O O    . LEU A 1 27  ? -8.632  115.280 101.148 1.00 0.00 ?  18  LEU A O    5  
ATOM 6830  C CB   . LEU A 1 27  ? -10.620 117.723 102.281 1.00 0.00 ?  18  LEU A CB   5  
ATOM 6831  C CG   . LEU A 1 27  ? -11.970 117.849 103.019 1.00 0.00 ?  18  LEU A CG   5  
ATOM 6832  C CD1  . LEU A 1 27  ? -12.757 119.129 102.452 1.00 0.00 ?  18  LEU A CD1  5  
ATOM 6833  C CD2  . LEU A 1 27  ? -12.783 116.565 102.804 1.00 0.00 ?  18  LEU A CD2  5  
ATOM 6834  H H    . LEU A 1 27  ? -8.950  118.433 104.141 1.00 0.00 ?  18  LEU A H    5  
ATOM 6835  H HA   . LEU A 1 27  ? -9.894  115.877 103.073 1.00 0.00 ?  18  LEU A HA   5  
ATOM 6836  H HB2  . LEU A 1 27  ? -10.332 118.773 102.242 1.00 0.00 ?  18  LEU A HB2  5  
ATOM 6837  H HB3  . LEU A 1 27  ? -10.781 117.550 101.216 1.00 0.00 ?  18  LEU A HB3  5  
ATOM 6838  H HG   . LEU A 1 27  ? -11.763 118.069 104.067 1.00 0.00 ?  18  LEU A HG   5  
ATOM 6839  H HD11 . LEU A 1 27  ? -13.748 119.018 102.894 1.00 0.00 ?  18  LEU A HD11 5  
ATOM 6840  H HD12 . LEU A 1 27  ? -12.161 120.013 102.676 1.00 0.00 ?  18  LEU A HD12 5  
ATOM 6841  H HD13 . LEU A 1 27  ? -12.955 119.037 101.384 1.00 0.00 ?  18  LEU A HD13 5  
ATOM 6842  H HD21 . LEU A 1 27  ? -13.840 116.677 103.047 1.00 0.00 ?  18  LEU A HD21 5  
ATOM 6843  H HD22 . LEU A 1 27  ? -12.667 116.113 101.818 1.00 0.00 ?  18  LEU A HD22 5  
ATOM 6844  H HD23 . LEU A 1 27  ? -12.396 115.821 103.501 1.00 0.00 ?  18  LEU A HD23 5  
ATOM 6845  N N    . LYS A 1 28  ? -7.632  117.308 101.170 1.00 0.00 ?  19  LYS A N    5  
ATOM 6846  C CA   . LYS A 1 28  ? -6.651  116.940 100.215 1.00 0.00 ?  19  LYS A CA   5  
ATOM 6847  C C    . LYS A 1 28  ? -5.654  115.883 100.682 1.00 0.00 ?  19  LYS A C    5  
ATOM 6848  O O    . LYS A 1 28  ? -5.335  115.004 99.883  1.00 0.00 ?  19  LYS A O    5  
ATOM 6849  C CB   . LYS A 1 28  ? -5.925  118.166 99.536  1.00 0.00 ?  19  LYS A CB   5  
ATOM 6850  C CG   . LYS A 1 28  ? -6.674  118.895 98.417  1.00 0.00 ?  19  LYS A CG   5  
ATOM 6851  C CD   . LYS A 1 28  ? -5.959  120.032 97.759  1.00 0.00 ?  19  LYS A CD   5  
ATOM 6852  C CE   . LYS A 1 28  ? -6.954  121.002 97.108  1.00 0.00 ?  19  LYS A CE   5  
ATOM 6853  N NZ   . LYS A 1 28  ? -7.778  121.721 98.108  1.00 0.00 1  19  LYS A NZ   5  
ATOM 6854  H H    . LYS A 1 28  ? -7.633  118.292 101.398 1.00 0.00 ?  19  LYS A H    5  
ATOM 6855  H HA   . LYS A 1 28  ? -7.153  116.569 99.321  1.00 0.00 ?  19  LYS A HA   5  
ATOM 6856  H HB2  . LYS A 1 28  ? -5.705  118.834 100.369 1.00 0.00 ?  19  LYS A HB2  5  
ATOM 6857  H HB3  . LYS A 1 28  ? -4.966  117.787 99.181  1.00 0.00 ?  19  LYS A HB3  5  
ATOM 6858  H HG2  . LYS A 1 28  ? -7.053  118.241 97.631  1.00 0.00 ?  19  LYS A HG2  5  
ATOM 6859  H HG3  . LYS A 1 28  ? -7.572  119.212 98.947  1.00 0.00 ?  19  LYS A HG3  5  
ATOM 6860  H HD2  . LYS A 1 28  ? -5.272  120.582 98.401  1.00 0.00 ?  19  LYS A HD2  5  
ATOM 6861  H HD3  . LYS A 1 28  ? -5.269  119.584 97.043  1.00 0.00 ?  19  LYS A HD3  5  
ATOM 6862  H HE2  . LYS A 1 28  ? -6.430  121.743 96.504  1.00 0.00 ?  19  LYS A HE2  5  
ATOM 6863  H HE3  . LYS A 1 28  ? -7.649  120.418 96.504  1.00 0.00 ?  19  LYS A HE3  5  
ATOM 6864  H HZ1  . LYS A 1 28  ? -8.561  122.148 97.633  1.00 0.00 ?  19  LYS A HZ1  5  
ATOM 6865  H HZ2  . LYS A 1 28  ? -8.030  121.078 98.844  1.00 0.00 ?  19  LYS A HZ2  5  
ATOM 6866  H HZ3  . LYS A 1 28  ? -7.118  122.402 98.457  1.00 0.00 ?  19  LYS A HZ3  5  
ATOM 6867  N N    . ALA A 1 29  ? -5.272  115.818 101.975 1.00 0.00 ?  20  ALA A N    5  
ATOM 6868  C CA   . ALA A 1 29  ? -4.596  114.708 102.602 1.00 0.00 ?  20  ALA A CA   5  
ATOM 6869  C C    . ALA A 1 29  ? -5.492  113.438 102.732 1.00 0.00 ?  20  ALA A C    5  
ATOM 6870  O O    . ALA A 1 29  ? -5.026  112.370 102.385 1.00 0.00 ?  20  ALA A O    5  
ATOM 6871  C CB   . ALA A 1 29  ? -4.041  115.115 104.025 1.00 0.00 ?  20  ALA A CB   5  
ATOM 6872  H H    . ALA A 1 29  ? -5.574  116.536 102.618 1.00 0.00 ?  20  ALA A H    5  
ATOM 6873  H HA   . ALA A 1 29  ? -3.829  114.389 101.896 1.00 0.00 ?  20  ALA A HA   5  
ATOM 6874  H HB1  . ALA A 1 29  ? -3.143  115.724 103.928 1.00 0.00 ?  20  ALA A HB1  5  
ATOM 6875  H HB2  . ALA A 1 29  ? -4.849  115.528 104.629 1.00 0.00 ?  20  ALA A HB2  5  
ATOM 6876  H HB3  . ALA A 1 29  ? -3.790  114.247 104.634 1.00 0.00 ?  20  ALA A HB3  5  
ATOM 6877  N N    . LEU A 1 30  ? -6.741  113.597 103.114 1.00 0.00 ?  21  LEU A N    5  
ATOM 6878  C CA   . LEU A 1 30  ? -7.732  112.443 103.284 1.00 0.00 ?  21  LEU A CA   5  
ATOM 6879  C C    . LEU A 1 30  ? -7.828  111.721 101.892 1.00 0.00 ?  21  LEU A C    5  
ATOM 6880  O O    . LEU A 1 30  ? -7.674  110.530 101.826 1.00 0.00 ?  21  LEU A O    5  
ATOM 6881  C CB   . LEU A 1 30  ? -9.072  112.843 103.751 1.00 0.00 ?  21  LEU A CB   5  
ATOM 6882  C CG   . LEU A 1 30  ? -10.203 111.872 103.613 1.00 0.00 ?  21  LEU A CG   5  
ATOM 6883  C CD1  . LEU A 1 30  ? -9.999  110.643 104.431 1.00 0.00 ?  21  LEU A CD1  5  
ATOM 6884  C CD2  . LEU A 1 30  ? -11.577 112.621 103.833 1.00 0.00 ?  21  LEU A CD2  5  
ATOM 6885  H H    . LEU A 1 30  ? -6.987  114.498 103.499 1.00 0.00 ?  21  LEU A H    5  
ATOM 6886  H HA   . LEU A 1 30  ? -7.405  111.725 104.035 1.00 0.00 ?  21  LEU A HA   5  
ATOM 6887  H HB2  . LEU A 1 30  ? -8.992  113.159 104.791 1.00 0.00 ?  21  LEU A HB2  5  
ATOM 6888  H HB3  . LEU A 1 30  ? -9.320  113.752 103.205 1.00 0.00 ?  21  LEU A HB3  5  
ATOM 6889  H HG   . LEU A 1 30  ? -10.284 111.499 102.592 1.00 0.00 ?  21  LEU A HG   5  
ATOM 6890  H HD11 . LEU A 1 30  ? -10.747 109.909 104.131 1.00 0.00 ?  21  LEU A HD11 5  
ATOM 6891  H HD12 . LEU A 1 30  ? -9.001  110.205 104.423 1.00 0.00 ?  21  LEU A HD12 5  
ATOM 6892  H HD13 . LEU A 1 30  ? -10.208 110.931 105.461 1.00 0.00 ?  21  LEU A HD13 5  
ATOM 6893  H HD21 . LEU A 1 30  ? -11.517 113.068 104.825 1.00 0.00 ?  21  LEU A HD21 5  
ATOM 6894  H HD22 . LEU A 1 30  ? -11.838 113.475 103.208 1.00 0.00 ?  21  LEU A HD22 5  
ATOM 6895  H HD23 . LEU A 1 30  ? -12.431 111.944 103.815 1.00 0.00 ?  21  LEU A HD23 5  
ATOM 6896  N N    . ASN A 1 31  ? -7.866  112.492 100.805 1.00 0.00 ?  22  ASN A N    5  
ATOM 6897  C CA   . ASN A 1 31  ? -7.879  112.192 99.411  1.00 0.00 ?  22  ASN A CA   5  
ATOM 6898  C C    . ASN A 1 31  ? -6.570  111.584 98.944  1.00 0.00 ?  22  ASN A C    5  
ATOM 6899  O O    . ASN A 1 31  ? -6.545  110.722 98.068  1.00 0.00 ?  22  ASN A O    5  
ATOM 6900  C CB   . ASN A 1 31  ? -8.433  113.355 98.570  1.00 0.00 ?  22  ASN A CB   5  
ATOM 6901  C CG   . ASN A 1 31  ? -9.990  113.394 98.641  1.00 0.00 ?  22  ASN A CG   5  
ATOM 6902  O OD1  . ASN A 1 31  ? -10.703 113.159 97.728  1.00 0.00 ?  22  ASN A OD1  5  
ATOM 6903  N ND2  . ASN A 1 31  ? -10.492 113.871 99.709  1.00 0.00 ?  22  ASN A ND2  5  
ATOM 6904  H H    . ASN A 1 31  ? -7.758  113.481 100.977 1.00 0.00 ?  22  ASN A H    5  
ATOM 6905  H HA   . ASN A 1 31  ? -8.617  111.391 99.353  1.00 0.00 ?  22  ASN A HA   5  
ATOM 6906  H HB2  . ASN A 1 31  ? -7.944  114.277 98.883  1.00 0.00 ?  22  ASN A HB2  5  
ATOM 6907  H HB3  . ASN A 1 31  ? -8.234  113.172 97.514  1.00 0.00 ?  22  ASN A HB3  5  
ATOM 6908  H HD21 . ASN A 1 31  ? -9.856  114.209 100.417 1.00 0.00 ?  22  ASN A HD21 5  
ATOM 6909  H HD22 . ASN A 1 31  ? -11.494 113.860 99.579  1.00 0.00 ?  22  ASN A HD22 5  
ATOM 6910  N N    . ALA A 1 32  ? -5.366  111.912 99.414  1.00 0.00 ?  23  ALA A N    5  
ATOM 6911  C CA   . ALA A 1 32  ? -4.070  111.330 99.011  1.00 0.00 ?  23  ALA A CA   5  
ATOM 6912  C C    . ALA A 1 32  ? -4.048  109.936 99.744  1.00 0.00 ?  23  ALA A C    5  
ATOM 6913  O O    . ALA A 1 32  ? -3.685  108.949 99.072  1.00 0.00 ?  23  ALA A O    5  
ATOM 6914  C CB   . ALA A 1 32  ? -2.955  112.259 99.571  1.00 0.00 ?  23  ALA A CB   5  
ATOM 6915  H H    . ALA A 1 32  ? -5.365  112.543 100.203 1.00 0.00 ?  23  ALA A H    5  
ATOM 6916  H HA   . ALA A 1 32  ? -3.971  111.070 97.958  1.00 0.00 ?  23  ALA A HA   5  
ATOM 6917  H HB1  . ALA A 1 32  ? -2.972  112.346 100.658 1.00 0.00 ?  23  ALA A HB1  5  
ATOM 6918  H HB2  . ALA A 1 32  ? -2.025  111.743 99.333  1.00 0.00 ?  23  ALA A HB2  5  
ATOM 6919  H HB3  . ALA A 1 32  ? -2.973  113.289 99.216  1.00 0.00 ?  23  ALA A HB3  5  
ATOM 6920  N N    . THR A 1 33  ? -4.396  109.864 101.080 1.00 0.00 ?  24  THR A N    5  
ATOM 6921  C CA   . THR A 1 33  ? -4.715  108.576 101.717 1.00 0.00 ?  24  THR A CA   5  
ATOM 6922  C C    . THR A 1 33  ? -5.623  107.712 100.903 1.00 0.00 ?  24  THR A C    5  
ATOM 6923  O O    . THR A 1 33  ? -5.438  106.497 100.754 1.00 0.00 ?  24  THR A O    5  
ATOM 6924  C CB   . THR A 1 33  ? -5.070  108.844 103.213 1.00 0.00 ?  24  THR A CB   5  
ATOM 6925  O OG1  . THR A 1 33  ? -4.379  109.820 103.909 1.00 0.00 ?  24  THR A OG1  5  
ATOM 6926  C CG2  . THR A 1 33  ? -5.009  107.554 104.006 1.00 0.00 ?  24  THR A CG2  5  
ATOM 6927  H H    . THR A 1 33  ? -4.584  110.715 101.592 1.00 0.00 ?  24  THR A H    5  
ATOM 6928  H HA   . THR A 1 33  ? -3.761  108.053 101.658 1.00 0.00 ?  24  THR A HA   5  
ATOM 6929  H HB   . THR A 1 33  ? -6.112  109.147 103.108 1.00 0.00 ?  24  THR A HB   5  
ATOM 6930  H HG1  . THR A 1 33  ? -5.006  110.256 104.488 1.00 0.00 ?  24  THR A HG1  5  
ATOM 6931  H HG21 . THR A 1 33  ? -5.937  106.991 103.900 1.00 0.00 ?  24  THR A HG21 5  
ATOM 6932  H HG22 . THR A 1 33  ? -4.161  106.950 103.683 1.00 0.00 ?  24  THR A HG22 5  
ATOM 6933  H HG23 . THR A 1 33  ? -4.816  107.729 105.064 1.00 0.00 ?  24  THR A HG23 5  
ATOM 6934  N N    . LEU A 1 34  ? -6.681  108.268 100.251 1.00 0.00 ?  25  LEU A N    5  
ATOM 6935  C CA   . LEU A 1 34  ? -7.702  107.482 99.516  1.00 0.00 ?  25  LEU A CA   5  
ATOM 6936  C C    . LEU A 1 34  ? -7.103  107.126 98.159  1.00 0.00 ?  25  LEU A C    5  
ATOM 6937  O O    . LEU A 1 34  ? -7.128  105.956 97.748  1.00 0.00 ?  25  LEU A O    5  
ATOM 6938  C CB   . LEU A 1 34  ? -9.029  108.248 99.480  1.00 0.00 ?  25  LEU A CB   5  
ATOM 6939  C CG   . LEU A 1 34  ? -9.898  108.072 100.730 1.00 0.00 ?  25  LEU A CG   5  
ATOM 6940  C CD1  . LEU A 1 34  ? -10.935 109.250 100.648 1.00 0.00 ?  25  LEU A CD1  5  
ATOM 6941  C CD2  . LEU A 1 34  ? -10.583 106.687 100.699 1.00 0.00 ?  25  LEU A CD2  5  
ATOM 6942  H H    . LEU A 1 34  ? -6.887  109.197 100.589 1.00 0.00 ?  25  LEU A H    5  
ATOM 6943  H HA   . LEU A 1 34  ? -7.758  106.550 100.078 1.00 0.00 ?  25  LEU A HA   5  
ATOM 6944  H HB2  . LEU A 1 34  ? -8.937  109.300 99.214  1.00 0.00 ?  25  LEU A HB2  5  
ATOM 6945  H HB3  . LEU A 1 34  ? -9.561  107.842 98.619  1.00 0.00 ?  25  LEU A HB3  5  
ATOM 6946  H HG   . LEU A 1 34  ? -9.321  108.208 101.645 1.00 0.00 ?  25  LEU A HG   5  
ATOM 6947  H HD11 . LEU A 1 34  ? -11.627 108.988 99.846  1.00 0.00 ?  25  LEU A HD11 5  
ATOM 6948  H HD12 . LEU A 1 34  ? -11.541 109.227 101.554 1.00 0.00 ?  25  LEU A HD12 5  
ATOM 6949  H HD13 . LEU A 1 34  ? -10.511 110.230 100.429 1.00 0.00 ?  25  LEU A HD13 5  
ATOM 6950  H HD21 . LEU A 1 34  ? -11.284 106.708 99.864  1.00 0.00 ?  25  LEU A HD21 5  
ATOM 6951  H HD22 . LEU A 1 34  ? -9.755  105.991 100.569 1.00 0.00 ?  25  LEU A HD22 5  
ATOM 6952  H HD23 . LEU A 1 34  ? -11.233 106.594 101.568 1.00 0.00 ?  25  LEU A HD23 5  
ATOM 6953  N N    . HIS A 1 35  ? -6.406  108.041 97.497  1.00 0.00 ?  26  HIS A N    5  
ATOM 6954  C CA   . HIS A 1 35  ? -5.775  107.773 96.198  1.00 0.00 ?  26  HIS A CA   5  
ATOM 6955  C C    . HIS A 1 35  ? -4.678  106.642 96.309  1.00 0.00 ?  26  HIS A C    5  
ATOM 6956  O O    . HIS A 1 35  ? -4.586  105.820 95.442  1.00 0.00 ?  26  HIS A O    5  
ATOM 6957  C CB   . HIS A 1 35  ? -5.140  109.051 95.679  1.00 0.00 ?  26  HIS A CB   5  
ATOM 6958  C CG   . HIS A 1 35  ? -4.736  109.000 94.219  1.00 0.00 ?  26  HIS A CG   5  
ATOM 6959  N ND1  . HIS A 1 35  ? -3.471  108.665 93.776  1.00 0.00 ?  26  HIS A ND1  5  
ATOM 6960  C CD2  . HIS A 1 35  ? -5.454  109.532 93.160  1.00 0.00 ?  26  HIS A CD2  5  
ATOM 6961  C CE1  . HIS A 1 35  ? -3.473  108.785 92.454  1.00 0.00 ?  26  HIS A CE1  5  
ATOM 6962  N NE2  . HIS A 1 35  ? -4.624  109.294 92.106  1.00 0.00 ?  26  HIS A NE2  5  
ATOM 6963  H H    . HIS A 1 35  ? -6.596  109.006 97.725  1.00 0.00 ?  26  HIS A H    5  
ATOM 6964  H HA   . HIS A 1 35  ? -6.497  107.377 95.483  1.00 0.00 ?  26  HIS A HA   5  
ATOM 6965  H HB2  . HIS A 1 35  ? -5.769  109.921 95.868  1.00 0.00 ?  26  HIS A HB2  5  
ATOM 6966  H HB3  . HIS A 1 35  ? -4.187  109.249 96.169  1.00 0.00 ?  26  HIS A HB3  5  
ATOM 6967  H HD2  . HIS A 1 35  ? -6.435  109.969 93.042  1.00 0.00 ?  26  HIS A HD2  5  
ATOM 6968  H HE1  . HIS A 1 35  ? -2.634  108.711 91.780  1.00 0.00 ?  26  HIS A HE1  5  
ATOM 6969  H HE2  . HIS A 1 35  ? -4.854  109.538 91.153  1.00 0.00 ?  26  HIS A HE2  5  
ATOM 6970  N N    . SER A 1 36  ? -4.029  106.583 97.408  1.00 0.00 ?  27  SER A N    5  
ATOM 6971  C CA   . SER A 1 36  ? -3.089  105.554 97.737  1.00 0.00 ?  27  SER A CA   5  
ATOM 6972  C C    . SER A 1 36  ? -3.785  104.193 97.796  1.00 0.00 ?  27  SER A C    5  
ATOM 6973  O O    . SER A 1 36  ? -3.226  103.201 97.239  1.00 0.00 ?  27  SER A O    5  
ATOM 6974  C CB   . SER A 1 36  ? -2.339  105.690 99.044  1.00 0.00 ?  27  SER A CB   5  
ATOM 6975  O OG   . SER A 1 36  ? -1.684  104.430 99.388  1.00 0.00 ?  27  SER A OG   5  
ATOM 6976  H H    . SER A 1 36  ? -4.320  107.222 98.134  1.00 0.00 ?  27  SER A H    5  
ATOM 6977  H HA   . SER A 1 36  ? -2.347  105.508 96.940  1.00 0.00 ?  27  SER A HA   5  
ATOM 6978  H HB2  . SER A 1 36  ? -1.536  106.424 98.967  1.00 0.00 ?  27  SER A HB2  5  
ATOM 6979  H HB3  . SER A 1 36  ? -3.086  105.915 99.805  1.00 0.00 ?  27  SER A HB3  5  
ATOM 6980  H HG   . SER A 1 36  ? -1.038  104.282 98.693  1.00 0.00 ?  27  SER A HG   5  
ATOM 6981  N N    . ASN A 1 37  ? -4.952  104.109 98.375  1.00 0.00 ?  28  ASN A N    5  
ATOM 6982  C CA   . ASN A 1 37  ? -5.617  102.840 98.608  1.00 0.00 ?  28  ASN A CA   5  
ATOM 6983  C C    . ASN A 1 37  ? -6.369  102.392 97.389  1.00 0.00 ?  28  ASN A C    5  
ATOM 6984  O O    . ASN A 1 37  ? -6.908  101.313 97.416  1.00 0.00 ?  28  ASN A O    5  
ATOM 6985  C CB   . ASN A 1 37  ? -6.552  103.063 99.745  1.00 0.00 ?  28  ASN A CB   5  
ATOM 6986  C CG   . ASN A 1 37  ? -5.963  103.369 101.053 1.00 0.00 ?  28  ASN A CG   5  
ATOM 6987  O OD1  . ASN A 1 37  ? -4.795  103.138 101.260 1.00 0.00 ?  28  ASN A OD1  5  
ATOM 6988  N ND2  . ASN A 1 37  ? -6.711  103.777 101.986 1.00 0.00 ?  28  ASN A ND2  5  
ATOM 6989  H H    . ASN A 1 37  ? -5.419  104.900 98.794  1.00 0.00 ?  28  ASN A H    5  
ATOM 6990  H HA   . ASN A 1 37  ? -4.851  102.127 98.912  1.00 0.00 ?  28  ASN A HA   5  
ATOM 6991  H HB2  . ASN A 1 37  ? -7.190  103.901 99.466  1.00 0.00 ?  28  ASN A HB2  5  
ATOM 6992  H HB3  . ASN A 1 37  ? -7.162  102.174 99.902  1.00 0.00 ?  28  ASN A HB3  5  
ATOM 6993  H HD21 . ASN A 1 37  ? -7.635  104.086 101.717 1.00 0.00 ?  28  ASN A HD21 5  
ATOM 6994  H HD22 . ASN A 1 37  ? -6.402  103.863 102.943 1.00 0.00 ?  28  ASN A HD22 5  
ATOM 6995  N N    . LEU A 1 38  ? -6.401  103.149 96.278  1.00 0.00 ?  29  LEU A N    5  
ATOM 6996  C CA   . LEU A 1 38  ? -7.099  102.617 94.975  1.00 0.00 ?  29  LEU A CA   5  
ATOM 6997  C C    . LEU A 1 38  ? -6.491  103.121 93.676  1.00 0.00 ?  29  LEU A C    5  
ATOM 6998  O O    . LEU A 1 38  ? -6.297  102.244 92.747  1.00 0.00 ?  29  LEU A O    5  
ATOM 6999  C CB   . LEU A 1 38  ? -8.616  102.984 94.899  1.00 0.00 ?  29  LEU A CB   5  
ATOM 7000  C CG   . LEU A 1 38  ? -9.490  102.266 93.839  1.00 0.00 ?  29  LEU A CG   5  
ATOM 7001  C CD1  . LEU A 1 38  ? -9.595  100.863 94.289  1.00 0.00 ?  29  LEU A CD1  5  
ATOM 7002  C CD2  . LEU A 1 38  ? -10.898 102.889 93.844  1.00 0.00 ?  29  LEU A CD2  5  
ATOM 7003  H H    . LEU A 1 38  ? -6.380  104.156 96.349  1.00 0.00 ?  29  LEU A H    5  
ATOM 7004  H HA   . LEU A 1 38  ? -6.999  101.534 94.909  1.00 0.00 ?  29  LEU A HA   5  
ATOM 7005  H HB2  . LEU A 1 38  ? -9.099  102.810 95.860  1.00 0.00 ?  29  LEU A HB2  5  
ATOM 7006  H HB3  . LEU A 1 38  ? -8.715  104.063 94.783  1.00 0.00 ?  29  LEU A HB3  5  
ATOM 7007  H HG   . LEU A 1 38  ? -9.040  102.273 92.846  1.00 0.00 ?  29  LEU A HG   5  
ATOM 7008  H HD11 . LEU A 1 38  ? -10.436 100.486 93.709  1.00 0.00 ?  29  LEU A HD11 5  
ATOM 7009  H HD12 . LEU A 1 38  ? -8.742  100.289 93.927  1.00 0.00 ?  29  LEU A HD12 5  
ATOM 7010  H HD13 . LEU A 1 38  ? -9.757  100.704 95.355  1.00 0.00 ?  29  LEU A HD13 5  
ATOM 7011  H HD21 . LEU A 1 38  ? -11.418 102.838 94.801  1.00 0.00 ?  29  LEU A HD21 5  
ATOM 7012  H HD22 . LEU A 1 38  ? -10.703 103.927 93.576  1.00 0.00 ?  29  LEU A HD22 5  
ATOM 7013  H HD23 . LEU A 1 38  ? -11.499 102.499 93.023  1.00 0.00 ?  29  LEU A HD23 5  
ATOM 7014  N N    . LEU A 1 39  ? -6.308  104.416 93.457  1.00 0.00 ?  30  LEU A N    5  
ATOM 7015  C CA   . LEU A 1 39  ? -6.089  104.946 92.174  1.00 0.00 ?  30  LEU A CA   5  
ATOM 7016  C C    . LEU A 1 39  ? -4.549  105.066 91.872  1.00 0.00 ?  30  LEU A C    5  
ATOM 7017  O O    . LEU A 1 39  ? -4.187  104.879 90.735  1.00 0.00 ?  30  LEU A O    5  
ATOM 7018  C CB   . LEU A 1 39  ? -6.770  106.326 92.023  1.00 0.00 ?  30  LEU A CB   5  
ATOM 7019  C CG   . LEU A 1 39  ? -8.260  106.331 92.284  1.00 0.00 ?  30  LEU A CG   5  
ATOM 7020  C CD1  . LEU A 1 39  ? -8.866  107.677 91.915  1.00 0.00 ?  30  LEU A CD1  5  
ATOM 7021  C CD2  . LEU A 1 39  ? -9.181  105.339 91.615  1.00 0.00 ?  30  LEU A CD2  5  
ATOM 7022  H H    . LEU A 1 39  ? -6.375  105.037 94.250  1.00 0.00 ?  30  LEU A H    5  
ATOM 7023  H HA   . LEU A 1 39  ? -6.455  104.291 91.384  1.00 0.00 ?  30  LEU A HA   5  
ATOM 7024  H HB2  . LEU A 1 39  ? -6.233  107.065 92.618  1.00 0.00 ?  30  LEU A HB2  5  
ATOM 7025  H HB3  . LEU A 1 39  ? -6.678  106.642 90.984  1.00 0.00 ?  30  LEU A HB3  5  
ATOM 7026  H HG   . LEU A 1 39  ? -8.421  106.250 93.359  1.00 0.00 ?  30  LEU A HG   5  
ATOM 7027  H HD11 . LEU A 1 39  ? -8.603  107.837 90.870  1.00 0.00 ?  30  LEU A HD11 5  
ATOM 7028  H HD12 . LEU A 1 39  ? -9.941  107.737 92.089  1.00 0.00 ?  30  LEU A HD12 5  
ATOM 7029  H HD13 . LEU A 1 39  ? -8.290  108.451 92.421  1.00 0.00 ?  30  LEU A HD13 5  
ATOM 7030  H HD21 . LEU A 1 39  ? -8.981  104.299 91.877  1.00 0.00 ?  30  LEU A HD21 5  
ATOM 7031  H HD22 . LEU A 1 39  ? -10.172 105.552 92.018  1.00 0.00 ?  30  LEU A HD22 5  
ATOM 7032  H HD23 . LEU A 1 39  ? -9.158  105.447 90.531  1.00 0.00 ?  30  LEU A HD23 5  
ATOM 7033  N N    . CYS A 1 40  ? -3.730  105.146 92.894  1.00 0.00 ?  31  CYS A N    5  
ATOM 7034  C CA   . CYS A 1 40  ? -2.314  104.900 92.795  1.00 0.00 ?  31  CYS A CA   5  
ATOM 7035  C C    . CYS A 1 40  ? -2.111  103.426 92.434  1.00 0.00 ?  31  CYS A C    5  
ATOM 7036  O O    . CYS A 1 40  ? -2.853  102.561 92.836  1.00 0.00 ?  31  CYS A O    5  
ATOM 7037  C CB   . CYS A 1 40  ? -1.757  105.222 94.225  1.00 0.00 ?  31  CYS A CB   5  
ATOM 7038  S SG   . CYS A 1 40  ? 0.104   105.114 94.079  1.00 0.00 ?  31  CYS A SG   5  
ATOM 7039  H H    . CYS A 1 40  ? -4.164  105.414 93.766  1.00 0.00 ?  31  CYS A H    5  
ATOM 7040  H HA   . CYS A 1 40  ? -1.713  105.471 92.088  1.00 0.00 ?  31  CYS A HA   5  
ATOM 7041  H HB2  . CYS A 1 40  ? -2.107  106.211 94.523  1.00 0.00 ?  31  CYS A HB2  5  
ATOM 7042  H HB3  . CYS A 1 40  ? -2.226  104.482 94.873  1.00 0.00 ?  31  CYS A HB3  5  
ATOM 7043  H HG   . CYS A 1 40  ? 0.126   103.790 93.900  1.00 0.00 ?  31  CYS A HG   5  
ATOM 7044  N N    . ARG A 1 41  ? -1.002  103.049 91.761  1.00 0.00 ?  32  ARG A N    5  
ATOM 7045  C CA   . ARG A 1 41  ? -0.580  101.735 91.261  1.00 0.00 ?  32  ARG A CA   5  
ATOM 7046  C C    . ARG A 1 41  ? 0.246   101.033 92.315  1.00 0.00 ?  32  ARG A C    5  
ATOM 7047  O O    . ARG A 1 41  ? 1.237   101.687 92.715  1.00 0.00 ?  32  ARG A O    5  
ATOM 7048  C CB   . ARG A 1 41  ? 0.112   101.734 89.898  1.00 0.00 ?  32  ARG A CB   5  
ATOM 7049  C CG   . ARG A 1 41  ? -0.966  101.550 88.817  1.00 0.00 ?  32  ARG A CG   5  
ATOM 7050  C CD   . ARG A 1 41  ? -0.299  101.404 87.473  1.00 0.00 ?  32  ARG A CD   5  
ATOM 7051  N NE   . ARG A 1 41  ? -1.261  100.915 86.462  1.00 0.00 ?  32  ARG A NE   5  
ATOM 7052  C CZ   . ARG A 1 41  ? -1.956  101.560 85.586  1.00 0.00 ?  32  ARG A CZ   5  
ATOM 7053  N NH1  . ARG A 1 41  ? -1.694  102.746 85.245  1.00 0.00 ?  32  ARG A NH1  5  
ATOM 7054  N NH2  . ARG A 1 41  ? -2.950  100.976 84.957  1.00 0.00 1  32  ARG A NH2  5  
ATOM 7055  H H    . ARG A 1 41  ? -0.452  103.835 91.447  1.00 0.00 ?  32  ARG A H    5  
ATOM 7056  H HA   . ARG A 1 41  ? -1.464  101.097 91.272  1.00 0.00 ?  32  ARG A HA   5  
ATOM 7057  H HB2  . ARG A 1 41  ? 0.685   102.651 89.763  1.00 0.00 ?  32  ARG A HB2  5  
ATOM 7058  H HB3  . ARG A 1 41  ? 0.874   100.957 89.843  1.00 0.00 ?  32  ARG A HB3  5  
ATOM 7059  H HG2  . ARG A 1 41  ? -1.578  100.674 89.031  1.00 0.00 ?  32  ARG A HG2  5  
ATOM 7060  H HG3  . ARG A 1 41  ? -1.621  102.413 88.691  1.00 0.00 ?  32  ARG A HG3  5  
ATOM 7061  H HD2  . ARG A 1 41  ? -0.001  102.410 87.180  1.00 0.00 ?  32  ARG A HD2  5  
ATOM 7062  H HD3  . ARG A 1 41  ? 0.574   100.751 87.503  1.00 0.00 ?  32  ARG A HD3  5  
ATOM 7063  H HE   . ARG A 1 41  ? -1.583  99.973  86.632  1.00 0.00 ?  32  ARG A HE   5  
ATOM 7064  H HH11 . ARG A 1 41  ? -0.929  103.252 85.670  1.00 0.00 ?  32  ARG A HH11 5  
ATOM 7065  H HH12 . ARG A 1 41  ? -2.211  103.165 84.486  1.00 0.00 ?  32  ARG A HH12 5  
ATOM 7066  H HH21 . ARG A 1 41  ? -3.292  100.047 85.160  1.00 0.00 ?  32  ARG A HH21 5  
ATOM 7067  H HH22 . ARG A 1 41  ? -3.506  101.455 84.263  1.00 0.00 ?  32  ARG A HH22 5  
ATOM 7068  N N    . PRO A 1 42  ? -0.144  99.816  92.805  1.00 0.00 ?  33  PRO A N    5  
ATOM 7069  C CA   . PRO A 1 42  ? 0.628   99.172  93.867  1.00 0.00 ?  33  PRO A CA   5  
ATOM 7070  C C    . PRO A 1 42  ? 1.894   98.549  93.263  1.00 0.00 ?  33  PRO A C    5  
ATOM 7071  O O    . PRO A 1 42  ? 1.862   97.926  92.163  1.00 0.00 ?  33  PRO A O    5  
ATOM 7072  C CB   . PRO A 1 42  ? -0.377  98.222  94.495  1.00 0.00 ?  33  PRO A CB   5  
ATOM 7073  C CG   . PRO A 1 42  ? -1.266  97.824  93.336  1.00 0.00 ?  33  PRO A CG   5  
ATOM 7074  C CD   . PRO A 1 42  ? -1.192  98.957  92.382  1.00 0.00 ?  33  PRO A CD   5  
ATOM 7075  H HA   . PRO A 1 42  ? 0.898   99.816  94.705  1.00 0.00 ?  33  PRO A HA   5  
ATOM 7076  H HB2  . PRO A 1 42  ? 0.140   97.379  94.952  1.00 0.00 ?  33  PRO A HB2  5  
ATOM 7077  H HB3  . PRO A 1 42  ? -0.926  98.691  95.312  1.00 0.00 ?  33  PRO A HB3  5  
ATOM 7078  H HG2  . PRO A 1 42  ? -0.991  96.884  92.858  1.00 0.00 ?  33  PRO A HG2  5  
ATOM 7079  H HG3  . PRO A 1 42  ? -2.311  97.682  93.611  1.00 0.00 ?  33  PRO A HG3  5  
ATOM 7080  H HD2  . PRO A 1 42  ? -1.084  98.649  91.342  1.00 0.00 ?  33  PRO A HD2  5  
ATOM 7081  H HD3  . PRO A 1 42  ? -2.083  99.554  92.570  1.00 0.00 ?  33  PRO A HD3  5  
ATOM 7082  N N    . GLY A 1 43  ? 3.047   98.723  93.919  1.00 0.00 ?  34  GLY A N    5  
ATOM 7083  C CA   . GLY A 1 43  ? 4.348   98.160  93.523  1.00 0.00 ?  34  GLY A CA   5  
ATOM 7084  C C    . GLY A 1 43  ? 4.448   96.665  93.708  1.00 0.00 ?  34  GLY A C    5  
ATOM 7085  O O    . GLY A 1 43  ? 3.561   96.040  94.270  1.00 0.00 ?  34  GLY A O    5  
ATOM 7086  H H    . GLY A 1 43  ? 3.048   99.407  94.661  1.00 0.00 ?  34  GLY A H    5  
ATOM 7087  H HA2  . GLY A 1 43  ? 4.671   98.452  92.524  1.00 0.00 ?  34  GLY A HA2  5  
ATOM 7088  H HA3  . GLY A 1 43  ? 5.060   98.655  94.184  1.00 0.00 ?  34  GLY A HA3  5  
ATOM 7089  N N    . PRO A 1 44  ? 5.534   96.031  93.186  1.00 0.00 ?  35  PRO A N    5  
ATOM 7090  C CA   . PRO A 1 44  ? 5.753   94.571  93.252  1.00 0.00 ?  35  PRO A CA   5  
ATOM 7091  C C    . PRO A 1 44  ? 6.282   94.243  94.648  1.00 0.00 ?  35  PRO A C    5  
ATOM 7092  O O    . PRO A 1 44  ? 6.854   95.090  95.386  1.00 0.00 ?  35  PRO A O    5  
ATOM 7093  C CB   . PRO A 1 44  ? 6.760   94.332  92.060  1.00 0.00 ?  35  PRO A CB   5  
ATOM 7094  C CG   . PRO A 1 44  ? 7.588   95.638  92.133  1.00 0.00 ?  35  PRO A CG   5  
ATOM 7095  C CD   . PRO A 1 44  ? 6.512   96.743  92.455  1.00 0.00 ?  35  PRO A CD   5  
ATOM 7096  H HA   . PRO A 1 44  ? 4.809   94.074  93.035  1.00 0.00 ?  35  PRO A HA   5  
ATOM 7097  H HB2  . PRO A 1 44  ? 7.330   93.432  92.292  1.00 0.00 ?  35  PRO A HB2  5  
ATOM 7098  H HB3  . PRO A 1 44  ? 6.212   94.312  91.118  1.00 0.00 ?  35  PRO A HB3  5  
ATOM 7099  H HG2  . PRO A 1 44  ? 8.435   95.655  92.819  1.00 0.00 ?  35  PRO A HG2  5  
ATOM 7100  H HG3  . PRO A 1 44  ? 7.950   95.936  91.149  1.00 0.00 ?  35  PRO A HG3  5  
ATOM 7101  H HD2  . PRO A 1 44  ? 6.996   97.545  93.012  1.00 0.00 ?  35  PRO A HD2  5  
ATOM 7102  H HD3  . PRO A 1 44  ? 6.066   97.095  91.526  1.00 0.00 ?  35  PRO A HD3  5  
ATOM 7103  N N    . GLY A 1 45  ? 6.269   92.986  95.083  1.00 0.00 ?  36  GLY A N    5  
ATOM 7104  C CA   . GLY A 1 45  ? 7.034   92.437  96.283  1.00 0.00 ?  36  GLY A CA   5  
ATOM 7105  C C    . GLY A 1 45  ? 8.492   92.161  96.139  1.00 0.00 ?  36  GLY A C    5  
ATOM 7106  O O    . GLY A 1 45  ? 9.069   91.741  95.092  1.00 0.00 ?  36  GLY A O    5  
ATOM 7107  H H    . GLY A 1 45  ? 6.052   92.406  94.285  1.00 0.00 ?  36  GLY A H    5  
ATOM 7108  H HA2  . GLY A 1 45  ? 6.829   92.979  97.206  1.00 0.00 ?  36  GLY A HA2  5  
ATOM 7109  H HA3  . GLY A 1 45  ? 6.688   91.425  96.492  1.00 0.00 ?  36  GLY A HA3  5  
ATOM 7110  N N    . LEU A 1 46  ? 9.203   92.122  97.291  1.00 0.00 ?  37  LEU A N    5  
ATOM 7111  C CA   . LEU A 1 46  ? 10.600  91.783  97.445  1.00 0.00 ?  37  LEU A CA   5  
ATOM 7112  C C    . LEU A 1 46  ? 10.762  90.279  97.692  1.00 0.00 ?  37  LEU A C    5  
ATOM 7113  O O    . LEU A 1 46  ? 9.930   89.653  98.335  1.00 0.00 ?  37  LEU A O    5  
ATOM 7114  C CB   . LEU A 1 46  ? 11.287  92.689  98.474  1.00 0.00 ?  37  LEU A CB   5  
ATOM 7115  C CG   . LEU A 1 46  ? 12.765  92.313  98.772  1.00 0.00 ?  37  LEU A CG   5  
ATOM 7116  C CD1  . LEU A 1 46  ? 13.590  93.472  99.355  1.00 0.00 ?  37  LEU A CD1  5  
ATOM 7117  C CD2  . LEU A 1 46  ? 13.007  91.252  99.850  1.00 0.00 ?  37  LEU A CD2  5  
ATOM 7118  H H    . LEU A 1 46  ? 8.673   92.149  98.150  1.00 0.00 ?  37  LEU A H    5  
ATOM 7119  H HA   . LEU A 1 46  ? 11.169  91.948  96.529  1.00 0.00 ?  37  LEU A HA   5  
ATOM 7120  H HB2  . LEU A 1 46  ? 11.268  93.710  98.094  1.00 0.00 ?  37  LEU A HB2  5  
ATOM 7121  H HB3  . LEU A 1 46  ? 10.702  92.785  99.390  1.00 0.00 ?  37  LEU A HB3  5  
ATOM 7122  H HG   . LEU A 1 46  ? 13.267  91.948  97.875  1.00 0.00 ?  37  LEU A HG   5  
ATOM 7123  H HD11 . LEU A 1 46  ? 13.395  94.376  98.779  1.00 0.00 ?  37  LEU A HD11 5  
ATOM 7124  H HD12 . LEU A 1 46  ? 13.315  93.619  100.400 1.00 0.00 ?  37  LEU A HD12 5  
ATOM 7125  H HD13 . LEU A 1 46  ? 14.678  93.407  99.398  1.00 0.00 ?  37  LEU A HD13 5  
ATOM 7126  H HD21 . LEU A 1 46  ? 12.660  91.674  100.794 1.00 0.00 ?  37  LEU A HD21 5  
ATOM 7127  H HD22 . LEU A 1 46  ? 12.302  90.437  99.686  1.00 0.00 ?  37  LEU A HD22 5  
ATOM 7128  H HD23 . LEU A 1 46  ? 14.053  90.972  99.731  1.00 0.00 ?  37  LEU A HD23 5  
ATOM 7129  N N    . GLY A 1 47  ? 11.697  89.684  96.929  1.00 0.00 ?  38  GLY A N    5  
ATOM 7130  C CA   . GLY A 1 47  ? 11.876  88.207  96.931  1.00 0.00 ?  38  GLY A CA   5  
ATOM 7131  C C    . GLY A 1 47  ? 12.374  87.670  98.272  1.00 0.00 ?  38  GLY A C    5  
ATOM 7132  O O    . GLY A 1 47  ? 13.429  88.085  98.708  1.00 0.00 ?  38  GLY A O    5  
ATOM 7133  H H    . GLY A 1 47  ? 12.463  90.252  96.597  1.00 0.00 ?  38  GLY A H    5  
ATOM 7134  H HA2  . GLY A 1 47  ? 10.895  87.768  96.753  1.00 0.00 ?  38  GLY A HA2  5  
ATOM 7135  H HA3  . GLY A 1 47  ? 12.618  88.008  96.157  1.00 0.00 ?  38  GLY A HA3  5  
ATOM 7136  N N    . PRO A 1 48  ? 11.622  86.862  99.070  1.00 0.00 ?  39  PRO A N    5  
ATOM 7137  C CA   . PRO A 1 48  ? 12.129  86.255  100.305 1.00 0.00 ?  39  PRO A CA   5  
ATOM 7138  C C    . PRO A 1 48  ? 13.364  85.447  100.191 1.00 0.00 ?  39  PRO A C    5  
ATOM 7139  O O    . PRO A 1 48  ? 13.597  84.575  99.341  1.00 0.00 ?  39  PRO A O    5  
ATOM 7140  C CB   . PRO A 1 48  ? 10.948  85.362  100.896 1.00 0.00 ?  39  PRO A CB   5  
ATOM 7141  C CG   . PRO A 1 48  ? 9.748   85.824  100.075 1.00 0.00 ?  39  PRO A CG   5  
ATOM 7142  C CD   . PRO A 1 48  ? 10.279  86.274  98.779  1.00 0.00 ?  39  PRO A CD   5  
ATOM 7143  H HA   . PRO A 1 48  ? 12.189  87.014  101.085 1.00 0.00 ?  39  PRO A HA   5  
ATOM 7144  H HB2  . PRO A 1 48  ? 11.207  84.327  100.673 1.00 0.00 ?  39  PRO A HB2  5  
ATOM 7145  H HB3  . PRO A 1 48  ? 10.713  85.526  101.948 1.00 0.00 ?  39  PRO A HB3  5  
ATOM 7146  H HG2  . PRO A 1 48  ? 9.152   84.922  99.941  1.00 0.00 ?  39  PRO A HG2  5  
ATOM 7147  H HG3  . PRO A 1 48  ? 9.229   86.624  100.604 1.00 0.00 ?  39  PRO A HG3  5  
ATOM 7148  H HD2  . PRO A 1 48  ? 10.473  85.482  98.055  1.00 0.00 ?  39  PRO A HD2  5  
ATOM 7149  H HD3  . PRO A 1 48  ? 9.675   87.042  98.297  1.00 0.00 ?  39  PRO A HD3  5  
ATOM 7150  N N    . ASP A 1 49  ? 14.328  85.601  101.110 1.00 0.00 ?  40  ASP A N    5  
ATOM 7151  C CA   . ASP A 1 49  ? 15.647  84.874  101.040 1.00 0.00 ?  40  ASP A CA   5  
ATOM 7152  C C    . ASP A 1 49  ? 15.472  83.368  101.383 1.00 0.00 ?  40  ASP A C    5  
ATOM 7153  O O    . ASP A 1 49  ? 16.343  82.515  101.032 1.00 0.00 ?  40  ASP A O    5  
ATOM 7154  C CB   . ASP A 1 49  ? 16.729  85.635  101.795 1.00 0.00 ?  40  ASP A CB   5  
ATOM 7155  C CG   . ASP A 1 49  ? 16.373  86.037  103.229 1.00 0.00 ?  40  ASP A CG   5  
ATOM 7156  O OD1  . ASP A 1 49  ? 15.344  86.723  103.426 1.00 0.00 -1 40  ASP A OD1  5  
ATOM 7157  O OD2  . ASP A 1 49  ? 17.185  85.834  104.134 1.00 0.00 ?  40  ASP A OD2  5  
ATOM 7158  H H    . ASP A 1 49  ? 14.354  86.367  101.767 1.00 0.00 ?  40  ASP A H    5  
ATOM 7159  H HA   . ASP A 1 49  ? 15.964  84.838  99.998  1.00 0.00 ?  40  ASP A HA   5  
ATOM 7160  H HB2  . ASP A 1 49  ? 17.644  85.042  101.810 1.00 0.00 ?  40  ASP A HB2  5  
ATOM 7161  H HB3  . ASP A 1 49  ? 16.911  86.572  101.270 1.00 0.00 ?  40  ASP A HB3  5  
ATOM 7162  N N    . ASN A 1 50  ? 14.294  83.031  101.916 1.00 0.00 ?  41  ASN A N    5  
ATOM 7163  C CA   . ASN A 1 50  ? 13.953  81.621  102.158 1.00 0.00 ?  41  ASN A CA   5  
ATOM 7164  C C    . ASN A 1 50  ? 13.641  80.909  100.857 1.00 0.00 ?  41  ASN A C    5  
ATOM 7165  O O    . ASN A 1 50  ? 13.671  79.704  100.850 1.00 0.00 ?  41  ASN A O    5  
ATOM 7166  C CB   . ASN A 1 50  ? 12.964  81.576  103.377 1.00 0.00 ?  41  ASN A CB   5  
ATOM 7167  C CG   . ASN A 1 50  ? 13.438  82.198  104.722 1.00 0.00 ?  41  ASN A CG   5  
ATOM 7168  O OD1  . ASN A 1 50  ? 13.322  83.395  104.876 1.00 0.00 ?  41  ASN A OD1  5  
ATOM 7169  N ND2  . ASN A 1 50  ? 13.995  81.410  105.579 1.00 0.00 ?  41  ASN A ND2  5  
ATOM 7170  H H    . ASN A 1 50  ? 13.581  83.738  102.030 1.00 0.00 ?  41  ASN A H    5  
ATOM 7171  H HA   . ASN A 1 50  ? 14.843  81.050  102.421 1.00 0.00 ?  41  ASN A HA   5  
ATOM 7172  H HB2  . ASN A 1 50  ? 12.041  82.103  103.139 1.00 0.00 ?  41  ASN A HB2  5  
ATOM 7173  H HB3  . ASN A 1 50  ? 12.705  80.525  103.505 1.00 0.00 ?  41  ASN A HB3  5  
ATOM 7174  H HD21 . ASN A 1 50  ? 14.025  80.420  105.380 1.00 0.00 ?  41  ASN A HD21 5  
ATOM 7175  H HD22 . ASN A 1 50  ? 14.483  81.851  106.346 1.00 0.00 ?  41  ASN A HD22 5  
ATOM 7176  N N    . GLN A 1 51  ? 13.275  81.585  99.721  1.00 0.00 ?  42  GLN A N    5  
ATOM 7177  C CA   . GLN A 1 51  ? 12.918  80.889  98.487  1.00 0.00 ?  42  GLN A CA   5  
ATOM 7178  C C    . GLN A 1 51  ? 14.168  80.506  97.630  1.00 0.00 ?  42  GLN A C    5  
ATOM 7179  O O    . GLN A 1 51  ? 15.026  81.364  97.580  1.00 0.00 ?  42  GLN A O    5  
ATOM 7180  C CB   . GLN A 1 51  ? 11.988  81.827  97.714  1.00 0.00 ?  42  GLN A CB   5  
ATOM 7181  C CG   . GLN A 1 51  ? 10.543  81.736  98.328  1.00 0.00 ?  42  GLN A CG   5  
ATOM 7182  C CD   . GLN A 1 51  ? 9.483   82.519  97.520  1.00 0.00 ?  42  GLN A CD   5  
ATOM 7183  O OE1  . GLN A 1 51  ? 9.630   82.979  96.411  1.00 0.00 ?  42  GLN A OE1  5  
ATOM 7184  N NE2  . GLN A 1 51  ? 8.298   82.623  98.012  1.00 0.00 ?  42  GLN A NE2  5  
ATOM 7185  H H    . GLN A 1 51  ? 13.453  82.575  99.626  1.00 0.00 ?  42  GLN A H    5  
ATOM 7186  H HA   . GLN A 1 51  ? 12.297  80.049  98.798  1.00 0.00 ?  42  GLN A HA   5  
ATOM 7187  H HB2  . GLN A 1 51  ? 12.273  82.876  97.790  1.00 0.00 ?  42  GLN A HB2  5  
ATOM 7188  H HB3  . GLN A 1 51  ? 11.803  81.559  96.674  1.00 0.00 ?  42  GLN A HB3  5  
ATOM 7189  H HG2  . GLN A 1 51  ? 10.247  80.689  98.276  1.00 0.00 ?  42  GLN A HG2  5  
ATOM 7190  H HG3  . GLN A 1 51  ? 10.652  82.041  99.369  1.00 0.00 ?  42  GLN A HG3  5  
ATOM 7191  H HE21 . GLN A 1 51  ? 8.140   82.428  98.991  1.00 0.00 ?  42  GLN A HE21 5  
ATOM 7192  H HE22 . GLN A 1 51  ? 7.610   83.169  97.513  1.00 0.00 ?  42  GLN A HE22 5  
ATOM 7193  N N    . THR A 1 52  ? 14.152  79.399  96.922  1.00 0.00 ?  43  THR A N    5  
ATOM 7194  C CA   . THR A 1 52  ? 15.335  78.946  96.171  1.00 0.00 ?  43  THR A CA   5  
ATOM 7195  C C    . THR A 1 52  ? 14.963  77.846  95.080  1.00 0.00 ?  43  THR A C    5  
ATOM 7196  O O    . THR A 1 52  ? 14.043  76.987  95.211  1.00 0.00 ?  43  THR A O    5  
ATOM 7197  C CB   . THR A 1 52  ? 16.386  78.266  97.048  1.00 0.00 ?  43  THR A CB   5  
ATOM 7198  O OG1  . THR A 1 52  ? 15.797  77.344  97.866  1.00 0.00 ?  43  THR A OG1  5  
ATOM 7199  C CG2  . THR A 1 52  ? 17.247  79.245  97.886  1.00 0.00 ?  43  THR A CG2  5  
ATOM 7200  H H    . THR A 1 52  ? 13.324  78.834  97.050  1.00 0.00 ?  43  THR A H    5  
ATOM 7201  H HA   . THR A 1 52  ? 15.842  79.820  95.764  1.00 0.00 ?  43  THR A HA   5  
ATOM 7202  H HB   . THR A 1 52  ? 17.022  77.752  96.327  1.00 0.00 ?  43  THR A HB   5  
ATOM 7203  H HG1  . THR A 1 52  ? 16.359  77.092  98.603  1.00 0.00 ?  43  THR A HG1  5  
ATOM 7204  H HG21 . THR A 1 52  ? 17.642  80.028  97.240  1.00 0.00 ?  43  THR A HG21 5  
ATOM 7205  H HG22 . THR A 1 52  ? 16.744  79.640  98.770  1.00 0.00 ?  43  THR A HG22 5  
ATOM 7206  H HG23 . THR A 1 52  ? 18.031  78.687  98.398  1.00 0.00 ?  43  THR A HG23 5  
ATOM 7207  N N    . GLU A 1 53  ? 15.864  77.723  94.100  1.00 0.00 ?  44  GLU A N    5  
ATOM 7208  C CA   . GLU A 1 53  ? 15.888  76.712  92.967  1.00 0.00 ?  44  GLU A CA   5  
ATOM 7209  C C    . GLU A 1 53  ? 16.907  75.624  93.325  1.00 0.00 ?  44  GLU A C    5  
ATOM 7210  O O    . GLU A 1 53  ? 18.072  75.923  93.548  1.00 0.00 ?  44  GLU A O    5  
ATOM 7211  C CB   . GLU A 1 53  ? 16.363  77.387  91.644  1.00 0.00 ?  44  GLU A CB   5  
ATOM 7212  C CG   . GLU A 1 53  ? 16.422  76.533  90.371  1.00 0.00 ?  44  GLU A CG   5  
ATOM 7213  C CD   . GLU A 1 53  ? 15.106  75.809  90.257  1.00 0.00 ?  44  GLU A CD   5  
ATOM 7214  O OE1  . GLU A 1 53  ? 14.079  76.490  89.850  1.00 0.00 ?  44  GLU A OE1  5  
ATOM 7215  O OE2  . GLU A 1 53  ? 15.003  74.580  90.537  1.00 0.00 -1 44  GLU A OE2  5  
ATOM 7216  H H    . GLU A 1 53  ? 16.610  78.398  94.010  1.00 0.00 ?  44  GLU A H    5  
ATOM 7217  H HA   . GLU A 1 53  ? 14.936  76.203  92.814  1.00 0.00 ?  44  GLU A HA   5  
ATOM 7218  H HB2  . GLU A 1 53  ? 15.655  78.205  91.509  1.00 0.00 ?  44  GLU A HB2  5  
ATOM 7219  H HB3  . GLU A 1 53  ? 17.400  77.669  91.824  1.00 0.00 ?  44  GLU A HB3  5  
ATOM 7220  H HG2  . GLU A 1 53  ? 16.554  77.185  89.509  1.00 0.00 ?  44  GLU A HG2  5  
ATOM 7221  H HG3  . GLU A 1 53  ? 17.276  75.856  90.413  1.00 0.00 ?  44  GLU A HG3  5  
ATOM 7222  N N    . GLU A 1 54  ? 16.606  74.284  93.155  1.00 0.00 ?  45  GLU A N    5  
ATOM 7223  C CA   . GLU A 1 54  ? 17.551  73.205  93.317  1.00 0.00 ?  45  GLU A CA   5  
ATOM 7224  C C    . GLU A 1 54  ? 17.930  72.534  91.997  1.00 0.00 ?  45  GLU A C    5  
ATOM 7225  O O    . GLU A 1 54  ? 18.753  71.643  92.023  1.00 0.00 ?  45  GLU A O    5  
ATOM 7226  C CB   . GLU A 1 54  ? 16.857  72.114  94.121  1.00 0.00 ?  45  GLU A CB   5  
ATOM 7227  C CG   . GLU A 1 54  ? 16.850  72.402  95.582  1.00 0.00 ?  45  GLU A CG   5  
ATOM 7228  C CD   . GLU A 1 54  ? 18.275  72.378  96.240  1.00 0.00 ?  45  GLU A CD   5  
ATOM 7229  O OE1  . GLU A 1 54  ? 19.214  71.867  95.685  1.00 0.00 -1 45  GLU A OE1  5  
ATOM 7230  O OE2  . GLU A 1 54  ? 18.484  73.083  97.308  1.00 0.00 ?  45  GLU A OE2  5  
ATOM 7231  H H    . GLU A 1 54  ? 15.641  74.067  92.951  1.00 0.00 ?  45  GLU A H    5  
ATOM 7232  H HA   . GLU A 1 54  ? 18.444  73.508  93.865  1.00 0.00 ?  45  GLU A HA   5  
ATOM 7233  H HB2  . GLU A 1 54  ? 15.810  72.098  93.816  1.00 0.00 ?  45  GLU A HB2  5  
ATOM 7234  H HB3  . GLU A 1 54  ? 17.347  71.149  93.995  1.00 0.00 ?  45  GLU A HB3  5  
ATOM 7235  H HG2  . GLU A 1 54  ? 16.423  73.345  95.920  1.00 0.00 ?  45  GLU A HG2  5  
ATOM 7236  H HG3  . GLU A 1 54  ? 16.299  71.633  96.123  1.00 0.00 ?  45  GLU A HG3  5  
ATOM 7237  N N    . ARG A 1 55  ? 17.336  72.881  90.869  1.00 0.00 ?  46  ARG A N    5  
ATOM 7238  C CA   . ARG A 1 55  ? 17.780  72.507  89.474  1.00 0.00 ?  46  ARG A CA   5  
ATOM 7239  C C    . ARG A 1 55  ? 19.013  73.164  88.967  1.00 0.00 ?  46  ARG A C    5  
ATOM 7240  O O    . ARG A 1 55  ? 19.239  74.334  89.270  1.00 0.00 ?  46  ARG A O    5  
ATOM 7241  C CB   . ARG A 1 55  ? 16.569  72.555  88.596  1.00 0.00 ?  46  ARG A CB   5  
ATOM 7242  C CG   . ARG A 1 55  ? 15.409  71.640  88.839  1.00 0.00 ?  46  ARG A CG   5  
ATOM 7243  C CD   . ARG A 1 55  ? 14.252  72.073  87.900  1.00 0.00 ?  46  ARG A CD   5  
ATOM 7244  N NE   . ARG A 1 55  ? 13.652  73.378  88.245  1.00 0.00 ?  46  ARG A NE   5  
ATOM 7245  C CZ   . ARG A 1 55  ? 12.833  74.073  87.468  1.00 0.00 ?  46  ARG A CZ   5  
ATOM 7246  N NH1  . ARG A 1 55  ? 12.335  73.619  86.336  1.00 0.00 ?  46  ARG A NH1  5  
ATOM 7247  N NH2  . ARG A 1 55  ? 12.477  75.297  87.636  1.00 0.00 1  46  ARG A NH2  5  
ATOM 7248  H H    . ARG A 1 55  ? 16.480  73.402  90.999  1.00 0.00 ?  46  ARG A H    5  
ATOM 7249  H HA   . ARG A 1 55  ? 17.964  71.442  89.618  1.00 0.00 ?  46  ARG A HA   5  
ATOM 7250  H HB2  . ARG A 1 55  ? 16.242  73.592  88.660  1.00 0.00 ?  46  ARG A HB2  5  
ATOM 7251  H HB3  . ARG A 1 55  ? 16.815  72.454  87.540  1.00 0.00 ?  46  ARG A HB3  5  
ATOM 7252  H HG2  . ARG A 1 55  ? 15.756  70.628  88.637  1.00 0.00 ?  46  ARG A HG2  5  
ATOM 7253  H HG3  . ARG A 1 55  ? 15.068  71.771  89.867  1.00 0.00 ?  46  ARG A HG3  5  
ATOM 7254  H HD2  . ARG A 1 55  ? 14.500  72.003  86.841  1.00 0.00 ?  46  ARG A HD2  5  
ATOM 7255  H HD3  . ARG A 1 55  ? 13.517  71.280  88.038  1.00 0.00 ?  46  ARG A HD3  5  
ATOM 7256  H HE   . ARG A 1 55  ? 14.180  73.927  88.906  1.00 0.00 ?  46  ARG A HE   5  
ATOM 7257  H HH11 . ARG A 1 55  ? 12.533  72.690  85.993  1.00 0.00 ?  46  ARG A HH11 5  
ATOM 7258  H HH12 . ARG A 1 55  ? 12.040  74.305  85.656  1.00 0.00 ?  46  ARG A HH12 5  
ATOM 7259  H HH21 . ARG A 1 55  ? 12.751  75.779  88.480  1.00 0.00 ?  46  ARG A HH21 5  
ATOM 7260  H HH22 . ARG A 1 55  ? 12.065  75.780  86.851  1.00 0.00 ?  46  ARG A HH22 5  
ATOM 7261  N N    . ARG A 1 56  ? 19.868  72.389  88.379  1.00 0.00 ?  47  ARG A N    5  
ATOM 7262  C CA   . ARG A 1 56  ? 21.322  72.664  88.182  1.00 0.00 ?  47  ARG A CA   5  
ATOM 7263  C C    . ARG A 1 56  ? 21.940  72.165  86.857  1.00 0.00 ?  47  ARG A C    5  
ATOM 7264  O O    . ARG A 1 56  ? 21.229  71.409  86.197  1.00 0.00 ?  47  ARG A O    5  
ATOM 7265  C CB   . ARG A 1 56  ? 22.141  72.116  89.323  1.00 0.00 ?  47  ARG A CB   5  
ATOM 7266  C CG   . ARG A 1 56  ? 22.104  70.557  89.426  1.00 0.00 ?  47  ARG A CG   5  
ATOM 7267  C CD   . ARG A 1 56  ? 21.570  70.088  90.785  1.00 0.00 ?  47  ARG A CD   5  
ATOM 7268  N NE   . ARG A 1 56  ? 22.581  70.265  91.869  1.00 0.00 ?  47  ARG A NE   5  
ATOM 7269  C CZ   . ARG A 1 56  ? 22.426  70.891  93.090  1.00 0.00 ?  47  ARG A CZ   5  
ATOM 7270  N NH1  . ARG A 1 56  ? 21.291  71.405  93.443  1.00 0.00 ?  47  ARG A NH1  5  
ATOM 7271  N NH2  . ARG A 1 56  ? 23.409  70.977  93.898  1.00 0.00 1  47  ARG A NH2  5  
ATOM 7272  H H    . ARG A 1 56  ? 19.514  71.499  88.059  1.00 0.00 ?  47  ARG A H    5  
ATOM 7273  H HA   . ARG A 1 56  ? 21.414  73.750  88.184  1.00 0.00 ?  47  ARG A HA   5  
ATOM 7274  H HB2  . ARG A 1 56  ? 23.189  72.414  89.305  1.00 0.00 ?  47  ARG A HB2  5  
ATOM 7275  H HB3  . ARG A 1 56  ? 21.670  72.395  90.265  1.00 0.00 ?  47  ARG A HB3  5  
ATOM 7276  H HG2  . ARG A 1 56  ? 21.362  70.230  88.697  1.00 0.00 ?  47  ARG A HG2  5  
ATOM 7277  H HG3  . ARG A 1 56  ? 23.123  70.186  89.311  1.00 0.00 ?  47  ARG A HG3  5  
ATOM 7278  H HD2  . ARG A 1 56  ? 20.574  70.472  91.008  1.00 0.00 ?  47  ARG A HD2  5  
ATOM 7279  H HD3  . ARG A 1 56  ? 21.367  69.018  90.830  1.00 0.00 ?  47  ARG A HD3  5  
ATOM 7280  H HE   . ARG A 1 56  ? 23.436  69.729  91.842  1.00 0.00 ?  47  ARG A HE   5  
ATOM 7281  H HH11 . ARG A 1 56  ? 20.406  71.229  92.991  1.00 0.00 ?  47  ARG A HH11 5  
ATOM 7282  H HH12 . ARG A 1 56  ? 21.229  71.856  94.345  1.00 0.00 ?  47  ARG A HH12 5  
ATOM 7283  H HH21 . ARG A 1 56  ? 24.210  70.367  93.816  1.00 0.00 ?  47  ARG A HH21 5  
ATOM 7284  H HH22 . ARG A 1 56  ? 23.175  71.324  94.817  1.00 0.00 ?  47  ARG A HH22 5  
ATOM 7285  N N    . ALA A 1 57  ? 23.101  72.586  86.554  1.00 0.00 ?  48  ALA A N    5  
ATOM 7286  C CA   . ALA A 1 57  ? 23.672  72.294  85.233  1.00 0.00 ?  48  ALA A CA   5  
ATOM 7287  C C    . ALA A 1 57  ? 23.790  70.800  84.879  1.00 0.00 ?  48  ALA A C    5  
ATOM 7288  O O    . ALA A 1 57  ? 24.146  69.942  85.693  1.00 0.00 ?  48  ALA A O    5  
ATOM 7289  C CB   . ALA A 1 57  ? 25.031  72.901  85.279  1.00 0.00 ?  48  ALA A CB   5  
ATOM 7290  H H    . ALA A 1 57  ? 23.533  73.186  87.243  1.00 0.00 ?  48  ALA A H    5  
ATOM 7291  H HA   . ALA A 1 57  ? 23.107  72.878  84.505  1.00 0.00 ?  48  ALA A HA   5  
ATOM 7292  H HB1  . ALA A 1 57  ? 24.888  73.976  85.387  1.00 0.00 ?  48  ALA A HB1  5  
ATOM 7293  H HB2  . ALA A 1 57  ? 25.555  72.439  86.116  1.00 0.00 ?  48  ALA A HB2  5  
ATOM 7294  H HB3  . ALA A 1 57  ? 25.652  72.725  84.400  1.00 0.00 ?  48  ALA A HB3  5  
ATOM 7295  N N    . SER A 1 58  ? 23.590  70.584  83.548  1.00 0.00 ?  49  SER A N    5  
ATOM 7296  C CA   . SER A 1 58  ? 23.588  69.220  82.866  1.00 0.00 ?  49  SER A CA   5  
ATOM 7297  C C    . SER A 1 58  ? 24.650  69.105  81.732  1.00 0.00 ?  49  SER A C    5  
ATOM 7298  O O    . SER A 1 58  ? 24.674  68.151  81.011  1.00 0.00 ?  49  SER A O    5  
ATOM 7299  C CB   . SER A 1 58  ? 22.190  68.924  82.338  1.00 0.00 ?  49  SER A CB   5  
ATOM 7300  O OG   . SER A 1 58  ? 21.359  69.207  83.403  1.00 0.00 ?  49  SER A OG   5  
ATOM 7301  H H    . SER A 1 58  ? 23.594  71.431  82.998  1.00 0.00 ?  49  SER A H    5  
ATOM 7302  H HA   . SER A 1 58  ? 23.736  68.376  83.540  1.00 0.00 ?  49  SER A HA   5  
ATOM 7303  H HB2  . SER A 1 58  ? 22.041  69.712  81.599  1.00 0.00 ?  49  SER A HB2  5  
ATOM 7304  H HB3  . SER A 1 58  ? 22.118  67.942  81.872  1.00 0.00 ?  49  SER A HB3  5  
ATOM 7305  H HG   . SER A 1 58  ? 21.457  70.150  83.558  1.00 0.00 ?  49  SER A HG   5  
ATOM 7306  N N    . LEU A 1 59  ? 25.649  70.021  81.698  1.00 0.00 ?  50  LEU A N    5  
ATOM 7307  C CA   . LEU A 1 59  ? 26.804  69.713  80.855  1.00 0.00 ?  50  LEU A CA   5  
ATOM 7308  C C    . LEU A 1 59  ? 27.663  68.540  81.487  1.00 0.00 ?  50  LEU A C    5  
ATOM 7309  O O    . LEU A 1 59  ? 27.992  68.637  82.666  1.00 0.00 ?  50  LEU A O    5  
ATOM 7310  C CB   . LEU A 1 59  ? 27.650  70.918  80.619  1.00 0.00 ?  50  LEU A CB   5  
ATOM 7311  C CG   . LEU A 1 59  ? 29.127  70.667  79.962  1.00 0.00 ?  50  LEU A CG   5  
ATOM 7312  C CD1  . LEU A 1 59  ? 29.042  70.524  78.436  1.00 0.00 ?  50  LEU A CD1  5  
ATOM 7313  C CD2  . LEU A 1 59  ? 30.071  71.849  80.213  1.00 0.00 ?  50  LEU A CD2  5  
ATOM 7314  H H    . LEU A 1 59  ? 25.761  70.683  82.454  1.00 0.00 ?  50  LEU A H    5  
ATOM 7315  H HA   . LEU A 1 59  ? 26.413  69.345  79.908  1.00 0.00 ?  50  LEU A HA   5  
ATOM 7316  H HB2  . LEU A 1 59  ? 27.100  71.724  80.131  1.00 0.00 ?  50  LEU A HB2  5  
ATOM 7317  H HB3  . LEU A 1 59  ? 27.794  71.280  81.637  1.00 0.00 ?  50  LEU A HB3  5  
ATOM 7318  H HG   . LEU A 1 59  ? 29.745  69.829  80.287  1.00 0.00 ?  50  LEU A HG   5  
ATOM 7319  H HD11 . LEU A 1 59  ? 28.278  69.759  78.297  1.00 0.00 ?  50  LEU A HD11 5  
ATOM 7320  H HD12 . LEU A 1 59  ? 28.774  71.459  77.942  1.00 0.00 ?  50  LEU A HD12 5  
ATOM 7321  H HD13 . LEU A 1 59  ? 29.997  70.182  78.037  1.00 0.00 ?  50  LEU A HD13 5  
ATOM 7322  H HD21 . LEU A 1 59  ? 30.206  72.007  81.283  1.00 0.00 ?  50  LEU A HD21 5  
ATOM 7323  H HD22 . LEU A 1 59  ? 31.048  71.632  79.781  1.00 0.00 ?  50  LEU A HD22 5  
ATOM 7324  H HD23 . LEU A 1 59  ? 29.655  72.801  79.885  1.00 0.00 ?  50  LEU A HD23 5  
ATOM 7325  N N    . PRO A 1 60  ? 28.032  67.404  80.774  1.00 0.00 ?  51  PRO A N    5  
ATOM 7326  C CA   . PRO A 1 60  ? 28.783  66.320  81.324  1.00 0.00 ?  51  PRO A CA   5  
ATOM 7327  C C    . PRO A 1 60  ? 30.099  66.736  82.007  1.00 0.00 ?  51  PRO A C    5  
ATOM 7328  O O    . PRO A 1 60  ? 30.770  67.622  81.565  1.00 0.00 ?  51  PRO A O    5  
ATOM 7329  C CB   . PRO A 1 60  ? 29.039  65.483  80.109  1.00 0.00 ?  51  PRO A CB   5  
ATOM 7330  C CG   . PRO A 1 60  ? 27.843  65.539  79.246  1.00 0.00 ?  51  PRO A CG   5  
ATOM 7331  C CD   . PRO A 1 60  ? 27.434  66.961  79.539  1.00 0.00 ?  51  PRO A CD   5  
ATOM 7332  H HA   . PRO A 1 60  ? 28.120  65.812  82.025  1.00 0.00 ?  51  PRO A HA   5  
ATOM 7333  H HB2  . PRO A 1 60  ? 29.950  65.789  79.595  1.00 0.00 ?  51  PRO A HB2  5  
ATOM 7334  H HB3  . PRO A 1 60  ? 29.195  64.449  80.414  1.00 0.00 ?  51  PRO A HB3  5  
ATOM 7335  H HG2  . PRO A 1 60  ? 28.064  65.508  78.179  1.00 0.00 ?  51  PRO A HG2  5  
ATOM 7336  H HG3  . PRO A 1 60  ? 27.042  64.853  79.525  1.00 0.00 ?  51  PRO A HG3  5  
ATOM 7337  H HD2  . PRO A 1 60  ? 27.612  67.626  78.695  1.00 0.00 ?  51  PRO A HD2  5  
ATOM 7338  H HD3  . PRO A 1 60  ? 26.346  66.972  79.598  1.00 0.00 ?  51  PRO A HD3  5  
ATOM 7339  N N    . GLY A 1 61  ? 30.512  65.980  83.051  1.00 0.00 ?  52  GLY A N    5  
ATOM 7340  C CA   . GLY A 1 61  ? 31.651  66.170  83.862  1.00 0.00 ?  52  GLY A CA   5  
ATOM 7341  C C    . GLY A 1 61  ? 31.314  66.515  85.345  1.00 0.00 ?  52  GLY A C    5  
ATOM 7342  O O    . GLY A 1 61  ? 30.165  66.835  85.620  1.00 0.00 ?  52  GLY A O    5  
ATOM 7343  H H    . GLY A 1 61  ? 29.955  65.200  83.372  1.00 0.00 ?  52  GLY A H    5  
ATOM 7344  H HA2  . GLY A 1 61  ? 32.051  65.159  83.777  1.00 0.00 ?  52  GLY A HA2  5  
ATOM 7345  H HA3  . GLY A 1 61  ? 32.349  66.914  83.478  1.00 0.00 ?  52  GLY A HA3  5  
ATOM 7346  N N    . ARG A 1 62  ? 32.357  66.358  86.201  1.00 0.00 ?  53  ARG A N    5  
ATOM 7347  C CA   . ARG A 1 62  ? 32.342  66.298  87.649  1.00 0.00 ?  53  ARG A CA   5  
ATOM 7348  C C    . ARG A 1 62  ? 33.552  66.991  88.373  1.00 0.00 ?  53  ARG A C    5  
ATOM 7349  O O    . ARG A 1 62  ? 33.529  67.179  89.563  1.00 0.00 ?  53  ARG A O    5  
ATOM 7350  C CB   . ARG A 1 62  ? 32.222  64.859  88.085  1.00 0.00 ?  53  ARG A CB   5  
ATOM 7351  C CG   . ARG A 1 62  ? 30.958  64.232  87.555  1.00 0.00 ?  53  ARG A CG   5  
ATOM 7352  C CD   . ARG A 1 62  ? 30.746  62.800  88.126  1.00 0.00 ?  53  ARG A CD   5  
ATOM 7353  N NE   . ARG A 1 62  ? 29.779  62.072  87.297  1.00 0.00 ?  53  ARG A NE   5  
ATOM 7354  C CZ   . ARG A 1 62  ? 29.633  60.796  87.273  1.00 0.00 ?  53  ARG A CZ   5  
ATOM 7355  N NH1  . ARG A 1 62  ? 30.489  59.969  87.750  1.00 0.00 ?  53  ARG A NH1  5  
ATOM 7356  N NH2  . ARG A 1 62  ? 28.594  60.241  86.751  1.00 0.00 1  53  ARG A NH2  5  
ATOM 7357  H H    . ARG A 1 62  ? 33.256  66.161  85.787  1.00 0.00 ?  53  ARG A H    5  
ATOM 7358  H HA   . ARG A 1 62  ? 31.473  66.769  88.111  1.00 0.00 ?  53  ARG A HA   5  
ATOM 7359  H HB2  . ARG A 1 62  ? 33.073  64.350  87.633  1.00 0.00 ?  53  ARG A HB2  5  
ATOM 7360  H HB3  . ARG A 1 62  ? 32.201  64.963  89.170  1.00 0.00 ?  53  ARG A HB3  5  
ATOM 7361  H HG2  . ARG A 1 62  ? 30.057  64.799  87.795  1.00 0.00 ?  53  ARG A HG2  5  
ATOM 7362  H HG3  . ARG A 1 62  ? 31.199  64.188  86.493  1.00 0.00 ?  53  ARG A HG3  5  
ATOM 7363  H HD2  . ARG A 1 62  ? 31.708  62.291  88.182  1.00 0.00 ?  53  ARG A HD2  5  
ATOM 7364  H HD3  . ARG A 1 62  ? 30.296  62.821  89.118  1.00 0.00 ?  53  ARG A HD3  5  
ATOM 7365  H HE   . ARG A 1 62  ? 29.074  62.643  86.852  1.00 0.00 ?  53  ARG A HE   5  
ATOM 7366  H HH11 . ARG A 1 62  ? 31.301  60.275  88.266  1.00 0.00 ?  53  ARG A HH11 5  
ATOM 7367  H HH12 . ARG A 1 62  ? 30.290  59.017  87.481  1.00 0.00 ?  53  ARG A HH12 5  
ATOM 7368  H HH21 . ARG A 1 62  ? 27.981  60.844  86.220  1.00 0.00 ?  53  ARG A HH21 5  
ATOM 7369  H HH22 . ARG A 1 62  ? 28.575  59.247  86.578  1.00 0.00 ?  53  ARG A HH22 5  
ATOM 7370  N N    . ASP A 1 63  ? 34.572  67.279  87.571  1.00 0.00 ?  54  ASP A N    5  
ATOM 7371  C CA   . ASP A 1 63  ? 35.848  67.667  88.167  1.00 0.00 ?  54  ASP A CA   5  
ATOM 7372  C C    . ASP A 1 63  ? 36.795  68.286  87.067  1.00 0.00 ?  54  ASP A C    5  
ATOM 7373  O O    . ASP A 1 63  ? 36.502  68.395  85.860  1.00 0.00 ?  54  ASP A O    5  
ATOM 7374  C CB   . ASP A 1 63  ? 36.678  66.496  88.847  1.00 0.00 ?  54  ASP A CB   5  
ATOM 7375  C CG   . ASP A 1 63  ? 37.311  65.398  87.889  1.00 0.00 ?  54  ASP A CG   5  
ATOM 7376  O OD1  . ASP A 1 63  ? 36.931  65.355  86.708  1.00 0.00 -1 54  ASP A OD1  5  
ATOM 7377  O OD2  . ASP A 1 63  ? 38.181  64.606  88.394  1.00 0.00 ?  54  ASP A OD2  5  
ATOM 7378  H H    . ASP A 1 63  ? 34.420  67.122  86.585  1.00 0.00 ?  54  ASP A H    5  
ATOM 7379  H HA   . ASP A 1 63  ? 35.618  68.559  88.748  1.00 0.00 ?  54  ASP A HA   5  
ATOM 7380  H HB2  . ASP A 1 63  ? 37.484  66.920  89.445  1.00 0.00 ?  54  ASP A HB2  5  
ATOM 7381  H HB3  . ASP A 1 63  ? 35.993  65.973  89.516  1.00 0.00 ?  54  ASP A HB3  5  
ATOM 7382  N N    . ASP A 1 64  ? 38.020  68.635  87.435  1.00 0.00 ?  55  ASP A N    5  
ATOM 7383  C CA   . ASP A 1 64  ? 38.947  69.343  86.564  1.00 0.00 ?  55  ASP A CA   5  
ATOM 7384  C C    . ASP A 1 64  ? 39.618  68.398  85.512  1.00 0.00 ?  55  ASP A C    5  
ATOM 7385  O O    . ASP A 1 64  ? 39.867  68.775  84.351  1.00 0.00 ?  55  ASP A O    5  
ATOM 7386  C CB   . ASP A 1 64  ? 40.033  70.058  87.336  1.00 0.00 ?  55  ASP A CB   5  
ATOM 7387  C CG   . ASP A 1 64  ? 40.741  69.304  88.440  1.00 0.00 ?  55  ASP A CG   5  
ATOM 7388  O OD1  . ASP A 1 64  ? 40.712  68.014  88.562  1.00 0.00 -1 55  ASP A OD1  5  
ATOM 7389  O OD2  . ASP A 1 64  ? 41.322  69.993  89.336  1.00 0.00 ?  55  ASP A OD2  5  
ATOM 7390  H H    . ASP A 1 64  ? 38.236  68.660  88.422  1.00 0.00 ?  55  ASP A H    5  
ATOM 7391  H HA   . ASP A 1 64  ? 38.364  70.070  86.000  1.00 0.00 ?  55  ASP A HA   5  
ATOM 7392  H HB2  . ASP A 1 64  ? 40.828  70.274  86.621  1.00 0.00 ?  55  ASP A HB2  5  
ATOM 7393  H HB3  . ASP A 1 64  ? 39.699  71.019  87.726  1.00 0.00 ?  55  ASP A HB3  5  
ATOM 7394  N N    . ASN A 1 65  ? 39.838  67.087  85.738  1.00 0.00 ?  56  ASN A N    5  
ATOM 7395  C CA   . ASN A 1 65  ? 40.143  66.057  84.687  1.00 0.00 ?  56  ASN A CA   5  
ATOM 7396  C C    . ASN A 1 65  ? 38.975  66.009  83.606  1.00 0.00 ?  56  ASN A C    5  
ATOM 7397  O O    . ASN A 1 65  ? 39.334  66.233  82.438  1.00 0.00 ?  56  ASN A O    5  
ATOM 7398  C CB   . ASN A 1 65  ? 40.494  64.717  85.304  1.00 0.00 ?  56  ASN A CB   5  
ATOM 7399  C CG   . ASN A 1 65  ? 40.825  63.550  84.355  1.00 0.00 ?  56  ASN A CG   5  
ATOM 7400  O OD1  . ASN A 1 65  ? 41.801  63.701  83.603  1.00 0.00 ?  56  ASN A OD1  5  
ATOM 7401  N ND2  . ASN A 1 65  ? 40.150  62.429  84.352  1.00 0.00 ?  56  ASN A ND2  5  
ATOM 7402  H H    . ASN A 1 65  ? 39.702  66.812  86.701  1.00 0.00 ?  56  ASN A H    5  
ATOM 7403  H HA   . ASN A 1 65  ? 41.055  66.335  84.157  1.00 0.00 ?  56  ASN A HA   5  
ATOM 7404  H HB2  . ASN A 1 65  ? 41.389  64.787  85.922  1.00 0.00 ?  56  ASN A HB2  5  
ATOM 7405  H HB3  . ASN A 1 65  ? 39.558  64.521  85.829  1.00 0.00 ?  56  ASN A HB3  5  
ATOM 7406  H HD21 . ASN A 1 65  ? 39.604  62.150  85.155  1.00 0.00 ?  56  ASN A HD21 5  
ATOM 7407  H HD22 . ASN A 1 65  ? 40.268  61.793  83.575  1.00 0.00 ?  56  ASN A HD22 5  
ATOM 7408  N N    . SER A 1 66  ? 37.718  65.734  83.991  1.00 0.00 ?  57  SER A N    5  
ATOM 7409  C CA   . SER A 1 66  ? 36.649  65.702  83.035  1.00 0.00 ?  57  SER A CA   5  
ATOM 7410  C C    . SER A 1 66  ? 36.513  67.013  82.244  1.00 0.00 ?  57  SER A C    5  
ATOM 7411  O O    . SER A 1 66  ? 36.428  66.989  81.004  1.00 0.00 ?  57  SER A O    5  
ATOM 7412  C CB   . SER A 1 66  ? 35.246  65.354  83.575  1.00 0.00 ?  57  SER A CB   5  
ATOM 7413  O OG   . SER A 1 66  ? 35.000  66.095  84.834  1.00 0.00 ?  57  SER A OG   5  
ATOM 7414  H H    . SER A 1 66  ? 37.536  65.612  84.978  1.00 0.00 ?  57  SER A H    5  
ATOM 7415  H HA   . SER A 1 66  ? 36.875  64.945  82.284  1.00 0.00 ?  57  SER A HA   5  
ATOM 7416  H HB2  . SER A 1 66  ? 34.467  65.523  82.833  1.00 0.00 ?  57  SER A HB2  5  
ATOM 7417  H HB3  . SER A 1 66  ? 35.247  64.297  83.839  1.00 0.00 ?  57  SER A HB3  5  
ATOM 7418  H HG   . SER A 1 66  ? 35.719  65.795  85.395  1.00 0.00 ?  57  SER A HG   5  
ATOM 7419  N N    . TYR A 1 67  ? 36.580  68.105  82.965  1.00 0.00 ?  58  TYR A N    5  
ATOM 7420  C CA   . TYR A 1 67  ? 36.339  69.443  82.381  1.00 0.00 ?  58  TYR A CA   5  
ATOM 7421  C C    . TYR A 1 67  ? 37.356  69.961  81.352  1.00 0.00 ?  58  TYR A C    5  
ATOM 7422  O O    . TYR A 1 67  ? 36.980  70.681  80.464  1.00 0.00 ?  58  TYR A O    5  
ATOM 7423  C CB   . TYR A 1 67  ? 35.844  70.567  83.306  1.00 0.00 ?  58  TYR A CB   5  
ATOM 7424  C CG   . TYR A 1 67  ? 34.344  70.514  83.590  1.00 0.00 ?  58  TYR A CG   5  
ATOM 7425  C CD1  . TYR A 1 67  ? 33.401  70.474  82.517  1.00 0.00 ?  58  TYR A CD1  5  
ATOM 7426  C CD2  . TYR A 1 67  ? 34.000  70.211  84.901  1.00 0.00 ?  58  TYR A CD2  5  
ATOM 7427  C CE1  . TYR A 1 67  ? 32.052  70.208  82.833  1.00 0.00 ?  58  TYR A CE1  5  
ATOM 7428  C CE2  . TYR A 1 67  ? 32.696  69.950  85.191  1.00 0.00 ?  58  TYR A CE2  5  
ATOM 7429  C CZ   . TYR A 1 67  ? 31.690  69.985  84.180  1.00 0.00 ?  58  TYR A CZ   5  
ATOM 7430  O OH   . TYR A 1 67  ? 30.423  69.547  84.480  1.00 0.00 ?  58  TYR A OH   5  
ATOM 7431  H H    . TYR A 1 67  ? 36.657  68.050  83.970  1.00 0.00 ?  58  TYR A H    5  
ATOM 7432  H HA   . TYR A 1 67  ? 35.400  69.269  81.854  1.00 0.00 ?  58  TYR A HA   5  
ATOM 7433  H HB2  . TYR A 1 67  ? 36.441  70.432  84.208  1.00 0.00 ?  58  TYR A HB2  5  
ATOM 7434  H HB3  . TYR A 1 67  ? 36.138  71.481  82.791  1.00 0.00 ?  58  TYR A HB3  5  
ATOM 7435  H HD1  . TYR A 1 67  ? 33.776  70.602  81.513  1.00 0.00 ?  58  TYR A HD1  5  
ATOM 7436  H HD2  . TYR A 1 67  ? 34.805  70.150  85.619  1.00 0.00 ?  58  TYR A HD2  5  
ATOM 7437  H HE1  . TYR A 1 67  ? 31.334  70.107  82.032  1.00 0.00 ?  58  TYR A HE1  5  
ATOM 7438  H HE2  . TYR A 1 67  ? 32.400  69.796  86.219  1.00 0.00 ?  58  TYR A HE2  5  
ATOM 7439  H HH   . TYR A 1 67  ? 29.984  68.988  83.835  1.00 0.00 ?  58  TYR A HH   5  
ATOM 7440  N N    . MET A 1 68  ? 38.563  69.422  81.558  1.00 0.00 ?  59  MET A N    5  
ATOM 7441  C CA   . MET A 1 68  ? 39.688  69.809  80.652  1.00 0.00 ?  59  MET A CA   5  
ATOM 7442  C C    . MET A 1 68  ? 39.661  68.862  79.418  1.00 0.00 ?  59  MET A C    5  
ATOM 7443  O O    . MET A 1 68  ? 39.816  69.345  78.250  1.00 0.00 ?  59  MET A O    5  
ATOM 7444  C CB   . MET A 1 68  ? 41.004  69.864  81.448  1.00 0.00 ?  59  MET A CB   5  
ATOM 7445  C CG   . MET A 1 68  ? 41.759  68.609  81.633  1.00 0.00 ?  59  MET A CG   5  
ATOM 7446  S SD   . MET A 1 68  ? 43.435  68.733  82.303  1.00 0.00 ?  59  MET A SD   5  
ATOM 7447  C CE   . MET A 1 68  ? 43.590  67.049  82.945  1.00 0.00 ?  59  MET A CE   5  
ATOM 7448  H H    . MET A 1 68  ? 38.733  68.680  82.222  1.00 0.00 ?  59  MET A H    5  
ATOM 7449  H HA   . MET A 1 68  ? 39.549  70.823  80.275  1.00 0.00 ?  59  MET A HA   5  
ATOM 7450  H HB2  . MET A 1 68  ? 41.758  70.503  80.989  1.00 0.00 ?  59  MET A HB2  5  
ATOM 7451  H HB3  . MET A 1 68  ? 40.716  70.265  82.420  1.00 0.00 ?  59  MET A HB3  5  
ATOM 7452  H HG2  . MET A 1 68  ? 41.095  68.162  82.373  1.00 0.00 ?  59  MET A HG2  5  
ATOM 7453  H HG3  . MET A 1 68  ? 41.769  68.051  80.697  1.00 0.00 ?  59  MET A HG3  5  
ATOM 7454  H HE1  . MET A 1 68  ? 43.439  66.316  82.152  1.00 0.00 ?  59  MET A HE1  5  
ATOM 7455  H HE2  . MET A 1 68  ? 44.589  66.847  83.334  1.00 0.00 ?  59  MET A HE2  5  
ATOM 7456  H HE3  . MET A 1 68  ? 42.940  66.826  83.791  1.00 0.00 ?  59  MET A HE3  5  
ATOM 7457  N N    . TYR A 1 69  ? 39.307  67.582  79.612  1.00 0.00 ?  60  TYR A N    5  
ATOM 7458  C CA   . TYR A 1 69  ? 38.681  66.778  78.502  1.00 0.00 ?  60  TYR A CA   5  
ATOM 7459  C C    . TYR A 1 69  ? 37.465  67.325  77.832  1.00 0.00 ?  60  TYR A C    5  
ATOM 7460  O O    . TYR A 1 69  ? 37.408  67.059  76.655  1.00 0.00 ?  60  TYR A O    5  
ATOM 7461  C CB   . TYR A 1 69  ? 38.532  65.334  78.974  1.00 0.00 ?  60  TYR A CB   5  
ATOM 7462  C CG   . TYR A 1 69  ? 39.754  64.366  78.857  1.00 0.00 ?  60  TYR A CG   5  
ATOM 7463  C CD1  . TYR A 1 69  ? 40.430  64.040  77.589  1.00 0.00 ?  60  TYR A CD1  5  
ATOM 7464  C CD2  . TYR A 1 69  ? 40.367  63.759  79.988  1.00 0.00 ?  60  TYR A CD2  5  
ATOM 7465  C CE1  . TYR A 1 69  ? 41.525  63.179  77.435  1.00 0.00 ?  60  TYR A CE1  5  
ATOM 7466  C CE2  . TYR A 1 69  ? 41.483  62.868  79.886  1.00 0.00 ?  60  TYR A CE2  5  
ATOM 7467  C CZ   . TYR A 1 69  ? 42.088  62.518  78.598  1.00 0.00 ?  60  TYR A CZ   5  
ATOM 7468  O OH   . TYR A 1 69  ? 42.964  61.491  78.427  1.00 0.00 ?  60  TYR A OH   5  
ATOM 7469  H H    . TYR A 1 69  ? 39.196  67.223  80.549  1.00 0.00 ?  60  TYR A H    5  
ATOM 7470  H HA   . TYR A 1 69  ? 39.527  66.725  77.816  1.00 0.00 ?  60  TYR A HA   5  
ATOM 7471  H HB2  . TYR A 1 69  ? 38.275  65.337  80.033  1.00 0.00 ?  60  TYR A HB2  5  
ATOM 7472  H HB3  . TYR A 1 69  ? 37.803  64.895  78.293  1.00 0.00 ?  60  TYR A HB3  5  
ATOM 7473  H HD1  . TYR A 1 69  ? 40.050  64.525  76.702  1.00 0.00 ?  60  TYR A HD1  5  
ATOM 7474  H HD2  . TYR A 1 69  ? 39.961  63.911  80.977  1.00 0.00 ?  60  TYR A HD2  5  
ATOM 7475  H HE1  . TYR A 1 69  ? 41.859  62.933  76.438  1.00 0.00 ?  60  TYR A HE1  5  
ATOM 7476  H HE2  . TYR A 1 69  ? 41.816  62.297  80.740  1.00 0.00 ?  60  TYR A HE2  5  
ATOM 7477  H HH   . TYR A 1 69  ? 43.478  61.359  79.227  1.00 0.00 ?  60  TYR A HH   5  
ATOM 7478  N N    . ILE A 1 70  ? 36.573  68.072  78.459  1.00 0.00 ?  61  ILE A N    5  
ATOM 7479  C CA   . ILE A 1 70  ? 35.388  68.747  77.802  1.00 0.00 ?  61  ILE A CA   5  
ATOM 7480  C C    . ILE A 1 70  ? 35.947  69.930  76.954  1.00 0.00 ?  61  ILE A C    5  
ATOM 7481  O O    . ILE A 1 70  ? 35.429  70.143  75.898  1.00 0.00 ?  61  ILE A O    5  
ATOM 7482  C CB   . ILE A 1 70  ? 34.278  69.140  78.752  1.00 0.00 ?  61  ILE A CB   5  
ATOM 7483  C CG1  . ILE A 1 70  ? 33.553  67.942  79.520  1.00 0.00 ?  61  ILE A CG1  5  
ATOM 7484  C CG2  . ILE A 1 70  ? 33.150  69.956  78.068  1.00 0.00 ?  61  ILE A CG2  5  
ATOM 7485  C CD1  . ILE A 1 70  ? 32.735  66.960  78.658  1.00 0.00 ?  61  ILE A CD1  5  
ATOM 7486  H H    . ILE A 1 70  ? 36.719  68.169  79.454  1.00 0.00 ?  61  ILE A H    5  
ATOM 7487  H HA   . ILE A 1 70  ? 34.993  68.037  77.076  1.00 0.00 ?  61  ILE A HA   5  
ATOM 7488  H HB   . ILE A 1 70  ? 34.741  69.836  79.451  1.00 0.00 ?  61  ILE A HB   5  
ATOM 7489  H HG12 . ILE A 1 70  ? 34.288  67.427  80.139  1.00 0.00 ?  61  ILE A HG12 5  
ATOM 7490  H HG13 . ILE A 1 70  ? 32.909  68.418  80.259  1.00 0.00 ?  61  ILE A HG13 5  
ATOM 7491  H HG21 . ILE A 1 70  ? 33.632  70.833  77.635  1.00 0.00 ?  61  ILE A HG21 5  
ATOM 7492  H HG22 . ILE A 1 70  ? 32.626  69.336  77.340  1.00 0.00 ?  61  ILE A HG22 5  
ATOM 7493  H HG23 . ILE A 1 70  ? 32.426  70.243  78.830  1.00 0.00 ?  61  ILE A HG23 5  
ATOM 7494  H HD11 . ILE A 1 70  ? 31.921  67.448  78.121  1.00 0.00 ?  61  ILE A HD11 5  
ATOM 7495  H HD12 . ILE A 1 70  ? 33.515  66.533  78.029  1.00 0.00 ?  61  ILE A HD12 5  
ATOM 7496  H HD13 . ILE A 1 70  ? 32.108  66.232  79.174  1.00 0.00 ?  61  ILE A HD13 5  
ATOM 7497  N N    . LEU A 1 71  ? 37.004  70.627  77.417  1.00 0.00 ?  62  LEU A N    5  
ATOM 7498  C CA   . LEU A 1 71  ? 37.656  71.723  76.633  1.00 0.00 ?  62  LEU A CA   5  
ATOM 7499  C C    . LEU A 1 71  ? 38.419  71.213  75.384  1.00 0.00 ?  62  LEU A C    5  
ATOM 7500  O O    . LEU A 1 71  ? 38.321  71.825  74.341  1.00 0.00 ?  62  LEU A O    5  
ATOM 7501  C CB   . LEU A 1 71  ? 38.725  72.472  77.537  1.00 0.00 ?  62  LEU A CB   5  
ATOM 7502  C CG   . LEU A 1 71  ? 39.782  73.362  76.921  1.00 0.00 ?  62  LEU A CG   5  
ATOM 7503  C CD1  . LEU A 1 71  ? 38.995  74.610  76.363  1.00 0.00 ?  62  LEU A CD1  5  
ATOM 7504  C CD2  . LEU A 1 71  ? 40.760  73.936  78.013  1.00 0.00 ?  62  LEU A CD2  5  
ATOM 7505  H H    . LEU A 1 71  ? 37.433  70.208  78.229  1.00 0.00 ?  62  LEU A H    5  
ATOM 7506  H HA   . LEU A 1 71  ? 36.926  72.465  76.305  1.00 0.00 ?  62  LEU A HA   5  
ATOM 7507  H HB2  . LEU A 1 71  ? 38.227  73.197  78.182  1.00 0.00 ?  62  LEU A HB2  5  
ATOM 7508  H HB3  . LEU A 1 71  ? 39.242  71.761  78.181  1.00 0.00 ?  62  LEU A HB3  5  
ATOM 7509  H HG   . LEU A 1 71  ? 40.439  72.930  76.166  1.00 0.00 ?  62  LEU A HG   5  
ATOM 7510  H HD11 . LEU A 1 71  ? 38.474  75.014  77.231  1.00 0.00 ?  62  LEU A HD11 5  
ATOM 7511  H HD12 . LEU A 1 71  ? 39.712  75.377  76.067  1.00 0.00 ?  62  LEU A HD12 5  
ATOM 7512  H HD13 . LEU A 1 71  ? 38.279  74.306  75.600  1.00 0.00 ?  62  LEU A HD13 5  
ATOM 7513  H HD21 . LEU A 1 71  ? 41.320  73.200  78.589  1.00 0.00 ?  62  LEU A HD21 5  
ATOM 7514  H HD22 . LEU A 1 71  ? 41.325  74.705  77.485  1.00 0.00 ?  62  LEU A HD22 5  
ATOM 7515  H HD23 . LEU A 1 71  ? 40.098  74.488  78.680  1.00 0.00 ?  62  LEU A HD23 5  
ATOM 7516  N N    . PHE A 1 72  ? 39.123  70.094  75.436  1.00 0.00 ?  63  PHE A N    5  
ATOM 7517  C CA   . PHE A 1 72  ? 39.511  69.206  74.314  1.00 0.00 ?  63  PHE A CA   5  
ATOM 7518  C C    . PHE A 1 72  ? 38.391  68.765  73.371  1.00 0.00 ?  63  PHE A C    5  
ATOM 7519  O O    . PHE A 1 72  ? 38.564  68.654  72.151  1.00 0.00 ?  63  PHE A O    5  
ATOM 7520  C CB   . PHE A 1 72  ? 40.415  68.034  74.678  1.00 0.00 ?  63  PHE A CB   5  
ATOM 7521  C CG   . PHE A 1 72  ? 40.431  66.843  73.832  1.00 0.00 ?  63  PHE A CG   5  
ATOM 7522  C CD1  . PHE A 1 72  ? 41.252  66.763  72.696  1.00 0.00 ?  63  PHE A CD1  5  
ATOM 7523  C CD2  . PHE A 1 72  ? 39.636  65.683  74.140  1.00 0.00 ?  63  PHE A CD2  5  
ATOM 7524  C CE1  . PHE A 1 72  ? 41.375  65.535  71.930  1.00 0.00 ?  63  PHE A CE1  5  
ATOM 7525  C CE2  . PHE A 1 72  ? 39.730  64.541  73.384  1.00 0.00 ?  63  PHE A CE2  5  
ATOM 7526  C CZ   . PHE A 1 72  ? 40.702  64.428  72.383  1.00 0.00 ?  63  PHE A CZ   5  
ATOM 7527  H H    . PHE A 1 72  ? 39.227  69.717  76.367  1.00 0.00 ?  63  PHE A H    5  
ATOM 7528  H HA   . PHE A 1 72  ? 40.080  69.749  73.558  1.00 0.00 ?  63  PHE A HA   5  
ATOM 7529  H HB2  . PHE A 1 72  ? 41.452  68.369  74.691  1.00 0.00 ?  63  PHE A HB2  5  
ATOM 7530  H HB3  . PHE A 1 72  ? 40.217  67.686  75.692  1.00 0.00 ?  63  PHE A HB3  5  
ATOM 7531  H HD1  . PHE A 1 72  ? 41.986  67.548  72.580  1.00 0.00 ?  63  PHE A HD1  5  
ATOM 7532  H HD2  . PHE A 1 72  ? 38.933  65.864  74.938  1.00 0.00 ?  63  PHE A HD2  5  
ATOM 7533  H HE1  . PHE A 1 72  ? 42.032  65.544  71.074  1.00 0.00 ?  63  PHE A HE1  5  
ATOM 7534  H HE2  . PHE A 1 72  ? 39.125  63.707  73.710  1.00 0.00 ?  63  PHE A HE2  5  
ATOM 7535  H HZ   . PHE A 1 72  ? 40.983  63.502  71.904  1.00 0.00 ?  63  PHE A HZ   5  
ATOM 7536  N N    . VAL A 1 73  ? 37.162  68.737  73.875  1.00 0.00 ?  64  VAL A N    5  
ATOM 7537  C CA   . VAL A 1 73  ? 36.062  68.169  73.080  1.00 0.00 ?  64  VAL A CA   5  
ATOM 7538  C C    . VAL A 1 73  ? 35.196  69.310  72.400  1.00 0.00 ?  64  VAL A C    5  
ATOM 7539  O O    . VAL A 1 73  ? 34.533  69.137  71.385  1.00 0.00 ?  64  VAL A O    5  
ATOM 7540  C CB   . VAL A 1 73  ? 35.217  67.231  74.015  1.00 0.00 ?  64  VAL A CB   5  
ATOM 7541  C CG1  . VAL A 1 73  ? 33.701  67.064  73.721  1.00 0.00 ?  64  VAL A CG1  5  
ATOM 7542  C CG2  . VAL A 1 73  ? 35.739  65.770  73.922  1.00 0.00 ?  64  VAL A CG2  5  
ATOM 7543  H H    . VAL A 1 73  ? 37.130  68.954  74.861  1.00 0.00 ?  64  VAL A H    5  
ATOM 7544  H HA   . VAL A 1 73  ? 36.449  67.518  72.296  1.00 0.00 ?  64  VAL A HA   5  
ATOM 7545  H HB   . VAL A 1 73  ? 35.253  67.624  75.031  1.00 0.00 ?  64  VAL A HB   5  
ATOM 7546  H HG11 . VAL A 1 73  ? 33.224  66.284  74.316  1.00 0.00 ?  64  VAL A HG11 5  
ATOM 7547  H HG12 . VAL A 1 73  ? 33.152  67.943  74.060  1.00 0.00 ?  64  VAL A HG12 5  
ATOM 7548  H HG13 . VAL A 1 73  ? 33.453  67.018  72.661  1.00 0.00 ?  64  VAL A HG13 5  
ATOM 7549  H HG21 . VAL A 1 73  ? 36.822  65.710  74.039  1.00 0.00 ?  64  VAL A HG21 5  
ATOM 7550  H HG22 . VAL A 1 73  ? 35.394  65.074  74.686  1.00 0.00 ?  64  VAL A HG22 5  
ATOM 7551  H HG23 . VAL A 1 73  ? 35.568  65.374  72.921  1.00 0.00 ?  64  VAL A HG23 5  
ATOM 7552  N N    . MET A 1 74  ? 35.263  70.541  72.916  1.00 0.00 ?  65  MET A N    5  
ATOM 7553  C CA   . MET A 1 74  ? 35.000  71.769  72.079  1.00 0.00 ?  65  MET A CA   5  
ATOM 7554  C C    . MET A 1 74  ? 36.057  71.945  70.890  1.00 0.00 ?  65  MET A C    5  
ATOM 7555  O O    . MET A 1 74  ? 35.671  72.227  69.761  1.00 0.00 ?  65  MET A O    5  
ATOM 7556  C CB   . MET A 1 74  ? 34.991  72.926  73.066  1.00 0.00 ?  65  MET A CB   5  
ATOM 7557  C CG   . MET A 1 74  ? 34.292  74.181  72.540  1.00 0.00 ?  65  MET A CG   5  
ATOM 7558  S SD   . MET A 1 74  ? 35.123  75.748  73.077  1.00 0.00 ?  65  MET A SD   5  
ATOM 7559  C CE   . MET A 1 74  ? 35.332  75.622  74.855  1.00 0.00 ?  65  MET A CE   5  
ATOM 7560  H H    . MET A 1 74  ? 35.718  70.660  73.809  1.00 0.00 ?  65  MET A H    5  
ATOM 7561  H HA   . MET A 1 74  ? 34.050  71.689  71.549  1.00 0.00 ?  65  MET A HA   5  
ATOM 7562  H HB2  . MET A 1 74  ? 34.534  72.599  74.000  1.00 0.00 ?  65  MET A HB2  5  
ATOM 7563  H HB3  . MET A 1 74  ? 36.025  73.089  73.371  1.00 0.00 ?  65  MET A HB3  5  
ATOM 7564  H HG2  . MET A 1 74  ? 34.235  74.161  71.452  1.00 0.00 ?  65  MET A HG2  5  
ATOM 7565  H HG3  . MET A 1 74  ? 33.218  74.211  72.726  1.00 0.00 ?  65  MET A HG3  5  
ATOM 7566  H HE1  . MET A 1 74  ? 36.011  74.785  75.018  1.00 0.00 ?  65  MET A HE1  5  
ATOM 7567  H HE2  . MET A 1 74  ? 35.792  76.534  75.237  1.00 0.00 ?  65  MET A HE2  5  
ATOM 7568  H HE3  . MET A 1 74  ? 34.403  75.342  75.352  1.00 0.00 ?  65  MET A HE3  5  
ATOM 7569  N N    . PHE A 1 75  ? 37.347  71.580  71.122  1.00 0.00 ?  66  PHE A N    5  
ATOM 7570  C CA   . PHE A 1 75  ? 38.295  71.455  70.009  1.00 0.00 ?  66  PHE A CA   5  
ATOM 7571  C C    . PHE A 1 75  ? 38.044  70.307  68.995  1.00 0.00 ?  66  PHE A C    5  
ATOM 7572  O O    . PHE A 1 75  ? 37.807  70.638  67.836  1.00 0.00 ?  66  PHE A O    5  
ATOM 7573  C CB   . PHE A 1 75  ? 39.807  71.569  70.563  1.00 0.00 ?  66  PHE A CB   5  
ATOM 7574  C CG   . PHE A 1 75  ? 40.896  71.013  69.636  1.00 0.00 ?  66  PHE A CG   5  
ATOM 7575  C CD1  . PHE A 1 75  ? 41.444  71.833  68.653  1.00 0.00 ?  66  PHE A CD1  5  
ATOM 7576  C CD2  . PHE A 1 75  ? 41.230  69.582  69.633  1.00 0.00 ?  66  PHE A CD2  5  
ATOM 7577  C CE1  . PHE A 1 75  ? 42.381  71.360  67.732  1.00 0.00 ?  66  PHE A CE1  5  
ATOM 7578  C CE2  . PHE A 1 75  ? 42.199  69.162  68.673  1.00 0.00 ?  66  PHE A CE2  5  
ATOM 7579  C CZ   . PHE A 1 75  ? 42.810  70.004  67.698  1.00 0.00 ?  66  PHE A CZ   5  
ATOM 7580  H H    . PHE A 1 75  ? 37.713  71.364  72.038  1.00 0.00 ?  66  PHE A H    5  
ATOM 7581  H HA   . PHE A 1 75  ? 38.230  72.336  69.369  1.00 0.00 ?  66  PHE A HA   5  
ATOM 7582  H HB2  . PHE A 1 75  ? 40.096  72.617  70.635  1.00 0.00 ?  66  PHE A HB2  5  
ATOM 7583  H HB3  . PHE A 1 75  ? 39.898  71.105  71.545  1.00 0.00 ?  66  PHE A HB3  5  
ATOM 7584  H HD1  . PHE A 1 75  ? 41.173  72.873  68.550  1.00 0.00 ?  66  PHE A HD1  5  
ATOM 7585  H HD2  . PHE A 1 75  ? 40.722  68.896  70.293  1.00 0.00 ?  66  PHE A HD2  5  
ATOM 7586  H HE1  . PHE A 1 75  ? 42.807  72.107  67.080  1.00 0.00 ?  66  PHE A HE1  5  
ATOM 7587  H HE2  . PHE A 1 75  ? 42.517  68.131  68.616  1.00 0.00 ?  66  PHE A HE2  5  
ATOM 7588  H HZ   . PHE A 1 75  ? 43.590  69.640  67.045  1.00 0.00 ?  66  PHE A HZ   5  
ATOM 7589  N N    . LEU A 1 76  ? 37.829  69.098  69.521  1.00 0.00 ?  67  LEU A N    5  
ATOM 7590  C CA   . LEU A 1 76  ? 37.367  67.957  68.680  1.00 0.00 ?  67  LEU A CA   5  
ATOM 7591  C C    . LEU A 1 76  ? 36.043  68.155  68.014  1.00 0.00 ?  67  LEU A C    5  
ATOM 7592  O O    . LEU A 1 76  ? 35.829  67.731  66.885  1.00 0.00 ?  67  LEU A O    5  
ATOM 7593  C CB   . LEU A 1 76  ? 37.245  66.704  69.566  1.00 0.00 ?  67  LEU A CB   5  
ATOM 7594  C CG   . LEU A 1 76  ? 36.672  65.400  69.028  1.00 0.00 ?  67  LEU A CG   5  
ATOM 7595  C CD1  . LEU A 1 76  ? 37.560  64.847  67.835  1.00 0.00 ?  67  LEU A CD1  5  
ATOM 7596  C CD2  . LEU A 1 76  ? 36.622  64.298  70.092  1.00 0.00 ?  67  LEU A CD2  5  
ATOM 7597  H H    . LEU A 1 76  ? 38.009  69.001  70.510  1.00 0.00 ?  67  LEU A H    5  
ATOM 7598  H HA   . LEU A 1 76  ? 38.172  67.820  67.958  1.00 0.00 ?  67  LEU A HA   5  
ATOM 7599  H HB2  . LEU A 1 76  ? 38.200  66.445  70.024  1.00 0.00 ?  67  LEU A HB2  5  
ATOM 7600  H HB3  . LEU A 1 76  ? 36.635  66.987  70.424  1.00 0.00 ?  67  LEU A HB3  5  
ATOM 7601  H HG   . LEU A 1 76  ? 35.660  65.647  68.705  1.00 0.00 ?  67  LEU A HG   5  
ATOM 7602  H HD11 . LEU A 1 76  ? 37.156  65.297  66.927  1.00 0.00 ?  67  LEU A HD11 5  
ATOM 7603  H HD12 . LEU A 1 76  ? 38.603  65.111  68.012  1.00 0.00 ?  67  LEU A HD12 5  
ATOM 7604  H HD13 . LEU A 1 76  ? 37.371  63.789  67.655  1.00 0.00 ?  67  LEU A HD13 5  
ATOM 7605  H HD21 . LEU A 1 76  ? 36.070  64.702  70.941  1.00 0.00 ?  67  LEU A HD21 5  
ATOM 7606  H HD22 . LEU A 1 76  ? 36.028  63.476  69.689  1.00 0.00 ?  67  LEU A HD22 5  
ATOM 7607  H HD23 . LEU A 1 76  ? 37.653  64.020  70.311  1.00 0.00 ?  67  LEU A HD23 5  
ATOM 7608  N N    . PHE A 1 77  ? 35.170  69.008  68.577  1.00 0.00 ?  68  PHE A N    5  
ATOM 7609  C CA   . PHE A 1 77  ? 34.010  69.547  67.824  1.00 0.00 ?  68  PHE A CA   5  
ATOM 7610  C C    . PHE A 1 77  ? 34.363  70.360  66.622  1.00 0.00 ?  68  PHE A C    5  
ATOM 7611  O O    . PHE A 1 77  ? 33.879  70.026  65.554  1.00 0.00 ?  68  PHE A O    5  
ATOM 7612  C CB   . PHE A 1 77  ? 33.062  70.230  68.812  1.00 0.00 ?  68  PHE A CB   5  
ATOM 7613  C CG   . PHE A 1 77  ? 32.187  71.265  68.165  1.00 0.00 ?  68  PHE A CG   5  
ATOM 7614  C CD1  . PHE A 1 77  ? 31.311  70.911  67.157  1.00 0.00 ?  68  PHE A CD1  5  
ATOM 7615  C CD2  . PHE A 1 77  ? 32.376  72.581  68.325  1.00 0.00 ?  68  PHE A CD2  5  
ATOM 7616  C CE1  . PHE A 1 77  ? 30.530  71.819  66.471  1.00 0.00 ?  68  PHE A CE1  5  
ATOM 7617  C CE2  . PHE A 1 77  ? 31.657  73.603  67.587  1.00 0.00 ?  68  PHE A CE2  5  
ATOM 7618  C CZ   . PHE A 1 77  ? 30.740  73.197  66.599  1.00 0.00 ?  68  PHE A CZ   5  
ATOM 7619  H H    . PHE A 1 77  ? 35.267  69.390  69.507  1.00 0.00 ?  68  PHE A H    5  
ATOM 7620  H HA   . PHE A 1 77  ? 33.460  68.662  67.505  1.00 0.00 ?  68  PHE A HA   5  
ATOM 7621  H HB2  . PHE A 1 77  ? 32.441  69.452  69.256  1.00 0.00 ?  68  PHE A HB2  5  
ATOM 7622  H HB3  . PHE A 1 77  ? 33.637  70.745  69.580  1.00 0.00 ?  68  PHE A HB3  5  
ATOM 7623  H HD1  . PHE A 1 77  ? 31.242  69.893  66.797  1.00 0.00 ?  68  PHE A HD1  5  
ATOM 7624  H HD2  . PHE A 1 77  ? 33.134  73.026  68.951  1.00 0.00 ?  68  PHE A HD2  5  
ATOM 7625  H HE1  . PHE A 1 77  ? 29.905  71.402  65.695  1.00 0.00 ?  68  PHE A HE1  5  
ATOM 7626  H HE2  . PHE A 1 77  ? 31.970  74.635  67.635  1.00 0.00 ?  68  PHE A HE2  5  
ATOM 7627  H HZ   . PHE A 1 77  ? 30.269  73.919  65.949  1.00 0.00 ?  68  PHE A HZ   5  
ATOM 7628  N N    . ALA A 1 78  ? 35.194  71.415  66.640  1.00 0.00 ?  69  ALA A N    5  
ATOM 7629  C CA   . ALA A 1 78  ? 35.501  72.034  65.381  1.00 0.00 ?  69  ALA A CA   5  
ATOM 7630  C C    . ALA A 1 78  ? 36.155  71.058  64.266  1.00 0.00 ?  69  ALA A C    5  
ATOM 7631  O O    . ALA A 1 78  ? 35.892  71.174  63.047  1.00 0.00 ?  69  ALA A O    5  
ATOM 7632  C CB   . ALA A 1 78  ? 36.431  73.237  65.559  1.00 0.00 ?  69  ALA A CB   5  
ATOM 7633  H H    . ALA A 1 78  ? 35.667  71.756  67.465  1.00 0.00 ?  69  ALA A H    5  
ATOM 7634  H HA   . ALA A 1 78  ? 34.494  72.352  65.113  1.00 0.00 ?  69  ALA A HA   5  
ATOM 7635  H HB1  . ALA A 1 78  ? 36.022  74.060  66.146  1.00 0.00 ?  69  ALA A HB1  5  
ATOM 7636  H HB2  . ALA A 1 78  ? 37.242  72.862  66.184  1.00 0.00 ?  69  ALA A HB2  5  
ATOM 7637  H HB3  . ALA A 1 78  ? 36.772  73.659  64.613  1.00 0.00 ?  69  ALA A HB3  5  
ATOM 7638  N N    . VAL A 1 79  ? 36.835  70.042  64.729  1.00 0.00 ?  70  VAL A N    5  
ATOM 7639  C CA   . VAL A 1 79  ? 37.319  68.959  63.790  1.00 0.00 ?  70  VAL A CA   5  
ATOM 7640  C C    . VAL A 1 79  ? 36.248  67.990  63.303  1.00 0.00 ?  70  VAL A C    5  
ATOM 7641  O O    . VAL A 1 79  ? 36.252  67.565  62.145  1.00 0.00 ?  70  VAL A O    5  
ATOM 7642  C CB   . VAL A 1 79  ? 38.436  68.124  64.449  1.00 0.00 ?  70  VAL A CB   5  
ATOM 7643  C CG1  . VAL A 1 79  ? 39.238  67.183  63.466  1.00 0.00 ?  70  VAL A CG1  5  
ATOM 7644  C CG2  . VAL A 1 79  ? 39.532  68.805  65.348  1.00 0.00 ?  70  VAL A CG2  5  
ATOM 7645  H H    . VAL A 1 79  ? 36.880  69.934  65.732  1.00 0.00 ?  70  VAL A H    5  
ATOM 7646  H HA   . VAL A 1 79  ? 37.789  69.414  62.919  1.00 0.00 ?  70  VAL A HA   5  
ATOM 7647  H HB   . VAL A 1 79  ? 37.981  67.536  65.246  1.00 0.00 ?  70  VAL A HB   5  
ATOM 7648  H HG11 . VAL A 1 79  ? 39.951  66.683  64.120  1.00 0.00 ?  70  VAL A HG11 5  
ATOM 7649  H HG12 . VAL A 1 79  ? 38.559  66.454  63.022  1.00 0.00 ?  70  VAL A HG12 5  
ATOM 7650  H HG13 . VAL A 1 79  ? 39.943  67.719  62.833  1.00 0.00 ?  70  VAL A HG13 5  
ATOM 7651  H HG21 . VAL A 1 79  ? 39.124  69.194  66.280  1.00 0.00 ?  70  VAL A HG21 5  
ATOM 7652  H HG22 . VAL A 1 79  ? 40.271  68.057  65.635  1.00 0.00 ?  70  VAL A HG22 5  
ATOM 7653  H HG23 . VAL A 1 79  ? 40.053  69.572  64.775  1.00 0.00 ?  70  VAL A HG23 5  
ATOM 7654  N N    . THR A 1 80  ? 35.227  67.666  64.101  1.00 0.00 ?  71  THR A N    5  
ATOM 7655  C CA   . THR A 1 80  ? 33.941  67.059  63.878  1.00 0.00 ?  71  THR A CA   5  
ATOM 7656  C C    . THR A 1 80  ? 33.087  67.848  62.918  1.00 0.00 ?  71  THR A C    5  
ATOM 7657  O O    . THR A 1 80  ? 32.202  67.292  62.241  1.00 0.00 ?  71  THR A O    5  
ATOM 7658  C CB   . THR A 1 80  ? 33.253  66.352  65.063  1.00 0.00 ?  71  THR A CB   5  
ATOM 7659  O OG1  . THR A 1 80  ? 34.104  65.858  66.077  1.00 0.00 ?  71  THR A OG1  5  
ATOM 7660  C CG2  . THR A 1 80  ? 32.276  65.243  64.784  1.00 0.00 ?  71  THR A CG2  5  
ATOM 7661  H H    . THR A 1 80  ? 35.318  68.055  65.028  1.00 0.00 ?  71  THR A H    5  
ATOM 7662  H HA   . THR A 1 80  ? 34.289  66.222  63.272  1.00 0.00 ?  71  THR A HA   5  
ATOM 7663  H HB   . THR A 1 80  ? 32.641  67.079  65.598  1.00 0.00 ?  71  THR A HB   5  
ATOM 7664  H HG1  . THR A 1 80  ? 34.750  66.516  66.341  1.00 0.00 ?  71  THR A HG1  5  
ATOM 7665  H HG21 . THR A 1 80  ? 31.696  65.552  63.914  1.00 0.00 ?  71  THR A HG21 5  
ATOM 7666  H HG22 . THR A 1 80  ? 32.728  64.264  64.629  1.00 0.00 ?  71  THR A HG22 5  
ATOM 7667  H HG23 . THR A 1 80  ? 31.643  65.144  65.666  1.00 0.00 ?  71  THR A HG23 5  
ATOM 7668  N N    . VAL A 1 81  ? 33.336  69.131  62.770  1.00 0.00 ?  72  VAL A N    5  
ATOM 7669  C CA   . VAL A 1 81  ? 32.779  69.969  61.673  1.00 0.00 ?  72  VAL A CA   5  
ATOM 7670  C C    . VAL A 1 81  ? 33.499  69.794  60.316  1.00 0.00 ?  72  VAL A C    5  
ATOM 7671  O O    . VAL A 1 81  ? 32.740  69.578  59.353  1.00 0.00 ?  72  VAL A O    5  
ATOM 7672  C CB   . VAL A 1 81  ? 32.769  71.505  62.124  1.00 0.00 ?  72  VAL A CB   5  
ATOM 7673  C CG1  . VAL A 1 81  ? 31.875  72.394  61.186  1.00 0.00 ?  72  VAL A CG1  5  
ATOM 7674  C CG2  . VAL A 1 81  ? 32.123  71.844  63.472  1.00 0.00 ?  72  VAL A CG2  5  
ATOM 7675  H H    . VAL A 1 81  ? 34.050  69.578  63.327  1.00 0.00 ?  72  VAL A H    5  
ATOM 7676  H HA   . VAL A 1 81  ? 31.749  69.842  61.341  1.00 0.00 ?  72  VAL A HA   5  
ATOM 7677  H HB   . VAL A 1 81  ? 33.743  71.992  62.081  1.00 0.00 ?  72  VAL A HB   5  
ATOM 7678  H HG11 . VAL A 1 81  ? 30.836  72.102  61.338  1.00 0.00 ?  72  VAL A HG11 5  
ATOM 7679  H HG12 . VAL A 1 81  ? 31.978  73.438  61.480  1.00 0.00 ?  72  VAL A HG12 5  
ATOM 7680  H HG13 . VAL A 1 81  ? 32.349  72.207  60.223  1.00 0.00 ?  72  VAL A HG13 5  
ATOM 7681  H HG21 . VAL A 1 81  ? 31.034  71.848  63.476  1.00 0.00 ?  72  VAL A HG21 5  
ATOM 7682  H HG22 . VAL A 1 81  ? 32.393  71.139  64.260  1.00 0.00 ?  72  VAL A HG22 5  
ATOM 7683  H HG23 . VAL A 1 81  ? 32.417  72.861  63.736  1.00 0.00 ?  72  VAL A HG23 5  
ATOM 7684  N N    . GLY A 1 82  ? 34.819  69.618  60.246  1.00 0.00 ?  73  GLY A N    5  
ATOM 7685  C CA   . GLY A 1 82  ? 35.572  69.112  59.080  1.00 0.00 ?  73  GLY A CA   5  
ATOM 7686  C C    . GLY A 1 82  ? 35.135  67.621  58.839  1.00 0.00 ?  73  GLY A C    5  
ATOM 7687  O O    . GLY A 1 82  ? 34.934  67.283  57.665  1.00 0.00 ?  73  GLY A O    5  
ATOM 7688  H H    . GLY A 1 82  ? 35.378  69.780  61.071  1.00 0.00 ?  73  GLY A H    5  
ATOM 7689  H HA2  . GLY A 1 82  ? 35.384  69.791  58.249  1.00 0.00 ?  73  GLY A HA2  5  
ATOM 7690  H HA3  . GLY A 1 82  ? 36.640  69.285  59.206  1.00 0.00 ?  73  GLY A HA3  5  
ATOM 7691  N N    . SER A 1 83  ? 34.923  66.801  59.872  1.00 0.00 ?  74  SER A N    5  
ATOM 7692  C CA   . SER A 1 83  ? 34.653  65.365  59.732  1.00 0.00 ?  74  SER A CA   5  
ATOM 7693  C C    . SER A 1 83  ? 33.185  65.109  59.273  1.00 0.00 ?  74  SER A C    5  
ATOM 7694  O O    . SER A 1 83  ? 33.017  64.324  58.373  1.00 0.00 ?  74  SER A O    5  
ATOM 7695  C CB   . SER A 1 83  ? 34.912  64.495  60.886  1.00 0.00 ?  74  SER A CB   5  
ATOM 7696  O OG   . SER A 1 83  ? 35.171  63.197  60.518  1.00 0.00 ?  74  SER A OG   5  
ATOM 7697  H H    . SER A 1 83  ? 35.165  67.132  60.794  1.00 0.00 ?  74  SER A H    5  
ATOM 7698  H HA   . SER A 1 83  ? 35.387  65.112  58.968  1.00 0.00 ?  74  SER A HA   5  
ATOM 7699  H HB2  . SER A 1 83  ? 35.756  64.867  61.467  1.00 0.00 ?  74  SER A HB2  5  
ATOM 7700  H HB3  . SER A 1 83  ? 34.021  64.411  61.510  1.00 0.00 ?  74  SER A HB3  5  
ATOM 7701  H HG   . SER A 1 83  ? 34.719  62.663  61.175  1.00 0.00 ?  74  SER A HG   5  
ATOM 7702  N N    . LEU A 1 84  ? 32.239  65.918  59.681  1.00 0.00 ?  75  LEU A N    5  
ATOM 7703  C CA   . LEU A 1 84  ? 30.825  65.896  59.201  1.00 0.00 ?  75  LEU A CA   5  
ATOM 7704  C C    . LEU A 1 84  ? 30.774  66.523  57.731  1.00 0.00 ?  75  LEU A C    5  
ATOM 7705  O O    . LEU A 1 84  ? 29.900  66.054  56.988  1.00 0.00 ?  75  LEU A O    5  
ATOM 7706  C CB   . LEU A 1 84  ? 29.817  66.606  60.136  1.00 0.00 ?  75  LEU A CB   5  
ATOM 7707  C CG   . LEU A 1 84  ? 28.386  66.800  59.641  1.00 0.00 ?  75  LEU A CG   5  
ATOM 7708  C CD1  . LEU A 1 84  ? 27.671  65.518  59.157  1.00 0.00 ?  75  LEU A CD1  5  
ATOM 7709  C CD2  . LEU A 1 84  ? 27.368  67.383  60.666  1.00 0.00 ?  75  LEU A CD2  5  
ATOM 7710  H H    . LEU A 1 84  ? 32.506  66.595  60.382  1.00 0.00 ?  75  LEU A H    5  
ATOM 7711  H HA   . LEU A 1 84  ? 30.464  64.871  59.112  1.00 0.00 ?  75  LEU A HA   5  
ATOM 7712  H HB2  . LEU A 1 84  ? 29.840  66.175  61.137  1.00 0.00 ?  75  LEU A HB2  5  
ATOM 7713  H HB3  . LEU A 1 84  ? 30.250  67.594  60.294  1.00 0.00 ?  75  LEU A HB3  5  
ATOM 7714  H HG   . LEU A 1 84  ? 28.401  67.487  58.796  1.00 0.00 ?  75  LEU A HG   5  
ATOM 7715  H HD11 . LEU A 1 84  ? 28.170  64.960  58.365  1.00 0.00 ?  75  LEU A HD11 5  
ATOM 7716  H HD12 . LEU A 1 84  ? 27.509  65.006  60.106  1.00 0.00 ?  75  LEU A HD12 5  
ATOM 7717  H HD13 . LEU A 1 84  ? 26.715  65.860  58.760  1.00 0.00 ?  75  LEU A HD13 5  
ATOM 7718  H HD21 . LEU A 1 84  ? 27.739  67.076  61.644  1.00 0.00 ?  75  LEU A HD21 5  
ATOM 7719  H HD22 . LEU A 1 84  ? 27.464  68.452  60.480  1.00 0.00 ?  75  LEU A HD22 5  
ATOM 7720  H HD23 . LEU A 1 84  ? 26.342  67.055  60.498  1.00 0.00 ?  75  LEU A HD23 5  
ATOM 7721  N N    . ILE A 1 85  ? 31.532  67.531  57.342  1.00 0.00 ?  76  ILE A N    5  
ATOM 7722  C CA   . ILE A 1 85  ? 31.495  67.979  55.935  1.00 0.00 ?  76  ILE A CA   5  
ATOM 7723  C C    . ILE A 1 85  ? 32.103  66.888  55.049  1.00 0.00 ?  76  ILE A C    5  
ATOM 7724  O O    . ILE A 1 85  ? 31.611  66.645  53.971  1.00 0.00 ?  76  ILE A O    5  
ATOM 7725  C CB   . ILE A 1 85  ? 32.216  69.415  55.752  1.00 0.00 ?  76  ILE A CB   5  
ATOM 7726  C CG1  . ILE A 1 85  ? 31.418  70.520  56.562  1.00 0.00 ?  76  ILE A CG1  5  
ATOM 7727  C CG2  . ILE A 1 85  ? 32.362  69.808  54.286  1.00 0.00 ?  76  ILE A CG2  5  
ATOM 7728  C CD1  . ILE A 1 85  ? 32.302  71.724  56.961  1.00 0.00 ?  76  ILE A CD1  5  
ATOM 7729  H H    . ILE A 1 85  ? 32.228  67.955  57.938  1.00 0.00 ?  76  ILE A H    5  
ATOM 7730  H HA   . ILE A 1 85  ? 30.483  68.137  55.564  1.00 0.00 ?  76  ILE A HA   5  
ATOM 7731  H HB   . ILE A 1 85  ? 33.187  69.368  56.245  1.00 0.00 ?  76  ILE A HB   5  
ATOM 7732  H HG12 . ILE A 1 85  ? 30.461  70.880  56.183  1.00 0.00 ?  76  ILE A HG12 5  
ATOM 7733  H HG13 . ILE A 1 85  ? 31.182  70.102  57.540  1.00 0.00 ?  76  ILE A HG13 5  
ATOM 7734  H HG21 . ILE A 1 85  ? 32.518  70.865  54.069  1.00 0.00 ?  76  ILE A HG21 5  
ATOM 7735  H HG22 . ILE A 1 85  ? 33.153  69.206  53.841  1.00 0.00 ?  76  ILE A HG22 5  
ATOM 7736  H HG23 . ILE A 1 85  ? 31.439  69.603  53.744  1.00 0.00 ?  76  ILE A HG23 5  
ATOM 7737  H HD11 . ILE A 1 85  ? 32.566  72.384  56.134  1.00 0.00 ?  76  ILE A HD11 5  
ATOM 7738  H HD12 . ILE A 1 85  ? 31.862  72.324  57.758  1.00 0.00 ?  76  ILE A HD12 5  
ATOM 7739  H HD13 . ILE A 1 85  ? 33.239  71.426  57.430  1.00 0.00 ?  76  ILE A HD13 5  
ATOM 7740  N N    . LEU A 1 86  ? 33.174  66.237  55.538  1.00 0.00 ?  77  LEU A N    5  
ATOM 7741  C CA   . LEU A 1 86  ? 33.737  65.046  54.923  1.00 0.00 ?  77  LEU A CA   5  
ATOM 7742  C C    . LEU A 1 86  ? 32.748  63.829  54.818  1.00 0.00 ?  77  LEU A C    5  
ATOM 7743  O O    . LEU A 1 86  ? 32.695  63.140  53.811  1.00 0.00 ?  77  LEU A O    5  
ATOM 7744  C CB   . LEU A 1 86  ? 35.093  64.742  55.725  1.00 0.00 ?  77  LEU A CB   5  
ATOM 7745  C CG   . LEU A 1 86  ? 35.883  63.506  55.221  1.00 0.00 ?  77  LEU A CG   5  
ATOM 7746  C CD1  . LEU A 1 86  ? 36.454  63.699  53.809  1.00 0.00 ?  77  LEU A CD1  5  
ATOM 7747  C CD2  . LEU A 1 86  ? 37.048  63.178  56.071  1.00 0.00 ?  77  LEU A CD2  5  
ATOM 7748  H H    . LEU A 1 86  ? 33.635  66.604  56.358  1.00 0.00 ?  77  LEU A H    5  
ATOM 7749  H HA   . LEU A 1 86  ? 33.991  65.217  53.876  1.00 0.00 ?  77  LEU A HA   5  
ATOM 7750  H HB2  . LEU A 1 86  ? 35.781  65.582  55.623  1.00 0.00 ?  77  LEU A HB2  5  
ATOM 7751  H HB3  . LEU A 1 86  ? 34.782  64.557  56.753  1.00 0.00 ?  77  LEU A HB3  5  
ATOM 7752  H HG   . LEU A 1 86  ? 35.273  62.603  55.221  1.00 0.00 ?  77  LEU A HG   5  
ATOM 7753  H HD11 . LEU A 1 86  ? 37.070  64.592  53.700  1.00 0.00 ?  77  LEU A HD11 5  
ATOM 7754  H HD12 . LEU A 1 86  ? 37.160  62.921  53.519  1.00 0.00 ?  77  LEU A HD12 5  
ATOM 7755  H HD13 . LEU A 1 86  ? 35.705  63.609  53.023  1.00 0.00 ?  77  LEU A HD13 5  
ATOM 7756  H HD21 . LEU A 1 86  ? 36.714  62.765  57.023  1.00 0.00 ?  77  LEU A HD21 5  
ATOM 7757  H HD22 . LEU A 1 86  ? 37.632  62.429  55.538  1.00 0.00 ?  77  LEU A HD22 5  
ATOM 7758  H HD23 . LEU A 1 86  ? 37.671  64.065  56.191  1.00 0.00 ?  77  LEU A HD23 5  
ATOM 7759  N N    . GLY A 1 87  ? 31.899  63.625  55.817  1.00 0.00 ?  78  GLY A N    5  
ATOM 7760  C CA   . GLY A 1 87  ? 30.836  62.617  55.845  1.00 0.00 ?  78  GLY A CA   5  
ATOM 7761  C C    . GLY A 1 87  ? 29.651  62.902  54.878  1.00 0.00 ?  78  GLY A C    5  
ATOM 7762  O O    . GLY A 1 87  ? 29.140  61.958  54.279  1.00 0.00 ?  78  GLY A O    5  
ATOM 7763  H H    . GLY A 1 87  ? 32.046  64.227  56.614  1.00 0.00 ?  78  GLY A H    5  
ATOM 7764  H HA2  . GLY A 1 87  ? 31.366  61.720  55.525  1.00 0.00 ?  78  GLY A HA2  5  
ATOM 7765  H HA3  . GLY A 1 87  ? 30.467  62.675  56.869  1.00 0.00 ?  78  GLY A HA3  5  
ATOM 7766  N N    . TYR A 1 88  ? 29.224  64.166  54.678  1.00 0.00 ?  79  TYR A N    5  
ATOM 7767  C CA   . TYR A 1 88  ? 28.454  64.505  53.486  1.00 0.00 ?  79  TYR A CA   5  
ATOM 7768  C C    . TYR A 1 88  ? 29.057  64.095  52.103  1.00 0.00 ?  79  TYR A C    5  
ATOM 7769  O O    . TYR A 1 88  ? 28.444  63.527  51.209  1.00 0.00 ?  79  TYR A O    5  
ATOM 7770  C CB   . TYR A 1 88  ? 27.983  65.935  53.530  1.00 0.00 ?  79  TYR A CB   5  
ATOM 7771  C CG   . TYR A 1 88  ? 26.703  66.116  54.260  1.00 0.00 ?  79  TYR A CG   5  
ATOM 7772  C CD1  . TYR A 1 88  ? 26.622  66.266  55.696  1.00 0.00 ?  79  TYR A CD1  5  
ATOM 7773  C CD2  . TYR A 1 88  ? 25.532  66.254  53.471  1.00 0.00 ?  79  TYR A CD2  5  
ATOM 7774  C CE1  . TYR A 1 88  ? 25.413  66.666  56.289  1.00 0.00 ?  79  TYR A CE1  5  
ATOM 7775  C CE2  . TYR A 1 88  ? 24.352  66.596  54.128  1.00 0.00 ?  79  TYR A CE2  5  
ATOM 7776  C CZ   . TYR A 1 88  ? 24.252  66.803  55.537  1.00 0.00 ?  79  TYR A CZ   5  
ATOM 7777  O OH   . TYR A 1 88  ? 23.164  67.054  56.234  1.00 0.00 ?  79  TYR A OH   5  
ATOM 7778  H H    . TYR A 1 88  ? 29.489  64.957  55.248  1.00 0.00 ?  79  TYR A H    5  
ATOM 7779  H HA   . TYR A 1 88  ? 27.566  63.872  53.471  1.00 0.00 ?  79  TYR A HA   5  
ATOM 7780  H HB2  . TYR A 1 88  ? 28.781  66.577  53.903  1.00 0.00 ?  79  TYR A HB2  5  
ATOM 7781  H HB3  . TYR A 1 88  ? 27.916  66.259  52.492  1.00 0.00 ?  79  TYR A HB3  5  
ATOM 7782  H HD1  . TYR A 1 88  ? 27.566  66.146  56.206  1.00 0.00 ?  79  TYR A HD1  5  
ATOM 7783  H HD2  . TYR A 1 88  ? 25.537  66.191  52.392  1.00 0.00 ?  79  TYR A HD2  5  
ATOM 7784  H HE1  . TYR A 1 88  ? 25.336  66.864  57.348  1.00 0.00 ?  79  TYR A HE1  5  
ATOM 7785  H HE2  . TYR A 1 88  ? 23.469  66.804  53.541  1.00 0.00 ?  79  TYR A HE2  5  
ATOM 7786  H HH   . TYR A 1 88  ? 22.408  67.332  55.713  1.00 0.00 ?  79  TYR A HH   5  
ATOM 7787  N N    . THR A 1 89  ? 30.392  64.173  52.076  1.00 0.00 ?  80  THR A N    5  
ATOM 7788  C CA   . THR A 1 89  ? 31.242  63.590  51.016  1.00 0.00 ?  80  THR A CA   5  
ATOM 7789  C C    . THR A 1 89  ? 31.231  62.073  50.827  1.00 0.00 ?  80  THR A C    5  
ATOM 7790  O O    . THR A 1 89  ? 31.055  61.520  49.752  1.00 0.00 ?  80  THR A O    5  
ATOM 7791  C CB   . THR A 1 89  ? 32.678  64.156  50.792  1.00 0.00 ?  80  THR A CB   5  
ATOM 7792  O OG1  . THR A 1 89  ? 32.798  65.471  51.279  1.00 0.00 ?  80  THR A OG1  5  
ATOM 7793  C CG2  . THR A 1 89  ? 32.983  64.161  49.303  1.00 0.00 ?  80  THR A CG2  5  
ATOM 7794  H H    . THR A 1 89  ? 30.908  64.715  52.754  1.00 0.00 ?  80  THR A H    5  
ATOM 7795  H HA   . THR A 1 89  ? 30.723  63.962  50.134  1.00 0.00 ?  80  THR A HA   5  
ATOM 7796  H HB   . THR A 1 89  ? 33.396  63.564  51.360  1.00 0.00 ?  80  THR A HB   5  
ATOM 7797  H HG1  . THR A 1 89  ? 32.234  66.170  50.939  1.00 0.00 ?  80  THR A HG1  5  
ATOM 7798  H HG21 . THR A 1 89  ? 32.786  65.153  48.897  1.00 0.00 ?  80  THR A HG21 5  
ATOM 7799  H HG22 . THR A 1 89  ? 34.023  63.894  49.114  1.00 0.00 ?  80  THR A HG22 5  
ATOM 7800  H HG23 . THR A 1 89  ? 32.446  63.384  48.761  1.00 0.00 ?  80  THR A HG23 5  
ATOM 7801  N N    . ARG A 1 90  ? 31.485  61.388  51.927  1.00 0.00 ?  81  ARG A N    5  
ATOM 7802  C CA   . ARG A 1 90  ? 31.736  59.881  51.967  1.00 0.00 ?  81  ARG A CA   5  
ATOM 7803  C C    . ARG A 1 90  ? 30.587  59.115  52.658  1.00 0.00 ?  81  ARG A C    5  
ATOM 7804  O O    . ARG A 1 90  ? 29.797  58.494  52.032  1.00 0.00 ?  81  ARG A O    5  
ATOM 7805  C CB   . ARG A 1 90  ? 33.100  59.637  52.666  1.00 0.00 ?  81  ARG A CB   5  
ATOM 7806  C CG   . ARG A 1 90  ? 34.243  60.519  52.080  1.00 0.00 ?  81  ARG A CG   5  
ATOM 7807  C CD   . ARG A 1 90  ? 35.753  60.189  52.547  1.00 0.00 ?  81  ARG A CD   5  
ATOM 7808  N NE   . ARG A 1 90  ? 36.808  61.090  51.957  1.00 0.00 ?  81  ARG A NE   5  
ATOM 7809  C CZ   . ARG A 1 90  ? 38.112  61.066  51.991  1.00 0.00 ?  81  ARG A CZ   5  
ATOM 7810  N NH1  . ARG A 1 90  ? 38.676  60.334  52.840  1.00 0.00 ?  81  ARG A NH1  5  
ATOM 7811  N NH2  . ARG A 1 90  ? 38.837  61.899  51.368  1.00 0.00 1  81  ARG A NH2  5  
ATOM 7812  H H    . ARG A 1 90  ? 31.496  61.923  52.784  1.00 0.00 ?  81  ARG A H    5  
ATOM 7813  H HA   . ARG A 1 90  ? 31.774  59.473  50.957  1.00 0.00 ?  81  ARG A HA   5  
ATOM 7814  H HB2  . ARG A 1 90  ? 33.002  59.946  53.706  1.00 0.00 ?  81  ARG A HB2  5  
ATOM 7815  H HB3  . ARG A 1 90  ? 33.445  58.603  52.666  1.00 0.00 ?  81  ARG A HB3  5  
ATOM 7816  H HG2  . ARG A 1 90  ? 34.245  60.411  50.995  1.00 0.00 ?  81  ARG A HG2  5  
ATOM 7817  H HG3  . ARG A 1 90  ? 33.974  61.556  52.281  1.00 0.00 ?  81  ARG A HG3  5  
ATOM 7818  H HD2  . ARG A 1 90  ? 35.752  60.372  53.623  1.00 0.00 ?  81  ARG A HD2  5  
ATOM 7819  H HD3  . ARG A 1 90  ? 36.073  59.156  52.412  1.00 0.00 ?  81  ARG A HD3  5  
ATOM 7820  H HE   . ARG A 1 90  ? 36.358  61.689  51.279  1.00 0.00 ?  81  ARG A HE   5  
ATOM 7821  H HH11 . ARG A 1 90  ? 38.161  59.996  53.641  1.00 0.00 ?  81  ARG A HH11 5  
ATOM 7822  H HH12 . ARG A 1 90  ? 39.679  60.257  52.747  1.00 0.00 ?  81  ARG A HH12 5  
ATOM 7823  H HH21 . ARG A 1 90  ? 38.424  62.630  50.807  1.00 0.00 ?  81  ARG A HH21 5  
ATOM 7824  H HH22 . ARG A 1 90  ? 39.835  61.749  51.327  1.00 0.00 ?  81  ARG A HH22 5  
ATOM 7825  N N    . SER A 1 91  ? 30.485  59.212  53.970  1.00 0.00 ?  82  SER A N    5  
ATOM 7826  C CA   . SER A 1 91  ? 29.573  58.321  54.757  1.00 0.00 ?  82  SER A CA   5  
ATOM 7827  C C    . SER A 1 91  ? 28.032  58.534  54.606  1.00 0.00 ?  82  SER A C    5  
ATOM 7828  O O    . SER A 1 91  ? 27.228  57.649  54.840  1.00 0.00 ?  82  SER A O    5  
ATOM 7829  C CB   . SER A 1 91  ? 30.046  58.440  56.247  1.00 0.00 ?  82  SER A CB   5  
ATOM 7830  O OG   . SER A 1 91  ? 29.862  59.760  56.714  1.00 0.00 ?  82  SER A OG   5  
ATOM 7831  H H    . SER A 1 91  ? 31.187  59.801  54.395  1.00 0.00 ?  82  SER A H    5  
ATOM 7832  H HA   . SER A 1 91  ? 29.768  57.301  54.424  1.00 0.00 ?  82  SER A HA   5  
ATOM 7833  H HB2  . SER A 1 91  ? 29.474  57.746  56.864  1.00 0.00 ?  82  SER A HB2  5  
ATOM 7834  H HB3  . SER A 1 91  ? 31.125  58.288  56.242  1.00 0.00 ?  82  SER A HB3  5  
ATOM 7835  H HG   . SER A 1 91  ? 29.598  59.742  57.637  1.00 0.00 ?  82  SER A HG   5  
ATOM 7836  N N    . ARG A 1 92  ? 27.627  59.649  54.030  1.00 0.00 ?  83  ARG A N    5  
ATOM 7837  C CA   . ARG A 1 92  ? 26.243  59.917  53.613  1.00 0.00 ?  83  ARG A CA   5  
ATOM 7838  C C    . ARG A 1 92  ? 26.028  59.340  52.158  1.00 0.00 ?  83  ARG A C    5  
ATOM 7839  O O    . ARG A 1 92  ? 24.981  59.539  51.479  1.00 0.00 ?  83  ARG A O    5  
ATOM 7840  C CB   . ARG A 1 92  ? 26.108  61.440  53.669  1.00 0.00 ?  83  ARG A CB   5  
ATOM 7841  C CG   . ARG A 1 92  ? 24.657  61.784  53.626  1.00 0.00 ?  83  ARG A CG   5  
ATOM 7842  C CD   . ARG A 1 92  ? 24.340  63.227  54.024  1.00 0.00 ?  83  ARG A CD   5  
ATOM 7843  N NE   . ARG A 1 92  ? 22.918  63.385  53.792  1.00 0.00 ?  83  ARG A NE   5  
ATOM 7844  C CZ   . ARG A 1 92  ? 22.265  64.167  52.957  1.00 0.00 ?  83  ARG A CZ   5  
ATOM 7845  N NH1  . ARG A 1 92  ? 22.769  64.739  51.922  1.00 0.00 ?  83  ARG A NH1  5  
ATOM 7846  N NH2  . ARG A 1 92  ? 20.984  64.235  53.082  1.00 0.00 1  83  ARG A NH2  5  
ATOM 7847  H H    . ARG A 1 92  ? 28.251  60.432  54.160  1.00 0.00 ?  83  ARG A H    5  
ATOM 7848  H HA   . ARG A 1 92  ? 25.556  59.426  54.304  1.00 0.00 ?  83  ARG A HA   5  
ATOM 7849  H HB2  . ARG A 1 92  ? 26.503  61.828  54.608  1.00 0.00 ?  83  ARG A HB2  5  
ATOM 7850  H HB3  . ARG A 1 92  ? 26.540  61.966  52.817  1.00 0.00 ?  83  ARG A HB3  5  
ATOM 7851  H HG2  . ARG A 1 92  ? 24.245  61.577  52.638  1.00 0.00 ?  83  ARG A HG2  5  
ATOM 7852  H HG3  . ARG A 1 92  ? 24.169  61.097  54.317  1.00 0.00 ?  83  ARG A HG3  5  
ATOM 7853  H HD2  . ARG A 1 92  ? 24.464  63.246  55.107  1.00 0.00 ?  83  ARG A HD2  5  
ATOM 7854  H HD3  . ARG A 1 92  ? 24.988  63.912  53.478  1.00 0.00 ?  83  ARG A HD3  5  
ATOM 7855  H HE   . ARG A 1 92  ? 22.360  62.761  54.357  1.00 0.00 ?  83  ARG A HE   5  
ATOM 7856  H HH11 . ARG A 1 92  ? 23.686  64.476  51.589  1.00 0.00 ?  83  ARG A HH11 5  
ATOM 7857  H HH12 . ARG A 1 92  ? 22.282  65.458  51.407  1.00 0.00 ?  83  ARG A HH12 5  
ATOM 7858  H HH21 . ARG A 1 92  ? 20.502  63.855  53.885  1.00 0.00 ?  83  ARG A HH21 5  
ATOM 7859  H HH22 . ARG A 1 92  ? 20.506  64.855  52.444  1.00 0.00 ?  83  ARG A HH22 5  
ATOM 7860  N N    . LYS A 1 93  ? 27.073  58.801  51.470  1.00 0.00 ?  84  LYS A N    5  
ATOM 7861  C CA   . LYS A 1 93  ? 27.026  58.363  50.086  1.00 0.00 ?  84  LYS A CA   5  
ATOM 7862  C C    . LYS A 1 93  ? 27.457  56.929  49.843  1.00 0.00 ?  84  LYS A C    5  
ATOM 7863  O O    . LYS A 1 93  ? 26.902  56.307  48.889  1.00 0.00 ?  84  LYS A O    5  
ATOM 7864  C CB   . LYS A 1 93  ? 27.863  59.301  49.108  1.00 0.00 ?  84  LYS A CB   5  
ATOM 7865  C CG   . LYS A 1 93  ? 27.480  60.842  49.093  1.00 0.00 ?  84  LYS A CG   5  
ATOM 7866  C CD   . LYS A 1 93  ? 28.175  61.504  47.916  1.00 0.00 ?  84  LYS A CD   5  
ATOM 7867  C CE   . LYS A 1 93  ? 28.040  63.056  48.136  1.00 0.00 ?  84  LYS A CE   5  
ATOM 7868  N NZ   . LYS A 1 93  ? 28.556  63.934  47.057  1.00 0.00 1  84  LYS A NZ   5  
ATOM 7869  H H    . LYS A 1 93  ? 27.985  58.805  51.903  1.00 0.00 ?  84  LYS A H    5  
ATOM 7870  H HA   . LYS A 1 93  ? 25.999  58.348  49.722  1.00 0.00 ?  84  LYS A HA   5  
ATOM 7871  H HB2  . LYS A 1 93  ? 28.886  59.426  49.463  1.00 0.00 ?  84  LYS A HB2  5  
ATOM 7872  H HB3  . LYS A 1 93  ? 27.983  58.885  48.107  1.00 0.00 ?  84  LYS A HB3  5  
ATOM 7873  H HG2  . LYS A 1 93  ? 26.401  60.919  48.960  1.00 0.00 ?  84  LYS A HG2  5  
ATOM 7874  H HG3  . LYS A 1 93  ? 27.725  61.393  50.000  1.00 0.00 ?  84  LYS A HG3  5  
ATOM 7875  H HD2  . LYS A 1 93  ? 29.239  61.286  47.813  1.00 0.00 ?  84  LYS A HD2  5  
ATOM 7876  H HD3  . LYS A 1 93  ? 27.716  61.263  46.956  1.00 0.00 ?  84  LYS A HD3  5  
ATOM 7877  H HE2  . LYS A 1 93  ? 26.983  63.214  48.351  1.00 0.00 ?  84  LYS A HE2  5  
ATOM 7878  H HE3  . LYS A 1 93  ? 28.523  63.316  49.079  1.00 0.00 ?  84  LYS A HE3  5  
ATOM 7879  H HZ1  . LYS A 1 93  ? 28.112  63.815  46.159  1.00 0.00 ?  84  LYS A HZ1  5  
ATOM 7880  H HZ2  . LYS A 1 93  ? 28.446  64.888  47.370  1.00 0.00 ?  84  LYS A HZ2  5  
ATOM 7881  H HZ3  . LYS A 1 93  ? 29.565  63.946  47.006  1.00 0.00 ?  84  LYS A HZ3  5  
ATOM 7882  N N    . VAL A 1 94  ? 28.543  56.415  50.464  1.00 0.00 ?  85  VAL A N    5  
ATOM 7883  C CA   . VAL A 1 94  ? 29.278  55.250  50.036  1.00 0.00 ?  85  VAL A CA   5  
ATOM 7884  C C    . VAL A 1 94  ? 30.096  54.690  51.261  1.00 0.00 ?  85  VAL A C    5  
ATOM 7885  O O    . VAL A 1 94  ? 30.368  55.253  52.344  1.00 0.00 ?  85  VAL A O    5  
ATOM 7886  C CB   . VAL A 1 94  ? 30.358  55.679  48.978  1.00 0.00 ?  85  VAL A CB   5  
ATOM 7887  C CG1  . VAL A 1 94  ? 29.831  55.988  47.569  1.00 0.00 ?  85  VAL A CG1  5  
ATOM 7888  C CG2  . VAL A 1 94  ? 31.115  56.957  49.375  1.00 0.00 ?  85  VAL A CG2  5  
ATOM 7889  H H    . VAL A 1 94  ? 29.025  57.018  51.115  1.00 0.00 ?  85  VAL A H    5  
ATOM 7890  H HA   . VAL A 1 94  ? 28.733  54.389  49.650  1.00 0.00 ?  85  VAL A HA   5  
ATOM 7891  H HB   . VAL A 1 94  ? 31.146  54.930  48.883  1.00 0.00 ?  85  VAL A HB   5  
ATOM 7892  H HG11 . VAL A 1 94  ? 30.616  56.083  46.819  1.00 0.00 ?  85  VAL A HG11 5  
ATOM 7893  H HG12 . VAL A 1 94  ? 29.168  55.158  47.322  1.00 0.00 ?  85  VAL A HG12 5  
ATOM 7894  H HG13 . VAL A 1 94  ? 29.437  57.002  47.624  1.00 0.00 ?  85  VAL A HG13 5  
ATOM 7895  H HG21 . VAL A 1 94  ? 30.414  57.776  49.537  1.00 0.00 ?  85  VAL A HG21 5  
ATOM 7896  H HG22 . VAL A 1 94  ? 31.772  56.869  50.241  1.00 0.00 ?  85  VAL A HG22 5  
ATOM 7897  H HG23 . VAL A 1 94  ? 31.714  57.416  48.588  1.00 0.00 ?  85  VAL A HG23 5  
ATOM 7898  N N    . ASP A 1 95  ? 30.611  53.435  51.107  1.00 0.00 ?  86  ASP A N    5  
ATOM 7899  C CA   . ASP A 1 95  ? 31.466  52.707  52.069  1.00 0.00 ?  86  ASP A CA   5  
ATOM 7900  C C    . ASP A 1 95  ? 32.876  52.225  51.579  1.00 0.00 ?  86  ASP A C    5  
ATOM 7901  O O    . ASP A 1 95  ? 33.119  51.592  50.499  1.00 0.00 ?  86  ASP A O    5  
ATOM 7902  C CB   . ASP A 1 95  ? 30.773  51.666  52.876  1.00 0.00 ?  86  ASP A CB   5  
ATOM 7903  C CG   . ASP A 1 95  ? 30.112  50.489  52.084  1.00 0.00 ?  86  ASP A CG   5  
ATOM 7904  O OD1  . ASP A 1 95  ? 30.869  49.849  51.293  1.00 0.00 -1 86  ASP A OD1  5  
ATOM 7905  O OD2  . ASP A 1 95  ? 28.901  50.405  52.011  1.00 0.00 ?  86  ASP A OD2  5  
ATOM 7906  H H    . ASP A 1 95  ? 30.418  53.019  50.207  1.00 0.00 ?  86  ASP A H    5  
ATOM 7907  H HA   . ASP A 1 95  ? 31.742  53.348  52.907  1.00 0.00 ?  86  ASP A HA   5  
ATOM 7908  H HB2  . ASP A 1 95  ? 31.389  51.183  53.633  1.00 0.00 ?  86  ASP A HB2  5  
ATOM 7909  H HB3  . ASP A 1 95  ? 29.998  52.166  53.457  1.00 0.00 ?  86  ASP A HB3  5  
ATOM 7910  N N    . LYS A 1 96  ? 33.937  52.452  52.430  1.00 0.00 ?  87  LYS A N    5  
ATOM 7911  C CA   . LYS A 1 96  ? 35.380  52.079  52.339  1.00 0.00 ?  87  LYS A CA   5  
ATOM 7912  C C    . LYS A 1 96  ? 35.706  50.639  52.220  1.00 0.00 ?  87  LYS A C    5  
ATOM 7913  O O    . LYS A 1 96  ? 34.983  49.800  52.747  1.00 0.00 ?  87  LYS A O    5  
ATOM 7914  C CB   . LYS A 1 96  ? 36.229  52.589  53.534  1.00 0.00 ?  87  LYS A CB   5  
ATOM 7915  C CG   . LYS A 1 96  ? 37.790  52.729  53.179  1.00 0.00 ?  87  LYS A CG   5  
ATOM 7916  C CD   . LYS A 1 96  ? 38.377  53.891  54.032  1.00 0.00 ?  87  LYS A CD   5  
ATOM 7917  C CE   . LYS A 1 96  ? 39.883  53.704  53.919  1.00 0.00 ?  87  LYS A CE   5  
ATOM 7918  N NZ   . LYS A 1 96  ? 40.651  54.658  54.666  1.00 0.00 1  87  LYS A NZ   5  
ATOM 7919  H H    . LYS A 1 96  ? 33.700  52.900  53.303  1.00 0.00 ?  87  LYS A H    5  
ATOM 7920  H HA   . LYS A 1 96  ? 35.667  52.639  51.449  1.00 0.00 ?  87  LYS A HA   5  
ATOM 7921  H HB2  . LYS A 1 96  ? 35.912  53.615  53.724  1.00 0.00 ?  87  LYS A HB2  5  
ATOM 7922  H HB3  . LYS A 1 96  ? 36.009  51.954  54.392  1.00 0.00 ?  87  LYS A HB3  5  
ATOM 7923  H HG2  . LYS A 1 96  ? 38.284  51.815  53.511  1.00 0.00 ?  87  LYS A HG2  5  
ATOM 7924  H HG3  . LYS A 1 96  ? 37.889  52.904  52.109  1.00 0.00 ?  87  LYS A HG3  5  
ATOM 7925  H HD2  . LYS A 1 96  ? 38.040  54.814  53.560  1.00 0.00 ?  87  LYS A HD2  5  
ATOM 7926  H HD3  . LYS A 1 96  ? 38.038  53.763  55.060  1.00 0.00 ?  87  LYS A HD3  5  
ATOM 7927  H HE2  . LYS A 1 96  ? 40.088  52.729  54.363  1.00 0.00 ?  87  LYS A HE2  5  
ATOM 7928  H HE3  . LYS A 1 96  ? 40.171  53.764  52.870  1.00 0.00 ?  87  LYS A HE3  5  
ATOM 7929  H HZ1  . LYS A 1 96  ? 41.650  54.558  54.564  1.00 0.00 ?  87  LYS A HZ1  5  
ATOM 7930  H HZ2  . LYS A 1 96  ? 40.372  55.567  54.325  1.00 0.00 ?  87  LYS A HZ2  5  
ATOM 7931  H HZ3  . LYS A 1 96  ? 40.456  54.637  55.658  1.00 0.00 ?  87  LYS A HZ3  5  
ATOM 7932  N N    . ARG A 1 97  ? 36.579  50.186  51.349  1.00 0.00 ?  88  ARG A N    5  
ATOM 7933  C CA   . ARG A 1 97  ? 36.891  48.826  51.172  1.00 0.00 ?  88  ARG A CA   5  
ATOM 7934  C C    . ARG A 1 97  ? 38.367  48.514  51.178  1.00 0.00 ?  88  ARG A C    5  
ATOM 7935  O O    . ARG A 1 97  ? 38.737  47.367  51.003  1.00 0.00 ?  88  ARG A O    5  
ATOM 7936  C CB   . ARG A 1 97  ? 36.163  48.196  49.972  1.00 0.00 ?  88  ARG A CB   5  
ATOM 7937  C CG   . ARG A 1 97  ? 36.275  48.933  48.656  1.00 0.00 ?  88  ARG A CG   5  
ATOM 7938  C CD   . ARG A 1 97  ? 35.549  48.257  47.561  1.00 0.00 ?  88  ARG A CD   5  
ATOM 7939  N NE   . ARG A 1 97  ? 36.038  48.616  46.196  1.00 0.00 ?  88  ARG A NE   5  
ATOM 7940  C CZ   . ARG A 1 97  ? 36.750  47.854  45.360  1.00 0.00 ?  88  ARG A CZ   5  
ATOM 7941  N NH1  . ARG A 1 97  ? 36.923  46.610  45.678  1.00 0.00 ?  88  ARG A NH1  5  
ATOM 7942  N NH2  . ARG A 1 97  ? 37.228  48.340  44.246  1.00 0.00 1  88  ARG A NH2  5  
ATOM 7943  H H    . ARG A 1 97  ? 37.068  50.895  50.821  1.00 0.00 ?  88  ARG A H    5  
ATOM 7944  H HA   . ARG A 1 97  ? 36.472  48.320  52.041  1.00 0.00 ?  88  ARG A HA   5  
ATOM 7945  H HB2  . ARG A 1 97  ? 36.397  47.133  49.923  1.00 0.00 ?  88  ARG A HB2  5  
ATOM 7946  H HB3  . ARG A 1 97  ? 35.135  48.188  50.333  1.00 0.00 ?  88  ARG A HB3  5  
ATOM 7947  H HG2  . ARG A 1 97  ? 35.842  49.920  48.814  1.00 0.00 ?  88  ARG A HG2  5  
ATOM 7948  H HG3  . ARG A 1 97  ? 37.314  48.999  48.332  1.00 0.00 ?  88  ARG A HG3  5  
ATOM 7949  H HD2  . ARG A 1 97  ? 35.526  47.181  47.730  1.00 0.00 ?  88  ARG A HD2  5  
ATOM 7950  H HD3  . ARG A 1 97  ? 34.519  48.557  47.755  1.00 0.00 ?  88  ARG A HD3  5  
ATOM 7951  H HE   . ARG A 1 97  ? 35.941  49.591  45.952  1.00 0.00 ?  88  ARG A HE   5  
ATOM 7952  H HH11 . ARG A 1 97  ? 36.701  46.311  46.616  1.00 0.00 ?  88  ARG A HH11 5  
ATOM 7953  H HH12 . ARG A 1 97  ? 37.403  45.965  45.065  1.00 0.00 ?  88  ARG A HH12 5  
ATOM 7954  H HH21 . ARG A 1 97  ? 37.193  49.277  43.871  1.00 0.00 ?  88  ARG A HH21 5  
ATOM 7955  H HH22 . ARG A 1 97  ? 37.643  47.679  43.606  1.00 0.00 ?  88  ARG A HH22 5  
ATOM 7956  N N    . SER A 1 98  ? 39.228  49.426  51.412  1.00 0.00 ?  89  SER A N    5  
ATOM 7957  C CA   . SER A 1 98  ? 40.686  49.122  51.627  1.00 0.00 ?  89  SER A CA   5  
ATOM 7958  C C    . SER A 1 98  ? 41.111  48.228  52.807  1.00 0.00 ?  89  SER A C    5  
ATOM 7959  O O    . SER A 1 98  ? 40.490  48.262  53.863  1.00 0.00 ?  89  SER A O    5  
ATOM 7960  C CB   . SER A 1 98  ? 41.579  50.377  51.662  1.00 0.00 ?  89  SER A CB   5  
ATOM 7961  O OG   . SER A 1 98  ? 41.021  51.252  52.656  1.00 0.00 ?  89  SER A OG   5  
ATOM 7962  H H    . SER A 1 98  ? 38.942  50.386  51.543  1.00 0.00 ?  89  SER A H    5  
ATOM 7963  H HA   . SER A 1 98  ? 41.044  48.538  50.779  1.00 0.00 ?  89  SER A HA   5  
ATOM 7964  H HB2  . SER A 1 98  ? 42.625  50.141  51.853  1.00 0.00 ?  89  SER A HB2  5  
ATOM 7965  H HB3  . SER A 1 98  ? 41.539  50.950  50.735  1.00 0.00 ?  89  SER A HB3  5  
ATOM 7966  H HG   . SER A 1 98  ? 41.102  52.115  52.241  1.00 0.00 ?  89  SER A HG   5  
ATOM 7967  N N    . ASP A 1 99  ? 42.198  47.409  52.586  1.00 0.00 ?  90  ASP A N    5  
ATOM 7968  C CA   . ASP A 1 99  ? 42.754  46.375  53.548  1.00 0.00 ?  90  ASP A CA   5  
ATOM 7969  C C    . ASP A 1 99  ? 43.835  47.053  54.462  1.00 0.00 ?  90  ASP A C    5  
ATOM 7970  O O    . ASP A 1 99  ? 44.922  47.221  53.934  1.00 0.00 ?  90  ASP A O    5  
ATOM 7971  C CB   . ASP A 1 99  ? 43.254  45.189  52.740  1.00 0.00 ?  90  ASP A CB   5  
ATOM 7972  C CG   . ASP A 1 99  ? 43.664  44.020  53.550  1.00 0.00 ?  90  ASP A CG   5  
ATOM 7973  O OD1  . ASP A 1 99  ? 44.788  44.121  54.123  1.00 0.00 ?  90  ASP A OD1  5  
ATOM 7974  O OD2  . ASP A 1 99  ? 42.885  43.062  53.540  1.00 0.00 -1 90  ASP A OD2  5  
ATOM 7975  H H    . ASP A 1 99  ? 42.521  47.301  51.635  1.00 0.00 ?  90  ASP A H    5  
ATOM 7976  H HA   . ASP A 1 99  ? 41.987  45.947  54.194  1.00 0.00 ?  90  ASP A HA   5  
ATOM 7977  H HB2  . ASP A 1 99  ? 42.455  44.934  52.044  1.00 0.00 ?  90  ASP A HB2  5  
ATOM 7978  H HB3  . ASP A 1 99  ? 44.054  45.397  52.030  1.00 0.00 ?  90  ASP A HB3  5  
ATOM 7979  N N    . PRO A 1 100 ? 43.671  47.544  55.701  1.00 0.00 ?  91  PRO A N    5  
ATOM 7980  C CA   . PRO A 1 100 ? 44.549  48.449  56.413  1.00 0.00 ?  91  PRO A CA   5  
ATOM 7981  C C    . PRO A 1 100 ? 45.948  47.924  56.726  1.00 0.00 ?  91  PRO A C    5  
ATOM 7982  O O    . PRO A 1 100 ? 46.724  48.602  57.348  1.00 0.00 ?  91  PRO A O    5  
ATOM 7983  C CB   . PRO A 1 100 ? 43.803  48.779  57.730  1.00 0.00 ?  91  PRO A CB   5  
ATOM 7984  C CG   . PRO A 1 100 ? 42.828  47.599  57.886  1.00 0.00 ?  91  PRO A CG   5  
ATOM 7985  C CD   . PRO A 1 100 ? 42.429  47.365  56.450  1.00 0.00 ?  91  PRO A CD   5  
ATOM 7986  H HA   . PRO A 1 100 ? 44.564  49.350  55.799  1.00 0.00 ?  91  PRO A HA   5  
ATOM 7987  H HB2  . PRO A 1 100 ? 44.444  48.962  58.593  1.00 0.00 ?  91  PRO A HB2  5  
ATOM 7988  H HB3  . PRO A 1 100 ? 43.225  49.695  57.601  1.00 0.00 ?  91  PRO A HB3  5  
ATOM 7989  H HG2  . PRO A 1 100 ? 43.352  46.727  58.275  1.00 0.00 ?  91  PRO A HG2  5  
ATOM 7990  H HG3  . PRO A 1 100 ? 41.938  47.831  58.471  1.00 0.00 ?  91  PRO A HG3  5  
ATOM 7991  H HD2  . PRO A 1 100 ? 42.012  46.357  56.424  1.00 0.00 ?  91  PRO A HD2  5  
ATOM 7992  H HD3  . PRO A 1 100 ? 41.568  47.962  56.150  1.00 0.00 ?  91  PRO A HD3  5  
ATOM 7993  N N    . TYR A 1 101 ? 46.133  46.605  56.470  1.00 0.00 ?  92  TYR A N    5  
ATOM 7994  C CA   . TYR A 1 101 ? 47.050  45.703  57.111  1.00 0.00 ?  92  TYR A CA   5  
ATOM 7995  C C    . TYR A 1 101 ? 48.556  45.818  56.736  1.00 0.00 ?  92  TYR A C    5  
ATOM 7996  O O    . TYR A 1 101 ? 49.406  45.433  57.521  1.00 0.00 ?  92  TYR A O    5  
ATOM 7997  C CB   . TYR A 1 101 ? 46.424  44.372  57.251  1.00 0.00 ?  92  TYR A CB   5  
ATOM 7998  C CG   . TYR A 1 101 ? 45.299  44.089  58.190  1.00 0.00 ?  92  TYR A CG   5  
ATOM 7999  C CD1  . TYR A 1 101 ? 45.533  43.809  59.571  1.00 0.00 ?  92  TYR A CD1  5  
ATOM 8000  C CD2  . TYR A 1 101 ? 43.954  44.089  57.722  1.00 0.00 ?  92  TYR A CD2  5  
ATOM 8001  C CE1  . TYR A 1 101 ? 44.498  43.710  60.559  1.00 0.00 ?  92  TYR A CE1  5  
ATOM 8002  C CE2  . TYR A 1 101 ? 42.929  43.830  58.680  1.00 0.00 ?  92  TYR A CE2  5  
ATOM 8003  C CZ   . TYR A 1 101 ? 43.175  43.686  60.062  1.00 0.00 ?  92  TYR A CZ   5  
ATOM 8004  O OH   . TYR A 1 101 ? 42.165  43.401  60.889  1.00 0.00 ?  92  TYR A OH   5  
ATOM 8005  H H    . TYR A 1 101 ? 45.362  46.187  55.971  1.00 0.00 ?  92  TYR A H    5  
ATOM 8006  H HA   . TYR A 1 101 ? 47.055  46.016  58.155  1.00 0.00 ?  92  TYR A HA   5  
ATOM 8007  H HB2  . TYR A 1 101 ? 46.106  43.982  56.285  1.00 0.00 ?  92  TYR A HB2  5  
ATOM 8008  H HB3  . TYR A 1 101 ? 47.154  43.730  57.744  1.00 0.00 ?  92  TYR A HB3  5  
ATOM 8009  H HD1  . TYR A 1 101 ? 46.567  43.741  59.876  1.00 0.00 ?  92  TYR A HD1  5  
ATOM 8010  H HD2  . TYR A 1 101 ? 43.690  44.271  56.690  1.00 0.00 ?  92  TYR A HD2  5  
ATOM 8011  H HE1  . TYR A 1 101 ? 44.756  43.552  61.596  1.00 0.00 ?  92  TYR A HE1  5  
ATOM 8012  H HE2  . TYR A 1 101 ? 41.910  43.719  58.336  1.00 0.00 ?  92  TYR A HE2  5  
ATOM 8013  H HH   . TYR A 1 101 ? 41.389  43.818  60.508  1.00 0.00 ?  92  TYR A HH   5  
ATOM 8014  N N    . HIS A 1 102 ? 48.933  46.346  55.556  1.00 0.00 ?  93  HIS A N    5  
ATOM 8015  C CA   . HIS A 1 102 ? 50.261  46.685  55.044  1.00 0.00 ?  93  HIS A CA   5  
ATOM 8016  C C    . HIS A 1 102 ? 50.956  47.650  55.977  1.00 0.00 ?  93  HIS A C    5  
ATOM 8017  O O    . HIS A 1 102 ? 52.124  47.795  55.893  1.00 0.00 ?  93  HIS A O    5  
ATOM 8018  C CB   . HIS A 1 102 ? 50.161  47.221  53.624  1.00 0.00 ?  93  HIS A CB   5  
ATOM 8019  C CG   . HIS A 1 102 ? 49.491  48.580  53.513  1.00 0.00 ?  93  HIS A CG   5  
ATOM 8020  N ND1  . HIS A 1 102 ? 50.108  49.792  53.050  1.00 0.00 ?  93  HIS A ND1  5  
ATOM 8021  C CD2  . HIS A 1 102 ? 48.132  48.856  53.748  1.00 0.00 ?  93  HIS A CD2  5  
ATOM 8022  C CE1  . HIS A 1 102 ? 49.117  50.726  53.099  1.00 0.00 ?  93  HIS A CE1  5  
ATOM 8023  N NE2  . HIS A 1 102 ? 47.958  50.178  53.494  1.00 0.00 ?  93  HIS A NE2  5  
ATOM 8024  H H    . HIS A 1 102 ? 48.190  46.665  54.950  1.00 0.00 ?  93  HIS A H    5  
ATOM 8025  H HA   . HIS A 1 102 ? 50.831  45.789  54.797  1.00 0.00 ?  93  HIS A HA   5  
ATOM 8026  H HB2  . HIS A 1 102 ? 51.162  47.312  53.202  1.00 0.00 ?  93  HIS A HB2  5  
ATOM 8027  H HB3  . HIS A 1 102 ? 49.531  46.556  53.033  1.00 0.00 ?  93  HIS A HB3  5  
ATOM 8028  H HD2  . HIS A 1 102 ? 47.376  48.122  53.988  1.00 0.00 ?  93  HIS A HD2  5  
ATOM 8029  H HE1  . HIS A 1 102 ? 49.248  51.732  52.729  1.00 0.00 ?  93  HIS A HE1  5  
ATOM 8030  H HE2  . HIS A 1 102 ? 47.090  50.694  53.503  1.00 0.00 ?  93  HIS A HE2  5  
ATOM 8031  N N    . VAL A 1 103 ? 50.276  48.303  56.881  1.00 0.00 ?  94  VAL A N    5  
ATOM 8032  C CA   . VAL A 1 103 ? 50.768  49.170  57.968  1.00 0.00 ?  94  VAL A CA   5  
ATOM 8033  C C    . VAL A 1 103 ? 51.320  48.371  59.162  1.00 0.00 ?  94  VAL A C    5  
ATOM 8034  O O    . VAL A 1 103 ? 52.079  48.860  59.994  1.00 0.00 ?  94  VAL A O    5  
ATOM 8035  C CB   . VAL A 1 103 ? 49.689  50.301  58.332  1.00 0.00 ?  94  VAL A CB   5  
ATOM 8036  C CG1  . VAL A 1 103 ? 50.109  51.389  59.327  1.00 0.00 ?  94  VAL A CG1  5  
ATOM 8037  C CG2  . VAL A 1 103 ? 49.187  51.121  57.173  1.00 0.00 ?  94  VAL A CG2  5  
ATOM 8038  H H    . VAL A 1 103 ? 49.287  48.196  56.708  1.00 0.00 ?  94  VAL A H    5  
ATOM 8039  H HA   . VAL A 1 103 ? 51.564  49.808  57.586  1.00 0.00 ?  94  VAL A HA   5  
ATOM 8040  H HB   . VAL A 1 103 ? 48.891  49.735  58.813  1.00 0.00 ?  94  VAL A HB   5  
ATOM 8041  H HG11 . VAL A 1 103 ? 50.508  50.967  60.249  1.00 0.00 ?  94  VAL A HG11 5  
ATOM 8042  H HG12 . VAL A 1 103 ? 50.787  52.098  58.854  1.00 0.00 ?  94  VAL A HG12 5  
ATOM 8043  H HG13 . VAL A 1 103 ? 49.257  51.966  59.686  1.00 0.00 ?  94  VAL A HG13 5  
ATOM 8044  H HG21 . VAL A 1 103 ? 49.901  51.858  56.807  1.00 0.00 ?  94  VAL A HG21 5  
ATOM 8045  H HG22 . VAL A 1 103 ? 48.747  50.540  56.362  1.00 0.00 ?  94  VAL A HG22 5  
ATOM 8046  H HG23 . VAL A 1 103 ? 48.305  51.747  57.308  1.00 0.00 ?  94  VAL A HG23 5  
ATOM 8047  N N    . TYR A 1 104 ? 50.753  47.168  59.412  1.00 0.00 ?  95  TYR A N    5  
ATOM 8048  C CA   . TYR A 1 104 ? 51.128  46.237  60.516  1.00 0.00 ?  95  TYR A CA   5  
ATOM 8049  C C    . TYR A 1 104 ? 52.113  45.066  60.164  1.00 0.00 ?  95  TYR A C    5  
ATOM 8050  O O    . TYR A 1 104 ? 53.075  44.782  60.875  1.00 0.00 ?  95  TYR A O    5  
ATOM 8051  C CB   . TYR A 1 104 ? 49.796  45.574  60.968  1.00 0.00 ?  95  TYR A CB   5  
ATOM 8052  C CG   . TYR A 1 104 ? 48.785  46.545  61.614  1.00 0.00 ?  95  TYR A CG   5  
ATOM 8053  C CD1  . TYR A 1 104 ? 48.048  47.361  60.705  1.00 0.00 ?  95  TYR A CD1  5  
ATOM 8054  C CD2  . TYR A 1 104 ? 48.559  46.653  62.998  1.00 0.00 ?  95  TYR A CD2  5  
ATOM 8055  C CE1  . TYR A 1 104 ? 47.220  48.414  61.150  1.00 0.00 ?  95  TYR A CE1  5  
ATOM 8056  C CE2  . TYR A 1 104 ? 47.649  47.646  63.446  1.00 0.00 ?  95  TYR A CE2  5  
ATOM 8057  C CZ   . TYR A 1 104 ? 47.063  48.601  62.559  1.00 0.00 ?  95  TYR A CZ   5  
ATOM 8058  O OH   . TYR A 1 104 ? 46.301  49.597  63.063  1.00 0.00 ?  95  TYR A OH   5  
ATOM 8059  H H    . TYR A 1 104 ? 50.118  46.857  58.691  1.00 0.00 ?  95  TYR A H    5  
ATOM 8060  H HA   . TYR A 1 104 ? 51.501  46.848  61.339  1.00 0.00 ?  95  TYR A HA   5  
ATOM 8061  H HB2  . TYR A 1 104 ? 49.377  45.139  60.061  1.00 0.00 ?  95  TYR A HB2  5  
ATOM 8062  H HB3  . TYR A 1 104 ? 50.042  44.769  61.662  1.00 0.00 ?  95  TYR A HB3  5  
ATOM 8063  H HD1  . TYR A 1 104 ? 48.204  47.111  59.667  1.00 0.00 ?  95  TYR A HD1  5  
ATOM 8064  H HD2  . TYR A 1 104 ? 49.044  46.052  63.755  1.00 0.00 ?  95  TYR A HD2  5  
ATOM 8065  H HE1  . TYR A 1 104 ? 46.734  49.051  60.426  1.00 0.00 ?  95  TYR A HE1  5  
ATOM 8066  H HE2  . TYR A 1 104 ? 47.509  47.872  64.493  1.00 0.00 ?  95  TYR A HE2  5  
ATOM 8067  H HH   . TYR A 1 104 ? 45.555  49.827  62.504  1.00 0.00 ?  95  TYR A HH   5  
ATOM 8068  N N    . ILE A 1 105 ? 51.941  44.506  58.965  1.00 0.00 ?  96  ILE A N    5  
ATOM 8069  C CA   . ILE A 1 105 ? 52.848  43.573  58.334  1.00 0.00 ?  96  ILE A CA   5  
ATOM 8070  C C    . ILE A 1 105 ? 53.493  44.139  57.124  1.00 0.00 ?  96  ILE A C    5  
ATOM 8071  O O    . ILE A 1 105 ? 52.797  44.297  56.076  1.00 0.00 ?  96  ILE A O    5  
ATOM 8072  C CB   . ILE A 1 105 ? 52.055  42.270  57.972  1.00 0.00 ?  96  ILE A CB   5  
ATOM 8073  C CG1  . ILE A 1 105 ? 51.198  41.740  59.120  1.00 0.00 ?  96  ILE A CG1  5  
ATOM 8074  C CG2  . ILE A 1 105 ? 53.041  41.289  57.461  1.00 0.00 ?  96  ILE A CG2  5  
ATOM 8075  C CD1  . ILE A 1 105 ? 49.738  41.985  58.916  1.00 0.00 ?  96  ILE A CD1  5  
ATOM 8076  H H    . ILE A 1 105 ? 51.128  44.759  58.422  1.00 0.00 ?  96  ILE A H    5  
ATOM 8077  H HA   . ILE A 1 105 ? 53.620  43.285  59.048  1.00 0.00 ?  96  ILE A HA   5  
ATOM 8078  H HB   . ILE A 1 105 ? 51.453  42.605  57.127  1.00 0.00 ?  96  ILE A HB   5  
ATOM 8079  H HG12 . ILE A 1 105 ? 51.377  40.671  59.224  1.00 0.00 ?  96  ILE A HG12 5  
ATOM 8080  H HG13 . ILE A 1 105 ? 51.501  42.159  60.080  1.00 0.00 ?  96  ILE A HG13 5  
ATOM 8081  H HG21 . ILE A 1 105 ? 53.861  41.203  58.173  1.00 0.00 ?  96  ILE A HG21 5  
ATOM 8082  H HG22 . ILE A 1 105 ? 52.588  40.301  57.375  1.00 0.00 ?  96  ILE A HG22 5  
ATOM 8083  H HG23 . ILE A 1 105 ? 53.473  41.593  56.508  1.00 0.00 ?  96  ILE A HG23 5  
ATOM 8084  H HD11 . ILE A 1 105 ? 49.681  43.074  58.899  1.00 0.00 ?  96  ILE A HD11 5  
ATOM 8085  H HD12 . ILE A 1 105 ? 49.432  41.540  57.969  1.00 0.00 ?  96  ILE A HD12 5  
ATOM 8086  H HD13 . ILE A 1 105 ? 49.201  41.589  59.778  1.00 0.00 ?  96  ILE A HD13 5  
ATOM 8087  N N    . LYS A 1 106 ? 54.779  44.442  57.231  1.00 0.00 ?  97  LYS A N    5  
ATOM 8088  C CA   . LYS A 1 106 ? 55.556  45.076  56.196  1.00 0.00 ?  97  LYS A CA   5  
ATOM 8089  C C    . LYS A 1 106 ? 55.361  44.343  54.819  1.00 0.00 ?  97  LYS A C    5  
ATOM 8090  O O    . LYS A 1 106 ? 55.178  45.008  53.755  1.00 0.00 ?  97  LYS A O    5  
ATOM 8091  C CB   . LYS A 1 106 ? 57.047  45.227  56.574  1.00 0.00 ?  97  LYS A CB   5  
ATOM 8092  C CG   . LYS A 1 106 ? 58.050  45.557  55.443  1.00 0.00 ?  97  LYS A CG   5  
ATOM 8093  C CD   . LYS A 1 106 ? 57.969  47.051  55.097  1.00 0.00 ?  97  LYS A CD   5  
ATOM 8094  C CE   . LYS A 1 106 ? 58.765  47.304  53.851  1.00 0.00 ?  97  LYS A CE   5  
ATOM 8095  N NZ   . LYS A 1 106 ? 60.219  47.184  54.134  1.00 0.00 1  97  LYS A NZ   5  
ATOM 8096  H H    . LYS A 1 106 ? 55.200  44.298  58.138  1.00 0.00 ?  97  LYS A H    5  
ATOM 8097  H HA   . LYS A 1 106 ? 55.103  46.053  56.031  1.00 0.00 ?  97  LYS A HA   5  
ATOM 8098  H HB2  . LYS A 1 106 ? 57.170  45.932  57.396  1.00 0.00 ?  97  LYS A HB2  5  
ATOM 8099  H HB3  . LYS A 1 106 ? 57.306  44.208  56.864  1.00 0.00 ?  97  LYS A HB3  5  
ATOM 8100  H HG2  . LYS A 1 106 ? 59.031  45.521  55.915  1.00 0.00 ?  97  LYS A HG2  5  
ATOM 8101  H HG3  . LYS A 1 106 ? 58.061  44.868  54.600  1.00 0.00 ?  97  LYS A HG3  5  
ATOM 8102  H HD2  . LYS A 1 106 ? 56.933  47.273  54.840  1.00 0.00 ?  97  LYS A HD2  5  
ATOM 8103  H HD3  . LYS A 1 106 ? 58.266  47.666  55.946  1.00 0.00 ?  97  LYS A HD3  5  
ATOM 8104  H HE2  . LYS A 1 106 ? 58.409  46.580  53.119  1.00 0.00 ?  97  LYS A HE2  5  
ATOM 8105  H HE3  . LYS A 1 106 ? 58.596  48.334  53.536  1.00 0.00 ?  97  LYS A HE3  5  
ATOM 8106  H HZ1  . LYS A 1 106 ? 60.561  46.234  54.156  1.00 0.00 ?  97  LYS A HZ1  5  
ATOM 8107  H HZ2  . LYS A 1 106 ? 60.706  47.415  53.280  1.00 0.00 ?  97  LYS A HZ2  5  
ATOM 8108  H HZ3  . LYS A 1 106 ? 60.481  47.788  54.899  1.00 0.00 ?  97  LYS A HZ3  5  
ATOM 8109  N N    . ASN A 1 107 ? 55.328  43.046  54.716  1.00 0.00 ?  98  ASN A N    5  
ATOM 8110  C CA   . ASN A 1 107 ? 55.346  42.340  53.444  1.00 0.00 ?  98  ASN A CA   5  
ATOM 8111  C C    . ASN A 1 107 ? 53.921  42.152  52.867  1.00 0.00 ?  98  ASN A C    5  
ATOM 8112  O O    . ASN A 1 107 ? 53.840  41.619  51.738  1.00 0.00 ?  98  ASN A O    5  
ATOM 8113  C CB   . ASN A 1 107 ? 56.122  40.970  53.551  1.00 0.00 ?  98  ASN A CB   5  
ATOM 8114  C CG   . ASN A 1 107 ? 56.439  40.386  52.241  1.00 0.00 ?  98  ASN A CG   5  
ATOM 8115  O OD1  . ASN A 1 107 ? 57.212  40.892  51.454  1.00 0.00 ?  98  ASN A OD1  5  
ATOM 8116  N ND2  . ASN A 1 107 ? 56.149  39.147  52.101  1.00 0.00 ?  98  ASN A ND2  5  
ATOM 8117  H H    . ASN A 1 107 ? 55.323  42.580  55.612  1.00 0.00 ?  98  ASN A H    5  
ATOM 8118  H HA   . ASN A 1 107 ? 55.785  43.035  52.728  1.00 0.00 ?  98  ASN A HA   5  
ATOM 8119  H HB2  . ASN A 1 107 ? 57.012  41.164  54.151  1.00 0.00 ?  98  ASN A HB2  5  
ATOM 8120  H HB3  . ASN A 1 107 ? 55.575  40.299  54.214  1.00 0.00 ?  98  ASN A HB3  5  
ATOM 8121  H HD21 . ASN A 1 107 ? 55.543  38.762  52.811  1.00 0.00 ?  98  ASN A HD21 5  
ATOM 8122  H HD22 . ASN A 1 107 ? 56.345  38.691  51.222  1.00 0.00 ?  98  ASN A HD22 5  
ATOM 8123  N N    . ARG A 1 108 ? 52.840  42.620  53.506  1.00 0.00 ?  99  ARG A N    5  
ATOM 8124  C CA   . ARG A 1 108 ? 51.502  42.422  52.933  1.00 0.00 ?  99  ARG A CA   5  
ATOM 8125  C C    . ARG A 1 108 ? 51.298  43.562  51.840  1.00 0.00 ?  99  ARG A C    5  
ATOM 8126  O O    . ARG A 1 108 ? 51.784  44.657  51.939  1.00 0.00 ?  99  ARG A O    5  
ATOM 8127  C CB   . ARG A 1 108 ? 50.516  42.520  54.097  1.00 0.00 ?  99  ARG A CB   5  
ATOM 8128  C CG   . ARG A 1 108 ? 49.083  42.409  53.603  1.00 0.00 ?  99  ARG A CG   5  
ATOM 8129  C CD   . ARG A 1 108 ? 48.161  42.396  54.829  1.00 0.00 ?  99  ARG A CD   5  
ATOM 8130  N NE   . ARG A 1 108 ? 46.720  42.143  54.479  1.00 0.00 ?  99  ARG A NE   5  
ATOM 8131  C CZ   . ARG A 1 108 ? 46.148  40.969  54.626  1.00 0.00 ?  99  ARG A CZ   5  
ATOM 8132  N NH1  . ARG A 1 108 ? 46.703  39.858  54.980  1.00 0.00 ?  99  ARG A NH1  5  
ATOM 8133  N NH2  . ARG A 1 108 ? 44.802  40.810  54.497  1.00 0.00 1  99  ARG A NH2  5  
ATOM 8134  H H    . ARG A 1 108 ? 52.971  43.275  54.265  1.00 0.00 ?  99  ARG A H    5  
ATOM 8135  H HA   . ARG A 1 108 ? 51.491  41.443  52.455  1.00 0.00 ?  99  ARG A HA   5  
ATOM 8136  H HB2  . ARG A 1 108 ? 50.709  41.636  54.705  1.00 0.00 ?  99  ARG A HB2  5  
ATOM 8137  H HB3  . ARG A 1 108 ? 50.552  43.453  54.660  1.00 0.00 ?  99  ARG A HB3  5  
ATOM 8138  H HG2  . ARG A 1 108 ? 48.832  43.285  53.006  1.00 0.00 ?  99  ARG A HG2  5  
ATOM 8139  H HG3  . ARG A 1 108 ? 48.932  41.554  52.942  1.00 0.00 ?  99  ARG A HG3  5  
ATOM 8140  H HD2  . ARG A 1 108 ? 48.556  41.745  55.608  1.00 0.00 ?  99  ARG A HD2  5  
ATOM 8141  H HD3  . ARG A 1 108 ? 48.246  43.387  55.275  1.00 0.00 ?  99  ARG A HD3  5  
ATOM 8142  H HE   . ARG A 1 108 ? 46.213  42.964  54.182  1.00 0.00 ?  99  ARG A HE   5  
ATOM 8143  H HH11 . ARG A 1 108 ? 47.701  39.838  55.139  1.00 0.00 ?  99  ARG A HH11 5  
ATOM 8144  H HH12 . ARG A 1 108 ? 46.078  39.124  55.282  1.00 0.00 ?  99  ARG A HH12 5  
ATOM 8145  H HH21 . ARG A 1 108 ? 44.262  41.611  54.202  1.00 0.00 ?  99  ARG A HH21 5  
ATOM 8146  H HH22 . ARG A 1 108 ? 44.347  39.910  54.558  1.00 0.00 ?  99  ARG A HH22 5  
ATOM 8147  N N    . VAL A 1 109 ? 50.375  43.336  50.874  1.00 0.00 ?  100 VAL A N    5  
ATOM 8148  C CA   . VAL A 1 109 ? 50.003  44.288  49.840  1.00 0.00 ?  100 VAL A CA   5  
ATOM 8149  C C    . VAL A 1 109 ? 48.724  45.114  50.257  1.00 0.00 ?  100 VAL A C    5  
ATOM 8150  O O    . VAL A 1 109 ? 47.787  44.622  50.869  1.00 0.00 ?  100 VAL A O    5  
ATOM 8151  C CB   . VAL A 1 109 ? 49.990  43.580  48.513  1.00 0.00 ?  100 VAL A CB   5  
ATOM 8152  C CG1  . VAL A 1 109 ? 48.802  42.630  48.342  1.00 0.00 ?  100 VAL A CG1  5  
ATOM 8153  C CG2  . VAL A 1 109 ? 50.046  44.524  47.251  1.00 0.00 ?  100 VAL A CG2  5  
ATOM 8154  H H    . VAL A 1 109 ? 49.964  42.422  50.755  1.00 0.00 ?  100 VAL A H    5  
ATOM 8155  H HA   . VAL A 1 109 ? 50.758  45.076  49.835  1.00 0.00 ?  100 VAL A HA   5  
ATOM 8156  H HB   . VAL A 1 109 ? 50.873  42.942  48.533  1.00 0.00 ?  100 VAL A HB   5  
ATOM 8157  H HG11 . VAL A 1 109 ? 48.801  42.239  47.325  1.00 0.00 ?  100 VAL A HG11 5  
ATOM 8158  H HG12 . VAL A 1 109 ? 48.943  41.836  49.075  1.00 0.00 ?  100 VAL A HG12 5  
ATOM 8159  H HG13 . VAL A 1 109 ? 47.900  43.217  48.513  1.00 0.00 ?  100 VAL A HG13 5  
ATOM 8160  H HG21 . VAL A 1 109 ? 50.570  45.436  47.537  1.00 0.00 ?  100 VAL A HG21 5  
ATOM 8161  H HG22 . VAL A 1 109 ? 50.530  44.150  46.349  1.00 0.00 ?  100 VAL A HG22 5  
ATOM 8162  H HG23 . VAL A 1 109 ? 49.038  44.729  46.889  1.00 0.00 ?  100 VAL A HG23 5  
ATOM 8163  N N    . SER A 1 110 ? 48.649  46.406  49.899  1.00 0.00 ?  101 SER A N    5  
ATOM 8164  C CA   . SER A 1 110 ? 47.383  47.130  50.009  1.00 0.00 ?  101 SER A CA   5  
ATOM 8165  C C    . SER A 1 110 ? 46.333  46.523  49.073  1.00 0.00 ?  101 SER A C    5  
ATOM 8166  O O    . SER A 1 110 ? 46.602  46.274  47.883  1.00 0.00 ?  101 SER A O    5  
ATOM 8167  C CB   . SER A 1 110 ? 47.503  48.647  49.669  1.00 0.00 ?  101 SER A CB   5  
ATOM 8168  O OG   . SER A 1 110 ? 46.249  49.307  49.574  1.00 0.00 ?  101 SER A OG   5  
ATOM 8169  H H    . SER A 1 110 ? 49.429  46.799  49.391  1.00 0.00 ?  101 SER A H    5  
ATOM 8170  H HA   . SER A 1 110 ? 46.972  47.065  51.017  1.00 0.00 ?  101 SER A HA   5  
ATOM 8171  H HB2  . SER A 1 110 ? 48.162  49.148  50.378  1.00 0.00 ?  101 SER A HB2  5  
ATOM 8172  H HB3  . SER A 1 110 ? 47.911  48.903  48.692  1.00 0.00 ?  101 SER A HB3  5  
ATOM 8173  H HG   . SER A 1 110 ? 45.892  49.251  50.464  1.00 0.00 ?  101 SER A HG   5  
ATOM 8174  N N    . MET A 1 111 ? 45.152  46.276  49.633  1.00 0.00 ?  102 MET A N    5  
ATOM 8175  C CA   . MET A 1 111 ? 44.007  45.627  48.897  1.00 0.00 ?  102 MET A CA   5  
ATOM 8176  C C    . MET A 1 111 ? 42.733  46.461  49.016  1.00 0.00 ?  102 MET A C    5  
ATOM 8177  O O    . MET A 1 111 ? 42.523  47.271  49.849  1.00 0.00 ?  102 MET A O    5  
ATOM 8178  C CB   . MET A 1 111 ? 43.799  44.192  49.311  1.00 0.00 ?  102 MET A CB   5  
ATOM 8179  C CG   . MET A 1 111 ? 44.876  43.235  48.735  1.00 0.00 ?  102 MET A CG   5  
ATOM 8180  S SD   . MET A 1 111 ? 44.778  41.501  49.287  1.00 0.00 ?  102 MET A SD   5  
ATOM 8181  C CE   . MET A 1 111 ? 45.099  41.585  51.158  1.00 0.00 ?  102 MET A CE   5  
ATOM 8182  H H    . MET A 1 111 ? 45.001  46.662  50.554  1.00 0.00 ?  102 MET A H    5  
ATOM 8183  H HA   . MET A 1 111 ? 44.218  45.537  47.831  1.00 0.00 ?  102 MET A HA   5  
ATOM 8184  H HB2  . MET A 1 111 ? 43.686  44.095  50.391  1.00 0.00 ?  102 MET A HB2  5  
ATOM 8185  H HB3  . MET A 1 111 ? 42.820  43.804  49.029  1.00 0.00 ?  102 MET A HB3  5  
ATOM 8186  H HG2  . MET A 1 111 ? 44.823  43.277  47.647  1.00 0.00 ?  102 MET A HG2  5  
ATOM 8187  H HG3  . MET A 1 111 ? 45.838  43.573  49.120  1.00 0.00 ?  102 MET A HG3  5  
ATOM 8188  H HE1  . MET A 1 111 ? 44.491  42.360  51.625  1.00 0.00 ?  102 MET A HE1  5  
ATOM 8189  H HE2  . MET A 1 111 ? 45.053  40.603  51.630  1.00 0.00 ?  102 MET A HE2  5  
ATOM 8190  H HE3  . MET A 1 111 ? 46.136  41.900  51.273  1.00 0.00 ?  102 MET A HE3  5  
ATOM 8191  N N    . ILE A 1 112 ? 41.848  45.985  48.154  1.00 0.00 ?  103 ILE A N    5  
ATOM 8192  C CA   . ILE A 1 112 ? 40.455  46.465  47.994  1.00 0.00 ?  103 ILE A CA   5  
ATOM 8193  C C    . ILE A 1 112 ? 39.317  45.415  47.670  1.00 0.00 ?  103 ILE A C    5  
ATOM 8194  O O    . ILE A 1 112 ? 39.685  44.447  46.961  1.00 0.00 ?  103 ILE A O    5  
ATOM 8195  C CB   . ILE A 1 112 ? 40.512  47.616  46.963  1.00 0.00 ?  103 ILE A CB   5  
ATOM 8196  C CG1  . ILE A 1 112 ? 41.641  47.768  45.857  1.00 0.00 ?  103 ILE A CG1  5  
ATOM 8197  C CG2  . ILE A 1 112 ? 40.473  48.956  47.717  1.00 0.00 ?  103 ILE A CG2  5  
ATOM 8198  C CD1  . ILE A 1 112 ? 41.042  48.195  44.542  1.00 0.00 ?  103 ILE A CD1  5  
ATOM 8199  O OXT  . ILE A 1 112 ? 38.107  45.538  47.989  1.00 0.00 -1 103 ILE A OXT  5  
ATOM 8200  H H    . ILE A 1 112 ? 42.071  45.169  47.603  1.00 0.00 ?  103 ILE A H    5  
ATOM 8201  H HA   . ILE A 1 112 ? 40.281  46.833  49.004  1.00 0.00 ?  103 ILE A HA   5  
ATOM 8202  H HB   . ILE A 1 112 ? 39.580  47.528  46.404  1.00 0.00 ?  103 ILE A HB   5  
ATOM 8203  H HG12 . ILE A 1 112 ? 42.410  48.458  46.201  1.00 0.00 ?  103 ILE A HG12 5  
ATOM 8204  H HG13 . ILE A 1 112 ? 42.198  46.854  45.650  1.00 0.00 ?  103 ILE A HG13 5  
ATOM 8205  H HG21 . ILE A 1 112 ? 40.329  49.747  46.981  1.00 0.00 ?  103 ILE A HG21 5  
ATOM 8206  H HG22 . ILE A 1 112 ? 39.699  48.978  48.483  1.00 0.00 ?  103 ILE A HG22 5  
ATOM 8207  H HG23 . ILE A 1 112 ? 41.443  48.985  48.214  1.00 0.00 ?  103 ILE A HG23 5  
ATOM 8208  H HD11 . ILE A 1 112 ? 40.264  48.934  44.737  1.00 0.00 ?  103 ILE A HD11 5  
ATOM 8209  H HD12 . ILE A 1 112 ? 41.806  48.613  43.886  1.00 0.00 ?  103 ILE A HD12 5  
ATOM 8210  H HD13 . ILE A 1 112 ? 40.572  47.318  44.096  1.00 0.00 ?  103 ILE A HD13 5  
ATOM 8211  N N    . MET A 1 10  ? -6.048  123.354 84.354  1.00 0.00 ?  1   MET A N    6  
ATOM 8212  C CA   . MET A 1 10  ? -7.379  122.888 84.037  1.00 0.00 ?  1   MET A CA   6  
ATOM 8213  C C    . MET A 1 10  ? -7.567  121.405 84.301  1.00 0.00 ?  1   MET A C    6  
ATOM 8214  O O    . MET A 1 10  ? -6.764  120.606 83.816  1.00 0.00 ?  1   MET A O    6  
ATOM 8215  C CB   . MET A 1 10  ? -7.851  123.227 82.546  1.00 0.00 ?  1   MET A CB   6  
ATOM 8216  C CG   . MET A 1 10  ? -8.045  124.744 82.371  1.00 0.00 ?  1   MET A CG   6  
ATOM 8217  S SD   . MET A 1 10  ? -9.203  125.420 83.577  1.00 0.00 ?  1   MET A SD   6  
ATOM 8218  C CE   . MET A 1 10  ? -9.515  127.041 82.968  1.00 0.00 ?  1   MET A CE   6  
ATOM 8219  H H    . MET A 1 10  ? -5.513  123.001 85.134  1.00 0.00 ?  1   MET A H    6  
ATOM 8220  H HA   . MET A 1 10  ? -8.022  123.389 84.761  1.00 0.00 ?  1   MET A HA   6  
ATOM 8221  H HB2  . MET A 1 10  ? -7.152  122.932 81.765  1.00 0.00 ?  1   MET A HB2  6  
ATOM 8222  H HB3  . MET A 1 10  ? -8.814  122.751 82.364  1.00 0.00 ?  1   MET A HB3  6  
ATOM 8223  H HG2  . MET A 1 10  ? -7.070  125.149 82.643  1.00 0.00 ?  1   MET A HG2  6  
ATOM 8224  H HG3  . MET A 1 10  ? -8.562  124.866 81.419  1.00 0.00 ?  1   MET A HG3  6  
ATOM 8225  H HE1  . MET A 1 10  ? -10.089 126.915 82.050  1.00 0.00 ?  1   MET A HE1  6  
ATOM 8226  H HE2  . MET A 1 10  ? -10.011 127.730 83.651  1.00 0.00 ?  1   MET A HE2  6  
ATOM 8227  H HE3  . MET A 1 10  ? -8.562  127.517 82.739  1.00 0.00 ?  1   MET A HE3  6  
ATOM 8228  N N    . GLU A 1 11  ? -8.646  120.975 84.913  1.00 0.00 ?  2   GLU A N    6  
ATOM 8229  C CA   . GLU A 1 11  ? -8.955  119.488 84.973  1.00 0.00 ?  2   GLU A CA   6  
ATOM 8230  C C    . GLU A 1 11  ? -9.497  118.968 83.682  1.00 0.00 ?  2   GLU A C    6  
ATOM 8231  O O    . GLU A 1 11  ? -9.766  119.746 82.761  1.00 0.00 ?  2   GLU A O    6  
ATOM 8232  C CB   . GLU A 1 11  ? -10.125 119.401 86.026  1.00 0.00 ?  2   GLU A CB   6  
ATOM 8233  C CG   . GLU A 1 11  ? -9.822  119.861 87.510  1.00 0.00 ?  2   GLU A CG   6  
ATOM 8234  C CD   . GLU A 1 11  ? -9.919  121.411 87.642  1.00 0.00 ?  2   GLU A CD   6  
ATOM 8235  O OE1  . GLU A 1 11  ? -10.209 122.154 86.681  1.00 0.00 -1 2   GLU A OE1  6  
ATOM 8236  O OE2  . GLU A 1 11  ? -9.434  121.891 88.698  1.00 0.00 ?  2   GLU A OE2  6  
ATOM 8237  H H    . GLU A 1 11  ? -9.307  121.674 85.224  1.00 0.00 ?  2   GLU A H    6  
ATOM 8238  H HA   . GLU A 1 11  ? -8.124  118.898 85.360  1.00 0.00 ?  2   GLU A HA   6  
ATOM 8239  H HB2  . GLU A 1 11  ? -11.100 119.776 85.716  1.00 0.00 ?  2   GLU A HB2  6  
ATOM 8240  H HB3  . GLU A 1 11  ? -10.333 118.345 86.199  1.00 0.00 ?  2   GLU A HB3  6  
ATOM 8241  H HG2  . GLU A 1 11  ? -10.391 119.336 88.278  1.00 0.00 ?  2   GLU A HG2  6  
ATOM 8242  H HG3  . GLU A 1 11  ? -8.773  119.642 87.710  1.00 0.00 ?  2   GLU A HG3  6  
ATOM 8243  N N    . THR A 1 12  ? -9.702  117.649 83.716  1.00 0.00 ?  3   THR A N    6  
ATOM 8244  C CA   . THR A 1 12  ? -10.318 116.883 82.611  1.00 0.00 ?  3   THR A CA   6  
ATOM 8245  C C    . THR A 1 12  ? -11.707 116.575 83.037  1.00 0.00 ?  3   THR A C    6  
ATOM 8246  O O    . THR A 1 12  ? -11.888 116.048 84.169  1.00 0.00 ?  3   THR A O    6  
ATOM 8247  C CB   . THR A 1 12  ? -9.630  115.520 82.411  1.00 0.00 ?  3   THR A CB   6  
ATOM 8248  O OG1  . THR A 1 12  ? -9.180  115.112 83.654  1.00 0.00 ?  3   THR A OG1  6  
ATOM 8249  C CG2  . THR A 1 12  ? -8.426  115.551 81.553  1.00 0.00 ?  3   THR A CG2  6  
ATOM 8250  H H    . THR A 1 12  ? -9.423  117.115 84.527  1.00 0.00 ?  3   THR A H    6  
ATOM 8251  H HA   . THR A 1 12  ? -10.273 117.463 81.689  1.00 0.00 ?  3   THR A HA   6  
ATOM 8252  H HB   . THR A 1 12  ? -10.454 114.841 82.189  1.00 0.00 ?  3   THR A HB   6  
ATOM 8253  H HG1  . THR A 1 12  ? -9.802  114.500 84.055  1.00 0.00 ?  3   THR A HG1  6  
ATOM 8254  H HG21 . THR A 1 12  ? -8.106  114.565 81.216  1.00 0.00 ?  3   THR A HG21 6  
ATOM 8255  H HG22 . THR A 1 12  ? -8.595  116.228 80.717  1.00 0.00 ?  3   THR A HG22 6  
ATOM 8256  H HG23 . THR A 1 12  ? -7.617  115.898 82.196  1.00 0.00 ?  3   THR A HG23 6  
ATOM 8257  N N    . THR A 1 13  ? -12.704 117.091 82.342  1.00 0.00 ?  4   THR A N    6  
ATOM 8258  C CA   . THR A 1 13  ? -14.173 117.032 82.795  1.00 0.00 ?  4   THR A CA   6  
ATOM 8259  C C    . THR A 1 13  ? -14.779 115.605 82.595  1.00 0.00 ?  4   THR A C    6  
ATOM 8260  O O    . THR A 1 13  ? -14.465 114.929 81.591  1.00 0.00 ?  4   THR A O    6  
ATOM 8261  C CB   . THR A 1 13  ? -14.898 118.147 82.101  1.00 0.00 ?  4   THR A CB   6  
ATOM 8262  O OG1  . THR A 1 13  ? -16.135 118.411 82.841  1.00 0.00 ?  4   THR A OG1  6  
ATOM 8263  C CG2  . THR A 1 13  ? -15.361 117.775 80.641  1.00 0.00 ?  4   THR A CG2  6  
ATOM 8264  H H    . THR A 1 13  ? -12.568 117.245 81.353  1.00 0.00 ?  4   THR A H    6  
ATOM 8265  H HA   . THR A 1 13  ? -14.187 117.268 83.859  1.00 0.00 ?  4   THR A HA   6  
ATOM 8266  H HB   . THR A 1 13  ? -14.321 119.071 82.159  1.00 0.00 ?  4   THR A HB   6  
ATOM 8267  H HG1  . THR A 1 13  ? -16.433 119.178 82.345  1.00 0.00 ?  4   THR A HG1  6  
ATOM 8268  H HG21 . THR A 1 13  ? -14.522 117.782 79.945  1.00 0.00 ?  4   THR A HG21 6  
ATOM 8269  H HG22 . THR A 1 13  ? -15.862 116.807 80.639  1.00 0.00 ?  4   THR A HG22 6  
ATOM 8270  H HG23 . THR A 1 13  ? -16.081 118.473 80.210  1.00 0.00 ?  4   THR A HG23 6  
ATOM 8271  N N    . ASN A 1 14  ? -15.727 115.232 83.479  1.00 0.00 ?  5   ASN A N    6  
ATOM 8272  C CA   . ASN A 1 14  ? -16.613 114.080 83.406  1.00 0.00 ?  5   ASN A CA   6  
ATOM 8273  C C    . ASN A 1 14  ? -17.480 113.970 82.159  1.00 0.00 ?  5   ASN A C    6  
ATOM 8274  O O    . ASN A 1 14  ? -17.945 115.012 81.607  1.00 0.00 ?  5   ASN A O    6  
ATOM 8275  C CB   . ASN A 1 14  ? -17.448 113.888 84.762  1.00 0.00 ?  5   ASN A CB   6  
ATOM 8276  C CG   . ASN A 1 14  ? -16.617 113.539 85.946  1.00 0.00 ?  5   ASN A CG   6  
ATOM 8277  O OD1  . ASN A 1 14  ? -15.481 113.955 86.016  1.00 0.00 ?  5   ASN A OD1  6  
ATOM 8278  N ND2  . ASN A 1 14  ? -17.173 112.900 86.953  1.00 0.00 ?  5   ASN A ND2  6  
ATOM 8279  H H    . ASN A 1 14  ? -15.985 115.825 84.255  1.00 0.00 ?  5   ASN A H    6  
ATOM 8280  H HA   . ASN A 1 14  ? -16.037 113.170 83.230  1.00 0.00 ?  5   ASN A HA   6  
ATOM 8281  H HB2  . ASN A 1 14  ? -17.935 114.819 85.053  1.00 0.00 ?  5   ASN A HB2  6  
ATOM 8282  H HB3  . ASN A 1 14  ? -18.179 113.095 84.601  1.00 0.00 ?  5   ASN A HB3  6  
ATOM 8283  H HD21 . ASN A 1 14  ? -18.146 112.658 87.074  1.00 0.00 ?  5   ASN A HD21 6  
ATOM 8284  H HD22 . ASN A 1 14  ? -16.561 112.595 87.697  1.00 0.00 ?  5   ASN A HD22 6  
ATOM 8285  N N    . GLY A 1 15  ? -17.915 112.792 81.792  1.00 0.00 ?  6   GLY A N    6  
ATOM 8286  C CA   . GLY A 1 15  ? -18.870 112.640 80.682  1.00 0.00 ?  6   GLY A CA   6  
ATOM 8287  C C    . GLY A 1 15  ? -20.322 112.955 81.003  1.00 0.00 ?  6   GLY A C    6  
ATOM 8288  O O    . GLY A 1 15  ? -20.682 113.524 82.038  1.00 0.00 ?  6   GLY A O    6  
ATOM 8289  H H    . GLY A 1 15  ? -17.562 111.989 82.293  1.00 0.00 ?  6   GLY A H    6  
ATOM 8290  H HA2  . GLY A 1 15  ? -18.640 113.468 80.012  1.00 0.00 ?  6   GLY A HA2  6  
ATOM 8291  H HA3  . GLY A 1 15  ? -18.794 111.628 80.286  1.00 0.00 ?  6   GLY A HA3  6  
ATOM 8292  N N    . THR A 1 16  ? -21.237 112.544 80.161  1.00 0.00 ?  7   THR A N    6  
ATOM 8293  C CA   . THR A 1 16  ? -22.727 112.627 80.515  1.00 0.00 ?  7   THR A CA   6  
ATOM 8294  C C    . THR A 1 16  ? -23.275 111.568 81.512  1.00 0.00 ?  7   THR A C    6  
ATOM 8295  O O    . THR A 1 16  ? -22.477 110.795 82.177  1.00 0.00 ?  7   THR A O    6  
ATOM 8296  C CB   . THR A 1 16  ? -23.512 112.671 79.167  1.00 0.00 ?  7   THR A CB   6  
ATOM 8297  O OG1  . THR A 1 16  ? -23.560 111.476 78.492  1.00 0.00 ?  7   THR A OG1  6  
ATOM 8298  C CG2  . THR A 1 16  ? -23.038 113.717 78.189  1.00 0.00 ?  7   THR A CG2  6  
ATOM 8299  H H    . THR A 1 16  ? -20.922 112.109 79.306  1.00 0.00 ?  7   THR A H    6  
ATOM 8300  H HA   . THR A 1 16  ? -22.860 113.604 80.979  1.00 0.00 ?  7   THR A HA   6  
ATOM 8301  H HB   . THR A 1 16  ? -24.541 112.945 79.402  1.00 0.00 ?  7   THR A HB   6  
ATOM 8302  H HG1  . THR A 1 16  ? -24.092 111.697 77.725  1.00 0.00 ?  7   THR A HG1  6  
ATOM 8303  H HG21 . THR A 1 16  ? -21.971 113.533 78.059  1.00 0.00 ?  7   THR A HG21 6  
ATOM 8304  H HG22 . THR A 1 16  ? -23.440 113.555 77.189  1.00 0.00 ?  7   THR A HG22 6  
ATOM 8305  H HG23 . THR A 1 16  ? -23.402 114.646 78.627  1.00 0.00 ?  7   THR A HG23 6  
ATOM 8306  N N    . GLU A 1 17  ? -24.567 111.688 81.881  1.00 0.00 ?  8   GLU A N    6  
ATOM 8307  C CA   . GLU A 1 17  ? -25.259 110.758 82.727  1.00 0.00 ?  8   GLU A CA   6  
ATOM 8308  C C    . GLU A 1 17  ? -25.369 109.424 81.966  1.00 0.00 ?  8   GLU A C    6  
ATOM 8309  O O    . GLU A 1 17  ? -25.247 108.261 82.526  1.00 0.00 ?  8   GLU A O    6  
ATOM 8310  C CB   . GLU A 1 17  ? -26.610 111.324 83.181  1.00 0.00 ?  8   GLU A CB   6  
ATOM 8311  C CG   . GLU A 1 17  ? -27.527 111.655 81.971  1.00 0.00 ?  8   GLU A CG   6  
ATOM 8312  C CD   . GLU A 1 17  ? -28.789 112.449 82.294  1.00 0.00 ?  8   GLU A CD   6  
ATOM 8313  O OE1  . GLU A 1 17  ? -29.254 112.458 83.486  1.00 0.00 -1 8   GLU A OE1  6  
ATOM 8314  O OE2  . GLU A 1 17  ? -29.297 113.095 81.438  1.00 0.00 ?  8   GLU A OE2  6  
ATOM 8315  H H    . GLU A 1 17  ? -25.077 112.525 81.639  1.00 0.00 ?  8   GLU A H    6  
ATOM 8316  H HA   . GLU A 1 17  ? -24.669 110.587 83.627  1.00 0.00 ?  8   GLU A HA   6  
ATOM 8317  H HB2  . GLU A 1 17  ? -27.046 110.573 83.840  1.00 0.00 ?  8   GLU A HB2  6  
ATOM 8318  H HB3  . GLU A 1 17  ? -26.387 112.175 83.824  1.00 0.00 ?  8   GLU A HB3  6  
ATOM 8319  H HG2  . GLU A 1 17  ? -26.990 112.295 81.272  1.00 0.00 ?  8   GLU A HG2  6  
ATOM 8320  H HG3  . GLU A 1 17  ? -27.830 110.781 81.395  1.00 0.00 ?  8   GLU A HG3  6  
ATOM 8321  N N    . THR A 1 18  ? -25.603 109.510 80.673  1.00 0.00 ?  9   THR A N    6  
ATOM 8322  C CA   . THR A 1 18  ? -25.479 108.402 79.744  1.00 0.00 ?  9   THR A CA   6  
ATOM 8323  C C    . THR A 1 18  ? -24.031 107.813 79.639  1.00 0.00 ?  9   THR A C    6  
ATOM 8324  O O    . THR A 1 18  ? -23.852 106.615 79.520  1.00 0.00 ?  9   THR A O    6  
ATOM 8325  C CB   . THR A 1 18  ? -26.276 108.401 78.394  1.00 0.00 ?  9   THR A CB   6  
ATOM 8326  O OG1  . THR A 1 18  ? -25.447 108.696 77.339  1.00 0.00 ?  9   THR A OG1  6  
ATOM 8327  C CG2  . THR A 1 18  ? -27.504 109.369 78.469  1.00 0.00 ?  9   THR A CG2  6  
ATOM 8328  H H    . THR A 1 18  ? -25.800 110.419 80.278  1.00 0.00 ?  9   THR A H    6  
ATOM 8329  H HA   . THR A 1 18  ? -25.969 107.619 80.323  1.00 0.00 ?  9   THR A HA   6  
ATOM 8330  H HB   . THR A 1 18  ? -26.718 107.437 78.142  1.00 0.00 ?  9   THR A HB   6  
ATOM 8331  H HG1  . THR A 1 18  ? -25.814 108.524 76.470  1.00 0.00 ?  9   THR A HG1  6  
ATOM 8332  H HG21 . THR A 1 18  ? -27.103 110.381 78.411  1.00 0.00 ?  9   THR A HG21 6  
ATOM 8333  H HG22 . THR A 1 18  ? -28.214 109.251 77.651  1.00 0.00 ?  9   THR A HG22 6  
ATOM 8334  H HG23 . THR A 1 18  ? -28.007 109.024 79.372  1.00 0.00 ?  9   THR A HG23 6  
ATOM 8335  N N    . TRP A 1 19  ? -22.977 108.590 79.537  1.00 0.00 ?  10  TRP A N    6  
ATOM 8336  C CA   . TRP A 1 19  ? -21.559 108.011 79.472  1.00 0.00 ?  10  TRP A CA   6  
ATOM 8337  C C    . TRP A 1 19  ? -21.261 107.220 80.742  1.00 0.00 ?  10  TRP A C    6  
ATOM 8338  O O    . TRP A 1 19  ? -20.698 106.108 80.608  1.00 0.00 ?  10  TRP A O    6  
ATOM 8339  C CB   . TRP A 1 19  ? -20.537 109.073 79.150  1.00 0.00 ?  10  TRP A CB   6  
ATOM 8340  C CG   . TRP A 1 19  ? -19.174 108.875 79.690  1.00 0.00 ?  10  TRP A CG   6  
ATOM 8341  C CD1  . TRP A 1 19  ? -18.134 108.174 79.114  1.00 0.00 ?  10  TRP A CD1  6  
ATOM 8342  C CD2  . TRP A 1 19  ? -18.738 109.098 81.080  1.00 0.00 ?  10  TRP A CD2  6  
ATOM 8343  N NE1  . TRP A 1 19  ? -17.142 107.934 80.052  1.00 0.00 ?  10  TRP A NE1  6  
ATOM 8344  C CE2  . TRP A 1 19  ? -17.454 108.521 81.291  1.00 0.00 ?  10  TRP A CE2  6  
ATOM 8345  C CE3  . TRP A 1 19  ? -19.217 109.748 82.209  1.00 0.00 ?  10  TRP A CE3  6  
ATOM 8346  C CZ2  . TRP A 1 19  ? -16.655 108.545 82.444  1.00 0.00 ?  10  TRP A CZ2  6  
ATOM 8347  C CZ3  . TRP A 1 19  ? -18.463 109.922 83.375  1.00 0.00 ?  10  TRP A CZ3  6  
ATOM 8348  C CH2  . TRP A 1 19  ? -17.227 109.186 83.546  1.00 0.00 ?  10  TRP A CH2  6  
ATOM 8349  H H    . TRP A 1 19  ? -23.102 109.593 79.501  1.00 0.00 ?  10  TRP A H    6  
ATOM 8350  H HA   . TRP A 1 19  ? -21.588 107.238 78.704  1.00 0.00 ?  10  TRP A HA   6  
ATOM 8351  H HB2  . TRP A 1 19  ? -20.524 109.228 78.071  1.00 0.00 ?  10  TRP A HB2  6  
ATOM 8352  H HB3  . TRP A 1 19  ? -20.881 110.023 79.556  1.00 0.00 ?  10  TRP A HB3  6  
ATOM 8353  H HD1  . TRP A 1 19  ? -18.243 107.807 78.105  1.00 0.00 ?  10  TRP A HD1  6  
ATOM 8354  H HE1  . TRP A 1 19  ? -16.240 107.560 79.793  1.00 0.00 ?  10  TRP A HE1  6  
ATOM 8355  H HE3  . TRP A 1 19  ? -20.169 110.256 82.225  1.00 0.00 ?  10  TRP A HE3  6  
ATOM 8356  H HZ2  . TRP A 1 19  ? -15.707 108.039 82.543  1.00 0.00 ?  10  TRP A HZ2  6  
ATOM 8357  H HZ3  . TRP A 1 19  ? -18.793 110.442 84.263  1.00 0.00 ?  10  TRP A HZ3  6  
ATOM 8358  H HH2  . TRP A 1 19  ? -16.641 109.265 84.450  1.00 0.00 ?  10  TRP A HH2  6  
ATOM 8359  N N    . TYR A 1 20  ? -21.482 107.775 81.967  1.00 0.00 ?  11  TYR A N    6  
ATOM 8360  C CA   . TYR A 1 20  ? -21.338 106.905 83.124  1.00 0.00 ?  11  TYR A CA   6  
ATOM 8361  C C    . TYR A 1 20  ? -22.123 105.671 83.135  1.00 0.00 ?  11  TYR A C    6  
ATOM 8362  O O    . TYR A 1 20  ? -21.485 104.656 83.427  1.00 0.00 ?  11  TYR A O    6  
ATOM 8363  C CB   . TYR A 1 20  ? -21.272 107.704 84.422  1.00 0.00 ?  11  TYR A CB   6  
ATOM 8364  C CG   . TYR A 1 20  ? -21.363 106.881 85.701  1.00 0.00 ?  11  TYR A CG   6  
ATOM 8365  C CD1  . TYR A 1 20  ? -22.603 106.268 86.161  1.00 0.00 ?  11  TYR A CD1  6  
ATOM 8366  C CD2  . TYR A 1 20  ? -20.139 106.555 86.285  1.00 0.00 ?  11  TYR A CD2  6  
ATOM 8367  C CE1  . TYR A 1 20  ? -22.491 105.399 87.253  1.00 0.00 ?  11  TYR A CE1  6  
ATOM 8368  C CE2  . TYR A 1 20  ? -20.120 105.822 87.428  1.00 0.00 ?  11  TYR A CE2  6  
ATOM 8369  C CZ   . TYR A 1 20  ? -21.281 105.219 87.928  1.00 0.00 ?  11  TYR A CZ   6  
ATOM 8370  O OH   . TYR A 1 20  ? -21.181 104.402 89.049  1.00 0.00 ?  11  TYR A OH   6  
ATOM 8371  H H    . TYR A 1 20  ? -22.027 108.608 82.133  1.00 0.00 ?  11  TYR A H    6  
ATOM 8372  H HA   . TYR A 1 20  ? -20.341 106.470 83.056  1.00 0.00 ?  11  TYR A HA   6  
ATOM 8373  H HB2  . TYR A 1 20  ? -20.516 108.483 84.517  1.00 0.00 ?  11  TYR A HB2  6  
ATOM 8374  H HB3  . TYR A 1 20  ? -22.243 108.199 84.464  1.00 0.00 ?  11  TYR A HB3  6  
ATOM 8375  H HD1  . TYR A 1 20  ? -23.563 106.508 85.731  1.00 0.00 ?  11  TYR A HD1  6  
ATOM 8376  H HD2  . TYR A 1 20  ? -19.298 106.996 85.772  1.00 0.00 ?  11  TYR A HD2  6  
ATOM 8377  H HE1  . TYR A 1 20  ? -23.351 104.889 87.662  1.00 0.00 ?  11  TYR A HE1  6  
ATOM 8378  H HE2  . TYR A 1 20  ? -19.192 105.664 87.956  1.00 0.00 ?  11  TYR A HE2  6  
ATOM 8379  H HH   . TYR A 1 20  ? -20.308 104.526 89.427  1.00 0.00 ?  11  TYR A HH   6  
ATOM 8380  N N    . GLU A 1 21  ? -23.384 105.686 82.782  1.00 0.00 ?  12  GLU A N    6  
ATOM 8381  C CA   . GLU A 1 21  ? -24.161 104.397 82.797  1.00 0.00 ?  12  GLU A CA   6  
ATOM 8382  C C    . GLU A 1 21  ? -23.490 103.375 81.755  1.00 0.00 ?  12  GLU A C    6  
ATOM 8383  O O    . GLU A 1 21  ? -23.516 102.154 81.916  1.00 0.00 ?  12  GLU A O    6  
ATOM 8384  C CB   . GLU A 1 21  ? -25.674 104.674 82.474  1.00 0.00 ?  12  GLU A CB   6  
ATOM 8385  C CG   . GLU A 1 21  ? -26.509 103.403 82.660  1.00 0.00 ?  12  GLU A CG   6  
ATOM 8386  C CD   . GLU A 1 21  ? -26.873 103.096 84.078  1.00 0.00 ?  12  GLU A CD   6  
ATOM 8387  O OE1  . GLU A 1 21  ? -26.183 103.514 85.024  1.00 0.00 ?  12  GLU A OE1  6  
ATOM 8388  O OE2  . GLU A 1 21  ? -27.853 102.376 84.336  1.00 0.00 -1 12  GLU A OE2  6  
ATOM 8389  H H    . GLU A 1 21  ? -23.844 106.544 82.512  1.00 0.00 ?  12  GLU A H    6  
ATOM 8390  H HA   . GLU A 1 21  ? -24.149 104.016 83.819  1.00 0.00 ?  12  GLU A HA   6  
ATOM 8391  H HB2  . GLU A 1 21  ? -25.971 105.420 83.211  1.00 0.00 ?  12  GLU A HB2  6  
ATOM 8392  H HB3  . GLU A 1 21  ? -25.850 105.171 81.521  1.00 0.00 ?  12  GLU A HB3  6  
ATOM 8393  H HG2  . GLU A 1 21  ? -27.411 103.569 82.070  1.00 0.00 ?  12  GLU A HG2  6  
ATOM 8394  H HG3  . GLU A 1 21  ? -26.112 102.528 82.144  1.00 0.00 ?  12  GLU A HG3  6  
ATOM 8395  N N    . SER A 1 22  ? -22.787 103.896 80.797  1.00 0.00 ?  13  SER A N    6  
ATOM 8396  C CA   . SER A 1 22  ? -21.991 102.987 79.902  1.00 0.00 ?  13  SER A CA   6  
ATOM 8397  C C    . SER A 1 22  ? -20.680 102.563 80.551  1.00 0.00 ?  13  SER A C    6  
ATOM 8398  O O    . SER A 1 22  ? -20.198 101.417 80.409  1.00 0.00 ?  13  SER A O    6  
ATOM 8399  C CB   . SER A 1 22  ? -21.874 103.648 78.553  1.00 0.00 ?  13  SER A CB   6  
ATOM 8400  O OG   . SER A 1 22  ? -21.598 102.739 77.522  1.00 0.00 ?  13  SER A OG   6  
ATOM 8401  H H    . SER A 1 22  ? -22.583 104.884 80.733  1.00 0.00 ?  13  SER A H    6  
ATOM 8402  H HA   . SER A 1 22  ? -22.618 102.111 79.731  1.00 0.00 ?  13  SER A HA   6  
ATOM 8403  H HB2  . SER A 1 22  ? -22.825 104.165 78.421  1.00 0.00 ?  13  SER A HB2  6  
ATOM 8404  H HB3  . SER A 1 22  ? -21.149 104.458 78.639  1.00 0.00 ?  13  SER A HB3  6  
ATOM 8405  H HG   . SER A 1 22  ? -21.303 103.237 76.756  1.00 0.00 ?  13  SER A HG   6  
ATOM 8406  N N    . LEU A 1 23  ? -20.026 103.446 81.429  1.00 0.00 ?  14  LEU A N    6  
ATOM 8407  C CA   . LEU A 1 23  ? -18.967 102.922 82.290  1.00 0.00 ?  14  LEU A CA   6  
ATOM 8408  C C    . LEU A 1 23  ? -19.472 101.914 83.383  1.00 0.00 ?  14  LEU A C    6  
ATOM 8409  O O    . LEU A 1 23  ? -18.774 100.925 83.605  1.00 0.00 ?  14  LEU A O    6  
ATOM 8410  C CB   . LEU A 1 23  ? -18.106 104.045 82.844  1.00 0.00 ?  14  LEU A CB   6  
ATOM 8411  C CG   . LEU A 1 23  ? -16.957 103.607 83.814  1.00 0.00 ?  14  LEU A CG   6  
ATOM 8412  C CD1  . LEU A 1 23  ? -15.850 102.755 83.174  1.00 0.00 ?  14  LEU A CD1  6  
ATOM 8413  C CD2  . LEU A 1 23  ? -16.257 104.957 84.233  1.00 0.00 ?  14  LEU A CD2  6  
ATOM 8414  H H    . LEU A 1 23  ? -20.436 104.330 81.694  1.00 0.00 ?  14  LEU A H    6  
ATOM 8415  H HA   . LEU A 1 23  ? -18.236 102.352 81.717  1.00 0.00 ?  14  LEU A HA   6  
ATOM 8416  H HB2  . LEU A 1 23  ? -17.755 104.756 82.097  1.00 0.00 ?  14  LEU A HB2  6  
ATOM 8417  H HB3  . LEU A 1 23  ? -18.839 104.589 83.440  1.00 0.00 ?  14  LEU A HB3  6  
ATOM 8418  H HG   . LEU A 1 23  ? -17.293 103.097 84.718  1.00 0.00 ?  14  LEU A HG   6  
ATOM 8419  H HD11 . LEU A 1 23  ? -16.275 101.854 82.733  1.00 0.00 ?  14  LEU A HD11 6  
ATOM 8420  H HD12 . LEU A 1 23  ? -15.347 103.269 82.355  1.00 0.00 ?  14  LEU A HD12 6  
ATOM 8421  H HD13 . LEU A 1 23  ? -15.206 102.257 83.897  1.00 0.00 ?  14  LEU A HD13 6  
ATOM 8422  H HD21 . LEU A 1 23  ? -15.376 104.929 84.874  1.00 0.00 ?  14  LEU A HD21 6  
ATOM 8423  H HD22 . LEU A 1 23  ? -16.142 105.631 83.384  1.00 0.00 ?  14  LEU A HD22 6  
ATOM 8424  H HD23 . LEU A 1 23  ? -17.006 105.467 84.838  1.00 0.00 ?  14  LEU A HD23 6  
ATOM 8425  N N    . HIS A 1 24  ? -20.643 102.140 83.977  1.00 0.00 ?  15  HIS A N    6  
ATOM 8426  C CA   . HIS A 1 24  ? -21.320 101.167 84.901  1.00 0.00 ?  15  HIS A CA   6  
ATOM 8427  C C    . HIS A 1 24  ? -21.595 99.769  84.273  1.00 0.00 ?  15  HIS A C    6  
ATOM 8428  O O    . HIS A 1 24  ? -21.568 98.768  84.990  1.00 0.00 ?  15  HIS A O    6  
ATOM 8429  C CB   . HIS A 1 24  ? -22.671 101.848 85.277  1.00 0.00 ?  15  HIS A CB   6  
ATOM 8430  C CG   . HIS A 1 24  ? -23.554 100.892 85.991  1.00 0.00 ?  15  HIS A CG   6  
ATOM 8431  N ND1  . HIS A 1 24  ? -23.401 100.446 87.281  1.00 0.00 ?  15  HIS A ND1  6  
ATOM 8432  C CD2  . HIS A 1 24  ? -24.754 100.428 85.464  1.00 0.00 ?  15  HIS A CD2  6  
ATOM 8433  C CE1  . HIS A 1 24  ? -24.470 99.674  87.522  1.00 0.00 ?  15  HIS A CE1  6  
ATOM 8434  N NE2  . HIS A 1 24  ? -25.299 99.619  86.417  1.00 0.00 ?  15  HIS A NE2  6  
ATOM 8435  H H    . HIS A 1 24  ? -21.287 102.754 83.498  1.00 0.00 ?  15  HIS A H    6  
ATOM 8436  H HA   . HIS A 1 24  ? -20.710 100.988 85.785  1.00 0.00 ?  15  HIS A HA   6  
ATOM 8437  H HB2  . HIS A 1 24  ? -22.513 102.829 85.724  1.00 0.00 ?  15  HIS A HB2  6  
ATOM 8438  H HB3  . HIS A 1 24  ? -23.158 102.027 84.318  1.00 0.00 ?  15  HIS A HB3  6  
ATOM 8439  H HD2  . HIS A 1 24  ? -25.195 100.579 84.490  1.00 0.00 ?  15  HIS A HD2  6  
ATOM 8440  H HE1  . HIS A 1 24  ? -24.622 99.142  88.450  1.00 0.00 ?  15  HIS A HE1  6  
ATOM 8441  H HE2  . HIS A 1 24  ? -26.225 99.216  86.441  1.00 0.00 ?  15  HIS A HE2  6  
ATOM 8442  N N    . ALA A 1 25  ? -22.047 99.748  83.032  1.00 0.00 ?  16  ALA A N    6  
ATOM 8443  C CA   . ALA A 1 25  ? -22.314 98.551  82.212  1.00 0.00 ?  16  ALA A CA   6  
ATOM 8444  C C    . ALA A 1 25  ? -20.977 97.824  81.907  1.00 0.00 ?  16  ALA A C    6  
ATOM 8445  O O    . ALA A 1 25  ? -21.007 96.590  81.938  1.00 0.00 ?  16  ALA A O    6  
ATOM 8446  C CB   . ALA A 1 25  ? -23.148 98.936  80.924  1.00 0.00 ?  16  ALA A CB   6  
ATOM 8447  H H    . ALA A 1 25  ? -22.202 100.669 82.648  1.00 0.00 ?  16  ALA A H    6  
ATOM 8448  H HA   . ALA A 1 25  ? -22.975 97.915  82.800  1.00 0.00 ?  16  ALA A HA   6  
ATOM 8449  H HB1  . ALA A 1 25  ? -23.477 98.051  80.381  1.00 0.00 ?  16  ALA A HB1  6  
ATOM 8450  H HB2  . ALA A 1 25  ? -24.052 99.476  81.205  1.00 0.00 ?  16  ALA A HB2  6  
ATOM 8451  H HB3  . ALA A 1 25  ? -22.582 99.521  80.198  1.00 0.00 ?  16  ALA A HB3  6  
ATOM 8452  N N    . VAL A 1 26  ? -19.806 98.450  81.603  1.00 0.00 ?  17  VAL A N    6  
ATOM 8453  C CA   . VAL A 1 26  ? -18.466 97.936  81.649  1.00 0.00 ?  17  VAL A CA   6  
ATOM 8454  C C    . VAL A 1 26  ? -18.123 97.383  83.051  1.00 0.00 ?  17  VAL A C    6  
ATOM 8455  O O    . VAL A 1 26  ? -17.751 96.253  83.187  1.00 0.00 ?  17  VAL A O    6  
ATOM 8456  C CB   . VAL A 1 26  ? -17.415 98.933  81.147  1.00 0.00 ?  17  VAL A CB   6  
ATOM 8457  C CG1  . VAL A 1 26  ? -15.922 98.682  81.425  1.00 0.00 ?  17  VAL A CG1  6  
ATOM 8458  C CG2  . VAL A 1 26  ? -17.656 99.183  79.685  1.00 0.00 ?  17  VAL A CG2  6  
ATOM 8459  H H    . VAL A 1 26  ? -19.888 99.455  81.536  1.00 0.00 ?  17  VAL A H    6  
ATOM 8460  H HA   . VAL A 1 26  ? -18.496 97.049  81.017  1.00 0.00 ?  17  VAL A HA   6  
ATOM 8461  H HB   . VAL A 1 26  ? -17.534 99.878  81.677  1.00 0.00 ?  17  VAL A HB   6  
ATOM 8462  H HG11 . VAL A 1 26  ? -15.681 98.921  82.460  1.00 0.00 ?  17  VAL A HG11 6  
ATOM 8463  H HG12 . VAL A 1 26  ? -15.672 97.635  81.261  1.00 0.00 ?  17  VAL A HG12 6  
ATOM 8464  H HG13 . VAL A 1 26  ? -15.306 99.301  80.772  1.00 0.00 ?  17  VAL A HG13 6  
ATOM 8465  H HG21 . VAL A 1 26  ? -18.710 99.424  79.548  1.00 0.00 ?  17  VAL A HG21 6  
ATOM 8466  H HG22 . VAL A 1 26  ? -17.025 99.986  79.305  1.00 0.00 ?  17  VAL A HG22 6  
ATOM 8467  H HG23 . VAL A 1 26  ? -17.334 98.294  79.143  1.00 0.00 ?  17  VAL A HG23 6  
ATOM 8468  N N    . LEU A 1 27  ? -18.201 98.167  84.116  1.00 0.00 ?  18  LEU A N    6  
ATOM 8469  C CA   . LEU A 1 27  ? -17.831 97.637  85.437  1.00 0.00 ?  18  LEU A CA   6  
ATOM 8470  C C    . LEU A 1 27  ? -18.744 96.569  85.859  1.00 0.00 ?  18  LEU A C    6  
ATOM 8471  O O    . LEU A 1 27  ? -18.415 95.742  86.638  1.00 0.00 ?  18  LEU A O    6  
ATOM 8472  C CB   . LEU A 1 27  ? -17.833 98.774  86.542  1.00 0.00 ?  18  LEU A CB   6  
ATOM 8473  C CG   . LEU A 1 27  ? -16.512 99.572  86.829  1.00 0.00 ?  18  LEU A CG   6  
ATOM 8474  C CD1  . LEU A 1 27  ? -15.628 99.802  85.635  1.00 0.00 ?  18  LEU A CD1  6  
ATOM 8475  C CD2  . LEU A 1 27  ? -16.872 100.922 87.585  1.00 0.00 ?  18  LEU A CD2  6  
ATOM 8476  H H    . LEU A 1 27  ? -18.293 99.164  83.981  1.00 0.00 ?  18  LEU A H    6  
ATOM 8477  H HA   . LEU A 1 27  ? -16.829 97.229  85.294  1.00 0.00 ?  18  LEU A HA   6  
ATOM 8478  H HB2  . LEU A 1 27  ? -18.630 99.487  86.332  1.00 0.00 ?  18  LEU A HB2  6  
ATOM 8479  H HB3  . LEU A 1 27  ? -18.225 98.381  87.480  1.00 0.00 ?  18  LEU A HB3  6  
ATOM 8480  H HG   . LEU A 1 27  ? -16.004 98.960  87.574  1.00 0.00 ?  18  LEU A HG   6  
ATOM 8481  H HD11 . LEU A 1 27  ? -15.338 98.883  85.125  1.00 0.00 ?  18  LEU A HD11 6  
ATOM 8482  H HD12 . LEU A 1 27  ? -16.275 100.269 84.892  1.00 0.00 ?  18  LEU A HD12 6  
ATOM 8483  H HD13 . LEU A 1 27  ? -14.821 100.517 85.791  1.00 0.00 ?  18  LEU A HD13 6  
ATOM 8484  H HD21 . LEU A 1 27  ? -17.396 101.675 86.995  1.00 0.00 ?  18  LEU A HD21 6  
ATOM 8485  H HD22 . LEU A 1 27  ? -17.591 100.651 88.359  1.00 0.00 ?  18  LEU A HD22 6  
ATOM 8486  H HD23 . LEU A 1 27  ? -15.996 101.415 88.005  1.00 0.00 ?  18  LEU A HD23 6  
ATOM 8487  N N    . LYS A 1 28  ? -19.999 96.536  85.360  1.00 0.00 ?  19  LYS A N    6  
ATOM 8488  C CA   . LYS A 1 28  ? -20.911 95.382  85.747  1.00 0.00 ?  19  LYS A CA   6  
ATOM 8489  C C    . LYS A 1 28  ? -20.524 94.021  85.095  1.00 0.00 ?  19  LYS A C    6  
ATOM 8490  O O    . LYS A 1 28  ? -20.439 93.040  85.847  1.00 0.00 ?  19  LYS A O    6  
ATOM 8491  C CB   . LYS A 1 28  ? -22.300 95.777  85.234  1.00 0.00 ?  19  LYS A CB   6  
ATOM 8492  C CG   . LYS A 1 28  ? -23.467 94.840  85.591  1.00 0.00 ?  19  LYS A CG   6  
ATOM 8493  C CD   . LYS A 1 28  ? -24.837 95.333  85.112  1.00 0.00 ?  19  LYS A CD   6  
ATOM 8494  C CE   . LYS A 1 28  ? -25.913 94.587  85.770  1.00 0.00 ?  19  LYS A CE   6  
ATOM 8495  N NZ   . LYS A 1 28  ? -27.284 95.037  85.487  1.00 0.00 1  19  LYS A NZ   6  
ATOM 8496  H H    . LYS A 1 28  ? -20.225 96.981  84.482  1.00 0.00 ?  19  LYS A H    6  
ATOM 8497  H HA   . LYS A 1 28  ? -20.892 95.215  86.824  1.00 0.00 ?  19  LYS A HA   6  
ATOM 8498  H HB2  . LYS A 1 28  ? -22.556 96.787  85.552  1.00 0.00 ?  19  LYS A HB2  6  
ATOM 8499  H HB3  . LYS A 1 28  ? -22.206 95.837  84.150  1.00 0.00 ?  19  LYS A HB3  6  
ATOM 8500  H HG2  . LYS A 1 28  ? -23.263 93.853  85.175  1.00 0.00 ?  19  LYS A HG2  6  
ATOM 8501  H HG3  . LYS A 1 28  ? -23.474 94.688  86.670  1.00 0.00 ?  19  LYS A HG3  6  
ATOM 8502  H HD2  . LYS A 1 28  ? -24.901 96.370  85.444  1.00 0.00 ?  19  LYS A HD2  6  
ATOM 8503  H HD3  . LYS A 1 28  ? -24.915 95.348  84.025  1.00 0.00 ?  19  LYS A HD3  6  
ATOM 8504  H HE2  . LYS A 1 28  ? -25.863 93.580  85.357  1.00 0.00 ?  19  LYS A HE2  6  
ATOM 8505  H HE3  . LYS A 1 28  ? -25.752 94.559  86.847  1.00 0.00 ?  19  LYS A HE3  6  
ATOM 8506  H HZ1  . LYS A 1 28  ? -27.366 94.820  84.505  1.00 0.00 ?  19  LYS A HZ1  6  
ATOM 8507  H HZ2  . LYS A 1 28  ? -27.922 94.561  86.109  1.00 0.00 ?  19  LYS A HZ2  6  
ATOM 8508  H HZ3  . LYS A 1 28  ? -27.393 96.039  85.552  1.00 0.00 ?  19  LYS A HZ3  6  
ATOM 8509  N N    . ALA A 1 29  ? -20.188 94.068  83.785  1.00 0.00 ?  20  ALA A N    6  
ATOM 8510  C CA   . ALA A 1 29  ? -19.471 92.998  83.077  1.00 0.00 ?  20  ALA A CA   6  
ATOM 8511  C C    . ALA A 1 29  ? -18.268 92.543  83.907  1.00 0.00 ?  20  ALA A C    6  
ATOM 8512  O O    . ALA A 1 29  ? -18.030 91.400  84.169  1.00 0.00 ?  20  ALA A O    6  
ATOM 8513  C CB   . ALA A 1 29  ? -19.023 93.447  81.671  1.00 0.00 ?  20  ALA A CB   6  
ATOM 8514  H H    . ALA A 1 29  ? -20.396 94.839  83.167  1.00 0.00 ?  20  ALA A H    6  
ATOM 8515  H HA   . ALA A 1 29  ? -20.233 92.217  83.085  1.00 0.00 ?  20  ALA A HA   6  
ATOM 8516  H HB1  . ALA A 1 29  ? -18.287 94.250  81.725  1.00 0.00 ?  20  ALA A HB1  6  
ATOM 8517  H HB2  . ALA A 1 29  ? -18.608 92.557  81.197  1.00 0.00 ?  20  ALA A HB2  6  
ATOM 8518  H HB3  . ALA A 1 29  ? -19.774 93.844  80.988  1.00 0.00 ?  20  ALA A HB3  6  
ATOM 8519  N N    . LEU A 1 30  ? -17.316 93.466  84.108  1.00 0.00 ?  21  LEU A N    6  
ATOM 8520  C CA   . LEU A 1 30  ? -16.134 93.229  84.953  1.00 0.00 ?  21  LEU A CA   6  
ATOM 8521  C C    . LEU A 1 30  ? -16.421 92.573  86.316  1.00 0.00 ?  21  LEU A C    6  
ATOM 8522  O O    . LEU A 1 30  ? -15.661 91.673  86.722  1.00 0.00 ?  21  LEU A O    6  
ATOM 8523  C CB   . LEU A 1 30  ? -15.385 94.612  85.033  1.00 0.00 ?  21  LEU A CB   6  
ATOM 8524  C CG   . LEU A 1 30  ? -14.101 94.676  85.857  1.00 0.00 ?  21  LEU A CG   6  
ATOM 8525  C CD1  . LEU A 1 30  ? -13.166 95.870  85.423  1.00 0.00 ?  21  LEU A CD1  6  
ATOM 8526  C CD2  . LEU A 1 30  ? -14.392 94.742  87.362  1.00 0.00 ?  21  LEU A CD2  6  
ATOM 8527  H H    . LEU A 1 30  ? -17.415 94.403  83.745  1.00 0.00 ?  21  LEU A H    6  
ATOM 8528  H HA   . LEU A 1 30  ? -15.441 92.560  84.442  1.00 0.00 ?  21  LEU A HA   6  
ATOM 8529  H HB2  . LEU A 1 30  ? -15.138 94.891  84.009  1.00 0.00 ?  21  LEU A HB2  6  
ATOM 8530  H HB3  . LEU A 1 30  ? -16.049 95.352  85.479  1.00 0.00 ?  21  LEU A HB3  6  
ATOM 8531  H HG   . LEU A 1 30  ? -13.472 93.800  85.701  1.00 0.00 ?  21  LEU A HG   6  
ATOM 8532  H HD11 . LEU A 1 30  ? -12.912 95.763  84.368  1.00 0.00 ?  21  LEU A HD11 6  
ATOM 8533  H HD12 . LEU A 1 30  ? -13.750 96.763  85.643  1.00 0.00 ?  21  LEU A HD12 6  
ATOM 8534  H HD13 . LEU A 1 30  ? -12.269 95.812  86.038  1.00 0.00 ?  21  LEU A HD13 6  
ATOM 8535  H HD21 . LEU A 1 30  ? -14.871 93.864  87.795  1.00 0.00 ?  21  LEU A HD21 6  
ATOM 8536  H HD22 . LEU A 1 30  ? -13.501 95.000  87.933  1.00 0.00 ?  21  LEU A HD22 6  
ATOM 8537  H HD23 . LEU A 1 30  ? -15.006 95.632  87.502  1.00 0.00 ?  21  LEU A HD23 6  
ATOM 8538  N N    . ASN A 1 31  ? -17.465 92.903  87.035  1.00 0.00 ?  22  ASN A N    6  
ATOM 8539  C CA   . ASN A 1 31  ? -17.947 92.293  88.291  1.00 0.00 ?  22  ASN A CA   6  
ATOM 8540  C C    . ASN A 1 31  ? -18.578 90.853  87.986  1.00 0.00 ?  22  ASN A C    6  
ATOM 8541  O O    . ASN A 1 31  ? -18.706 90.035  88.878  1.00 0.00 ?  22  ASN A O    6  
ATOM 8542  C CB   . ASN A 1 31  ? -18.782 93.269  89.046  1.00 0.00 ?  22  ASN A CB   6  
ATOM 8543  C CG   . ASN A 1 31  ? -18.036 94.271  89.932  1.00 0.00 ?  22  ASN A CG   6  
ATOM 8544  O OD1  . ASN A 1 31  ? -17.835 94.004  91.107  1.00 0.00 ?  22  ASN A OD1  6  
ATOM 8545  N ND2  . ASN A 1 31  ? -17.612 95.375  89.366  1.00 0.00 ?  22  ASN A ND2  6  
ATOM 8546  H H    . ASN A 1 31  ? -18.076 93.559  86.567  1.00 0.00 ?  22  ASN A H    6  
ATOM 8547  H HA   . ASN A 1 31  ? -17.079 92.031  88.895  1.00 0.00 ?  22  ASN A HA   6  
ATOM 8548  H HB2  . ASN A 1 31  ? -19.297 93.807  88.249  1.00 0.00 ?  22  ASN A HB2  6  
ATOM 8549  H HB3  . ASN A 1 31  ? -19.514 92.709  89.628  1.00 0.00 ?  22  ASN A HB3  6  
ATOM 8550  H HD21 . ASN A 1 31  ? -17.797 95.539  88.386  1.00 0.00 ?  22  ASN A HD21 6  
ATOM 8551  H HD22 . ASN A 1 31  ? -17.021 96.039  89.846  1.00 0.00 ?  22  ASN A HD22 6  
ATOM 8552  N N    . ALA A 1 32  ? -19.041 90.605  86.782  1.00 0.00 ?  23  ALA A N    6  
ATOM 8553  C CA   . ALA A 1 32  ? -19.647 89.324  86.405  1.00 0.00 ?  23  ALA A CA   6  
ATOM 8554  C C    . ALA A 1 32  ? -18.529 88.290  86.245  1.00 0.00 ?  23  ALA A C    6  
ATOM 8555  O O    . ALA A 1 32  ? -18.549 87.250  86.898  1.00 0.00 ?  23  ALA A O    6  
ATOM 8556  C CB   . ALA A 1 32  ? -20.581 89.583  85.211  1.00 0.00 ?  23  ALA A CB   6  
ATOM 8557  H H    . ALA A 1 32  ? -18.934 91.331  86.088  1.00 0.00 ?  23  ALA A H    6  
ATOM 8558  H HA   . ALA A 1 32  ? -20.239 88.883  87.208  1.00 0.00 ?  23  ALA A HA   6  
ATOM 8559  H HB1  . ALA A 1 32  ? -21.024 88.653  84.852  1.00 0.00 ?  23  ALA A HB1  6  
ATOM 8560  H HB2  . ALA A 1 32  ? -21.338 90.312  85.502  1.00 0.00 ?  23  ALA A HB2  6  
ATOM 8561  H HB3  . ALA A 1 32  ? -20.116 89.786  84.247  1.00 0.00 ?  23  ALA A HB3  6  
ATOM 8562  N N    . THR A 1 33  ? -17.492 88.574  85.436  1.00 0.00 ?  24  THR A N    6  
ATOM 8563  C CA   . THR A 1 33  ? -16.184 87.910  85.398  1.00 0.00 ?  24  THR A CA   6  
ATOM 8564  C C    . THR A 1 33  ? -15.534 87.729  86.770  1.00 0.00 ?  24  THR A C    6  
ATOM 8565  O O    . THR A 1 33  ? -15.088 86.674  87.079  1.00 0.00 ?  24  THR A O    6  
ATOM 8566  C CB   . THR A 1 33  ? -15.219 88.606  84.413  1.00 0.00 ?  24  THR A CB   6  
ATOM 8567  O OG1  . THR A 1 33  ? -16.006 89.190  83.373  1.00 0.00 ?  24  THR A OG1  6  
ATOM 8568  C CG2  . THR A 1 33  ? -14.210 87.722  83.733  1.00 0.00 ?  24  THR A CG2  6  
ATOM 8569  H H    . THR A 1 33  ? -17.550 89.465  84.965  1.00 0.00 ?  24  THR A H    6  
ATOM 8570  H HA   . THR A 1 33  ? -16.360 86.927  84.962  1.00 0.00 ?  24  THR A HA   6  
ATOM 8571  H HB   . THR A 1 33  ? -14.683 89.344  85.010  1.00 0.00 ?  24  THR A HB   6  
ATOM 8572  H HG1  . THR A 1 33  ? -15.488 89.954  83.111  1.00 0.00 ?  24  THR A HG1  6  
ATOM 8573  H HG21 . THR A 1 33  ? -14.707 86.817  83.386  1.00 0.00 ?  24  THR A HG21 6  
ATOM 8574  H HG22 . THR A 1 33  ? -13.615 88.243  82.982  1.00 0.00 ?  24  THR A HG22 6  
ATOM 8575  H HG23 . THR A 1 33  ? -13.529 87.286  84.464  1.00 0.00 ?  24  THR A HG23 6  
ATOM 8576  N N    . LEU A 1 34  ? -15.534 88.705  87.688  1.00 0.00 ?  25  LEU A N    6  
ATOM 8577  C CA   . LEU A 1 34  ? -15.158 88.567  89.096  1.00 0.00 ?  25  LEU A CA   6  
ATOM 8578  C C    . LEU A 1 34  ? -15.913 87.490  89.841  1.00 0.00 ?  25  LEU A C    6  
ATOM 8579  O O    . LEU A 1 34  ? -15.367 86.590  90.374  1.00 0.00 ?  25  LEU A O    6  
ATOM 8580  C CB   . LEU A 1 34  ? -15.253 89.970  89.757  1.00 0.00 ?  25  LEU A CB   6  
ATOM 8581  C CG   . LEU A 1 34  ? -14.715 90.297  91.112  1.00 0.00 ?  25  LEU A CG   6  
ATOM 8582  C CD1  . LEU A 1 34  ? -13.178 90.534  91.058  1.00 0.00 ?  25  LEU A CD1  6  
ATOM 8583  C CD2  . LEU A 1 34  ? -15.396 91.572  91.633  1.00 0.00 ?  25  LEU A CD2  6  
ATOM 8584  H H    . LEU A 1 34  ? -15.945 89.589  87.421  1.00 0.00 ?  25  LEU A H    6  
ATOM 8585  H HA   . LEU A 1 34  ? -14.160 88.133  89.171  1.00 0.00 ?  25  LEU A HA   6  
ATOM 8586  H HB2  . LEU A 1 34  ? -14.769 90.660  89.067  1.00 0.00 ?  25  LEU A HB2  6  
ATOM 8587  H HB3  . LEU A 1 34  ? -16.323 90.178  89.745  1.00 0.00 ?  25  LEU A HB3  6  
ATOM 8588  H HG   . LEU A 1 34  ? -14.774 89.412  91.746  1.00 0.00 ?  25  LEU A HG   6  
ATOM 8589  H HD11 . LEU A 1 34  ? -12.746 90.842  92.010  1.00 0.00 ?  25  LEU A HD11 6  
ATOM 8590  H HD12 . LEU A 1 34  ? -12.731 89.680  90.550  1.00 0.00 ?  25  LEU A HD12 6  
ATOM 8591  H HD13 . LEU A 1 34  ? -12.961 91.410  90.448  1.00 0.00 ?  25  LEU A HD13 6  
ATOM 8592  H HD21 . LEU A 1 34  ? -16.408 91.353  91.973  1.00 0.00 ?  25  LEU A HD21 6  
ATOM 8593  H HD22 . LEU A 1 34  ? -14.795 91.919  92.474  1.00 0.00 ?  25  LEU A HD22 6  
ATOM 8594  H HD23 . LEU A 1 34  ? -15.453 92.419  90.950  1.00 0.00 ?  25  LEU A HD23 6  
ATOM 8595  N N    . HIS A 1 35  ? -17.224 87.650  89.921  1.00 0.00 ?  26  HIS A N    6  
ATOM 8596  C CA   . HIS A 1 35  ? -18.066 86.721  90.666  1.00 0.00 ?  26  HIS A CA   6  
ATOM 8597  C C    . HIS A 1 35  ? -18.008 85.335  90.092  1.00 0.00 ?  26  HIS A C    6  
ATOM 8598  O O    . HIS A 1 35  ? -17.811 84.384  90.849  1.00 0.00 ?  26  HIS A O    6  
ATOM 8599  C CB   . HIS A 1 35  ? -19.504 87.235  90.715  1.00 0.00 ?  26  HIS A CB   6  
ATOM 8600  C CG   . HIS A 1 35  ? -20.347 86.196  91.452  1.00 0.00 ?  26  HIS A CG   6  
ATOM 8601  N ND1  . HIS A 1 35  ? -20.330 85.988  92.852  1.00 0.00 ?  26  HIS A ND1  6  
ATOM 8602  C CD2  . HIS A 1 35  ? -21.354 85.476  90.945  1.00 0.00 ?  26  HIS A CD2  6  
ATOM 8603  C CE1  . HIS A 1 35  ? -21.321 85.140  93.129  1.00 0.00 ?  26  HIS A CE1  6  
ATOM 8604  N NE2  . HIS A 1 35  ? -22.037 84.903  91.989  1.00 0.00 ?  26  HIS A NE2  6  
ATOM 8605  H H    . HIS A 1 35  ? -17.541 88.510  89.495  1.00 0.00 ?  26  HIS A H    6  
ATOM 8606  H HA   . HIS A 1 35  ? -17.668 86.627  91.675  1.00 0.00 ?  26  HIS A HA   6  
ATOM 8607  H HB2  . HIS A 1 35  ? -19.468 88.182  91.254  1.00 0.00 ?  26  HIS A HB2  6  
ATOM 8608  H HB3  . HIS A 1 35  ? -19.923 87.460  89.734  1.00 0.00 ?  26  HIS A HB3  6  
ATOM 8609  H HD2  . HIS A 1 35  ? -21.634 85.479  89.902  1.00 0.00 ?  26  HIS A HD2  6  
ATOM 8610  H HE1  . HIS A 1 35  ? -21.620 84.794  94.107  1.00 0.00 ?  26  HIS A HE1  6  
ATOM 8611  H HE2  . HIS A 1 35  ? -22.763 84.218  91.833  1.00 0.00 ?  26  HIS A HE2  6  
ATOM 8612  N N    . SER A 1 36  ? -17.885 85.216  88.754  1.00 0.00 ?  27  SER A N    6  
ATOM 8613  C CA   . SER A 1 36  ? -17.713 83.989  87.997  1.00 0.00 ?  27  SER A CA   6  
ATOM 8614  C C    . SER A 1 36  ? -16.489 83.112  88.436  1.00 0.00 ?  27  SER A C    6  
ATOM 8615  O O    . SER A 1 36  ? -16.472 81.907  88.204  1.00 0.00 ?  27  SER A O    6  
ATOM 8616  C CB   . SER A 1 36  ? -17.753 84.314  86.466  1.00 0.00 ?  27  SER A CB   6  
ATOM 8617  O OG   . SER A 1 36  ? -17.618 83.178  85.691  1.00 0.00 ?  27  SER A OG   6  
ATOM 8618  H H    . SER A 1 36  ? -18.054 86.033  88.185  1.00 0.00 ?  27  SER A H    6  
ATOM 8619  H HA   . SER A 1 36  ? -18.596 83.367  88.144  1.00 0.00 ?  27  SER A HA   6  
ATOM 8620  H HB2  . SER A 1 36  ? -18.730 84.754  86.265  1.00 0.00 ?  27  SER A HB2  6  
ATOM 8621  H HB3  . SER A 1 36  ? -16.969 85.008  86.160  1.00 0.00 ?  27  SER A HB3  6  
ATOM 8622  H HG   . SER A 1 36  ? -18.415 82.649  85.776  1.00 0.00 ?  27  SER A HG   6  
ATOM 8623  N N    . ASN A 1 37  ? -15.456 83.852  88.897  1.00 0.00 ?  28  ASN A N    6  
ATOM 8624  C CA   . ASN A 1 37  ? -14.199 83.300  89.456  1.00 0.00 ?  28  ASN A CA   6  
ATOM 8625  C C    . ASN A 1 37  ? -14.256 83.034  91.011  1.00 0.00 ?  28  ASN A C    6  
ATOM 8626  O O    . ASN A 1 37  ? -13.762 82.027  91.481  1.00 0.00 ?  28  ASN A O    6  
ATOM 8627  C CB   . ASN A 1 37  ? -13.052 84.170  88.897  1.00 0.00 ?  28  ASN A CB   6  
ATOM 8628  C CG   . ASN A 1 37  ? -12.695 83.720  87.480  1.00 0.00 ?  28  ASN A CG   6  
ATOM 8629  O OD1  . ASN A 1 37  ? -12.586 82.555  87.214  1.00 0.00 ?  28  ASN A OD1  6  
ATOM 8630  N ND2  . ASN A 1 37  ? -12.534 84.685  86.597  1.00 0.00 ?  28  ASN A ND2  6  
ATOM 8631  H H    . ASN A 1 37  ? -15.616 84.837  89.051  1.00 0.00 ?  28  ASN A H    6  
ATOM 8632  H HA   . ASN A 1 37  ? -14.126 82.282  89.076  1.00 0.00 ?  28  ASN A HA   6  
ATOM 8633  H HB2  . ASN A 1 37  ? -13.335 85.222  88.875  1.00 0.00 ?  28  ASN A HB2  6  
ATOM 8634  H HB3  . ASN A 1 37  ? -12.142 84.053  89.487  1.00 0.00 ?  28  ASN A HB3  6  
ATOM 8635  H HD21 . ASN A 1 37  ? -12.612 85.654  86.873  1.00 0.00 ?  28  ASN A HD21 6  
ATOM 8636  H HD22 . ASN A 1 37  ? -12.112 84.382  85.732  1.00 0.00 ?  28  ASN A HD22 6  
ATOM 8637  N N    . LEU A 1 38  ? -14.946 84.004  91.695  1.00 0.00 ?  29  LEU A N    6  
ATOM 8638  C CA   . LEU A 1 38  ? -15.196 83.817  93.100  1.00 0.00 ?  29  LEU A CA   6  
ATOM 8639  C C    . LEU A 1 38  ? -16.088 82.574  93.480  1.00 0.00 ?  29  LEU A C    6  
ATOM 8640  O O    . LEU A 1 38  ? -16.006 81.987  94.528  1.00 0.00 ?  29  LEU A O    6  
ATOM 8641  C CB   . LEU A 1 38  ? -15.803 85.117  93.704  1.00 0.00 ?  29  LEU A CB   6  
ATOM 8642  C CG   . LEU A 1 38  ? -14.813 86.366  93.801  1.00 0.00 ?  29  LEU A CG   6  
ATOM 8643  C CD1  . LEU A 1 38  ? -15.593 87.553  94.237  1.00 0.00 ?  29  LEU A CD1  6  
ATOM 8644  C CD2  . LEU A 1 38  ? -13.498 86.241  94.661  1.00 0.00 ?  29  LEU A CD2  6  
ATOM 8645  H H    . LEU A 1 38  ? -15.412 84.765  91.222  1.00 0.00 ?  29  LEU A H    6  
ATOM 8646  H HA   . LEU A 1 38  ? -14.249 83.713  93.629  1.00 0.00 ?  29  LEU A HA   6  
ATOM 8647  H HB2  . LEU A 1 38  ? -16.661 85.416  93.103  1.00 0.00 ?  29  LEU A HB2  6  
ATOM 8648  H HB3  . LEU A 1 38  ? -16.182 85.003  94.720  1.00 0.00 ?  29  LEU A HB3  6  
ATOM 8649  H HG   . LEU A 1 38  ? -14.475 86.507  92.774  1.00 0.00 ?  29  LEU A HG   6  
ATOM 8650  H HD11 . LEU A 1 38  ? -16.076 87.395  95.201  1.00 0.00 ?  29  LEU A HD11 6  
ATOM 8651  H HD12 . LEU A 1 38  ? -14.919 88.396  94.388  1.00 0.00 ?  29  LEU A HD12 6  
ATOM 8652  H HD13 . LEU A 1 38  ? -16.399 87.812  93.552  1.00 0.00 ?  29  LEU A HD13 6  
ATOM 8653  H HD21 . LEU A 1 38  ? -12.901 87.136  94.829  1.00 0.00 ?  29  LEU A HD21 6  
ATOM 8654  H HD22 . LEU A 1 38  ? -13.868 85.836  95.603  1.00 0.00 ?  29  LEU A HD22 6  
ATOM 8655  H HD23 . LEU A 1 38  ? -12.799 85.561  94.173  1.00 0.00 ?  29  LEU A HD23 6  
ATOM 8656  N N    . LEU A 1 39  ? -16.933 82.094  92.559  1.00 0.00 ?  30  LEU A N    6  
ATOM 8657  C CA   . LEU A 1 39  ? -17.521 80.694  92.616  1.00 0.00 ?  30  LEU A CA   6  
ATOM 8658  C C    . LEU A 1 39  ? -16.557 79.585  92.589  1.00 0.00 ?  30  LEU A C    6  
ATOM 8659  O O    . LEU A 1 39  ? -16.810 78.413  92.887  1.00 0.00 ?  30  LEU A O    6  
ATOM 8660  C CB   . LEU A 1 39  ? -18.560 80.610  91.427  1.00 0.00 ?  30  LEU A CB   6  
ATOM 8661  C CG   . LEU A 1 39  ? -19.751 81.538  91.531  1.00 0.00 ?  30  LEU A CG   6  
ATOM 8662  C CD1  . LEU A 1 39  ? -20.668 81.347  90.292  1.00 0.00 ?  30  LEU A CD1  6  
ATOM 8663  C CD2  . LEU A 1 39  ? -20.505 81.184  92.837  1.00 0.00 ?  30  LEU A CD2  6  
ATOM 8664  H H    . LEU A 1 39  ? -17.108 82.685  91.759  1.00 0.00 ?  30  LEU A H    6  
ATOM 8665  H HA   . LEU A 1 39  ? -18.144 80.549  93.499  1.00 0.00 ?  30  LEU A HA   6  
ATOM 8666  H HB2  . LEU A 1 39  ? -18.007 80.793  90.505  1.00 0.00 ?  30  LEU A HB2  6  
ATOM 8667  H HB3  . LEU A 1 39  ? -18.925 79.584  91.416  1.00 0.00 ?  30  LEU A HB3  6  
ATOM 8668  H HG   . LEU A 1 39  ? -19.433 82.574  91.637  1.00 0.00 ?  30  LEU A HG   6  
ATOM 8669  H HD11 . LEU A 1 39  ? -20.114 81.631  89.397  1.00 0.00 ?  30  LEU A HD11 6  
ATOM 8670  H HD12 . LEU A 1 39  ? -21.052 80.328  90.237  1.00 0.00 ?  30  LEU A HD12 6  
ATOM 8671  H HD13 . LEU A 1 39  ? -21.491 82.039  90.461  1.00 0.00 ?  30  LEU A HD13 6  
ATOM 8672  H HD21 . LEU A 1 39  ? -20.827 80.143  92.844  1.00 0.00 ?  30  LEU A HD21 6  
ATOM 8673  H HD22 . LEU A 1 39  ? -19.996 81.566  93.722  1.00 0.00 ?  30  LEU A HD22 6  
ATOM 8674  H HD23 . LEU A 1 39  ? -21.347 81.875  92.884  1.00 0.00 ?  30  LEU A HD23 6  
ATOM 8675  N N    . CYS A 1 40  ? -15.332 79.837  92.085  1.00 0.00 ?  31  CYS A N    6  
ATOM 8676  C CA   . CYS A 1 40  ? -14.418 78.828  91.782  1.00 0.00 ?  31  CYS A CA   6  
ATOM 8677  C C    . CYS A 1 40  ? -13.722 78.337  93.061  1.00 0.00 ?  31  CYS A C    6  
ATOM 8678  O O    . CYS A 1 40  ? -13.466 79.059  93.981  1.00 0.00 ?  31  CYS A O    6  
ATOM 8679  C CB   . CYS A 1 40  ? -13.322 79.175  90.753  1.00 0.00 ?  31  CYS A CB   6  
ATOM 8680  S SG   . CYS A 1 40  ? -13.944 79.415  89.033  1.00 0.00 ?  31  CYS A SG   6  
ATOM 8681  H H    . CYS A 1 40  ? -15.097 80.711  91.636  1.00 0.00 ?  31  CYS A H    6  
ATOM 8682  H HA   . CYS A 1 40  ? -14.880 77.942  91.347  1.00 0.00 ?  31  CYS A HA   6  
ATOM 8683  H HB2  . CYS A 1 40  ? -12.743 80.050  91.046  1.00 0.00 ?  31  CYS A HB2  6  
ATOM 8684  H HB3  . CYS A 1 40  ? -12.615 78.347  90.822  1.00 0.00 ?  31  CYS A HB3  6  
ATOM 8685  H HG   . CYS A 1 40  ? -12.783 79.637  88.408  1.00 0.00 ?  31  CYS A HG   6  
ATOM 8686  N N    . ARG A 1 41  ? -13.345 77.021  93.091  1.00 0.00 ?  32  ARG A N    6  
ATOM 8687  C CA   . ARG A 1 41  ? -12.409 76.626  94.264  1.00 0.00 ?  32  ARG A CA   6  
ATOM 8688  C C    . ARG A 1 41  ? -11.018 77.201  94.223  1.00 0.00 ?  32  ARG A C    6  
ATOM 8689  O O    . ARG A 1 41  ? -10.492 77.309  93.152  1.00 0.00 ?  32  ARG A O    6  
ATOM 8690  C CB   . ARG A 1 41  ? -12.289 75.161  94.418  1.00 0.00 ?  32  ARG A CB   6  
ATOM 8691  C CG   . ARG A 1 41  ? -11.664 74.358  93.264  1.00 0.00 ?  32  ARG A CG   6  
ATOM 8692  C CD   . ARG A 1 41  ? -11.749 72.820  93.452  1.00 0.00 ?  32  ARG A CD   6  
ATOM 8693  N NE   . ARG A 1 41  ? -10.883 72.011  92.526  1.00 0.00 ?  32  ARG A NE   6  
ATOM 8694  C CZ   . ARG A 1 41  ? -11.040 72.013  91.182  1.00 0.00 ?  32  ARG A CZ   6  
ATOM 8695  N NH1  . ARG A 1 41  ? -12.100 72.271  90.492  1.00 0.00 ?  32  ARG A NH1  6  
ATOM 8696  N NH2  . ARG A 1 41  ? -10.067 71.553  90.424  1.00 0.00 1  32  ARG A NH2  6  
ATOM 8697  H H    . ARG A 1 41  ? -13.516 76.400  92.313  1.00 0.00 ?  32  ARG A H    6  
ATOM 8698  H HA   . ARG A 1 41  ? -12.832 76.988  95.201  1.00 0.00 ?  32  ARG A HA   6  
ATOM 8699  H HB2  . ARG A 1 41  ? -11.736 74.939  95.330  1.00 0.00 ?  32  ARG A HB2  6  
ATOM 8700  H HB3  . ARG A 1 41  ? -13.317 74.831  94.567  1.00 0.00 ?  32  ARG A HB3  6  
ATOM 8701  H HG2  . ARG A 1 41  ? -12.122 74.704  92.338  1.00 0.00 ?  32  ARG A HG2  6  
ATOM 8702  H HG3  . ARG A 1 41  ? -10.587 74.506  93.175  1.00 0.00 ?  32  ARG A HG3  6  
ATOM 8703  H HD2  . ARG A 1 41  ? -11.479 72.567  94.477  1.00 0.00 ?  32  ARG A HD2  6  
ATOM 8704  H HD3  . ARG A 1 41  ? -12.802 72.565  93.335  1.00 0.00 ?  32  ARG A HD3  6  
ATOM 8705  H HE   . ARG A 1 41  ? -10.067 71.556  92.909  1.00 0.00 ?  32  ARG A HE   6  
ATOM 8706  H HH11 . ARG A 1 41  ? -13.049 72.377  90.822  1.00 0.00 ?  32  ARG A HH11 6  
ATOM 8707  H HH12 . ARG A 1 41  ? -12.077 72.267  89.483  1.00 0.00 ?  32  ARG A HH12 6  
ATOM 8708  H HH21 . ARG A 1 41  ? -9.248  71.084  90.784  1.00 0.00 ?  32  ARG A HH21 6  
ATOM 8709  H HH22 . ARG A 1 41  ? -10.327 71.492  89.450  1.00 0.00 ?  32  ARG A HH22 6  
ATOM 8710  N N    . PRO A 1 42  ? -10.323 77.534  95.329  1.00 0.00 ?  33  PRO A N    6  
ATOM 8711  C CA   . PRO A 1 42  ? -8.880  77.892  95.357  1.00 0.00 ?  33  PRO A CA   6  
ATOM 8712  C C    . PRO A 1 42  ? -8.008  76.674  94.961  1.00 0.00 ?  33  PRO A C    6  
ATOM 8713  O O    . PRO A 1 42  ? -8.454  75.522  95.060  1.00 0.00 ?  33  PRO A O    6  
ATOM 8714  C CB   . PRO A 1 42  ? -8.696  78.407  96.800  1.00 0.00 ?  33  PRO A CB   6  
ATOM 8715  C CG   . PRO A 1 42  ? -9.767  77.764  97.655  1.00 0.00 ?  33  PRO A CG   6  
ATOM 8716  C CD   . PRO A 1 42  ? -10.898 77.835  96.610  1.00 0.00 ?  33  PRO A CD   6  
ATOM 8717  H HA   . PRO A 1 42  ? -8.579  78.619  94.603  1.00 0.00 ?  33  PRO A HA   6  
ATOM 8718  H HB2  . PRO A 1 42  ? -7.724  78.237  97.263  1.00 0.00 ?  33  PRO A HB2  6  
ATOM 8719  H HB3  . PRO A 1 42  ? -8.937  79.470  96.780  1.00 0.00 ?  33  PRO A HB3  6  
ATOM 8720  H HG2  . PRO A 1 42  ? -9.534  76.726  97.892  1.00 0.00 ?  33  PRO A HG2  6  
ATOM 8721  H HG3  . PRO A 1 42  ? -10.099 78.338  98.520  1.00 0.00 ?  33  PRO A HG3  6  
ATOM 8722  H HD2  . PRO A 1 42  ? -11.645 77.062  96.792  1.00 0.00 ?  33  PRO A HD2  6  
ATOM 8723  H HD3  . PRO A 1 42  ? -11.252 78.863  96.542  1.00 0.00 ?  33  PRO A HD3  6  
ATOM 8724  N N    . GLY A 1 43  ? -6.806  76.916  94.402  1.00 0.00 ?  34  GLY A N    6  
ATOM 8725  C CA   . GLY A 1 43  ? -5.878  75.882  93.868  1.00 0.00 ?  34  GLY A CA   6  
ATOM 8726  C C    . GLY A 1 43  ? -4.896  75.264  94.892  1.00 0.00 ?  34  GLY A C    6  
ATOM 8727  O O    . GLY A 1 43  ? -4.922  75.537  96.092  1.00 0.00 ?  34  GLY A O    6  
ATOM 8728  H H    . GLY A 1 43  ? -6.455  77.862  94.448  1.00 0.00 ?  34  GLY A H    6  
ATOM 8729  H HA2  . GLY A 1 43  ? -6.481  75.153  93.325  1.00 0.00 ?  34  GLY A HA2  6  
ATOM 8730  H HA3  . GLY A 1 43  ? -5.206  76.346  93.146  1.00 0.00 ?  34  GLY A HA3  6  
ATOM 8731  N N    . PRO A 1 44  ? -3.980  74.425  94.461  1.00 0.00 ?  35  PRO A N    6  
ATOM 8732  C CA   . PRO A 1 44  ? -2.873  73.889  95.349  1.00 0.00 ?  35  PRO A CA   6  
ATOM 8733  C C    . PRO A 1 44  ? -1.855  74.948  95.780  1.00 0.00 ?  35  PRO A C    6  
ATOM 8734  O O    . PRO A 1 44  ? -1.678  76.034  95.174  1.00 0.00 ?  35  PRO A O    6  
ATOM 8735  C CB   . PRO A 1 44  ? -2.296  72.756  94.404  1.00 0.00 ?  35  PRO A CB   6  
ATOM 8736  C CG   . PRO A 1 44  ? -2.553  73.412  93.016  1.00 0.00 ?  35  PRO A CG   6  
ATOM 8737  C CD   . PRO A 1 44  ? -3.944  73.872  93.057  1.00 0.00 ?  35  PRO A CD   6  
ATOM 8738  H HA   . PRO A 1 44  ? -3.135  73.335  96.250  1.00 0.00 ?  35  PRO A HA   6  
ATOM 8739  H HB2  . PRO A 1 44  ? -1.217  72.627  94.484  1.00 0.00 ?  35  PRO A HB2  6  
ATOM 8740  H HB3  . PRO A 1 44  ? -2.930  71.897  94.620  1.00 0.00 ?  35  PRO A HB3  6  
ATOM 8741  H HG2  . PRO A 1 44  ? -1.742  74.099  92.773  1.00 0.00 ?  35  PRO A HG2  6  
ATOM 8742  H HG3  . PRO A 1 44  ? -2.494  72.622  92.266  1.00 0.00 ?  35  PRO A HG3  6  
ATOM 8743  H HD2  . PRO A 1 44  ? -3.917  74.634  92.279  1.00 0.00 ?  35  PRO A HD2  6  
ATOM 8744  H HD3  . PRO A 1 44  ? -4.755  73.154  92.927  1.00 0.00 ?  35  PRO A HD3  6  
ATOM 8745  N N    . GLY A 1 45  ? -1.056  74.572  96.828  1.00 0.00 ?  36  GLY A N    6  
ATOM 8746  C CA   . GLY A 1 45  ? -0.218  75.477  97.520  1.00 0.00 ?  36  GLY A CA   6  
ATOM 8747  C C    . GLY A 1 45  ? 1.223   75.506  97.033  1.00 0.00 ?  36  GLY A C    6  
ATOM 8748  O O    . GLY A 1 45  ? 1.622   74.607  96.303  1.00 0.00 ?  36  GLY A O    6  
ATOM 8749  H H    . GLY A 1 45  ? -1.169  73.646  97.216  1.00 0.00 ?  36  GLY A H    6  
ATOM 8750  H HA2  . GLY A 1 45  ? -0.620  76.488  97.482  1.00 0.00 ?  36  GLY A HA2  6  
ATOM 8751  H HA3  . GLY A 1 45  ? -0.099  75.189  98.565  1.00 0.00 ?  36  GLY A HA3  6  
ATOM 8752  N N    . LEU A 1 46  ? 2.057   76.494  97.519  1.00 0.00 ?  37  LEU A N    6  
ATOM 8753  C CA   . LEU A 1 46  ? 3.535   76.392  97.496  1.00 0.00 ?  37  LEU A CA   6  
ATOM 8754  C C    . LEU A 1 46  ? 4.070   75.141  98.205  1.00 0.00 ?  37  LEU A C    6  
ATOM 8755  O O    . LEU A 1 46  ? 3.279   74.402  98.801  1.00 0.00 ?  37  LEU A O    6  
ATOM 8756  C CB   . LEU A 1 46  ? 4.033   77.524  98.316  1.00 0.00 ?  37  LEU A CB   6  
ATOM 8757  C CG   . LEU A 1 46  ? 3.703   78.909  97.833  1.00 0.00 ?  37  LEU A CG   6  
ATOM 8758  C CD1  . LEU A 1 46  ? 3.933   80.021  98.913  1.00 0.00 ?  37  LEU A CD1  6  
ATOM 8759  C CD2  . LEU A 1 46  ? 4.618   79.337  96.671  1.00 0.00 ?  37  LEU A CD2  6  
ATOM 8760  H H    . LEU A 1 46  ? 1.695   77.231  98.107  1.00 0.00 ?  37  LEU A H    6  
ATOM 8761  H HA   . LEU A 1 46  ? 3.964   76.431  96.496  1.00 0.00 ?  37  LEU A HA   6  
ATOM 8762  H HB2  . LEU A 1 46  ? 3.659   77.445  99.336  1.00 0.00 ?  37  LEU A HB2  6  
ATOM 8763  H HB3  . LEU A 1 46  ? 5.119   77.593  98.369  1.00 0.00 ?  37  LEU A HB3  6  
ATOM 8764  H HG   . LEU A 1 46  ? 2.636   78.905  97.614  1.00 0.00 ?  37  LEU A HG   6  
ATOM 8765  H HD11 . LEU A 1 46  ? 3.293   79.834  99.776  1.00 0.00 ?  37  LEU A HD11 6  
ATOM 8766  H HD12 . LEU A 1 46  ? 4.989   79.960  99.178  1.00 0.00 ?  37  LEU A HD12 6  
ATOM 8767  H HD13 . LEU A 1 46  ? 3.578   81.009  98.624  1.00 0.00 ?  37  LEU A HD13 6  
ATOM 8768  H HD21 . LEU A 1 46  ? 4.462   80.334  96.258  1.00 0.00 ?  37  LEU A HD21 6  
ATOM 8769  H HD22 . LEU A 1 46  ? 5.629   79.346  97.081  1.00 0.00 ?  37  LEU A HD22 6  
ATOM 8770  H HD23 . LEU A 1 46  ? 4.529   78.649  95.830  1.00 0.00 ?  37  LEU A HD23 6  
ATOM 8771  N N    . GLY A 1 47  ? 5.378   74.918  98.103  1.00 0.00 ?  38  GLY A N    6  
ATOM 8772  C CA   . GLY A 1 47  ? 6.073   73.950  98.966  1.00 0.00 ?  38  GLY A CA   6  
ATOM 8773  C C    . GLY A 1 47  ? 7.204   73.216  98.326  1.00 0.00 ?  38  GLY A C    6  
ATOM 8774  O O    . GLY A 1 47  ? 7.407   73.272  97.150  1.00 0.00 ?  38  GLY A O    6  
ATOM 8775  H H    . GLY A 1 47  ? 5.869   75.390  97.357  1.00 0.00 ?  38  GLY A H    6  
ATOM 8776  H HA2  . GLY A 1 47  ? 6.347   74.526  99.849  1.00 0.00 ?  38  GLY A HA2  6  
ATOM 8777  H HA3  . GLY A 1 47  ? 5.299   73.225  99.218  1.00 0.00 ?  38  GLY A HA3  6  
ATOM 8778  N N    . PRO A 1 48  ? 7.881   72.435  99.088  1.00 0.00 ?  39  PRO A N    6  
ATOM 8779  C CA   . PRO A 1 48  ? 9.110   71.649  98.621  1.00 0.00 ?  39  PRO A CA   6  
ATOM 8780  C C    . PRO A 1 48  ? 8.819   70.687  97.456  1.00 0.00 ?  39  PRO A C    6  
ATOM 8781  O O    . PRO A 1 48  ? 9.766   70.340  96.811  1.00 0.00 ?  39  PRO A O    6  
ATOM 8782  C CB   . PRO A 1 48  ? 9.674   70.983  99.895  1.00 0.00 ?  39  PRO A CB   6  
ATOM 8783  C CG   . PRO A 1 48  ? 9.145   71.788  101.094 1.00 0.00 ?  39  PRO A CG   6  
ATOM 8784  C CD   . PRO A 1 48  ? 7.929   72.606  100.530 1.00 0.00 ?  39  PRO A CD   6  
ATOM 8785  H HA   . PRO A 1 48  ? 9.920   72.291  98.271  1.00 0.00 ?  39  PRO A HA   6  
ATOM 8786  H HB2  . PRO A 1 48  ? 9.354   69.941  99.850  1.00 0.00 ?  39  PRO A HB2  6  
ATOM 8787  H HB3  . PRO A 1 48  ? 10.761  70.994  99.827  1.00 0.00 ?  39  PRO A HB3  6  
ATOM 8788  H HG2  . PRO A 1 48  ? 8.765   71.257  101.967 1.00 0.00 ?  39  PRO A HG2  6  
ATOM 8789  H HG3  . PRO A 1 48  ? 9.906   72.493  101.429 1.00 0.00 ?  39  PRO A HG3  6  
ATOM 8790  H HD2  . PRO A 1 48  ? 7.057   72.127  100.975 1.00 0.00 ?  39  PRO A HD2  6  
ATOM 8791  H HD3  . PRO A 1 48  ? 8.092   73.639  100.835 1.00 0.00 ?  39  PRO A HD3  6  
ATOM 8792  N N    . ASP A 1 49  ? 7.554   70.250  97.087  1.00 0.00 ?  40  ASP A N    6  
ATOM 8793  C CA   . ASP A 1 49  ? 7.138   69.231  96.037  1.00 0.00 ?  40  ASP A CA   6  
ATOM 8794  C C    . ASP A 1 49  ? 7.175   69.848  94.652  1.00 0.00 ?  40  ASP A C    6  
ATOM 8795  O O    . ASP A 1 49  ? 7.128   69.151  93.647  1.00 0.00 ?  40  ASP A O    6  
ATOM 8796  C CB   . ASP A 1 49  ? 5.712   68.605  96.392  1.00 0.00 ?  40  ASP A CB   6  
ATOM 8797  C CG   . ASP A 1 49  ? 5.631   67.593  97.515  1.00 0.00 ?  40  ASP A CG   6  
ATOM 8798  O OD1  . ASP A 1 49  ? 6.716   67.158  97.997  1.00 0.00 -1 40  ASP A OD1  6  
ATOM 8799  O OD2  . ASP A 1 49  ? 4.531   67.354  98.009  1.00 0.00 ?  40  ASP A OD2  6  
ATOM 8800  H H    . ASP A 1 49  ? 6.820   70.666  97.643  1.00 0.00 ?  40  ASP A H    6  
ATOM 8801  H HA   . ASP A 1 49  ? 7.886   68.439  95.996  1.00 0.00 ?  40  ASP A HA   6  
ATOM 8802  H HB2  . ASP A 1 49  ? 5.062   69.443  96.644  1.00 0.00 ?  40  ASP A HB2  6  
ATOM 8803  H HB3  . ASP A 1 49  ? 5.207   68.166  95.531  1.00 0.00 ?  40  ASP A HB3  6  
ATOM 8804  N N    . ASN A 1 50  ? 7.214   71.189  94.666  1.00 0.00 ?  41  ASN A N    6  
ATOM 8805  C CA   . ASN A 1 50  ? 7.187   71.934  93.417  1.00 0.00 ?  41  ASN A CA   6  
ATOM 8806  C C    . ASN A 1 50  ? 8.549   72.117  92.709  1.00 0.00 ?  41  ASN A C    6  
ATOM 8807  O O    . ASN A 1 50  ? 8.617   72.516  91.556  1.00 0.00 ?  41  ASN A O    6  
ATOM 8808  C CB   . ASN A 1 50  ? 6.515   73.257  93.693  1.00 0.00 ?  41  ASN A CB   6  
ATOM 8809  C CG   . ASN A 1 50  ? 4.994   73.192  94.004  1.00 0.00 ?  41  ASN A CG   6  
ATOM 8810  O OD1  . ASN A 1 50  ? 4.295   72.295  93.584  1.00 0.00 ?  41  ASN A OD1  6  
ATOM 8811  N ND2  . ASN A 1 50  ? 4.495   74.294  94.549  1.00 0.00 ?  41  ASN A ND2  6  
ATOM 8812  H H    . ASN A 1 50  ? 7.290   71.700  95.533  1.00 0.00 ?  41  ASN A H    6  
ATOM 8813  H HA   . ASN A 1 50  ? 6.525   71.454  92.696  1.00 0.00 ?  41  ASN A HA   6  
ATOM 8814  H HB2  . ASN A 1 50  ? 7.061   73.788  94.472  1.00 0.00 ?  41  ASN A HB2  6  
ATOM 8815  H HB3  . ASN A 1 50  ? 6.618   73.789  92.747  1.00 0.00 ?  41  ASN A HB3  6  
ATOM 8816  H HD21 . ASN A 1 50  ? 5.152   74.957  94.937  1.00 0.00 ?  41  ASN A HD21 6  
ATOM 8817  H HD22 . ASN A 1 50  ? 3.495   74.361  94.675  1.00 0.00 ?  41  ASN A HD22 6  
ATOM 8818  N N    . GLN A 1 51  ? 9.644   71.727  93.357  1.00 0.00 ?  42  GLN A N    6  
ATOM 8819  C CA   . GLN A 1 51  ? 10.969  71.933  92.856  1.00 0.00 ?  42  GLN A CA   6  
ATOM 8820  C C    . GLN A 1 51  ? 11.470  70.692  92.001  1.00 0.00 ?  42  GLN A C    6  
ATOM 8821  O O    . GLN A 1 51  ? 10.942  69.562  92.109  1.00 0.00 ?  42  GLN A O    6  
ATOM 8822  C CB   . GLN A 1 51  ? 11.821  72.147  94.134  1.00 0.00 ?  42  GLN A CB   6  
ATOM 8823  C CG   . GLN A 1 51  ? 11.422  73.392  94.880  1.00 0.00 ?  42  GLN A CG   6  
ATOM 8824  C CD   . GLN A 1 51  ? 11.111  74.611  94.000  1.00 0.00 ?  42  GLN A CD   6  
ATOM 8825  O OE1  . GLN A 1 51  ? 10.001  74.963  93.581  1.00 0.00 ?  42  GLN A OE1  6  
ATOM 8826  N NE2  . GLN A 1 51  ? 12.205  75.097  93.381  1.00 0.00 ?  42  GLN A NE2  6  
ATOM 8827  H H    . GLN A 1 51  ? 9.631   71.369  94.301  1.00 0.00 ?  42  GLN A H    6  
ATOM 8828  H HA   . GLN A 1 51  ? 11.046  72.889  92.338  1.00 0.00 ?  42  GLN A HA   6  
ATOM 8829  H HB2  . GLN A 1 51  ? 11.728  71.316  94.834  1.00 0.00 ?  42  GLN A HB2  6  
ATOM 8830  H HB3  . GLN A 1 51  ? 12.866  72.232  93.837  1.00 0.00 ?  42  GLN A HB3  6  
ATOM 8831  H HG2  . GLN A 1 51  ? 10.637  73.126  95.588  1.00 0.00 ?  42  GLN A HG2  6  
ATOM 8832  H HG3  . GLN A 1 51  ? 12.225  73.556  95.599  1.00 0.00 ?  42  GLN A HG3  6  
ATOM 8833  H HE21 . GLN A 1 51  ? 13.094  74.732  93.690  1.00 0.00 ?  42  GLN A HE21 6  
ATOM 8834  H HE22 . GLN A 1 51  ? 12.050  75.788  92.660  1.00 0.00 ?  42  GLN A HE22 6  
ATOM 8835  N N    . THR A 1 52  ? 12.600  70.819  91.268  1.00 0.00 ?  43  THR A N    6  
ATOM 8836  C CA   . THR A 1 52  ? 13.177  69.764  90.340  1.00 0.00 ?  43  THR A CA   6  
ATOM 8837  C C    . THR A 1 52  ? 14.633  69.414  90.654  1.00 0.00 ?  43  THR A C    6  
ATOM 8838  O O    . THR A 1 52  ? 15.457  70.275  90.996  1.00 0.00 ?  43  THR A O    6  
ATOM 8839  C CB   . THR A 1 52  ? 12.892  70.125  88.876  1.00 0.00 ?  43  THR A CB   6  
ATOM 8840  O OG1  . THR A 1 52  ? 11.871  71.055  88.704  1.00 0.00 ?  43  THR A OG1  6  
ATOM 8841  C CG2  . THR A 1 52  ? 12.498  68.814  88.182  1.00 0.00 ?  43  THR A CG2  6  
ATOM 8842  H H    . THR A 1 52  ? 12.914  71.775  91.171  1.00 0.00 ?  43  THR A H    6  
ATOM 8843  H HA   . THR A 1 52  ? 12.670  68.813  90.505  1.00 0.00 ?  43  THR A HA   6  
ATOM 8844  H HB   . THR A 1 52  ? 13.753  70.613  88.421  1.00 0.00 ?  43  THR A HB   6  
ATOM 8845  H HG1  . THR A 1 52  ? 12.234  71.932  88.842  1.00 0.00 ?  43  THR A HG1  6  
ATOM 8846  H HG21 . THR A 1 52  ? 12.427  68.846  87.095  1.00 0.00 ?  43  THR A HG21 6  
ATOM 8847  H HG22 . THR A 1 52  ? 13.273  68.126  88.516  1.00 0.00 ?  43  THR A HG22 6  
ATOM 8848  H HG23 . THR A 1 52  ? 11.500  68.561  88.539  1.00 0.00 ?  43  THR A HG23 6  
ATOM 8849  N N    . GLU A 1 53  ? 15.032  68.108  90.765  1.00 0.00 ?  44  GLU A N    6  
ATOM 8850  C CA   . GLU A 1 53  ? 16.370  67.698  91.282  1.00 0.00 ?  44  GLU A CA   6  
ATOM 8851  C C    . GLU A 1 53  ? 17.386  67.554  90.105  1.00 0.00 ?  44  GLU A C    6  
ATOM 8852  O O    . GLU A 1 53  ? 17.063  67.225  88.957  1.00 0.00 ?  44  GLU A O    6  
ATOM 8853  C CB   . GLU A 1 53  ? 16.196  66.351  91.988  1.00 0.00 ?  44  GLU A CB   6  
ATOM 8854  C CG   . GLU A 1 53  ? 15.274  66.568  93.190  1.00 0.00 ?  44  GLU A CG   6  
ATOM 8855  C CD   . GLU A 1 53  ? 15.790  67.251  94.393  1.00 0.00 ?  44  GLU A CD   6  
ATOM 8856  O OE1  . GLU A 1 53  ? 16.982  67.530  94.446  1.00 0.00 -1 44  GLU A OE1  6  
ATOM 8857  O OE2  . GLU A 1 53  ? 14.989  67.668  95.267  1.00 0.00 ?  44  GLU A OE2  6  
ATOM 8858  H H    . GLU A 1 53  ? 14.412  67.353  90.512  1.00 0.00 ?  44  GLU A H    6  
ATOM 8859  H HA   . GLU A 1 53  ? 16.681  68.472  91.983  1.00 0.00 ?  44  GLU A HA   6  
ATOM 8860  H HB2  . GLU A 1 53  ? 15.825  65.586  91.306  1.00 0.00 ?  44  GLU A HB2  6  
ATOM 8861  H HB3  . GLU A 1 53  ? 17.145  65.933  92.324  1.00 0.00 ?  44  GLU A HB3  6  
ATOM 8862  H HG2  . GLU A 1 53  ? 14.304  66.932  92.850  1.00 0.00 ?  44  GLU A HG2  6  
ATOM 8863  H HG3  . GLU A 1 53  ? 15.026  65.550  93.491  1.00 0.00 ?  44  GLU A HG3  6  
ATOM 8864  N N    . GLU A 1 54  ? 18.633  67.893  90.403  1.00 0.00 ?  45  GLU A N    6  
ATOM 8865  C CA   . GLU A 1 54  ? 19.818  68.007  89.511  1.00 0.00 ?  45  GLU A CA   6  
ATOM 8866  C C    . GLU A 1 54  ? 20.055  66.573  88.977  1.00 0.00 ?  45  GLU A C    6  
ATOM 8867  O O    . GLU A 1 54  ? 20.112  65.589  89.745  1.00 0.00 ?  45  GLU A O    6  
ATOM 8868  C CB   . GLU A 1 54  ? 21.037  68.618  90.136  1.00 0.00 ?  45  GLU A CB   6  
ATOM 8869  C CG   . GLU A 1 54  ? 22.277  68.611  89.251  1.00 0.00 ?  45  GLU A CG   6  
ATOM 8870  C CD   . GLU A 1 54  ? 23.550  68.709  90.119  1.00 0.00 ?  45  GLU A CD   6  
ATOM 8871  O OE1  . GLU A 1 54  ? 23.389  68.691  91.358  1.00 0.00 ?  45  GLU A OE1  6  
ATOM 8872  O OE2  . GLU A 1 54  ? 24.661  68.793  89.541  1.00 0.00 -1 45  GLU A OE2  6  
ATOM 8873  H H    . GLU A 1 54  ? 18.754  68.033  91.395  1.00 0.00 ?  45  GLU A H    6  
ATOM 8874  H HA   . GLU A 1 54  ? 19.600  68.625  88.640  1.00 0.00 ?  45  GLU A HA   6  
ATOM 8875  H HB2  . GLU A 1 54  ? 20.822  69.662  90.364  1.00 0.00 ?  45  GLU A HB2  6  
ATOM 8876  H HB3  . GLU A 1 54  ? 21.143  68.172  91.125  1.00 0.00 ?  45  GLU A HB3  6  
ATOM 8877  H HG2  . GLU A 1 54  ? 22.323  67.671  88.701  1.00 0.00 ?  45  GLU A HG2  6  
ATOM 8878  H HG3  . GLU A 1 54  ? 22.261  69.433  88.535  1.00 0.00 ?  45  GLU A HG3  6  
ATOM 8879  N N    . ARG A 1 55  ? 20.189  66.473  87.679  1.00 0.00 ?  46  ARG A N    6  
ATOM 8880  C CA   . ARG A 1 55  ? 20.647  65.219  86.985  1.00 0.00 ?  46  ARG A CA   6  
ATOM 8881  C C    . ARG A 1 55  ? 22.113  65.252  86.474  1.00 0.00 ?  46  ARG A C    6  
ATOM 8882  O O    . ARG A 1 55  ? 22.400  66.213  85.816  1.00 0.00 ?  46  ARG A O    6  
ATOM 8883  C CB   . ARG A 1 55  ? 19.664  64.909  85.788  1.00 0.00 ?  46  ARG A CB   6  
ATOM 8884  C CG   . ARG A 1 55  ? 18.402  64.040  86.239  1.00 0.00 ?  46  ARG A CG   6  
ATOM 8885  C CD   . ARG A 1 55  ? 17.479  64.802  87.147  1.00 0.00 ?  46  ARG A CD   6  
ATOM 8886  N NE   . ARG A 1 55  ? 16.320  63.933  87.568  1.00 0.00 ?  46  ARG A NE   6  
ATOM 8887  C CZ   . ARG A 1 55  ? 15.305  64.203  88.328  1.00 0.00 ?  46  ARG A CZ   6  
ATOM 8888  N NH1  . ARG A 1 55  ? 14.843  65.439  88.505  1.00 0.00 ?  46  ARG A NH1  6  
ATOM 8889  N NH2  . ARG A 1 55  ? 14.662  63.244  88.827  1.00 0.00 1  46  ARG A NH2  6  
ATOM 8890  H H    . ARG A 1 55  ? 20.116  67.283  87.081  1.00 0.00 ?  46  ARG A H    6  
ATOM 8891  H HA   . ARG A 1 55  ? 20.533  64.318  87.589  1.00 0.00 ?  46  ARG A HA   6  
ATOM 8892  H HB2  . ARG A 1 55  ? 19.364  65.908  85.472  1.00 0.00 ?  46  ARG A HB2  6  
ATOM 8893  H HB3  . ARG A 1 55  ? 20.167  64.310  85.027  1.00 0.00 ?  46  ARG A HB3  6  
ATOM 8894  H HG2  . ARG A 1 55  ? 17.785  63.742  85.391  1.00 0.00 ?  46  ARG A HG2  6  
ATOM 8895  H HG3  . ARG A 1 55  ? 18.773  63.181  86.796  1.00 0.00 ?  46  ARG A HG3  6  
ATOM 8896  H HD2  . ARG A 1 55  ? 17.978  65.035  88.087  1.00 0.00 ?  46  ARG A HD2  6  
ATOM 8897  H HD3  . ARG A 1 55  ? 17.080  65.708  86.692  1.00 0.00 ?  46  ARG A HD3  6  
ATOM 8898  H HE   . ARG A 1 55  ? 16.399  62.963  87.303  1.00 0.00 ?  46  ARG A HE   6  
ATOM 8899  H HH11 . ARG A 1 55  ? 15.528  66.177  88.433  1.00 0.00 ?  46  ARG A HH11 6  
ATOM 8900  H HH12 . ARG A 1 55  ? 14.046  65.555  89.115  1.00 0.00 ?  46  ARG A HH12 6  
ATOM 8901  H HH21 . ARG A 1 55  ? 14.971  62.314  88.586  1.00 0.00 ?  46  ARG A HH21 6  
ATOM 8902  H HH22 . ARG A 1 55  ? 13.882  63.262  89.469  1.00 0.00 ?  46  ARG A HH22 6  
ATOM 8903  N N    . ARG A 1 56  ? 22.908  64.249  86.884  1.00 0.00 ?  47  ARG A N    6  
ATOM 8904  C CA   . ARG A 1 56  ? 24.337  64.282  86.540  1.00 0.00 ?  47  ARG A CA   6  
ATOM 8905  C C    . ARG A 1 56  ? 24.881  62.900  86.179  1.00 0.00 ?  47  ARG A C    6  
ATOM 8906  O O    . ARG A 1 56  ? 24.661  62.006  86.953  1.00 0.00 ?  47  ARG A O    6  
ATOM 8907  C CB   . ARG A 1 56  ? 25.096  65.062  87.601  1.00 0.00 ?  47  ARG A CB   6  
ATOM 8908  C CG   . ARG A 1 56  ? 26.631  65.515  87.390  1.00 0.00 ?  47  ARG A CG   6  
ATOM 8909  C CD   . ARG A 1 56  ? 27.222  66.198  88.631  1.00 0.00 ?  47  ARG A CD   6  
ATOM 8910  N NE   . ARG A 1 56  ? 28.680  66.639  88.344  1.00 0.00 ?  47  ARG A NE   6  
ATOM 8911  C CZ   . ARG A 1 56  ? 29.649  65.896  87.725  1.00 0.00 ?  47  ARG A CZ   6  
ATOM 8912  N NH1  . ARG A 1 56  ? 29.684  64.600  87.635  1.00 0.00 ?  47  ARG A NH1  6  
ATOM 8913  N NH2  . ARG A 1 56  ? 30.659  66.444  87.147  1.00 0.00 1  47  ARG A NH2  6  
ATOM 8914  H H    . ARG A 1 56  ? 22.552  63.386  87.268  1.00 0.00 ?  47  ARG A H    6  
ATOM 8915  H HA   . ARG A 1 56  ? 24.446  64.876  85.633  1.00 0.00 ?  47  ARG A HA   6  
ATOM 8916  H HB2  . ARG A 1 56  ? 24.503  65.971  87.696  1.00 0.00 ?  47  ARG A HB2  6  
ATOM 8917  H HB3  . ARG A 1 56  ? 25.051  64.376  88.447  1.00 0.00 ?  47  ARG A HB3  6  
ATOM 8918  H HG2  . ARG A 1 56  ? 27.117  64.570  87.153  1.00 0.00 ?  47  ARG A HG2  6  
ATOM 8919  H HG3  . ARG A 1 56  ? 26.757  66.209  86.560  1.00 0.00 ?  47  ARG A HG3  6  
ATOM 8920  H HD2  . ARG A 1 56  ? 26.684  67.098  88.929  1.00 0.00 ?  47  ARG A HD2  6  
ATOM 8921  H HD3  . ARG A 1 56  ? 27.175  65.567  89.519  1.00 0.00 ?  47  ARG A HD3  6  
ATOM 8922  H HE   . ARG A 1 56  ? 28.819  67.639  88.344  1.00 0.00 ?  47  ARG A HE   6  
ATOM 8923  H HH11 . ARG A 1 56  ? 29.100  64.033  88.233  1.00 0.00 ?  47  ARG A HH11 6  
ATOM 8924  H HH12 . ARG A 1 56  ? 30.405  64.227  87.033  1.00 0.00 ?  47  ARG A HH12 6  
ATOM 8925  H HH21 . ARG A 1 56  ? 30.687  67.450  87.219  1.00 0.00 ?  47  ARG A HH21 6  
ATOM 8926  H HH22 . ARG A 1 56  ? 31.446  65.904  86.817  1.00 0.00 ?  47  ARG A HH22 6  
ATOM 8927  N N    . ALA A 1 57  ? 25.503  62.844  85.002  1.00 0.00 ?  48  ALA A N    6  
ATOM 8928  C CA   . ALA A 1 57  ? 26.169  61.617  84.627  1.00 0.00 ?  48  ALA A CA   6  
ATOM 8929  C C    . ALA A 1 57  ? 27.403  61.336  85.445  1.00 0.00 ?  48  ALA A C    6  
ATOM 8930  O O    . ALA A 1 57  ? 28.120  62.312  85.770  1.00 0.00 ?  48  ALA A O    6  
ATOM 8931  C CB   . ALA A 1 57  ? 26.489  61.652  83.122  1.00 0.00 ?  48  ALA A CB   6  
ATOM 8932  H H    . ALA A 1 57  ? 25.642  63.701  84.486  1.00 0.00 ?  48  ALA A H    6  
ATOM 8933  H HA   . ALA A 1 57  ? 25.567  60.740  84.867  1.00 0.00 ?  48  ALA A HA   6  
ATOM 8934  H HB1  . ALA A 1 57  ? 27.372  62.267  82.952  1.00 0.00 ?  48  ALA A HB1  6  
ATOM 8935  H HB2  . ALA A 1 57  ? 26.691  60.690  82.650  1.00 0.00 ?  48  ALA A HB2  6  
ATOM 8936  H HB3  . ALA A 1 57  ? 25.653  61.953  82.489  1.00 0.00 ?  48  ALA A HB3  6  
ATOM 8937  N N    . SER A 1 58  ? 27.755  60.141  85.673  1.00 0.00 ?  49  SER A N    6  
ATOM 8938  C CA   . SER A 1 58  ? 28.770  59.572  86.555  1.00 0.00 ?  49  SER A CA   6  
ATOM 8939  C C    . SER A 1 58  ? 29.621  58.582  85.825  1.00 0.00 ?  49  SER A C    6  
ATOM 8940  O O    . SER A 1 58  ? 29.509  57.358  86.109  1.00 0.00 ?  49  SER A O    6  
ATOM 8941  C CB   . SER A 1 58  ? 28.075  59.028  87.748  1.00 0.00 ?  49  SER A CB   6  
ATOM 8942  O OG   . SER A 1 58  ? 29.058  58.650  88.748  1.00 0.00 ?  49  SER A OG   6  
ATOM 8943  H H    . SER A 1 58  ? 27.362  59.385  85.130  1.00 0.00 ?  49  SER A H    6  
ATOM 8944  H HA   . SER A 1 58  ? 29.419  60.416  86.787  1.00 0.00 ?  49  SER A HA   6  
ATOM 8945  H HB2  . SER A 1 58  ? 27.281  59.672  88.124  1.00 0.00 ?  49  SER A HB2  6  
ATOM 8946  H HB3  . SER A 1 58  ? 27.502  58.135  87.500  1.00 0.00 ?  49  SER A HB3  6  
ATOM 8947  H HG   . SER A 1 58  ? 29.060  59.350  89.405  1.00 0.00 ?  49  SER A HG   6  
ATOM 8948  N N    . LEU A 1 59  ? 30.250  59.050  84.763  1.00 0.00 ?  50  LEU A N    6  
ATOM 8949  C CA   . LEU A 1 59  ? 30.962  58.132  83.810  1.00 0.00 ?  50  LEU A CA   6  
ATOM 8950  C C    . LEU A 1 59  ? 32.140  57.518  84.548  1.00 0.00 ?  50  LEU A C    6  
ATOM 8951  O O    . LEU A 1 59  ? 32.784  58.160  85.439  1.00 0.00 ?  50  LEU A O    6  
ATOM 8952  C CB   . LEU A 1 59  ? 31.440  58.954  82.637  1.00 0.00 ?  50  LEU A CB   6  
ATOM 8953  C CG   . LEU A 1 59  ? 30.417  59.550  81.576  1.00 0.00 ?  50  LEU A CG   6  
ATOM 8954  C CD1  . LEU A 1 59  ? 31.011  60.749  80.705  1.00 0.00 ?  50  LEU A CD1  6  
ATOM 8955  C CD2  . LEU A 1 59  ? 29.763  58.533  80.553  1.00 0.00 ?  50  LEU A CD2  6  
ATOM 8956  H H    . LEU A 1 59  ? 30.251  60.023  84.494  1.00 0.00 ?  50  LEU A H    6  
ATOM 8957  H HA   . LEU A 1 59  ? 30.390  57.293  83.415  1.00 0.00 ?  50  LEU A HA   6  
ATOM 8958  H HB2  . LEU A 1 59  ? 31.982  59.813  83.034  1.00 0.00 ?  50  LEU A HB2  6  
ATOM 8959  H HB3  . LEU A 1 59  ? 32.083  58.270  82.084  1.00 0.00 ?  50  LEU A HB3  6  
ATOM 8960  H HG   . LEU A 1 59  ? 29.518  59.934  82.057  1.00 0.00 ?  50  LEU A HG   6  
ATOM 8961  H HD11 . LEU A 1 59  ? 31.924  60.499  80.164  1.00 0.00 ?  50  LEU A HD11 6  
ATOM 8962  H HD12 . LEU A 1 59  ? 30.321  61.099  79.936  1.00 0.00 ?  50  LEU A HD12 6  
ATOM 8963  H HD13 . LEU A 1 59  ? 31.171  61.564  81.411  1.00 0.00 ?  50  LEU A HD13 6  
ATOM 8964  H HD21 . LEU A 1 59  ? 29.005  58.917  79.872  1.00 0.00 ?  50  LEU A HD21 6  
ATOM 8965  H HD22 . LEU A 1 59  ? 30.605  58.031  80.074  1.00 0.00 ?  50  LEU A HD22 6  
ATOM 8966  H HD23 . LEU A 1 59  ? 29.239  57.743  81.091  1.00 0.00 ?  50  LEU A HD23 6  
ATOM 8967  N N    . PRO A 1 60  ? 32.473  56.236  84.293  1.00 0.00 ?  51  PRO A N    6  
ATOM 8968  C CA   . PRO A 1 60  ? 33.240  55.369  85.188  1.00 0.00 ?  51  PRO A CA   6  
ATOM 8969  C C    . PRO A 1 60  ? 34.673  55.851  85.220  1.00 0.00 ?  51  PRO A C    6  
ATOM 8970  O O    . PRO A 1 60  ? 35.439  55.593  84.268  1.00 0.00 ?  51  PRO A O    6  
ATOM 8971  C CB   . PRO A 1 60  ? 33.057  53.874  84.722  1.00 0.00 ?  51  PRO A CB   6  
ATOM 8972  C CG   . PRO A 1 60  ? 32.721  54.093  83.218  1.00 0.00 ?  51  PRO A CG   6  
ATOM 8973  C CD   . PRO A 1 60  ? 31.851  55.347  83.370  1.00 0.00 ?  51  PRO A CD   6  
ATOM 8974  H HA   . PRO A 1 60  ? 32.863  55.403  86.210  1.00 0.00 ?  51  PRO A HA   6  
ATOM 8975  H HB2  . PRO A 1 60  ? 33.851  53.165  84.956  1.00 0.00 ?  51  PRO A HB2  6  
ATOM 8976  H HB3  . PRO A 1 60  ? 32.167  53.445  85.184  1.00 0.00 ?  51  PRO A HB3  6  
ATOM 8977  H HG2  . PRO A 1 60  ? 33.660  54.277  82.696  1.00 0.00 ?  51  PRO A HG2  6  
ATOM 8978  H HG3  . PRO A 1 60  ? 32.255  53.250  82.707  1.00 0.00 ?  51  PRO A HG3  6  
ATOM 8979  H HD2  . PRO A 1 60  ? 31.598  55.784  82.404  1.00 0.00 ?  51  PRO A HD2  6  
ATOM 8980  H HD3  . PRO A 1 60  ? 30.919  55.023  83.834  1.00 0.00 ?  51  PRO A HD3  6  
ATOM 8981  N N    . GLY A 1 61  ? 35.035  56.518  86.264  1.00 0.00 ?  52  GLY A N    6  
ATOM 8982  C CA   . GLY A 1 61  ? 36.432  56.931  86.478  1.00 0.00 ?  52  GLY A CA   6  
ATOM 8983  C C    . GLY A 1 61  ? 36.487  58.280  87.158  1.00 0.00 ?  52  GLY A C    6  
ATOM 8984  O O    . GLY A 1 61  ? 35.522  59.075  87.033  1.00 0.00 ?  52  GLY A O    6  
ATOM 8985  H H    . GLY A 1 61  ? 34.298  56.740  86.918  1.00 0.00 ?  52  GLY A H    6  
ATOM 8986  H HA2  . GLY A 1 61  ? 36.980  56.169  87.032  1.00 0.00 ?  52  GLY A HA2  6  
ATOM 8987  H HA3  . GLY A 1 61  ? 36.921  57.130  85.524  1.00 0.00 ?  52  GLY A HA3  6  
ATOM 8988  N N    . ARG A 1 62  ? 37.535  58.580  87.958  1.00 0.00 ?  53  ARG A N    6  
ATOM 8989  C CA   . ARG A 1 62  ? 37.516  59.678  88.848  1.00 0.00 ?  53  ARG A CA   6  
ATOM 8990  C C    . ARG A 1 62  ? 38.794  60.428  88.899  1.00 0.00 ?  53  ARG A C    6  
ATOM 8991  O O    . ARG A 1 62  ? 39.564  60.346  89.786  1.00 0.00 ?  53  ARG A O    6  
ATOM 8992  C CB   . ARG A 1 62  ? 37.262  59.042  90.271  1.00 0.00 ?  53  ARG A CB   6  
ATOM 8993  C CG   . ARG A 1 62  ? 35.873  58.424  90.495  1.00 0.00 ?  53  ARG A CG   6  
ATOM 8994  C CD   . ARG A 1 62  ? 35.804  57.831  91.948  1.00 0.00 ?  53  ARG A CD   6  
ATOM 8995  N NE   . ARG A 1 62  ? 34.454  57.277  92.241  1.00 0.00 ?  53  ARG A NE   6  
ATOM 8996  C CZ   . ARG A 1 62  ? 34.120  56.034  92.499  1.00 0.00 ?  53  ARG A CZ   6  
ATOM 8997  N NH1  . ARG A 1 62  ? 34.924  55.032  92.373  1.00 0.00 ?  53  ARG A NH1  6  
ATOM 8998  N NH2  . ARG A 1 62  ? 32.881  55.713  92.662  1.00 0.00 1  53  ARG A NH2  6  
ATOM 8999  H H    . ARG A 1 62  ? 38.339  57.972  87.917  1.00 0.00 ?  53  ARG A H    6  
ATOM 9000  H HA   . ARG A 1 62  ? 36.711  60.369  88.597  1.00 0.00 ?  53  ARG A HA   6  
ATOM 9001  H HB2  . ARG A 1 62  ? 38.039  58.303  90.463  1.00 0.00 ?  53  ARG A HB2  6  
ATOM 9002  H HB3  . ARG A 1 62  ? 37.285  59.871  90.980  1.00 0.00 ?  53  ARG A HB3  6  
ATOM 9003  H HG2  . ARG A 1 62  ? 35.114  59.203  90.441  1.00 0.00 ?  53  ARG A HG2  6  
ATOM 9004  H HG3  . ARG A 1 62  ? 35.503  57.642  89.830  1.00 0.00 ?  53  ARG A HG3  6  
ATOM 9005  H HD2  . ARG A 1 62  ? 36.572  57.078  92.127  1.00 0.00 ?  53  ARG A HD2  6  
ATOM 9006  H HD3  . ARG A 1 62  ? 35.907  58.725  92.562  1.00 0.00 ?  53  ARG A HD3  6  
ATOM 9007  H HE   . ARG A 1 62  ? 33.708  57.949  92.354  1.00 0.00 ?  53  ARG A HE   6  
ATOM 9008  H HH11 . ARG A 1 62  ? 35.896  55.106  92.111  1.00 0.00 ?  53  ARG A HH11 6  
ATOM 9009  H HH12 . ARG A 1 62  ? 34.476  54.128  92.423  1.00 0.00 ?  53  ARG A HH12 6  
ATOM 9010  H HH21 . ARG A 1 62  ? 32.216  56.446  92.866  1.00 0.00 ?  53  ARG A HH21 6  
ATOM 9011  H HH22 . ARG A 1 62  ? 32.714  54.733  92.839  1.00 0.00 ?  53  ARG A HH22 6  
ATOM 9012  N N    . ASP A 1 63  ? 38.969  61.103  87.781  1.00 0.00 ?  54  ASP A N    6  
ATOM 9013  C CA   . ASP A 1 63  ? 40.149  61.956  87.540  1.00 0.00 ?  54  ASP A CA   6  
ATOM 9014  C C    . ASP A 1 63  ? 39.804  63.415  86.942  1.00 0.00 ?  54  ASP A C    6  
ATOM 9015  O O    . ASP A 1 63  ? 39.064  63.388  85.961  1.00 0.00 ?  54  ASP A O    6  
ATOM 9016  C CB   . ASP A 1 63  ? 41.105  61.192  86.681  1.00 0.00 ?  54  ASP A CB   6  
ATOM 9017  C CG   . ASP A 1 63  ? 42.286  61.860  86.007  1.00 0.00 ?  54  ASP A CG   6  
ATOM 9018  O OD1  . ASP A 1 63  ? 42.564  63.062  86.260  1.00 0.00 ?  54  ASP A OD1  6  
ATOM 9019  O OD2  . ASP A 1 63  ? 42.833  61.235  85.063  1.00 0.00 -1 54  ASP A OD2  6  
ATOM 9020  H H    . ASP A 1 63  ? 38.412  60.941  86.954  1.00 0.00 ?  54  ASP A H    6  
ATOM 9021  H HA   . ASP A 1 63  ? 40.634  62.180  88.490  1.00 0.00 ?  54  ASP A HA   6  
ATOM 9022  H HB2  . ASP A 1 63  ? 41.459  60.349  87.275  1.00 0.00 ?  54  ASP A HB2  6  
ATOM 9023  H HB3  . ASP A 1 63  ? 40.470  60.849  85.864  1.00 0.00 ?  54  ASP A HB3  6  
ATOM 9024  N N    . ASP A 1 64  ? 40.222  64.426  87.676  1.00 0.00 ?  55  ASP A N    6  
ATOM 9025  C CA   . ASP A 1 64  ? 39.903  65.800  87.298  1.00 0.00 ?  55  ASP A CA   6  
ATOM 9026  C C    . ASP A 1 64  ? 40.473  66.347  85.907  1.00 0.00 ?  55  ASP A C    6  
ATOM 9027  O O    . ASP A 1 64  ? 40.115  67.424  85.491  1.00 0.00 ?  55  ASP A O    6  
ATOM 9028  C CB   . ASP A 1 64  ? 40.039  66.745  88.496  1.00 0.00 ?  55  ASP A CB   6  
ATOM 9029  C CG   . ASP A 1 64  ? 41.390  66.655  89.222  1.00 0.00 ?  55  ASP A CG   6  
ATOM 9030  O OD1  . ASP A 1 64  ? 42.484  66.377  88.642  1.00 0.00 -1 55  ASP A OD1  6  
ATOM 9031  O OD2  . ASP A 1 64  ? 41.315  66.866  90.465  1.00 0.00 ?  55  ASP A OD2  6  
ATOM 9032  H H    . ASP A 1 64  ? 40.605  64.299  88.601  1.00 0.00 ?  55  ASP A H    6  
ATOM 9033  H HA   . ASP A 1 64  ? 38.832  65.788  87.097  1.00 0.00 ?  55  ASP A HA   6  
ATOM 9034  H HB2  . ASP A 1 64  ? 39.850  67.780  88.212  1.00 0.00 ?  55  ASP A HB2  6  
ATOM 9035  H HB3  . ASP A 1 64  ? 39.303  66.423  89.232  1.00 0.00 ?  55  ASP A HB3  6  
ATOM 9036  N N    . ASN A 1 65  ? 41.247  65.536  85.146  1.00 0.00 ?  56  ASN A N    6  
ATOM 9037  C CA   . ASN A 1 65  ? 41.497  65.737  83.716  1.00 0.00 ?  56  ASN A CA   6  
ATOM 9038  C C    . ASN A 1 65  ? 40.201  65.642  82.894  1.00 0.00 ?  56  ASN A C    6  
ATOM 9039  O O    . ASN A 1 65  ? 40.291  65.898  81.677  1.00 0.00 ?  56  ASN A O    6  
ATOM 9040  C CB   . ASN A 1 65  ? 42.595  64.798  83.171  1.00 0.00 ?  56  ASN A CB   6  
ATOM 9041  C CG   . ASN A 1 65  ? 43.849  65.292  83.855  1.00 0.00 ?  56  ASN A CG   6  
ATOM 9042  O OD1  . ASN A 1 65  ? 44.304  66.379  83.559  1.00 0.00 ?  56  ASN A OD1  6  
ATOM 9043  N ND2  . ASN A 1 65  ? 44.481  64.447  84.600  1.00 0.00 ?  56  ASN A ND2  6  
ATOM 9044  H H    . ASN A 1 65  ? 41.456  64.628  85.536  1.00 0.00 ?  56  ASN A H    6  
ATOM 9045  H HA   . ASN A 1 65  ? 41.841  66.705  83.353  1.00 0.00 ?  56  ASN A HA   6  
ATOM 9046  H HB2  . ASN A 1 65  ? 42.479  63.720  83.294  1.00 0.00 ?  56  ASN A HB2  6  
ATOM 9047  H HB3  . ASN A 1 65  ? 42.768  65.002  82.114  1.00 0.00 ?  56  ASN A HB3  6  
ATOM 9048  H HD21 . ASN A 1 65  ? 43.979  63.601  84.831  1.00 0.00 ?  56  ASN A HD21 6  
ATOM 9049  H HD22 . ASN A 1 65  ? 45.066  64.938  85.260  1.00 0.00 ?  56  ASN A HD22 6  
ATOM 9050  N N    . SER A 1 66  ? 39.054  65.312  83.502  1.00 0.00 ?  57  SER A N    6  
ATOM 9051  C CA   . SER A 1 66  ? 37.785  65.617  82.822  1.00 0.00 ?  57  SER A CA   6  
ATOM 9052  C C    . SER A 1 66  ? 37.575  67.041  82.339  1.00 0.00 ?  57  SER A C    6  
ATOM 9053  O O    . SER A 1 66  ? 37.153  67.224  81.212  1.00 0.00 ?  57  SER A O    6  
ATOM 9054  C CB   . SER A 1 66  ? 36.572  65.267  83.638  1.00 0.00 ?  57  SER A CB   6  
ATOM 9055  O OG   . SER A 1 66  ? 36.516  66.076  84.796  1.00 0.00 ?  57  SER A OG   6  
ATOM 9056  H H    . SER A 1 66  ? 39.028  64.982  84.456  1.00 0.00 ?  57  SER A H    6  
ATOM 9057  H HA   . SER A 1 66  ? 37.696  64.855  82.048  1.00 0.00 ?  57  SER A HA   6  
ATOM 9058  H HB2  . SER A 1 66  ? 35.659  65.489  83.085  1.00 0.00 ?  57  SER A HB2  6  
ATOM 9059  H HB3  . SER A 1 66  ? 36.553  64.223  83.948  1.00 0.00 ?  57  SER A HB3  6  
ATOM 9060  H HG   . SER A 1 66  ? 35.668  66.524  84.819  1.00 0.00 ?  57  SER A HG   6  
ATOM 9061  N N    . TYR A 1 67  ? 38.141  68.155  82.974  1.00 0.00 ?  58  TYR A N    6  
ATOM 9062  C CA   . TYR A 1 67  ? 37.999  69.452  82.481  1.00 0.00 ?  58  TYR A CA   6  
ATOM 9063  C C    . TYR A 1 67  ? 38.705  69.777  81.151  1.00 0.00 ?  58  TYR A C    6  
ATOM 9064  O O    . TYR A 1 67  ? 38.324  70.603  80.292  1.00 0.00 ?  58  TYR A O    6  
ATOM 9065  C CB   . TYR A 1 67  ? 38.247  70.416  83.707  1.00 0.00 ?  58  TYR A CB   6  
ATOM 9066  C CG   . TYR A 1 67  ? 37.161  70.312  84.724  1.00 0.00 ?  58  TYR A CG   6  
ATOM 9067  C CD1  . TYR A 1 67  ? 35.844  70.700  84.405  1.00 0.00 ?  58  TYR A CD1  6  
ATOM 9068  C CD2  . TYR A 1 67  ? 37.340  69.584  85.908  1.00 0.00 ?  58  TYR A CD2  6  
ATOM 9069  C CE1  . TYR A 1 67  ? 34.777  70.467  85.378  1.00 0.00 ?  58  TYR A CE1  6  
ATOM 9070  C CE2  . TYR A 1 67  ? 36.274  69.326  86.834  1.00 0.00 ?  58  TYR A CE2  6  
ATOM 9071  C CZ   . TYR A 1 67  ? 34.960  69.828  86.572  1.00 0.00 ?  58  TYR A CZ   6  
ATOM 9072  O OH   . TYR A 1 67  ? 33.936  69.671  87.486  1.00 0.00 ?  58  TYR A OH   6  
ATOM 9073  H H    . TYR A 1 67  ? 38.408  68.053  83.943  1.00 0.00 ?  58  TYR A H    6  
ATOM 9074  H HA   . TYR A 1 67  ? 36.929  69.552  82.292  1.00 0.00 ?  58  TYR A HA   6  
ATOM 9075  H HB2  . TYR A 1 67  ? 39.206  70.159  84.155  1.00 0.00 ?  58  TYR A HB2  6  
ATOM 9076  H HB3  . TYR A 1 67  ? 38.247  71.404  83.247  1.00 0.00 ?  58  TYR A HB3  6  
ATOM 9077  H HD1  . TYR A 1 67  ? 35.576  71.004  83.403  1.00 0.00 ?  58  TYR A HD1  6  
ATOM 9078  H HD2  . TYR A 1 67  ? 38.318  69.195  86.148  1.00 0.00 ?  58  TYR A HD2  6  
ATOM 9079  H HE1  . TYR A 1 67  ? 33.833  70.850  85.018  1.00 0.00 ?  58  TYR A HE1  6  
ATOM 9080  H HE2  . TYR A 1 67  ? 36.423  68.898  87.816  1.00 0.00 ?  58  TYR A HE2  6  
ATOM 9081  H HH   . TYR A 1 67  ? 33.924  68.773  87.826  1.00 0.00 ?  58  TYR A HH   6  
ATOM 9082  N N    . MET A 1 68  ? 39.821  69.094  80.982  1.00 0.00 ?  59  MET A N    6  
ATOM 9083  C CA   . MET A 1 68  ? 40.743  68.898  79.882  1.00 0.00 ?  59  MET A CA   6  
ATOM 9084  C C    . MET A 1 68  ? 40.030  68.093  78.783  1.00 0.00 ?  59  MET A C    6  
ATOM 9085  O O    . MET A 1 68  ? 39.981  68.569  77.657  1.00 0.00 ?  59  MET A O    6  
ATOM 9086  C CB   . MET A 1 68  ? 42.144  68.498  80.328  1.00 0.00 ?  59  MET A CB   6  
ATOM 9087  C CG   . MET A 1 68  ? 43.071  68.436  79.096  1.00 0.00 ?  59  MET A CG   6  
ATOM 9088  S SD   . MET A 1 68  ? 44.849  68.784  79.296  1.00 0.00 ?  59  MET A SD   6  
ATOM 9089  C CE   . MET A 1 68  ? 45.487  67.435  80.353  1.00 0.00 ?  59  MET A CE   6  
ATOM 9090  H H    . MET A 1 68  ? 39.861  68.380  81.695  1.00 0.00 ?  59  MET A H    6  
ATOM 9091  H HA   . MET A 1 68  ? 40.960  69.882  79.466  1.00 0.00 ?  59  MET A HA   6  
ATOM 9092  H HB2  . MET A 1 68  ? 42.558  69.176  81.075  1.00 0.00 ?  59  MET A HB2  6  
ATOM 9093  H HB3  . MET A 1 68  ? 42.084  67.591  80.929  1.00 0.00 ?  59  MET A HB3  6  
ATOM 9094  H HG2  . MET A 1 68  ? 42.933  67.529  78.506  1.00 0.00 ?  59  MET A HG2  6  
ATOM 9095  H HG3  . MET A 1 68  ? 42.655  69.314  78.602  1.00 0.00 ?  59  MET A HG3  6  
ATOM 9096  H HE1  . MET A 1 68  ? 45.204  66.428  80.048  1.00 0.00 ?  59  MET A HE1  6  
ATOM 9097  H HE2  . MET A 1 68  ? 46.554  67.624  80.465  1.00 0.00 ?  59  MET A HE2  6  
ATOM 9098  H HE3  . MET A 1 68  ? 45.013  67.726  81.290  1.00 0.00 ?  59  MET A HE3  6  
ATOM 9099  N N    . TYR A 1 69  ? 39.420  66.976  79.106  1.00 0.00 ?  60  TYR A N    6  
ATOM 9100  C CA   . TYR A 1 69  ? 38.418  66.375  78.276  1.00 0.00 ?  60  TYR A CA   6  
ATOM 9101  C C    . TYR A 1 69  ? 37.343  67.341  77.727  1.00 0.00 ?  60  TYR A C    6  
ATOM 9102  O O    . TYR A 1 69  ? 37.017  67.377  76.607  1.00 0.00 ?  60  TYR A O    6  
ATOM 9103  C CB   . TYR A 1 69  ? 38.043  64.955  78.650  1.00 0.00 ?  60  TYR A CB   6  
ATOM 9104  C CG   . TYR A 1 69  ? 39.157  63.856  78.451  1.00 0.00 ?  60  TYR A CG   6  
ATOM 9105  C CD1  . TYR A 1 69  ? 39.490  63.556  77.061  1.00 0.00 ?  60  TYR A CD1  6  
ATOM 9106  C CD2  . TYR A 1 69  ? 39.703  63.122  79.520  1.00 0.00 ?  60  TYR A CD2  6  
ATOM 9107  C CE1  . TYR A 1 69  ? 40.467  62.581  76.819  1.00 0.00 ?  60  TYR A CE1  6  
ATOM 9108  C CE2  . TYR A 1 69  ? 40.630  62.131  79.227  1.00 0.00 ?  60  TYR A CE2  6  
ATOM 9109  C CZ   . TYR A 1 69  ? 41.077  61.892  77.893  1.00 0.00 ?  60  TYR A CZ   6  
ATOM 9110  O OH   . TYR A 1 69  ? 41.927  60.883  77.610  1.00 0.00 ?  60  TYR A OH   6  
ATOM 9111  H H    . TYR A 1 69  ? 39.637  66.574  80.007  1.00 0.00 ?  60  TYR A H    6  
ATOM 9112  H HA   . TYR A 1 69  ? 39.001  66.227  77.366  1.00 0.00 ?  60  TYR A HA   6  
ATOM 9113  H HB2  . TYR A 1 69  ? 37.627  65.019  79.656  1.00 0.00 ?  60  TYR A HB2  6  
ATOM 9114  H HB3  . TYR A 1 69  ? 37.261  64.734  77.924  1.00 0.00 ?  60  TYR A HB3  6  
ATOM 9115  H HD1  . TYR A 1 69  ? 39.176  64.192  76.247  1.00 0.00 ?  60  TYR A HD1  6  
ATOM 9116  H HD2  . TYR A 1 69  ? 39.330  63.312  80.516  1.00 0.00 ?  60  TYR A HD2  6  
ATOM 9117  H HE1  . TYR A 1 69  ? 40.813  62.333  75.827  1.00 0.00 ?  60  TYR A HE1  6  
ATOM 9118  H HE2  . TYR A 1 69  ? 41.164  61.575  79.984  1.00 0.00 ?  60  TYR A HE2  6  
ATOM 9119  H HH   . TYR A 1 69  ? 42.076  60.445  78.451  1.00 0.00 ?  60  TYR A HH   6  
ATOM 9120  N N    . ILE A 1 70  ? 36.895  68.276  78.633  1.00 0.00 ?  61  ILE A N    6  
ATOM 9121  C CA   . ILE A 1 70  ? 35.871  69.345  78.266  1.00 0.00 ?  61  ILE A CA   6  
ATOM 9122  C C    . ILE A 1 70  ? 36.519  70.460  77.356  1.00 0.00 ?  61  ILE A C    6  
ATOM 9123  O O    . ILE A 1 70  ? 35.744  71.092  76.625  1.00 0.00 ?  61  ILE A O    6  
ATOM 9124  C CB   . ILE A 1 70  ? 35.060  69.856  79.521  1.00 0.00 ?  61  ILE A CB   6  
ATOM 9125  C CG1  . ILE A 1 70  ? 34.189  68.695  80.011  1.00 0.00 ?  61  ILE A CG1  6  
ATOM 9126  C CG2  . ILE A 1 70  ? 34.184  71.090  79.250  1.00 0.00 ?  61  ILE A CG2  6  
ATOM 9127  C CD1  . ILE A 1 70  ? 33.842  68.737  81.453  1.00 0.00 ?  61  ILE A CD1  6  
ATOM 9128  H H    . ILE A 1 70  ? 37.093  68.221  79.621  1.00 0.00 ?  61  ILE A H    6  
ATOM 9129  H HA   . ILE A 1 70  ? 35.173  68.881  77.570  1.00 0.00 ?  61  ILE A HA   6  
ATOM 9130  H HB   . ILE A 1 70  ? 35.777  70.248  80.242  1.00 0.00 ?  61  ILE A HB   6  
ATOM 9131  H HG12 . ILE A 1 70  ? 33.269  68.485  79.464  1.00 0.00 ?  61  ILE A HG12 6  
ATOM 9132  H HG13 . ILE A 1 70  ? 34.799  67.797  79.913  1.00 0.00 ?  61  ILE A HG13 6  
ATOM 9133  H HG21 . ILE A 1 70  ? 33.418  70.957  78.486  1.00 0.00 ?  61  ILE A HG21 6  
ATOM 9134  H HG22 . ILE A 1 70  ? 33.902  71.439  80.243  1.00 0.00 ?  61  ILE A HG22 6  
ATOM 9135  H HG23 . ILE A 1 70  ? 34.798  71.917  78.891  1.00 0.00 ?  61  ILE A HG23 6  
ATOM 9136  H HD11 . ILE A 1 70  ? 33.148  69.547  81.681  1.00 0.00 ?  61  ILE A HD11 6  
ATOM 9137  H HD12 . ILE A 1 70  ? 33.310  67.834  81.752  1.00 0.00 ?  61  ILE A HD12 6  
ATOM 9138  H HD13 . ILE A 1 70  ? 34.792  68.849  81.975  1.00 0.00 ?  61  ILE A HD13 6  
ATOM 9139  N N    . LEU A 1 71  ? 37.846  70.636  77.321  1.00 0.00 ?  62  LEU A N    6  
ATOM 9140  C CA   . LEU A 1 71  ? 38.564  71.495  76.392  1.00 0.00 ?  62  LEU A CA   6  
ATOM 9141  C C    . LEU A 1 71  ? 38.565  70.808  75.053  1.00 0.00 ?  62  LEU A C    6  
ATOM 9142  O O    . LEU A 1 71  ? 38.151  71.396  74.091  1.00 0.00 ?  62  LEU A O    6  
ATOM 9143  C CB   . LEU A 1 71  ? 40.014  71.752  76.811  1.00 0.00 ?  62  LEU A CB   6  
ATOM 9144  C CG   . LEU A 1 71  ? 40.833  72.743  75.995  1.00 0.00 ?  62  LEU A CG   6  
ATOM 9145  C CD1  . LEU A 1 71  ? 42.011  73.174  76.915  1.00 0.00 ?  62  LEU A CD1  6  
ATOM 9146  C CD2  . LEU A 1 71  ? 41.559  72.055  74.842  1.00 0.00 ?  62  LEU A CD2  6  
ATOM 9147  H H    . LEU A 1 71  ? 38.416  70.165  78.009  1.00 0.00 ?  62  LEU A H    6  
ATOM 9148  H HA   . LEU A 1 71  ? 37.985  72.413  76.298  1.00 0.00 ?  62  LEU A HA   6  
ATOM 9149  H HB2  . LEU A 1 71  ? 39.884  72.063  77.847  1.00 0.00 ?  62  LEU A HB2  6  
ATOM 9150  H HB3  . LEU A 1 71  ? 40.529  70.792  76.835  1.00 0.00 ?  62  LEU A HB3  6  
ATOM 9151  H HG   . LEU A 1 71  ? 40.251  73.594  75.642  1.00 0.00 ?  62  LEU A HG   6  
ATOM 9152  H HD11 . LEU A 1 71  ? 41.662  73.745  77.775  1.00 0.00 ?  62  LEU A HD11 6  
ATOM 9153  H HD12 . LEU A 1 71  ? 42.577  72.369  77.386  1.00 0.00 ?  62  LEU A HD12 6  
ATOM 9154  H HD13 . LEU A 1 71  ? 42.660  73.764  76.267  1.00 0.00 ?  62  LEU A HD13 6  
ATOM 9155  H HD21 . LEU A 1 71  ? 42.114  71.166  75.142  1.00 0.00 ?  62  LEU A HD21 6  
ATOM 9156  H HD22 . LEU A 1 71  ? 40.757  71.804  74.148  1.00 0.00 ?  62  LEU A HD22 6  
ATOM 9157  H HD23 . LEU A 1 71  ? 42.257  72.751  74.374  1.00 0.00 ?  62  LEU A HD23 6  
ATOM 9158  N N    . PHE A 1 72  ? 39.063  69.560  75.116  1.00 0.00 ?  63  PHE A N    6  
ATOM 9159  C CA   . PHE A 1 72  ? 39.049  68.632  73.971  1.00 0.00 ?  63  PHE A CA   6  
ATOM 9160  C C    . PHE A 1 72  ? 37.719  68.356  73.312  1.00 0.00 ?  63  PHE A C    6  
ATOM 9161  O O    . PHE A 1 72  ? 37.657  68.071  72.122  1.00 0.00 ?  63  PHE A O    6  
ATOM 9162  C CB   . PHE A 1 72  ? 40.025  67.446  74.204  1.00 0.00 ?  63  PHE A CB   6  
ATOM 9163  C CG   . PHE A 1 72  ? 41.492  67.718  74.052  1.00 0.00 ?  63  PHE A CG   6  
ATOM 9164  C CD1  . PHE A 1 72  ? 42.154  67.918  72.812  1.00 0.00 ?  63  PHE A CD1  6  
ATOM 9165  C CD2  . PHE A 1 72  ? 42.201  67.674  75.255  1.00 0.00 ?  63  PHE A CD2  6  
ATOM 9166  C CE1  . PHE A 1 72  ? 43.505  68.129  72.745  1.00 0.00 ?  63  PHE A CE1  6  
ATOM 9167  C CE2  . PHE A 1 72  ? 43.521  68.088  75.196  1.00 0.00 ?  63  PHE A CE2  6  
ATOM 9168  C CZ   . PHE A 1 72  ? 44.196  68.202  73.996  1.00 0.00 ?  63  PHE A CZ   6  
ATOM 9169  H H    . PHE A 1 72  ? 39.151  69.153  76.036  1.00 0.00 ?  63  PHE A H    6  
ATOM 9170  H HA   . PHE A 1 72  ? 39.503  69.181  73.148  1.00 0.00 ?  63  PHE A HA   6  
ATOM 9171  H HB2  . PHE A 1 72  ? 39.819  66.980  75.168  1.00 0.00 ?  63  PHE A HB2  6  
ATOM 9172  H HB3  . PHE A 1 72  ? 39.680  66.739  73.449  1.00 0.00 ?  63  PHE A HB3  6  
ATOM 9173  H HD1  . PHE A 1 72  ? 41.534  67.826  71.933  1.00 0.00 ?  63  PHE A HD1  6  
ATOM 9174  H HD2  . PHE A 1 72  ? 41.735  67.443  76.201  1.00 0.00 ?  63  PHE A HD2  6  
ATOM 9175  H HE1  . PHE A 1 72  ? 44.111  68.223  71.857  1.00 0.00 ?  63  PHE A HE1  6  
ATOM 9176  H HE2  . PHE A 1 72  ? 43.998  68.262  76.149  1.00 0.00 ?  63  PHE A HE2  6  
ATOM 9177  H HZ   . PHE A 1 72  ? 45.233  68.504  74.007  1.00 0.00 ?  63  PHE A HZ   6  
ATOM 9178  N N    . VAL A 1 73  ? 36.591  68.580  74.029  1.00 0.00 ?  64  VAL A N    6  
ATOM 9179  C CA   . VAL A 1 73  ? 35.219  68.506  73.587  1.00 0.00 ?  64  VAL A CA   6  
ATOM 9180  C C    . VAL A 1 73  ? 34.879  69.697  72.718  1.00 0.00 ?  64  VAL A C    6  
ATOM 9181  O O    . VAL A 1 73  ? 34.109  69.568  71.736  1.00 0.00 ?  64  VAL A O    6  
ATOM 9182  C CB   . VAL A 1 73  ? 34.169  68.051  74.638  1.00 0.00 ?  64  VAL A CB   6  
ATOM 9183  C CG1  . VAL A 1 73  ? 33.295  69.239  75.102  1.00 0.00 ?  64  VAL A CG1  6  
ATOM 9184  C CG2  . VAL A 1 73  ? 33.313  66.925  73.987  1.00 0.00 ?  64  VAL A CG2  6  
ATOM 9185  H H    . VAL A 1 73  ? 36.809  68.955  74.941  1.00 0.00 ?  64  VAL A H    6  
ATOM 9186  H HA   . VAL A 1 73  ? 35.192  67.717  72.836  1.00 0.00 ?  64  VAL A HA   6  
ATOM 9187  H HB   . VAL A 1 73  ? 34.642  67.691  75.552  1.00 0.00 ?  64  VAL A HB   6  
ATOM 9188  H HG11 . VAL A 1 73  ? 32.410  68.945  75.667  1.00 0.00 ?  64  VAL A HG11 6  
ATOM 9189  H HG12 . VAL A 1 73  ? 33.967  69.967  75.558  1.00 0.00 ?  64  VAL A HG12 6  
ATOM 9190  H HG13 . VAL A 1 73  ? 32.836  69.736  74.248  1.00 0.00 ?  64  VAL A HG13 6  
ATOM 9191  H HG21 . VAL A 1 73  ? 32.428  66.828  74.617  1.00 0.00 ?  64  VAL A HG21 6  
ATOM 9192  H HG22 . VAL A 1 73  ? 32.894  67.250  73.036  1.00 0.00 ?  64  VAL A HG22 6  
ATOM 9193  H HG23 . VAL A 1 73  ? 33.899  66.037  73.753  1.00 0.00 ?  64  VAL A HG23 6  
ATOM 9194  N N    . MET A 1 74  ? 35.337  70.899  73.075  1.00 0.00 ?  65  MET A N    6  
ATOM 9195  C CA   . MET A 1 74  ? 35.187  72.063  72.193  1.00 0.00 ?  65  MET A CA   6  
ATOM 9196  C C    . MET A 1 74  ? 35.970  71.973  70.944  1.00 0.00 ?  65  MET A C    6  
ATOM 9197  O O    . MET A 1 74  ? 35.547  72.532  69.908  1.00 0.00 ?  65  MET A O    6  
ATOM 9198  C CB   . MET A 1 74  ? 35.523  73.280  73.054  1.00 0.00 ?  65  MET A CB   6  
ATOM 9199  C CG   . MET A 1 74  ? 35.059  74.594  72.339  1.00 0.00 ?  65  MET A CG   6  
ATOM 9200  S SD   . MET A 1 74  ? 33.313  74.986  72.502  1.00 0.00 ?  65  MET A SD   6  
ATOM 9201  C CE   . MET A 1 74  ? 33.154  75.549  74.265  1.00 0.00 ?  65  MET A CE   6  
ATOM 9202  H H    . MET A 1 74  ? 35.883  71.006  73.917  1.00 0.00 ?  65  MET A H    6  
ATOM 9203  H HA   . MET A 1 74  ? 34.193  72.263  71.793  1.00 0.00 ?  65  MET A HA   6  
ATOM 9204  H HB2  . MET A 1 74  ? 35.120  73.290  74.066  1.00 0.00 ?  65  MET A HB2  6  
ATOM 9205  H HB3  . MET A 1 74  ? 36.594  73.398  73.218  1.00 0.00 ?  65  MET A HB3  6  
ATOM 9206  H HG2  . MET A 1 74  ? 35.655  75.358  72.839  1.00 0.00 ?  65  MET A HG2  6  
ATOM 9207  H HG3  . MET A 1 74  ? 35.335  74.654  71.286  1.00 0.00 ?  65  MET A HG3  6  
ATOM 9208  H HE1  . MET A 1 74  ? 33.038  74.636  74.850  1.00 0.00 ?  65  MET A HE1  6  
ATOM 9209  H HE2  . MET A 1 74  ? 34.089  75.964  74.640  1.00 0.00 ?  65  MET A HE2  6  
ATOM 9210  H HE3  . MET A 1 74  ? 32.193  76.052  74.361  1.00 0.00 ?  65  MET A HE3  6  
ATOM 9211  N N    . PHE A 1 75  ? 37.147  71.323  71.034  1.00 0.00 ?  66  PHE A N    6  
ATOM 9212  C CA   . PHE A 1 75  ? 37.758  70.847  69.801  1.00 0.00 ?  66  PHE A CA   6  
ATOM 9213  C C    . PHE A 1 75  ? 36.985  69.864  68.990  1.00 0.00 ?  66  PHE A C    6  
ATOM 9214  O O    . PHE A 1 75  ? 36.823  69.960  67.807  1.00 0.00 ?  66  PHE A O    6  
ATOM 9215  C CB   . PHE A 1 75  ? 39.257  70.611  70.001  1.00 0.00 ?  66  PHE A CB   6  
ATOM 9216  C CG   . PHE A 1 75  ? 40.059  71.880  70.011  1.00 0.00 ?  66  PHE A CG   6  
ATOM 9217  C CD1  . PHE A 1 75  ? 40.069  72.825  71.070  1.00 0.00 ?  66  PHE A CD1  6  
ATOM 9218  C CD2  . PHE A 1 75  ? 40.741  72.177  68.807  1.00 0.00 ?  66  PHE A CD2  6  
ATOM 9219  C CE1  . PHE A 1 75  ? 40.789  74.038  70.925  1.00 0.00 ?  66  PHE A CE1  6  
ATOM 9220  C CE2  . PHE A 1 75  ? 41.262  73.446  68.628  1.00 0.00 ?  66  PHE A CE2  6  
ATOM 9221  C CZ   . PHE A 1 75  ? 41.327  74.365  69.627  1.00 0.00 ?  66  PHE A CZ   6  
ATOM 9222  H H    . PHE A 1 75  ? 37.373  70.829  71.884  1.00 0.00 ?  66  PHE A H    6  
ATOM 9223  H HA   . PHE A 1 75  ? 37.711  71.710  69.137  1.00 0.00 ?  66  PHE A HA   6  
ATOM 9224  H HB2  . PHE A 1 75  ? 39.401  70.087  70.946  1.00 0.00 ?  66  PHE A HB2  6  
ATOM 9225  H HB3  . PHE A 1 75  ? 39.586  69.889  69.254  1.00 0.00 ?  66  PHE A HB3  6  
ATOM 9226  H HD1  . PHE A 1 75  ? 39.654  72.515  72.018  1.00 0.00 ?  66  PHE A HD1  6  
ATOM 9227  H HD2  . PHE A 1 75  ? 40.882  71.423  68.046  1.00 0.00 ?  66  PHE A HD2  6  
ATOM 9228  H HE1  . PHE A 1 75  ? 40.858  74.677  71.793  1.00 0.00 ?  66  PHE A HE1  6  
ATOM 9229  H HE2  . PHE A 1 75  ? 41.779  73.654  67.702  1.00 0.00 ?  66  PHE A HE2  6  
ATOM 9230  H HZ   . PHE A 1 75  ? 41.760  75.339  69.447  1.00 0.00 ?  66  PHE A HZ   6  
ATOM 9231  N N    . LEU A 1 76  ? 36.518  68.762  69.594  1.00 0.00 ?  67  LEU A N    6  
ATOM 9232  C CA   . LEU A 1 76  ? 35.489  67.928  69.024  1.00 0.00 ?  67  LEU A CA   6  
ATOM 9233  C C    . LEU A 1 76  ? 34.279  68.573  68.352  1.00 0.00 ?  67  LEU A C    6  
ATOM 9234  O O    . LEU A 1 76  ? 33.883  68.070  67.331  1.00 0.00 ?  67  LEU A O    6  
ATOM 9235  C CB   . LEU A 1 76  ? 35.096  66.921  70.112  1.00 0.00 ?  67  LEU A CB   6  
ATOM 9236  C CG   . LEU A 1 76  ? 34.527  65.636  69.592  1.00 0.00 ?  67  LEU A CG   6  
ATOM 9237  C CD1  . LEU A 1 76  ? 35.721  64.795  69.189  1.00 0.00 ?  67  LEU A CD1  6  
ATOM 9238  C CD2  . LEU A 1 76  ? 33.902  64.862  70.776  1.00 0.00 ?  67  LEU A CD2  6  
ATOM 9239  H H    . LEU A 1 76  ? 36.571  68.593  70.589  1.00 0.00 ?  67  LEU A H    6  
ATOM 9240  H HA   . LEU A 1 76  ? 35.924  67.340  68.215  1.00 0.00 ?  67  LEU A HA   6  
ATOM 9241  H HB2  . LEU A 1 76  ? 35.849  66.816  70.892  1.00 0.00 ?  67  LEU A HB2  6  
ATOM 9242  H HB3  . LEU A 1 76  ? 34.202  67.389  70.523  1.00 0.00 ?  67  LEU A HB3  6  
ATOM 9243  H HG   . LEU A 1 76  ? 33.945  65.933  68.719  1.00 0.00 ?  67  LEU A HG   6  
ATOM 9244  H HD11 . LEU A 1 76  ? 36.410  64.764  70.033  1.00 0.00 ?  67  LEU A HD11 6  
ATOM 9245  H HD12 . LEU A 1 76  ? 35.449  63.773  68.926  1.00 0.00 ?  67  LEU A HD12 6  
ATOM 9246  H HD13 . LEU A 1 76  ? 36.225  65.199  68.311  1.00 0.00 ?  67  LEU A HD13 6  
ATOM 9247  H HD21 . LEU A 1 76  ? 33.216  65.546  71.276  1.00 0.00 ?  67  LEU A HD21 6  
ATOM 9248  H HD22 . LEU A 1 76  ? 33.406  63.970  70.392  1.00 0.00 ?  67  LEU A HD22 6  
ATOM 9249  H HD23 . LEU A 1 76  ? 34.596  64.499  71.535  1.00 0.00 ?  67  LEU A HD23 6  
ATOM 9250  N N    . PHE A 1 77  ? 33.714  69.553  68.990  1.00 0.00 ?  68  PHE A N    6  
ATOM 9251  C CA   . PHE A 1 77  ? 32.882  70.429  68.213  1.00 0.00 ?  68  PHE A CA   6  
ATOM 9252  C C    . PHE A 1 77  ? 33.482  70.959  66.858  1.00 0.00 ?  68  PHE A C    6  
ATOM 9253  O O    . PHE A 1 77  ? 32.889  70.624  65.843  1.00 0.00 ?  68  PHE A O    6  
ATOM 9254  C CB   . PHE A 1 77  ? 32.331  71.540  69.101  1.00 0.00 ?  68  PHE A CB   6  
ATOM 9255  C CG   . PHE A 1 77  ? 31.754  72.864  68.524  1.00 0.00 ?  68  PHE A CG   6  
ATOM 9256  C CD1  . PHE A 1 77  ? 30.592  72.805  67.749  1.00 0.00 ?  68  PHE A CD1  6  
ATOM 9257  C CD2  . PHE A 1 77  ? 32.428  74.102  68.779  1.00 0.00 ?  68  PHE A CD2  6  
ATOM 9258  C CE1  . PHE A 1 77  ? 30.127  74.008  67.111  1.00 0.00 ?  68  PHE A CE1  6  
ATOM 9259  C CE2  . PHE A 1 77  ? 31.862  75.350  68.297  1.00 0.00 ?  68  PHE A CE2  6  
ATOM 9260  C CZ   . PHE A 1 77  ? 30.722  75.302  67.505  1.00 0.00 ?  68  PHE A CZ   6  
ATOM 9261  H H    . PHE A 1 77  ? 34.044  69.879  69.887  1.00 0.00 ?  68  PHE A H    6  
ATOM 9262  H HA   . PHE A 1 77  ? 31.959  69.914  67.946  1.00 0.00 ?  68  PHE A HA   6  
ATOM 9263  H HB2  . PHE A 1 77  ? 31.495  71.074  69.623  1.00 0.00 ?  68  PHE A HB2  6  
ATOM 9264  H HB3  . PHE A 1 77  ? 33.107  71.870  69.791  1.00 0.00 ?  68  PHE A HB3  6  
ATOM 9265  H HD1  . PHE A 1 77  ? 30.151  71.823  67.660  1.00 0.00 ?  68  PHE A HD1  6  
ATOM 9266  H HD2  . PHE A 1 77  ? 33.305  74.065  69.409  1.00 0.00 ?  68  PHE A HD2  6  
ATOM 9267  H HE1  . PHE A 1 77  ? 29.196  74.062  66.567  1.00 0.00 ?  68  PHE A HE1  6  
ATOM 9268  H HE2  . PHE A 1 77  ? 32.300  76.287  68.606  1.00 0.00 ?  68  PHE A HE2  6  
ATOM 9269  H HZ   . PHE A 1 77  ? 30.277  76.210  67.130  1.00 0.00 ?  68  PHE A HZ   6  
ATOM 9270  N N    . ALA A 1 78  ? 34.612  71.714  66.836  1.00 0.00 ?  69  ALA A N    6  
ATOM 9271  C CA   . ALA A 1 78  ? 35.263  72.150  65.602  1.00 0.00 ?  69  ALA A CA   6  
ATOM 9272  C C    . ALA A 1 78  ? 35.517  71.017  64.560  1.00 0.00 ?  69  ALA A C    6  
ATOM 9273  O O    . ALA A 1 78  ? 35.094  71.145  63.392  1.00 0.00 ?  69  ALA A O    6  
ATOM 9274  C CB   . ALA A 1 78  ? 36.608  73.009  65.776  1.00 0.00 ?  69  ALA A CB   6  
ATOM 9275  H H    . ALA A 1 78  ? 34.959  72.173  67.667  1.00 0.00 ?  69  ALA A H    6  
ATOM 9276  H HA   . ALA A 1 78  ? 34.487  72.797  65.194  1.00 0.00 ?  69  ALA A HA   6  
ATOM 9277  H HB1  . ALA A 1 78  ? 36.888  73.457  64.822  1.00 0.00 ?  69  ALA A HB1  6  
ATOM 9278  H HB2  . ALA A 1 78  ? 36.482  73.782  66.534  1.00 0.00 ?  69  ALA A HB2  6  
ATOM 9279  H HB3  . ALA A 1 78  ? 37.448  72.504  66.252  1.00 0.00 ?  69  ALA A HB3  6  
ATOM 9280  N N    . VAL A 1 79  ? 35.875  69.830  65.058  1.00 0.00 ?  70  VAL A N    6  
ATOM 9281  C CA   . VAL A 1 79  ? 36.246  68.660  64.225  1.00 0.00 ?  70  VAL A CA   6  
ATOM 9282  C C    . VAL A 1 79  ? 35.055  67.917  63.762  1.00 0.00 ?  70  VAL A C    6  
ATOM 9283  O O    . VAL A 1 79  ? 35.079  67.314  62.691  1.00 0.00 ?  70  VAL A O    6  
ATOM 9284  C CB   . VAL A 1 79  ? 37.269  67.783  64.877  1.00 0.00 ?  70  VAL A CB   6  
ATOM 9285  C CG1  . VAL A 1 79  ? 37.753  66.573  64.056  1.00 0.00 ?  70  VAL A CG1  6  
ATOM 9286  C CG2  . VAL A 1 79  ? 38.507  68.759  65.114  1.00 0.00 ?  70  VAL A CG2  6  
ATOM 9287  H H    . VAL A 1 79  ? 36.040  69.715  66.048  1.00 0.00 ?  70  VAL A H    6  
ATOM 9288  H HA   . VAL A 1 79  ? 36.656  69.059  63.297  1.00 0.00 ?  70  VAL A HA   6  
ATOM 9289  H HB   . VAL A 1 79  ? 37.009  67.442  65.879  1.00 0.00 ?  70  VAL A HB   6  
ATOM 9290  H HG11 . VAL A 1 79  ? 36.905  65.891  64.016  1.00 0.00 ?  70  VAL A HG11 6  
ATOM 9291  H HG12 . VAL A 1 79  ? 38.036  66.892  63.052  1.00 0.00 ?  70  VAL A HG12 6  
ATOM 9292  H HG13 . VAL A 1 79  ? 38.575  66.068  64.565  1.00 0.00 ?  70  VAL A HG13 6  
ATOM 9293  H HG21 . VAL A 1 79  ? 39.330  68.146  65.484  1.00 0.00 ?  70  VAL A HG21 6  
ATOM 9294  H HG22 . VAL A 1 79  ? 38.764  69.358  64.241  1.00 0.00 ?  70  VAL A HG22 6  
ATOM 9295  H HG23 . VAL A 1 79  ? 38.253  69.475  65.897  1.00 0.00 ?  70  VAL A HG23 6  
ATOM 9296  N N    . THR A 1 80  ? 33.916  67.902  64.525  1.00 0.00 ?  71  THR A N    6  
ATOM 9297  C CA   . THR A 1 80  ? 32.596  67.615  63.963  1.00 0.00 ?  71  THR A CA   6  
ATOM 9298  C C    . THR A 1 80  ? 32.116  68.545  62.880  1.00 0.00 ?  71  THR A C    6  
ATOM 9299  O O    . THR A 1 80  ? 31.495  68.009  61.951  1.00 0.00 ?  71  THR A O    6  
ATOM 9300  C CB   . THR A 1 80  ? 31.457  67.552  65.116  1.00 0.00 ?  71  THR A CB   6  
ATOM 9301  O OG1  . THR A 1 80  ? 31.869  66.855  66.226  1.00 0.00 ?  71  THR A OG1  6  
ATOM 9302  C CG2  . THR A 1 80  ? 30.208  66.911  64.556  1.00 0.00 ?  71  THR A CG2  6  
ATOM 9303  H H    . THR A 1 80  ? 33.846  68.341  65.432  1.00 0.00 ?  71  THR A H    6  
ATOM 9304  H HA   . THR A 1 80  ? 32.561  66.603  63.560  1.00 0.00 ?  71  THR A HA   6  
ATOM 9305  H HB   . THR A 1 80  ? 31.249  68.541  65.524  1.00 0.00 ?  71  THR A HB   6  
ATOM 9306  H HG1  . THR A 1 80  ? 32.733  67.174  66.497  1.00 0.00 ?  71  THR A HG1  6  
ATOM 9307  H HG21 . THR A 1 80  ? 30.469  66.188  63.783  1.00 0.00 ?  71  THR A HG21 6  
ATOM 9308  H HG22 . THR A 1 80  ? 29.664  66.461  65.387  1.00 0.00 ?  71  THR A HG22 6  
ATOM 9309  H HG23 . THR A 1 80  ? 29.629  67.765  64.205  1.00 0.00 ?  71  THR A HG23 6  
ATOM 9310  N N    . VAL A 1 81  ? 32.576  69.839  62.738  1.00 0.00 ?  72  VAL A N    6  
ATOM 9311  C CA   . VAL A 1 81  ? 32.243  70.663  61.540  1.00 0.00 ?  72  VAL A CA   6  
ATOM 9312  C C    . VAL A 1 81  ? 32.947  70.124  60.250  1.00 0.00 ?  72  VAL A C    6  
ATOM 9313  O O    . VAL A 1 81  ? 32.372  69.871  59.208  1.00 0.00 ?  72  VAL A O    6  
ATOM 9314  C CB   . VAL A 1 81  ? 32.334  72.206  61.612  1.00 0.00 ?  72  VAL A CB   6  
ATOM 9315  C CG1  . VAL A 1 81  ? 31.560  72.915  60.515  1.00 0.00 ?  72  VAL A CG1  6  
ATOM 9316  C CG2  . VAL A 1 81  ? 31.872  72.822  63.003  1.00 0.00 ?  72  VAL A CG2  6  
ATOM 9317  H H    . VAL A 1 81  ? 33.222  70.209  63.421  1.00 0.00 ?  72  VAL A H    6  
ATOM 9318  H HA   . VAL A 1 81  ? 31.214  70.361  61.342  1.00 0.00 ?  72  VAL A HA   6  
ATOM 9319  H HB   . VAL A 1 81  ? 33.373  72.449  61.390  1.00 0.00 ?  72  VAL A HB   6  
ATOM 9320  H HG11 . VAL A 1 81  ? 31.692  72.466  59.531  1.00 0.00 ?  72  VAL A HG11 6  
ATOM 9321  H HG12 . VAL A 1 81  ? 30.526  72.694  60.781  1.00 0.00 ?  72  VAL A HG12 6  
ATOM 9322  H HG13 . VAL A 1 81  ? 31.797  73.976  60.594  1.00 0.00 ?  72  VAL A HG13 6  
ATOM 9323  H HG21 . VAL A 1 81  ? 30.826  72.643  63.250  1.00 0.00 ?  72  VAL A HG21 6  
ATOM 9324  H HG22 . VAL A 1 81  ? 32.461  72.209  63.686  1.00 0.00 ?  72  VAL A HG22 6  
ATOM 9325  H HG23 . VAL A 1 81  ? 32.227  73.849  63.083  1.00 0.00 ?  72  VAL A HG23 6  
ATOM 9326  N N    . GLY A 1 82  ? 34.199  69.832  60.462  1.00 0.00 ?  73  GLY A N    6  
ATOM 9327  C CA   . GLY A 1 82  ? 35.029  69.110  59.463  1.00 0.00 ?  73  GLY A CA   6  
ATOM 9328  C C    . GLY A 1 82  ? 34.433  67.733  59.147  1.00 0.00 ?  73  GLY A C    6  
ATOM 9329  O O    . GLY A 1 82  ? 34.333  67.322  57.979  1.00 0.00 ?  73  GLY A O    6  
ATOM 9330  H H    . GLY A 1 82  ? 34.643  70.124  61.320  1.00 0.00 ?  73  GLY A H    6  
ATOM 9331  H HA2  . GLY A 1 82  ? 35.080  69.625  58.504  1.00 0.00 ?  73  GLY A HA2  6  
ATOM 9332  H HA3  . GLY A 1 82  ? 36.045  69.022  59.848  1.00 0.00 ?  73  GLY A HA3  6  
ATOM 9333  N N    . SER A 1 83  ? 33.738  67.175  60.141  1.00 0.00 ?  74  SER A N    6  
ATOM 9334  C CA   . SER A 1 83  ? 33.045  65.837  59.980  1.00 0.00 ?  74  SER A CA   6  
ATOM 9335  C C    . SER A 1 83  ? 31.634  65.901  59.320  1.00 0.00 ?  74  SER A C    6  
ATOM 9336  O O    . SER A 1 83  ? 31.070  64.865  58.902  1.00 0.00 ?  74  SER A O    6  
ATOM 9337  C CB   . SER A 1 83  ? 32.893  65.087  61.205  1.00 0.00 ?  74  SER A CB   6  
ATOM 9338  O OG   . SER A 1 83  ? 34.020  65.004  62.053  1.00 0.00 ?  74  SER A OG   6  
ATOM 9339  H H    . SER A 1 83  ? 33.779  67.589  61.062  1.00 0.00 ?  74  SER A H    6  
ATOM 9340  H HA   . SER A 1 83  ? 33.593  65.196  59.290  1.00 0.00 ?  74  SER A HA   6  
ATOM 9341  H HB2  . SER A 1 83  ? 32.047  65.471  61.775  1.00 0.00 ?  74  SER A HB2  6  
ATOM 9342  H HB3  . SER A 1 83  ? 32.606  64.047  61.049  1.00 0.00 ?  74  SER A HB3  6  
ATOM 9343  H HG   . SER A 1 83  ? 34.348  65.873  62.292  1.00 0.00 ?  74  SER A HG   6  
ATOM 9344  N N    . LEU A 1 84  ? 31.081  67.132  59.079  1.00 0.00 ?  75  LEU A N    6  
ATOM 9345  C CA   . LEU A 1 84  ? 30.127  67.438  58.010  1.00 0.00 ?  75  LEU A CA   6  
ATOM 9346  C C    . LEU A 1 84  ? 30.684  67.240  56.629  1.00 0.00 ?  75  LEU A C    6  
ATOM 9347  O O    . LEU A 1 84  ? 30.173  66.506  55.766  1.00 0.00 ?  75  LEU A O    6  
ATOM 9348  C CB   . LEU A 1 84  ? 29.368  68.751  58.219  1.00 0.00 ?  75  LEU A CB   6  
ATOM 9349  C CG   . LEU A 1 84  ? 28.491  68.951  59.447  1.00 0.00 ?  75  LEU A CG   6  
ATOM 9350  C CD1  . LEU A 1 84  ? 28.068  70.415  59.616  1.00 0.00 ?  75  LEU A CD1  6  
ATOM 9351  C CD2  . LEU A 1 84  ? 27.145  68.172  59.417  1.00 0.00 ?  75  LEU A CD2  6  
ATOM 9352  H H    . LEU A 1 84  ? 31.561  67.958  59.407  1.00 0.00 ?  75  LEU A H    6  
ATOM 9353  H HA   . LEU A 1 84  ? 29.358  66.670  57.953  1.00 0.00 ?  75  LEU A HA   6  
ATOM 9354  H HB2  . LEU A 1 84  ? 30.121  69.527  58.358  1.00 0.00 ?  75  LEU A HB2  6  
ATOM 9355  H HB3  . LEU A 1 84  ? 28.852  68.908  57.272  1.00 0.00 ?  75  LEU A HB3  6  
ATOM 9356  H HG   . LEU A 1 84  ? 29.082  68.622  60.301  1.00 0.00 ?  75  LEU A HG   6  
ATOM 9357  H HD11 . LEU A 1 84  ? 27.371  70.494  60.450  1.00 0.00 ?  75  LEU A HD11 6  
ATOM 9358  H HD12 . LEU A 1 84  ? 28.907  71.069  59.852  1.00 0.00 ?  75  LEU A HD12 6  
ATOM 9359  H HD13 . LEU A 1 84  ? 27.614  70.723  58.674  1.00 0.00 ?  75  LEU A HD13 6  
ATOM 9360  H HD21 . LEU A 1 84  ? 27.399  67.180  59.042  1.00 0.00 ?  75  LEU A HD21 6  
ATOM 9361  H HD22 . LEU A 1 84  ? 26.740  68.180  60.428  1.00 0.00 ?  75  LEU A HD22 6  
ATOM 9362  H HD23 . LEU A 1 84  ? 26.486  68.663  58.702  1.00 0.00 ?  75  LEU A HD23 6  
ATOM 9363  N N    . ILE A 1 85  ? 31.893  67.863  56.402  1.00 0.00 ?  76  ILE A N    6  
ATOM 9364  C CA   . ILE A 1 85  ? 32.632  67.701  55.117  1.00 0.00 ?  76  ILE A CA   6  
ATOM 9365  C C    . ILE A 1 85  ? 33.044  66.213  54.829  1.00 0.00 ?  76  ILE A C    6  
ATOM 9366  O O    . ILE A 1 85  ? 32.674  65.674  53.817  1.00 0.00 ?  76  ILE A O    6  
ATOM 9367  C CB   . ILE A 1 85  ? 33.869  68.577  54.991  1.00 0.00 ?  76  ILE A CB   6  
ATOM 9368  C CG1  . ILE A 1 85  ? 33.698  70.107  55.518  1.00 0.00 ?  76  ILE A CG1  6  
ATOM 9369  C CG2  . ILE A 1 85  ? 34.369  68.667  53.570  1.00 0.00 ?  76  ILE A CG2  6  
ATOM 9370  C CD1  . ILE A 1 85  ? 32.481  70.843  54.904  1.00 0.00 ?  76  ILE A CD1  6  
ATOM 9371  H H    . ILE A 1 85  ? 32.234  68.419  57.172  1.00 0.00 ?  76  ILE A H    6  
ATOM 9372  H HA   . ILE A 1 85  ? 31.906  67.961  54.346  1.00 0.00 ?  76  ILE A HA   6  
ATOM 9373  H HB   . ILE A 1 85  ? 34.726  68.208  55.556  1.00 0.00 ?  76  ILE A HB   6  
ATOM 9374  H HG12 . ILE A 1 85  ? 33.604  69.973  56.596  1.00 0.00 ?  76  ILE A HG12 6  
ATOM 9375  H HG13 . ILE A 1 85  ? 34.602  70.670  55.289  1.00 0.00 ?  76  ILE A HG13 6  
ATOM 9376  H HG21 . ILE A 1 85  ? 35.147  69.405  53.378  1.00 0.00 ?  76  ILE A HG21 6  
ATOM 9377  H HG22 . ILE A 1 85  ? 34.859  67.737  53.283  1.00 0.00 ?  76  ILE A HG22 6  
ATOM 9378  H HG23 . ILE A 1 85  ? 33.509  68.715  52.900  1.00 0.00 ?  76  ILE A HG23 6  
ATOM 9379  H HD11 . ILE A 1 85  ? 32.563  70.864  53.817  1.00 0.00 ?  76  ILE A HD11 6  
ATOM 9380  H HD12 . ILE A 1 85  ? 31.576  70.310  55.193  1.00 0.00 ?  76  ILE A HD12 6  
ATOM 9381  H HD13 . ILE A 1 85  ? 32.231  71.853  55.229  1.00 0.00 ?  76  ILE A HD13 6  
ATOM 9382  N N    . LEU A 1 86  ? 33.747  65.563  55.749  1.00 0.00 ?  77  LEU A N    6  
ATOM 9383  C CA   . LEU A 1 86  ? 34.019  64.159  55.714  1.00 0.00 ?  77  LEU A CA   6  
ATOM 9384  C C    . LEU A 1 86  ? 32.796  63.207  55.872  1.00 0.00 ?  77  LEU A C    6  
ATOM 9385  O O    . LEU A 1 86  ? 32.852  62.080  55.327  1.00 0.00 ?  77  LEU A O    6  
ATOM 9386  C CB   . LEU A 1 86  ? 35.129  63.780  56.791  1.00 0.00 ?  77  LEU A CB   6  
ATOM 9387  C CG   . LEU A 1 86  ? 36.294  64.669  57.093  1.00 0.00 ?  77  LEU A CG   6  
ATOM 9388  C CD1  . LEU A 1 86  ? 37.046  64.122  58.281  1.00 0.00 ?  77  LEU A CD1  6  
ATOM 9389  C CD2  . LEU A 1 86  ? 37.287  64.661  55.904  1.00 0.00 ?  77  LEU A CD2  6  
ATOM 9390  H H    . LEU A 1 86  ? 33.925  65.998  56.644  1.00 0.00 ?  77  LEU A H    6  
ATOM 9391  H HA   . LEU A 1 86  ? 34.426  63.961  54.722  1.00 0.00 ?  77  LEU A HA   6  
ATOM 9392  H HB2  . LEU A 1 86  ? 34.494  63.646  57.667  1.00 0.00 ?  77  LEU A HB2  6  
ATOM 9393  H HB3  . LEU A 1 86  ? 35.600  62.836  56.520  1.00 0.00 ?  77  LEU A HB3  6  
ATOM 9394  H HG   . LEU A 1 86  ? 35.943  65.674  57.330  1.00 0.00 ?  77  LEU A HG   6  
ATOM 9395  H HD11 . LEU A 1 86  ? 36.387  63.905  59.121  1.00 0.00 ?  77  LEU A HD11 6  
ATOM 9396  H HD12 . LEU A 1 86  ? 37.654  63.243  58.067  1.00 0.00 ?  77  LEU A HD12 6  
ATOM 9397  H HD13 . LEU A 1 86  ? 37.847  64.809  58.555  1.00 0.00 ?  77  LEU A HD13 6  
ATOM 9398  H HD21 . LEU A 1 86  ? 38.261  65.088  56.145  1.00 0.00 ?  77  LEU A HD21 6  
ATOM 9399  H HD22 . LEU A 1 86  ? 37.516  63.661  55.536  1.00 0.00 ?  77  LEU A HD22 6  
ATOM 9400  H HD23 . LEU A 1 86  ? 36.846  65.252  55.101  1.00 0.00 ?  77  LEU A HD23 6  
ATOM 9401  N N    . GLY A 1 87  ? 31.700  63.744  56.426  1.00 0.00 ?  78  GLY A N    6  
ATOM 9402  C CA   . GLY A 1 87  ? 30.411  63.052  56.280  1.00 0.00 ?  78  GLY A CA   6  
ATOM 9403  C C    . GLY A 1 87  ? 29.898  62.940  54.806  1.00 0.00 ?  78  GLY A C    6  
ATOM 9404  O O    . GLY A 1 87  ? 29.232  61.952  54.532  1.00 0.00 ?  78  GLY A O    6  
ATOM 9405  H H    . GLY A 1 87  ? 31.737  64.742  56.581  1.00 0.00 ?  78  GLY A H    6  
ATOM 9406  H HA2  . GLY A 1 87  ? 30.594  62.008  56.529  1.00 0.00 ?  78  GLY A HA2  6  
ATOM 9407  H HA3  . GLY A 1 87  ? 29.540  63.435  56.813  1.00 0.00 ?  78  GLY A HA3  6  
ATOM 9408  N N    . TYR A 1 88  ? 30.311  63.849  53.895  1.00 0.00 ?  79  TYR A N    6  
ATOM 9409  C CA   . TYR A 1 88  ? 30.373  63.805  52.503  1.00 0.00 ?  79  TYR A CA   6  
ATOM 9410  C C    . TYR A 1 88  ? 31.571  63.039  51.810  1.00 0.00 ?  79  TYR A C    6  
ATOM 9411  O O    . TYR A 1 88  ? 31.364  62.475  50.767  1.00 0.00 ?  79  TYR A O    6  
ATOM 9412  C CB   . TYR A 1 88  ? 30.075  65.196  51.941  1.00 0.00 ?  79  TYR A CB   6  
ATOM 9413  C CG   . TYR A 1 88  ? 30.424  65.539  50.463  1.00 0.00 ?  79  TYR A CG   6  
ATOM 9414  C CD1  . TYR A 1 88  ? 29.801  64.829  49.394  1.00 0.00 ?  79  TYR A CD1  6  
ATOM 9415  C CD2  . TYR A 1 88  ? 31.277  66.532  50.162  1.00 0.00 ?  79  TYR A CD2  6  
ATOM 9416  C CE1  . TYR A 1 88  ? 29.865  65.266  48.097  1.00 0.00 ?  79  TYR A CE1  6  
ATOM 9417  C CE2  . TYR A 1 88  ? 31.428  66.999  48.842  1.00 0.00 ?  79  TYR A CE2  6  
ATOM 9418  C CZ   . TYR A 1 88  ? 30.702  66.413  47.797  1.00 0.00 ?  79  TYR A CZ   6  
ATOM 9419  O OH   . TYR A 1 88  ? 30.784  66.922  46.581  1.00 0.00 ?  79  TYR A OH   6  
ATOM 9420  H H    . TYR A 1 88  ? 30.744  64.684  54.264  1.00 0.00 ?  79  TYR A H    6  
ATOM 9421  H HA   . TYR A 1 88  ? 29.484  63.213  52.282  1.00 0.00 ?  79  TYR A HA   6  
ATOM 9422  H HB2  . TYR A 1 88  ? 29.008  65.316  52.126  1.00 0.00 ?  79  TYR A HB2  6  
ATOM 9423  H HB3  . TYR A 1 88  ? 30.579  65.926  52.575  1.00 0.00 ?  79  TYR A HB3  6  
ATOM 9424  H HD1  . TYR A 1 88  ? 29.053  64.096  49.661  1.00 0.00 ?  79  TYR A HD1  6  
ATOM 9425  H HD2  . TYR A 1 88  ? 31.814  67.157  50.859  1.00 0.00 ?  79  TYR A HD2  6  
ATOM 9426  H HE1  . TYR A 1 88  ? 29.258  64.805  47.332  1.00 0.00 ?  79  TYR A HE1  6  
ATOM 9427  H HE2  . TYR A 1 88  ? 32.052  67.809  48.493  1.00 0.00 ?  79  TYR A HE2  6  
ATOM 9428  H HH   . TYR A 1 88  ? 30.521  66.264  45.932  1.00 0.00 ?  79  TYR A HH   6  
ATOM 9429  N N    . THR A 1 89  ? 32.852  63.179  52.291  1.00 0.00 ?  80  THR A N    6  
ATOM 9430  C CA   . THR A 1 89  ? 34.054  62.658  51.625  1.00 0.00 ?  80  THR A CA   6  
ATOM 9431  C C    . THR A 1 89  ? 34.586  61.286  52.068  1.00 0.00 ?  80  THR A C    6  
ATOM 9432  O O    . THR A 1 89  ? 34.579  60.308  51.269  1.00 0.00 ?  80  THR A O    6  
ATOM 9433  C CB   . THR A 1 89  ? 35.177  63.722  51.429  1.00 0.00 ?  80  THR A CB   6  
ATOM 9434  O OG1  . THR A 1 89  ? 36.037  63.850  52.590  1.00 0.00 ?  80  THR A OG1  6  
ATOM 9435  C CG2  . THR A 1 89  ? 34.543  65.034  51.040  1.00 0.00 ?  80  THR A CG2  6  
ATOM 9436  H H    . THR A 1 89  ? 32.986  63.736  53.123  1.00 0.00 ?  80  THR A H    6  
ATOM 9437  H HA   . THR A 1 89  ? 33.750  62.467  50.597  1.00 0.00 ?  80  THR A HA   6  
ATOM 9438  H HB   . THR A 1 89  ? 35.878  63.456  50.639  1.00 0.00 ?  80  THR A HB   6  
ATOM 9439  H HG1  . THR A 1 89  ? 36.673  64.564  52.500  1.00 0.00 ?  80  THR A HG1  6  
ATOM 9440  H HG21 . THR A 1 89  ? 33.957  65.466  51.851  1.00 0.00 ?  80  THR A HG21 6  
ATOM 9441  H HG22 . THR A 1 89  ? 35.337  65.681  50.667  1.00 0.00 ?  80  THR A HG22 6  
ATOM 9442  H HG23 . THR A 1 89  ? 33.768  64.879  50.290  1.00 0.00 ?  80  THR A HG23 6  
ATOM 9443  N N    . ARG A 1 90  ? 35.097  61.210  53.289  1.00 0.00 ?  81  ARG A N    6  
ATOM 9444  C CA   . ARG A 1 90  ? 35.647  59.972  53.901  1.00 0.00 ?  81  ARG A CA   6  
ATOM 9445  C C    . ARG A 1 90  ? 34.664  59.218  54.911  1.00 0.00 ?  81  ARG A C    6  
ATOM 9446  O O    . ARG A 1 90  ? 35.206  58.446  55.689  1.00 0.00 ?  81  ARG A O    6  
ATOM 9447  C CB   . ARG A 1 90  ? 36.996  60.412  54.617  1.00 0.00 ?  81  ARG A CB   6  
ATOM 9448  C CG   . ARG A 1 90  ? 38.068  60.693  53.466  1.00 0.00 ?  81  ARG A CG   6  
ATOM 9449  C CD   . ARG A 1 90  ? 38.776  59.486  52.838  1.00 0.00 ?  81  ARG A CD   6  
ATOM 9450  N NE   . ARG A 1 90  ? 39.762  59.884  51.775  1.00 0.00 ?  81  ARG A NE   6  
ATOM 9451  C CZ   . ARG A 1 90  ? 41.073  60.016  51.860  1.00 0.00 ?  81  ARG A CZ   6  
ATOM 9452  N NH1  . ARG A 1 90  ? 41.790  59.852  52.934  1.00 0.00 ?  81  ARG A NH1  6  
ATOM 9453  N NH2  . ARG A 1 90  ? 41.716  60.376  50.766  1.00 0.00 1  81  ARG A NH2  6  
ATOM 9454  H H    . ARG A 1 90  ? 34.893  62.052  53.808  1.00 0.00 ?  81  ARG A H    6  
ATOM 9455  H HA   . ARG A 1 90  ? 35.934  59.214  53.171  1.00 0.00 ?  81  ARG A HA   6  
ATOM 9456  H HB2  . ARG A 1 90  ? 36.996  61.292  55.260  1.00 0.00 ?  81  ARG A HB2  6  
ATOM 9457  H HB3  . ARG A 1 90  ? 37.345  59.545  55.179  1.00 0.00 ?  81  ARG A HB3  6  
ATOM 9458  H HG2  . ARG A 1 90  ? 37.577  61.329  52.729  1.00 0.00 ?  81  ARG A HG2  6  
ATOM 9459  H HG3  . ARG A 1 90  ? 38.914  61.250  53.868  1.00 0.00 ?  81  ARG A HG3  6  
ATOM 9460  H HD2  . ARG A 1 90  ? 39.216  58.929  53.665  1.00 0.00 ?  81  ARG A HD2  6  
ATOM 9461  H HD3  . ARG A 1 90  ? 38.071  58.792  52.380  1.00 0.00 ?  81  ARG A HD3  6  
ATOM 9462  H HE   . ARG A 1 90  ? 39.347  60.114  50.883  1.00 0.00 ?  81  ARG A HE   6  
ATOM 9463  H HH11 . ARG A 1 90  ? 41.326  59.549  53.778  1.00 0.00 ?  81  ARG A HH11 6  
ATOM 9464  H HH12 . ARG A 1 90  ? 42.757  60.139  52.912  1.00 0.00 ?  81  ARG A HH12 6  
ATOM 9465  H HH21 . ARG A 1 90  ? 41.126  60.498  49.956  1.00 0.00 ?  81  ARG A HH21 6  
ATOM 9466  H HH22 . ARG A 1 90  ? 42.713  60.538  50.793  1.00 0.00 ?  81  ARG A HH22 6  
ATOM 9467  N N    . SER A 1 91  ? 33.335  59.413  54.902  1.00 0.00 ?  82  SER A N    6  
ATOM 9468  C CA   . SER A 1 91  ? 32.484  58.621  55.867  1.00 0.00 ?  82  SER A CA   6  
ATOM 9469  C C    . SER A 1 91  ? 32.372  57.113  55.601  1.00 0.00 ?  82  SER A C    6  
ATOM 9470  O O    . SER A 1 91  ? 31.804  56.459  56.436  1.00 0.00 ?  82  SER A O    6  
ATOM 9471  C CB   . SER A 1 91  ? 31.153  59.284  55.872  1.00 0.00 ?  82  SER A CB   6  
ATOM 9472  O OG   . SER A 1 91  ? 30.681  59.417  54.546  1.00 0.00 ?  82  SER A OG   6  
ATOM 9473  H H    . SER A 1 91  ? 32.895  60.225  54.493  1.00 0.00 ?  82  SER A H    6  
ATOM 9474  H HA   . SER A 1 91  ? 32.859  58.691  56.887  1.00 0.00 ?  82  SER A HA   6  
ATOM 9475  H HB2  . SER A 1 91  ? 30.379  58.743  56.417  1.00 0.00 ?  82  SER A HB2  6  
ATOM 9476  H HB3  . SER A 1 91  ? 31.334  60.221  56.400  1.00 0.00 ?  82  SER A HB3  6  
ATOM 9477  H HG   . SER A 1 91  ? 30.049  60.139  54.573  1.00 0.00 ?  82  SER A HG   6  
ATOM 9478  N N    . ARG A 1 92  ? 32.943  56.569  54.505  1.00 0.00 ?  83  ARG A N    6  
ATOM 9479  C CA   . ARG A 1 92  ? 33.067  55.091  54.404  1.00 0.00 ?  83  ARG A CA   6  
ATOM 9480  C C    . ARG A 1 92  ? 33.606  54.343  55.606  1.00 0.00 ?  83  ARG A C    6  
ATOM 9481  O O    . ARG A 1 92  ? 34.627  54.623  56.087  1.00 0.00 ?  83  ARG A O    6  
ATOM 9482  C CB   . ARG A 1 92  ? 33.736  54.712  53.082  1.00 0.00 ?  83  ARG A CB   6  
ATOM 9483  C CG   . ARG A 1 92  ? 35.171  55.277  52.910  1.00 0.00 ?  83  ARG A CG   6  
ATOM 9484  C CD   . ARG A 1 92  ? 35.711  54.884  51.505  1.00 0.00 ?  83  ARG A CD   6  
ATOM 9485  N NE   . ARG A 1 92  ? 37.023  55.537  51.419  1.00 0.00 ?  83  ARG A NE   6  
ATOM 9486  C CZ   . ARG A 1 92  ? 38.205  55.102  51.735  1.00 0.00 ?  83  ARG A CZ   6  
ATOM 9487  N NH1  . ARG A 1 92  ? 38.321  54.021  52.356  1.00 0.00 ?  83  ARG A NH1  6  
ATOM 9488  N NH2  . ARG A 1 92  ? 39.276  55.783  51.533  1.00 0.00 1  83  ARG A NH2  6  
ATOM 9489  H H    . ARG A 1 92  ? 33.332  57.266  53.885  1.00 0.00 ?  83  ARG A H    6  
ATOM 9490  H HA   . ARG A 1 92  ? 32.067  54.701  54.213  1.00 0.00 ?  83  ARG A HA   6  
ATOM 9491  H HB2  . ARG A 1 92  ? 33.793  53.624  53.053  1.00 0.00 ?  83  ARG A HB2  6  
ATOM 9492  H HB3  . ARG A 1 92  ? 33.176  55.052  52.211  1.00 0.00 ?  83  ARG A HB3  6  
ATOM 9493  H HG2  . ARG A 1 92  ? 35.066  56.358  52.820  1.00 0.00 ?  83  ARG A HG2  6  
ATOM 9494  H HG3  . ARG A 1 92  ? 35.881  54.980  53.683  1.00 0.00 ?  83  ARG A HG3  6  
ATOM 9495  H HD2  . ARG A 1 92  ? 35.865  53.810  51.397  1.00 0.00 ?  83  ARG A HD2  6  
ATOM 9496  H HD3  . ARG A 1 92  ? 34.972  55.199  50.768  1.00 0.00 ?  83  ARG A HD3  6  
ATOM 9497  H HE   . ARG A 1 92  ? 37.009  56.468  51.029  1.00 0.00 ?  83  ARG A HE   6  
ATOM 9498  H HH11 . ARG A 1 92  ? 37.476  53.498  52.542  1.00 0.00 ?  83  ARG A HH11 6  
ATOM 9499  H HH12 . ARG A 1 92  ? 39.172  53.671  52.773  1.00 0.00 ?  83  ARG A HH12 6  
ATOM 9500  H HH21 . ARG A 1 92  ? 39.258  56.374  50.714  1.00 0.00 ?  83  ARG A HH21 6  
ATOM 9501  H HH22 . ARG A 1 92  ? 40.135  55.559  52.014  1.00 0.00 ?  83  ARG A HH22 6  
ATOM 9502  N N    . LYS A 1 93  ? 33.048  53.189  55.907  1.00 0.00 ?  84  LYS A N    6  
ATOM 9503  C CA   . LYS A 1 93  ? 33.677  52.001  56.546  1.00 0.00 ?  84  LYS A CA   6  
ATOM 9504  C C    . LYS A 1 93  ? 34.464  51.096  55.614  1.00 0.00 ?  84  LYS A C    6  
ATOM 9505  O O    . LYS A 1 93  ? 35.497  50.520  56.093  1.00 0.00 ?  84  LYS A O    6  
ATOM 9506  C CB   . LYS A 1 93  ? 32.549  51.204  57.326  1.00 0.00 ?  84  LYS A CB   6  
ATOM 9507  C CG   . LYS A 1 93  ? 32.847  49.796  57.823  1.00 0.00 ?  84  LYS A CG   6  
ATOM 9508  C CD   . LYS A 1 93  ? 31.707  49.377  58.659  1.00 0.00 ?  84  LYS A CD   6  
ATOM 9509  C CE   . LYS A 1 93  ? 31.830  48.090  59.359  1.00 0.00 ?  84  LYS A CE   6  
ATOM 9510  N NZ   . LYS A 1 93  ? 32.223  46.902  58.460  1.00 0.00 1  84  LYS A NZ   6  
ATOM 9511  H H    . LYS A 1 93  ? 32.217  52.978  55.372  1.00 0.00 ?  84  LYS A H    6  
ATOM 9512  H HA   . LYS A 1 93  ? 34.316  52.238  57.397  1.00 0.00 ?  84  LYS A HA   6  
ATOM 9513  H HB2  . LYS A 1 93  ? 32.351  51.848  58.183  1.00 0.00 ?  84  LYS A HB2  6  
ATOM 9514  H HB3  . LYS A 1 93  ? 31.589  51.158  56.812  1.00 0.00 ?  84  LYS A HB3  6  
ATOM 9515  H HG2  . LYS A 1 93  ? 32.937  49.184  56.924  1.00 0.00 ?  84  LYS A HG2  6  
ATOM 9516  H HG3  . LYS A 1 93  ? 33.814  49.764  58.325  1.00 0.00 ?  84  LYS A HG3  6  
ATOM 9517  H HD2  . LYS A 1 93  ? 31.171  50.223  59.087  1.00 0.00 ?  84  LYS A HD2  6  
ATOM 9518  H HD3  . LYS A 1 93  ? 30.990  49.232  57.850  1.00 0.00 ?  84  LYS A HD3  6  
ATOM 9519  H HE2  . LYS A 1 93  ? 32.599  48.221  60.121  1.00 0.00 ?  84  LYS A HE2  6  
ATOM 9520  H HE3  . LYS A 1 93  ? 30.866  47.870  59.818  1.00 0.00 ?  84  LYS A HE3  6  
ATOM 9521  H HZ1  . LYS A 1 93  ? 33.164  47.024  58.113  1.00 0.00 ?  84  LYS A HZ1  6  
ATOM 9522  H HZ2  . LYS A 1 93  ? 32.334  46.035  58.966  1.00 0.00 ?  84  LYS A HZ2  6  
ATOM 9523  H HZ3  . LYS A 1 93  ? 31.610  46.749  57.673  1.00 0.00 ?  84  LYS A HZ3  6  
ATOM 9524  N N    . VAL A 1 94  ? 34.129  50.921  54.347  1.00 0.00 ?  85  VAL A N    6  
ATOM 9525  C CA   . VAL A 1 94  ? 34.822  50.099  53.358  1.00 0.00 ?  85  VAL A CA   6  
ATOM 9526  C C    . VAL A 1 94  ? 36.147  50.625  52.978  1.00 0.00 ?  85  VAL A C    6  
ATOM 9527  O O    . VAL A 1 94  ? 36.291  51.771  52.671  1.00 0.00 ?  85  VAL A O    6  
ATOM 9528  C CB   . VAL A 1 94  ? 33.878  49.650  52.238  1.00 0.00 ?  85  VAL A CB   6  
ATOM 9529  C CG1  . VAL A 1 94  ? 33.877  50.600  51.030  1.00 0.00 ?  85  VAL A CG1  6  
ATOM 9530  C CG2  . VAL A 1 94  ? 34.366  48.249  51.859  1.00 0.00 ?  85  VAL A CG2  6  
ATOM 9531  H H    . VAL A 1 94  ? 33.271  51.369  54.059  1.00 0.00 ?  85  VAL A H    6  
ATOM 9532  H HA   . VAL A 1 94  ? 35.011  49.219  53.973  1.00 0.00 ?  85  VAL A HA   6  
ATOM 9533  H HB   . VAL A 1 94  ? 32.832  49.581  52.536  1.00 0.00 ?  85  VAL A HB   6  
ATOM 9534  H HG11 . VAL A 1 94  ? 33.501  51.574  51.340  1.00 0.00 ?  85  VAL A HG11 6  
ATOM 9535  H HG12 . VAL A 1 94  ? 34.830  50.727  50.517  1.00 0.00 ?  85  VAL A HG12 6  
ATOM 9536  H HG13 . VAL A 1 94  ? 33.308  50.121  50.232  1.00 0.00 ?  85  VAL A HG13 6  
ATOM 9537  H HG21 . VAL A 1 94  ? 34.537  47.606  52.722  1.00 0.00 ?  85  VAL A HG21 6  
ATOM 9538  H HG22 . VAL A 1 94  ? 33.558  47.778  51.297  1.00 0.00 ?  85  VAL A HG22 6  
ATOM 9539  H HG23 . VAL A 1 94  ? 35.295  48.254  51.290  1.00 0.00 ?  85  VAL A HG23 6  
ATOM 9540  N N    . ASP A 1 95  ? 37.132  49.730  52.923  1.00 0.00 ?  86  ASP A N    6  
ATOM 9541  C CA   . ASP A 1 95  ? 38.460  50.093  52.529  1.00 0.00 ?  86  ASP A CA   6  
ATOM 9542  C C    . ASP A 1 95  ? 38.722  50.251  50.976  1.00 0.00 ?  86  ASP A C    6  
ATOM 9543  O O    . ASP A 1 95  ? 37.850  49.879  50.190  1.00 0.00 ?  86  ASP A O    6  
ATOM 9544  C CB   . ASP A 1 95  ? 39.534  49.112  53.208  1.00 0.00 ?  86  ASP A CB   6  
ATOM 9545  C CG   . ASP A 1 95  ? 39.260  47.595  53.226  1.00 0.00 ?  86  ASP A CG   6  
ATOM 9546  O OD1  . ASP A 1 95  ? 38.105  47.119  53.539  1.00 0.00 ?  86  ASP A OD1  6  
ATOM 9547  O OD2  . ASP A 1 95  ? 40.245  46.880  52.980  1.00 0.00 -1 86  ASP A OD2  6  
ATOM 9548  H H    . ASP A 1 95  ? 36.896  48.822  53.299  1.00 0.00 ?  86  ASP A H    6  
ATOM 9549  H HA   . ASP A 1 95  ? 38.651  51.062  52.989  1.00 0.00 ?  86  ASP A HA   6  
ATOM 9550  H HB2  . ASP A 1 95  ? 40.501  49.278  52.733  1.00 0.00 ?  86  ASP A HB2  6  
ATOM 9551  H HB3  . ASP A 1 95  ? 39.558  49.426  54.251  1.00 0.00 ?  86  ASP A HB3  6  
ATOM 9552  N N    . LYS A 1 96  ? 39.923  50.672  50.636  1.00 0.00 ?  87  LYS A N    6  
ATOM 9553  C CA   . LYS A 1 96  ? 40.385  50.806  49.255  1.00 0.00 ?  87  LYS A CA   6  
ATOM 9554  C C    . LYS A 1 96  ? 40.631  49.432  48.526  1.00 0.00 ?  87  LYS A C    6  
ATOM 9555  O O    . LYS A 1 96  ? 41.746  48.930  48.427  1.00 0.00 ?  87  LYS A O    6  
ATOM 9556  C CB   . LYS A 1 96  ? 41.657  51.648  49.172  1.00 0.00 ?  87  LYS A CB   6  
ATOM 9557  C CG   . LYS A 1 96  ? 41.441  53.173  49.591  1.00 0.00 ?  87  LYS A CG   6  
ATOM 9558  C CD   . LYS A 1 96  ? 40.144  53.800  48.810  1.00 0.00 ?  87  LYS A CD   6  
ATOM 9559  C CE   . LYS A 1 96  ? 40.350  54.013  47.323  1.00 0.00 ?  87  LYS A CE   6  
ATOM 9560  N NZ   . LYS A 1 96  ? 41.628  54.652  46.991  1.00 0.00 1  87  LYS A NZ   6  
ATOM 9561  H H    . LYS A 1 96  ? 40.679  50.963  51.240  1.00 0.00 ?  87  LYS A H    6  
ATOM 9562  H HA   . LYS A 1 96  ? 39.518  51.159  48.698  1.00 0.00 ?  87  LYS A HA   6  
ATOM 9563  H HB2  . LYS A 1 96  ? 42.445  51.198  49.775  1.00 0.00 ?  87  LYS A HB2  6  
ATOM 9564  H HB3  . LYS A 1 96  ? 41.971  51.700  48.129  1.00 0.00 ?  87  LYS A HB3  6  
ATOM 9565  H HG2  . LYS A 1 96  ? 41.163  53.270  50.641  1.00 0.00 ?  87  LYS A HG2  6  
ATOM 9566  H HG3  . LYS A 1 96  ? 42.302  53.833  49.484  1.00 0.00 ?  87  LYS A HG3  6  
ATOM 9567  H HD2  . LYS A 1 96  ? 39.210  53.325  49.108  1.00 0.00 ?  87  LYS A HD2  6  
ATOM 9568  H HD3  . LYS A 1 96  ? 40.136  54.810  49.219  1.00 0.00 ?  87  LYS A HD3  6  
ATOM 9569  H HE2  . LYS A 1 96  ? 40.306  53.059  46.796  1.00 0.00 ?  87  LYS A HE2  6  
ATOM 9570  H HE3  . LYS A 1 96  ? 39.602  54.699  46.927  1.00 0.00 ?  87  LYS A HE3  6  
ATOM 9571  H HZ1  . LYS A 1 96  ? 41.757  55.516  47.496  1.00 0.00 ?  87  LYS A HZ1  6  
ATOM 9572  H HZ2  . LYS A 1 96  ? 42.439  54.058  47.085  1.00 0.00 ?  87  LYS A HZ2  6  
ATOM 9573  H HZ3  . LYS A 1 96  ? 41.629  54.823  45.995  1.00 0.00 ?  87  LYS A HZ3  6  
ATOM 9574  N N    . ARG A 1 97  ? 39.489  48.840  48.126  1.00 0.00 ?  88  ARG A N    6  
ATOM 9575  C CA   . ARG A 1 97  ? 39.447  47.598  47.329  1.00 0.00 ?  88  ARG A CA   6  
ATOM 9576  C C    . ARG A 1 97  ? 39.927  47.644  45.945  1.00 0.00 ?  88  ARG A C    6  
ATOM 9577  O O    . ARG A 1 97  ? 40.406  46.623  45.563  1.00 0.00 ?  88  ARG A O    6  
ATOM 9578  C CB   . ARG A 1 97  ? 38.092  46.895  47.333  1.00 0.00 ?  88  ARG A CB   6  
ATOM 9579  C CG   . ARG A 1 97  ? 37.426  46.707  48.715  1.00 0.00 ?  88  ARG A CG   6  
ATOM 9580  C CD   . ARG A 1 97  ? 38.122  45.730  49.630  1.00 0.00 ?  88  ARG A CD   6  
ATOM 9581  N NE   . ARG A 1 97  ? 37.684  45.763  51.046  1.00 0.00 ?  88  ARG A NE   6  
ATOM 9582  C CZ   . ARG A 1 97  ? 36.544  45.214  51.450  1.00 0.00 ?  88  ARG A CZ   6  
ATOM 9583  N NH1  . ARG A 1 97  ? 35.834  44.391  50.732  1.00 0.00 ?  88  ARG A NH1  6  
ATOM 9584  N NH2  . ARG A 1 97  ? 36.052  45.501  52.642  1.00 0.00 1  88  ARG A NH2  6  
ATOM 9585  H H    . ARG A 1 97  ? 38.669  49.419  48.238  1.00 0.00 ?  88  ARG A H    6  
ATOM 9586  H HA   . ARG A 1 97  ? 40.058  46.775  47.702  1.00 0.00 ?  88  ARG A HA   6  
ATOM 9587  H HB2  . ARG A 1 97  ? 37.425  47.451  46.674  1.00 0.00 ?  88  ARG A HB2  6  
ATOM 9588  H HB3  . ARG A 1 97  ? 38.123  45.954  46.784  1.00 0.00 ?  88  ARG A HB3  6  
ATOM 9589  H HG2  . ARG A 1 97  ? 37.344  47.653  49.250  1.00 0.00 ?  88  ARG A HG2  6  
ATOM 9590  H HG3  . ARG A 1 97  ? 36.414  46.331  48.566  1.00 0.00 ?  88  ARG A HG3  6  
ATOM 9591  H HD2  . ARG A 1 97  ? 38.060  44.722  49.220  1.00 0.00 ?  88  ARG A HD2  6  
ATOM 9592  H HD3  . ARG A 1 97  ? 39.179  46.000  49.621  1.00 0.00 ?  88  ARG A HD3  6  
ATOM 9593  H HE   . ARG A 1 97  ? 38.040  46.488  51.653  1.00 0.00 ?  88  ARG A HE   6  
ATOM 9594  H HH11 . ARG A 1 97  ? 36.178  44.022  49.858  1.00 0.00 ?  88  ARG A HH11 6  
ATOM 9595  H HH12 . ARG A 1 97  ? 35.058  43.981  51.232  1.00 0.00 ?  88  ARG A HH12 6  
ATOM 9596  H HH21 . ARG A 1 97  ? 36.544  46.208  53.168  1.00 0.00 ?  88  ARG A HH21 6  
ATOM 9597  H HH22 . ARG A 1 97  ? 35.163  45.177  52.997  1.00 0.00 ?  88  ARG A HH22 6  
ATOM 9598  N N    . SER A 1 98  ? 39.819  48.814  45.322  1.00 0.00 ?  89  SER A N    6  
ATOM 9599  C CA   . SER A 1 98  ? 40.397  49.125  44.059  1.00 0.00 ?  89  SER A CA   6  
ATOM 9600  C C    . SER A 1 98  ? 41.895  48.680  43.808  1.00 0.00 ?  89  SER A C    6  
ATOM 9601  O O    . SER A 1 98  ? 42.210  48.300  42.691  1.00 0.00 ?  89  SER A O    6  
ATOM 9602  C CB   . SER A 1 98  ? 40.088  50.652  43.960  1.00 0.00 ?  89  SER A CB   6  
ATOM 9603  O OG   . SER A 1 98  ? 40.765  51.326  44.976  1.00 0.00 ?  89  SER A OG   6  
ATOM 9604  H H    . SER A 1 98  ? 39.403  49.519  45.915  1.00 0.00 ?  89  SER A H    6  
ATOM 9605  H HA   . SER A 1 98  ? 39.829  48.715  43.224  1.00 0.00 ?  89  SER A HA   6  
ATOM 9606  H HB2  . SER A 1 98  ? 40.438  50.890  42.955  1.00 0.00 ?  89  SER A HB2  6  
ATOM 9607  H HB3  . SER A 1 98  ? 39.035  50.931  43.952  1.00 0.00 ?  89  SER A HB3  6  
ATOM 9608  H HG   . SER A 1 98  ? 41.149  52.087  44.534  1.00 0.00 ?  89  SER A HG   6  
ATOM 9609  N N    . ASP A 1 99  ? 42.687  48.797  44.878  1.00 0.00 ?  90  ASP A N    6  
ATOM 9610  C CA   . ASP A 1 99  ? 44.115  48.487  45.049  1.00 0.00 ?  90  ASP A CA   6  
ATOM 9611  C C    . ASP A 1 99  ? 44.406  47.224  45.901  1.00 0.00 ?  90  ASP A C    6  
ATOM 9612  O O    . ASP A 1 99  ? 43.505  46.956  46.774  1.00 0.00 ?  90  ASP A O    6  
ATOM 9613  C CB   . ASP A 1 99  ? 44.849  49.681  45.613  1.00 0.00 ?  90  ASP A CB   6  
ATOM 9614  C CG   . ASP A 1 99  ? 45.337  50.627  44.535  1.00 0.00 ?  90  ASP A CG   6  
ATOM 9615  O OD1  . ASP A 1 99  ? 46.097  50.275  43.652  1.00 0.00 -1 90  ASP A OD1  6  
ATOM 9616  O OD2  . ASP A 1 99  ? 45.290  51.872  44.729  1.00 0.00 ?  90  ASP A OD2  6  
ATOM 9617  H H    . ASP A 1 99  ? 42.200  49.045  45.728  1.00 0.00 ?  90  ASP A H    6  
ATOM 9618  H HA   . ASP A 1 99  ? 44.603  48.151  44.135  1.00 0.00 ?  90  ASP A HA   6  
ATOM 9619  H HB2  . ASP A 1 99  ? 44.104  50.153  46.251  1.00 0.00 ?  90  ASP A HB2  6  
ATOM 9620  H HB3  . ASP A 1 99  ? 45.669  49.308  46.228  1.00 0.00 ?  90  ASP A HB3  6  
ATOM 9621  N N    . PRO A 1 100 ? 45.578  46.441  45.741  1.00 0.00 ?  91  PRO A N    6  
ATOM 9622  C CA   . PRO A 1 100 ? 45.772  45.154  46.412  1.00 0.00 ?  91  PRO A CA   6  
ATOM 9623  C C    . PRO A 1 100 ? 46.314  45.251  47.885  1.00 0.00 ?  91  PRO A C    6  
ATOM 9624  O O    . PRO A 1 100 ? 47.161  44.515  48.348  1.00 0.00 ?  91  PRO A O    6  
ATOM 9625  C CB   . PRO A 1 100 ? 46.579  44.305  45.440  1.00 0.00 ?  91  PRO A CB   6  
ATOM 9626  C CG   . PRO A 1 100 ? 47.409  45.281  44.700  1.00 0.00 ?  91  PRO A CG   6  
ATOM 9627  C CD   . PRO A 1 100 ? 46.585  46.635  44.707  1.00 0.00 ?  91  PRO A CD   6  
ATOM 9628  H HA   . PRO A 1 100 ? 44.782  44.710  46.516  1.00 0.00 ?  91  PRO A HA   6  
ATOM 9629  H HB2  . PRO A 1 100 ? 47.161  43.564  45.988  1.00 0.00 ?  91  PRO A HB2  6  
ATOM 9630  H HB3  . PRO A 1 100 ? 45.892  43.796  44.764  1.00 0.00 ?  91  PRO A HB3  6  
ATOM 9631  H HG2  . PRO A 1 100 ? 48.395  45.494  45.113  1.00 0.00 ?  91  PRO A HG2  6  
ATOM 9632  H HG3  . PRO A 1 100 ? 47.422  44.971  43.656  1.00 0.00 ?  91  PRO A HG3  6  
ATOM 9633  H HD2  . PRO A 1 100 ? 47.261  47.444  44.985  1.00 0.00 ?  91  PRO A HD2  6  
ATOM 9634  H HD3  . PRO A 1 100 ? 46.237  46.842  43.694  1.00 0.00 ?  91  PRO A HD3  6  
ATOM 9635  N N    . TYR A 1 101 ? 45.783  46.174  48.697  1.00 0.00 ?  92  TYR A N    6  
ATOM 9636  C CA   . TYR A 1 101 ? 46.098  46.301  50.096  1.00 0.00 ?  92  TYR A CA   6  
ATOM 9637  C C    . TYR A 1 101 ? 45.895  45.114  51.063  1.00 0.00 ?  92  TYR A C    6  
ATOM 9638  O O    . TYR A 1 101 ? 46.791  44.977  51.961  1.00 0.00 ?  92  TYR A O    6  
ATOM 9639  C CB   . TYR A 1 101 ? 45.432  47.552  50.660  1.00 0.00 ?  92  TYR A CB   6  
ATOM 9640  C CG   . TYR A 1 101 ? 45.956  48.860  50.262  1.00 0.00 ?  92  TYR A CG   6  
ATOM 9641  C CD1  . TYR A 1 101 ? 47.260  49.229  50.792  1.00 0.00 ?  92  TYR A CD1  6  
ATOM 9642  C CD2  . TYR A 1 101 ? 45.425  49.527  49.218  1.00 0.00 ?  92  TYR A CD2  6  
ATOM 9643  C CE1  . TYR A 1 101 ? 47.829  50.461  50.376  1.00 0.00 ?  92  TYR A CE1  6  
ATOM 9644  C CE2  . TYR A 1 101 ? 46.068  50.673  48.704  1.00 0.00 ?  92  TYR A CE2  6  
ATOM 9645  C CZ   . TYR A 1 101 ? 47.192  51.196  49.331  1.00 0.00 ?  92  TYR A CZ   6  
ATOM 9646  O OH   . TYR A 1 101 ? 47.781  52.287  48.861  1.00 0.00 ?  92  TYR A OH   6  
ATOM 9647  H H    . TYR A 1 101 ? 45.091  46.795  48.302  1.00 0.00 ?  92  TYR A H    6  
ATOM 9648  H HA   . TYR A 1 101 ? 47.159  46.554  50.103  1.00 0.00 ?  92  TYR A HA   6  
ATOM 9649  H HB2  . TYR A 1 101 ? 44.366  47.473  50.449  1.00 0.00 ?  92  TYR A HB2  6  
ATOM 9650  H HB3  . TYR A 1 101 ? 45.562  47.593  51.741  1.00 0.00 ?  92  TYR A HB3  6  
ATOM 9651  H HD1  . TYR A 1 101 ? 47.684  48.588  51.550  1.00 0.00 ?  92  TYR A HD1  6  
ATOM 9652  H HD2  . TYR A 1 101 ? 44.486  49.281  48.744  1.00 0.00 ?  92  TYR A HD2  6  
ATOM 9653  H HE1  . TYR A 1 101 ? 48.725  50.797  50.879  1.00 0.00 ?  92  TYR A HE1  6  
ATOM 9654  H HE2  . TYR A 1 101 ? 45.595  51.259  47.931  1.00 0.00 ?  92  TYR A HE2  6  
ATOM 9655  H HH   . TYR A 1 101 ? 47.123  52.961  48.675  1.00 0.00 ?  92  TYR A HH   6  
ATOM 9656  N N    . HIS A 1 102 ? 44.934  44.265  50.796  1.00 0.00 ?  93  HIS A N    6  
ATOM 9657  C CA   . HIS A 1 102 ? 44.785  42.976  51.467  1.00 0.00 ?  93  HIS A CA   6  
ATOM 9658  C C    . HIS A 1 102 ? 45.994  42.051  51.339  1.00 0.00 ?  93  HIS A C    6  
ATOM 9659  O O    . HIS A 1 102 ? 46.209  41.362  52.286  1.00 0.00 ?  93  HIS A O    6  
ATOM 9660  C CB   . HIS A 1 102 ? 43.642  42.225  50.821  1.00 0.00 ?  93  HIS A CB   6  
ATOM 9661  C CG   . HIS A 1 102 ? 43.727  41.873  49.342  1.00 0.00 ?  93  HIS A CG   6  
ATOM 9662  N ND1  . HIS A 1 102 ? 43.617  42.839  48.292  1.00 0.00 ?  93  HIS A ND1  6  
ATOM 9663  C CD2  . HIS A 1 102 ? 43.846  40.671  48.802  1.00 0.00 ?  93  HIS A CD2  6  
ATOM 9664  C CE1  . HIS A 1 102 ? 43.688  42.191  47.154  1.00 0.00 ?  93  HIS A CE1  6  
ATOM 9665  N NE2  . HIS A 1 102 ? 43.944  40.884  47.420  1.00 0.00 ?  93  HIS A NE2  6  
ATOM 9666  H H    . HIS A 1 102 ? 44.298  44.535  50.061  1.00 0.00 ?  93  HIS A H    6  
ATOM 9667  H HA   . HIS A 1 102 ? 44.433  43.095  52.493  1.00 0.00 ?  93  HIS A HA   6  
ATOM 9668  H HB2  . HIS A 1 102 ? 43.637  41.346  51.464  1.00 0.00 ?  93  HIS A HB2  6  
ATOM 9669  H HB3  . HIS A 1 102 ? 42.772  42.869  50.959  1.00 0.00 ?  93  HIS A HB3  6  
ATOM 9670  H HD2  . HIS A 1 102 ? 43.893  39.744  49.354  1.00 0.00 ?  93  HIS A HD2  6  
ATOM 9671  H HE1  . HIS A 1 102 ? 43.751  42.565  46.142  1.00 0.00 ?  93  HIS A HE1  6  
ATOM 9672  H HE2  . HIS A 1 102 ? 44.111  40.186  46.709  1.00 0.00 ?  93  HIS A HE2  6  
ATOM 9673  N N    . VAL A 1 103 ? 46.882  42.011  50.405  1.00 0.00 ?  94  VAL A N    6  
ATOM 9674  C CA   . VAL A 1 103 ? 48.029  41.165  50.350  1.00 0.00 ?  94  VAL A CA   6  
ATOM 9675  C C    . VAL A 1 103 ? 49.120  41.652  51.288  1.00 0.00 ?  94  VAL A C    6  
ATOM 9676  O O    . VAL A 1 103 ? 49.749  40.796  51.961  1.00 0.00 ?  94  VAL A O    6  
ATOM 9677  C CB   . VAL A 1 103 ? 48.493  41.044  48.965  1.00 0.00 ?  94  VAL A CB   6  
ATOM 9678  C CG1  . VAL A 1 103 ? 49.702  40.126  48.813  1.00 0.00 ?  94  VAL A CG1  6  
ATOM 9679  C CG2  . VAL A 1 103 ? 47.505  40.637  47.869  1.00 0.00 ?  94  VAL A CG2  6  
ATOM 9680  H H    . VAL A 1 103 ? 46.894  42.729  49.694  1.00 0.00 ?  94  VAL A H    6  
ATOM 9681  H HA   . VAL A 1 103 ? 47.678  40.189  50.686  1.00 0.00 ?  94  VAL A HA   6  
ATOM 9682  H HB   . VAL A 1 103 ? 48.804  42.039  48.645  1.00 0.00 ?  94  VAL A HB   6  
ATOM 9683  H HG11 . VAL A 1 103 ? 50.596  40.398  49.374  1.00 0.00 ?  94  VAL A HG11 6  
ATOM 9684  H HG12 . VAL A 1 103 ? 49.373  39.095  48.933  1.00 0.00 ?  94  VAL A HG12 6  
ATOM 9685  H HG13 . VAL A 1 103 ? 50.131  40.269  47.822  1.00 0.00 ?  94  VAL A HG13 6  
ATOM 9686  H HG21 . VAL A 1 103 ? 46.760  39.979  48.316  1.00 0.00 ?  94  VAL A HG21 6  
ATOM 9687  H HG22 . VAL A 1 103 ? 46.898  41.490  47.564  1.00 0.00 ?  94  VAL A HG22 6  
ATOM 9688  H HG23 . VAL A 1 103 ? 47.963  40.234  46.965  1.00 0.00 ?  94  VAL A HG23 6  
ATOM 9689  N N    . TYR A 1 104 ? 49.181  42.972  51.423  1.00 0.00 ?  95  TYR A N    6  
ATOM 9690  C CA   . TYR A 1 104 ? 49.890  43.792  52.462  1.00 0.00 ?  95  TYR A CA   6  
ATOM 9691  C C    . TYR A 1 104 ? 49.553  43.776  54.037  1.00 0.00 ?  95  TYR A C    6  
ATOM 9692  O O    . TYR A 1 104 ? 50.448  43.581  54.872  1.00 0.00 ?  95  TYR A O    6  
ATOM 9693  C CB   . TYR A 1 104 ? 50.146  45.132  51.843  1.00 0.00 ?  95  TYR A CB   6  
ATOM 9694  C CG   . TYR A 1 104 ? 50.379  46.355  52.667  1.00 0.00 ?  95  TYR A CG   6  
ATOM 9695  C CD1  . TYR A 1 104 ? 49.363  46.889  53.466  1.00 0.00 ?  95  TYR A CD1  6  
ATOM 9696  C CD2  . TYR A 1 104 ? 51.740  46.924  52.719  1.00 0.00 ?  95  TYR A CD2  6  
ATOM 9697  C CE1  . TYR A 1 104 ? 49.648  47.825  54.460  1.00 0.00 ?  95  TYR A CE1  6  
ATOM 9698  C CE2  . TYR A 1 104 ? 51.924  48.026  53.583  1.00 0.00 ?  95  TYR A CE2  6  
ATOM 9699  C CZ   . TYR A 1 104 ? 50.911  48.426  54.509  1.00 0.00 ?  95  TYR A CZ   6  
ATOM 9700  O OH   . TYR A 1 104 ? 51.262  49.424  55.348  1.00 0.00 ?  95  TYR A OH   6  
ATOM 9701  H H    . TYR A 1 104 ? 48.497  43.504  50.904  1.00 0.00 ?  95  TYR A H    6  
ATOM 9702  H HA   . TYR A 1 104 ? 50.874  43.323  52.445  1.00 0.00 ?  95  TYR A HA   6  
ATOM 9703  H HB2  . TYR A 1 104 ? 50.809  45.051  50.981  1.00 0.00 ?  95  TYR A HB2  6  
ATOM 9704  H HB3  . TYR A 1 104 ? 49.209  45.417  51.365  1.00 0.00 ?  95  TYR A HB3  6  
ATOM 9705  H HD1  . TYR A 1 104 ? 48.364  46.485  53.398  1.00 0.00 ?  95  TYR A HD1  6  
ATOM 9706  H HD2  . TYR A 1 104 ? 52.508  46.543  52.062  1.00 0.00 ?  95  TYR A HD2  6  
ATOM 9707  H HE1  . TYR A 1 104 ? 48.869  48.209  55.102  1.00 0.00 ?  95  TYR A HE1  6  
ATOM 9708  H HE2  . TYR A 1 104 ? 52.906  48.448  53.742  1.00 0.00 ?  95  TYR A HE2  6  
ATOM 9709  H HH   . TYR A 1 104 ? 52.107  49.784  55.068  1.00 0.00 ?  95  TYR A HH   6  
ATOM 9710  N N    . ILE A 1 105 ? 48.189  43.611  54.354  1.00 0.00 ?  96  ILE A N    6  
ATOM 9711  C CA   . ILE A 1 105 ? 47.716  43.755  55.675  1.00 0.00 ?  96  ILE A CA   6  
ATOM 9712  C C    . ILE A 1 105 ? 47.953  42.489  56.499  1.00 0.00 ?  96  ILE A C    6  
ATOM 9713  O O    . ILE A 1 105 ? 47.970  41.390  55.970  1.00 0.00 ?  96  ILE A O    6  
ATOM 9714  C CB   . ILE A 1 105 ? 46.225  44.301  55.797  1.00 0.00 ?  96  ILE A CB   6  
ATOM 9715  C CG1  . ILE A 1 105 ? 45.092  43.381  55.258  1.00 0.00 ?  96  ILE A CG1  6  
ATOM 9716  C CG2  . ILE A 1 105 ? 46.017  45.692  55.274  1.00 0.00 ?  96  ILE A CG2  6  
ATOM 9717  C CD1  . ILE A 1 105 ? 43.587  43.600  55.648  1.00 0.00 ?  96  ILE A CD1  6  
ATOM 9718  H H    . ILE A 1 105 ? 47.520  43.644  53.597  1.00 0.00 ?  96  ILE A H    6  
ATOM 9719  H HA   . ILE A 1 105 ? 48.376  44.488  56.140  1.00 0.00 ?  96  ILE A HA   6  
ATOM 9720  H HB   . ILE A 1 105 ? 46.017  44.384  56.863  1.00 0.00 ?  96  ILE A HB   6  
ATOM 9721  H HG12 . ILE A 1 105 ? 45.288  43.370  54.186  1.00 0.00 ?  96  ILE A HG12 6  
ATOM 9722  H HG13 . ILE A 1 105 ? 45.219  42.319  55.466  1.00 0.00 ?  96  ILE A HG13 6  
ATOM 9723  H HG21 . ILE A 1 105 ? 45.016  46.081  55.460  1.00 0.00 ?  96  ILE A HG21 6  
ATOM 9724  H HG22 . ILE A 1 105 ? 46.594  46.429  55.833  1.00 0.00 ?  96  ILE A HG22 6  
ATOM 9725  H HG23 . ILE A 1 105 ? 46.138  45.850  54.202  1.00 0.00 ?  96  ILE A HG23 6  
ATOM 9726  H HD11 . ILE A 1 105 ? 43.410  43.496  56.719  1.00 0.00 ?  96  ILE A HD11 6  
ATOM 9727  H HD12 . ILE A 1 105 ? 43.207  44.585  55.377  1.00 0.00 ?  96  ILE A HD12 6  
ATOM 9728  H HD13 . ILE A 1 105 ? 42.883  43.041  55.031  1.00 0.00 ?  96  ILE A HD13 6  
ATOM 9729  N N    . LYS A 1 106 ? 48.149  42.655  57.849  1.00 0.00 ?  97  LYS A N    6  
ATOM 9730  C CA   . LYS A 1 106 ? 48.369  41.572  58.843  1.00 0.00 ?  97  LYS A CA   6  
ATOM 9731  C C    . LYS A 1 106 ? 47.306  41.586  59.933  1.00 0.00 ?  97  LYS A C    6  
ATOM 9732  O O    . LYS A 1 106 ? 46.530  42.595  59.997  1.00 0.00 ?  97  LYS A O    6  
ATOM 9733  C CB   . LYS A 1 106 ? 49.769  41.715  59.442  1.00 0.00 ?  97  LYS A CB   6  
ATOM 9734  C CG   . LYS A 1 106 ? 50.822  41.487  58.387  1.00 0.00 ?  97  LYS A CG   6  
ATOM 9735  C CD   . LYS A 1 106 ? 52.300  41.455  58.763  1.00 0.00 ?  97  LYS A CD   6  
ATOM 9736  C CE   . LYS A 1 106 ? 53.292  41.289  57.600  1.00 0.00 ?  97  LYS A CE   6  
ATOM 9737  N NZ   . LYS A 1 106 ? 54.653  41.523  57.959  1.00 0.00 1  97  LYS A NZ   6  
ATOM 9738  H H    . LYS A 1 106 ? 48.021  43.522  58.350  1.00 0.00 ?  97  LYS A H    6  
ATOM 9739  H HA   . LYS A 1 106 ? 48.273  40.583  58.395  1.00 0.00 ?  97  LYS A HA   6  
ATOM 9740  H HB2  . LYS A 1 106 ? 49.946  42.703  59.865  1.00 0.00 ?  97  LYS A HB2  6  
ATOM 9741  H HB3  . LYS A 1 106 ? 49.880  40.937  60.197  1.00 0.00 ?  97  LYS A HB3  6  
ATOM 9742  H HG2  . LYS A 1 106 ? 50.683  40.467  58.028  1.00 0.00 ?  97  LYS A HG2  6  
ATOM 9743  H HG3  . LYS A 1 106 ? 50.678  42.189  57.566  1.00 0.00 ?  97  LYS A HG3  6  
ATOM 9744  H HD2  . LYS A 1 106 ? 52.378  42.456  59.187  1.00 0.00 ?  97  LYS A HD2  6  
ATOM 9745  H HD3  . LYS A 1 106 ? 52.549  40.734  59.541  1.00 0.00 ?  97  LYS A HD3  6  
ATOM 9746  H HE2  . LYS A 1 106 ? 53.299  40.310  57.119  1.00 0.00 ?  97  LYS A HE2  6  
ATOM 9747  H HE3  . LYS A 1 106 ? 52.940  41.985  56.838  1.00 0.00 ?  97  LYS A HE3  6  
ATOM 9748  H HZ1  . LYS A 1 106 ? 54.891  42.494  58.103  1.00 0.00 ?  97  LYS A HZ1  6  
ATOM 9749  H HZ2  . LYS A 1 106 ? 54.845  41.040  58.825  1.00 0.00 ?  97  LYS A HZ2  6  
ATOM 9750  H HZ3  . LYS A 1 106 ? 55.215  41.111  57.228  1.00 0.00 ?  97  LYS A HZ3  6  
ATOM 9751  N N    . ASN A 1 107 ? 47.186  40.543  60.740  1.00 0.00 ?  98  ASN A N    6  
ATOM 9752  C CA   . ASN A 1 107 ? 46.151  40.416  61.817  1.00 0.00 ?  98  ASN A CA   6  
ATOM 9753  C C    . ASN A 1 107 ? 46.589  41.229  63.061  1.00 0.00 ?  98  ASN A C    6  
ATOM 9754  O O    . ASN A 1 107 ? 45.787  41.905  63.717  1.00 0.00 ?  98  ASN A O    6  
ATOM 9755  C CB   . ASN A 1 107 ? 46.080  38.917  62.024  1.00 0.00 ?  98  ASN A CB   6  
ATOM 9756  C CG   . ASN A 1 107 ? 45.718  38.081  60.822  1.00 0.00 ?  98  ASN A CG   6  
ATOM 9757  O OD1  . ASN A 1 107 ? 46.524  37.609  60.086  1.00 0.00 ?  98  ASN A OD1  6  
ATOM 9758  N ND2  . ASN A 1 107 ? 44.453  37.737  60.616  1.00 0.00 ?  98  ASN A ND2  6  
ATOM 9759  H H    . ASN A 1 107 ? 47.954  39.899  60.620  1.00 0.00 ?  98  ASN A H    6  
ATOM 9760  H HA   . ASN A 1 107 ? 45.208  40.834  61.467  1.00 0.00 ?  98  ASN A HA   6  
ATOM 9761  H HB2  . ASN A 1 107 ? 47.075  38.554  62.282  1.00 0.00 ?  98  ASN A HB2  6  
ATOM 9762  H HB3  . ASN A 1 107 ? 45.473  38.726  62.909  1.00 0.00 ?  98  ASN A HB3  6  
ATOM 9763  H HD21 . ASN A 1 107 ? 43.743  38.271  61.098  1.00 0.00 ?  98  ASN A HD21 6  
ATOM 9764  H HD22 . ASN A 1 107 ? 44.267  37.086  59.868  1.00 0.00 ?  98  ASN A HD22 6  
ATOM 9765  N N    . ARG A 1 108 ? 47.890  41.365  63.356  1.00 0.00 ?  99  ARG A N    6  
ATOM 9766  C CA   . ARG A 1 108 ? 48.406  42.052  64.571  1.00 0.00 ?  99  ARG A CA   6  
ATOM 9767  C C    . ARG A 1 108 ? 49.738  42.729  64.343  1.00 0.00 ?  99  ARG A C    6  
ATOM 9768  O O    . ARG A 1 108 ? 50.359  42.559  63.282  1.00 0.00 ?  99  ARG A O    6  
ATOM 9769  C CB   . ARG A 1 108 ? 48.572  40.968  65.674  1.00 0.00 ?  99  ARG A CB   6  
ATOM 9770  C CG   . ARG A 1 108 ? 49.498  39.758  65.401  1.00 0.00 ?  99  ARG A CG   6  
ATOM 9771  C CD   . ARG A 1 108 ? 49.824  39.095  66.666  1.00 0.00 ?  99  ARG A CD   6  
ATOM 9772  N NE   . ARG A 1 108 ? 50.402  37.742  66.440  1.00 0.00 ?  99  ARG A NE   6  
ATOM 9773  C CZ   . ARG A 1 108 ? 51.649  37.532  66.341  1.00 0.00 ?  99  ARG A CZ   6  
ATOM 9774  N NH1  . ARG A 1 108 ? 52.582  38.494  66.124  1.00 0.00 ?  99  ARG A NH1  6  
ATOM 9775  N NH2  . ARG A 1 108 ? 52.099  36.324  66.312  1.00 0.00 1  99  ARG A NH2  6  
ATOM 9776  H H    . ARG A 1 108 ? 48.599  40.857  62.846  1.00 0.00 ?  99  ARG A H    6  
ATOM 9777  H HA   . ARG A 1 108 ? 47.745  42.875  64.845  1.00 0.00 ?  99  ARG A HA   6  
ATOM 9778  H HB2  . ARG A 1 108 ? 49.028  41.457  66.535  1.00 0.00 ?  99  ARG A HB2  6  
ATOM 9779  H HB3  . ARG A 1 108 ? 47.642  40.517  66.022  1.00 0.00 ?  99  ARG A HB3  6  
ATOM 9780  H HG2  . ARG A 1 108 ? 48.975  39.017  64.796  1.00 0.00 ?  99  ARG A HG2  6  
ATOM 9781  H HG3  . ARG A 1 108 ? 50.438  40.090  64.957  1.00 0.00 ?  99  ARG A HG3  6  
ATOM 9782  H HD2  . ARG A 1 108 ? 50.490  39.714  67.269  1.00 0.00 ?  99  ARG A HD2  6  
ATOM 9783  H HD3  . ARG A 1 108 ? 48.987  38.899  67.336  1.00 0.00 ?  99  ARG A HD3  6  
ATOM 9784  H HE   . ARG A 1 108 ? 49.763  36.965  66.529  1.00 0.00 ?  99  ARG A HE   6  
ATOM 9785  H HH11 . ARG A 1 108 ? 52.441  39.488  66.018  1.00 0.00 ?  99  ARG A HH11 6  
ATOM 9786  H HH12 . ARG A 1 108 ? 53.544  38.202  66.214  1.00 0.00 ?  99  ARG A HH12 6  
ATOM 9787  H HH21 . ARG A 1 108 ? 51.500  35.519  66.420  1.00 0.00 ?  99  ARG A HH21 6  
ATOM 9788  H HH22 . ARG A 1 108 ? 53.075  36.062  66.286  1.00 0.00 ?  99  ARG A HH22 6  
ATOM 9789  N N    . VAL A 1 109 ? 50.210  43.483  65.387  1.00 0.00 ?  100 VAL A N    6  
ATOM 9790  C CA   . VAL A 1 109 ? 51.682  43.754  65.631  1.00 0.00 ?  100 VAL A CA   6  
ATOM 9791  C C    . VAL A 1 109 ? 52.631  42.589  66.029  1.00 0.00 ?  100 VAL A C    6  
ATOM 9792  O O    . VAL A 1 109 ? 52.112  41.523  66.369  1.00 0.00 ?  100 VAL A O    6  
ATOM 9793  C CB   . VAL A 1 109 ? 52.007  45.105  66.460  1.00 0.00 ?  100 VAL A CB   6  
ATOM 9794  C CG1  . VAL A 1 109 ? 51.055  46.263  66.007  1.00 0.00 ?  100 VAL A CG1  6  
ATOM 9795  C CG2  . VAL A 1 109 ? 51.912  44.891  67.971  1.00 0.00 ?  100 VAL A CG2  6  
ATOM 9796  H H    . VAL A 1 109 ? 49.548  43.675  66.126  1.00 0.00 ?  100 VAL A H    6  
ATOM 9797  H HA   . VAL A 1 109 ? 52.162  43.894  64.662  1.00 0.00 ?  100 VAL A HA   6  
ATOM 9798  H HB   . VAL A 1 109 ? 53.050  45.385  66.318  1.00 0.00 ?  100 VAL A HB   6  
ATOM 9799  H HG11 . VAL A 1 109 ? 50.024  46.044  66.286  1.00 0.00 ?  100 VAL A HG11 6  
ATOM 9800  H HG12 . VAL A 1 109 ? 51.331  47.206  66.477  1.00 0.00 ?  100 VAL A HG12 6  
ATOM 9801  H HG13 . VAL A 1 109 ? 51.053  46.462  64.935  1.00 0.00 ?  100 VAL A HG13 6  
ATOM 9802  H HG21 . VAL A 1 109 ? 52.503  45.665  68.458  1.00 0.00 ?  100 VAL A HG21 6  
ATOM 9803  H HG22 . VAL A 1 109 ? 50.862  44.985  68.249  1.00 0.00 ?  100 VAL A HG22 6  
ATOM 9804  H HG23 . VAL A 1 109 ? 52.290  43.890  68.182  1.00 0.00 ?  100 VAL A HG23 6  
ATOM 9805  N N    . SER A 1 110 ? 53.944  42.790  65.796  1.00 0.00 ?  101 SER A N    6  
ATOM 9806  C CA   . SER A 1 110 ? 54.910  41.662  65.935  1.00 0.00 ?  101 SER A CA   6  
ATOM 9807  C C    . SER A 1 110 ? 55.932  41.919  66.994  1.00 0.00 ?  101 SER A C    6  
ATOM 9808  O O    . SER A 1 110 ? 56.229  43.052  67.314  1.00 0.00 ?  101 SER A O    6  
ATOM 9809  C CB   . SER A 1 110 ? 55.678  41.499  64.650  1.00 0.00 ?  101 SER A CB   6  
ATOM 9810  O OG   . SER A 1 110 ? 56.654  40.475  64.613  1.00 0.00 ?  101 SER A OG   6  
ATOM 9811  H H    . SER A 1 110 ? 54.275  43.738  65.689  1.00 0.00 ?  101 SER A H    6  
ATOM 9812  H HA   . SER A 1 110 ? 54.387  40.726  66.130  1.00 0.00 ?  101 SER A HA   6  
ATOM 9813  H HB2  . SER A 1 110 ? 54.976  41.426  63.819  1.00 0.00 ?  101 SER A HB2  6  
ATOM 9814  H HB3  . SER A 1 110 ? 56.276  42.404  64.549  1.00 0.00 ?  101 SER A HB3  6  
ATOM 9815  H HG   . SER A 1 110 ? 57.322  40.697  63.960  1.00 0.00 ?  101 SER A HG   6  
ATOM 9816  N N    . MET A 1 111 ? 56.458  40.916  67.553  1.00 0.00 ?  102 MET A N    6  
ATOM 9817  C CA   . MET A 1 111 ? 57.616  40.893  68.498  1.00 0.00 ?  102 MET A CA   6  
ATOM 9818  C C    . MET A 1 111 ? 59.034  41.091  67.891  1.00 0.00 ?  102 MET A C    6  
ATOM 9819  O O    . MET A 1 111 ? 59.181  40.829  66.708  1.00 0.00 ?  102 MET A O    6  
ATOM 9820  C CB   . MET A 1 111 ? 57.482  39.620  69.296  1.00 0.00 ?  102 MET A CB   6  
ATOM 9821  C CG   . MET A 1 111 ? 58.574  39.432  70.432  1.00 0.00 ?  102 MET A CG   6  
ATOM 9822  S SD   . MET A 1 111 ? 58.569  40.611  71.856  1.00 0.00 ?  102 MET A SD   6  
ATOM 9823  C CE   . MET A 1 111 ? 57.257  39.842  72.912  1.00 0.00 ?  102 MET A CE   6  
ATOM 9824  H H    . MET A 1 111 ? 55.983  40.049  67.341  1.00 0.00 ?  102 MET A H    6  
ATOM 9825  H HA   . MET A 1 111 ? 57.474  41.682  69.237  1.00 0.00 ?  102 MET A HA   6  
ATOM 9826  H HB2  . MET A 1 111 ? 56.518  39.581  69.802  1.00 0.00 ?  102 MET A HB2  6  
ATOM 9827  H HB3  . MET A 1 111 ? 57.614  38.825  68.563  1.00 0.00 ?  102 MET A HB3  6  
ATOM 9828  H HG2  . MET A 1 111 ? 58.367  38.475  70.911  1.00 0.00 ?  102 MET A HG2  6  
ATOM 9829  H HG3  . MET A 1 111 ? 59.558  39.461  69.963  1.00 0.00 ?  102 MET A HG3  6  
ATOM 9830  H HE1  . MET A 1 111 ? 57.498  38.809  73.161  1.00 0.00 ?  102 MET A HE1  6  
ATOM 9831  H HE2  . MET A 1 111 ? 57.339  40.382  73.856  1.00 0.00 ?  102 MET A HE2  6  
ATOM 9832  H HE3  . MET A 1 111 ? 56.269  39.845  72.454  1.00 0.00 ?  102 MET A HE3  6  
ATOM 9833  N N    . ILE A 1 112 ? 59.988  41.542  68.687  1.00 0.00 ?  103 ILE A N    6  
ATOM 9834  C CA   . ILE A 1 112 ? 61.339  41.990  68.229  1.00 0.00 ?  103 ILE A CA   6  
ATOM 9835  C C    . ILE A 1 112 ? 62.179  40.755  67.743  1.00 0.00 ?  103 ILE A C    6  
ATOM 9836  O O    . ILE A 1 112 ? 62.403  39.766  68.489  1.00 0.00 ?  103 ILE A O    6  
ATOM 9837  C CB   . ILE A 1 112 ? 61.926  43.002  69.277  1.00 0.00 ?  103 ILE A CB   6  
ATOM 9838  C CG1  . ILE A 1 112 ? 63.311  43.525  68.865  1.00 0.00 ?  103 ILE A CG1  6  
ATOM 9839  C CG2  . ILE A 1 112 ? 62.058  42.278  70.670  1.00 0.00 ?  103 ILE A CG2  6  
ATOM 9840  C CD1  . ILE A 1 112 ? 63.678  44.861  69.441  1.00 0.00 ?  103 ILE A CD1  6  
ATOM 9841  O OXT  . ILE A 1 112 ? 62.651  40.878  66.622  1.00 0.00 -1 103 ILE A OXT  6  
ATOM 9842  H H    . ILE A 1 112 ? 59.883  41.549  69.692  1.00 0.00 ?  103 ILE A H    6  
ATOM 9843  H HA   . ILE A 1 112 ? 61.145  42.608  67.352  1.00 0.00 ?  103 ILE A HA   6  
ATOM 9844  H HB   . ILE A 1 112 ? 61.270  43.861  69.422  1.00 0.00 ?  103 ILE A HB   6  
ATOM 9845  H HG12 . ILE A 1 112 ? 64.156  42.892  69.136  1.00 0.00 ?  103 ILE A HG12 6  
ATOM 9846  H HG13 . ILE A 1 112 ? 63.348  43.611  67.779  1.00 0.00 ?  103 ILE A HG13 6  
ATOM 9847  H HG21 . ILE A 1 112 ? 61.098  42.011  71.110  1.00 0.00 ?  103 ILE A HG21 6  
ATOM 9848  H HG22 . ILE A 1 112 ? 62.563  41.326  70.501  1.00 0.00 ?  103 ILE A HG22 6  
ATOM 9849  H HG23 . ILE A 1 112 ? 62.567  42.932  71.378  1.00 0.00 ?  103 ILE A HG23 6  
ATOM 9850  H HD11 . ILE A 1 112 ? 63.560  44.813  70.524  1.00 0.00 ?  103 ILE A HD11 6  
ATOM 9851  H HD12 . ILE A 1 112 ? 64.742  45.031  69.270  1.00 0.00 ?  103 ILE A HD12 6  
ATOM 9852  H HD13 . ILE A 1 112 ? 63.040  45.622  68.993  1.00 0.00 ?  103 ILE A HD13 6  
ATOM 9853  N N    . MET A 1 10  ? 17.197  53.459  103.110 1.00 0.00 ?  1   MET A N    7  
ATOM 9854  C CA   . MET A 1 10  ? 16.771  54.289  104.273 1.00 0.00 ?  1   MET A CA   7  
ATOM 9855  C C    . MET A 1 10  ? 17.991  54.820  105.057 1.00 0.00 ?  1   MET A C    7  
ATOM 9856  O O    . MET A 1 10  ? 18.831  54.017  105.342 1.00 0.00 ?  1   MET A O    7  
ATOM 9857  C CB   . MET A 1 10  ? 15.792  53.572  105.249 1.00 0.00 ?  1   MET A CB   7  
ATOM 9858  C CG   . MET A 1 10  ? 15.402  54.377  106.416 1.00 0.00 ?  1   MET A CG   7  
ATOM 9859  S SD   . MET A 1 10  ? 14.355  55.812  106.142 1.00 0.00 ?  1   MET A SD   7  
ATOM 9860  C CE   . MET A 1 10  ? 14.842  56.803  107.630 1.00 0.00 ?  1   MET A CE   7  
ATOM 9861  H H    . MET A 1 10  ? 17.803  54.026  102.533 1.00 0.00 ?  1   MET A H    7  
ATOM 9862  H HA   . MET A 1 10  ? 16.371  55.213  103.855 1.00 0.00 ?  1   MET A HA   7  
ATOM 9863  H HB2  . MET A 1 10  ? 14.953  53.222  104.648 1.00 0.00 ?  1   MET A HB2  7  
ATOM 9864  H HB3  . MET A 1 10  ? 16.253  52.677  105.670 1.00 0.00 ?  1   MET A HB3  7  
ATOM 9865  H HG2  . MET A 1 10  ? 14.833  53.793  107.140 1.00 0.00 ?  1   MET A HG2  7  
ATOM 9866  H HG3  . MET A 1 10  ? 16.300  54.659  106.964 1.00 0.00 ?  1   MET A HG3  7  
ATOM 9867  H HE1  . MET A 1 10  ? 14.217  57.661  107.878 1.00 0.00 ?  1   MET A HE1  7  
ATOM 9868  H HE2  . MET A 1 10  ? 14.833  56.139  108.494 1.00 0.00 ?  1   MET A HE2  7  
ATOM 9869  H HE3  . MET A 1 10  ? 15.843  57.225  107.541 1.00 0.00 ?  1   MET A HE3  7  
ATOM 9870  N N    . GLU A 1 11  ? 18.060  56.122  105.437 1.00 0.00 ?  2   GLU A N    7  
ATOM 9871  C CA   . GLU A 1 11  ? 19.303  56.695  106.099 1.00 0.00 ?  2   GLU A CA   7  
ATOM 9872  C C    . GLU A 1 11  ? 19.227  56.782  107.653 1.00 0.00 ?  2   GLU A C    7  
ATOM 9873  O O    . GLU A 1 11  ? 18.263  57.319  108.197 1.00 0.00 ?  2   GLU A O    7  
ATOM 9874  C CB   . GLU A 1 11  ? 19.760  58.048  105.523 1.00 0.00 ?  2   GLU A CB   7  
ATOM 9875  C CG   . GLU A 1 11  ? 20.127  58.038  104.034 1.00 0.00 ?  2   GLU A CG   7  
ATOM 9876  C CD   . GLU A 1 11  ? 21.478  57.398  103.713 1.00 0.00 ?  2   GLU A CD   7  
ATOM 9877  O OE1  . GLU A 1 11  ? 22.102  56.873  104.667 1.00 0.00 -1 2   GLU A OE1  7  
ATOM 9878  O OE2  . GLU A 1 11  ? 21.731  57.395  102.481 1.00 0.00 ?  2   GLU A OE2  7  
ATOM 9879  H H    . GLU A 1 11  ? 17.268  56.703  105.205 1.00 0.00 ?  2   GLU A H    7  
ATOM 9880  H HA   . GLU A 1 11  ? 20.126  56.044  105.802 1.00 0.00 ?  2   GLU A HA   7  
ATOM 9881  H HB2  . GLU A 1 11  ? 18.934  58.759  105.532 1.00 0.00 ?  2   GLU A HB2  7  
ATOM 9882  H HB3  . GLU A 1 11  ? 20.589  58.496  106.072 1.00 0.00 ?  2   GLU A HB3  7  
ATOM 9883  H HG2  . GLU A 1 11  ? 19.251  57.627  103.534 1.00 0.00 ?  2   GLU A HG2  7  
ATOM 9884  H HG3  . GLU A 1 11  ? 20.296  59.054  103.678 1.00 0.00 ?  2   GLU A HG3  7  
ATOM 9885  N N    . THR A 1 12  ? 20.340  56.596  108.399 1.00 0.00 ?  3   THR A N    7  
ATOM 9886  C CA   . THR A 1 12  ? 20.534  57.063  109.781 1.00 0.00 ?  3   THR A CA   7  
ATOM 9887  C C    . THR A 1 12  ? 21.805  57.727  110.072 1.00 0.00 ?  3   THR A C    7  
ATOM 9888  O O    . THR A 1 12  ? 22.947  57.422  109.651 1.00 0.00 ?  3   THR A O    7  
ATOM 9889  C CB   . THR A 1 12  ? 20.284  55.894  110.727 1.00 0.00 ?  3   THR A CB   7  
ATOM 9890  O OG1  . THR A 1 12  ? 20.026  56.428  111.994 1.00 0.00 ?  3   THR A OG1  7  
ATOM 9891  C CG2  . THR A 1 12  ? 21.416  54.903  110.689 1.00 0.00 ?  3   THR A CG2  7  
ATOM 9892  H H    . THR A 1 12  ? 21.164  56.191  107.976 1.00 0.00 ?  3   THR A H    7  
ATOM 9893  H HA   . THR A 1 12  ? 19.749  57.768  110.050 1.00 0.00 ?  3   THR A HA   7  
ATOM 9894  H HB   . THR A 1 12  ? 19.404  55.342  110.399 1.00 0.00 ?  3   THR A HB   7  
ATOM 9895  H HG1  . THR A 1 12  ? 19.252  55.965  112.323 1.00 0.00 ?  3   THR A HG1  7  
ATOM 9896  H HG21 . THR A 1 12  ? 21.678  54.411  109.752 1.00 0.00 ?  3   THR A HG21 7  
ATOM 9897  H HG22 . THR A 1 12  ? 22.263  55.375  111.187 1.00 0.00 ?  3   THR A HG22 7  
ATOM 9898  H HG23 . THR A 1 12  ? 21.213  54.073  111.364 1.00 0.00 ?  3   THR A HG23 7  
ATOM 9899  N N    . THR A 1 13  ? 21.689  58.715  110.984 1.00 0.00 ?  4   THR A N    7  
ATOM 9900  C CA   . THR A 1 13  ? 22.778  59.558  111.573 1.00 0.00 ?  4   THR A CA   7  
ATOM 9901  C C    . THR A 1 13  ? 22.481  59.796  113.049 1.00 0.00 ?  4   THR A C    7  
ATOM 9902  O O    . THR A 1 13  ? 21.370  59.679  113.519 1.00 0.00 ?  4   THR A O    7  
ATOM 9903  C CB   . THR A 1 13  ? 23.258  60.831  110.775 1.00 0.00 ?  4   THR A CB   7  
ATOM 9904  O OG1  . THR A 1 13  ? 22.515  62.029  111.031 1.00 0.00 ?  4   THR A OG1  7  
ATOM 9905  C CG2  . THR A 1 13  ? 23.046  60.603  109.278 1.00 0.00 ?  4   THR A CG2  7  
ATOM 9906  H H    . THR A 1 13  ? 20.800  58.926  111.414 1.00 0.00 ?  4   THR A H    7  
ATOM 9907  H HA   . THR A 1 13  ? 23.700  58.978  111.549 1.00 0.00 ?  4   THR A HA   7  
ATOM 9908  H HB   . THR A 1 13  ? 24.310  60.996  111.000 1.00 0.00 ?  4   THR A HB   7  
ATOM 9909  H HG1  . THR A 1 13  ? 22.135  62.006  111.913 1.00 0.00 ?  4   THR A HG1  7  
ATOM 9910  H HG21 . THR A 1 13  ? 23.629  59.766  108.892 1.00 0.00 ?  4   THR A HG21 7  
ATOM 9911  H HG22 . THR A 1 13  ? 21.998  60.586  108.979 1.00 0.00 ?  4   THR A HG22 7  
ATOM 9912  H HG23 . THR A 1 13  ? 23.448  61.545  108.902 1.00 0.00 ?  4   THR A HG23 7  
ATOM 9913  N N    . ASN A 1 14  ? 23.547  60.243  113.756 1.00 0.00 ?  5   ASN A N    7  
ATOM 9914  C CA   . ASN A 1 14  ? 23.400  60.868  115.102 1.00 0.00 ?  5   ASN A CA   7  
ATOM 9915  C C    . ASN A 1 14  ? 22.617  62.176  115.017 1.00 0.00 ?  5   ASN A C    7  
ATOM 9916  O O    . ASN A 1 14  ? 22.676  62.882  113.966 1.00 0.00 ?  5   ASN A O    7  
ATOM 9917  C CB   . ASN A 1 14  ? 24.685  60.895  115.934 1.00 0.00 ?  5   ASN A CB   7  
ATOM 9918  C CG   . ASN A 1 14  ? 24.424  61.352  117.301 1.00 0.00 ?  5   ASN A CG   7  
ATOM 9919  O OD1  . ASN A 1 14  ? 23.394  61.178  117.887 1.00 0.00 ?  5   ASN A OD1  7  
ATOM 9920  N ND2  . ASN A 1 14  ? 25.426  61.774  117.982 1.00 0.00 ?  5   ASN A ND2  7  
ATOM 9921  H H    . ASN A 1 14  ? 24.466  60.298  113.340 1.00 0.00 ?  5   ASN A H    7  
ATOM 9922  H HA   . ASN A 1 14  ? 22.795  60.092  115.573 1.00 0.00 ?  5   ASN A HA   7  
ATOM 9923  H HB2  . ASN A 1 14  ? 25.201  59.935  115.940 1.00 0.00 ?  5   ASN A HB2  7  
ATOM 9924  H HB3  . ASN A 1 14  ? 25.388  61.522  115.385 1.00 0.00 ?  5   ASN A HB3  7  
ATOM 9925  H HD21 . ASN A 1 14  ? 26.334  61.681  117.552 1.00 0.00 ?  5   ASN A HD21 7  
ATOM 9926  H HD22 . ASN A 1 14  ? 25.318  62.125  118.923 1.00 0.00 ?  5   ASN A HD22 7  
ATOM 9927  N N    . GLY A 1 15  ? 21.764  62.400  116.030 1.00 0.00 ?  6   GLY A N    7  
ATOM 9928  C CA   . GLY A 1 15  ? 21.055  63.647  116.227 1.00 0.00 ?  6   GLY A CA   7  
ATOM 9929  C C    . GLY A 1 15  ? 20.271  63.595  117.556 1.00 0.00 ?  6   GLY A C    7  
ATOM 9930  O O    . GLY A 1 15  ? 20.655  62.741  118.304 1.00 0.00 ?  6   GLY A O    7  
ATOM 9931  H H    . GLY A 1 15  ? 21.855  61.806  116.842 1.00 0.00 ?  6   GLY A H    7  
ATOM 9932  H HA2  . GLY A 1 15  ? 21.730  64.502  116.183 1.00 0.00 ?  6   GLY A HA2  7  
ATOM 9933  H HA3  . GLY A 1 15  ? 20.254  63.793  115.502 1.00 0.00 ?  6   GLY A HA3  7  
ATOM 9934  N N    . THR A 1 16  ? 19.265  64.444  117.766 1.00 0.00 ?  7   THR A N    7  
ATOM 9935  C CA   . THR A 1 16  ? 18.547  64.381  119.011 1.00 0.00 ?  7   THR A CA   7  
ATOM 9936  C C    . THR A 1 16  ? 17.611  63.160  119.142 1.00 0.00 ?  7   THR A C    7  
ATOM 9937  O O    . THR A 1 16  ? 17.315  62.547  118.116 1.00 0.00 ?  7   THR A O    7  
ATOM 9938  C CB   . THR A 1 16  ? 17.837  65.740  119.375 1.00 0.00 ?  7   THR A CB   7  
ATOM 9939  O OG1  . THR A 1 16  ? 16.483  65.798  118.923 1.00 0.00 ?  7   THR A OG1  7  
ATOM 9940  C CG2  . THR A 1 16  ? 18.571  66.996  118.849 1.00 0.00 ?  7   THR A CG2  7  
ATOM 9941  H H    . THR A 1 16  ? 18.821  64.973  117.029 1.00 0.00 ?  7   THR A H    7  
ATOM 9942  H HA   . THR A 1 16  ? 19.296  64.228  119.787 1.00 0.00 ?  7   THR A HA   7  
ATOM 9943  H HB   . THR A 1 16  ? 17.695  65.888  120.446 1.00 0.00 ?  7   THR A HB   7  
ATOM 9944  H HG1  . THR A 1 16  ? 16.137  66.683  119.064 1.00 0.00 ?  7   THR A HG1  7  
ATOM 9945  H HG21 . THR A 1 16  ? 18.798  66.894  117.788 1.00 0.00 ?  7   THR A HG21 7  
ATOM 9946  H HG22 . THR A 1 16  ? 17.915  67.842  119.048 1.00 0.00 ?  7   THR A HG22 7  
ATOM 9947  H HG23 . THR A 1 16  ? 19.469  67.164  119.445 1.00 0.00 ?  7   THR A HG23 7  
ATOM 9948  N N    . GLU A 1 17  ? 17.017  62.871  120.334 1.00 0.00 ?  8   GLU A N    7  
ATOM 9949  C CA   . GLU A 1 17  ? 16.062  61.791  120.360 1.00 0.00 ?  8   GLU A CA   7  
ATOM 9950  C C    . GLU A 1 17  ? 14.800  62.123  119.414 1.00 0.00 ?  8   GLU A C    7  
ATOM 9951  O O    . GLU A 1 17  ? 14.001  61.246  119.030 1.00 0.00 ?  8   GLU A O    7  
ATOM 9952  C CB   . GLU A 1 17  ? 15.558  61.435  121.790 1.00 0.00 ?  8   GLU A CB   7  
ATOM 9953  C CG   . GLU A 1 17  ? 14.747  62.517  122.464 1.00 0.00 ?  8   GLU A CG   7  
ATOM 9954  C CD   . GLU A 1 17  ? 15.481  63.480  123.277 1.00 0.00 ?  8   GLU A CD   7  
ATOM 9955  O OE1  . GLU A 1 17  ? 16.754  63.507  123.181 1.00 0.00 ?  8   GLU A OE1  7  
ATOM 9956  O OE2  . GLU A 1 17  ? 14.848  64.233  124.021 1.00 0.00 -1 8   GLU A OE2  7  
ATOM 9957  H H    . GLU A 1 17  ? 17.180  63.407  121.174 1.00 0.00 ?  8   GLU A H    7  
ATOM 9958  H HA   . GLU A 1 17  ? 16.508  60.870  119.984 1.00 0.00 ?  8   GLU A HA   7  
ATOM 9959  H HB2  . GLU A 1 17  ? 14.988  60.507  121.731 1.00 0.00 ?  8   GLU A HB2  7  
ATOM 9960  H HB3  . GLU A 1 17  ? 16.448  61.199  122.373 1.00 0.00 ?  8   GLU A HB3  7  
ATOM 9961  H HG2  . GLU A 1 17  ? 14.086  63.065  121.793 1.00 0.00 ?  8   GLU A HG2  7  
ATOM 9962  H HG3  . GLU A 1 17  ? 14.044  62.056  123.157 1.00 0.00 ?  8   GLU A HG3  7  
ATOM 9963  N N    . THR A 1 18  ? 14.495  63.476  119.210 1.00 0.00 ?  9   THR A N    7  
ATOM 9964  C CA   . THR A 1 18  ? 13.359  63.982  118.296 1.00 0.00 ?  9   THR A CA   7  
ATOM 9965  C C    . THR A 1 18  ? 13.658  63.790  116.835 1.00 0.00 ?  9   THR A C    7  
ATOM 9966  O O    . THR A 1 18  ? 12.723  63.579  116.085 1.00 0.00 ?  9   THR A O    7  
ATOM 9967  C CB   . THR A 1 18  ? 12.782  65.344  118.604 1.00 0.00 ?  9   THR A CB   7  
ATOM 9968  O OG1  . THR A 1 18  ? 13.620  66.329  118.041 1.00 0.00 ?  9   THR A OG1  7  
ATOM 9969  C CG2  . THR A 1 18  ? 12.659  65.636  120.077 1.00 0.00 ?  9   THR A CG2  7  
ATOM 9970  H H    . THR A 1 18  ? 15.044  64.223  119.608 1.00 0.00 ?  9   THR A H    7  
ATOM 9971  H HA   . THR A 1 18  ? 12.487  63.335  118.394 1.00 0.00 ?  9   THR A HA   7  
ATOM 9972  H HB   . THR A 1 18  ? 11.803  65.381  118.126 1.00 0.00 ?  9   THR A HB   7  
ATOM 9973  H HG1  . THR A 1 18  ? 14.263  66.497  118.735 1.00 0.00 ?  9   THR A HG1  7  
ATOM 9974  H HG21 . THR A 1 18  ? 11.945  64.969  120.561 1.00 0.00 ?  9   THR A HG21 7  
ATOM 9975  H HG22 . THR A 1 18  ? 13.599  65.795  120.603 1.00 0.00 ?  9   THR A HG22 7  
ATOM 9976  H HG23 . THR A 1 18  ? 12.211  66.623  120.195 1.00 0.00 ?  9   THR A HG23 7  
ATOM 9977  N N    . TRP A 1 19  ? 14.943  63.909  116.473 1.00 0.00 ?  10  TRP A N    7  
ATOM 9978  C CA   . TRP A 1 19  ? 15.439  63.465  115.202 1.00 0.00 ?  10  TRP A CA   7  
ATOM 9979  C C    . TRP A 1 19  ? 15.312  61.974  114.986 1.00 0.00 ?  10  TRP A C    7  
ATOM 9980  O O    . TRP A 1 19  ? 14.758  61.607  113.934 1.00 0.00 ?  10  TRP A O    7  
ATOM 9981  C CB   . TRP A 1 19  ? 16.890  63.969  115.022 1.00 0.00 ?  10  TRP A CB   7  
ATOM 9982  C CG   . TRP A 1 19  ? 17.853  63.089  114.147 1.00 0.00 ?  10  TRP A CG   7  
ATOM 9983  C CD1  . TRP A 1 19  ? 18.468  61.956  114.610 1.00 0.00 ?  10  TRP A CD1  7  
ATOM 9984  C CD2  . TRP A 1 19  ? 17.962  63.170  112.699 1.00 0.00 ?  10  TRP A CD2  7  
ATOM 9985  N NE1  . TRP A 1 19  ? 19.095  61.343  113.512 1.00 0.00 ?  10  TRP A NE1  7  
ATOM 9986  C CE2  . TRP A 1 19  ? 18.786  62.053  112.356 1.00 0.00 ?  10  TRP A CE2  7  
ATOM 9987  C CE3  . TRP A 1 19  ? 17.577  64.155  111.743 1.00 0.00 ?  10  TRP A CE3  7  
ATOM 9988  C CZ2  . TRP A 1 19  ? 19.041  61.776  111.020 1.00 0.00 ?  10  TRP A CZ2  7  
ATOM 9989  C CZ3  . TRP A 1 19  ? 17.958  63.926  110.403 1.00 0.00 ?  10  TRP A CZ3  7  
ATOM 9990  C CH2  . TRP A 1 19  ? 18.636  62.736  110.024 1.00 0.00 ?  10  TRP A CH2  7  
ATOM 9991  H H    . TRP A 1 19  ? 15.552  64.243  117.206 1.00 0.00 ?  10  TRP A H    7  
ATOM 9992  H HA   . TRP A 1 19  ? 14.826  63.878  114.401 1.00 0.00 ?  10  TRP A HA   7  
ATOM 9993  H HB2  . TRP A 1 19  ? 16.803  64.973  114.605 1.00 0.00 ?  10  TRP A HB2  7  
ATOM 9994  H HB3  . TRP A 1 19  ? 17.305  63.960  116.030 1.00 0.00 ?  10  TRP A HB3  7  
ATOM 9995  H HD1  . TRP A 1 19  ? 18.445  61.492  115.585 1.00 0.00 ?  10  TRP A HD1  7  
ATOM 9996  H HE1  . TRP A 1 19  ? 19.612  60.476  113.571 1.00 0.00 ?  10  TRP A HE1  7  
ATOM 9997  H HE3  . TRP A 1 19  ? 17.036  64.990  112.163 1.00 0.00 ?  10  TRP A HE3  7  
ATOM 9998  H HZ2  . TRP A 1 19  ? 19.653  60.929  110.748 1.00 0.00 ?  10  TRP A HZ2  7  
ATOM 9999  H HZ3  . TRP A 1 19  ? 17.826  64.778  109.752 1.00 0.00 ?  10  TRP A HZ3  7  
ATOM 10000 H HH2  . TRP A 1 19  ? 18.929  62.689  108.986 1.00 0.00 ?  10  TRP A HH2  7  
ATOM 10001 N N    . TYR A 1 20  ? 15.597  61.241  116.060 1.00 0.00 ?  11  TYR A N    7  
ATOM 10002 C CA   . TYR A 1 20  ? 15.236  59.746  116.124 1.00 0.00 ?  11  TYR A CA   7  
ATOM 10003 C C    . TYR A 1 20  ? 13.728  59.378  115.990 1.00 0.00 ?  11  TYR A C    7  
ATOM 10004 O O    . TYR A 1 20  ? 13.415  58.361  115.381 1.00 0.00 ?  11  TYR A O    7  
ATOM 10005 C CB   . TYR A 1 20  ? 16.132  59.034  117.263 1.00 0.00 ?  11  TYR A CB   7  
ATOM 10006 C CG   . TYR A 1 20  ? 17.545  58.668  116.884 1.00 0.00 ?  11  TYR A CG   7  
ATOM 10007 C CD1  . TYR A 1 20  ? 17.818  57.641  115.944 1.00 0.00 ?  11  TYR A CD1  7  
ATOM 10008 C CD2  . TYR A 1 20  ? 18.595  59.529  117.367 1.00 0.00 ?  11  TYR A CD2  7  
ATOM 10009 C CE1  . TYR A 1 20  ? 19.193  57.376  115.724 1.00 0.00 ?  11  TYR A CE1  7  
ATOM 10010 C CE2  . TYR A 1 20  ? 19.958  59.320  117.062 1.00 0.00 ?  11  TYR A CE2  7  
ATOM 10011 C CZ   . TYR A 1 20  ? 20.265  58.204  116.213 1.00 0.00 ?  11  TYR A CZ   7  
ATOM 10012 O OH   . TYR A 1 20  ? 21.562  57.877  115.947 1.00 0.00 ?  11  TYR A OH   7  
ATOM 10013 H H    . TYR A 1 20  ? 15.997  61.749  116.836 1.00 0.00 ?  11  TYR A H    7  
ATOM 10014 H HA   . TYR A 1 20  ? 15.662  59.316  115.219 1.00 0.00 ?  11  TYR A HA   7  
ATOM 10015 H HB2  . TYR A 1 20  ? 16.147  59.721  118.109 1.00 0.00 ?  11  TYR A HB2  7  
ATOM 10016 H HB3  . TYR A 1 20  ? 15.578  58.189  117.671 1.00 0.00 ?  11  TYR A HB3  7  
ATOM 10017 H HD1  . TYR A 1 20  ? 17.107  56.997  115.448 1.00 0.00 ?  11  TYR A HD1  7  
ATOM 10018 H HD2  . TYR A 1 20  ? 18.295  60.464  117.817 1.00 0.00 ?  11  TYR A HD2  7  
ATOM 10019 H HE1  . TYR A 1 20  ? 19.510  56.475  115.221 1.00 0.00 ?  11  TYR A HE1  7  
ATOM 10020 H HE2  . TYR A 1 20  ? 20.689  60.056  117.364 1.00 0.00 ?  11  TYR A HE2  7  
ATOM 10021 H HH   . TYR A 1 20  ? 21.783  57.430  115.126 1.00 0.00 ?  11  TYR A HH   7  
ATOM 10022 N N    . GLU A 1 21  ? 12.892  60.239  116.435 1.00 0.00 ?  12  GLU A N    7  
ATOM 10023 C CA   . GLU A 1 21  ? 11.460  60.114  116.262 1.00 0.00 ?  12  GLU A CA   7  
ATOM 10024 C C    . GLU A 1 21  ? 10.873  60.726  114.977 1.00 0.00 ?  12  GLU A C    7  
ATOM 10025 O O    . GLU A 1 21  ? 9.679   60.471  114.700 1.00 0.00 ?  12  GLU A O    7  
ATOM 10026 C CB   . GLU A 1 21  ? 10.769  60.747  117.515 1.00 0.00 ?  12  GLU A CB   7  
ATOM 10027 C CG   . GLU A 1 21  ? 9.325   60.341  117.736 1.00 0.00 ?  12  GLU A CG   7  
ATOM 10028 C CD   . GLU A 1 21  ? 8.678   61.035  118.961 1.00 0.00 ?  12  GLU A CD   7  
ATOM 10029 O OE1  . GLU A 1 21  ? 9.225   61.992  119.590 1.00 0.00 -1 12  GLU A OE1  7  
ATOM 10030 O OE2  . GLU A 1 21  ? 7.597   60.581  119.263 1.00 0.00 ?  12  GLU A OE2  7  
ATOM 10031 H H    . GLU A 1 21  ? 13.299  60.972  116.999 1.00 0.00 ?  12  GLU A H    7  
ATOM 10032 H HA   . GLU A 1 21  ? 11.195  59.057  116.273 1.00 0.00 ?  12  GLU A HA   7  
ATOM 10033 H HB2  . GLU A 1 21  ? 11.363  60.327  118.328 1.00 0.00 ?  12  GLU A HB2  7  
ATOM 10034 H HB3  . GLU A 1 21  ? 10.743  61.836  117.490 1.00 0.00 ?  12  GLU A HB3  7  
ATOM 10035 H HG2  . GLU A 1 21  ? 8.698   60.615  116.886 1.00 0.00 ?  12  GLU A HG2  7  
ATOM 10036 H HG3  . GLU A 1 21  ? 9.385   59.263  117.888 1.00 0.00 ?  12  GLU A HG3  7  
ATOM 10037 N N    . SER A 1 22  ? 11.662  61.496  114.286 1.00 0.00 ?  13  SER A N    7  
ATOM 10038 C CA   . SER A 1 22  ? 11.353  61.937  112.961 1.00 0.00 ?  13  SER A CA   7  
ATOM 10039 C C    . SER A 1 22  ? 11.775  60.794  112.003 1.00 0.00 ?  13  SER A C    7  
ATOM 10040 O O    . SER A 1 22  ? 10.994  60.594  111.023 1.00 0.00 ?  13  SER A O    7  
ATOM 10041 C CB   . SER A 1 22  ? 12.055  63.268  112.678 1.00 0.00 ?  13  SER A CB   7  
ATOM 10042 O OG   . SER A 1 22  ? 11.657  64.237  113.673 1.00 0.00 ?  13  SER A OG   7  
ATOM 10043 H H    . SER A 1 22  ? 12.547  61.758  114.696 1.00 0.00 ?  13  SER A H    7  
ATOM 10044 H HA   . SER A 1 22  ? 10.270  62.057  112.919 1.00 0.00 ?  13  SER A HA   7  
ATOM 10045 H HB2  . SER A 1 22  ? 13.138  63.155  112.717 1.00 0.00 ?  13  SER A HB2  7  
ATOM 10046 H HB3  . SER A 1 22  ? 11.672  63.566  111.703 1.00 0.00 ?  13  SER A HB3  7  
ATOM 10047 H HG   . SER A 1 22  ? 12.101  63.930  114.466 1.00 0.00 ?  13  SER A HG   7  
ATOM 10048 N N    . LEU A 1 23  ? 12.877  60.059  112.240 1.00 0.00 ?  14  LEU A N    7  
ATOM 10049 C CA   . LEU A 1 23  ? 13.173  58.867  111.446 1.00 0.00 ?  14  LEU A CA   7  
ATOM 10050 C C    . LEU A 1 23  ? 12.036  57.825  111.607 1.00 0.00 ?  14  LEU A C    7  
ATOM 10051 O O    . LEU A 1 23  ? 11.713  57.109  110.654 1.00 0.00 ?  14  LEU A O    7  
ATOM 10052 C CB   . LEU A 1 23  ? 14.492  58.126  111.874 1.00 0.00 ?  14  LEU A CB   7  
ATOM 10053 C CG   . LEU A 1 23  ? 15.716  59.060  111.637 1.00 0.00 ?  14  LEU A CG   7  
ATOM 10054 C CD1  . LEU A 1 23  ? 16.959  58.299  112.092 1.00 0.00 ?  14  LEU A CD1  7  
ATOM 10055 C CD2  . LEU A 1 23  ? 15.979  59.486  110.222 1.00 0.00 ?  14  LEU A CD2  7  
ATOM 10056 H H    . LEU A 1 23  ? 13.583  60.387  112.882 1.00 0.00 ?  14  LEU A H    7  
ATOM 10057 H HA   . LEU A 1 23  ? 13.269  59.133  110.393 1.00 0.00 ?  14  LEU A HA   7  
ATOM 10058 H HB2  . LEU A 1 23  ? 14.424  57.707  112.878 1.00 0.00 ?  14  LEU A HB2  7  
ATOM 10059 H HB3  . LEU A 1 23  ? 14.614  57.365  111.104 1.00 0.00 ?  14  LEU A HB3  7  
ATOM 10060 H HG   . LEU A 1 23  ? 15.558  59.920  112.285 1.00 0.00 ?  14  LEU A HG   7  
ATOM 10061 H HD11 . LEU A 1 23  ? 16.925  57.306  111.646 1.00 0.00 ?  14  LEU A HD11 7  
ATOM 10062 H HD12 . LEU A 1 23  ? 17.809  58.888  111.747 1.00 0.00 ?  14  LEU A HD12 7  
ATOM 10063 H HD13 . LEU A 1 23  ? 16.893  58.223  113.177 1.00 0.00 ?  14  LEU A HD13 7  
ATOM 10064 H HD21 . LEU A 1 23  ? 16.842  60.149  110.287 1.00 0.00 ?  14  LEU A HD21 7  
ATOM 10065 H HD22 . LEU A 1 23  ? 16.242  58.673  109.546 1.00 0.00 ?  14  LEU A HD22 7  
ATOM 10066 H HD23 . LEU A 1 23  ? 15.216  60.096  109.736 1.00 0.00 ?  14  LEU A HD23 7  
ATOM 10067 N N    . HIS A 1 24  ? 11.470  57.796  112.807 1.00 0.00 ?  15  HIS A N    7  
ATOM 10068 C CA   . HIS A 1 24  ? 10.439  56.835  113.140 1.00 0.00 ?  15  HIS A CA   7  
ATOM 10069 C C    . HIS A 1 24  ? 9.247   57.056  112.319 1.00 0.00 ?  15  HIS A C    7  
ATOM 10070 O O    . HIS A 1 24  ? 8.621   56.121  111.900 1.00 0.00 ?  15  HIS A O    7  
ATOM 10071 C CB   . HIS A 1 24  ? 10.019  56.920  114.657 1.00 0.00 ?  15  HIS A CB   7  
ATOM 10072 C CG   . HIS A 1 24  ? 8.902   56.080  115.147 1.00 0.00 ?  15  HIS A CG   7  
ATOM 10073 N ND1  . HIS A 1 24  ? 8.863   54.738  115.215 1.00 0.00 ?  15  HIS A ND1  7  
ATOM 10074 C CD2  . HIS A 1 24  ? 7.792   56.558  115.729 1.00 0.00 ?  15  HIS A CD2  7  
ATOM 10075 C CE1  . HIS A 1 24  ? 7.759   54.409  115.851 1.00 0.00 ?  15  HIS A CE1  7  
ATOM 10076 N NE2  . HIS A 1 24  ? 7.043   55.484  116.159 1.00 0.00 ?  15  HIS A NE2  7  
ATOM 10077 H H    . HIS A 1 24  ? 11.836  58.464  113.471 1.00 0.00 ?  15  HIS A H    7  
ATOM 10078 H HA   . HIS A 1 24  ? 10.829  55.825  113.013 1.00 0.00 ?  15  HIS A HA   7  
ATOM 10079 H HB2  . HIS A 1 24  ? 10.959  56.851  115.206 1.00 0.00 ?  15  HIS A HB2  7  
ATOM 10080 H HB3  . HIS A 1 24  ? 9.578   57.915  114.702 1.00 0.00 ?  15  HIS A HB3  7  
ATOM 10081 H HD2  . HIS A 1 24  ? 7.503   57.593  115.833 1.00 0.00 ?  15  HIS A HD2  7  
ATOM 10082 H HE1  . HIS A 1 24  ? 7.402   53.426  116.122 1.00 0.00 ?  15  HIS A HE1  7  
ATOM 10083 H HE2  . HIS A 1 24  ? 6.205   55.359  116.709 1.00 0.00 ?  15  HIS A HE2  7  
ATOM 10084 N N    . ALA A 1 25  ? 8.869   58.342  112.099 1.00 0.00 ?  16  ALA A N    7  
ATOM 10085 C CA   . ALA A 1 25  ? 7.824   58.687  111.132 1.00 0.00 ?  16  ALA A CA   7  
ATOM 10086 C C    . ALA A 1 25  ? 8.083   58.280  109.649 1.00 0.00 ?  16  ALA A C    7  
ATOM 10087 O O    . ALA A 1 25  ? 7.110   57.983  108.907 1.00 0.00 ?  16  ALA A O    7  
ATOM 10088 C CB   . ALA A 1 25  ? 7.549   60.196  111.084 1.00 0.00 ?  16  ALA A CB   7  
ATOM 10089 H H    . ALA A 1 25  ? 9.440   59.085  112.476 1.00 0.00 ?  16  ALA A H    7  
ATOM 10090 H HA   . ALA A 1 25  ? 6.896   58.202  111.435 1.00 0.00 ?  16  ALA A HA   7  
ATOM 10091 H HB1  . ALA A 1 25  ? 8.378   60.797  110.708 1.00 0.00 ?  16  ALA A HB1  7  
ATOM 10092 H HB2  . ALA A 1 25  ? 6.612   60.393  110.565 1.00 0.00 ?  16  ALA A HB2  7  
ATOM 10093 H HB3  . ALA A 1 25  ? 7.318   60.502  112.105 1.00 0.00 ?  16  ALA A HB3  7  
ATOM 10094 N N    . VAL A 1 26  ? 9.364   58.209  109.226 1.00 0.00 ?  17  VAL A N    7  
ATOM 10095 C CA   . VAL A 1 26  ? 9.803   57.673  107.906 1.00 0.00 ?  17  VAL A CA   7  
ATOM 10096 C C    . VAL A 1 26  ? 9.680   56.161  107.813 1.00 0.00 ?  17  VAL A C    7  
ATOM 10097 O O    . VAL A 1 26  ? 8.982   55.694  106.937 1.00 0.00 ?  17  VAL A O    7  
ATOM 10098 C CB   . VAL A 1 26  ? 11.126  58.157  107.526 1.00 0.00 ?  17  VAL A CB   7  
ATOM 10099 C CG1  . VAL A 1 26  ? 11.485  58.010  106.035 1.00 0.00 ?  17  VAL A CG1  7  
ATOM 10100 C CG2  . VAL A 1 26  ? 11.354  59.603  107.883 1.00 0.00 ?  17  VAL A CG2  7  
ATOM 10101 H H    . VAL A 1 26  ? 10.092  58.422  109.894 1.00 0.00 ?  17  VAL A H    7  
ATOM 10102 H HA   . VAL A 1 26  ? 9.100   58.138  107.215 1.00 0.00 ?  17  VAL A HA   7  
ATOM 10103 H HB   . VAL A 1 26  ? 11.878  57.576  108.060 1.00 0.00 ?  17  VAL A HB   7  
ATOM 10104 H HG11 . VAL A 1 26  ? 10.777  58.567  105.421 1.00 0.00 ?  17  VAL A HG11 7  
ATOM 10105 H HG12 . VAL A 1 26  ? 12.459  58.450  105.820 1.00 0.00 ?  17  VAL A HG12 7  
ATOM 10106 H HG13 . VAL A 1 26  ? 11.404  56.952  105.784 1.00 0.00 ?  17  VAL A HG13 7  
ATOM 10107 H HG21 . VAL A 1 26  ? 12.428  59.760  107.795 1.00 0.00 ?  17  VAL A HG21 7  
ATOM 10108 H HG22 . VAL A 1 26  ? 10.753  60.184  107.183 1.00 0.00 ?  17  VAL A HG22 7  
ATOM 10109 H HG23 . VAL A 1 26  ? 11.135  59.842  108.924 1.00 0.00 ?  17  VAL A HG23 7  
ATOM 10110 N N    . LEU A 1 27  ? 10.067  55.358  108.837 1.00 0.00 ?  18  LEU A N    7  
ATOM 10111 C CA   . LEU A 1 27  ? 9.832   53.985  108.958 1.00 0.00 ?  18  LEU A CA   7  
ATOM 10112 C C    . LEU A 1 27  ? 8.343   53.600  109.003 1.00 0.00 ?  18  LEU A C    7  
ATOM 10113 O O    . LEU A 1 27  ? 7.975   52.552  108.487 1.00 0.00 ?  18  LEU A O    7  
ATOM 10114 C CB   . LEU A 1 27  ? 10.450  53.370  110.255 1.00 0.00 ?  18  LEU A CB   7  
ATOM 10115 C CG   . LEU A 1 27  ? 11.933  53.545  110.441 1.00 0.00 ?  18  LEU A CG   7  
ATOM 10116 C CD1  . LEU A 1 27  ? 12.257  53.029  111.884 1.00 0.00 ?  18  LEU A CD1  7  
ATOM 10117 C CD2  . LEU A 1 27  ? 12.774  52.782  109.337 1.00 0.00 ?  18  LEU A CD2  7  
ATOM 10118 H H    . LEU A 1 27  ? 10.354  55.799  109.700 1.00 0.00 ?  18  LEU A H    7  
ATOM 10119 H HA   . LEU A 1 27  ? 10.260  53.480  108.093 1.00 0.00 ?  18  LEU A HA   7  
ATOM 10120 H HB2  . LEU A 1 27  ? 9.919   53.828  111.091 1.00 0.00 ?  18  LEU A HB2  7  
ATOM 10121 H HB3  . LEU A 1 27  ? 10.292  52.291  110.229 1.00 0.00 ?  18  LEU A HB3  7  
ATOM 10122 H HG   . LEU A 1 27  ? 12.205  54.598  110.380 1.00 0.00 ?  18  LEU A HG   7  
ATOM 10123 H HD11 . LEU A 1 27  ? 11.600  53.509  112.609 1.00 0.00 ?  18  LEU A HD11 7  
ATOM 10124 H HD12 . LEU A 1 27  ? 11.999  51.973  111.953 1.00 0.00 ?  18  LEU A HD12 7  
ATOM 10125 H HD13 . LEU A 1 27  ? 13.286  53.140  112.221 1.00 0.00 ?  18  LEU A HD13 7  
ATOM 10126 H HD21 . LEU A 1 27  ? 12.358  53.104  108.383 1.00 0.00 ?  18  LEU A HD21 7  
ATOM 10127 H HD22 . LEU A 1 27  ? 13.811  53.114  109.378 1.00 0.00 ?  18  LEU A HD22 7  
ATOM 10128 H HD23 . LEU A 1 27  ? 12.757  51.704  109.499 1.00 0.00 ?  18  LEU A HD23 7  
ATOM 10129 N N    . LYS A 1 28  ? 7.421   54.437  109.520 1.00 0.00 ?  19  LYS A N    7  
ATOM 10130 C CA   . LYS A 1 28  ? 5.979   54.261  109.414 1.00 0.00 ?  19  LYS A CA   7  
ATOM 10131 C C    . LYS A 1 28  ? 5.427   54.324  108.049 1.00 0.00 ?  19  LYS A C    7  
ATOM 10132 O O    . LYS A 1 28  ? 4.637   53.457  107.602 1.00 0.00 ?  19  LYS A O    7  
ATOM 10133 C CB   . LYS A 1 28  ? 5.397   55.241  110.388 1.00 0.00 ?  19  LYS A CB   7  
ATOM 10134 C CG   . LYS A 1 28  ? 3.913   55.123  110.649 1.00 0.00 ?  19  LYS A CG   7  
ATOM 10135 C CD   . LYS A 1 28  ? 3.265   53.912  111.227 1.00 0.00 ?  19  LYS A CD   7  
ATOM 10136 C CE   . LYS A 1 28  ? 4.144   53.278  112.318 1.00 0.00 ?  19  LYS A CE   7  
ATOM 10137 N NZ   . LYS A 1 28  ? 3.664   53.537  113.714 1.00 0.00 1  19  LYS A NZ   7  
ATOM 10138 H H    . LYS A 1 28  ? 7.711   55.287  109.981 1.00 0.00 ?  19  LYS A H    7  
ATOM 10139 H HA   . LYS A 1 28  ? 5.662   53.269  109.736 1.00 0.00 ?  19  LYS A HA   7  
ATOM 10140 H HB2  . LYS A 1 28  ? 6.011   55.220  111.288 1.00 0.00 ?  19  LYS A HB2  7  
ATOM 10141 H HB3  . LYS A 1 28  ? 5.602   56.233  109.982 1.00 0.00 ?  19  LYS A HB3  7  
ATOM 10142 H HG2  . LYS A 1 28  ? 3.851   55.933  111.376 1.00 0.00 ?  19  LYS A HG2  7  
ATOM 10143 H HG3  . LYS A 1 28  ? 3.200   55.422  109.881 1.00 0.00 ?  19  LYS A HG3  7  
ATOM 10144 H HD2  . LYS A 1 28  ? 2.294   54.148  111.662 1.00 0.00 ?  19  LYS A HD2  7  
ATOM 10145 H HD3  . LYS A 1 28  ? 3.033   53.222  110.417 1.00 0.00 ?  19  LYS A HD3  7  
ATOM 10146 H HE2  . LYS A 1 28  ? 4.040   52.219  112.079 1.00 0.00 ?  19  LYS A HE2  7  
ATOM 10147 H HE3  . LYS A 1 28  ? 5.185   53.590  112.235 1.00 0.00 ?  19  LYS A HE3  7  
ATOM 10148 H HZ1  . LYS A 1 28  ? 3.917   52.762  114.311 1.00 0.00 ?  19  LYS A HZ1  7  
ATOM 10149 H HZ2  . LYS A 1 28  ? 4.054   54.383  114.105 1.00 0.00 ?  19  LYS A HZ2  7  
ATOM 10150 H HZ3  . LYS A 1 28  ? 2.663   53.648  113.635 1.00 0.00 ?  19  LYS A HZ3  7  
ATOM 10151 N N    . ALA A 1 29  ? 5.940   55.334  107.346 1.00 0.00 ?  20  ALA A N    7  
ATOM 10152 C CA   . ALA A 1 29  ? 5.513   55.523  105.943 1.00 0.00 ?  20  ALA A CA   7  
ATOM 10153 C C    . ALA A 1 29  ? 6.035   54.358  105.135 1.00 0.00 ?  20  ALA A C    7  
ATOM 10154 O O    . ALA A 1 29  ? 5.277   53.789  104.367 1.00 0.00 ?  20  ALA A O    7  
ATOM 10155 C CB   . ALA A 1 29  ? 6.208   56.834  105.375 1.00 0.00 ?  20  ALA A CB   7  
ATOM 10156 H H    . ALA A 1 29  ? 6.511   56.059  107.758 1.00 0.00 ?  20  ALA A H    7  
ATOM 10157 H HA   . ALA A 1 29  ? 4.423   55.539  105.919 1.00 0.00 ?  20  ALA A HA   7  
ATOM 10158 H HB1  . ALA A 1 29  ? 7.284   56.662  105.396 1.00 0.00 ?  20  ALA A HB1  7  
ATOM 10159 H HB2  . ALA A 1 29  ? 5.811   57.045  104.382 1.00 0.00 ?  20  ALA A HB2  7  
ATOM 10160 H HB3  . ALA A 1 29  ? 6.048   57.665  106.063 1.00 0.00 ?  20  ALA A HB3  7  
ATOM 10161 N N    . LEU A 1 30  ? 7.312   53.945  105.258 1.00 0.00 ?  21  LEU A N    7  
ATOM 10162 C CA   . LEU A 1 30  ? 7.838   52.774  104.539 1.00 0.00 ?  21  LEU A CA   7  
ATOM 10163 C C    . LEU A 1 30  ? 7.241   51.431  104.953 1.00 0.00 ?  21  LEU A C    7  
ATOM 10164 O O    . LEU A 1 30  ? 6.887   50.667  104.077 1.00 0.00 ?  21  LEU A O    7  
ATOM 10165 C CB   . LEU A 1 30  ? 9.339   52.876  104.856 1.00 0.00 ?  21  LEU A CB   7  
ATOM 10166 C CG   . LEU A 1 30  ? 10.179  51.895  104.035 1.00 0.00 ?  21  LEU A CG   7  
ATOM 10167 C CD1  . LEU A 1 30  ? 11.560  52.535  103.577 1.00 0.00 ?  21  LEU A CD1  7  
ATOM 10168 C CD2  . LEU A 1 30  ? 10.385  50.556  104.758 1.00 0.00 ?  21  LEU A CD2  7  
ATOM 10169 H H    . LEU A 1 30  ? 7.954   54.348  105.926 1.00 0.00 ?  21  LEU A H    7  
ATOM 10170 H HA   . LEU A 1 30  ? 7.738   52.904  103.462 1.00 0.00 ?  21  LEU A HA   7  
ATOM 10171 H HB2  . LEU A 1 30  ? 9.672   53.867  104.550 1.00 0.00 ?  21  LEU A HB2  7  
ATOM 10172 H HB3  . LEU A 1 30  ? 9.501   52.730  105.924 1.00 0.00 ?  21  LEU A HB3  7  
ATOM 10173 H HG   . LEU A 1 30  ? 9.517   51.617  103.215 1.00 0.00 ?  21  LEU A HG   7  
ATOM 10174 H HD11 . LEU A 1 30  ? 11.335  53.539  103.216 1.00 0.00 ?  21  LEU A HD11 7  
ATOM 10175 H HD12 . LEU A 1 30  ? 12.257  52.634  104.409 1.00 0.00 ?  21  LEU A HD12 7  
ATOM 10176 H HD13 . LEU A 1 30  ? 12.001  51.960  102.762 1.00 0.00 ?  21  LEU A HD13 7  
ATOM 10177 H HD21 . LEU A 1 30  ? 10.940  50.704  105.685 1.00 0.00 ?  21  LEU A HD21 7  
ATOM 10178 H HD22 . LEU A 1 30  ? 9.402   50.193  105.058 1.00 0.00 ?  21  LEU A HD22 7  
ATOM 10179 H HD23 . LEU A 1 30  ? 10.908  49.919  104.044 1.00 0.00 ?  21  LEU A HD23 7  
ATOM 10180 N N    . ASN A 1 31  ? 7.114   51.092  106.206 1.00 0.00 ?  22  ASN A N    7  
ATOM 10181 C CA   . ASN A 1 31  ? 6.566   49.767  106.571 1.00 0.00 ?  22  ASN A CA   7  
ATOM 10182 C C    . ASN A 1 31  ? 5.101   49.593  106.169 1.00 0.00 ?  22  ASN A C    7  
ATOM 10183 O O    . ASN A 1 31  ? 4.643   48.461  106.118 1.00 0.00 ?  22  ASN A O    7  
ATOM 10184 C CB   . ASN A 1 31  ? 6.917   49.376  108.020 1.00 0.00 ?  22  ASN A CB   7  
ATOM 10185 C CG   . ASN A 1 31  ? 8.410   49.160  108.141 1.00 0.00 ?  22  ASN A CG   7  
ATOM 10186 O OD1  . ASN A 1 31  ? 8.930   48.317  107.382 1.00 0.00 ?  22  ASN A OD1  7  
ATOM 10187 N ND2  . ASN A 1 31  ? 9.070   49.840  109.037 1.00 0.00 ?  22  ASN A ND2  7  
ATOM 10188 H H    . ASN A 1 31  ? 7.414   51.689  106.963 1.00 0.00 ?  22  ASN A H    7  
ATOM 10189 H HA   . ASN A 1 31  ? 7.202   49.121  105.965 1.00 0.00 ?  22  ASN A HA   7  
ATOM 10190 H HB2  . ASN A 1 31  ? 6.653   50.143  108.748 1.00 0.00 ?  22  ASN A HB2  7  
ATOM 10191 H HB3  . ASN A 1 31  ? 6.478   48.422  108.313 1.00 0.00 ?  22  ASN A HB3  7  
ATOM 10192 H HD21 . ASN A 1 31  ? 8.561   50.394  109.711 1.00 0.00 ?  22  ASN A HD21 7  
ATOM 10193 H HD22 . ASN A 1 31  ? 10.022  49.565  109.237 1.00 0.00 ?  22  ASN A HD22 7  
ATOM 10194 N N    . ALA A 1 32  ? 4.385   50.725  106.021 1.00 0.00 ?  23  ALA A N    7  
ATOM 10195 C CA   . ALA A 1 32  ? 3.003   50.884  105.366 1.00 0.00 ?  23  ALA A CA   7  
ATOM 10196 C C    . ALA A 1 32  ? 2.965   50.821  103.853 1.00 0.00 ?  23  ALA A C    7  
ATOM 10197 O O    . ALA A 1 32  ? 2.119   50.037  103.353 1.00 0.00 ?  23  ALA A O    7  
ATOM 10198 C CB   . ALA A 1 32  ? 2.336   52.185  105.821 1.00 0.00 ?  23  ALA A CB   7  
ATOM 10199 H H    . ALA A 1 32  ? 4.885   51.602  106.045 1.00 0.00 ?  23  ALA A H    7  
ATOM 10200 H HA   . ALA A 1 32  ? 2.352   50.073  105.694 1.00 0.00 ?  23  ALA A HA   7  
ATOM 10201 H HB1  . ALA A 1 32  ? 2.191   52.100  106.898 1.00 0.00 ?  23  ALA A HB1  7  
ATOM 10202 H HB2  . ALA A 1 32  ? 2.978   53.044  105.623 1.00 0.00 ?  23  ALA A HB2  7  
ATOM 10203 H HB3  . ALA A 1 32  ? 1.407   52.375  105.283 1.00 0.00 ?  23  ALA A HB3  7  
ATOM 10204 N N    . THR A 1 33  ? 3.853   51.470  103.159 1.00 0.00 ?  24  THR A N    7  
ATOM 10205 C CA   . THR A 1 33  ? 4.093   51.178  101.757 1.00 0.00 ?  24  THR A CA   7  
ATOM 10206 C C    . THR A 1 33  ? 4.499   49.706  101.483 1.00 0.00 ?  24  THR A C    7  
ATOM 10207 O O    . THR A 1 33  ? 3.986   49.210  100.467 1.00 0.00 ?  24  THR A O    7  
ATOM 10208 C CB   . THR A 1 33  ? 5.165   52.113  101.148 1.00 0.00 ?  24  THR A CB   7  
ATOM 10209 O OG1  . THR A 1 33  ? 5.104   53.425  101.578 1.00 0.00 ?  24  THR A OG1  7  
ATOM 10210 C CG2  . THR A 1 33  ? 5.309   52.052  99.662  1.00 0.00 ?  24  THR A CG2  7  
ATOM 10211 H H    . THR A 1 33  ? 4.490   52.058  103.677 1.00 0.00 ?  24  THR A H    7  
ATOM 10212 H HA   . THR A 1 33  ? 3.185   51.438  101.210 1.00 0.00 ?  24  THR A HA   7  
ATOM 10213 H HB   . THR A 1 33  ? 6.099   51.786  101.604 1.00 0.00 ?  24  THR A HB   7  
ATOM 10214 H HG1  . THR A 1 33  ? 4.683   53.412  102.440 1.00 0.00 ?  24  THR A HG1  7  
ATOM 10215 H HG21 . THR A 1 33  ? 5.964   51.215  99.421  1.00 0.00 ?  24  THR A HG21 7  
ATOM 10216 H HG22 . THR A 1 33  ? 4.342   51.931  99.172  1.00 0.00 ?  24  THR A HG22 7  
ATOM 10217 H HG23 . THR A 1 33  ? 5.915   52.890  99.320  1.00 0.00 ?  24  THR A HG23 7  
ATOM 10218 N N    . LEU A 1 34  ? 5.181   49.083  102.452 1.00 0.00 ?  25  LEU A N    7  
ATOM 10219 C CA   . LEU A 1 34  ? 5.399   47.643  102.509 1.00 0.00 ?  25  LEU A CA   7  
ATOM 10220 C C    . LEU A 1 34  ? 4.172   46.898  102.932 1.00 0.00 ?  25  LEU A C    7  
ATOM 10221 O O    . LEU A 1 34  ? 3.845   45.898  102.261 1.00 0.00 ?  25  LEU A O    7  
ATOM 10222 C CB   . LEU A 1 34  ? 6.609   47.326  103.415 1.00 0.00 ?  25  LEU A CB   7  
ATOM 10223 C CG   . LEU A 1 34  ? 6.806   45.861  103.843 1.00 0.00 ?  25  LEU A CG   7  
ATOM 10224 C CD1  . LEU A 1 34  ? 7.362   45.033  102.699 1.00 0.00 ?  25  LEU A CD1  7  
ATOM 10225 C CD2  . LEU A 1 34  ? 7.590   45.755  105.170 1.00 0.00 ?  25  LEU A CD2  7  
ATOM 10226 H H    . LEU A 1 34  ? 5.717   49.620  103.119 1.00 0.00 ?  25  LEU A H    7  
ATOM 10227 H HA   . LEU A 1 34  ? 5.581   47.237  101.514 1.00 0.00 ?  25  LEU A HA   7  
ATOM 10228 H HB2  . LEU A 1 34  ? 7.487   47.675  102.871 1.00 0.00 ?  25  LEU A HB2  7  
ATOM 10229 H HB3  . LEU A 1 34  ? 6.591   48.005  104.266 1.00 0.00 ?  25  LEU A HB3  7  
ATOM 10230 H HG   . LEU A 1 34  ? 5.868   45.357  104.075 1.00 0.00 ?  25  LEU A HG   7  
ATOM 10231 H HD11 . LEU A 1 34  ? 8.044   45.700  102.170 1.00 0.00 ?  25  LEU A HD11 7  
ATOM 10232 H HD12 . LEU A 1 34  ? 7.809   44.081  102.989 1.00 0.00 ?  25  LEU A HD12 7  
ATOM 10233 H HD13 . LEU A 1 34  ? 6.546   44.788  102.020 1.00 0.00 ?  25  LEU A HD13 7  
ATOM 10234 H HD21 . LEU A 1 34  ? 7.134   46.421  105.903 1.00 0.00 ?  25  LEU A HD21 7  
ATOM 10235 H HD22 . LEU A 1 34  ? 7.617   44.724  105.523 1.00 0.00 ?  25  LEU A HD22 7  
ATOM 10236 H HD23 . LEU A 1 34  ? 8.621   46.017  104.926 1.00 0.00 ?  25  LEU A HD23 7  
ATOM 10237 N N    . HIS A 1 35  ? 3.273   47.362  103.852 1.00 0.00 ?  26  HIS A N    7  
ATOM 10238 C CA   . HIS A 1 35  ? 2.045   46.775  104.287 1.00 0.00 ?  26  HIS A CA   7  
ATOM 10239 C C    . HIS A 1 35  ? 0.961   46.821  103.254 1.00 0.00 ?  26  HIS A C    7  
ATOM 10240 O O    . HIS A 1 35  ? 0.126   45.885  103.162 1.00 0.00 ?  26  HIS A O    7  
ATOM 10241 C CB   . HIS A 1 35  ? 1.511   47.320  105.664 1.00 0.00 ?  26  HIS A CB   7  
ATOM 10242 C CG   . HIS A 1 35  ? 0.583   46.323  106.280 1.00 0.00 ?  26  HIS A CG   7  
ATOM 10243 N ND1  . HIS A 1 35  ? 0.988   45.252  107.120 1.00 0.00 ?  26  HIS A ND1  7  
ATOM 10244 C CD2  . HIS A 1 35  ? -0.797  46.345  106.215 1.00 0.00 ?  26  HIS A CD2  7  
ATOM 10245 C CE1  . HIS A 1 35  ? -0.169  44.691  107.532 1.00 0.00 ?  26  HIS A CE1  7  
ATOM 10246 N NE2  . HIS A 1 35  ? -1.260  45.299  107.010 1.00 0.00 ?  26  HIS A NE2  7  
ATOM 10247 H H    . HIS A 1 35  ? 3.497   48.218  104.340 1.00 0.00 ?  26  HIS A H    7  
ATOM 10248 H HA   . HIS A 1 35  ? 2.325   45.733  104.440 1.00 0.00 ?  26  HIS A HA   7  
ATOM 10249 H HB2  . HIS A 1 35  ? 2.346   47.269  106.364 1.00 0.00 ?  26  HIS A HB2  7  
ATOM 10250 H HB3  . HIS A 1 35  ? 1.112   48.330  105.567 1.00 0.00 ?  26  HIS A HB3  7  
ATOM 10251 H HD2  . HIS A 1 35  ? -1.339  46.942  105.497 1.00 0.00 ?  26  HIS A HD2  7  
ATOM 10252 H HE1  . HIS A 1 35  ? -0.139  43.734  108.030 1.00 0.00 ?  26  HIS A HE1  7  
ATOM 10253 H HE2  . HIS A 1 35  ? -2.191  44.918  107.101 1.00 0.00 ?  26  HIS A HE2  7  
ATOM 10254 N N    . SER A 1 36  ? 0.962   47.749  102.320 1.00 0.00 ?  27  SER A N    7  
ATOM 10255 C CA   . SER A 1 36  ? -0.010  47.898  101.286 1.00 0.00 ?  27  SER A CA   7  
ATOM 10256 C C    . SER A 1 36  ? 0.360   46.893  100.160 1.00 0.00 ?  27  SER A C    7  
ATOM 10257 O O    . SER A 1 36  ? -0.434  46.139  99.635  1.00 0.00 ?  27  SER A O    7  
ATOM 10258 C CB   . SER A 1 36  ? 0.038   49.344  100.651 1.00 0.00 ?  27  SER A CB   7  
ATOM 10259 O OG   . SER A 1 36  ? -0.588  49.317  99.401  1.00 0.00 ?  27  SER A OG   7  
ATOM 10260 H H    . SER A 1 36  ? 1.694   48.431  102.455 1.00 0.00 ?  27  SER A H    7  
ATOM 10261 H HA   . SER A 1 36  ? -0.980  47.546  101.637 1.00 0.00 ?  27  SER A HA   7  
ATOM 10262 H HB2  . SER A 1 36  ? -0.494  49.997  101.342 1.00 0.00 ?  27  SER A HB2  7  
ATOM 10263 H HB3  . SER A 1 36  ? 1.022   49.783  100.485 1.00 0.00 ?  27  SER A HB3  7  
ATOM 10264 H HG   . SER A 1 36  ? -0.457  50.137  98.918  1.00 0.00 ?  27  SER A HG   7  
ATOM 10265 N N    . ASN A 1 37  ? 1.650   46.800  99.831  1.00 0.00 ?  28  ASN A N    7  
ATOM 10266 C CA   . ASN A 1 37  ? 2.143   45.697  98.962  1.00 0.00 ?  28  ASN A CA   7  
ATOM 10267 C C    . ASN A 1 37  ? 1.878   44.309  99.348  1.00 0.00 ?  28  ASN A C    7  
ATOM 10268 O O    . ASN A 1 37  ? 1.530   43.477  98.526  1.00 0.00 ?  28  ASN A O    7  
ATOM 10269 C CB   . ASN A 1 37  ? 3.641   45.898  98.736  1.00 0.00 ?  28  ASN A CB   7  
ATOM 10270 C CG   . ASN A 1 37  ? 4.068   47.138  97.914  1.00 0.00 ?  28  ASN A CG   7  
ATOM 10271 O OD1  . ASN A 1 37  ? 3.394   47.456  96.944  1.00 0.00 ?  28  ASN A OD1  7  
ATOM 10272 N ND2  . ASN A 1 37  ? 5.225   47.739  98.266  1.00 0.00 ?  28  ASN A ND2  7  
ATOM 10273 H H    . ASN A 1 37  ? 2.289   47.385  100.350 1.00 0.00 ?  28  ASN A H    7  
ATOM 10274 H HA   . ASN A 1 37  ? 1.593   45.803  98.027  1.00 0.00 ?  28  ASN A HA   7  
ATOM 10275 H HB2  . ASN A 1 37  ? 4.033   46.032  99.744  1.00 0.00 ?  28  ASN A HB2  7  
ATOM 10276 H HB3  . ASN A 1 37  ? 4.122   45.049  98.250  1.00 0.00 ?  28  ASN A HB3  7  
ATOM 10277 H HD21 . ASN A 1 37  ? 5.847   47.376  98.975  1.00 0.00 ?  28  ASN A HD21 7  
ATOM 10278 H HD22 . ASN A 1 37  ? 5.666   48.330  97.576  1.00 0.00 ?  28  ASN A HD22 7  
ATOM 10279 N N    . LEU A 1 38  ? 2.039   43.978  100.569 1.00 0.00 ?  29  LEU A N    7  
ATOM 10280 C CA   . LEU A 1 38  ? 1.693   42.716  101.245 1.00 0.00 ?  29  LEU A CA   7  
ATOM 10281 C C    . LEU A 1 38  ? 0.236   42.246  101.178 1.00 0.00 ?  29  LEU A C    7  
ATOM 10282 O O    . LEU A 1 38  ? -0.118  41.067  101.156 1.00 0.00 ?  29  LEU A O    7  
ATOM 10283 C CB   . LEU A 1 38  ? 2.276   42.955  102.643 1.00 0.00 ?  29  LEU A CB   7  
ATOM 10284 C CG   . LEU A 1 38  ? 2.165   41.876  103.728 1.00 0.00 ?  29  LEU A CG   7  
ATOM 10285 C CD1  . LEU A 1 38  ? 2.582   40.478  103.372 1.00 0.00 ?  29  LEU A CD1  7  
ATOM 10286 C CD2  . LEU A 1 38  ? 2.922   42.478  104.913 1.00 0.00 ?  29  LEU A CD2  7  
ATOM 10287 H H    . LEU A 1 38  ? 2.409   44.757  101.095 1.00 0.00 ?  29  LEU A H    7  
ATOM 10288 H HA   . LEU A 1 38  ? 2.310   41.947  100.780 1.00 0.00 ?  29  LEU A HA   7  
ATOM 10289 H HB2  . LEU A 1 38  ? 3.342   43.129  102.500 1.00 0.00 ?  29  LEU A HB2  7  
ATOM 10290 H HB3  . LEU A 1 38  ? 1.784   43.840  103.045 1.00 0.00 ?  29  LEU A HB3  7  
ATOM 10291 H HG   . LEU A 1 38  ? 1.103   42.018  103.927 1.00 0.00 ?  29  LEU A HG   7  
ATOM 10292 H HD11 . LEU A 1 38  ? 3.633   40.544  103.092 1.00 0.00 ?  29  LEU A HD11 7  
ATOM 10293 H HD12 . LEU A 1 38  ? 2.448   39.832  104.240 1.00 0.00 ?  29  LEU A HD12 7  
ATOM 10294 H HD13 . LEU A 1 38  ? 2.043   40.026  102.538 1.00 0.00 ?  29  LEU A HD13 7  
ATOM 10295 H HD21 . LEU A 1 38  ? 2.502   43.382  105.355 1.00 0.00 ?  29  LEU A HD21 7  
ATOM 10296 H HD22 . LEU A 1 38  ? 3.030   41.733  105.703 1.00 0.00 ?  29  LEU A HD22 7  
ATOM 10297 H HD23 . LEU A 1 38  ? 3.958   42.575  104.591 1.00 0.00 ?  29  LEU A HD23 7  
ATOM 10298 N N    . LEU A 1 39  ? -0.709  43.184  101.002 1.00 0.00 ?  30  LEU A N    7  
ATOM 10299 C CA   . LEU A 1 39  ? -2.166  42.913  100.759 1.00 0.00 ?  30  LEU A CA   7  
ATOM 10300 C C    . LEU A 1 39  ? -2.574  43.166  99.281  1.00 0.00 ?  30  LEU A C    7  
ATOM 10301 O O    . LEU A 1 39  ? -3.570  42.584  98.866  1.00 0.00 ?  30  LEU A O    7  
ATOM 10302 C CB   . LEU A 1 39  ? -2.908  43.763  101.843 1.00 0.00 ?  30  LEU A CB   7  
ATOM 10303 C CG   . LEU A 1 39  ? -2.699  43.313  103.282 1.00 0.00 ?  30  LEU A CG   7  
ATOM 10304 C CD1  . LEU A 1 39  ? -3.152  44.366  104.266 1.00 0.00 ?  30  LEU A CD1  7  
ATOM 10305 C CD2  . LEU A 1 39  ? -3.472  42.058  103.615 1.00 0.00 ?  30  LEU A CD2  7  
ATOM 10306 H H    . LEU A 1 39  ? -0.571  44.185  100.992 1.00 0.00 ?  30  LEU A H    7  
ATOM 10307 H HA   . LEU A 1 39  ? -2.298  41.842  100.908 1.00 0.00 ?  30  LEU A HA   7  
ATOM 10308 H HB2  . LEU A 1 39  ? -2.526  44.783  101.794 1.00 0.00 ?  30  LEU A HB2  7  
ATOM 10309 H HB3  . LEU A 1 39  ? -3.928  43.788  101.458 1.00 0.00 ?  30  LEU A HB3  7  
ATOM 10310 H HG   . LEU A 1 39  ? -1.649  43.161  103.530 1.00 0.00 ?  30  LEU A HG   7  
ATOM 10311 H HD11 . LEU A 1 39  ? -4.045  44.872  103.898 1.00 0.00 ?  30  LEU A HD11 7  
ATOM 10312 H HD12 . LEU A 1 39  ? -3.329  44.065  105.299 1.00 0.00 ?  30  LEU A HD12 7  
ATOM 10313 H HD13 . LEU A 1 39  ? -2.466  45.210  104.195 1.00 0.00 ?  30  LEU A HD13 7  
ATOM 10314 H HD21 . LEU A 1 39  ? -4.547  42.227  103.688 1.00 0.00 ?  30  LEU A HD21 7  
ATOM 10315 H HD22 . LEU A 1 39  ? -3.227  41.361  102.813 1.00 0.00 ?  30  LEU A HD22 7  
ATOM 10316 H HD23 . LEU A 1 39  ? -3.099  41.720  104.582 1.00 0.00 ?  30  LEU A HD23 7  
ATOM 10317 N N    . CYS A 1 40  ? -1.826  44.000  98.521  1.00 0.00 ?  31  CYS A N    7  
ATOM 10318 C CA   . CYS A 1 40  ? -2.037  44.222  97.080  1.00 0.00 ?  31  CYS A CA   7  
ATOM 10319 C C    . CYS A 1 40  ? -1.936  42.892  96.321  1.00 0.00 ?  31  CYS A C    7  
ATOM 10320 O O    . CYS A 1 40  ? -1.312  41.920  96.824  1.00 0.00 ?  31  CYS A O    7  
ATOM 10321 C CB   . CYS A 1 40  ? -1.035  45.197  96.505  1.00 0.00 ?  31  CYS A CB   7  
ATOM 10322 S SG   . CYS A 1 40  ? -1.553  45.768  94.852  1.00 0.00 ?  31  CYS A SG   7  
ATOM 10323 H H    . CYS A 1 40  ? -1.136  44.551  99.013  1.00 0.00 ?  31  CYS A H    7  
ATOM 10324 H HA   . CYS A 1 40  ? -3.044  44.626  96.982  1.00 0.00 ?  31  CYS A HA   7  
ATOM 10325 H HB2  . CYS A 1 40  ? -0.876  46.076  97.131  1.00 0.00 ?  31  CYS A HB2  7  
ATOM 10326 H HB3  . CYS A 1 40  ? -0.071  44.698  96.400  1.00 0.00 ?  31  CYS A HB3  7  
ATOM 10327 H HG   . CYS A 1 40  ? -0.287  45.719  94.428  1.00 0.00 ?  31  CYS A HG   7  
ATOM 10328 N N    . ARG A 1 41  ? -2.693  42.794  95.248  1.00 0.00 ?  32  ARG A N    7  
ATOM 10329 C CA   . ARG A 1 41  ? -3.124  41.658  94.338  1.00 0.00 ?  32  ARG A CA   7  
ATOM 10330 C C    . ARG A 1 41  ? -1.931  41.479  93.325  1.00 0.00 ?  32  ARG A C    7  
ATOM 10331 O O    . ARG A 1 41  ? -1.734  42.281  92.374  1.00 0.00 ?  32  ARG A O    7  
ATOM 10332 C CB   . ARG A 1 41  ? -4.382  42.100  93.571  1.00 0.00 ?  32  ARG A CB   7  
ATOM 10333 C CG   . ARG A 1 41  ? -5.007  41.386  92.338  1.00 0.00 ?  32  ARG A CG   7  
ATOM 10334 C CD   . ARG A 1 41  ? -5.333  39.897  92.768  1.00 0.00 ?  32  ARG A CD   7  
ATOM 10335 N NE   . ARG A 1 41  ? -6.310  39.238  91.858  1.00 0.00 ?  32  ARG A NE   7  
ATOM 10336 C CZ   . ARG A 1 41  ? -6.723  37.991  92.000  1.00 0.00 ?  32  ARG A CZ   7  
ATOM 10337 N NH1  . ARG A 1 41  ? -6.358  37.239  92.981  1.00 0.00 ?  32  ARG A NH1  7  
ATOM 10338 N NH2  . ARG A 1 41  ? -7.705  37.521  91.281  1.00 0.00 1  32  ARG A NH2  7  
ATOM 10339 H H    . ARG A 1 41  ? -3.112  43.667  94.959  1.00 0.00 ?  32  ARG A H    7  
ATOM 10340 H HA   . ARG A 1 41  ? -3.291  40.784  94.969  1.00 0.00 ?  32  ARG A HA   7  
ATOM 10341 H HB2  . ARG A 1 41  ? -5.167  42.130  94.327  1.00 0.00 ?  32  ARG A HB2  7  
ATOM 10342 H HB3  . ARG A 1 41  ? -4.202  43.111  93.206  1.00 0.00 ?  32  ARG A HB3  7  
ATOM 10343 H HG2  . ARG A 1 41  ? -5.905  41.919  92.025  1.00 0.00 ?  32  ARG A HG2  7  
ATOM 10344 H HG3  . ARG A 1 41  ? -4.311  41.367  91.499  1.00 0.00 ?  32  ARG A HG3  7  
ATOM 10345 H HD2  . ARG A 1 41  ? -4.372  39.383  92.751  1.00 0.00 ?  32  ARG A HD2  7  
ATOM 10346 H HD3  . ARG A 1 41  ? -5.841  40.001  93.727  1.00 0.00 ?  32  ARG A HD3  7  
ATOM 10347 H HE   . ARG A 1 41  ? -6.718  39.845  91.162  1.00 0.00 ?  32  ARG A HE   7  
ATOM 10348 H HH11 . ARG A 1 41  ? -5.719  37.721  93.597  1.00 0.00 ?  32  ARG A HH11 7  
ATOM 10349 H HH12 . ARG A 1 41  ? -6.773  36.318  92.977  1.00 0.00 ?  32  ARG A HH12 7  
ATOM 10350 H HH21 . ARG A 1 41  ? -8.212  38.116  90.643  1.00 0.00 ?  32  ARG A HH21 7  
ATOM 10351 H HH22 . ARG A 1 41  ? -8.271  36.714  91.497  1.00 0.00 ?  32  ARG A HH22 7  
ATOM 10352 N N    . PRO A 1 42  ? -1.125  40.388  93.424  1.00 0.00 ?  33  PRO A N    7  
ATOM 10353 C CA   . PRO A 1 42  ? -0.160  40.030  92.325  1.00 0.00 ?  33  PRO A CA   7  
ATOM 10354 C C    . PRO A 1 42  ? -0.877  39.733  90.958  1.00 0.00 ?  33  PRO A C    7  
ATOM 10355 O O    . PRO A 1 42  ? -2.129  39.782  90.838  1.00 0.00 ?  33  PRO A O    7  
ATOM 10356 C CB   . PRO A 1 42  ? 0.434   38.731  92.862  1.00 0.00 ?  33  PRO A CB   7  
ATOM 10357 C CG   . PRO A 1 42  ? -0.548  38.157  93.845  1.00 0.00 ?  33  PRO A CG   7  
ATOM 10358 C CD   . PRO A 1 42  ? -1.216  39.383  94.464  1.00 0.00 ?  33  PRO A CD   7  
ATOM 10359 H HA   . PRO A 1 42  ? 0.555   40.850  92.252  1.00 0.00 ?  33  PRO A HA   7  
ATOM 10360 H HB2  . PRO A 1 42  ? 0.672   37.926  92.167  1.00 0.00 ?  33  PRO A HB2  7  
ATOM 10361 H HB3  . PRO A 1 42  ? 1.285   39.065  93.455  1.00 0.00 ?  33  PRO A HB3  7  
ATOM 10362 H HG2  . PRO A 1 42  ? -1.378  37.669  93.334  1.00 0.00 ?  33  PRO A HG2  7  
ATOM 10363 H HG3  . PRO A 1 42  ? 0.041   37.660  94.616  1.00 0.00 ?  33  PRO A HG3  7  
ATOM 10364 H HD2  . PRO A 1 42  ? -2.193  38.961  94.702  1.00 0.00 ?  33  PRO A HD2  7  
ATOM 10365 H HD3  . PRO A 1 42  ? -0.689  39.624  95.387  1.00 0.00 ?  33  PRO A HD3  7  
ATOM 10366 N N    . GLY A 1 43  ? -0.044  39.336  90.018  1.00 0.00 ?  34  GLY A N    7  
ATOM 10367 C CA   . GLY A 1 43  ? -0.592  38.972  88.730  1.00 0.00 ?  34  GLY A CA   7  
ATOM 10368 C C    . GLY A 1 43  ? 0.481   38.416  87.885  1.00 0.00 ?  34  GLY A C    7  
ATOM 10369 O O    . GLY A 1 43  ? 1.668   38.509  88.231  1.00 0.00 ?  34  GLY A O    7  
ATOM 10370 H H    . GLY A 1 43  ? 0.962   39.335  90.089  1.00 0.00 ?  34  GLY A H    7  
ATOM 10371 H HA2  . GLY A 1 43  ? -1.302  38.155  88.859  1.00 0.00 ?  34  GLY A HA2  7  
ATOM 10372 H HA3  . GLY A 1 43  ? -1.018  39.800  88.162  1.00 0.00 ?  34  GLY A HA3  7  
ATOM 10373 N N    . PRO A 1 44  ? 0.094   37.664  86.817  1.00 0.00 ?  35  PRO A N    7  
ATOM 10374 C CA   . PRO A 1 44  ? 0.989   37.094  85.862  1.00 0.00 ?  35  PRO A CA   7  
ATOM 10375 C C    . PRO A 1 44  ? 1.931   38.161  85.252  1.00 0.00 ?  35  PRO A C    7  
ATOM 10376 O O    . PRO A 1 44  ? 1.615   39.348  85.253  1.00 0.00 ?  35  PRO A O    7  
ATOM 10377 C CB   . PRO A 1 44  ? 0.052   36.363  84.875  1.00 0.00 ?  35  PRO A CB   7  
ATOM 10378 C CG   . PRO A 1 44  ? -1.134  37.320  84.793  1.00 0.00 ?  35  PRO A CG   7  
ATOM 10379 C CD   . PRO A 1 44  ? -1.233  37.563  86.293  1.00 0.00 ?  35  PRO A CD   7  
ATOM 10380 H HA   . PRO A 1 44  ? 1.557   36.314  86.369  1.00 0.00 ?  35  PRO A HA   7  
ATOM 10381 H HB2  . PRO A 1 44  ? 0.634   36.220  83.965  1.00 0.00 ?  35  PRO A HB2  7  
ATOM 10382 H HB3  . PRO A 1 44  ? -0.122  35.351  85.242  1.00 0.00 ?  35  PRO A HB3  7  
ATOM 10383 H HG2  . PRO A 1 44  ? -0.789  38.198  84.247  1.00 0.00 ?  35  PRO A HG2  7  
ATOM 10384 H HG3  . PRO A 1 44  ? -1.926  36.796  84.256  1.00 0.00 ?  35  PRO A HG3  7  
ATOM 10385 H HD2  . PRO A 1 44  ? -1.920  38.393  86.456  1.00 0.00 ?  35  PRO A HD2  7  
ATOM 10386 H HD3  . PRO A 1 44  ? -1.659  36.711  86.822  1.00 0.00 ?  35  PRO A HD3  7  
ATOM 10387 N N    . GLY A 1 45  ? 3.145   37.788  84.849  1.00 0.00 ?  36  GLY A N    7  
ATOM 10388 C CA   . GLY A 1 45  ? 3.989   38.566  83.922  1.00 0.00 ?  36  GLY A CA   7  
ATOM 10389 C C    . GLY A 1 45  ? 4.441   37.833  82.617  1.00 0.00 ?  36  GLY A C    7  
ATOM 10390 O O    . GLY A 1 45  ? 4.089   36.614  82.422  1.00 0.00 ?  36  GLY A O    7  
ATOM 10391 H H    . GLY A 1 45  ? 3.270   36.793  84.975  1.00 0.00 ?  36  GLY A H    7  
ATOM 10392 H HA2  . GLY A 1 45  ? 3.559   39.531  83.650  1.00 0.00 ?  36  GLY A HA2  7  
ATOM 10393 H HA3  . GLY A 1 45  ? 4.929   38.845  84.397  1.00 0.00 ?  36  GLY A HA3  7  
ATOM 10394 N N    . LEU A 1 46  ? 5.184   38.452  81.698  1.00 0.00 ?  37  LEU A N    7  
ATOM 10395 C CA   . LEU A 1 46  ? 5.512   37.893  80.398  1.00 0.00 ?  37  LEU A CA   7  
ATOM 10396 C C    . LEU A 1 46  ? 6.670   36.848  80.380  1.00 0.00 ?  37  LEU A C    7  
ATOM 10397 O O    . LEU A 1 46  ? 6.518   35.862  79.635  1.00 0.00 ?  37  LEU A O    7  
ATOM 10398 C CB   . LEU A 1 46  ? 5.687   39.074  79.434  1.00 0.00 ?  37  LEU A CB   7  
ATOM 10399 C CG   . LEU A 1 46  ? 5.848   38.805  77.897  1.00 0.00 ?  37  LEU A CG   7  
ATOM 10400 C CD1  . LEU A 1 46  ? 4.722   37.922  77.396  1.00 0.00 ?  37  LEU A CD1  7  
ATOM 10401 C CD2  . LEU A 1 46  ? 5.844   40.107  77.167  1.00 0.00 ?  37  LEU A CD2  7  
ATOM 10402 H H    . LEU A 1 46  ? 5.472   39.391  81.933  1.00 0.00 ?  37  LEU A H    7  
ATOM 10403 H HA   . LEU A 1 46  ? 4.619   37.321  80.145  1.00 0.00 ?  37  LEU A HA   7  
ATOM 10404 H HB2  . LEU A 1 46  ? 4.828   39.731  79.572  1.00 0.00 ?  37  LEU A HB2  7  
ATOM 10405 H HB3  . LEU A 1 46  ? 6.559   39.688  79.662  1.00 0.00 ?  37  LEU A HB3  7  
ATOM 10406 H HG   . LEU A 1 46  ? 6.821   38.321  77.804  1.00 0.00 ?  37  LEU A HG   7  
ATOM 10407 H HD11 . LEU A 1 46  ? 3.749   38.343  77.655  1.00 0.00 ?  37  LEU A HD11 7  
ATOM 10408 H HD12 . LEU A 1 46  ? 4.770   37.816  76.313  1.00 0.00 ?  37  LEU A HD12 7  
ATOM 10409 H HD13 . LEU A 1 46  ? 4.858   36.936  77.839  1.00 0.00 ?  37  LEU A HD13 7  
ATOM 10410 H HD21 . LEU A 1 46  ? 4.994   40.749  77.400  1.00 0.00 ?  37  LEU A HD21 7  
ATOM 10411 H HD22 . LEU A 1 46  ? 6.747   40.682  77.371  1.00 0.00 ?  37  LEU A HD22 7  
ATOM 10412 H HD23 . LEU A 1 46  ? 5.902   40.034  76.081  1.00 0.00 ?  37  LEU A HD23 7  
ATOM 10413 N N    . GLY A 1 47  ? 7.859   36.998  80.989  1.00 0.00 ?  38  GLY A N    7  
ATOM 10414 C CA   . GLY A 1 47  ? 8.837   35.948  81.148  1.00 0.00 ?  38  GLY A CA   7  
ATOM 10415 C C    . GLY A 1 47  ? 9.550   35.703  82.529  1.00 0.00 ?  38  GLY A C    7  
ATOM 10416 O O    . GLY A 1 47  ? 9.218   36.284  83.529  1.00 0.00 ?  38  GLY A O    7  
ATOM 10417 H H    . GLY A 1 47  ? 8.086   37.930  81.308  1.00 0.00 ?  38  GLY A H    7  
ATOM 10418 H HA2  . GLY A 1 47  ? 8.415   35.027  80.747  1.00 0.00 ?  38  GLY A HA2  7  
ATOM 10419 H HA3  . GLY A 1 47  ? 9.636   36.176  80.443  1.00 0.00 ?  38  GLY A HA3  7  
ATOM 10420 N N    . PRO A 1 48  ? 10.639  34.967  82.560  1.00 0.00 ?  39  PRO A N    7  
ATOM 10421 C CA   . PRO A 1 48  ? 11.344  34.671  83.841  1.00 0.00 ?  39  PRO A CA   7  
ATOM 10422 C C    . PRO A 1 48  ? 12.338  35.791  84.312  1.00 0.00 ?  39  PRO A C    7  
ATOM 10423 O O    . PRO A 1 48  ? 12.819  36.569  83.477  1.00 0.00 ?  39  PRO A O    7  
ATOM 10424 C CB   . PRO A 1 48  ? 12.003  33.314  83.658  1.00 0.00 ?  39  PRO A CB   7  
ATOM 10425 C CG   . PRO A 1 48  ? 12.139  33.176  82.210  1.00 0.00 ?  39  PRO A CG   7  
ATOM 10426 C CD   . PRO A 1 48  ? 10.984  33.972  81.582  1.00 0.00 ?  39  PRO A CD   7  
ATOM 10427 H HA   . PRO A 1 48  ? 10.607  34.627  84.642  1.00 0.00 ?  39  PRO A HA   7  
ATOM 10428 H HB2  . PRO A 1 48  ? 12.969  33.293  84.162  1.00 0.00 ?  39  PRO A HB2  7  
ATOM 10429 H HB3  . PRO A 1 48  ? 11.211  32.635  83.974  1.00 0.00 ?  39  PRO A HB3  7  
ATOM 10430 H HG2  . PRO A 1 48  ? 13.006  33.730  81.851  1.00 0.00 ?  39  PRO A HG2  7  
ATOM 10431 H HG3  . PRO A 1 48  ? 12.221  32.151  81.849  1.00 0.00 ?  39  PRO A HG3  7  
ATOM 10432 H HD2  . PRO A 1 48  ? 11.242  34.450  80.637  1.00 0.00 ?  39  PRO A HD2  7  
ATOM 10433 H HD3  . PRO A 1 48  ? 10.145  33.293  81.433  1.00 0.00 ?  39  PRO A HD3  7  
ATOM 10434 N N    . ASP A 1 49  ? 12.841  35.778  85.583  1.00 0.00 ?  40  ASP A N    7  
ATOM 10435 C CA   . ASP A 1 49  ? 13.782  36.699  86.206  1.00 0.00 ?  40  ASP A CA   7  
ATOM 10436 C C    . ASP A 1 49  ? 15.228  36.611  85.717  1.00 0.00 ?  40  ASP A C    7  
ATOM 10437 O O    . ASP A 1 49  ? 16.038  37.433  86.115  1.00 0.00 ?  40  ASP A O    7  
ATOM 10438 C CB   . ASP A 1 49  ? 13.610  36.807  87.770  1.00 0.00 ?  40  ASP A CB   7  
ATOM 10439 C CG   . ASP A 1 49  ? 12.228  37.476  88.117  1.00 0.00 ?  40  ASP A CG   7  
ATOM 10440 O OD1  . ASP A 1 49  ? 11.841  38.490  87.482  1.00 0.00 ?  40  ASP A OD1  7  
ATOM 10441 O OD2  . ASP A 1 49  ? 11.637  37.064  89.135  1.00 0.00 -1 40  ASP A OD2  7  
ATOM 10442 H H    . ASP A 1 49  ? 12.542  35.058  86.226  1.00 0.00 ?  40  ASP A H    7  
ATOM 10443 H HA   . ASP A 1 49  ? 13.547  37.649  85.725  1.00 0.00 ?  40  ASP A HA   7  
ATOM 10444 H HB2  . ASP A 1 49  ? 13.701  35.833  88.252  1.00 0.00 ?  40  ASP A HB2  7  
ATOM 10445 H HB3  . ASP A 1 49  ? 14.380  37.458  88.181  1.00 0.00 ?  40  ASP A HB3  7  
ATOM 10446 N N    . ASN A 1 50  ? 15.479  35.631  84.863  1.00 0.00 ?  41  ASN A N    7  
ATOM 10447 C CA   . ASN A 1 50  ? 16.737  35.370  84.422  1.00 0.00 ?  41  ASN A CA   7  
ATOM 10448 C C    . ASN A 1 50  ? 17.078  36.226  83.212  1.00 0.00 ?  41  ASN A C    7  
ATOM 10449 O O    . ASN A 1 50  ? 18.220  36.470  82.855  1.00 0.00 ?  41  ASN A O    7  
ATOM 10450 C CB   . ASN A 1 50  ? 16.972  33.952  83.931  1.00 0.00 ?  41  ASN A CB   7  
ATOM 10451 C CG   . ASN A 1 50  ? 16.619  32.774  84.865  1.00 0.00 ?  41  ASN A CG   7  
ATOM 10452 O OD1  . ASN A 1 50  ? 15.473  32.582  85.110  1.00 0.00 ?  41  ASN A OD1  7  
ATOM 10453 N ND2  . ASN A 1 50  ? 17.534  32.013  85.403  1.00 0.00 ?  41  ASN A ND2  7  
ATOM 10454 H H    . ASN A 1 50  ? 14.751  34.970  84.632  1.00 0.00 ?  41  ASN A H    7  
ATOM 10455 H HA   . ASN A 1 50  ? 17.487  35.592  85.182  1.00 0.00 ?  41  ASN A HA   7  
ATOM 10456 H HB2  . ASN A 1 50  ? 16.556  33.820  82.932  1.00 0.00 ?  41  ASN A HB2  7  
ATOM 10457 H HB3  . ASN A 1 50  ? 18.027  33.863  83.674  1.00 0.00 ?  41  ASN A HB3  7  
ATOM 10458 H HD21 . ASN A 1 50  ? 18.520  32.156  85.238  1.00 0.00 ?  41  ASN A HD21 7  
ATOM 10459 H HD22 . ASN A 1 50  ? 17.318  31.360  86.142  1.00 0.00 ?  41  ASN A HD22 7  
ATOM 10460 N N    . GLN A 1 51  ? 16.033  36.775  82.580  1.00 0.00 ?  42  GLN A N    7  
ATOM 10461 C CA   . GLN A 1 51  ? 16.182  37.901  81.614  1.00 0.00 ?  42  GLN A CA   7  
ATOM 10462 C C    . GLN A 1 51  ? 17.026  39.075  82.275  1.00 0.00 ?  42  GLN A C    7  
ATOM 10463 O O    . GLN A 1 51  ? 16.960  39.147  83.493  1.00 0.00 ?  42  GLN A O    7  
ATOM 10464 C CB   . GLN A 1 51  ? 14.814  38.578  81.292  1.00 0.00 ?  42  GLN A CB   7  
ATOM 10465 C CG   . GLN A 1 51  ? 13.970  37.829  80.208  1.00 0.00 ?  42  GLN A CG   7  
ATOM 10466 C CD   . GLN A 1 51  ? 12.585  38.389  79.912  1.00 0.00 ?  42  GLN A CD   7  
ATOM 10467 O OE1  . GLN A 1 51  ? 12.278  39.088  78.946  1.00 0.00 ?  42  GLN A OE1  7  
ATOM 10468 N NE2  . GLN A 1 51  ? 11.731  38.287  80.858  1.00 0.00 ?  42  GLN A NE2  7  
ATOM 10469 H H    . GLN A 1 51  ? 15.097  36.499  82.838  1.00 0.00 ?  42  GLN A H    7  
ATOM 10470 H HA   . GLN A 1 51  ? 16.682  37.394  80.787  1.00 0.00 ?  42  GLN A HA   7  
ATOM 10471 H HB2  . GLN A 1 51  ? 14.214  38.595  82.201  1.00 0.00 ?  42  GLN A HB2  7  
ATOM 10472 H HB3  . GLN A 1 51  ? 14.841  39.656  81.137  1.00 0.00 ?  42  GLN A HB3  7  
ATOM 10473 H HG2  . GLN A 1 51  ? 14.502  37.680  79.270  1.00 0.00 ?  42  GLN A HG2  7  
ATOM 10474 H HG3  . GLN A 1 51  ? 13.713  36.821  80.533  1.00 0.00 ?  42  GLN A HG3  7  
ATOM 10475 H HE21 . GLN A 1 51  ? 11.963  37.720  81.660  1.00 0.00 ?  42  GLN A HE21 7  
ATOM 10476 H HE22 . GLN A 1 51  ? 10.831  38.744  80.810  1.00 0.00 ?  42  GLN A HE22 7  
ATOM 10477 N N    . THR A 1 52  ? 17.685  39.931  81.458  1.00 0.00 ?  43  THR A N    7  
ATOM 10478 C CA   . THR A 1 52  ? 18.480  41.088  81.926  1.00 0.00 ?  43  THR A CA   7  
ATOM 10479 C C    . THR A 1 52  ? 18.307  42.429  81.283  1.00 0.00 ?  43  THR A C    7  
ATOM 10480 O O    . THR A 1 52  ? 17.811  42.477  80.138  1.00 0.00 ?  43  THR A O    7  
ATOM 10481 C CB   . THR A 1 52  ? 19.992  40.799  82.210  1.00 0.00 ?  43  THR A CB   7  
ATOM 10482 O OG1  . THR A 1 52  ? 20.724  41.473  81.214  1.00 0.00 ?  43  THR A OG1  7  
ATOM 10483 C CG2  . THR A 1 52  ? 20.332  39.296  82.048  1.00 0.00 ?  43  THR A CG2  7  
ATOM 10484 H H    . THR A 1 52  ? 17.719  39.812  80.455  1.00 0.00 ?  43  THR A H    7  
ATOM 10485 H HA   . THR A 1 52  ? 18.107  41.243  82.938  1.00 0.00 ?  43  THR A HA   7  
ATOM 10486 H HB   . THR A 1 52  ? 20.328  41.221  83.157  1.00 0.00 ?  43  THR A HB   7  
ATOM 10487 H HG1  . THR A 1 52  ? 21.592  41.588  81.606  1.00 0.00 ?  43  THR A HG1  7  
ATOM 10488 H HG21 . THR A 1 52  ? 21.375  39.061  82.262  1.00 0.00 ?  43  THR A HG21 7  
ATOM 10489 H HG22 . THR A 1 52  ? 19.684  38.644  82.635  1.00 0.00 ?  43  THR A HG22 7  
ATOM 10490 H HG23 . THR A 1 52  ? 20.237  39.056  80.989  1.00 0.00 ?  43  THR A HG23 7  
ATOM 10491 N N    . GLU A 1 53  ? 18.480  43.560  81.946  1.00 0.00 ?  44  GLU A N    7  
ATOM 10492 C CA   . GLU A 1 53  ? 18.241  44.962  81.415  1.00 0.00 ?  44  GLU A CA   7  
ATOM 10493 C C    . GLU A 1 53  ? 19.197  45.893  82.146  1.00 0.00 ?  44  GLU A C    7  
ATOM 10494 O O    . GLU A 1 53  ? 18.824  46.802  82.851  1.00 0.00 ?  44  GLU A O    7  
ATOM 10495 C CB   . GLU A 1 53  ? 16.801  45.509  81.291  1.00 0.00 ?  44  GLU A CB   7  
ATOM 10496 C CG   . GLU A 1 53  ? 15.980  44.978  82.515  1.00 0.00 ?  44  GLU A CG   7  
ATOM 10497 C CD   . GLU A 1 53  ? 14.719  45.762  82.890  1.00 0.00 ?  44  GLU A CD   7  
ATOM 10498 O OE1  . GLU A 1 53  ? 14.289  46.644  82.120  1.00 0.00 ?  44  GLU A OE1  7  
ATOM 10499 O OE2  . GLU A 1 53  ? 14.029  45.319  83.844  1.00 0.00 -1 44  GLU A OE2  7  
ATOM 10500 H H    . GLU A 1 53  ? 18.742  43.417  82.912  1.00 0.00 ?  44  GLU A H    7  
ATOM 10501 H HA   . GLU A 1 53  ? 18.692  45.057  80.427  1.00 0.00 ?  44  GLU A HA   7  
ATOM 10502 H HB2  . GLU A 1 53  ? 16.781  46.598  81.266  1.00 0.00 ?  44  GLU A HB2  7  
ATOM 10503 H HB3  . GLU A 1 53  ? 16.316  45.061  80.425  1.00 0.00 ?  44  GLU A HB3  7  
ATOM 10504 H HG2  . GLU A 1 53  ? 15.786  43.919  82.339  1.00 0.00 ?  44  GLU A HG2  7  
ATOM 10505 H HG3  . GLU A 1 53  ? 16.643  44.957  83.379  1.00 0.00 ?  44  GLU A HG3  7  
ATOM 10506 N N    . GLU A 1 54  ? 20.496  45.684  81.815  1.00 0.00 ?  45  GLU A N    7  
ATOM 10507 C CA   . GLU A 1 54  ? 21.579  46.463  82.451  1.00 0.00 ?  45  GLU A CA   7  
ATOM 10508 C C    . GLU A 1 54  ? 21.699  47.846  81.833  1.00 0.00 ?  45  GLU A C    7  
ATOM 10509 O O    . GLU A 1 54  ? 21.256  48.099  80.678  1.00 0.00 ?  45  GLU A O    7  
ATOM 10510 C CB   . GLU A 1 54  ? 22.887  45.674  82.286  1.00 0.00 ?  45  GLU A CB   7  
ATOM 10511 C CG   . GLU A 1 54  ? 22.822  44.271  82.976  1.00 0.00 ?  45  GLU A CG   7  
ATOM 10512 C CD   . GLU A 1 54  ? 22.658  44.271  84.506  1.00 0.00 ?  45  GLU A CD   7  
ATOM 10513 O OE1  . GLU A 1 54  ? 22.877  45.286  85.182  1.00 0.00 -1 45  GLU A OE1  7  
ATOM 10514 O OE2  . GLU A 1 54  ? 22.299  43.222  85.032  1.00 0.00 ?  45  GLU A OE2  7  
ATOM 10515 H H    . GLU A 1 54  ? 20.735  44.857  81.286  1.00 0.00 ?  45  GLU A H    7  
ATOM 10516 H HA   . GLU A 1 54  ? 21.337  46.617  83.502  1.00 0.00 ?  45  GLU A HA   7  
ATOM 10517 H HB2  . GLU A 1 54  ? 23.117  45.509  81.233  1.00 0.00 ?  45  GLU A HB2  7  
ATOM 10518 H HB3  . GLU A 1 54  ? 23.712  46.233  82.728  1.00 0.00 ?  45  GLU A HB3  7  
ATOM 10519 H HG2  . GLU A 1 54  ? 21.968  43.740  82.555  1.00 0.00 ?  45  GLU A HG2  7  
ATOM 10520 H HG3  . GLU A 1 54  ? 23.669  43.644  82.698  1.00 0.00 ?  45  GLU A HG3  7  
ATOM 10521 N N    . ARG A 1 55  ? 22.408  48.827  82.444  1.00 0.00 ?  46  ARG A N    7  
ATOM 10522 C CA   . ARG A 1 55  ? 22.835  50.103  81.794  1.00 0.00 ?  46  ARG A CA   7  
ATOM 10523 C C    . ARG A 1 55  ? 24.151  49.835  80.947  1.00 0.00 ?  46  ARG A C    7  
ATOM 10524 O O    . ARG A 1 55  ? 24.645  48.755  80.984  1.00 0.00 ?  46  ARG A O    7  
ATOM 10525 C CB   . ARG A 1 55  ? 23.004  51.327  82.775  1.00 0.00 ?  46  ARG A CB   7  
ATOM 10526 C CG   . ARG A 1 55  ? 23.960  50.952  83.896  1.00 0.00 ?  46  ARG A CG   7  
ATOM 10527 C CD   . ARG A 1 55  ? 24.383  52.082  84.807  1.00 0.00 ?  46  ARG A CD   7  
ATOM 10528 N NE   . ARG A 1 55  ? 24.997  53.070  83.930  1.00 0.00 ?  46  ARG A NE   7  
ATOM 10529 C CZ   . ARG A 1 55  ? 26.271  53.404  83.811  1.00 0.00 ?  46  ARG A CZ   7  
ATOM 10530 N NH1  . ARG A 1 55  ? 27.335  52.652  84.100  1.00 0.00 ?  46  ARG A NH1  7  
ATOM 10531 N NH2  . ARG A 1 55  ? 26.598  54.558  83.306  1.00 0.00 1  46  ARG A NH2  7  
ATOM 10532 H H    . ARG A 1 55  ? 22.842  48.633  83.336  1.00 0.00 ?  46  ARG A H    7  
ATOM 10533 H HA   . ARG A 1 55  ? 22.053  50.453  81.120  1.00 0.00 ?  46  ARG A HA   7  
ATOM 10534 H HB2  . ARG A 1 55  ? 23.415  52.171  82.220  1.00 0.00 ?  46  ARG A HB2  7  
ATOM 10535 H HB3  . ARG A 1 55  ? 22.005  51.605  83.114  1.00 0.00 ?  46  ARG A HB3  7  
ATOM 10536 H HG2  . ARG A 1 55  ? 23.499  50.268  84.608  1.00 0.00 ?  46  ARG A HG2  7  
ATOM 10537 H HG3  . ARG A 1 55  ? 24.824  50.448  83.467  1.00 0.00 ?  46  ARG A HG3  7  
ATOM 10538 H HD2  . ARG A 1 55  ? 23.501  52.512  85.283  1.00 0.00 ?  46  ARG A HD2  7  
ATOM 10539 H HD3  . ARG A 1 55  ? 25.036  51.720  85.601  1.00 0.00 ?  46  ARG A HD3  7  
ATOM 10540 H HE   . ARG A 1 55  ? 24.319  53.683  83.498  1.00 0.00 ?  46  ARG A HE   7  
ATOM 10541 H HH11 . ARG A 1 55  ? 27.258  51.731  84.508  1.00 0.00 ?  46  ARG A HH11 7  
ATOM 10542 H HH12 . ARG A 1 55  ? 28.229  53.084  83.913  1.00 0.00 ?  46  ARG A HH12 7  
ATOM 10543 H HH21 . ARG A 1 55  ? 25.892  55.217  83.009  1.00 0.00 ?  46  ARG A HH21 7  
ATOM 10544 H HH22 . ARG A 1 55  ? 27.550  54.806  83.082  1.00 0.00 ?  46  ARG A HH22 7  
ATOM 10545 N N    . ARG A 1 56  ? 24.583  50.918  80.280  1.00 0.00 ?  47  ARG A N    7  
ATOM 10546 C CA   . ARG A 1 56  ? 25.939  50.928  79.668  1.00 0.00 ?  47  ARG A CA   7  
ATOM 10547 C C    . ARG A 1 56  ? 27.118  50.671  80.642  1.00 0.00 ?  47  ARG A C    7  
ATOM 10548 O O    . ARG A 1 56  ? 26.853  50.735  81.869  1.00 0.00 ?  47  ARG A O    7  
ATOM 10549 C CB   . ARG A 1 56  ? 26.105  52.236  78.909  1.00 0.00 ?  47  ARG A CB   7  
ATOM 10550 C CG   . ARG A 1 56  ? 26.393  53.499  79.817  1.00 0.00 ?  47  ARG A CG   7  
ATOM 10551 C CD   . ARG A 1 56  ? 26.882  54.783  79.076  1.00 0.00 ?  47  ARG A CD   7  
ATOM 10552 N NE   . ARG A 1 56  ? 27.522  55.701  80.103  1.00 0.00 ?  47  ARG A NE   7  
ATOM 10553 C CZ   . ARG A 1 56  ? 27.357  56.968  80.226  1.00 0.00 ?  47  ARG A CZ   7  
ATOM 10554 N NH1  . ARG A 1 56  ? 26.672  57.698  79.352  1.00 0.00 ?  47  ARG A NH1  7  
ATOM 10555 N NH2  . ARG A 1 56  ? 28.000  57.642  81.150  1.00 0.00 1  47  ARG A NH2  7  
ATOM 10556 H H    . ARG A 1 56  ? 23.886  51.643  80.180  1.00 0.00 ?  47  ARG A H    7  
ATOM 10557 H HA   . ARG A 1 56  ? 25.951  50.085  78.976  1.00 0.00 ?  47  ARG A HA   7  
ATOM 10558 H HB2  . ARG A 1 56  ? 26.956  51.940  78.295  1.00 0.00 ?  47  ARG A HB2  7  
ATOM 10559 H HB3  . ARG A 1 56  ? 25.215  52.424  78.309  1.00 0.00 ?  47  ARG A HB3  7  
ATOM 10560 H HG2  . ARG A 1 56  ? 25.489  53.798  80.345  1.00 0.00 ?  47  ARG A HG2  7  
ATOM 10561 H HG3  . ARG A 1 56  ? 27.131  53.268  80.586  1.00 0.00 ?  47  ARG A HG3  7  
ATOM 10562 H HD2  . ARG A 1 56  ? 27.618  54.333  78.410  1.00 0.00 ?  47  ARG A HD2  7  
ATOM 10563 H HD3  . ARG A 1 56  ? 26.097  55.317  78.541  1.00 0.00 ?  47  ARG A HD3  7  
ATOM 10564 H HE   . ARG A 1 56  ? 28.027  55.257  80.856  1.00 0.00 ?  47  ARG A HE   7  
ATOM 10565 H HH11 . ARG A 1 56  ? 26.125  57.149  78.703  1.00 0.00 ?  47  ARG A HH11 7  
ATOM 10566 H HH12 . ARG A 1 56  ? 26.340  58.575  79.726  1.00 0.00 ?  47  ARG A HH12 7  
ATOM 10567 H HH21 . ARG A 1 56  ? 28.419  57.159  81.932  1.00 0.00 ?  47  ARG A HH21 7  
ATOM 10568 H HH22 . ARG A 1 56  ? 28.215  58.626  81.079  1.00 0.00 ?  47  ARG A HH22 7  
ATOM 10569 N N    . ALA A 1 57  ? 28.260  50.280  80.131  1.00 0.00 ?  48  ALA A N    7  
ATOM 10570 C CA   . ALA A 1 57  ? 29.450  49.816  80.955  1.00 0.00 ?  48  ALA A CA   7  
ATOM 10571 C C    . ALA A 1 57  ? 29.878  50.779  82.063  1.00 0.00 ?  48  ALA A C    7  
ATOM 10572 O O    . ALA A 1 57  ? 29.396  51.941  82.061  1.00 0.00 ?  48  ALA A O    7  
ATOM 10573 C CB   . ALA A 1 57  ? 30.717  49.553  80.049  1.00 0.00 ?  48  ALA A CB   7  
ATOM 10574 H H    . ALA A 1 57  ? 28.288  50.093  79.138  1.00 0.00 ?  48  ALA A H    7  
ATOM 10575 H HA   . ALA A 1 57  ? 29.308  48.824  81.385  1.00 0.00 ?  48  ALA A HA   7  
ATOM 10576 H HB1  . ALA A 1 57  ? 30.434  49.198  79.059  1.00 0.00 ?  48  ALA A HB1  7  
ATOM 10577 H HB2  . ALA A 1 57  ? 31.265  50.490  80.136  1.00 0.00 ?  48  ALA A HB2  7  
ATOM 10578 H HB3  . ALA A 1 57  ? 31.362  48.771  80.451  1.00 0.00 ?  48  ALA A HB3  7  
ATOM 10579 N N    . SER A 1 58  ? 30.608  50.263  83.035  1.00 0.00 ?  49  SER A N    7  
ATOM 10580 C CA   . SER A 1 58  ? 31.121  50.999  84.166  1.00 0.00 ?  49  SER A CA   7  
ATOM 10581 C C    . SER A 1 58  ? 32.521  50.579  84.475  1.00 0.00 ?  49  SER A C    7  
ATOM 10582 O O    . SER A 1 58  ? 32.752  49.591  85.139  1.00 0.00 ?  49  SER A O    7  
ATOM 10583 C CB   . SER A 1 58  ? 30.185  50.931  85.329  1.00 0.00 ?  49  SER A CB   7  
ATOM 10584 O OG   . SER A 1 58  ? 30.071  52.096  86.151  1.00 0.00 ?  49  SER A OG   7  
ATOM 10585 H H    . SER A 1 58  ? 30.785  49.278  82.901  1.00 0.00 ?  49  SER A H    7  
ATOM 10586 H HA   . SER A 1 58  ? 31.280  52.056  83.956  1.00 0.00 ?  49  SER A HA   7  
ATOM 10587 H HB2  . SER A 1 58  ? 29.223  50.674  84.885  1.00 0.00 ?  49  SER A HB2  7  
ATOM 10588 H HB3  . SER A 1 58  ? 30.524  50.124  85.979  1.00 0.00 ?  49  SER A HB3  7  
ATOM 10589 H HG   . SER A 1 58  ? 29.583  51.928  86.960  1.00 0.00 ?  49  SER A HG   7  
ATOM 10590 N N    . LEU A 1 59  ? 33.523  51.283  83.881  1.00 0.00 ?  50  LEU A N    7  
ATOM 10591 C CA   . LEU A 1 59  ? 34.928  51.306  84.322  1.00 0.00 ?  50  LEU A CA   7  
ATOM 10592 C C    . LEU A 1 59  ? 35.084  52.317  85.526  1.00 0.00 ?  50  LEU A C    7  
ATOM 10593 O O    . LEU A 1 59  ? 34.661  53.477  85.362  1.00 0.00 ?  50  LEU A O    7  
ATOM 10594 C CB   . LEU A 1 59  ? 35.908  51.746  83.161  1.00 0.00 ?  50  LEU A CB   7  
ATOM 10595 C CG   . LEU A 1 59  ? 35.951  50.562  82.173  1.00 0.00 ?  50  LEU A CG   7  
ATOM 10596 C CD1  . LEU A 1 59  ? 36.240  51.185  80.773  1.00 0.00 ?  50  LEU A CD1  7  
ATOM 10597 C CD2  . LEU A 1 59  ? 37.154  49.602  82.520  1.00 0.00 ?  50  LEU A CD2  7  
ATOM 10598 H H    . LEU A 1 59  ? 33.233  52.004  83.236  1.00 0.00 ?  50  LEU A H    7  
ATOM 10599 H HA   . LEU A 1 59  ? 35.206  50.296  84.622  1.00 0.00 ?  50  LEU A HA   7  
ATOM 10600 H HB2  . LEU A 1 59  ? 35.619  52.668  82.656  1.00 0.00 ?  50  LEU A HB2  7  
ATOM 10601 H HB3  . LEU A 1 59  ? 36.927  51.819  83.540  1.00 0.00 ?  50  LEU A HB3  7  
ATOM 10602 H HG   . LEU A 1 59  ? 35.028  49.995  82.051  1.00 0.00 ?  50  LEU A HG   7  
ATOM 10603 H HD11 . LEU A 1 59  ? 37.225  51.647  80.831  1.00 0.00 ?  50  LEU A HD11 7  
ATOM 10604 H HD12 . LEU A 1 59  ? 36.208  50.411  80.008  1.00 0.00 ?  50  LEU A HD12 7  
ATOM 10605 H HD13 . LEU A 1 59  ? 35.411  51.865  80.571  1.00 0.00 ?  50  LEU A HD13 7  
ATOM 10606 H HD21 . LEU A 1 59  ? 38.154  49.964  82.281  1.00 0.00 ?  50  LEU A HD21 7  
ATOM 10607 H HD22 . LEU A 1 59  ? 37.053  49.204  83.530  1.00 0.00 ?  50  LEU A HD22 7  
ATOM 10608 H HD23 . LEU A 1 59  ? 37.117  48.665  81.964  1.00 0.00 ?  50  LEU A HD23 7  
ATOM 10609 N N    . PRO A 1 60  ? 35.673  51.885  86.660  1.00 0.00 ?  51  PRO A N    7  
ATOM 10610 C CA   . PRO A 1 60  ? 35.852  52.733  87.877  1.00 0.00 ?  51  PRO A CA   7  
ATOM 10611 C C    . PRO A 1 60  ? 36.631  54.021  87.621  1.00 0.00 ?  51  PRO A C    7  
ATOM 10612 O O    . PRO A 1 60  ? 37.767  53.981  87.236  1.00 0.00 ?  51  PRO A O    7  
ATOM 10613 C CB   . PRO A 1 60  ? 36.434  51.722  88.972  1.00 0.00 ?  51  PRO A CB   7  
ATOM 10614 C CG   . PRO A 1 60  ? 35.926  50.360  88.447  1.00 0.00 ?  51  PRO A CG   7  
ATOM 10615 C CD   . PRO A 1 60  ? 35.890  50.492  86.952  1.00 0.00 ?  51  PRO A CD   7  
ATOM 10616 H HA   . PRO A 1 60  ? 34.930  53.134  88.301  1.00 0.00 ?  51  PRO A HA   7  
ATOM 10617 H HB2  . PRO A 1 60  ? 37.519  51.777  89.065  1.00 0.00 ?  51  PRO A HB2  7  
ATOM 10618 H HB3  . PRO A 1 60  ? 35.934  51.871  89.929  1.00 0.00 ?  51  PRO A HB3  7  
ATOM 10619 H HG2  . PRO A 1 60  ? 36.573  49.503  88.634  1.00 0.00 ?  51  PRO A HG2  7  
ATOM 10620 H HG3  . PRO A 1 60  ? 34.940  50.118  88.845  1.00 0.00 ?  51  PRO A HG3  7  
ATOM 10621 H HD2  . PRO A 1 60  ? 36.848  50.120  86.590  1.00 0.00 ?  51  PRO A HD2  7  
ATOM 10622 H HD3  . PRO A 1 60  ? 35.058  49.850  86.661  1.00 0.00 ?  51  PRO A HD3  7  
ATOM 10623 N N    . GLY A 1 61  ? 36.088  55.193  87.894  1.00 0.00 ?  52  GLY A N    7  
ATOM 10624 C CA   . GLY A 1 61  ? 36.604  56.478  87.440  1.00 0.00 ?  52  GLY A CA   7  
ATOM 10625 C C    . GLY A 1 61  ? 35.671  57.582  87.888  1.00 0.00 ?  52  GLY A C    7  
ATOM 10626 O O    . GLY A 1 61  ? 34.462  57.619  87.585  1.00 0.00 ?  52  GLY A O    7  
ATOM 10627 H H    . GLY A 1 61  ? 35.155  55.167  88.279  1.00 0.00 ?  52  GLY A H    7  
ATOM 10628 H HA2  . GLY A 1 61  ? 37.541  56.578  87.987  1.00 0.00 ?  52  GLY A HA2  7  
ATOM 10629 H HA3  . GLY A 1 61  ? 36.727  56.439  86.358  1.00 0.00 ?  52  GLY A HA3  7  
ATOM 10630 N N    . ARG A 1 62  ? 36.341  58.567  88.497  1.00 0.00 ?  53  ARG A N    7  
ATOM 10631 C CA   . ARG A 1 62  ? 35.701  59.732  88.897  1.00 0.00 ?  53  ARG A CA   7  
ATOM 10632 C C    . ARG A 1 62  ? 36.763  60.805  89.104  1.00 0.00 ?  53  ARG A C    7  
ATOM 10633 O O    . ARG A 1 62  ? 37.624  60.697  89.991  1.00 0.00 ?  53  ARG A O    7  
ATOM 10634 C CB   . ARG A 1 62  ? 34.910  59.500  90.185  1.00 0.00 ?  53  ARG A CB   7  
ATOM 10635 C CG   . ARG A 1 62  ? 34.267  60.743  90.825  1.00 0.00 ?  53  ARG A CG   7  
ATOM 10636 C CD   . ARG A 1 62  ? 33.052  61.060  90.050  1.00 0.00 ?  53  ARG A CD   7  
ATOM 10637 N NE   . ARG A 1 62  ? 33.342  61.892  88.874  1.00 0.00 ?  53  ARG A NE   7  
ATOM 10638 C CZ   . ARG A 1 62  ? 33.723  63.160  88.868  1.00 0.00 ?  53  ARG A CZ   7  
ATOM 10639 N NH1  . ARG A 1 62  ? 33.800  63.808  89.966  1.00 0.00 ?  53  ARG A NH1  7  
ATOM 10640 N NH2  . ARG A 1 62  ? 34.067  63.807  87.789  1.00 0.00 1  53  ARG A NH2  7  
ATOM 10641 H H    . ARG A 1 62  ? 37.333  58.450  88.647  1.00 0.00 ?  53  ARG A H    7  
ATOM 10642 H HA   . ARG A 1 62  ? 35.037  60.059  88.097  1.00 0.00 ?  53  ARG A HA   7  
ATOM 10643 H HB2  . ARG A 1 62  ? 34.171  58.712  90.036  1.00 0.00 ?  53  ARG A HB2  7  
ATOM 10644 H HB3  . ARG A 1 62  ? 35.544  59.006  90.921  1.00 0.00 ?  53  ARG A HB3  7  
ATOM 10645 H HG2  . ARG A 1 62  ? 33.989  60.356  91.806  1.00 0.00 ?  53  ARG A HG2  7  
ATOM 10646 H HG3  . ARG A 1 62  ? 34.983  61.552  90.966  1.00 0.00 ?  53  ARG A HG3  7  
ATOM 10647 H HD2  . ARG A 1 62  ? 32.463  60.165  89.849  1.00 0.00 ?  53  ARG A HD2  7  
ATOM 10648 H HD3  . ARG A 1 62  ? 32.396  61.657  90.683  1.00 0.00 ?  53  ARG A HD3  7  
ATOM 10649 H HE   . ARG A 1 62  ? 33.493  61.378  88.018  1.00 0.00 ?  53  ARG A HE   7  
ATOM 10650 H HH11 . ARG A 1 62  ? 33.912  63.222  90.780  1.00 0.00 ?  53  ARG A HH11 7  
ATOM 10651 H HH12 . ARG A 1 62  ? 34.125  64.755  90.093  1.00 0.00 ?  53  ARG A HH12 7  
ATOM 10652 H HH21 . ARG A 1 62  ? 34.144  63.231  86.963  1.00 0.00 ?  53  ARG A HH21 7  
ATOM 10653 H HH22 . ARG A 1 62  ? 34.172  64.811  87.752  1.00 0.00 ?  53  ARG A HH22 7  
ATOM 10654 N N    . ASP A 1 63  ? 36.918  61.668  88.148  1.00 0.00 ?  54  ASP A N    7  
ATOM 10655 C CA   . ASP A 1 63  ? 37.941  62.723  88.131  1.00 0.00 ?  54  ASP A CA   7  
ATOM 10656 C C    . ASP A 1 63  ? 37.551  63.955  87.292  1.00 0.00 ?  54  ASP A C    7  
ATOM 10657 O O    . ASP A 1 63  ? 37.188  63.856  86.106  1.00 0.00 ?  54  ASP A O    7  
ATOM 10658 C CB   . ASP A 1 63  ? 39.294  62.147  87.552  1.00 0.00 ?  54  ASP A CB   7  
ATOM 10659 C CG   . ASP A 1 63  ? 40.442  63.164  87.425  1.00 0.00 ?  54  ASP A CG   7  
ATOM 10660 O OD1  . ASP A 1 63  ? 40.266  64.314  87.863  1.00 0.00 ?  54  ASP A OD1  7  
ATOM 10661 O OD2  . ASP A 1 63  ? 41.436  62.732  86.814  1.00 0.00 -1 54  ASP A OD2  7  
ATOM 10662 H H    . ASP A 1 63  ? 36.186  61.720  87.455  1.00 0.00 ?  54  ASP A H    7  
ATOM 10663 H HA   . ASP A 1 63  ? 38.012  62.997  89.184  1.00 0.00 ?  54  ASP A HA   7  
ATOM 10664 H HB2  . ASP A 1 63  ? 39.646  61.363  88.222  1.00 0.00 ?  54  ASP A HB2  7  
ATOM 10665 H HB3  . ASP A 1 63  ? 39.155  61.766  86.539  1.00 0.00 ?  54  ASP A HB3  7  
ATOM 10666 N N    . ASP A 1 64  ? 37.461  65.068  88.018  1.00 0.00 ?  55  ASP A N    7  
ATOM 10667 C CA   . ASP A 1 64  ? 37.139  66.416  87.611  1.00 0.00 ?  55  ASP A CA   7  
ATOM 10668 C C    . ASP A 1 64  ? 38.056  67.011  86.513  1.00 0.00 ?  55  ASP A C    7  
ATOM 10669 O O    . ASP A 1 64  ? 37.661  67.907  85.805  1.00 0.00 ?  55  ASP A O    7  
ATOM 10670 C CB   . ASP A 1 64  ? 36.940  67.287  88.804  1.00 0.00 ?  55  ASP A CB   7  
ATOM 10671 C CG   . ASP A 1 64  ? 35.731  67.086  89.634  1.00 0.00 ?  55  ASP A CG   7  
ATOM 10672 O OD1  . ASP A 1 64  ? 34.803  66.353  89.190  1.00 0.00 ?  55  ASP A OD1  7  
ATOM 10673 O OD2  . ASP A 1 64  ? 35.702  67.605  90.773  1.00 0.00 -1 55  ASP A OD2  7  
ATOM 10674 H H    . ASP A 1 64  ? 37.912  65.050  88.921  1.00 0.00 ?  55  ASP A H    7  
ATOM 10675 H HA   . ASP A 1 64  ? 36.122  66.456  87.221  1.00 0.00 ?  55  ASP A HA   7  
ATOM 10676 H HB2  . ASP A 1 64  ? 37.824  67.199  89.435  1.00 0.00 ?  55  ASP A HB2  7  
ATOM 10677 H HB3  . ASP A 1 64  ? 36.960  68.329  88.484  1.00 0.00 ?  55  ASP A HB3  7  
ATOM 10678 N N    . ASN A 1 65  ? 39.139  66.280  86.061  1.00 0.00 ?  56  ASN A N    7  
ATOM 10679 C CA   . ASN A 1 65  ? 39.900  66.599  84.833  1.00 0.00 ?  56  ASN A CA   7  
ATOM 10680 C C    . ASN A 1 65  ? 39.088  66.237  83.544  1.00 0.00 ?  56  ASN A C    7  
ATOM 10681 O O    . ASN A 1 65  ? 39.381  66.749  82.455  1.00 0.00 ?  56  ASN A O    7  
ATOM 10682 C CB   . ASN A 1 65  ? 41.267  65.805  84.851  1.00 0.00 ?  56  ASN A CB   7  
ATOM 10683 C CG   . ASN A 1 65  ? 42.278  66.419  85.774  1.00 0.00 ?  56  ASN A CG   7  
ATOM 10684 O OD1  . ASN A 1 65  ? 42.806  67.527  85.511  1.00 0.00 ?  56  ASN A OD1  7  
ATOM 10685 N ND2  . ASN A 1 65  ? 42.506  65.683  86.827  1.00 0.00 ?  56  ASN A ND2  7  
ATOM 10686 H H    . ASN A 1 65  ? 39.438  65.451  86.554  1.00 0.00 ?  56  ASN A H    7  
ATOM 10687 H HA   . ASN A 1 65  ? 40.242  67.631  84.763  1.00 0.00 ?  56  ASN A HA   7  
ATOM 10688 H HB2  . ASN A 1 65  ? 41.013  64.747  84.923  1.00 0.00 ?  56  ASN A HB2  7  
ATOM 10689 H HB3  . ASN A 1 65  ? 41.794  65.927  83.904  1.00 0.00 ?  56  ASN A HB3  7  
ATOM 10690 H HD21 . ASN A 1 65  ? 41.886  64.908  87.010  1.00 0.00 ?  56  ASN A HD21 7  
ATOM 10691 H HD22 . ASN A 1 65  ? 43.163  65.953  87.546  1.00 0.00 ?  56  ASN A HD22 7  
ATOM 10692 N N    . SER A 1 66  ? 37.962  65.540  83.743  1.00 0.00 ?  57  SER A N    7  
ATOM 10693 C CA   . SER A 1 66  ? 36.826  65.354  82.771  1.00 0.00 ?  57  SER A CA   7  
ATOM 10694 C C    . SER A 1 66  ? 36.328  66.758  82.229  1.00 0.00 ?  57  SER A C    7  
ATOM 10695 O O    . SER A 1 66  ? 35.759  66.819  81.113  1.00 0.00 ?  57  SER A O    7  
ATOM 10696 C CB   . SER A 1 66  ? 35.664  64.671  83.529  1.00 0.00 ?  57  SER A CB   7  
ATOM 10697 O OG   . SER A 1 66  ? 35.240  65.372  84.689  1.00 0.00 ?  57  SER A OG   7  
ATOM 10698 H H    . SER A 1 66  ? 37.772  65.246  84.690  1.00 0.00 ?  57  SER A H    7  
ATOM 10699 H HA   . SER A 1 66  ? 37.161  64.684  81.980  1.00 0.00 ?  57  SER A HA   7  
ATOM 10700 H HB2  . SER A 1 66  ? 34.935  64.503  82.738  1.00 0.00 ?  57  SER A HB2  7  
ATOM 10701 H HB3  . SER A 1 66  ? 35.900  63.649  83.826  1.00 0.00 ?  57  SER A HB3  7  
ATOM 10702 H HG   . SER A 1 66  ? 35.695  65.035  85.464  1.00 0.00 ?  57  SER A HG   7  
ATOM 10703 N N    . TYR A 1 67  ? 36.588  67.823  82.994  1.00 0.00 ?  58  TYR A N    7  
ATOM 10704 C CA   . TYR A 1 67  ? 36.371  69.189  82.446  1.00 0.00 ?  58  TYR A CA   7  
ATOM 10705 C C    . TYR A 1 67  ? 37.439  69.827  81.511  1.00 0.00 ?  58  TYR A C    7  
ATOM 10706 O O    . TYR A 1 67  ? 37.097  70.641  80.653  1.00 0.00 ?  58  TYR A O    7  
ATOM 10707 C CB   . TYR A 1 67  ? 36.013  70.151  83.576  1.00 0.00 ?  58  TYR A CB   7  
ATOM 10708 C CG   . TYR A 1 67  ? 34.648  69.993  84.212  1.00 0.00 ?  58  TYR A CG   7  
ATOM 10709 C CD1  . TYR A 1 67  ? 33.425  70.239  83.545  1.00 0.00 ?  58  TYR A CD1  7  
ATOM 10710 C CD2  . TYR A 1 67  ? 34.556  69.606  85.579  1.00 0.00 ?  58  TYR A CD2  7  
ATOM 10711 C CE1  . TYR A 1 67  ? 32.164  70.030  84.165  1.00 0.00 ?  58  TYR A CE1  7  
ATOM 10712 C CE2  . TYR A 1 67  ? 33.360  69.389  86.231  1.00 0.00 ?  58  TYR A CE2  7  
ATOM 10713 C CZ   . TYR A 1 67  ? 32.136  69.608  85.551  1.00 0.00 ?  58  TYR A CZ   7  
ATOM 10714 O OH   . TYR A 1 67  ? 30.969  69.454  86.217  1.00 0.00 ?  58  TYR A OH   7  
ATOM 10715 H H    . TYR A 1 67  ? 37.088  67.692  83.862  1.00 0.00 ?  58  TYR A H    7  
ATOM 10716 H HA   . TYR A 1 67  ? 35.548  69.182  81.732  1.00 0.00 ?  58  TYR A HA   7  
ATOM 10717 H HB2  . TYR A 1 67  ? 36.722  69.913  84.370  1.00 0.00 ?  58  TYR A HB2  7  
ATOM 10718 H HB3  . TYR A 1 67  ? 36.220  71.178  83.274  1.00 0.00 ?  58  TYR A HB3  7  
ATOM 10719 H HD1  . TYR A 1 67  ? 33.387  70.339  82.470  1.00 0.00 ?  58  TYR A HD1  7  
ATOM 10720 H HD2  . TYR A 1 67  ? 35.501  69.369  86.045  1.00 0.00 ?  58  TYR A HD2  7  
ATOM 10721 H HE1  . TYR A 1 67  ? 31.319  70.283  83.543  1.00 0.00 ?  58  TYR A HE1  7  
ATOM 10722 H HE2  . TYR A 1 67  ? 33.374  69.004  87.239  1.00 0.00 ?  58  TYR A HE2  7  
ATOM 10723 H HH   . TYR A 1 67  ? 30.223  69.952  85.876  1.00 0.00 ?  58  TYR A HH   7  
ATOM 10724 N N    . MET A 1 68  ? 38.652  69.368  81.564  1.00 0.00 ?  59  MET A N    7  
ATOM 10725 C CA   . MET A 1 68  ? 39.731  69.550  80.540  1.00 0.00 ?  59  MET A CA   7  
ATOM 10726 C C    . MET A 1 68  ? 39.452  68.643  79.313  1.00 0.00 ?  59  MET A C    7  
ATOM 10727 O O    . MET A 1 68  ? 39.755  69.029  78.202  1.00 0.00 ?  59  MET A O    7  
ATOM 10728 C CB   . MET A 1 68  ? 41.100  69.427  81.205  1.00 0.00 ?  59  MET A CB   7  
ATOM 10729 C CG   . MET A 1 68  ? 42.231  69.607  80.109  1.00 0.00 ?  59  MET A CG   7  
ATOM 10730 S SD   . MET A 1 68  ? 43.882  69.464  80.821  1.00 0.00 ?  59  MET A SD   7  
ATOM 10731 C CE   . MET A 1 68  ? 43.973  71.045  81.725  1.00 0.00 ?  59  MET A CE   7  
ATOM 10732 H H    . MET A 1 68  ? 38.614  68.503  82.085  1.00 0.00 ?  59  MET A H    7  
ATOM 10733 H HA   . MET A 1 68  ? 39.702  70.611  80.294  1.00 0.00 ?  59  MET A HA   7  
ATOM 10734 H HB2  . MET A 1 68  ? 41.227  70.193  81.971  1.00 0.00 ?  59  MET A HB2  7  
ATOM 10735 H HB3  . MET A 1 68  ? 41.240  68.431  81.623  1.00 0.00 ?  59  MET A HB3  7  
ATOM 10736 H HG2  . MET A 1 68  ? 42.020  69.018  79.216  1.00 0.00 ?  59  MET A HG2  7  
ATOM 10737 H HG3  . MET A 1 68  ? 42.068  70.634  79.781  1.00 0.00 ?  59  MET A HG3  7  
ATOM 10738 H HE1  . MET A 1 68  ? 43.054  71.619  81.607  1.00 0.00 ?  59  MET A HE1  7  
ATOM 10739 H HE2  . MET A 1 68  ? 44.183  70.898  82.784  1.00 0.00 ?  59  MET A HE2  7  
ATOM 10740 H HE3  . MET A 1 68  ? 44.803  71.539  81.218  1.00 0.00 ?  59  MET A HE3  7  
ATOM 10741 N N    . TYR A 1 69  ? 38.797  67.500  79.598  1.00 0.00 ?  60  TYR A N    7  
ATOM 10742 C CA   . TYR A 1 69  ? 38.103  66.901  78.515  1.00 0.00 ?  60  TYR A CA   7  
ATOM 10743 C C    . TYR A 1 69  ? 37.060  67.796  77.867  1.00 0.00 ?  60  TYR A C    7  
ATOM 10744 O O    . TYR A 1 69  ? 37.233  68.034  76.691  1.00 0.00 ?  60  TYR A O    7  
ATOM 10745 C CB   . TYR A 1 69  ? 37.750  65.400  78.724  1.00 0.00 ?  60  TYR A CB   7  
ATOM 10746 C CG   . TYR A 1 69  ? 36.722  64.856  77.745  1.00 0.00 ?  60  TYR A CG   7  
ATOM 10747 C CD1  . TYR A 1 69  ? 37.254  64.391  76.506  1.00 0.00 ?  60  TYR A CD1  7  
ATOM 10748 C CD2  . TYR A 1 69  ? 35.340  64.910  78.047  1.00 0.00 ?  60  TYR A CD2  7  
ATOM 10749 C CE1  . TYR A 1 69  ? 36.284  63.888  75.574  1.00 0.00 ?  60  TYR A CE1  7  
ATOM 10750 C CE2  . TYR A 1 69  ? 34.425  64.384  77.085  1.00 0.00 ?  60  TYR A CE2  7  
ATOM 10751 C CZ   . TYR A 1 69  ? 34.932  63.911  75.871  1.00 0.00 ?  60  TYR A CZ   7  
ATOM 10752 O OH   . TYR A 1 69  ? 34.033  63.672  74.845  1.00 0.00 ?  60  TYR A OH   7  
ATOM 10753 H H    . TYR A 1 69  ? 38.520  67.361  80.559  1.00 0.00 ?  60  TYR A H    7  
ATOM 10754 H HA   . TYR A 1 69  ? 38.841  66.769  77.724  1.00 0.00 ?  60  TYR A HA   7  
ATOM 10755 H HB2  . TYR A 1 69  ? 38.654  64.794  78.795  1.00 0.00 ?  60  TYR A HB2  7  
ATOM 10756 H HB3  . TYR A 1 69  ? 37.169  65.261  79.636  1.00 0.00 ?  60  TYR A HB3  7  
ATOM 10757 H HD1  . TYR A 1 69  ? 38.302  64.461  76.256  1.00 0.00 ?  60  TYR A HD1  7  
ATOM 10758 H HD2  . TYR A 1 69  ? 34.936  65.279  78.977  1.00 0.00 ?  60  TYR A HD2  7  
ATOM 10759 H HE1  . TYR A 1 69  ? 36.708  63.698  74.599  1.00 0.00 ?  60  TYR A HE1  7  
ATOM 10760 H HE2  . TYR A 1 69  ? 33.362  64.451  77.262  1.00 0.00 ?  60  TYR A HE2  7  
ATOM 10761 H HH   . TYR A 1 69  ? 33.168  63.711  75.260  1.00 0.00 ?  60  TYR A HH   7  
ATOM 10762 N N    . ILE A 1 70  ? 36.234  68.453  78.586  1.00 0.00 ?  61  ILE A N    7  
ATOM 10763 C CA   . ILE A 1 70  ? 35.330  69.476  78.038  1.00 0.00 ?  61  ILE A CA   7  
ATOM 10764 C C    . ILE A 1 70  ? 35.982  70.541  77.175  1.00 0.00 ?  61  ILE A C    7  
ATOM 10765 O O    . ILE A 1 70  ? 35.389  70.948  76.129  1.00 0.00 ?  61  ILE A O    7  
ATOM 10766 C CB   . ILE A 1 70  ? 34.267  70.006  79.039  1.00 0.00 ?  61  ILE A CB   7  
ATOM 10767 C CG1  . ILE A 1 70  ? 33.241  68.871  79.462  1.00 0.00 ?  61  ILE A CG1  7  
ATOM 10768 C CG2  . ILE A 1 70  ? 33.399  71.144  78.583  1.00 0.00 ?  61  ILE A CG2  7  
ATOM 10769 C CD1  . ILE A 1 70  ? 32.311  68.295  78.381  1.00 0.00 ?  61  ILE A CD1  7  
ATOM 10770 H H    . ILE A 1 70  ? 36.157  68.139  79.543  1.00 0.00 ?  61  ILE A H    7  
ATOM 10771 H HA   . ILE A 1 70  ? 34.834  68.982  77.203  1.00 0.00 ?  61  ILE A HA   7  
ATOM 10772 H HB   . ILE A 1 70  ? 34.850  70.377  79.882  1.00 0.00 ?  61  ILE A HB   7  
ATOM 10773 H HG12 . ILE A 1 70  ? 33.920  68.099  79.826  1.00 0.00 ?  61  ILE A HG12 7  
ATOM 10774 H HG13 . ILE A 1 70  ? 32.639  69.122  80.335  1.00 0.00 ?  61  ILE A HG13 7  
ATOM 10775 H HG21 . ILE A 1 70  ? 32.651  71.267  79.366  1.00 0.00 ?  61  ILE A HG21 7  
ATOM 10776 H HG22 . ILE A 1 70  ? 33.993  72.055  78.515  1.00 0.00 ?  61  ILE A HG22 7  
ATOM 10777 H HG23 . ILE A 1 70  ? 33.101  70.795  77.594  1.00 0.00 ?  61  ILE A HG23 7  
ATOM 10778 H HD11 . ILE A 1 70  ? 32.925  68.014  77.527  1.00 0.00 ?  61  ILE A HD11 7  
ATOM 10779 H HD12 . ILE A 1 70  ? 31.743  67.422  78.706  1.00 0.00 ?  61  ILE A HD12 7  
ATOM 10780 H HD13 . ILE A 1 70  ? 31.565  68.994  78.003  1.00 0.00 ?  61  ILE A HD13 7  
ATOM 10781 N N    . LEU A 1 71  ? 37.162  71.006  77.464  1.00 0.00 ?  62  LEU A N    7  
ATOM 10782 C CA   . LEU A 1 71  ? 37.941  71.936  76.619  1.00 0.00 ?  62  LEU A CA   7  
ATOM 10783 C C    . LEU A 1 71  ? 38.611  71.265  75.422  1.00 0.00 ?  62  LEU A C    7  
ATOM 10784 O O    . LEU A 1 71  ? 38.559  71.877  74.366  1.00 0.00 ?  62  LEU A O    7  
ATOM 10785 C CB   . LEU A 1 71  ? 39.035  72.651  77.430  1.00 0.00 ?  62  LEU A CB   7  
ATOM 10786 C CG   . LEU A 1 71  ? 38.741  73.279  78.732  1.00 0.00 ?  62  LEU A CG   7  
ATOM 10787 C CD1  . LEU A 1 71  ? 40.079  73.718  79.362  1.00 0.00 ?  62  LEU A CD1  7  
ATOM 10788 C CD2  . LEU A 1 71  ? 37.726  74.398  78.617  1.00 0.00 ?  62  LEU A CD2  7  
ATOM 10789 H H    . LEU A 1 71  ? 37.634  70.522  78.214  1.00 0.00 ?  62  LEU A H    7  
ATOM 10790 H HA   . LEU A 1 71  ? 37.200  72.664  76.290  1.00 0.00 ?  62  LEU A HA   7  
ATOM 10791 H HB2  . LEU A 1 71  ? 39.847  71.944  77.600  1.00 0.00 ?  62  LEU A HB2  7  
ATOM 10792 H HB3  . LEU A 1 71  ? 39.428  73.472  76.832  1.00 0.00 ?  62  LEU A HB3  7  
ATOM 10793 H HG   . LEU A 1 71  ? 38.397  72.498  79.409  1.00 0.00 ?  62  LEU A HG   7  
ATOM 10794 H HD11 . LEU A 1 71  ? 40.895  73.069  79.042  1.00 0.00 ?  62  LEU A HD11 7  
ATOM 10795 H HD12 . LEU A 1 71  ? 40.268  74.762  79.110  1.00 0.00 ?  62  LEU A HD12 7  
ATOM 10796 H HD13 . LEU A 1 71  ? 40.065  73.644  80.449  1.00 0.00 ?  62  LEU A HD13 7  
ATOM 10797 H HD21 . LEU A 1 71  ? 37.609  75.041  79.490  1.00 0.00 ?  62  LEU A HD21 7  
ATOM 10798 H HD22 . LEU A 1 71  ? 38.007  75.022  77.769  1.00 0.00 ?  62  LEU A HD22 7  
ATOM 10799 H HD23 . LEU A 1 71  ? 36.728  74.009  78.417  1.00 0.00 ?  62  LEU A HD23 7  
ATOM 10800 N N    . PHE A 1 72  ? 39.224  70.049  75.601  1.00 0.00 ?  63  PHE A N    7  
ATOM 10801 C CA   . PHE A 1 72  ? 39.702  69.252  74.415  1.00 0.00 ?  63  PHE A CA   7  
ATOM 10802 C C    . PHE A 1 72  ? 38.648  68.813  73.383  1.00 0.00 ?  63  PHE A C    7  
ATOM 10803 O O    . PHE A 1 72  ? 38.993  68.510  72.142  1.00 0.00 ?  63  PHE A O    7  
ATOM 10804 C CB   . PHE A 1 72  ? 40.508  68.086  74.904  1.00 0.00 ?  63  PHE A CB   7  
ATOM 10805 C CG   . PHE A 1 72  ? 40.723  66.959  73.876  1.00 0.00 ?  63  PHE A CG   7  
ATOM 10806 C CD1  . PHE A 1 72  ? 41.784  66.931  72.917  1.00 0.00 ?  63  PHE A CD1  7  
ATOM 10807 C CD2  . PHE A 1 72  ? 39.801  65.840  73.834  1.00 0.00 ?  63  PHE A CD2  7  
ATOM 10808 C CE1  . PHE A 1 72  ? 41.874  65.976  71.896  1.00 0.00 ?  63  PHE A CE1  7  
ATOM 10809 C CE2  . PHE A 1 72  ? 39.930  64.879  72.787  1.00 0.00 ?  63  PHE A CE2  7  
ATOM 10810 C CZ   . PHE A 1 72  ? 40.971  64.897  71.837  1.00 0.00 ?  63  PHE A CZ   7  
ATOM 10811 H H    . PHE A 1 72  ? 39.093  69.518  76.449  1.00 0.00 ?  63  PHE A H    7  
ATOM 10812 H HA   . PHE A 1 72  ? 40.405  69.897  73.887  1.00 0.00 ?  63  PHE A HA   7  
ATOM 10813 H HB2  . PHE A 1 72  ? 41.456  68.519  75.224  1.00 0.00 ?  63  PHE A HB2  7  
ATOM 10814 H HB3  . PHE A 1 72  ? 40.038  67.614  75.766  1.00 0.00 ?  63  PHE A HB3  7  
ATOM 10815 H HD1  . PHE A 1 72  ? 42.575  67.661  73.007  1.00 0.00 ?  63  PHE A HD1  7  
ATOM 10816 H HD2  . PHE A 1 72  ? 38.931  65.916  74.469  1.00 0.00 ?  63  PHE A HD2  7  
ATOM 10817 H HE1  . PHE A 1 72  ? 42.685  66.001  71.184  1.00 0.00 ?  63  PHE A HE1  7  
ATOM 10818 H HE2  . PHE A 1 72  ? 39.199  64.094  72.666  1.00 0.00 ?  63  PHE A HE2  7  
ATOM 10819 H HZ   . PHE A 1 72  ? 40.904  64.157  71.052  1.00 0.00 ?  63  PHE A HZ   7  
ATOM 10820 N N    . VAL A 1 73  ? 37.393  68.649  73.880  1.00 0.00 ?  64  VAL A N    7  
ATOM 10821 C CA   . VAL A 1 73  ? 36.211  68.202  73.071  1.00 0.00 ?  64  VAL A CA   7  
ATOM 10822 C C    . VAL A 1 73  ? 35.357  69.331  72.493  1.00 0.00 ?  64  VAL A C    7  
ATOM 10823 O O    . VAL A 1 73  ? 34.748  69.173  71.429  1.00 0.00 ?  64  VAL A O    7  
ATOM 10824 C CB   . VAL A 1 73  ? 35.327  67.133  73.798  1.00 0.00 ?  64  VAL A CB   7  
ATOM 10825 C CG1  . VAL A 1 73  ? 34.056  67.564  74.602  1.00 0.00 ?  64  VAL A CG1  7  
ATOM 10826 C CG2  . VAL A 1 73  ? 34.850  66.058  72.783  1.00 0.00 ?  64  VAL A CG2  7  
ATOM 10827 H H    . VAL A 1 73  ? 37.279  68.934  74.841  1.00 0.00 ?  64  VAL A H    7  
ATOM 10828 H HA   . VAL A 1 73  ? 36.517  67.740  72.133  1.00 0.00 ?  64  VAL A HA   7  
ATOM 10829 H HB   . VAL A 1 73  ? 35.926  66.583  74.526  1.00 0.00 ?  64  VAL A HB   7  
ATOM 10830 H HG11 . VAL A 1 73  ? 33.205  67.769  73.951  1.00 0.00 ?  64  VAL A HG11 7  
ATOM 10831 H HG12 . VAL A 1 73  ? 33.761  66.781  75.300  1.00 0.00 ?  64  VAL A HG12 7  
ATOM 10832 H HG13 . VAL A 1 73  ? 34.334  68.402  75.241  1.00 0.00 ?  64  VAL A HG13 7  
ATOM 10833 H HG21 . VAL A 1 73  ? 34.378  66.515  71.913  1.00 0.00 ?  64  VAL A HG21 7  
ATOM 10834 H HG22 . VAL A 1 73  ? 35.734  65.540  72.410  1.00 0.00 ?  64  VAL A HG22 7  
ATOM 10835 H HG23 . VAL A 1 73  ? 34.229  65.346  73.324  1.00 0.00 ?  64  VAL A HG23 7  
ATOM 10836 N N    . MET A 1 74  ? 35.559  70.594  72.981  1.00 0.00 ?  65  MET A N    7  
ATOM 10837 C CA   . MET A 1 74  ? 35.295  71.854  72.165  1.00 0.00 ?  65  MET A CA   7  
ATOM 10838 C C    . MET A 1 74  ? 36.293  71.884  70.957  1.00 0.00 ?  65  MET A C    7  
ATOM 10839 O O    . MET A 1 74  ? 36.009  72.281  69.847  1.00 0.00 ?  65  MET A O    7  
ATOM 10840 C CB   . MET A 1 74  ? 35.356  73.066  73.068  1.00 0.00 ?  65  MET A CB   7  
ATOM 10841 C CG   . MET A 1 74  ? 34.054  73.248  73.766  1.00 0.00 ?  65  MET A CG   7  
ATOM 10842 S SD   . MET A 1 74  ? 33.905  74.952  74.435  1.00 0.00 ?  65  MET A SD   7  
ATOM 10843 C CE   . MET A 1 74  ? 35.035  74.970  75.832  1.00 0.00 ?  65  MET A CE   7  
ATOM 10844 H H    . MET A 1 74  ? 36.028  70.807  73.849  1.00 0.00 ?  65  MET A H    7  
ATOM 10845 H HA   . MET A 1 74  ? 34.313  71.835  71.690  1.00 0.00 ?  65  MET A HA   7  
ATOM 10846 H HB2  . MET A 1 74  ? 36.214  73.046  73.740  1.00 0.00 ?  65  MET A HB2  7  
ATOM 10847 H HB3  . MET A 1 74  ? 35.539  73.857  72.342  1.00 0.00 ?  65  MET A HB3  7  
ATOM 10848 H HG2  . MET A 1 74  ? 33.229  73.160  73.058  1.00 0.00 ?  65  MET A HG2  7  
ATOM 10849 H HG3  . MET A 1 74  ? 33.850  72.502  74.533  1.00 0.00 ?  65  MET A HG3  7  
ATOM 10850 H HE1  . MET A 1 74  ? 34.819  75.929  76.300  1.00 0.00 ?  65  MET A HE1  7  
ATOM 10851 H HE2  . MET A 1 74  ? 34.795  74.167  76.529  1.00 0.00 ?  65  MET A HE2  7  
ATOM 10852 H HE3  . MET A 1 74  ? 36.072  74.793  75.545  1.00 0.00 ?  65  MET A HE3  7  
ATOM 10853 N N    . PHE A 1 75  ? 37.510  71.429  71.233  1.00 0.00 ?  66  PHE A N    7  
ATOM 10854 C CA   . PHE A 1 75  ? 38.420  71.257  70.093  1.00 0.00 ?  66  PHE A CA   7  
ATOM 10855 C C    . PHE A 1 75  ? 38.071  70.105  69.133  1.00 0.00 ?  66  PHE A C    7  
ATOM 10856 O O    . PHE A 1 75  ? 38.105  70.336  67.884  1.00 0.00 ?  66  PHE A O    7  
ATOM 10857 C CB   . PHE A 1 75  ? 39.884  71.374  70.575  1.00 0.00 ?  66  PHE A CB   7  
ATOM 10858 C CG   . PHE A 1 75  ? 40.720  70.831  69.484  1.00 0.00 ?  66  PHE A CG   7  
ATOM 10859 C CD1  . PHE A 1 75  ? 40.920  71.631  68.370  1.00 0.00 ?  66  PHE A CD1  7  
ATOM 10860 C CD2  . PHE A 1 75  ? 41.254  69.531  69.492  1.00 0.00 ?  66  PHE A CD2  7  
ATOM 10861 C CE1  . PHE A 1 75  ? 41.733  71.223  67.337  1.00 0.00 ?  66  PHE A CE1  7  
ATOM 10862 C CE2  . PHE A 1 75  ? 41.981  69.068  68.370  1.00 0.00 ?  66  PHE A CE2  7  
ATOM 10863 C CZ   . PHE A 1 75  ? 42.346  69.923  67.333  1.00 0.00 ?  66  PHE A CZ   7  
ATOM 10864 H H    . PHE A 1 75  ? 37.671  71.155  72.192  1.00 0.00 ?  66  PHE A H    7  
ATOM 10865 H HA   . PHE A 1 75  ? 38.231  72.124  69.461  1.00 0.00 ?  66  PHE A HA   7  
ATOM 10866 H HB2  . PHE A 1 75  ? 40.067  72.416  70.837  1.00 0.00 ?  66  PHE A HB2  7  
ATOM 10867 H HB3  . PHE A 1 75  ? 40.097  70.885  71.526  1.00 0.00 ?  66  PHE A HB3  7  
ATOM 10868 H HD1  . PHE A 1 75  ? 40.463  72.606  68.296  1.00 0.00 ?  66  PHE A HD1  7  
ATOM 10869 H HD2  . PHE A 1 75  ? 40.852  68.829  70.207  1.00 0.00 ?  66  PHE A HD2  7  
ATOM 10870 H HE1  . PHE A 1 75  ? 42.113  71.902  66.587  1.00 0.00 ?  66  PHE A HE1  7  
ATOM 10871 H HE2  . PHE A 1 75  ? 42.370  68.060  68.383  1.00 0.00 ?  66  PHE A HE2  7  
ATOM 10872 H HZ   . PHE A 1 75  ? 42.967  69.612  66.506  1.00 0.00 ?  66  PHE A HZ   7  
ATOM 10873 N N    . LEU A 1 76  ? 37.690  68.938  69.628  1.00 0.00 ?  67  LEU A N    7  
ATOM 10874 C CA   . LEU A 1 76  ? 37.168  67.867  68.741  1.00 0.00 ?  67  LEU A CA   7  
ATOM 10875 C C    . LEU A 1 76  ? 35.841  68.157  68.097  1.00 0.00 ?  67  LEU A C    7  
ATOM 10876 O O    . LEU A 1 76  ? 35.595  67.630  66.959  1.00 0.00 ?  67  LEU A O    7  
ATOM 10877 C CB   . LEU A 1 76  ? 37.217  66.457  69.446  1.00 0.00 ?  67  LEU A CB   7  
ATOM 10878 C CG   . LEU A 1 76  ? 36.856  65.190  68.603  1.00 0.00 ?  67  LEU A CG   7  
ATOM 10879 C CD1  . LEU A 1 76  ? 37.861  64.931  67.475  1.00 0.00 ?  67  LEU A CD1  7  
ATOM 10880 C CD2  . LEU A 1 76  ? 36.853  63.957  69.546  1.00 0.00 ?  67  LEU A CD2  7  
ATOM 10881 H H    . LEU A 1 76  ? 37.748  68.865  70.634  1.00 0.00 ?  67  LEU A H    7  
ATOM 10882 H HA   . LEU A 1 76  ? 37.884  67.810  67.921  1.00 0.00 ?  67  LEU A HA   7  
ATOM 10883 H HB2  . LEU A 1 76  ? 38.206  66.324  69.880  1.00 0.00 ?  67  LEU A HB2  7  
ATOM 10884 H HB3  . LEU A 1 76  ? 36.596  66.564  70.336  1.00 0.00 ?  67  LEU A HB3  7  
ATOM 10885 H HG   . LEU A 1 76  ? 35.843  65.316  68.220  1.00 0.00 ?  67  LEU A HG   7  
ATOM 10886 H HD11 . LEU A 1 76  ? 37.535  64.092  66.859  1.00 0.00 ?  67  LEU A HD11 7  
ATOM 10887 H HD12 . LEU A 1 76  ? 37.826  65.752  66.759  1.00 0.00 ?  67  LEU A HD12 7  
ATOM 10888 H HD13 . LEU A 1 76  ? 38.842  64.687  67.882  1.00 0.00 ?  67  LEU A HD13 7  
ATOM 10889 H HD21 . LEU A 1 76  ? 35.885  63.894  70.042  1.00 0.00 ?  67  LEU A HD21 7  
ATOM 10890 H HD22 . LEU A 1 76  ? 36.948  63.084  68.900  1.00 0.00 ?  67  LEU A HD22 7  
ATOM 10891 H HD23 . LEU A 1 76  ? 37.688  63.982  70.246  1.00 0.00 ?  67  LEU A HD23 7  
ATOM 10892 N N    . PHE A 1 77  ? 35.057  68.972  68.755  1.00 0.00 ?  68  PHE A N    7  
ATOM 10893 C CA   . PHE A 1 77  ? 33.963  69.701  68.109  1.00 0.00 ?  68  PHE A CA   7  
ATOM 10894 C C    . PHE A 1 77  ? 34.199  70.332  66.786  1.00 0.00 ?  68  PHE A C    7  
ATOM 10895 O O    . PHE A 1 77  ? 33.612  69.921  65.780  1.00 0.00 ?  68  PHE A O    7  
ATOM 10896 C CB   . PHE A 1 77  ? 32.961  70.390  69.035  1.00 0.00 ?  68  PHE A CB   7  
ATOM 10897 C CG   . PHE A 1 77  ? 32.052  71.388  68.331  1.00 0.00 ?  68  PHE A CG   7  
ATOM 10898 C CD1  . PHE A 1 77  ? 32.522  72.619  67.901  1.00 0.00 ?  68  PHE A CD1  7  
ATOM 10899 C CD2  . PHE A 1 77  ? 30.732  70.973  67.858  1.00 0.00 ?  68  PHE A CD2  7  
ATOM 10900 C CE1  . PHE A 1 77  ? 31.654  73.445  67.187  1.00 0.00 ?  68  PHE A CE1  7  
ATOM 10901 C CE2  . PHE A 1 77  ? 29.921  71.792  67.037  1.00 0.00 ?  68  PHE A CE2  7  
ATOM 10902 C CZ   . PHE A 1 77  ? 30.376  73.060  66.746  1.00 0.00 ?  68  PHE A CZ   7  
ATOM 10903 H H    . PHE A 1 77  ? 35.320  69.186  69.707  1.00 0.00 ?  68  PHE A H    7  
ATOM 10904 H HA   . PHE A 1 77  ? 33.364  68.914  67.650  1.00 0.00 ?  68  PHE A HA   7  
ATOM 10905 H HB2  . PHE A 1 77  ? 32.268  69.733  69.562  1.00 0.00 ?  68  PHE A HB2  7  
ATOM 10906 H HB3  . PHE A 1 77  ? 33.477  70.900  69.848  1.00 0.00 ?  68  PHE A HB3  7  
ATOM 10907 H HD1  . PHE A 1 77  ? 33.559  72.848  68.093  1.00 0.00 ?  68  PHE A HD1  7  
ATOM 10908 H HD2  . PHE A 1 77  ? 30.424  69.940  67.932  1.00 0.00 ?  68  PHE A HD2  7  
ATOM 10909 H HE1  . PHE A 1 77  ? 31.980  74.417  66.846  1.00 0.00 ?  68  PHE A HE1  7  
ATOM 10910 H HE2  . PHE A 1 77  ? 28.948  71.462  66.707  1.00 0.00 ?  68  PHE A HE2  7  
ATOM 10911 H HZ   . PHE A 1 77  ? 29.711  73.736  66.230  1.00 0.00 ?  68  PHE A HZ   7  
ATOM 10912 N N    . ALA A 1 78  ? 35.159  71.288  66.675  1.00 0.00 ?  69  ALA A N    7  
ATOM 10913 C CA   . ALA A 1 78  ? 35.328  71.951  65.383  1.00 0.00 ?  69  ALA A CA   7  
ATOM 10914 C C    . ALA A 1 78  ? 35.949  70.975  64.325  1.00 0.00 ?  69  ALA A C    7  
ATOM 10915 O O    . ALA A 1 78  ? 35.783  71.206  63.116  1.00 0.00 ?  69  ALA A O    7  
ATOM 10916 C CB   . ALA A 1 78  ? 36.186  73.284  65.499  1.00 0.00 ?  69  ALA A CB   7  
ATOM 10917 H H    . ALA A 1 78  ? 35.657  71.685  67.458  1.00 0.00 ?  69  ALA A H    7  
ATOM 10918 H HA   . ALA A 1 78  ? 34.321  72.240  65.085  1.00 0.00 ?  69  ALA A HA   7  
ATOM 10919 H HB1  . ALA A 1 78  ? 35.640  74.167  65.831  1.00 0.00 ?  69  ALA A HB1  7  
ATOM 10920 H HB2  . ALA A 1 78  ? 36.910  73.124  66.297  1.00 0.00 ?  69  ALA A HB2  7  
ATOM 10921 H HB3  . ALA A 1 78  ? 36.559  73.519  64.502  1.00 0.00 ?  69  ALA A HB3  7  
ATOM 10922 N N    . VAL A 1 79  ? 36.714  69.937  64.702  1.00 0.00 ?  70  VAL A N    7  
ATOM 10923 C CA   . VAL A 1 79  ? 37.380  68.935  63.880  1.00 0.00 ?  70  VAL A CA   7  
ATOM 10924 C C    . VAL A 1 79  ? 36.236  67.965  63.365  1.00 0.00 ?  70  VAL A C    7  
ATOM 10925 O O    . VAL A 1 79  ? 36.218  67.560  62.220  1.00 0.00 ?  70  VAL A O    7  
ATOM 10926 C CB   . VAL A 1 79  ? 38.321  68.072  64.839  1.00 0.00 ?  70  VAL A CB   7  
ATOM 10927 C CG1  . VAL A 1 79  ? 38.846  66.773  64.137  1.00 0.00 ?  70  VAL A CG1  7  
ATOM 10928 C CG2  . VAL A 1 79  ? 39.512  68.915  65.286  1.00 0.00 ?  70  VAL A CG2  7  
ATOM 10929 H H    . VAL A 1 79  ? 36.733  69.929  65.712  1.00 0.00 ?  70  VAL A H    7  
ATOM 10930 H HA   . VAL A 1 79  ? 38.021  69.459  63.172  1.00 0.00 ?  70  VAL A HA   7  
ATOM 10931 H HB   . VAL A 1 79  ? 37.735  67.641  65.651  1.00 0.00 ?  70  VAL A HB   7  
ATOM 10932 H HG11 . VAL A 1 79  ? 39.569  66.872  63.327  1.00 0.00 ?  70  VAL A HG11 7  
ATOM 10933 H HG12 . VAL A 1 79  ? 39.252  66.051  64.845  1.00 0.00 ?  70  VAL A HG12 7  
ATOM 10934 H HG13 . VAL A 1 79  ? 37.971  66.285  63.708  1.00 0.00 ?  70  VAL A HG13 7  
ATOM 10935 H HG21 . VAL A 1 79  ? 40.273  69.006  64.511  1.00 0.00 ?  70  VAL A HG21 7  
ATOM 10936 H HG22 . VAL A 1 79  ? 39.239  69.891  65.687  1.00 0.00 ?  70  VAL A HG22 7  
ATOM 10937 H HG23 . VAL A 1 79  ? 39.971  68.394  66.126  1.00 0.00 ?  70  VAL A HG23 7  
ATOM 10938 N N    . THR A 1 80  ? 35.267  67.670  64.253  1.00 0.00 ?  71  THR A N    7  
ATOM 10939 C CA   . THR A 1 80  ? 34.061  67.015  63.874  1.00 0.00 ?  71  THR A CA   7  
ATOM 10940 C C    . THR A 1 80  ? 33.198  67.870  62.903  1.00 0.00 ?  71  THR A C    7  
ATOM 10941 O O    . THR A 1 80  ? 32.698  67.209  62.075  1.00 0.00 ?  71  THR A O    7  
ATOM 10942 C CB   . THR A 1 80  ? 33.337  66.392  65.101  1.00 0.00 ?  71  THR A CB   7  
ATOM 10943 O OG1  . THR A 1 80  ? 34.212  65.654  65.919  1.00 0.00 ?  71  THR A OG1  7  
ATOM 10944 C CG2  . THR A 1 80  ? 32.318  65.384  64.661  1.00 0.00 ?  71  THR A CG2  7  
ATOM 10945 H H    . THR A 1 80  ? 35.386  68.044  65.184  1.00 0.00 ?  71  THR A H    7  
ATOM 10946 H HA   . THR A 1 80  ? 34.463  66.170  63.316  1.00 0.00 ?  71  THR A HA   7  
ATOM 10947 H HB   . THR A 1 80  ? 32.816  67.170  65.660  1.00 0.00 ?  71  THR A HB   7  
ATOM 10948 H HG1  . THR A 1 80  ? 34.855  66.321  66.171  1.00 0.00 ?  71  THR A HG1  7  
ATOM 10949 H HG21 . THR A 1 80  ? 31.478  65.797  64.105  1.00 0.00 ?  71  THR A HG21 7  
ATOM 10950 H HG22 . THR A 1 80  ? 32.811  64.580  64.113  1.00 0.00 ?  71  THR A HG22 7  
ATOM 10951 H HG23 . THR A 1 80  ? 31.792  64.879  65.471  1.00 0.00 ?  71  THR A HG23 7  
ATOM 10952 N N    . VAL A 1 81  ? 33.100  69.193  63.012  1.00 0.00 ?  72  VAL A N    7  
ATOM 10953 C CA   . VAL A 1 81  ? 32.500  69.974  61.944  1.00 0.00 ?  72  VAL A CA   7  
ATOM 10954 C C    . VAL A 1 81  ? 33.116  69.685  60.558  1.00 0.00 ?  72  VAL A C    7  
ATOM 10955 O O    . VAL A 1 81  ? 32.407  69.380  59.549  1.00 0.00 ?  72  VAL A O    7  
ATOM 10956 C CB   . VAL A 1 81  ? 32.377  71.468  62.282  1.00 0.00 ?  72  VAL A CB   7  
ATOM 10957 C CG1  . VAL A 1 81  ? 31.618  72.158  61.137  1.00 0.00 ?  72  VAL A CG1  7  
ATOM 10958 C CG2  . VAL A 1 81  ? 31.635  71.695  63.608  1.00 0.00 ?  72  VAL A CG2  7  
ATOM 10959 H H    . VAL A 1 81  ? 33.657  69.656  63.716  1.00 0.00 ?  72  VAL A H    7  
ATOM 10960 H HA   . VAL A 1 81  ? 31.445  69.701  61.900  1.00 0.00 ?  72  VAL A HA   7  
ATOM 10961 H HB   . VAL A 1 81  ? 33.299  72.010  62.489  1.00 0.00 ?  72  VAL A HB   7  
ATOM 10962 H HG11 . VAL A 1 81  ? 30.646  71.664  61.133  1.00 0.00 ?  72  VAL A HG11 7  
ATOM 10963 H HG12 . VAL A 1 81  ? 31.525  73.201  61.441  1.00 0.00 ?  72  VAL A HG12 7  
ATOM 10964 H HG13 . VAL A 1 81  ? 32.156  71.997  60.203  1.00 0.00 ?  72  VAL A HG13 7  
ATOM 10965 H HG21 . VAL A 1 81  ? 31.320  72.738  63.634  1.00 0.00 ?  72  VAL A HG21 7  
ATOM 10966 H HG22 . VAL A 1 81  ? 30.754  71.077  63.782  1.00 0.00 ?  72  VAL A HG22 7  
ATOM 10967 H HG23 . VAL A 1 81  ? 32.391  71.500  64.370  1.00 0.00 ?  72  VAL A HG23 7  
ATOM 10968 N N    . GLY A 1 82  ? 34.417  69.766  60.443  1.00 0.00 ?  73  GLY A N    7  
ATOM 10969 C CA   . GLY A 1 82  ? 35.024  69.402  59.148  1.00 0.00 ?  73  GLY A CA   7  
ATOM 10970 C C    . GLY A 1 82  ? 34.908  67.940  58.824  1.00 0.00 ?  73  GLY A C    7  
ATOM 10971 O O    . GLY A 1 82  ? 35.146  67.660  57.661  1.00 0.00 ?  73  GLY A O    7  
ATOM 10972 H H    . GLY A 1 82  ? 35.009  70.241  61.108  1.00 0.00 ?  73  GLY A H    7  
ATOM 10973 H HA2  . GLY A 1 82  ? 34.550  70.050  58.411  1.00 0.00 ?  73  GLY A HA2  7  
ATOM 10974 H HA3  . GLY A 1 82  ? 36.051  69.761  59.216  1.00 0.00 ?  73  GLY A HA3  7  
ATOM 10975 N N    . SER A 1 83  ? 34.702  67.023  59.781  1.00 0.00 ?  74  SER A N    7  
ATOM 10976 C CA   . SER A 1 83  ? 34.508  65.529  59.645  1.00 0.00 ?  74  SER A CA   7  
ATOM 10977 C C    . SER A 1 83  ? 33.094  65.293  59.046  1.00 0.00 ?  74  SER A C    7  
ATOM 10978 O O    . SER A 1 83  ? 32.944  64.478  58.143  1.00 0.00 ?  74  SER A O    7  
ATOM 10979 C CB   . SER A 1 83  ? 34.723  64.703  60.905  1.00 0.00 ?  74  SER A CB   7  
ATOM 10980 O OG   . SER A 1 83  ? 36.039  65.001  61.320  1.00 0.00 ?  74  SER A OG   7  
ATOM 10981 H H    . SER A 1 83  ? 34.825  67.371  60.721  1.00 0.00 ?  74  SER A H    7  
ATOM 10982 H HA   . SER A 1 83  ? 35.233  65.150  58.926  1.00 0.00 ?  74  SER A HA   7  
ATOM 10983 H HB2  . SER A 1 83  ? 33.921  65.019  61.571  1.00 0.00 ?  74  SER A HB2  7  
ATOM 10984 H HB3  . SER A 1 83  ? 34.521  63.635  60.820  1.00 0.00 ?  74  SER A HB3  7  
ATOM 10985 H HG   . SER A 1 83  ? 36.114  65.951  61.429  1.00 0.00 ?  74  SER A HG   7  
ATOM 10986 N N    . LEU A 1 84  ? 32.139  66.103  59.532  1.00 0.00 ?  75  LEU A N    7  
ATOM 10987 C CA   . LEU A 1 84  ? 30.775  66.056  59.005  1.00 0.00 ?  75  LEU A CA   7  
ATOM 10988 C C    . LEU A 1 84  ? 30.594  66.497  57.521  1.00 0.00 ?  75  LEU A C    7  
ATOM 10989 O O    . LEU A 1 84  ? 29.758  65.983  56.716  1.00 0.00 ?  75  LEU A O    7  
ATOM 10990 C CB   . LEU A 1 84  ? 29.821  66.685  60.033  1.00 0.00 ?  75  LEU A CB   7  
ATOM 10991 C CG   . LEU A 1 84  ? 28.369  66.751  59.511  1.00 0.00 ?  75  LEU A CG   7  
ATOM 10992 C CD1  . LEU A 1 84  ? 27.670  65.387  59.361  1.00 0.00 ?  75  LEU A CD1  7  
ATOM 10993 C CD2  . LEU A 1 84  ? 27.644  67.462  60.668  1.00 0.00 ?  75  LEU A CD2  7  
ATOM 10994 H H    . LEU A 1 84  ? 32.415  66.763  60.244  1.00 0.00 ?  75  LEU A H    7  
ATOM 10995 H HA   . LEU A 1 84  ? 30.426  65.023  59.016  1.00 0.00 ?  75  LEU A HA   7  
ATOM 10996 H HB2  . LEU A 1 84  ? 30.015  66.213  60.997  1.00 0.00 ?  75  LEU A HB2  7  
ATOM 10997 H HB3  . LEU A 1 84  ? 30.261  67.680  60.092  1.00 0.00 ?  75  LEU A HB3  7  
ATOM 10998 H HG   . LEU A 1 84  ? 28.349  67.340  58.594  1.00 0.00 ?  75  LEU A HG   7  
ATOM 10999 H HD11 . LEU A 1 84  ? 27.933  64.814  60.251  1.00 0.00 ?  75  LEU A HD11 7  
ATOM 11000 H HD12 . LEU A 1 84  ? 26.581  65.428  59.388  1.00 0.00 ?  75  LEU A HD12 7  
ATOM 11001 H HD13 . LEU A 1 84  ? 28.086  64.825  58.525  1.00 0.00 ?  75  LEU A HD13 7  
ATOM 11002 H HD21 . LEU A 1 84  ? 26.606  67.677  60.413  1.00 0.00 ?  75  LEU A HD21 7  
ATOM 11003 H HD22 . LEU A 1 84  ? 27.511  66.884  61.583  1.00 0.00 ?  75  LEU A HD22 7  
ATOM 11004 H HD23 . LEU A 1 84  ? 28.159  68.392  60.910  1.00 0.00 ?  75  LEU A HD23 7  
ATOM 11005 N N    . ILE A 1 85  ? 31.373  67.428  57.091  1.00 0.00 ?  76  ILE A N    7  
ATOM 11006 C CA   . ILE A 1 85  ? 31.562  67.851  55.687  1.00 0.00 ?  76  ILE A CA   7  
ATOM 11007 C C    . ILE A 1 85  ? 32.222  66.683  54.956  1.00 0.00 ?  76  ILE A C    7  
ATOM 11008 O O    . ILE A 1 85  ? 31.718  66.196  53.932  1.00 0.00 ?  76  ILE A O    7  
ATOM 11009 C CB   . ILE A 1 85  ? 32.315  69.213  55.554  1.00 0.00 ?  76  ILE A CB   7  
ATOM 11010 C CG1  . ILE A 1 85  ? 31.507  70.363  56.207  1.00 0.00 ?  76  ILE A CG1  7  
ATOM 11011 C CG2  . ILE A 1 85  ? 32.779  69.629  54.249  1.00 0.00 ?  76  ILE A CG2  7  
ATOM 11012 C CD1  . ILE A 1 85  ? 32.313  71.631  56.479  1.00 0.00 ?  76  ILE A CD1  7  
ATOM 11013 H H    . ILE A 1 85  ? 31.961  67.914  57.753  1.00 0.00 ?  76  ILE A H    7  
ATOM 11014 H HA   . ILE A 1 85  ? 30.628  68.023  55.151  1.00 0.00 ?  76  ILE A HA   7  
ATOM 11015 H HB   . ILE A 1 85  ? 33.255  69.093  56.095  1.00 0.00 ?  76  ILE A HB   7  
ATOM 11016 H HG12 . ILE A 1 85  ? 30.610  70.561  55.620  1.00 0.00 ?  76  ILE A HG12 7  
ATOM 11017 H HG13 . ILE A 1 85  ? 31.261  70.050  57.221  1.00 0.00 ?  76  ILE A HG13 7  
ATOM 11018 H HG21 . ILE A 1 85  ? 31.955  70.049  53.672  1.00 0.00 ?  76  ILE A HG21 7  
ATOM 11019 H HG22 . ILE A 1 85  ? 33.429  70.501  54.321  1.00 0.00 ?  76  ILE A HG22 7  
ATOM 11020 H HG23 . ILE A 1 85  ? 33.362  68.922  53.659  1.00 0.00 ?  76  ILE A HG23 7  
ATOM 11021 H HD11 . ILE A 1 85  ? 33.239  71.319  56.962  1.00 0.00 ?  76  ILE A HD11 7  
ATOM 11022 H HD12 . ILE A 1 85  ? 32.673  72.085  55.555  1.00 0.00 ?  76  ILE A HD12 7  
ATOM 11023 H HD13 . ILE A 1 85  ? 31.894  72.363  57.169  1.00 0.00 ?  76  ILE A HD13 7  
ATOM 11024 N N    . LEU A 1 86  ? 33.287  66.054  55.466  1.00 0.00 ?  77  LEU A N    7  
ATOM 11025 C CA   . LEU A 1 86  ? 33.879  64.803  54.829  1.00 0.00 ?  77  LEU A CA   7  
ATOM 11026 C C    . LEU A 1 86  ? 32.879  63.675  54.916  1.00 0.00 ?  77  LEU A C    7  
ATOM 11027 O O    . LEU A 1 86  ? 32.867  62.894  53.992  1.00 0.00 ?  77  LEU A O    7  
ATOM 11028 C CB   . LEU A 1 86  ? 35.139  64.429  55.677  1.00 0.00 ?  77  LEU A CB   7  
ATOM 11029 C CG   . LEU A 1 86  ? 35.878  63.135  55.355  1.00 0.00 ?  77  LEU A CG   7  
ATOM 11030 C CD1  . LEU A 1 86  ? 36.487  63.179  53.975  1.00 0.00 ?  77  LEU A CD1  7  
ATOM 11031 C CD2  . LEU A 1 86  ? 37.060  62.971  56.335  1.00 0.00 ?  77  LEU A CD2  7  
ATOM 11032 H H    . LEU A 1 86  ? 33.679  66.476  56.295  1.00 0.00 ?  77  LEU A H    7  
ATOM 11033 H HA   . LEU A 1 86  ? 34.153  65.154  53.833  1.00 0.00 ?  77  LEU A HA   7  
ATOM 11034 H HB2  . LEU A 1 86  ? 35.829  65.272  55.620  1.00 0.00 ?  77  LEU A HB2  7  
ATOM 11035 H HB3  . LEU A 1 86  ? 34.891  64.280  56.728  1.00 0.00 ?  77  LEU A HB3  7  
ATOM 11036 H HG   . LEU A 1 86  ? 35.210  62.282  55.467  1.00 0.00 ?  77  LEU A HG   7  
ATOM 11037 H HD11 . LEU A 1 86  ? 37.015  64.131  53.918  1.00 0.00 ?  77  LEU A HD11 7  
ATOM 11038 H HD12 . LEU A 1 86  ? 37.117  62.312  53.774  1.00 0.00 ?  77  LEU A HD12 7  
ATOM 11039 H HD13 . LEU A 1 86  ? 35.670  63.051  53.266  1.00 0.00 ?  77  LEU A HD13 7  
ATOM 11040 H HD21 . LEU A 1 86  ? 36.670  62.902  57.351  1.00 0.00 ?  77  LEU A HD21 7  
ATOM 11041 H HD22 . LEU A 1 86  ? 37.636  62.082  56.083  1.00 0.00 ?  77  LEU A HD22 7  
ATOM 11042 H HD23 . LEU A 1 86  ? 37.713  63.843  56.320  1.00 0.00 ?  77  LEU A HD23 7  
ATOM 11043 N N    . GLY A 1 87  ? 31.975  63.697  55.828  1.00 0.00 ?  78  GLY A N    7  
ATOM 11044 C CA   . GLY A 1 87  ? 30.926  62.787  56.021  1.00 0.00 ?  78  GLY A CA   7  
ATOM 11045 C C    . GLY A 1 87  ? 29.872  63.007  54.935  1.00 0.00 ?  78  GLY A C    7  
ATOM 11046 O O    . GLY A 1 87  ? 29.457  62.020  54.380  1.00 0.00 ?  78  GLY A O    7  
ATOM 11047 H H    . GLY A 1 87  ? 32.252  64.286  56.599  1.00 0.00 ?  78  GLY A H    7  
ATOM 11048 H HA2  . GLY A 1 87  ? 31.293  61.766  55.913  1.00 0.00 ?  78  GLY A HA2  7  
ATOM 11049 H HA3  . GLY A 1 87  ? 30.590  63.047  57.025  1.00 0.00 ?  78  GLY A HA3  7  
ATOM 11050 N N    . TYR A 1 88  ? 29.439  64.203  54.531  1.00 0.00 ?  79  TYR A N    7  
ATOM 11051 C CA   . TYR A 1 88  ? 28.671  64.429  53.319  1.00 0.00 ?  79  TYR A CA   7  
ATOM 11052 C C    . TYR A 1 88  ? 29.285  63.785  52.040  1.00 0.00 ?  79  TYR A C    7  
ATOM 11053 O O    . TYR A 1 88  ? 28.528  63.077  51.324  1.00 0.00 ?  79  TYR A O    7  
ATOM 11054 C CB   . TYR A 1 88  ? 28.346  65.918  53.149  1.00 0.00 ?  79  TYR A CB   7  
ATOM 11055 C CG   . TYR A 1 88  ? 27.659  66.325  51.901  1.00 0.00 ?  79  TYR A CG   7  
ATOM 11056 C CD1  . TYR A 1 88  ? 26.273  66.341  51.799  1.00 0.00 ?  79  TYR A CD1  7  
ATOM 11057 C CD2  . TYR A 1 88  ? 28.387  66.428  50.700  1.00 0.00 ?  79  TYR A CD2  7  
ATOM 11058 C CE1  . TYR A 1 88  ? 25.601  66.583  50.590  1.00 0.00 ?  79  TYR A CE1  7  
ATOM 11059 C CE2  . TYR A 1 88  ? 27.734  66.636  49.462  1.00 0.00 ?  79  TYR A CE2  7  
ATOM 11060 C CZ   . TYR A 1 88  ? 26.321  66.708  49.423  1.00 0.00 ?  79  TYR A CZ   7  
ATOM 11061 O OH   . TYR A 1 88  ? 25.740  66.929  48.240  1.00 0.00 ?  79  TYR A OH   7  
ATOM 11062 H H    . TYR A 1 88  ? 29.975  64.996  54.852  1.00 0.00 ?  79  TYR A H    7  
ATOM 11063 H HA   . TYR A 1 88  ? 27.756  63.854  53.463  1.00 0.00 ?  79  TYR A HA   7  
ATOM 11064 H HB2  . TYR A 1 88  ? 27.889  66.363  54.033  1.00 0.00 ?  79  TYR A HB2  7  
ATOM 11065 H HB3  . TYR A 1 88  ? 29.314  66.417  53.106  1.00 0.00 ?  79  TYR A HB3  7  
ATOM 11066 H HD1  . TYR A 1 88  ? 25.639  66.332  52.673  1.00 0.00 ?  79  TYR A HD1  7  
ATOM 11067 H HD2  . TYR A 1 88  ? 29.460  66.331  50.773  1.00 0.00 ?  79  TYR A HD2  7  
ATOM 11068 H HE1  . TYR A 1 88  ? 24.521  66.604  50.574  1.00 0.00 ?  79  TYR A HE1  7  
ATOM 11069 H HE2  . TYR A 1 88  ? 28.363  66.668  48.584  1.00 0.00 ?  79  TYR A HE2  7  
ATOM 11070 H HH   . TYR A 1 88  ? 24.806  66.715  48.196  1.00 0.00 ?  79  TYR A HH   7  
ATOM 11071 N N    . THR A 1 89  ? 30.551  63.791  51.750  1.00 0.00 ?  80  THR A N    7  
ATOM 11072 C CA   . THR A 1 89  ? 31.326  63.164  50.670  1.00 0.00 ?  80  THR A CA   7  
ATOM 11073 C C    . THR A 1 89  ? 31.457  61.608  50.862  1.00 0.00 ?  80  THR A C    7  
ATOM 11074 O O    . THR A 1 89  ? 31.728  60.930  49.880  1.00 0.00 ?  80  THR A O    7  
ATOM 11075 C CB   . THR A 1 89  ? 32.745  63.746  50.256  1.00 0.00 ?  80  THR A CB   7  
ATOM 11076 O OG1  . THR A 1 89  ? 32.826  65.109  50.578  1.00 0.00 ?  80  THR A OG1  7  
ATOM 11077 C CG2  . THR A 1 89  ? 33.052  63.552  48.779  1.00 0.00 ?  80  THR A CG2  7  
ATOM 11078 H H    . THR A 1 89  ? 31.100  64.454  52.278  1.00 0.00 ?  80  THR A H    7  
ATOM 11079 H HA   . THR A 1 89  ? 30.699  63.320  49.791  1.00 0.00 ?  80  THR A HA   7  
ATOM 11080 H HB   . THR A 1 89  ? 33.494  63.261  50.883  1.00 0.00 ?  80  THR A HB   7  
ATOM 11081 H HG1  . THR A 1 89  ? 33.752  65.262  50.783  1.00 0.00 ?  80  THR A HG1  7  
ATOM 11082 H HG21 . THR A 1 89  ? 33.099  62.497  48.508  1.00 0.00 ?  80  THR A HG21 7  
ATOM 11083 H HG22 . THR A 1 89  ? 32.176  64.005  48.314  1.00 0.00 ?  80  THR A HG22 7  
ATOM 11084 H HG23 . THR A 1 89  ? 33.925  64.149  48.520  1.00 0.00 ?  80  THR A HG23 7  
ATOM 11085 N N    . ARG A 1 90  ? 31.431  61.047  52.087  1.00 0.00 ?  81  ARG A N    7  
ATOM 11086 C CA   . ARG A 1 90  ? 31.872  59.645  52.354  1.00 0.00 ?  81  ARG A CA   7  
ATOM 11087 C C    . ARG A 1 90  ? 30.957  58.795  53.291  1.00 0.00 ?  81  ARG A C    7  
ATOM 11088 O O    . ARG A 1 90  ? 30.583  57.763  52.910  1.00 0.00 ?  81  ARG A O    7  
ATOM 11089 C CB   . ARG A 1 90  ? 33.252  59.648  52.851  1.00 0.00 ?  81  ARG A CB   7  
ATOM 11090 C CG   . ARG A 1 90  ? 34.266  60.147  51.788  1.00 0.00 ?  81  ARG A CG   7  
ATOM 11091 C CD   . ARG A 1 90  ? 35.678  59.982  52.400  1.00 0.00 ?  81  ARG A CD   7  
ATOM 11092 N NE   . ARG A 1 90  ? 36.657  60.459  51.399  1.00 0.00 ?  81  ARG A NE   7  
ATOM 11093 C CZ   . ARG A 1 90  ? 37.312  59.763  50.543  1.00 0.00 ?  81  ARG A CZ   7  
ATOM 11094 N NH1  . ARG A 1 90  ? 37.215  58.489  50.296  1.00 0.00 ?  81  ARG A NH1  7  
ATOM 11095 N NH2  . ARG A 1 90  ? 38.307  60.366  49.892  1.00 0.00 1  81  ARG A NH2  7  
ATOM 11096 H H    . ARG A 1 90  ? 31.384  61.687  52.867  1.00 0.00 ?  81  ARG A H    7  
ATOM 11097 H HA   . ARG A 1 90  ? 31.893  59.068  51.429  1.00 0.00 ?  81  ARG A HA   7  
ATOM 11098 H HB2  . ARG A 1 90  ? 33.367  60.156  53.809  1.00 0.00 ?  81  ARG A HB2  7  
ATOM 11099 H HB3  . ARG A 1 90  ? 33.522  58.621  53.102  1.00 0.00 ?  81  ARG A HB3  7  
ATOM 11100 H HG2  . ARG A 1 90  ? 34.101  59.639  50.837  1.00 0.00 ?  81  ARG A HG2  7  
ATOM 11101 H HG3  . ARG A 1 90  ? 34.111  61.224  51.715  1.00 0.00 ?  81  ARG A HG3  7  
ATOM 11102 H HD2  . ARG A 1 90  ? 35.736  60.510  53.351  1.00 0.00 ?  81  ARG A HD2  7  
ATOM 11103 H HD3  . ARG A 1 90  ? 35.801  58.916  52.591  1.00 0.00 ?  81  ARG A HD3  7  
ATOM 11104 H HE   . ARG A 1 90  ? 36.943  61.426  51.363  1.00 0.00 ?  81  ARG A HE   7  
ATOM 11105 H HH11 . ARG A 1 90  ? 36.404  57.995  50.640  1.00 0.00 ?  81  ARG A HH11 7  
ATOM 11106 H HH12 . ARG A 1 90  ? 38.064  57.981  50.094  1.00 0.00 ?  81  ARG A HH12 7  
ATOM 11107 H HH21 . ARG A 1 90  ? 38.374  61.373  49.865  1.00 0.00 ?  81  ARG A HH21 7  
ATOM 11108 H HH22 . ARG A 1 90  ? 38.817  59.836  49.199  1.00 0.00 ?  81  ARG A HH22 7  
ATOM 11109 N N    . SER A 1 91  ? 30.587  59.293  54.511  1.00 0.00 ?  82  SER A N    7  
ATOM 11110 C CA   . SER A 1 91  ? 29.737  58.519  55.350  1.00 0.00 ?  82  SER A CA   7  
ATOM 11111 C C    . SER A 1 91  ? 28.301  58.442  54.730  1.00 0.00 ?  82  SER A C    7  
ATOM 11112 O O    . SER A 1 91  ? 27.722  57.314  54.833  1.00 0.00 ?  82  SER A O    7  
ATOM 11113 C CB   . SER A 1 91  ? 29.758  59.172  56.727  1.00 0.00 ?  82  SER A CB   7  
ATOM 11114 O OG   . SER A 1 91  ? 30.997  59.193  57.371  1.00 0.00 ?  82  SER A OG   7  
ATOM 11115 H H    . SER A 1 91  ? 30.879  60.212  54.814  1.00 0.00 ?  82  SER A H    7  
ATOM 11116 H HA   . SER A 1 91  ? 30.067  57.483  55.420  1.00 0.00 ?  82  SER A HA   7  
ATOM 11117 H HB2  . SER A 1 91  ? 29.331  60.174  56.677  1.00 0.00 ?  82  SER A HB2  7  
ATOM 11118 H HB3  . SER A 1 91  ? 29.137  58.522  57.343  1.00 0.00 ?  82  SER A HB3  7  
ATOM 11119 H HG   . SER A 1 91  ? 31.378  58.314  57.307  1.00 0.00 ?  82  SER A HG   7  
ATOM 11120 N N    . ARG A 1 92  ? 27.747  59.486  54.076  1.00 0.00 ?  83  ARG A N    7  
ATOM 11121 C CA   . ARG A 1 92  ? 26.472  59.392  53.294  1.00 0.00 ?  83  ARG A CA   7  
ATOM 11122 C C    . ARG A 1 92  ? 26.743  58.263  52.335  1.00 0.00 ?  83  ARG A C    7  
ATOM 11123 O O    . ARG A 1 92  ? 27.747  58.237  51.655  1.00 0.00 ?  83  ARG A O    7  
ATOM 11124 C CB   . ARG A 1 92  ? 26.248  60.741  52.591  1.00 0.00 ?  83  ARG A CB   7  
ATOM 11125 C CG   . ARG A 1 92  ? 24.829  60.788  52.005  1.00 0.00 ?  83  ARG A CG   7  
ATOM 11126 C CD   . ARG A 1 92  ? 24.691  62.141  51.296  1.00 0.00 ?  83  ARG A CD   7  
ATOM 11127 N NE   . ARG A 1 92  ? 23.349  62.407  50.712  1.00 0.00 ?  83  ARG A NE   7  
ATOM 11128 C CZ   . ARG A 1 92  ? 23.162  63.177  49.689  1.00 0.00 ?  83  ARG A CZ   7  
ATOM 11129 N NH1  . ARG A 1 92  ? 24.145  63.517  48.851  1.00 0.00 ?  83  ARG A NH1  7  
ATOM 11130 N NH2  . ARG A 1 92  ? 21.932  63.531  49.454  1.00 0.00 1  83  ARG A NH2  7  
ATOM 11131 H H    . ARG A 1 92  ? 28.212  60.377  53.973  1.00 0.00 ?  83  ARG A H    7  
ATOM 11132 H HA   . ARG A 1 92  ? 25.680  59.058  53.964  1.00 0.00 ?  83  ARG A HA   7  
ATOM 11133 H HB2  . ARG A 1 92  ? 26.454  61.513  53.332  1.00 0.00 ?  83  ARG A HB2  7  
ATOM 11134 H HB3  . ARG A 1 92  ? 26.954  60.737  51.761  1.00 0.00 ?  83  ARG A HB3  7  
ATOM 11135 H HG2  . ARG A 1 92  ? 24.682  60.025  51.241  1.00 0.00 ?  83  ARG A HG2  7  
ATOM 11136 H HG3  . ARG A 1 92  ? 24.094  60.712  52.808  1.00 0.00 ?  83  ARG A HG3  7  
ATOM 11137 H HD2  . ARG A 1 92  ? 25.053  62.904  51.985  1.00 0.00 ?  83  ARG A HD2  7  
ATOM 11138 H HD3  . ARG A 1 92  ? 25.470  62.078  50.536  1.00 0.00 ?  83  ARG A HD3  7  
ATOM 11139 H HE   . ARG A 1 92  ? 22.542  62.181  51.275  1.00 0.00 ?  83  ARG A HE   7  
ATOM 11140 H HH11 . ARG A 1 92  ? 25.060  63.221  49.157  1.00 0.00 ?  83  ARG A HH11 7  
ATOM 11141 H HH12 . ARG A 1 92  ? 24.048  64.323  48.249  1.00 0.00 ?  83  ARG A HH12 7  
ATOM 11142 H HH21 . ARG A 1 92  ? 21.240  63.126  50.068  1.00 0.00 ?  83  ARG A HH21 7  
ATOM 11143 H HH22 . ARG A 1 92  ? 21.634  64.103  48.677  1.00 0.00 ?  83  ARG A HH22 7  
ATOM 11144 N N    . LYS A 1 93  ? 25.793  57.353  52.079  1.00 0.00 ?  84  LYS A N    7  
ATOM 11145 C CA   . LYS A 1 93  ? 25.802  56.215  51.096  1.00 0.00 ?  84  LYS A CA   7  
ATOM 11146 C C    . LYS A 1 93  ? 25.704  56.666  49.626  1.00 0.00 ?  84  LYS A C    7  
ATOM 11147 O O    . LYS A 1 93  ? 25.863  55.807  48.746  1.00 0.00 ?  84  LYS A O    7  
ATOM 11148 C CB   . LYS A 1 93  ? 24.628  55.182  51.351  1.00 0.00 ?  84  LYS A CB   7  
ATOM 11149 C CG   . LYS A 1 93  ? 24.573  54.391  52.679  1.00 0.00 ?  84  LYS A CG   7  
ATOM 11150 C CD   . LYS A 1 93  ? 25.814  53.543  52.923  1.00 0.00 ?  84  LYS A CD   7  
ATOM 11151 C CE   . LYS A 1 93  ? 26.101  52.297  52.053  1.00 0.00 ?  84  LYS A CE   7  
ATOM 11152 N NZ   . LYS A 1 93  ? 25.118  51.226  52.241  1.00 0.00 1  84  LYS A NZ   7  
ATOM 11153 H H    . LYS A 1 93  ? 24.962  57.494  52.635  1.00 0.00 ?  84  LYS A H    7  
ATOM 11154 H HA   . LYS A 1 93  ? 26.786  55.772  51.249  1.00 0.00 ?  84  LYS A HA   7  
ATOM 11155 H HB2  . LYS A 1 93  ? 23.736  55.803  51.266  1.00 0.00 ?  84  LYS A HB2  7  
ATOM 11156 H HB3  . LYS A 1 93  ? 24.678  54.502  50.501  1.00 0.00 ?  84  LYS A HB3  7  
ATOM 11157 H HG2  . LYS A 1 93  ? 24.504  55.055  53.542  1.00 0.00 ?  84  LYS A HG2  7  
ATOM 11158 H HG3  . LYS A 1 93  ? 23.658  53.803  52.742  1.00 0.00 ?  84  LYS A HG3  7  
ATOM 11159 H HD2  . LYS A 1 93  ? 26.592  54.305  52.865  1.00 0.00 ?  84  LYS A HD2  7  
ATOM 11160 H HD3  . LYS A 1 93  ? 25.807  53.220  53.964  1.00 0.00 ?  84  LYS A HD3  7  
ATOM 11161 H HE2  . LYS A 1 93  ? 26.047  52.589  51.004  1.00 0.00 ?  84  LYS A HE2  7  
ATOM 11162 H HE3  . LYS A 1 93  ? 27.135  52.018  52.255  1.00 0.00 ?  84  LYS A HE3  7  
ATOM 11163 H HZ1  . LYS A 1 93  ? 25.418  50.323  51.903  1.00 0.00 ?  84  LYS A HZ1  7  
ATOM 11164 H HZ2  . LYS A 1 93  ? 24.900  51.182  53.227  1.00 0.00 ?  84  LYS A HZ2  7  
ATOM 11165 H HZ3  . LYS A 1 93  ? 24.172  51.364  51.915  1.00 0.00 ?  84  LYS A HZ3  7  
ATOM 11166 N N    . VAL A 1 94  ? 25.556  57.923  49.328  1.00 0.00 ?  85  VAL A N    7  
ATOM 11167 C CA   . VAL A 1 94  ? 25.660  58.548  48.007  1.00 0.00 ?  85  VAL A CA   7  
ATOM 11168 C C    . VAL A 1 94  ? 26.516  59.785  47.986  1.00 0.00 ?  85  VAL A C    7  
ATOM 11169 O O    . VAL A 1 94  ? 26.771  60.370  49.040  1.00 0.00 ?  85  VAL A O    7  
ATOM 11170 C CB   . VAL A 1 94  ? 24.265  58.736  47.339  1.00 0.00 ?  85  VAL A CB   7  
ATOM 11171 C CG1  . VAL A 1 94  ? 23.264  57.660  47.483  1.00 0.00 ?  85  VAL A CG1  7  
ATOM 11172 C CG2  . VAL A 1 94  ? 23.621  60.111  47.576  1.00 0.00 ?  85  VAL A CG2  7  
ATOM 11173 H H    . VAL A 1 94  ? 25.481  58.518  50.141  1.00 0.00 ?  85  VAL A H    7  
ATOM 11174 H HA   . VAL A 1 94  ? 26.209  57.891  47.333  1.00 0.00 ?  85  VAL A HA   7  
ATOM 11175 H HB   . VAL A 1 94  ? 24.660  58.789  46.324  1.00 0.00 ?  85  VAL A HB   7  
ATOM 11176 H HG11 . VAL A 1 94  ? 22.863  57.628  48.496  1.00 0.00 ?  85  VAL A HG11 7  
ATOM 11177 H HG12 . VAL A 1 94  ? 22.406  57.921  46.863  1.00 0.00 ?  85  VAL A HG12 7  
ATOM 11178 H HG13 . VAL A 1 94  ? 23.599  56.667  47.186  1.00 0.00 ?  85  VAL A HG13 7  
ATOM 11179 H HG21 . VAL A 1 94  ? 22.650  60.239  47.098  1.00 0.00 ?  85  VAL A HG21 7  
ATOM 11180 H HG22 . VAL A 1 94  ? 23.464  60.195  48.651  1.00 0.00 ?  85  VAL A HG22 7  
ATOM 11181 H HG23 . VAL A 1 94  ? 24.209  60.940  47.181  1.00 0.00 ?  85  VAL A HG23 7  
ATOM 11182 N N    . ASP A 1 95  ? 27.106  60.092  46.834  1.00 0.00 ?  86  ASP A N    7  
ATOM 11183 C CA   . ASP A 1 95  ? 28.124  61.189  46.660  1.00 0.00 ?  86  ASP A CA   7  
ATOM 11184 C C    . ASP A 1 95  ? 28.065  61.737  45.244  1.00 0.00 ?  86  ASP A C    7  
ATOM 11185 O O    . ASP A 1 95  ? 27.425  61.214  44.379  1.00 0.00 ?  86  ASP A O    7  
ATOM 11186 C CB   . ASP A 1 95  ? 29.525  60.661  47.045  1.00 0.00 ?  86  ASP A CB   7  
ATOM 11187 C CG   . ASP A 1 95  ? 30.178  59.938  45.861  1.00 0.00 ?  86  ASP A CG   7  
ATOM 11188 O OD1  . ASP A 1 95  ? 30.753  60.576  44.951  1.00 0.00 ?  86  ASP A OD1  7  
ATOM 11189 O OD2  . ASP A 1 95  ? 30.250  58.710  45.887  1.00 0.00 -1 86  ASP A OD2  7  
ATOM 11190 H H    . ASP A 1 95  ? 26.743  59.615  46.021  1.00 0.00 ?  86  ASP A H    7  
ATOM 11191 H HA   . ASP A 1 95  ? 27.926  61.961  47.404  1.00 0.00 ?  86  ASP A HA   7  
ATOM 11192 H HB2  . ASP A 1 95  ? 30.154  61.521  47.275  1.00 0.00 ?  86  ASP A HB2  7  
ATOM 11193 H HB3  . ASP A 1 95  ? 29.592  60.042  47.940  1.00 0.00 ?  86  ASP A HB3  7  
ATOM 11194 N N    . LYS A 1 96  ? 28.773  62.934  45.043  1.00 0.00 ?  87  LYS A N    7  
ATOM 11195 C CA   . LYS A 1 96  ? 29.142  63.482  43.775  1.00 0.00 ?  87  LYS A CA   7  
ATOM 11196 C C    . LYS A 1 96  ? 30.583  63.946  43.820  1.00 0.00 ?  87  LYS A C    7  
ATOM 11197 O O    . LYS A 1 96  ? 30.781  65.143  43.813  1.00 0.00 ?  87  LYS A O    7  
ATOM 11198 C CB   . LYS A 1 96  ? 28.159  64.597  43.279  1.00 0.00 ?  87  LYS A CB   7  
ATOM 11199 C CG   . LYS A 1 96  ? 28.548  65.171  41.844  1.00 0.00 ?  87  LYS A CG   7  
ATOM 11200 C CD   . LYS A 1 96  ? 28.336  64.007  40.715  1.00 0.00 ?  87  LYS A CD   7  
ATOM 11201 C CE   . LYS A 1 96  ? 28.520  64.554  39.250  1.00 0.00 ?  87  LYS A CE   7  
ATOM 11202 N NZ   . LYS A 1 96  ? 30.002  64.741  38.958  1.00 0.00 1  87  LYS A NZ   7  
ATOM 11203 H H    . LYS A 1 96  ? 28.995  63.518  45.836  1.00 0.00 ?  87  LYS A H    7  
ATOM 11204 H HA   . LYS A 1 96  ? 29.044  62.674  43.049  1.00 0.00 ?  87  LYS A HA   7  
ATOM 11205 H HB2  . LYS A 1 96  ? 27.115  64.283  43.253  1.00 0.00 ?  87  LYS A HB2  7  
ATOM 11206 H HB3  . LYS A 1 96  ? 28.155  65.428  43.984  1.00 0.00 ?  87  LYS A HB3  7  
ATOM 11207 H HG2  . LYS A 1 96  ? 27.892  65.984  41.529  1.00 0.00 ?  87  LYS A HG2  7  
ATOM 11208 H HG3  . LYS A 1 96  ? 29.565  65.550  41.743  1.00 0.00 ?  87  LYS A HG3  7  
ATOM 11209 H HD2  . LYS A 1 96  ? 29.074  63.214  40.840  1.00 0.00 ?  87  LYS A HD2  7  
ATOM 11210 H HD3  . LYS A 1 96  ? 27.343  63.561  40.763  1.00 0.00 ?  87  LYS A HD3  7  
ATOM 11211 H HE2  . LYS A 1 96  ? 28.149  63.791  38.565  1.00 0.00 ?  87  LYS A HE2  7  
ATOM 11212 H HE3  . LYS A 1 96  ? 27.985  65.476  39.023  1.00 0.00 ?  87  LYS A HE3  7  
ATOM 11213 H HZ1  . LYS A 1 96  ? 30.155  64.727  37.960  1.00 0.00 ?  87  LYS A HZ1  7  
ATOM 11214 H HZ2  . LYS A 1 96  ? 30.294  65.616  39.370  1.00 0.00 ?  87  LYS A HZ2  7  
ATOM 11215 H HZ3  . LYS A 1 96  ? 30.729  64.110  39.264  1.00 0.00 ?  87  LYS A HZ3  7  
ATOM 11216 N N    . ARG A 1 97  ? 31.519  63.040  43.879  1.00 0.00 ?  88  ARG A N    7  
ATOM 11217 C CA   . ARG A 1 97  ? 32.931  63.237  44.299  1.00 0.00 ?  88  ARG A CA   7  
ATOM 11218 C C    . ARG A 1 97  ? 33.664  64.183  43.364  1.00 0.00 ?  88  ARG A C    7  
ATOM 11219 O O    . ARG A 1 97  ? 34.188  65.206  43.854  1.00 0.00 ?  88  ARG A O    7  
ATOM 11220 C CB   . ARG A 1 97  ? 33.673  61.908  44.530  1.00 0.00 ?  88  ARG A CB   7  
ATOM 11221 C CG   . ARG A 1 97  ? 35.193  62.011  44.778  1.00 0.00 ?  88  ARG A CG   7  
ATOM 11222 C CD   . ARG A 1 97  ? 35.938  60.717  44.905  1.00 0.00 ?  88  ARG A CD   7  
ATOM 11223 N NE   . ARG A 1 97  ? 37.330  60.958  45.324  1.00 0.00 ?  88  ARG A NE   7  
ATOM 11224 C CZ   . ARG A 1 97  ? 38.175  60.096  45.929  1.00 0.00 ?  88  ARG A CZ   7  
ATOM 11225 N NH1  . ARG A 1 97  ? 37.699  58.981  46.452  1.00 0.00 ?  88  ARG A NH1  7  
ATOM 11226 N NH2  . ARG A 1 97  ? 39.381  60.430  46.271  1.00 0.00 1  88  ARG A NH2  7  
ATOM 11227 H H    . ARG A 1 97  ? 31.104  62.146  43.663  1.00 0.00 ?  88  ARG A H    7  
ATOM 11228 H HA   . ARG A 1 97  ? 32.851  63.637  45.309  1.00 0.00 ?  88  ARG A HA   7  
ATOM 11229 H HB2  . ARG A 1 97  ? 33.227  61.336  45.345  1.00 0.00 ?  88  ARG A HB2  7  
ATOM 11230 H HB3  . ARG A 1 97  ? 33.541  61.282  43.648  1.00 0.00 ?  88  ARG A HB3  7  
ATOM 11231 H HG2  . ARG A 1 97  ? 35.633  62.532  43.927  1.00 0.00 ?  88  ARG A HG2  7  
ATOM 11232 H HG3  . ARG A 1 97  ? 35.345  62.643  45.652  1.00 0.00 ?  88  ARG A HG3  7  
ATOM 11233 H HD2  . ARG A 1 97  ? 35.488  60.103  45.685  1.00 0.00 ?  88  ARG A HD2  7  
ATOM 11234 H HD3  . ARG A 1 97  ? 35.829  60.082  44.026  1.00 0.00 ?  88  ARG A HD3  7  
ATOM 11235 H HE   . ARG A 1 97  ? 37.733  61.852  45.083  1.00 0.00 ?  88  ARG A HE   7  
ATOM 11236 H HH11 . ARG A 1 97  ? 36.827  58.546  46.190  1.00 0.00 ?  88  ARG A HH11 7  
ATOM 11237 H HH12 . ARG A 1 97  ? 38.272  58.488  47.122  1.00 0.00 ?  88  ARG A HH12 7  
ATOM 11238 H HH21 . ARG A 1 97  ? 39.786  61.281  45.905  1.00 0.00 ?  88  ARG A HH21 7  
ATOM 11239 H HH22 . ARG A 1 97  ? 39.902  59.906  46.958  1.00 0.00 ?  88  ARG A HH22 7  
ATOM 11240 N N    . SER A 1 98  ? 33.705  63.853  42.049  1.00 0.00 ?  89  SER A N    7  
ATOM 11241 C CA   . SER A 1 98  ? 34.093  64.767  40.976  1.00 0.00 ?  89  SER A CA   7  
ATOM 11242 C C    . SER A 1 98  ? 33.031  65.848  40.719  1.00 0.00 ?  89  SER A C    7  
ATOM 11243 O O    . SER A 1 98  ? 31.853  65.534  40.650  1.00 0.00 ?  89  SER A O    7  
ATOM 11244 C CB   . SER A 1 98  ? 34.560  64.060  39.770  1.00 0.00 ?  89  SER A CB   7  
ATOM 11245 O OG   . SER A 1 98  ? 35.311  64.838  38.845  1.00 0.00 ?  89  SER A OG   7  
ATOM 11246 H H    . SER A 1 98  ? 33.150  63.112  41.645  1.00 0.00 ?  89  SER A H    7  
ATOM 11247 H HA   . SER A 1 98  ? 34.913  65.381  41.346  1.00 0.00 ?  89  SER A HA   7  
ATOM 11248 H HB2  . SER A 1 98  ? 35.079  63.122  39.972  1.00 0.00 ?  89  SER A HB2  7  
ATOM 11249 H HB3  . SER A 1 98  ? 33.690  63.693  39.226  1.00 0.00 ?  89  SER A HB3  7  
ATOM 11250 H HG   . SER A 1 98  ? 36.247  64.795  39.051  1.00 0.00 ?  89  SER A HG   7  
ATOM 11251 N N    . ASP A 1 99  ? 33.548  67.039  40.503  1.00 0.00 ?  90  ASP A N    7  
ATOM 11252 C CA   . ASP A 1 99  ? 32.948  68.064  39.591  1.00 0.00 ?  90  ASP A CA   7  
ATOM 11253 C C    . ASP A 1 99  ? 33.917  69.006  38.722  1.00 0.00 ?  90  ASP A C    7  
ATOM 11254 O O    . ASP A 1 99  ? 35.095  69.190  39.066  1.00 0.00 ?  90  ASP A O    7  
ATOM 11255 C CB   . ASP A 1 99  ? 31.864  68.848  40.362  1.00 0.00 ?  90  ASP A CB   7  
ATOM 11256 C CG   . ASP A 1 99  ? 30.500  68.213  40.300  1.00 0.00 ?  90  ASP A CG   7  
ATOM 11257 O OD1  . ASP A 1 99  ? 30.083  67.503  39.369  1.00 0.00 ?  90  ASP A OD1  7  
ATOM 11258 O OD2  . ASP A 1 99  ? 29.756  68.548  41.252  1.00 0.00 -1 90  ASP A OD2  7  
ATOM 11259 H H    . ASP A 1 99  ? 34.552  67.104  40.577  1.00 0.00 ?  90  ASP A H    7  
ATOM 11260 H HA   . ASP A 1 99  ? 32.430  67.462  38.845  1.00 0.00 ?  90  ASP A HA   7  
ATOM 11261 H HB2  . ASP A 1 99  ? 32.221  69.155  41.344  1.00 0.00 ?  90  ASP A HB2  7  
ATOM 11262 H HB3  . ASP A 1 99  ? 31.780  69.752  39.759  1.00 0.00 ?  90  ASP A HB3  7  
ATOM 11263 N N    . PRO A 1 100 ? 33.456  69.581  37.611  1.00 0.00 ?  91  PRO A N    7  
ATOM 11264 C CA   . PRO A 1 100 ? 34.326  70.372  36.655  1.00 0.00 ?  91  PRO A CA   7  
ATOM 11265 C C    . PRO A 1 100 ? 35.079  71.543  37.267  1.00 0.00 ?  91  PRO A C    7  
ATOM 11266 O O    . PRO A 1 100 ? 36.210  71.845  36.832  1.00 0.00 ?  91  PRO A O    7  
ATOM 11267 C CB   . PRO A 1 100 ? 33.512  70.889  35.478  1.00 0.00 ?  91  PRO A CB   7  
ATOM 11268 C CG   . PRO A 1 100 ? 32.133  70.830  36.107  1.00 0.00 ?  91  PRO A CG   7  
ATOM 11269 C CD   . PRO A 1 100 ? 32.118  69.639  37.082  1.00 0.00 ?  91  PRO A CD   7  
ATOM 11270 H HA   . PRO A 1 100 ? 35.100  69.675  36.334  1.00 0.00 ?  91  PRO A HA   7  
ATOM 11271 H HB2  . PRO A 1 100 ? 33.830  71.862  35.102  1.00 0.00 ?  91  PRO A HB2  7  
ATOM 11272 H HB3  . PRO A 1 100 ? 33.460  70.145  34.684  1.00 0.00 ?  91  PRO A HB3  7  
ATOM 11273 H HG2  . PRO A 1 100 ? 32.039  71.763  36.662  1.00 0.00 ?  91  PRO A HG2  7  
ATOM 11274 H HG3  . PRO A 1 100 ? 31.370  70.732  35.335  1.00 0.00 ?  91  PRO A HG3  7  
ATOM 11275 H HD2  . PRO A 1 100 ? 31.350  69.855  37.823  1.00 0.00 ?  91  PRO A HD2  7  
ATOM 11276 H HD3  . PRO A 1 100 ? 31.945  68.725  36.514  1.00 0.00 ?  91  PRO A HD3  7  
ATOM 11277 N N    . TYR A 1 101 ? 34.507  72.128  38.301  1.00 0.00 ?  92  TYR A N    7  
ATOM 11278 C CA   . TYR A 1 101 ? 35.123  73.150  39.166  1.00 0.00 ?  92  TYR A CA   7  
ATOM 11279 C C    . TYR A 1 101 ? 36.334  72.729  39.869  1.00 0.00 ?  92  TYR A C    7  
ATOM 11280 O O    . TYR A 1 101 ? 37.024  73.541  40.410  1.00 0.00 ?  92  TYR A O    7  
ATOM 11281 C CB   . TYR A 1 101 ? 34.089  73.852  40.007  1.00 0.00 ?  92  TYR A CB   7  
ATOM 11282 C CG   . TYR A 1 101 ? 33.058  73.028  40.777  1.00 0.00 ?  92  TYR A CG   7  
ATOM 11283 C CD1  . TYR A 1 101 ? 31.843  72.692  40.138  1.00 0.00 ?  92  TYR A CD1  7  
ATOM 11284 C CD2  . TYR A 1 101 ? 33.286  72.544  42.070  1.00 0.00 ?  92  TYR A CD2  7  
ATOM 11285 C CE1  . TYR A 1 101 ? 30.928  71.873  40.798  1.00 0.00 ?  92  TYR A CE1  7  
ATOM 11286 C CE2  . TYR A 1 101 ? 32.336  71.732  42.758  1.00 0.00 ?  92  TYR A CE2  7  
ATOM 11287 C CZ   . TYR A 1 101 ? 31.132  71.389  42.110  1.00 0.00 ?  92  TYR A CZ   7  
ATOM 11288 O OH   . TYR A 1 101 ? 30.258  70.586  42.741  1.00 0.00 ?  92  TYR A OH   7  
ATOM 11289 H H    . TYR A 1 101 ? 33.514  71.984  38.420  1.00 0.00 ?  92  TYR A H    7  
ATOM 11290 H HA   . TYR A 1 101 ? 35.575  73.904  38.521  1.00 0.00 ?  92  TYR A HA   7  
ATOM 11291 H HB2  . TYR A 1 101 ? 34.505  74.515  40.765  1.00 0.00 ?  92  TYR A HB2  7  
ATOM 11292 H HB3  . TYR A 1 101 ? 33.515  74.469  39.316  1.00 0.00 ?  92  TYR A HB3  7  
ATOM 11293 H HD1  . TYR A 1 101 ? 31.686  73.169  39.181  1.00 0.00 ?  92  TYR A HD1  7  
ATOM 11294 H HD2  . TYR A 1 101 ? 34.255  72.788  42.479  1.00 0.00 ?  92  TYR A HD2  7  
ATOM 11295 H HE1  . TYR A 1 101 ? 30.030  71.535  40.301  1.00 0.00 ?  92  TYR A HE1  7  
ATOM 11296 H HE2  . TYR A 1 101 ? 32.587  71.279  43.705  1.00 0.00 ?  92  TYR A HE2  7  
ATOM 11297 H HH   . TYR A 1 101 ? 30.021  69.787  42.265  1.00 0.00 ?  92  TYR A HH   7  
ATOM 11298 N N    . HIS A 1 102 ? 36.584  71.438  40.039  1.00 0.00 ?  93  HIS A N    7  
ATOM 11299 C CA   . HIS A 1 102 ? 37.963  70.949  40.394  1.00 0.00 ?  93  HIS A CA   7  
ATOM 11300 C C    . HIS A 1 102 ? 38.680  70.461  39.125  1.00 0.00 ?  93  HIS A C    7  
ATOM 11301 O O    . HIS A 1 102 ? 39.795  70.886  38.854  1.00 0.00 ?  93  HIS A O    7  
ATOM 11302 C CB   . HIS A 1 102 ? 37.829  69.843  41.411  1.00 0.00 ?  93  HIS A CB   7  
ATOM 11303 C CG   . HIS A 1 102 ? 36.814  70.058  42.505  1.00 0.00 ?  93  HIS A CG   7  
ATOM 11304 N ND1  . HIS A 1 102 ? 36.957  71.018  43.521  1.00 0.00 ?  93  HIS A ND1  7  
ATOM 11305 C CD2  . HIS A 1 102 ? 35.573  69.446  42.716  1.00 0.00 ?  93  HIS A CD2  7  
ATOM 11306 C CE1  . HIS A 1 102 ? 35.775  70.985  44.246  1.00 0.00 ?  93  HIS A CE1  7  
ATOM 11307 N NE2  . HIS A 1 102 ? 34.955  70.034  43.748  1.00 0.00 ?  93  HIS A NE2  7  
ATOM 11308 H H    . HIS A 1 102 ? 36.013  70.807  39.494  1.00 0.00 ?  93  HIS A H    7  
ATOM 11309 H HA   . HIS A 1 102 ? 38.495  71.771  40.874  1.00 0.00 ?  93  HIS A HA   7  
ATOM 11310 H HB2  . HIS A 1 102 ? 37.641  68.884  40.929  1.00 0.00 ?  93  HIS A HB2  7  
ATOM 11311 H HB3  . HIS A 1 102 ? 38.804  69.749  41.888  1.00 0.00 ?  93  HIS A HB3  7  
ATOM 11312 H HD2  . HIS A 1 102 ? 35.116  68.759  42.019  1.00 0.00 ?  93  HIS A HD2  7  
ATOM 11313 H HE1  . HIS A 1 102 ? 35.565  71.572  45.128  1.00 0.00 ?  93  HIS A HE1  7  
ATOM 11314 H HE2  . HIS A 1 102 ? 34.150  69.756  44.291  1.00 0.00 ?  93  HIS A HE2  7  
ATOM 11315 N N    . VAL A 1 103 ? 38.010  69.585  38.290  1.00 0.00 ?  94  VAL A N    7  
ATOM 11316 C CA   . VAL A 1 103 ? 38.745  68.813  37.198  1.00 0.00 ?  94  VAL A CA   7  
ATOM 11317 C C    . VAL A 1 103 ? 39.296  69.674  36.169  1.00 0.00 ?  94  VAL A C    7  
ATOM 11318 O O    . VAL A 1 103 ? 40.432  69.438  35.754  1.00 0.00 ?  94  VAL A O    7  
ATOM 11319 C CB   . VAL A 1 103 ? 37.916  67.695  36.593  1.00 0.00 ?  94  VAL A CB   7  
ATOM 11320 C CG1  . VAL A 1 103 ? 38.555  66.946  35.362  1.00 0.00 ?  94  VAL A CG1  7  
ATOM 11321 C CG2  . VAL A 1 103 ? 37.539  66.533  37.537  1.00 0.00 ?  94  VAL A CG2  7  
ATOM 11322 H H    . VAL A 1 103 ? 37.050  69.283  38.369  1.00 0.00 ?  94  VAL A H    7  
ATOM 11323 H HA   . VAL A 1 103 ? 39.537  68.297  37.739  1.00 0.00 ?  94  VAL A HA   7  
ATOM 11324 H HB   . VAL A 1 103 ? 36.945  68.048  36.245  1.00 0.00 ?  94  VAL A HB   7  
ATOM 11325 H HG11 . VAL A 1 103 ? 38.755  67.566  34.488  1.00 0.00 ?  94  VAL A HG11 7  
ATOM 11326 H HG12 . VAL A 1 103 ? 39.432  66.342  35.594  1.00 0.00 ?  94  VAL A HG12 7  
ATOM 11327 H HG13 . VAL A 1 103 ? 37.826  66.190  35.070  1.00 0.00 ?  94  VAL A HG13 7  
ATOM 11328 H HG21 . VAL A 1 103 ? 36.977  66.943  38.376  1.00 0.00 ?  94  VAL A HG21 7  
ATOM 11329 H HG22 . VAL A 1 103 ? 36.838  65.923  36.967  1.00 0.00 ?  94  VAL A HG22 7  
ATOM 11330 H HG23 . VAL A 1 103 ? 38.469  66.014  37.772  1.00 0.00 ?  94  VAL A HG23 7  
ATOM 11331 N N    . TYR A 1 104 ? 38.646  70.760  35.774  1.00 0.00 ?  95  TYR A N    7  
ATOM 11332 C CA   . TYR A 1 104 ? 39.353  71.755  34.960  1.00 0.00 ?  95  TYR A CA   7  
ATOM 11333 C C    . TYR A 1 104 ? 40.614  72.455  35.496  1.00 0.00 ?  95  TYR A C    7  
ATOM 11334 O O    . TYR A 1 104 ? 41.360  73.133  34.750  1.00 0.00 ?  95  TYR A O    7  
ATOM 11335 C CB   . TYR A 1 104 ? 38.422  72.593  34.097  1.00 0.00 ?  95  TYR A CB   7  
ATOM 11336 C CG   . TYR A 1 104 ? 37.636  71.832  33.083  1.00 0.00 ?  95  TYR A CG   7  
ATOM 11337 C CD1  . TYR A 1 104 ? 36.343  71.308  33.427  1.00 0.00 ?  95  TYR A CD1  7  
ATOM 11338 C CD2  . TYR A 1 104 ? 38.089  71.730  31.752  1.00 0.00 ?  95  TYR A CD2  7  
ATOM 11339 C CE1  . TYR A 1 104 ? 35.698  70.576  32.475  1.00 0.00 ?  95  TYR A CE1  7  
ATOM 11340 C CE2  . TYR A 1 104 ? 37.388  70.910  30.858  1.00 0.00 ?  95  TYR A CE2  7  
ATOM 11341 C CZ   . TYR A 1 104 ? 36.250  70.288  31.208  1.00 0.00 ?  95  TYR A CZ   7  
ATOM 11342 O OH   . TYR A 1 104 ? 35.568  69.496  30.371  1.00 0.00 ?  95  TYR A OH   7  
ATOM 11343 H H    . TYR A 1 104 ? 37.767  71.028  36.191  1.00 0.00 ?  95  TYR A H    7  
ATOM 11344 H HA   . TYR A 1 104 ? 39.955  71.143  34.289  1.00 0.00 ?  95  TYR A HA   7  
ATOM 11345 H HB2  . TYR A 1 104 ? 37.833  73.181  34.801  1.00 0.00 ?  95  TYR A HB2  7  
ATOM 11346 H HB3  . TYR A 1 104 ? 38.908  73.385  33.528  1.00 0.00 ?  95  TYR A HB3  7  
ATOM 11347 H HD1  . TYR A 1 104 ? 36.005  71.305  34.452  1.00 0.00 ?  95  TYR A HD1  7  
ATOM 11348 H HD2  . TYR A 1 104 ? 38.990  72.273  31.506  1.00 0.00 ?  95  TYR A HD2  7  
ATOM 11349 H HE1  . TYR A 1 104 ? 34.820  70.035  32.798  1.00 0.00 ?  95  TYR A HE1  7  
ATOM 11350 H HE2  . TYR A 1 104 ? 37.776  70.706  29.871  1.00 0.00 ?  95  TYR A HE2  7  
ATOM 11351 H HH   . TYR A 1 104 ? 34.610  69.442  30.360  1.00 0.00 ?  95  TYR A HH   7  
ATOM 11352 N N    . ILE A 1 105 ? 40.910  72.350  36.814  1.00 0.00 ?  96  ILE A N    7  
ATOM 11353 C CA   . ILE A 1 105 ? 42.148  73.082  37.322  1.00 0.00 ?  96  ILE A CA   7  
ATOM 11354 C C    . ILE A 1 105 ? 43.448  72.416  36.866  1.00 0.00 ?  96  ILE A C    7  
ATOM 11355 O O    . ILE A 1 105 ? 43.771  71.282  37.358  1.00 0.00 ?  96  ILE A O    7  
ATOM 11356 C CB   . ILE A 1 105 ? 42.057  73.163  38.879  1.00 0.00 ?  96  ILE A CB   7  
ATOM 11357 C CG1  . ILE A 1 105 ? 40.797  73.915  39.318  1.00 0.00 ?  96  ILE A CG1  7  
ATOM 11358 C CG2  . ILE A 1 105 ? 43.291  73.865  39.459  1.00 0.00 ?  96  ILE A CG2  7  
ATOM 11359 C CD1  . ILE A 1 105 ? 40.417  75.218  38.505  1.00 0.00 ?  96  ILE A CD1  7  
ATOM 11360 H H    . ILE A 1 105 ? 40.424  71.613  37.305  1.00 0.00 ?  96  ILE A H    7  
ATOM 11361 H HA   . ILE A 1 105 ? 42.251  74.056  36.845  1.00 0.00 ?  96  ILE A HA   7  
ATOM 11362 H HB   . ILE A 1 105 ? 42.004  72.143  39.258  1.00 0.00 ?  96  ILE A HB   7  
ATOM 11363 H HG12 . ILE A 1 105 ? 39.939  73.253  39.211  1.00 0.00 ?  96  ILE A HG12 7  
ATOM 11364 H HG13 . ILE A 1 105 ? 40.897  74.194  40.366  1.00 0.00 ?  96  ILE A HG13 7  
ATOM 11365 H HG21 . ILE A 1 105 ? 43.371  74.937  39.279  1.00 0.00 ?  96  ILE A HG21 7  
ATOM 11366 H HG22 . ILE A 1 105 ? 43.409  73.699  40.530  1.00 0.00 ?  96  ILE A HG22 7  
ATOM 11367 H HG23 . ILE A 1 105 ? 44.172  73.429  38.987  1.00 0.00 ?  96  ILE A HG23 7  
ATOM 11368 H HD11 . ILE A 1 105 ? 39.549  75.688  38.966  1.00 0.00 ?  96  ILE A HD11 7  
ATOM 11369 H HD12 . ILE A 1 105 ? 41.247  75.917  38.606  1.00 0.00 ?  96  ILE A HD12 7  
ATOM 11370 H HD13 . ILE A 1 105 ? 40.103  74.981  37.488  1.00 0.00 ?  96  ILE A HD13 7  
ATOM 11371 N N    . LYS A 1 106 ? 44.169  73.059  35.976  1.00 0.00 ?  97  LYS A N    7  
ATOM 11372 C CA   . LYS A 1 106 ? 45.549  72.713  35.523  1.00 0.00 ?  97  LYS A CA   7  
ATOM 11373 C C    . LYS A 1 106 ? 46.603  72.775  36.563  1.00 0.00 ?  97  LYS A C    7  
ATOM 11374 O O    . LYS A 1 106 ? 47.245  71.760  36.754  1.00 0.00 ?  97  LYS A O    7  
ATOM 11375 C CB   . LYS A 1 106 ? 46.031  73.720  34.481  1.00 0.00 ?  97  LYS A CB   7  
ATOM 11376 C CG   . LYS A 1 106 ? 45.618  73.205  33.045  1.00 0.00 ?  97  LYS A CG   7  
ATOM 11377 C CD   . LYS A 1 106 ? 44.179  73.273  32.587  1.00 0.00 ?  97  LYS A CD   7  
ATOM 11378 C CE   . LYS A 1 106 ? 43.456  74.617  32.465  1.00 0.00 ?  97  LYS A CE   7  
ATOM 11379 N NZ   . LYS A 1 106 ? 42.114  74.537  32.055  1.00 0.00 1  97  LYS A NZ   7  
ATOM 11380 H H    . LYS A 1 106 ? 43.704  73.880  35.616  1.00 0.00 ?  97  LYS A H    7  
ATOM 11381 H HA   . LYS A 1 106 ? 45.630  71.712  35.102  1.00 0.00 ?  97  LYS A HA   7  
ATOM 11382 H HB2  . LYS A 1 106 ? 45.602  74.694  34.718  1.00 0.00 ?  97  LYS A HB2  7  
ATOM 11383 H HB3  . LYS A 1 106 ? 47.103  73.910  34.535  1.00 0.00 ?  97  LYS A HB3  7  
ATOM 11384 H HG2  . LYS A 1 106 ? 46.224  73.676  32.270  1.00 0.00 ?  97  LYS A HG2  7  
ATOM 11385 H HG3  . LYS A 1 106 ? 45.889  72.154  32.939  1.00 0.00 ?  97  LYS A HG3  7  
ATOM 11386 H HD2  . LYS A 1 106 ? 44.001  72.748  31.650  1.00 0.00 ?  97  LYS A HD2  7  
ATOM 11387 H HD3  . LYS A 1 106 ? 43.563  72.754  33.321  1.00 0.00 ?  97  LYS A HD3  7  
ATOM 11388 H HE2  . LYS A 1 106 ? 43.492  75.204  33.383  1.00 0.00 ?  97  LYS A HE2  7  
ATOM 11389 H HE3  . LYS A 1 106 ? 43.944  75.246  31.720  1.00 0.00 ?  97  LYS A HE3  7  
ATOM 11390 H HZ1  . LYS A 1 106 ? 41.766  75.472  31.899  1.00 0.00 ?  97  LYS A HZ1  7  
ATOM 11391 H HZ2  . LYS A 1 106 ? 42.032  73.996  31.206  1.00 0.00 ?  97  LYS A HZ2  7  
ATOM 11392 H HZ3  . LYS A 1 106 ? 41.554  74.113  32.780  1.00 0.00 ?  97  LYS A HZ3  7  
ATOM 11393 N N    . ASN A 1 107 ? 46.603  73.849  37.442  1.00 0.00 ?  98  ASN A N    7  
ATOM 11394 C CA   . ASN A 1 107 ? 47.555  74.062  38.429  1.00 0.00 ?  98  ASN A CA   7  
ATOM 11395 C C    . ASN A 1 107 ? 47.662  72.914  39.492  1.00 0.00 ?  98  ASN A C    7  
ATOM 11396 O O    . ASN A 1 107 ? 48.582  72.972  40.298  1.00 0.00 ?  98  ASN A O    7  
ATOM 11397 C CB   . ASN A 1 107 ? 47.372  75.447  39.053  1.00 0.00 ?  98  ASN A CB   7  
ATOM 11398 C CG   . ASN A 1 107 ? 48.502  75.747  40.086  1.00 0.00 ?  98  ASN A CG   7  
ATOM 11399 O OD1  . ASN A 1 107 ? 48.180  75.891  41.274  1.00 0.00 ?  98  ASN A OD1  7  
ATOM 11400 N ND2  . ASN A 1 107 ? 49.770  75.930  39.712  1.00 0.00 ?  98  ASN A ND2  7  
ATOM 11401 H H    . ASN A 1 107 ? 45.927  74.591  37.329  1.00 0.00 ?  98  ASN A H    7  
ATOM 11402 H HA   . ASN A 1 107 ? 48.510  73.972  37.911  1.00 0.00 ?  98  ASN A HA   7  
ATOM 11403 H HB2  . ASN A 1 107 ? 47.533  76.199  38.279  1.00 0.00 ?  98  ASN A HB2  7  
ATOM 11404 H HB3  . ASN A 1 107 ? 46.404  75.625  39.519  1.00 0.00 ?  98  ASN A HB3  7  
ATOM 11405 H HD21 . ASN A 1 107 ? 50.161  75.740  38.801  1.00 0.00 ?  98  ASN A HD21 7  
ATOM 11406 H HD22 . ASN A 1 107 ? 50.474  76.155  40.400  1.00 0.00 ?  98  ASN A HD22 7  
ATOM 11407 N N    . ARG A 1 108 ? 46.750  71.919  39.555  1.00 0.00 ?  99  ARG A N    7  
ATOM 11408 C CA   . ARG A 1 108 ? 46.542  70.975  40.677  1.00 0.00 ?  99  ARG A CA   7  
ATOM 11409 C C    . ARG A 1 108 ? 47.521  69.855  40.606  1.00 0.00 ?  99  ARG A C    7  
ATOM 11410 O O    . ARG A 1 108 ? 47.726  69.221  39.599  1.00 0.00 ?  99  ARG A O    7  
ATOM 11411 C CB   . ARG A 1 108 ? 45.069  70.494  40.704  1.00 0.00 ?  99  ARG A CB   7  
ATOM 11412 C CG   . ARG A 1 108 ? 44.845  69.466  41.815  1.00 0.00 ?  99  ARG A CG   7  
ATOM 11413 C CD   . ARG A 1 108 ? 43.364  69.057  41.677  1.00 0.00 ?  99  ARG A CD   7  
ATOM 11414 N NE   . ARG A 1 108 ? 43.065  68.213  42.836  1.00 0.00 ?  99  ARG A NE   7  
ATOM 11415 C CZ   . ARG A 1 108 ? 42.134  68.441  43.788  1.00 0.00 ?  99  ARG A CZ   7  
ATOM 11416 N NH1  . ARG A 1 108 ? 41.429  69.555  43.999  1.00 0.00 ?  99  ARG A NH1  7  
ATOM 11417 N NH2  . ARG A 1 108 ? 42.021  67.554  44.766  1.00 0.00 1  99  ARG A NH2  7  
ATOM 11418 H H    . ARG A 1 108 ? 46.145  71.720  38.771  1.00 0.00 ?  99  ARG A H    7  
ATOM 11419 H HA   . ARG A 1 108 ? 46.708  71.488  41.625  1.00 0.00 ?  99  ARG A HA   7  
ATOM 11420 H HB2  . ARG A 1 108 ? 44.422  71.336  40.945  1.00 0.00 ?  99  ARG A HB2  7  
ATOM 11421 H HB3  . ARG A 1 108 ? 44.759  69.981  39.794  1.00 0.00 ?  99  ARG A HB3  7  
ATOM 11422 H HG2  . ARG A 1 108 ? 45.512  68.634  41.588  1.00 0.00 ?  99  ARG A HG2  7  
ATOM 11423 H HG3  . ARG A 1 108 ? 45.086  69.804  42.823  1.00 0.00 ?  99  ARG A HG3  7  
ATOM 11424 H HD2  . ARG A 1 108 ? 42.628  69.861  41.691  1.00 0.00 ?  99  ARG A HD2  7  
ATOM 11425 H HD3  . ARG A 1 108 ? 43.207  68.500  40.754  1.00 0.00 ?  99  ARG A HD3  7  
ATOM 11426 H HE   . ARG A 1 108 ? 43.623  67.378  42.943  1.00 0.00 ?  99  ARG A HE   7  
ATOM 11427 H HH11 . ARG A 1 108 ? 41.609  70.425  43.519  1.00 0.00 ?  99  ARG A HH11 7  
ATOM 11428 H HH12 . ARG A 1 108 ? 40.673  69.524  44.669  1.00 0.00 ?  99  ARG A HH12 7  
ATOM 11429 H HH21 . ARG A 1 108 ? 42.405  66.621  44.777  1.00 0.00 ?  99  ARG A HH21 7  
ATOM 11430 H HH22 . ARG A 1 108 ? 41.554  67.832  45.617  1.00 0.00 ?  99  ARG A HH22 7  
ATOM 11431 N N    . VAL A 1 109 ? 48.189  69.658  41.724  1.00 0.00 ?  100 VAL A N    7  
ATOM 11432 C CA   . VAL A 1 109 ? 49.160  68.598  41.894  1.00 0.00 ?  100 VAL A CA   7  
ATOM 11433 C C    . VAL A 1 109 ? 48.544  67.358  42.608  1.00 0.00 ?  100 VAL A C    7  
ATOM 11434 O O    . VAL A 1 109 ? 49.071  66.271  42.547  1.00 0.00 ?  100 VAL A O    7  
ATOM 11435 C CB   . VAL A 1 109 ? 50.503  69.115  42.528  1.00 0.00 ?  100 VAL A CB   7  
ATOM 11436 C CG1  . VAL A 1 109 ? 50.894  70.512  42.101  1.00 0.00 ?  100 VAL A CG1  7  
A