data_2NSQ
# 
_entry.id   2NSQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NSQ         
RCSB  RCSB040255   
WWPDB D_1000040255 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2NSQ 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Walker, J.R.'                         1  
'Avvakumov, G.V.'                      2  
'Xue, S.'                              3  
'Butler-Cole, C.'                      4  
'Finerty Jr., P.J.'                    5  
'Weigelt, J.'                          6  
'Sundstrom, M.'                        7  
'Arrowsmith, C.H.'                     8  
'Edwards, A.M.'                        9  
'Bochkarev, A.'                        10 
'Dhe-Paganon, S.'                      11 
'Structural Genomics Consortium (SGC)' 12 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like protein' 'To be Published' ?   ?     ?     ?    ?      
?  ?         0353 ? ?        ?                                
1       'NEDD4L on human chromosome 18q21 has multiple forms of transcripts and is a homologue of the mouse Nedd4-2 gene' 
Eur.J.Hum.Genet.  9   922   930   2001 ?      UK 1018-4813 ?    ? 11840194 10.1038/sj.ejhg.5200747          
2       
;14-3-3 proteins modulate the expression of epithelial Na+ channels by phosphorylation-dependent interaction with Nedd4-2 ubiquitin ligase
;
J.Biol.Chem.      280 13187 13194 2005 JBCHA3 US 0021-9258 0071 ? 15677482 10.1074/jbc.M412884200           
3       
;Latent membrane protein 2A of Epstein-Barr virus binds WW domain E3 protein-ubiquitin ligases that ubiquitinate B-cell tyrosine kinases
;
Mol.Cell.Biol.    20  8526  8535  2000 MCEBD4 US 0270-7306 2044 ? 11046148 10.1128/MCB.20.22.8526-8535.2000 
4       'Serum and glucocorticoid-regulated kinase modulates Nedd4-2-mediated inhibition of the epithelial Na+ channel' 
J.Biol.Chem.      277 5     8     2002 JBCHA3 US 0021-9258 0071 ? 11696533 10.1074/jbc.C100623200           
5       'N4WBP5, a potential target for ubiquitination by the Nedd4 family of proteins, is a novel Golgi-associated protein' 
J.Biol.Chem.      277 9307  9317  2002 JBCHA3 US 0021-9258 0071 ? 11748237 10.1074/jbc.M110443200           
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Walker, J.R.'          1  
primary 'Avvakumov, G.V.'       2  
primary 'Xue, S.'               3  
primary 'Butler-Cole, C.'       4  
primary 'Finerty Jr., P.J.'     5  
primary 'Weigelt, J.'           6  
primary 'Sundstrom, M.'         7  
primary 'Arrowsmith, C.H.'      8  
primary 'Edwards, A.M.'         9  
primary 'Bochkarev, A.'         10 
primary 'Dhe-Paganon, S.'       11 
1       'Chen, H.'              12 
1       'Ross, C.A.'            13 
1       'Wang, N.'              14 
1       'Huo, Y.'               15 
1       'MacKinnon, D.F.'       16 
1       'Potash, J.B.'          17 
1       'Simpson, S.G.'         18 
1       'McMahon, F.J.'         19 
1       'DePaulo Jr., J.R.'     20 
1       'McInnis, M.G.'         21 
2       'Ichimura, T.'          22 
2       'Yamamura, H.'          23 
2       'Sasamoto, K.'          24 
2       'Tominaga, Y.'          25 
2       'Taoka, M.'             26 
2       'Kakiuchi, K.'          27 
2       'Shinkawa, T.'          28 
2       'Takahashi, N.'         29 
2       'Shimada, S.'           30 
2       'Isobe, T.'             31 
3       'Winberg, G.'           32 
3       'Matskova, L.'          33 
3       'Chen, F.'              34 
3       'Plant, P.'             35 
3       'Rotin, D.'             36 
3       'Gish, G.'              37 
3       'Ingham, R.'            38 
3       'Ernberg, I.'           39 
3       'Pawson, T.'            40 
4       'Snyder, P.M.'          41 
4       'Olson, D.R.'           42 
4       'Thomas, B.C.'          43 
5       'Harvey, K.F.'          44 
5       'Shearwin-Whyatt, L.M.' 45 
5       'Fotia, A.'             46 
5       'Parton, R.G.'          47 
5       'Kumar, S.'             48 
# 
_cell.entry_id           2NSQ 
_cell.length_a           32.930 
_cell.length_b           60.036 
_cell.length_c           74.510 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2NSQ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'E3 ubiquitin-protein ligase NEDD4-like protein' 17935.568 1   6.3.2.- ? 'C2 Domain' ? 
2 non-polymer syn 1,2-ETHANEDIOL                                   62.068    1   ?       ? ?           ? 
3 non-polymer syn GLYCEROL                                         92.094    1   ?       ? ?           ? 
4 water       nat water                                            18.015    111 ?       ? ?           ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Nedd4-2, NEDD4.2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GMATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFY
FRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GMATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFY
FRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   MET n 
1 3   ALA n 
1 4   THR n 
1 5   GLY n 
1 6   LEU n 
1 7   GLY n 
1 8   GLU n 
1 9   PRO n 
1 10  VAL n 
1 11  TYR n 
1 12  GLY n 
1 13  LEU n 
1 14  SER n 
1 15  GLU n 
1 16  ASP n 
1 17  GLU n 
1 18  GLY n 
1 19  GLU n 
1 20  SER n 
1 21  ARG n 
1 22  ILE n 
1 23  LEU n 
1 24  ARG n 
1 25  VAL n 
1 26  LYS n 
1 27  VAL n 
1 28  VAL n 
1 29  SER n 
1 30  GLY n 
1 31  ILE n 
1 32  ASP n 
1 33  LEU n 
1 34  ALA n 
1 35  LYS n 
1 36  LYS n 
1 37  ASP n 
1 38  ILE n 
1 39  PHE n 
1 40  GLY n 
1 41  ALA n 
1 42  SER n 
1 43  ASP n 
1 44  PRO n 
1 45  TYR n 
1 46  VAL n 
1 47  LYS n 
1 48  LEU n 
1 49  SER n 
1 50  LEU n 
1 51  TYR n 
1 52  VAL n 
1 53  ALA n 
1 54  ASP n 
1 55  GLU n 
1 56  ASN n 
1 57  ARG n 
1 58  GLU n 
1 59  LEU n 
1 60  ALA n 
1 61  LEU n 
1 62  VAL n 
1 63  GLN n 
1 64  THR n 
1 65  LYS n 
1 66  THR n 
1 67  ILE n 
1 68  LYS n 
1 69  LYS n 
1 70  THR n 
1 71  LEU n 
1 72  ASN n 
1 73  PRO n 
1 74  LYS n 
1 75  TRP n 
1 76  ASN n 
1 77  GLU n 
1 78  GLU n 
1 79  PHE n 
1 80  TYR n 
1 81  PHE n 
1 82  ARG n 
1 83  VAL n 
1 84  ASN n 
1 85  PRO n 
1 86  SER n 
1 87  ASN n 
1 88  HIS n 
1 89  ARG n 
1 90  LEU n 
1 91  LEU n 
1 92  PHE n 
1 93  GLU n 
1 94  VAL n 
1 95  PHE n 
1 96  ASP n 
1 97  GLU n 
1 98  ASN n 
1 99  ARG n 
1 100 LEU n 
1 101 THR n 
1 102 ARG n 
1 103 ASP n 
1 104 ASP n 
1 105 PHE n 
1 106 LEU n 
1 107 GLY n 
1 108 GLN n 
1 109 VAL n 
1 110 ASP n 
1 111 VAL n 
1 112 PRO n 
1 113 LEU n 
1 114 SER n 
1 115 HIS n 
1 116 LEU n 
1 117 PRO n 
1 118 THR n 
1 119 GLU n 
1 120 ASP n 
1 121 PRO n 
1 122 THR n 
1 123 MET n 
1 124 GLU n 
1 125 ARG n 
1 126 PRO n 
1 127 TYR n 
1 128 THR n 
1 129 PHE n 
1 130 LYS n 
1 131 ASP n 
1 132 PHE n 
1 133 LEU n 
1 134 LEU n 
1 135 ARG n 
1 136 PRO n 
1 137 ARG n 
1 138 SER n 
1 139 HIS n 
1 140 LYS n 
1 141 SER n 
1 142 ARG n 
1 143 VAL n 
1 144 LYS n 
1 145 GLY n 
1 146 PHE n 
1 147 LEU n 
1 148 ARG n 
1 149 LEU n 
1 150 LYS n 
1 151 MET n 
1 152 ALA n 
1 153 TYR n 
1 154 MET n 
1 155 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'NEDD4L, KIAA0439, NEDL3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       p28a-LIC-TEV 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NED4L_HUMAN 
_struct_ref.pdbx_db_accession          Q96PU5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYF
RVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMP
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2NSQ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 155 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q96PU5 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  154 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       154 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2NSQ 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q96PU5 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'CLONING ARTIFACT' 
_struct_ref_seq_dif.pdbx_auth_seq_num            0 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL'               'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2NSQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.05 
_exptl_crystal.density_percent_sol   40.06 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.50 
_exptl_crystal_grow.pdbx_details    
;14% PEG 4000, 0.2 M NaOAc, pH 6.5, 1 mM DTT. 20% Ethylene glycol added as cryoprotectant, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K, pH 6.50
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2006-10-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.54178 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2NSQ 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            1.850 
_reflns.number_obs                   12925 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.081 
_reflns.pdbx_netI_over_sigmaI        23.0700 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.100 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              1.92 
_reflns_shell.percent_possible_all   88.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.638 
_reflns_shell.meanI_over_sigI_obs    2.000 
_reflns_shell.pdbx_redundancy        3.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2NSQ 
_refine.ls_number_reflns_obs                     12260 
_refine.ls_number_reflns_all                     12893 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.84 
_refine.ls_d_res_high                            1.85 
_refine.ls_percent_reflns_obs                    98.1 
_refine.ls_R_factor_obs                          0.174 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.171 
_refine.ls_R_factor_R_free                       0.218 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_number_reflns_R_free                  631 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.964 
_refine.correlation_coeff_Fo_to_Fc_free          0.953 
_refine.B_iso_mean                               21.92 
_refine.aniso_B[1][1]                            1.59000 
_refine.aniso_B[2][2]                            -0.82000 
_refine.aniso_B[3][3]                            -0.78000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1TJM' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.137 
_refine.pdbx_overall_ESU_R_Free                  0.133 
_refine.overall_SU_ML                            0.098 
_refine.overall_SU_B                             6.577 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1139 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             111 
_refine_hist.number_atoms_total               1260 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        27.84 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017  0.022  ? 1189 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.699  1.985  ? 1605 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.842  5.000  ? 141  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.697 22.982 ? 57   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.083 15.000 ? 208  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.932 15.000 ? 11   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.137  0.200  ? 175  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 899  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.202  0.200  ? 463  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.314  0.200  ? 786  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.162  0.200  ? 111  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.160  0.200  ? 26   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.197  0.200  ? 11   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.057  3.000  ? 734  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.818  4.000  ? 1157 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.873  5.000  ? 514  'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.292  7.000  ? 448  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.85 
_refine_ls_shell.d_res_low                        1.90 
_refine_ls_shell.number_reflns_R_work             762 
_refine_ls_shell.R_factor_R_work                  0.251 
_refine_ls_shell.percent_reflns_obs               85.18 
_refine_ls_shell.R_factor_R_free                  0.412 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             37 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NSQ 
_struct.title                     'Crystal structure of the C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like protein' 
_struct.pdbx_descriptor           'E3 ubiquitin-protein ligase NEDD4-like protein (E.C.6.3.2.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NSQ 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'LIGASE, UBL-CONJUGATION PATHWAY, C2 DOMAIN, STRUCTURAL GENOMICS CONSORTIUM, SGC' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 10  ? TYR A 11  ? VAL A 9   TYR A 10  
A 2 LYS A 74  ? VAL A 83  ? LYS A 73  VAL A 82  
A 3 ARG A 21  ? ILE A 31  ? ARG A 20  ILE A 30  
A 4 PHE A 146 ? TYR A 153 ? PHE A 145 TYR A 152 
A 5 LYS A 130 ? LEU A 133 ? LYS A 129 LEU A 132 
B 1 ARG A 57  ? GLN A 63  ? ARG A 56  GLN A 62  
B 2 PRO A 44  ? VAL A 52  ? PRO A 43  VAL A 51  
B 3 HIS A 88  ? ASP A 96  ? HIS A 87  ASP A 95  
B 4 ASP A 104 ? PRO A 112 ? ASP A 103 PRO A 111 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 11  ? N TYR A 10  O ARG A 82  ? O ARG A 81  
A 2 3 O PHE A 79  ? O PHE A 78  N VAL A 25  ? N VAL A 24  
A 3 4 N SER A 29  ? N SER A 28  O ARG A 148 ? O ARG A 147 
A 4 5 O LEU A 147 ? O LEU A 146 N PHE A 132 ? N PHE A 131 
B 1 2 O LEU A 59  ? O LEU A 58  N LEU A 50  ? N LEU A 49  
B 2 3 N LYS A 47  ? N LYS A 46  O GLU A 93  ? O GLU A 92  
B 3 4 N VAL A 94  ? N VAL A 93  O LEU A 106 ? O LEU A 105 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 155' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 156' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 THR A 128 ? THR A 127 . ? 1_555 ? 
2  AC1 4 LEU A 149 ? LEU A 148 . ? 1_555 ? 
3  AC1 4 LYS A 150 ? LYS A 149 . ? 1_555 ? 
4  AC1 4 MET A 151 ? MET A 150 . ? 1_555 ? 
5  AC2 7 ASN A 98  ? ASN A 97  . ? 1_555 ? 
6  AC2 7 ARG A 99  ? ARG A 98  . ? 1_555 ? 
7  AC2 7 THR A 101 ? THR A 100 . ? 1_555 ? 
8  AC2 7 ARG A 102 ? ARG A 101 . ? 1_555 ? 
9  AC2 7 ASP A 103 ? ASP A 102 . ? 1_555 ? 
10 AC2 7 LEU A 133 ? LEU A 132 . ? 3_545 ? 
11 AC2 7 HOH D .   ? HOH A 182 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2NSQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2NSQ 
_atom_sites.fract_transf_matrix[1][1]   0.030367 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016657 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013421 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 7   ? 25.126  26.263 2.086   1.00 61.84  ? 6   GLY A N   1 
ATOM   2    C CA  . GLY A 1 7   ? 25.997  25.612 3.110   1.00 65.84  ? 6   GLY A CA  1 
ATOM   3    C C   . GLY A 1 7   ? 25.218  25.060 4.297   1.00 62.63  ? 6   GLY A C   1 
ATOM   4    O O   . GLY A 1 7   ? 25.668  25.147 5.462   1.00 66.49  ? 6   GLY A O   1 
ATOM   5    N N   . GLU A 1 8   ? 24.052  24.505 3.992   1.00 52.69  ? 7   GLU A N   1 
ATOM   6    C CA  . GLU A 1 8   ? 23.046  24.054 4.970   1.00 47.45  ? 7   GLU A CA  1 
ATOM   7    C C   . GLU A 1 8   ? 22.264  22.902 4.310   1.00 42.38  ? 7   GLU A C   1 
ATOM   8    O O   . GLU A 1 8   ? 22.104  22.889 3.087   1.00 43.29  ? 7   GLU A O   1 
ATOM   9    C CB  . GLU A 1 8   ? 22.064  25.184 5.344   1.00 45.59  ? 7   GLU A CB  1 
ATOM   10   C CG  . GLU A 1 8   ? 22.678  26.444 5.992   1.00 48.15  ? 7   GLU A CG  1 
ATOM   11   C CD  . GLU A 1 8   ? 23.240  26.175 7.376   1.00 56.07  ? 7   GLU A CD  1 
ATOM   12   O OE1 . GLU A 1 8   ? 22.953  25.092 7.945   1.00 55.43  ? 7   GLU A OE1 1 
ATOM   13   O OE2 . GLU A 1 8   ? 23.976  27.040 7.888   1.00 61.68  ? 7   GLU A OE2 1 
ATOM   14   N N   . PRO A 1 9   ? 21.755  21.944 5.104   1.00 40.84  ? 8   PRO A N   1 
ATOM   15   C CA  . PRO A 1 9   ? 20.882  20.917 4.506   1.00 37.09  ? 8   PRO A CA  1 
ATOM   16   C C   . PRO A 1 9   ? 19.588  21.525 3.943   1.00 34.98  ? 8   PRO A C   1 
ATOM   17   O O   . PRO A 1 9   ? 18.996  22.417 4.571   1.00 33.81  ? 8   PRO A O   1 
ATOM   18   C CB  . PRO A 1 9   ? 20.481  20.051 5.713   1.00 39.04  ? 8   PRO A CB  1 
ATOM   19   C CG  . PRO A 1 9   ? 21.506  20.349 6.786   1.00 41.82  ? 8   PRO A CG  1 
ATOM   20   C CD  . PRO A 1 9   ? 21.908  21.771 6.563   1.00 43.14  ? 8   PRO A CD  1 
ATOM   21   N N   . VAL A 1 10  ? 19.136  20.996 2.804   1.00 30.14  ? 9   VAL A N   1 
ATOM   22   C CA  . VAL A 1 10  ? 17.848  21.362 2.198   1.00 27.90  ? 9   VAL A CA  1 
ATOM   23   C C   . VAL A 1 10  ? 16.944  20.114 2.069   1.00 26.53  ? 9   VAL A C   1 
ATOM   24   O O   . VAL A 1 10  ? 17.415  19.049 1.671   1.00 28.18  ? 9   VAL A O   1 
ATOM   25   C CB  . VAL A 1 10  ? 18.059  22.059 0.828   1.00 32.47  ? 9   VAL A CB  1 
ATOM   26   C CG1 . VAL A 1 10  ? 16.709  22.376 0.163   1.00 28.61  ? 9   VAL A CG1 1 
ATOM   27   C CG2 . VAL A 1 10  ? 18.984  23.336 0.952   1.00 30.10  ? 9   VAL A CG2 1 
ATOM   28   N N   . TYR A 1 11  ? 15.674  20.259 2.460   1.00 23.74  ? 10  TYR A N   1 
ATOM   29   C CA  . TYR A 1 11  ? 14.649  19.207 2.406   1.00 24.45  ? 10  TYR A CA  1 
ATOM   30   C C   . TYR A 1 11  ? 13.779  19.388 1.177   1.00 24.03  ? 10  TYR A C   1 
ATOM   31   O O   . TYR A 1 11  ? 13.325  20.503 0.895   1.00 28.36  ? 10  TYR A O   1 
ATOM   32   C CB  . TYR A 1 11  ? 13.787  19.206 3.691   1.00 22.86  ? 10  TYR A CB  1 
ATOM   33   C CG  . TYR A 1 11  ? 14.645  18.981 4.906   1.00 27.43  ? 10  TYR A CG  1 
ATOM   34   C CD1 . TYR A 1 11  ? 14.945  17.698 5.352   1.00 26.79  ? 10  TYR A CD1 1 
ATOM   35   C CD2 . TYR A 1 11  ? 15.218  20.061 5.568   1.00 29.30  ? 10  TYR A CD2 1 
ATOM   36   C CE1 . TYR A 1 11  ? 15.777  17.518 6.489   1.00 28.07  ? 10  TYR A CE1 1 
ATOM   37   C CE2 . TYR A 1 11  ? 16.053  19.884 6.682   1.00 30.20  ? 10  TYR A CE2 1 
ATOM   38   C CZ  . TYR A 1 11  ? 16.332  18.626 7.121   1.00 30.02  ? 10  TYR A CZ  1 
ATOM   39   O OH  . TYR A 1 11  ? 17.154  18.511 8.232   1.00 34.41  ? 10  TYR A OH  1 
ATOM   40   N N   . GLY A 1 12  ? 13.586  18.301 0.436   1.00 24.29  ? 11  GLY A N   1 
ATOM   41   C CA  . GLY A 1 12  ? 12.787  18.313 -0.781  1.00 24.96  ? 11  GLY A CA  1 
ATOM   42   C C   . GLY A 1 12  ? 13.704  18.213 -2.003  1.00 30.41  ? 11  GLY A C   1 
ATOM   43   O O   . GLY A 1 12  ? 14.776  18.829 -2.033  1.00 33.14  ? 11  GLY A O   1 
ATOM   44   N N   . LEU A 1 13  ? 13.295  17.430 -2.999  1.00 31.14  ? 12  LEU A N   1 
ATOM   45   C CA  . LEU A 1 13  ? 14.007  17.357 -4.265  1.00 35.88  ? 12  LEU A CA  1 
ATOM   46   C C   . LEU A 1 13  ? 13.101  18.061 -5.255  1.00 42.96  ? 12  LEU A C   1 
ATOM   47   O O   . LEU A 1 13  ? 11.872  17.944 -5.151  1.00 46.32  ? 12  LEU A O   1 
ATOM   48   C CB  . LEU A 1 13  ? 14.224  15.889 -4.666  1.00 36.92  ? 12  LEU A CB  1 
ATOM   49   C CG  . LEU A 1 13  ? 14.891  14.897 -3.673  1.00 30.85  ? 12  LEU A CG  1 
ATOM   50   C CD1 . LEU A 1 13  ? 14.787  13.430 -4.206  1.00 37.52  ? 12  LEU A CD1 1 
ATOM   51   C CD2 . LEU A 1 13  ? 16.343  15.257 -3.513  1.00 38.36  ? 12  LEU A CD2 1 
ATOM   52   N N   . SER A 1 14  ? 13.685  18.809 -6.191  1.00 49.31  ? 13  SER A N   1 
ATOM   53   C CA  . SER A 1 14  ? 12.906  19.554 -7.181  1.00 53.99  ? 13  SER A CA  1 
ATOM   54   C C   . SER A 1 14  ? 12.296  18.636 -8.213  1.00 58.87  ? 13  SER A C   1 
ATOM   55   O O   . SER A 1 14  ? 12.949  17.724 -8.712  1.00 61.20  ? 13  SER A O   1 
ATOM   56   C CB  . SER A 1 14  ? 13.764  20.576 -7.934  1.00 61.21  ? 13  SER A CB  1 
ATOM   57   O OG  . SER A 1 14  ? 13.820  21.814 -7.252  1.00 67.18  ? 13  SER A OG  1 
ATOM   58   N N   . GLU A 1 15  ? 11.049  18.922 -8.558  1.00 57.43  ? 14  GLU A N   1 
ATOM   59   C CA  . GLU A 1 15  ? 10.382  18.274 -9.686  1.00 59.48  ? 14  GLU A CA  1 
ATOM   60   C C   . GLU A 1 15  ? 10.442  19.176 -10.906 1.00 51.90  ? 14  GLU A C   1 
ATOM   61   O O   . GLU A 1 15  ? 10.401  18.718 -12.048 1.00 55.64  ? 14  GLU A O   1 
ATOM   62   C CB  . GLU A 1 15  ? 8.948   17.900 -9.286  1.00 69.73  ? 14  GLU A CB  1 
ATOM   63   C CG  . GLU A 1 15  ? 8.960   16.752 -8.234  1.00 84.73  ? 14  GLU A CG  1 
ATOM   64   C CD  . GLU A 1 15  ? 7.552   16.419 -7.568  1.00 96.45  ? 14  GLU A CD  1 
ATOM   65   O OE1 . GLU A 1 15  ? 7.463   15.269 -6.952  1.00 110.69 ? 14  GLU A OE1 1 
ATOM   66   O OE2 . GLU A 1 15  ? 6.539   17.216 -7.646  1.00 100.22 ? 14  GLU A OE2 1 
ATOM   67   N N   . ASP A 1 16  ? 10.583  20.472 -10.664 1.00 46.52  ? 15  ASP A N   1 
ATOM   68   C CA  . ASP A 1 16  ? 10.717  21.453 -11.727 1.00 40.63  ? 15  ASP A CA  1 
ATOM   69   C C   . ASP A 1 16  ? 11.565  22.546 -11.153 1.00 40.39  ? 15  ASP A C   1 
ATOM   70   O O   . ASP A 1 16  ? 11.108  23.318 -10.289 1.00 37.30  ? 15  ASP A O   1 
ATOM   71   C CB  . ASP A 1 16  ? 9.349   22.021 -12.123 1.00 43.00  ? 15  ASP A CB  1 
ATOM   72   C CG  . ASP A 1 16  ? 9.444   23.035 -13.275 1.00 41.54  ? 15  ASP A CG  1 
ATOM   73   O OD1 . ASP A 1 16  ? 10.558  23.519 -13.544 1.00 40.39  ? 15  ASP A OD1 1 
ATOM   74   O OD2 . ASP A 1 16  ? 8.418   23.287 -13.940 1.00 44.23  ? 15  ASP A OD2 1 
ATOM   75   N N   . GLU A 1 17  ? 12.798  22.639 -11.640 1.00 39.11  ? 16  GLU A N   1 
ATOM   76   C CA  . GLU A 1 17  ? 13.753  23.591 -11.093 1.00 41.69  ? 16  GLU A CA  1 
ATOM   77   C C   . GLU A 1 17  ? 13.363  25.045 -11.448 1.00 39.59  ? 16  GLU A C   1 
ATOM   78   O O   . GLU A 1 17  ? 13.752  25.982 -10.758 1.00 39.88  ? 16  GLU A O   1 
ATOM   79   C CB  . GLU A 1 17  ? 15.171  23.232 -11.561 1.00 46.03  ? 16  GLU A CB  1 
ATOM   80   C CG  . GLU A 1 17  ? 16.188  23.229 -10.425 1.00 55.05  ? 16  GLU A CG  1 
ATOM   81   N N   . GLY A 1 18  ? 12.568  25.235 -12.499 1.00 38.48  ? 17  GLY A N   1 
ATOM   82   C CA  . GLY A 1 18  ? 12.087  26.596 -12.845 1.00 40.14  ? 17  GLY A CA  1 
ATOM   83   C C   . GLY A 1 18  ? 10.908  27.092 -12.005 1.00 41.19  ? 17  GLY A C   1 
ATOM   84   O O   . GLY A 1 18  ? 10.344  28.168 -12.256 1.00 44.66  ? 17  GLY A O   1 
ATOM   85   N N   . GLU A 1 19  ? 10.505  26.309 -11.017 1.00 37.60  ? 18  GLU A N   1 
ATOM   86   C CA  . GLU A 1 19  ? 9.413   26.722 -10.150 1.00 44.22  ? 18  GLU A CA  1 
ATOM   87   C C   . GLU A 1 19  ? 9.773   26.654 -8.689  1.00 43.14  ? 18  GLU A C   1 
ATOM   88   O O   . GLU A 1 19  ? 8.964   27.035 -7.855  1.00 48.71  ? 18  GLU A O   1 
ATOM   89   C CB  . GLU A 1 19  ? 8.121   25.925 -10.415 1.00 49.98  ? 18  GLU A CB  1 
ATOM   90   C CG  . GLU A 1 19  ? 7.173   26.632 -11.408 1.00 60.12  ? 18  GLU A CG  1 
ATOM   91   C CD  . GLU A 1 19  ? 6.023   25.760 -11.888 1.00 68.89  ? 18  GLU A CD  1 
ATOM   92   O OE1 . GLU A 1 19  ? 4.862   26.049 -11.517 1.00 78.62  ? 18  GLU A OE1 1 
ATOM   93   O OE2 . GLU A 1 19  ? 6.274   24.792 -12.644 1.00 72.28  ? 18  GLU A OE2 1 
ATOM   94   N N   . SER A 1 20  ? 10.968  26.185 -8.356  1.00 37.45  ? 19  SER A N   1 
ATOM   95   C CA  . SER A 1 20  ? 11.261  26.101 -6.959  1.00 38.72  ? 19  SER A CA  1 
ATOM   96   C C   . SER A 1 20  ? 12.068  27.238 -6.375  1.00 36.94  ? 19  SER A C   1 
ATOM   97   O O   . SER A 1 20  ? 12.785  27.934 -7.072  1.00 36.84  ? 19  SER A O   1 
ATOM   98   C CB  . SER A 1 20  ? 11.795  24.722 -6.553  1.00 43.59  ? 19  SER A CB  1 
ATOM   99   O OG  . SER A 1 20  ? 12.959  24.414 -7.257  1.00 48.35  ? 19  SER A OG  1 
ATOM   100  N N   . ARG A 1 21  ? 11.921  27.406 -5.070  1.00 34.50  ? 20  ARG A N   1 
ATOM   101  C CA  . ARG A 1 21  ? 12.503  28.507 -4.309  1.00 34.53  ? 20  ARG A CA  1 
ATOM   102  C C   . ARG A 1 21  ? 12.996  27.850 -3.033  1.00 33.90  ? 20  ARG A C   1 
ATOM   103  O O   . ARG A 1 21  ? 12.532  26.764 -2.673  1.00 33.09  ? 20  ARG A O   1 
ATOM   104  C CB  . ARG A 1 21  ? 11.402  29.533 -3.936  1.00 33.55  ? 20  ARG A CB  1 
ATOM   105  C CG  . ARG A 1 21  ? 10.768  30.294 -5.116  1.00 39.46  ? 20  ARG A CG  1 
ATOM   106  C CD  . ARG A 1 21  ? 11.777  31.230 -5.793  1.00 39.56  ? 20  ARG A CD  1 
ATOM   107  N NE  . ARG A 1 21  ? 12.349  32.116 -4.787  1.00 42.17  ? 20  ARG A NE  1 
ATOM   108  C CZ  . ARG A 1 21  ? 11.800  33.267 -4.424  1.00 45.41  ? 20  ARG A CZ  1 
ATOM   109  N NH1 . ARG A 1 21  ? 10.691  33.663 -5.037  1.00 52.67  ? 20  ARG A NH1 1 
ATOM   110  N NH2 . ARG A 1 21  ? 12.360  34.021 -3.469  1.00 44.53  ? 20  ARG A NH2 1 
ATOM   111  N N   . ILE A 1 22  ? 13.903  28.524 -2.330  1.00 25.79  ? 21  ILE A N   1 
ATOM   112  C CA  . ILE A 1 22  ? 14.410  28.004 -1.055  1.00 23.67  ? 21  ILE A CA  1 
ATOM   113  C C   . ILE A 1 22  ? 13.719  28.806 0.017   1.00 27.41  ? 21  ILE A C   1 
ATOM   114  O O   . ILE A 1 22  ? 13.846  30.036 0.067   1.00 29.53  ? 21  ILE A O   1 
ATOM   115  C CB  . ILE A 1 22  ? 15.943  28.147 -0.905  1.00 28.82  ? 21  ILE A CB  1 
ATOM   116  C CG1 . ILE A 1 22  ? 16.694  27.340 -2.001  1.00 33.86  ? 21  ILE A CG1 1 
ATOM   117  C CG2 . ILE A 1 22  ? 16.347  27.728 0.526   1.00 29.55  ? 21  ILE A CG2 1 
ATOM   118  C CD1 . ILE A 1 22  ? 16.821  25.831 -1.746  1.00 38.06  ? 21  ILE A CD1 1 
ATOM   119  N N   . LEU A 1 23  ? 12.971  28.105 0.847   1.00 28.00  ? 22  LEU A N   1 
ATOM   120  C CA  . LEU A 1 23  ? 12.283  28.681 2.032   1.00 26.44  ? 22  LEU A CA  1 
ATOM   121  C C   . LEU A 1 23  ? 13.011  28.283 3.333   1.00 26.16  ? 22  LEU A C   1 
ATOM   122  O O   . LEU A 1 23  ? 13.229  27.099 3.620   1.00 26.61  ? 22  LEU A O   1 
ATOM   123  C CB  . LEU A 1 23  ? 10.882  28.117 2.142   1.00 26.35  ? 22  LEU A CB  1 
ATOM   124  C CG  . LEU A 1 23  ? 10.052  28.557 3.371   1.00 24.96  ? 22  LEU A CG  1 
ATOM   125  C CD1 . LEU A 1 23  ? 9.730   30.067 3.245   1.00 29.05  ? 22  LEU A CD1 1 
ATOM   126  C CD2 . LEU A 1 23  ? 8.765   27.711 3.425   1.00 29.87  ? 22  LEU A CD2 1 
ATOM   127  N N   . ARG A 1 24  ? 13.346  29.291 4.129   1.00 24.28  ? 23  ARG A N   1 
ATOM   128  C CA  . ARG A 1 24  ? 13.957  29.110 5.429   1.00 24.08  ? 23  ARG A CA  1 
ATOM   129  C C   . ARG A 1 24  ? 12.841  29.108 6.496   1.00 25.01  ? 23  ARG A C   1 
ATOM   130  O O   . ARG A 1 24  ? 12.011  30.040 6.570   1.00 27.76  ? 23  ARG A O   1 
ATOM   131  C CB  . ARG A 1 24  ? 14.897  30.263 5.724   1.00 27.53  ? 23  ARG A CB  1 
ATOM   132  C CG  . ARG A 1 24  ? 15.638  30.156 7.043   1.00 35.59  ? 23  ARG A CG  1 
ATOM   133  C CD  . ARG A 1 24  ? 16.572  31.391 7.169   1.00 50.83  ? 23  ARG A CD  1 
ATOM   134  N NE  . ARG A 1 24  ? 17.413  31.394 8.367   1.00 68.38  ? 23  ARG A NE  1 
ATOM   135  C CZ  . ARG A 1 24  ? 16.993  31.624 9.614   1.00 75.55  ? 23  ARG A CZ  1 
ATOM   136  N NH1 . ARG A 1 24  ? 15.705  31.840 9.898   1.00 72.33  ? 23  ARG A NH1 1 
ATOM   137  N NH2 . ARG A 1 24  ? 17.875  31.603 10.599  1.00 83.57  ? 23  ARG A NH2 1 
ATOM   138  N N   . VAL A 1 25  ? 12.873  28.104 7.352   1.00 22.45  ? 24  VAL A N   1 
ATOM   139  C CA  . VAL A 1 25  ? 11.838  27.921 8.395   1.00 24.33  ? 24  VAL A CA  1 
ATOM   140  C C   . VAL A 1 25  ? 12.548  27.695 9.736   1.00 24.40  ? 24  VAL A C   1 
ATOM   141  O O   . VAL A 1 25  ? 13.418  26.827 9.846   1.00 32.82  ? 24  VAL A O   1 
ATOM   142  C CB  . VAL A 1 25  ? 10.986  26.674 8.092   1.00 25.62  ? 24  VAL A CB  1 
ATOM   143  C CG1 . VAL A 1 25  ? 10.025  26.412 9.241   1.00 25.64  ? 24  VAL A CG1 1 
ATOM   144  C CG2 . VAL A 1 25  ? 10.219  26.803 6.749   1.00 26.54  ? 24  VAL A CG2 1 
ATOM   145  N N   . LYS A 1 26  ? 12.196  28.461 10.758  1.00 24.09  ? 25  LYS A N   1 
ATOM   146  C CA  . LYS A 1 26  ? 12.725  28.218 12.066  1.00 24.74  ? 25  LYS A CA  1 
ATOM   147  C C   . LYS A 1 26  ? 11.530  27.866 12.965  1.00 26.26  ? 25  LYS A C   1 
ATOM   148  O O   . LYS A 1 26  ? 10.557  28.627 13.058  1.00 27.07  ? 25  LYS A O   1 
ATOM   149  C CB  . LYS A 1 26  ? 13.444  29.466 12.602  1.00 27.06  ? 25  LYS A CB  1 
ATOM   150  C CG  . LYS A 1 26  ? 13.868  29.272 14.052  1.00 32.44  ? 25  LYS A CG  1 
ATOM   151  C CD  . LYS A 1 26  ? 14.698  30.470 14.538  1.00 43.33  ? 25  LYS A CD  1 
ATOM   152  C CE  . LYS A 1 26  ? 15.195  30.272 15.964  1.00 52.82  ? 25  LYS A CE  1 
ATOM   153  N NZ  . LYS A 1 26  ? 16.647  29.984 15.888  1.00 67.88  ? 25  LYS A NZ  1 
ATOM   154  N N   . VAL A 1 27  ? 11.610  26.700 13.604  1.00 24.67  ? 26  VAL A N   1 
ATOM   155  C CA  . VAL A 1 27  ? 10.586  26.239 14.539  1.00 23.94  ? 26  VAL A CA  1 
ATOM   156  C C   . VAL A 1 27  ? 11.110  26.701 15.890  1.00 25.17  ? 26  VAL A C   1 
ATOM   157  O O   . VAL A 1 27  ? 12.112  26.168 16.402  1.00 25.52  ? 26  VAL A O   1 
ATOM   158  C CB  . VAL A 1 27  ? 10.406  24.725 14.485  1.00 24.69  ? 26  VAL A CB  1 
ATOM   159  C CG1 . VAL A 1 27  ? 9.439   24.254 15.640  1.00 24.89  ? 26  VAL A CG1 1 
ATOM   160  C CG2 . VAL A 1 27  ? 9.863   24.328 13.085  1.00 25.83  ? 26  VAL A CG2 1 
ATOM   161  N N   . VAL A 1 28  ? 10.511  27.763 16.412  1.00 24.72  ? 27  VAL A N   1 
ATOM   162  C CA  . VAL A 1 28  ? 11.053  28.415 17.651  1.00 24.01  ? 27  VAL A CA  1 
ATOM   163  C C   . VAL A 1 28  ? 10.629  27.666 18.928  1.00 24.61  ? 27  VAL A C   1 
ATOM   164  O O   . VAL A 1 28  ? 11.476  27.162 19.668  1.00 26.56  ? 27  VAL A O   1 
ATOM   165  C CB  . VAL A 1 28  ? 10.665  29.924 17.692  1.00 24.54  ? 27  VAL A CB  1 
ATOM   166  C CG1 . VAL A 1 28  ? 11.082  30.579 19.017  1.00 21.97  ? 27  VAL A CG1 1 
ATOM   167  C CG2 . VAL A 1 28  ? 11.305  30.674 16.531  1.00 27.56  ? 27  VAL A CG2 1 
ATOM   168  N N   . SER A 1 29  ? 9.321   27.564 19.171  1.00 25.51  ? 28  SER A N   1 
ATOM   169  C CA  . SER A 1 29  ? 8.811   27.108 20.461  1.00 25.70  ? 28  SER A CA  1 
ATOM   170  C C   . SER A 1 29  ? 7.344   26.730 20.327  1.00 24.38  ? 28  SER A C   1 
ATOM   171  O O   . SER A 1 29  ? 6.661   27.131 19.351  1.00 23.94  ? 28  SER A O   1 
ATOM   172  C CB  . SER A 1 29  ? 8.935   28.244 21.478  1.00 23.39  ? 28  SER A CB  1 
ATOM   173  O OG  . SER A 1 29  ? 8.068   29.328 21.082  1.00 25.47  ? 28  SER A OG  1 
ATOM   174  N N   . GLY A 1 30  ? 6.870   25.926 21.289  1.00 26.62  ? 29  GLY A N   1 
ATOM   175  C CA  . GLY A 1 30  ? 5.452   25.631 21.438  1.00 25.65  ? 29  GLY A CA  1 
ATOM   176  C C   . GLY A 1 30  ? 5.018   26.277 22.738  1.00 27.89  ? 29  GLY A C   1 
ATOM   177  O O   . GLY A 1 30  ? 5.802   26.331 23.718  1.00 24.85  ? 29  GLY A O   1 
ATOM   178  N N   . ILE A 1 31  ? 3.778   26.746 22.780  1.00 24.71  ? 30  ILE A N   1 
ATOM   179  C CA  . ILE A 1 31  ? 3.359   27.633 23.845  1.00 27.88  ? 30  ILE A CA  1 
ATOM   180  C C   . ILE A 1 31  ? 2.010   27.127 24.371  1.00 27.98  ? 30  ILE A C   1 
ATOM   181  O O   . ILE A 1 31  ? 1.050   27.014 23.588  1.00 27.40  ? 30  ILE A O   1 
ATOM   182  C CB  . ILE A 1 31  ? 3.204   29.111 23.296  1.00 29.74  ? 30  ILE A CB  1 
ATOM   183  C CG1 . ILE A 1 31  ? 4.564   29.713 22.885  1.00 27.39  ? 30  ILE A CG1 1 
ATOM   184  C CG2 . ILE A 1 31  ? 2.494   29.989 24.305  1.00 29.32  ? 30  ILE A CG2 1 
ATOM   185  C CD1 . ILE A 1 31  ? 4.451   30.862 21.801  1.00 28.06  ? 30  ILE A CD1 1 
ATOM   186  N N   . ASP A 1 32  ? 1.943   26.822 25.668  1.00 25.75  ? 31  ASP A N   1 
ATOM   187  C CA  . ASP A 1 32  ? 0.669   26.542 26.321  1.00 28.24  ? 31  ASP A CA  1 
ATOM   188  C C   . ASP A 1 32  ? -0.016  25.293 25.643  1.00 30.62  ? 31  ASP A C   1 
ATOM   189  O O   . ASP A 1 32  ? -1.219  25.316 25.331  1.00 30.20  ? 31  ASP A O   1 
ATOM   190  C CB  . ASP A 1 32  ? -0.234  27.796 26.240  1.00 28.99  ? 31  ASP A CB  1 
ATOM   191  C CG  . ASP A 1 32  ? -1.502  27.674 27.103  1.00 41.72  ? 31  ASP A CG  1 
ATOM   192  O OD1 . ASP A 1 32  ? -1.494  26.864 28.059  1.00 37.85  ? 31  ASP A OD1 1 
ATOM   193  O OD2 . ASP A 1 32  ? -2.507  28.378 26.818  1.00 42.09  ? 31  ASP A OD2 1 
ATOM   194  N N   . LEU A 1 33  ? 0.750   24.217 25.425  1.00 27.60  ? 32  LEU A N   1 
ATOM   195  C CA  . LEU A 1 33  ? 0.212   23.013 24.761  1.00 27.70  ? 32  LEU A CA  1 
ATOM   196  C C   . LEU A 1 33  ? -0.786  22.289 25.661  1.00 30.72  ? 32  LEU A C   1 
ATOM   197  O O   . LEU A 1 33  ? -0.745  22.429 26.889  1.00 30.46  ? 32  LEU A O   1 
ATOM   198  C CB  . LEU A 1 33  ? 1.363   22.074 24.374  1.00 28.00  ? 32  LEU A CB  1 
ATOM   199  C CG  . LEU A 1 33  ? 2.446   22.699 23.489  1.00 26.35  ? 32  LEU A CG  1 
ATOM   200  C CD1 . LEU A 1 33  ? 3.581   21.726 23.238  1.00 24.18  ? 32  LEU A CD1 1 
ATOM   201  C CD2 . LEU A 1 33  ? 1.800   23.221 22.195  1.00 26.82  ? 32  LEU A CD2 1 
ATOM   202  N N   . ALA A 1 34  ? -1.669  21.506 25.044  1.00 32.64  ? 33  ALA A N   1 
ATOM   203  C CA  . ALA A 1 34  ? -2.674  20.742 25.761  1.00 35.62  ? 33  ALA A CA  1 
ATOM   204  C C   . ALA A 1 34  ? -2.003  19.618 26.526  1.00 37.74  ? 33  ALA A C   1 
ATOM   205  O O   . ALA A 1 34  ? -1.093  19.011 26.006  1.00 39.32  ? 33  ALA A O   1 
ATOM   206  C CB  . ALA A 1 34  ? -3.709  20.146 24.765  1.00 36.25  ? 33  ALA A CB  1 
ATOM   207  N N   . LYS A 1 35  ? -2.468  19.346 27.747  1.00 56.79  ? 34  LYS A N   1 
ATOM   208  C CA  . LYS A 1 35  ? -2.060  18.127 28.459  1.00 58.98  ? 34  LYS A CA  1 
ATOM   209  C C   . LYS A 1 35  ? -3.094  17.005 28.237  1.00 62.48  ? 34  LYS A C   1 
ATOM   210  O O   . LYS A 1 35  ? -4.218  17.051 28.761  1.00 71.25  ? 34  LYS A O   1 
ATOM   211  C CB  . LYS A 1 35  ? -1.797  18.405 29.945  1.00 60.28  ? 34  LYS A CB  1 
ATOM   212  C CG  . LYS A 1 35  ? -1.278  17.198 30.747  1.00 63.39  ? 34  LYS A CG  1 
ATOM   213  C CD  . LYS A 1 35  ? 0.214   16.987 30.630  1.00 55.73  ? 34  LYS A CD  1 
ATOM   214  N N   . LYS A 1 36  ? -2.687  16.009 27.449  1.00 62.48  ? 35  LYS A N   1 
ATOM   215  C CA  . LYS A 1 36  ? -3.562  14.902 27.021  1.00 67.98  ? 35  LYS A CA  1 
ATOM   216  C C   . LYS A 1 36  ? -3.536  13.717 28.007  1.00 69.76  ? 35  LYS A C   1 
ATOM   217  O O   . LYS A 1 36  ? -4.558  13.356 28.586  1.00 76.40  ? 35  LYS A O   1 
ATOM   218  C CB  . LYS A 1 36  ? -3.208  14.446 25.586  1.00 63.16  ? 35  LYS A CB  1 
ATOM   219  N N   . ALA A 1 41  ? 3.711   12.200 31.283  1.00 56.06  ? 40  ALA A N   1 
ATOM   220  C CA  . ALA A 1 41  ? 4.794   13.002 30.676  1.00 53.64  ? 40  ALA A CA  1 
ATOM   221  C C   . ALA A 1 41  ? 4.503   13.532 29.286  1.00 48.75  ? 40  ALA A C   1 
ATOM   222  O O   . ALA A 1 41  ? 4.368   12.749 28.322  1.00 49.49  ? 40  ALA A O   1 
ATOM   223  C CB  . ALA A 1 41  ? 6.113   12.227 30.647  1.00 55.73  ? 40  ALA A CB  1 
ATOM   224  N N   . SER A 1 42  ? 4.463   14.860 29.175  1.00 43.31  ? 41  SER A N   1 
ATOM   225  C CA  . SER A 1 42  ? 4.406   15.512 27.870  1.00 38.65  ? 41  SER A CA  1 
ATOM   226  C C   . SER A 1 42  ? 5.813   15.790 27.294  1.00 33.93  ? 41  SER A C   1 
ATOM   227  O O   . SER A 1 42  ? 6.551   16.559 27.872  1.00 31.11  ? 41  SER A O   1 
ATOM   228  C CB  . SER A 1 42  ? 3.617   16.819 27.963  1.00 39.16  ? 41  SER A CB  1 
ATOM   229  O OG  . SER A 1 42  ? 3.665   17.523 26.711  1.00 40.62  ? 41  SER A OG  1 
ATOM   230  N N   . ASP A 1 43  ? 6.139   15.167 26.154  1.00 30.95  ? 42  ASP A N   1 
ATOM   231  C CA  . ASP A 1 43  ? 7.471   15.258 25.513  1.00 29.17  ? 42  ASP A CA  1 
ATOM   232  C C   . ASP A 1 43  ? 7.332   15.665 24.039  1.00 26.22  ? 42  ASP A C   1 
ATOM   233  O O   . ASP A 1 43  ? 7.339   14.826 23.119  1.00 26.28  ? 42  ASP A O   1 
ATOM   234  C CB  . ASP A 1 43  ? 8.227   13.942 25.590  1.00 32.04  ? 42  ASP A CB  1 
ATOM   235  C CG  . ASP A 1 43  ? 8.257   13.347 26.981  1.00 41.52  ? 42  ASP A CG  1 
ATOM   236  O OD1 . ASP A 1 43  ? 8.651   14.015 27.996  1.00 36.89  ? 42  ASP A OD1 1 
ATOM   237  O OD2 . ASP A 1 43  ? 7.907   12.157 27.035  1.00 44.71  ? 42  ASP A OD2 1 
ATOM   238  N N   . PRO A 1 44  ? 7.181   16.966 23.799  1.00 24.35  ? 43  PRO A N   1 
ATOM   239  C CA  . PRO A 1 44  ? 6.839   17.425 22.468  1.00 23.23  ? 43  PRO A CA  1 
ATOM   240  C C   . PRO A 1 44  ? 7.935   17.556 21.414  1.00 24.45  ? 43  PRO A C   1 
ATOM   241  O O   . PRO A 1 44  ? 9.072   17.923 21.704  1.00 25.40  ? 43  PRO A O   1 
ATOM   242  C CB  . PRO A 1 44  ? 6.271   18.801 22.704  1.00 24.25  ? 43  PRO A CB  1 
ATOM   243  C CG  . PRO A 1 44  ? 6.066   18.912 24.206  1.00 29.77  ? 43  PRO A CG  1 
ATOM   244  C CD  . PRO A 1 44  ? 7.174   18.058 24.770  1.00 25.07  ? 43  PRO A CD  1 
ATOM   245  N N   . TYR A 1 45  ? 7.530   17.283 20.183  1.00 23.03  ? 44  TYR A N   1 
ATOM   246  C CA  . TYR A 1 45  ? 8.331   17.580 18.991  1.00 20.96  ? 44  TYR A CA  1 
ATOM   247  C C   . TYR A 1 45  ? 7.366   18.040 17.926  1.00 22.34  ? 44  TYR A C   1 
ATOM   248  O O   . TYR A 1 45  ? 6.142   17.867 18.060  1.00 19.93  ? 44  TYR A O   1 
ATOM   249  C CB  . TYR A 1 45  ? 9.098   16.349 18.506  1.00 19.67  ? 44  TYR A CB  1 
ATOM   250  C CG  . TYR A 1 45  ? 8.246   15.194 17.999  1.00 24.40  ? 44  TYR A CG  1 
ATOM   251  C CD1 . TYR A 1 45  ? 7.861   15.102 16.640  1.00 21.64  ? 44  TYR A CD1 1 
ATOM   252  C CD2 . TYR A 1 45  ? 7.867   14.158 18.850  1.00 22.40  ? 44  TYR A CD2 1 
ATOM   253  C CE1 . TYR A 1 45  ? 7.117   14.000 16.166  1.00 25.55  ? 44  TYR A CE1 1 
ATOM   254  C CE2 . TYR A 1 45  ? 7.105   13.060 18.376  1.00 25.06  ? 44  TYR A CE2 1 
ATOM   255  C CZ  . TYR A 1 45  ? 6.738   12.985 17.028  1.00 23.12  ? 44  TYR A CZ  1 
ATOM   256  O OH  . TYR A 1 45  ? 5.967   11.900 16.566  1.00 24.58  ? 44  TYR A OH  1 
ATOM   257  N N   . VAL A 1 46  ? 7.916   18.662 16.878  1.00 21.58  ? 45  VAL A N   1 
ATOM   258  C CA  . VAL A 1 46  ? 7.131   19.063 15.704  1.00 22.72  ? 45  VAL A CA  1 
ATOM   259  C C   . VAL A 1 46  ? 7.563   18.222 14.502  1.00 21.87  ? 45  VAL A C   1 
ATOM   260  O O   . VAL A 1 46  ? 8.771   18.082 14.218  1.00 23.67  ? 45  VAL A O   1 
ATOM   261  C CB  . VAL A 1 46  ? 7.356   20.546 15.367  1.00 23.44  ? 45  VAL A CB  1 
ATOM   262  C CG1 . VAL A 1 46  ? 6.383   20.971 14.238  1.00 22.01  ? 45  VAL A CG1 1 
ATOM   263  C CG2 . VAL A 1 46  ? 7.079   21.405 16.554  1.00 20.93  ? 45  VAL A CG2 1 
ATOM   264  N N   . LYS A 1 47  ? 6.585   17.659 13.810  1.00 21.32  ? 46  LYS A N   1 
ATOM   265  C CA  . LYS A 1 47  ? 6.810   16.986 12.539  1.00 22.24  ? 46  LYS A CA  1 
ATOM   266  C C   . LYS A 1 47  ? 6.392   17.988 11.446  1.00 25.01  ? 46  LYS A C   1 
ATOM   267  O O   . LYS A 1 47  ? 5.256   18.512 11.442  1.00 26.13  ? 46  LYS A O   1 
ATOM   268  C CB  . LYS A 1 47  ? 5.970   15.701 12.500  1.00 21.94  ? 46  LYS A CB  1 
ATOM   269  C CG  . LYS A 1 47  ? 5.890   15.071 11.154  1.00 26.37  ? 46  LYS A CG  1 
ATOM   270  C CD  . LYS A 1 47  ? 5.140   13.725 11.102  1.00 32.32  ? 46  LYS A CD  1 
ATOM   271  C CE  . LYS A 1 47  ? 5.240   13.081 9.686   1.00 32.87  ? 46  LYS A CE  1 
ATOM   272  N NZ  . LYS A 1 47  ? 4.154   12.012 9.450   1.00 34.80  ? 46  LYS A NZ  1 
ATOM   273  N N   . LEU A 1 48  ? 7.324   18.289 10.546  1.00 22.76  ? 47  LEU A N   1 
ATOM   274  C CA  . LEU A 1 48  ? 7.071   19.186 9.418   1.00 21.64  ? 47  LEU A CA  1 
ATOM   275  C C   . LEU A 1 48  ? 6.882   18.334 8.165   1.00 25.62  ? 47  LEU A C   1 
ATOM   276  O O   . LEU A 1 48  ? 7.750   17.522 7.835   1.00 24.10  ? 47  LEU A O   1 
ATOM   277  C CB  . LEU A 1 48  ? 8.259   20.126 9.208   1.00 23.93  ? 47  LEU A CB  1 
ATOM   278  C CG  . LEU A 1 48  ? 8.563   21.196 10.301  1.00 23.72  ? 47  LEU A CG  1 
ATOM   279  C CD1 . LEU A 1 48  ? 9.170   20.521 11.556  1.00 28.32  ? 47  LEU A CD1 1 
ATOM   280  C CD2 . LEU A 1 48  ? 9.539   22.271 9.746   1.00 24.66  ? 47  LEU A CD2 1 
ATOM   281  N N   . SER A 1 49  ? 5.755   18.529 7.469   1.00 24.17  ? 48  SER A N   1 
ATOM   282  C CA  . SER A 1 49  ? 5.490   17.851 6.204   1.00 22.34  ? 48  SER A CA  1 
ATOM   283  C C   . SER A 1 49  ? 5.281   18.863 5.066   1.00 23.40  ? 48  SER A C   1 
ATOM   284  O O   . SER A 1 49  ? 4.289   19.616 5.050   1.00 23.13  ? 48  SER A O   1 
ATOM   285  C CB  . SER A 1 49  ? 4.224   17.004 6.322   1.00 22.90  ? 48  SER A CB  1 
ATOM   286  O OG  . SER A 1 49  ? 4.287   16.077 7.380   1.00 24.19  ? 48  SER A OG  1 
ATOM   287  N N   . LEU A 1 50  ? 6.195   18.870 4.097   1.00 22.10  ? 49  LEU A N   1 
ATOM   288  C CA  . LEU A 1 50  ? 6.032   19.686 2.901   1.00 21.33  ? 49  LEU A CA  1 
ATOM   289  C C   . LEU A 1 50  ? 5.169   18.833 1.967   1.00 24.09  ? 49  LEU A C   1 
ATOM   290  O O   . LEU A 1 50  ? 5.441   17.631 1.792   1.00 22.89  ? 49  LEU A O   1 
ATOM   291  C CB  . LEU A 1 50  ? 7.433   19.937 2.263   1.00 20.90  ? 49  LEU A CB  1 
ATOM   292  C CG  . LEU A 1 50  ? 7.408   20.639 0.893   1.00 24.76  ? 49  LEU A CG  1 
ATOM   293  C CD1 . LEU A 1 50  ? 6.926   22.100 1.103   1.00 24.72  ? 49  LEU A CD1 1 
ATOM   294  C CD2 . LEU A 1 50  ? 8.779   20.605 0.220   1.00 26.52  ? 49  LEU A CD2 1 
ATOM   295  N N   . TYR A 1 51  ? 4.124   19.409 1.366   1.00 23.68  ? 50  TYR A N   1 
ATOM   296  C CA  . TYR A 1 51  ? 3.258   18.593 0.525   1.00 19.91  ? 50  TYR A CA  1 
ATOM   297  C C   . TYR A 1 51  ? 2.669   19.399 -0.602  1.00 25.26  ? 50  TYR A C   1 
ATOM   298  O O   . TYR A 1 51  ? 2.600   20.630 -0.526  1.00 24.51  ? 50  TYR A O   1 
ATOM   299  C CB  . TYR A 1 51  ? 2.130   17.924 1.364   1.00 21.10  ? 50  TYR A CB  1 
ATOM   300  C CG  . TYR A 1 51  ? 1.031   18.830 1.883   1.00 22.58  ? 50  TYR A CG  1 
ATOM   301  C CD1 . TYR A 1 51  ? -0.157  18.982 1.191   1.00 20.74  ? 50  TYR A CD1 1 
ATOM   302  C CD2 . TYR A 1 51  ? 1.181   19.521 3.100   1.00 26.93  ? 50  TYR A CD2 1 
ATOM   303  C CE1 . TYR A 1 51  ? -1.188  19.822 1.684   1.00 22.56  ? 50  TYR A CE1 1 
ATOM   304  C CE2 . TYR A 1 51  ? 0.182   20.334 3.582   1.00 27.49  ? 50  TYR A CE2 1 
ATOM   305  C CZ  . TYR A 1 51  ? -0.998  20.480 2.856   1.00 27.73  ? 50  TYR A CZ  1 
ATOM   306  O OH  . TYR A 1 51  ? -1.976  21.283 3.351   1.00 28.39  ? 50  TYR A OH  1 
ATOM   307  N N   . VAL A 1 52  ? 2.219   18.708 -1.639  1.00 23.34  ? 51  VAL A N   1 
ATOM   308  C CA  . VAL A 1 52  ? 1.603   19.347 -2.792  1.00 25.19  ? 51  VAL A CA  1 
ATOM   309  C C   . VAL A 1 52  ? 0.127   19.619 -2.469  1.00 24.72  ? 51  VAL A C   1 
ATOM   310  O O   . VAL A 1 52  ? -0.599  18.704 -2.077  1.00 26.90  ? 51  VAL A O   1 
ATOM   311  C CB  . VAL A 1 52  ? 1.706   18.403 -4.045  1.00 23.43  ? 51  VAL A CB  1 
ATOM   312  C CG1 . VAL A 1 52  ? 0.992   19.031 -5.261  1.00 25.41  ? 51  VAL A CG1 1 
ATOM   313  C CG2 . VAL A 1 52  ? 3.174   18.151 -4.373  1.00 25.28  ? 51  VAL A CG2 1 
ATOM   314  N N   . ALA A 1 53  ? -0.334  20.860 -2.653  1.00 26.30  ? 52  ALA A N   1 
ATOM   315  C CA  . ALA A 1 53  ? -1.746  21.164 -2.399  1.00 25.76  ? 52  ALA A CA  1 
ATOM   316  C C   . ALA A 1 53  ? -2.673  20.385 -3.349  1.00 27.32  ? 52  ALA A C   1 
ATOM   317  O O   . ALA A 1 53  ? -2.316  20.150 -4.527  1.00 26.72  ? 52  ALA A O   1 
ATOM   318  C CB  . ALA A 1 53  ? -2.036  22.659 -2.533  1.00 27.74  ? 52  ALA A CB  1 
ATOM   319  N N   . ASP A 1 54  ? -3.860  20.059 -2.834  1.00 30.02  ? 53  ASP A N   1 
ATOM   320  C CA  . ASP A 1 54  ? -4.953  19.381 -3.571  1.00 31.07  ? 53  ASP A CA  1 
ATOM   321  C C   . ASP A 1 54  ? -4.640  17.892 -3.756  1.00 27.04  ? 53  ASP A C   1 
ATOM   322  O O   . ASP A 1 54  ? -5.440  17.037 -3.407  1.00 26.19  ? 53  ASP A O   1 
ATOM   323  C CB  . ASP A 1 54  ? -5.230  20.050 -4.937  1.00 30.45  ? 53  ASP A CB  1 
ATOM   324  C CG  . ASP A 1 54  ? -5.805  21.417 -4.808  1.00 45.34  ? 53  ASP A CG  1 
ATOM   325  O OD1 . ASP A 1 54  ? -6.362  21.727 -3.740  1.00 51.40  ? 53  ASP A OD1 1 
ATOM   326  O OD2 . ASP A 1 54  ? -5.724  22.183 -5.795  1.00 53.75  ? 53  ASP A OD2 1 
ATOM   327  N N   . GLU A 1 55  ? -3.470  17.605 -4.304  1.00 26.75  ? 54  GLU A N   1 
ATOM   328  C CA  . GLU A 1 55  ? -2.958  16.230 -4.404  1.00 27.65  ? 54  GLU A CA  1 
ATOM   329  C C   . GLU A 1 55  ? -2.748  15.638 -2.999  1.00 24.61  ? 54  GLU A C   1 
ATOM   330  O O   . GLU A 1 55  ? -2.871  14.431 -2.825  1.00 25.38  ? 54  GLU A O   1 
ATOM   331  C CB  . GLU A 1 55  ? -1.642  16.169 -5.201  1.00 25.55  ? 54  GLU A CB  1 
ATOM   332  C CG  . GLU A 1 55  ? -1.795  16.512 -6.641  1.00 27.87  ? 54  GLU A CG  1 
ATOM   333  C CD  . GLU A 1 55  ? -0.482  16.436 -7.354  1.00 34.95  ? 54  GLU A CD  1 
ATOM   334  O OE1 . GLU A 1 55  ? 0.445   15.805 -6.813  1.00 33.11  ? 54  GLU A OE1 1 
ATOM   335  O OE2 . GLU A 1 55  ? -0.371  17.014 -8.438  1.00 34.99  ? 54  GLU A OE2 1 
ATOM   336  N N   . ASN A 1 56  ? -2.513  16.493 -2.005  1.00 24.40  ? 55  ASN A N   1 
ATOM   337  C CA  . ASN A 1 56  ? -2.141  16.062 -0.648  1.00 24.71  ? 55  ASN A CA  1 
ATOM   338  C C   . ASN A 1 56  ? -1.075  14.922 -0.703  1.00 25.60  ? 55  ASN A C   1 
ATOM   339  O O   . ASN A 1 56  ? -1.133  13.843 -0.039  1.00 24.72  ? 55  ASN A O   1 
ATOM   340  C CB  . ASN A 1 56  ? -3.369  15.769 0.230   1.00 29.03  ? 55  ASN A CB  1 
ATOM   341  C CG  . ASN A 1 56  ? -4.227  17.004 0.469   1.00 36.21  ? 55  ASN A CG  1 
ATOM   342  O OD1 . ASN A 1 56  ? -5.466  16.950 0.507   1.00 41.13  ? 55  ASN A OD1 1 
ATOM   343  N ND2 . ASN A 1 56  ? -3.589  18.099 0.625   1.00 32.65  ? 55  ASN A ND2 1 
ATOM   344  N N   . ARG A 1 57  ? -0.046  15.238 -1.456  1.00 21.97  ? 56  ARG A N   1 
ATOM   345  C CA  . ARG A 1 57  ? 1.094   14.333 -1.675  1.00 24.40  ? 56  ARG A CA  1 
ATOM   346  C C   . ARG A 1 57  ? 2.345   14.825 -0.939  1.00 23.74  ? 56  ARG A C   1 
ATOM   347  O O   . ARG A 1 57  ? 2.862   15.901 -1.253  1.00 22.70  ? 56  ARG A O   1 
ATOM   348  C CB  . ARG A 1 57  ? 1.399   14.325 -3.173  1.00 27.07  ? 56  ARG A CB  1 
ATOM   349  C CG  . ARG A 1 57  ? 2.641   13.559 -3.514  1.00 32.72  ? 56  ARG A CG  1 
ATOM   350  C CD  . ARG A 1 57  ? 2.748   13.312 -5.000  1.00 35.49  ? 56  ARG A CD  1 
ATOM   351  N NE  . ARG A 1 57  ? 2.845   14.482 -5.876  1.00 35.30  ? 56  ARG A NE  1 
ATOM   352  C CZ  . ARG A 1 57  ? 3.996   14.968 -6.344  1.00 40.52  ? 56  ARG A CZ  1 
ATOM   353  N NH1 . ARG A 1 57  ? 5.155   14.451 -5.955  1.00 35.19  ? 56  ARG A NH1 1 
ATOM   354  N NH2 . ARG A 1 57  ? 3.996   15.988 -7.170  1.00 38.12  ? 56  ARG A NH2 1 
ATOM   355  N N   . GLU A 1 58  ? 2.831   14.056 0.046   1.00 25.47  ? 57  GLU A N   1 
ATOM   356  C CA  . GLU A 1 58  ? 4.047   14.459 0.857   1.00 26.52  ? 57  GLU A CA  1 
ATOM   357  C C   . GLU A 1 58  ? 5.285   14.586 -0.047  1.00 30.52  ? 57  GLU A C   1 
ATOM   358  O O   . GLU A 1 58  ? 5.514   13.697 -0.868  1.00 24.22  ? 57  GLU A O   1 
ATOM   359  C CB  . GLU A 1 58  ? 4.329   13.423 1.919   1.00 33.50  ? 57  GLU A CB  1 
ATOM   360  C CG  . GLU A 1 58  ? 3.122   13.130 2.793   1.00 35.87  ? 57  GLU A CG  1 
ATOM   361  C CD  . GLU A 1 58  ? 3.374   11.985 3.805   1.00 44.32  ? 57  GLU A CD  1 
ATOM   362  O OE1 . GLU A 1 58  ? 3.912   10.924 3.390   1.00 45.59  ? 57  GLU A OE1 1 
ATOM   363  O OE2 . GLU A 1 58  ? 3.026   12.139 5.006   1.00 53.99  ? 57  GLU A OE2 1 
ATOM   364  N N   . LEU A 1 59  ? 6.047   15.704 0.076   1.00 27.41  ? 58  LEU A N   1 
ATOM   365  C CA  . LEU A 1 59  ? 7.345   15.904 -0.653  1.00 24.10  ? 58  LEU A CA  1 
ATOM   366  C C   . LEU A 1 59  ? 8.573   15.840 0.260   1.00 27.83  ? 58  LEU A C   1 
ATOM   367  O O   . LEU A 1 59  ? 9.712   15.688 -0.232  1.00 28.58  ? 58  LEU A O   1 
ATOM   368  C CB  . LEU A 1 59  ? 7.374   17.275 -1.303  1.00 22.85  ? 58  LEU A CB  1 
ATOM   369  C CG  . LEU A 1 59  ? 6.274   17.509 -2.339  1.00 24.29  ? 58  LEU A CG  1 
ATOM   370  C CD1 . LEU A 1 59  ? 6.344   18.947 -2.686  1.00 27.91  ? 58  LEU A CD1 1 
ATOM   371  C CD2 . LEU A 1 59  ? 6.470   16.596 -3.546  1.00 30.95  ? 58  LEU A CD2 1 
ATOM   372  N N   . ALA A 1 60  ? 8.369   16.009 1.571   1.00 21.85  ? 59  ALA A N   1 
ATOM   373  C CA  . ALA A 1 60  ? 9.506   15.974 2.523   1.00 20.54  ? 59  ALA A CA  1 
ATOM   374  C C   . ALA A 1 60  ? 8.979   15.947 3.948   1.00 25.21  ? 59  ALA A C   1 
ATOM   375  O O   . ALA A 1 60  ? 7.998   16.607 4.224   1.00 25.25  ? 59  ALA A O   1 
ATOM   376  C CB  . ALA A 1 60  ? 10.441  17.198 2.357   1.00 22.82  ? 59  ALA A CB  1 
ATOM   377  N N   . LEU A 1 61  ? 9.612   15.140 4.822   1.00 23.43  ? 60  LEU A N   1 
ATOM   378  C CA  . LEU A 1 61  ? 9.118   14.911 6.181   1.00 22.24  ? 60  LEU A CA  1 
ATOM   379  C C   . LEU A 1 61  ? 10.360  14.974 7.055   1.00 24.72  ? 60  LEU A C   1 
ATOM   380  O O   . LEU A 1 61  ? 11.369  14.289 6.780   1.00 24.53  ? 60  LEU A O   1 
ATOM   381  C CB  . LEU A 1 61  ? 8.475   13.521 6.375   1.00 22.67  ? 60  LEU A CB  1 
ATOM   382  C CG  . LEU A 1 61  ? 7.361   13.099 5.428   1.00 28.31  ? 60  LEU A CG  1 
ATOM   383  C CD1 . LEU A 1 61  ? 6.906   11.661 5.835   1.00 33.27  ? 60  LEU A CD1 1 
ATOM   384  C CD2 . LEU A 1 61  ? 6.168   14.096 5.391   1.00 30.44  ? 60  LEU A CD2 1 
ATOM   385  N N   . VAL A 1 62  ? 10.276  15.774 8.102   1.00 25.18  ? 61  VAL A N   1 
ATOM   386  C CA  . VAL A 1 62  ? 11.396  15.888 9.051   1.00 25.27  ? 61  VAL A CA  1 
ATOM   387  C C   . VAL A 1 62  ? 10.809  16.331 10.399  1.00 25.03  ? 61  VAL A C   1 
ATOM   388  O O   . VAL A 1 62  ? 9.718   16.976 10.453  1.00 23.76  ? 61  VAL A O   1 
ATOM   389  C CB  . VAL A 1 62  ? 12.497  16.874 8.567   1.00 28.61  ? 61  VAL A CB  1 
ATOM   390  C CG1 . VAL A 1 62  ? 11.912  18.290 8.488   1.00 24.23  ? 61  VAL A CG1 1 
ATOM   391  C CG2 . VAL A 1 62  ? 13.741  16.824 9.563   1.00 27.64  ? 61  VAL A CG2 1 
ATOM   392  N N   . GLN A 1 63  ? 11.444  15.911 11.485  1.00 24.90  ? 62  GLN A N   1 
ATOM   393  C CA  . GLN A 1 63  ? 10.916  16.306 12.810  1.00 23.32  ? 62  GLN A CA  1 
ATOM   394  C C   . GLN A 1 63  ? 11.962  16.976 13.657  1.00 27.10  ? 62  GLN A C   1 
ATOM   395  O O   . GLN A 1 63  ? 13.159  16.782 13.420  1.00 25.61  ? 62  GLN A O   1 
ATOM   396  C CB  . GLN A 1 63  ? 10.221  15.141 13.504  1.00 26.92  ? 62  GLN A CB  1 
ATOM   397  C CG  . GLN A 1 63  ? 11.030  14.162 14.216  1.00 31.57  ? 62  GLN A CG  1 
ATOM   398  C CD  . GLN A 1 63  ? 10.156  13.013 14.680  1.00 33.76  ? 62  GLN A CD  1 
ATOM   399  O OE1 . GLN A 1 63  ? 9.351   12.466 13.895  1.00 36.20  ? 62  GLN A OE1 1 
ATOM   400  N NE2 . GLN A 1 63  ? 10.294  12.648 15.942  1.00 30.91  ? 62  GLN A NE2 1 
ATOM   401  N N   . THR A 1 64  ? 11.533  17.818 14.588  1.00 22.56  ? 63  THR A N   1 
ATOM   402  C CA  . THR A 1 64  ? 12.478  18.483 15.507  1.00 23.59  ? 63  THR A CA  1 
ATOM   403  C C   . THR A 1 64  ? 12.907  17.466 16.575  1.00 25.48  ? 63  THR A C   1 
ATOM   404  O O   . THR A 1 64  ? 12.312  16.359 16.669  1.00 23.82  ? 63  THR A O   1 
ATOM   405  C CB  . THR A 1 64  ? 11.792  19.639 16.239  1.00 23.33  ? 63  THR A CB  1 
ATOM   406  O OG1 . THR A 1 64  ? 10.754  19.109 17.097  1.00 21.24  ? 63  THR A OG1 1 
ATOM   407  C CG2 . THR A 1 64  ? 11.230  20.696 15.280  1.00 25.63  ? 63  THR A CG2 1 
ATOM   408  N N   A LYS A 1 65  ? 13.885  17.837 17.392  0.50 25.26  ? 64  LYS A N   1 
ATOM   409  N N   B LYS A 1 65  ? 13.895  17.826 17.393  0.50 26.13  ? 64  LYS A N   1 
ATOM   410  C CA  A LYS A 1 65  ? 14.156  17.104 18.627  0.50 26.04  ? 64  LYS A CA  1 
ATOM   411  C CA  B LYS A 1 65  ? 14.173  17.050 18.607  0.50 27.85  ? 64  LYS A CA  1 
ATOM   412  C C   A LYS A 1 65  ? 12.906  17.051 19.524  0.50 26.04  ? 64  LYS A C   1 
ATOM   413  C C   B LYS A 1 65  ? 12.970  17.091 19.575  0.50 27.31  ? 64  LYS A C   1 
ATOM   414  O O   A LYS A 1 65  ? 12.006  17.906 19.443  0.50 22.83  ? 64  LYS A O   1 
ATOM   415  O O   B LYS A 1 65  ? 12.148  18.031 19.566  0.50 24.21  ? 64  LYS A O   1 
ATOM   416  C CB  A LYS A 1 65  ? 15.313  17.746 19.393  0.50 28.64  ? 64  LYS A CB  1 
ATOM   417  C CB  B LYS A 1 65  ? 15.493  17.469 19.293  0.50 31.04  ? 64  LYS A CB  1 
ATOM   418  C CG  A LYS A 1 65  ? 14.926  18.977 20.224  0.50 30.47  ? 64  LYS A CG  1 
ATOM   419  C CG  B LYS A 1 65  ? 15.394  18.600 20.317  0.50 36.28  ? 64  LYS A CG  1 
ATOM   420  C CD  A LYS A 1 65  ? 16.160  19.568 20.985  0.50 30.71  ? 64  LYS A CD  1 
ATOM   421  C CD  B LYS A 1 65  ? 16.722  18.810 21.123  0.50 34.74  ? 64  LYS A CD  1 
ATOM   422  C CE  A LYS A 1 65  ? 17.065  20.365 20.042  0.50 30.64  ? 64  LYS A CE  1 
ATOM   423  C CE  B LYS A 1 65  ? 16.751  18.042 22.456  0.50 42.15  ? 64  LYS A CE  1 
ATOM   424  N NZ  A LYS A 1 65  ? 16.312  21.531 19.507  0.50 26.57  ? 64  LYS A NZ  1 
ATOM   425  N NZ  B LYS A 1 65  ? 17.992  18.349 23.281  0.50 39.15  ? 64  LYS A NZ  1 
ATOM   426  N N   . THR A 1 66  ? 12.875  16.064 20.415  1.00 25.88  ? 65  THR A N   1 
ATOM   427  C CA  . THR A 1 66  ? 11.836  15.995 21.428  1.00 24.36  ? 65  THR A CA  1 
ATOM   428  C C   . THR A 1 66  ? 12.311  16.736 22.659  1.00 26.91  ? 65  THR A C   1 
ATOM   429  O O   . THR A 1 66  ? 13.423  16.505 23.095  1.00 30.52  ? 65  THR A O   1 
ATOM   430  C CB  . THR A 1 66  ? 11.573  14.506 21.733  1.00 25.98  ? 65  THR A CB  1 
ATOM   431  O OG1 . THR A 1 66  ? 11.044  13.925 20.534  1.00 28.98  ? 65  THR A OG1 1 
ATOM   432  C CG2 . THR A 1 66  ? 10.670  14.320 22.992  1.00 28.29  ? 65  THR A CG2 1 
ATOM   433  N N   . ILE A 1 67  ? 11.500  17.633 23.217  1.00 27.88  ? 66  ILE A N   1 
ATOM   434  C CA  . ILE A 1 67  ? 11.878  18.229 24.516  1.00 27.71  ? 66  ILE A CA  1 
ATOM   435  C C   . ILE A 1 67  ? 11.134  17.459 25.616  1.00 29.27  ? 66  ILE A C   1 
ATOM   436  O O   . ILE A 1 67  ? 9.919   17.294 25.527  1.00 28.21  ? 66  ILE A O   1 
ATOM   437  C CB  . ILE A 1 67  ? 11.523  19.746 24.644  1.00 27.37  ? 66  ILE A CB  1 
ATOM   438  C CG1 . ILE A 1 67  ? 11.993  20.595 23.431  1.00 30.70  ? 66  ILE A CG1 1 
ATOM   439  C CG2 . ILE A 1 67  ? 11.944  20.302 26.021  1.00 30.78  ? 66  ILE A CG2 1 
ATOM   440  C CD1 . ILE A 1 67  ? 13.450  20.462 23.081  1.00 31.91  ? 66  ILE A CD1 1 
ATOM   441  N N   . LYS A 1 68  ? 11.841  17.042 26.669  1.00 27.53  ? 67  LYS A N   1 
ATOM   442  C CA  . LYS A 1 68  ? 11.231  16.191 27.730  1.00 29.26  ? 67  LYS A CA  1 
ATOM   443  C C   . LYS A 1 68  ? 10.379  16.979 28.708  1.00 31.43  ? 67  LYS A C   1 
ATOM   444  O O   . LYS A 1 68  ? 10.802  18.063 29.136  1.00 30.80  ? 67  LYS A O   1 
ATOM   445  C CB  . LYS A 1 68  ? 12.345  15.504 28.551  1.00 36.37  ? 67  LYS A CB  1 
ATOM   446  C CG  . LYS A 1 68  ? 13.196  14.523 27.771  1.00 39.17  ? 67  LYS A CG  1 
ATOM   447  C CD  . LYS A 1 68  ? 12.359  13.535 27.021  1.00 41.32  ? 67  LYS A CD  1 
ATOM   448  C CE  . LYS A 1 68  ? 13.159  12.296 26.691  1.00 48.58  ? 67  LYS A CE  1 
ATOM   449  N NZ  . LYS A 1 68  ? 12.297  11.433 25.856  1.00 54.35  ? 67  LYS A NZ  1 
ATOM   450  N N   . LYS A 1 69  ? 9.211   16.442 29.092  1.00 29.42  ? 68  LYS A N   1 
ATOM   451  C CA  . LYS A 1 69  ? 8.463   16.953 30.258  1.00 31.83  ? 68  LYS A CA  1 
ATOM   452  C C   . LYS A 1 69  ? 8.183   18.482 30.274  1.00 33.75  ? 68  LYS A C   1 
ATOM   453  O O   . LYS A 1 69  ? 8.605   19.215 31.183  1.00 32.62  ? 68  LYS A O   1 
ATOM   454  C CB  . LYS A 1 69  ? 9.086   16.476 31.579  1.00 37.74  ? 68  LYS A CB  1 
ATOM   455  C CG  . LYS A 1 69  ? 8.893   14.965 31.815  1.00 44.36  ? 68  LYS A CG  1 
ATOM   456  N N   . THR A 1 70  ? 7.443   18.943 29.274  1.00 31.29  ? 69  THR A N   1 
ATOM   457  C CA  . THR A 1 70  ? 7.105   20.361 29.162  1.00 30.12  ? 69  THR A CA  1 
ATOM   458  C C   . THR A 1 70  ? 5.833   20.520 28.329  1.00 29.04  ? 69  THR A C   1 
ATOM   459  O O   . THR A 1 70  ? 5.556   19.698 27.427  1.00 29.89  ? 69  THR A O   1 
ATOM   460  C CB  . THR A 1 70  ? 8.267   21.159 28.508  1.00 26.45  ? 69  THR A CB  1 
ATOM   461  O OG1 . THR A 1 70  ? 7.947   22.555 28.530  1.00 32.94  ? 69  THR A OG1 1 
ATOM   462  C CG2 . THR A 1 70  ? 8.503   20.709 27.035  1.00 30.02  ? 69  THR A CG2 1 
ATOM   463  N N   . LEU A 1 71  ? 5.070   21.580 28.609  1.00 28.39  ? 70  LEU A N   1 
ATOM   464  C CA  . LEU A 1 71  ? 4.010   22.047 27.715  1.00 28.54  ? 70  LEU A CA  1 
ATOM   465  C C   . LEU A 1 71  ? 4.457   23.382 27.048  1.00 27.87  ? 70  LEU A C   1 
ATOM   466  O O   . LEU A 1 71  ? 3.687   24.045 26.361  1.00 27.05  ? 70  LEU A O   1 
ATOM   467  C CB  . LEU A 1 71  ? 2.701   22.254 28.494  1.00 30.76  ? 70  LEU A CB  1 
ATOM   468  C CG  . LEU A 1 71  ? 2.142   21.005 29.205  1.00 32.07  ? 70  LEU A CG  1 
ATOM   469  C CD1 . LEU A 1 71  ? 0.971   21.415 30.115  1.00 32.70  ? 70  LEU A CD1 1 
ATOM   470  C CD2 . LEU A 1 71  ? 1.768   19.905 28.209  1.00 35.25  ? 70  LEU A CD2 1 
ATOM   471  N N   . ASN A 1 72  ? 5.721   23.749 27.219  1.00 27.35  ? 71  ASN A N   1 
ATOM   472  C CA  . ASN A 1 72  ? 6.192   25.021 26.668  1.00 26.02  ? 71  ASN A CA  1 
ATOM   473  C C   . ASN A 1 72  ? 7.590   24.880 26.080  1.00 27.37  ? 71  ASN A C   1 
ATOM   474  O O   . ASN A 1 72  ? 8.524   25.539 26.553  1.00 29.48  ? 71  ASN A O   1 
ATOM   475  C CB  . ASN A 1 72  ? 6.176   26.101 27.765  1.00 27.27  ? 71  ASN A CB  1 
ATOM   476  C CG  . ASN A 1 72  ? 4.765   26.409 28.248  1.00 30.07  ? 71  ASN A CG  1 
ATOM   477  O OD1 . ASN A 1 72  ? 4.286   25.800 29.208  1.00 36.98  ? 71  ASN A OD1 1 
ATOM   478  N ND2 . ASN A 1 72  ? 4.071   27.285 27.545  1.00 24.88  ? 71  ASN A ND2 1 
ATOM   479  N N   . PRO A 1 73  ? 7.759   23.943 25.134  1.00 27.36  ? 72  PRO A N   1 
ATOM   480  C CA  . PRO A 1 73  ? 9.058   23.477 24.594  1.00 26.44  ? 72  PRO A CA  1 
ATOM   481  C C   . PRO A 1 73  ? 9.708   24.563 23.761  1.00 29.05  ? 72  PRO A C   1 
ATOM   482  O O   . PRO A 1 73  ? 9.020   25.245 23.010  1.00 25.77  ? 72  PRO A O   1 
ATOM   483  C CB  . PRO A 1 73  ? 8.663   22.320 23.646  1.00 24.11  ? 72  PRO A CB  1 
ATOM   484  C CG  . PRO A 1 73  ? 7.184   22.662 23.263  1.00 24.45  ? 72  PRO A CG  1 
ATOM   485  C CD  . PRO A 1 73  ? 6.613   23.196 24.553  1.00 26.77  ? 72  PRO A CD  1 
ATOM   486  N N   . LYS A 1 74  ? 11.016  24.718 23.893  1.00 28.29  ? 73  LYS A N   1 
ATOM   487  C CA  . LYS A 1 74  ? 11.756  25.650 23.057  1.00 29.25  ? 73  LYS A CA  1 
ATOM   488  C C   . LYS A 1 74  ? 12.625  24.762 22.163  1.00 31.21  ? 73  LYS A C   1 
ATOM   489  O O   . LYS A 1 74  ? 13.552  24.084 22.641  1.00 30.23  ? 73  LYS A O   1 
ATOM   490  C CB  . LYS A 1 74  ? 12.700  26.499 23.893  1.00 33.08  ? 73  LYS A CB  1 
ATOM   491  C CG  . LYS A 1 74  ? 12.165  27.658 24.738  1.00 41.50  ? 73  LYS A CG  1 
ATOM   492  C CD  . LYS A 1 74  ? 10.669  27.839 24.880  1.00 43.01  ? 73  LYS A CD  1 
ATOM   493  C CE  . LYS A 1 74  ? 10.408  28.829 26.048  1.00 41.84  ? 73  LYS A CE  1 
ATOM   494  N NZ  . LYS A 1 74  ? 9.522   28.122 26.990  1.00 43.78  ? 73  LYS A NZ  1 
ATOM   495  N N   . TRP A 1 75  ? 12.325  24.745 20.873  1.00 29.40  ? 74  TRP A N   1 
ATOM   496  C CA  . TRP A 1 75  ? 13.121  23.932 19.954  1.00 25.76  ? 74  TRP A CA  1 
ATOM   497  C C   . TRP A 1 75  ? 14.247  24.725 19.295  1.00 27.62  ? 74  TRP A C   1 
ATOM   498  O O   . TRP A 1 75  ? 15.376  24.229 19.257  1.00 29.75  ? 74  TRP A O   1 
ATOM   499  C CB  . TRP A 1 75  ? 12.262  23.299 18.890  1.00 24.46  ? 74  TRP A CB  1 
ATOM   500  C CG  . TRP A 1 75  ? 11.270  22.303 19.388  1.00 27.31  ? 74  TRP A CG  1 
ATOM   501  C CD1 . TRP A 1 75  ? 11.516  21.030 19.829  1.00 27.91  ? 74  TRP A CD1 1 
ATOM   502  C CD2 . TRP A 1 75  ? 9.849   22.500 19.471  1.00 27.87  ? 74  TRP A CD2 1 
ATOM   503  N NE1 . TRP A 1 75  ? 10.302  20.418 20.194  1.00 25.12  ? 74  TRP A NE1 1 
ATOM   504  C CE2 . TRP A 1 75  ? 9.277   21.298 19.956  1.00 24.93  ? 74  TRP A CE2 1 
ATOM   505  C CE3 . TRP A 1 75  ? 9.009   23.556 19.130  1.00 21.48  ? 74  TRP A CE3 1 
ATOM   506  C CZ2 . TRP A 1 75  ? 7.884   21.138 20.119  1.00 23.63  ? 74  TRP A CZ2 1 
ATOM   507  C CZ3 . TRP A 1 75  ? 7.639   23.416 19.323  1.00 25.77  ? 74  TRP A CZ3 1 
ATOM   508  C CH2 . TRP A 1 75  ? 7.086   22.230 19.817  1.00 21.87  ? 74  TRP A CH2 1 
ATOM   509  N N   . ASN A 1 76  ? 13.963  25.944 18.813  1.00 24.63  ? 75  ASN A N   1 
ATOM   510  C CA  . ASN A 1 76  ? 14.979  26.753 18.088  1.00 28.91  ? 75  ASN A CA  1 
ATOM   511  C C   . ASN A 1 76  ? 15.732  26.019 16.969  1.00 31.18  ? 75  ASN A C   1 
ATOM   512  O O   . ASN A 1 76  ? 16.976  26.064 16.906  1.00 29.97  ? 75  ASN A O   1 
ATOM   513  C CB  . ASN A 1 76  ? 15.991  27.389 19.067  1.00 30.75  ? 75  ASN A CB  1 
ATOM   514  C CG  . ASN A 1 76  ? 15.334  28.407 19.936  1.00 36.73  ? 75  ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 76  ? 15.380  28.329 21.163  1.00 48.60  ? 75  ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 76  ? 14.634  29.342 19.296  1.00 36.69  ? 75  ASN A ND2 1 
ATOM   517  N N   . GLU A 1 77  ? 14.985  25.358 16.097  1.00 27.40  ? 76  GLU A N   1 
ATOM   518  C CA  . GLU A 1 77  ? 15.570  24.552 15.043  1.00 28.09  ? 76  GLU A CA  1 
ATOM   519  C C   . GLU A 1 77  ? 15.254  25.165 13.694  1.00 31.48  ? 76  GLU A C   1 
ATOM   520  O O   . GLU A 1 77  ? 14.144  25.670 13.493  1.00 30.42  ? 76  GLU A O   1 
ATOM   521  C CB  . GLU A 1 77  ? 15.052  23.106 15.113  1.00 24.76  ? 76  GLU A CB  1 
ATOM   522  C CG  . GLU A 1 77  ? 15.608  22.360 16.271  1.00 32.81  ? 76  GLU A CG  1 
ATOM   523  C CD  . GLU A 1 77  ? 15.248  20.878 16.250  1.00 26.78  ? 76  GLU A CD  1 
ATOM   524  O OE1 . GLU A 1 77  ? 15.225  20.296 15.160  1.00 31.59  ? 76  GLU A OE1 1 
ATOM   525  O OE2 . GLU A 1 77  ? 15.107  20.308 17.343  1.00 33.54  ? 76  GLU A OE2 1 
ATOM   526  N N   . GLU A 1 78  ? 16.235  25.111 12.781  1.00 27.52  ? 77  GLU A N   1 
ATOM   527  C CA  . GLU A 1 78  ? 16.123  25.758 11.487  1.00 30.20  ? 77  GLU A CA  1 
ATOM   528  C C   . GLU A 1 78  ? 16.086  24.694 10.413  1.00 29.31  ? 77  GLU A C   1 
ATOM   529  O O   . GLU A 1 78  ? 16.771  23.672 10.523  1.00 29.63  ? 77  GLU A O   1 
ATOM   530  C CB  . GLU A 1 78  ? 17.344  26.681 11.306  1.00 33.35  ? 77  GLU A CB  1 
ATOM   531  C CG  . GLU A 1 78  ? 17.525  27.312 9.962   1.00 38.97  ? 77  GLU A CG  1 
ATOM   532  C CD  . GLU A 1 78  ? 18.877  28.020 9.891   1.00 41.37  ? 77  GLU A CD  1 
ATOM   533  O OE1 . GLU A 1 78  ? 19.941  27.360 9.733   1.00 51.18  ? 77  GLU A OE1 1 
ATOM   534  O OE2 . GLU A 1 78  ? 18.880  29.246 10.056  1.00 44.37  ? 77  GLU A OE2 1 
ATOM   535  N N   . PHE A 1 79  ? 15.289  24.934 9.372   1.00 25.79  ? 78  PHE A N   1 
ATOM   536  C CA  . PHE A 1 79  ? 15.161  24.005 8.242   1.00 25.77  ? 78  PHE A CA  1 
ATOM   537  C C   . PHE A 1 79  ? 15.126  24.824 6.963   1.00 28.36  ? 78  PHE A C   1 
ATOM   538  O O   . PHE A 1 79  ? 14.588  25.931 6.962   1.00 30.85  ? 78  PHE A O   1 
ATOM   539  C CB  . PHE A 1 79  ? 13.854  23.219 8.336   1.00 27.89  ? 78  PHE A CB  1 
ATOM   540  C CG  . PHE A 1 79  ? 13.707  22.419 9.613   1.00 27.33  ? 78  PHE A CG  1 
ATOM   541  C CD1 . PHE A 1 79  ? 14.132  21.110 9.667   1.00 26.78  ? 78  PHE A CD1 1 
ATOM   542  C CD2 . PHE A 1 79  ? 13.186  23.006 10.760  1.00 28.79  ? 78  PHE A CD2 1 
ATOM   543  C CE1 . PHE A 1 79  ? 14.010  20.375 10.851  1.00 29.24  ? 78  PHE A CE1 1 
ATOM   544  C CE2 . PHE A 1 79  ? 13.066  22.279 11.969  1.00 26.15  ? 78  PHE A CE2 1 
ATOM   545  C CZ  . PHE A 1 79  ? 13.496  20.964 11.995  1.00 26.07  ? 78  PHE A CZ  1 
ATOM   546  N N   . TYR A 1 80  ? 15.746  24.326 5.889   1.00 27.79  ? 79  TYR A N   1 
ATOM   547  C CA  . TYR A 1 80  ? 15.593  24.966 4.584   1.00 23.92  ? 79  TYR A CA  1 
ATOM   548  C C   . TYR A 1 80  ? 14.827  23.986 3.713   1.00 24.50  ? 79  TYR A C   1 
ATOM   549  O O   . TYR A 1 80  ? 15.170  22.775 3.686   1.00 26.41  ? 79  TYR A O   1 
ATOM   550  C CB  . TYR A 1 80  ? 16.926  25.247 3.929   1.00 26.64  ? 79  TYR A CB  1 
ATOM   551  C CG  . TYR A 1 80  ? 17.659  26.380 4.590   1.00 31.72  ? 79  TYR A CG  1 
ATOM   552  C CD1 . TYR A 1 80  ? 17.560  27.699 4.093   1.00 32.48  ? 79  TYR A CD1 1 
ATOM   553  C CD2 . TYR A 1 80  ? 18.402  26.146 5.741   1.00 30.15  ? 79  TYR A CD2 1 
ATOM   554  C CE1 . TYR A 1 80  ? 18.245  28.756 4.714   1.00 35.06  ? 79  TYR A CE1 1 
ATOM   555  C CE2 . TYR A 1 80  ? 19.065  27.157 6.354   1.00 36.59  ? 79  TYR A CE2 1 
ATOM   556  C CZ  . TYR A 1 80  ? 18.983  28.468 5.862   1.00 38.78  ? 79  TYR A CZ  1 
ATOM   557  O OH  . TYR A 1 80  ? 19.690  29.458 6.536   1.00 39.69  ? 79  TYR A OH  1 
ATOM   558  N N   . PHE A 1 81  ? 13.753  24.458 3.080   1.00 25.22  ? 80  PHE A N   1 
ATOM   559  C CA  . PHE A 1 81  ? 12.981  23.574 2.171   1.00 20.91  ? 80  PHE A CA  1 
ATOM   560  C C   . PHE A 1 81  ? 13.070  24.050 0.694   1.00 25.35  ? 80  PHE A C   1 
ATOM   561  O O   . PHE A 1 81  ? 13.078  25.247 0.427   1.00 26.53  ? 80  PHE A O   1 
ATOM   562  C CB  . PHE A 1 81  ? 11.500  23.545 2.531   1.00 21.17  ? 80  PHE A CB  1 
ATOM   563  C CG  . PHE A 1 81  ? 11.206  22.792 3.797   1.00 23.30  ? 80  PHE A CG  1 
ATOM   564  C CD1 . PHE A 1 81  ? 10.950  21.430 3.758   1.00 23.27  ? 80  PHE A CD1 1 
ATOM   565  C CD2 . PHE A 1 81  ? 11.228  23.450 5.024   1.00 23.57  ? 80  PHE A CD2 1 
ATOM   566  C CE1 . PHE A 1 81  ? 10.653  20.718 4.963   1.00 24.86  ? 80  PHE A CE1 1 
ATOM   567  C CE2 . PHE A 1 81  ? 10.937  22.761 6.234   1.00 21.68  ? 80  PHE A CE2 1 
ATOM   568  C CZ  . PHE A 1 81  ? 10.711  21.391 6.213   1.00 23.90  ? 80  PHE A CZ  1 
ATOM   569  N N   . ARG A 1 82  ? 13.015  23.114 -0.246  1.00 27.18  ? 81  ARG A N   1 
ATOM   570  C CA  . ARG A 1 82  ? 12.906  23.447 -1.660  1.00 27.59  ? 81  ARG A CA  1 
ATOM   571  C C   . ARG A 1 82  ? 11.418  23.333 -1.981  1.00 30.26  ? 81  ARG A C   1 
ATOM   572  O O   . ARG A 1 82  ? 10.843  22.222 -1.889  1.00 28.64  ? 81  ARG A O   1 
ATOM   573  C CB  . ARG A 1 82  ? 13.674  22.388 -2.478  1.00 29.28  ? 81  ARG A CB  1 
ATOM   574  C CG  . ARG A 1 82  ? 14.070  22.781 -3.833  1.00 33.93  ? 81  ARG A CG  1 
ATOM   575  C CD  . ARG A 1 82  ? 15.050  21.734 -4.405  1.00 35.39  ? 81  ARG A CD  1 
ATOM   576  N NE  . ARG A 1 82  ? 16.430  22.142 -4.183  1.00 39.64  ? 81  ARG A NE  1 
ATOM   577  C CZ  . ARG A 1 82  ? 17.310  21.441 -3.474  1.00 44.96  ? 81  ARG A CZ  1 
ATOM   578  N NH1 . ARG A 1 82  ? 16.956  20.283 -2.933  1.00 43.52  ? 81  ARG A NH1 1 
ATOM   579  N NH2 . ARG A 1 82  ? 18.556  21.878 -3.337  1.00 47.38  ? 81  ARG A NH2 1 
ATOM   580  N N   . VAL A 1 83  ? 10.806  24.447 -2.388  1.00 27.36  ? 82  VAL A N   1 
ATOM   581  C CA  . VAL A 1 83  ? 9.339   24.524 -2.502  1.00 26.47  ? 82  VAL A CA  1 
ATOM   582  C C   . VAL A 1 83  ? 8.880   25.251 -3.770  1.00 27.69  ? 82  VAL A C   1 
ATOM   583  O O   . VAL A 1 83  ? 9.644   26.013 -4.356  1.00 28.11  ? 82  VAL A O   1 
ATOM   584  C CB  . VAL A 1 83  ? 8.692   25.191 -1.252  1.00 23.29  ? 82  VAL A CB  1 
ATOM   585  C CG1 . VAL A 1 83  ? 9.328   24.586 0.067   1.00 24.83  ? 82  VAL A CG1 1 
ATOM   586  C CG2 . VAL A 1 83  ? 8.815   26.747 -1.241  1.00 23.64  ? 82  VAL A CG2 1 
ATOM   587  N N   . ASN A 1 84  ? 7.621   25.000 -4.157  1.00 27.18  ? 83  ASN A N   1 
ATOM   588  C CA  . ASN A 1 84  ? 6.948   25.668 -5.257  1.00 27.20  ? 83  ASN A CA  1 
ATOM   589  C C   . ASN A 1 84  ? 5.951   26.573 -4.519  1.00 28.38  ? 83  ASN A C   1 
ATOM   590  O O   . ASN A 1 84  ? 5.021   26.084 -3.862  1.00 28.05  ? 83  ASN A O   1 
ATOM   591  C CB  . ASN A 1 84  ? 6.227   24.625 -6.152  1.00 28.70  ? 83  ASN A CB  1 
ATOM   592  C CG  . ASN A 1 84  ? 5.428   25.253 -7.243  1.00 33.64  ? 83  ASN A CG  1 
ATOM   593  O OD1 . ASN A 1 84  ? 5.034   26.439 -7.151  1.00 38.73  ? 83  ASN A OD1 1 
ATOM   594  N ND2 . ASN A 1 84  ? 5.194   24.483 -8.330  1.00 36.26  ? 83  ASN A ND2 1 
ATOM   595  N N   . PRO A 1 85  ? 6.180   27.883 -4.550  1.00 30.16  ? 84  PRO A N   1 
ATOM   596  C CA  . PRO A 1 85  ? 5.354   28.733 -3.655  1.00 29.94  ? 84  PRO A CA  1 
ATOM   597  C C   . PRO A 1 85  ? 3.879   28.696 -4.001  1.00 32.67  ? 84  PRO A C   1 
ATOM   598  O O   . PRO A 1 85  ? 3.032   28.884 -3.116  1.00 34.69  ? 84  PRO A O   1 
ATOM   599  C CB  . PRO A 1 85  ? 5.900   30.147 -3.899  1.00 28.52  ? 84  PRO A CB  1 
ATOM   600  C CG  . PRO A 1 85  ? 7.298   29.935 -4.403  1.00 32.91  ? 84  PRO A CG  1 
ATOM   601  C CD  . PRO A 1 85  ? 7.197   28.668 -5.275  1.00 32.56  ? 84  PRO A CD  1 
ATOM   602  N N   . SER A 1 86  ? 3.562   28.473 -5.277  1.00 33.84  ? 85  SER A N   1 
ATOM   603  C CA  . SER A 1 86  ? 2.167   28.556 -5.683  1.00 38.83  ? 85  SER A CA  1 
ATOM   604  C C   . SER A 1 86  ? 1.354   27.271 -5.381  1.00 38.26  ? 85  SER A C   1 
ATOM   605  O O   . SER A 1 86  ? 0.140   27.328 -5.255  1.00 38.81  ? 85  SER A O   1 
ATOM   606  C CB  . SER A 1 86  ? 2.039   29.017 -7.154  1.00 43.60  ? 85  SER A CB  1 
ATOM   607  O OG  . SER A 1 86  ? 2.691   28.089 -8.007  1.00 51.63  ? 85  SER A OG  1 
ATOM   608  N N   . ASN A 1 87  ? 2.025   26.139 -5.244  1.00 33.02  ? 86  ASN A N   1 
ATOM   609  C CA  . ASN A 1 87  ? 1.355   24.812 -5.257  1.00 35.22  ? 86  ASN A CA  1 
ATOM   610  C C   . ASN A 1 87  ? 1.697   23.882 -4.097  1.00 31.60  ? 86  ASN A C   1 
ATOM   611  O O   . ASN A 1 87  ? 1.130   22.782 -3.995  1.00 30.66  ? 86  ASN A O   1 
ATOM   612  C CB  . ASN A 1 87  ? 1.692   24.046 -6.557  1.00 39.50  ? 86  ASN A CB  1 
ATOM   613  C CG  . ASN A 1 87  ? 1.236   24.772 -7.797  1.00 49.67  ? 86  ASN A CG  1 
ATOM   614  O OD1 . ASN A 1 87  ? 0.352   25.634 -7.753  1.00 59.10  ? 86  ASN A OD1 1 
ATOM   615  N ND2 . ASN A 1 87  ? 1.844   24.435 -8.923  1.00 57.85  ? 86  ASN A ND2 1 
ATOM   616  N N   . HIS A 1 88  ? 2.613   24.299 -3.244  1.00 27.05  ? 87  HIS A N   1 
ATOM   617  C CA  . HIS A 1 88  ? 2.978   23.523 -2.056  1.00 28.48  ? 87  HIS A CA  1 
ATOM   618  C C   . HIS A 1 88  ? 2.501   24.216 -0.769  1.00 27.96  ? 87  HIS A C   1 
ATOM   619  O O   . HIS A 1 88  ? 2.222   25.462 -0.741  1.00 28.40  ? 87  HIS A O   1 
ATOM   620  C CB  . HIS A 1 88  ? 4.520   23.313 -1.958  1.00 24.71  ? 87  HIS A CB  1 
ATOM   621  C CG  . HIS A 1 88  ? 5.093   22.531 -3.094  1.00 32.89  ? 87  HIS A CG  1 
ATOM   622  N ND1 . HIS A 1 88  ? 6.460   22.395 -3.289  1.00 24.68  ? 87  HIS A ND1 1 
ATOM   623  C CD2 . HIS A 1 88  ? 4.489   21.874 -4.122  1.00 30.01  ? 87  HIS A CD2 1 
ATOM   624  C CE1 . HIS A 1 88  ? 6.661   21.645 -4.361  1.00 27.12  ? 87  HIS A CE1 1 
ATOM   625  N NE2 . HIS A 1 88  ? 5.484   21.323 -4.890  1.00 28.84  ? 87  HIS A NE2 1 
ATOM   626  N N   . ARG A 1 89  ? 2.405   23.404 0.299   1.00 26.28  ? 88  ARG A N   1 
ATOM   627  C CA  . ARG A 1 89  ? 1.990   23.905 1.612   1.00 22.80  ? 88  ARG A CA  1 
ATOM   628  C C   . ARG A 1 89  ? 2.876   23.212 2.617   1.00 23.81  ? 88  ARG A C   1 
ATOM   629  O O   . ARG A 1 89  ? 3.435   22.144 2.334   1.00 25.38  ? 88  ARG A O   1 
ATOM   630  C CB  . ARG A 1 89  ? 0.516   23.583 1.913   1.00 22.11  ? 88  ARG A CB  1 
ATOM   631  C CG  . ARG A 1 89  ? -0.454  24.153 0.861   1.00 24.95  ? 88  ARG A CG  1 
ATOM   632  C CD  . ARG A 1 89  ? -1.946  23.824 1.171   1.00 28.67  ? 88  ARG A CD  1 
ATOM   633  N NE  . ARG A 1 89  ? -2.350  24.329 2.481   1.00 32.59  ? 88  ARG A NE  1 
ATOM   634  C CZ  . ARG A 1 89  ? -2.964  25.490 2.682   1.00 37.09  ? 88  ARG A CZ  1 
ATOM   635  N NH1 . ARG A 1 89  ? -3.292  26.276 1.654   1.00 35.40  ? 88  ARG A NH1 1 
ATOM   636  N NH2 . ARG A 1 89  ? -3.264  25.858 3.927   1.00 37.23  ? 88  ARG A NH2 1 
ATOM   637  N N   . LEU A 1 90  ? 2.974   23.793 3.799   1.00 23.70  ? 89  LEU A N   1 
ATOM   638  C CA  . LEU A 1 90  ? 3.790   23.149 4.857   1.00 24.23  ? 89  LEU A CA  1 
ATOM   639  C C   . LEU A 1 90  ? 2.891   22.878 6.055   1.00 26.60  ? 89  LEU A C   1 
ATOM   640  O O   . LEU A 1 90  ? 2.242   23.823 6.582   1.00 27.57  ? 89  LEU A O   1 
ATOM   641  C CB  . LEU A 1 90  ? 4.936   24.111 5.212   1.00 25.15  ? 89  LEU A CB  1 
ATOM   642  C CG  . LEU A 1 90  ? 6.216   23.597 5.867   1.00 31.58  ? 89  LEU A CG  1 
ATOM   643  C CD1 . LEU A 1 90  ? 6.650   22.181 5.417   1.00 26.75  ? 89  LEU A CD1 1 
ATOM   644  C CD2 . LEU A 1 90  ? 7.347   24.635 5.695   1.00 29.63  ? 89  LEU A CD2 1 
ATOM   645  N N   . LEU A 1 91  ? 2.776   21.600 6.443   1.00 22.54  ? 90  LEU A N   1 
ATOM   646  C CA  . LEU A 1 91  ? 2.028   21.217 7.626   1.00 21.96  ? 90  LEU A CA  1 
ATOM   647  C C   . LEU A 1 91  ? 2.984   21.075 8.816   1.00 24.45  ? 90  LEU A C   1 
ATOM   648  O O   . LEU A 1 91  ? 4.033   20.403 8.702   1.00 24.29  ? 90  LEU A O   1 
ATOM   649  C CB  . LEU A 1 91  ? 1.314   19.869 7.394   1.00 22.57  ? 90  LEU A CB  1 
ATOM   650  C CG  . LEU A 1 91  ? 0.513   19.278 8.553   1.00 20.84  ? 90  LEU A CG  1 
ATOM   651  C CD1 . LEU A 1 91  ? -0.702  20.175 8.935   1.00 24.36  ? 90  LEU A CD1 1 
ATOM   652  C CD2 . LEU A 1 91  ? -0.029  17.902 8.096   1.00 23.42  ? 90  LEU A CD2 1 
ATOM   653  N N   . PHE A 1 92  ? 2.618   21.683 9.944   1.00 23.68  ? 91  PHE A N   1 
ATOM   654  C CA  . PHE A 1 92  ? 3.388   21.514 11.171  1.00 22.71  ? 91  PHE A CA  1 
ATOM   655  C C   . PHE A 1 92  ? 2.476   20.756 12.136  1.00 24.52  ? 91  PHE A C   1 
ATOM   656  O O   . PHE A 1 92  ? 1.364   21.211 12.391  1.00 24.93  ? 91  PHE A O   1 
ATOM   657  C CB  . PHE A 1 92  ? 3.731   22.881 11.800  1.00 23.00  ? 91  PHE A CB  1 
ATOM   658  C CG  . PHE A 1 92  ? 4.615   23.734 10.954  1.00 21.61  ? 91  PHE A CG  1 
ATOM   659  C CD1 . PHE A 1 92  ? 5.990   23.833 11.204  1.00 22.76  ? 91  PHE A CD1 1 
ATOM   660  C CD2 . PHE A 1 92  ? 4.077   24.446 9.868   1.00 20.65  ? 91  PHE A CD2 1 
ATOM   661  C CE1 . PHE A 1 92  ? 6.826   24.639 10.375  1.00 23.78  ? 91  PHE A CE1 1 
ATOM   662  C CE2 . PHE A 1 92  ? 4.904   25.253 9.036   1.00 24.21  ? 91  PHE A CE2 1 
ATOM   663  C CZ  . PHE A 1 92  ? 6.255   25.364 9.282   1.00 22.39  ? 91  PHE A CZ  1 
ATOM   664  N N   . GLU A 1 93  ? 2.897   19.586 12.621  1.00 22.83  ? 92  GLU A N   1 
ATOM   665  C CA  . GLU A 1 93  ? 2.060   18.866 13.629  1.00 23.25  ? 92  GLU A CA  1 
ATOM   666  C C   . GLU A 1 93  ? 2.875   18.695 14.882  1.00 23.67  ? 92  GLU A C   1 
ATOM   667  O O   . GLU A 1 93  ? 4.048   18.246 14.813  1.00 21.29  ? 92  GLU A O   1 
ATOM   668  C CB  . GLU A 1 93  ? 1.665   17.475 13.138  1.00 23.44  ? 92  GLU A CB  1 
ATOM   669  C CG  . GLU A 1 93  ? 0.732   17.443 11.899  1.00 21.98  ? 92  GLU A CG  1 
ATOM   670  C CD  . GLU A 1 93  ? 0.640   16.027 11.353  1.00 32.21  ? 92  GLU A CD  1 
ATOM   671  O OE1 . GLU A 1 93  ? 1.667   15.507 10.869  1.00 31.88  ? 92  GLU A OE1 1 
ATOM   672  O OE2 . GLU A 1 93  ? -0.440  15.415 11.401  1.00 39.81  ? 92  GLU A OE2 1 
ATOM   673  N N   . VAL A 1 94  ? 2.268   19.014 16.013  1.00 21.77  ? 93  VAL A N   1 
ATOM   674  C CA  . VAL A 1 94  ? 2.956   18.869 17.304  1.00 21.04  ? 93  VAL A CA  1 
ATOM   675  C C   . VAL A 1 94  ? 2.518   17.533 17.896  1.00 21.72  ? 93  VAL A C   1 
ATOM   676  O O   . VAL A 1 94  ? 1.315   17.268 17.976  1.00 24.45  ? 93  VAL A O   1 
ATOM   677  C CB  . VAL A 1 94  ? 2.627   20.037 18.321  1.00 21.95  ? 93  VAL A CB  1 
ATOM   678  C CG1 . VAL A 1 94  ? 3.375   19.883 19.624  1.00 22.47  ? 93  VAL A CG1 1 
ATOM   679  C CG2 . VAL A 1 94  ? 2.915   21.400 17.713  1.00 27.28  ? 93  VAL A CG2 1 
ATOM   680  N N   . PHE A 1 95  ? 3.487   16.729 18.343  1.00 21.08  ? 94  PHE A N   1 
ATOM   681  C CA  . PHE A 1 95  ? 3.185   15.432 18.933  1.00 23.04  ? 94  PHE A CA  1 
ATOM   682  C C   . PHE A 1 95  ? 3.874   15.339 20.273  1.00 24.52  ? 94  PHE A C   1 
ATOM   683  O O   . PHE A 1 95  ? 4.956   15.933 20.472  1.00 23.81  ? 94  PHE A O   1 
ATOM   684  C CB  . PHE A 1 95  ? 3.737   14.324 18.029  1.00 23.45  ? 94  PHE A CB  1 
ATOM   685  C CG  . PHE A 1 95  ? 2.936   14.083 16.799  1.00 24.10  ? 94  PHE A CG  1 
ATOM   686  C CD1 . PHE A 1 95  ? 1.780   13.302 16.858  1.00 27.20  ? 94  PHE A CD1 1 
ATOM   687  C CD2 . PHE A 1 95  ? 3.340   14.627 15.563  1.00 24.83  ? 94  PHE A CD2 1 
ATOM   688  C CE1 . PHE A 1 95  ? 1.025   13.081 15.735  1.00 26.78  ? 94  PHE A CE1 1 
ATOM   689  C CE2 . PHE A 1 95  ? 2.570   14.390 14.394  1.00 26.18  ? 94  PHE A CE2 1 
ATOM   690  C CZ  . PHE A 1 95  ? 1.430   13.600 14.495  1.00 28.02  ? 94  PHE A CZ  1 
ATOM   691  N N   . ASP A 1 96  ? 3.265   14.559 21.155  1.00 24.74  ? 95  ASP A N   1 
ATOM   692  C CA  . ASP A 1 96  ? 3.834   14.152 22.401  1.00 24.87  ? 95  ASP A CA  1 
ATOM   693  C C   . ASP A 1 96  ? 4.435   12.774 22.194  1.00 25.04  ? 95  ASP A C   1 
ATOM   694  O O   . ASP A 1 96  ? 3.719   11.815 21.942  1.00 23.34  ? 95  ASP A O   1 
ATOM   695  C CB  . ASP A 1 96  ? 2.739   14.132 23.502  1.00 28.85  ? 95  ASP A CB  1 
ATOM   696  C CG  . ASP A 1 96  ? 3.166   13.383 24.769  1.00 34.24  ? 95  ASP A CG  1 
ATOM   697  O OD1 . ASP A 1 96  ? 4.384   13.238 25.032  1.00 35.98  ? 95  ASP A OD1 1 
ATOM   698  O OD2 . ASP A 1 96  ? 2.275   12.938 25.526  1.00 46.27  ? 95  ASP A OD2 1 
ATOM   699  N N   . GLU A 1 97  ? 5.759   12.690 22.240  1.00 24.99  ? 96  GLU A N   1 
ATOM   700  C CA  . GLU A 1 97  ? 6.430   11.443 21.944  1.00 25.18  ? 96  GLU A CA  1 
ATOM   701  C C   . GLU A 1 97  ? 6.232   10.454 23.100  1.00 28.55  ? 96  GLU A C   1 
ATOM   702  O O   . GLU A 1 97  ? 6.442   10.796 24.280  1.00 27.77  ? 96  GLU A O   1 
ATOM   703  C CB  . GLU A 1 97  ? 7.923   11.690 21.743  1.00 26.26  ? 96  GLU A CB  1 
ATOM   704  C CG  . GLU A 1 97  ? 8.720   10.433 21.424  1.00 31.79  ? 96  GLU A CG  1 
ATOM   705  C CD  . GLU A 1 97  ? 10.218  10.766 21.340  1.00 35.88  ? 96  GLU A CD  1 
ATOM   706  O OE1 . GLU A 1 97  ? 10.897  10.804 22.367  1.00 50.07  ? 96  GLU A OE1 1 
ATOM   707  O OE2 . GLU A 1 97  ? 10.690  11.037 20.259  1.00 43.15  ? 96  GLU A OE2 1 
ATOM   708  N N   . ASN A 1 98  ? 5.837   9.224  22.763  1.00 26.67  ? 97  ASN A N   1 
ATOM   709  C CA  . ASN A 1 98  ? 5.714   8.152  23.773  1.00 31.28  ? 97  ASN A CA  1 
ATOM   710  C C   . ASN A 1 98  ? 6.502   6.927  23.358  1.00 34.39  ? 97  ASN A C   1 
ATOM   711  O O   . ASN A 1 98  ? 6.677   6.676  22.180  1.00 31.10  ? 97  ASN A O   1 
ATOM   712  C CB  . ASN A 1 98  ? 4.249   7.743  23.971  1.00 35.44  ? 97  ASN A CB  1 
ATOM   713  C CG  . ASN A 1 98  ? 3.368   8.907  24.318  1.00 38.47  ? 97  ASN A CG  1 
ATOM   714  O OD1 . ASN A 1 98  ? 3.639   9.638  25.289  1.00 40.43  ? 97  ASN A OD1 1 
ATOM   715  N ND2 . ASN A 1 98  ? 2.283   9.081  23.555  1.00 34.77  ? 97  ASN A ND2 1 
ATOM   716  N N   . ARG A 1 99  ? 6.977   6.182  24.343  1.00 31.78  ? 98  ARG A N   1 
ATOM   717  C CA  . ARG A 1 99  ? 7.769   4.976  24.125  1.00 38.40  ? 98  ARG A CA  1 
ATOM   718  C C   . ARG A 1 99  ? 6.934   3.746  23.731  1.00 35.32  ? 98  ARG A C   1 
ATOM   719  O O   . ARG A 1 99  ? 7.311   2.973  22.848  1.00 37.29  ? 98  ARG A O   1 
ATOM   720  C CB  . ARG A 1 99  ? 8.507   4.658  25.416  1.00 40.53  ? 98  ARG A CB  1 
ATOM   721  C CG  . ARG A 1 99  ? 9.683   3.770  25.296  1.00 54.07  ? 98  ARG A CG  1 
ATOM   722  C CD  . ARG A 1 99  ? 10.385  3.719  26.646  1.00 62.39  ? 98  ARG A CD  1 
ATOM   723  N NE  . ARG A 1 99  ? 11.395  2.675  26.673  1.00 80.72  ? 98  ARG A NE  1 
ATOM   724  C CZ  . ARG A 1 99  ? 11.231  1.475  27.231  1.00 86.46  ? 98  ARG A CZ  1 
ATOM   725  N NH1 . ARG A 1 99  ? 10.088  1.138  27.820  1.00 85.30  ? 98  ARG A NH1 1 
ATOM   726  N NH2 . ARG A 1 99  ? 12.225  0.607  27.207  1.00 95.83  ? 98  ARG A NH2 1 
ATOM   727  N N   . LEU A 1 100 ? 5.851   3.531  24.454  1.00 30.84  ? 99  LEU A N   1 
ATOM   728  C CA  . LEU A 1 100 ? 5.134   2.270  24.379  1.00 34.16  ? 99  LEU A CA  1 
ATOM   729  C C   . LEU A 1 100 ? 3.750   2.421  23.742  1.00 29.32  ? 99  LEU A C   1 
ATOM   730  O O   . LEU A 1 100 ? 3.028   1.449  23.619  1.00 33.09  ? 99  LEU A O   1 
ATOM   731  C CB  . LEU A 1 100 ? 5.017   1.652  25.775  1.00 37.88  ? 99  LEU A CB  1 
ATOM   732  C CG  . LEU A 1 100 ? 6.343   1.197  26.412  1.00 45.81  ? 99  LEU A CG  1 
ATOM   733  C CD1 . LEU A 1 100 ? 6.125   0.433  27.703  1.00 53.69  ? 99  LEU A CD1 1 
ATOM   734  C CD2 . LEU A 1 100 ? 7.159   0.350  25.432  1.00 47.67  ? 99  LEU A CD2 1 
ATOM   735  N N   . THR A 1 101 ? 3.378   3.646  23.392  1.00 30.40  ? 100 THR A N   1 
ATOM   736  C CA  . THR A 1 101 ? 2.152   3.889  22.639  1.00 25.81  ? 100 THR A CA  1 
ATOM   737  C C   . THR A 1 101 ? 2.478   4.803  21.457  1.00 27.69  ? 100 THR A C   1 
ATOM   738  O O   . THR A 1 101 ? 3.537   5.431  21.413  1.00 26.82  ? 100 THR A O   1 
ATOM   739  C CB  . THR A 1 101 ? 1.055   4.571  23.524  1.00 26.99  ? 100 THR A CB  1 
ATOM   740  O OG1 . THR A 1 101 ? 1.558   5.822  24.048  1.00 28.24  ? 100 THR A OG1 1 
ATOM   741  C CG2 . THR A 1 101 ? 0.609   3.673  24.639  1.00 27.74  ? 100 THR A CG2 1 
ATOM   742  N N   . ARG A 1 102 ? 1.573   4.888  20.486  1.00 26.18  ? 101 ARG A N   1 
ATOM   743  C CA  . ARG A 1 102 ? 1.724   5.862  19.417  1.00 26.52  ? 101 ARG A CA  1 
ATOM   744  C C   . ARG A 1 102 ? 1.877   7.282  19.988  1.00 27.43  ? 101 ARG A C   1 
ATOM   745  O O   . ARG A 1 102 ? 1.233   7.636  20.977  1.00 25.18  ? 101 ARG A O   1 
ATOM   746  C CB  . ARG A 1 102 ? 0.536   5.775  18.463  1.00 26.92  ? 101 ARG A CB  1 
ATOM   747  C CG  . ARG A 1 102 ? 0.811   6.450  17.113  1.00 30.47  ? 101 ARG A CG  1 
ATOM   748  C CD  . ARG A 1 102 ? -0.426  6.480  16.218  1.00 33.23  ? 101 ARG A CD  1 
ATOM   749  N NE  . ARG A 1 102 ? -1.017  5.161  15.902  1.00 27.14  ? 101 ARG A NE  1 
ATOM   750  C CZ  . ARG A 1 102 ? -0.533  4.330  14.993  1.00 37.06  ? 101 ARG A CZ  1 
ATOM   751  N NH1 . ARG A 1 102 ? 0.584   4.642  14.340  1.00 38.18  ? 101 ARG A NH1 1 
ATOM   752  N NH2 . ARG A 1 102 ? -1.139  3.195  14.749  1.00 34.89  ? 101 ARG A NH2 1 
ATOM   753  N N   . ASP A 1 103 ? 2.729   8.093  19.364  1.00 25.91  ? 102 ASP A N   1 
ATOM   754  C CA  . ASP A 1 103 ? 2.870   9.514  19.775  1.00 26.10  ? 102 ASP A CA  1 
ATOM   755  C C   . ASP A 1 103 ? 1.543   10.216 19.655  1.00 28.17  ? 102 ASP A C   1 
ATOM   756  O O   . ASP A 1 103 ? 0.799   10.011 18.671  1.00 28.48  ? 102 ASP A O   1 
ATOM   757  C CB  . ASP A 1 103 ? 3.891   10.215 18.905  1.00 23.41  ? 102 ASP A CB  1 
ATOM   758  C CG  . ASP A 1 103 ? 5.274   9.578  19.019  1.00 30.09  ? 102 ASP A CG  1 
ATOM   759  O OD1 . ASP A 1 103 ? 5.488   8.767  19.944  1.00 32.06  ? 102 ASP A OD1 1 
ATOM   760  O OD2 . ASP A 1 103 ? 6.134   9.884  18.188  1.00 31.20  ? 102 ASP A OD2 1 
ATOM   761  N N   . ASP A 1 104 ? 1.213   11.029 20.656  1.00 27.30  ? 103 ASP A N   1 
ATOM   762  C CA  . ASP A 1 104 ? -0.069  11.741 20.684  1.00 26.65  ? 103 ASP A CA  1 
ATOM   763  C C   . ASP A 1 104 ? -0.090  13.059 19.960  1.00 28.52  ? 103 ASP A C   1 
ATOM   764  O O   . ASP A 1 104 ? 0.727   13.928 20.210  1.00 28.29  ? 103 ASP A O   1 
ATOM   765  C CB  . ASP A 1 104 ? -0.473  12.047 22.114  1.00 31.56  ? 103 ASP A CB  1 
ATOM   766  C CG  . ASP A 1 104 ? -1.439  11.089 22.603  1.00 45.89  ? 103 ASP A CG  1 
ATOM   767  O OD1 . ASP A 1 104 ? -2.595  11.124 22.098  1.00 53.77  ? 103 ASP A OD1 1 
ATOM   768  O OD2 . ASP A 1 104 ? -1.016  10.282 23.444  1.00 50.16  ? 103 ASP A OD2 1 
ATOM   769  N N   . PHE A 1 105 ? -1.087  13.236 19.113  1.00 28.50  ? 104 PHE A N   1 
ATOM   770  C CA  . PHE A 1 105 ? -1.266  14.507 18.426  1.00 25.67  ? 104 PHE A CA  1 
ATOM   771  C C   . PHE A 1 105 ? -1.716  15.671 19.340  1.00 27.41  ? 104 PHE A C   1 
ATOM   772  O O   . PHE A 1 105 ? -2.706  15.547 20.076  1.00 27.90  ? 104 PHE A O   1 
ATOM   773  C CB  . PHE A 1 105 ? -2.268  14.281 17.294  1.00 30.27  ? 104 PHE A CB  1 
ATOM   774  C CG  . PHE A 1 105 ? -2.607  15.518 16.555  1.00 26.46  ? 104 PHE A CG  1 
ATOM   775  C CD1 . PHE A 1 105 ? -1.735  16.024 15.590  1.00 27.42  ? 104 PHE A CD1 1 
ATOM   776  C CD2 . PHE A 1 105 ? -3.806  16.181 16.811  1.00 32.49  ? 104 PHE A CD2 1 
ATOM   777  C CE1 . PHE A 1 105 ? -2.057  17.178 14.856  1.00 26.28  ? 104 PHE A CE1 1 
ATOM   778  C CE2 . PHE A 1 105 ? -4.121  17.350 16.111  1.00 28.35  ? 104 PHE A CE2 1 
ATOM   779  C CZ  . PHE A 1 105 ? -3.246  17.847 15.121  1.00 29.12  ? 104 PHE A CZ  1 
ATOM   780  N N   . LEU A 1 106 ? -1.022  16.817 19.250  1.00 24.63  ? 105 LEU A N   1 
ATOM   781  C CA  . LEU A 1 106 ? -1.343  17.977 20.103  1.00 26.18  ? 105 LEU A CA  1 
ATOM   782  C C   . LEU A 1 106 ? -1.836  19.214 19.346  1.00 26.98  ? 105 LEU A C   1 
ATOM   783  O O   . LEU A 1 106 ? -2.201  20.219 19.964  1.00 32.65  ? 105 LEU A O   1 
ATOM   784  C CB  . LEU A 1 106 ? -0.128  18.375 20.952  1.00 24.96  ? 105 LEU A CB  1 
ATOM   785  C CG  . LEU A 1 106 ? 0.466   17.332 21.894  1.00 29.73  ? 105 LEU A CG  1 
ATOM   786  C CD1 . LEU A 1 106 ? 1.589   18.000 22.700  1.00 31.84  ? 105 LEU A CD1 1 
ATOM   787  C CD2 . LEU A 1 106 ? -0.582  16.700 22.895  1.00 33.53  ? 105 LEU A CD2 1 
ATOM   788  N N   . GLY A 1 107 ? -1.803  19.176 18.016  1.00 22.59  ? 106 GLY A N   1 
ATOM   789  C CA  . GLY A 1 107 ? -2.318  20.289 17.249  1.00 24.32  ? 106 GLY A CA  1 
ATOM   790  C C   . GLY A 1 107 ? -1.523  20.495 15.980  1.00 24.09  ? 106 GLY A C   1 
ATOM   791  O O   . GLY A 1 107 ? -0.397  19.999 15.873  1.00 23.32  ? 106 GLY A O   1 
ATOM   792  N N   . GLN A 1 108 ? -2.081  21.264 15.048  1.00 22.51  ? 107 GLN A N   1 
ATOM   793  C CA  . GLN A 1 108 ? -1.400  21.495 13.793  1.00 21.07  ? 107 GLN A CA  1 
ATOM   794  C C   . GLN A 1 108 ? -1.527  22.921 13.276  1.00 21.09  ? 107 GLN A C   1 
ATOM   795  O O   . GLN A 1 108 ? -2.429  23.661 13.650  1.00 24.48  ? 107 GLN A O   1 
ATOM   796  C CB  . GLN A 1 108 ? -1.922  20.532 12.707  1.00 23.06  ? 107 GLN A CB  1 
ATOM   797  C CG  . GLN A 1 108 ? -3.338  20.913 12.229  1.00 23.03  ? 107 GLN A CG  1 
ATOM   798  C CD  . GLN A 1 108 ? -3.873  19.897 11.230  1.00 32.29  ? 107 GLN A CD  1 
ATOM   799  O OE1 . GLN A 1 108 ? -3.452  18.738 11.237  1.00 33.27  ? 107 GLN A OE1 1 
ATOM   800  N NE2 . GLN A 1 108 ? -4.808  20.316 10.395  1.00 34.49  ? 107 GLN A NE2 1 
ATOM   801  N N   . VAL A 1 109 ? -0.628  23.293 12.372  1.00 21.32  ? 108 VAL A N   1 
ATOM   802  C CA  . VAL A 1 109 ? -0.746  24.561 11.654  1.00 23.36  ? 108 VAL A CA  1 
ATOM   803  C C   . VAL A 1 109 ? -0.439  24.192 10.224  1.00 25.87  ? 108 VAL A C   1 
ATOM   804  O O   . VAL A 1 109 ? 0.575   23.536 9.956   1.00 24.34  ? 108 VAL A O   1 
ATOM   805  C CB  . VAL A 1 109 ? 0.307   25.569 12.138  1.00 24.23  ? 108 VAL A CB  1 
ATOM   806  C CG1 . VAL A 1 109 ? 0.238   26.901 11.328  1.00 26.66  ? 108 VAL A CG1 1 
ATOM   807  C CG2 . VAL A 1 109 ? 0.166   25.830 13.653  1.00 27.21  ? 108 VAL A CG2 1 
ATOM   808  N N   . ASP A 1 110 ? -1.340  24.551 9.307   1.00 27.43  ? 109 ASP A N   1 
ATOM   809  C CA  . ASP A 1 110 ? -1.150  24.213 7.909   1.00 27.97  ? 109 ASP A CA  1 
ATOM   810  C C   . ASP A 1 110 ? -0.963  25.539 7.162   1.00 31.71  ? 109 ASP A C   1 
ATOM   811  O O   . ASP A 1 110 ? -1.875  26.348 7.129   1.00 30.91  ? 109 ASP A O   1 
ATOM   812  C CB  . ASP A 1 110 ? -2.371  23.441 7.387   1.00 31.79  ? 109 ASP A CB  1 
ATOM   813  C CG  . ASP A 1 110 ? -2.121  22.813 6.034   1.00 40.04  ? 109 ASP A CG  1 
ATOM   814  O OD1 . ASP A 1 110 ? -1.977  21.590 5.952   1.00 54.50  ? 109 ASP A OD1 1 
ATOM   815  O OD2 . ASP A 1 110 ? -2.070  23.517 5.060   1.00 39.15  ? 109 ASP A OD2 1 
ATOM   816  N N   . VAL A 1 111 ? 0.217   25.773 6.593   1.00 30.04  ? 110 VAL A N   1 
ATOM   817  C CA  . VAL A 1 111 ? 0.573   27.105 6.027   1.00 32.54  ? 110 VAL A CA  1 
ATOM   818  C C   . VAL A 1 111 ? 0.661   27.069 4.510   1.00 32.35  ? 110 VAL A C   1 
ATOM   819  O O   . VAL A 1 111 ? 1.387   26.244 3.938   1.00 28.27  ? 110 VAL A O   1 
ATOM   820  C CB  . VAL A 1 111 ? 1.923   27.684 6.634   1.00 34.63  ? 110 VAL A CB  1 
ATOM   821  C CG1 . VAL A 1 111 ? 3.073   26.857 6.293   1.00 40.32  ? 110 VAL A CG1 1 
ATOM   822  C CG2 . VAL A 1 111 ? 2.251   29.049 6.118   1.00 34.98  ? 110 VAL A CG2 1 
ATOM   823  N N   . PRO A 1 112 ? -0.065  27.980 3.846   1.00 33.98  ? 111 PRO A N   1 
ATOM   824  C CA  . PRO A 1 112 ? 0.193   28.139 2.406   1.00 32.85  ? 111 PRO A CA  1 
ATOM   825  C C   . PRO A 1 112 ? 1.520   28.889 2.217   1.00 31.25  ? 111 PRO A C   1 
ATOM   826  O O   . PRO A 1 112 ? 1.887   29.752 3.038   1.00 31.46  ? 111 PRO A O   1 
ATOM   827  C CB  . PRO A 1 112 ? -0.979  29.019 1.932   1.00 31.99  ? 111 PRO A CB  1 
ATOM   828  C CG  . PRO A 1 112 ? -1.467  29.737 3.150   1.00 35.35  ? 111 PRO A CG  1 
ATOM   829  C CD  . PRO A 1 112 ? -1.074  28.936 4.363   1.00 36.46  ? 111 PRO A CD  1 
ATOM   830  N N   . LEU A 1 113 ? 2.228   28.612 1.127   1.00 31.44  ? 112 LEU A N   1 
ATOM   831  C CA  . LEU A 1 113 ? 3.531   29.227 0.925   1.00 30.58  ? 112 LEU A CA  1 
ATOM   832  C C   . LEU A 1 113 ? 3.562   30.372 -0.100  1.00 34.56  ? 112 LEU A C   1 
ATOM   833  O O   . LEU A 1 113 ? 4.640   30.912 -0.420  1.00 33.70  ? 112 LEU A O   1 
ATOM   834  C CB  . LEU A 1 113 ? 4.511   28.148 0.507   1.00 26.43  ? 112 LEU A CB  1 
ATOM   835  C CG  . LEU A 1 113 ? 4.538   26.944 1.410   1.00 26.73  ? 112 LEU A CG  1 
ATOM   836  C CD1 . LEU A 1 113 ? 5.465   25.946 0.752   1.00 28.94  ? 112 LEU A CD1 1 
ATOM   837  C CD2 . LEU A 1 113 ? 4.951   27.340 2.868   1.00 27.84  ? 112 LEU A CD2 1 
ATOM   838  N N   . SER A 1 114 ? 2.392   30.746 -0.603  1.00 34.88  ? 113 SER A N   1 
ATOM   839  C CA  . SER A 1 114 ? 2.330   31.674 -1.724  1.00 39.59  ? 113 SER A CA  1 
ATOM   840  C C   . SER A 1 114 ? 2.617   33.125 -1.380  1.00 40.40  ? 113 SER A C   1 
ATOM   841  O O   . SER A 1 114 ? 3.035   33.898 -2.258  1.00 45.03  ? 113 SER A O   1 
ATOM   842  C CB  . SER A 1 114 ? 0.995   31.565 -2.450  1.00 42.33  ? 113 SER A CB  1 
ATOM   843  O OG  . SER A 1 114 ? -0.057  31.629 -1.514  1.00 44.84  ? 113 SER A OG  1 
ATOM   844  N N   . HIS A 1 115 ? 2.372   33.519 -0.135  1.00 39.23  ? 114 HIS A N   1 
ATOM   845  C CA  . HIS A 1 115 ? 2.536   34.927 0.219   1.00 43.68  ? 114 HIS A CA  1 
ATOM   846  C C   . HIS A 1 115 ? 3.449   35.145 1.443   1.00 42.44  ? 114 HIS A C   1 
ATOM   847  O O   . HIS A 1 115 ? 3.241   36.071 2.210   1.00 46.16  ? 114 HIS A O   1 
ATOM   848  C CB  . HIS A 1 115 ? 1.173   35.624 0.416   1.00 44.83  ? 114 HIS A CB  1 
ATOM   849  C CG  . HIS A 1 115 ? 0.242   35.522 -0.765  1.00 53.26  ? 114 HIS A CG  1 
ATOM   850  N ND1 . HIS A 1 115 ? 0.198   36.469 -1.771  1.00 59.51  ? 114 HIS A ND1 1 
ATOM   851  C CD2 . HIS A 1 115 ? -0.707  34.606 -1.079  1.00 56.07  ? 114 HIS A CD2 1 
ATOM   852  C CE1 . HIS A 1 115 ? -0.725  36.133 -2.658  1.00 59.99  ? 114 HIS A CE1 1 
ATOM   853  N NE2 . HIS A 1 115 ? -1.293  35.010 -2.259  1.00 57.41  ? 114 HIS A NE2 1 
ATOM   854  N N   . LEU A 1 116 ? 4.465   34.314 1.606   1.00 37.68  ? 115 LEU A N   1 
ATOM   855  C CA  . LEU A 1 116 ? 5.417   34.472 2.699   1.00 37.57  ? 115 LEU A CA  1 
ATOM   856  C C   . LEU A 1 116 ? 6.412   35.553 2.312   1.00 39.02  ? 115 LEU A C   1 
ATOM   857  O O   . LEU A 1 116 ? 6.634   35.754 1.126   1.00 41.16  ? 115 LEU A O   1 
ATOM   858  C CB  . LEU A 1 116 ? 6.134   33.163 2.970   1.00 34.96  ? 115 LEU A CB  1 
ATOM   859  C CG  . LEU A 1 116 ? 5.184   32.087 3.443   1.00 38.24  ? 115 LEU A CG  1 
ATOM   860  C CD1 . LEU A 1 116 ? 5.914   30.771 3.611   1.00 33.32  ? 115 LEU A CD1 1 
ATOM   861  C CD2 . LEU A 1 116 ? 4.547   32.525 4.742   1.00 37.27  ? 115 LEU A CD2 1 
ATOM   862  N N   . PRO A 1 117 ? 7.015   36.250 3.302   1.00 38.08  ? 116 PRO A N   1 
ATOM   863  C CA  . PRO A 1 117 ? 7.986   37.290 2.950   1.00 38.25  ? 116 PRO A CA  1 
ATOM   864  C C   . PRO A 1 117 ? 9.319   36.712 2.432   1.00 37.10  ? 116 PRO A C   1 
ATOM   865  O O   . PRO A 1 117 ? 9.612   35.517 2.561   1.00 33.00  ? 116 PRO A O   1 
ATOM   866  C CB  . PRO A 1 117 ? 8.232   38.001 4.286   1.00 37.50  ? 116 PRO A CB  1 
ATOM   867  C CG  . PRO A 1 117 ? 8.063   36.956 5.288   1.00 40.21  ? 116 PRO A CG  1 
ATOM   868  C CD  . PRO A 1 117 ? 6.893   36.107 4.771   1.00 39.74  ? 116 PRO A CD  1 
ATOM   869  N N   . THR A 1 118 ? 10.127  37.589 1.865   1.00 39.71  ? 117 THR A N   1 
ATOM   870  C CA  . THR A 1 118 ? 11.401  37.212 1.343   1.00 38.81  ? 117 THR A CA  1 
ATOM   871  C C   . THR A 1 118 ? 12.450  38.000 2.080   1.00 40.22  ? 117 THR A C   1 
ATOM   872  O O   . THR A 1 118 ? 12.328  39.214 2.220   1.00 42.60  ? 117 THR A O   1 
ATOM   873  C CB  . THR A 1 118 ? 11.448  37.508 -0.131  1.00 40.13  ? 117 THR A CB  1 
ATOM   874  O OG1 . THR A 1 118 ? 10.470  36.681 -0.780  1.00 39.65  ? 117 THR A OG1 1 
ATOM   875  C CG2 . THR A 1 118 ? 12.856  37.214 -0.685  1.00 39.49  ? 117 THR A CG2 1 
ATOM   876  N N   . GLU A 1 119 ? 13.505  37.329 2.500   1.00 56.74  ? 118 GLU A N   1 
ATOM   877  C CA  . GLU A 1 119 ? 14.457  37.953 3.378   1.00 57.54  ? 118 GLU A CA  1 
ATOM   878  C C   . GLU A 1 119 ? 15.791  37.248 3.279   1.00 57.89  ? 118 GLU A C   1 
ATOM   879  O O   . GLU A 1 119 ? 15.879  36.046 3.522   1.00 55.13  ? 118 GLU A O   1 
ATOM   880  C CB  . GLU A 1 119 ? 13.898  37.856 4.798   1.00 52.52  ? 118 GLU A CB  1 
ATOM   881  C CG  . GLU A 1 119 ? 14.805  38.277 5.923   1.00 54.25  ? 118 GLU A CG  1 
ATOM   882  C CD  . GLU A 1 119 ? 14.132  38.056 7.258   1.00 56.69  ? 118 GLU A CD  1 
ATOM   883  O OE1 . GLU A 1 119 ? 13.241  38.866 7.624   1.00 61.29  ? 118 GLU A OE1 1 
ATOM   884  O OE2 . GLU A 1 119 ? 14.469  37.046 7.920   1.00 47.29  ? 118 GLU A OE2 1 
ATOM   885  N N   . ASP A 1 120 ? 16.828  37.986 2.910   1.00 65.55  ? 119 ASP A N   1 
ATOM   886  C CA  . ASP A 1 120 ? 18.195  37.503 3.092   1.00 68.73  ? 119 ASP A CA  1 
ATOM   887  C C   . ASP A 1 120 ? 18.430  37.239 4.585   1.00 62.16  ? 119 ASP A C   1 
ATOM   888  O O   . ASP A 1 120 ? 18.146  38.102 5.411   1.00 60.51  ? 119 ASP A O   1 
ATOM   889  C CB  . ASP A 1 120 ? 19.203  38.543 2.568   1.00 77.50  ? 119 ASP A CB  1 
ATOM   890  C CG  . ASP A 1 120 ? 20.627  38.294 3.050   1.00 80.57  ? 119 ASP A CG  1 
ATOM   891  O OD1 . ASP A 1 120 ? 21.255  39.249 3.556   1.00 86.56  ? 119 ASP A OD1 1 
ATOM   892  O OD2 . ASP A 1 120 ? 21.127  37.157 2.919   1.00 84.35  ? 119 ASP A OD2 1 
ATOM   893  N N   . PRO A 1 121 ? 18.962  36.055 4.941   1.00 63.64  ? 120 PRO A N   1 
ATOM   894  C CA  . PRO A 1 121 ? 19.366  35.838 6.343   1.00 62.25  ? 120 PRO A CA  1 
ATOM   895  C C   . PRO A 1 121 ? 20.493  36.791 6.754   1.00 64.79  ? 120 PRO A C   1 
ATOM   896  O O   . PRO A 1 121 ? 20.264  37.731 7.514   1.00 67.67  ? 120 PRO A O   1 
ATOM   897  C CB  . PRO A 1 121 ? 19.885  34.389 6.348   1.00 64.83  ? 120 PRO A CB  1 
ATOM   898  C CG  . PRO A 1 121 ? 19.392  33.764 5.098   1.00 67.96  ? 120 PRO A CG  1 
ATOM   899  C CD  . PRO A 1 121 ? 19.227  34.874 4.097   1.00 69.14  ? 120 PRO A CD  1 
ATOM   900  N N   . TYR A 1 127 ? 12.223  40.037 16.064  1.00 62.97  ? 126 TYR A N   1 
ATOM   901  C CA  . TYR A 1 127 ? 10.851  39.795 16.511  1.00 65.08  ? 126 TYR A CA  1 
ATOM   902  C C   . TYR A 1 127 ? 9.916   39.640 15.312  1.00 59.29  ? 126 TYR A C   1 
ATOM   903  O O   . TYR A 1 127 ? 8.781   40.146 15.320  1.00 62.82  ? 126 TYR A O   1 
ATOM   904  C CB  . TYR A 1 127 ? 10.347  40.958 17.367  1.00 73.74  ? 126 TYR A CB  1 
ATOM   905  C CG  . TYR A 1 127 ? 11.159  41.281 18.591  1.00 81.41  ? 126 TYR A CG  1 
ATOM   906  C CD1 . TYR A 1 127 ? 12.042  42.365 18.595  1.00 84.77  ? 126 TYR A CD1 1 
ATOM   907  C CD2 . TYR A 1 127 ? 11.022  40.531 19.758  1.00 90.03  ? 126 TYR A CD2 1 
ATOM   908  C CE1 . TYR A 1 127 ? 12.790  42.688 19.736  1.00 92.58  ? 126 TYR A CE1 1 
ATOM   909  C CE2 . TYR A 1 127 ? 11.764  40.843 20.904  1.00 98.51  ? 126 TYR A CE2 1 
ATOM   910  C CZ  . TYR A 1 127 ? 12.644  41.919 20.884  1.00 99.80  ? 126 TYR A CZ  1 
ATOM   911  O OH  . TYR A 1 127 ? 13.373  42.222 22.011  1.00 108.43 ? 126 TYR A OH  1 
ATOM   912  N N   . THR A 1 128 ? 10.394  38.942 14.285  1.00 49.99  ? 127 THR A N   1 
ATOM   913  C CA  . THR A 1 128 ? 9.627   38.755 13.055  1.00 44.85  ? 127 THR A CA  1 
ATOM   914  C C   . THR A 1 128 ? 9.002   37.330 12.980  1.00 42.73  ? 127 THR A C   1 
ATOM   915  O O   . THR A 1 128 ? 8.541   36.893 11.915  1.00 41.07  ? 127 THR A O   1 
ATOM   916  C CB  . THR A 1 128 ? 10.492  39.055 11.837  1.00 41.62  ? 127 THR A CB  1 
ATOM   917  O OG1 . THR A 1 128 ? 11.612  38.171 11.841  1.00 43.35  ? 127 THR A OG1 1 
ATOM   918  C CG2 . THR A 1 128 ? 11.012  40.476 11.914  1.00 49.80  ? 127 THR A CG2 1 
ATOM   919  N N   . PHE A 1 129 ? 9.012   36.605 14.096  1.00 40.28  ? 128 PHE A N   1 
ATOM   920  C CA  . PHE A 1 129 ? 8.231   35.373 14.213  1.00 36.22  ? 128 PHE A CA  1 
ATOM   921  C C   . PHE A 1 129 ? 6.728   35.672 14.292  1.00 35.03  ? 128 PHE A C   1 
ATOM   922  O O   . PHE A 1 129 ? 6.334   36.831 14.490  1.00 34.18  ? 128 PHE A O   1 
ATOM   923  C CB  . PHE A 1 129 ? 8.615   34.575 15.477  1.00 35.54  ? 128 PHE A CB  1 
ATOM   924  C CG  . PHE A 1 129 ? 8.505   35.359 16.772  1.00 40.94  ? 128 PHE A CG  1 
ATOM   925  C CD1 . PHE A 1 129 ? 7.263   35.582 17.383  1.00 41.67  ? 128 PHE A CD1 1 
ATOM   926  C CD2 . PHE A 1 129 ? 9.652   35.818 17.415  1.00 44.81  ? 128 PHE A CD2 1 
ATOM   927  C CE1 . PHE A 1 129 ? 7.169   36.304 18.597  1.00 42.36  ? 128 PHE A CE1 1 
ATOM   928  C CE2 . PHE A 1 129 ? 9.572   36.508 18.633  1.00 46.62  ? 128 PHE A CE2 1 
ATOM   929  C CZ  . PHE A 1 129 ? 8.324   36.765 19.216  1.00 44.00  ? 128 PHE A CZ  1 
ATOM   930  N N   . LYS A 1 130 ? 5.900   34.629 14.173  1.00 28.15  ? 129 LYS A N   1 
ATOM   931  C CA  . LYS A 1 130 ? 4.456   34.751 14.367  1.00 31.03  ? 129 LYS A CA  1 
ATOM   932  C C   . LYS A 1 130 ? 4.053   33.569 15.253  1.00 27.05  ? 129 LYS A C   1 
ATOM   933  O O   . LYS A 1 130 ? 4.625   32.493 15.148  1.00 28.48  ? 129 LYS A O   1 
ATOM   934  C CB  . LYS A 1 130 ? 3.683   34.657 13.029  1.00 30.16  ? 129 LYS A CB  1 
ATOM   935  C CG  . LYS A 1 130 ? 3.670   35.894 12.150  1.00 38.94  ? 129 LYS A CG  1 
ATOM   936  N N   . ASP A 1 131 ? 3.076   33.774 16.126  1.00 27.86  ? 130 ASP A N   1 
ATOM   937  C CA  . ASP A 1 131 ? 2.595   32.710 16.971  1.00 26.63  ? 130 ASP A CA  1 
ATOM   938  C C   . ASP A 1 131 ? 1.345   32.166 16.300  1.00 25.86  ? 130 ASP A C   1 
ATOM   939  O O   . ASP A 1 131 ? 0.316   32.855 16.287  1.00 28.52  ? 130 ASP A O   1 
ATOM   940  C CB  . ASP A 1 131 ? 2.250   33.242 18.354  1.00 22.47  ? 130 ASP A CB  1 
ATOM   941  C CG  . ASP A 1 131 ? 3.468   33.445 19.207  1.00 29.95  ? 130 ASP A CG  1 
ATOM   942  O OD1 . ASP A 1 131 ? 4.571   33.052 18.767  1.00 28.89  ? 130 ASP A OD1 1 
ATOM   943  O OD2 . ASP A 1 131 ? 3.345   34.060 20.285  1.00 29.63  ? 130 ASP A OD2 1 
ATOM   944  N N   . PHE A 1 132 ? 1.457   30.988 15.692  1.00 23.32  ? 131 PHE A N   1 
ATOM   945  C CA  . PHE A 1 132 ? 0.316   30.408 14.946  1.00 23.84  ? 131 PHE A CA  1 
ATOM   946  C C   . PHE A 1 132 ? -0.587  29.625 15.910  1.00 23.82  ? 131 PHE A C   1 
ATOM   947  O O   . PHE A 1 132 ? -0.104  28.834 16.745  1.00 26.45  ? 131 PHE A O   1 
ATOM   948  C CB  . PHE A 1 132 ? 0.793   29.513 13.782  1.00 24.16  ? 131 PHE A CB  1 
ATOM   949  C CG  . PHE A 1 132 ? 1.438   30.270 12.643  1.00 27.14  ? 131 PHE A CG  1 
ATOM   950  C CD1 . PHE A 1 132 ? 0.711   30.579 11.490  1.00 26.86  ? 131 PHE A CD1 1 
ATOM   951  C CD2 . PHE A 1 132 ? 2.795   30.658 12.710  1.00 25.38  ? 131 PHE A CD2 1 
ATOM   952  C CE1 . PHE A 1 132 ? 1.277   31.297 10.445  1.00 33.44  ? 131 PHE A CE1 1 
ATOM   953  C CE2 . PHE A 1 132 ? 3.385   31.385 11.655  1.00 29.69  ? 131 PHE A CE2 1 
ATOM   954  C CZ  . PHE A 1 132 ? 2.628   31.692 10.516  1.00 31.95  ? 131 PHE A CZ  1 
ATOM   955  N N   . LEU A 1 133 ? -1.888  29.893 15.835  1.00 23.82  ? 132 LEU A N   1 
ATOM   956  C CA  . LEU A 1 133 ? -2.863  29.165 16.642  1.00 27.04  ? 132 LEU A CA  1 
ATOM   957  C C   . LEU A 1 133 ? -2.870  27.678 16.251  1.00 26.95  ? 132 LEU A C   1 
ATOM   958  O O   . LEU A 1 133 ? -3.110  27.359 15.088  1.00 27.64  ? 132 LEU A O   1 
ATOM   959  C CB  . LEU A 1 133 ? -4.240  29.741 16.372  1.00 28.44  ? 132 LEU A CB  1 
ATOM   960  C CG  . LEU A 1 133 ? -5.346  29.297 17.310  1.00 34.06  ? 132 LEU A CG  1 
ATOM   961  C CD1 . LEU A 1 133 ? -5.113  29.905 18.704  1.00 39.67  ? 132 LEU A CD1 1 
ATOM   962  C CD2 . LEU A 1 133 ? -6.744  29.671 16.748  1.00 40.87  ? 132 LEU A CD2 1 
ATOM   963  N N   . LEU A 1 134 ? -2.598  26.777 17.200  1.00 23.48  ? 133 LEU A N   1 
ATOM   964  C CA  . LEU A 1 134 ? -2.734  25.365 16.911  1.00 21.51  ? 133 LEU A CA  1 
ATOM   965  C C   . LEU A 1 134 ? -4.180  25.010 16.657  1.00 22.49  ? 133 LEU A C   1 
ATOM   966  O O   . LEU A 1 134 ? -5.058  25.465 17.390  1.00 25.96  ? 133 LEU A O   1 
ATOM   967  C CB  . LEU A 1 134 ? -2.154  24.461 18.019  1.00 21.79  ? 133 LEU A CB  1 
ATOM   968  C CG  . LEU A 1 134 ? -0.601  24.570 18.056  1.00 24.88  ? 133 LEU A CG  1 
ATOM   969  C CD1 . LEU A 1 134 ? -0.016  24.107 19.357  1.00 28.49  ? 133 LEU A CD1 1 
ATOM   970  C CD2 . LEU A 1 134 ? 0.069   23.791 16.877  1.00 23.57  ? 133 LEU A CD2 1 
ATOM   971  N N   . ARG A 1 135 ? -4.394  24.158 15.642  1.00 24.51  ? 134 ARG A N   1 
ATOM   972  C CA  . ARG A 1 135 ? -5.742  23.711 15.195  1.00 25.68  ? 134 ARG A CA  1 
ATOM   973  C C   . ARG A 1 135 ? -5.892  22.190 15.383  1.00 26.66  ? 134 ARG A C   1 
ATOM   974  O O   . ARG A 1 135 ? -4.901  21.468 15.217  1.00 25.26  ? 134 ARG A O   1 
ATOM   975  C CB  . ARG A 1 135 ? -5.946  23.997 13.708  1.00 28.35  ? 134 ARG A CB  1 
ATOM   976  C CG  . ARG A 1 135 ? -5.549  25.422 13.201  1.00 38.02  ? 134 ARG A CG  1 
ATOM   977  C CD  . ARG A 1 135 ? -6.672  26.422 13.119  1.00 40.04  ? 134 ARG A CD  1 
ATOM   978  N NE  . ARG A 1 135 ? -7.924  26.009 12.463  1.00 40.66  ? 134 ARG A NE  1 
ATOM   979  C CZ  . ARG A 1 135 ? -8.277  26.218 11.190  1.00 45.18  ? 134 ARG A CZ  1 
ATOM   980  N NH1 . ARG A 1 135 ? -7.469  26.797 10.309  1.00 46.37  ? 134 ARG A NH1 1 
ATOM   981  N NH2 . ARG A 1 135 ? -9.472  25.819 10.778  1.00 54.44  ? 134 ARG A NH2 1 
ATOM   982  N N   . PRO A 1 136 ? -7.147  21.686 15.658  1.00 29.15  ? 135 PRO A N   1 
ATOM   983  C CA  . PRO A 1 136 ? -7.367  20.237 15.752  1.00 30.22  ? 135 PRO A CA  1 
ATOM   984  C C   . PRO A 1 136 ? -7.276  19.556 14.394  1.00 30.54  ? 135 PRO A C   1 
ATOM   985  O O   . PRO A 1 136 ? -7.327  20.235 13.366  1.00 29.38  ? 135 PRO A O   1 
ATOM   986  C CB  . PRO A 1 136 ? -8.790  20.120 16.321  1.00 31.10  ? 135 PRO A CB  1 
ATOM   987  C CG  . PRO A 1 136 ? -9.488  21.384 15.900  1.00 33.98  ? 135 PRO A CG  1 
ATOM   988  C CD  . PRO A 1 136 ? -8.406  22.448 15.850  1.00 29.31  ? 135 PRO A CD  1 
ATOM   989  N N   . ARG A 1 137 ? -7.094  18.239 14.388  1.00 34.37  ? 136 ARG A N   1 
ATOM   990  C CA  . ARG A 1 137 ? -7.110  17.499 13.150  1.00 41.94  ? 136 ARG A CA  1 
ATOM   991  C C   . ARG A 1 137 ? -8.489  17.499 12.547  1.00 45.23  ? 136 ARG A C   1 
ATOM   992  O O   . ARG A 1 137 ? -8.625  17.610 11.332  1.00 47.72  ? 136 ARG A O   1 
ATOM   993  C CB  . ARG A 1 137 ? -6.675  16.045 13.368  1.00 45.73  ? 136 ARG A CB  1 
ATOM   994  C CG  . ARG A 1 137 ? -5.220  15.853 13.078  1.00 47.46  ? 136 ARG A CG  1 
ATOM   995  C CD  . ARG A 1 137 ? -4.750  14.409 13.202  1.00 53.16  ? 136 ARG A CD  1 
ATOM   996  N NE  . ARG A 1 137 ? -3.351  14.317 12.791  1.00 51.57  ? 136 ARG A NE  1 
ATOM   997  C CZ  . ARG A 1 137 ? -2.574  13.257 13.002  1.00 60.95  ? 136 ARG A CZ  1 
ATOM   998  N NH1 . ARG A 1 137 ? -3.054  12.184 13.637  1.00 58.78  ? 136 ARG A NH1 1 
ATOM   999  N NH2 . ARG A 1 137 ? -1.319  13.265 12.576  1.00 61.87  ? 136 ARG A NH2 1 
ATOM   1000 N N   . SER A 1 138 ? -9.510  17.326 13.390  1.00 48.24  ? 137 SER A N   1 
ATOM   1001 C CA  . SER A 1 138 ? -10.900 17.440 12.928  1.00 53.24  ? 137 SER A CA  1 
ATOM   1002 C C   . SER A 1 138 ? -11.620 18.523 13.720  1.00 52.19  ? 137 SER A C   1 
ATOM   1003 O O   . SER A 1 138 ? -11.285 18.788 14.857  1.00 46.84  ? 137 SER A O   1 
ATOM   1004 C CB  . SER A 1 138 ? -11.662 16.101 13.003  1.00 57.77  ? 137 SER A CB  1 
ATOM   1005 O OG  . SER A 1 138 ? -11.790 15.590 14.327  1.00 60.48  ? 137 SER A OG  1 
ATOM   1006 N N   . HIS A 1 139 ? -12.619 19.140 13.099  1.00 50.44  ? 138 HIS A N   1 
ATOM   1007 C CA  . HIS A 1 139 ? -13.510 20.071 13.782  1.00 47.15  ? 138 HIS A CA  1 
ATOM   1008 C C   . HIS A 1 139 ? -14.064 19.495 15.115  1.00 41.26  ? 138 HIS A C   1 
ATOM   1009 O O   . HIS A 1 139 ? -14.515 20.261 15.976  1.00 41.36  ? 138 HIS A O   1 
ATOM   1010 C CB  . HIS A 1 139 ? -14.663 20.408 12.851  1.00 51.08  ? 138 HIS A CB  1 
ATOM   1011 C CG  . HIS A 1 139 ? -15.436 19.207 12.452  1.00 46.47  ? 138 HIS A CG  1 
ATOM   1012 N ND1 . HIS A 1 139 ? -16.505 18.750 13.184  1.00 46.93  ? 138 HIS A ND1 1 
ATOM   1013 C CD2 . HIS A 1 139 ? -15.254 18.320 11.447  1.00 53.56  ? 138 HIS A CD2 1 
ATOM   1014 C CE1 . HIS A 1 139 ? -16.994 17.664 12.606  1.00 52.75  ? 138 HIS A CE1 1 
ATOM   1015 N NE2 . HIS A 1 139 ? -16.240 17.372 11.560  1.00 56.82  ? 138 HIS A NE2 1 
ATOM   1016 N N   . LYS A 1 140 ? -14.043 18.164 15.263  1.00 40.08  ? 139 LYS A N   1 
ATOM   1017 C CA  . LYS A 1 140 ? -14.707 17.458 16.415  1.00 38.30  ? 139 LYS A CA  1 
ATOM   1018 C C   . LYS A 1 140 ? -13.838 17.426 17.664  1.00 37.41  ? 139 LYS A C   1 
ATOM   1019 O O   . LYS A 1 140 ? -14.286 17.015 18.740  1.00 38.00  ? 139 LYS A O   1 
ATOM   1020 C CB  . LYS A 1 140 ? -15.078 16.010 16.046  1.00 39.18  ? 139 LYS A CB  1 
ATOM   1021 C CG  . LYS A 1 140 ? -16.477 15.844 15.576  1.00 41.27  ? 139 LYS A CG  1 
ATOM   1022 C CD  . LYS A 1 140 ? -16.924 14.385 15.599  1.00 49.52  ? 139 LYS A CD  1 
ATOM   1023 C CE  . LYS A 1 140 ? -18.033 14.182 14.594  1.00 48.82  ? 139 LYS A CE  1 
ATOM   1024 N NZ  . LYS A 1 140 ? -18.486 12.767 14.440  1.00 50.67  ? 139 LYS A NZ  1 
ATOM   1025 N N   A SER A 1 141 ? -12.581 17.820 17.523  0.50 35.92  ? 140 SER A N   1 
ATOM   1026 N N   B SER A 1 141 ? -12.596 17.867 17.512  0.50 36.20  ? 140 SER A N   1 
ATOM   1027 C CA  A SER A 1 141 ? -11.664 17.799 18.659  0.50 35.82  ? 140 SER A CA  1 
ATOM   1028 C CA  B SER A 1 141 ? -11.626 17.826 18.600  0.50 36.86  ? 140 SER A CA  1 
ATOM   1029 C C   A SER A 1 141 ? -11.189 19.225 18.971  0.50 35.20  ? 140 SER A C   1 
ATOM   1030 C C   B SER A 1 141 ? -11.195 19.248 18.970  0.50 35.68  ? 140 SER A C   1 
ATOM   1031 O O   A SER A 1 141 ? -11.516 20.162 18.247  0.50 36.80  ? 140 SER A O   1 
ATOM   1032 O O   B SER A 1 141 ? -11.554 20.206 18.288  0.50 37.33  ? 140 SER A O   1 
ATOM   1033 C CB  A SER A 1 141 ? -10.494 16.846 18.396  0.50 36.73  ? 140 SER A CB  1 
ATOM   1034 C CB  B SER A 1 141 ? -10.424 16.976 18.193  0.50 37.56  ? 140 SER A CB  1 
ATOM   1035 O OG  A SER A 1 141 ? -9.895  17.123 17.155  0.50 38.04  ? 140 SER A OG  1 
ATOM   1036 O OG  B SER A 1 141 ? -10.857 15.681 17.840  0.50 46.28  ? 140 SER A OG  1 
ATOM   1037 N N   . ARG A 1 142 ? -10.442 19.400 20.055  1.00 35.81  ? 141 ARG A N   1 
ATOM   1038 C CA  . ARG A 1 142 ? -9.965  20.719 20.427  1.00 33.69  ? 141 ARG A CA  1 
ATOM   1039 C C   . ARG A 1 142 ? -8.554  20.548 20.850  1.00 33.64  ? 141 ARG A C   1 
ATOM   1040 O O   . ARG A 1 142 ? -8.193  19.513 21.391  1.00 35.04  ? 141 ARG A O   1 
ATOM   1041 C CB  . ARG A 1 142 ? -10.769 21.286 21.608  1.00 40.30  ? 141 ARG A CB  1 
ATOM   1042 C CG  . ARG A 1 142 ? -12.277 21.309 21.383  1.00 45.03  ? 141 ARG A CG  1 
ATOM   1043 C CD  . ARG A 1 142 ? -13.004 22.024 22.490  1.00 61.97  ? 141 ARG A CD  1 
ATOM   1044 N NE  . ARG A 1 142 ? -12.682 23.459 22.532  1.00 70.43  ? 141 ARG A NE  1 
ATOM   1045 C CZ  . ARG A 1 142 ? -13.511 24.443 22.164  1.00 79.63  ? 141 ARG A CZ  1 
ATOM   1046 N NH1 . ARG A 1 142 ? -14.737 24.181 21.701  1.00 73.30  ? 141 ARG A NH1 1 
ATOM   1047 N NH2 . ARG A 1 142 ? -13.097 25.707 22.252  1.00 85.06  ? 141 ARG A NH2 1 
ATOM   1048 N N   . VAL A 1 143 ? -7.751  21.573 20.601  1.00 31.09  ? 142 VAL A N   1 
ATOM   1049 C CA  . VAL A 1 143 ? -6.405  21.598 21.085  1.00 29.93  ? 142 VAL A CA  1 
ATOM   1050 C C   . VAL A 1 143 ? -6.270  22.955 21.748  1.00 31.41  ? 142 VAL A C   1 
ATOM   1051 O O   . VAL A 1 143 ? -7.280  23.635 21.956  1.00 36.29  ? 142 VAL A O   1 
ATOM   1052 C CB  . VAL A 1 143 ? -5.414  21.385 19.938  1.00 29.82  ? 142 VAL A CB  1 
ATOM   1053 C CG1 . VAL A 1 143 ? -5.602  19.998 19.347  1.00 27.02  ? 142 VAL A CG1 1 
ATOM   1054 C CG2 . VAL A 1 143 ? -5.601  22.419 18.864  1.00 25.82  ? 142 VAL A CG2 1 
ATOM   1055 N N   . LYS A 1 144 ? -5.058  23.321 22.155  1.00 31.54  ? 143 LYS A N   1 
ATOM   1056 C CA  . LYS A 1 144 ? -4.816  24.654 22.729  1.00 31.44  ? 143 LYS A CA  1 
ATOM   1057 C C   . LYS A 1 144 ? -3.394  25.141 22.397  1.00 30.13  ? 143 LYS A C   1 
ATOM   1058 O O   . LYS A 1 144 ? -2.516  24.383 21.933  1.00 29.50  ? 143 LYS A O   1 
ATOM   1059 C CB  . LYS A 1 144 ? -5.190  24.748 24.213  1.00 39.77  ? 143 LYS A CB  1 
ATOM   1060 C CG  . LYS A 1 144 ? -4.208  24.273 25.209  1.00 38.79  ? 143 LYS A CG  1 
ATOM   1061 C CD  . LYS A 1 144 ? -4.749  24.572 26.613  1.00 47.52  ? 143 LYS A CD  1 
ATOM   1062 C CE  . LYS A 1 144 ? -3.640  24.711 27.580  1.00 55.01  ? 143 LYS A CE  1 
ATOM   1063 N NZ  . LYS A 1 144 ? -4.090  24.572 28.979  1.00 62.94  ? 143 LYS A NZ  1 
ATOM   1064 N N   . GLY A 1 145 ? -3.205  26.438 22.547  1.00 31.36  ? 144 GLY A N   1 
ATOM   1065 C CA  . GLY A 1 145 ? -1.891  27.022 22.477  1.00 26.76  ? 144 GLY A CA  1 
ATOM   1066 C C   . GLY A 1 145 ? -1.453  27.377 21.084  1.00 23.42  ? 144 GLY A C   1 
ATOM   1067 O O   . GLY A 1 145 ? -2.262  27.392 20.092  1.00 23.81  ? 144 GLY A O   1 
ATOM   1068 N N   . PHE A 1 146 ? -0.173  27.715 21.012  1.00 25.16  ? 145 PHE A N   1 
ATOM   1069 C CA  . PHE A 1 146 ? 0.431   28.306 19.788  1.00 24.13  ? 145 PHE A CA  1 
ATOM   1070 C C   . PHE A 1 146 ? 1.755   27.649 19.441  1.00 25.50  ? 145 PHE A C   1 
ATOM   1071 O O   . PHE A 1 146 ? 2.437   27.101 20.295  1.00 26.03  ? 145 PHE A O   1 
ATOM   1072 C CB  . PHE A 1 146 ? 0.690   29.817 19.979  1.00 22.05  ? 145 PHE A CB  1 
ATOM   1073 C CG  . PHE A 1 146 ? -0.552  30.629 20.207  1.00 31.13  ? 145 PHE A CG  1 
ATOM   1074 C CD1 . PHE A 1 146 ? -1.161  31.284 19.151  1.00 29.08  ? 145 PHE A CD1 1 
ATOM   1075 C CD2 . PHE A 1 146 ? -1.096  30.766 21.480  1.00 35.36  ? 145 PHE A CD2 1 
ATOM   1076 C CE1 . PHE A 1 146 ? -2.277  32.044 19.354  1.00 30.01  ? 145 PHE A CE1 1 
ATOM   1077 C CE2 . PHE A 1 146 ? -2.233  31.520 21.697  1.00 36.44  ? 145 PHE A CE2 1 
ATOM   1078 C CZ  . PHE A 1 146 ? -2.828  32.166 20.631  1.00 37.08  ? 145 PHE A CZ  1 
ATOM   1079 N N   . LEU A 1 147 ? 2.137   27.769 18.173  1.00 23.69  ? 146 LEU A N   1 
ATOM   1080 C CA  . LEU A 1 147 ? 3.431   27.340 17.686  1.00 22.85  ? 146 LEU A CA  1 
ATOM   1081 C C   . LEU A 1 147 ? 4.078   28.574 17.084  1.00 24.65  ? 146 LEU A C   1 
ATOM   1082 O O   . LEU A 1 147 ? 3.500   29.252 16.208  1.00 25.90  ? 146 LEU A O   1 
ATOM   1083 C CB  . LEU A 1 147 ? 3.215   26.232 16.619  1.00 24.09  ? 146 LEU A CB  1 
ATOM   1084 C CG  . LEU A 1 147 ? 4.435   25.772 15.828  1.00 25.90  ? 146 LEU A CG  1 
ATOM   1085 C CD1 . LEU A 1 147 ? 5.386   25.046 16.808  1.00 24.74  ? 146 LEU A CD1 1 
ATOM   1086 C CD2 . LEU A 1 147 ? 3.960   24.828 14.676  1.00 25.43  ? 146 LEU A CD2 1 
ATOM   1087 N N   . ARG A 1 148 ? 5.260   28.905 17.607  1.00 24.19  ? 147 ARG A N   1 
ATOM   1088 C CA  . ARG A 1 148 ? 5.972   30.102 17.189  1.00 23.14  ? 147 ARG A CA  1 
ATOM   1089 C C   . ARG A 1 148 ? 6.961   29.742 16.083  1.00 24.30  ? 147 ARG A C   1 
ATOM   1090 O O   . ARG A 1 148 ? 7.882   28.897 16.273  1.00 23.02  ? 147 ARG A O   1 
ATOM   1091 C CB  . ARG A 1 148 ? 6.672   30.705 18.406  1.00 24.06  ? 147 ARG A CB  1 
ATOM   1092 C CG  . ARG A 1 148 ? 7.506   31.922 18.102  1.00 22.48  ? 147 ARG A CG  1 
ATOM   1093 C CD  . ARG A 1 148 ? 7.960   32.573 19.430  1.00 24.38  ? 147 ARG A CD  1 
ATOM   1094 N NE  . ARG A 1 148 ? 6.846   33.266 20.058  1.00 27.92  ? 147 ARG A NE  1 
ATOM   1095 C CZ  . ARG A 1 148 ? 6.968   34.105 21.075  1.00 32.88  ? 147 ARG A CZ  1 
ATOM   1096 N NH1 . ARG A 1 148 ? 8.167   34.321 21.631  1.00 31.91  ? 147 ARG A NH1 1 
ATOM   1097 N NH2 . ARG A 1 148 ? 5.881   34.734 21.528  1.00 33.73  ? 147 ARG A NH2 1 
ATOM   1098 N N   . LEU A 1 149 ? 6.746   30.378 14.921  1.00 22.56  ? 148 LEU A N   1 
ATOM   1099 C CA  . LEU A 1 149 ? 7.492   30.069 13.685  1.00 24.21  ? 148 LEU A CA  1 
ATOM   1100 C C   . LEU A 1 149 ? 8.010   31.325 13.004  1.00 26.30  ? 148 LEU A C   1 
ATOM   1101 O O   . LEU A 1 149 ? 7.402   32.395 13.106  1.00 24.43  ? 148 LEU A O   1 
ATOM   1102 C CB  . LEU A 1 149 ? 6.576   29.393 12.677  1.00 22.37  ? 148 LEU A CB  1 
ATOM   1103 C CG  . LEU A 1 149 ? 5.894   28.078 13.091  1.00 25.58  ? 148 LEU A CG  1 
ATOM   1104 C CD1 . LEU A 1 149 ? 4.865   27.609 12.053  1.00 26.37  ? 148 LEU A CD1 1 
ATOM   1105 C CD2 . LEU A 1 149 ? 6.943   27.000 13.313  1.00 24.63  ? 148 LEU A CD2 1 
ATOM   1106 N N   . LYS A 1 150 ? 9.160   31.211 12.348  1.00 25.80  ? 149 LYS A N   1 
ATOM   1107 C CA  . LYS A 1 150 ? 9.618   32.248 11.474  1.00 32.36  ? 149 LYS A CA  1 
ATOM   1108 C C   . LYS A 1 150 ? 9.824   31.586 10.106  1.00 36.19  ? 149 LYS A C   1 
ATOM   1109 O O   . LYS A 1 150 ? 10.397  30.503 10.000  1.00 33.91  ? 149 LYS A O   1 
ATOM   1110 C CB  . LYS A 1 150 ? 10.937  32.863 12.006  1.00 33.95  ? 149 LYS A CB  1 
ATOM   1111 C CG  . LYS A 1 150 ? 11.411  34.055 11.136  1.00 46.71  ? 149 LYS A CG  1 
ATOM   1112 C CD  . LYS A 1 150 ? 12.909  34.131 11.002  1.00 56.57  ? 149 LYS A CD  1 
ATOM   1113 C CE  . LYS A 1 150 ? 13.297  34.749 9.653   1.00 61.66  ? 149 LYS A CE  1 
ATOM   1114 N NZ  . LYS A 1 150 ? 12.644  36.087 9.459   1.00 63.32  ? 149 LYS A NZ  1 
ATOM   1115 N N   . MET A 1 151 ? 9.343   32.232 9.057   1.00 26.15  ? 150 MET A N   1 
ATOM   1116 C CA  . MET A 1 151 ? 9.448   31.672 7.729   1.00 23.78  ? 150 MET A CA  1 
ATOM   1117 C C   . MET A 1 151 ? 9.644   32.797 6.756   1.00 27.55  ? 150 MET A C   1 
ATOM   1118 O O   . MET A 1 151 ? 8.880   33.795 6.807   1.00 28.27  ? 150 MET A O   1 
ATOM   1119 C CB  . MET A 1 151 ? 8.162   30.899 7.344   1.00 25.24  ? 150 MET A CB  1 
ATOM   1120 C CG  . MET A 1 151 ? 7.775   29.707 8.264   1.00 26.61  ? 150 MET A CG  1 
ATOM   1121 S SD  . MET A 1 151 ? 6.190   29.038 7.767   1.00 31.36  ? 150 MET A SD  1 
ATOM   1122 C CE  . MET A 1 151 ? 5.069   30.097 8.673   1.00 29.82  ? 150 MET A CE  1 
ATOM   1123 N N   . ALA A 1 152 ? 10.649  32.653 5.873   1.00 26.08  ? 151 ALA A N   1 
ATOM   1124 C CA  . ALA A 1 152 ? 10.900  33.645 4.806   1.00 26.98  ? 151 ALA A CA  1 
ATOM   1125 C C   . ALA A 1 152 ? 11.741  33.005 3.683   1.00 26.10  ? 151 ALA A C   1 
ATOM   1126 O O   . ALA A 1 152 ? 12.671  32.219 3.957   1.00 27.82  ? 151 ALA A O   1 
ATOM   1127 C CB  . ALA A 1 152 ? 11.660  34.785 5.384   1.00 25.74  ? 151 ALA A CB  1 
ATOM   1128 N N   . TYR A 1 153 ? 11.454  33.379 2.450   1.00 26.93  ? 152 TYR A N   1 
ATOM   1129 C CA  . TYR A 1 153 ? 12.207  32.886 1.292   1.00 29.19  ? 152 TYR A CA  1 
ATOM   1130 C C   . TYR A 1 153 ? 13.606  33.462 1.266   1.00 32.40  ? 152 TYR A C   1 
ATOM   1131 O O   . TYR A 1 153 ? 13.813  34.617 1.616   1.00 31.84  ? 152 TYR A O   1 
ATOM   1132 C CB  . TYR A 1 153 ? 11.482  33.227 -0.036  1.00 29.65  ? 152 TYR A CB  1 
ATOM   1133 C CG  . TYR A 1 153 ? 10.300  32.329 -0.256  1.00 28.69  ? 152 TYR A CG  1 
ATOM   1134 C CD1 . TYR A 1 153 ? 10.475  31.013 -0.679  1.00 29.60  ? 152 TYR A CD1 1 
ATOM   1135 C CD2 . TYR A 1 153 ? 9.014   32.771 -0.004  1.00 28.00  ? 152 TYR A CD2 1 
ATOM   1136 C CE1 . TYR A 1 153 ? 9.390   30.158 -0.884  1.00 33.79  ? 152 TYR A CE1 1 
ATOM   1137 C CE2 . TYR A 1 153 ? 7.910   31.915 -0.219  1.00 30.78  ? 152 TYR A CE2 1 
ATOM   1138 C CZ  . TYR A 1 153 ? 8.110   30.614 -0.612  1.00 29.71  ? 152 TYR A CZ  1 
ATOM   1139 O OH  . TYR A 1 153 ? 7.014   29.801 -0.824  1.00 30.64  ? 152 TYR A OH  1 
ATOM   1140 N N   . MET A 1 154 ? 14.541  32.645 0.792   1.00 33.41  ? 153 MET A N   1 
ATOM   1141 C CA  . MET A 1 154 ? 15.807  33.146 0.304   1.00 38.86  ? 153 MET A CA  1 
ATOM   1142 C C   . MET A 1 154 ? 15.546  33.973 -0.999  1.00 40.63  ? 153 MET A C   1 
ATOM   1143 O O   . MET A 1 154 ? 14.782  33.537 -1.872  1.00 39.69  ? 153 MET A O   1 
ATOM   1144 C CB  . MET A 1 154 ? 16.751  31.969 0.035   1.00 41.90  ? 153 MET A CB  1 
ATOM   1145 C CG  . MET A 1 154 ? 17.001  31.106 1.248   1.00 43.49  ? 153 MET A CG  1 
ATOM   1146 S SD  . MET A 1 154 ? 17.863  32.029 2.531   1.00 55.99  ? 153 MET A SD  1 
ATOM   1147 C CE  . MET A 1 154 ? 19.422  32.286 1.664   1.00 58.97  ? 153 MET A CE  1 
ATOM   1148 N N   . PRO A 1 155 ? 16.156  35.168 -1.116  1.00 44.91  ? 154 PRO A N   1 
ATOM   1149 C CA  . PRO A 1 155 ? 15.924  36.062 -2.274  1.00 46.78  ? 154 PRO A CA  1 
ATOM   1150 C C   . PRO A 1 155 ? 15.995  35.369 -3.646  1.00 49.01  ? 154 PRO A C   1 
ATOM   1151 O O   . PRO A 1 155 ? 16.929  34.622 -3.903  1.00 51.29  ? 154 PRO A O   1 
ATOM   1152 C CB  . PRO A 1 155 ? 17.042  37.106 -2.157  1.00 52.22  ? 154 PRO A CB  1 
ATOM   1153 C CG  . PRO A 1 155 ? 17.456  37.102 -0.749  1.00 51.70  ? 154 PRO A CG  1 
ATOM   1154 C CD  . PRO A 1 155 ? 17.132  35.737 -0.161  1.00 46.71  ? 154 PRO A CD  1 
HETATM 1155 C C1  . EDO B 2 .   ? 6.627   34.433 10.361  1.00 43.90  ? 155 EDO A C1  1 
HETATM 1156 O O1  . EDO B 2 .   ? 7.965   34.724 9.964   1.00 36.85  ? 155 EDO A O1  1 
HETATM 1157 C C2  . EDO B 2 .   ? 6.007   33.513 9.346   1.00 44.61  ? 155 EDO A C2  1 
HETATM 1158 O O2  . EDO B 2 .   ? 6.103   34.138 8.062   1.00 46.97  ? 155 EDO A O2  1 
HETATM 1159 C C1  . GOL C 3 .   ? 7.127   6.193  18.727  1.00 56.22  ? 156 GOL A C1  1 
HETATM 1160 O O1  . GOL C 3 .   ? 7.516   6.932  19.865  1.00 43.25  ? 156 GOL A O1  1 
HETATM 1161 C C2  . GOL C 3 .   ? 5.864   5.397  19.108  1.00 51.15  ? 156 GOL A C2  1 
HETATM 1162 O O2  . GOL C 3 .   ? 5.264   6.056  20.169  1.00 39.92  ? 156 GOL A O2  1 
HETATM 1163 C C3  . GOL C 3 .   ? 6.237   3.994  19.553  1.00 49.72  ? 156 GOL A C3  1 
HETATM 1164 O O3  . GOL C 3 .   ? 6.264   3.304  18.328  1.00 56.39  ? 156 GOL A O3  1 
HETATM 1165 O O   . HOH D 4 .   ? -4.824  26.515 19.955  1.00 25.18  ? 157 HOH A O   1 
HETATM 1166 O O   . HOH D 4 .   ? 3.434   17.130 9.580   1.00 23.81  ? 158 HOH A O   1 
HETATM 1167 O O   . HOH D 4 .   ? -2.027  21.697 22.088  1.00 32.67  ? 159 HOH A O   1 
HETATM 1168 O O   . HOH D 4 .   ? 4.802   16.707 31.448  1.00 38.44  ? 160 HOH A O   1 
HETATM 1169 O O   . HOH D 4 .   ? 10.729  16.015 -2.603  1.00 31.42  ? 161 HOH A O   1 
HETATM 1170 O O   . HOH D 4 .   ? 4.987   4.991  26.998  1.00 38.53  ? 162 HOH A O   1 
HETATM 1171 O O   . HOH D 4 .   ? 0.395   2.007  12.661  1.00 36.62  ? 163 HOH A O   1 
HETATM 1172 O O   . HOH D 4 .   ? 5.176   11.500 26.229  1.00 29.85  ? 164 HOH A O   1 
HETATM 1173 O O   . HOH D 4 .   ? 13.522  13.860 11.290  1.00 35.76  ? 165 HOH A O   1 
HETATM 1174 O O   . HOH D 4 .   ? 18.900  24.133 13.691  1.00 32.53  ? 166 HOH A O   1 
HETATM 1175 O O   . HOH D 4 .   ? 20.864  19.159 1.339   1.00 37.47  ? 167 HOH A O   1 
HETATM 1176 O O   . HOH D 4 .   ? 7.280   28.166 25.038  1.00 32.27  ? 168 HOH A O   1 
HETATM 1177 O O   . HOH D 4 .   ? 18.226  22.856 6.977   1.00 36.45  ? 169 HOH A O   1 
HETATM 1178 O O   . HOH D 4 .   ? -4.128  25.217 9.914   1.00 39.90  ? 170 HOH A O   1 
HETATM 1179 O O   . HOH D 4 .   ? 2.646   13.809 7.273   1.00 34.01  ? 171 HOH A O   1 
HETATM 1180 O O   . HOH D 4 .   ? 5.358   29.449 26.915  1.00 30.94  ? 172 HOH A O   1 
HETATM 1181 O O   . HOH D 4 .   ? -3.085  28.704 12.802  1.00 27.23  ? 173 HOH A O   1 
HETATM 1182 O O   . HOH D 4 .   ? 14.556  31.177 -3.221  1.00 37.75  ? 174 HOH A O   1 
HETATM 1183 O O   . HOH D 4 .   ? -4.978  28.652 23.364  1.00 37.14  ? 175 HOH A O   1 
HETATM 1184 O O   . HOH D 4 .   ? -1.793  6.504  21.222  1.00 41.13  ? 176 HOH A O   1 
HETATM 1185 O O   . HOH D 4 .   ? -5.540  23.090 10.123  1.00 38.33  ? 177 HOH A O   1 
HETATM 1186 O O   . HOH D 4 .   ? -2.833  29.776 24.632  1.00 36.63  ? 178 HOH A O   1 
HETATM 1187 O O   . HOH D 4 .   ? 8.782   32.271 -6.772  1.00 40.42  ? 179 HOH A O   1 
HETATM 1188 O O   . HOH D 4 .   ? 1.122   27.609 -1.648  1.00 37.85  ? 180 HOH A O   1 
HETATM 1189 O O   . HOH D 4 .   ? 1.702   12.935 10.403  1.00 39.20  ? 181 HOH A O   1 
HETATM 1190 O O   . HOH D 4 .   ? 4.428   7.003  17.199  1.00 36.96  ? 182 HOH A O   1 
HETATM 1191 O O   . HOH D 4 .   ? -11.423 17.315 22.212  1.00 58.65  ? 183 HOH A O   1 
HETATM 1192 O O   . HOH D 4 .   ? 17.568  18.150 -0.816  1.00 31.86  ? 184 HOH A O   1 
HETATM 1193 O O   . HOH D 4 .   ? 11.966  13.986 17.981  1.00 28.48  ? 185 HOH A O   1 
HETATM 1194 O O   . HOH D 4 .   ? 12.795  28.450 -9.918  1.00 40.52  ? 186 HOH A O   1 
HETATM 1195 O O   . HOH D 4 .   ? 12.138  23.837 26.530  1.00 35.30  ? 187 HOH A O   1 
HETATM 1196 O O   . HOH D 4 .   ? -7.966  25.721 17.794  1.00 32.16  ? 188 HOH A O   1 
HETATM 1197 O O   . HOH D 4 .   ? 16.437  19.078 -6.119  1.00 44.05  ? 189 HOH A O   1 
HETATM 1198 O O   . HOH D 4 .   ? -0.515  24.484 28.711  1.00 34.42  ? 190 HOH A O   1 
HETATM 1199 O O   . HOH D 4 .   ? 8.137   30.654 23.525  1.00 38.02  ? 191 HOH A O   1 
HETATM 1200 O O   . HOH D 4 .   ? -7.268  17.035 17.039  1.00 35.75  ? 192 HOH A O   1 
HETATM 1201 O O   . HOH D 4 .   ? 15.192  33.533 4.487   1.00 36.08  ? 193 HOH A O   1 
HETATM 1202 O O   . HOH D 4 .   ? 5.452   23.426 30.683  1.00 28.49  ? 194 HOH A O   1 
HETATM 1203 O O   . HOH D 4 .   ? 1.401   25.889 30.242  1.00 33.86  ? 195 HOH A O   1 
HETATM 1204 O O   . HOH D 4 .   ? -4.465  20.725 -0.018  1.00 33.19  ? 196 HOH A O   1 
HETATM 1205 O O   . HOH D 4 .   ? -7.934  17.533 -1.722  1.00 47.73  ? 197 HOH A O   1 
HETATM 1206 O O   . HOH D 4 .   ? -1.660  26.757 -1.795  1.00 46.66  ? 198 HOH A O   1 
HETATM 1207 O O   . HOH D 4 .   ? 10.149  20.677 -3.953  1.00 40.37  ? 199 HOH A O   1 
HETATM 1208 O O   . HOH D 4 .   ? 9.329   10.363 25.259  1.00 53.22  ? 200 HOH A O   1 
HETATM 1209 O O   . HOH D 4 .   ? 10.998  33.710 21.017  1.00 37.39  ? 201 HOH A O   1 
HETATM 1210 O O   . HOH D 4 .   ? -2.755  16.394 10.847  1.00 41.27  ? 202 HOH A O   1 
HETATM 1211 O O   . HOH D 4 .   ? 11.776  11.847 8.149   1.00 35.73  ? 203 HOH A O   1 
HETATM 1212 O O   . HOH D 4 .   ? -16.840 22.892 22.240  1.00 36.82  ? 204 HOH A O   1 
HETATM 1213 O O   . HOH D 4 .   ? 10.539  31.468 22.937  1.00 40.66  ? 205 HOH A O   1 
HETATM 1214 O O   . HOH D 4 .   ? 5.830   12.594 -3.758  1.00 37.45  ? 206 HOH A O   1 
HETATM 1215 O O   . HOH D 4 .   ? 14.791  17.743 26.863  1.00 37.21  ? 207 HOH A O   1 
HETATM 1216 O O   . HOH D 4 .   ? 16.839  40.887 2.579   1.00 47.61  ? 208 HOH A O   1 
HETATM 1217 O O   . HOH D 4 .   ? 8.187   23.417 31.357  1.00 45.07  ? 209 HOH A O   1 
HETATM 1218 O O   . HOH D 4 .   ? -16.794 14.831 10.917  1.00 44.07  ? 210 HOH A O   1 
HETATM 1219 O O   . HOH D 4 .   ? 20.648  24.730 9.627   1.00 46.73  ? 211 HOH A O   1 
HETATM 1220 O O   . HOH D 4 .   ? 18.960  33.898 -2.378  1.00 40.49  ? 212 HOH A O   1 
HETATM 1221 O O   . HOH D 4 .   ? 14.962  14.150 20.332  1.00 32.08  ? 213 HOH A O   1 
HETATM 1222 O O   . HOH D 4 .   ? 21.603  28.976 8.304   1.00 40.94  ? 214 HOH A O   1 
HETATM 1223 O O   . HOH D 4 .   ? 17.940  21.141 9.230   1.00 36.23  ? 215 HOH A O   1 
HETATM 1224 O O   . HOH D 4 .   ? 1.518   32.218 2.099   1.00 47.44  ? 216 HOH A O   1 
HETATM 1225 O O   . HOH D 4 .   ? 9.267   10.040 17.530  1.00 51.97  ? 217 HOH A O   1 
HETATM 1226 O O   . HOH D 4 .   ? 17.838  15.996 8.848   1.00 41.47  ? 218 HOH A O   1 
HETATM 1227 O O   . HOH D 4 .   ? 7.670   29.769 28.703  1.00 44.90  ? 219 HOH A O   1 
HETATM 1228 O O   . HOH D 4 .   ? 13.448  11.570 23.338  1.00 47.48  ? 220 HOH A O   1 
HETATM 1229 O O   . HOH D 4 .   ? 17.043  21.331 24.063  1.00 44.47  ? 221 HOH A O   1 
HETATM 1230 O O   . HOH D 4 .   ? 9.691   12.423 29.840  1.00 42.70  ? 222 HOH A O   1 
HETATM 1231 O O   . HOH D 4 .   ? 19.020  40.174 7.381   1.00 51.57  ? 223 HOH A O   1 
HETATM 1232 O O   . HOH D 4 .   ? -3.221  11.350 18.426  1.00 37.91  ? 224 HOH A O   1 
HETATM 1233 O O   . HOH D 4 .   ? 13.060  37.166 -4.666  1.00 33.61  ? 225 HOH A O   1 
HETATM 1234 O O   . HOH D 4 .   ? 1.023   17.098 26.338  1.00 37.09  ? 226 HOH A O   1 
HETATM 1235 O O   . HOH D 4 .   ? 5.706   19.774 -7.126  1.00 46.74  ? 227 HOH A O   1 
HETATM 1236 O O   . HOH D 4 .   ? -3.827  19.395 6.646   1.00 48.58  ? 228 HOH A O   1 
HETATM 1237 O O   . HOH D 4 .   ? 0.260   13.828 7.885   1.00 45.84  ? 229 HOH A O   1 
HETATM 1238 O O   . HOH D 4 .   ? -9.245  26.350 15.640  1.00 56.99  ? 230 HOH A O   1 
HETATM 1239 O O   . HOH D 4 .   ? -4.851  28.294 4.000   1.00 53.34  ? 231 HOH A O   1 
HETATM 1240 O O   . HOH D 4 .   ? 1.985   28.782 28.878  1.00 61.10  ? 232 HOH A O   1 
HETATM 1241 O O   . HOH D 4 .   ? 6.654   39.194 16.594  1.00 59.04  ? 233 HOH A O   1 
HETATM 1242 O O   . HOH D 4 .   ? 7.901   37.371 -0.447  1.00 50.41  ? 234 HOH A O   1 
HETATM 1243 O O   . HOH D 4 .   ? -4.862  28.646 1.430   1.00 54.20  ? 235 HOH A O   1 
HETATM 1244 O O   . HOH D 4 .   ? 6.191   28.649 -8.983  1.00 71.60  ? 236 HOH A O   1 
HETATM 1245 O O   . HOH D 4 .   ? 3.337   20.369 -7.979  1.00 49.95  ? 237 HOH A O   1 
HETATM 1246 O O   . HOH D 4 .   ? 24.812  27.936 0.112   1.00 68.78  ? 238 HOH A O   1 
HETATM 1247 O O   . HOH D 4 .   ? -5.676  24.290 -2.320  1.00 49.39  ? 239 HOH A O   1 
HETATM 1248 O O   . HOH D 4 .   ? 14.773  40.116 14.576  1.00 53.73  ? 240 HOH A O   1 
HETATM 1249 O O   . HOH D 4 .   ? -16.312 26.138 22.409  1.00 57.70  ? 241 HOH A O   1 
HETATM 1250 O O   . HOH D 4 .   ? 2.193   11.373 27.417  1.00 56.98  ? 242 HOH A O   1 
HETATM 1251 O O   . HOH D 4 .   ? -4.222  13.697 22.010  1.00 58.75  ? 243 HOH A O   1 
HETATM 1252 O O   . HOH D 4 .   ? 9.193   22.812 -8.359  1.00 52.00  ? 244 HOH A O   1 
HETATM 1253 O O   . HOH D 4 .   ? -19.836 11.462 13.223  1.00 53.28  ? 245 HOH A O   1 
HETATM 1254 O O   . HOH D 4 .   ? 6.746   11.144 14.092  1.00 47.00  ? 246 HOH A O   1 
HETATM 1255 O O   . HOH D 4 .   ? 18.183  30.152 18.411  1.00 55.06  ? 247 HOH A O   1 
HETATM 1256 O O   . HOH D 4 .   ? 3.706   10.774 13.971  1.00 45.47  ? 248 HOH A O   1 
HETATM 1257 O O   . HOH D 4 .   ? 17.063  36.744 10.656  1.00 61.08  ? 249 HOH A O   1 
HETATM 1258 O O   . HOH D 4 .   ? 19.420  27.874 19.113  1.00 70.27  ? 250 HOH A O   1 
HETATM 1259 O O   . HOH D 4 .   ? 27.039  23.755 6.770   1.00 69.40  ? 251 HOH A O   1 
HETATM 1260 O O   . HOH D 4 .   ? 10.262  22.540 -5.926  1.00 47.41  ? 252 HOH A O   1 
HETATM 1261 O O   . HOH D 4 .   ? 13.086  37.431 18.158  1.00 64.79  ? 253 HOH A O   1 
HETATM 1262 O O   . HOH D 4 .   ? -10.795 24.994 21.151  1.00 54.19  ? 254 HOH A O   1 
HETATM 1263 O O   . HOH D 4 .   ? 0.745   13.807 28.929  1.00 56.95  ? 255 HOH A O   1 
HETATM 1264 O O   . HOH D 4 .   ? 17.216  39.587 8.975   1.00 57.41  ? 256 HOH A O   1 
HETATM 1265 O O   . HOH D 4 .   ? 19.975  23.241 11.290  1.00 42.47  ? 257 HOH A O   1 
HETATM 1266 O O   . HOH D 4 .   ? 9.407   40.344 1.212   1.00 50.21  ? 258 HOH A O   1 
HETATM 1267 O O   . HOH D 4 .   ? -0.352  14.788 26.449  1.00 61.03  ? 259 HOH A O   1 
HETATM 1268 O O   . HOH D 4 .   ? 22.430  22.641 12.502  1.00 60.92  ? 260 HOH A O   1 
HETATM 1269 O O   . HOH D 4 .   ? 3.814   10.465 7.152   1.00 46.93  ? 261 HOH A O   1 
HETATM 1270 O O   . HOH D 4 .   ? 15.011  41.681 12.607  1.00 53.50  ? 262 HOH A O   1 
HETATM 1271 O O   . HOH D 4 .   ? 2.081   17.790 -8.892  1.00 46.31  ? 263 HOH A O   1 
HETATM 1272 O O   . HOH D 4 .   ? 12.752  14.606 -8.710  1.00 61.31  ? 264 HOH A O   1 
HETATM 1273 O O   . HOH D 4 .   ? -14.480 23.864 18.816  1.00 64.36  ? 265 HOH A O   1 
HETATM 1274 O O   . HOH D 4 .   ? -7.056  16.494 20.090  1.00 67.27  ? 266 HOH A O   1 
HETATM 1275 O O   . HOH D 4 .   ? 13.805  39.734 -3.620  1.00 53.17  ? 267 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 7   ? 0.5374 0.8707 0.9414 -0.2768 0.0345  -0.0047 6   GLY A N   
2    C CA  . GLY A 7   ? 0.5227 0.9426 1.0362 -0.2496 -0.0015 -0.0312 6   GLY A CA  
3    C C   . GLY A 7   ? 0.5261 0.8869 0.9665 -0.1973 -0.0561 -0.0456 6   GLY A C   
4    O O   . GLY A 7   ? 0.5654 0.9289 1.0322 -0.1950 -0.1185 -0.0598 6   GLY A O   
5    N N   . GLU A 8   ? 0.4525 0.7560 0.7936 -0.1636 -0.0335 -0.0408 7   GLU A N   
6    C CA  . GLU A 8   ? 0.4372 0.6764 0.6891 -0.1271 -0.0631 -0.0508 7   GLU A CA  
7    C C   . GLU A 8   ? 0.3895 0.6220 0.5989 -0.0914 -0.0278 -0.0434 7   GLU A C   
8    O O   . GLU A 8   ? 0.4014 0.6375 0.6058 -0.0993 0.0134  -0.0323 7   GLU A O   
9    C CB  . GLU A 8   ? 0.4681 0.6175 0.6466 -0.1401 -0.0750 -0.0591 7   GLU A CB  
10   C CG  . GLU A 8   ? 0.5011 0.6258 0.7024 -0.1776 -0.1160 -0.0728 7   GLU A CG  
11   C CD  . GLU A 8   ? 0.6035 0.7341 0.7928 -0.1739 -0.1688 -0.0942 7   GLU A CD  
12   O OE1 . GLU A 8   ? 0.6113 0.7441 0.7507 -0.1426 -0.1741 -0.0953 7   GLU A OE1 
13   O OE2 . GLU A 8   ? 0.6675 0.7885 0.8877 -0.2078 -0.2131 -0.1064 7   GLU A OE2 
14   N N   . PRO A 9   ? 0.3934 0.6026 0.5559 -0.0600 -0.0472 -0.0473 8   PRO A N   
15   C CA  . PRO A 9   ? 0.3666 0.5549 0.4876 -0.0336 -0.0203 -0.0400 8   PRO A CA  
16   C C   . PRO A 9   ? 0.3747 0.5105 0.4437 -0.0416 0.0016  -0.0361 8   PRO A C   
17   O O   . PRO A 9   ? 0.3796 0.4794 0.4257 -0.0514 -0.0087 -0.0464 8   PRO A O   
18   C CB  . PRO A 9   ? 0.4218 0.5752 0.4865 -0.0167 -0.0512 -0.0389 8   PRO A CB  
19   C CG  . PRO A 9   ? 0.4460 0.6130 0.5301 -0.0269 -0.1024 -0.0441 8   PRO A CG  
20   C CD  . PRO A 9   ? 0.4431 0.6282 0.5678 -0.0569 -0.0976 -0.0550 8   PRO A CD  
21   N N   . VAL A 10  ? 0.3215 0.4482 0.3754 -0.0339 0.0251  -0.0268 9   VAL A N   
22   C CA  . VAL A 10  ? 0.3229 0.3971 0.3402 -0.0365 0.0268  -0.0200 9   VAL A CA  
23   C C   . VAL A 10  ? 0.3190 0.3770 0.3121 -0.0147 0.0290  -0.0191 9   VAL A C   
24   O O   . VAL A 10  ? 0.3377 0.4079 0.3252 -0.0016 0.0368  -0.0191 9   VAL A O   
25   C CB  . VAL A 10  ? 0.3950 0.4465 0.3924 -0.0628 0.0358  -0.0029 9   VAL A CB  
26   C CG1 . VAL A 10  ? 0.3799 0.3639 0.3434 -0.0620 0.0128  0.0086  9   VAL A CG1 
27   C CG2 . VAL A 10  ? 0.3525 0.4130 0.3783 -0.0978 0.0329  0.0024  9   VAL A CG2 
28   N N   . TYR A 11  ? 0.2913 0.3251 0.2857 -0.0114 0.0226  -0.0235 10  TYR A N   
29   C CA  . TYR A 11  ? 0.3062 0.3273 0.2953 -0.0027 0.0229  -0.0212 10  TYR A CA  
30   C C   . TYR A 11  ? 0.3103 0.2985 0.3044 -0.0049 0.0044  -0.0134 10  TYR A C   
31   O O   . TYR A 11  ? 0.3625 0.3323 0.3827 -0.0094 -0.0132 -0.0137 10  TYR A O   
32   C CB  . TYR A 11  ? 0.2784 0.3095 0.2808 -0.0066 0.0370  -0.0350 10  TYR A CB  
33   C CG  . TYR A 11  ? 0.3485 0.3867 0.3071 -0.0120 0.0408  -0.0370 10  TYR A CG  
34   C CD1 . TYR A 11  ? 0.3589 0.3831 0.2758 -0.0122 0.0326  -0.0202 10  TYR A CD1 
35   C CD2 . TYR A 11  ? 0.3721 0.4154 0.3258 -0.0184 0.0379  -0.0535 10  TYR A CD2 
36   C CE1 . TYR A 11  ? 0.3956 0.4092 0.2617 -0.0189 0.0148  -0.0156 10  TYR A CE1 
37   C CE2 . TYR A 11  ? 0.4021 0.4408 0.3046 -0.0271 0.0239  -0.0542 10  TYR A CE2 
38   C CZ  . TYR A 11  ? 0.4197 0.4433 0.2776 -0.0268 0.0088  -0.0331 10  TYR A CZ  
39   O OH  . TYR A 11  ? 0.5017 0.5052 0.3006 -0.0373 -0.0243 -0.0290 10  TYR A OH  
40   N N   . GLY A 12  ? 0.3306 0.2974 0.2948 -0.0018 -0.0028 -0.0068 11  GLY A N   
41   C CA  . GLY A 12  ? 0.3608 0.2809 0.3066 -0.0084 -0.0350 0.0016  11  GLY A CA  
42   C C   . GLY A 12  ? 0.4708 0.3569 0.3279 -0.0177 -0.0294 0.0068  11  GLY A C   
43   O O   . GLY A 12  ? 0.5032 0.4105 0.3453 -0.0263 -0.0028 0.0078  11  GLY A O   
44   N N   . LEU A 13  ? 0.5173 0.3518 0.3141 -0.0215 -0.0498 0.0058  12  LEU A N   
45   C CA  . LEU A 13  ? 0.6293 0.4194 0.3144 -0.0375 -0.0360 0.0031  12  LEU A CA  
46   C C   . LEU A 13  ? 0.7669 0.4767 0.3887 -0.0633 -0.0947 0.0273  12  LEU A C   
47   O O   . LEU A 13  ? 0.7974 0.4882 0.4743 -0.0573 -0.1504 0.0332  12  LEU A O   
48   C CB  . LEU A 13  ? 0.6643 0.4328 0.3056 -0.0218 -0.0227 -0.0246 12  LEU A CB  
49   C CG  . LEU A 13  ? 0.5462 0.3666 0.2593 0.0110  0.0058  -0.0452 12  LEU A CG  
50   C CD1 . LEU A 13  ? 0.6642 0.4278 0.3337 0.0276  -0.0037 -0.0730 12  LEU A CD1 
51   C CD2 . LEU A 13  ? 0.6116 0.4960 0.3500 0.0185  0.0578  -0.0591 12  LEU A CD2 
52   N N   . SER A 14  ? 0.8996 0.5613 0.4127 -0.0964 -0.0871 0.0437  13  SER A N   
53   C CA  . SER A 14  ? 1.0226 0.5807 0.4482 -0.1272 -0.1600 0.0772  13  SER A CA  
54   C C   . SER A 14  ? 1.1497 0.6245 0.4627 -0.1373 -0.2027 0.0698  13  SER A C   
55   O O   . SER A 14  ? 1.2135 0.6796 0.4321 -0.1405 -0.1522 0.0400  13  SER A O   
56   C CB  . SER A 14  ? 1.1714 0.6793 0.4749 -0.1758 -0.1385 0.1057  13  SER A CB  
57   O OG  . SER A 14  ? 1.2109 0.7374 0.6042 -0.1778 -0.1535 0.1283  13  SER A OG  
58   N N   . GLU A 15  ? 1.1518 0.5924 0.4380 -0.3087 -0.0669 0.1307  14  GLU A N   
59   C CA  . GLU A 15  ? 1.1829 0.6171 0.4600 -0.3750 -0.0623 0.1368  14  GLU A CA  
60   C C   . GLU A 15  ? 0.9629 0.5717 0.4374 -0.3232 -0.0701 0.1256  14  GLU A C   
61   O O   . GLU A 15  ? 1.0260 0.6001 0.4881 -0.3268 -0.0889 0.1276  14  GLU A O   
62   C CB  . GLU A 15  ? 1.3142 0.7876 0.5477 -0.5265 -0.0009 0.1217  14  GLU A CB  
63   C CG  . GLU A 15  ? 1.7260 0.8737 0.6198 -0.6117 0.0250  0.1357  14  GLU A CG  
64   C CD  . GLU A 15  ? 1.8919 1.0676 0.7052 -0.8216 0.1333  0.0908  14  GLU A CD  
65   O OE1 . GLU A 15  ? 2.3266 1.1269 0.7524 -0.9380 0.1762  0.0995  14  GLU A OE1 
66   O OE2 . GLU A 15  ? 1.7295 1.2646 0.8137 -0.8775 0.1795  0.0278  14  GLU A OE2 
67   N N   . ASP A 16  ? 0.8073 0.5491 0.4112 -0.2740 -0.0545 0.1135  15  ASP A N   
68   C CA  . ASP A 16  ? 0.6886 0.4851 0.3700 -0.2250 -0.0536 0.1017  15  ASP A CA  
69   C C   . ASP A 16  ? 0.6641 0.4840 0.3864 -0.1817 -0.0263 0.0842  15  ASP A C   
70   O O   . ASP A 16  ? 0.5856 0.4827 0.3489 -0.1763 -0.0111 0.0838  15  ASP A O   
71   C CB  . ASP A 16  ? 0.6584 0.5778 0.3975 -0.2261 -0.0640 0.0839  15  ASP A CB  
72   C CG  . ASP A 16  ? 0.6733 0.5310 0.3740 -0.1505 -0.0801 0.0734  15  ASP A CG  
73   O OD1 . ASP A 16  ? 0.7187 0.4553 0.3606 -0.1361 -0.0470 0.0783  15  ASP A OD1 
74   O OD2 . ASP A 16  ? 0.6891 0.6023 0.3893 -0.1095 -0.1251 0.0427  15  ASP A OD2 
75   N N   . GLU A 17  ? 0.6656 0.4382 0.3823 -0.1616 -0.0115 0.0509  16  GLU A N   
76   C CA  . GLU A 17  ? 0.6675 0.4864 0.4302 -0.1498 0.0294  0.0011  16  GLU A CA  
77   C C   . GLU A 17  ? 0.6706 0.4450 0.3888 -0.1592 0.0773  0.0047  16  GLU A C   
78   O O   . GLU A 17  ? 0.6627 0.4599 0.3925 -0.1644 0.1158  -0.0225 16  GLU A O   
79   C CB  . GLU A 17  ? 0.7059 0.5450 0.4979 -0.1446 0.0442  -0.0829 16  GLU A CB  
80   C CG  . GLU A 17  ? 0.7548 0.7114 0.6256 -0.1021 0.0277  -0.1645 16  GLU A CG  
81   N N   . GLY A 18  ? 0.7191 0.3968 0.3463 -0.1475 0.0636  0.0318  17  GLY A N   
82   C CA  . GLY A 18  ? 0.8299 0.3776 0.3176 -0.1150 0.0800  0.0313  17  GLY A CA  
83   C C   . GLY A 18  ? 0.7941 0.4463 0.3247 -0.0531 0.0334  0.0454  17  GLY A C   
84   O O   . GLY A 18  ? 0.9233 0.4604 0.3130 0.0167  0.0155  0.0352  17  GLY A O   
85   N N   . GLU A 19  ? 0.6336 0.4760 0.3192 -0.0738 0.0132  0.0559  18  GLU A N   
86   C CA  . GLU A 19  ? 0.6477 0.6339 0.3986 -0.0398 -0.0097 0.0440  18  GLU A CA  
87   C C   . GLU A 19  ? 0.5824 0.6495 0.4074 -0.0789 0.0239  0.0528  18  GLU A C   
88   O O   . GLU A 19  ? 0.5959 0.7825 0.4725 -0.0651 0.0225  0.0369  18  GLU A O   
89   C CB  . GLU A 19  ? 0.6387 0.7880 0.4724 -0.0469 -0.0552 0.0157  18  GLU A CB  
90   C CG  . GLU A 19  ? 0.7845 0.9393 0.5606 0.0656  -0.1255 -0.0365 18  GLU A CG  
91   C CD  . GLU A 19  ? 0.7901 1.1508 0.6767 0.0508  -0.1738 -0.1009 18  GLU A CD  
92   O OE1 . GLU A 19  ? 0.7918 1.4023 0.7931 0.0947  -0.2089 -0.1953 18  GLU A OE1 
93   O OE2 . GLU A 19  ? 0.8614 1.1568 0.7281 -0.0075 -0.1745 -0.0767 18  GLU A OE2 
94   N N   . SER A 20  ? 0.5286 0.5409 0.3534 -0.1137 0.0463  0.0601  19  SER A N   
95   C CA  . SER A 20  ? 0.5197 0.5772 0.3742 -0.1249 0.0565  0.0602  19  SER A CA  
96   C C   . SER A 20  ? 0.4989 0.5476 0.3570 -0.1045 0.0881  0.0343  19  SER A C   
97   O O   . SER A 20  ? 0.5324 0.5138 0.3536 -0.1104 0.1211  0.0041  19  SER A O   
98   C CB  . SER A 20  ? 0.6142 0.6151 0.4270 -0.1461 0.0309  0.0656  19  SER A CB  
99   O OG  . SER A 20  ? 0.6891 0.6464 0.5015 -0.1228 0.0179  0.0326  19  SER A OG  
100  N N   . ARG A 21  ? 0.4454 0.5435 0.3218 -0.0996 0.0900  0.0381  20  ARG A N   
101  C CA  . ARG A 21  ? 0.4420 0.5468 0.3232 -0.0846 0.1182  0.0114  20  ARG A CA  
102  C C   . ARG A 21  ? 0.4279 0.5488 0.3114 -0.0746 0.0916  0.0012  20  ARG A C   
103  O O   . ARG A 21  ? 0.4520 0.5284 0.2767 -0.0859 0.0647  0.0301  20  ARG A O   
104  C CB  . ARG A 21  ? 0.4276 0.5579 0.2893 -0.0567 0.1303  0.0287  20  ARG A CB  
105  C CG  . ARG A 21  ? 0.5544 0.6096 0.3353 -0.0148 0.1242  0.0262  20  ARG A CG  
106  C CD  . ARG A 21  ? 0.6635 0.5311 0.3086 -0.0339 0.1714  0.0021  20  ARG A CD  
107  N NE  . ARG A 21  ? 0.7072 0.5609 0.3343 -0.0508 0.2124  -0.0206 20  ARG A NE  
108  C CZ  . ARG A 21  ? 0.8179 0.5810 0.3266 -0.0004 0.2162  -0.0170 20  ARG A CZ  
109  N NH1 . ARG A 21  ? 0.9729 0.6595 0.3690 0.0928  0.1674  -0.0067 20  ARG A NH1 
110  N NH2 . ARG A 21  ? 0.8175 0.5659 0.3087 -0.0264 0.2565  -0.0386 20  ARG A NH2 
111  N N   . ILE A 22  ? 0.4040 0.2968 0.2791 -0.0616 0.0588  -0.0078 21  ILE A N   
112  C CA  . ILE A 22  ? 0.3386 0.3019 0.2587 -0.0562 0.0586  -0.0061 21  ILE A CA  
113  C C   . ILE A 22  ? 0.3891 0.3433 0.3092 -0.0640 0.0431  -0.0134 21  ILE A C   
114  O O   . ILE A 22  ? 0.4504 0.3517 0.3199 -0.0887 0.0490  -0.0201 21  ILE A O   
115  C CB  . ILE A 22  ? 0.3593 0.4298 0.3061 -0.0694 0.0736  -0.0052 21  ILE A CB  
116  C CG1 . ILE A 22  ? 0.4195 0.5118 0.3552 -0.0357 0.0975  0.0078  21  ILE A CG1 
117  C CG2 . ILE A 22  ? 0.3211 0.4975 0.3042 -0.0452 0.0654  -0.0021 21  ILE A CG2 
118  C CD1 . ILE A 22  ? 0.4913 0.5659 0.3890 0.0474  0.1151  0.0283  21  ILE A CD1 
119  N N   . LEU A 23  ? 0.3845 0.3553 0.3240 -0.0468 0.0344  -0.0132 22  LEU A N   
120  C CA  . LEU A 23  ? 0.3628 0.3371 0.3047 -0.0427 0.0235  -0.0178 22  LEU A CA  
121  C C   . LEU A 23  ? 0.3368 0.3547 0.3025 -0.0439 0.0235  -0.0169 22  LEU A C   
122  O O   . LEU A 23  ? 0.3402 0.3675 0.3034 -0.0194 0.0326  -0.0097 22  LEU A O   
123  C CB  . LEU A 23  ? 0.3501 0.3538 0.2972 -0.0339 0.0178  -0.0225 22  LEU A CB  
124  C CG  . LEU A 23  ? 0.3213 0.3535 0.2737 -0.0177 0.0122  -0.0254 22  LEU A CG  
125  C CD1 . LEU A 23  ? 0.4083 0.3943 0.3013 0.0287  0.0120  -0.0183 22  LEU A CD1 
126  C CD2 . LEU A 23  ? 0.3488 0.4719 0.3143 -0.0393 0.0142  -0.0381 22  LEU A CD2 
127  N N   . ARG A 24  ? 0.3179 0.3368 0.2677 -0.0685 0.0195  -0.0243 23  ARG A N   
128  C CA  . ARG A 24  ? 0.2870 0.3751 0.2527 -0.0737 0.0128  -0.0268 23  ARG A CA  
129  C C   . ARG A 24  ? 0.3210 0.3556 0.2735 -0.0534 0.0084  -0.0271 23  ARG A C   
130  O O   . ARG A 24  ? 0.3959 0.3556 0.3033 -0.0524 0.0122  -0.0305 23  ARG A O   
131  C CB  . ARG A 24  ? 0.3329 0.4530 0.2603 -0.1483 0.0161  -0.0449 23  ARG A CB  
132  C CG  . ARG A 24  ? 0.3865 0.6358 0.3298 -0.1673 0.0029  -0.0529 23  ARG A CG  
133  C CD  . ARG A 24  ? 0.5887 0.8796 0.4629 -0.2939 0.0145  -0.0847 23  ARG A CD  
134  N NE  . ARG A 24  ? 0.7437 1.2240 0.6304 -0.3385 -0.0025 -0.1011 23  ARG A NE  
135  C CZ  . ARG A 24  ? 0.8681 1.2913 0.7111 -0.3436 -0.0119 -0.1065 23  ARG A CZ  
136  N NH1 . ARG A 24  ? 0.9218 1.1137 0.7126 -0.2966 -0.0028 -0.0946 23  ARG A NH1 
137  N NH2 . ARG A 24  ? 0.8951 1.5317 0.7485 -0.3883 -0.0312 -0.1235 23  ARG A NH2 
138  N N   . VAL A 25  ? 0.2754 0.3384 0.2392 -0.0242 0.0082  -0.0210 24  VAL A N   
139  C CA  . VAL A 25  ? 0.3191 0.3386 0.2666 -0.0137 0.0114  -0.0232 24  VAL A CA  
140  C C   . VAL A 25  ? 0.3146 0.3670 0.2454 0.0022  0.0050  -0.0206 24  VAL A C   
141  O O   . VAL A 25  ? 0.4101 0.5101 0.3267 0.0451  0.0080  -0.0089 24  VAL A O   
142  C CB  . VAL A 25  ? 0.3564 0.3353 0.2818 -0.0102 0.0325  -0.0231 24  VAL A CB  
143  C CG1 . VAL A 25  ? 0.3726 0.3284 0.2732 -0.0185 0.0447  -0.0303 24  VAL A CG1 
144  C CG2 . VAL A 25  ? 0.3556 0.3545 0.2983 -0.0338 0.0334  -0.0299 24  VAL A CG2 
145  N N   . LYS A 26  ? 0.3254 0.3538 0.2362 -0.0147 -0.0008 -0.0286 25  LYS A N   
146  C CA  . LYS A 26  ? 0.3298 0.3937 0.2165 -0.0003 -0.0093 -0.0277 25  LYS A CA  
147  C C   . LYS A 26  ? 0.3894 0.3632 0.2452 0.0173  0.0070  -0.0269 25  LYS A C   
148  O O   . LYS A 26  ? 0.4164 0.3451 0.2670 0.0035  0.0144  -0.0331 25  LYS A O   
149  C CB  . LYS A 26  ? 0.3545 0.4606 0.2132 -0.0640 -0.0243 -0.0453 25  LYS A CB  
150  C CG  . LYS A 26  ? 0.4130 0.5777 0.2418 -0.0541 -0.0384 -0.0477 25  LYS A CG  
151  C CD  . LYS A 26  ? 0.5482 0.7748 0.3234 -0.1563 -0.0501 -0.0758 25  LYS A CD  
152  C CE  . LYS A 26  ? 0.6436 0.9741 0.3894 -0.1516 -0.0714 -0.0812 25  LYS A CE  
153  N NZ  . LYS A 26  ? 0.7195 1.3496 0.5100 -0.1621 -0.0988 -0.0881 25  LYS A NZ  
154  N N   . VAL A 27  ? 0.3365 0.3249 0.2761 -0.0595 0.0263  -0.0399 26  VAL A N   
155  C CA  . VAL A 27  ? 0.3276 0.3045 0.2774 -0.0415 0.0219  -0.0303 26  VAL A CA  
156  C C   . VAL A 27  ? 0.3461 0.3106 0.2996 -0.0269 0.0161  -0.0206 26  VAL A C   
157  O O   . VAL A 27  ? 0.3411 0.3123 0.3164 -0.0222 0.0189  -0.0243 26  VAL A O   
158  C CB  . VAL A 27  ? 0.3272 0.3074 0.3035 -0.0404 0.0342  -0.0438 26  VAL A CB  
159  C CG1 . VAL A 27  ? 0.3319 0.2986 0.3152 -0.0249 0.0296  -0.0318 26  VAL A CG1 
160  C CG2 . VAL A 27  ? 0.3399 0.3368 0.3047 -0.0644 0.0426  -0.0583 26  VAL A CG2 
161  N N   . VAL A 28  ? 0.3519 0.3016 0.2858 -0.0222 0.0086  -0.0086 27  VAL A N   
162  C CA  . VAL A 28  ? 0.3487 0.2876 0.2758 -0.0180 0.0060  -0.0040 27  VAL A CA  
163  C C   . VAL A 28  ? 0.3527 0.2914 0.2909 -0.0083 0.0053  0.0007  27  VAL A C   
164  O O   . VAL A 28  ? 0.3706 0.3191 0.3196 -0.0081 0.0025  0.0038  27  VAL A O   
165  C CB  . VAL A 28  ? 0.3714 0.2870 0.2739 -0.0200 0.0045  0.0019  27  VAL A CB  
166  C CG1 . VAL A 28  ? 0.3470 0.2501 0.2377 -0.0223 0.0070  0.0002  27  VAL A CG1 
167  C CG2 . VAL A 28  ? 0.4162 0.3289 0.3022 -0.0347 0.0033  0.0023  27  VAL A CG2 
168  N N   . SER A 29  ? 0.3667 0.2989 0.3036 -0.0020 0.0067  0.0033  28  SER A N   
169  C CA  . SER A 29  ? 0.3695 0.3000 0.3068 0.0008  0.0077  0.0074  28  SER A CA  
170  C C   . SER A 29  ? 0.3499 0.2830 0.2935 0.0053  0.0117  0.0063  28  SER A C   
171  O O   . SER A 29  ? 0.3414 0.2796 0.2885 0.0080  0.0112  0.0053  28  SER A O   
172  C CB  . SER A 29  ? 0.3508 0.2710 0.2671 -0.0044 0.0098  0.0061  28  SER A CB  
173  O OG  . SER A 29  ? 0.3832 0.2889 0.2956 0.0012  0.0156  0.0019  28  SER A OG  
174  N N   . GLY A 30  ? 0.3774 0.3119 0.3223 0.0034  0.0141  0.0091  29  GLY A N   
175  C CA  . GLY A 30  ? 0.3610 0.3031 0.3105 0.0036  0.0200  0.0061  29  GLY A CA  
176  C C   . GLY A 30  ? 0.3945 0.3343 0.3309 0.0000  0.0264  0.0032  29  GLY A C   
177  O O   . GLY A 30  ? 0.3636 0.2977 0.2830 -0.0092 0.0245  0.0071  29  GLY A O   
178  N N   . ILE A 31  ? 0.3477 0.2973 0.2939 0.0047  0.0348  -0.0045 30  ILE A N   
179  C CA  . ILE A 31  ? 0.3913 0.3376 0.3305 0.0018  0.0476  -0.0153 30  ILE A CA  
180  C C   . ILE A 31  ? 0.3818 0.3495 0.3317 -0.0029 0.0587  -0.0231 30  ILE A C   
181  O O   . ILE A 31  ? 0.3589 0.3468 0.3355 0.0074  0.0583  -0.0235 30  ILE A O   
182  C CB  . ILE A 31  ? 0.4141 0.3483 0.3675 0.0174  0.0521  -0.0205 30  ILE A CB  
183  C CG1 . ILE A 31  ? 0.3977 0.3095 0.3336 0.0152  0.0440  -0.0152 30  ILE A CG1 
184  C CG2 . ILE A 31  ? 0.4086 0.3382 0.3672 0.0170  0.0730  -0.0385 30  ILE A CG2 
185  C CD1 . ILE A 31  ? 0.4064 0.3031 0.3566 0.0303  0.0414  -0.0098 30  ILE A CD1 
186  N N   . ASP A 32  ? 0.3605 0.3296 0.2883 -0.0222 0.0677  -0.0283 31  ASP A N   
187  C CA  . ASP A 32  ? 0.3824 0.3738 0.3168 -0.0319 0.0833  -0.0408 31  ASP A CA  
188  C C   . ASP A 32  ? 0.4025 0.4107 0.3503 -0.0332 0.0767  -0.0324 31  ASP A C   
189  O O   . ASP A 32  ? 0.3785 0.4157 0.3533 -0.0286 0.0849  -0.0419 31  ASP A O   
190  C CB  . ASP A 32  ? 0.3775 0.3793 0.3447 -0.0154 0.1007  -0.0604 31  ASP A CB  
191  C CG  . ASP A 32  ? 0.5250 0.5562 0.5038 -0.0274 0.1231  -0.0805 31  ASP A CG  
192  O OD1 . ASP A 32  ? 0.4858 0.5218 0.4307 -0.0564 0.1274  -0.0813 31  ASP A OD1 
193  O OD2 . ASP A 32  ? 0.5075 0.5596 0.5320 -0.0083 0.1361  -0.0938 31  ASP A OD2 
194  N N   . LEU A 33  ? 0.3748 0.3662 0.3075 -0.0404 0.0637  -0.0159 32  LEU A N   
195  C CA  . LEU A 33  ? 0.3710 0.3686 0.3129 -0.0461 0.0617  -0.0118 32  LEU A CA  
196  C C   . LEU A 33  ? 0.4087 0.4195 0.3392 -0.0691 0.0738  -0.0164 32  LEU A C   
197  O O   . LEU A 33  ? 0.4141 0.4226 0.3206 -0.0850 0.0802  -0.0167 32  LEU A O   
198  C CB  . LEU A 33  ? 0.3868 0.3549 0.3221 -0.0463 0.0502  0.0039  32  LEU A CB  
199  C CG  . LEU A 33  ? 0.3658 0.3247 0.3107 -0.0288 0.0404  0.0062  32  LEU A CG  
200  C CD1 . LEU A 33  ? 0.3452 0.2801 0.2933 -0.0282 0.0335  0.0181  32  LEU A CD1 
201  C CD2 . LEU A 33  ? 0.3580 0.3383 0.3226 -0.0192 0.0406  -0.0035 32  LEU A CD2 
202  N N   . ALA A 34  ? 0.4232 0.4504 0.3664 -0.0766 0.0777  -0.0209 33  ALA A N   
203  C CA  . ALA A 34  ? 0.4598 0.5017 0.3919 -0.1026 0.0904  -0.0264 33  ALA A CA  
204  C C   . ALA A 34  ? 0.5116 0.5125 0.4099 -0.1230 0.0865  -0.0068 33  ALA A C   
205  O O   . ALA A 34  ? 0.5422 0.5097 0.4420 -0.1151 0.0760  0.0076  33  ALA A O   
206  C CB  . ALA A 34  ? 0.4505 0.5225 0.4044 -0.1093 0.0944  -0.0361 33  ALA A CB  
207  N N   . LYS A 35  ? 0.5937 0.8303 0.7338 -0.0609 0.2965  -0.0490 34  LYS A N   
208  C CA  . LYS A 35  ? 0.6755 0.8362 0.7292 -0.1199 0.3031  -0.0350 34  LYS A CA  
209  C C   . LYS A 35  ? 0.6835 0.9070 0.7834 -0.1715 0.3232  -0.0473 34  LYS A C   
210  O O   . LYS A 35  ? 0.7540 1.0528 0.9004 -0.1986 0.3748  -0.0741 34  LYS A O   
211  C CB  . LYS A 35  ? 0.7522 0.8322 0.7060 -0.1416 0.3411  -0.0350 34  LYS A CB  
212  C CG  . LYS A 35  ? 0.8677 0.8397 0.7012 -0.1942 0.3399  -0.0156 34  LYS A CG  
213  C CD  . LYS A 35  ? 0.8245 0.7099 0.5831 -0.1719 0.2821  0.0116  34  LYS A CD  
214  N N   . LYS A 36  ? 0.6989 0.8918 0.7831 -0.1884 0.2858  -0.0317 35  LYS A N   
215  C CA  . LYS A 36  ? 0.7421 0.9823 0.8586 -0.2443 0.2982  -0.0437 35  LYS A CA  
216  C C   . LYS A 36  ? 0.8434 0.9708 0.8364 -0.3159 0.3315  -0.0363 35  LYS A C   
217  O O   . LYS A 36  ? 0.9123 1.0794 0.9112 -0.3763 0.3856  -0.0596 35  LYS A O   
218  C CB  . LYS A 36  ? 0.6664 0.9173 0.8161 -0.2289 0.2446  -0.0335 35  LYS A CB  
219  N N   . ALA A 41  ? 1.1099 0.5618 0.4582 -0.1663 0.1225  0.1106  40  ALA A N   
220  C CA  . ALA A 41  ? 1.0251 0.5590 0.4541 -0.1103 0.0775  0.1057  40  ALA A CA  
221  C C   . ALA A 41  ? 0.8785 0.5259 0.4479 -0.0974 0.0809  0.0886  40  ALA A C   
222  O O   . ALA A 41  ? 0.8787 0.5242 0.4774 -0.0951 0.0717  0.0898  40  ALA A O   
223  C CB  . ALA A 41  ? 1.0915 0.5649 0.4612 -0.0618 0.0166  0.1221  40  ALA A CB  
224  N N   . SER A 42  ? 0.7591 0.4884 0.3979 -0.0881 0.0920  0.0733  41  SER A N   
225  C CA  . SER A 42  ? 0.6344 0.4519 0.3823 -0.0674 0.0855  0.0597  41  SER A CA  
226  C C   . SER A 42  ? 0.5624 0.4000 0.3267 -0.0312 0.0419  0.0574  41  SER A C   
227  O O   . SER A 42  ? 0.5323 0.3768 0.2730 -0.0243 0.0329  0.0523  41  SER A O   
228  C CB  . SER A 42  ? 0.6041 0.4804 0.4033 -0.0706 0.1210  0.0435  41  SER A CB  
229  O OG  . SER A 42  ? 0.5758 0.5131 0.4545 -0.0451 0.1081  0.0337  41  SER A OG  
230  N N   . ASP A 43  ? 0.5069 0.3581 0.3109 -0.0150 0.0200  0.0568  42  ASP A N   
231  C CA  . ASP A 43  ? 0.4669 0.3472 0.2943 0.0159  -0.0148 0.0483  42  ASP A CA  
232  C C   . ASP A 43  ? 0.3883 0.3191 0.2890 0.0186  -0.0118 0.0352  42  ASP A C   
233  O O   . ASP A 43  ? 0.3867 0.3077 0.3041 0.0244  -0.0214 0.0355  42  ASP A O   
234  C CB  . ASP A 43  ? 0.5350 0.3639 0.3186 0.0415  -0.0463 0.0582  42  ASP A CB  
235  C CG  . ASP A 43  ? 0.7152 0.4635 0.3990 0.0407  -0.0542 0.0766  42  ASP A CG  
236  O OD1 . ASP A 43  ? 0.6658 0.4214 0.3144 0.0385  -0.0608 0.0762  42  ASP A OD1 
237  O OD2 . ASP A 43  ? 0.8039 0.4666 0.4284 0.0391  -0.0545 0.0914  42  ASP A OD2 
238  N N   . PRO A 44  ? 0.3430 0.3111 0.2711 0.0134  0.0025  0.0238  43  PRO A N   
239  C CA  . PRO A 44  ? 0.3046 0.2990 0.2789 0.0147  0.0055  0.0152  43  PRO A CA  
240  C C   . PRO A 44  ? 0.3092 0.3212 0.2987 0.0219  -0.0103 0.0003  43  PRO A C   
241  O O   . PRO A 44  ? 0.3183 0.3490 0.2976 0.0233  -0.0176 -0.0128 43  PRO A O   
242  C CB  . PRO A 44  ? 0.3157 0.3169 0.2889 0.0126  0.0273  0.0099  43  PRO A CB  
243  C CG  . PRO A 44  ? 0.4052 0.3872 0.3389 0.0038  0.0440  0.0152  43  PRO A CG  
244  C CD  . PRO A 44  ? 0.3620 0.3291 0.2614 0.0048  0.0190  0.0195  43  PRO A CD  
245  N N   . TYR A 45  ? 0.2831 0.2952 0.2967 0.0208  -0.0131 -0.0012 44  TYR A N   
246  C CA  . TYR A 45  ? 0.2520 0.2721 0.2721 0.0191  -0.0178 -0.0182 44  TYR A CA  
247  C C   . TYR A 45  ? 0.2724 0.2799 0.2967 0.0138  -0.0159 -0.0150 44  TYR A C   
248  O O   . TYR A 45  ? 0.2341 0.2475 0.2755 0.0155  -0.0160 -0.0024 44  TYR A O   
249  C CB  . TYR A 45  ? 0.2325 0.2524 0.2623 0.0290  -0.0305 -0.0250 44  TYR A CB  
250  C CG  . TYR A 45  ? 0.3039 0.2902 0.3331 0.0265  -0.0349 -0.0127 44  TYR A CG  
251  C CD1 . TYR A 45  ? 0.2710 0.2468 0.3044 0.0136  -0.0356 -0.0183 44  TYR A CD1 
252  C CD2 . TYR A 45  ? 0.2966 0.2498 0.3048 0.0303  -0.0379 0.0027  44  TYR A CD2 
253  C CE1 . TYR A 45  ? 0.3334 0.2783 0.3590 0.0016  -0.0396 -0.0111 44  TYR A CE1 
254  C CE2 . TYR A 45  ? 0.3495 0.2605 0.3423 0.0153  -0.0369 0.0100  44  TYR A CE2 
255  C CZ  . TYR A 45  ? 0.3197 0.2329 0.3259 -0.0004 -0.0381 0.0017  44  TYR A CZ  
256  O OH  . TYR A 45  ? 0.3591 0.2313 0.3435 -0.0253 -0.0368 0.0056  44  TYR A OH  
257  N N   . VAL A 46  ? 0.2738 0.2671 0.2789 0.0057  -0.0145 -0.0290 45  VAL A N   
258  C CA  . VAL A 46  ? 0.3021 0.2689 0.2921 0.0044  -0.0216 -0.0252 45  VAL A CA  
259  C C   . VAL A 46  ? 0.2968 0.2516 0.2825 -0.0084 -0.0287 -0.0348 45  VAL A C   
260  O O   . VAL A 46  ? 0.3217 0.2784 0.2992 -0.0185 -0.0181 -0.0545 45  VAL A O   
261  C CB  . VAL A 46  ? 0.3450 0.2670 0.2788 0.0007  -0.0114 -0.0323 45  VAL A CB  
262  C CG1 . VAL A 46  ? 0.3493 0.2324 0.2545 0.0121  -0.0288 -0.0229 45  VAL A CG1 
263  C CG2 . VAL A 46  ? 0.3172 0.2363 0.2416 0.0120  0.0017  -0.0275 45  VAL A CG2 
264  N N   . LYS A 47  ? 0.2888 0.2390 0.2824 -0.0102 -0.0447 -0.0251 46  LYS A N   
265  C CA  . LYS A 47  ? 0.3168 0.2394 0.2888 -0.0268 -0.0509 -0.0343 46  LYS A CA  
266  C C   . LYS A 47  ? 0.3822 0.2648 0.3031 -0.0314 -0.0628 -0.0331 46  LYS A C   
267  O O   . LYS A 47  ? 0.3912 0.2839 0.3176 -0.0150 -0.0829 -0.0186 46  LYS A O   
268  C CB  . LYS A 47  ? 0.3016 0.2344 0.2977 -0.0348 -0.0626 -0.0256 46  LYS A CB  
269  C CG  . LYS A 47  ? 0.3804 0.2775 0.3440 -0.0567 -0.0716 -0.0336 46  LYS A CG  
270  C CD  . LYS A 47  ? 0.4544 0.3480 0.4257 -0.0770 -0.0783 -0.0297 46  LYS A CD  
271  C CE  . LYS A 47  ? 0.4951 0.3373 0.4167 -0.1041 -0.0835 -0.0421 46  LYS A CE  
272  N NZ  . LYS A 47  ? 0.5214 0.3619 0.4390 -0.1385 -0.0957 -0.0392 46  LYS A NZ  
273  N N   . LEU A 48  ? 0.2731 0.3462 0.2455 -0.0403 -0.0008 -0.0203 47  LEU A N   
274  C CA  . LEU A 48  ? 0.2718 0.3126 0.2377 -0.0286 0.0012  -0.0307 47  LEU A CA  
275  C C   . LEU A 48  ? 0.3168 0.3559 0.3006 -0.0294 0.0066  -0.0207 47  LEU A C   
276  O O   . LEU A 48  ? 0.2926 0.3303 0.2929 -0.0376 0.0066  -0.0108 47  LEU A O   
277  C CB  . LEU A 48  ? 0.3143 0.3205 0.2746 -0.0356 -0.0071 -0.0323 47  LEU A CB  
278  C CG  . LEU A 48  ? 0.3254 0.3147 0.2610 -0.0362 -0.0194 -0.0463 47  LEU A CG  
279  C CD1 . LEU A 48  ? 0.3741 0.3917 0.3101 -0.0504 -0.0216 -0.0387 47  LEU A CD1 
280  C CD2 . LEU A 48  ? 0.3531 0.2993 0.2845 -0.0459 -0.0341 -0.0430 47  LEU A CD2 
281  N N   . SER A 49  ? 0.2997 0.3394 0.2794 -0.0192 0.0100  -0.0247 48  SER A N   
282  C CA  . SER A 49  ? 0.2754 0.3093 0.2642 -0.0207 0.0127  -0.0184 48  SER A CA  
283  C C   . SER A 49  ? 0.2987 0.3110 0.2794 -0.0148 0.0133  -0.0230 48  SER A C   
284  O O   . SER A 49  ? 0.2973 0.3101 0.2713 -0.0040 0.0118  -0.0280 48  SER A O   
285  C CB  . SER A 49  ? 0.2722 0.3323 0.2656 -0.0209 0.0117  -0.0108 48  SER A CB  
286  O OG  . SER A 49  ? 0.2771 0.3622 0.2799 -0.0307 0.0067  -0.0002 48  SER A OG  
287  N N   . LEU A 50  ? 0.2855 0.2851 0.2691 -0.0212 0.0146  -0.0194 49  LEU A N   
288  C CA  . LEU A 50  ? 0.2819 0.2692 0.2595 -0.0216 0.0130  -0.0171 49  LEU A CA  
289  C C   . LEU A 50  ? 0.3140 0.3106 0.2907 -0.0209 0.0168  -0.0157 49  LEU A C   
290  O O   . LEU A 50  ? 0.2955 0.2980 0.2763 -0.0233 0.0199  -0.0171 49  LEU A O   
291  C CB  . LEU A 50  ? 0.2752 0.2626 0.2562 -0.0320 0.0136  -0.0096 49  LEU A CB  
292  C CG  . LEU A 50  ? 0.3260 0.3130 0.3017 -0.0386 0.0111  -0.0006 49  LEU A CG  
293  C CD1 . LEU A 50  ? 0.3361 0.2957 0.3073 -0.0386 -0.0048 0.0027  49  LEU A CD1 
294  C CD2 . LEU A 50  ? 0.3391 0.3485 0.3200 -0.0494 0.0152  0.0102  49  LEU A CD2 
295  N N   . TYR A 51  ? 0.3111 0.3056 0.2829 -0.0177 0.0134  -0.0130 50  TYR A N   
296  C CA  . TYR A 51  ? 0.2616 0.2647 0.2302 -0.0209 0.0137  -0.0096 50  TYR A CA  
297  C C   . TYR A 51  ? 0.3321 0.3323 0.2952 -0.0234 0.0094  -0.0021 50  TYR A C   
298  O O   . TYR A 51  ? 0.3251 0.3150 0.2911 -0.0190 0.0035  0.0012  50  TYR A O   
299  C CB  . TYR A 51  ? 0.2687 0.2895 0.2434 -0.0175 0.0112  -0.0064 50  TYR A CB  
300  C CG  . TYR A 51  ? 0.2809 0.3171 0.2598 -0.0051 0.0096  -0.0041 50  TYR A CG  
301  C CD1 . TYR A 51  ? 0.2526 0.3015 0.2339 -0.0037 0.0057  0.0056  50  TYR A CD1 
302  C CD2 . TYR A 51  ? 0.3340 0.3751 0.3141 0.0075  0.0112  -0.0131 50  TYR A CD2 
303  C CE1 . TYR A 51  ? 0.2657 0.3356 0.2558 0.0140  0.0050  0.0067  50  TYR A CE1 
304  C CE2 . TYR A 51  ? 0.3345 0.3925 0.3174 0.0261  0.0106  -0.0170 50  TYR A CE2 
305  C CZ  . TYR A 51  ? 0.3297 0.4037 0.3202 0.0311  0.0081  -0.0068 50  TYR A CZ  
306  O OH  . TYR A 51  ? 0.3281 0.4248 0.3257 0.0551  0.0082  -0.0118 50  TYR A OH  
307  N N   . VAL A 52  ? 0.3089 0.3146 0.2633 -0.0312 0.0087  0.0008  51  VAL A N   
308  C CA  . VAL A 52  ? 0.3335 0.3418 0.2818 -0.0378 0.0030  0.0116  51  VAL A CA  
309  C C   . VAL A 52  ? 0.3209 0.3386 0.2796 -0.0309 -0.0037 0.0207  51  VAL A C   
310  O O   . VAL A 52  ? 0.3436 0.3741 0.3044 -0.0315 -0.0046 0.0221  51  VAL A O   
311  C CB  . VAL A 52  ? 0.3159 0.3295 0.2448 -0.0497 0.0041  0.0084  51  VAL A CB  
312  C CG1 . VAL A 52  ? 0.3409 0.3631 0.2613 -0.0610 -0.0035 0.0231  51  VAL A CG1 
313  C CG2 . VAL A 52  ? 0.3404 0.3582 0.2618 -0.0503 0.0136  -0.0022 51  VAL A CG2 
314  N N   . ALA A 53  ? 0.3391 0.3533 0.3068 -0.0246 -0.0109 0.0295  52  ALA A N   
315  C CA  . ALA A 53  ? 0.3216 0.3533 0.3038 -0.0127 -0.0162 0.0382  52  ALA A CA  
316  C C   . ALA A 53  ? 0.3368 0.3874 0.3139 -0.0280 -0.0209 0.0528  52  ALA A C   
317  O O   . ALA A 53  ? 0.3373 0.3805 0.2976 -0.0461 -0.0239 0.0568  52  ALA A O   
318  C CB  . ALA A 53  ? 0.3470 0.3644 0.3426 0.0001  -0.0272 0.0438  52  ALA A CB  
319  N N   . ASP A 54  ? 0.3721 0.3086 0.4600 0.0472  -0.0251 -0.0137 53  ASP A N   
320  C CA  . ASP A 54  ? 0.3728 0.3608 0.4469 0.0533  -0.0336 -0.0054 53  ASP A CA  
321  C C   . ASP A 54  ? 0.3371 0.3436 0.3467 0.0323  -0.0276 -0.0189 53  ASP A C   
322  O O   . ASP A 54  ? 0.3195 0.3486 0.3271 0.0231  -0.0217 -0.0445 53  ASP A O   
323  C CB  . ASP A 54  ? 0.3433 0.3667 0.4471 0.0705  -0.0554 0.0539  53  ASP A CB  
324  C CG  . ASP A 54  ? 0.5037 0.5054 0.7136 0.0971  -0.0652 0.0765  53  ASP A CG  
325  O OD1 . ASP A 54  ? 0.5703 0.5502 0.8323 0.1050  -0.0531 0.0213  53  ASP A OD1 
326  O OD2 . ASP A 54  ? 0.5897 0.6087 0.8437 0.1098  -0.0847 0.1518  53  ASP A OD2 
327  N N   . GLU A 55  ? 0.3468 0.3452 0.3243 0.0241  -0.0276 -0.0037 54  GLU A N   
328  C CA  . GLU A 55  ? 0.3650 0.3686 0.3168 0.0085  -0.0200 -0.0264 54  GLU A CA  
329  C C   . GLU A 55  ? 0.3381 0.3043 0.2926 -0.0027 -0.0091 -0.0366 54  GLU A C   
330  O O   . GLU A 55  ? 0.3434 0.3091 0.3118 -0.0145 -0.0041 -0.0466 54  GLU A O   
331  C CB  . GLU A 55  ? 0.3411 0.3560 0.2736 0.0053  -0.0189 -0.0161 54  GLU A CB  
332  C CG  . GLU A 55  ? 0.3487 0.4429 0.2673 0.0075  -0.0279 0.0013  54  GLU A CG  
333  C CD  . GLU A 55  ? 0.4332 0.5627 0.3322 -0.0008 -0.0205 0.0066  54  GLU A CD  
334  O OE1 . GLU A 55  ? 0.4205 0.5098 0.3278 -0.0049 -0.0093 -0.0187 54  GLU A OE1 
335  O OE2 . GLU A 55  ? 0.4124 0.6235 0.2936 -0.0038 -0.0263 0.0429  54  GLU A OE2 
336  N N   . ASN A 56  ? 0.3410 0.2908 0.2953 -0.0015 -0.0062 -0.0337 55  ASN A N   
337  C CA  . ASN A 56  ? 0.3468 0.3017 0.2903 -0.0162 0.0010  -0.0343 55  ASN A CA  
338  C C   . ASN A 56  ? 0.3635 0.3034 0.3058 -0.0232 -0.0012 -0.0122 55  ASN A C   
339  O O   . ASN A 56  ? 0.3444 0.2920 0.3028 -0.0353 0.0007  0.0095  55  ASN A O   
340  C CB  . ASN A 56  ? 0.3856 0.3818 0.3357 -0.0267 0.0105  -0.0453 55  ASN A CB  
341  C CG  . ASN A 56  ? 0.4607 0.4796 0.4354 -0.0147 0.0147  -0.0811 55  ASN A CG  
342  O OD1 . ASN A 56  ? 0.5042 0.5571 0.5015 -0.0128 0.0203  -0.0969 55  ASN A OD1 
343  N ND2 . ASN A 56  ? 0.4159 0.4178 0.4069 -0.0066 0.0126  -0.0984 55  ASN A ND2 
344  N N   . ARG A 57  ? 0.3238 0.2478 0.2631 -0.0155 -0.0052 -0.0110 56  ARG A N   
345  C CA  . ARG A 57  ? 0.3510 0.2671 0.3088 -0.0150 -0.0064 -0.0023 56  ARG A CA  
346  C C   . ARG A 57  ? 0.3434 0.2658 0.2928 -0.0175 -0.0114 0.0126  56  ARG A C   
347  O O   . ARG A 57  ? 0.3340 0.2557 0.2729 -0.0175 -0.0112 0.0055  56  ARG A O   
348  C CB  . ARG A 57  ? 0.3791 0.3088 0.3406 -0.0080 -0.0036 -0.0226 56  ARG A CB  
349  C CG  . ARG A 57  ? 0.4373 0.3731 0.4327 -0.0041 -0.0003 -0.0325 56  ARG A CG  
350  C CD  . ARG A 57  ? 0.4533 0.4402 0.4550 -0.0026 0.0080  -0.0717 56  ARG A CD  
351  N NE  . ARG A 57  ? 0.4512 0.4859 0.4043 -0.0064 0.0085  -0.0548 56  ARG A NE  
352  C CZ  . ARG A 57  ? 0.5079 0.5775 0.4543 -0.0102 0.0149  -0.0434 56  ARG A CZ  
353  N NH1 . ARG A 57  ? 0.4316 0.4920 0.4133 -0.0066 0.0199  -0.0562 56  ARG A NH1 
354  N NH2 . ARG A 57  ? 0.4709 0.5911 0.3864 -0.0185 0.0152  -0.0088 56  ARG A NH2 
355  N N   . GLU A 58  ? 0.3547 0.2929 0.3202 -0.0221 -0.0178 0.0400  57  GLU A N   
356  C CA  . GLU A 58  ? 0.3585 0.3320 0.3173 -0.0268 -0.0278 0.0537  57  GLU A CA  
357  C C   . GLU A 58  ? 0.4050 0.3676 0.3871 -0.0174 -0.0273 0.0433  57  GLU A C   
358  O O   . GLU A 58  ? 0.3169 0.2636 0.3396 -0.0050 -0.0229 0.0391  57  GLU A O   
359  C CB  . GLU A 58  ? 0.4259 0.4388 0.4083 -0.0307 -0.0403 0.1063  57  GLU A CB  
360  C CG  . GLU A 58  ? 0.4509 0.4982 0.4137 -0.0466 -0.0370 0.1297  57  GLU A CG  
361  C CD  . GLU A 58  ? 0.5285 0.6278 0.5278 -0.0546 -0.0513 0.2138  57  GLU A CD  
362  O OE1 . GLU A 58  ? 0.5319 0.5854 0.6149 -0.0391 -0.0590 0.2510  57  GLU A OE1 
363  O OE2 . GLU A 58  ? 0.6320 0.8301 0.5891 -0.0768 -0.0547 0.2446  57  GLU A OE2 
364  N N   . LEU A 59  ? 0.3639 0.3441 0.3333 -0.0265 -0.0285 0.0295  58  LEU A N   
365  C CA  . LEU A 59  ? 0.3098 0.3009 0.3049 -0.0248 -0.0258 0.0255  58  LEU A CA  
366  C C   . LEU A 59  ? 0.3326 0.3756 0.3494 -0.0297 -0.0404 0.0360  58  LEU A C   
367  O O   . LEU A 59  ? 0.3226 0.3876 0.3758 -0.0250 -0.0392 0.0353  58  LEU A O   
368  C CB  . LEU A 59  ? 0.3007 0.2781 0.2895 -0.0378 -0.0163 0.0134  58  LEU A CB  
369  C CG  . LEU A 59  ? 0.3330 0.2839 0.3060 -0.0323 -0.0072 0.0176  58  LEU A CG  
370  C CD1 . LEU A 59  ? 0.3767 0.3135 0.3704 -0.0454 -0.0038 0.0289  58  LEU A CD1 
371  C CD2 . LEU A 59  ? 0.4077 0.3866 0.3818 -0.0228 0.0018  0.0146  58  LEU A CD2 
372  N N   . ALA A 60  ? 0.2261 0.3253 0.2789 -0.0133 -0.0142 -0.0020 59  ALA A N   
373  C CA  . ALA A 60  ? 0.2077 0.3076 0.2653 -0.0028 -0.0113 -0.0082 59  ALA A CA  
374  C C   . ALA A 60  ? 0.2679 0.3592 0.3309 -0.0046 -0.0128 -0.0033 59  ALA A C   
375  O O   . ALA A 60  ? 0.2619 0.3639 0.3335 -0.0095 -0.0116 0.0046  59  ALA A O   
376  C CB  . ALA A 60  ? 0.2253 0.3504 0.2912 -0.0079 -0.0039 -0.0087 59  ALA A CB  
377  N N   . LEU A 61  ? 0.2550 0.3293 0.3061 0.0051  -0.0163 -0.0088 60  LEU A N   
378  C CA  . LEU A 61  ? 0.2460 0.3056 0.2934 -0.0003 -0.0186 -0.0042 60  LEU A CA  
379  C C   . LEU A 61  ? 0.2737 0.3409 0.3246 0.0172  -0.0185 -0.0104 60  LEU A C   
380  O O   . LEU A 61  ? 0.2769 0.3441 0.3111 0.0400  -0.0228 -0.0200 60  LEU A O   
381  C CB  . LEU A 61  ? 0.2831 0.2929 0.2853 -0.0132 -0.0280 -0.0030 60  LEU A CB  
382  C CG  . LEU A 61  ? 0.3616 0.3679 0.3460 -0.0403 -0.0314 0.0013  60  LEU A CG  
383  C CD1 . LEU A 61  ? 0.4730 0.4066 0.3845 -0.0673 -0.0428 0.0026  60  LEU A CD1 
384  C CD2 . LEU A 61  ? 0.3519 0.4280 0.3765 -0.0541 -0.0254 0.0102  60  LEU A CD2 
385  N N   . VAL A 62  ? 0.2700 0.3496 0.3370 0.0109  -0.0145 -0.0062 61  VAL A N   
386  C CA  . VAL A 62  ? 0.2646 0.3611 0.3346 0.0210  -0.0154 -0.0112 61  VAL A CA  
387  C C   . VAL A 62  ? 0.2650 0.3489 0.3370 0.0116  -0.0137 -0.0050 61  VAL A C   
388  O O   . VAL A 62  ? 0.2487 0.3286 0.3253 0.0021  -0.0088 0.0015  61  VAL A O   
389  C CB  . VAL A 62  ? 0.2854 0.4316 0.3699 0.0134  -0.0098 -0.0160 61  VAL A CB  
390  C CG1 . VAL A 62  ? 0.2373 0.3654 0.3181 -0.0102 -0.0032 -0.0084 61  VAL A CG1 
391  C CG2 . VAL A 62  ? 0.2572 0.4480 0.3450 0.0208  -0.0128 -0.0227 61  VAL A CG2 
392  N N   . GLN A 63  ? 0.2669 0.3487 0.3305 0.0206  -0.0185 -0.0077 62  GLN A N   
393  C CA  . GLN A 63  ? 0.2512 0.3215 0.3135 0.0112  -0.0163 -0.0025 62  GLN A CA  
394  C C   . GLN A 63  ? 0.2896 0.3838 0.3564 0.0103  -0.0161 -0.0064 62  GLN A C   
395  O O   . GLN A 63  ? 0.2566 0.3892 0.3274 0.0196  -0.0203 -0.0134 62  GLN A O   
396  C CB  . GLN A 63  ? 0.3187 0.3509 0.3531 0.0088  -0.0227 0.0019  62  GLN A CB  
397  C CG  . GLN A 63  ? 0.3985 0.4009 0.4000 0.0266  -0.0338 -0.0013 62  GLN A CG  
398  C CD  . GLN A 63  ? 0.4658 0.4031 0.4140 0.0108  -0.0412 0.0054  62  GLN A CD  
399  O OE1 . GLN A 63  ? 0.5128 0.4244 0.4384 -0.0085 -0.0424 0.0086  62  GLN A OE1 
400  N NE2 . GLN A 63  ? 0.4489 0.3575 0.3681 0.0111  -0.0468 0.0082  62  GLN A NE2 
401  N N   . THR A 64  ? 0.2375 0.3195 0.3001 -0.0009 -0.0113 -0.0030 63  THR A N   
402  C CA  . THR A 64  ? 0.2480 0.3448 0.3037 -0.0111 -0.0123 -0.0064 63  THR A CA  
403  C C   . THR A 64  ? 0.2714 0.3740 0.3228 0.0037  -0.0212 -0.0075 63  THR A C   
404  O O   . THR A 64  ? 0.2646 0.3365 0.3040 0.0168  -0.0259 -0.0042 63  THR A O   
405  C CB  . THR A 64  ? 0.2643 0.3242 0.2979 -0.0217 -0.0057 -0.0037 63  THR A CB  
406  O OG1 . THR A 64  ? 0.2420 0.2892 0.2760 -0.0101 -0.0044 0.0003  63  THR A OG1 
407  C CG2 . THR A 64  ? 0.3104 0.3393 0.3241 -0.0247 0.0000  -0.0020 63  THR A CG2 
408  N N   A LYS A 65  ? 0.2592 0.3928 0.3076 -0.0027 -0.0248 -0.0114 64  LYS A N   
409  N N   B LYS A 65  ? 0.2701 0.4042 0.3186 -0.0025 -0.0249 -0.0114 64  LYS A N   
410  C CA  A LYS A 65  ? 0.2747 0.4044 0.3102 0.0123  -0.0338 -0.0110 64  LYS A CA  
411  C CA  B LYS A 65  ? 0.2976 0.4277 0.3329 0.0136  -0.0342 -0.0111 64  LYS A CA  
412  C C   A LYS A 65  ? 0.2986 0.3725 0.3184 0.0051  -0.0291 -0.0036 64  LYS A C   
413  C C   B LYS A 65  ? 0.3141 0.3899 0.3338 0.0047  -0.0293 -0.0039 64  LYS A C   
414  O O   A LYS A 65  ? 0.2632 0.3200 0.2844 -0.0083 -0.0185 -0.0012 64  LYS A O   
415  O O   B LYS A 65  ? 0.2802 0.3392 0.3003 -0.0098 -0.0187 -0.0019 64  LYS A O   
416  C CB  A LYS A 65  ? 0.2895 0.4737 0.3250 -0.0015 -0.0378 -0.0161 64  LYS A CB  
417  C CB  B LYS A 65  ? 0.3158 0.5103 0.3531 0.0070  -0.0404 -0.0172 64  LYS A CB  
418  C CG  A LYS A 65  ? 0.3301 0.4805 0.3472 -0.0352 -0.0303 -0.0138 64  LYS A CG  
419  C CG  B LYS A 65  ? 0.3929 0.5706 0.4151 -0.0270 -0.0354 -0.0156 64  LYS A CG  
420  C CD  A LYS A 65  ? 0.3182 0.5241 0.3246 -0.0611 -0.0364 -0.0189 64  LYS A CD  
421  C CD  B LYS A 65  ? 0.3500 0.6010 0.3689 -0.0392 -0.0447 -0.0212 64  LYS A CD  
422  C CE  A LYS A 65  ? 0.2986 0.5617 0.3040 -0.0976 -0.0345 -0.0236 64  LYS A CE  
423  C CE  B LYS A 65  ? 0.4521 0.6913 0.4581 -0.0147 -0.0547 -0.0192 64  LYS A CE  
424  N NZ  A LYS A 65  ? 0.2873 0.4661 0.2562 -0.1272 -0.0243 -0.0201 64  LYS A NZ  
425  N NZ  B LYS A 65  ? 0.3877 0.7096 0.3904 -0.0282 -0.0646 -0.0247 64  LYS A NZ  
426  N N   . THR A 66  ? 0.3129 0.3617 0.3087 0.0171  -0.0380 -0.0007 65  THR A N   
427  C CA  . THR A 66  ? 0.3113 0.3256 0.2888 0.0029  -0.0334 0.0060  65  THR A CA  
428  C C   . THR A 66  ? 0.3409 0.3675 0.3141 -0.0040 -0.0329 0.0037  65  THR A C   
429  O O   . THR A 66  ? 0.3812 0.4294 0.3489 0.0068  -0.0439 0.0003  65  THR A O   
430  C CB  . THR A 66  ? 0.3645 0.3261 0.2964 0.0090  -0.0449 0.0118  65  THR A CB  
431  O OG1 . THR A 66  ? 0.4113 0.3530 0.3369 0.0066  -0.0448 0.0134  65  THR A OG1 
432  C CG2 . THR A 66  ? 0.4120 0.3477 0.3153 -0.0145 -0.0414 0.0193  65  THR A CG2 
433  N N   . ILE A 67  ? 0.3570 0.3752 0.3273 -0.0175 -0.0212 0.0043  66  ILE A N   
434  C CA  . ILE A 67  ? 0.3623 0.3766 0.3140 -0.0254 -0.0217 0.0020  66  ILE A CA  
435  C C   . ILE A 67  ? 0.3958 0.3906 0.3256 -0.0276 -0.0218 0.0082  66  ILE A C   
436  O O   . ILE A 67  ? 0.3827 0.3781 0.3112 -0.0330 -0.0123 0.0120  66  ILE A O   
437  C CB  . ILE A 67  ? 0.3694 0.3656 0.3049 -0.0338 -0.0104 -0.0032 66  ILE A CB  
438  C CG1 . ILE A 67  ? 0.4123 0.4055 0.3486 -0.0415 -0.0092 -0.0071 66  ILE A CG1 
439  C CG2 . ILE A 67  ? 0.4286 0.4089 0.3320 -0.0454 -0.0123 -0.0066 66  ILE A CG2 
440  C CD1 . ILE A 67  ? 0.4097 0.4452 0.3577 -0.0578 -0.0194 -0.0099 66  ILE A CD1 
441  N N   . LYS A 68  ? 0.3833 0.3707 0.2919 -0.0267 -0.0324 0.0092  67  LYS A N   
442  C CA  . LYS A 68  ? 0.4270 0.3844 0.3002 -0.0344 -0.0348 0.0168  67  LYS A CA  
443  C C   . LYS A 68  ? 0.4548 0.4196 0.3198 -0.0479 -0.0205 0.0154  67  LYS A C   
444  O O   . LYS A 68  ? 0.4451 0.4150 0.3102 -0.0463 -0.0170 0.0080  67  LYS A O   
445  C CB  . LYS A 68  ? 0.5322 0.4742 0.3754 -0.0207 -0.0538 0.0182  67  LYS A CB  
446  C CG  . LYS A 68  ? 0.5746 0.5073 0.4064 0.0095  -0.0710 0.0180  67  LYS A CG  
447  C CD  . LYS A 68  ? 0.6300 0.5072 0.4327 0.0054  -0.0716 0.0247  67  LYS A CD  
448  C CE  . LYS A 68  ? 0.7571 0.5832 0.5057 0.0444  -0.0937 0.0250  67  LYS A CE  
449  N NZ  . LYS A 68  ? 0.8670 0.6240 0.5741 0.0297  -0.0939 0.0308  67  LYS A NZ  
450  N N   . LYS A 69  ? 0.4540 0.3912 0.2727 0.0197  -0.0589 0.0252  68  LYS A N   
451  C CA  . LYS A 69  ? 0.4888 0.4294 0.2912 0.0076  -0.0571 0.0208  68  LYS A CA  
452  C C   . LYS A 69  ? 0.5010 0.4606 0.3208 -0.0014 -0.0529 0.0065  68  LYS A C   
453  O O   . LYS A 69  ? 0.4823 0.4576 0.2997 -0.0059 -0.0575 0.0004  68  LYS A O   
454  C CB  . LYS A 69  ? 0.5706 0.5138 0.3496 0.0116  -0.0677 0.0280  68  LYS A CB  
455  C CG  . LYS A 69  ? 0.6760 0.5862 0.4233 0.0179  -0.0683 0.0430  68  LYS A CG  
456  N N   . THR A 70  ? 0.4663 0.4223 0.3004 -0.0036 -0.0435 0.0012  69  THR A N   
457  C CA  . THR A 70  ? 0.4445 0.4092 0.2906 -0.0084 -0.0381 -0.0109 69  THR A CA  
458  C C   . THR A 70  ? 0.4310 0.3905 0.2818 -0.0084 -0.0274 -0.0137 69  THR A C   
459  O O   . THR A 70  ? 0.4426 0.3960 0.2971 -0.0056 -0.0247 -0.0076 69  THR A O   
460  C CB  . THR A 70  ? 0.3886 0.3618 0.2547 -0.0061 -0.0414 -0.0153 69  THR A CB  
461  O OG1 . THR A 70  ? 0.4701 0.4419 0.3395 -0.0117 -0.0350 -0.0268 69  THR A OG1 
462  C CG2 . THR A 70  ? 0.4297 0.3983 0.3126 0.0010  -0.0394 -0.0101 69  THR A CG2 
463  N N   . LEU A 71  ? 0.4216 0.3852 0.2718 -0.0107 -0.0212 -0.0237 70  LEU A N   
464  C CA  . LEU A 71  ? 0.4202 0.3854 0.2788 -0.0060 -0.0122 -0.0279 70  LEU A CA  
465  C C   . LEU A 71  ? 0.4098 0.3682 0.2808 -0.0004 -0.0102 -0.0338 70  LEU A C   
466  O O   . LEU A 71  ? 0.3985 0.3554 0.2738 0.0071  -0.0034 -0.0374 70  LEU A O   
467  C CB  . LEU A 71  ? 0.4491 0.4244 0.2951 -0.0091 -0.0056 -0.0354 70  LEU A CB  
468  C CG  . LEU A 71  ? 0.4703 0.4498 0.2984 -0.0191 -0.0053 -0.0307 70  LEU A CG  
469  C CD1 . LEU A 71  ? 0.4770 0.4723 0.2933 -0.0241 0.0013  -0.0411 70  LEU A CD1 
470  C CD2 . LEU A 71  ? 0.5105 0.4880 0.3407 -0.0206 -0.0022 -0.0234 70  LEU A CD2 
471  N N   . ASN A 72  ? 0.4035 0.3579 0.2778 -0.0041 -0.0158 -0.0345 71  ASN A N   
472  C CA  . ASN A 72  ? 0.3887 0.3313 0.2685 -0.0036 -0.0123 -0.0407 71  ASN A CA  
473  C C   . ASN A 72  ? 0.4009 0.3466 0.2926 -0.0077 -0.0179 -0.0375 71  ASN A C   
474  O O   . ASN A 72  ? 0.4279 0.3749 0.3174 -0.0167 -0.0201 -0.0440 71  ASN A O   
475  C CB  . ASN A 72  ? 0.4114 0.3472 0.2774 -0.0097 -0.0096 -0.0524 71  ASN A CB  
476  C CG  . ASN A 72  ? 0.4506 0.3856 0.3062 -0.0033 -0.0026 -0.0580 71  ASN A CG  
477  O OD1 . ASN A 72  ? 0.5364 0.4849 0.3836 -0.0071 -0.0044 -0.0585 71  ASN A OD1 
478  N ND2 . ASN A 72  ? 0.3895 0.3108 0.2449 0.0075  0.0053  -0.0616 71  ASN A ND2 
479  N N   . PRO A 73  ? 0.3951 0.3460 0.2986 -0.0025 -0.0200 -0.0287 72  PRO A N   
480  C CA  . PRO A 73  ? 0.3758 0.3368 0.2920 -0.0037 -0.0261 -0.0251 72  PRO A CA  
481  C C   . PRO A 73  ? 0.4083 0.3633 0.3320 -0.0090 -0.0220 -0.0304 72  PRO A C   
482  O O   . PRO A 73  ? 0.3730 0.3113 0.2949 -0.0060 -0.0143 -0.0309 72  PRO A O   
483  C CB  . PRO A 73  ? 0.3439 0.3049 0.2674 0.0043  -0.0254 -0.0160 72  PRO A CB  
484  C CG  . PRO A 73  ? 0.3527 0.3049 0.2714 0.0076  -0.0167 -0.0169 72  PRO A CG  
485  C CD  . PRO A 73  ? 0.3875 0.3382 0.2916 0.0045  -0.0159 -0.0230 72  PRO A CD  
486  N N   . LYS A 74  ? 0.3917 0.3614 0.3217 -0.0170 -0.0269 -0.0343 73  LYS A N   
487  C CA  . LYS A 74  ? 0.4037 0.3690 0.3388 -0.0265 -0.0222 -0.0398 73  LYS A CA  
488  C C   . LYS A 74  ? 0.4152 0.4019 0.3688 -0.0228 -0.0268 -0.0349 73  LYS A C   
489  O O   . LYS A 74  ? 0.3911 0.4053 0.3523 -0.0217 -0.0355 -0.0353 73  LYS A O   
490  C CB  . LYS A 74  ? 0.4514 0.4255 0.3798 -0.0428 -0.0233 -0.0512 73  LYS A CB  
491  C CG  . LYS A 74  ? 0.5729 0.5231 0.4807 -0.0512 -0.0167 -0.0604 73  LYS A CG  
492  C CD  . LYS A 74  ? 0.6045 0.5288 0.5008 -0.0389 -0.0109 -0.0574 73  LYS A CD  
493  C CE  . LYS A 74  ? 0.6014 0.5108 0.4776 -0.0475 -0.0064 -0.0691 73  LYS A CE  
494  N NZ  . LYS A 74  ? 0.6235 0.5438 0.4962 -0.0384 -0.0104 -0.0662 73  LYS A NZ  
495  N N   . TRP A 75  ? 0.3935 0.3698 0.3538 -0.0191 -0.0213 -0.0305 74  TRP A N   
496  C CA  . TRP A 75  ? 0.3349 0.3311 0.3126 -0.0157 -0.0243 -0.0274 74  TRP A CA  
497  C C   . TRP A 75  ? 0.3526 0.3595 0.3372 -0.0299 -0.0213 -0.0348 74  TRP A C   
498  O O   . TRP A 75  ? 0.3644 0.4033 0.3628 -0.0312 -0.0270 -0.0380 74  TRP A O   
499  C CB  . TRP A 75  ? 0.3207 0.3061 0.3026 -0.0057 -0.0201 -0.0194 74  TRP A CB  
500  C CG  . TRP A 75  ? 0.3608 0.3405 0.3364 0.0047  -0.0220 -0.0132 74  TRP A CG  
501  C CD1 . TRP A 75  ? 0.3654 0.3535 0.3416 0.0123  -0.0282 -0.0089 74  TRP A CD1 
502  C CD2 . TRP A 75  ? 0.3769 0.3407 0.3415 0.0080  -0.0167 -0.0110 74  TRP A CD2 
503  N NE1 . TRP A 75  ? 0.3387 0.3132 0.3025 0.0162  -0.0259 -0.0042 74  TRP A NE1 
504  C CE2 . TRP A 75  ? 0.3410 0.3059 0.3002 0.0133  -0.0191 -0.0063 74  TRP A CE2 
505  C CE3 . TRP A 75  ? 0.3031 0.2524 0.2606 0.0081  -0.0098 -0.0126 74  TRP A CE3 
506  C CZ2 . TRP A 75  ? 0.3301 0.2885 0.2792 0.0151  -0.0143 -0.0049 74  TRP A CZ2 
507  C CZ3 . TRP A 75  ? 0.3614 0.3070 0.3108 0.0145  -0.0063 -0.0110 74  TRP A CZ3 
508  C CH2 . TRP A 75  ? 0.3103 0.2638 0.2568 0.0162  -0.0084 -0.0081 74  TRP A CH2 
509  N N   . ASN A 76  ? 0.3275 0.3082 0.3003 -0.0403 -0.0121 -0.0377 75  ASN A N   
510  C CA  . ASN A 76  ? 0.3801 0.3646 0.3538 -0.0581 -0.0068 -0.0447 75  ASN A CA  
511  C C   . ASN A 76  ? 0.3931 0.4046 0.3870 -0.0567 -0.0082 -0.0430 75  ASN A C   
512  O O   . ASN A 76  ? 0.3637 0.4070 0.3680 -0.0688 -0.0100 -0.0514 75  ASN A O   
513  C CB  . ASN A 76  ? 0.3992 0.4009 0.3682 -0.0766 -0.0086 -0.0572 75  ASN A CB  
514  C CG  . ASN A 76  ? 0.4943 0.4619 0.4394 -0.0829 -0.0034 -0.0615 75  ASN A CG  
515  O OD1 . ASN A 76  ? 0.6420 0.6213 0.5834 -0.0840 -0.0086 -0.0663 75  ASN A OD1 
516  N ND2 . ASN A 76  ? 0.5148 0.4378 0.4414 -0.0844 0.0072  -0.0592 75  ASN A ND2 
517  N N   . GLU A 77  ? 0.3464 0.3492 0.3456 -0.0429 -0.0068 -0.0338 76  GLU A N   
518  C CA  . GLU A 77  ? 0.3412 0.3675 0.3586 -0.0396 -0.0075 -0.0325 76  GLU A CA  
519  C C   . GLU A 77  ? 0.3925 0.3994 0.4043 -0.0457 0.0017  -0.0291 76  GLU A C   
520  O O   . GLU A 77  ? 0.3946 0.3699 0.3912 -0.0408 0.0064  -0.0228 76  GLU A O   
521  C CB  . GLU A 77  ? 0.2936 0.3270 0.3201 -0.0199 -0.0131 -0.0255 76  GLU A CB  
522  C CG  . GLU A 77  ? 0.3871 0.4415 0.4181 -0.0122 -0.0227 -0.0274 76  GLU A CG  
523  C CD  . GLU A 77  ? 0.3095 0.3638 0.3442 0.0060  -0.0267 -0.0203 76  GLU A CD  
524  O OE1 . GLU A 77  ? 0.3672 0.4227 0.4103 0.0104  -0.0231 -0.0184 76  GLU A OE1 
525  O OE2 . GLU A 77  ? 0.3981 0.4510 0.4253 0.0146  -0.0332 -0.0175 76  GLU A OE2 
526  N N   . GLU A 78  ? 0.3311 0.3600 0.3544 -0.0555 0.0041  -0.0335 77  GLU A N   
527  C CA  . GLU A 78  ? 0.3733 0.3855 0.3885 -0.0647 0.0131  -0.0307 77  GLU A CA  
528  C C   . GLU A 78  ? 0.3499 0.3815 0.3821 -0.0549 0.0128  -0.0271 77  GLU A C   
529  O O   . GLU A 78  ? 0.3365 0.4010 0.3883 -0.0483 0.0074  -0.0315 77  GLU A O   
530  C CB  . GLU A 78  ? 0.4116 0.4334 0.4222 -0.0900 0.0184  -0.0409 77  GLU A CB  
531  C CG  . GLU A 78  ? 0.4905 0.4990 0.4912 -0.1040 0.0281  -0.0390 77  GLU A CG  
532  C CD  . GLU A 78  ? 0.5154 0.5429 0.5136 -0.1327 0.0333  -0.0518 77  GLU A CD  
533  O OE1 . GLU A 78  ? 0.6144 0.6935 0.6368 -0.1372 0.0299  -0.0611 77  GLU A OE1 
534  O OE2 . GLU A 78  ? 0.5748 0.5660 0.5452 -0.1510 0.0413  -0.0538 77  GLU A OE2 
535  N N   . PHE A 79  ? 0.3153 0.3263 0.3382 -0.0528 0.0188  -0.0194 78  PHE A N   
536  C CA  . PHE A 79  ? 0.3052 0.3328 0.3413 -0.0462 0.0201  -0.0167 78  PHE A CA  
537  C C   . PHE A 79  ? 0.3464 0.3610 0.3703 -0.0575 0.0285  -0.0131 78  PHE A C   
538  O O   . PHE A 79  ? 0.3969 0.3779 0.3974 -0.0610 0.0327  -0.0076 78  PHE A O   
539  C CB  . PHE A 79  ? 0.3354 0.3537 0.3705 -0.0288 0.0179  -0.0094 78  PHE A CB  
540  C CG  . PHE A 79  ? 0.3252 0.3478 0.3653 -0.0182 0.0107  -0.0108 78  PHE A CG  
541  C CD1 . PHE A 79  ? 0.3070 0.3489 0.3616 -0.0099 0.0070  -0.0135 78  PHE A CD1 
542  C CD2 . PHE A 79  ? 0.3540 0.3586 0.3813 -0.0163 0.0082  -0.0095 78  PHE A CD2 
543  C CE1 . PHE A 79  ? 0.3390 0.3794 0.3927 0.0002  0.0005  -0.0131 78  PHE A CE1 
544  C CE2 . PHE A 79  ? 0.3187 0.3271 0.3478 -0.0079 0.0016  -0.0102 78  PHE A CE2 
545  C CZ  . PHE A 79  ? 0.3080 0.3333 0.3492 0.0002  -0.0024 -0.0113 78  PHE A CZ  
546  N N   . TYR A 80  ? 0.3267 0.3658 0.3634 -0.0631 0.0315  -0.0163 79  TYR A N   
547  C CA  . TYR A 80  ? 0.2861 0.3133 0.3093 -0.0728 0.0394  -0.0111 79  TYR A CA  
548  C C   . TYR A 80  ? 0.2866 0.3255 0.3187 -0.0603 0.0394  -0.0065 79  TYR A C   
549  O O   . TYR A 80  ? 0.2946 0.3608 0.3480 -0.0539 0.0367  -0.0127 79  TYR A O   
550  C CB  . TYR A 80  ? 0.3114 0.3608 0.3400 -0.0936 0.0445  -0.0199 79  TYR A CB  
551  C CG  . TYR A 80  ? 0.3849 0.4213 0.3989 -0.1128 0.0474  -0.0254 79  TYR A CG  
552  C CD1 . TYR A 80  ? 0.4184 0.4155 0.4003 -0.1292 0.0563  -0.0201 79  TYR A CD1 
553  C CD2 . TYR A 80  ? 0.3525 0.4124 0.3806 -0.1143 0.0415  -0.0357 79  TYR A CD2 
554  C CE1 . TYR A 80  ? 0.4629 0.4427 0.4266 -0.1508 0.0609  -0.0269 79  TYR A CE1 
555  C CE2 . TYR A 80  ? 0.4415 0.4931 0.4556 -0.1347 0.0448  -0.0427 79  TYR A CE2 
556  C CZ  . TYR A 80  ? 0.4941 0.5039 0.4755 -0.1545 0.0551  -0.0391 79  TYR A CZ  
557  O OH  . TYR A 80  ? 0.5148 0.5139 0.4793 -0.1785 0.0599  -0.0484 79  TYR A OH  
558  N N   . PHE A 81  ? 0.3086 0.3266 0.3230 -0.0551 0.0424  0.0039  80  PHE A N   
559  C CA  . PHE A 81  ? 0.2465 0.2804 0.2677 -0.0465 0.0432  0.0071  80  PHE A CA  
560  C C   . PHE A 81  ? 0.3057 0.3413 0.3161 -0.0563 0.0498  0.0117  80  PHE A C   
561  O O   . PHE A 81  ? 0.3373 0.3466 0.3242 -0.0627 0.0534  0.0186  80  PHE A O   
562  C CB  . PHE A 81  ? 0.2571 0.2786 0.2685 -0.0306 0.0405  0.0149  80  PHE A CB  
563  C CG  . PHE A 81  ? 0.2800 0.3040 0.3014 -0.0214 0.0349  0.0108  80  PHE A CG  
564  C CD1 . PHE A 81  ? 0.2688 0.3113 0.3041 -0.0170 0.0339  0.0064  80  PHE A CD1 
565  C CD2 . PHE A 81  ? 0.2925 0.2970 0.3061 -0.0190 0.0315  0.0109  80  PHE A CD2 
566  C CE1 . PHE A 81  ? 0.2888 0.3279 0.3277 -0.0095 0.0294  0.0038  80  PHE A CE1 
567  C CE2 . PHE A 81  ? 0.2658 0.2722 0.2859 -0.0113 0.0263  0.0078  80  PHE A CE2 
568  C CZ  . PHE A 81  ? 0.2843 0.3073 0.3166 -0.0067 0.0251  0.0048  80  PHE A CZ  
569  N N   . ARG A 82  ? 0.3432 0.3640 0.3255 -0.0353 0.0481  -0.0089 81  ARG A N   
570  C CA  . ARG A 82  ? 0.3665 0.3627 0.3191 -0.0438 0.0563  -0.0153 81  ARG A CA  
571  C C   . ARG A 82  ? 0.4204 0.3806 0.3487 -0.0403 0.0452  -0.0186 81  ARG A C   
572  O O   . ARG A 82  ? 0.3996 0.3536 0.3349 -0.0296 0.0462  -0.0230 81  ARG A O   
573  C CB  . ARG A 82  ? 0.3805 0.3876 0.3443 -0.0351 0.0784  -0.0207 81  ARG A CB  
574  C CG  . ARG A 82  ? 0.4528 0.4485 0.3878 -0.0494 0.0925  -0.0270 81  ARG A CG  
575  C CD  . ARG A 82  ? 0.4594 0.4710 0.4141 -0.0385 0.1221  -0.0335 81  ARG A CD  
576  N NE  . ARG A 82  ? 0.4846 0.5473 0.4743 -0.0413 0.1331  -0.0255 81  ARG A NE  
577  C CZ  . ARG A 82  ? 0.5182 0.6277 0.5623 -0.0213 0.1424  -0.0159 81  ARG A CZ  
578  N NH1 . ARG A 82  ? 0.4964 0.5961 0.5610 0.0046  0.1447  -0.0131 81  ARG A NH1 
579  N NH2 . ARG A 82  ? 0.5175 0.6862 0.5967 -0.0278 0.1502  -0.0068 81  ARG A NH2 
580  N N   . VAL A 83  ? 0.4000 0.3381 0.3016 -0.0497 0.0359  -0.0144 82  VAL A N   
581  C CA  . VAL A 83  ? 0.3989 0.3179 0.2890 -0.0440 0.0216  -0.0112 82  VAL A CA  
582  C C   . VAL A 83  ? 0.4322 0.3324 0.2875 -0.0524 0.0162  -0.0036 82  VAL A C   
583  O O   . VAL A 83  ? 0.4471 0.3385 0.2826 -0.0638 0.0236  0.0000  82  VAL A O   
584  C CB  . VAL A 83  ? 0.3557 0.2697 0.2595 -0.0372 0.0131  -0.0062 82  VAL A CB  
585  C CG1 . VAL A 83  ? 0.3587 0.2952 0.2894 -0.0342 0.0168  -0.0104 82  VAL A CG1 
586  C CG2 . VAL A 83  ? 0.3745 0.2640 0.2598 -0.0446 0.0145  0.0011  82  VAL A CG2 
587  N N   . ASN A 84  ? 0.4285 0.3274 0.2770 -0.0486 0.0022  0.0010  83  ASN A N   
588  C CA  . ASN A 84  ? 0.4413 0.3320 0.2602 -0.0539 -0.0098 0.0154  83  ASN A CA  
589  C C   . ASN A 84  ? 0.4513 0.3373 0.2899 -0.0367 -0.0209 0.0313  83  ASN A C   
590  O O   . ASN A 84  ? 0.4325 0.3354 0.2978 -0.0264 -0.0284 0.0300  83  ASN A O   
591  C CB  . ASN A 84  ? 0.4614 0.3660 0.2629 -0.0649 -0.0184 0.0098  83  ASN A CB  
592  C CG  . ASN A 84  ? 0.5323 0.4416 0.3042 -0.0720 -0.0371 0.0296  83  ASN A CG  
593  O OD1 . ASN A 84  ? 0.5976 0.5000 0.3740 -0.0589 -0.0463 0.0525  83  ASN A OD1 
594  N ND2 . ASN A 84  ? 0.5743 0.4924 0.3111 -0.0942 -0.0415 0.0224  83  ASN A ND2 
595  N N   . PRO A 85  ? 0.4868 0.3459 0.3131 -0.0335 -0.0171 0.0448  84  PRO A N   
596  C CA  . PRO A 85  ? 0.4818 0.3263 0.3294 -0.0139 -0.0177 0.0558  84  PRO A CA  
597  C C   . PRO A 85  ? 0.5036 0.3703 0.3675 0.0029  -0.0353 0.0745  84  PRO A C   
598  O O   . PRO A 85  ? 0.5169 0.3886 0.4126 0.0214  -0.0341 0.0778  84  PRO A O   
599  C CB  . PRO A 85  ? 0.4879 0.2870 0.3086 -0.0166 -0.0066 0.0680  84  PRO A CB  
600  C CG  . PRO A 85  ? 0.5518 0.3506 0.3482 -0.0416 0.0030  0.0557  84  PRO A CG  
601  C CD  . PRO A 85  ? 0.5367 0.3711 0.3294 -0.0482 -0.0068 0.0494  84  PRO A CD  
602  N N   . SER A 86  ? 0.5194 0.4045 0.3618 -0.0054 -0.0512 0.0875  85  SER A N   
603  C CA  . SER A 86  ? 0.5655 0.4844 0.4256 0.0083  -0.0722 0.1115  85  SER A CA  
604  C C   . SER A 86  ? 0.5332 0.5000 0.4204 0.0019  -0.0831 0.0981  85  SER A C   
605  O O   . SER A 86  ? 0.5171 0.5208 0.4368 0.0156  -0.0967 0.1147  85  SER A O   
606  C CB  . SER A 86  ? 0.6370 0.5605 0.4592 0.0001  -0.0888 0.1378  85  SER A CB  
607  O OG  . SER A 86  ? 0.7489 0.6807 0.5322 -0.0318 -0.0903 0.1191  85  SER A OG  
608  N N   . ASN A 87  ? 0.4711 0.4363 0.3472 -0.0181 -0.0746 0.0698  86  ASN A N   
609  C CA  . ASN A 87  ? 0.4847 0.4836 0.3698 -0.0332 -0.0828 0.0559  86  ASN A CA  
610  C C   . ASN A 87  ? 0.4354 0.4245 0.3409 -0.0330 -0.0663 0.0316  86  ASN A C   
611  O O   . ASN A 87  ? 0.4152 0.4227 0.3272 -0.0460 -0.0690 0.0199  86  ASN A O   
612  C CB  . ASN A 87  ? 0.5541 0.5551 0.3918 -0.0641 -0.0873 0.0458  86  ASN A CB  
613  C CG  . ASN A 87  ? 0.6861 0.7054 0.4956 -0.0712 -0.1085 0.0721  86  ASN A CG  
614  O OD1 . ASN A 87  ? 0.7888 0.8330 0.6236 -0.0513 -0.1252 0.1020  86  ASN A OD1 
615  N ND2 . ASN A 87  ? 0.8116 0.8186 0.5677 -0.0982 -0.1063 0.0634  86  ASN A ND2 
616  N N   . HIS A 88  ? 0.3848 0.3459 0.2970 -0.0219 -0.0498 0.0253  87  HIS A N   
617  C CA  . HIS A 88  ? 0.3986 0.3540 0.3296 -0.0196 -0.0367 0.0089  87  HIS A CA  
618  C C   . HIS A 88  ? 0.3827 0.3373 0.3423 -0.0022 -0.0327 0.0143  87  HIS A C   
619  O O   . HIS A 88  ? 0.3906 0.3351 0.3535 0.0109  -0.0327 0.0281  87  HIS A O   
620  C CB  . HIS A 88  ? 0.3623 0.2968 0.2797 -0.0241 -0.0209 -0.0025 87  HIS A CB  
621  C CG  . HIS A 88  ? 0.4767 0.4060 0.3670 -0.0392 -0.0154 -0.0122 87  HIS A CG  
622  N ND1 . HIS A 88  ? 0.3792 0.2976 0.2609 -0.0417 0.0010  -0.0195 87  HIS A ND1 
623  C CD2 . HIS A 88  ? 0.4462 0.3805 0.3137 -0.0553 -0.0216 -0.0167 87  HIS A CD2 
624  C CE1 . HIS A 88  ? 0.4216 0.3323 0.2767 -0.0552 0.0088  -0.0299 87  HIS A CE1 
625  N NE2 . HIS A 88  ? 0.4459 0.3629 0.2869 -0.0665 -0.0052 -0.0297 87  HIS A NE2 
626  N N   . ARG A 89  ? 0.3545 0.3135 0.3307 -0.0024 -0.0258 0.0036  88  ARG A N   
627  C CA  . ARG A 89  ? 0.3046 0.2610 0.3008 0.0090  -0.0179 0.0044  88  ARG A CA  
628  C C   . ARG A 89  ? 0.3213 0.2691 0.3142 0.0031  -0.0085 -0.0065 88  ARG A C   
629  O O   . ARG A 89  ? 0.3428 0.2917 0.3298 -0.0041 -0.0078 -0.0121 88  ARG A O   
630  C CB  . ARG A 89  ? 0.2768 0.2620 0.3014 0.0140  -0.0222 0.0086  88  ARG A CB  
631  C CG  . ARG A 89  ? 0.3002 0.3115 0.3363 0.0210  -0.0365 0.0259  88  ARG A CG  
632  C CD  . ARG A 89  ? 0.3193 0.3759 0.3942 0.0251  -0.0414 0.0326  88  ARG A CD  
633  N NE  . ARG A 89  ? 0.3633 0.4129 0.4620 0.0414  -0.0231 0.0308  88  ARG A NE  
634  C CZ  . ARG A 89  ? 0.4122 0.4626 0.5343 0.0662  -0.0148 0.0448  88  ARG A CZ  
635  N NH1 . ARG A 89  ? 0.3845 0.4467 0.5138 0.0807  -0.0267 0.0672  88  ARG A NH1 
636  N NH2 . ARG A 89  ? 0.4140 0.4504 0.5501 0.0770  0.0079  0.0375  88  ARG A NH2 
637  N N   . LEU A 90  ? 0.3222 0.2608 0.3176 0.0063  0.0003  -0.0084 89  LEU A N   
638  C CA  . LEU A 90  ? 0.3302 0.2693 0.3213 -0.0008 0.0053  -0.0135 89  LEU A CA  
639  C C   . LEU A 90  ? 0.3555 0.2990 0.3563 0.0002  0.0114  -0.0158 89  LEU A C   
640  O O   . LEU A 90  ? 0.3701 0.3049 0.3726 0.0046  0.0200  -0.0175 89  LEU A O   
641  C CB  . LEU A 90  ? 0.3512 0.2791 0.3253 -0.0083 0.0094  -0.0148 89  LEU A CB  
642  C CG  . LEU A 90  ? 0.4287 0.3720 0.3991 -0.0177 0.0083  -0.0138 89  LEU A CG  
643  C CD1 . LEU A 90  ? 0.3580 0.3164 0.3420 -0.0111 0.0057  -0.0091 89  LEU A CD1 
644  C CD2 . LEU A 90  ? 0.4099 0.3508 0.3652 -0.0308 0.0099  -0.0149 89  LEU A CD2 
645  N N   . LEU A 91  ? 0.2995 0.2515 0.3055 -0.0034 0.0109  -0.0156 90  LEU A N   
646  C CA  . LEU A 91  ? 0.2896 0.2450 0.2997 -0.0064 0.0183  -0.0168 90  LEU A CA  
647  C C   . LEU A 91  ? 0.3281 0.2804 0.3205 -0.0137 0.0206  -0.0140 90  LEU A C   
648  O O   . LEU A 91  ? 0.3258 0.2820 0.3151 -0.0135 0.0150  -0.0066 90  LEU A O   
649  C CB  . LEU A 91  ? 0.2917 0.2536 0.3122 -0.0106 0.0177  -0.0162 90  LEU A CB  
650  C CG  . LEU A 91  ? 0.2678 0.2329 0.2912 -0.0174 0.0270  -0.0163 90  LEU A CG  
651  C CD1 . LEU A 91  ? 0.3012 0.2821 0.3421 -0.0140 0.0354  -0.0203 90  LEU A CD1 
652  C CD2 . LEU A 91  ? 0.2997 0.2628 0.3275 -0.0269 0.0273  -0.0168 90  LEU A CD2 
653  N N   . PHE A 92  ? 0.3232 0.2846 0.2920 -0.0251 -0.0044 -0.0323 91  PHE A N   
654  C CA  . PHE A 92  ? 0.2960 0.2810 0.2858 -0.0231 0.0114  -0.0349 91  PHE A CA  
655  C C   . PHE A 92  ? 0.3011 0.3070 0.3237 -0.0206 0.0071  -0.0283 91  PHE A C   
656  O O   . PHE A 92  ? 0.2941 0.3137 0.3393 -0.0129 0.0065  -0.0143 91  PHE A O   
657  C CB  . PHE A 92  ? 0.3073 0.2830 0.2835 -0.0253 0.0172  -0.0334 91  PHE A CB  
658  C CG  . PHE A 92  ? 0.3022 0.2636 0.2552 -0.0357 0.0187  -0.0310 91  PHE A CG  
659  C CD1 . PHE A 92  ? 0.3062 0.2866 0.2720 -0.0522 0.0212  -0.0189 91  PHE A CD1 
660  C CD2 . PHE A 92  ? 0.3073 0.2431 0.2341 -0.0320 0.0149  -0.0313 91  PHE A CD2 
661  C CE1 . PHE A 92  ? 0.3215 0.3017 0.2803 -0.0657 0.0255  -0.0041 91  PHE A CE1 
662  C CE2 . PHE A 92  ? 0.3667 0.2858 0.2673 -0.0430 0.0197  -0.0255 91  PHE A CE2 
663  C CZ  . PHE A 92  ? 0.3295 0.2729 0.2483 -0.0601 0.0276  -0.0108 91  PHE A CZ  
664  N N   . GLU A 93  ? 0.2754 0.2865 0.3055 -0.0231 0.0081  -0.0309 92  GLU A N   
665  C CA  . GLU A 93  ? 0.2641 0.2948 0.3246 -0.0239 0.0063  -0.0201 92  GLU A CA  
666  C C   . GLU A 93  ? 0.2703 0.3032 0.3259 -0.0210 0.0182  -0.0238 92  GLU A C   
667  O O   . GLU A 93  ? 0.2424 0.2739 0.2927 -0.0225 0.0177  -0.0281 92  GLU A O   
668  C CB  . GLU A 93  ? 0.2730 0.2872 0.3306 -0.0374 -0.0145 -0.0160 92  GLU A CB  
669  C CG  . GLU A 93  ? 0.2651 0.2581 0.3119 -0.0549 -0.0467 -0.0047 92  GLU A CG  
670  C CD  . GLU A 93  ? 0.4335 0.3618 0.4287 -0.0760 -0.0759 -0.0055 92  GLU A CD  
671  O OE1 . GLU A 93  ? 0.4749 0.3384 0.3980 -0.0622 -0.0619 -0.0267 92  GLU A OE1 
672  O OE2 . GLU A 93  ? 0.5190 0.4534 0.5401 -0.1053 -0.1116 0.0208  92  GLU A OE2 
673  N N   . VAL A 94  ? 0.2467 0.2795 0.3011 -0.0137 0.0307  -0.0154 93  VAL A N   
674  C CA  . VAL A 94  ? 0.2542 0.2662 0.2791 -0.0161 0.0339  -0.0172 93  VAL A CA  
675  C C   . VAL A 94  ? 0.2496 0.2771 0.2985 -0.0172 0.0352  -0.0081 93  VAL A C   
676  O O   . VAL A 94  ? 0.2673 0.3153 0.3462 -0.0119 0.0458  0.0090  93  VAL A O   
677  C CB  . VAL A 94  ? 0.3057 0.2628 0.2656 -0.0041 0.0518  -0.0151 93  VAL A CB  
678  C CG1 . VAL A 94  ? 0.3489 0.2566 0.2483 -0.0160 0.0421  -0.0160 93  VAL A CG1 
679  C CG2 . VAL A 94  ? 0.3967 0.3203 0.3196 -0.0054 0.0476  -0.0223 93  VAL A CG2 
680  N N   . PHE A 95  ? 0.2450 0.2677 0.2884 -0.0245 0.0236  -0.0107 94  PHE A N   
681  C CA  . PHE A 95  ? 0.2660 0.2895 0.3200 -0.0267 0.0224  -0.0024 94  PHE A CA  
682  C C   . PHE A 95  ? 0.3044 0.3037 0.3234 -0.0297 0.0185  0.0017  94  PHE A C   
683  O O   . PHE A 95  ? 0.3045 0.2947 0.3053 -0.0377 0.0023  0.0015  94  PHE A O   
684  C CB  . PHE A 95  ? 0.2686 0.2886 0.3338 -0.0268 0.0100  -0.0067 94  PHE A CB  
685  C CG  . PHE A 95  ? 0.2801 0.2890 0.3467 -0.0334 0.0015  -0.0086 94  PHE A CG  
686  C CD1 . PHE A 95  ? 0.3169 0.3211 0.3956 -0.0516 -0.0123 0.0070  94  PHE A CD1 
687  C CD2 . PHE A 95  ? 0.2984 0.2958 0.3491 -0.0275 0.0014  -0.0192 94  PHE A CD2 
688  C CE1 . PHE A 95  ? 0.3204 0.3044 0.3929 -0.0710 -0.0378 0.0135  94  PHE A CE1 
689  C CE2 . PHE A 95  ? 0.3345 0.2984 0.3620 -0.0399 -0.0171 -0.0194 94  PHE A CE2 
690  C CZ  . PHE A 95  ? 0.3582 0.3120 0.3943 -0.0651 -0.0427 -0.0025 94  PHE A CZ  
691  N N   . ASP A 96  ? 0.3138 0.3020 0.3242 -0.0293 0.0271  0.0121  95  ASP A N   
692  C CA  . ASP A 96  ? 0.3408 0.2953 0.3090 -0.0343 0.0185  0.0185  95  ASP A CA  
693  C C   . ASP A 96  ? 0.3273 0.2961 0.3279 -0.0360 0.0014  0.0232  95  ASP A C   
694  O O   . ASP A 96  ? 0.2995 0.2695 0.3178 -0.0371 0.0065  0.0275  95  ASP A O   
695  C CB  . ASP A 96  ? 0.4154 0.3385 0.3423 -0.0260 0.0495  0.0317  95  ASP A CB  
696  C CG  . ASP A 96  ? 0.5164 0.3942 0.3904 -0.0331 0.0399  0.0405  95  ASP A CG  
697  O OD1 . ASP A 96  ? 0.5493 0.4118 0.4061 -0.0464 0.0029  0.0387  95  ASP A OD1 
698  O OD2 . ASP A 96  ? 0.6803 0.5426 0.5353 -0.0257 0.0694  0.0571  95  ASP A OD2 
699  N N   . GLU A 97  ? 0.3208 0.2980 0.3308 -0.0360 -0.0203 0.0293  96  GLU A N   
700  C CA  . GLU A 97  ? 0.3108 0.2963 0.3498 -0.0220 -0.0259 0.0392  96  GLU A CA  
701  C C   . GLU A 97  ? 0.3743 0.3263 0.3840 -0.0264 -0.0334 0.0501  96  GLU A C   
702  O O   . GLU A 97  ? 0.3843 0.3149 0.3558 -0.0402 -0.0482 0.0597  96  GLU A O   
703  C CB  . GLU A 97  ? 0.2963 0.3229 0.3787 -0.0140 -0.0405 0.0608  96  GLU A CB  
704  C CG  . GLU A 97  ? 0.3527 0.3875 0.4675 0.0184  -0.0325 0.0808  96  GLU A CG  
705  C CD  . GLU A 97  ? 0.3560 0.4616 0.5457 0.0292  -0.0428 0.1231  96  GLU A CD  
706  O OE1 . GLU A 97  ? 0.5209 0.6493 0.7322 0.0110  -0.0790 0.1550  96  GLU A OE1 
707  O OE2 . GLU A 97  ? 0.4241 0.5635 0.6518 0.0518  -0.0174 0.1311  96  GLU A OE2 
708  N N   . ASN A 98  ? 0.3591 0.2870 0.3672 -0.0182 -0.0270 0.0497  97  ASN A N   
709  C CA  . ASN A 98  ? 0.4394 0.3302 0.4190 -0.0224 -0.0348 0.0631  97  ASN A CA  
710  C C   . ASN A 98  ? 0.4872 0.3508 0.4686 0.0036  -0.0389 0.0722  97  ASN A C   
711  O O   . ASN A 98  ? 0.4505 0.2987 0.4325 0.0237  -0.0269 0.0636  97  ASN A O   
712  C CB  . ASN A 98  ? 0.5045 0.3745 0.4676 -0.0430 -0.0231 0.0641  97  ASN A CB  
713  C CG  . ASN A 98  ? 0.5335 0.4299 0.4984 -0.0520 -0.0023 0.0644  97  ASN A CG  
714  O OD1 . ASN A 98  ? 0.5770 0.4580 0.5012 -0.0498 0.0025  0.0662  97  ASN A OD1 
715  N ND2 . ASN A 98  ? 0.4660 0.3889 0.4663 -0.0613 0.0084  0.0679  97  ASN A ND2 
716  N N   . ARG A 99  ? 0.3985 0.3905 0.4186 -0.0307 -0.1427 0.1031  98  ARG A N   
717  C CA  . ARG A 99  ? 0.4347 0.4622 0.5621 -0.0077 -0.1573 0.1261  98  ARG A CA  
718  C C   . ARG A 99  ? 0.4035 0.4069 0.5317 0.0144  -0.1161 0.1207  98  ARG A C   
719  O O   . ARG A 99  ? 0.3916 0.4172 0.6082 0.0359  -0.0877 0.1150  98  ARG A O   
720  C CB  . ARG A 99  ? 0.4725 0.4811 0.5862 -0.0199 -0.2323 0.1687  98  ARG A CB  
721  C CG  . ARG A 99  ? 0.5743 0.6368 0.8432 0.0053  -0.2660 0.2048  98  ARG A CG  
722  C CD  . ARG A 99  ? 0.6957 0.7386 0.9362 -0.0179 -0.3663 0.2564  98  ARG A CD  
723  N NE  . ARG A 99  ? 0.8552 0.9467 1.2651 0.0159  -0.4072 0.3062  98  ARG A NE  
724  C CZ  . ARG A 99  ? 0.9491 0.9891 1.3467 0.0383  -0.4291 0.3456  98  ARG A CZ  
725  N NH1 . ARG A 99  ? 1.0284 0.9680 1.2445 0.0241  -0.4099 0.3389  98  ARG A NH1 
726  N NH2 . ARG A 99  ? 0.9911 1.0782 1.5717 0.0760  -0.4657 0.3955  98  ARG A NH2 
727  N N   . LEU A 100 ? 0.3986 0.3464 0.4266 0.0045  -0.1080 0.1220  99  LEU A N   
728  C CA  . LEU A 100 ? 0.4519 0.3677 0.4784 0.0151  -0.0808 0.1254  99  LEU A CA  
729  C C   . LEU A 100 ? 0.3997 0.3151 0.3993 0.0061  -0.0325 0.0958  99  LEU A C   
730  O O   . LEU A 100 ? 0.4554 0.3466 0.4553 0.0043  -0.0096 0.0947  99  LEU A O   
731  C CB  . LEU A 100 ? 0.5484 0.3965 0.4944 0.0056  -0.1101 0.1612  99  LEU A CB  
732  C CG  . LEU A 100 ? 0.6346 0.4816 0.6242 0.0154  -0.1782 0.2069  99  LEU A CG  
733  C CD1 . LEU A 100 ? 0.7987 0.5573 0.6838 0.0024  -0.2109 0.2499  99  LEU A CD1 
734  C CD2 . LEU A 100 ? 0.5895 0.4835 0.7381 0.0530  -0.1660 0.2105  99  LEU A CD2 
735  N N   . THR A 101 ? 0.4102 0.3502 0.3945 -0.0017 -0.0228 0.0772  100 THR A N   
736  C CA  . THR A 101 ? 0.3433 0.3007 0.3367 -0.0069 0.0075  0.0591  100 THR A CA  
737  C C   . THR A 101 ? 0.3459 0.3402 0.3661 -0.0059 0.0046  0.0440  100 THR A C   
738  O O   . THR A 101 ? 0.3292 0.3337 0.3561 -0.0039 -0.0093 0.0445  100 THR A O   
739  C CB  . THR A 101 ? 0.3801 0.3156 0.3297 -0.0142 0.0313  0.0607  100 THR A CB  
740  O OG1 . THR A 101 ? 0.4181 0.3347 0.3202 -0.0160 0.0234  0.0576  100 THR A OG1 
741  C CG2 . THR A 101 ? 0.4226 0.3068 0.3246 -0.0236 0.0481  0.0754  100 THR A CG2 
742  N N   . ARG A 102 ? 0.3163 0.3280 0.3504 -0.0131 0.0129  0.0351  101 ARG A N   
743  C CA  . ARG A 102 ? 0.3157 0.3442 0.3478 -0.0170 0.0063  0.0290  101 ARG A CA  
744  C C   . ARG A 102 ? 0.3332 0.3580 0.3510 -0.0099 0.0044  0.0348  101 ARG A C   
745  O O   . ARG A 102 ? 0.3133 0.3225 0.3211 -0.0043 0.0159  0.0397  101 ARG A O   
746  C CB  . ARG A 102 ? 0.3135 0.3554 0.3541 -0.0314 -0.0039 0.0303  101 ARG A CB  
747  C CG  . ARG A 102 ? 0.3719 0.4079 0.3779 -0.0447 -0.0178 0.0281  101 ARG A CG  
748  C CD  . ARG A 102 ? 0.4023 0.4501 0.4103 -0.0653 -0.0519 0.0410  101 ARG A CD  
749  N NE  . ARG A 102 ? 0.3285 0.3690 0.3337 -0.0921 -0.0608 0.0309  101 ARG A NE  
750  C CZ  . ARG A 102 ? 0.4956 0.4854 0.4272 -0.1203 -0.0546 0.0074  101 ARG A CZ  
751  N NH1 . ARG A 102 ? 0.5443 0.4946 0.4116 -0.1215 -0.0299 -0.0074 101 ARG A NH1 
752  N NH2 . ARG A 102 ? 0.4784 0.4476 0.3996 -0.1504 -0.0631 -0.0040 101 ARG A NH2 
753  N N   . ASP A 103 ? 0.3165 0.3421 0.3258 -0.0143 -0.0001 0.0316  102 ASP A N   
754  C CA  . ASP A 103 ? 0.3325 0.3385 0.3207 -0.0139 -0.0003 0.0345  102 ASP A CA  
755  C C   . ASP A 103 ? 0.3579 0.3569 0.3556 -0.0021 0.0071  0.0440  102 ASP A C   
756  O O   . ASP A 103 ? 0.3462 0.3675 0.3686 -0.0023 -0.0055 0.0544  102 ASP A O   
757  C CB  . ASP A 103 ? 0.2995 0.3061 0.2837 -0.0266 -0.0014 0.0322  102 ASP A CB  
758  C CG  . ASP A 103 ? 0.3644 0.3941 0.3848 -0.0341 -0.0019 0.0271  102 ASP A CG  
759  O OD1 . ASP A 103 ? 0.3805 0.4180 0.4198 -0.0276 -0.0149 0.0310  102 ASP A OD1 
760  O OD2 . ASP A 103 ? 0.3697 0.4083 0.4075 -0.0460 0.0127  0.0236  102 ASP A OD2 
761  N N   . ASP A 104 ? 0.3647 0.3272 0.3454 0.0062  0.0269  0.0422  103 ASP A N   
762  C CA  . ASP A 104 ? 0.3449 0.3002 0.3676 0.0275  0.0488  0.0535  103 ASP A CA  
763  C C   . ASP A 104 ? 0.3738 0.3064 0.4034 0.0363  0.0432  0.0662  103 ASP A C   
764  O O   . ASP A 104 ? 0.4056 0.2878 0.3815 0.0264  0.0498  0.0558  103 ASP A O   
765  C CB  . ASP A 104 ? 0.4359 0.3366 0.4267 0.0336  0.0957  0.0407  103 ASP A CB  
766  C CG  . ASP A 104 ? 0.5955 0.5206 0.6277 0.0390  0.1208  0.0444  103 ASP A CG  
767  O OD1 . ASP A 104 ? 0.6446 0.6168 0.7816 0.0575  0.1297  0.0621  103 ASP A OD1 
768  O OD2 . ASP A 104 ? 0.6792 0.5795 0.6471 0.0220  0.1244  0.0352  103 ASP A OD2 
769  N N   . PHE A 105 ? 0.3258 0.2973 0.4598 -0.0871 -0.0057 0.0571  104 PHE A N   
770  C CA  . PHE A 105 ? 0.2810 0.2851 0.4093 -0.0694 -0.0005 0.0391  104 PHE A CA  
771  C C   . PHE A 105 ? 0.2879 0.3467 0.4069 -0.0384 0.0115  0.0510  104 PHE A C   
772  O O   . PHE A 105 ? 0.2717 0.3874 0.4011 -0.0316 0.0267  0.0862  104 PHE A O   
773  C CB  . PHE A 105 ? 0.3421 0.3453 0.4627 -0.1028 -0.0225 0.0405  104 PHE A CB  
774  C CG  . PHE A 105 ? 0.2824 0.3233 0.3997 -0.0859 -0.0204 0.0294  104 PHE A CG  
775  C CD1 . PHE A 105 ? 0.3284 0.3110 0.4026 -0.0662 -0.0106 -0.0029 104 PHE A CD1 
776  C CD2 . PHE A 105 ? 0.3096 0.4520 0.4729 -0.0804 -0.0198 0.0650  104 PHE A CD2 
777  C CE1 . PHE A 105 ? 0.3088 0.3166 0.3733 -0.0539 -0.0126 -0.0100 104 PHE A CE1 
778  C CE2 . PHE A 105 ? 0.2512 0.4191 0.4068 -0.0571 -0.0183 0.0580  104 PHE A CE2 
779  C CZ  . PHE A 105 ? 0.3045 0.3969 0.4051 -0.0505 -0.0211 0.0155  104 PHE A CZ  
780  N N   . LEU A 106 ? 0.2741 0.3020 0.3598 -0.0145 0.0067  0.0309  105 LEU A N   
781  C CA  . LEU A 106 ? 0.3268 0.3313 0.3365 0.0247  0.0098  0.0332  105 LEU A CA  
782  C C   . LEU A 106 ? 0.3449 0.3520 0.3281 0.0498  0.0144  0.0213  105 LEU A C   
783  O O   . LEU A 106 ? 0.4665 0.4207 0.3535 0.0982  0.0227  0.0218  105 LEU A O   
784  C CB  . LEU A 106 ? 0.3627 0.2745 0.3112 0.0217  -0.0292 0.0297  105 LEU A CB  
785  C CG  . LEU A 106 ? 0.4242 0.3206 0.3847 0.0038  -0.0433 0.0490  105 LEU A CG  
786  C CD1 . LEU A 106 ? 0.5076 0.3038 0.3983 -0.0096 -0.1087 0.0588  105 LEU A CD1 
787  C CD2 . LEU A 106 ? 0.4809 0.3954 0.3975 0.0273  -0.0070 0.0695  105 LEU A CD2 
788  N N   . GLY A 107 ? 0.2612 0.2990 0.2980 0.0258  0.0092  0.0103  106 GLY A N   
789  C CA  . GLY A 107 ? 0.2878 0.3322 0.3042 0.0471  0.0103  0.0047  106 GLY A CA  
790  C C   . GLY A 107 ? 0.2875 0.3087 0.3192 0.0224  -0.0032 -0.0125 106 GLY A C   
791  O O   . GLY A 107 ? 0.2778 0.2753 0.3329 0.0043  -0.0051 -0.0127 106 GLY A O   
792  N N   . GLN A 108 ? 0.2674 0.3005 0.2872 0.0319  -0.0052 -0.0149 107 GLN A N   
793  C CA  . GLN A 108 ? 0.2601 0.2660 0.2746 0.0170  -0.0077 -0.0238 107 GLN A CA  
794  C C   . GLN A 108 ? 0.2796 0.2631 0.2585 0.0349  -0.0183 -0.0228 107 GLN A C   
795  O O   . GLN A 108 ? 0.3298 0.3188 0.2815 0.0670  -0.0211 -0.0180 107 GLN A O   
796  C CB  . GLN A 108 ? 0.2885 0.2948 0.2930 -0.0056 -0.0099 -0.0290 107 GLN A CB  
797  C CG  . GLN A 108 ? 0.2699 0.3253 0.2797 -0.0103 -0.0355 -0.0130 107 GLN A CG  
798  C CD  . GLN A 108 ? 0.4121 0.4300 0.3849 -0.0555 -0.0723 -0.0109 107 GLN A CD  
799  O OE1 . GLN A 108 ? 0.4602 0.4090 0.3948 -0.0764 -0.0741 -0.0240 107 GLN A OE1 
800  N NE2 . GLN A 108 ? 0.4349 0.4748 0.4009 -0.0716 -0.1120 0.0097  107 GLN A NE2 
801  N N   . VAL A 109 ? 0.2919 0.2492 0.2689 0.0233  -0.0157 -0.0171 108 VAL A N   
802  C CA  . VAL A 109 ? 0.3388 0.2687 0.2799 0.0320  -0.0283 -0.0107 108 VAL A CA  
803  C C   . VAL A 109 ? 0.3748 0.3047 0.3033 0.0248  -0.0048 -0.0060 108 VAL A C   
804  O O   . VAL A 109 ? 0.3490 0.2774 0.2985 0.0232  0.0274  0.0094  108 VAL A O   
805  C CB  . VAL A 109 ? 0.3696 0.2437 0.3075 0.0177  -0.0570 0.0124  108 VAL A CB  
806  C CG1 . VAL A 109 ? 0.4308 0.2579 0.3243 0.0201  -0.0758 0.0253  108 VAL A CG1 
807  C CG2 . VAL A 109 ? 0.4461 0.2559 0.3319 0.0274  -0.0888 0.0024  108 VAL A CG2 
808  N N   . ASP A 110 ? 0.4129 0.3359 0.2933 0.0303  -0.0170 -0.0122 109 ASP A N   
809  C CA  . ASP A 110 ? 0.4578 0.3366 0.2684 0.0287  -0.0006 -0.0118 109 ASP A CA  
810  C C   . ASP A 110 ? 0.5193 0.3808 0.3049 0.0368  -0.0036 0.0095  109 ASP A C   
811  O O   . ASP A 110 ? 0.5092 0.3788 0.2863 0.0424  -0.0378 0.0091  109 ASP A O   
812  C CB  . ASP A 110 ? 0.5308 0.3913 0.2856 0.0101  -0.0382 -0.0269 109 ASP A CB  
813  C CG  . ASP A 110 ? 0.7220 0.4663 0.3331 0.0096  -0.0307 -0.0371 109 ASP A CG  
814  O OD1 . ASP A 110 ? 0.9554 0.6207 0.4948 0.0040  -0.0266 -0.0542 109 ASP A OD1 
815  O OD2 . ASP A 110 ? 0.7474 0.4518 0.2885 0.0204  -0.0286 -0.0280 109 ASP A OD2 
816  N N   . VAL A 111 ? 0.4420 0.3466 0.3528 -0.0026 0.0794  0.0212  110 VAL A N   
817  C CA  . VAL A 111 ? 0.4796 0.3800 0.3768 0.0062  0.0548  0.0117  110 VAL A CA  
818  C C   . VAL A 111 ? 0.4646 0.3748 0.3899 0.0163  0.0312  0.0091  110 VAL A C   
819  O O   . VAL A 111 ? 0.4102 0.3256 0.3382 0.0124  0.0258  0.0196  110 VAL A O   
820  C CB  . VAL A 111 ? 0.5301 0.4169 0.3688 -0.0009 0.0424  0.0278  110 VAL A CB  
821  C CG1 . VAL A 111 ? 0.6036 0.4904 0.4379 -0.0029 0.0285  0.0514  110 VAL A CG1 
822  C CG2 . VAL A 111 ? 0.5391 0.4169 0.3731 0.0059  0.0253  0.0172  110 VAL A CG2 
823  N N   . PRO A 112 ? 0.4764 0.3901 0.4246 0.0271  0.0165  -0.0050 111 PRO A N   
824  C CA  . PRO A 112 ? 0.4599 0.3806 0.4077 0.0318  -0.0115 0.0000  111 PRO A CA  
825  C C   . PRO A 112 ? 0.4636 0.3619 0.3619 0.0274  -0.0231 0.0173  111 PRO A C   
826  O O   . PRO A 112 ? 0.4787 0.3582 0.3585 0.0274  -0.0184 0.0193  111 PRO A O   
827  C CB  . PRO A 112 ? 0.4337 0.3607 0.4210 0.0460  -0.0296 -0.0109 111 PRO A CB  
828  C CG  . PRO A 112 ? 0.4742 0.3882 0.4808 0.0486  -0.0093 -0.0236 111 PRO A CG  
829  C CD  . PRO A 112 ? 0.4989 0.4096 0.4768 0.0337  0.0237  -0.0244 111 PRO A CD  
830  N N   . LEU A 113 ? 0.4707 0.3727 0.3510 0.0205  -0.0346 0.0240  112 LEU A N   
831  C CA  . LEU A 113 ? 0.4797 0.3605 0.3216 0.0129  -0.0388 0.0361  112 LEU A CA  
832  C C   . LEU A 113 ? 0.5436 0.4083 0.3611 0.0144  -0.0582 0.0476  112 LEU A C   
833  O O   . LEU A 113 ? 0.5497 0.3941 0.3368 0.0050  -0.0571 0.0566  112 LEU A O   
834  C CB  . LEU A 113 ? 0.4233 0.3145 0.2664 -0.0015 -0.0294 0.0336  112 LEU A CB  
835  C CG  . LEU A 113 ? 0.4124 0.3149 0.2882 -0.0024 -0.0136 0.0324  112 LEU A CG  
836  C CD1 . LEU A 113 ? 0.4285 0.3418 0.3292 -0.0157 -0.0052 0.0262  112 LEU A CD1 
837  C CD2 . LEU A 113 ? 0.4378 0.3248 0.2952 0.0004  -0.0112 0.0448  112 LEU A CD2 
838  N N   . SER A 114 ? 0.5390 0.4116 0.3748 0.0257  -0.0768 0.0495  113 SER A N   
839  C CA  . SER A 114 ? 0.6118 0.4705 0.4219 0.0266  -0.1024 0.0708  113 SER A CA  
840  C C   . SER A 114 ? 0.6345 0.4545 0.4460 0.0345  -0.1053 0.0878  113 SER A C   
841  O O   . SER A 114 ? 0.7122 0.5085 0.4904 0.0293  -0.1185 0.1133  113 SER A O   
842  C CB  . SER A 114 ? 0.6290 0.5138 0.4654 0.0370  -0.1313 0.0714  113 SER A CB  
843  O OG  . SER A 114 ? 0.6358 0.5289 0.5389 0.0544  -0.1269 0.0551  113 SER A OG  
844  N N   . HIS A 115 ? 0.6091 0.4221 0.4594 0.0438  -0.0900 0.0726  114 HIS A N   
845  C CA  . HIS A 115 ? 0.6697 0.4496 0.5404 0.0503  -0.0887 0.0794  114 HIS A CA  
846  C C   . HIS A 115 ? 0.6590 0.4303 0.5234 0.0408  -0.0610 0.0587  114 HIS A C   
847  O O   . HIS A 115 ? 0.6980 0.4566 0.5992 0.0451  -0.0503 0.0441  114 HIS A O   
848  C CB  . HIS A 115 ? 0.6598 0.4399 0.6036 0.0702  -0.1009 0.0753  114 HIS A CB  
849  C CG  . HIS A 115 ? 0.7576 0.5505 0.7156 0.0815  -0.1388 0.0977  114 HIS A CG  
850  N ND1 . HIS A 115 ? 0.8463 0.6139 0.8008 0.0882  -0.1703 0.1372  114 HIS A ND1 
851  C CD2 . HIS A 115 ? 0.7740 0.6045 0.7520 0.0863  -0.1528 0.0866  114 HIS A CD2 
852  C CE1 . HIS A 115 ? 0.8410 0.6335 0.8049 0.0965  -0.2079 0.1514  114 HIS A CE1 
853  N NE2 . HIS A 115 ? 0.7883 0.6215 0.7717 0.0957  -0.1971 0.1166  114 HIS A NE2 
854  N N   . LEU A 116 ? 0.6086 0.3897 0.4335 0.0268  -0.0513 0.0550  115 LEU A N   
855  C CA  . LEU A 116 ? 0.6110 0.3902 0.4264 0.0169  -0.0352 0.0387  115 LEU A CA  
856  C C   . LEU A 116 ? 0.6408 0.3904 0.4514 0.0106  -0.0331 0.0444  115 LEU A C   
857  O O   . LEU A 116 ? 0.6790 0.4112 0.4738 0.0082  -0.0408 0.0662  115 LEU A O   
858  C CB  . LEU A 116 ? 0.5783 0.3791 0.3708 0.0070  -0.0321 0.0379  115 LEU A CB  
859  C CG  . LEU A 116 ? 0.6087 0.4335 0.4109 0.0113  -0.0281 0.0343  115 LEU A CG  
860  C CD1 . LEU A 116 ? 0.5436 0.3843 0.3380 0.0030  -0.0263 0.0405  115 LEU A CD1 
861  C CD2 . LEU A 116 ? 0.5927 0.4211 0.4022 0.0117  -0.0149 0.0166  115 LEU A CD2 
862  N N   . PRO A 117 ? 0.6267 0.3718 0.4485 0.0043  -0.0206 0.0228  116 PRO A N   
863  C CA  . PRO A 117 ? 0.6358 0.3522 0.4654 -0.0032 -0.0138 0.0235  116 PRO A CA  
864  C C   . PRO A 117 ? 0.6299 0.3475 0.4324 -0.0177 -0.0125 0.0283  116 PRO A C   
865  O O   . PRO A 117 ? 0.5745 0.3181 0.3614 -0.0215 -0.0178 0.0271  116 PRO A O   
866  C CB  . PRO A 117 ? 0.6155 0.3398 0.4694 -0.0092 0.0000  -0.0126 116 PRO A CB  
867  C CG  . PRO A 117 ? 0.6465 0.4079 0.4733 -0.0132 -0.0031 -0.0254 116 PRO A CG  
868  C CD  . PRO A 117 ? 0.6396 0.4080 0.4625 -0.0008 -0.0106 -0.0053 116 PRO A CD  
869  N N   . THR A 118 ? 0.6706 0.3582 0.4799 -0.0268 -0.0020 0.0318  117 THR A N   
870  C CA  . THR A 118 ? 0.6635 0.3494 0.4616 -0.0435 0.0066  0.0290  117 THR A CA  
871  C C   . THR A 118 ? 0.6717 0.3534 0.5032 -0.0530 0.0187  0.0005  117 THR A C   
872  O O   . THR A 118 ? 0.7017 0.3576 0.5594 -0.0518 0.0297  -0.0046 117 THR A O   
873  C CB  . THR A 118 ? 0.7003 0.3537 0.4706 -0.0525 0.0139  0.0573  117 THR A CB  
874  O OG1 . THR A 118 ? 0.6997 0.3682 0.4388 -0.0459 -0.0019 0.0769  117 THR A OG1 
875  C CG2 . THR A 118 ? 0.6948 0.3441 0.4616 -0.0762 0.0341  0.0452  117 THR A CG2 
876  N N   . GLU A 119 ? 0.6535 1.1819 0.3203 -0.1094 -0.0367 0.2064  118 GLU A N   
877  C CA  . GLU A 119 ? 0.6752 1.0860 0.4249 -0.1017 0.0125  0.1720  118 GLU A CA  
878  C C   . GLU A 119 ? 0.6578 1.0932 0.4486 -0.1369 0.0289  0.0259  118 GLU A C   
879  O O   . GLU A 119 ? 0.6039 1.0618 0.4291 -0.1337 -0.0271 -0.0697 118 GLU A O   
880  C CB  . GLU A 119 ? 0.6213 0.9347 0.4395 -0.0595 -0.0214 0.1630  118 GLU A CB  
881  C CG  . GLU A 119 ? 0.6529 0.8625 0.5459 -0.0507 0.0027  0.0996  118 GLU A CG  
882  C CD  . GLU A 119 ? 0.7101 0.8370 0.6069 -0.0299 -0.0303 0.0922  118 GLU A CD  
883  O OE1 . GLU A 119 ? 0.7640 0.8664 0.6983 -0.0181 0.0017  0.1568  118 GLU A OE1 
884  O OE2 . GLU A 119 ? 0.6166 0.6993 0.4809 -0.0305 -0.0872 0.0215  118 GLU A OE2 
885  N N   . ASP A 120 ? 0.7493 1.1764 0.5650 -0.1725 0.1095  0.0010  119 ASP A N   
886  C CA  . ASP A 120 ? 0.7458 1.1864 0.6791 -0.1958 0.1276  -0.1660 119 ASP A CA  
887  C C   . ASP A 120 ? 0.6597 1.0009 0.7011 -0.1362 0.0550  -0.2242 119 ASP A C   
888  O O   . ASP A 120 ? 0.6642 0.9193 0.7156 -0.1073 0.0657  -0.1612 119 ASP A O   
889  C CB  . ASP A 120 ? 0.8476 1.2838 0.8131 -0.2512 0.2489  -0.1857 119 ASP A CB  
890  C CG  . ASP A 120 ? 0.8197 1.2622 0.9795 -0.2607 0.2657  -0.3765 119 ASP A CG  
891  O OD1 . ASP A 120 ? 0.8829 1.2629 1.1430 -0.2603 0.3250  -0.3980 119 ASP A OD1 
892  O OD2 . ASP A 120 ? 0.8145 1.3306 1.0598 -0.2665 0.2171  -0.5171 119 ASP A OD2 
893  N N   . PRO A 121 ? 0.6481 0.9982 0.7716 -0.1207 -0.0223 -0.3460 120 PRO A N   
894  C CA  . PRO A 121 ? 0.6419 0.8876 0.8356 -0.0680 -0.1068 -0.3935 120 PRO A CA  
895  C C   . PRO A 121 ? 0.6368 0.8711 0.9540 -0.0688 -0.0628 -0.4723 120 PRO A C   
896  O O   . PRO A 121 ? 0.7013 0.8716 0.9981 -0.0543 -0.0399 -0.4192 120 PRO A O   
897  C CB  . PRO A 121 ? 0.6378 0.8979 0.9276 -0.0527 -0.2003 -0.5077 120 PRO A CB  
898  C CG  . PRO A 121 ? 0.6515 1.0231 0.9077 -0.0975 -0.1615 -0.5124 120 PRO A CG  
899  C CD  . PRO A 121 ? 0.6694 1.1218 0.8357 -0.1511 -0.0414 -0.4482 120 PRO A CD  
900  N N   . TYR A 127 ? 1.0117 0.7176 0.6632 -0.2109 0.1341  -0.1763 126 TYR A N   
901  C CA  . TYR A 127 ? 1.0602 0.7471 0.6654 -0.2709 0.2042  -0.1725 126 TYR A CA  
902  C C   . TYR A 127 ? 0.9161 0.6633 0.6734 -0.2336 0.2184  -0.1021 126 TYR A C   
903  O O   . TYR A 127 ? 0.8938 0.6902 0.8027 -0.2540 0.3004  -0.1200 126 TYR A O   
904  C CB  . TYR A 127 ? 1.1164 0.8446 0.8406 -0.3262 0.3251  -0.2680 126 TYR A CB  
905  C CG  . TYR A 127 ? 1.2672 0.9728 0.8533 -0.3757 0.3231  -0.3640 126 TYR A CG  
906  C CD1 . TYR A 127 ? 1.2294 0.9984 0.9930 -0.3463 0.3417  -0.4346 126 TYR A CD1 
907  C CD2 . TYR A 127 ? 1.5091 1.1304 0.7811 -0.4602 0.3064  -0.3875 126 TYR A CD2 
908  C CE1 . TYR A 127 ? 1.3622 1.1409 1.0145 -0.3937 0.3327  -0.5477 126 TYR A CE1 
909  C CE2 . TYR A 127 ? 1.6714 1.2878 0.7837 -0.5093 0.2870  -0.4779 126 TYR A CE2 
910  C CZ  . TYR A 127 ? 1.5889 1.2992 0.9038 -0.4727 0.2955  -0.5679 126 TYR A CZ  
911  O OH  . TYR A 127 ? 1.7392 1.4721 0.9087 -0.5221 0.2677  -0.6779 126 TYR A OH  
912  N N   . THR A 128 ? 0.8022 0.5610 0.5363 -0.1809 0.1342  -0.0384 127 THR A N   
913  C CA  . THR A 128 ? 0.6719 0.5107 0.5214 -0.1454 0.1269  0.0233  127 THR A CA  
914  C C   . THR A 128 ? 0.6967 0.5050 0.4217 -0.1735 0.0905  0.0357  127 THR A C   
915  O O   . THR A 128 ? 0.6271 0.5150 0.4183 -0.1465 0.0610  0.0692  127 THR A O   
916  C CB  . THR A 128 ? 0.5879 0.4856 0.5079 -0.0861 0.0834  0.0703  127 THR A CB  
917  O OG1 . THR A 128 ? 0.6667 0.5217 0.4587 -0.0816 0.0103  0.0478  127 THR A OG1 
918  C CG2 . THR A 128 ? 0.6404 0.5474 0.7044 -0.0691 0.1407  0.0607  127 THR A CG2 
919  N N   . PHE A 129 ? 0.5870 0.4536 0.4897 -0.1184 0.1065  -0.0196 128 PHE A N   
920  C CA  . PHE A 129 ? 0.5253 0.4204 0.4304 -0.0843 0.0904  -0.0147 128 PHE A CA  
921  C C   . PHE A 129 ? 0.5332 0.3800 0.4177 -0.0599 0.0741  -0.0119 128 PHE A C   
922  O O   . PHE A 129 ? 0.5395 0.3361 0.4229 -0.0654 0.0748  -0.0179 128 PHE A O   
923  C CB  . PHE A 129 ? 0.4774 0.4480 0.4248 -0.0828 0.0763  -0.0255 128 PHE A CB  
924  C CG  . PHE A 129 ? 0.5434 0.5208 0.4913 -0.1026 0.0674  -0.0466 128 PHE A CG  
925  C CD1 . PHE A 129 ? 0.5678 0.5187 0.4967 -0.0904 0.0619  -0.0596 128 PHE A CD1 
926  C CD2 . PHE A 129 ? 0.5708 0.5895 0.5423 -0.1382 0.0671  -0.0589 128 PHE A CD2 
927  C CE1 . PHE A 129 ? 0.5763 0.5334 0.4996 -0.1163 0.0640  -0.0908 128 PHE A CE1 
928  C CE2 . PHE A 129 ? 0.5950 0.6221 0.5544 -0.1665 0.0605  -0.0858 128 PHE A CE2 
929  C CZ  . PHE A 129 ? 0.5831 0.5753 0.5133 -0.1567 0.0628  -0.1047 128 PHE A CZ  
930  N N   . LYS A 130 ? 0.4412 0.3049 0.3234 -0.0334 0.0613  -0.0058 129 LYS A N   
931  C CA  . LYS A 130 ? 0.4850 0.3247 0.3693 -0.0098 0.0457  -0.0068 129 LYS A CA  
932  C C   . LYS A 130 ? 0.4100 0.3047 0.3129 0.0017  0.0389  -0.0164 129 LYS A C   
933  O O   . LYS A 130 ? 0.4149 0.3452 0.3221 0.0021  0.0394  -0.0093 129 LYS A O   
934  C CB  . LYS A 130 ? 0.4974 0.2968 0.3518 0.0043  0.0316  0.0183  129 LYS A CB  
935  C CG  . LYS A 130 ? 0.6400 0.3704 0.4690 -0.0052 0.0270  0.0414  129 LYS A CG  
936  N N   . ASP A 131 ? 0.4136 0.3124 0.3327 0.0090  0.0363  -0.0331 130 ASP A N   
937  C CA  . ASP A 131 ? 0.3803 0.3249 0.3067 0.0123  0.0322  -0.0382 130 ASP A CA  
938  C C   . ASP A 131 ? 0.3710 0.3051 0.3063 0.0364  0.0222  -0.0305 130 ASP A C   
939  O O   . ASP A 131 ? 0.4031 0.3178 0.3626 0.0488  0.0210  -0.0409 130 ASP A O   
940  C CB  . ASP A 131 ? 0.3203 0.2822 0.2511 -0.0050 0.0435  -0.0677 130 ASP A CB  
941  C CG  . ASP A 131 ? 0.4108 0.4024 0.3249 -0.0378 0.0445  -0.0741 130 ASP A CG  
942  O OD1 . ASP A 131 ? 0.3910 0.3985 0.3082 -0.0412 0.0351  -0.0527 130 ASP A OD1 
943  O OD2 . ASP A 131 ? 0.4074 0.4087 0.3097 -0.0634 0.0563  -0.1045 130 ASP A OD2 
944  N N   . PHE A 132 ? 0.3379 0.2843 0.2639 0.0423  0.0151  -0.0147 131 PHE A N   
945  C CA  . PHE A 132 ? 0.3456 0.2850 0.2752 0.0575  0.0023  -0.0094 131 PHE A CA  
946  C C   . PHE A 132 ? 0.3258 0.2998 0.2794 0.0581  0.0040  -0.0195 131 PHE A C   
947  O O   . PHE A 132 ? 0.3517 0.3515 0.3017 0.0464  0.0098  -0.0161 131 PHE A O   
948  C CB  . PHE A 132 ? 0.3617 0.2915 0.2646 0.0558  0.0006  0.0020  131 PHE A CB  
949  C CG  . PHE A 132 ? 0.4237 0.3181 0.2893 0.0474  0.0026  0.0119  131 PHE A CG  
950  C CD1 . PHE A 132 ? 0.4409 0.3054 0.2741 0.0473  -0.0168 0.0251  131 PHE A CD1 
951  C CD2 . PHE A 132 ? 0.4030 0.2976 0.2638 0.0336  0.0217  0.0112  131 PHE A CD2 
952  C CE1 . PHE A 132 ? 0.5538 0.3807 0.3362 0.0309  -0.0159 0.0413  131 PHE A CE1 
953  C CE2 . PHE A 132 ? 0.4824 0.3426 0.3029 0.0177  0.0297  0.0210  131 PHE A CE2 
954  C CZ  . PHE A 132 ? 0.5394 0.3617 0.3127 0.0146  0.0120  0.0378  131 PHE A CZ  
955  N N   . LEU A 133 ? 0.3148 0.2917 0.2987 0.0691  -0.0023 -0.0286 132 LEU A N   
956  C CA  . LEU A 133 ? 0.3348 0.3475 0.3450 0.0644  0.0052  -0.0410 132 LEU A CA  
957  C C   . LEU A 133 ? 0.3360 0.3555 0.3325 0.0593  -0.0020 -0.0271 132 LEU A C   
958  O O   . LEU A 133 ? 0.3518 0.3560 0.3425 0.0661  -0.0177 -0.0206 132 LEU A O   
959  C CB  . LEU A 133 ? 0.3311 0.3516 0.3979 0.0807  -0.0019 -0.0539 132 LEU A CB  
960  C CG  . LEU A 133 ? 0.3731 0.4379 0.4831 0.0723  0.0168  -0.0769 132 LEU A CG  
961  C CD1 . LEU A 133 ? 0.4416 0.5195 0.5463 0.0539  0.0517  -0.1047 132 LEU A CD1 
962  C CD2 . LEU A 133 ? 0.4260 0.5098 0.6172 0.0934  0.0019  -0.0858 132 LEU A CD2 
963  N N   . LEU A 134 ? 0.2889 0.3265 0.2769 0.0434  0.0084  -0.0215 133 LEU A N   
964  C CA  . LEU A 134 ? 0.2645 0.2986 0.2541 0.0388  0.0045  -0.0097 133 LEU A CA  
965  C C   . LEU A 134 ? 0.2621 0.3117 0.2809 0.0366  0.0018  -0.0227 133 LEU A C   
966  O O   . LEU A 134 ? 0.2874 0.3664 0.3324 0.0309  0.0125  -0.0378 133 LEU A O   
967  C CB  . LEU A 134 ? 0.2682 0.3113 0.2483 0.0218  0.0095  0.0108  133 LEU A CB  
968  C CG  . LEU A 134 ? 0.3126 0.3483 0.2843 0.0266  0.0035  0.0282  133 LEU A CG  
969  C CD1 . LEU A 134 ? 0.3549 0.4103 0.3173 0.0076  -0.0037 0.0552  133 LEU A CD1 
970  C CD2 . LEU A 134 ? 0.2993 0.3070 0.2891 0.0421  0.0031  0.0319  133 LEU A CD2 
971  N N   . ARG A 135 ? 0.2932 0.3266 0.3115 0.0368  -0.0089 -0.0218 134 ARG A N   
972  C CA  . ARG A 135 ? 0.2914 0.3439 0.3406 0.0298  -0.0187 -0.0345 134 ARG A CA  
973  C C   . ARG A 135 ? 0.3062 0.3483 0.3583 0.0096  -0.0092 -0.0317 134 ARG A C   
974  O O   . ARG A 135 ? 0.3070 0.3137 0.3392 0.0097  -0.0031 -0.0213 134 ARG A O   
975  C CB  . ARG A 135 ? 0.3342 0.3737 0.3693 0.0363  -0.0449 -0.0382 134 ARG A CB  
976  C CG  . ARG A 135 ? 0.4661 0.4931 0.4852 0.0542  -0.0594 -0.0295 134 ARG A CG  
977  C CD  . ARG A 135 ? 0.4650 0.5189 0.5376 0.0683  -0.0817 -0.0303 134 ARG A CD  
978  N NE  . ARG A 135 ? 0.4498 0.5354 0.5598 0.0623  -0.1110 -0.0340 134 ARG A NE  
979  C CZ  . ARG A 135 ? 0.5148 0.5960 0.6057 0.0594  -0.1530 -0.0204 134 ARG A CZ  
980  N NH1 . ARG A 135 ? 0.5668 0.6058 0.5891 0.0590  -0.1672 -0.0008 134 ARG A NH1 
981  N NH2 . ARG A 135 ? 0.6026 0.7262 0.7398 0.0503  -0.1831 -0.0250 134 ARG A NH2 
982  N N   . PRO A 136 ? 0.3157 0.3872 0.4047 -0.0081 -0.0066 -0.0425 135 PRO A N   
983  C CA  . PRO A 136 ? 0.3341 0.3861 0.4282 -0.0321 0.0027  -0.0396 135 PRO A CA  
984  C C   . PRO A 136 ? 0.3529 0.3726 0.4348 -0.0359 -0.0098 -0.0543 135 PRO A C   
985  O O   . PRO A 136 ? 0.3418 0.3675 0.4069 -0.0264 -0.0303 -0.0653 135 PRO A O   
986  C CB  . PRO A 136 ? 0.3130 0.4146 0.4542 -0.0539 0.0110  -0.0528 135 PRO A CB  
987  C CG  . PRO A 136 ? 0.3216 0.4692 0.5003 -0.0343 -0.0056 -0.0704 135 PRO A CG  
988  C CD  . PRO A 136 ? 0.2825 0.4069 0.4242 -0.0066 -0.0102 -0.0598 135 PRO A CD  
989  N N   . ARG A 137 ? 0.4134 0.3937 0.4989 -0.0533 0.0035  -0.0539 136 ARG A N   
990  C CA  . ARG A 137 ? 0.5240 0.4719 0.5977 -0.0663 0.0004  -0.0805 136 ARG A CA  
991  C C   . ARG A 137 ? 0.5466 0.5353 0.6366 -0.0899 -0.0205 -0.1040 136 ARG A C   
992  O O   . ARG A 137 ? 0.5883 0.5765 0.6485 -0.0990 -0.0398 -0.1256 136 ARG A O   
993  C CB  . ARG A 137 ? 0.5856 0.4741 0.6779 -0.0797 0.0238  -0.0786 136 ARG A CB  
994  C CG  . ARG A 137 ? 0.6254 0.4668 0.7110 -0.0569 0.0386  -0.0752 136 ARG A CG  
995  C CD  . ARG A 137 ? 0.7059 0.4809 0.8330 -0.0631 0.0613  -0.0742 136 ARG A CD  
996  N NE  . ARG A 137 ? 0.6919 0.4333 0.8342 -0.0368 0.0783  -0.0793 136 ARG A NE  
997  C CZ  . ARG A 137 ? 0.8093 0.4940 1.0127 -0.0258 0.0975  -0.0707 136 ARG A CZ  
998  N NH1 . ARG A 137 ? 0.7822 0.4264 1.0249 -0.0414 0.0994  -0.0499 136 ARG A NH1 
999  N NH2 . ARG A 137 ? 0.8161 0.4838 1.0508 0.0001  0.1161  -0.0817 136 ARG A NH2 
1000 N N   . SER A 138 ? 0.5559 0.5841 0.6929 -0.1056 -0.0166 -0.0999 137 SER A N   
1001 C CA  . SER A 138 ? 0.5858 0.6730 0.7641 -0.1259 -0.0396 -0.1210 137 SER A CA  
1002 C C   . SER A 138 ? 0.5317 0.6884 0.7628 -0.1100 -0.0424 -0.1135 137 SER A C   
1003 O O   . SER A 138 ? 0.4641 0.6204 0.6953 -0.1016 -0.0155 -0.0982 137 SER A O   
1004 C CB  . SER A 138 ? 0.6358 0.7145 0.8446 -0.1694 -0.0266 -0.1377 137 SER A CB  
1005 O OG  . SER A 138 ? 0.6641 0.7367 0.8972 -0.1827 0.0062  -0.1179 137 SER A OG  
1006 N N   . HIS A 139 ? 0.4724 0.9360 0.5082 -0.2119 -0.0997 -0.0230 138 HIS A N   
1007 C CA  . HIS A 139 ? 0.4495 0.8037 0.5382 -0.1693 -0.1376 0.0577  138 HIS A CA  
1008 C C   . HIS A 139 ? 0.3804 0.6528 0.5344 -0.0864 -0.0971 0.0223  138 HIS A C   
1009 O O   . HIS A 139 ? 0.3784 0.6002 0.5928 -0.0532 -0.1018 0.0351  138 HIS A O   
1010 C CB  . HIS A 139 ? 0.4786 0.8658 0.5964 -0.2225 -0.2020 0.1280  138 HIS A CB  
1011 C CG  . HIS A 139 ? 0.4042 0.8358 0.5258 -0.2221 -0.1752 0.0781  138 HIS A CG  
1012 N ND1 . HIS A 139 ? 0.4087 0.7629 0.6116 -0.1531 -0.1598 0.0651  138 HIS A ND1 
1013 C CD2 . HIS A 139 ? 0.4653 1.0319 0.5378 -0.2870 -0.1548 0.0163  138 HIS A CD2 
1014 C CE1 . HIS A 139 ? 0.4631 0.8744 0.6666 -0.1686 -0.1439 0.0226  138 HIS A CE1 
1015 N NE2 . HIS A 139 ? 0.4928 1.0356 0.6305 -0.2460 -0.1377 -0.0203 138 HIS A NE2 
1016 N N   . LYS A 140 ? 0.3550 0.6431 0.5249 -0.0708 -0.0656 -0.0275 139 LYS A N   
1017 C CA  . LYS A 140 ? 0.3275 0.5747 0.5530 -0.0316 -0.0487 -0.0261 139 LYS A CA  
1018 C C   . LYS A 140 ? 0.3257 0.5531 0.5425 -0.0207 -0.0330 -0.0197 139 LYS A C   
1019 O O   . LYS A 140 ? 0.3236 0.5595 0.5606 -0.0254 -0.0275 0.0031  139 LYS A O   
1020 C CB  . LYS A 140 ? 0.3079 0.5773 0.6035 -0.0327 -0.0520 -0.0557 139 LYS A CB  
1021 C CG  . LYS A 140 ? 0.3241 0.6021 0.6418 -0.0347 -0.0617 -0.0437 139 LYS A CG  
1022 C CD  . LYS A 140 ? 0.3927 0.6785 0.8105 -0.0279 -0.0689 -0.0656 139 LYS A CD  
1023 C CE  . LYS A 140 ? 0.3686 0.6889 0.7976 -0.0410 -0.0767 -0.0798 139 LYS A CE  
1024 N NZ  . LYS A 140 ? 0.3452 0.6802 0.9000 -0.0346 -0.0879 -0.1163 139 LYS A NZ  
1025 N N   A SER A 141 ? 0.3196 0.5449 0.5004 -0.0252 -0.0306 -0.0328 140 SER A N   
1026 N N   B SER A 141 ? 0.3238 0.5489 0.5027 -0.0252 -0.0306 -0.0323 140 SER A N   
1027 C CA  A SER A 141 ? 0.3258 0.5365 0.4987 -0.0233 -0.0249 -0.0182 140 SER A CA  
1028 C CA  B SER A 141 ? 0.3394 0.5501 0.5109 -0.0232 -0.0248 -0.0200 140 SER A CA  
1029 C C   A SER A 141 ? 0.3407 0.5437 0.4530 -0.0200 -0.0115 -0.0181 140 SER A C   
1030 C C   B SER A 141 ? 0.3470 0.5499 0.4589 -0.0199 -0.0115 -0.0182 140 SER A C   
1031 O O   A SER A 141 ? 0.3635 0.5616 0.4730 -0.0204 -0.0239 -0.0169 140 SER A O   
1032 O O   B SER A 141 ? 0.3698 0.5675 0.4811 -0.0198 -0.0236 -0.0168 140 SER A O   
1033 C CB  A SER A 141 ? 0.3127 0.5240 0.5590 -0.0258 -0.0421 -0.0470 140 SER A CB  
1034 C CB  B SER A 141 ? 0.3251 0.5406 0.5615 -0.0259 -0.0386 -0.0562 140 SER A CB  
1035 O OG  A SER A 141 ? 0.3206 0.5751 0.5497 -0.0371 -0.0295 -0.1118 140 SER A OG  
1036 O OG  B SER A 141 ? 0.3893 0.6166 0.7527 -0.0255 -0.0611 -0.0799 140 SER A OG  
1037 N N   . ARG A 142 ? 0.3544 0.5629 0.4434 -0.0269 -0.0011 -0.0096 141 ARG A N   
1038 C CA  . ARG A 142 ? 0.3365 0.5453 0.3983 -0.0220 0.0122  -0.0272 141 ARG A CA  
1039 C C   . ARG A 142 ? 0.3518 0.5505 0.3758 -0.0297 0.0109  -0.0161 141 ARG A C   
1040 O O   . ARG A 142 ? 0.3604 0.5666 0.4045 -0.0488 -0.0057 0.0150  141 ARG A O   
1041 C CB  . ARG A 142 ? 0.3873 0.6649 0.4790 -0.0373 0.0410  -0.0635 141 ARG A CB  
1042 C CG  . ARG A 142 ? 0.4126 0.7161 0.5822 -0.0316 0.0440  -0.0913 141 ARG A CG  
1043 C CD  . ARG A 142 ? 0.5631 0.9811 0.8104 -0.0551 0.0845  -0.1819 141 ARG A CD  
1044 N NE  . ARG A 142 ? 0.6345 1.0462 0.9952 -0.0300 0.0805  -0.2517 141 ARG A NE  
1045 C CZ  . ARG A 142 ? 0.6851 1.0876 1.2527 -0.0009 0.0538  -0.3156 141 ARG A CZ  
1046 N NH1 . ARG A 142 ? 0.5755 0.9750 1.2347 0.0083  0.0367  -0.3203 141 ARG A NH1 
1047 N NH2 . ARG A 142 ? 0.7063 1.0971 1.4285 0.0185  0.0297  -0.3713 141 ARG A NH2 
1048 N N   . VAL A 143 ? 0.3344 0.5144 0.3324 -0.0207 0.0128  -0.0295 142 VAL A N   
1049 C CA  . VAL A 143 ? 0.3331 0.5053 0.2988 -0.0261 0.0145  -0.0255 142 VAL A CA  
1050 C C   . VAL A 143 ? 0.3500 0.5356 0.3079 -0.0233 0.0301  -0.0487 142 VAL A C   
1051 O O   . VAL A 143 ? 0.3823 0.5947 0.4020 -0.0183 0.0378  -0.0826 142 VAL A O   
1052 C CB  . VAL A 143 ? 0.3362 0.4973 0.2995 -0.0263 0.0042  -0.0430 142 VAL A CB  
1053 C CG1 . VAL A 143 ? 0.2692 0.4485 0.3090 -0.0300 -0.0065 -0.0681 142 VAL A CG1 
1054 C CG2 . VAL A 143 ? 0.2918 0.4649 0.2243 -0.0412 -0.0069 -0.0376 142 VAL A CG2 
1055 N N   . LYS A 144 ? 0.3660 0.5439 0.2883 -0.0266 0.0332  -0.0484 143 LYS A N   
1056 C CA  . LYS A 144 ? 0.3510 0.5463 0.2972 -0.0223 0.0454  -0.0878 143 LYS A CA  
1057 C C   . LYS A 144 ? 0.3616 0.5140 0.2693 -0.0159 0.0331  -0.0719 143 LYS A C   
1058 O O   . LYS A 144 ? 0.3748 0.5065 0.2394 -0.0206 0.0255  -0.0485 143 LYS A O   
1059 C CB  . LYS A 144 ? 0.4195 0.7230 0.3685 -0.0589 0.0823  -0.1367 143 LYS A CB  
1060 C CG  . LYS A 144 ? 0.4191 0.7713 0.2834 -0.1059 0.0861  -0.1031 143 LYS A CG  
1061 C CD  . LYS A 144 ? 0.4729 1.0044 0.3283 -0.1806 0.1281  -0.1678 143 LYS A CD  
1062 C CE  . LYS A 144 ? 0.5694 1.1702 0.3507 -0.2367 0.1298  -0.1513 143 LYS A CE  
1063 N NZ  . LYS A 144 ? 0.6098 1.4463 0.3352 -0.3620 0.1615  -0.1829 143 LYS A NZ  
1064 N N   . GLY A 145 ? 0.3594 0.5073 0.3248 -0.0065 0.0259  -0.0993 144 GLY A N   
1065 C CA  . GLY A 145 ? 0.3212 0.4420 0.2537 -0.0065 0.0169  -0.0871 144 GLY A CA  
1066 C C   . GLY A 145 ? 0.2935 0.3825 0.2138 -0.0223 -0.0260 -0.0331 144 GLY A C   
1067 O O   . GLY A 145 ? 0.2871 0.3795 0.2381 -0.0418 -0.0618 0.0048  144 GLY A O   
1068 N N   . PHE A 146 ? 0.2998 0.3233 0.3327 -0.0018 0.0583  -0.0173 145 PHE A N   
1069 C CA  . PHE A 146 ? 0.2996 0.2947 0.3225 0.0033  0.0344  -0.0318 145 PHE A CA  
1070 C C   . PHE A 146 ? 0.3257 0.3089 0.3343 -0.0041 0.0224  -0.0214 145 PHE A C   
1071 O O   . PHE A 146 ? 0.3365 0.3237 0.3290 -0.0095 0.0265  -0.0071 145 PHE A O   
1072 C CB  . PHE A 146 ? 0.2908 0.2688 0.2782 0.0111  0.0296  -0.0484 145 PHE A CB  
1073 C CG  . PHE A 146 ? 0.3968 0.3847 0.4013 0.0257  0.0347  -0.0681 145 PHE A CG  
1074 C CD1 . PHE A 146 ? 0.3714 0.3406 0.3929 0.0386  0.0179  -0.0801 145 PHE A CD1 
1075 C CD2 . PHE A 146 ? 0.4407 0.4617 0.4411 0.0307  0.0551  -0.0762 145 PHE A CD2 
1076 C CE1 . PHE A 146 ? 0.3727 0.3515 0.4162 0.0569  0.0176  -0.1028 145 PHE A CE1 
1077 C CE2 . PHE A 146 ? 0.4403 0.4808 0.4633 0.0481  0.0601  -0.1020 145 PHE A CE2 
1078 C CZ  . PHE A 146 ? 0.4473 0.4645 0.4969 0.0618  0.0392  -0.1173 145 PHE A CZ  
1079 N N   . LEU A 147 ? 0.3054 0.2788 0.3160 -0.0006 0.0067  -0.0299 146 LEU A N   
1080 C CA  . LEU A 147 ? 0.2983 0.2722 0.2978 -0.0045 -0.0031 -0.0281 146 LEU A CA  
1081 C C   . LEU A 147 ? 0.3353 0.2979 0.3034 -0.0066 -0.0056 -0.0314 146 LEU A C   
1082 O O   . LEU A 147 ? 0.3563 0.3085 0.3191 0.0009  -0.0099 -0.0335 146 LEU A O   
1083 C CB  . LEU A 147 ? 0.2979 0.2829 0.3345 0.0031  -0.0165 -0.0371 146 LEU A CB  
1084 C CG  . LEU A 147 ? 0.3181 0.3169 0.3492 0.0064  -0.0276 -0.0457 146 LEU A CG  
1085 C CD1 . LEU A 147 ? 0.3020 0.3009 0.3372 0.0004  -0.0286 -0.0367 146 LEU A CD1 
1086 C CD2 . LEU A 147 ? 0.2943 0.3088 0.3630 0.0216  -0.0453 -0.0675 146 LEU A CD2 
1087 N N   . ARG A 148 ? 0.3350 0.2984 0.2856 -0.0171 -0.0042 -0.0297 147 ARG A N   
1088 C CA  . ARG A 148 ? 0.3314 0.2822 0.2658 -0.0271 -0.0038 -0.0287 147 ARG A CA  
1089 C C   . ARG A 148 ? 0.3375 0.3122 0.2735 -0.0319 -0.0036 -0.0253 147 ARG A C   
1090 O O   . ARG A 148 ? 0.3077 0.3106 0.2564 -0.0335 -0.0062 -0.0322 147 ARG A O   
1091 C CB  . ARG A 148 ? 0.3465 0.2930 0.2746 -0.0365 -0.0043 -0.0368 147 ARG A CB  
1092 C CG  . ARG A 148 ? 0.3310 0.2616 0.2617 -0.0533 -0.0054 -0.0375 147 ARG A CG  
1093 C CD  . ARG A 148 ? 0.3558 0.2818 0.2887 -0.0574 -0.0133 -0.0583 147 ARG A CD  
1094 N NE  . ARG A 148 ? 0.4115 0.3135 0.3357 -0.0440 -0.0155 -0.0705 147 ARG A NE  
1095 C CZ  . ARG A 148 ? 0.4767 0.3705 0.4020 -0.0412 -0.0252 -0.0969 147 ARG A CZ  
1096 N NH1 . ARG A 148 ? 0.4565 0.3633 0.3927 -0.0524 -0.0361 -0.1138 147 ARG A NH1 
1097 N NH2 . ARG A 148 ? 0.4941 0.3725 0.4151 -0.0243 -0.0267 -0.1133 147 ARG A NH2 
1098 N N   . LEU A 149 ? 0.3228 0.2904 0.2439 -0.0306 -0.0012 -0.0147 148 LEU A N   
1099 C CA  . LEU A 149 ? 0.3349 0.3376 0.2474 -0.0302 0.0038  -0.0104 148 LEU A CA  
1100 C C   . LEU A 149 ? 0.3722 0.3629 0.2640 -0.0467 0.0162  0.0150  148 LEU A C   
1101 O O   . LEU A 149 ? 0.3678 0.3109 0.2494 -0.0496 0.0134  0.0301  148 LEU A O   
1102 C CB  . LEU A 149 ? 0.3094 0.3258 0.2148 -0.0055 -0.0062 -0.0181 148 LEU A CB  
1103 C CG  . LEU A 149 ? 0.3357 0.3603 0.2759 0.0089  -0.0198 -0.0406 148 LEU A CG  
1104 C CD1 . LEU A 149 ? 0.3404 0.3767 0.2849 0.0330  -0.0352 -0.0554 148 LEU A CD1 
1105 C CD2 . LEU A 149 ? 0.3053 0.3612 0.2694 0.0078  -0.0223 -0.0550 148 LEU A CD2 
1106 N N   . LYS A 150 ? 0.3513 0.3858 0.2433 -0.0583 0.0305  0.0208  149 LYS A N   
1107 C CA  . LYS A 150 ? 0.4421 0.4739 0.3137 -0.0756 0.0482  0.0547  149 LYS A CA  
1108 C C   . LYS A 150 ? 0.4805 0.5733 0.3211 -0.0582 0.0579  0.0568  149 LYS A C   
1109 O O   . LYS A 150 ? 0.4264 0.5773 0.2846 -0.0479 0.0579  0.0273  149 LYS A O   
1110 C CB  . LYS A 150 ? 0.4460 0.4884 0.3556 -0.1116 0.0631  0.0597  149 LYS A CB  
1111 C CG  . LYS A 150 ? 0.6145 0.6459 0.5143 -0.1387 0.0860  0.1058  149 LYS A CG  
1112 C CD  . LYS A 150 ? 0.7059 0.7972 0.6462 -0.1708 0.1113  0.1088  149 LYS A CD  
1113 C CE  . LYS A 150 ? 0.7718 0.8876 0.6834 -0.1879 0.1444  0.1606  149 LYS A CE  
1114 N NZ  . LYS A 150 ? 0.8287 0.8554 0.7216 -0.2014 0.1416  0.2097  149 LYS A NZ  
1115 N N   . MET A 151 ? 0.4459 0.2574 0.2902 -0.0506 0.0071  0.0058  150 MET A N   
1116 C CA  . MET A 151 ? 0.3824 0.2422 0.2788 -0.0455 0.0023  0.0064  150 MET A CA  
1117 C C   . MET A 151 ? 0.4405 0.2847 0.3216 -0.0475 0.0061  0.0058  150 MET A C   
1118 O O   . MET A 151 ? 0.4747 0.2783 0.3212 -0.0332 0.0185  0.0082  150 MET A O   
1119 C CB  . MET A 151 ? 0.3811 0.2677 0.3102 -0.0311 0.0120  0.0071  150 MET A CB  
1120 C CG  . MET A 151 ? 0.3983 0.2825 0.3304 -0.0355 0.0194  0.0082  150 MET A CG  
1121 S SD  . MET A 151 ? 0.4280 0.3550 0.4084 -0.0362 0.0339  0.0048  150 MET A SD  
1122 C CE  . MET A 151 ? 0.4101 0.3342 0.3888 -0.0190 0.0627  0.0073  150 MET A CE  
1123 N N   . ALA A 152 ? 0.4079 0.2749 0.3080 -0.0611 0.0017  0.0041  151 ALA A N   
1124 C CA  . ALA A 152 ? 0.4390 0.2768 0.3094 -0.0683 0.0120  0.0050  151 ALA A CA  
1125 C C   . ALA A 152 ? 0.4065 0.2791 0.3062 -0.0773 0.0180  0.0022  151 ALA A C   
1126 O O   . ALA A 152 ? 0.3965 0.3164 0.3442 -0.0848 0.0156  -0.0014 151 ALA A O   
1127 C CB  . ALA A 152 ? 0.4512 0.2457 0.2811 -0.0972 0.0166  0.0017  151 ALA A CB  
1128 N N   . TYR A 153 ? 0.4390 0.2818 0.3024 -0.0725 0.0275  0.0050  152 TYR A N   
1129 C CA  . TYR A 153 ? 0.4629 0.3164 0.3296 -0.0819 0.0444  0.0007  152 TYR A CA  
1130 C C   . TYR A 153 ? 0.4956 0.3589 0.3766 -0.1149 0.0675  -0.0028 152 TYR A C   
1131 O O   . TYR A 153 ? 0.5125 0.3375 0.3597 -0.1375 0.0719  -0.0009 152 TYR A O   
1132 C CB  . TYR A 153 ? 0.5097 0.3107 0.3063 -0.0707 0.0453  0.0061  152 TYR A CB  
1133 C CG  . TYR A 153 ? 0.4873 0.3097 0.2929 -0.0492 0.0195  0.0049  152 TYR A CG  
1134 C CD1 . TYR A 153 ? 0.4861 0.3292 0.3093 -0.0534 0.0227  -0.0065 152 TYR A CD1 
1135 C CD2 . TYR A 153 ? 0.4797 0.3036 0.2807 -0.0266 -0.0049 0.0136  152 TYR A CD2 
1136 C CE1 . TYR A 153 ? 0.5336 0.3908 0.3593 -0.0484 -0.0012 -0.0114 152 TYR A CE1 
1137 C CE2 . TYR A 153 ? 0.4924 0.3575 0.3195 -0.0177 -0.0303 0.0103  152 TYR A CE2 
1138 C CZ  . TYR A 153 ? 0.4710 0.3502 0.3078 -0.0352 -0.0296 -0.0034 152 TYR A CZ  
1139 O OH  . TYR A 153 ? 0.4652 0.3784 0.3207 -0.0402 -0.0549 -0.0098 152 TYR A OH  
1140 N N   . MET A 154 ? 0.4758 0.3878 0.4057 -0.1185 0.0868  -0.0090 153 MET A N   
1141 C CA  . MET A 154 ? 0.5312 0.4634 0.4818 -0.1512 0.1214  -0.0131 153 MET A CA  
1142 C C   . MET A 154 ? 0.6177 0.4586 0.4674 -0.1640 0.1510  -0.0094 153 MET A C   
1143 O O   . MET A 154 ? 0.6407 0.4359 0.4315 -0.1399 0.1488  -0.0074 153 MET A O   
1144 C CB  . MET A 154 ? 0.5170 0.5255 0.5494 -0.1370 0.1426  -0.0194 153 MET A CB  
1145 C CG  . MET A 154 ? 0.4857 0.5673 0.5993 -0.1144 0.1100  -0.0173 153 MET A CG  
1146 S SD  . MET A 154 ? 0.6030 0.7503 0.7740 -0.1535 0.0818  -0.0161 153 MET A SD  
1147 C CE  . MET A 154 ? 0.5845 0.8163 0.8398 -0.1852 0.1312  -0.0231 153 MET A CE  
1148 N N   . PRO A 155 ? 0.6952 0.4992 0.5119 -0.2056 0.1758  -0.0083 154 PRO A N   
1149 C CA  . PRO A 155 ? 0.7968 0.4877 0.4928 -0.2177 0.2053  -0.0002 154 PRO A CA  
1150 C C   . PRO A 155 ? 0.8480 0.5142 0.5001 -0.2049 0.2357  -0.0018 154 PRO A C   
1151 O O   . PRO A 155 ? 0.8311 0.5647 0.5531 -0.2132 0.2700  -0.0129 154 PRO A O   
1152 C CB  . PRO A 155 ? 0.8688 0.5488 0.5665 -0.2803 0.2435  -0.0045 154 PRO A CB  
1153 C CG  . PRO A 155 ? 0.8021 0.5674 0.5948 -0.2984 0.2130  -0.0127 154 PRO A CG  
1154 C CD  . PRO A 155 ? 0.6783 0.5371 0.5593 -0.2497 0.1757  -0.0146 154 PRO A CD  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   ?   ?   ?   A . n 
A 1 3   ALA 3   2   ?   ?   ?   A . n 
A 1 4   THR 4   3   ?   ?   ?   A . n 
A 1 5   GLY 5   4   ?   ?   ?   A . n 
A 1 6   LEU 6   5   ?   ?   ?   A . n 
A 1 7   GLY 7   6   6   GLY GLY A . n 
A 1 8   GLU 8   7   7   GLU GLU A . n 
A 1 9   PRO 9   8   8   PRO PRO A . n 
A 1 10  VAL 10  9   9   VAL VAL A . n 
A 1 11  TYR 11  10  10  TYR TYR A . n 
A 1 12  GLY 12  11  11  GLY GLY A . n 
A 1 13  LEU 13  12  12  LEU LEU A . n 
A 1 14  SER 14  13  13  SER SER A . n 
A 1 15  GLU 15  14  14  GLU GLU A . n 
A 1 16  ASP 16  15  15  ASP ASP A . n 
A 1 17  GLU 17  16  16  GLU GLU A . n 
A 1 18  GLY 18  17  17  GLY GLY A . n 
A 1 19  GLU 19  18  18  GLU GLU A . n 
A 1 20  SER 20  19  19  SER SER A . n 
A 1 21  ARG 21  20  20  ARG ARG A . n 
A 1 22  ILE 22  21  21  ILE ILE A . n 
A 1 23  LEU 23  22  22  LEU LEU A . n 
A 1 24  ARG 24  23  23  ARG ARG A . n 
A 1 25  VAL 25  24  24  VAL VAL A . n 
A 1 26  LYS 26  25  25  LYS LYS A . n 
A 1 27  VAL 27  26  26  VAL VAL A . n 
A 1 28  VAL 28  27  27  VAL VAL A . n 
A 1 29  SER 29  28  28  SER SER A . n 
A 1 30  GLY 30  29  29  GLY GLY A . n 
A 1 31  ILE 31  30  30  ILE ILE A . n 
A 1 32  ASP 32  31  31  ASP ASP A . n 
A 1 33  LEU 33  32  32  LEU LEU A . n 
A 1 34  ALA 34  33  33  ALA ALA A . n 
A 1 35  LYS 35  34  34  LYS LYS A . n 
A 1 36  LYS 36  35  35  LYS LYS A . n 
A 1 37  ASP 37  36  ?   ?   ?   A . n 
A 1 38  ILE 38  37  ?   ?   ?   A . n 
A 1 39  PHE 39  38  ?   ?   ?   A . n 
A 1 40  GLY 40  39  ?   ?   ?   A . n 
A 1 41  ALA 41  40  40  ALA ALA A . n 
A 1 42  SER 42  41  41  SER SER A . n 
A 1 43  ASP 43  42  42  ASP ASP A . n 
A 1 44  PRO 44  43  43  PRO PRO A . n 
A 1 45  TYR 45  44  44  TYR TYR A . n 
A 1 46  VAL 46  45  45  VAL VAL A . n 
A 1 47  LYS 47  46  46  LYS LYS A . n 
A 1 48  LEU 48  47  47  LEU LEU A . n 
A 1 49  SER 49  48  48  SER SER A . n 
A 1 50  LEU 50  49  49  LEU LEU A . n 
A 1 51  TYR 51  50  50  TYR TYR A . n 
A 1 52  VAL 52  51  51  VAL VAL A . n 
A 1 53  ALA 53  52  52  ALA ALA A . n 
A 1 54  ASP 54  53  53  ASP ASP A . n 
A 1 55  GLU 55  54  54  GLU GLU A . n 
A 1 56  ASN 56  55  55  ASN ASN A . n 
A 1 57  ARG 57  56  56  ARG ARG A . n 
A 1 58  GLU 58  57  57  GLU GLU A . n 
A 1 59  LEU 59  58  58  LEU LEU A . n 
A 1 60  ALA 60  59  59  ALA ALA A . n 
A 1 61  LEU 61  60  60  LEU LEU A . n 
A 1 62  VAL 62  61  61  VAL VAL A . n 
A 1 63  GLN 63  62  62  GLN GLN A . n 
A 1 64  THR 64  63  63  THR THR A . n 
A 1 65  LYS 65  64  64  LYS LYS A . n 
A 1 66  THR 66  65  65  THR THR A . n 
A 1 67  ILE 67  66  66  ILE ILE A . n 
A 1 68  LYS 68  67  67  LYS LYS A . n 
A 1 69  LYS 69  68  68  LYS LYS A . n 
A 1 70  THR 70  69  69  THR THR A . n 
A 1 71  LEU 71  70  70  LEU LEU A . n 
A 1 72  ASN 72  71  71  ASN ASN A . n 
A 1 73  PRO 73  72  72  PRO PRO A . n 
A 1 74  LYS 74  73  73  LYS LYS A . n 
A 1 75  TRP 75  74  74  TRP TRP A . n 
A 1 76  ASN 76  75  75  ASN ASN A . n 
A 1 77  GLU 77  76  76  GLU GLU A . n 
A 1 78  GLU 78  77  77  GLU GLU A . n 
A 1 79  PHE 79  78  78  PHE PHE A . n 
A 1 80  TYR 80  79  79  TYR TYR A . n 
A 1 81  PHE 81  80  80  PHE PHE A . n 
A 1 82  ARG 82  81  81  ARG ARG A . n 
A 1 83  VAL 83  82  82  VAL VAL A . n 
A 1 84  ASN 84  83  83  ASN ASN A . n 
A 1 85  PRO 85  84  84  PRO PRO A . n 
A 1 86  SER 86  85  85  SER SER A . n 
A 1 87  ASN 87  86  86  ASN ASN A . n 
A 1 88  HIS 88  87  87  HIS HIS A . n 
A 1 89  ARG 89  88  88  ARG ARG A . n 
A 1 90  LEU 90  89  89  LEU LEU A . n 
A 1 91  LEU 91  90  90  LEU LEU A . n 
A 1 92  PHE 92  91  91  PHE PHE A . n 
A 1 93  GLU 93  92  92  GLU GLU A . n 
A 1 94  VAL 94  93  93  VAL VAL A . n 
A 1 95  PHE 95  94  94  PHE PHE A . n 
A 1 96  ASP 96  95  95  ASP ASP A . n 
A 1 97  GLU 97  96  96  GLU GLU A . n 
A 1 98  ASN 98  97  97  ASN ASN A . n 
A 1 99  ARG 99  98  98  ARG ARG A . n 
A 1 100 LEU 100 99  99  LEU LEU A . n 
A 1 101 THR 101 100 100 THR THR A . n 
A 1 102 ARG 102 101 101 ARG ARG A . n 
A 1 103 ASP 103 102 102 ASP ASP A . n 
A 1 104 ASP 104 103 103 ASP ASP A . n 
A 1 105 PHE 105 104 104 PHE PHE A . n 
A 1 106 LEU 106 105 105 LEU LEU A . n 
A 1 107 GLY 107 106 106 GLY GLY A . n 
A 1 108 GLN 108 107 107 GLN GLN A . n 
A 1 109 VAL 109 108 108 VAL VAL A . n 
A 1 110 ASP 110 109 109 ASP ASP A . n 
A 1 111 VAL 111 110 110 VAL VAL A . n 
A 1 112 PRO 112 111 111 PRO PRO A . n 
A 1 113 LEU 113 112 112 LEU LEU A . n 
A 1 114 SER 114 113 113 SER SER A . n 
A 1 115 HIS 115 114 114 HIS HIS A . n 
A 1 116 LEU 116 115 115 LEU LEU A . n 
A 1 117 PRO 117 116 116 PRO PRO A . n 
A 1 118 THR 118 117 117 THR THR A . n 
A 1 119 GLU 119 118 118 GLU GLU A . n 
A 1 120 ASP 120 119 119 ASP ASP A . n 
A 1 121 PRO 121 120 120 PRO PRO A . n 
A 1 122 THR 122 121 ?   ?   ?   A . n 
A 1 123 MET 123 122 ?   ?   ?   A . n 
A 1 124 GLU 124 123 ?   ?   ?   A . n 
A 1 125 ARG 125 124 ?   ?   ?   A . n 
A 1 126 PRO 126 125 ?   ?   ?   A . n 
A 1 127 TYR 127 126 126 TYR TYR A . n 
A 1 128 THR 128 127 127 THR THR A . n 
A 1 129 PHE 129 128 128 PHE PHE A . n 
A 1 130 LYS 130 129 129 LYS LYS A . n 
A 1 131 ASP 131 130 130 ASP ASP A . n 
A 1 132 PHE 132 131 131 PHE PHE A . n 
A 1 133 LEU 133 132 132 LEU LEU A . n 
A 1 134 LEU 134 133 133 LEU LEU A . n 
A 1 135 ARG 135 134 134 ARG ARG A . n 
A 1 136 PRO 136 135 135 PRO PRO A . n 
A 1 137 ARG 137 136 136 ARG ARG A . n 
A 1 138 SER 138 137 137 SER SER A . n 
A 1 139 HIS 139 138 138 HIS HIS A . n 
A 1 140 LYS 140 139 139 LYS LYS A . n 
A 1 141 SER 141 140 140 SER SER A . n 
A 1 142 ARG 142 141 141 ARG ARG A . n 
A 1 143 VAL 143 142 142 VAL VAL A . n 
A 1 144 LYS 144 143 143 LYS LYS A . n 
A 1 145 GLY 145 144 144 GLY GLY A . n 
A 1 146 PHE 146 145 145 PHE PHE A . n 
A 1 147 LEU 147 146 146 LEU LEU A . n 
A 1 148 ARG 148 147 147 ARG ARG A . n 
A 1 149 LEU 149 148 148 LEU LEU A . n 
A 1 150 LYS 150 149 149 LYS LYS A . n 
A 1 151 MET 151 150 150 MET MET A . n 
A 1 152 ALA 152 151 151 ALA ALA A . n 
A 1 153 TYR 153 152 152 TYR TYR A . n 
A 1 154 MET 154 153 153 MET MET A . n 
A 1 155 PRO 155 154 154 PRO PRO A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 EDO 1   155 2   EDO EDO A . 
C 3 GOL 1   156 1   GOL GOL A . 
D 4 HOH 1   157 3   HOH HOH A . 
D 4 HOH 2   158 4   HOH HOH A . 
D 4 HOH 3   159 5   HOH HOH A . 
D 4 HOH 4   160 6   HOH HOH A . 
D 4 HOH 5   161 7   HOH HOH A . 
D 4 HOH 6   162 8   HOH HOH A . 
D 4 HOH 7   163 9   HOH HOH A . 
D 4 HOH 8   164 10  HOH HOH A . 
D 4 HOH 9   165 11  HOH HOH A . 
D 4 HOH 10  166 12  HOH HOH A . 
D 4 HOH 11  167 13  HOH HOH A . 
D 4 HOH 12  168 14  HOH HOH A . 
D 4 HOH 13  169 15  HOH HOH A . 
D 4 HOH 14  170 16  HOH HOH A . 
D 4 HOH 15  171 17  HOH HOH A . 
D 4 HOH 16  172 18  HOH HOH A . 
D 4 HOH 17  173 19  HOH HOH A . 
D 4 HOH 18  174 20  HOH HOH A . 
D 4 HOH 19  175 21  HOH HOH A . 
D 4 HOH 20  176 22  HOH HOH A . 
D 4 HOH 21  177 23  HOH HOH A . 
D 4 HOH 22  178 24  HOH HOH A . 
D 4 HOH 23  179 25  HOH HOH A . 
D 4 HOH 24  180 26  HOH HOH A . 
D 4 HOH 25  181 27  HOH HOH A . 
D 4 HOH 26  182 28  HOH HOH A . 
D 4 HOH 27  183 29  HOH HOH A . 
D 4 HOH 28  184 30  HOH HOH A . 
D 4 HOH 29  185 31  HOH HOH A . 
D 4 HOH 30  186 32  HOH HOH A . 
D 4 HOH 31  187 33  HOH HOH A . 
D 4 HOH 32  188 34  HOH HOH A . 
D 4 HOH 33  189 35  HOH HOH A . 
D 4 HOH 34  190 36  HOH HOH A . 
D 4 HOH 35  191 37  HOH HOH A . 
D 4 HOH 36  192 38  HOH HOH A . 
D 4 HOH 37  193 39  HOH HOH A . 
D 4 HOH 38  194 40  HOH HOH A . 
D 4 HOH 39  195 41  HOH HOH A . 
D 4 HOH 40  196 42  HOH HOH A . 
D 4 HOH 41  197 43  HOH HOH A . 
D 4 HOH 42  198 44  HOH HOH A . 
D 4 HOH 43  199 45  HOH HOH A . 
D 4 HOH 44  200 46  HOH HOH A . 
D 4 HOH 45  201 47  HOH HOH A . 
D 4 HOH 46  202 48  HOH HOH A . 
D 4 HOH 47  203 49  HOH HOH A . 
D 4 HOH 48  204 50  HOH HOH A . 
D 4 HOH 49  205 51  HOH HOH A . 
D 4 HOH 50  206 52  HOH HOH A . 
D 4 HOH 51  207 53  HOH HOH A . 
D 4 HOH 52  208 54  HOH HOH A . 
D 4 HOH 53  209 55  HOH HOH A . 
D 4 HOH 54  210 56  HOH HOH A . 
D 4 HOH 55  211 57  HOH HOH A . 
D 4 HOH 56  212 58  HOH HOH A . 
D 4 HOH 57  213 59  HOH HOH A . 
D 4 HOH 58  214 60  HOH HOH A . 
D 4 HOH 59  215 61  HOH HOH A . 
D 4 HOH 60  216 62  HOH HOH A . 
D 4 HOH 61  217 63  HOH HOH A . 
D 4 HOH 62  218 64  HOH HOH A . 
D 4 HOH 63  219 65  HOH HOH A . 
D 4 HOH 64  220 66  HOH HOH A . 
D 4 HOH 65  221 67  HOH HOH A . 
D 4 HOH 66  222 68  HOH HOH A . 
D 4 HOH 67  223 69  HOH HOH A . 
D 4 HOH 68  224 70  HOH HOH A . 
D 4 HOH 69  225 71  HOH HOH A . 
D 4 HOH 70  226 72  HOH HOH A . 
D 4 HOH 71  227 73  HOH HOH A . 
D 4 HOH 72  228 74  HOH HOH A . 
D 4 HOH 73  229 75  HOH HOH A . 
D 4 HOH 74  230 76  HOH HOH A . 
D 4 HOH 75  231 77  HOH HOH A . 
D 4 HOH 76  232 78  HOH HOH A . 
D 4 HOH 77  233 79  HOH HOH A . 
D 4 HOH 78  234 80  HOH HOH A . 
D 4 HOH 79  235 81  HOH HOH A . 
D 4 HOH 80  236 82  HOH HOH A . 
D 4 HOH 81  237 83  HOH HOH A . 
D 4 HOH 82  238 84  HOH HOH A . 
D 4 HOH 83  239 85  HOH HOH A . 
D 4 HOH 84  240 86  HOH HOH A . 
D 4 HOH 85  241 87  HOH HOH A . 
D 4 HOH 86  242 88  HOH HOH A . 
D 4 HOH 87  243 89  HOH HOH A . 
D 4 HOH 88  244 90  HOH HOH A . 
D 4 HOH 89  245 91  HOH HOH A . 
D 4 HOH 90  246 92  HOH HOH A . 
D 4 HOH 91  247 93  HOH HOH A . 
D 4 HOH 92  248 94  HOH HOH A . 
D 4 HOH 93  249 95  HOH HOH A . 
D 4 HOH 94  250 96  HOH HOH A . 
D 4 HOH 95  251 97  HOH HOH A . 
D 4 HOH 96  252 98  HOH HOH A . 
D 4 HOH 97  253 99  HOH HOH A . 
D 4 HOH 98  254 100 HOH HOH A . 
D 4 HOH 99  255 101 HOH HOH A . 
D 4 HOH 100 256 102 HOH HOH A . 
D 4 HOH 101 257 103 HOH HOH A . 
D 4 HOH 102 258 104 HOH HOH A . 
D 4 HOH 103 259 105 HOH HOH A . 
D 4 HOH 104 260 106 HOH HOH A . 
D 4 HOH 105 261 107 HOH HOH A . 
D 4 HOH 106 262 108 HOH HOH A . 
D 4 HOH 107 263 109 HOH HOH A . 
D 4 HOH 108 264 110 HOH HOH A . 
D 4 HOH 109 265 111 HOH HOH A . 
D 4 HOH 110 266 112 HOH HOH A . 
D 4 HOH 111 267 113 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-19 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2013-08-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1  ? refined 17.6518  20.6239 1.4952  0.0926 0.1611 0.0913 -0.0282 0.0360  -0.0150 10.8834 20.0849 10.3085 4.8186  5.0766   2.7890 
-0.2381 0.1666  0.4466  -0.5283 0.1752  -0.5141 -0.2783 0.9411  0.0629  'X-RAY DIFFRACTION' 
2  ? refined 11.1141  24.7544 -8.8252 0.2692 0.2516 0.0842 -0.1490 0.0222  0.0721  0.0843  22.9050 42.5646 -0.9311 -0.2548  
25.7850  0.4448  -0.5650 -0.0974 -0.5117 0.0572  0.3566  0.4386  -1.4981 -0.5021 'X-RAY DIFFRACTION' 
3  ? refined 13.5607  28.8353 6.4349  0.0782 0.1633 0.0447 -0.0559 0.0075  -0.0256 2.4759  5.8363  45.5637 -0.7768 -10.5526 1.4991 
-0.0735 -0.5304 0.1068  0.1088  0.0682  -0.3046 -0.7380 2.0011  0.0053  'X-RAY DIFFRACTION' 
4  ? refined 4.5686   25.9855 21.9430 0.1202 0.0672 0.0688 0.0041  0.0255  0.0026  6.6391  3.8924  5.3350  4.1731  -1.5748  0.2104 
0.1124  -0.1613 0.0114  0.2714  -0.1621 0.2008  -0.0782 -0.2831 0.0497  'X-RAY DIFFRACTION' 
5  ? refined 4.9038   16.0470 21.9967 0.0956 0.0861 0.1005 -0.0064 0.0175  0.0288  2.4620  8.9851  14.8531 2.3300  -1.5930  3.7814 
0.1743  -0.3265 -0.2672 0.7642  -0.0509 0.5655  0.6815  -0.4741 -0.1234 'X-RAY DIFFRACTION' 
6  ? refined 3.4514   19.5049 2.3972  0.0755 0.0778 0.0499 -0.0092 0.0122  -0.0163 6.3069  2.2492  5.7151  0.9098  3.6968   
-2.2081  -0.1526 -0.1088 0.2353  -0.0558 0.1164  0.0148  -0.3101 -0.2740 0.0363  'X-RAY DIFFRACTION' 
7  ? refined 0.7756   16.0048 -2.2438 0.1560 0.0750 0.0903 -0.0095 -0.0074 -0.0084 27.3817 5.0612  6.6241  2.8774  -0.0722  1.3568 
0.0672  0.1404  -0.0175 0.0197  -0.2122 0.0095  -0.0944 -0.1043 0.1450  'X-RAY DIFFRACTION' 
8  ? refined 11.9154  16.6443 16.8751 0.0642 0.1293 0.1041 0.0099  -0.0225 -0.0021 1.3931  1.6272  17.7780 0.5215  1.5441   0.6503 
0.1629  -0.0371 -0.0760 0.2599  0.0555  -0.0807 0.4004  0.6305  -0.2184 'X-RAY DIFFRACTION' 
9  ? refined 11.7614  23.8230 17.4581 0.1059 0.0767 0.0891 -0.0064 -0.0115 -0.0168 1.7122  0.7938  4.8933  0.4567  -0.8215  0.9355 
0.0756  -0.1829 0.1210  0.1528  0.0620  -0.2020 -0.3291 0.3729  -0.1376 'X-RAY DIFFRACTION' 
10 ? refined 5.0593   24.2858 -1.2726 0.1588 0.0818 0.0815 -0.0168 -0.0153 0.0019  4.5857  4.5328  6.9576  2.4365  -2.6910  
-1.3217  -0.1325 0.4627  0.1490  -0.4721 0.2084  0.2229  -0.2660 -0.2127 -0.0760 'X-RAY DIFFRACTION' 
11 ? refined 4.0030   15.5695 17.8038 0.0908 0.1205 0.1527 -0.0253 0.0141  -0.0116 1.8757  15.2594 12.9261 -0.0789 0.9060   
-9.6812  0.1060  -0.1358 -0.2819 0.2282  -0.0119 0.0769  0.1022  0.0281  -0.0941 'X-RAY DIFFRACTION' 
12 ? refined 3.5785   5.9023  21.9199 0.1191 0.1151 0.1253 -0.0063 -0.0156 0.0480  7.8495  20.9700 9.3068  5.5052  -2.5854  
-2.9342  0.0143  -0.2324 -0.5311 0.8846  -0.1083 -0.5201 0.0411  0.2527  0.0940  'X-RAY DIFFRACTION' 
13 ? refined -1.6363  20.2884 14.3487 0.0600 0.0861 0.0996 0.0032  -0.0032 -0.0211 5.7320  23.0061 20.8512 -3.4831 4.4497   
-16.4624 -0.2134 -0.0016 -0.3478 -0.3060 0.2652  0.0642  -0.0663 -0.9710 -0.0518 'X-RAY DIFFRACTION' 
14 ? refined 4.1276   32.5505 1.8299  0.2740 0.0922 0.0940 0.0232  -0.0462 0.0464  10.4339 8.7270  1.6859  3.2715  -1.7562  2.7216 
-0.0601 0.1378  0.6380  -0.2092 -0.0654 0.6496  -0.5148 -0.2203 0.1255  'X-RAY DIFFRACTION' 
15 ? refined 14.6238  38.4627 9.8472  0.1736 0.1298 0.0810 -0.0252 -0.0385 0.0013  28.6243 25.3249 9.7243  7.9522  -2.8821  
13.9667  1.1632  0.9400  1.7405  0.7731  0.9466  -0.6877 0.2149  -0.0482 -2.1098 'X-RAY DIFFRACTION' 
16 ? refined -1.7409  26.7389 15.0087 0.1434 0.1337 0.1040 0.0595  -0.0087 -0.0099 11.1224 10.5571 6.2732  5.8380  -0.9468  0.9633 
0.0378  -0.1459 0.0620  -0.3612 -0.1946 0.4280  -0.1086 -0.2513 0.1568  'X-RAY DIFFRACTION' 
17 ? refined -10.4103 20.5877 19.0691 0.0599 0.2505 0.1371 -0.0173 -0.0093 -0.0223 43.4014 11.5159 3.3870  20.4727 12.1047  5.8525 
-0.1582 -0.0645 0.2370  -0.0963 0.1036  0.9372  -0.1946 -0.1826 0.0545  'X-RAY DIFFRACTION' 
18 ? refined 5.4340   30.3624 16.3059 0.1597 0.1025 0.0912 -0.0212 -0.0051 -0.0245 11.2850 6.5664  5.5941  -2.6766 2.4411   2.5353 
0.0777  0.2041  0.2867  -0.1116 -0.0945 0.0972  -0.5932 0.2677  0.0168  'X-RAY DIFFRACTION' 
19 ? refined 12.3729  32.8644 1.9698  0.2256 0.0954 0.1143 -0.0850 0.0392  0.0000  3.8478  13.0228 14.1839 1.0200  -2.8383  
-0.0904  0.0978  0.1909  0.0008  -0.6679 0.0536  -0.6312 -1.0044 0.5591  -0.1514 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1  A 6   A 7   A 13  A 14  ? 'X-RAY DIFFRACTION' ? 
2  2  A 14  A 15  A 20  A 21  ? 'X-RAY DIFFRACTION' ? 
3  3  A 21  A 22  A 25  A 26  ? 'X-RAY DIFFRACTION' ? 
4  4  A 26  A 27  A 33  A 34  ? 'X-RAY DIFFRACTION' ? 
5  5  A 34  A 35  A 46  A 47  ? 'X-RAY DIFFRACTION' ? 
6  6  A 47  A 48  A 52  A 53  ? 'X-RAY DIFFRACTION' ? 
7  7  A 53  A 54  A 58  A 59  ? 'X-RAY DIFFRACTION' ? 
8  8  A 59  A 60  A 67  A 68  ? 'X-RAY DIFFRACTION' ? 
9  9  A 68  A 69  A 80  A 81  ? 'X-RAY DIFFRACTION' ? 
10 10 A 81  A 82  A 90  A 91  ? 'X-RAY DIFFRACTION' ? 
11 11 A 91  A 92  A 97  A 98  ? 'X-RAY DIFFRACTION' ? 
12 12 A 98  A 99  A 103 A 104 ? 'X-RAY DIFFRACTION' ? 
13 13 A 104 A 105 A 109 A 110 ? 'X-RAY DIFFRACTION' ? 
14 14 A 110 A 111 A 118 A 119 ? 'X-RAY DIFFRACTION' ? 
15 15 A 119 A 120 A 127 A 128 ? 'X-RAY DIFFRACTION' ? 
16 16 A 128 A 129 A 137 A 138 ? 'X-RAY DIFFRACTION' ? 
17 17 A 138 A 139 A 144 A 145 ? 'X-RAY DIFFRACTION' ? 
18 18 A 145 A 146 A 149 A 150 ? 'X-RAY DIFFRACTION' ? 
19 19 A 150 A 151 A 154 A 155 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.2.0019 ? 1 
HKL-2000 'data reduction' .        ? 2 
HKL-2000 'data scaling'   .        ? 3 
PHASER   phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 53 ? ? 75.26   -53.20 
2 1 ALA A 59 ? ? -170.15 139.47 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 16  ? CD  ? A GLU 17  CD  
2  1 Y 1 A GLU 16  ? OE1 ? A GLU 17  OE1 
3  1 Y 1 A GLU 16  ? OE2 ? A GLU 17  OE2 
4  1 Y 1 A LYS 34  ? CE  ? A LYS 35  CE  
5  1 Y 1 A LYS 34  ? NZ  ? A LYS 35  NZ  
6  1 Y 1 A LYS 35  ? CG  ? A LYS 36  CG  
7  1 Y 1 A LYS 35  ? CD  ? A LYS 36  CD  
8  1 Y 1 A LYS 35  ? CE  ? A LYS 36  CE  
9  1 Y 1 A LYS 35  ? NZ  ? A LYS 36  NZ  
10 1 Y 1 A LYS 68  ? CD  ? A LYS 69  CD  
11 1 Y 1 A LYS 68  ? CE  ? A LYS 69  CE  
12 1 Y 1 A LYS 68  ? NZ  ? A LYS 69  NZ  
13 1 Y 1 A LYS 129 ? CD  ? A LYS 130 CD  
14 1 Y 1 A LYS 129 ? CE  ? A LYS 130 CE  
15 1 Y 1 A LYS 129 ? NZ  ? A LYS 130 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 0   ? A GLY 1   
2  1 Y 1 A MET 1   ? A MET 2   
3  1 Y 1 A ALA 2   ? A ALA 3   
4  1 Y 1 A THR 3   ? A THR 4   
5  1 Y 1 A GLY 4   ? A GLY 5   
6  1 Y 1 A LEU 5   ? A LEU 6   
7  1 Y 1 A ASP 36  ? A ASP 37  
8  1 Y 1 A ILE 37  ? A ILE 38  
9  1 Y 1 A PHE 38  ? A PHE 39  
10 1 Y 1 A GLY 39  ? A GLY 40  
11 1 Y 1 A THR 121 ? A THR 122 
12 1 Y 1 A MET 122 ? A MET 123 
13 1 Y 1 A GLU 123 ? A GLU 124 
14 1 Y 1 A ARG 124 ? A ARG 125 
15 1 Y 1 A PRO 125 ? A PRO 126 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-ETHANEDIOL EDO 
3 GLYCEROL       GOL 
4 water          HOH 
#