data_2NUN
# 
_entry.id   2NUN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NUN         
RCSB  RCSB040321   
WWPDB D_1000040321 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1NH1 'Crystal Structure of the Type III Effector AvrB from Pseudomonas syringae'                   unspecified 
PDB 2NUD 'Crystal Structure of the Type III Effector AvrB complexed with a high-affinity RIN4 peptide' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2NUN 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Singer, A.U.' 1 
'Desveaux, D.' 2 
'Wu, A.J.'     3 
'McNulty, B.'  4 
'Dangl, J.L.'  5 
'Sondek, J.'   6 
# 
_citation.id                        primary 
_citation.title                     
'Type III Effector Activation via Nucleotide Binding, Phosphorylation, and Host Target Interaction.' 
_citation.journal_abbrev            'Plos Pathog.' 
_citation.journal_volume            3 
_citation.page_first                e48 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1553-7366 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17397263 
_citation.pdbx_database_id_DOI      10.1371/journal.ppat.0030048 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Desveaux, D.'    1 
primary 'Singer, A.U.'    2 
primary 'Wu, A.J.'        3 
primary 'McNulty, B.C.'   4 
primary 'Musselwhite, L.' 5 
primary 'Nimchuk, Z.'     6 
primary 'Sondek, J.'      7 
primary 'Dangl, J.L.'     8 
# 
_cell.entry_id           2NUN 
_cell.length_a           122.717 
_cell.length_b           122.717 
_cell.length_c           64.091 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2NUN 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Avirulence B protein'                   36181.262 1  ? ? ? ? 
2 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"               427.201   1  ? ? ? ? 
3 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143   1  ? ? ? ? 
4 water       nat water                                    18.015    86 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMGCVSSKSTTVLSPQTSFNEASRTSFRALPGPSQRQLEVYDQCLIGAARWPDDSSKSNTPENRAYCQSMYNSIRSAGD
EISRGGITSFEELWGRATEWRLSKLQRGEPLYSAFASERTSDTDAVTPLVKPYKSVLARVVDHEDAHDEIMQDNLFGDLN
VKVYRQTAYLHGNVIPLNTFRVATDTEYLRDRVAHLRTELGAKALKQHLQRYNPDRIDHTNASYLPIIKDHLNDLYRQAI
SSDLSQAELISLIARTHWWAASAMPDQRGSAAKAEFAARAIASAHGIELPPFRNGNVSDIEAMLSGEEEFVEKYRSLLDS
DCF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMGCVSSKSTTVLSPQTSFNEASRTSFRALPGPSQRQLEVYDQCLIGAARWPDDSSKSNTPENRAYCQSMYNSIRSAGD
EISRGGITSFEELWGRATEWRLSKLQRGEPLYSAFASERTSDTDAVTPLVKPYKSVLARVVDHEDAHDEIMQDNLFGDLN
VKVYRQTAYLHGNVIPLNTFRVATDTEYLRDRVAHLRTELGAKALKQHLQRYNPDRIDHTNASYLPIIKDHLNDLYRQAI
SSDLSQAELISLIARTHWWAASAMPDQRGSAAKAEFAARAIASAHGIELPPFRNGNVSDIEAMLSGEEEFVEKYRSLLDS
DCF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   CYS n 
1 6   VAL n 
1 7   SER n 
1 8   SER n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  THR n 
1 13  VAL n 
1 14  LEU n 
1 15  SER n 
1 16  PRO n 
1 17  GLN n 
1 18  THR n 
1 19  SER n 
1 20  PHE n 
1 21  ASN n 
1 22  GLU n 
1 23  ALA n 
1 24  SER n 
1 25  ARG n 
1 26  THR n 
1 27  SER n 
1 28  PHE n 
1 29  ARG n 
1 30  ALA n 
1 31  LEU n 
1 32  PRO n 
1 33  GLY n 
1 34  PRO n 
1 35  SER n 
1 36  GLN n 
1 37  ARG n 
1 38  GLN n 
1 39  LEU n 
1 40  GLU n 
1 41  VAL n 
1 42  TYR n 
1 43  ASP n 
1 44  GLN n 
1 45  CYS n 
1 46  LEU n 
1 47  ILE n 
1 48  GLY n 
1 49  ALA n 
1 50  ALA n 
1 51  ARG n 
1 52  TRP n 
1 53  PRO n 
1 54  ASP n 
1 55  ASP n 
1 56  SER n 
1 57  SER n 
1 58  LYS n 
1 59  SER n 
1 60  ASN n 
1 61  THR n 
1 62  PRO n 
1 63  GLU n 
1 64  ASN n 
1 65  ARG n 
1 66  ALA n 
1 67  TYR n 
1 68  CYS n 
1 69  GLN n 
1 70  SER n 
1 71  MET n 
1 72  TYR n 
1 73  ASN n 
1 74  SER n 
1 75  ILE n 
1 76  ARG n 
1 77  SER n 
1 78  ALA n 
1 79  GLY n 
1 80  ASP n 
1 81  GLU n 
1 82  ILE n 
1 83  SER n 
1 84  ARG n 
1 85  GLY n 
1 86  GLY n 
1 87  ILE n 
1 88  THR n 
1 89  SER n 
1 90  PHE n 
1 91  GLU n 
1 92  GLU n 
1 93  LEU n 
1 94  TRP n 
1 95  GLY n 
1 96  ARG n 
1 97  ALA n 
1 98  THR n 
1 99  GLU n 
1 100 TRP n 
1 101 ARG n 
1 102 LEU n 
1 103 SER n 
1 104 LYS n 
1 105 LEU n 
1 106 GLN n 
1 107 ARG n 
1 108 GLY n 
1 109 GLU n 
1 110 PRO n 
1 111 LEU n 
1 112 TYR n 
1 113 SER n 
1 114 ALA n 
1 115 PHE n 
1 116 ALA n 
1 117 SER n 
1 118 GLU n 
1 119 ARG n 
1 120 THR n 
1 121 SER n 
1 122 ASP n 
1 123 THR n 
1 124 ASP n 
1 125 ALA n 
1 126 VAL n 
1 127 THR n 
1 128 PRO n 
1 129 LEU n 
1 130 VAL n 
1 131 LYS n 
1 132 PRO n 
1 133 TYR n 
1 134 LYS n 
1 135 SER n 
1 136 VAL n 
1 137 LEU n 
1 138 ALA n 
1 139 ARG n 
1 140 VAL n 
1 141 VAL n 
1 142 ASP n 
1 143 HIS n 
1 144 GLU n 
1 145 ASP n 
1 146 ALA n 
1 147 HIS n 
1 148 ASP n 
1 149 GLU n 
1 150 ILE n 
1 151 MET n 
1 152 GLN n 
1 153 ASP n 
1 154 ASN n 
1 155 LEU n 
1 156 PHE n 
1 157 GLY n 
1 158 ASP n 
1 159 LEU n 
1 160 ASN n 
1 161 VAL n 
1 162 LYS n 
1 163 VAL n 
1 164 TYR n 
1 165 ARG n 
1 166 GLN n 
1 167 THR n 
1 168 ALA n 
1 169 TYR n 
1 170 LEU n 
1 171 HIS n 
1 172 GLY n 
1 173 ASN n 
1 174 VAL n 
1 175 ILE n 
1 176 PRO n 
1 177 LEU n 
1 178 ASN n 
1 179 THR n 
1 180 PHE n 
1 181 ARG n 
1 182 VAL n 
1 183 ALA n 
1 184 THR n 
1 185 ASP n 
1 186 THR n 
1 187 GLU n 
1 188 TYR n 
1 189 LEU n 
1 190 ARG n 
1 191 ASP n 
1 192 ARG n 
1 193 VAL n 
1 194 ALA n 
1 195 HIS n 
1 196 LEU n 
1 197 ARG n 
1 198 THR n 
1 199 GLU n 
1 200 LEU n 
1 201 GLY n 
1 202 ALA n 
1 203 LYS n 
1 204 ALA n 
1 205 LEU n 
1 206 LYS n 
1 207 GLN n 
1 208 HIS n 
1 209 LEU n 
1 210 GLN n 
1 211 ARG n 
1 212 TYR n 
1 213 ASN n 
1 214 PRO n 
1 215 ASP n 
1 216 ARG n 
1 217 ILE n 
1 218 ASP n 
1 219 HIS n 
1 220 THR n 
1 221 ASN n 
1 222 ALA n 
1 223 SER n 
1 224 TYR n 
1 225 LEU n 
1 226 PRO n 
1 227 ILE n 
1 228 ILE n 
1 229 LYS n 
1 230 ASP n 
1 231 HIS n 
1 232 LEU n 
1 233 ASN n 
1 234 ASP n 
1 235 LEU n 
1 236 TYR n 
1 237 ARG n 
1 238 GLN n 
1 239 ALA n 
1 240 ILE n 
1 241 SER n 
1 242 SER n 
1 243 ASP n 
1 244 LEU n 
1 245 SER n 
1 246 GLN n 
1 247 ALA n 
1 248 GLU n 
1 249 LEU n 
1 250 ILE n 
1 251 SER n 
1 252 LEU n 
1 253 ILE n 
1 254 ALA n 
1 255 ARG n 
1 256 THR n 
1 257 HIS n 
1 258 TRP n 
1 259 TRP n 
1 260 ALA n 
1 261 ALA n 
1 262 SER n 
1 263 ALA n 
1 264 MET n 
1 265 PRO n 
1 266 ASP n 
1 267 GLN n 
1 268 ARG n 
1 269 GLY n 
1 270 SER n 
1 271 ALA n 
1 272 ALA n 
1 273 LYS n 
1 274 ALA n 
1 275 GLU n 
1 276 PHE n 
1 277 ALA n 
1 278 ALA n 
1 279 ARG n 
1 280 ALA n 
1 281 ILE n 
1 282 ALA n 
1 283 SER n 
1 284 ALA n 
1 285 HIS n 
1 286 GLY n 
1 287 ILE n 
1 288 GLU n 
1 289 LEU n 
1 290 PRO n 
1 291 PRO n 
1 292 PHE n 
1 293 ARG n 
1 294 ASN n 
1 295 GLY n 
1 296 ASN n 
1 297 VAL n 
1 298 SER n 
1 299 ASP n 
1 300 ILE n 
1 301 GLU n 
1 302 ALA n 
1 303 MET n 
1 304 LEU n 
1 305 SER n 
1 306 GLY n 
1 307 GLU n 
1 308 GLU n 
1 309 GLU n 
1 310 PHE n 
1 311 VAL n 
1 312 GLU n 
1 313 LYS n 
1 314 TYR n 
1 315 ARG n 
1 316 SER n 
1 317 LEU n 
1 318 LEU n 
1 319 ASP n 
1 320 SER n 
1 321 ASP n 
1 322 CYS n 
1 323 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pseudomonas 
_entity_src_gen.pdbx_gene_src_gene                 avrB 
_entity_src_gen.gene_src_species                   'Pseudomonas savastanoi' 
_entity_src_gen.gene_src_strain                    'pv glycinea' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas syringae pv. glycinea' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     318 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) Rosetta' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pProEX-HTa 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AVRB_PSESG 
_struct_ref.pdbx_db_accession          P13835 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MGCVSSKSTTVLSPQTSFNEASRTSFRALPGPSQRQLEVYDQCLIGAARWPDDSSKSNTPENRAYCQSMYNSIRSAGDEI
SRGGITSFEELWGRATEWRLSKLQRGEPLYSAFASERTSDTDAVTPLVKPYKSVLARVVDHEDAHDEIMQDNLFGDLNVK
VYRQTAYLHGNVIPLNTFRVATDTEYLRDRVAHLRTELGAKALKQHLQRYNPDRIDHTNASYLPIIKDHLNDLYRQAISS
DLSQAELISLIARTHWWAASAMPDQRGSAAKAEFAARAIASAHGIELPPFRNGNVSDIEAMLSGEEEFVEKYRSLLDSDC
F
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2NUN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 323 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P13835 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  321 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       321 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2NUN GLY A 1 ? UNP P13835 ? ? 'CLONING ARTIFACT' -1 1 
1 2NUN ALA A 2 ? UNP P13835 ? ? 'CLONING ARTIFACT' 0  2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"               ?             'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                                  ?             'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                 ?             'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?             'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?             'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?             'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                ?             'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?             'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                  ?             'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?             'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                    ?             'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?             'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?             'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                   ?             'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                               ?             'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?             'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                  ?             'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                   ?             'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                ?             'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?             'C11 H12 N2 O2'     204.225 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1'     122.143 
TYR 'L-peptide linking' y TYROSINE                                 ?             'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                   ?             'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2NUN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.85 
_exptl_crystal.density_percent_sol   68.04 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_details    
;Protein (8-10 mg/ml) was mixed with well solution (100 mM Glycine, pH 9.0, 20-30% PEG 550 MME)at a 1:1 ratio.  Microseeding was employed to obtain better crystals.  Nucleotides were incorporated by exchanging drop and resevoir solutions with 20    l 27% PEG 500 MME and 100 mM Tris 7.5 plus 5 mM MgCl2, followed by a final exchange of this solution plus 5 mM nucleotide.  Nucleotides were soaked for ~ 1 day. , VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2005-10-30 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2NUN 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            2.15 
_reflns.number_obs                   24091 
_reflns.number_all                   29955 
_reflns.percent_possible_obs         80.4 
_reflns.pdbx_Rmerge_I_obs            0.093 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        28.0 
_reflns.B_iso_Wilson_estimate        45.1 
_reflns.pdbx_redundancy              4.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_all   32. 
_reflns_shell.Rmerge_I_obs           0.318 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.63 
_reflns_shell.pdbx_redundancy        3.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      943 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2NUN 
_refine.ls_number_reflns_obs                     20678 
_refine.ls_number_reflns_all                     21650 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.5 
_refine.pdbx_data_cutoff_high_absF               1928271.38 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    95.2 
_refine.ls_R_factor_obs                          0.232 
_refine.ls_R_factor_all                          0.233 
_refine.ls_R_factor_R_work                       0.232 
_refine.ls_R_factor_R_free                       0.254 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  999 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               52.8 
_refine.aniso_B[1][1]                            7.69 
_refine.aniso_B[2][2]                            7.69 
_refine.aniso_B[3][3]                            -15.38 
_refine.aniso_B[1][2]                            6.67 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.30493 
_refine.solvent_model_param_bsol                 32.5504 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1NH1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2NUN 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.34 
_refine_analyze.Luzzati_d_res_low_obs           4.00 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            0.30 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2389 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             86 
_refine_hist.number_atoms_total               2510 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.81  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.04  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.89  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.27  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.05  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             2664 
_refine_ls_shell.R_factor_R_work                  0.301 
_refine_ls_shell.percent_reflns_obs               78.0 
_refine_ls_shell.R_factor_R_free                  0.279 
_refine_ls_shell.R_factor_R_free_error            0.024 
_refine_ls_shell.percent_reflns_R_free            4.7 
_refine_ls_shell.number_reflns_R_free             130 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top       'X-RAY DIFFRACTION' 
2 water_rep.param   water.top         'X-RAY DIFFRACTION' 
3 ion.param         ion.top           'X-RAY DIFFRACTION' 
4 adp_xplor_par.txt adp_xplor_top.txt 'X-RAY DIFFRACTION' 
5 tmn_xplor_par.txt tmn_xplor_top.txt 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NUN 
_struct.title                     'The structure of the type III effector AvrB complexed with ADP' 
_struct.pdbx_descriptor           'Avirulence B protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NUN 
_struct_keywords.pdbx_keywords   'TOXIN/PROTEIN BINDING' 
_struct_keywords.text            'type III effector, AvrB, nuclotide, pocket, ADP, TOXIN-PROTEIN BINDING COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'only one molecule in the asymmetric unit and the biological assembly' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 40  ? CYS A 45  ? GLU A 38  CYS A 43  1 ? 6  
HELX_P HELX_P2  2  THR A 61  ? ARG A 84  ? THR A 59  ARG A 82  1 ? 24 
HELX_P HELX_P3  3  SER A 89  ? SER A 103 ? SER A 87  SER A 101 1 ? 15 
HELX_P HELX_P4  4  LEU A 111 ? SER A 117 ? LEU A 109 SER A 115 1 ? 7  
HELX_P HELX_P5  5  SER A 135 ? ASP A 142 ? SER A 133 ASP A 140 1 ? 8  
HELX_P HELX_P6  6  ASP A 185 ? LEU A 200 ? ASP A 183 LEU A 198 1 ? 16 
HELX_P HELX_P7  7  LEU A 200 ? ASN A 213 ? LEU A 198 ASN A 211 1 ? 14 
HELX_P HELX_P8  8  ASN A 221 ? SER A 223 ? ASN A 219 SER A 221 5 ? 3  
HELX_P HELX_P9  9  TYR A 224 ? ILE A 240 ? TYR A 222 ILE A 238 1 ? 17 
HELX_P HELX_P10 10 SER A 245 ? MET A 264 ? SER A 243 MET A 262 1 ? 20 
HELX_P HELX_P11 11 GLY A 269 ? HIS A 285 ? GLY A 267 HIS A 283 1 ? 17 
HELX_P HELX_P12 12 VAL A 297 ? LEU A 304 ? VAL A 295 LEU A 302 1 ? 8  
HELX_P HELX_P13 13 GLY A 306 ? LEU A 318 ? GLY A 304 LEU A 316 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           131 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            129 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    132 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     130 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 19  ? ASN A 21  ? SER A 17  ASN A 19  
A 2 THR A 26  ? PHE A 28  ? THR A 24  PHE A 26  
B 1 VAL A 126 ? PRO A 128 ? VAL A 124 PRO A 126 
B 2 ARG A 216 ? ASP A 218 ? ARG A 214 ASP A 216 
B 3 ASN A 173 ? ALA A 183 ? ASN A 171 ALA A 181 
B 4 GLY A 157 ? LEU A 170 ? GLY A 155 LEU A 168 
B 5 HIS A 147 ? ASP A 153 ? HIS A 145 ASP A 151 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 19  ? N SER A 17  O PHE A 28  ? O PHE A 26  
B 1 2 N THR A 127 ? N THR A 125 O ILE A 217 ? O ILE A 215 
B 2 3 O ASP A 218 ? O ASP A 216 N THR A 179 ? N THR A 177 
B 3 4 O ASN A 173 ? O ASN A 171 N LEU A 170 ? N LEU A 168 
B 4 5 O LEU A 159 ? O LEU A 157 N MET A 151 ? N MET A 149 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ADP A 600'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE TRS A 1503' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 GLY A 48  ? GLY A 46   . ? 1_555 ? 
2  AC1 14 ASN A 64  ? ASN A 62   . ? 1_555 ? 
3  AC1 14 TYR A 67  ? TYR A 65   . ? 1_555 ? 
4  AC1 14 ARG A 101 ? ARG A 99   . ? 1_555 ? 
5  AC1 14 ARG A 268 ? ARG A 266  . ? 1_555 ? 
6  AC1 14 GLY A 269 ? GLY A 267  . ? 1_555 ? 
7  AC1 14 SER A 270 ? SER A 268  . ? 1_555 ? 
8  AC1 14 ALA A 271 ? ALA A 269  . ? 1_555 ? 
9  AC1 14 ALA A 272 ? ALA A 270  . ? 1_555 ? 
10 AC1 14 HOH D .   ? HOH A 1081 . ? 1_555 ? 
11 AC1 14 HOH D .   ? HOH A 1082 . ? 1_555 ? 
12 AC1 14 HOH D .   ? HOH A 1083 . ? 1_555 ? 
13 AC1 14 HOH D .   ? HOH A 1084 . ? 1_555 ? 
14 AC1 14 TRS C .   ? TRS A 1503 . ? 1_555 ? 
15 AC2 5  THR A 127 ? THR A 125  . ? 1_555 ? 
16 AC2 5  TYR A 133 ? TYR A 131  . ? 1_555 ? 
17 AC2 5  ASP A 299 ? ASP A 297  . ? 1_555 ? 
18 AC2 5  ADP B .   ? ADP A 600  . ? 1_555 ? 
19 AC2 5  HOH D .   ? HOH A 1069 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2NUN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2NUN 
_atom_sites.fract_transf_matrix[1][1]   0.008149 
_atom_sites.fract_transf_matrix[1][2]   0.004705 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009409 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015603 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . THR A 1 18  ? -99.776  73.678 4.643   1.00 73.67 ? 16   THR A N     1 
ATOM   2    C CA    . THR A 1 18  ? -99.639  74.887 3.778   1.00 73.76 ? 16   THR A CA    1 
ATOM   3    C C     . THR A 1 18  ? -100.553 74.798 2.552   1.00 73.43 ? 16   THR A C     1 
ATOM   4    O O     . THR A 1 18  ? -101.490 75.586 2.410   1.00 73.52 ? 16   THR A O     1 
ATOM   5    C CB    . THR A 1 18  ? -98.184  75.049 3.341   1.00 73.98 ? 16   THR A CB    1 
ATOM   6    N N     . SER A 1 19  ? -100.272 73.845 1.667   1.00 72.56 ? 17   SER A N     1 
ATOM   7    C CA    . SER A 1 19  ? -101.083 73.653 0.465   1.00 72.10 ? 17   SER A CA    1 
ATOM   8    C C     . SER A 1 19  ? -102.049 72.493 0.681   1.00 71.50 ? 17   SER A C     1 
ATOM   9    O O     . SER A 1 19  ? -102.015 71.829 1.719   1.00 71.23 ? 17   SER A O     1 
ATOM   10   C CB    . SER A 1 19  ? -100.196 73.346 -0.746  1.00 72.25 ? 17   SER A CB    1 
ATOM   11   O OG    . SER A 1 19  ? -99.333  74.429 -1.049  1.00 73.28 ? 17   SER A OG    1 
ATOM   12   N N     . PHE A 1 20  ? -102.916 72.255 -0.296  1.00 70.74 ? 18   PHE A N     1 
ATOM   13   C CA    . PHE A 1 20  ? -103.863 71.155 -0.197  1.00 70.34 ? 18   PHE A CA    1 
ATOM   14   C C     . PHE A 1 20  ? -103.943 70.405 -1.523  1.00 69.75 ? 18   PHE A C     1 
ATOM   15   O O     . PHE A 1 20  ? -104.107 71.012 -2.580  1.00 70.14 ? 18   PHE A O     1 
ATOM   16   C CB    . PHE A 1 20  ? -105.254 71.670 0.197   1.00 70.17 ? 18   PHE A CB    1 
ATOM   17   C CG    . PHE A 1 20  ? -106.209 70.581 0.615   1.00 69.93 ? 18   PHE A CG    1 
ATOM   18   C CD1   . PHE A 1 20  ? -105.958 69.814 1.750   1.00 69.51 ? 18   PHE A CD1   1 
ATOM   19   C CD2   . PHE A 1 20  ? -107.347 70.309 -0.134  1.00 69.92 ? 18   PHE A CD2   1 
ATOM   20   C CE1   . PHE A 1 20  ? -106.826 68.791 2.132   1.00 69.55 ? 18   PHE A CE1   1 
ATOM   21   C CE2   . PHE A 1 20  ? -108.225 69.287 0.237   1.00 70.02 ? 18   PHE A CE2   1 
ATOM   22   C CZ    . PHE A 1 20  ? -107.962 68.526 1.374   1.00 69.71 ? 18   PHE A CZ    1 
ATOM   23   N N     . ASN A 1 21  ? -103.805 69.084 -1.459  1.00 69.19 ? 19   ASN A N     1 
ATOM   24   C CA    . ASN A 1 21  ? -103.878 68.240 -2.645  1.00 68.74 ? 19   ASN A CA    1 
ATOM   25   C C     . ASN A 1 21  ? -105.277 67.630 -2.670  1.00 69.32 ? 19   ASN A C     1 
ATOM   26   O O     . ASN A 1 21  ? -105.614 66.800 -1.822  1.00 69.35 ? 19   ASN A O     1 
ATOM   27   C CB    . ASN A 1 21  ? -102.814 67.137 -2.577  1.00 67.10 ? 19   ASN A CB    1 
ATOM   28   C CG    . ASN A 1 21  ? -102.753 66.301 -3.845  1.00 66.04 ? 19   ASN A CG    1 
ATOM   29   O OD1   . ASN A 1 21  ? -103.701 65.597 -4.186  1.00 64.97 ? 19   ASN A OD1   1 
ATOM   30   N ND2   . ASN A 1 21  ? -101.631 66.378 -4.551  1.00 65.50 ? 19   ASN A ND2   1 
ATOM   31   N N     . GLU A 1 22  ? -106.090 68.056 -3.635  1.00 70.09 ? 20   GLU A N     1 
ATOM   32   C CA    . GLU A 1 22  ? -107.465 67.572 -3.766  1.00 70.83 ? 20   GLU A CA    1 
ATOM   33   C C     . GLU A 1 22  ? -107.563 66.070 -4.016  1.00 70.58 ? 20   GLU A C     1 
ATOM   34   O O     . GLU A 1 22  ? -108.381 65.385 -3.405  1.00 70.04 ? 20   GLU A O     1 
ATOM   35   C CB    . GLU A 1 22  ? -108.175 68.301 -4.907  1.00 71.76 ? 20   GLU A CB    1 
ATOM   36   C CG    . GLU A 1 22  ? -108.202 69.808 -4.787  1.00 73.93 ? 20   GLU A CG    1 
ATOM   37   C CD    . GLU A 1 22  ? -108.742 70.279 -3.453  1.00 75.18 ? 20   GLU A CD    1 
ATOM   38   O OE1   . GLU A 1 22  ? -109.887 69.917 -3.102  1.00 75.49 ? 20   GLU A OE1   1 
ATOM   39   O OE2   . GLU A 1 22  ? -108.012 71.016 -2.755  1.00 76.43 ? 20   GLU A OE2   1 
ATOM   40   N N     . ALA A 1 23  ? -106.725 65.578 -4.925  1.00 70.56 ? 21   ALA A N     1 
ATOM   41   C CA    . ALA A 1 23  ? -106.686 64.168 -5.311  1.00 70.49 ? 21   ALA A CA    1 
ATOM   42   C C     . ALA A 1 23  ? -106.510 63.180 -4.154  1.00 70.27 ? 21   ALA A C     1 
ATOM   43   O O     . ALA A 1 23  ? -107.178 62.146 -4.109  1.00 69.34 ? 21   ALA A O     1 
ATOM   44   C CB    . ALA A 1 23  ? -105.580 63.953 -6.350  1.00 69.75 ? 21   ALA A CB    1 
ATOM   45   N N     . SER A 1 24  ? -105.606 63.488 -3.228  1.00 70.81 ? 22   SER A N     1 
ATOM   46   C CA    . SER A 1 24  ? -105.361 62.602 -2.093  1.00 71.49 ? 22   SER A CA    1 
ATOM   47   C C     . SER A 1 24  ? -105.962 63.134 -0.791  1.00 71.68 ? 22   SER A C     1 
ATOM   48   O O     . SER A 1 24  ? -105.911 62.462 0.241   1.00 71.41 ? 22   SER A O     1 
ATOM   49   C CB    . SER A 1 24  ? -103.851 62.355 -1.926  1.00 71.62 ? 22   SER A CB    1 
ATOM   50   O OG    . SER A 1 24  ? -103.130 63.562 -1.751  1.00 71.48 ? 22   SER A OG    1 
ATOM   51   N N     . ARG A 1 25  ? -106.534 64.337 -0.854  1.00 72.27 ? 23   ARG A N     1 
ATOM   52   C CA    . ARG A 1 25  ? -107.167 64.976 0.303   1.00 72.89 ? 23   ARG A CA    1 
ATOM   53   C C     . ARG A 1 25  ? -106.175 65.188 1.445   1.00 72.84 ? 23   ARG A C     1 
ATOM   54   O O     . ARG A 1 25  ? -106.508 64.980 2.615   1.00 72.78 ? 23   ARG A O     1 
ATOM   55   C CB    . ARG A 1 25  ? -108.340 64.122 0.807   1.00 73.59 ? 23   ARG A CB    1 
ATOM   56   C CG    . ARG A 1 25  ? -109.449 63.872 -0.208  1.00 74.42 ? 23   ARG A CG    1 
ATOM   57   C CD    . ARG A 1 25  ? -110.199 65.150 -0.540  1.00 75.38 ? 23   ARG A CD    1 
ATOM   58   N NE    . ARG A 1 25  ? -110.824 65.731 0.643   1.00 75.96 ? 23   ARG A NE    1 
ATOM   59   C CZ    . ARG A 1 25  ? -111.456 66.900 0.652   1.00 76.14 ? 23   ARG A CZ    1 
ATOM   60   N NH1   . ARG A 1 25  ? -111.546 67.610 -0.466  1.00 75.92 ? 23   ARG A NH1   1 
ATOM   61   N NH2   . ARG A 1 25  ? -111.987 67.362 1.778   1.00 75.96 ? 23   ARG A NH2   1 
ATOM   62   N N     . THR A 1 26  ? -104.962 65.611 1.104   1.00 72.69 ? 24   THR A N     1 
ATOM   63   C CA    . THR A 1 26  ? -103.921 65.832 2.104   1.00 72.54 ? 24   THR A CA    1 
ATOM   64   C C     . THR A 1 26  ? -103.211 67.172 1.933   1.00 72.36 ? 24   THR A C     1 
ATOM   65   O O     . THR A 1 26  ? -102.875 67.565 0.818   1.00 72.63 ? 24   THR A O     1 
ATOM   66   C CB    . THR A 1 26  ? -102.861 64.697 2.048   1.00 72.58 ? 24   THR A CB    1 
ATOM   67   O OG1   . THR A 1 26  ? -103.390 63.515 2.665   1.00 72.86 ? 24   THR A OG1   1 
ATOM   68   C CG2   . THR A 1 26  ? -101.577 65.113 2.758   1.00 72.50 ? 24   THR A CG2   1 
ATOM   69   N N     . SER A 1 27  ? -102.991 67.875 3.040   1.00 71.82 ? 25   SER A N     1 
ATOM   70   C CA    . SER A 1 27  ? -102.287 69.149 2.986   1.00 71.51 ? 25   SER A CA    1 
ATOM   71   C C     . SER A 1 27  ? -100.789 68.837 2.996   1.00 71.13 ? 25   SER A C     1 
ATOM   72   O O     . SER A 1 27  ? -100.366 67.782 3.482   1.00 70.62 ? 25   SER A O     1 
ATOM   73   C CB    . SER A 1 27  ? -102.669 70.037 4.178   1.00 71.82 ? 25   SER A CB    1 
ATOM   74   O OG    . SER A 1 27  ? -102.400 69.399 5.411   1.00 72.87 ? 25   SER A OG    1 
ATOM   75   N N     . PHE A 1 28  ? -99.987  69.752 2.462   1.00 70.10 ? 26   PHE A N     1 
ATOM   76   C CA    . PHE A 1 28  ? -98.549  69.533 2.380   1.00 69.14 ? 26   PHE A CA    1 
ATOM   77   C C     . PHE A 1 28  ? -97.810  70.849 2.165   1.00 68.76 ? 26   PHE A C     1 
ATOM   78   O O     . PHE A 1 28  ? -98.411  71.922 2.119   1.00 68.34 ? 26   PHE A O     1 
ATOM   79   C CB    . PHE A 1 28  ? -98.253  68.600 1.200   1.00 68.63 ? 26   PHE A CB    1 
ATOM   80   C CG    . PHE A 1 28  ? -98.591  69.207 -0.139  1.00 68.47 ? 26   PHE A CG    1 
ATOM   81   C CD1   . PHE A 1 28  ? -97.631  69.909 -0.866  1.00 68.31 ? 26   PHE A CD1   1 
ATOM   82   C CD2   . PHE A 1 28  ? -99.893  69.147 -0.636  1.00 68.04 ? 26   PHE A CD2   1 
ATOM   83   C CE1   . PHE A 1 28  ? -97.960  70.547 -2.064  1.00 68.04 ? 26   PHE A CE1   1 
ATOM   84   C CE2   . PHE A 1 28  ? -100.232 69.779 -1.829  1.00 67.88 ? 26   PHE A CE2   1 
ATOM   85   C CZ    . PHE A 1 28  ? -99.264  70.482 -2.545  1.00 68.45 ? 26   PHE A CZ    1 
ATOM   86   N N     . ARG A 1 29  ? -96.496  70.746 2.023   1.00 68.61 ? 27   ARG A N     1 
ATOM   87   C CA    . ARG A 1 29  ? -95.652  71.904 1.777   1.00 68.38 ? 27   ARG A CA    1 
ATOM   88   C C     . ARG A 1 29  ? -95.028  71.679 0.406   1.00 66.92 ? 27   ARG A C     1 
ATOM   89   O O     . ARG A 1 29  ? -94.365  70.667 0.181   1.00 66.55 ? 27   ARG A O     1 
ATOM   90   C CB    . ARG A 1 29  ? -94.563  71.992 2.843   1.00 70.42 ? 27   ARG A CB    1 
ATOM   91   C CG    . ARG A 1 29  ? -95.104  71.926 4.255   1.00 73.12 ? 27   ARG A CG    1 
ATOM   92   C CD    . ARG A 1 29  ? -94.000  71.640 5.258   1.00 75.76 ? 27   ARG A CD    1 
ATOM   93   N NE    . ARG A 1 29  ? -94.543  71.294 6.571   1.00 77.53 ? 27   ARG A NE    1 
ATOM   94   C CZ    . ARG A 1 29  ? -93.800  71.018 7.638   1.00 78.96 ? 27   ARG A CZ    1 
ATOM   95   N NH1   . ARG A 1 29  ? -92.472  71.046 7.553   1.00 79.27 ? 27   ARG A NH1   1 
ATOM   96   N NH2   . ARG A 1 29  ? -94.386  70.717 8.793   1.00 79.28 ? 27   ARG A NH2   1 
ATOM   97   N N     . ALA A 1 30  ? -95.259  72.610 -0.514  1.00 65.75 ? 28   ALA A N     1 
ATOM   98   C CA    . ALA A 1 30  ? -94.719  72.493 -1.862  1.00 64.29 ? 28   ALA A CA    1 
ATOM   99   C C     . ALA A 1 30  ? -93.200  72.398 -1.841  1.00 63.51 ? 28   ALA A C     1 
ATOM   100  O O     . ALA A 1 30  ? -92.530  73.076 -1.062  1.00 63.38 ? 28   ALA A O     1 
ATOM   101  C CB    . ALA A 1 30  ? -95.154  73.678 -2.704  1.00 64.43 ? 28   ALA A CB    1 
ATOM   102  N N     . LEU A 1 31  ? -92.664  71.542 -2.703  1.00 62.40 ? 29   LEU A N     1 
ATOM   103  C CA    . LEU A 1 31  ? -91.230  71.353 -2.802  1.00 61.43 ? 29   LEU A CA    1 
ATOM   104  C C     . LEU A 1 31  ? -90.809  71.533 -4.249  1.00 61.51 ? 29   LEU A C     1 
ATOM   105  O O     . LEU A 1 31  ? -91.640  71.501 -5.155  1.00 61.26 ? 29   LEU A O     1 
ATOM   106  C CB    . LEU A 1 31  ? -90.843  69.948 -2.339  1.00 60.69 ? 29   LEU A CB    1 
ATOM   107  C CG    . LEU A 1 31  ? -91.075  69.552 -0.883  1.00 59.78 ? 29   LEU A CG    1 
ATOM   108  C CD1   . LEU A 1 31  ? -90.729  68.083 -0.710  1.00 59.75 ? 29   LEU A CD1   1 
ATOM   109  C CD2   . LEU A 1 31  ? -90.231  70.416 0.034   1.00 59.08 ? 29   LEU A CD2   1 
ATOM   110  N N     . PRO A 1 32  ? -89.507  71.743 -4.484  1.00 61.85 ? 30   PRO A N     1 
ATOM   111  C CA    . PRO A 1 32  ? -88.988  71.919 -5.843  1.00 62.35 ? 30   PRO A CA    1 
ATOM   112  C C     . PRO A 1 32  ? -88.920  70.533 -6.467  1.00 63.13 ? 30   PRO A C     1 
ATOM   113  O O     . PRO A 1 32  ? -88.053  69.744 -6.100  1.00 65.09 ? 30   PRO A O     1 
ATOM   114  C CB    . PRO A 1 32  ? -87.585  72.483 -5.615  1.00 62.33 ? 30   PRO A CB    1 
ATOM   115  C CG    . PRO A 1 32  ? -87.636  73.048 -4.214  1.00 62.39 ? 30   PRO A CG    1 
ATOM   116  C CD    . PRO A 1 32  ? -88.472  72.049 -3.484  1.00 61.89 ? 30   PRO A CD    1 
ATOM   117  N N     . GLY A 1 33  ? -89.817  70.221 -7.394  1.00 62.36 ? 31   GLY A N     1 
ATOM   118  C CA    . GLY A 1 33  ? -89.782  68.902 -8.002  1.00 61.43 ? 31   GLY A CA    1 
ATOM   119  C C     . GLY A 1 33  ? -88.437  68.525 -8.612  1.00 61.28 ? 31   GLY A C     1 
ATOM   120  O O     . GLY A 1 33  ? -87.410  69.128 -8.298  1.00 60.31 ? 31   GLY A O     1 
ATOM   121  N N     . PRO A 1 34  ? -88.406  67.513 -9.488  1.00 61.38 ? 32   PRO A N     1 
ATOM   122  C CA    . PRO A 1 34  ? -87.158  67.087 -10.124 1.00 62.38 ? 32   PRO A CA    1 
ATOM   123  C C     . PRO A 1 34  ? -86.485  68.251 -10.840 1.00 63.40 ? 32   PRO A C     1 
ATOM   124  O O     . PRO A 1 34  ? -87.129  68.980 -11.592 1.00 64.06 ? 32   PRO A O     1 
ATOM   125  C CB    . PRO A 1 34  ? -87.623  66.014 -11.098 1.00 62.36 ? 32   PRO A CB    1 
ATOM   126  C CG    . PRO A 1 34  ? -88.805  65.429 -10.402 1.00 62.09 ? 32   PRO A CG    1 
ATOM   127  C CD    . PRO A 1 34  ? -89.524  66.653 -9.906  1.00 61.68 ? 32   PRO A CD    1 
ATOM   128  N N     . SER A 1 35  ? -85.193  68.428 -10.605 1.00 64.24 ? 33   SER A N     1 
ATOM   129  C CA    . SER A 1 35  ? -84.446  69.511 -11.236 1.00 65.41 ? 33   SER A CA    1 
ATOM   130  C C     . SER A 1 35  ? -84.527  69.412 -12.752 1.00 66.23 ? 33   SER A C     1 
ATOM   131  O O     . SER A 1 35  ? -84.814  68.350 -13.292 1.00 65.92 ? 33   SER A O     1 
ATOM   132  C CB    . SER A 1 35  ? -82.979  69.452 -10.808 1.00 65.38 ? 33   SER A CB    1 
ATOM   133  O OG    . SER A 1 35  ? -82.412  68.193 -11.130 1.00 64.82 ? 33   SER A OG    1 
ATOM   134  N N     . GLN A 1 36  ? -84.279  70.516 -13.446 1.00 67.56 ? 34   GLN A N     1 
ATOM   135  C CA    . GLN A 1 36  ? -84.313  70.478 -14.901 1.00 68.78 ? 34   GLN A CA    1 
ATOM   136  C C     . GLN A 1 36  ? -82.966  70.001 -15.429 1.00 68.70 ? 34   GLN A C     1 
ATOM   137  O O     . GLN A 1 36  ? -82.882  69.453 -16.529 1.00 68.46 ? 34   GLN A O     1 
ATOM   138  C CB    . GLN A 1 36  ? -84.674  71.849 -15.466 1.00 70.12 ? 34   GLN A CB    1 
ATOM   139  C CG    . GLN A 1 36  ? -86.139  72.201 -15.253 1.00 72.07 ? 34   GLN A CG    1 
ATOM   140  C CD    . GLN A 1 36  ? -86.546  73.474 -15.970 1.00 73.23 ? 34   GLN A CD    1 
ATOM   141  O OE1   . GLN A 1 36  ? -86.395  73.588 -17.189 1.00 73.95 ? 34   GLN A OE1   1 
ATOM   142  N NE2   . GLN A 1 36  ? -87.070  74.440 -15.217 1.00 73.01 ? 34   GLN A NE2   1 
ATOM   143  N N     . ARG A 1 37  ? -81.916  70.213 -14.636 1.00 68.89 ? 35   ARG A N     1 
ATOM   144  C CA    . ARG A 1 37  ? -80.574  69.755 -14.992 1.00 68.79 ? 35   ARG A CA    1 
ATOM   145  C C     . ARG A 1 37  ? -80.682  68.253 -14.789 1.00 67.54 ? 35   ARG A C     1 
ATOM   146  O O     . ARG A 1 37  ? -81.050  67.804 -13.706 1.00 67.73 ? 35   ARG A O     1 
ATOM   147  C CB    . ARG A 1 37  ? -79.526  70.273 -14.011 1.00 70.86 ? 35   ARG A CB    1 
ATOM   148  C CG    . ARG A 1 37  ? -79.522  71.763 -13.726 1.00 73.66 ? 35   ARG A CG    1 
ATOM   149  C CD    . ARG A 1 37  ? -78.744  71.996 -12.430 1.00 76.24 ? 35   ARG A CD    1 
ATOM   150  N NE    . ARG A 1 37  ? -78.356  73.385 -12.199 1.00 78.47 ? 35   ARG A NE    1 
ATOM   151  C CZ    . ARG A 1 37  ? -77.796  73.815 -11.072 1.00 79.50 ? 35   ARG A CZ    1 
ATOM   152  N NH1   . ARG A 1 37  ? -77.566  72.960 -10.081 1.00 79.88 ? 35   ARG A NH1   1 
ATOM   153  N NH2   . ARG A 1 37  ? -77.452  75.091 -10.936 1.00 79.76 ? 35   ARG A NH2   1 
ATOM   154  N N     . GLN A 1 38  ? -80.366  67.469 -15.806 1.00 65.60 ? 36   GLN A N     1 
ATOM   155  C CA    . GLN A 1 38  ? -80.480  66.032 -15.656 1.00 64.17 ? 36   GLN A CA    1 
ATOM   156  C C     . GLN A 1 38  ? -79.171  65.293 -15.853 1.00 63.30 ? 36   GLN A C     1 
ATOM   157  O O     . GLN A 1 38  ? -78.277  65.760 -16.555 1.00 63.50 ? 36   GLN A O     1 
ATOM   158  C CB    . GLN A 1 38  ? -81.530  65.487 -16.631 1.00 63.93 ? 36   GLN A CB    1 
ATOM   159  C CG    . GLN A 1 38  ? -82.936  66.011 -16.389 1.00 63.80 ? 36   GLN A CG    1 
ATOM   160  C CD    . GLN A 1 38  ? -83.966  65.413 -17.338 1.00 64.51 ? 36   GLN A CD    1 
ATOM   161  O OE1   . GLN A 1 38  ? -84.165  64.194 -17.380 1.00 64.32 ? 36   GLN A OE1   1 
ATOM   162  N NE2   . GLN A 1 38  ? -84.627  66.272 -18.105 1.00 64.50 ? 36   GLN A NE2   1 
ATOM   163  N N     . LEU A 1 39  ? -79.064  64.133 -15.215 1.00 62.24 ? 37   LEU A N     1 
ATOM   164  C CA    . LEU A 1 39  ? -77.883  63.301 -15.344 1.00 61.00 ? 37   LEU A CA    1 
ATOM   165  C C     . LEU A 1 39  ? -77.672  63.017 -16.826 1.00 61.02 ? 37   LEU A C     1 
ATOM   166  O O     . LEU A 1 39  ? -78.611  63.071 -17.619 1.00 60.22 ? 37   LEU A O     1 
ATOM   167  C CB    . LEU A 1 39  ? -78.079  61.961 -14.627 1.00 59.58 ? 37   LEU A CB    1 
ATOM   168  C CG    . LEU A 1 39  ? -78.277  61.891 -13.117 1.00 58.02 ? 37   LEU A CG    1 
ATOM   169  C CD1   . LEU A 1 39  ? -78.454  60.436 -12.720 1.00 56.68 ? 37   LEU A CD1   1 
ATOM   170  C CD2   . LEU A 1 39  ? -77.085  62.495 -12.406 1.00 57.27 ? 37   LEU A CD2   1 
ATOM   171  N N     . GLU A 1 40  ? -76.438  62.711 -17.196 1.00 61.24 ? 38   GLU A N     1 
ATOM   172  C CA    . GLU A 1 40  ? -76.143  62.394 -18.577 1.00 61.64 ? 38   GLU A CA    1 
ATOM   173  C C     . GLU A 1 40  ? -76.836  61.065 -18.869 1.00 61.27 ? 38   GLU A C     1 
ATOM   174  O O     . GLU A 1 40  ? -76.874  60.177 -18.016 1.00 61.30 ? 38   GLU A O     1 
ATOM   175  C CB    . GLU A 1 40  ? -74.635  62.255 -18.768 1.00 62.70 ? 38   GLU A CB    1 
ATOM   176  C CG    . GLU A 1 40  ? -74.127  62.855 -20.063 1.00 64.78 ? 38   GLU A CG    1 
ATOM   177  C CD    . GLU A 1 40  ? -74.382  64.353 -20.143 1.00 65.59 ? 38   GLU A CD    1 
ATOM   178  O OE1   . GLU A 1 40  ? -73.997  65.080 -19.198 1.00 65.42 ? 38   GLU A OE1   1 
ATOM   179  O OE2   . GLU A 1 40  ? -74.964  64.803 -21.153 1.00 66.09 ? 38   GLU A OE2   1 
ATOM   180  N N     . VAL A 1 41  ? -77.394  60.932 -20.064 1.00 60.75 ? 39   VAL A N     1 
ATOM   181  C CA    . VAL A 1 41  ? -78.081  59.706 -20.442 1.00 60.49 ? 39   VAL A CA    1 
ATOM   182  C C     . VAL A 1 41  ? -77.242  58.480 -20.090 1.00 60.62 ? 39   VAL A C     1 
ATOM   183  O O     . VAL A 1 41  ? -77.776  57.392 -19.871 1.00 61.11 ? 39   VAL A O     1 
ATOM   184  C CB    . VAL A 1 41  ? -78.395  59.692 -21.951 1.00 60.16 ? 39   VAL A CB    1 
ATOM   185  C CG1   . VAL A 1 41  ? -79.196  58.445 -22.312 1.00 59.85 ? 39   VAL A CG1   1 
ATOM   186  C CG2   . VAL A 1 41  ? -79.166  60.942 -22.321 1.00 60.09 ? 39   VAL A CG2   1 
ATOM   187  N N     . TYR A 1 42  ? -75.927  58.656 -20.032 1.00 60.62 ? 40   TYR A N     1 
ATOM   188  C CA    . TYR A 1 42  ? -75.037  57.552 -19.693 1.00 60.17 ? 40   TYR A CA    1 
ATOM   189  C C     . TYR A 1 42  ? -75.205  57.157 -18.225 1.00 58.67 ? 40   TYR A C     1 
ATOM   190  O O     . TYR A 1 42  ? -75.247  55.970 -17.902 1.00 57.79 ? 40   TYR A O     1 
ATOM   191  C CB    . TYR A 1 42  ? -73.573  57.925 -19.980 1.00 61.84 ? 40   TYR A CB    1 
ATOM   192  C CG    . TYR A 1 42  ? -72.582  56.878 -19.513 1.00 63.99 ? 40   TYR A CG    1 
ATOM   193  C CD1   . TYR A 1 42  ? -72.086  56.893 -18.211 1.00 64.82 ? 40   TYR A CD1   1 
ATOM   194  C CD2   . TYR A 1 42  ? -72.194  55.830 -20.353 1.00 65.15 ? 40   TYR A CD2   1 
ATOM   195  C CE1   . TYR A 1 42  ? -71.231  55.887 -17.748 1.00 66.23 ? 40   TYR A CE1   1 
ATOM   196  C CE2   . TYR A 1 42  ? -71.341  54.818 -19.902 1.00 66.27 ? 40   TYR A CE2   1 
ATOM   197  C CZ    . TYR A 1 42  ? -70.866  54.852 -18.595 1.00 66.73 ? 40   TYR A CZ    1 
ATOM   198  O OH    . TYR A 1 42  ? -70.046  53.844 -18.127 1.00 67.45 ? 40   TYR A OH    1 
ATOM   199  N N     . ASP A 1 43  ? -75.290  58.150 -17.341 1.00 57.50 ? 41   ASP A N     1 
ATOM   200  C CA    . ASP A 1 43  ? -75.467  57.873 -15.919 1.00 56.52 ? 41   ASP A CA    1 
ATOM   201  C C     . ASP A 1 43  ? -76.886  57.390 -15.649 1.00 55.35 ? 41   ASP A C     1 
ATOM   202  O O     . ASP A 1 43  ? -77.099  56.522 -14.805 1.00 55.40 ? 41   ASP A O     1 
ATOM   203  C CB    . ASP A 1 43  ? -75.188  59.114 -15.071 1.00 57.26 ? 41   ASP A CB    1 
ATOM   204  C CG    . ASP A 1 43  ? -73.709  59.439 -14.975 1.00 58.22 ? 41   ASP A CG    1 
ATOM   205  O OD1   . ASP A 1 43  ? -72.901  58.518 -14.712 1.00 58.44 ? 41   ASP A OD1   1 
ATOM   206  O OD2   . ASP A 1 43  ? -73.359  60.626 -15.145 1.00 58.41 ? 41   ASP A OD2   1 
ATOM   207  N N     . GLN A 1 44  ? -77.851  57.958 -16.365 1.00 53.70 ? 42   GLN A N     1 
ATOM   208  C CA    . GLN A 1 44  ? -79.243  57.565 -16.210 1.00 52.09 ? 42   GLN A CA    1 
ATOM   209  C C     . GLN A 1 44  ? -79.357  56.056 -16.371 1.00 51.51 ? 42   GLN A C     1 
ATOM   210  O O     . GLN A 1 44  ? -80.157  55.407 -15.694 1.00 51.55 ? 42   GLN A O     1 
ATOM   211  C CB    . GLN A 1 44  ? -80.112  58.254 -17.267 1.00 51.75 ? 42   GLN A CB    1 
ATOM   212  C CG    . GLN A 1 44  ? -80.402  59.718 -16.999 1.00 51.69 ? 42   GLN A CG    1 
ATOM   213  C CD    . GLN A 1 44  ? -81.148  60.385 -18.141 1.00 52.15 ? 42   GLN A CD    1 
ATOM   214  O OE1   . GLN A 1 44  ? -82.003  59.774 -18.783 1.00 52.70 ? 42   GLN A OE1   1 
ATOM   215  N NE2   . GLN A 1 44  ? -80.842  61.652 -18.386 1.00 51.65 ? 42   GLN A NE2   1 
ATOM   216  N N     . CYS A 1 45  ? -78.543  55.498 -17.260 1.00 50.06 ? 43   CYS A N     1 
ATOM   217  C CA    . CYS A 1 45  ? -78.579  54.065 -17.516 1.00 49.77 ? 43   CYS A CA    1 
ATOM   218  C C     . CYS A 1 45  ? -77.774  53.255 -16.509 1.00 49.05 ? 43   CYS A C     1 
ATOM   219  O O     . CYS A 1 45  ? -77.543  52.063 -16.695 1.00 48.87 ? 43   CYS A O     1 
ATOM   220  C CB    . CYS A 1 45  ? -78.107  53.786 -18.946 1.00 51.04 ? 43   CYS A CB    1 
ATOM   221  S SG    . CYS A 1 45  ? -79.233  54.468 -20.223 1.00 54.02 ? 43   CYS A SG    1 
ATOM   222  N N     . LEU A 1 46  ? -77.362  53.916 -15.431 1.00 48.70 ? 44   LEU A N     1 
ATOM   223  C CA    . LEU A 1 46  ? -76.604  53.282 -14.357 1.00 47.92 ? 44   LEU A CA    1 
ATOM   224  C C     . LEU A 1 46  ? -77.376  53.325 -13.031 1.00 46.95 ? 44   LEU A C     1 
ATOM   225  O O     . LEU A 1 46  ? -76.987  52.675 -12.054 1.00 46.85 ? 44   LEU A O     1 
ATOM   226  C CB    . LEU A 1 46  ? -75.253  53.982 -14.188 1.00 48.75 ? 44   LEU A CB    1 
ATOM   227  C CG    . LEU A 1 46  ? -74.190  53.645 -15.239 1.00 49.67 ? 44   LEU A CG    1 
ATOM   228  C CD1   . LEU A 1 46  ? -72.990  54.575 -15.074 1.00 49.63 ? 44   LEU A CD1   1 
ATOM   229  C CD2   . LEU A 1 46  ? -73.776  52.176 -15.099 1.00 48.74 ? 44   LEU A CD2   1 
ATOM   230  N N     . ILE A 1 47  ? -78.466  54.094 -13.008 1.00 45.21 ? 45   ILE A N     1 
ATOM   231  C CA    . ILE A 1 47  ? -79.301  54.235 -11.820 1.00 43.02 ? 45   ILE A CA    1 
ATOM   232  C C     . ILE A 1 47  ? -79.977  52.915 -11.497 1.00 42.16 ? 45   ILE A C     1 
ATOM   233  O O     . ILE A 1 47  ? -80.616  52.316 -12.357 1.00 42.07 ? 45   ILE A O     1 
ATOM   234  C CB    . ILE A 1 47  ? -80.385  55.321 -12.032 1.00 42.47 ? 45   ILE A CB    1 
ATOM   235  C CG1   . ILE A 1 47  ? -79.716  56.691 -12.170 1.00 42.08 ? 45   ILE A CG1   1 
ATOM   236  C CG2   . ILE A 1 47  ? -81.388  55.318 -10.881 1.00 41.28 ? 45   ILE A CG2   1 
ATOM   237  C CD1   . ILE A 1 47  ? -78.864  57.086 -10.987 1.00 41.00 ? 45   ILE A CD1   1 
ATOM   238  N N     . GLY A 1 48  ? -79.824  52.460 -10.258 1.00 41.67 ? 46   GLY A N     1 
ATOM   239  C CA    . GLY A 1 48  ? -80.435  51.209 -9.855  1.00 41.80 ? 46   GLY A CA    1 
ATOM   240  C C     . GLY A 1 48  ? -79.715  49.953 -10.313 1.00 42.57 ? 46   GLY A C     1 
ATOM   241  O O     . GLY A 1 48  ? -80.226  48.849 -10.146 1.00 41.79 ? 46   GLY A O     1 
ATOM   242  N N     . ALA A 1 49  ? -78.532  50.110 -10.894 1.00 43.85 ? 47   ALA A N     1 
ATOM   243  C CA    . ALA A 1 49  ? -77.757  48.960 -11.352 1.00 45.85 ? 47   ALA A CA    1 
ATOM   244  C C     . ALA A 1 49  ? -77.007  48.365 -10.172 1.00 46.50 ? 47   ALA A C     1 
ATOM   245  O O     . ALA A 1 49  ? -76.687  49.072 -9.218  1.00 46.26 ? 47   ALA A O     1 
ATOM   246  C CB    . ALA A 1 49  ? -76.762  49.389 -12.436 1.00 46.03 ? 47   ALA A CB    1 
ATOM   247  N N     . ALA A 1 50  ? -76.737  47.065 -10.229 1.00 48.53 ? 48   ALA A N     1 
ATOM   248  C CA    . ALA A 1 50  ? -75.991  46.410 -9.158  1.00 51.76 ? 48   ALA A CA    1 
ATOM   249  C C     . ALA A 1 50  ? -74.545  46.944 -9.148  1.00 53.48 ? 48   ALA A C     1 
ATOM   250  O O     . ALA A 1 50  ? -74.172  47.721 -8.253  1.00 54.80 ? 48   ALA A O     1 
ATOM   251  C CB    . ALA A 1 50  ? -76.004  44.901 -9.351  1.00 51.50 ? 48   ALA A CB    1 
ATOM   252  N N     . ARG A 1 51  ? -73.743  46.544 -10.135 1.00 54.02 ? 49   ARG A N     1 
ATOM   253  C CA    . ARG A 1 51  ? -72.347  47.008 -10.249 1.00 55.59 ? 49   ARG A CA    1 
ATOM   254  C C     . ARG A 1 51  ? -71.361  46.332 -9.305  1.00 56.12 ? 49   ARG A C     1 
ATOM   255  O O     . ARG A 1 51  ? -70.564  47.005 -8.657  1.00 55.64 ? 49   ARG A O     1 
ATOM   256  C CB    . ARG A 1 51  ? -72.246  48.526 -10.028 1.00 55.55 ? 49   ARG A CB    1 
ATOM   257  C CG    . ARG A 1 51  ? -73.033  49.376 -11.009 1.00 56.07 ? 49   ARG A CG    1 
ATOM   258  C CD    . ARG A 1 51  ? -72.329  49.533 -12.357 1.00 56.44 ? 49   ARG A CD    1 
ATOM   259  N NE    . ARG A 1 51  ? -71.402  50.669 -12.418 1.00 55.82 ? 49   ARG A NE    1 
ATOM   260  C CZ    . ARG A 1 51  ? -71.688  51.897 -11.999 1.00 55.25 ? 49   ARG A CZ    1 
ATOM   261  N NH1   . ARG A 1 51  ? -72.874  52.154 -11.471 1.00 56.97 ? 49   ARG A NH1   1 
ATOM   262  N NH2   . ARG A 1 51  ? -70.806  52.877 -12.140 1.00 54.85 ? 49   ARG A NH2   1 
ATOM   263  N N     . TRP A 1 52  ? -71.409  45.008 -9.228  1.00 57.89 ? 50   TRP A N     1 
ATOM   264  C CA    . TRP A 1 52  ? -70.494  44.278 -8.368  1.00 60.41 ? 50   TRP A CA    1 
ATOM   265  C C     . TRP A 1 52  ? -69.037  44.559 -8.750  1.00 62.74 ? 50   TRP A C     1 
ATOM   266  O O     . TRP A 1 52  ? -68.692  44.623 -9.933  1.00 62.09 ? 50   TRP A O     1 
ATOM   267  C CB    . TRP A 1 52  ? -70.769  42.780 -8.462  1.00 59.92 ? 50   TRP A CB    1 
ATOM   268  C CG    . TRP A 1 52  ? -72.099  42.402 -7.943  1.00 60.17 ? 50   TRP A CG    1 
ATOM   269  C CD1   . TRP A 1 52  ? -73.226  42.145 -8.672  1.00 60.36 ? 50   TRP A CD1   1 
ATOM   270  C CD2   . TRP A 1 52  ? -72.467  42.260 -6.568  1.00 59.77 ? 50   TRP A CD2   1 
ATOM   271  N NE1   . TRP A 1 52  ? -74.275  41.850 -7.832  1.00 60.17 ? 50   TRP A NE1   1 
ATOM   272  C CE2   . TRP A 1 52  ? -73.836  41.915 -6.535  1.00 60.03 ? 50   TRP A CE2   1 
ATOM   273  C CE3   . TRP A 1 52  ? -71.772  42.394 -5.359  1.00 59.21 ? 50   TRP A CE3   1 
ATOM   274  C CZ2   . TRP A 1 52  ? -74.525  41.698 -5.338  1.00 59.72 ? 50   TRP A CZ2   1 
ATOM   275  C CZ3   . TRP A 1 52  ? -72.451  42.181 -4.172  1.00 59.38 ? 50   TRP A CZ3   1 
ATOM   276  C CH2   . TRP A 1 52  ? -73.818  41.836 -4.169  1.00 60.44 ? 50   TRP A CH2   1 
ATOM   277  N N     . PRO A 1 53  ? -68.158  44.720 -7.746  1.00 65.32 ? 51   PRO A N     1 
ATOM   278  C CA    . PRO A 1 53  ? -66.742  44.993 -8.007  1.00 67.41 ? 51   PRO A CA    1 
ATOM   279  C C     . PRO A 1 53  ? -66.062  43.860 -8.783  1.00 69.13 ? 51   PRO A C     1 
ATOM   280  O O     . PRO A 1 53  ? -65.096  44.091 -9.505  1.00 69.54 ? 51   PRO A O     1 
ATOM   281  C CB    . PRO A 1 53  ? -66.168  45.184 -6.604  1.00 67.10 ? 51   PRO A CB    1 
ATOM   282  C CG    . PRO A 1 53  ? -67.000  44.252 -5.781  1.00 66.63 ? 51   PRO A CG    1 
ATOM   283  C CD    . PRO A 1 53  ? -68.395  44.520 -6.305  1.00 66.00 ? 51   PRO A CD    1 
ATOM   284  N N     . ASP A 1 54  ? -66.575  42.641 -8.637  1.00 70.97 ? 52   ASP A N     1 
ATOM   285  C CA    . ASP A 1 54  ? -66.018  41.490 -9.343  1.00 72.69 ? 52   ASP A CA    1 
ATOM   286  C C     . ASP A 1 54  ? -66.763  41.250 -10.657 1.00 74.23 ? 52   ASP A C     1 
ATOM   287  O O     . ASP A 1 54  ? -66.910  40.114 -11.105 1.00 74.79 ? 52   ASP A O     1 
ATOM   288  C CB    . ASP A 1 54  ? -66.075  40.235 -8.454  1.00 72.65 ? 52   ASP A CB    1 
ATOM   289  C CG    . ASP A 1 54  ? -67.480  39.922 -7.949  1.00 72.70 ? 52   ASP A CG    1 
ATOM   290  O OD1   . ASP A 1 54  ? -68.065  40.754 -7.224  1.00 73.13 ? 52   ASP A OD1   1 
ATOM   291  O OD2   . ASP A 1 54  ? -67.999  38.834 -8.271  1.00 72.04 ? 52   ASP A OD2   1 
ATOM   292  N N     . ASP A 1 55  ? -67.224  42.338 -11.269 1.00 76.01 ? 53   ASP A N     1 
ATOM   293  C CA    . ASP A 1 55  ? -67.957  42.286 -12.533 1.00 77.56 ? 53   ASP A CA    1 
ATOM   294  C C     . ASP A 1 55  ? -69.139  41.321 -12.473 1.00 77.85 ? 53   ASP A C     1 
ATOM   295  O O     . ASP A 1 55  ? -69.987  41.302 -13.368 1.00 77.79 ? 53   ASP A O     1 
ATOM   296  C CB    . ASP A 1 55  ? -67.019  41.873 -13.671 1.00 79.15 ? 53   ASP A CB    1 
ATOM   297  C CG    . ASP A 1 55  ? -67.602  42.169 -15.045 1.00 80.75 ? 53   ASP A CG    1 
ATOM   298  O OD1   . ASP A 1 55  ? -67.794  43.368 -15.357 1.00 81.51 ? 53   ASP A OD1   1 
ATOM   299  O OD2   . ASP A 1 55  ? -67.867  41.209 -15.809 1.00 81.52 ? 53   ASP A OD2   1 
ATOM   300  N N     . SER A 1 59  ? -72.257  43.074 -18.131 1.00 89.51 ? 57   SER A N     1 
ATOM   301  C CA    . SER A 1 59  ? -73.592  43.016 -17.544 1.00 89.36 ? 57   SER A CA    1 
ATOM   302  C C     . SER A 1 59  ? -74.387  44.297 -17.806 1.00 89.04 ? 57   SER A C     1 
ATOM   303  O O     . SER A 1 59  ? -75.245  44.680 -17.007 1.00 88.91 ? 57   SER A O     1 
ATOM   304  C CB    . SER A 1 59  ? -73.498  42.766 -16.034 1.00 89.72 ? 57   SER A CB    1 
ATOM   305  O OG    . SER A 1 59  ? -72.798  43.813 -15.383 1.00 90.01 ? 57   SER A OG    1 
ATOM   306  N N     . ASN A 1 60  ? -74.091  44.958 -18.925 1.00 88.27 ? 58   ASN A N     1 
ATOM   307  C CA    . ASN A 1 60  ? -74.790  46.183 -19.304 1.00 87.17 ? 58   ASN A CA    1 
ATOM   308  C C     . ASN A 1 60  ? -75.365  46.037 -20.713 1.00 86.08 ? 58   ASN A C     1 
ATOM   309  O O     . ASN A 1 60  ? -74.982  46.752 -21.641 1.00 85.81 ? 58   ASN A O     1 
ATOM   310  C CB    . ASN A 1 60  ? -73.847  47.390 -19.248 1.00 87.59 ? 58   ASN A CB    1 
ATOM   311  C CG    . ASN A 1 60  ? -72.699  47.273 -20.222 1.00 87.87 ? 58   ASN A CG    1 
ATOM   312  O OD1   . ASN A 1 60  ? -71.806  46.442 -20.051 1.00 88.47 ? 58   ASN A OD1   1 
ATOM   313  N ND2   . ASN A 1 60  ? -72.722  48.098 -21.262 1.00 87.70 ? 58   ASN A ND2   1 
ATOM   314  N N     . THR A 1 61  ? -76.287  45.094 -20.858 1.00 84.76 ? 59   THR A N     1 
ATOM   315  C CA    . THR A 1 61  ? -76.942  44.825 -22.130 1.00 83.24 ? 59   THR A CA    1 
ATOM   316  C C     . THR A 1 61  ? -77.951  45.939 -22.386 1.00 81.77 ? 59   THR A C     1 
ATOM   317  O O     . THR A 1 61  ? -78.201  46.768 -21.511 1.00 81.64 ? 59   THR A O     1 
ATOM   318  C CB    . THR A 1 61  ? -77.704  43.479 -22.077 1.00 83.94 ? 59   THR A CB    1 
ATOM   319  O OG1   . THR A 1 61  ? -77.350  42.775 -20.879 1.00 83.90 ? 59   THR A OG1   1 
ATOM   320  C CG2   . THR A 1 61  ? -77.358  42.613 -23.281 1.00 84.20 ? 59   THR A CG2   1 
ATOM   321  N N     . PRO A 1 62  ? -78.533  45.987 -23.595 1.00 80.29 ? 60   PRO A N     1 
ATOM   322  C CA    . PRO A 1 62  ? -79.516  47.038 -23.867 1.00 78.52 ? 60   PRO A CA    1 
ATOM   323  C C     . PRO A 1 62  ? -80.647  46.949 -22.848 1.00 76.60 ? 60   PRO A C     1 
ATOM   324  O O     . PRO A 1 62  ? -81.330  47.932 -22.576 1.00 76.29 ? 60   PRO A O     1 
ATOM   325  C CB    . PRO A 1 62  ? -79.978  46.712 -25.283 1.00 78.74 ? 60   PRO A CB    1 
ATOM   326  C CG    . PRO A 1 62  ? -78.734  46.189 -25.905 1.00 79.29 ? 60   PRO A CG    1 
ATOM   327  C CD    . PRO A 1 62  ? -78.198  45.260 -24.832 1.00 79.83 ? 60   PRO A CD    1 
ATOM   328  N N     . GLU A 1 63  ? -80.834  45.757 -22.290 1.00 74.34 ? 61   GLU A N     1 
ATOM   329  C CA    . GLU A 1 63  ? -81.867  45.536 -21.289 1.00 72.42 ? 61   GLU A CA    1 
ATOM   330  C C     . GLU A 1 63  ? -81.488  46.211 -19.979 1.00 70.08 ? 61   GLU A C     1 
ATOM   331  O O     . GLU A 1 63  ? -82.216  47.068 -19.483 1.00 69.88 ? 61   GLU A O     1 
ATOM   332  C CB    . GLU A 1 63  ? -82.073  44.041 -21.043 1.00 73.54 ? 61   GLU A CB    1 
ATOM   333  C CG    . GLU A 1 63  ? -82.818  43.321 -22.151 1.00 75.85 ? 61   GLU A CG    1 
ATOM   334  C CD    . GLU A 1 63  ? -83.214  41.905 -21.763 1.00 77.04 ? 61   GLU A CD    1 
ATOM   335  O OE1   . GLU A 1 63  ? -82.306  41.080 -21.517 1.00 77.68 ? 61   GLU A OE1   1 
ATOM   336  O OE2   . GLU A 1 63  ? -84.433  41.621 -21.701 1.00 77.46 ? 61   GLU A OE2   1 
ATOM   337  N N     . ASN A 1 64  ? -80.348  45.815 -19.422 1.00 67.05 ? 62   ASN A N     1 
ATOM   338  C CA    . ASN A 1 64  ? -79.876  46.388 -18.171 1.00 64.33 ? 62   ASN A CA    1 
ATOM   339  C C     . ASN A 1 64  ? -79.906  47.901 -18.253 1.00 62.09 ? 62   ASN A C     1 
ATOM   340  O O     . ASN A 1 64  ? -80.318  48.568 -17.307 1.00 61.99 ? 62   ASN A O     1 
ATOM   341  C CB    . ASN A 1 64  ? -78.453  45.910 -17.866 1.00 64.57 ? 62   ASN A CB    1 
ATOM   342  C CG    . ASN A 1 64  ? -78.402  44.442 -17.492 1.00 64.95 ? 62   ASN A CG    1 
ATOM   343  O OD1   . ASN A 1 64  ? -78.932  43.590 -18.203 1.00 66.21 ? 62   ASN A OD1   1 
ATOM   344  N ND2   . ASN A 1 64  ? -77.759  44.137 -16.373 1.00 64.93 ? 62   ASN A ND2   1 
ATOM   345  N N     . ARG A 1 65  ? -79.480  48.442 -19.389 1.00 59.46 ? 63   ARG A N     1 
ATOM   346  C CA    . ARG A 1 65  ? -79.469  49.886 -19.569 1.00 57.19 ? 63   ARG A CA    1 
ATOM   347  C C     . ARG A 1 65  ? -80.865  50.489 -19.622 1.00 54.62 ? 63   ARG A C     1 
ATOM   348  O O     . ARG A 1 65  ? -81.081  51.606 -19.153 1.00 54.69 ? 63   ARG A O     1 
ATOM   349  C CB    . ARG A 1 65  ? -78.714  50.273 -20.844 1.00 58.49 ? 63   ARG A CB    1 
ATOM   350  C CG    . ARG A 1 65  ? -77.200  50.206 -20.733 1.00 60.57 ? 63   ARG A CG    1 
ATOM   351  C CD    . ARG A 1 65  ? -76.562  51.098 -21.789 1.00 62.33 ? 63   ARG A CD    1 
ATOM   352  N NE    . ARG A 1 65  ? -77.002  50.730 -23.130 1.00 64.30 ? 63   ARG A NE    1 
ATOM   353  C CZ    . ARG A 1 65  ? -76.510  49.712 -23.829 1.00 65.38 ? 63   ARG A CZ    1 
ATOM   354  N NH1   . ARG A 1 65  ? -76.988  49.451 -25.041 1.00 65.28 ? 63   ARG A NH1   1 
ATOM   355  N NH2   . ARG A 1 65  ? -75.526  48.970 -23.330 1.00 65.58 ? 63   ARG A NH2   1 
ATOM   356  N N     . ALA A 1 66  ? -81.809  49.755 -20.199 1.00 51.47 ? 64   ALA A N     1 
ATOM   357  C CA    . ALA A 1 66  ? -83.179  50.240 -20.317 1.00 48.89 ? 64   ALA A CA    1 
ATOM   358  C C     . ALA A 1 66  ? -83.901  50.139 -18.981 1.00 46.63 ? 64   ALA A C     1 
ATOM   359  O O     . ALA A 1 66  ? -84.784  50.943 -18.681 1.00 45.90 ? 64   ALA A O     1 
ATOM   360  C CB    . ALA A 1 66  ? -83.931  49.440 -21.385 1.00 49.17 ? 64   ALA A CB    1 
ATOM   361  N N     . TYR A 1 67  ? -83.524  49.130 -18.200 1.00 43.81 ? 65   TYR A N     1 
ATOM   362  C CA    . TYR A 1 67  ? -84.101  48.891 -16.885 1.00 41.49 ? 65   TYR A CA    1 
ATOM   363  C C     . TYR A 1 67  ? -83.752  50.079 -15.998 1.00 40.99 ? 65   TYR A C     1 
ATOM   364  O O     . TYR A 1 67  ? -84.613  50.646 -15.326 1.00 39.72 ? 65   TYR A O     1 
ATOM   365  C CB    . TYR A 1 67  ? -83.521  47.601 -16.301 1.00 39.71 ? 65   TYR A CB    1 
ATOM   366  C CG    . TYR A 1 67  ? -83.780  47.400 -14.830 1.00 37.90 ? 65   TYR A CG    1 
ATOM   367  C CD1   . TYR A 1 67  ? -84.846  46.612 -14.392 1.00 37.26 ? 65   TYR A CD1   1 
ATOM   368  C CD2   . TYR A 1 67  ? -82.959  47.998 -13.875 1.00 37.14 ? 65   TYR A CD2   1 
ATOM   369  C CE1   . TYR A 1 67  ? -85.091  46.419 -13.040 1.00 37.19 ? 65   TYR A CE1   1 
ATOM   370  C CE2   . TYR A 1 67  ? -83.190  47.820 -12.516 1.00 37.81 ? 65   TYR A CE2   1 
ATOM   371  C CZ    . TYR A 1 67  ? -84.259  47.027 -12.101 1.00 37.81 ? 65   TYR A CZ    1 
ATOM   372  O OH    . TYR A 1 67  ? -84.495  46.848 -10.758 1.00 36.55 ? 65   TYR A OH    1 
ATOM   373  N N     . CYS A 1 68  ? -82.480  50.457 -16.028 1.00 40.94 ? 66   CYS A N     1 
ATOM   374  C CA    . CYS A 1 68  ? -81.989  51.579 -15.247 1.00 41.85 ? 66   CYS A CA    1 
ATOM   375  C C     . CYS A 1 68  ? -82.590  52.895 -15.712 1.00 41.81 ? 66   CYS A C     1 
ATOM   376  O O     . CYS A 1 68  ? -83.003  53.713 -14.892 1.00 42.45 ? 66   CYS A O     1 
ATOM   377  C CB    . CYS A 1 68  ? -80.463  51.656 -15.338 1.00 41.87 ? 66   CYS A CB    1 
ATOM   378  S SG    . CYS A 1 68  ? -79.606  50.323 -14.487 1.00 45.15 ? 66   CYS A SG    1 
ATOM   379  N N     . GLN A 1 69  ? -82.629  53.100 -17.025 1.00 41.89 ? 67   GLN A N     1 
ATOM   380  C CA    . GLN A 1 69  ? -83.171  54.325 -17.596 1.00 42.04 ? 67   GLN A CA    1 
ATOM   381  C C     . GLN A 1 69  ? -84.604  54.502 -17.145 1.00 40.34 ? 67   GLN A C     1 
ATOM   382  O O     . GLN A 1 69  ? -85.036  55.605 -16.816 1.00 40.46 ? 67   GLN A O     1 
ATOM   383  C CB    . GLN A 1 69  ? -83.119  54.270 -19.121 1.00 44.99 ? 67   GLN A CB    1 
ATOM   384  C CG    . GLN A 1 69  ? -83.807  55.448 -19.814 1.00 47.33 ? 67   GLN A CG    1 
ATOM   385  C CD    . GLN A 1 69  ? -82.844  56.250 -20.670 1.00 49.31 ? 67   GLN A CD    1 
ATOM   386  O OE1   . GLN A 1 69  ? -82.157  55.700 -21.545 1.00 48.43 ? 67   GLN A OE1   1 
ATOM   387  N NE2   . GLN A 1 69  ? -82.793  57.557 -20.431 1.00 49.77 ? 67   GLN A NE2   1 
ATOM   388  N N     . SER A 1 70  ? -85.337  53.402 -17.132 1.00 38.78 ? 68   SER A N     1 
ATOM   389  C CA    . SER A 1 70  ? -86.719  53.429 -16.703 1.00 38.06 ? 68   SER A CA    1 
ATOM   390  C C     . SER A 1 70  ? -86.789  53.788 -15.222 1.00 38.19 ? 68   SER A C     1 
ATOM   391  O O     . SER A 1 70  ? -87.635  54.594 -14.827 1.00 37.93 ? 68   SER A O     1 
ATOM   392  C CB    . SER A 1 70  ? -87.375  52.070 -16.936 1.00 37.92 ? 68   SER A CB    1 
ATOM   393  O OG    . SER A 1 70  ? -88.680  52.049 -16.392 1.00 38.21 ? 68   SER A OG    1 
ATOM   394  N N     . MET A 1 71  ? -85.911  53.203 -14.399 1.00 37.13 ? 69   MET A N     1 
ATOM   395  C CA    . MET A 1 71  ? -85.933  53.515 -12.972 1.00 36.78 ? 69   MET A CA    1 
ATOM   396  C C     . MET A 1 71  ? -85.699  55.007 -12.762 1.00 35.94 ? 69   MET A C     1 
ATOM   397  O O     . MET A 1 71  ? -86.327  55.627 -11.902 1.00 35.62 ? 69   MET A O     1 
ATOM   398  C CB    . MET A 1 71  ? -84.883  52.715 -12.186 1.00 37.44 ? 69   MET A CB    1 
ATOM   399  C CG    . MET A 1 71  ? -85.006  52.928 -10.673 1.00 39.16 ? 69   MET A CG    1 
ATOM   400  S SD    . MET A 1 71  ? -84.031  51.865 -9.587  1.00 40.37 ? 69   MET A SD    1 
ATOM   401  C CE    . MET A 1 71  ? -83.093  53.082 -8.738  1.00 40.65 ? 69   MET A CE    1 
ATOM   402  N N     . TYR A 1 72  ? -84.814  55.581 -13.569 1.00 35.10 ? 70   TYR A N     1 
ATOM   403  C CA    . TYR A 1 72  ? -84.492  56.996 -13.475 1.00 35.17 ? 70   TYR A CA    1 
ATOM   404  C C     . TYR A 1 72  ? -85.711  57.867 -13.758 1.00 35.43 ? 70   TYR A C     1 
ATOM   405  O O     . TYR A 1 72  ? -86.006  58.806 -13.025 1.00 34.78 ? 70   TYR A O     1 
ATOM   406  C CB    . TYR A 1 72  ? -83.377  57.336 -14.461 1.00 36.00 ? 70   TYR A CB    1 
ATOM   407  C CG    . TYR A 1 72  ? -83.104  58.819 -14.585 1.00 37.20 ? 70   TYR A CG    1 
ATOM   408  C CD1   . TYR A 1 72  ? -82.403  59.514 -13.595 1.00 37.52 ? 70   TYR A CD1   1 
ATOM   409  C CD2   . TYR A 1 72  ? -83.590  59.538 -15.676 1.00 37.16 ? 70   TYR A CD2   1 
ATOM   410  C CE1   . TYR A 1 72  ? -82.196  60.898 -13.695 1.00 37.87 ? 70   TYR A CE1   1 
ATOM   411  C CE2   . TYR A 1 72  ? -83.394  60.910 -15.785 1.00 37.75 ? 70   TYR A CE2   1 
ATOM   412  C CZ    . TYR A 1 72  ? -82.700  61.585 -14.796 1.00 38.20 ? 70   TYR A CZ    1 
ATOM   413  O OH    . TYR A 1 72  ? -82.526  62.948 -14.921 1.00 38.56 ? 70   TYR A OH    1 
ATOM   414  N N     . ASN A 1 73  ? -86.420  57.537 -14.831 1.00 35.80 ? 71   ASN A N     1 
ATOM   415  C CA    . ASN A 1 73  ? -87.606  58.277 -15.230 1.00 35.41 ? 71   ASN A CA    1 
ATOM   416  C C     . ASN A 1 73  ? -88.702  58.180 -14.184 1.00 34.60 ? 71   ASN A C     1 
ATOM   417  O O     . ASN A 1 73  ? -89.346  59.176 -13.848 1.00 34.44 ? 71   ASN A O     1 
ATOM   418  C CB    . ASN A 1 73  ? -88.121  57.743 -16.562 1.00 35.45 ? 71   ASN A CB    1 
ATOM   419  C CG    . ASN A 1 73  ? -87.221  58.110 -17.726 1.00 35.97 ? 71   ASN A CG    1 
ATOM   420  O OD1   . ASN A 1 73  ? -87.127  57.370 -18.706 1.00 36.13 ? 71   ASN A OD1   1 
ATOM   421  N ND2   . ASN A 1 73  ? -86.573  59.265 -17.636 1.00 35.00 ? 71   ASN A ND2   1 
ATOM   422  N N     . SER A 1 74  ? -88.920  56.979 -13.672 1.00 33.77 ? 72   SER A N     1 
ATOM   423  C CA    . SER A 1 74  ? -89.952  56.783 -12.672 1.00 34.90 ? 72   SER A CA    1 
ATOM   424  C C     . SER A 1 74  ? -89.598  57.454 -11.347 1.00 36.29 ? 72   SER A C     1 
ATOM   425  O O     . SER A 1 74  ? -90.483  57.956 -10.645 1.00 35.85 ? 72   SER A O     1 
ATOM   426  C CB    . SER A 1 74  ? -90.218  55.291 -12.478 1.00 33.64 ? 72   SER A CB    1 
ATOM   427  O OG    . SER A 1 74  ? -90.911  54.793 -13.601 1.00 30.89 ? 72   SER A OG    1 
ATOM   428  N N     . ILE A 1 75  ? -88.306  57.463 -11.017 1.00 37.47 ? 73   ILE A N     1 
ATOM   429  C CA    . ILE A 1 75  ? -87.824  58.108 -9.798  1.00 37.98 ? 73   ILE A CA    1 
ATOM   430  C C     . ILE A 1 75  ? -88.220  59.584 -9.822  1.00 37.64 ? 73   ILE A C     1 
ATOM   431  O O     . ILE A 1 75  ? -88.800  60.104 -8.869  1.00 37.79 ? 73   ILE A O     1 
ATOM   432  C CB    . ILE A 1 75  ? -86.269  58.049 -9.690  1.00 39.81 ? 73   ILE A CB    1 
ATOM   433  C CG1   . ILE A 1 75  ? -85.804  56.634 -9.369  1.00 39.62 ? 73   ILE A CG1   1 
ATOM   434  C CG2   . ILE A 1 75  ? -85.775  59.006 -8.618  1.00 38.80 ? 73   ILE A CG2   1 
ATOM   435  C CD1   . ILE A 1 75  ? -86.296  56.144 -8.068  1.00 43.57 ? 73   ILE A CD1   1 
ATOM   436  N N     . ARG A 1 76  ? -87.901  60.264 -10.914 1.00 37.59 ? 74   ARG A N     1 
ATOM   437  C CA    . ARG A 1 76  ? -88.215  61.687 -11.012 1.00 38.72 ? 74   ARG A CA    1 
ATOM   438  C C     . ARG A 1 76  ? -89.720  61.925 -11.017 1.00 38.07 ? 74   ARG A C     1 
ATOM   439  O O     . ARG A 1 76  ? -90.195  62.950 -10.537 1.00 37.97 ? 74   ARG A O     1 
ATOM   440  C CB    . ARG A 1 76  ? -87.589  62.290 -12.266 1.00 39.13 ? 74   ARG A CB    1 
ATOM   441  C CG    . ARG A 1 76  ? -86.169  61.813 -12.522 1.00 41.13 ? 74   ARG A CG    1 
ATOM   442  C CD    . ARG A 1 76  ? -85.586  62.512 -13.721 1.00 42.61 ? 74   ARG A CD    1 
ATOM   443  N NE    . ARG A 1 76  ? -85.332  63.910 -13.396 1.00 45.58 ? 74   ARG A NE    1 
ATOM   444  C CZ    . ARG A 1 76  ? -85.869  64.935 -14.038 1.00 44.75 ? 74   ARG A CZ    1 
ATOM   445  N NH1   . ARG A 1 76  ? -86.689  64.728 -15.052 1.00 45.36 ? 74   ARG A NH1   1 
ATOM   446  N NH2   . ARG A 1 76  ? -85.601  66.163 -13.643 1.00 46.00 ? 74   ARG A NH2   1 
ATOM   447  N N     . SER A 1 77  ? -90.467  60.968 -11.551 1.00 37.42 ? 75   SER A N     1 
ATOM   448  C CA    . SER A 1 77  ? -91.920  61.081 -11.604 1.00 36.67 ? 75   SER A CA    1 
ATOM   449  C C     . SER A 1 77  ? -92.514  60.952 -10.200 1.00 36.55 ? 75   SER A C     1 
ATOM   450  O O     . SER A 1 77  ? -93.435  61.689 -9.840  1.00 36.57 ? 75   SER A O     1 
ATOM   451  C CB    . SER A 1 77  ? -92.493  60.001 -12.524 1.00 36.54 ? 75   SER A CB    1 
ATOM   452  O OG    . SER A 1 77  ? -93.898  60.029 -12.521 1.00 37.75 ? 75   SER A OG    1 
ATOM   453  N N     . ALA A 1 78  ? -92.000  60.015 -9.406  1.00 35.37 ? 76   ALA A N     1 
ATOM   454  C CA    . ALA A 1 78  ? -92.496  59.849 -8.044  1.00 35.22 ? 76   ALA A CA    1 
ATOM   455  C C     . ALA A 1 78  ? -92.044  61.045 -7.214  1.00 35.32 ? 76   ALA A C     1 
ATOM   456  O O     . ALA A 1 78  ? -92.715  61.427 -6.268  1.00 35.00 ? 76   ALA A O     1 
ATOM   457  C CB    . ALA A 1 78  ? -91.979  58.556 -7.431  1.00 33.75 ? 76   ALA A CB    1 
ATOM   458  N N     . GLY A 1 79  ? -90.909  61.632 -7.579  1.00 35.87 ? 77   GLY A N     1 
ATOM   459  C CA    . GLY A 1 79  ? -90.408  62.787 -6.855  1.00 37.53 ? 77   GLY A CA    1 
ATOM   460  C C     . GLY A 1 79  ? -91.282  63.982 -7.167  1.00 39.02 ? 77   GLY A C     1 
ATOM   461  O O     . GLY A 1 79  ? -91.478  64.875 -6.340  1.00 39.45 ? 77   GLY A O     1 
ATOM   462  N N     . ASP A 1 80  ? -91.809  64.003 -8.383  1.00 40.54 ? 78   ASP A N     1 
ATOM   463  C CA    . ASP A 1 80  ? -92.703  65.071 -8.793  1.00 41.66 ? 78   ASP A CA    1 
ATOM   464  C C     . ASP A 1 80  ? -93.989  64.938 -7.976  1.00 40.62 ? 78   ASP A C     1 
ATOM   465  O O     . ASP A 1 80  ? -94.526  65.932 -7.488  1.00 40.51 ? 78   ASP A O     1 
ATOM   466  C CB    . ASP A 1 80  ? -93.032  64.958 -10.276 1.00 44.25 ? 78   ASP A CB    1 
ATOM   467  C CG    . ASP A 1 80  ? -94.016  66.007 -10.717 1.00 47.19 ? 78   ASP A CG    1 
ATOM   468  O OD1   . ASP A 1 80  ? -95.022  65.644 -11.367 1.00 49.90 ? 78   ASP A OD1   1 
ATOM   469  O OD2   . ASP A 1 80  ? -93.786  67.196 -10.405 1.00 48.84 ? 78   ASP A OD2   1 
ATOM   470  N N     . GLU A 1 81  ? -94.473  63.706 -7.834  1.00 39.82 ? 79   GLU A N     1 
ATOM   471  C CA    . GLU A 1 81  ? -95.678  63.436 -7.048  1.00 41.02 ? 79   GLU A CA    1 
ATOM   472  C C     . GLU A 1 81  ? -95.493  63.888 -5.600  1.00 40.88 ? 79   GLU A C     1 
ATOM   473  O O     . GLU A 1 81  ? -96.357  64.563 -5.038  1.00 40.97 ? 79   GLU A O     1 
ATOM   474  C CB    . GLU A 1 81  ? -96.011  61.945 -7.043  1.00 41.23 ? 79   GLU A CB    1 
ATOM   475  C CG    . GLU A 1 81  ? -96.657  61.417 -8.298  1.00 43.78 ? 79   GLU A CG    1 
ATOM   476  C CD    . GLU A 1 81  ? -97.086  59.964 -8.137  1.00 46.86 ? 79   GLU A CD    1 
ATOM   477  O OE1   . GLU A 1 81  ? -96.316  59.054 -8.546  1.00 47.99 ? 79   GLU A OE1   1 
ATOM   478  O OE2   . GLU A 1 81  ? -98.189  59.736 -7.576  1.00 47.61 ? 79   GLU A OE2   1 
ATOM   479  N N     . ILE A 1 82  ? -94.365  63.513 -5.002  1.00 40.46 ? 80   ILE A N     1 
ATOM   480  C CA    . ILE A 1 82  ? -94.073  63.884 -3.625  1.00 40.07 ? 80   ILE A CA    1 
ATOM   481  C C     . ILE A 1 82  ? -94.111  65.391 -3.397  1.00 40.54 ? 80   ILE A C     1 
ATOM   482  O O     . ILE A 1 82  ? -94.715  65.858 -2.433  1.00 40.43 ? 80   ILE A O     1 
ATOM   483  C CB    . ILE A 1 82  ? -92.687  63.377 -3.184  1.00 39.92 ? 80   ILE A CB    1 
ATOM   484  C CG1   . ILE A 1 82  ? -92.655  61.847 -3.206  1.00 40.30 ? 80   ILE A CG1   1 
ATOM   485  C CG2   . ILE A 1 82  ? -92.373  63.880 -1.773  1.00 39.43 ? 80   ILE A CG2   1 
ATOM   486  C CD1   . ILE A 1 82  ? -91.278  61.256 -2.883  1.00 40.03 ? 80   ILE A CD1   1 
ATOM   487  N N     . SER A 1 83  ? -93.463  66.145 -4.281  1.00 41.25 ? 81   SER A N     1 
ATOM   488  C CA    . SER A 1 83  ? -93.406  67.602 -4.162  1.00 41.84 ? 81   SER A CA    1 
ATOM   489  C C     . SER A 1 83  ? -94.771  68.264 -4.290  1.00 42.16 ? 81   SER A C     1 
ATOM   490  O O     . SER A 1 83  ? -94.934  69.425 -3.931  1.00 42.26 ? 81   SER A O     1 
ATOM   491  C CB    . SER A 1 83  ? -92.467  68.190 -5.218  1.00 41.43 ? 81   SER A CB    1 
ATOM   492  O OG    . SER A 1 83  ? -92.988  68.021 -6.526  1.00 42.03 ? 81   SER A OG    1 
ATOM   493  N N     . ARG A 1 84  ? -95.742  67.523 -4.810  1.00 42.80 ? 82   ARG A N     1 
ATOM   494  C CA    . ARG A 1 84  ? -97.098  68.030 -4.984  1.00 42.99 ? 82   ARG A CA    1 
ATOM   495  C C     . ARG A 1 84  ? -98.063  67.417 -3.970  1.00 42.63 ? 82   ARG A C     1 
ATOM   496  O O     . ARG A 1 84  ? -99.277  67.583 -4.085  1.00 43.09 ? 82   ARG A O     1 
ATOM   497  C CB    . ARG A 1 84  ? -97.585  67.718 -6.395  1.00 44.85 ? 82   ARG A CB    1 
ATOM   498  C CG    . ARG A 1 84  ? -96.946  68.570 -7.476  1.00 48.86 ? 82   ARG A CG    1 
ATOM   499  C CD    . ARG A 1 84  ? -96.986  67.866 -8.822  1.00 53.06 ? 82   ARG A CD    1 
ATOM   500  N NE    . ARG A 1 84  ? -97.169  68.787 -9.945  1.00 57.44 ? 82   ARG A NE    1 
ATOM   501  C CZ    . ARG A 1 84  ? -96.456  69.894 -10.147 1.00 59.59 ? 82   ARG A CZ    1 
ATOM   502  N NH1   . ARG A 1 84  ? -95.495  70.240 -9.298  1.00 61.78 ? 82   ARG A NH1   1 
ATOM   503  N NH2   . ARG A 1 84  ? -96.703  70.660 -11.204 1.00 60.67 ? 82   ARG A NH2   1 
ATOM   504  N N     . GLY A 1 85  ? -97.533  66.709 -2.978  1.00 41.48 ? 83   GLY A N     1 
ATOM   505  C CA    . GLY A 1 85  ? -98.398  66.092 -1.990  1.00 40.35 ? 83   GLY A CA    1 
ATOM   506  C C     . GLY A 1 85  ? -99.139  64.883 -2.537  1.00 39.94 ? 83   GLY A C     1 
ATOM   507  O O     . GLY A 1 85  ? -100.025 64.357 -1.872  1.00 39.86 ? 83   GLY A O     1 
ATOM   508  N N     . GLY A 1 86  ? -98.775  64.448 -3.744  1.00 39.78 ? 84   GLY A N     1 
ATOM   509  C CA    . GLY A 1 86  ? -99.398  63.286 -4.371  1.00 39.64 ? 84   GLY A CA    1 
ATOM   510  C C     . GLY A 1 86  ? -99.093  61.977 -3.651  1.00 40.31 ? 84   GLY A C     1 
ATOM   511  O O     . GLY A 1 86  ? -99.925  61.059 -3.631  1.00 40.32 ? 84   GLY A O     1 
ATOM   512  N N     . ILE A 1 87  ? -97.890  61.877 -3.085  1.00 39.69 ? 85   ILE A N     1 
ATOM   513  C CA    . ILE A 1 87  ? -97.488  60.698 -2.311  1.00 39.19 ? 85   ILE A CA    1 
ATOM   514  C C     . ILE A 1 87  ? -97.396  61.264 -0.896  1.00 39.51 ? 85   ILE A C     1 
ATOM   515  O O     . ILE A 1 87  ? -96.767  62.305 -0.675  1.00 40.55 ? 85   ILE A O     1 
ATOM   516  C CB    . ILE A 1 87  ? -96.123  60.111 -2.806  1.00 38.22 ? 85   ILE A CB    1 
ATOM   517  C CG1   . ILE A 1 87  ? -96.304  59.554 -4.228  1.00 37.71 ? 85   ILE A CG1   1 
ATOM   518  C CG2   . ILE A 1 87  ? -95.640  59.009 -1.875  1.00 35.38 ? 85   ILE A CG2   1 
ATOM   519  C CD1   . ILE A 1 87  ? -95.133  58.761 -4.774  1.00 35.69 ? 85   ILE A CD1   1 
ATOM   520  N N     . THR A 1 88  ? -98.035  60.598 0.059   1.00 39.46 ? 86   THR A N     1 
ATOM   521  C CA    . THR A 1 88  ? -98.079  61.123 1.414   1.00 38.85 ? 86   THR A CA    1 
ATOM   522  C C     . THR A 1 88  ? -97.464  60.302 2.529   1.00 39.13 ? 86   THR A C     1 
ATOM   523  O O     . THR A 1 88  ? -97.425  60.765 3.672   1.00 39.89 ? 86   THR A O     1 
ATOM   524  C CB    . THR A 1 88  ? -99.530  61.451 1.802   1.00 38.87 ? 86   THR A CB    1 
ATOM   525  O OG1   . THR A 1 88  ? -100.291 60.240 1.881   1.00 40.02 ? 86   THR A OG1   1 
ATOM   526  C CG2   . THR A 1 88  ? -100.156 62.345 0.751   1.00 38.54 ? 86   THR A CG2   1 
ATOM   527  N N     . SER A 1 89  ? -96.995  59.093 2.225   1.00 38.01 ? 87   SER A N     1 
ATOM   528  C CA    . SER A 1 89  ? -96.339  58.263 3.247   1.00 37.17 ? 87   SER A CA    1 
ATOM   529  C C     . SER A 1 89  ? -95.234  57.429 2.598   1.00 35.69 ? 87   SER A C     1 
ATOM   530  O O     . SER A 1 89  ? -95.173  57.330 1.375   1.00 36.05 ? 87   SER A O     1 
ATOM   531  C CB    . SER A 1 89  ? -97.349  57.336 3.925   1.00 35.96 ? 87   SER A CB    1 
ATOM   532  O OG    . SER A 1 89  ? -97.856  56.401 2.988   1.00 38.44 ? 87   SER A OG    1 
ATOM   533  N N     . PHE A 1 90  ? -94.363  56.836 3.406   1.00 34.88 ? 88   PHE A N     1 
ATOM   534  C CA    . PHE A 1 90  ? -93.290  56.006 2.863   1.00 34.95 ? 88   PHE A CA    1 
ATOM   535  C C     . PHE A 1 90  ? -93.910  54.773 2.210   1.00 35.12 ? 88   PHE A C     1 
ATOM   536  O O     . PHE A 1 90  ? -93.535  54.384 1.109   1.00 34.59 ? 88   PHE A O     1 
ATOM   537  C CB    . PHE A 1 90  ? -92.317  55.550 3.953   1.00 33.21 ? 88   PHE A CB    1 
ATOM   538  C CG    . PHE A 1 90  ? -91.173  54.739 3.416   1.00 32.26 ? 88   PHE A CG    1 
ATOM   539  C CD1   . PHE A 1 90  ? -90.075  55.363 2.831   1.00 32.37 ? 88   PHE A CD1   1 
ATOM   540  C CD2   . PHE A 1 90  ? -91.243  53.358 3.392   1.00 31.57 ? 88   PHE A CD2   1 
ATOM   541  C CE1   . PHE A 1 90  ? -89.072  54.621 2.223   1.00 31.44 ? 88   PHE A CE1   1 
ATOM   542  C CE2   . PHE A 1 90  ? -90.248  52.609 2.786   1.00 32.43 ? 88   PHE A CE2   1 
ATOM   543  C CZ    . PHE A 1 90  ? -89.163  53.239 2.200   1.00 32.22 ? 88   PHE A CZ    1 
ATOM   544  N N     . GLU A 1 91  ? -94.859  54.172 2.915   1.00 36.19 ? 89   GLU A N     1 
ATOM   545  C CA    . GLU A 1 91  ? -95.583  53.000 2.444   1.00 38.71 ? 89   GLU A CA    1 
ATOM   546  C C     . GLU A 1 91  ? -96.147  53.234 1.034   1.00 38.01 ? 89   GLU A C     1 
ATOM   547  O O     . GLU A 1 91  ? -96.192  52.329 0.203   1.00 37.87 ? 89   GLU A O     1 
ATOM   548  C CB    . GLU A 1 91  ? -96.719  52.693 3.426   1.00 41.35 ? 89   GLU A CB    1 
ATOM   549  C CG    . GLU A 1 91  ? -97.731  51.665 2.954   1.00 46.75 ? 89   GLU A CG    1 
ATOM   550  C CD    . GLU A 1 91  ? -98.819  51.391 3.993   1.00 51.02 ? 89   GLU A CD    1 
ATOM   551  O OE1   . GLU A 1 91  ? -99.680  50.521 3.735   1.00 53.15 ? 89   GLU A OE1   1 
ATOM   552  O OE2   . GLU A 1 91  ? -98.815  52.039 5.069   1.00 52.32 ? 89   GLU A OE2   1 
ATOM   553  N N     . GLU A 1 92  ? -96.571  54.460 0.772   1.00 37.52 ? 90   GLU A N     1 
ATOM   554  C CA    . GLU A 1 92  ? -97.126  54.798 -0.527  1.00 37.08 ? 90   GLU A CA    1 
ATOM   555  C C     . GLU A 1 92  ? -96.005  54.854 -1.563  1.00 34.35 ? 90   GLU A C     1 
ATOM   556  O O     . GLU A 1 92  ? -96.167  54.394 -2.692  1.00 32.27 ? 90   GLU A O     1 
ATOM   557  C CB    . GLU A 1 92  ? -97.844  56.142 -0.441  1.00 39.73 ? 90   GLU A CB    1 
ATOM   558  C CG    . GLU A 1 92  ? -98.986  56.292 -1.419  1.00 44.39 ? 90   GLU A CG    1 
ATOM   559  C CD    . GLU A 1 92  ? -99.716  57.623 -1.267  1.00 47.51 ? 90   GLU A CD    1 
ATOM   560  O OE1   . GLU A 1 92  ? -99.981  58.047 -0.113  1.00 46.90 ? 90   GLU A OE1   1 
ATOM   561  O OE2   . GLU A 1 92  ? -100.033 58.231 -2.315  1.00 49.53 ? 90   GLU A OE2   1 
ATOM   562  N N     . LEU A 1 93  ? -94.871  55.432 -1.170  1.00 32.30 ? 91   LEU A N     1 
ATOM   563  C CA    . LEU A 1 93  ? -93.712  55.525 -2.051  1.00 30.16 ? 91   LEU A CA    1 
ATOM   564  C C     . LEU A 1 93  ? -93.202  54.108 -2.362  1.00 30.14 ? 91   LEU A C     1 
ATOM   565  O O     . LEU A 1 93  ? -92.909  53.784 -3.515  1.00 29.30 ? 91   LEU A O     1 
ATOM   566  C CB    . LEU A 1 93  ? -92.624  56.371 -1.387  1.00 29.23 ? 91   LEU A CB    1 
ATOM   567  C CG    . LEU A 1 93  ? -91.327  56.569 -2.170  1.00 30.12 ? 91   LEU A CG    1 
ATOM   568  C CD1   . LEU A 1 93  ? -91.632  57.007 -3.602  1.00 30.76 ? 91   LEU A CD1   1 
ATOM   569  C CD2   . LEU A 1 93  ? -90.461  57.597 -1.456  1.00 29.90 ? 91   LEU A CD2   1 
ATOM   570  N N     . TRP A 1 94  ? -93.132  53.259 -1.338  1.00 29.50 ? 92   TRP A N     1 
ATOM   571  C CA    . TRP A 1 94  ? -92.688  51.885 -1.518  1.00 30.57 ? 92   TRP A CA    1 
ATOM   572  C C     . TRP A 1 94  ? -93.620  51.158 -2.493  1.00 30.70 ? 92   TRP A C     1 
ATOM   573  O O     . TRP A 1 94  ? -93.194  50.253 -3.234  1.00 31.23 ? 92   TRP A O     1 
ATOM   574  C CB    . TRP A 1 94  ? -92.667  51.161 -0.161  1.00 32.06 ? 92   TRP A CB    1 
ATOM   575  C CG    . TRP A 1 94  ? -92.082  49.766 -0.213  1.00 33.08 ? 92   TRP A CG    1 
ATOM   576  C CD1   . TRP A 1 94  ? -92.766  48.587 -0.342  1.00 33.38 ? 92   TRP A CD1   1 
ATOM   577  C CD2   . TRP A 1 94  ? -90.697  49.417 -0.120  1.00 32.52 ? 92   TRP A CD2   1 
ATOM   578  N NE1   . TRP A 1 94  ? -91.889  47.523 -0.328  1.00 32.63 ? 92   TRP A NE1   1 
ATOM   579  C CE2   . TRP A 1 94  ? -90.614  48.007 -0.191  1.00 33.28 ? 92   TRP A CE2   1 
ATOM   580  C CE3   . TRP A 1 94  ? -89.516  50.157 0.020   1.00 33.10 ? 92   TRP A CE3   1 
ATOM   581  C CZ2   . TRP A 1 94  ? -89.391  47.326 -0.122  1.00 33.63 ? 92   TRP A CZ2   1 
ATOM   582  C CZ3   . TRP A 1 94  ? -88.298  49.479 0.086   1.00 31.43 ? 92   TRP A CZ3   1 
ATOM   583  C CH2   . TRP A 1 94  ? -88.248  48.081 0.017   1.00 31.87 ? 92   TRP A CH2   1 
ATOM   584  N N     . GLY A 1 95  ? -94.894  51.556 -2.487  1.00 30.08 ? 93   GLY A N     1 
ATOM   585  C CA    . GLY A 1 95  ? -95.873  50.958 -3.384  1.00 28.05 ? 93   GLY A CA    1 
ATOM   586  C C     . GLY A 1 95  ? -95.630  51.388 -4.815  1.00 28.03 ? 93   GLY A C     1 
ATOM   587  O O     . GLY A 1 95  ? -95.751  50.597 -5.747  1.00 29.27 ? 93   GLY A O     1 
ATOM   588  N N     . ARG A 1 96  ? -95.291  52.653 -5.011  1.00 28.17 ? 94   ARG A N     1 
ATOM   589  C CA    . ARG A 1 96  ? -95.013  53.116 -6.356  1.00 29.74 ? 94   ARG A CA    1 
ATOM   590  C C     . ARG A 1 96  ? -93.720  52.433 -6.824  1.00 30.14 ? 94   ARG A C     1 
ATOM   591  O O     . ARG A 1 96  ? -93.573  52.089 -7.998  1.00 29.59 ? 94   ARG A O     1 
ATOM   592  C CB    . ARG A 1 96  ? -94.840  54.634 -6.380  1.00 30.62 ? 94   ARG A CB    1 
ATOM   593  C CG    . ARG A 1 96  ? -94.577  55.185 -7.775  1.00 33.06 ? 94   ARG A CG    1 
ATOM   594  C CD    . ARG A 1 96  ? -95.866  55.329 -8.604  1.00 34.98 ? 94   ARG A CD    1 
ATOM   595  N NE    . ARG A 1 96  ? -96.755  56.336 -8.019  1.00 36.51 ? 94   ARG A NE    1 
ATOM   596  C CZ    . ARG A 1 96  ? -97.713  56.067 -7.137  1.00 36.64 ? 94   ARG A CZ    1 
ATOM   597  N NH1   . ARG A 1 96  ? -98.463  57.045 -6.647  1.00 36.38 ? 94   ARG A NH1   1 
ATOM   598  N NH2   . ARG A 1 96  ? -97.937  54.816 -6.762  1.00 36.60 ? 94   ARG A NH2   1 
ATOM   599  N N     . ALA A 1 97  ? -92.782  52.242 -5.896  1.00 30.40 ? 95   ALA A N     1 
ATOM   600  C CA    . ALA A 1 97  ? -91.528  51.582 -6.231  1.00 30.46 ? 95   ALA A CA    1 
ATOM   601  C C     . ALA A 1 97  ? -91.810  50.122 -6.617  1.00 30.12 ? 95   ALA A C     1 
ATOM   602  O O     . ALA A 1 97  ? -91.233  49.603 -7.561  1.00 29.53 ? 95   ALA A O     1 
ATOM   603  C CB    . ALA A 1 97  ? -90.553  51.640 -5.051  1.00 29.63 ? 95   ALA A CB    1 
ATOM   604  N N     . THR A 1 98  ? -92.700  49.460 -5.888  1.00 30.19 ? 96   THR A N     1 
ATOM   605  C CA    . THR A 1 98  ? -93.017  48.075 -6.210  1.00 30.78 ? 96   THR A CA    1 
ATOM   606  C C     . THR A 1 98  ? -93.719  47.938 -7.562  1.00 31.20 ? 96   THR A C     1 
ATOM   607  O O     . THR A 1 98  ? -93.374  47.069 -8.363  1.00 31.27 ? 96   THR A O     1 
ATOM   608  C CB    . THR A 1 98  ? -93.886  47.440 -5.112  1.00 30.51 ? 96   THR A CB    1 
ATOM   609  O OG1   . THR A 1 98  ? -93.147  47.423 -3.890  1.00 32.12 ? 96   THR A OG1   1 
ATOM   610  C CG2   . THR A 1 98  ? -94.269  46.025 -5.473  1.00 29.43 ? 96   THR A CG2   1 
ATOM   611  N N     . GLU A 1 99  ? -94.696  48.792 -7.836  1.00 32.99 ? 97   GLU A N     1 
ATOM   612  C CA    . GLU A 1 99  ? -95.386  48.701 -9.123  1.00 33.84 ? 97   GLU A CA    1 
ATOM   613  C C     . GLU A 1 99  ? -94.443  48.962 -10.297 1.00 33.36 ? 97   GLU A C     1 
ATOM   614  O O     . GLU A 1 99  ? -94.586  48.352 -11.348 1.00 34.68 ? 97   GLU A O     1 
ATOM   615  C CB    . GLU A 1 99  ? -96.601  49.638 -9.157  1.00 32.58 ? 97   GLU A CB    1 
ATOM   616  C CG    . GLU A 1 99  ? -97.667  49.197 -8.163  1.00 36.68 ? 97   GLU A CG    1 
ATOM   617  C CD    . GLU A 1 99  ? -99.007  49.905 -8.323  1.00 37.62 ? 97   GLU A CD    1 
ATOM   618  O OE1   . GLU A 1 99  ? -99.614  49.812 -9.408  1.00 40.32 ? 97   GLU A OE1   1 
ATOM   619  O OE2   . GLU A 1 99  ? -99.455  50.548 -7.358  1.00 38.98 ? 97   GLU A OE2   1 
ATOM   620  N N     . TRP A 1 100 ? -93.473  49.852 -10.134 1.00 33.74 ? 98   TRP A N     1 
ATOM   621  C CA    . TRP A 1 100 ? -92.535  50.098 -11.225 1.00 34.09 ? 98   TRP A CA    1 
ATOM   622  C C     . TRP A 1 100 ? -91.709  48.826 -11.423 1.00 34.60 ? 98   TRP A C     1 
ATOM   623  O O     . TRP A 1 100 ? -91.487  48.368 -12.553 1.00 34.09 ? 98   TRP A O     1 
ATOM   624  C CB    . TRP A 1 100 ? -91.587  51.248 -10.889 1.00 35.12 ? 98   TRP A CB    1 
ATOM   625  C CG    . TRP A 1 100 ? -90.410  51.271 -11.806 1.00 37.30 ? 98   TRP A CG    1 
ATOM   626  C CD1   . TRP A 1 100 ? -90.368  51.772 -13.072 1.00 38.42 ? 98   TRP A CD1   1 
ATOM   627  C CD2   . TRP A 1 100 ? -89.138  50.650 -11.580 1.00 38.19 ? 98   TRP A CD2   1 
ATOM   628  N NE1   . TRP A 1 100 ? -89.150  51.496 -13.653 1.00 38.96 ? 98   TRP A NE1   1 
ATOM   629  C CE2   . TRP A 1 100 ? -88.379  50.805 -12.757 1.00 38.44 ? 98   TRP A CE2   1 
ATOM   630  C CE3   . TRP A 1 100 ? -88.570  49.972 -10.493 1.00 38.36 ? 98   TRP A CE3   1 
ATOM   631  C CZ2   . TRP A 1 100 ? -87.078  50.303 -12.883 1.00 40.46 ? 98   TRP A CZ2   1 
ATOM   632  C CZ3   . TRP A 1 100 ? -87.284  49.476 -10.613 1.00 38.68 ? 98   TRP A CZ3   1 
ATOM   633  C CH2   . TRP A 1 100 ? -86.548  49.641 -11.804 1.00 40.07 ? 98   TRP A CH2   1 
ATOM   634  N N     . ARG A 1 101 ? -91.251  48.268 -10.306 1.00 33.73 ? 99   ARG A N     1 
ATOM   635  C CA    . ARG A 1 101 ? -90.452  47.060 -10.319 1.00 34.49 ? 99   ARG A CA    1 
ATOM   636  C C     . ARG A 1 101 ? -91.167  45.890 -10.986 1.00 34.46 ? 99   ARG A C     1 
ATOM   637  O O     . ARG A 1 101 ? -90.581  45.177 -11.795 1.00 34.32 ? 99   ARG A O     1 
ATOM   638  C CB    . ARG A 1 101 ? -90.067  46.676 -8.890  1.00 35.24 ? 99   ARG A CB    1 
ATOM   639  C CG    . ARG A 1 101 ? -89.282  45.394 -8.820  1.00 35.13 ? 99   ARG A CG    1 
ATOM   640  C CD    . ARG A 1 101 ? -87.968  45.558 -9.539  1.00 37.07 ? 99   ARG A CD    1 
ATOM   641  N NE    . ARG A 1 101 ? -87.679  44.396 -10.369 1.00 40.98 ? 99   ARG A NE    1 
ATOM   642  C CZ    . ARG A 1 101 ? -86.479  43.851 -10.461 1.00 41.29 ? 99   ARG A CZ    1 
ATOM   643  N NH1   . ARG A 1 101 ? -85.491  44.387 -9.762  1.00 43.64 ? 99   ARG A NH1   1 
ATOM   644  N NH2   . ARG A 1 101 ? -86.266  42.792 -11.232 1.00 39.64 ? 99   ARG A NH2   1 
ATOM   645  N N     . LEU A 1 102 ? -92.429  45.690 -10.629 1.00 35.18 ? 100  LEU A N     1 
ATOM   646  C CA    . LEU A 1 102 ? -93.229  44.611 -11.200 1.00 36.55 ? 100  LEU A CA    1 
ATOM   647  C C     . LEU A 1 102 ? -93.435  44.766 -12.706 1.00 36.54 ? 100  LEU A C     1 
ATOM   648  O O     . LEU A 1 102 ? -93.622  43.778 -13.411 1.00 35.35 ? 100  LEU A O     1 
ATOM   649  C CB    . LEU A 1 102 ? -94.596  44.551 -10.520 1.00 37.02 ? 100  LEU A CB    1 
ATOM   650  C CG    . LEU A 1 102 ? -94.674  44.057 -9.081  1.00 37.27 ? 100  LEU A CG    1 
ATOM   651  C CD1   . LEU A 1 102 ? -96.059  44.349 -8.536  1.00 37.57 ? 100  LEU A CD1   1 
ATOM   652  C CD2   . LEU A 1 102 ? -94.383  42.563 -9.032  1.00 37.58 ? 100  LEU A CD2   1 
ATOM   653  N N     . SER A 1 103 ? -93.404  46.001 -13.196 1.00 37.37 ? 101  SER A N     1 
ATOM   654  C CA    . SER A 1 103 ? -93.605  46.243 -14.618 1.00 39.94 ? 101  SER A CA    1 
ATOM   655  C C     . SER A 1 103 ? -92.435  45.759 -15.467 1.00 41.69 ? 101  SER A C     1 
ATOM   656  O O     . SER A 1 103 ? -92.539  45.680 -16.686 1.00 41.63 ? 101  SER A O     1 
ATOM   657  C CB    . SER A 1 103 ? -93.841  47.736 -14.881 1.00 38.79 ? 101  SER A CB    1 
ATOM   658  O OG    . SER A 1 103 ? -92.641  48.476 -14.800 1.00 39.02 ? 101  SER A OG    1 
ATOM   659  N N     . LYS A 1 104 ? -91.315  45.447 -14.825 1.00 44.93 ? 102  LYS A N     1 
ATOM   660  C CA    . LYS A 1 104 ? -90.142  44.978 -15.554 1.00 46.93 ? 102  LYS A CA    1 
ATOM   661  C C     . LYS A 1 104 ? -90.085  43.467 -15.598 1.00 49.07 ? 102  LYS A C     1 
ATOM   662  O O     . LYS A 1 104 ? -89.197  42.901 -16.222 1.00 49.51 ? 102  LYS A O     1 
ATOM   663  C CB    . LYS A 1 104 ? -88.865  45.508 -14.914 1.00 46.44 ? 102  LYS A CB    1 
ATOM   664  C CG    . LYS A 1 104 ? -88.787  47.012 -14.874 1.00 47.24 ? 102  LYS A CG    1 
ATOM   665  C CD    . LYS A 1 104 ? -88.917  47.603 -16.260 1.00 47.99 ? 102  LYS A CD    1 
ATOM   666  C CE    . LYS A 1 104 ? -89.079  49.103 -16.190 1.00 48.95 ? 102  LYS A CE    1 
ATOM   667  N NZ    . LYS A 1 104 ? -89.289  49.694 -17.537 1.00 50.00 ? 102  LYS A NZ    1 
ATOM   668  N N     . LEU A 1 105 ? -91.032  42.817 -14.930 1.00 52.15 ? 103  LEU A N     1 
ATOM   669  C CA    . LEU A 1 105 ? -91.091  41.362 -14.904 1.00 55.90 ? 103  LEU A CA    1 
ATOM   670  C C     . LEU A 1 105 ? -91.752  40.817 -16.166 1.00 59.25 ? 103  LEU A C     1 
ATOM   671  O O     . LEU A 1 105 ? -92.766  41.351 -16.633 1.00 59.64 ? 103  LEU A O     1 
ATOM   672  C CB    . LEU A 1 105 ? -91.865  40.876 -13.676 1.00 54.64 ? 103  LEU A CB    1 
ATOM   673  C CG    . LEU A 1 105 ? -91.155  40.999 -12.326 1.00 54.60 ? 103  LEU A CG    1 
ATOM   674  C CD1   . LEU A 1 105 ? -92.014  40.376 -11.240 1.00 53.50 ? 103  LEU A CD1   1 
ATOM   675  C CD2   . LEU A 1 105 ? -89.808  40.299 -12.396 1.00 53.29 ? 103  LEU A CD2   1 
ATOM   676  N N     . GLN A 1 106 ? -91.173  39.747 -16.709 1.00 62.61 ? 104  GLN A N     1 
ATOM   677  C CA    . GLN A 1 106 ? -91.694  39.113 -17.914 1.00 65.55 ? 104  GLN A CA    1 
ATOM   678  C C     . GLN A 1 106 ? -93.067  38.504 -17.640 1.00 67.08 ? 104  GLN A C     1 
ATOM   679  O O     . GLN A 1 106 ? -93.305  37.952 -16.565 1.00 67.53 ? 104  GLN A O     1 
ATOM   680  C CB    . GLN A 1 106 ? -90.728  38.028 -18.395 1.00 66.76 ? 104  GLN A CB    1 
ATOM   681  C CG    . GLN A 1 106 ? -90.281  38.203 -19.838 1.00 69.33 ? 104  GLN A CG    1 
ATOM   682  C CD    . GLN A 1 106 ? -89.581  39.535 -20.078 1.00 70.68 ? 104  GLN A CD    1 
ATOM   683  O OE1   . GLN A 1 106 ? -88.478  39.774 -19.575 1.00 70.53 ? 104  GLN A OE1   1 
ATOM   684  N NE2   . GLN A 1 106 ? -90.227  40.415 -20.844 1.00 70.86 ? 104  GLN A NE2   1 
ATOM   685  N N     . ARG A 1 107 ? -93.962  38.617 -18.620 1.00 68.72 ? 105  ARG A N     1 
ATOM   686  C CA    . ARG A 1 107 ? -95.326  38.098 -18.520 1.00 70.08 ? 105  ARG A CA    1 
ATOM   687  C C     . ARG A 1 107 ? -95.395  36.661 -17.998 1.00 70.13 ? 105  ARG A C     1 
ATOM   688  O O     . ARG A 1 107 ? -94.599  35.802 -18.391 1.00 70.30 ? 105  ARG A O     1 
ATOM   689  C CB    . ARG A 1 107 ? -96.012  38.184 -19.892 1.00 72.06 ? 105  ARG A CB    1 
ATOM   690  C CG    . ARG A 1 107 ? -97.346  37.436 -19.999 1.00 74.04 ? 105  ARG A CG    1 
ATOM   691  C CD    . ARG A 1 107 ? -97.867  37.445 -21.439 1.00 75.62 ? 105  ARG A CD    1 
ATOM   692  N NE    . ARG A 1 107 ? -98.949  36.483 -21.661 1.00 76.90 ? 105  ARG A NE    1 
ATOM   693  C CZ    . ARG A 1 107 ? -98.816  35.160 -21.566 1.00 77.42 ? 105  ARG A CZ    1 
ATOM   694  N NH1   . ARG A 1 107 ? -97.642  34.627 -21.251 1.00 77.85 ? 105  ARG A NH1   1 
ATOM   695  N NH2   . ARG A 1 107 ? -99.855  34.365 -21.792 1.00 77.41 ? 105  ARG A NH2   1 
ATOM   696  N N     . GLY A 1 108 ? -96.358  36.412 -17.113 1.00 69.72 ? 106  GLY A N     1 
ATOM   697  C CA    . GLY A 1 108 ? -96.539  35.088 -16.541 1.00 68.88 ? 106  GLY A CA    1 
ATOM   698  C C     . GLY A 1 108 ? -95.404  34.640 -15.638 1.00 68.33 ? 106  GLY A C     1 
ATOM   699  O O     . GLY A 1 108 ? -95.190  33.442 -15.455 1.00 68.85 ? 106  GLY A O     1 
ATOM   700  N N     . GLU A 1 109 ? -94.675  35.597 -15.072 1.00 67.27 ? 107  GLU A N     1 
ATOM   701  C CA    . GLU A 1 109 ? -93.554  35.286 -14.187 1.00 65.47 ? 107  GLU A CA    1 
ATOM   702  C C     . GLU A 1 109 ? -94.045  34.605 -12.905 1.00 63.12 ? 107  GLU A C     1 
ATOM   703  O O     . GLU A 1 109 ? -94.957  35.093 -12.238 1.00 63.16 ? 107  GLU A O     1 
ATOM   704  C CB    . GLU A 1 109 ? -92.795  36.570 -13.837 1.00 65.90 ? 107  GLU A CB    1 
ATOM   705  C CG    . GLU A 1 109 ? -91.314  36.530 -14.162 1.00 68.27 ? 107  GLU A CG    1 
ATOM   706  C CD    . GLU A 1 109 ? -90.600  35.361 -13.505 1.00 69.51 ? 107  GLU A CD    1 
ATOM   707  O OE1   . GLU A 1 109 ? -90.666  35.238 -12.266 1.00 70.07 ? 107  GLU A OE1   1 
ATOM   708  O OE2   . GLU A 1 109 ? -89.972  34.560 -14.228 1.00 71.17 ? 107  GLU A OE2   1 
ATOM   709  N N     . PRO A 1 110 ? -93.454  33.455 -12.553 1.00 61.15 ? 108  PRO A N     1 
ATOM   710  C CA    . PRO A 1 110 ? -93.889  32.765 -11.333 1.00 59.37 ? 108  PRO A CA    1 
ATOM   711  C C     . PRO A 1 110 ? -93.392  33.463 -10.069 1.00 57.27 ? 108  PRO A C     1 
ATOM   712  O O     . PRO A 1 110 ? -93.904  33.228 -8.973  1.00 56.16 ? 108  PRO A O     1 
ATOM   713  C CB    . PRO A 1 110 ? -93.310  31.362 -11.507 1.00 59.73 ? 108  PRO A CB    1 
ATOM   714  C CG    . PRO A 1 110 ? -92.050  31.619 -12.291 1.00 60.56 ? 108  PRO A CG    1 
ATOM   715  C CD    . PRO A 1 110 ? -92.498  32.633 -13.316 1.00 60.85 ? 108  PRO A CD    1 
ATOM   716  N N     . LEU A 1 111 ? -92.400  34.333 -10.240 1.00 55.13 ? 109  LEU A N     1 
ATOM   717  C CA    . LEU A 1 111 ? -91.820  35.079 -9.131  1.00 53.29 ? 109  LEU A CA    1 
ATOM   718  C C     . LEU A 1 111 ? -92.536  36.390 -8.886  1.00 52.26 ? 109  LEU A C     1 
ATOM   719  O O     . LEU A 1 111 ? -92.275  37.068 -7.897  1.00 52.36 ? 109  LEU A O     1 
ATOM   720  C CB    . LEU A 1 111 ? -90.352  35.378 -9.407  1.00 53.23 ? 109  LEU A CB    1 
ATOM   721  C CG    . LEU A 1 111 ? -89.433  34.168 -9.467  1.00 52.62 ? 109  LEU A CG    1 
ATOM   722  C CD1   . LEU A 1 111 ? -88.023  34.638 -9.774  1.00 53.26 ? 109  LEU A CD1   1 
ATOM   723  C CD2   . LEU A 1 111 ? -89.494  33.418 -8.144  1.00 52.42 ? 109  LEU A CD2   1 
ATOM   724  N N     . TYR A 1 112 ? -93.432  36.742 -9.800  1.00 51.02 ? 110  TYR A N     1 
ATOM   725  C CA    . TYR A 1 112 ? -94.198  37.981 -9.718  1.00 48.95 ? 110  TYR A CA    1 
ATOM   726  C C     . TYR A 1 112 ? -94.720  38.263 -8.312  1.00 47.95 ? 110  TYR A C     1 
ATOM   727  O O     . TYR A 1 112 ? -94.608  39.375 -7.810  1.00 48.40 ? 110  TYR A O     1 
ATOM   728  C CB    . TYR A 1 112 ? -95.382  37.911 -10.681 1.00 48.18 ? 110  TYR A CB    1 
ATOM   729  C CG    . TYR A 1 112 ? -96.142  39.205 -10.821 1.00 46.43 ? 110  TYR A CG    1 
ATOM   730  C CD1   . TYR A 1 112 ? -95.809  40.121 -11.818 1.00 46.65 ? 110  TYR A CD1   1 
ATOM   731  C CD2   . TYR A 1 112 ? -97.183  39.523 -9.949  1.00 45.39 ? 110  TYR A CD2   1 
ATOM   732  C CE1   . TYR A 1 112 ? -96.496  41.324 -11.945 1.00 46.62 ? 110  TYR A CE1   1 
ATOM   733  C CE2   . TYR A 1 112 ? -97.873  40.722 -10.064 1.00 45.68 ? 110  TYR A CE2   1 
ATOM   734  C CZ    . TYR A 1 112 ? -97.521  41.617 -11.065 1.00 46.32 ? 110  TYR A CZ    1 
ATOM   735  O OH    . TYR A 1 112 ? -98.178  42.819 -11.177 1.00 48.41 ? 110  TYR A OH    1 
ATOM   736  N N     . SER A 1 113 ? -95.289  37.243 -7.689  1.00 47.09 ? 111  SER A N     1 
ATOM   737  C CA    . SER A 1 113 ? -95.870  37.356 -6.360  1.00 46.85 ? 111  SER A CA    1 
ATOM   738  C C     . SER A 1 113 ? -94.846  37.683 -5.272  1.00 45.58 ? 111  SER A C     1 
ATOM   739  O O     . SER A 1 113 ? -95.136  38.420 -4.335  1.00 45.31 ? 111  SER A O     1 
ATOM   740  C CB    . SER A 1 113 ? -96.611  36.052 -6.026  1.00 48.14 ? 111  SER A CB    1 
ATOM   741  O OG    . SER A 1 113 ? -97.261  36.131 -4.771  1.00 51.25 ? 111  SER A OG    1 
ATOM   742  N N     . ALA A 1 114 ? -93.651  37.124 -5.391  1.00 44.35 ? 112  ALA A N     1 
ATOM   743  C CA    . ALA A 1 114 ? -92.590  37.388 -4.425  1.00 43.16 ? 112  ALA A CA    1 
ATOM   744  C C     . ALA A 1 114 ? -92.125  38.845 -4.547  1.00 41.33 ? 112  ALA A C     1 
ATOM   745  O O     . ALA A 1 114 ? -91.779  39.479 -3.550  1.00 39.97 ? 112  ALA A O     1 
ATOM   746  C CB    . ALA A 1 114 ? -91.406  36.419 -4.656  1.00 43.35 ? 112  ALA A CB    1 
ATOM   747  N N     . PHE A 1 115 ? -92.120  39.369 -5.771  1.00 40.18 ? 113  PHE A N     1 
ATOM   748  C CA    . PHE A 1 115 ? -91.727  40.756 -5.990  1.00 40.43 ? 113  PHE A CA    1 
ATOM   749  C C     . PHE A 1 115 ? -92.830  41.731 -5.562  1.00 40.64 ? 113  PHE A C     1 
ATOM   750  O O     . PHE A 1 115 ? -92.578  42.921 -5.378  1.00 39.77 ? 113  PHE A O     1 
ATOM   751  C CB    . PHE A 1 115 ? -91.382  41.015 -7.460  1.00 39.74 ? 113  PHE A CB    1 
ATOM   752  C CG    . PHE A 1 115 ? -90.004  40.580 -7.849  1.00 40.42 ? 113  PHE A CG    1 
ATOM   753  C CD1   . PHE A 1 115 ? -89.753  39.267 -8.243  1.00 40.10 ? 113  PHE A CD1   1 
ATOM   754  C CD2   . PHE A 1 115 ? -88.944  41.483 -7.803  1.00 41.00 ? 113  PHE A CD2   1 
ATOM   755  C CE1   . PHE A 1 115 ? -88.466  38.858 -8.591  1.00 39.62 ? 113  PHE A CE1   1 
ATOM   756  C CE2   . PHE A 1 115 ? -87.643  41.082 -8.151  1.00 40.88 ? 113  PHE A CE2   1 
ATOM   757  C CZ    . PHE A 1 115 ? -87.409  39.766 -8.543  1.00 39.88 ? 113  PHE A CZ    1 
ATOM   758  N N     . ALA A 1 116 ? -94.051  41.238 -5.392  1.00 40.33 ? 114  ALA A N     1 
ATOM   759  C CA    . ALA A 1 116 ? -95.135  42.130 -4.998  1.00 41.89 ? 114  ALA A CA    1 
ATOM   760  C C     . ALA A 1 116 ? -95.506  42.001 -3.533  1.00 42.83 ? 114  ALA A C     1 
ATOM   761  O O     . ALA A 1 116 ? -96.228  42.843 -2.997  1.00 43.35 ? 114  ALA A O     1 
ATOM   762  C CB    . ALA A 1 116 ? -96.374  41.875 -5.871  1.00 40.31 ? 114  ALA A CB    1 
ATOM   763  N N     . SER A 1 117 ? -94.985  40.972 -2.876  1.00 43.66 ? 115  SER A N     1 
ATOM   764  C CA    . SER A 1 117 ? -95.329  40.718 -1.485  1.00 44.48 ? 115  SER A CA    1 
ATOM   765  C C     . SER A 1 117 ? -94.313  41.044 -0.400  1.00 45.20 ? 115  SER A C     1 
ATOM   766  O O     . SER A 1 117 ? -93.103  40.949 -0.592  1.00 45.40 ? 115  SER A O     1 
ATOM   767  C CB    . SER A 1 117 ? -95.732  39.254 -1.337  1.00 44.47 ? 115  SER A CB    1 
ATOM   768  O OG    . SER A 1 117 ? -96.710  38.919 -2.303  1.00 46.00 ? 115  SER A OG    1 
ATOM   769  N N     . GLU A 1 118 ? -94.836  41.408 0.762   1.00 46.10 ? 116  GLU A N     1 
ATOM   770  C CA    . GLU A 1 118 ? -94.005  41.710 1.907   1.00 46.74 ? 116  GLU A CA    1 
ATOM   771  C C     . GLU A 1 118 ? -93.603  40.372 2.528   1.00 46.34 ? 116  GLU A C     1 
ATOM   772  O O     . GLU A 1 118 ? -94.329  39.378 2.440   1.00 45.96 ? 116  GLU A O     1 
ATOM   773  C CB    . GLU A 1 118 ? -94.770  42.568 2.918   1.00 48.05 ? 116  GLU A CB    1 
ATOM   774  C CG    . GLU A 1 118 ? -93.935  42.976 4.132   1.00 52.82 ? 116  GLU A CG    1 
ATOM   775  C CD    . GLU A 1 118 ? -94.532  44.149 4.906   1.00 54.73 ? 116  GLU A CD    1 
ATOM   776  O OE1   . GLU A 1 118 ? -94.490  45.294 4.394   1.00 55.89 ? 116  GLU A OE1   1 
ATOM   777  O OE2   . GLU A 1 118 ? -95.042  43.920 6.024   1.00 55.42 ? 116  GLU A OE2   1 
ATOM   778  N N     . ARG A 1 119 ? -92.430  40.363 3.141   1.00 45.76 ? 117  ARG A N     1 
ATOM   779  C CA    . ARG A 1 119 ? -91.862  39.182 3.773   1.00 45.75 ? 117  ARG A CA    1 
ATOM   780  C C     . ARG A 1 119 ? -92.572  38.836 5.095   1.00 46.59 ? 117  ARG A C     1 
ATOM   781  O O     . ARG A 1 119 ? -93.024  39.731 5.811   1.00 46.27 ? 117  ARG A O     1 
ATOM   782  C CB    . ARG A 1 119 ? -90.378  39.474 4.004   1.00 44.69 ? 117  ARG A CB    1 
ATOM   783  C CG    . ARG A 1 119 ? -89.477  38.296 4.129   1.00 43.34 ? 117  ARG A CG    1 
ATOM   784  C CD    . ARG A 1 119 ? -88.080  38.659 3.641   1.00 42.22 ? 117  ARG A CD    1 
ATOM   785  N NE    . ARG A 1 119 ? -87.438  39.758 4.368   1.00 39.90 ? 117  ARG A NE    1 
ATOM   786  C CZ    . ARG A 1 119 ? -87.039  39.701 5.638   1.00 39.75 ? 117  ARG A CZ    1 
ATOM   787  N NH1   . ARG A 1 119 ? -86.454  40.757 6.199   1.00 38.90 ? 117  ARG A NH1   1 
ATOM   788  N NH2   . ARG A 1 119 ? -87.234  38.603 6.355   1.00 37.92 ? 117  ARG A NH2   1 
ATOM   789  N N     . THR A 1 120 ? -92.691  37.544 5.404   1.00 48.29 ? 118  THR A N     1 
ATOM   790  C CA    . THR A 1 120 ? -93.317  37.107 6.655   1.00 50.77 ? 118  THR A CA    1 
ATOM   791  C C     . THR A 1 120 ? -92.385  36.173 7.421   1.00 53.07 ? 118  THR A C     1 
ATOM   792  O O     . THR A 1 120 ? -91.325  35.803 6.929   1.00 52.67 ? 118  THR A O     1 
ATOM   793  C CB    . THR A 1 120 ? -94.654  36.360 6.431   1.00 50.37 ? 118  THR A CB    1 
ATOM   794  O OG1   . THR A 1 120 ? -94.403  35.093 5.809   1.00 50.46 ? 118  THR A OG1   1 
ATOM   795  C CG2   . THR A 1 120 ? -95.593  37.191 5.564   1.00 49.86 ? 118  THR A CG2   1 
ATOM   796  N N     . SER A 1 121 ? -92.796  35.790 8.625   1.00 56.91 ? 119  SER A N     1 
ATOM   797  C CA    . SER A 1 121 ? -92.008  34.913 9.490   1.00 60.44 ? 119  SER A CA    1 
ATOM   798  C C     . SER A 1 121 ? -91.613  33.565 8.896   1.00 62.87 ? 119  SER A C     1 
ATOM   799  O O     . SER A 1 121 ? -90.450  33.169 8.970   1.00 63.91 ? 119  SER A O     1 
ATOM   800  C CB    . SER A 1 121 ? -92.748  34.687 10.804  1.00 59.98 ? 119  SER A CB    1 
ATOM   801  O OG    . SER A 1 121 ? -92.865  35.908 11.509  1.00 61.24 ? 119  SER A OG    1 
ATOM   802  N N     . ASP A 1 122 ? -92.568  32.844 8.323   1.00 65.42 ? 120  ASP A N     1 
ATOM   803  C CA    . ASP A 1 122 ? -92.238  31.553 7.733   1.00 67.96 ? 120  ASP A CA    1 
ATOM   804  C C     . ASP A 1 122 ? -91.957  31.680 6.237   1.00 68.95 ? 120  ASP A C     1 
ATOM   805  O O     . ASP A 1 122 ? -92.698  31.153 5.402   1.00 69.63 ? 120  ASP A O     1 
ATOM   806  C CB    . ASP A 1 122 ? -93.363  30.536 7.981   1.00 69.27 ? 120  ASP A CB    1 
ATOM   807  C CG    . ASP A 1 122 ? -94.738  31.074 7.622   1.00 70.48 ? 120  ASP A CG    1 
ATOM   808  O OD1   . ASP A 1 122 ? -94.923  31.544 6.478   1.00 70.47 ? 120  ASP A OD1   1 
ATOM   809  O OD2   . ASP A 1 122 ? -95.638  31.015 8.491   1.00 71.88 ? 120  ASP A OD2   1 
ATOM   810  N N     . THR A 1 123 ? -90.884  32.388 5.903   1.00 69.14 ? 121  THR A N     1 
ATOM   811  C CA    . THR A 1 123 ? -90.504  32.564 4.512   1.00 69.63 ? 121  THR A CA    1 
ATOM   812  C C     . THR A 1 123 ? -88.990  32.750 4.409   1.00 69.35 ? 121  THR A C     1 
ATOM   813  O O     . THR A 1 123 ? -88.303  32.915 5.425   1.00 69.95 ? 121  THR A O     1 
ATOM   814  C CB    . THR A 1 123 ? -91.244  33.777 3.873   1.00 70.44 ? 121  THR A CB    1 
ATOM   815  O OG1   . THR A 1 123 ? -91.183  33.678 2.444   1.00 71.45 ? 121  THR A OG1   1 
ATOM   816  C CG2   . THR A 1 123 ? -90.611  35.089 4.300   1.00 70.63 ? 121  THR A CG2   1 
ATOM   817  N N     . ASP A 1 124 ? -88.482  32.703 3.179   1.00 68.54 ? 122  ASP A N     1 
ATOM   818  C CA    . ASP A 1 124 ? -87.054  32.853 2.899   1.00 67.55 ? 122  ASP A CA    1 
ATOM   819  C C     . ASP A 1 124 ? -86.474  34.108 3.552   1.00 66.21 ? 122  ASP A C     1 
ATOM   820  O O     . ASP A 1 124 ? -87.052  35.197 3.453   1.00 67.43 ? 122  ASP A O     1 
ATOM   821  C CB    . ASP A 1 124 ? -86.835  32.908 1.379   1.00 68.76 ? 122  ASP A CB    1 
ATOM   822  C CG    . ASP A 1 124 ? -85.386  33.208 0.988   1.00 69.75 ? 122  ASP A CG    1 
ATOM   823  O OD1   . ASP A 1 124 ? -85.125  33.375 -0.225  1.00 71.21 ? 122  ASP A OD1   1 
ATOM   824  O OD2   . ASP A 1 124 ? -84.508  33.278 1.873   1.00 69.02 ? 122  ASP A OD2   1 
ATOM   825  N N     . ALA A 1 125 ? -85.335  33.949 4.220   1.00 63.04 ? 123  ALA A N     1 
ATOM   826  C CA    . ALA A 1 125 ? -84.673  35.066 4.870   1.00 59.73 ? 123  ALA A CA    1 
ATOM   827  C C     . ALA A 1 125 ? -83.161  34.884 4.813   1.00 57.57 ? 123  ALA A C     1 
ATOM   828  O O     . ALA A 1 125 ? -82.435  35.425 5.650   1.00 56.95 ? 123  ALA A O     1 
ATOM   829  C CB    . ALA A 1 125 ? -85.136  35.169 6.319   1.00 60.83 ? 123  ALA A CB    1 
ATOM   830  N N     . VAL A 1 126 ? -82.691  34.133 3.817   1.00 54.83 ? 124  VAL A N     1 
ATOM   831  C CA    . VAL A 1 126 ? -81.264  33.858 3.658   1.00 52.56 ? 124  VAL A CA    1 
ATOM   832  C C     . VAL A 1 126 ? -80.719  34.049 2.245   1.00 51.58 ? 124  VAL A C     1 
ATOM   833  O O     . VAL A 1 126 ? -81.386  33.755 1.260   1.00 51.36 ? 124  VAL A O     1 
ATOM   834  C CB    . VAL A 1 126 ? -80.926  32.403 4.092   1.00 52.03 ? 124  VAL A CB    1 
ATOM   835  C CG1   . VAL A 1 126 ? -79.437  32.142 3.940   1.00 50.92 ? 124  VAL A CG1   1 
ATOM   836  C CG2   . VAL A 1 126 ? -81.357  32.171 5.527   1.00 50.86 ? 124  VAL A CG2   1 
ATOM   837  N N     . THR A 1 127 ? -79.491  34.544 2.162   1.00 51.05 ? 125  THR A N     1 
ATOM   838  C CA    . THR A 1 127 ? -78.818  34.734 0.884   1.00 50.36 ? 125  THR A CA    1 
ATOM   839  C C     . THR A 1 127 ? -77.448  34.052 0.926   1.00 50.27 ? 125  THR A C     1 
ATOM   840  O O     . THR A 1 127 ? -76.512  34.553 1.557   1.00 49.01 ? 125  THR A O     1 
ATOM   841  C CB    . THR A 1 127 ? -78.588  36.224 0.550   1.00 50.36 ? 125  THR A CB    1 
ATOM   842  O OG1   . THR A 1 127 ? -79.846  36.864 0.309   1.00 51.30 ? 125  THR A OG1   1 
ATOM   843  C CG2   . THR A 1 127 ? -77.714  36.358 -0.693  1.00 48.98 ? 125  THR A CG2   1 
ATOM   844  N N     . PRO A 1 128 ? -77.325  32.880 0.284   1.00 50.22 ? 126  PRO A N     1 
ATOM   845  C CA    . PRO A 1 128 ? -76.049  32.154 0.255   1.00 49.91 ? 126  PRO A CA    1 
ATOM   846  C C     . PRO A 1 128 ? -75.007  33.040 -0.424  1.00 49.79 ? 126  PRO A C     1 
ATOM   847  O O     . PRO A 1 128 ? -75.246  33.544 -1.519  1.00 49.70 ? 126  PRO A O     1 
ATOM   848  C CB    . PRO A 1 128 ? -76.382  30.922 -0.578  1.00 50.06 ? 126  PRO A CB    1 
ATOM   849  C CG    . PRO A 1 128 ? -77.830  30.681 -0.244  1.00 50.24 ? 126  PRO A CG    1 
ATOM   850  C CD    . PRO A 1 128 ? -78.404  32.074 -0.312  1.00 49.96 ? 126  PRO A CD    1 
ATOM   851  N N     . LEU A 1 129 ? -73.861  33.240 0.218   1.00 50.30 ? 127  LEU A N     1 
ATOM   852  C CA    . LEU A 1 129 ? -72.824  34.093 -0.362  1.00 51.48 ? 127  LEU A CA    1 
ATOM   853  C C     . LEU A 1 129 ? -71.980  33.418 -1.443  1.00 52.67 ? 127  LEU A C     1 
ATOM   854  O O     . LEU A 1 129 ? -70.781  33.211 -1.287  1.00 53.08 ? 127  LEU A O     1 
ATOM   855  C CB    . LEU A 1 129 ? -71.915  34.663 0.734   1.00 50.07 ? 127  LEU A CB    1 
ATOM   856  C CG    . LEU A 1 129 ? -72.580  35.708 1.637   1.00 48.99 ? 127  LEU A CG    1 
ATOM   857  C CD1   . LEU A 1 129 ? -71.609  36.182 2.698   1.00 48.28 ? 127  LEU A CD1   1 
ATOM   858  C CD2   . LEU A 1 129 ? -73.044  36.877 0.793   1.00 47.98 ? 127  LEU A CD2   1 
ATOM   859  N N     . VAL A 1 130 ? -72.637  33.089 -2.544  1.00 54.31 ? 128  VAL A N     1 
ATOM   860  C CA    . VAL A 1 130 ? -72.006  32.470 -3.691  1.00 55.57 ? 128  VAL A CA    1 
ATOM   861  C C     . VAL A 1 130 ? -72.107  33.524 -4.790  1.00 56.57 ? 128  VAL A C     1 
ATOM   862  O O     . VAL A 1 130 ? -72.557  34.642 -4.533  1.00 56.38 ? 128  VAL A O     1 
ATOM   863  C CB    . VAL A 1 130 ? -72.766  31.192 -4.106  1.00 55.82 ? 128  VAL A CB    1 
ATOM   864  C CG1   . VAL A 1 130 ? -72.008  30.454 -5.209  1.00 56.97 ? 128  VAL A CG1   1 
ATOM   865  C CG2   . VAL A 1 130 ? -72.936  30.291 -2.899  1.00 55.10 ? 128  VAL A CG2   1 
ATOM   866  N N     . LYS A 1 131 ? -71.688  33.181 -6.004  1.00 57.84 ? 129  LYS A N     1 
ATOM   867  C CA    . LYS A 1 131 ? -71.736  34.121 -7.121  1.00 59.05 ? 129  LYS A CA    1 
ATOM   868  C C     . LYS A 1 131 ? -73.193  34.554 -7.310  1.00 59.05 ? 129  LYS A C     1 
ATOM   869  O O     . LYS A 1 131 ? -74.100  33.720 -7.267  1.00 58.88 ? 129  LYS A O     1 
ATOM   870  C CB    . LYS A 1 131 ? -71.205  33.438 -8.386  1.00 60.45 ? 129  LYS A CB    1 
ATOM   871  C CG    . LYS A 1 131 ? -70.851  34.373 -9.546  1.00 62.85 ? 129  LYS A CG    1 
ATOM   872  C CD    . LYS A 1 131 ? -69.394  34.859 -9.492  1.00 64.13 ? 129  LYS A CD    1 
ATOM   873  C CE    . LYS A 1 131 ? -69.234  36.192 -8.748  1.00 64.81 ? 129  LYS A CE    1 
ATOM   874  N NZ    . LYS A 1 131 ? -69.559  36.138 -7.291  1.00 63.67 ? 129  LYS A NZ    1 
ATOM   875  N N     . PRO A 1 132 ? -73.437  35.853 -7.567  1.00 59.05 ? 130  PRO A N     1 
ATOM   876  C CA    . PRO A 1 132 ? -72.508  36.983 -7.703  1.00 59.22 ? 130  PRO A CA    1 
ATOM   877  C C     . PRO A 1 132 ? -72.100  37.724 -6.428  1.00 59.09 ? 130  PRO A C     1 
ATOM   878  O O     . PRO A 1 132 ? -71.577  38.839 -6.503  1.00 59.02 ? 130  PRO A O     1 
ATOM   879  C CB    . PRO A 1 132 ? -73.253  37.901 -8.656  1.00 59.46 ? 130  PRO A CB    1 
ATOM   880  C CG    . PRO A 1 132 ? -74.658  37.774 -8.146  1.00 59.32 ? 130  PRO A CG    1 
ATOM   881  C CD    . PRO A 1 132 ? -74.807  36.271 -7.927  1.00 59.22 ? 130  PRO A CD    1 
ATOM   882  N N     . TYR A 1 133 ? -72.321  37.115 -5.268  1.00 59.66 ? 131  TYR A N     1 
ATOM   883  C CA    . TYR A 1 133 ? -71.985  37.765 -4.001  1.00 60.28 ? 131  TYR A CA    1 
ATOM   884  C C     . TYR A 1 133 ? -70.594  37.441 -3.457  1.00 59.96 ? 131  TYR A C     1 
ATOM   885  O O     . TYR A 1 133 ? -70.237  37.874 -2.361  1.00 59.86 ? 131  TYR A O     1 
ATOM   886  C CB    . TYR A 1 133 ? -73.031  37.415 -2.941  1.00 60.92 ? 131  TYR A CB    1 
ATOM   887  C CG    . TYR A 1 133 ? -74.458  37.614 -3.398  1.00 62.24 ? 131  TYR A CG    1 
ATOM   888  C CD1   . TYR A 1 133 ? -75.191  36.558 -3.928  1.00 62.37 ? 131  TYR A CD1   1 
ATOM   889  C CD2   . TYR A 1 133 ? -75.073  38.862 -3.312  1.00 63.21 ? 131  TYR A CD2   1 
ATOM   890  C CE1   . TYR A 1 133 ? -76.497  36.733 -4.360  1.00 63.13 ? 131  TYR A CE1   1 
ATOM   891  C CE2   . TYR A 1 133 ? -76.385  39.050 -3.745  1.00 63.90 ? 131  TYR A CE2   1 
ATOM   892  C CZ    . TYR A 1 133 ? -77.091  37.980 -4.268  1.00 63.67 ? 131  TYR A CZ    1 
ATOM   893  O OH    . TYR A 1 133 ? -78.390  38.145 -4.703  1.00 64.06 ? 131  TYR A OH    1 
ATOM   894  N N     . LYS A 1 134 ? -69.814  36.693 -4.233  1.00 59.59 ? 132  LYS A N     1 
ATOM   895  C CA    . LYS A 1 134 ? -68.459  36.282 -3.857  1.00 58.28 ? 132  LYS A CA    1 
ATOM   896  C C     . LYS A 1 134 ? -67.607  37.384 -3.214  1.00 56.78 ? 132  LYS A C     1 
ATOM   897  O O     . LYS A 1 134 ? -66.883  37.130 -2.254  1.00 56.70 ? 132  LYS A O     1 
ATOM   898  C CB    . LYS A 1 134 ? -67.733  35.743 -5.092  1.00 60.02 ? 132  LYS A CB    1 
ATOM   899  C CG    . LYS A 1 134 ? -67.168  34.343 -4.951  1.00 61.49 ? 132  LYS A CG    1 
ATOM   900  C CD    . LYS A 1 134 ? -68.243  33.280 -5.013  1.00 62.80 ? 132  LYS A CD    1 
ATOM   901  C CE    . LYS A 1 134 ? -67.617  31.884 -5.076  1.00 64.48 ? 132  LYS A CE    1 
ATOM   902  N NZ    . LYS A 1 134 ? -68.633  30.802 -5.299  1.00 65.22 ? 132  LYS A NZ    1 
ATOM   903  N N     . SER A 1 135 ? -67.690  38.600 -3.746  1.00 55.04 ? 133  SER A N     1 
ATOM   904  C CA    . SER A 1 135 ? -66.917  39.729 -3.224  1.00 53.44 ? 133  SER A CA    1 
ATOM   905  C C     . SER A 1 135 ? -67.304  40.180 -1.815  1.00 52.30 ? 133  SER A C     1 
ATOM   906  O O     . SER A 1 135 ? -66.691  41.095 -1.268  1.00 52.20 ? 133  SER A O     1 
ATOM   907  C CB    . SER A 1 135 ? -67.032  40.928 -4.166  1.00 53.66 ? 133  SER A CB    1 
ATOM   908  O OG    . SER A 1 135 ? -68.379  41.356 -4.282  1.00 54.82 ? 133  SER A OG    1 
ATOM   909  N N     . VAL A 1 136 ? -68.320  39.552 -1.235  1.00 50.90 ? 134  VAL A N     1 
ATOM   910  C CA    . VAL A 1 136 ? -68.766  39.907 0.109   1.00 49.89 ? 134  VAL A CA    1 
ATOM   911  C C     . VAL A 1 136 ? -67.969  39.123 1.144   1.00 49.29 ? 134  VAL A C     1 
ATOM   912  O O     . VAL A 1 136 ? -67.828  39.541 2.297   1.00 49.00 ? 134  VAL A O     1 
ATOM   913  C CB    . VAL A 1 136 ? -70.284  39.615 0.292   1.00 48.96 ? 134  VAL A CB    1 
ATOM   914  C CG1   . VAL A 1 136 ? -70.710  39.899 1.718   1.00 48.50 ? 134  VAL A CG1   1 
ATOM   915  C CG2   . VAL A 1 136 ? -71.088  40.471 -0.656  1.00 48.81 ? 134  VAL A CG2   1 
ATOM   916  N N     . LEU A 1 137 ? -67.445  37.981 0.716   1.00 49.12 ? 135  LEU A N     1 
ATOM   917  C CA    . LEU A 1 137 ? -66.656  37.123 1.588   1.00 48.49 ? 135  LEU A CA    1 
ATOM   918  C C     . LEU A 1 137 ? -65.511  37.903 2.206   1.00 48.42 ? 135  LEU A C     1 
ATOM   919  O O     . LEU A 1 137 ? -65.292  37.844 3.411   1.00 47.82 ? 135  LEU A O     1 
ATOM   920  C CB    . LEU A 1 137 ? -66.108  35.937 0.797   1.00 47.76 ? 135  LEU A CB    1 
ATOM   921  C CG    . LEU A 1 137 ? -67.158  34.974 0.238   1.00 47.10 ? 135  LEU A CG    1 
ATOM   922  C CD1   . LEU A 1 137 ? -66.483  33.858 -0.550  1.00 47.44 ? 135  LEU A CD1   1 
ATOM   923  C CD2   . LEU A 1 137 ? -67.966  34.402 1.375   1.00 45.68 ? 135  LEU A CD2   1 
ATOM   924  N N     . ALA A 1 138 ? -64.792  38.645 1.369   1.00 49.60 ? 136  ALA A N     1 
ATOM   925  C CA    . ALA A 1 138 ? -63.664  39.444 1.826   1.00 50.62 ? 136  ALA A CA    1 
ATOM   926  C C     . ALA A 1 138 ? -64.134  40.504 2.813   1.00 51.37 ? 136  ALA A C     1 
ATOM   927  O O     . ALA A 1 138 ? -63.672  40.550 3.957   1.00 52.02 ? 136  ALA A O     1 
ATOM   928  C CB    . ALA A 1 138 ? -62.975  40.105 0.635   1.00 50.64 ? 136  ALA A CB    1 
ATOM   929  N N     . ARG A 1 139 ? -65.057  41.348 2.364   1.00 51.61 ? 137  ARG A N     1 
ATOM   930  C CA    . ARG A 1 139 ? -65.611  42.417 3.188   1.00 51.45 ? 137  ARG A CA    1 
ATOM   931  C C     . ARG A 1 139 ? -65.989  41.954 4.596   1.00 51.20 ? 137  ARG A C     1 
ATOM   932  O O     . ARG A 1 139 ? -65.873  42.714 5.550   1.00 50.70 ? 137  ARG A O     1 
ATOM   933  C CB    . ARG A 1 139 ? -66.836  43.017 2.500   1.00 51.81 ? 137  ARG A CB    1 
ATOM   934  C CG    . ARG A 1 139 ? -66.543  43.678 1.166   1.00 52.32 ? 137  ARG A CG    1 
ATOM   935  C CD    . ARG A 1 139 ? -65.657  44.893 1.350   1.00 53.33 ? 137  ARG A CD    1 
ATOM   936  N NE    . ARG A 1 139 ? -66.298  45.901 2.190   1.00 55.18 ? 137  ARG A NE    1 
ATOM   937  C CZ    . ARG A 1 139 ? -67.257  46.726 1.776   1.00 55.23 ? 137  ARG A CZ    1 
ATOM   938  N NH1   . ARG A 1 139 ? -67.687  46.668 0.524   1.00 55.24 ? 137  ARG A NH1   1 
ATOM   939  N NH2   . ARG A 1 139 ? -67.790  47.602 2.617   1.00 54.57 ? 137  ARG A NH2   1 
ATOM   940  N N     . VAL A 1 140 ? -66.454  40.718 4.734   1.00 51.79 ? 138  VAL A N     1 
ATOM   941  C CA    . VAL A 1 140 ? -66.819  40.221 6.056   1.00 52.83 ? 138  VAL A CA    1 
ATOM   942  C C     . VAL A 1 140 ? -65.556  39.857 6.830   1.00 54.58 ? 138  VAL A C     1 
ATOM   943  O O     . VAL A 1 140 ? -65.349  40.307 7.960   1.00 54.88 ? 138  VAL A O     1 
ATOM   944  C CB    . VAL A 1 140 ? -67.723  38.971 5.980   1.00 52.08 ? 138  VAL A CB    1 
ATOM   945  C CG1   . VAL A 1 140 ? -67.978  38.435 7.375   1.00 51.04 ? 138  VAL A CG1   1 
ATOM   946  C CG2   . VAL A 1 140 ? -69.042  39.315 5.312   1.00 52.64 ? 138  VAL A CG2   1 
ATOM   947  N N     . VAL A 1 141 ? -64.714  39.032 6.214   1.00 55.84 ? 139  VAL A N     1 
ATOM   948  C CA    . VAL A 1 141 ? -63.462  38.605 6.828   1.00 56.54 ? 139  VAL A CA    1 
ATOM   949  C C     . VAL A 1 141 ? -62.640  39.801 7.326   1.00 57.38 ? 139  VAL A C     1 
ATOM   950  O O     . VAL A 1 141 ? -62.187  39.814 8.474   1.00 57.21 ? 139  VAL A O     1 
ATOM   951  C CB    . VAL A 1 141 ? -62.625  37.761 5.819   1.00 56.18 ? 139  VAL A CB    1 
ATOM   952  C CG1   . VAL A 1 141 ? -61.155  37.770 6.203   1.00 55.67 ? 139  VAL A CG1   1 
ATOM   953  C CG2   . VAL A 1 141 ? -63.151  36.328 5.791   1.00 54.29 ? 139  VAL A CG2   1 
ATOM   954  N N     . ASP A 1 142 ? -62.484  40.808 6.468   1.00 58.05 ? 140  ASP A N     1 
ATOM   955  C CA    . ASP A 1 142 ? -61.708  42.005 6.785   1.00 59.77 ? 140  ASP A CA    1 
ATOM   956  C C     . ASP A 1 142 ? -62.493  43.104 7.514   1.00 60.82 ? 140  ASP A C     1 
ATOM   957  O O     . ASP A 1 142 ? -61.973  44.207 7.710   1.00 60.98 ? 140  ASP A O     1 
ATOM   958  C CB    . ASP A 1 142 ? -61.131  42.598 5.494   1.00 61.07 ? 140  ASP A CB    1 
ATOM   959  C CG    . ASP A 1 142 ? -60.426  41.556 4.623   1.00 63.45 ? 140  ASP A CG    1 
ATOM   960  O OD1   . ASP A 1 142 ? -60.158  41.864 3.437   1.00 63.34 ? 140  ASP A OD1   1 
ATOM   961  O OD2   . ASP A 1 142 ? -60.135  40.436 5.114   1.00 64.11 ? 140  ASP A OD2   1 
ATOM   962  N N     . HIS A 1 143 ? -63.731  42.815 7.916   1.00 61.26 ? 141  HIS A N     1 
ATOM   963  C CA    . HIS A 1 143 ? -64.560  43.812 8.593   1.00 61.61 ? 141  HIS A CA    1 
ATOM   964  C C     . HIS A 1 143 ? -64.071  44.146 9.995   1.00 62.38 ? 141  HIS A C     1 
ATOM   965  O O     . HIS A 1 143 ? -63.978  43.278 10.858  1.00 62.36 ? 141  HIS A O     1 
ATOM   966  C CB    . HIS A 1 143 ? -66.015  43.343 8.675   1.00 61.10 ? 141  HIS A CB    1 
ATOM   967  C CG    . HIS A 1 143 ? -66.994  44.455 8.910   1.00 60.94 ? 141  HIS A CG    1 
ATOM   968  N ND1   . HIS A 1 143 ? -66.925  45.292 10.003  1.00 60.68 ? 141  HIS A ND1   1 
ATOM   969  C CD2   . HIS A 1 143 ? -68.055  44.877 8.182   1.00 60.46 ? 141  HIS A CD2   1 
ATOM   970  C CE1   . HIS A 1 143 ? -67.900  46.180 9.939   1.00 60.32 ? 141  HIS A CE1   1 
ATOM   971  N NE2   . HIS A 1 143 ? -68.600  45.951 8.843   1.00 60.11 ? 141  HIS A NE2   1 
ATOM   972  N N     . GLU A 1 144 ? -63.789  45.425 10.213  1.00 63.67 ? 142  GLU A N     1 
ATOM   973  C CA    . GLU A 1 144 ? -63.302  45.913 11.497  1.00 65.17 ? 142  GLU A CA    1 
ATOM   974  C C     . GLU A 1 144 ? -64.192  45.562 12.681  1.00 65.05 ? 142  GLU A C     1 
ATOM   975  O O     . GLU A 1 144 ? -63.764  45.671 13.826  1.00 65.29 ? 142  GLU A O     1 
ATOM   976  C CB    . GLU A 1 144 ? -63.115  47.429 11.426  1.00 66.60 ? 142  GLU A CB    1 
ATOM   977  C CG    . GLU A 1 144 ? -62.181  47.854 10.299  1.00 69.32 ? 142  GLU A CG    1 
ATOM   978  C CD    . GLU A 1 144 ? -62.054  49.359 10.164  1.00 70.71 ? 142  GLU A CD    1 
ATOM   979  O OE1   . GLU A 1 144 ? -61.643  50.013 11.148  1.00 71.27 ? 142  GLU A OE1   1 
ATOM   980  O OE2   . GLU A 1 144 ? -62.358  49.885 9.068   1.00 71.39 ? 142  GLU A OE2   1 
ATOM   981  N N     . ASP A 1 145 ? -65.423  45.139 12.413  1.00 65.12 ? 143  ASP A N     1 
ATOM   982  C CA    . ASP A 1 145 ? -66.346  44.778 13.484  1.00 65.42 ? 143  ASP A CA    1 
ATOM   983  C C     . ASP A 1 145 ? -66.728  43.302 13.472  1.00 65.77 ? 143  ASP A C     1 
ATOM   984  O O     . ASP A 1 145 ? -67.614  42.880 14.214  1.00 65.39 ? 143  ASP A O     1 
ATOM   985  C CB    . ASP A 1 145 ? -67.615  45.636 13.411  1.00 65.71 ? 143  ASP A CB    1 
ATOM   986  C CG    . ASP A 1 145 ? -67.383  47.068 13.868  1.00 66.33 ? 143  ASP A CG    1 
ATOM   987  O OD1   . ASP A 1 145 ? -66.953  47.250 15.027  1.00 67.13 ? 143  ASP A OD1   1 
ATOM   988  O OD2   . ASP A 1 145 ? -67.628  48.011 13.079  1.00 65.37 ? 143  ASP A OD2   1 
ATOM   989  N N     . ALA A 1 146 ? -66.064  42.517 12.632  1.00 66.50 ? 144  ALA A N     1 
ATOM   990  C CA    . ALA A 1 146 ? -66.355  41.090 12.557  1.00 68.08 ? 144  ALA A CA    1 
ATOM   991  C C     . ALA A 1 146 ? -65.677  40.376 13.719  1.00 69.22 ? 144  ALA A C     1 
ATOM   992  O O     . ALA A 1 146 ? -64.614  40.795 14.172  1.00 69.26 ? 144  ALA A O     1 
ATOM   993  C CB    . ALA A 1 146 ? -65.861  40.523 11.241  1.00 67.90 ? 144  ALA A CB    1 
ATOM   994  N N     . HIS A 1 147 ? -66.296  39.304 14.202  1.00 70.69 ? 145  HIS A N     1 
ATOM   995  C CA    . HIS A 1 147 ? -65.731  38.548 15.309  1.00 72.34 ? 145  HIS A CA    1 
ATOM   996  C C     . HIS A 1 147 ? -65.730  37.049 15.040  1.00 72.97 ? 145  HIS A C     1 
ATOM   997  O O     . HIS A 1 147 ? -66.707  36.500 14.530  1.00 73.15 ? 145  HIS A O     1 
ATOM   998  C CB    . HIS A 1 147 ? -66.498  38.836 16.607  1.00 74.06 ? 145  HIS A CB    1 
ATOM   999  C CG    . HIS A 1 147 ? -67.888  38.274 16.643  1.00 76.80 ? 145  HIS A CG    1 
ATOM   1000 N ND1   . HIS A 1 147 ? -68.895  38.707 15.804  1.00 78.27 ? 145  HIS A ND1   1 
ATOM   1001 C CD2   . HIS A 1 147 ? -68.446  37.329 17.440  1.00 77.64 ? 145  HIS A CD2   1 
ATOM   1002 C CE1   . HIS A 1 147 ? -70.012  38.056 16.082  1.00 78.04 ? 145  HIS A CE1   1 
ATOM   1003 N NE2   . HIS A 1 147 ? -69.767  37.214 17.072  1.00 78.70 ? 145  HIS A NE2   1 
ATOM   1004 N N     . ASP A 1 148 ? -64.624  36.390 15.379  1.00 73.24 ? 146  ASP A N     1 
ATOM   1005 C CA    . ASP A 1 148 ? -64.509  34.950 15.188  1.00 73.42 ? 146  ASP A CA    1 
ATOM   1006 C C     . ASP A 1 148 ? -65.565  34.318 16.064  1.00 73.33 ? 146  ASP A C     1 
ATOM   1007 O O     . ASP A 1 148 ? -65.848  34.814 17.149  1.00 73.26 ? 146  ASP A O     1 
ATOM   1008 C CB    . ASP A 1 148 ? -63.124  34.457 15.605  1.00 73.89 ? 146  ASP A CB    1 
ATOM   1009 C CG    . ASP A 1 148 ? -62.018  35.117 14.819  1.00 75.03 ? 146  ASP A CG    1 
ATOM   1010 O OD1   . ASP A 1 148 ? -62.022  35.004 13.574  1.00 75.56 ? 146  ASP A OD1   1 
ATOM   1011 O OD2   . ASP A 1 148 ? -61.145  35.754 15.445  1.00 76.03 ? 146  ASP A OD2   1 
ATOM   1012 N N     . GLU A 1 149 ? -66.142  33.220 15.601  1.00 73.59 ? 147  GLU A N     1 
ATOM   1013 C CA    . GLU A 1 149 ? -67.189  32.566 16.362  1.00 73.99 ? 147  GLU A CA    1 
ATOM   1014 C C     . GLU A 1 149 ? -67.303  31.130 15.875  1.00 74.13 ? 147  GLU A C     1 
ATOM   1015 O O     . GLU A 1 149 ? -66.793  30.790 14.810  1.00 73.62 ? 147  GLU A O     1 
ATOM   1016 C CB    . GLU A 1 149 ? -68.497  33.316 16.117  1.00 75.03 ? 147  GLU A CB    1 
ATOM   1017 C CG    . GLU A 1 149 ? -69.549  33.224 17.202  1.00 76.55 ? 147  GLU A CG    1 
ATOM   1018 C CD    . GLU A 1 149 ? -70.820  33.972 16.813  1.00 77.41 ? 147  GLU A CD    1 
ATOM   1019 O OE1   . GLU A 1 149 ? -71.516  33.510 15.883  1.00 77.44 ? 147  GLU A OE1   1 
ATOM   1020 O OE2   . GLU A 1 149 ? -71.119  35.023 17.425  1.00 77.23 ? 147  GLU A OE2   1 
ATOM   1021 N N     . ILE A 1 150 ? -67.960  30.286 16.661  1.00 74.66 ? 148  ILE A N     1 
ATOM   1022 C CA    . ILE A 1 150 ? -68.151  28.895 16.279  1.00 75.74 ? 148  ILE A CA    1 
ATOM   1023 C C     . ILE A 1 150 ? -69.621  28.664 15.949  1.00 76.71 ? 148  ILE A C     1 
ATOM   1024 O O     . ILE A 1 150 ? -70.507  28.848 16.789  1.00 76.82 ? 148  ILE A O     1 
ATOM   1025 C CB    . ILE A 1 150 ? -67.693  27.913 17.402  1.00 75.70 ? 148  ILE A CB    1 
ATOM   1026 C CG1   . ILE A 1 150 ? -66.199  27.596 17.253  1.00 75.40 ? 148  ILE A CG1   1 
ATOM   1027 C CG2   . ILE A 1 150 ? -68.482  26.607 17.325  1.00 75.30 ? 148  ILE A CG2   1 
ATOM   1028 C CD1   . ILE A 1 150 ? -65.277  28.792 17.357  1.00 75.26 ? 148  ILE A CD1   1 
ATOM   1029 N N     . MET A 1 151 ? -69.860  28.264 14.707  1.00 77.49 ? 149  MET A N     1 
ATOM   1030 C CA    . MET A 1 151 ? -71.199  28.005 14.204  1.00 78.44 ? 149  MET A CA    1 
ATOM   1031 C C     . MET A 1 151 ? -71.488  26.516 14.301  1.00 78.99 ? 149  MET A C     1 
ATOM   1032 O O     . MET A 1 151 ? -70.623  25.692 14.031  1.00 79.07 ? 149  MET A O     1 
ATOM   1033 C CB    . MET A 1 151 ? -71.277  28.473 12.747  1.00 78.49 ? 149  MET A CB    1 
ATOM   1034 C CG    . MET A 1 151 ? -72.614  28.287 12.058  1.00 78.47 ? 149  MET A CG    1 
ATOM   1035 S SD    . MET A 1 151 ? -72.559  29.002 10.401  1.00 78.69 ? 149  MET A SD    1 
ATOM   1036 C CE    . MET A 1 151 ? -72.051  27.588 9.437   1.00 78.58 ? 149  MET A CE    1 
ATOM   1037 N N     . GLN A 1 152 ? -72.705  26.173 14.696  1.00 80.27 ? 150  GLN A N     1 
ATOM   1038 C CA    . GLN A 1 152 ? -73.092  24.776 14.816  1.00 81.96 ? 150  GLN A CA    1 
ATOM   1039 C C     . GLN A 1 152 ? -74.076  24.398 13.715  1.00 82.45 ? 150  GLN A C     1 
ATOM   1040 O O     . GLN A 1 152 ? -75.107  25.044 13.538  1.00 82.66 ? 150  GLN A O     1 
ATOM   1041 C CB    . GLN A 1 152 ? -73.705  24.503 16.198  1.00 82.94 ? 150  GLN A CB    1 
ATOM   1042 C CG    . GLN A 1 152 ? -74.872  25.412 16.614  1.00 84.62 ? 150  GLN A CG    1 
ATOM   1043 C CD    . GLN A 1 152 ? -74.443  26.839 16.968  1.00 85.61 ? 150  GLN A CD    1 
ATOM   1044 O OE1   . GLN A 1 152 ? -74.287  27.696 16.092  1.00 85.94 ? 150  GLN A OE1   1 
ATOM   1045 N NE2   . GLN A 1 152 ? -74.243  27.091 18.261  1.00 85.69 ? 150  GLN A NE2   1 
ATOM   1046 N N     . ASP A 1 153 ? -73.748  23.349 12.968  1.00 83.11 ? 151  ASP A N     1 
ATOM   1047 C CA    . ASP A 1 153 ? -74.603  22.899 11.878  1.00 83.82 ? 151  ASP A CA    1 
ATOM   1048 C C     . ASP A 1 153 ? -74.901  21.411 12.007  1.00 83.69 ? 151  ASP A C     1 
ATOM   1049 O O     . ASP A 1 153 ? -74.053  20.637 12.440  1.00 83.72 ? 151  ASP A O     1 
ATOM   1050 C CB    . ASP A 1 153 ? -73.925  23.185 10.537  1.00 84.74 ? 151  ASP A CB    1 
ATOM   1051 C CG    . ASP A 1 153 ? -74.821  22.884 9.356   1.00 85.69 ? 151  ASP A CG    1 
ATOM   1052 O OD1   . ASP A 1 153 ? -75.918  23.478 9.273   1.00 86.23 ? 151  ASP A OD1   1 
ATOM   1053 O OD2   . ASP A 1 153 ? -74.430  22.054 8.509   1.00 86.58 ? 151  ASP A OD2   1 
ATOM   1054 N N     . ASN A 1 154 ? -76.114  21.020 11.628  1.00 83.74 ? 152  ASN A N     1 
ATOM   1055 C CA    . ASN A 1 154 ? -76.545  19.627 11.706  1.00 83.79 ? 152  ASN A CA    1 
ATOM   1056 C C     . ASN A 1 154 ? -75.799  18.765 10.696  1.00 83.52 ? 152  ASN A C     1 
ATOM   1057 O O     . ASN A 1 154 ? -75.665  17.553 10.874  1.00 83.32 ? 152  ASN A O     1 
ATOM   1058 C CB    . ASN A 1 154 ? -78.050  19.533 11.445  1.00 84.26 ? 152  ASN A CB    1 
ATOM   1059 C CG    . ASN A 1 154 ? -78.844  20.541 12.255  1.00 85.05 ? 152  ASN A CG    1 
ATOM   1060 O OD1   . ASN A 1 154 ? -78.801  20.532 13.486  1.00 85.16 ? 152  ASN A OD1   1 
ATOM   1061 N ND2   . ASN A 1 154 ? -79.570  21.423 11.567  1.00 84.91 ? 152  ASN A ND2   1 
ATOM   1062 N N     . LEU A 1 155 ? -75.315  19.401 9.635   1.00 82.99 ? 153  LEU A N     1 
ATOM   1063 C CA    . LEU A 1 155 ? -74.590  18.703 8.582   1.00 82.39 ? 153  LEU A CA    1 
ATOM   1064 C C     . LEU A 1 155 ? -73.078  18.834 8.761   1.00 81.92 ? 153  LEU A C     1 
ATOM   1065 O O     . LEU A 1 155 ? -72.417  17.913 9.243   1.00 82.36 ? 153  LEU A O     1 
ATOM   1066 C CB    . LEU A 1 155 ? -75.001  19.265 7.220   1.00 82.57 ? 153  LEU A CB    1 
ATOM   1067 C CG    . LEU A 1 155 ? -76.508  19.294 6.942   1.00 83.39 ? 153  LEU A CG    1 
ATOM   1068 C CD1   . LEU A 1 155 ? -76.776  20.021 5.631   1.00 83.66 ? 153  LEU A CD1   1 
ATOM   1069 C CD2   . LEU A 1 155 ? -77.057  17.873 6.902   1.00 83.31 ? 153  LEU A CD2   1 
ATOM   1070 N N     . PHE A 1 156 ? -72.539  19.986 8.378   1.00 80.82 ? 154  PHE A N     1 
ATOM   1071 C CA    . PHE A 1 156 ? -71.108  20.245 8.479   1.00 79.85 ? 154  PHE A CA    1 
ATOM   1072 C C     . PHE A 1 156 ? -70.565  20.097 9.897   1.00 79.46 ? 154  PHE A C     1 
ATOM   1073 O O     . PHE A 1 156 ? -69.354  19.981 10.095  1.00 79.61 ? 154  PHE A O     1 
ATOM   1074 C CB    . PHE A 1 156 ? -70.791  21.657 7.975   1.00 79.41 ? 154  PHE A CB    1 
ATOM   1075 C CG    . PHE A 1 156 ? -71.186  21.897 6.548   1.00 78.91 ? 154  PHE A CG    1 
ATOM   1076 C CD1   . PHE A 1 156 ? -72.527  21.963 6.183   1.00 78.99 ? 154  PHE A CD1   1 
ATOM   1077 C CD2   . PHE A 1 156 ? -70.216  22.050 5.564   1.00 78.83 ? 154  PHE A CD2   1 
ATOM   1078 C CE1   . PHE A 1 156 ? -72.897  22.181 4.859   1.00 78.62 ? 154  PHE A CE1   1 
ATOM   1079 C CE2   . PHE A 1 156 ? -70.573  22.268 4.236   1.00 78.86 ? 154  PHE A CE2   1 
ATOM   1080 C CZ    . PHE A 1 156 ? -71.918  22.333 3.883   1.00 78.70 ? 154  PHE A CZ    1 
ATOM   1081 N N     . GLY A 1 157 ? -71.460  20.093 10.879  1.00 78.56 ? 155  GLY A N     1 
ATOM   1082 C CA    . GLY A 1 157 ? -71.025  19.995 12.258  1.00 77.35 ? 155  GLY A CA    1 
ATOM   1083 C C     . GLY A 1 157 ? -70.647  21.391 12.715  1.00 76.62 ? 155  GLY A C     1 
ATOM   1084 O O     . GLY A 1 157 ? -71.309  22.360 12.349  1.00 76.80 ? 155  GLY A O     1 
ATOM   1085 N N     . ASP A 1 158 ? -69.585  21.508 13.501  1.00 75.56 ? 156  ASP A N     1 
ATOM   1086 C CA    . ASP A 1 158 ? -69.148  22.813 13.980  1.00 74.27 ? 156  ASP A CA    1 
ATOM   1087 C C     . ASP A 1 158 ? -68.112  23.403 13.031  1.00 73.04 ? 156  ASP A C     1 
ATOM   1088 O O     . ASP A 1 158 ? -67.229  22.695 12.547  1.00 73.08 ? 156  ASP A O     1 
ATOM   1089 C CB    . ASP A 1 158 ? -68.573  22.687 15.392  1.00 74.95 ? 156  ASP A CB    1 
ATOM   1090 C CG    . ASP A 1 158 ? -69.605  22.196 16.400  1.00 75.87 ? 156  ASP A CG    1 
ATOM   1091 O OD1   . ASP A 1 158 ? -69.224  21.946 17.564  1.00 75.97 ? 156  ASP A OD1   1 
ATOM   1092 O OD2   . ASP A 1 158 ? -70.796  22.061 16.031  1.00 75.78 ? 156  ASP A OD2   1 
ATOM   1093 N N     . LEU A 1 159 ? -68.228  24.702 12.767  1.00 71.28 ? 157  LEU A N     1 
ATOM   1094 C CA    . LEU A 1 159 ? -67.318  25.392 11.856  1.00 69.37 ? 157  LEU A CA    1 
ATOM   1095 C C     . LEU A 1 159 ? -66.837  26.712 12.435  1.00 67.96 ? 157  LEU A C     1 
ATOM   1096 O O     . LEU A 1 159 ? -67.513  27.315 13.261  1.00 67.97 ? 157  LEU A O     1 
ATOM   1097 C CB    . LEU A 1 159 ? -68.024  25.671 10.524  1.00 68.94 ? 157  LEU A CB    1 
ATOM   1098 C CG    . LEU A 1 159 ? -68.511  24.478 9.699   1.00 68.76 ? 157  LEU A CG    1 
ATOM   1099 C CD1   . LEU A 1 159 ? -69.574  24.932 8.713   1.00 68.17 ? 157  LEU A CD1   1 
ATOM   1100 C CD2   . LEU A 1 159 ? -67.331  23.837 8.982   1.00 68.45 ? 157  LEU A CD2   1 
ATOM   1101 N N     . ASN A 1 160 ? -65.666  27.153 11.994  1.00 66.54 ? 158  ASN A N     1 
ATOM   1102 C CA    . ASN A 1 160 ? -65.114  28.421 12.445  1.00 65.38 ? 158  ASN A CA    1 
ATOM   1103 C C     . ASN A 1 160 ? -65.553  29.459 11.419  1.00 64.22 ? 158  ASN A C     1 
ATOM   1104 O O     . ASN A 1 160 ? -65.193  29.379 10.241  1.00 63.94 ? 158  ASN A O     1 
ATOM   1105 C CB    . ASN A 1 160 ? -63.581  28.372 12.506  1.00 65.98 ? 158  ASN A CB    1 
ATOM   1106 C CG    . ASN A 1 160 ? -63.062  27.297 13.450  1.00 66.60 ? 158  ASN A CG    1 
ATOM   1107 O OD1   . ASN A 1 160 ? -63.515  27.180 14.591  1.00 66.26 ? 158  ASN A OD1   1 
ATOM   1108 N ND2   . ASN A 1 160 ? -62.099  26.510 12.976  1.00 66.98 ? 158  ASN A ND2   1 
ATOM   1109 N N     . VAL A 1 161 ? -66.332  30.435 11.868  1.00 62.38 ? 159  VAL A N     1 
ATOM   1110 C CA    . VAL A 1 161 ? -66.830  31.467 10.973  1.00 60.69 ? 159  VAL A CA    1 
ATOM   1111 C C     . VAL A 1 161 ? -66.540  32.877 11.447  1.00 60.05 ? 159  VAL A C     1 
ATOM   1112 O O     . VAL A 1 161 ? -66.531  33.154 12.644  1.00 60.50 ? 159  VAL A O     1 
ATOM   1113 C CB    . VAL A 1 161 ? -68.362  31.351 10.789  1.00 59.95 ? 159  VAL A CB    1 
ATOM   1114 C CG1   . VAL A 1 161 ? -68.707  30.118 9.971   1.00 60.24 ? 159  VAL A CG1   1 
ATOM   1115 C CG2   . VAL A 1 161 ? -69.040  31.279 12.145  1.00 58.49 ? 159  VAL A CG2   1 
ATOM   1116 N N     . LYS A 1 162 ? -66.271  33.758 10.494  1.00 59.11 ? 160  LYS A N     1 
ATOM   1117 C CA    . LYS A 1 162 ? -66.054  35.160 10.791  1.00 58.07 ? 160  LYS A CA    1 
ATOM   1118 C C     . LYS A 1 162 ? -67.495  35.657 10.735  1.00 57.18 ? 160  LYS A C     1 
ATOM   1119 O O     . LYS A 1 162 ? -68.187  35.434 9.738   1.00 56.92 ? 160  LYS A O     1 
ATOM   1120 C CB    . LYS A 1 162 ? -65.234  35.829 9.689   1.00 59.02 ? 160  LYS A CB    1 
ATOM   1121 C CG    . LYS A 1 162 ? -63.786  35.381 9.605   1.00 61.30 ? 160  LYS A CG    1 
ATOM   1122 C CD    . LYS A 1 162 ? -62.942  35.964 10.731  1.00 62.57 ? 160  LYS A CD    1 
ATOM   1123 C CE    . LYS A 1 162 ? -61.457  35.719 10.478  1.00 63.56 ? 160  LYS A CE    1 
ATOM   1124 N NZ    . LYS A 1 162 ? -60.587  36.452 11.439  1.00 64.06 ? 160  LYS A NZ    1 
ATOM   1125 N N     . VAL A 1 163 ? -67.962  36.306 11.796  1.00 55.52 ? 161  VAL A N     1 
ATOM   1126 C CA    . VAL A 1 163 ? -69.343  36.778 11.818  1.00 53.65 ? 161  VAL A CA    1 
ATOM   1127 C C     . VAL A 1 163 ? -69.523  38.265 12.073  1.00 52.32 ? 161  VAL A C     1 
ATOM   1128 O O     . VAL A 1 163 ? -69.008  38.802 13.050  1.00 51.63 ? 161  VAL A O     1 
ATOM   1129 C CB    . VAL A 1 163 ? -70.172  36.022 12.881  1.00 53.37 ? 161  VAL A CB    1 
ATOM   1130 C CG1   . VAL A 1 163 ? -71.571  36.610 12.966  1.00 53.11 ? 161  VAL A CG1   1 
ATOM   1131 C CG2   . VAL A 1 163 ? -70.235  34.545 12.538  1.00 53.15 ? 161  VAL A CG2   1 
ATOM   1132 N N     . TYR A 1 164 ? -70.251  38.925 11.176  1.00 50.77 ? 162  TYR A N     1 
ATOM   1133 C CA    . TYR A 1 164 ? -70.553  40.340 11.342  1.00 49.31 ? 162  TYR A CA    1 
ATOM   1134 C C     . TYR A 1 164 ? -72.028  40.458 11.707  1.00 48.23 ? 162  TYR A C     1 
ATOM   1135 O O     . TYR A 1 164 ? -72.898  40.064 10.927  1.00 48.23 ? 162  TYR A O     1 
ATOM   1136 C CB    . TYR A 1 164 ? -70.308  41.135 10.064  1.00 49.65 ? 162  TYR A CB    1 
ATOM   1137 C CG    . TYR A 1 164 ? -70.800  42.560 10.198  1.00 50.36 ? 162  TYR A CG    1 
ATOM   1138 C CD1   . TYR A 1 164 ? -70.310  43.388 11.209  1.00 50.62 ? 162  TYR A CD1   1 
ATOM   1139 C CD2   . TYR A 1 164 ? -71.793  43.065 9.355   1.00 49.96 ? 162  TYR A CD2   1 
ATOM   1140 C CE1   . TYR A 1 164 ? -70.801  44.678 11.382  1.00 50.39 ? 162  TYR A CE1   1 
ATOM   1141 C CE2   . TYR A 1 164 ? -72.291  44.360 9.518   1.00 48.96 ? 162  TYR A CE2   1 
ATOM   1142 C CZ    . TYR A 1 164 ? -71.791  45.158 10.533  1.00 50.01 ? 162  TYR A CZ    1 
ATOM   1143 O OH    . TYR A 1 164 ? -72.271  46.437 10.715  1.00 49.52 ? 162  TYR A OH    1 
ATOM   1144 N N     . ARG A 1 165 ? -72.312  40.991 12.891  1.00 46.64 ? 163  ARG A N     1 
ATOM   1145 C CA    . ARG A 1 165 ? -73.696  41.146 13.328  1.00 45.05 ? 163  ARG A CA    1 
ATOM   1146 C C     . ARG A 1 165 ? -74.192  42.583 13.230  1.00 43.04 ? 163  ARG A C     1 
ATOM   1147 O O     . ARG A 1 165 ? -73.913  43.403 14.105  1.00 43.11 ? 163  ARG A O     1 
ATOM   1148 C CB    . ARG A 1 165 ? -73.849  40.622 14.760  1.00 46.05 ? 163  ARG A CB    1 
ATOM   1149 C CG    . ARG A 1 165 ? -73.723  39.102 14.838  1.00 47.95 ? 163  ARG A CG    1 
ATOM   1150 C CD    . ARG A 1 165 ? -73.634  38.572 16.261  1.00 48.70 ? 163  ARG A CD    1 
ATOM   1151 N NE    . ARG A 1 165 ? -73.653  37.109 16.273  1.00 49.90 ? 163  ARG A NE    1 
ATOM   1152 C CZ    . ARG A 1 165 ? -74.731  36.373 16.013  1.00 51.17 ? 163  ARG A CZ    1 
ATOM   1153 N NH1   . ARG A 1 165 ? -75.886  36.961 15.726  1.00 51.42 ? 163  ARG A NH1   1 
ATOM   1154 N NH2   . ARG A 1 165 ? -74.659  35.047 16.023  1.00 51.64 ? 163  ARG A NH2   1 
ATOM   1155 N N     . GLN A 1 166 ? -74.917  42.886 12.154  1.00 40.65 ? 164  GLN A N     1 
ATOM   1156 C CA    . GLN A 1 166 ? -75.473  44.228 11.952  1.00 38.55 ? 164  GLN A CA    1 
ATOM   1157 C C     . GLN A 1 166 ? -76.592  44.483 12.968  1.00 37.76 ? 164  GLN A C     1 
ATOM   1158 O O     . GLN A 1 166 ? -77.464  43.639 13.158  1.00 36.81 ? 164  GLN A O     1 
ATOM   1159 C CB    . GLN A 1 166 ? -76.053  44.372 10.540  1.00 37.03 ? 164  GLN A CB    1 
ATOM   1160 C CG    . GLN A 1 166 ? -76.388  45.830 10.138  1.00 34.45 ? 164  GLN A CG    1 
ATOM   1161 C CD    . GLN A 1 166 ? -77.385  45.932 8.983   1.00 31.25 ? 164  GLN A CD    1 
ATOM   1162 O OE1   . GLN A 1 166 ? -77.442  46.944 8.293   1.00 31.06 ? 164  GLN A OE1   1 
ATOM   1163 N NE2   . GLN A 1 166 ? -78.169  44.885 8.775   1.00 30.58 ? 164  GLN A NE2   1 
ATOM   1164 N N     . THR A 1 167 ? -76.551  45.637 13.629  1.00 37.36 ? 165  THR A N     1 
ATOM   1165 C CA    . THR A 1 167 ? -77.589  45.995 14.600  1.00 37.57 ? 165  THR A CA    1 
ATOM   1166 C C     . THR A 1 167 ? -78.073  47.412 14.342  1.00 36.18 ? 165  THR A C     1 
ATOM   1167 O O     . THR A 1 167 ? -77.424  48.180 13.634  1.00 35.86 ? 165  THR A O     1 
ATOM   1168 C CB    . THR A 1 167 ? -77.090  45.964 16.067  1.00 37.86 ? 165  THR A CB    1 
ATOM   1169 O OG1   . THR A 1 167 ? -76.102  46.983 16.255  1.00 39.55 ? 165  THR A OG1   1 
ATOM   1170 C CG2   . THR A 1 167 ? -76.512  44.613 16.413  1.00 38.78 ? 165  THR A CG2   1 
ATOM   1171 N N     . ALA A 1 168 ? -79.208  47.756 14.941  1.00 35.24 ? 166  ALA A N     1 
ATOM   1172 C CA    . ALA A 1 168 ? -79.776  49.091 14.796  1.00 34.33 ? 166  ALA A CA    1 
ATOM   1173 C C     . ALA A 1 168 ? -80.332  49.602 16.119  1.00 34.37 ? 166  ALA A C     1 
ATOM   1174 O O     . ALA A 1 168 ? -80.719  48.825 17.000  1.00 33.75 ? 166  ALA A O     1 
ATOM   1175 C CB    . ALA A 1 168 ? -80.871  49.081 13.753  1.00 32.84 ? 166  ALA A CB    1 
ATOM   1176 N N     . TYR A 1 169 ? -80.367  50.921 16.249  1.00 34.95 ? 167  TYR A N     1 
ATOM   1177 C CA    . TYR A 1 169 ? -80.903  51.562 17.441  1.00 34.82 ? 167  TYR A CA    1 
ATOM   1178 C C     . TYR A 1 169 ? -82.306  52.081 17.109  1.00 35.13 ? 167  TYR A C     1 
ATOM   1179 O O     . TYR A 1 169 ? -82.479  52.870 16.182  1.00 35.01 ? 167  TYR A O     1 
ATOM   1180 C CB    . TYR A 1 169 ? -80.019  52.743 17.850  1.00 33.71 ? 167  TYR A CB    1 
ATOM   1181 C CG    . TYR A 1 169 ? -80.505  53.436 19.099  1.00 34.26 ? 167  TYR A CG    1 
ATOM   1182 C CD1   . TYR A 1 169 ? -79.988  53.094 20.355  1.00 33.67 ? 167  TYR A CD1   1 
ATOM   1183 C CD2   . TYR A 1 169 ? -81.505  54.422 19.034  1.00 33.79 ? 167  TYR A CD2   1 
ATOM   1184 C CE1   . TYR A 1 169 ? -80.444  53.712 21.512  1.00 34.12 ? 167  TYR A CE1   1 
ATOM   1185 C CE2   . TYR A 1 169 ? -81.972  55.048 20.187  1.00 34.01 ? 167  TYR A CE2   1 
ATOM   1186 C CZ    . TYR A 1 169 ? -81.435  54.690 21.422  1.00 34.56 ? 167  TYR A CZ    1 
ATOM   1187 O OH    . TYR A 1 169 ? -81.862  55.321 22.566  1.00 35.07 ? 167  TYR A OH    1 
ATOM   1188 N N     . LEU A 1 170 ? -83.307  51.654 17.863  1.00 35.72 ? 168  LEU A N     1 
ATOM   1189 C CA    . LEU A 1 170 ? -84.661  52.126 17.603  1.00 36.34 ? 168  LEU A CA    1 
ATOM   1190 C C     . LEU A 1 170 ? -85.408  52.384 18.901  1.00 35.90 ? 168  LEU A C     1 
ATOM   1191 O O     . LEU A 1 170 ? -85.833  51.444 19.567  1.00 36.80 ? 168  LEU A O     1 
ATOM   1192 C CB    . LEU A 1 170 ? -85.437  51.100 16.770  1.00 36.44 ? 168  LEU A CB    1 
ATOM   1193 C CG    . LEU A 1 170 ? -86.304  51.588 15.596  1.00 37.47 ? 168  LEU A CG    1 
ATOM   1194 C CD1   . LEU A 1 170 ? -87.700  51.051 15.767  1.00 37.07 ? 168  LEU A CD1   1 
ATOM   1195 C CD2   . LEU A 1 170 ? -86.320  53.116 15.497  1.00 36.97 ? 168  LEU A CD2   1 
ATOM   1196 N N     . HIS A 1 171 ? -85.565  53.658 19.252  1.00 35.59 ? 169  HIS A N     1 
ATOM   1197 C CA    . HIS A 1 171 ? -86.280  54.047 20.474  1.00 36.03 ? 169  HIS A CA    1 
ATOM   1198 C C     . HIS A 1 171 ? -85.678  53.445 21.736  1.00 35.67 ? 169  HIS A C     1 
ATOM   1199 O O     . HIS A 1 171 ? -86.400  53.191 22.703  1.00 36.71 ? 169  HIS A O     1 
ATOM   1200 C CB    . HIS A 1 171 ? -87.763  53.633 20.387  1.00 35.46 ? 169  HIS A CB    1 
ATOM   1201 C CG    . HIS A 1 171 ? -88.472  54.176 19.187  1.00 35.60 ? 169  HIS A CG    1 
ATOM   1202 N ND1   . HIS A 1 171 ? -89.543  53.537 18.601  1.00 35.02 ? 169  HIS A ND1   1 
ATOM   1203 C CD2   . HIS A 1 171 ? -88.247  55.291 18.448  1.00 35.42 ? 169  HIS A CD2   1 
ATOM   1204 C CE1   . HIS A 1 171 ? -89.946  54.232 17.552  1.00 35.75 ? 169  HIS A CE1   1 
ATOM   1205 N NE2   . HIS A 1 171 ? -89.174  55.301 17.438  1.00 35.56 ? 169  HIS A NE2   1 
ATOM   1206 N N     . GLY A 1 172 ? -84.370  53.208 21.730  1.00 36.33 ? 170  GLY A N     1 
ATOM   1207 C CA    . GLY A 1 172 ? -83.715  52.638 22.900  1.00 36.21 ? 170  GLY A CA    1 
ATOM   1208 C C     . GLY A 1 172 ? -83.599  51.130 22.823  1.00 36.92 ? 170  GLY A C     1 
ATOM   1209 O O     . GLY A 1 172 ? -82.947  50.495 23.647  1.00 37.57 ? 170  GLY A O     1 
ATOM   1210 N N     . ASN A 1 173 ? -84.242  50.549 21.822  1.00 37.14 ? 171  ASN A N     1 
ATOM   1211 C CA    . ASN A 1 173 ? -84.203  49.109 21.617  1.00 37.41 ? 171  ASN A CA    1 
ATOM   1212 C C     . ASN A 1 173 ? -83.144  48.846 20.548  1.00 37.55 ? 171  ASN A C     1 
ATOM   1213 O O     . ASN A 1 173 ? -83.214  49.396 19.452  1.00 38.02 ? 171  ASN A O     1 
ATOM   1214 C CB    . ASN A 1 173 ? -85.584  48.634 21.152  1.00 37.86 ? 171  ASN A CB    1 
ATOM   1215 C CG    . ASN A 1 173 ? -85.673  47.121 20.962  1.00 37.05 ? 171  ASN A CG    1 
ATOM   1216 O OD1   . ASN A 1 173 ? -85.074  46.345 21.699  1.00 35.63 ? 171  ASN A OD1   1 
ATOM   1217 N ND2   . ASN A 1 173 ? -86.462  46.704 19.980  1.00 37.60 ? 171  ASN A ND2   1 
ATOM   1218 N N     . VAL A 1 174 ? -82.140  48.045 20.883  1.00 37.56 ? 172  VAL A N     1 
ATOM   1219 C CA    . VAL A 1 174 ? -81.087  47.717 19.936  1.00 36.97 ? 172  VAL A CA    1 
ATOM   1220 C C     . VAL A 1 174 ? -81.436  46.374 19.339  1.00 36.90 ? 172  VAL A C     1 
ATOM   1221 O O     . VAL A 1 174 ? -81.416  45.363 20.028  1.00 37.29 ? 172  VAL A O     1 
ATOM   1222 C CB    . VAL A 1 174 ? -79.721  47.605 20.610  1.00 37.97 ? 172  VAL A CB    1 
ATOM   1223 C CG1   . VAL A 1 174 ? -78.684  47.147 19.585  1.00 36.89 ? 172  VAL A CG1   1 
ATOM   1224 C CG2   . VAL A 1 174 ? -79.327  48.944 21.202  1.00 37.54 ? 172  VAL A CG2   1 
ATOM   1225 N N     . ILE A 1 175 ? -81.744  46.360 18.052  1.00 36.44 ? 173  ILE A N     1 
ATOM   1226 C CA    . ILE A 1 175 ? -82.136  45.121 17.410  1.00 35.95 ? 173  ILE A CA    1 
ATOM   1227 C C     . ILE A 1 175 ? -81.162  44.621 16.359  1.00 35.47 ? 173  ILE A C     1 
ATOM   1228 O O     . ILE A 1 175 ? -80.416  45.393 15.745  1.00 34.30 ? 173  ILE A O     1 
ATOM   1229 C CB    . ILE A 1 175 ? -83.505  45.277 16.735  1.00 36.34 ? 173  ILE A CB    1 
ATOM   1230 C CG1   . ILE A 1 175 ? -83.422  46.379 15.678  1.00 35.28 ? 173  ILE A CG1   1 
ATOM   1231 C CG2   . ILE A 1 175 ? -84.572  45.601 17.781  1.00 35.82 ? 173  ILE A CG2   1 
ATOM   1232 C CD1   . ILE A 1 175 ? -84.655  46.493 14.817  1.00 37.43 ? 173  ILE A CD1   1 
ATOM   1233 N N     . PRO A 1 176 ? -81.162  43.304 16.138  1.00 35.64 ? 174  PRO A N     1 
ATOM   1234 C CA    . PRO A 1 176 ? -80.269  42.720 15.140  1.00 35.87 ? 174  PRO A CA    1 
ATOM   1235 C C     . PRO A 1 176 ? -80.939  42.738 13.772  1.00 35.78 ? 174  PRO A C     1 
ATOM   1236 O O     . PRO A 1 176 ? -82.095  42.325 13.621  1.00 35.37 ? 174  PRO A O     1 
ATOM   1237 C CB    . PRO A 1 176 ? -80.059  41.299 15.655  1.00 35.27 ? 174  PRO A CB    1 
ATOM   1238 C CG    . PRO A 1 176 ? -81.401  40.962 16.219  1.00 36.28 ? 174  PRO A CG    1 
ATOM   1239 C CD    . PRO A 1 176 ? -81.798  42.253 16.958  1.00 36.50 ? 174  PRO A CD    1 
ATOM   1240 N N     . LEU A 1 177 ? -80.224  43.238 12.779  1.00 35.17 ? 175  LEU A N     1 
ATOM   1241 C CA    . LEU A 1 177 ? -80.769  43.250 11.439  1.00 35.54 ? 175  LEU A CA    1 
ATOM   1242 C C     . LEU A 1 177 ? -80.156  42.047 10.738  1.00 36.29 ? 175  LEU A C     1 
ATOM   1243 O O     . LEU A 1 177 ? -80.501  40.905 11.036  1.00 36.50 ? 175  LEU A O     1 
ATOM   1244 C CB    . LEU A 1 177 ? -80.406  44.554 10.714  1.00 34.71 ? 175  LEU A CB    1 
ATOM   1245 C CG    . LEU A 1 177 ? -80.878  45.866 11.360  1.00 34.07 ? 175  LEU A CG    1 
ATOM   1246 C CD1   . LEU A 1 177 ? -80.638  47.015 10.404  1.00 34.56 ? 175  LEU A CD1   1 
ATOM   1247 C CD2   . LEU A 1 177 ? -82.362  45.784 11.697  1.00 35.38 ? 175  LEU A CD2   1 
ATOM   1248 N N     . ASN A 1 178 ? -79.216  42.315 9.839   1.00 37.26 ? 176  ASN A N     1 
ATOM   1249 C CA    . ASN A 1 178 ? -78.544  41.283 9.067   1.00 37.74 ? 176  ASN A CA    1 
ATOM   1250 C C     . ASN A 1 178 ? -77.284  40.710 9.724   1.00 39.02 ? 176  ASN A C     1 
ATOM   1251 O O     . ASN A 1 178 ? -76.493  41.432 10.339  1.00 38.50 ? 176  ASN A O     1 
ATOM   1252 C CB    . ASN A 1 178 ? -78.195  41.847 7.692   1.00 35.60 ? 176  ASN A CB    1 
ATOM   1253 C CG    . ASN A 1 178 ? -79.424  42.240 6.905   1.00 33.58 ? 176  ASN A CG    1 
ATOM   1254 O OD1   . ASN A 1 178 ? -80.204  41.386 6.493   1.00 31.87 ? 176  ASN A OD1   1 
ATOM   1255 N ND2   . ASN A 1 178 ? -79.610  43.536 6.707   1.00 32.85 ? 176  ASN A ND2   1 
ATOM   1256 N N     . THR A 1 179 ? -77.111  39.401 9.563   1.00 39.85 ? 177  THR A N     1 
ATOM   1257 C CA    . THR A 1 179 ? -75.970  38.682 10.105  1.00 41.18 ? 177  THR A CA    1 
ATOM   1258 C C     . THR A 1 179 ? -75.204  37.978 8.969   1.00 41.90 ? 177  THR A C     1 
ATOM   1259 O O     . THR A 1 179 ? -75.771  37.185 8.220   1.00 40.45 ? 177  THR A O     1 
ATOM   1260 C CB    . THR A 1 179 ? -76.439  37.625 11.123  1.00 41.22 ? 177  THR A CB    1 
ATOM   1261 O OG1   . THR A 1 179 ? -77.305  38.240 12.082  1.00 42.73 ? 177  THR A OG1   1 
ATOM   1262 C CG2   . THR A 1 179 ? -75.260  37.014 11.850  1.00 40.36 ? 177  THR A CG2   1 
ATOM   1263 N N     . PHE A 1 180 ? -73.919  38.283 8.844   1.00 43.55 ? 178  PHE A N     1 
ATOM   1264 C CA    . PHE A 1 180 ? -73.068  37.674 7.817   1.00 44.95 ? 178  PHE A CA    1 
ATOM   1265 C C     . PHE A 1 180 ? -72.214  36.540 8.419   1.00 46.52 ? 178  PHE A C     1 
ATOM   1266 O O     . PHE A 1 180 ? -71.493  36.755 9.401   1.00 45.79 ? 178  PHE A O     1 
ATOM   1267 C CB    . PHE A 1 180 ? -72.125  38.717 7.207   1.00 43.80 ? 178  PHE A CB    1 
ATOM   1268 C CG    . PHE A 1 180 ? -72.822  39.849 6.492   1.00 43.88 ? 178  PHE A CG    1 
ATOM   1269 C CD1   . PHE A 1 180 ? -73.585  40.783 7.195   1.00 43.30 ? 178  PHE A CD1   1 
ATOM   1270 C CD2   . PHE A 1 180 ? -72.672  40.011 5.117   1.00 42.88 ? 178  PHE A CD2   1 
ATOM   1271 C CE1   . PHE A 1 180 ? -74.178  41.858 6.537   1.00 42.47 ? 178  PHE A CE1   1 
ATOM   1272 C CE2   . PHE A 1 180 ? -73.263  41.081 4.450   1.00 42.84 ? 178  PHE A CE2   1 
ATOM   1273 C CZ    . PHE A 1 180 ? -74.016  42.008 5.163   1.00 42.55 ? 178  PHE A CZ    1 
ATOM   1274 N N     . ARG A 1 181 ? -72.312  35.346 7.831   1.00 47.95 ? 179  ARG A N     1 
ATOM   1275 C CA    . ARG A 1 181 ? -71.548  34.166 8.258   1.00 49.81 ? 179  ARG A CA    1 
ATOM   1276 C C     . ARG A 1 181 ? -70.561  33.782 7.141   1.00 50.45 ? 179  ARG A C     1 
ATOM   1277 O O     . ARG A 1 181 ? -70.954  33.617 5.980   1.00 49.81 ? 179  ARG A O     1 
ATOM   1278 C CB    . ARG A 1 181 ? -72.471  32.955 8.490   1.00 51.29 ? 179  ARG A CB    1 
ATOM   1279 C CG    . ARG A 1 181 ? -73.549  33.073 9.566   1.00 54.11 ? 179  ARG A CG    1 
ATOM   1280 C CD    . ARG A 1 181 ? -72.974  32.955 10.969  1.00 58.01 ? 179  ARG A CD    1 
ATOM   1281 N NE    . ARG A 1 181 ? -73.893  32.323 11.927  1.00 60.76 ? 179  ARG A NE    1 
ATOM   1282 C CZ    . ARG A 1 181 ? -75.154  32.697 12.136  1.00 61.54 ? 179  ARG A CZ    1 
ATOM   1283 N NH1   . ARG A 1 181 ? -75.678  33.706 11.452  1.00 62.03 ? 179  ARG A NH1   1 
ATOM   1284 N NH2   . ARG A 1 181 ? -75.888  32.076 13.052  1.00 61.59 ? 179  ARG A NH2   1 
ATOM   1285 N N     . VAL A 1 182 ? -69.285  33.643 7.481   1.00 51.22 ? 180  VAL A N     1 
ATOM   1286 C CA    . VAL A 1 182 ? -68.288  33.234 6.490   1.00 52.42 ? 180  VAL A CA    1 
ATOM   1287 C C     . VAL A 1 182 ? -67.351  32.172 7.062   1.00 53.14 ? 180  VAL A C     1 
ATOM   1288 O O     . VAL A 1 182 ? -66.479  32.479 7.881   1.00 53.08 ? 180  VAL A O     1 
ATOM   1289 C CB    . VAL A 1 182 ? -67.428  34.409 5.996   1.00 52.13 ? 180  VAL A CB    1 
ATOM   1290 C CG1   . VAL A 1 182 ? -66.352  33.892 5.057   1.00 52.31 ? 180  VAL A CG1   1 
ATOM   1291 C CG2   . VAL A 1 182 ? -68.286  35.414 5.265   1.00 52.66 ? 180  VAL A CG2   1 
ATOM   1292 N N     . ALA A 1 183 ? -67.544  30.926 6.633   1.00 53.80 ? 181  ALA A N     1 
ATOM   1293 C CA    . ALA A 1 183 ? -66.721  29.808 7.092   1.00 54.86 ? 181  ALA A CA    1 
ATOM   1294 C C     . ALA A 1 183 ? -65.261  30.021 6.680   1.00 55.72 ? 181  ALA A C     1 
ATOM   1295 O O     . ALA A 1 183 ? -64.966  30.376 5.532   1.00 55.05 ? 181  ALA A O     1 
ATOM   1296 C CB    . ALA A 1 183 ? -67.252  28.498 6.514   1.00 54.19 ? 181  ALA A CB    1 
ATOM   1297 N N     . THR A 1 184 ? -64.348  29.799 7.621   1.00 56.93 ? 182  THR A N     1 
ATOM   1298 C CA    . THR A 1 184 ? -62.929  29.994 7.355   1.00 58.22 ? 182  THR A CA    1 
ATOM   1299 C C     . THR A 1 184 ? -62.091  28.733 7.087   1.00 58.45 ? 182  THR A C     1 
ATOM   1300 O O     . THR A 1 184 ? -60.993  28.838 6.534   1.00 58.31 ? 182  THR A O     1 
ATOM   1301 C CB    . THR A 1 184 ? -62.281  30.803 8.499   1.00 58.53 ? 182  THR A CB    1 
ATOM   1302 O OG1   . THR A 1 184 ? -62.620  30.209 9.760   1.00 59.97 ? 182  THR A OG1   1 
ATOM   1303 C CG2   . THR A 1 184 ? -62.780  32.240 8.476   1.00 58.59 ? 182  THR A CG2   1 
ATOM   1304 N N     . ASP A 1 185 ? -62.599  27.557 7.464   1.00 58.93 ? 183  ASP A N     1 
ATOM   1305 C CA    . ASP A 1 185 ? -61.872  26.293 7.247   1.00 59.25 ? 183  ASP A CA    1 
ATOM   1306 C C     . ASP A 1 185 ? -62.055  25.784 5.813   1.00 59.49 ? 183  ASP A C     1 
ATOM   1307 O O     . ASP A 1 185 ? -62.785  24.824 5.570   1.00 59.04 ? 183  ASP A O     1 
ATOM   1308 C CB    . ASP A 1 185 ? -62.354  25.205 8.220   1.00 59.67 ? 183  ASP A CB    1 
ATOM   1309 C CG    . ASP A 1 185 ? -62.348  25.661 9.674   1.00 60.82 ? 183  ASP A CG    1 
ATOM   1310 O OD1   . ASP A 1 185 ? -61.322  26.219 10.127  1.00 60.85 ? 183  ASP A OD1   1 
ATOM   1311 O OD2   . ASP A 1 185 ? -63.372  25.446 10.367  1.00 60.56 ? 183  ASP A OD2   1 
ATOM   1312 N N     . THR A 1 186 ? -61.372  26.425 4.874   1.00 60.55 ? 184  THR A N     1 
ATOM   1313 C CA    . THR A 1 186 ? -61.458  26.080 3.461   1.00 62.40 ? 184  THR A CA    1 
ATOM   1314 C C     . THR A 1 186 ? -61.339  24.595 3.121   1.00 64.23 ? 184  THR A C     1 
ATOM   1315 O O     . THR A 1 186 ? -62.291  23.990 2.627   1.00 65.11 ? 184  THR A O     1 
ATOM   1316 C CB    . THR A 1 186 ? -60.399  26.845 2.667   1.00 62.16 ? 184  THR A CB    1 
ATOM   1317 O OG1   . THR A 1 186 ? -60.523  28.243 2.948   1.00 62.58 ? 184  THR A OG1   1 
ATOM   1318 C CG2   . THR A 1 186 ? -60.577  26.621 1.178   1.00 61.98 ? 184  THR A CG2   1 
ATOM   1319 N N     . GLU A 1 187 ? -60.170  24.015 3.369   1.00 65.96 ? 185  GLU A N     1 
ATOM   1320 C CA    . GLU A 1 187 ? -59.932  22.606 3.069   1.00 67.37 ? 185  GLU A CA    1 
ATOM   1321 C C     . GLU A 1 187 ? -60.983  21.693 3.680   1.00 67.25 ? 185  GLU A C     1 
ATOM   1322 O O     . GLU A 1 187 ? -61.506  20.796 3.011   1.00 67.19 ? 185  GLU A O     1 
ATOM   1323 C CB    . GLU A 1 187 ? -58.560  22.169 3.586   1.00 69.46 ? 185  GLU A CB    1 
ATOM   1324 C CG    . GLU A 1 187 ? -57.380  22.990 3.094   1.00 72.49 ? 185  GLU A CG    1 
ATOM   1325 C CD    . GLU A 1 187 ? -57.161  22.877 1.601   1.00 74.51 ? 185  GLU A CD    1 
ATOM   1326 O OE1   . GLU A 1 187 ? -56.079  23.305 1.137   1.00 75.74 ? 185  GLU A OE1   1 
ATOM   1327 O OE2   . GLU A 1 187 ? -58.064  22.370 0.894   1.00 75.01 ? 185  GLU A OE2   1 
ATOM   1328 N N     . TYR A 1 188 ? -61.276  21.911 4.959   1.00 66.77 ? 186  TYR A N     1 
ATOM   1329 C CA    . TYR A 1 188 ? -62.254  21.089 5.657   1.00 67.11 ? 186  TYR A CA    1 
ATOM   1330 C C     . TYR A 1 188 ? -63.619  21.126 4.976   1.00 66.76 ? 186  TYR A C     1 
ATOM   1331 O O     . TYR A 1 188 ? -64.322  20.119 4.931   1.00 65.73 ? 186  TYR A O     1 
ATOM   1332 C CB    . TYR A 1 188 ? -62.386  21.539 7.116   1.00 67.72 ? 186  TYR A CB    1 
ATOM   1333 C CG    . TYR A 1 188 ? -63.493  20.829 7.864   1.00 68.95 ? 186  TYR A CG    1 
ATOM   1334 C CD1   . TYR A 1 188 ? -63.486  19.441 8.012   1.00 69.13 ? 186  TYR A CD1   1 
ATOM   1335 C CD2   . TYR A 1 188 ? -64.569  21.540 8.388   1.00 69.32 ? 186  TYR A CD2   1 
ATOM   1336 C CE1   . TYR A 1 188 ? -64.527  18.781 8.658   1.00 69.96 ? 186  TYR A CE1   1 
ATOM   1337 C CE2   . TYR A 1 188 ? -65.615  20.891 9.034   1.00 69.97 ? 186  TYR A CE2   1 
ATOM   1338 C CZ    . TYR A 1 188 ? -65.590  19.515 9.164   1.00 70.62 ? 186  TYR A CZ    1 
ATOM   1339 O OH    . TYR A 1 188 ? -66.637  18.878 9.792   1.00 71.70 ? 186  TYR A OH    1 
ATOM   1340 N N     . LEU A 1 189 ? -63.983  22.292 4.448   1.00 67.52 ? 187  LEU A N     1 
ATOM   1341 C CA    . LEU A 1 189 ? -65.261  22.468 3.766   1.00 68.04 ? 187  LEU A CA    1 
ATOM   1342 C C     . LEU A 1 189 ? -65.304  21.716 2.444   1.00 68.09 ? 187  LEU A C     1 
ATOM   1343 O O     . LEU A 1 189 ? -66.311  21.083 2.117   1.00 67.36 ? 187  LEU A O     1 
ATOM   1344 C CB    . LEU A 1 189 ? -65.534  23.952 3.516   1.00 68.92 ? 187  LEU A CB    1 
ATOM   1345 C CG    . LEU A 1 189 ? -65.922  24.801 4.729   1.00 69.62 ? 187  LEU A CG    1 
ATOM   1346 C CD1   . LEU A 1 189 ? -66.114  26.241 4.289   1.00 70.06 ? 187  LEU A CD1   1 
ATOM   1347 C CD2   . LEU A 1 189 ? -67.197  24.261 5.355   1.00 69.33 ? 187  LEU A CD2   1 
ATOM   1348 N N     . ARG A 1 190 ? -64.216  21.795 1.683   1.00 68.35 ? 188  ARG A N     1 
ATOM   1349 C CA    . ARG A 1 190 ? -64.136  21.100 0.401   1.00 69.17 ? 188  ARG A CA    1 
ATOM   1350 C C     . ARG A 1 190 ? -64.477  19.629 0.608   1.00 69.08 ? 188  ARG A C     1 
ATOM   1351 O O     . ARG A 1 190 ? -65.241  19.045 -0.165  1.00 69.05 ? 188  ARG A O     1 
ATOM   1352 C CB    . ARG A 1 190 ? -62.729  21.217 -0.186  1.00 70.21 ? 188  ARG A CB    1 
ATOM   1353 C CG    . ARG A 1 190 ? -62.274  22.640 -0.441  1.00 72.22 ? 188  ARG A CG    1 
ATOM   1354 C CD    . ARG A 1 190 ? -63.082  23.298 -1.546  1.00 73.83 ? 188  ARG A CD    1 
ATOM   1355 N NE    . ARG A 1 190 ? -62.637  24.666 -1.812  1.00 76.12 ? 188  ARG A NE    1 
ATOM   1356 C CZ    . ARG A 1 190 ? -62.905  25.714 -1.035  1.00 76.60 ? 188  ARG A CZ    1 
ATOM   1357 N NH1   . ARG A 1 190 ? -62.450  26.921 -1.363  1.00 76.68 ? 188  ARG A NH1   1 
ATOM   1358 N NH2   . ARG A 1 190 ? -63.639  25.559 0.061   1.00 76.29 ? 188  ARG A NH2   1 
ATOM   1359 N N     . ASP A 1 191 ? -63.911  19.041 1.661   1.00 68.83 ? 189  ASP A N     1 
ATOM   1360 C CA    . ASP A 1 191 ? -64.149  17.639 1.979   1.00 69.00 ? 189  ASP A CA    1 
ATOM   1361 C C     . ASP A 1 191 ? -65.538  17.352 2.518   1.00 67.94 ? 189  ASP A C     1 
ATOM   1362 O O     . ASP A 1 191 ? -66.130  16.331 2.183   1.00 67.89 ? 189  ASP A O     1 
ATOM   1363 C CB    . ASP A 1 191 ? -63.100  17.131 2.966   1.00 70.94 ? 189  ASP A CB    1 
ATOM   1364 C CG    . ASP A 1 191 ? -61.803  16.771 2.283   1.00 72.95 ? 189  ASP A CG    1 
ATOM   1365 O OD1   . ASP A 1 191 ? -61.796  15.797 1.500   1.00 74.38 ? 189  ASP A OD1   1 
ATOM   1366 O OD2   . ASP A 1 191 ? -60.790  17.465 2.514   1.00 75.11 ? 189  ASP A OD2   1 
ATOM   1367 N N     . ARG A 1 192 ? -66.053  18.235 3.363   1.00 67.30 ? 190  ARG A N     1 
ATOM   1368 C CA    . ARG A 1 192 ? -67.393  18.053 3.913   1.00 66.68 ? 190  ARG A CA    1 
ATOM   1369 C C     . ARG A 1 192 ? -68.416  18.017 2.777   1.00 66.07 ? 190  ARG A C     1 
ATOM   1370 O O     . ARG A 1 192 ? -69.279  17.145 2.727   1.00 65.73 ? 190  ARG A O     1 
ATOM   1371 C CB    . ARG A 1 192 ? -67.721  19.196 4.869   1.00 67.08 ? 190  ARG A CB    1 
ATOM   1372 C CG    . ARG A 1 192 ? -67.476  18.878 6.329   1.00 68.61 ? 190  ARG A CG    1 
ATOM   1373 C CD    . ARG A 1 192 ? -68.577  17.982 6.883   1.00 69.83 ? 190  ARG A CD    1 
ATOM   1374 N NE    . ARG A 1 192 ? -68.480  16.610 6.401   1.00 70.68 ? 190  ARG A NE    1 
ATOM   1375 C CZ    . ARG A 1 192 ? -69.429  15.691 6.553   1.00 71.32 ? 190  ARG A CZ    1 
ATOM   1376 N NH1   . ARG A 1 192 ? -70.564  15.994 7.173   1.00 70.88 ? 190  ARG A NH1   1 
ATOM   1377 N NH2   . ARG A 1 192 ? -69.232  14.459 6.099   1.00 71.94 ? 190  ARG A NH2   1 
ATOM   1378 N N     . VAL A 1 193 ? -68.301  18.973 1.864   1.00 65.57 ? 191  VAL A N     1 
ATOM   1379 C CA    . VAL A 1 193 ? -69.199  19.065 0.722   1.00 65.38 ? 191  VAL A CA    1 
ATOM   1380 C C     . VAL A 1 193 ? -69.155  17.804 -0.127  1.00 65.43 ? 191  VAL A C     1 
ATOM   1381 O O     . VAL A 1 193 ? -70.194  17.239 -0.458  1.00 65.02 ? 191  VAL A O     1 
ATOM   1382 C CB    . VAL A 1 193 ? -68.832  20.275 -0.168  1.00 65.31 ? 191  VAL A CB    1 
ATOM   1383 C CG1   . VAL A 1 193 ? -69.619  20.240 -1.463  1.00 64.91 ? 191  VAL A CG1   1 
ATOM   1384 C CG2   . VAL A 1 193 ? -69.109  21.566 0.583   1.00 65.04 ? 191  VAL A CG2   1 
ATOM   1385 N N     . ALA A 1 194 ? -67.948  17.372 -0.480  1.00 65.86 ? 192  ALA A N     1 
ATOM   1386 C CA    . ALA A 1 194 ? -67.764  16.179 -1.302  1.00 66.12 ? 192  ALA A CA    1 
ATOM   1387 C C     . ALA A 1 194 ? -68.456  14.966 -0.696  1.00 66.82 ? 192  ALA A C     1 
ATOM   1388 O O     . ALA A 1 194 ? -69.091  14.188 -1.411  1.00 66.77 ? 192  ALA A O     1 
ATOM   1389 C CB    . ALA A 1 194 ? -66.287  15.899 -1.487  1.00 66.16 ? 192  ALA A CB    1 
ATOM   1390 N N     . HIS A 1 195 ? -68.335  14.801 0.619   1.00 67.33 ? 193  HIS A N     1 
ATOM   1391 C CA    . HIS A 1 195 ? -68.974  13.680 1.300   1.00 68.02 ? 193  HIS A CA    1 
ATOM   1392 C C     . HIS A 1 195 ? -70.493  13.817 1.245   1.00 69.11 ? 193  HIS A C     1 
ATOM   1393 O O     . HIS A 1 195 ? -71.196  12.878 0.878   1.00 68.72 ? 193  HIS A O     1 
ATOM   1394 C CB    . HIS A 1 195 ? -68.535  13.602 2.768   1.00 67.19 ? 193  HIS A CB    1 
ATOM   1395 C CG    . HIS A 1 195 ? -67.232  12.893 2.983   1.00 66.84 ? 193  HIS A CG    1 
ATOM   1396 N ND1   . HIS A 1 195 ? -66.009  13.486 2.752   1.00 66.12 ? 193  HIS A ND1   1 
ATOM   1397 C CD2   . HIS A 1 195 ? -66.964  11.636 3.413   1.00 66.45 ? 193  HIS A CD2   1 
ATOM   1398 C CE1   . HIS A 1 195 ? -65.045  12.627 3.032   1.00 66.05 ? 193  HIS A CE1   1 
ATOM   1399 N NE2   . HIS A 1 195 ? -65.598  11.496 3.434   1.00 65.75 ? 193  HIS A NE2   1 
ATOM   1400 N N     . LEU A 1 196 ? -70.991  14.994 1.611   1.00 70.79 ? 194  LEU A N     1 
ATOM   1401 C CA    . LEU A 1 196 ? -72.426  15.261 1.622   1.00 72.81 ? 194  LEU A CA    1 
ATOM   1402 C C     . LEU A 1 196 ? -73.046  15.204 0.234   1.00 74.08 ? 194  LEU A C     1 
ATOM   1403 O O     . LEU A 1 196 ? -74.171  14.731 0.064   1.00 74.07 ? 194  LEU A O     1 
ATOM   1404 C CB    . LEU A 1 196 ? -72.704  16.634 2.241   1.00 72.89 ? 194  LEU A CB    1 
ATOM   1405 C CG    . LEU A 1 196 ? -72.415  16.788 3.734   1.00 72.97 ? 194  LEU A CG    1 
ATOM   1406 C CD1   . LEU A 1 196 ? -72.582  18.238 4.135   1.00 72.81 ? 194  LEU A CD1   1 
ATOM   1407 C CD2   . LEU A 1 196 ? -73.355  15.903 4.534   1.00 73.31 ? 194  LEU A CD2   1 
ATOM   1408 N N     . ARG A 1 197 ? -72.309  15.690 -0.757  1.00 75.72 ? 195  ARG A N     1 
ATOM   1409 C CA    . ARG A 1 197 ? -72.795  15.699 -2.127  1.00 77.57 ? 195  ARG A CA    1 
ATOM   1410 C C     . ARG A 1 197 ? -73.005  14.277 -2.630  1.00 78.85 ? 195  ARG A C     1 
ATOM   1411 O O     . ARG A 1 197 ? -73.496  14.066 -3.739  1.00 79.04 ? 195  ARG A O     1 
ATOM   1412 C CB    . ARG A 1 197 ? -71.799  16.427 -3.026  1.00 77.85 ? 195  ARG A CB    1 
ATOM   1413 C CG    . ARG A 1 197 ? -72.354  16.790 -4.383  1.00 78.71 ? 195  ARG A CG    1 
ATOM   1414 C CD    . ARG A 1 197 ? -71.300  17.458 -5.246  1.00 79.51 ? 195  ARG A CD    1 
ATOM   1415 N NE    . ARG A 1 197 ? -70.777  18.683 -4.647  1.00 80.16 ? 195  ARG A NE    1 
ATOM   1416 C CZ    . ARG A 1 197 ? -69.949  19.521 -5.267  1.00 81.20 ? 195  ARG A CZ    1 
ATOM   1417 N NH1   . ARG A 1 197 ? -69.546  19.269 -6.510  1.00 81.00 ? 195  ARG A NH1   1 
ATOM   1418 N NH2   . ARG A 1 197 ? -69.523  20.614 -4.647  1.00 81.05 ? 195  ARG A NH2   1 
ATOM   1419 N N     . THR A 1 198 ? -72.634  13.304 -1.803  1.00 80.25 ? 196  THR A N     1 
ATOM   1420 C CA    . THR A 1 198 ? -72.771  11.895 -2.152  1.00 81.43 ? 196  THR A CA    1 
ATOM   1421 C C     . THR A 1 198 ? -73.725  11.191 -1.195  1.00 82.44 ? 196  THR A C     1 
ATOM   1422 O O     . THR A 1 198 ? -74.268  10.137 -1.513  1.00 82.74 ? 196  THR A O     1 
ATOM   1423 C CB    . THR A 1 198 ? -71.395  11.183 -2.118  1.00 81.25 ? 196  THR A CB    1 
ATOM   1424 O OG1   . THR A 1 198 ? -70.545  11.739 -3.129  1.00 80.80 ? 196  THR A OG1   1 
ATOM   1425 C CG2   . THR A 1 198 ? -71.547  9.692  -2.363  1.00 80.93 ? 196  THR A CG2   1 
ATOM   1426 N N     . GLU A 1 199 ? -73.934  11.782 -0.025  1.00 83.94 ? 197  GLU A N     1 
ATOM   1427 C CA    . GLU A 1 199 ? -74.828  11.200 0.970   1.00 85.81 ? 197  GLU A CA    1 
ATOM   1428 C C     . GLU A 1 199 ? -76.234  11.791 0.881   1.00 86.59 ? 197  GLU A C     1 
ATOM   1429 O O     . GLU A 1 199 ? -77.187  11.234 1.432   1.00 86.97 ? 197  GLU A O     1 
ATOM   1430 C CB    . GLU A 1 199 ? -74.266  11.423 2.377   1.00 86.64 ? 197  GLU A CB    1 
ATOM   1431 C CG    . GLU A 1 199 ? -72.965  10.679 2.643   1.00 88.75 ? 197  GLU A CG    1 
ATOM   1432 C CD    . GLU A 1 199 ? -72.248  11.167 3.893   1.00 89.93 ? 197  GLU A CD    1 
ATOM   1433 O OE1   . GLU A 1 199 ? -72.848  11.114 4.991   1.00 90.04 ? 197  GLU A OE1   1 
ATOM   1434 O OE2   . GLU A 1 199 ? -71.079  11.602 3.774   1.00 90.47 ? 197  GLU A OE2   1 
ATOM   1435 N N     . LEU A 1 200 ? -76.362  12.914 0.180   1.00 87.04 ? 198  LEU A N     1 
ATOM   1436 C CA    . LEU A 1 200 ? -77.653  13.577 0.036   1.00 87.15 ? 198  LEU A CA    1 
ATOM   1437 C C     . LEU A 1 200 ? -77.965  13.845 -1.430  1.00 87.40 ? 198  LEU A C     1 
ATOM   1438 O O     . LEU A 1 200 ? -79.120  14.067 -1.798  1.00 87.73 ? 198  LEU A O     1 
ATOM   1439 C CB    . LEU A 1 200 ? -77.647  14.900 0.804   1.00 86.88 ? 198  LEU A CB    1 
ATOM   1440 C CG    . LEU A 1 200 ? -77.236  14.838 2.277   1.00 86.70 ? 198  LEU A CG    1 
ATOM   1441 C CD1   . LEU A 1 200 ? -76.962  16.242 2.783   1.00 86.83 ? 198  LEU A CD1   1 
ATOM   1442 C CD2   . LEU A 1 200 ? -78.320  14.163 3.099   1.00 86.57 ? 198  LEU A CD2   1 
ATOM   1443 N N     . GLY A 1 201 ? -76.933  13.819 -2.265  1.00 87.32 ? 199  GLY A N     1 
ATOM   1444 C CA    . GLY A 1 201 ? -77.127  14.076 -3.680  1.00 87.62 ? 199  GLY A CA    1 
ATOM   1445 C C     . GLY A 1 201 ? -77.183  15.568 -3.947  1.00 88.01 ? 199  GLY A C     1 
ATOM   1446 O O     . GLY A 1 201 ? -77.681  16.329 -3.116  1.00 88.18 ? 199  GLY A O     1 
ATOM   1447 N N     . ALA A 1 202 ? -76.672  15.988 -5.101  1.00 88.10 ? 200  ALA A N     1 
ATOM   1448 C CA    . ALA A 1 202 ? -76.659  17.399 -5.476  1.00 88.39 ? 200  ALA A CA    1 
ATOM   1449 C C     . ALA A 1 202 ? -77.976  18.109 -5.153  1.00 88.60 ? 200  ALA A C     1 
ATOM   1450 O O     . ALA A 1 202 ? -77.988  19.295 -4.808  1.00 88.47 ? 200  ALA A O     1 
ATOM   1451 C CB    . ALA A 1 202 ? -76.346  17.534 -6.965  1.00 88.07 ? 200  ALA A CB    1 
ATOM   1452 N N     . LYS A 1 203 ? -79.079  17.372 -5.260  1.00 88.51 ? 201  LYS A N     1 
ATOM   1453 C CA    . LYS A 1 203 ? -80.404  17.921 -4.999  1.00 88.20 ? 201  LYS A CA    1 
ATOM   1454 C C     . LYS A 1 203 ? -80.606  18.245 -3.522  1.00 87.92 ? 201  LYS A C     1 
ATOM   1455 O O     . LYS A 1 203 ? -80.559  19.408 -3.125  1.00 88.44 ? 201  LYS A O     1 
ATOM   1456 C CB    . LYS A 1 203 ? -81.480  16.935 -5.459  1.00 88.63 ? 201  LYS A CB    1 
ATOM   1457 C CG    . LYS A 1 203 ? -82.791  17.596 -5.845  1.00 88.92 ? 201  LYS A CG    1 
ATOM   1458 C CD    . LYS A 1 203 ? -82.623  18.417 -7.120  1.00 89.23 ? 201  LYS A CD    1 
ATOM   1459 C CE    . LYS A 1 203 ? -83.833  19.299 -7.377  1.00 89.44 ? 201  LYS A CE    1 
ATOM   1460 N NZ    . LYS A 1 203 ? -84.024  20.290 -6.276  1.00 89.39 ? 201  LYS A NZ    1 
ATOM   1461 N N     . ALA A 1 204 ? -80.832  17.216 -2.712  1.00 87.17 ? 202  ALA A N     1 
ATOM   1462 C CA    . ALA A 1 204 ? -81.047  17.406 -1.281  1.00 86.69 ? 202  ALA A CA    1 
ATOM   1463 C C     . ALA A 1 204 ? -80.053  18.390 -0.672  1.00 86.35 ? 202  ALA A C     1 
ATOM   1464 O O     . ALA A 1 204 ? -80.394  19.141 0.238   1.00 86.41 ? 202  ALA A O     1 
ATOM   1465 C CB    . ALA A 1 204 ? -80.963  16.067 -0.558  1.00 86.63 ? 202  ALA A CB    1 
ATOM   1466 N N     . LEU A 1 205 ? -78.826  18.390 -1.178  1.00 86.01 ? 203  LEU A N     1 
ATOM   1467 C CA    . LEU A 1 205 ? -77.798  19.287 -0.665  1.00 85.66 ? 203  LEU A CA    1 
ATOM   1468 C C     . LEU A 1 205 ? -78.186  20.743 -0.905  1.00 85.58 ? 203  LEU A C     1 
ATOM   1469 O O     . LEU A 1 205 ? -78.313  21.516 0.042   1.00 85.72 ? 203  LEU A O     1 
ATOM   1470 C CB    . LEU A 1 205 ? -76.454  19.000 -1.342  1.00 85.68 ? 203  LEU A CB    1 
ATOM   1471 C CG    . LEU A 1 205 ? -75.163  19.425 -0.631  1.00 85.30 ? 203  LEU A CG    1 
ATOM   1472 C CD1   . LEU A 1 205 ? -74.007  19.316 -1.610  1.00 85.05 ? 203  LEU A CD1   1 
ATOM   1473 C CD2   . LEU A 1 205 ? -75.265  20.847 -0.116  1.00 85.62 ? 203  LEU A CD2   1 
ATOM   1474 N N     . LYS A 1 206 ? -78.373  21.112 -2.170  1.00 85.33 ? 204  LYS A N     1 
ATOM   1475 C CA    . LYS A 1 206 ? -78.731  22.481 -2.521  1.00 85.15 ? 204  LYS A CA    1 
ATOM   1476 C C     . LYS A 1 206 ? -79.900  23.013 -1.713  1.00 84.91 ? 204  LYS A C     1 
ATOM   1477 O O     . LYS A 1 206 ? -79.950  24.198 -1.392  1.00 85.07 ? 204  LYS A O     1 
ATOM   1478 C CB    . LYS A 1 206 ? -79.044  22.584 -4.014  1.00 85.35 ? 204  LYS A CB    1 
ATOM   1479 C CG    . LYS A 1 206 ? -77.817  22.434 -4.879  1.00 86.04 ? 204  LYS A CG    1 
ATOM   1480 C CD    . LYS A 1 206 ? -76.792  23.501 -4.525  1.00 86.60 ? 204  LYS A CD    1 
ATOM   1481 C CE    . LYS A 1 206 ? -75.377  23.006 -4.772  1.00 86.72 ? 204  LYS A CE    1 
ATOM   1482 N NZ    . LYS A 1 206 ? -75.067  21.817 -3.923  1.00 86.59 ? 204  LYS A NZ    1 
ATOM   1483 N N     . GLN A 1 207 ? -80.842  22.140 -1.386  1.00 84.43 ? 205  GLN A N     1 
ATOM   1484 C CA    . GLN A 1 207 ? -81.993  22.551 -0.599  1.00 84.12 ? 205  GLN A CA    1 
ATOM   1485 C C     . GLN A 1 207 ? -81.522  22.964 0.791   1.00 83.28 ? 205  GLN A C     1 
ATOM   1486 O O     . GLN A 1 207 ? -81.813  24.066 1.255   1.00 83.58 ? 205  GLN A O     1 
ATOM   1487 C CB    . GLN A 1 207 ? -82.999  21.405 -0.496  1.00 85.13 ? 205  GLN A CB    1 
ATOM   1488 C CG    . GLN A 1 207 ? -84.144  21.663 0.464   1.00 86.56 ? 205  GLN A CG    1 
ATOM   1489 C CD    . GLN A 1 207 ? -85.111  20.501 0.521   1.00 87.83 ? 205  GLN A CD    1 
ATOM   1490 O OE1   . GLN A 1 207 ? -84.702  19.345 0.650   1.00 88.41 ? 205  GLN A OE1   1 
ATOM   1491 N NE2   . GLN A 1 207 ? -86.404  20.800 0.429   1.00 88.31 ? 205  GLN A NE2   1 
ATOM   1492 N N     . HIS A 1 208 ? -80.789  22.077 1.453   1.00 81.92 ? 206  HIS A N     1 
ATOM   1493 C CA    . HIS A 1 208 ? -80.279  22.377 2.783   1.00 80.89 ? 206  HIS A CA    1 
ATOM   1494 C C     . HIS A 1 208 ? -79.269  23.510 2.693   1.00 79.05 ? 206  HIS A C     1 
ATOM   1495 O O     . HIS A 1 208 ? -79.121  24.307 3.619   1.00 78.59 ? 206  HIS A O     1 
ATOM   1496 C CB    . HIS A 1 208 ? -79.607  21.144 3.385   1.00 82.15 ? 206  HIS A CB    1 
ATOM   1497 C CG    . HIS A 1 208 ? -80.542  20.000 3.616   1.00 83.93 ? 206  HIS A CG    1 
ATOM   1498 N ND1   . HIS A 1 208 ? -81.590  20.066 4.509   1.00 84.66 ? 206  HIS A ND1   1 
ATOM   1499 C CD2   . HIS A 1 208 ? -80.595  18.765 3.063   1.00 84.52 ? 206  HIS A CD2   1 
ATOM   1500 C CE1   . HIS A 1 208 ? -82.249  18.921 4.495   1.00 85.22 ? 206  HIS A CE1   1 
ATOM   1501 N NE2   . HIS A 1 208 ? -81.666  18.114 3.626   1.00 85.14 ? 206  HIS A NE2   1 
ATOM   1502 N N     . LEU A 1 209 ? -78.583  23.577 1.559   1.00 76.98 ? 207  LEU A N     1 
ATOM   1503 C CA    . LEU A 1 209 ? -77.566  24.590 1.337   1.00 75.17 ? 207  LEU A CA    1 
ATOM   1504 C C     . LEU A 1 209 ? -78.187  25.914 0.943   1.00 74.33 ? 207  LEU A C     1 
ATOM   1505 O O     . LEU A 1 209 ? -77.492  26.917 0.800   1.00 74.14 ? 207  LEU A O     1 
ATOM   1506 C CB    . LEU A 1 209 ? -76.597  24.127 0.251   1.00 74.49 ? 207  LEU A CB    1 
ATOM   1507 C CG    . LEU A 1 209 ? -75.123  24.462 0.479   1.00 73.79 ? 207  LEU A CG    1 
ATOM   1508 C CD1   . LEU A 1 209 ? -74.661  23.840 1.784   1.00 72.99 ? 207  LEU A CD1   1 
ATOM   1509 C CD2   . LEU A 1 209 ? -74.289  23.943 -0.683  1.00 73.64 ? 207  LEU A CD2   1 
ATOM   1510 N N     . GLN A 1 210 ? -79.501  25.921 0.763   1.00 73.68 ? 208  GLN A N     1 
ATOM   1511 C CA    . GLN A 1 210 ? -80.177  27.152 0.396   1.00 72.97 ? 208  GLN A CA    1 
ATOM   1512 C C     . GLN A 1 210 ? -80.401  27.967 1.653   1.00 71.58 ? 208  GLN A C     1 
ATOM   1513 O O     . GLN A 1 210 ? -80.524  29.186 1.596   1.00 71.25 ? 208  GLN A O     1 
ATOM   1514 C CB    . GLN A 1 210 ? -81.507  26.856 -0.293  1.00 74.10 ? 208  GLN A CB    1 
ATOM   1515 C CG    . GLN A 1 210 ? -81.772  27.762 -1.487  1.00 75.57 ? 208  GLN A CG    1 
ATOM   1516 C CD    . GLN A 1 210 ? -80.693  27.657 -2.565  1.00 76.82 ? 208  GLN A CD    1 
ATOM   1517 O OE1   . GLN A 1 210 ? -80.733  28.373 -3.566  1.00 77.32 ? 208  GLN A OE1   1 
ATOM   1518 N NE2   . GLN A 1 210 ? -79.728  26.762 -2.364  1.00 77.59 ? 208  GLN A NE2   1 
ATOM   1519 N N     . ARG A 1 211 ? -80.438  27.282 2.791   1.00 70.47 ? 209  ARG A N     1 
ATOM   1520 C CA    . ARG A 1 211 ? -80.619  27.948 4.070   1.00 69.75 ? 209  ARG A CA    1 
ATOM   1521 C C     . ARG A 1 211 ? -79.390  27.828 4.971   1.00 68.93 ? 209  ARG A C     1 
ATOM   1522 O O     . ARG A 1 211 ? -79.150  28.699 5.812   1.00 68.69 ? 209  ARG A O     1 
ATOM   1523 C CB    . ARG A 1 211 ? -81.819  27.378 4.825   1.00 70.30 ? 209  ARG A CB    1 
ATOM   1524 C CG    . ARG A 1 211 ? -82.122  28.174 6.089   1.00 71.92 ? 209  ARG A CG    1 
ATOM   1525 C CD    . ARG A 1 211 ? -83.057  27.459 7.049   1.00 72.63 ? 209  ARG A CD    1 
ATOM   1526 N NE    . ARG A 1 211 ? -84.301  27.029 6.419   1.00 73.21 ? 209  ARG A NE    1 
ATOM   1527 C CZ    . ARG A 1 211 ? -85.361  26.590 7.092   1.00 73.70 ? 209  ARG A CZ    1 
ATOM   1528 N NH1   . ARG A 1 211 ? -85.329  26.528 8.421   1.00 73.56 ? 209  ARG A NH1   1 
ATOM   1529 N NH2   . ARG A 1 211 ? -86.450  26.205 6.438   1.00 73.28 ? 209  ARG A NH2   1 
ATOM   1530 N N     . TYR A 1 212 ? -78.610  26.761 4.800   1.00 67.62 ? 210  TYR A N     1 
ATOM   1531 C CA    . TYR A 1 212 ? -77.436  26.562 5.647   1.00 66.25 ? 210  TYR A CA    1 
ATOM   1532 C C     . TYR A 1 212 ? -76.071  26.566 4.962   1.00 64.65 ? 210  TYR A C     1 
ATOM   1533 O O     . TYR A 1 212 ? -75.142  25.911 5.426   1.00 64.63 ? 210  TYR A O     1 
ATOM   1534 C CB    . TYR A 1 212 ? -77.591  25.273 6.452   1.00 67.29 ? 210  TYR A CB    1 
ATOM   1535 C CG    . TYR A 1 212 ? -78.884  25.208 7.227   1.00 68.53 ? 210  TYR A CG    1 
ATOM   1536 C CD1   . TYR A 1 212 ? -80.058  24.765 6.620   1.00 69.16 ? 210  TYR A CD1   1 
ATOM   1537 C CD2   . TYR A 1 212 ? -78.945  25.631 8.555   1.00 69.01 ? 210  TYR A CD2   1 
ATOM   1538 C CE1   . TYR A 1 212 ? -81.262  24.743 7.309   1.00 69.52 ? 210  TYR A CE1   1 
ATOM   1539 C CE2   . TYR A 1 212 ? -80.148  25.616 9.256   1.00 70.12 ? 210  TYR A CE2   1 
ATOM   1540 C CZ    . TYR A 1 212 ? -81.303  25.170 8.625   1.00 70.11 ? 210  TYR A CZ    1 
ATOM   1541 O OH    . TYR A 1 212 ? -82.502  25.160 9.302   1.00 70.66 ? 210  TYR A OH    1 
ATOM   1542 N N     . ASN A 1 213 ? -75.942  27.303 3.868   1.00 62.49 ? 211  ASN A N     1 
ATOM   1543 C CA    . ASN A 1 213 ? -74.667  27.375 3.178   1.00 61.32 ? 211  ASN A CA    1 
ATOM   1544 C C     . ASN A 1 213 ? -73.695  28.056 4.138   1.00 60.81 ? 211  ASN A C     1 
ATOM   1545 O O     . ASN A 1 213 ? -73.958  29.157 4.611   1.00 60.96 ? 211  ASN A O     1 
ATOM   1546 C CB    . ASN A 1 213 ? -74.811  28.185 1.888   1.00 60.68 ? 211  ASN A CB    1 
ATOM   1547 C CG    . ASN A 1 213 ? -73.572  28.129 1.023   1.00 60.45 ? 211  ASN A CG    1 
ATOM   1548 O OD1   . ASN A 1 213 ? -72.645  28.918 1.185   1.00 60.57 ? 211  ASN A OD1   1 
ATOM   1549 N ND2   . ASN A 1 213 ? -73.546  27.180 0.099   1.00 60.98 ? 211  ASN A ND2   1 
ATOM   1550 N N     . PRO A 1 214 ? -72.562  27.401 4.445   1.00 60.19 ? 212  PRO A N     1 
ATOM   1551 C CA    . PRO A 1 214 ? -71.539  27.929 5.356   1.00 58.97 ? 212  PRO A CA    1 
ATOM   1552 C C     . PRO A 1 214 ? -71.308  29.430 5.210   1.00 57.98 ? 212  PRO A C     1 
ATOM   1553 O O     . PRO A 1 214 ? -71.130  30.139 6.200   1.00 57.86 ? 212  PRO A O     1 
ATOM   1554 C CB    . PRO A 1 214 ? -70.308  27.111 4.986   1.00 59.68 ? 212  PRO A CB    1 
ATOM   1555 C CG    . PRO A 1 214 ? -70.903  25.776 4.662   1.00 60.02 ? 212  PRO A CG    1 
ATOM   1556 C CD    . PRO A 1 214 ? -72.099  26.151 3.812   1.00 60.22 ? 212  PRO A CD    1 
ATOM   1557 N N     . ASP A 1 215 ? -71.305  29.902 3.969   1.00 56.53 ? 213  ASP A N     1 
ATOM   1558 C CA    . ASP A 1 215 ? -71.112  31.314 3.671   1.00 55.52 ? 213  ASP A CA    1 
ATOM   1559 C C     . ASP A 1 215 ? -72.492  31.885 3.319   1.00 53.75 ? 213  ASP A C     1 
ATOM   1560 O O     . ASP A 1 215 ? -73.019  31.606 2.241   1.00 53.30 ? 213  ASP A O     1 
ATOM   1561 C CB    . ASP A 1 215 ? -70.169  31.475 2.472   1.00 57.18 ? 213  ASP A CB    1 
ATOM   1562 C CG    . ASP A 1 215 ? -68.866  30.702 2.631   1.00 58.68 ? 213  ASP A CG    1 
ATOM   1563 O OD1   . ASP A 1 215 ? -67.961  31.176 3.352   1.00 59.88 ? 213  ASP A OD1   1 
ATOM   1564 O OD2   . ASP A 1 215 ? -68.749  29.614 2.027   1.00 59.63 ? 213  ASP A OD2   1 
ATOM   1565 N N     . ARG A 1 216 ? -73.074  32.687 4.209   1.00 51.49 ? 214  ARG A N     1 
ATOM   1566 C CA    . ARG A 1 216 ? -74.406  33.239 3.952   1.00 49.49 ? 214  ARG A CA    1 
ATOM   1567 C C     . ARG A 1 216 ? -74.767  34.482 4.745   1.00 48.15 ? 214  ARG A C     1 
ATOM   1568 O O     . ARG A 1 216 ? -74.095  34.835 5.717   1.00 47.39 ? 214  ARG A O     1 
ATOM   1569 C CB    . ARG A 1 216 ? -75.475  32.190 4.254   1.00 49.75 ? 214  ARG A CB    1 
ATOM   1570 C CG    . ARG A 1 216 ? -75.422  31.654 5.681   1.00 51.38 ? 214  ARG A CG    1 
ATOM   1571 C CD    . ARG A 1 216 ? -76.798  31.225 6.161   1.00 53.14 ? 214  ARG A CD    1 
ATOM   1572 N NE    . ARG A 1 216 ? -76.773  30.049 7.031   1.00 55.55 ? 214  ARG A NE    1 
ATOM   1573 C CZ    . ARG A 1 216 ? -76.114  29.961 8.183   1.00 56.21 ? 214  ARG A CZ    1 
ATOM   1574 N NH1   . ARG A 1 216 ? -75.402  30.987 8.629   1.00 58.22 ? 214  ARG A NH1   1 
ATOM   1575 N NH2   . ARG A 1 216 ? -76.176  28.848 8.899   1.00 56.01 ? 214  ARG A NH2   1 
ATOM   1576 N N     . ILE A 1 217 ? -75.850  35.135 4.317   1.00 46.50 ? 215  ILE A N     1 
ATOM   1577 C CA    . ILE A 1 217 ? -76.369  36.314 5.000   1.00 43.79 ? 215  ILE A CA    1 
ATOM   1578 C C     . ILE A 1 217 ? -77.711  35.921 5.576   1.00 42.91 ? 215  ILE A C     1 
ATOM   1579 O O     . ILE A 1 217 ? -78.603  35.511 4.834   1.00 41.89 ? 215  ILE A O     1 
ATOM   1580 C CB    . ILE A 1 217 ? -76.681  37.494 4.067   1.00 43.59 ? 215  ILE A CB    1 
ATOM   1581 C CG1   . ILE A 1 217 ? -75.547  37.744 3.094   1.00 43.57 ? 215  ILE A CG1   1 
ATOM   1582 C CG2   . ILE A 1 217 ? -76.929  38.734 4.900   1.00 43.09 ? 215  ILE A CG2   1 
ATOM   1583 C CD1   . ILE A 1 217 ? -74.224  37.850 3.770   1.00 46.37 ? 215  ILE A CD1   1 
ATOM   1584 N N     . ASP A 1 218 ? -77.852  36.010 6.891   1.00 42.39 ? 216  ASP A N     1 
ATOM   1585 C CA    . ASP A 1 218 ? -79.138  35.724 7.522   1.00 42.16 ? 216  ASP A CA    1 
ATOM   1586 C C     . ASP A 1 218 ? -79.762  37.116 7.668   1.00 40.40 ? 216  ASP A C     1 
ATOM   1587 O O     . ASP A 1 218 ? -79.276  37.975 8.413   1.00 38.51 ? 216  ASP A O     1 
ATOM   1588 C CB    . ASP A 1 218 ? -78.954  35.044 8.880   1.00 43.79 ? 216  ASP A CB    1 
ATOM   1589 C CG    . ASP A 1 218 ? -78.442  33.615 8.754   1.00 46.80 ? 216  ASP A CG    1 
ATOM   1590 O OD1   . ASP A 1 218 ? -79.211  32.730 8.310   1.00 48.29 ? 216  ASP A OD1   1 
ATOM   1591 O OD2   . ASP A 1 218 ? -77.261  33.373 9.093   1.00 48.88 ? 216  ASP A OD2   1 
ATOM   1592 N N     . HIS A 1 219 ? -80.825  37.338 6.911   1.00 39.44 ? 217  HIS A N     1 
ATOM   1593 C CA    . HIS A 1 219 ? -81.485  38.629 6.897   1.00 38.69 ? 217  HIS A CA    1 
ATOM   1594 C C     . HIS A 1 219 ? -82.334  38.961 8.106   1.00 37.85 ? 217  HIS A C     1 
ATOM   1595 O O     . HIS A 1 219 ? -82.695  38.091 8.898   1.00 37.10 ? 217  HIS A O     1 
ATOM   1596 C CB    . HIS A 1 219 ? -82.313  38.749 5.623   1.00 38.17 ? 217  HIS A CB    1 
ATOM   1597 C CG    . HIS A 1 219 ? -81.486  38.713 4.381   1.00 37.44 ? 217  HIS A CG    1 
ATOM   1598 N ND1   . HIS A 1 219 ? -80.487  39.631 4.134   1.00 37.75 ? 217  HIS A ND1   1 
ATOM   1599 C CD2   . HIS A 1 219 ? -81.493  37.869 3.324   1.00 37.68 ? 217  HIS A CD2   1 
ATOM   1600 C CE1   . HIS A 1 219 ? -79.915  39.353 2.975   1.00 37.29 ? 217  HIS A CE1   1 
ATOM   1601 N NE2   . HIS A 1 219 ? -80.507  38.289 2.465   1.00 37.23 ? 217  HIS A NE2   1 
ATOM   1602 N N     . THR A 1 220 ? -82.626  40.250 8.237   1.00 37.44 ? 218  THR A N     1 
ATOM   1603 C CA    . THR A 1 220 ? -83.441  40.768 9.320   1.00 36.59 ? 218  THR A CA    1 
ATOM   1604 C C     . THR A 1 220 ? -84.687  39.925 9.534   1.00 36.34 ? 218  THR A C     1 
ATOM   1605 O O     . THR A 1 220 ? -85.364  39.552 8.582   1.00 36.05 ? 218  THR A O     1 
ATOM   1606 C CB    . THR A 1 220 ? -83.878  42.192 9.021   1.00 35.53 ? 218  THR A CB    1 
ATOM   1607 O OG1   . THR A 1 220 ? -82.717  42.986 8.748   1.00 35.95 ? 218  THR A OG1   1 
ATOM   1608 C CG2   . THR A 1 220 ? -84.635  42.776 10.196  1.00 34.72 ? 218  THR A CG2   1 
ATOM   1609 N N     . ASN A 1 221 ? -84.977  39.625 10.792  1.00 36.74 ? 219  ASN A N     1 
ATOM   1610 C CA    . ASN A 1 221 ? -86.144  38.839 11.121  1.00 37.51 ? 219  ASN A CA    1 
ATOM   1611 C C     . ASN A 1 221 ? -87.381  39.649 10.723  1.00 37.73 ? 219  ASN A C     1 
ATOM   1612 O O     . ASN A 1 221 ? -87.456  40.852 10.987  1.00 35.92 ? 219  ASN A O     1 
ATOM   1613 C CB    . ASN A 1 221 ? -86.160  38.525 12.613  1.00 38.24 ? 219  ASN A CB    1 
ATOM   1614 C CG    . ASN A 1 221 ? -87.100  37.393 12.943  1.00 40.37 ? 219  ASN A CG    1 
ATOM   1615 O OD1   . ASN A 1 221 ? -88.317  37.528 12.833  1.00 40.96 ? 219  ASN A OD1   1 
ATOM   1616 N ND2   . ASN A 1 221 ? -86.538  36.255 13.323  1.00 41.52 ? 219  ASN A ND2   1 
ATOM   1617 N N     . ALA A 1 222 ? -88.340  38.988 10.076  1.00 38.02 ? 220  ALA A N     1 
ATOM   1618 C CA    . ALA A 1 222 ? -89.548  39.661 9.606   1.00 38.53 ? 220  ALA A CA    1 
ATOM   1619 C C     . ALA A 1 222 ? -90.362  40.248 10.747  1.00 38.69 ? 220  ALA A C     1 
ATOM   1620 O O     . ALA A 1 222 ? -91.104  41.216 10.563  1.00 39.16 ? 220  ALA A O     1 
ATOM   1621 C CB    . ALA A 1 222 ? -90.408  38.690 8.782   1.00 38.58 ? 220  ALA A CB    1 
ATOM   1622 N N     . SER A 1 223 ? -90.211  39.664 11.929  1.00 38.42 ? 221  SER A N     1 
ATOM   1623 C CA    . SER A 1 223 ? -90.929  40.125 13.103  1.00 37.91 ? 221  SER A CA    1 
ATOM   1624 C C     . SER A 1 223 ? -90.648  41.591 13.428  1.00 37.44 ? 221  SER A C     1 
ATOM   1625 O O     . SER A 1 223 ? -91.390  42.211 14.200  1.00 37.87 ? 221  SER A O     1 
ATOM   1626 C CB    . SER A 1 223 ? -90.554  39.270 14.303  1.00 37.96 ? 221  SER A CB    1 
ATOM   1627 O OG    . SER A 1 223 ? -89.201  39.507 14.649  1.00 41.42 ? 221  SER A OG    1 
ATOM   1628 N N     . TYR A 1 224 ? -89.586  42.150 12.849  1.00 36.75 ? 222  TYR A N     1 
ATOM   1629 C CA    . TYR A 1 224 ? -89.235  43.548 13.105  1.00 36.39 ? 222  TYR A CA    1 
ATOM   1630 C C     . TYR A 1 224 ? -89.733  44.517 12.038  1.00 35.68 ? 222  TYR A C     1 
ATOM   1631 O O     . TYR A 1 224 ? -89.581  45.732 12.187  1.00 35.23 ? 222  TYR A O     1 
ATOM   1632 C CB    . TYR A 1 224 ? -87.720  43.714 13.239  1.00 37.62 ? 222  TYR A CB    1 
ATOM   1633 C CG    . TYR A 1 224 ? -87.105  43.018 14.427  1.00 39.63 ? 222  TYR A CG    1 
ATOM   1634 C CD1   . TYR A 1 224 ? -86.222  41.954 14.252  1.00 40.71 ? 222  TYR A CD1   1 
ATOM   1635 C CD2   . TYR A 1 224 ? -87.383  43.435 15.727  1.00 40.77 ? 222  TYR A CD2   1 
ATOM   1636 C CE1   . TYR A 1 224 ? -85.626  41.322 15.338  1.00 41.56 ? 222  TYR A CE1   1 
ATOM   1637 C CE2   . TYR A 1 224 ? -86.792  42.811 16.828  1.00 41.75 ? 222  TYR A CE2   1 
ATOM   1638 C CZ    . TYR A 1 224 ? -85.910  41.752 16.623  1.00 42.86 ? 222  TYR A CZ    1 
ATOM   1639 O OH    . TYR A 1 224 ? -85.303  41.128 17.699  1.00 44.34 ? 222  TYR A OH    1 
ATOM   1640 N N     . LEU A 1 225 ? -90.329  43.994 10.970  1.00 35.01 ? 223  LEU A N     1 
ATOM   1641 C CA    . LEU A 1 225 ? -90.826  44.846 9.890   1.00 34.97 ? 223  LEU A CA    1 
ATOM   1642 C C     . LEU A 1 225 ? -91.812  45.950 10.314  1.00 34.33 ? 223  LEU A C     1 
ATOM   1643 O O     . LEU A 1 225 ? -91.666  47.105 9.911   1.00 35.15 ? 223  LEU A O     1 
ATOM   1644 C CB    . LEU A 1 225 ? -91.431  43.982 8.779   1.00 35.59 ? 223  LEU A CB    1 
ATOM   1645 C CG    . LEU A 1 225 ? -90.368  43.112 8.094   1.00 37.94 ? 223  LEU A CG    1 
ATOM   1646 C CD1   . LEU A 1 225 ? -90.980  42.323 6.945   1.00 37.58 ? 223  LEU A CD1   1 
ATOM   1647 C CD2   . LEU A 1 225 ? -89.221  44.014 7.585   1.00 38.08 ? 223  LEU A CD2   1 
ATOM   1648 N N     . PRO A 1 226 ? -92.815  45.619 11.139  1.00 33.05 ? 224  PRO A N     1 
ATOM   1649 C CA    . PRO A 1 226 ? -93.766  46.651 11.562  1.00 32.44 ? 224  PRO A CA    1 
ATOM   1650 C C     . PRO A 1 226 ? -93.129  47.910 12.172  1.00 32.90 ? 224  PRO A C     1 
ATOM   1651 O O     . PRO A 1 226 ? -93.396  49.035 11.703  1.00 32.93 ? 224  PRO A O     1 
ATOM   1652 C CB    . PRO A 1 226 ? -94.670  45.907 12.549  1.00 32.45 ? 224  PRO A CB    1 
ATOM   1653 C CG    . PRO A 1 226 ? -94.710  44.511 11.965  1.00 32.72 ? 224  PRO A CG    1 
ATOM   1654 C CD    . PRO A 1 226 ? -93.245  44.280 11.590  1.00 33.25 ? 224  PRO A CD    1 
ATOM   1655 N N     . ILE A 1 227 ? -92.292  47.760 13.201  1.00 32.06 ? 225  ILE A N     1 
ATOM   1656 C CA    . ILE A 1 227 ? -91.689  48.960 13.777  1.00 31.62 ? 225  ILE A CA    1 
ATOM   1657 C C     . ILE A 1 227 ? -90.700  49.586 12.797  1.00 31.25 ? 225  ILE A C     1 
ATOM   1658 O O     . ILE A 1 227 ? -90.483  50.793 12.822  1.00 31.29 ? 225  ILE A O     1 
ATOM   1659 C CB    . ILE A 1 227 ? -90.991  48.703 15.143  1.00 31.91 ? 225  ILE A CB    1 
ATOM   1660 C CG1   . ILE A 1 227 ? -89.747  47.820 14.967  1.00 34.05 ? 225  ILE A CG1   1 
ATOM   1661 C CG2   . ILE A 1 227 ? -91.968  48.076 16.107  1.00 30.29 ? 225  ILE A CG2   1 
ATOM   1662 C CD1   . ILE A 1 227 ? -89.013  47.529 16.283  1.00 32.91 ? 225  ILE A CD1   1 
ATOM   1663 N N     . ILE A 1 228 ? -90.115  48.782 11.915  1.00 31.12 ? 226  ILE A N     1 
ATOM   1664 C CA    . ILE A 1 228 ? -89.194  49.354 10.939  1.00 30.64 ? 226  ILE A CA    1 
ATOM   1665 C C     . ILE A 1 228 ? -89.997  50.155 9.904   1.00 30.36 ? 226  ILE A C     1 
ATOM   1666 O O     . ILE A 1 228 ? -89.624  51.277 9.561   1.00 29.35 ? 226  ILE A O     1 
ATOM   1667 C CB    . ILE A 1 228 ? -88.330  48.262 10.254  1.00 30.21 ? 226  ILE A CB    1 
ATOM   1668 C CG1   . ILE A 1 228 ? -87.317  47.703 11.270  1.00 30.06 ? 226  ILE A CG1   1 
ATOM   1669 C CG2   . ILE A 1 228 ? -87.586  48.841 9.051   1.00 28.67 ? 226  ILE A CG2   1 
ATOM   1670 C CD1   . ILE A 1 228 ? -86.434  46.583 10.728  1.00 27.50 ? 226  ILE A CD1   1 
ATOM   1671 N N     . LYS A 1 229 ? -91.106  49.600 9.420   1.00 31.11 ? 227  LYS A N     1 
ATOM   1672 C CA    . LYS A 1 229 ? -91.925  50.344 8.459   1.00 32.15 ? 227  LYS A CA    1 
ATOM   1673 C C     . LYS A 1 229 ? -92.438  51.634 9.115   1.00 31.25 ? 227  LYS A C     1 
ATOM   1674 O O     . LYS A 1 229 ? -92.456  52.694 8.487   1.00 30.86 ? 227  LYS A O     1 
ATOM   1675 C CB    . LYS A 1 229 ? -93.087  49.492 7.942   1.00 34.15 ? 227  LYS A CB    1 
ATOM   1676 C CG    . LYS A 1 229 ? -92.614  48.276 7.138   1.00 38.37 ? 227  LYS A CG    1 
ATOM   1677 C CD    . LYS A 1 229 ? -93.569  47.903 6.004   1.00 40.83 ? 227  LYS A CD    1 
ATOM   1678 C CE    . LYS A 1 229 ? -94.921  47.444 6.503   1.00 42.99 ? 227  LYS A CE    1 
ATOM   1679 N NZ    . LYS A 1 229 ? -94.788  46.200 7.316   1.00 46.19 ? 227  LYS A NZ    1 
ATOM   1680 N N     . ASP A 1 230 ? -92.812  51.568 10.388  1.00 31.46 ? 228  ASP A N     1 
ATOM   1681 C CA    . ASP A 1 230 ? -93.269  52.781 11.059  1.00 31.62 ? 228  ASP A CA    1 
ATOM   1682 C C     . ASP A 1 230 ? -92.122  53.770 11.115  1.00 31.11 ? 228  ASP A C     1 
ATOM   1683 O O     . ASP A 1 230 ? -92.300  54.955 10.835  1.00 31.46 ? 228  ASP A O     1 
ATOM   1684 C CB    . ASP A 1 230 ? -93.778  52.484 12.468  1.00 33.00 ? 228  ASP A CB    1 
ATOM   1685 C CG    . ASP A 1 230 ? -95.028  51.610 12.470  1.00 36.70 ? 228  ASP A CG    1 
ATOM   1686 O OD1   . ASP A 1 230 ? -95.817  51.675 11.498  1.00 37.64 ? 228  ASP A OD1   1 
ATOM   1687 O OD2   . ASP A 1 230 ? -95.235  50.862 13.455  1.00 39.03 ? 228  ASP A OD2   1 
ATOM   1688 N N     . HIS A 1 231 ? -90.926  53.302 11.461  1.00 31.11 ? 229  HIS A N     1 
ATOM   1689 C CA    . HIS A 1 231 ? -89.786  54.218 11.501  1.00 29.95 ? 229  HIS A CA    1 
ATOM   1690 C C     . HIS A 1 231 ? -89.515  54.843 10.123  1.00 29.46 ? 229  HIS A C     1 
ATOM   1691 O O     . HIS A 1 231 ? -89.206  56.037 10.025  1.00 28.87 ? 229  HIS A O     1 
ATOM   1692 C CB    . HIS A 1 231 ? -88.531  53.512 12.002  1.00 29.22 ? 229  HIS A CB    1 
ATOM   1693 C CG    . HIS A 1 231 ? -87.407  54.454 12.295  1.00 29.81 ? 229  HIS A CG    1 
ATOM   1694 N ND1   . HIS A 1 231 ? -86.251  54.496 11.545  1.00 30.19 ? 229  HIS A ND1   1 
ATOM   1695 C CD2   . HIS A 1 231 ? -87.295  55.440 13.216  1.00 30.93 ? 229  HIS A CD2   1 
ATOM   1696 C CE1   . HIS A 1 231 ? -85.478  55.471 11.991  1.00 31.28 ? 229  HIS A CE1   1 
ATOM   1697 N NE2   . HIS A 1 231 ? -86.090  56.061 13.003  1.00 30.25 ? 229  HIS A NE2   1 
ATOM   1698 N N     . LEU A 1 232 ? -89.625  54.046 9.063   1.00 28.85 ? 230  LEU A N     1 
ATOM   1699 C CA    . LEU A 1 232 ? -89.409  54.576 7.709   1.00 30.92 ? 230  LEU A CA    1 
ATOM   1700 C C     . LEU A 1 232 ? -90.418  55.687 7.381   1.00 31.80 ? 230  LEU A C     1 
ATOM   1701 O O     . LEU A 1 232 ? -90.073  56.655 6.696   1.00 31.09 ? 230  LEU A O     1 
ATOM   1702 C CB    . LEU A 1 232 ? -89.474  53.448 6.664   1.00 29.40 ? 230  LEU A CB    1 
ATOM   1703 C CG    . LEU A 1 232 ? -88.132  52.699 6.540   1.00 29.85 ? 230  LEU A CG    1 
ATOM   1704 C CD1   . LEU A 1 232 ? -88.321  51.372 5.855   1.00 29.26 ? 230  LEU A CD1   1 
ATOM   1705 C CD2   . LEU A 1 232 ? -87.126  53.568 5.779   1.00 27.93 ? 230  LEU A CD2   1 
ATOM   1706 N N     . ASN A 1 233 ? -91.653  55.539 7.871   1.00 32.26 ? 231  ASN A N     1 
ATOM   1707 C CA    . ASN A 1 233 ? -92.691  56.547 7.675   1.00 34.16 ? 231  ASN A CA    1 
ATOM   1708 C C     . ASN A 1 233 ? -92.290  57.814 8.437   1.00 33.92 ? 231  ASN A C     1 
ATOM   1709 O O     . ASN A 1 233 ? -92.514  58.924 7.962   1.00 33.48 ? 231  ASN A O     1 
ATOM   1710 C CB    . ASN A 1 233 ? -94.054  56.049 8.191   1.00 35.60 ? 231  ASN A CB    1 
ATOM   1711 C CG    . ASN A 1 233 ? -94.834  55.252 7.145   1.00 38.55 ? 231  ASN A CG    1 
ATOM   1712 O OD1   . ASN A 1 233 ? -95.618  54.372 7.488   1.00 41.01 ? 231  ASN A OD1   1 
ATOM   1713 N ND2   . ASN A 1 233 ? -94.638  55.571 5.873   1.00 40.52 ? 231  ASN A ND2   1 
ATOM   1714 N N     . ASP A 1 234 ? -91.710  57.646 9.624   1.00 34.51 ? 232  ASP A N     1 
ATOM   1715 C CA    . ASP A 1 234 ? -91.258  58.796 10.413  1.00 35.26 ? 232  ASP A CA    1 
ATOM   1716 C C     . ASP A 1 234 ? -90.123  59.552 9.703   1.00 34.70 ? 232  ASP A C     1 
ATOM   1717 O O     . ASP A 1 234 ? -90.059  60.775 9.775   1.00 35.80 ? 232  ASP A O     1 
ATOM   1718 C CB    . ASP A 1 234 ? -90.779  58.372 11.809  1.00 36.32 ? 232  ASP A CB    1 
ATOM   1719 C CG    . ASP A 1 234 ? -91.898  57.820 12.677  1.00 38.77 ? 232  ASP A CG    1 
ATOM   1720 O OD1   . ASP A 1 234 ? -93.012  58.377 12.646  1.00 41.12 ? 232  ASP A OD1   1 
ATOM   1721 O OD2   . ASP A 1 234 ? -91.668  56.842 13.417  1.00 40.71 ? 232  ASP A OD2   1 
ATOM   1722 N N     . LEU A 1 235 ? -89.228  58.837 9.027   1.00 33.33 ? 233  LEU A N     1 
ATOM   1723 C CA    . LEU A 1 235 ? -88.127  59.503 8.322   1.00 33.82 ? 233  LEU A CA    1 
ATOM   1724 C C     . LEU A 1 235 ? -88.642  60.223 7.086   1.00 33.86 ? 233  LEU A C     1 
ATOM   1725 O O     . LEU A 1 235 ? -88.118  61.278 6.710   1.00 33.50 ? 233  LEU A O     1 
ATOM   1726 C CB    . LEU A 1 235 ? -87.042  58.490 7.920   1.00 33.18 ? 233  LEU A CB    1 
ATOM   1727 C CG    . LEU A 1 235 ? -86.330  57.865 9.124   1.00 33.78 ? 233  LEU A CG    1 
ATOM   1728 C CD1   . LEU A 1 235 ? -85.430  56.739 8.675   1.00 35.69 ? 233  LEU A CD1   1 
ATOM   1729 C CD2   . LEU A 1 235 ? -85.531  58.928 9.854   1.00 34.90 ? 233  LEU A CD2   1 
ATOM   1730 N N     . TYR A 1 236 ? -89.654  59.634 6.447   1.00 34.21 ? 234  TYR A N     1 
ATOM   1731 C CA    . TYR A 1 236 ? -90.277  60.226 5.267   1.00 34.88 ? 234  TYR A CA    1 
ATOM   1732 C C     . TYR A 1 236 ? -90.920  61.555 5.682   1.00 35.88 ? 234  TYR A C     1 
ATOM   1733 O O     . TYR A 1 236 ? -90.749  62.581 5.020   1.00 35.48 ? 234  TYR A O     1 
ATOM   1734 C CB    . TYR A 1 236 ? -91.357  59.300 4.704   1.00 33.43 ? 234  TYR A CB    1 
ATOM   1735 C CG    . TYR A 1 236 ? -92.071  59.865 3.491   1.00 33.34 ? 234  TYR A CG    1 
ATOM   1736 C CD1   . TYR A 1 236 ? -91.485  59.813 2.229   1.00 33.22 ? 234  TYR A CD1   1 
ATOM   1737 C CD2   . TYR A 1 236 ? -93.339  60.458 3.608   1.00 34.31 ? 234  TYR A CD2   1 
ATOM   1738 C CE1   . TYR A 1 236 ? -92.127  60.328 1.109   1.00 33.62 ? 234  TYR A CE1   1 
ATOM   1739 C CE2   . TYR A 1 236 ? -93.999  60.981 2.490   1.00 34.16 ? 234  TYR A CE2   1 
ATOM   1740 C CZ    . TYR A 1 236 ? -93.383  60.910 1.244   1.00 34.83 ? 234  TYR A CZ    1 
ATOM   1741 O OH    . TYR A 1 236 ? -94.012  61.407 0.126   1.00 35.81 ? 234  TYR A OH    1 
ATOM   1742 N N     . ARG A 1 237 ? -91.651  61.527 6.787   1.00 37.82 ? 235  ARG A N     1 
ATOM   1743 C CA    . ARG A 1 237 ? -92.311  62.722 7.283   1.00 41.45 ? 235  ARG A CA    1 
ATOM   1744 C C     . ARG A 1 237 ? -91.279  63.826 7.473   1.00 42.03 ? 235  ARG A C     1 
ATOM   1745 O O     . ARG A 1 237 ? -91.523  64.975 7.120   1.00 41.73 ? 235  ARG A O     1 
ATOM   1746 C CB    . ARG A 1 237 ? -93.019  62.435 8.613   1.00 44.12 ? 235  ARG A CB    1 
ATOM   1747 C CG    . ARG A 1 237 ? -94.189  63.369 8.884   1.00 49.59 ? 235  ARG A CG    1 
ATOM   1748 C CD    . ARG A 1 237 ? -95.264  63.169 7.804   1.00 54.83 ? 235  ARG A CD    1 
ATOM   1749 N NE    . ARG A 1 237 ? -96.251  64.252 7.741   1.00 58.14 ? 235  ARG A NE    1 
ATOM   1750 C CZ    . ARG A 1 237 ? -95.972  65.510 7.402   1.00 59.37 ? 235  ARG A CZ    1 
ATOM   1751 N NH1   . ARG A 1 237 ? -96.942  66.421 7.373   1.00 59.96 ? 235  ARG A NH1   1 
ATOM   1752 N NH2   . ARG A 1 237 ? -94.725  65.862 7.097   1.00 59.17 ? 235  ARG A NH2   1 
ATOM   1753 N N     . GLN A 1 238 ? -90.121  63.474 8.026   1.00 42.77 ? 236  GLN A N     1 
ATOM   1754 C CA    . GLN A 1 238 ? -89.065  64.457 8.244   1.00 44.24 ? 236  GLN A CA    1 
ATOM   1755 C C     . GLN A 1 238 ? -88.474  64.907 6.920   1.00 45.56 ? 236  GLN A C     1 
ATOM   1756 O O     . GLN A 1 238 ? -88.277  66.100 6.692   1.00 46.56 ? 236  GLN A O     1 
ATOM   1757 C CB    . GLN A 1 238 ? -87.928  63.875 9.089   1.00 42.99 ? 236  GLN A CB    1 
ATOM   1758 C CG    . GLN A 1 238 ? -88.306  63.389 10.465  1.00 43.21 ? 236  GLN A CG    1 
ATOM   1759 C CD    . GLN A 1 238 ? -87.125  62.760 11.179  1.00 43.91 ? 236  GLN A CD    1 
ATOM   1760 O OE1   . GLN A 1 238 ? -86.079  63.388 11.322  1.00 46.56 ? 236  GLN A OE1   1 
ATOM   1761 N NE2   . GLN A 1 238 ? -87.281  61.519 11.629  1.00 44.23 ? 236  GLN A NE2   1 
ATOM   1762 N N     . ALA A 1 239 ? -88.197  63.935 6.055   1.00 47.01 ? 237  ALA A N     1 
ATOM   1763 C CA    . ALA A 1 239 ? -87.581  64.178 4.756   1.00 48.27 ? 237  ALA A CA    1 
ATOM   1764 C C     . ALA A 1 239 ? -88.336  65.081 3.796   1.00 49.48 ? 237  ALA A C     1 
ATOM   1765 O O     . ALA A 1 239 ? -87.731  65.662 2.895   1.00 48.96 ? 237  ALA A O     1 
ATOM   1766 C CB    . ALA A 1 239 ? -87.295  62.854 4.077   1.00 49.46 ? 237  ALA A CB    1 
ATOM   1767 N N     . ILE A 1 240 ? -89.646  65.205 3.966   1.00 50.71 ? 238  ILE A N     1 
ATOM   1768 C CA    . ILE A 1 240 ? -90.404  66.050 3.060   1.00 52.69 ? 238  ILE A CA    1 
ATOM   1769 C C     . ILE A 1 240 ? -90.597  67.463 3.592   1.00 55.01 ? 238  ILE A C     1 
ATOM   1770 O O     . ILE A 1 240 ? -91.483  68.192 3.132   1.00 55.04 ? 238  ILE A O     1 
ATOM   1771 C CB    . ILE A 1 240 ? -91.784  65.435 2.715   1.00 51.71 ? 238  ILE A CB    1 
ATOM   1772 C CG1   . ILE A 1 240 ? -92.610  65.230 3.983   1.00 51.57 ? 238  ILE A CG1   1 
ATOM   1773 C CG2   . ILE A 1 240 ? -91.584  64.135 1.970   1.00 51.27 ? 238  ILE A CG2   1 
ATOM   1774 C CD1   . ILE A 1 240 ? -94.050  64.838 3.724   1.00 50.00 ? 238  ILE A CD1   1 
ATOM   1775 N N     . SER A 1 241 ? -89.769  67.845 4.566   1.00 57.28 ? 239  SER A N     1 
ATOM   1776 C CA    . SER A 1 241 ? -89.828  69.193 5.126   1.00 59.41 ? 239  SER A CA    1 
ATOM   1777 C C     . SER A 1 241 ? -89.266  70.146 4.079   1.00 60.45 ? 239  SER A C     1 
ATOM   1778 O O     . SER A 1 241 ? -88.377  69.783 3.309   1.00 60.36 ? 239  SER A O     1 
ATOM   1779 C CB    . SER A 1 241 ? -88.985  69.301 6.401   1.00 60.17 ? 239  SER A CB    1 
ATOM   1780 O OG    . SER A 1 241 ? -89.648  68.737 7.519   1.00 62.30 ? 239  SER A OG    1 
ATOM   1781 N N     . SER A 1 242 ? -89.786  71.366 4.056   1.00 61.87 ? 240  SER A N     1 
ATOM   1782 C CA    . SER A 1 242 ? -89.347  72.372 3.098   1.00 63.59 ? 240  SER A CA    1 
ATOM   1783 C C     . SER A 1 242 ? -88.249  73.284 3.655   1.00 64.76 ? 240  SER A C     1 
ATOM   1784 O O     . SER A 1 242 ? -87.771  74.185 2.960   1.00 65.17 ? 240  SER A O     1 
ATOM   1785 C CB    . SER A 1 242 ? -90.549  73.216 2.679   1.00 64.01 ? 240  SER A CB    1 
ATOM   1786 O OG    . SER A 1 242 ? -91.257  73.665 3.824   1.00 64.73 ? 240  SER A OG    1 
ATOM   1787 N N     . ASP A 1 243 ? -87.850  73.039 4.903   1.00 65.63 ? 241  ASP A N     1 
ATOM   1788 C CA    . ASP A 1 243 ? -86.831  73.846 5.572   1.00 66.02 ? 241  ASP A CA    1 
ATOM   1789 C C     . ASP A 1 243 ? -85.592  73.039 5.983   1.00 66.25 ? 241  ASP A C     1 
ATOM   1790 O O     . ASP A 1 243 ? -85.041  73.233 7.071   1.00 66.37 ? 241  ASP A O     1 
ATOM   1791 C CB    . ASP A 1 243 ? -87.447  74.511 6.808   1.00 66.86 ? 241  ASP A CB    1 
ATOM   1792 C CG    . ASP A 1 243 ? -87.852  73.504 7.873   1.00 68.14 ? 241  ASP A CG    1 
ATOM   1793 O OD1   . ASP A 1 243 ? -88.017  72.308 7.537   1.00 69.33 ? 241  ASP A OD1   1 
ATOM   1794 O OD2   . ASP A 1 243 ? -88.016  73.907 9.045   1.00 68.92 ? 241  ASP A OD2   1 
ATOM   1795 N N     . LEU A 1 244 ? -85.156  72.139 5.105   1.00 65.78 ? 242  LEU A N     1 
ATOM   1796 C CA    . LEU A 1 244 ? -83.987  71.312 5.372   1.00 65.13 ? 242  LEU A CA    1 
ATOM   1797 C C     . LEU A 1 244 ? -82.816  71.717 4.493   1.00 65.06 ? 242  LEU A C     1 
ATOM   1798 O O     . LEU A 1 244 ? -82.973  71.926 3.288   1.00 65.10 ? 242  LEU A O     1 
ATOM   1799 C CB    . LEU A 1 244 ? -84.300  69.837 5.108   1.00 65.05 ? 242  LEU A CB    1 
ATOM   1800 C CG    . LEU A 1 244 ? -85.303  69.115 6.006   1.00 65.01 ? 242  LEU A CG    1 
ATOM   1801 C CD1   . LEU A 1 244 ? -85.584  67.741 5.435   1.00 64.81 ? 242  LEU A CD1   1 
ATOM   1802 C CD2   . LEU A 1 244 ? -84.755  69.008 7.415   1.00 64.67 ? 242  LEU A CD2   1 
ATOM   1803 N N     . SER A 1 245 ? -81.640  71.826 5.098   1.00 64.65 ? 243  SER A N     1 
ATOM   1804 C CA    . SER A 1 245 ? -80.442  72.166 4.348   1.00 64.19 ? 243  SER A CA    1 
ATOM   1805 C C     . SER A 1 245 ? -80.084  70.897 3.587   1.00 63.97 ? 243  SER A C     1 
ATOM   1806 O O     . SER A 1 245 ? -80.474  69.804 3.990   1.00 63.51 ? 243  SER A O     1 
ATOM   1807 C CB    . SER A 1 245 ? -79.306  72.530 5.301   1.00 64.19 ? 243  SER A CB    1 
ATOM   1808 O OG    . SER A 1 245 ? -78.990  71.436 6.144   1.00 64.89 ? 243  SER A OG    1 
ATOM   1809 N N     . GLN A 1 246 ? -79.347  71.033 2.492   1.00 63.92 ? 244  GLN A N     1 
ATOM   1810 C CA    . GLN A 1 246 ? -78.965  69.864 1.716   1.00 64.07 ? 244  GLN A CA    1 
ATOM   1811 C C     . GLN A 1 246 ? -78.132  68.869 2.511   1.00 63.29 ? 244  GLN A C     1 
ATOM   1812 O O     . GLN A 1 246 ? -78.064  67.694 2.164   1.00 63.43 ? 244  GLN A O     1 
ATOM   1813 C CB    . GLN A 1 246 ? -78.222  70.278 0.446   1.00 65.28 ? 244  GLN A CB    1 
ATOM   1814 C CG    . GLN A 1 246 ? -79.156  70.542 -0.727  1.00 66.93 ? 244  GLN A CG    1 
ATOM   1815 C CD    . GLN A 1 246 ? -78.430  70.544 -2.059  1.00 68.49 ? 244  GLN A CD    1 
ATOM   1816 O OE1   . GLN A 1 246 ? -77.595  69.675 -2.324  1.00 69.17 ? 244  GLN A OE1   1 
ATOM   1817 N NE2   . GLN A 1 246 ? -78.756  71.511 -2.912  1.00 68.97 ? 244  GLN A NE2   1 
ATOM   1818 N N     . ALA A 1 247 ? -77.504  69.336 3.583   1.00 62.51 ? 245  ALA A N     1 
ATOM   1819 C CA    . ALA A 1 247 ? -76.703  68.457 4.426   1.00 61.72 ? 245  ALA A CA    1 
ATOM   1820 C C     . ALA A 1 247 ? -77.653  67.614 5.274   1.00 61.27 ? 245  ALA A C     1 
ATOM   1821 O O     . ALA A 1 247 ? -77.460  66.409 5.433   1.00 61.40 ? 245  ALA A O     1 
ATOM   1822 C CB    . ALA A 1 247 ? -75.783  69.280 5.325   1.00 61.77 ? 245  ALA A CB    1 
ATOM   1823 N N     . GLU A 1 248 ? -78.680  68.260 5.819   1.00 60.54 ? 246  GLU A N     1 
ATOM   1824 C CA    . GLU A 1 248 ? -79.676  67.572 6.637   1.00 59.36 ? 246  GLU A CA    1 
ATOM   1825 C C     . GLU A 1 248 ? -80.494  66.634 5.755   1.00 57.23 ? 246  GLU A C     1 
ATOM   1826 O O     . GLU A 1 248 ? -80.908  65.561 6.177   1.00 57.51 ? 246  GLU A O     1 
ATOM   1827 C CB    . GLU A 1 248 ? -80.621  68.584 7.289   1.00 60.33 ? 246  GLU A CB    1 
ATOM   1828 C CG    . GLU A 1 248 ? -79.979  69.474 8.338   1.00 61.43 ? 246  GLU A CG    1 
ATOM   1829 C CD    . GLU A 1 248 ? -80.996  70.382 9.016   1.00 62.70 ? 246  GLU A CD    1 
ATOM   1830 O OE1   . GLU A 1 248 ? -81.530  71.297 8.347   1.00 62.24 ? 246  GLU A OE1   1 
ATOM   1831 O OE2   . GLU A 1 248 ? -81.269  70.170 10.219  1.00 63.21 ? 246  GLU A OE2   1 
ATOM   1832 N N     . LEU A 1 249 ? -80.716  67.068 4.524   1.00 55.30 ? 247  LEU A N     1 
ATOM   1833 C CA    . LEU A 1 249 ? -81.486  66.322 3.547   1.00 53.79 ? 247  LEU A CA    1 
ATOM   1834 C C     . LEU A 1 249 ? -80.793  65.047 3.101   1.00 52.26 ? 247  LEU A C     1 
ATOM   1835 O O     . LEU A 1 249 ? -81.409  63.981 3.069   1.00 51.31 ? 247  LEU A O     1 
ATOM   1836 C CB    . LEU A 1 249 ? -81.751  67.206 2.334   1.00 55.07 ? 247  LEU A CB    1 
ATOM   1837 C CG    . LEU A 1 249 ? -82.544  66.559 1.208   1.00 56.49 ? 247  LEU A CG    1 
ATOM   1838 C CD1   . LEU A 1 249 ? -83.972  66.280 1.685   1.00 56.67 ? 247  LEU A CD1   1 
ATOM   1839 C CD2   . LEU A 1 249 ? -82.539  67.484 -0.002  1.00 57.41 ? 247  LEU A CD2   1 
ATOM   1840 N N     . ILE A 1 250 ? -79.516  65.161 2.742   1.00 50.66 ? 248  ILE A N     1 
ATOM   1841 C CA    . ILE A 1 250 ? -78.749  64.005 2.300   1.00 48.76 ? 248  ILE A CA    1 
ATOM   1842 C C     . ILE A 1 250 ? -78.676  62.955 3.399   1.00 47.31 ? 248  ILE A C     1 
ATOM   1843 O O     . ILE A 1 250 ? -78.733  61.758 3.122   1.00 46.93 ? 248  ILE A O     1 
ATOM   1844 C CB    . ILE A 1 250 ? -77.317  64.400 1.886   1.00 49.86 ? 248  ILE A CB    1 
ATOM   1845 C CG1   . ILE A 1 250 ? -77.365  65.340 0.679   1.00 50.44 ? 248  ILE A CG1   1 
ATOM   1846 C CG2   . ILE A 1 250 ? -76.518  63.163 1.532   1.00 49.96 ? 248  ILE A CG2   1 
ATOM   1847 C CD1   . ILE A 1 250 ? -78.084  64.766 -0.521  1.00 50.40 ? 248  ILE A CD1   1 
ATOM   1848 N N     . SER A 1 251 ? -78.558  63.406 4.644   1.00 45.56 ? 249  SER A N     1 
ATOM   1849 C CA    . SER A 1 251 ? -78.491  62.494 5.782   1.00 45.25 ? 249  SER A CA    1 
ATOM   1850 C C     . SER A 1 251 ? -79.760  61.668 5.902   1.00 43.77 ? 249  SER A C     1 
ATOM   1851 O O     . SER A 1 251 ? -79.701  60.454 6.114   1.00 43.96 ? 249  SER A O     1 
ATOM   1852 C CB    . SER A 1 251 ? -78.292  63.268 7.082   1.00 46.01 ? 249  SER A CB    1 
ATOM   1853 O OG    . SER A 1 251 ? -77.198  64.155 6.962   1.00 48.84 ? 249  SER A OG    1 
ATOM   1854 N N     . LEU A 1 252 ? -80.906  62.335 5.786   1.00 42.56 ? 250  LEU A N     1 
ATOM   1855 C CA    . LEU A 1 252 ? -82.197  61.660 5.879   1.00 41.10 ? 250  LEU A CA    1 
ATOM   1856 C C     . LEU A 1 252 ? -82.370  60.618 4.786   1.00 39.49 ? 250  LEU A C     1 
ATOM   1857 O O     . LEU A 1 252 ? -82.855  59.513 5.038   1.00 39.02 ? 250  LEU A O     1 
ATOM   1858 C CB    . LEU A 1 252 ? -83.330  62.683 5.825   1.00 41.98 ? 250  LEU A CB    1 
ATOM   1859 C CG    . LEU A 1 252 ? -83.550  63.389 7.168   1.00 42.22 ? 250  LEU A CG    1 
ATOM   1860 C CD1   . LEU A 1 252 ? -84.557  64.524 7.025   1.00 42.32 ? 250  LEU A CD1   1 
ATOM   1861 C CD2   . LEU A 1 252 ? -84.026  62.366 8.185   1.00 42.33 ? 250  LEU A CD2   1 
ATOM   1862 N N     . ILE A 1 253 ? -81.955  60.972 3.579   1.00 38.23 ? 251  ILE A N     1 
ATOM   1863 C CA    . ILE A 1 253 ? -82.031  60.077 2.433   1.00 38.43 ? 251  ILE A CA    1 
ATOM   1864 C C     . ILE A 1 253 ? -81.164  58.838 2.657   1.00 38.63 ? 251  ILE A C     1 
ATOM   1865 O O     . ILE A 1 253 ? -81.582  57.707 2.367   1.00 38.79 ? 251  ILE A O     1 
ATOM   1866 C CB    . ILE A 1 253 ? -81.553  60.798 1.174   1.00 39.50 ? 251  ILE A CB    1 
ATOM   1867 C CG1   . ILE A 1 253 ? -82.427  62.034 0.942   1.00 38.68 ? 251  ILE A CG1   1 
ATOM   1868 C CG2   . ILE A 1 253 ? -81.558  59.836 -0.009  1.00 39.75 ? 251  ILE A CG2   1 
ATOM   1869 C CD1   . ILE A 1 253 ? -81.910  62.975 -0.110  1.00 40.83 ? 251  ILE A CD1   1 
ATOM   1870 N N     . ALA A 1 254 ? -79.961  59.047 3.191   1.00 38.26 ? 252  ALA A N     1 
ATOM   1871 C CA    . ALA A 1 254 ? -79.054  57.939 3.461   1.00 37.25 ? 252  ALA A CA    1 
ATOM   1872 C C     . ALA A 1 254 ? -79.653  57.014 4.526   1.00 36.04 ? 252  ALA A C     1 
ATOM   1873 O O     . ALA A 1 254 ? -79.578  55.788 4.410   1.00 34.34 ? 252  ALA A O     1 
ATOM   1874 C CB    . ALA A 1 254 ? -77.704  58.475 3.914   1.00 40.19 ? 252  ALA A CB    1 
ATOM   1875 N N     . ARG A 1 255 ? -80.258  57.606 5.553   1.00 35.08 ? 253  ARG A N     1 
ATOM   1876 C CA    . ARG A 1 255 ? -80.898  56.831 6.628   1.00 34.68 ? 253  ARG A CA    1 
ATOM   1877 C C     . ARG A 1 255 ? -82.052  55.991 6.095   1.00 33.77 ? 253  ARG A C     1 
ATOM   1878 O O     . ARG A 1 255 ? -82.157  54.797 6.370   1.00 33.33 ? 253  ARG A O     1 
ATOM   1879 C CB    . ARG A 1 255 ? -81.444  57.765 7.710   1.00 35.96 ? 253  ARG A CB    1 
ATOM   1880 C CG    . ARG A 1 255 ? -80.464  58.106 8.783   1.00 37.85 ? 253  ARG A CG    1 
ATOM   1881 C CD    . ARG A 1 255 ? -80.971  59.202 9.683   1.00 39.37 ? 253  ARG A CD    1 
ATOM   1882 N NE    . ARG A 1 255 ? -79.850  59.855 10.352  1.00 42.48 ? 253  ARG A NE    1 
ATOM   1883 C CZ    . ARG A 1 255 ? -79.184  59.335 11.379  1.00 44.89 ? 253  ARG A CZ    1 
ATOM   1884 N NH1   . ARG A 1 255 ? -79.530  58.153 11.869  1.00 45.64 ? 253  ARG A NH1   1 
ATOM   1885 N NH2   . ARG A 1 255 ? -78.153  59.988 11.908  1.00 47.04 ? 253  ARG A NH2   1 
ATOM   1886 N N     . THR A 1 256 ? -82.931  56.642 5.346   1.00 33.33 ? 254  THR A N     1 
ATOM   1887 C CA    . THR A 1 256 ? -84.078  55.980 4.759   1.00 32.87 ? 254  THR A CA    1 
ATOM   1888 C C     . THR A 1 256 ? -83.600  54.790 3.931   1.00 33.00 ? 254  THR A C     1 
ATOM   1889 O O     . THR A 1 256 ? -84.154  53.680 4.020   1.00 32.02 ? 254  THR A O     1 
ATOM   1890 C CB    . THR A 1 256 ? -84.838  56.962 3.851   1.00 34.17 ? 254  THR A CB    1 
ATOM   1891 O OG1   . THR A 1 256 ? -85.348  58.044 4.642   1.00 33.58 ? 254  THR A OG1   1 
ATOM   1892 C CG2   . THR A 1 256 ? -85.983  56.259 3.146   1.00 35.09 ? 254  THR A CG2   1 
ATOM   1893 N N     . HIS A 1 257 ? -82.571  55.034 3.118   1.00 32.59 ? 255  HIS A N     1 
ATOM   1894 C CA    . HIS A 1 257 ? -81.993  53.998 2.269   1.00 31.69 ? 255  HIS A CA    1 
ATOM   1895 C C     . HIS A 1 257 ? -81.415  52.892 3.146   1.00 31.51 ? 255  HIS A C     1 
ATOM   1896 O O     . HIS A 1 257 ? -81.619  51.706 2.870   1.00 31.09 ? 255  HIS A O     1 
ATOM   1897 C CB    . HIS A 1 257 ? -80.900  54.599 1.369   1.00 33.17 ? 255  HIS A CB    1 
ATOM   1898 C CG    . HIS A 1 257 ? -80.535  53.736 0.200   1.00 34.49 ? 255  HIS A CG    1 
ATOM   1899 N ND1   . HIS A 1 257 ? -79.824  54.211 -0.885  1.00 34.54 ? 255  HIS A ND1   1 
ATOM   1900 C CD2   . HIS A 1 257 ? -80.799  52.432 -0.064  1.00 33.77 ? 255  HIS A CD2   1 
ATOM   1901 C CE1   . HIS A 1 257 ? -79.671  53.239 -1.766  1.00 33.80 ? 255  HIS A CE1   1 
ATOM   1902 N NE2   . HIS A 1 257 ? -80.253  52.149 -1.292  1.00 34.16 ? 255  HIS A NE2   1 
ATOM   1903 N N     . TRP A 1 258 ? -80.712  53.276 4.216   1.00 30.28 ? 256  TRP A N     1 
ATOM   1904 C CA    . TRP A 1 258 ? -80.121  52.290 5.127   1.00 29.50 ? 256  TRP A CA    1 
ATOM   1905 C C     . TRP A 1 258 ? -81.173  51.365 5.735   1.00 28.83 ? 256  TRP A C     1 
ATOM   1906 O O     . TRP A 1 258 ? -81.066  50.130 5.666   1.00 29.15 ? 256  TRP A O     1 
ATOM   1907 C CB    . TRP A 1 258 ? -79.371  52.979 6.280   1.00 29.49 ? 256  TRP A CB    1 
ATOM   1908 C CG    . TRP A 1 258 ? -78.615  52.016 7.181   1.00 30.95 ? 256  TRP A CG    1 
ATOM   1909 C CD1   . TRP A 1 258 ? -77.424  51.411 6.910   1.00 31.08 ? 256  TRP A CD1   1 
ATOM   1910 C CD2   . TRP A 1 258 ? -79.018  51.535 8.475   1.00 31.57 ? 256  TRP A CD2   1 
ATOM   1911 N NE1   . TRP A 1 258 ? -77.055  50.590 7.947   1.00 31.41 ? 256  TRP A NE1   1 
ATOM   1912 C CE2   . TRP A 1 258 ? -78.014  50.644 8.921   1.00 31.29 ? 256  TRP A CE2   1 
ATOM   1913 C CE3   . TRP A 1 258 ? -80.129  51.769 9.299   1.00 31.93 ? 256  TRP A CE3   1 
ATOM   1914 C CZ2   . TRP A 1 258 ? -78.083  49.984 10.153  1.00 31.21 ? 256  TRP A CZ2   1 
ATOM   1915 C CZ3   . TRP A 1 258 ? -80.202  51.107 10.533  1.00 32.13 ? 256  TRP A CZ3   1 
ATOM   1916 C CH2   . TRP A 1 258 ? -79.182  50.227 10.944  1.00 32.48 ? 256  TRP A CH2   1 
ATOM   1917 N N     . TRP A 1 259 ? -82.176  51.968 6.357   1.00 28.34 ? 257  TRP A N     1 
ATOM   1918 C CA    . TRP A 1 259 ? -83.233  51.195 7.003   1.00 27.70 ? 257  TRP A CA    1 
ATOM   1919 C C     . TRP A 1 259 ? -83.992  50.299 6.048   1.00 27.44 ? 257  TRP A C     1 
ATOM   1920 O O     . TRP A 1 259 ? -84.210  49.122 6.341   1.00 27.50 ? 257  TRP A O     1 
ATOM   1921 C CB    . TRP A 1 259 ? -84.217  52.120 7.723   1.00 26.24 ? 257  TRP A CB    1 
ATOM   1922 C CG    . TRP A 1 259 ? -83.680  52.673 8.995   1.00 25.45 ? 257  TRP A CG    1 
ATOM   1923 C CD1   . TRP A 1 259 ? -82.999  53.851 9.163   1.00 25.62 ? 257  TRP A CD1   1 
ATOM   1924 C CD2   . TRP A 1 259 ? -83.746  52.056 10.285  1.00 23.96 ? 257  TRP A CD2   1 
ATOM   1925 N NE1   . TRP A 1 259 ? -82.641  53.999 10.483  1.00 25.57 ? 257  TRP A NE1   1 
ATOM   1926 C CE2   . TRP A 1 259 ? -83.086  52.910 11.191  1.00 24.13 ? 257  TRP A CE2   1 
ATOM   1927 C CE3   . TRP A 1 259 ? -84.301  50.857 10.763  1.00 25.75 ? 257  TRP A CE3   1 
ATOM   1928 C CZ2   . TRP A 1 259 ? -82.962  52.609 12.548  1.00 22.71 ? 257  TRP A CZ2   1 
ATOM   1929 C CZ3   . TRP A 1 259 ? -84.177  50.553 12.124  1.00 25.40 ? 257  TRP A CZ3   1 
ATOM   1930 C CH2   . TRP A 1 259 ? -83.510  51.432 12.996  1.00 24.04 ? 257  TRP A CH2   1 
ATOM   1931 N N     . ALA A 1 260 ? -84.386  50.859 4.908   1.00 27.75 ? 258  ALA A N     1 
ATOM   1932 C CA    . ALA A 1 260 ? -85.137  50.113 3.904   1.00 28.63 ? 258  ALA A CA    1 
ATOM   1933 C C     . ALA A 1 260 ? -84.345  48.949 3.334   1.00 28.74 ? 258  ALA A C     1 
ATOM   1934 O O     . ALA A 1 260 ? -84.856  47.835 3.230   1.00 29.85 ? 258  ALA A O     1 
ATOM   1935 C CB    . ALA A 1 260 ? -85.572  51.055 2.763   1.00 27.29 ? 258  ALA A CB    1 
ATOM   1936 N N     . ALA A 1 261 ? -83.105  49.207 2.938   1.00 29.13 ? 259  ALA A N     1 
ATOM   1937 C CA    . ALA A 1 261 ? -82.275  48.150 2.369   1.00 29.17 ? 259  ALA A CA    1 
ATOM   1938 C C     . ALA A 1 261 ? -81.958  47.104 3.425   1.00 29.90 ? 259  ALA A C     1 
ATOM   1939 O O     . ALA A 1 261 ? -82.047  45.910 3.155   1.00 29.99 ? 259  ALA A O     1 
ATOM   1940 C CB    . ALA A 1 261 ? -80.989  48.734 1.807   1.00 28.49 ? 259  ALA A CB    1 
ATOM   1941 N N     . SER A 1 262 ? -81.620  47.544 4.636   1.00 29.89 ? 260  SER A N     1 
ATOM   1942 C CA    . SER A 1 262 ? -81.281  46.591 5.683   1.00 31.62 ? 260  SER A CA    1 
ATOM   1943 C C     . SER A 1 262 ? -82.469  45.783 6.169   1.00 32.95 ? 260  SER A C     1 
ATOM   1944 O O     . SER A 1 262 ? -82.316  44.636 6.601   1.00 33.49 ? 260  SER A O     1 
ATOM   1945 C CB    . SER A 1 262 ? -80.609  47.300 6.864   1.00 31.17 ? 260  SER A CB    1 
ATOM   1946 O OG    . SER A 1 262 ? -79.430  47.960 6.445   1.00 30.66 ? 260  SER A OG    1 
ATOM   1947 N N     . ALA A 1 263 ? -83.657  46.374 6.121   1.00 34.49 ? 261  ALA A N     1 
ATOM   1948 C CA    . ALA A 1 263 ? -84.849  45.655 6.559   1.00 34.88 ? 261  ALA A CA    1 
ATOM   1949 C C     . ALA A 1 263 ? -85.207  44.581 5.544   1.00 35.29 ? 261  ALA A C     1 
ATOM   1950 O O     . ALA A 1 263 ? -85.582  43.468 5.916   1.00 35.05 ? 261  ALA A O     1 
ATOM   1951 C CB    . ALA A 1 263 ? -86.016  46.618 6.721   1.00 34.93 ? 261  ALA A CB    1 
ATOM   1952 N N     . MET A 1 264 ? -85.075  44.916 4.261   1.00 36.21 ? 262  MET A N     1 
ATOM   1953 C CA    . MET A 1 264 ? -85.424  43.987 3.192   1.00 38.02 ? 262  MET A CA    1 
ATOM   1954 C C     . MET A 1 264 ? -86.894  43.610 3.423   1.00 37.43 ? 262  MET A C     1 
ATOM   1955 O O     . MET A 1 264 ? -87.225  42.456 3.680   1.00 38.07 ? 262  MET A O     1 
ATOM   1956 C CB    . MET A 1 264 ? -84.532  42.736 3.243   1.00 40.30 ? 262  MET A CB    1 
ATOM   1957 C CG    . MET A 1 264 ? -84.508  41.953 1.927   1.00 44.25 ? 262  MET A CG    1 
ATOM   1958 S SD    . MET A 1 264 ? -83.568  40.397 1.943   1.00 47.47 ? 262  MET A SD    1 
ATOM   1959 C CE    . MET A 1 264 ? -84.880  39.198 2.047   1.00 45.69 ? 262  MET A CE    1 
ATOM   1960 N N     . PRO A 1 265 ? -87.797  44.593 3.317   1.00 37.43 ? 263  PRO A N     1 
ATOM   1961 C CA    . PRO A 1 265 ? -89.243  44.420 3.521   1.00 37.73 ? 263  PRO A CA    1 
ATOM   1962 C C     . PRO A 1 265 ? -89.958  43.375 2.664   1.00 37.60 ? 263  PRO A C     1 
ATOM   1963 O O     . PRO A 1 265 ? -90.859  42.683 3.150   1.00 38.29 ? 263  PRO A O     1 
ATOM   1964 C CB    . PRO A 1 265 ? -89.807  45.824 3.277   1.00 37.06 ? 263  PRO A CB    1 
ATOM   1965 C CG    . PRO A 1 265 ? -88.627  46.732 3.520   1.00 37.85 ? 263  PRO A CG    1 
ATOM   1966 C CD    . PRO A 1 265 ? -87.497  45.970 2.892   1.00 36.92 ? 263  PRO A CD    1 
ATOM   1967 N N     . ASP A 1 266 ? -89.574  43.253 1.399   1.00 36.85 ? 264  ASP A N     1 
ATOM   1968 C CA    . ASP A 1 266 ? -90.250  42.301 0.530   1.00 36.07 ? 264  ASP A CA    1 
ATOM   1969 C C     . ASP A 1 266 ? -89.484  41.022 0.264   1.00 35.34 ? 264  ASP A C     1 
ATOM   1970 O O     . ASP A 1 266 ? -88.261  40.969 0.365   1.00 33.81 ? 264  ASP A O     1 
ATOM   1971 C CB    . ASP A 1 266 ? -90.633  42.976 -0.796  1.00 37.13 ? 264  ASP A CB    1 
ATOM   1972 C CG    . ASP A 1 266 ? -91.566  44.171 -0.595  1.00 39.37 ? 264  ASP A CG    1 
ATOM   1973 O OD1   . ASP A 1 266 ? -92.267  44.223 0.441   1.00 40.03 ? 264  ASP A OD1   1 
ATOM   1974 O OD2   . ASP A 1 266 ? -91.610  45.064 -1.471  1.00 41.81 ? 264  ASP A OD2   1 
ATOM   1975 N N     . GLN A 1 267 ? -90.229  39.978 -0.076  1.00 35.53 ? 265  GLN A N     1 
ATOM   1976 C CA    . GLN A 1 267 ? -89.640  38.680 -0.353  1.00 35.57 ? 265  GLN A CA    1 
ATOM   1977 C C     . GLN A 1 267 ? -88.635  38.793 -1.481  1.00 35.38 ? 265  GLN A C     1 
ATOM   1978 O O     . GLN A 1 267 ? -87.643  38.052 -1.538  1.00 34.72 ? 265  GLN A O     1 
ATOM   1979 C CB    . GLN A 1 267 ? -90.730  37.695 -0.757  1.00 36.51 ? 265  GLN A CB    1 
ATOM   1980 C CG    . GLN A 1 267 ? -91.632  37.266 0.374   1.00 38.54 ? 265  GLN A CG    1 
ATOM   1981 C CD    . GLN A 1 267 ? -92.878  36.557 -0.131  1.00 40.52 ? 265  GLN A CD    1 
ATOM   1982 O OE1   . GLN A 1 267 ? -92.804  35.684 -0.995  1.00 41.43 ? 265  GLN A OE1   1 
ATOM   1983 N NE2   . GLN A 1 267 ? -94.032  36.928 0.412   1.00 42.58 ? 265  GLN A NE2   1 
ATOM   1984 N N     . ARG A 1 268 ? -88.879  39.756 -2.360  1.00 34.07 ? 266  ARG A N     1 
ATOM   1985 C CA    . ARG A 1 268 ? -88.034  39.918 -3.517  1.00 32.99 ? 266  ARG A CA    1 
ATOM   1986 C C     . ARG A 1 268 ? -88.026  41.382 -3.969  1.00 32.17 ? 266  ARG A C     1 
ATOM   1987 O O     . ARG A 1 268 ? -89.018  42.094 -3.799  1.00 33.32 ? 266  ARG A O     1 
ATOM   1988 C CB    . ARG A 1 268 ? -88.616  38.998 -4.594  1.00 34.88 ? 266  ARG A CB    1 
ATOM   1989 C CG    . ARG A 1 268 ? -87.662  38.361 -5.552  1.00 37.01 ? 266  ARG A CG    1 
ATOM   1990 C CD    . ARG A 1 268 ? -86.582  37.496 -4.900  1.00 36.78 ? 266  ARG A CD    1 
ATOM   1991 N NE    . ARG A 1 268 ? -85.410  37.585 -5.770  1.00 38.27 ? 266  ARG A NE    1 
ATOM   1992 C CZ    . ARG A 1 268 ? -85.306  36.948 -6.930  1.00 38.36 ? 266  ARG A CZ    1 
ATOM   1993 N NH1   . ARG A 1 268 ? -86.288  36.155 -7.340  1.00 40.27 ? 266  ARG A NH1   1 
ATOM   1994 N NH2   . ARG A 1 268 ? -84.266  37.160 -7.715  1.00 39.06 ? 266  ARG A NH2   1 
ATOM   1995 N N     . GLY A 1 269 ? -86.897  41.847 -4.495  1.00 29.95 ? 267  GLY A N     1 
ATOM   1996 C CA    . GLY A 1 269 ? -86.816  43.203 -5.006  1.00 27.79 ? 267  GLY A CA    1 
ATOM   1997 C C     . GLY A 1 269 ? -86.574  44.362 -4.057  1.00 28.57 ? 267  GLY A C     1 
ATOM   1998 O O     . GLY A 1 269 ? -86.669  45.529 -4.460  1.00 27.39 ? 267  GLY A O     1 
ATOM   1999 N N     . SER A 1 270 ? -86.230  44.066 -2.811  1.00 28.99 ? 268  SER A N     1 
ATOM   2000 C CA    . SER A 1 270 ? -86.012  45.123 -1.841  1.00 29.31 ? 268  SER A CA    1 
ATOM   2001 C C     . SER A 1 270 ? -84.932  46.147 -2.184  1.00 30.07 ? 268  SER A C     1 
ATOM   2002 O O     . SER A 1 270 ? -85.118  47.347 -1.945  1.00 30.07 ? 268  SER A O     1 
ATOM   2003 C CB    . SER A 1 270 ? -85.709  44.522 -0.479  1.00 29.74 ? 268  SER A CB    1 
ATOM   2004 O OG    . SER A 1 270 ? -86.819  43.790 -0.017  1.00 31.57 ? 268  SER A OG    1 
ATOM   2005 N N     . ALA A 1 271 ? -83.809  45.706 -2.744  1.00 28.22 ? 269  ALA A N     1 
ATOM   2006 C CA    . ALA A 1 271 ? -82.759  46.671 -3.032  1.00 27.62 ? 269  ALA A CA    1 
ATOM   2007 C C     . ALA A 1 271 ? -83.186  47.695 -4.093  1.00 26.85 ? 269  ALA A C     1 
ATOM   2008 O O     . ALA A 1 271 ? -82.911  48.886 -3.953  1.00 27.08 ? 269  ALA A O     1 
ATOM   2009 C CB    . ALA A 1 271 ? -81.471  45.951 -3.425  1.00 27.07 ? 269  ALA A CB    1 
ATOM   2010 N N     . ALA A 1 272 ? -83.871  47.241 -5.141  1.00 26.86 ? 270  ALA A N     1 
ATOM   2011 C CA    . ALA A 1 272 ? -84.361  48.150 -6.191  1.00 25.30 ? 270  ALA A CA    1 
ATOM   2012 C C     . ALA A 1 272 ? -85.343  49.171 -5.580  1.00 26.31 ? 270  ALA A C     1 
ATOM   2013 O O     . ALA A 1 272 ? -85.225  50.379 -5.799  1.00 26.48 ? 270  ALA A O     1 
ATOM   2014 C CB    . ALA A 1 272 ? -85.058  47.355 -7.292  1.00 22.86 ? 270  ALA A CB    1 
ATOM   2015 N N     . LYS A 1 273 ? -86.299  48.680 -4.799  1.00 26.19 ? 271  LYS A N     1 
ATOM   2016 C CA    . LYS A 1 273 ? -87.294  49.541 -4.162  1.00 28.24 ? 271  LYS A CA    1 
ATOM   2017 C C     . LYS A 1 273 ? -86.693  50.551 -3.198  1.00 28.41 ? 271  LYS A C     1 
ATOM   2018 O O     . LYS A 1 273 ? -87.080  51.723 -3.175  1.00 28.59 ? 271  LYS A O     1 
ATOM   2019 C CB    . LYS A 1 273 ? -88.327  48.670 -3.439  1.00 29.20 ? 271  LYS A CB    1 
ATOM   2020 C CG    . LYS A 1 273 ? -88.996  47.680 -4.393  1.00 28.33 ? 271  LYS A CG    1 
ATOM   2021 C CD    . LYS A 1 273 ? -89.741  46.600 -3.664  1.00 29.28 ? 271  LYS A CD    1 
ATOM   2022 C CE    . LYS A 1 273 ? -90.116  45.492 -4.641  1.00 28.89 ? 271  LYS A CE    1 
ATOM   2023 N NZ    . LYS A 1 273 ? -90.868  44.411 -3.991  1.00 26.31 ? 271  LYS A NZ    1 
ATOM   2024 N N     . ALA A 1 274 ? -85.728  50.089 -2.413  1.00 30.48 ? 272  ALA A N     1 
ATOM   2025 C CA    . ALA A 1 274 ? -85.046  50.914 -1.425  1.00 30.90 ? 272  ALA A CA    1 
ATOM   2026 C C     . ALA A 1 274 ? -84.336  52.073 -2.094  1.00 31.78 ? 272  ALA A C     1 
ATOM   2027 O O     . ALA A 1 274 ? -84.496  53.222 -1.686  1.00 32.57 ? 272  ALA A O     1 
ATOM   2028 C CB    . ALA A 1 274 ? -84.046  50.061 -0.639  1.00 29.96 ? 272  ALA A CB    1 
ATOM   2029 N N     . GLU A 1 275 ? -83.557  51.771 -3.127  1.00 32.10 ? 273  GLU A N     1 
ATOM   2030 C CA    . GLU A 1 275 ? -82.826  52.805 -3.858  1.00 32.91 ? 273  GLU A CA    1 
ATOM   2031 C C     . GLU A 1 275 ? -83.777  53.754 -4.586  1.00 31.94 ? 273  GLU A C     1 
ATOM   2032 O O     . GLU A 1 275 ? -83.537  54.973 -4.677  1.00 31.35 ? 273  GLU A O     1 
ATOM   2033 C CB    . GLU A 1 275 ? -81.876  52.157 -4.871  1.00 33.97 ? 273  GLU A CB    1 
ATOM   2034 C CG    . GLU A 1 275 ? -81.062  53.143 -5.680  1.00 37.11 ? 273  GLU A CG    1 
ATOM   2035 C CD    . GLU A 1 275 ? -80.043  52.456 -6.569  1.00 39.88 ? 273  GLU A CD    1 
ATOM   2036 O OE1   . GLU A 1 275 ? -79.443  53.133 -7.427  1.00 41.23 ? 273  GLU A OE1   1 
ATOM   2037 O OE2   . GLU A 1 275 ? -79.840  51.236 -6.408  1.00 42.33 ? 273  GLU A OE2   1 
ATOM   2038 N N     . PHE A 1 276 ? -84.844  53.173 -5.124  1.00 30.28 ? 274  PHE A N     1 
ATOM   2039 C CA    . PHE A 1 276 ? -85.859  53.932 -5.837  1.00 29.53 ? 274  PHE A CA    1 
ATOM   2040 C C     . PHE A 1 276 ? -86.480  54.945 -4.875  1.00 28.68 ? 274  PHE A C     1 
ATOM   2041 O O     . PHE A 1 276 ? -86.615  56.120 -5.213  1.00 27.64 ? 274  PHE A O     1 
ATOM   2042 C CB    . PHE A 1 276 ? -86.926  52.969 -6.387  1.00 28.62 ? 274  PHE A CB    1 
ATOM   2043 C CG    . PHE A 1 276 ? -88.051  53.645 -7.134  1.00 28.26 ? 274  PHE A CG    1 
ATOM   2044 C CD1   . PHE A 1 276 ? -88.971  54.474 -6.466  1.00 27.68 ? 274  PHE A CD1   1 
ATOM   2045 C CD2   . PHE A 1 276 ? -88.243  53.395 -8.486  1.00 26.71 ? 274  PHE A CD2   1 
ATOM   2046 C CE1   . PHE A 1 276 ? -90.060  55.026 -7.143  1.00 26.71 ? 274  PHE A CE1   1 
ATOM   2047 C CE2   . PHE A 1 276 ? -89.329  53.943 -9.166  1.00 27.26 ? 274  PHE A CE2   1 
ATOM   2048 C CZ    . PHE A 1 276 ? -90.242  54.758 -8.491  1.00 26.65 ? 274  PHE A CZ    1 
ATOM   2049 N N     . ALA A 1 277 ? -86.831  54.492 -3.673  1.00 27.37 ? 275  ALA A N     1 
ATOM   2050 C CA    . ALA A 1 277 ? -87.442  55.384 -2.680  1.00 28.45 ? 275  ALA A CA    1 
ATOM   2051 C C     . ALA A 1 277 ? -86.510  56.517 -2.299  1.00 29.55 ? 275  ALA A C     1 
ATOM   2052 O O     . ALA A 1 277 ? -86.893  57.681 -2.331  1.00 30.77 ? 275  ALA A O     1 
ATOM   2053 C CB    . ALA A 1 277 ? -87.834  54.605 -1.431  1.00 24.66 ? 275  ALA A CB    1 
ATOM   2054 N N     . ALA A 1 278 ? -85.285  56.162 -1.926  1.00 30.92 ? 276  ALA A N     1 
ATOM   2055 C CA    . ALA A 1 278 ? -84.293  57.136 -1.526  1.00 31.98 ? 276  ALA A CA    1 
ATOM   2056 C C     . ALA A 1 278 ? -84.099  58.224 -2.581  1.00 33.00 ? 276  ALA A C     1 
ATOM   2057 O O     . ALA A 1 278 ? -84.064  59.416 -2.255  1.00 32.78 ? 276  ALA A O     1 
ATOM   2058 C CB    . ALA A 1 278 ? -82.976  56.433 -1.247  1.00 31.84 ? 276  ALA A CB    1 
ATOM   2059 N N     . ARG A 1 279 ? -83.979  57.823 -3.845  1.00 33.87 ? 277  ARG A N     1 
ATOM   2060 C CA    . ARG A 1 279 ? -83.772  58.804 -4.911  1.00 34.79 ? 277  ARG A CA    1 
ATOM   2061 C C     . ARG A 1 279 ? -85.032  59.601 -5.266  1.00 34.12 ? 277  ARG A C     1 
ATOM   2062 O O     . ARG A 1 279 ? -84.933  60.708 -5.802  1.00 33.34 ? 277  ARG A O     1 
ATOM   2063 C CB    . ARG A 1 279 ? -83.204  58.121 -6.162  1.00 35.77 ? 277  ARG A CB    1 
ATOM   2064 C CG    . ARG A 1 279 ? -81.949  57.326 -5.879  1.00 38.46 ? 277  ARG A CG    1 
ATOM   2065 C CD    . ARG A 1 279 ? -81.375  56.689 -7.135  1.00 41.48 ? 277  ARG A CD    1 
ATOM   2066 N NE    . ARG A 1 279 ? -80.120  57.336 -7.504  1.00 45.39 ? 277  ARG A NE    1 
ATOM   2067 C CZ    . ARG A 1 279 ? -78.948  56.718 -7.542  1.00 46.16 ? 277  ARG A CZ    1 
ATOM   2068 N NH1   . ARG A 1 279 ? -77.866  57.386 -7.878  1.00 46.90 ? 277  ARG A NH1   1 
ATOM   2069 N NH2   . ARG A 1 279 ? -78.862  55.428 -7.259  1.00 46.80 ? 277  ARG A NH2   1 
ATOM   2070 N N     . ALA A 1 280 ? -86.206  59.033 -4.984  1.00 33.83 ? 278  ALA A N     1 
ATOM   2071 C CA    . ALA A 1 280 ? -87.469  59.717 -5.257  1.00 33.85 ? 278  ALA A CA    1 
ATOM   2072 C C     . ALA A 1 280 ? -87.554  60.863 -4.259  1.00 33.27 ? 278  ALA A C     1 
ATOM   2073 O O     . ALA A 1 280 ? -87.920  61.980 -4.610  1.00 33.51 ? 278  ALA A O     1 
ATOM   2074 C CB    . ALA A 1 280 ? -88.670  58.754 -5.082  1.00 33.93 ? 278  ALA A CB    1 
ATOM   2075 N N     . ILE A 1 281 ? -87.197  60.590 -3.013  1.00 32.76 ? 279  ILE A N     1 
ATOM   2076 C CA    . ILE A 1 281 ? -87.207  61.639 -2.010  1.00 33.08 ? 279  ILE A CA    1 
ATOM   2077 C C     . ILE A 1 281 ? -86.218  62.760 -2.362  1.00 35.04 ? 279  ILE A C     1 
ATOM   2078 O O     . ILE A 1 281 ? -86.538  63.943 -2.229  1.00 36.07 ? 279  ILE A O     1 
ATOM   2079 C CB    . ILE A 1 281 ? -86.864  61.089 -0.629  1.00 31.46 ? 279  ILE A CB    1 
ATOM   2080 C CG1   . ILE A 1 281 ? -87.923  60.078 -0.204  1.00 30.68 ? 279  ILE A CG1   1 
ATOM   2081 C CG2   . ILE A 1 281 ? -86.766  62.245 0.377   1.00 31.82 ? 279  ILE A CG2   1 
ATOM   2082 C CD1   . ILE A 1 281 ? -87.548  59.271 1.002   1.00 28.97 ? 279  ILE A CD1   1 
ATOM   2083 N N     . ALA A 1 282 ? -85.016  62.398 -2.805  1.00 36.83 ? 280  ALA A N     1 
ATOM   2084 C CA    . ALA A 1 282 ? -84.020  63.402 -3.178  1.00 37.43 ? 280  ALA A CA    1 
ATOM   2085 C C     . ALA A 1 282 ? -84.511  64.200 -4.381  1.00 37.59 ? 280  ALA A C     1 
ATOM   2086 O O     . ALA A 1 282 ? -84.366  65.421 -4.446  1.00 37.21 ? 280  ALA A O     1 
ATOM   2087 C CB    . ALA A 1 282 ? -82.698  62.728 -3.517  1.00 38.26 ? 280  ALA A CB    1 
ATOM   2088 N N     . SER A 1 283 ? -85.098  63.492 -5.332  1.00 38.14 ? 281  SER A N     1 
ATOM   2089 C CA    . SER A 1 283 ? -85.599  64.103 -6.552  1.00 38.78 ? 281  SER A CA    1 
ATOM   2090 C C     . SER A 1 283 ? -86.677  65.150 -6.260  1.00 39.82 ? 281  SER A C     1 
ATOM   2091 O O     . SER A 1 283 ? -86.746  66.180 -6.931  1.00 38.96 ? 281  SER A O     1 
ATOM   2092 C CB    . SER A 1 283 ? -86.143  63.013 -7.470  1.00 38.93 ? 281  SER A CB    1 
ATOM   2093 O OG    . SER A 1 283 ? -86.545  63.552 -8.711  1.00 42.66 ? 281  SER A OG    1 
ATOM   2094 N N     . ALA A 1 284 ? -87.506  64.888 -5.249  1.00 40.19 ? 282  ALA A N     1 
ATOM   2095 C CA    . ALA A 1 284 ? -88.564  65.817 -4.866  1.00 40.08 ? 282  ALA A CA    1 
ATOM   2096 C C     . ALA A 1 284 ? -87.980  67.146 -4.404  1.00 40.81 ? 282  ALA A C     1 
ATOM   2097 O O     . ALA A 1 284 ? -88.652  68.173 -4.450  1.00 41.02 ? 282  ALA A O     1 
ATOM   2098 C CB    . ALA A 1 284 ? -89.413  65.218 -3.753  1.00 38.59 ? 282  ALA A CB    1 
ATOM   2099 N N     . HIS A 1 285 ? -86.735  67.121 -3.940  1.00 41.93 ? 283  HIS A N     1 
ATOM   2100 C CA    . HIS A 1 285 ? -86.076  68.331 -3.462  1.00 43.16 ? 283  HIS A CA    1 
ATOM   2101 C C     . HIS A 1 285 ? -85.161  68.932 -4.517  1.00 44.13 ? 283  HIS A C     1 
ATOM   2102 O O     . HIS A 1 285 ? -84.442  69.882 -4.245  1.00 44.85 ? 283  HIS A O     1 
ATOM   2103 C CB    . HIS A 1 285 ? -85.259  68.038 -2.210  1.00 42.24 ? 283  HIS A CB    1 
ATOM   2104 C CG    . HIS A 1 285 ? -86.084  67.753 -0.996  1.00 42.41 ? 283  HIS A CG    1 
ATOM   2105 N ND1   . HIS A 1 285 ? -86.494  68.741 -0.129  1.00 42.27 ? 283  HIS A ND1   1 
ATOM   2106 C CD2   . HIS A 1 285 ? -86.539  66.585 -0.482  1.00 41.95 ? 283  HIS A CD2   1 
ATOM   2107 C CE1   . HIS A 1 285 ? -87.161  68.192 0.872   1.00 42.22 ? 283  HIS A CE1   1 
ATOM   2108 N NE2   . HIS A 1 285 ? -87.201  66.886 0.683   1.00 41.33 ? 283  HIS A NE2   1 
ATOM   2109 N N     . GLY A 1 286 ? -85.175  68.369 -5.716  1.00 45.45 ? 284  GLY A N     1 
ATOM   2110 C CA    . GLY A 1 286 ? -84.336  68.905 -6.771  1.00 46.61 ? 284  GLY A CA    1 
ATOM   2111 C C     . GLY A 1 286 ? -82.996  68.212 -6.871  1.00 47.71 ? 284  GLY A C     1 
ATOM   2112 O O     . GLY A 1 286 ? -82.348  68.269 -7.908  1.00 48.18 ? 284  GLY A O     1 
ATOM   2113 N N     . ILE A 1 287 ? -82.580  67.553 -5.797  1.00 48.38 ? 285  ILE A N     1 
ATOM   2114 C CA    . ILE A 1 287 ? -81.307  66.859 -5.792  1.00 49.19 ? 285  ILE A CA    1 
ATOM   2115 C C     . ILE A 1 287 ? -81.286  65.768 -6.857  1.00 49.71 ? 285  ILE A C     1 
ATOM   2116 O O     . ILE A 1 287 ? -82.111  64.859 -6.844  1.00 50.40 ? 285  ILE A O     1 
ATOM   2117 C CB    . ILE A 1 287 ? -81.029  66.202 -4.425  1.00 49.92 ? 285  ILE A CB    1 
ATOM   2118 C CG1   . ILE A 1 287 ? -81.260  67.205 -3.297  1.00 49.91 ? 285  ILE A CG1   1 
ATOM   2119 C CG2   . ILE A 1 287 ? -79.594  65.703 -4.375  1.00 49.96 ? 285  ILE A CG2   1 
ATOM   2120 C CD1   . ILE A 1 287 ? -80.472  68.477 -3.448  1.00 51.94 ? 285  ILE A CD1   1 
ATOM   2121 N N     . GLU A 1 288 ? -80.348  65.860 -7.788  1.00 49.82 ? 286  GLU A N     1 
ATOM   2122 C CA    . GLU A 1 288 ? -80.243  64.851 -8.831  1.00 49.94 ? 286  GLU A CA    1 
ATOM   2123 C C     . GLU A 1 288 ? -79.056  63.952 -8.489  1.00 49.76 ? 286  GLU A C     1 
ATOM   2124 O O     . GLU A 1 288 ? -77.935  64.175 -8.944  1.00 50.03 ? 286  GLU A O     1 
ATOM   2125 C CB    . GLU A 1 288 ? -80.037  65.510 -10.195 1.00 50.69 ? 286  GLU A CB    1 
ATOM   2126 C CG    . GLU A 1 288 ? -80.091  64.532 -11.355 1.00 53.06 ? 286  GLU A CG    1 
ATOM   2127 C CD    . GLU A 1 288 ? -81.510  64.156 -11.759 1.00 54.48 ? 286  GLU A CD    1 
ATOM   2128 O OE1   . GLU A 1 288 ? -82.414  64.147 -10.892 1.00 55.01 ? 286  GLU A OE1   1 
ATOM   2129 O OE2   . GLU A 1 288 ? -81.717  63.854 -12.954 1.00 54.89 ? 286  GLU A OE2   1 
ATOM   2130 N N     . LEU A 1 289 ? -79.318  62.945 -7.667  1.00 48.79 ? 287  LEU A N     1 
ATOM   2131 C CA    . LEU A 1 289 ? -78.309  61.997 -7.225  1.00 47.94 ? 287  LEU A CA    1 
ATOM   2132 C C     . LEU A 1 289 ? -77.738  61.153 -8.364  1.00 48.13 ? 287  LEU A C     1 
ATOM   2133 O O     . LEU A 1 289 ? -78.474  60.450 -9.049  1.00 48.95 ? 287  LEU A O     1 
ATOM   2134 C CB    . LEU A 1 289 ? -78.922  61.078 -6.168  1.00 46.98 ? 287  LEU A CB    1 
ATOM   2135 C CG    . LEU A 1 289 ? -78.477  61.236 -4.713  1.00 46.68 ? 287  LEU A CG    1 
ATOM   2136 C CD1   . LEU A 1 289 ? -78.325  62.703 -4.351  1.00 47.12 ? 287  LEU A CD1   1 
ATOM   2137 C CD2   . LEU A 1 289 ? -79.476  60.544 -3.813  1.00 45.13 ? 287  LEU A CD2   1 
ATOM   2138 N N     . PRO A 1 290 ? -76.411  61.207 -8.573  1.00 47.82 ? 288  PRO A N     1 
ATOM   2139 C CA    . PRO A 1 290 ? -75.749  60.436 -9.633  1.00 47.38 ? 288  PRO A CA    1 
ATOM   2140 C C     . PRO A 1 290 ? -75.717  58.973 -9.215  1.00 46.36 ? 288  PRO A C     1 
ATOM   2141 O O     . PRO A 1 290 ? -75.928  58.665 -8.050  1.00 45.87 ? 288  PRO A O     1 
ATOM   2142 C CB    . PRO A 1 290 ? -74.348  61.039 -9.665  1.00 47.44 ? 288  PRO A CB    1 
ATOM   2143 C CG    . PRO A 1 290 ? -74.100  61.306 -8.219  1.00 47.63 ? 288  PRO A CG    1 
ATOM   2144 C CD    . PRO A 1 290 ? -75.416  61.964 -7.791  1.00 48.18 ? 288  PRO A CD    1 
ATOM   2145 N N     . PRO A 1 291 ? -75.423  58.056 -10.151 1.00 46.12 ? 289  PRO A N     1 
ATOM   2146 C CA    . PRO A 1 291 ? -75.377  56.629 -9.812  1.00 46.20 ? 289  PRO A CA    1 
ATOM   2147 C C     . PRO A 1 291 ? -74.283  56.264 -8.808  1.00 46.16 ? 289  PRO A C     1 
ATOM   2148 O O     . PRO A 1 291 ? -73.393  57.056 -8.539  1.00 46.08 ? 289  PRO A O     1 
ATOM   2149 C CB    . PRO A 1 291 ? -75.166  55.967 -11.172 1.00 45.63 ? 289  PRO A CB    1 
ATOM   2150 C CG    . PRO A 1 291 ? -74.375  56.980 -11.908 1.00 45.65 ? 289  PRO A CG    1 
ATOM   2151 C CD    . PRO A 1 291 ? -75.069  58.269 -11.564 1.00 45.57 ? 289  PRO A CD    1 
ATOM   2152 N N     . PHE A 1 292 ? -74.366  55.067 -8.238  1.00 47.40 ? 290  PHE A N     1 
ATOM   2153 C CA    . PHE A 1 292 ? -73.354  54.613 -7.289  1.00 48.80 ? 290  PHE A CA    1 
ATOM   2154 C C     . PHE A 1 292 ? -72.074  54.194 -8.035  1.00 49.41 ? 290  PHE A C     1 
ATOM   2155 O O     . PHE A 1 292 ? -72.141  53.635 -9.131  1.00 48.81 ? 290  PHE A O     1 
ATOM   2156 C CB    . PHE A 1 292 ? -73.881  53.435 -6.458  1.00 49.02 ? 290  PHE A CB    1 
ATOM   2157 C CG    . PHE A 1 292 ? -74.885  53.832 -5.403  1.00 50.16 ? 290  PHE A CG    1 
ATOM   2158 C CD1   . PHE A 1 292 ? -76.236  53.942 -5.710  1.00 50.66 ? 290  PHE A CD1   1 
ATOM   2159 C CD2   . PHE A 1 292 ? -74.472  54.122 -4.107  1.00 50.38 ? 290  PHE A CD2   1 
ATOM   2160 C CE1   . PHE A 1 292 ? -77.163  54.337 -4.742  1.00 50.71 ? 290  PHE A CE1   1 
ATOM   2161 C CE2   . PHE A 1 292 ? -75.389  54.518 -3.135  1.00 51.35 ? 290  PHE A CE2   1 
ATOM   2162 C CZ    . PHE A 1 292 ? -76.738  54.625 -3.457  1.00 50.86 ? 290  PHE A CZ    1 
ATOM   2163 N N     . ARG A 1 293 ? -70.918  54.474 -7.436  1.00 50.57 ? 291  ARG A N     1 
ATOM   2164 C CA    . ARG A 1 293 ? -69.619  54.137 -8.028  1.00 51.45 ? 291  ARG A CA    1 
ATOM   2165 C C     . ARG A 1 293 ? -69.512  52.654 -8.329  1.00 51.32 ? 291  ARG A C     1 
ATOM   2166 O O     . ARG A 1 293 ? -69.991  51.831 -7.552  1.00 50.76 ? 291  ARG A O     1 
ATOM   2167 C CB    . ARG A 1 293 ? -68.483  54.499 -7.075  1.00 52.78 ? 291  ARG A CB    1 
ATOM   2168 C CG    . ARG A 1 293 ? -68.342  55.968 -6.750  1.00 55.08 ? 291  ARG A CG    1 
ATOM   2169 C CD    . ARG A 1 293 ? -67.267  56.164 -5.683  1.00 56.85 ? 291  ARG A CD    1 
ATOM   2170 N NE    . ARG A 1 293 ? -66.954  57.574 -5.496  1.00 58.31 ? 291  ARG A NE    1 
ATOM   2171 C CZ    . ARG A 1 293 ? -66.462  58.351 -6.455  1.00 59.52 ? 291  ARG A CZ    1 
ATOM   2172 N NH1   . ARG A 1 293 ? -66.227  57.844 -7.661  1.00 59.43 ? 291  ARG A NH1   1 
ATOM   2173 N NH2   . ARG A 1 293 ? -66.219  59.635 -6.212  1.00 59.88 ? 291  ARG A NH2   1 
ATOM   2174 N N     . ASN A 1 294 ? -68.860  52.319 -9.442  1.00 51.26 ? 292  ASN A N     1 
ATOM   2175 C CA    . ASN A 1 294 ? -68.678  50.924 -9.833  1.00 51.65 ? 292  ASN A CA    1 
ATOM   2176 C C     . ASN A 1 294 ? -68.058  50.151 -8.672  1.00 50.72 ? 292  ASN A C     1 
ATOM   2177 O O     . ASN A 1 294 ? -67.070  50.588 -8.103  1.00 50.95 ? 292  ASN A O     1 
ATOM   2178 C CB    . ASN A 1 294 ? -67.763  50.832 -11.050 1.00 53.93 ? 292  ASN A CB    1 
ATOM   2179 C CG    . ASN A 1 294 ? -67.981  49.559 -11.845 1.00 56.02 ? 292  ASN A CG    1 
ATOM   2180 O OD1   . ASN A 1 294 ? -67.941  48.447 -11.304 1.00 57.31 ? 292  ASN A OD1   1 
ATOM   2181 N ND2   . ASN A 1 294 ? -68.212  49.714 -13.143 1.00 57.75 ? 292  ASN A ND2   1 
ATOM   2182 N N     . GLY A 1 295 ? -68.639  49.004 -8.327  1.00 49.97 ? 293  GLY A N     1 
ATOM   2183 C CA    . GLY A 1 295 ? -68.129  48.222 -7.214  1.00 49.11 ? 293  GLY A CA    1 
ATOM   2184 C C     . GLY A 1 295 ? -68.913  48.483 -5.933  1.00 48.68 ? 293  GLY A C     1 
ATOM   2185 O O     . GLY A 1 295 ? -68.862  47.693 -4.984  1.00 48.06 ? 293  GLY A O     1 
ATOM   2186 N N     . ASN A 1 296 ? -69.630  49.603 -5.897  1.00 47.79 ? 294  ASN A N     1 
ATOM   2187 C CA    . ASN A 1 296 ? -70.446  49.960 -4.735  1.00 47.84 ? 294  ASN A CA    1 
ATOM   2188 C C     . ASN A 1 296 ? -71.903  49.528 -4.908  1.00 46.68 ? 294  ASN A C     1 
ATOM   2189 O O     . ASN A 1 296 ? -72.667  50.182 -5.617  1.00 46.22 ? 294  ASN A O     1 
ATOM   2190 C CB    . ASN A 1 296 ? -70.398  51.468 -4.498  1.00 48.67 ? 294  ASN A CB    1 
ATOM   2191 C CG    . ASN A 1 296 ? -69.084  51.917 -3.918  1.00 49.89 ? 294  ASN A CG    1 
ATOM   2192 O OD1   . ASN A 1 296 ? -68.804  53.110 -3.834  1.00 52.46 ? 294  ASN A OD1   1 
ATOM   2193 N ND2   . ASN A 1 296 ? -68.268  50.963 -3.500  1.00 50.74 ? 294  ASN A ND2   1 
ATOM   2194 N N     . VAL A 1 297 ? -72.269  48.419 -4.271  1.00 45.59 ? 295  VAL A N     1 
ATOM   2195 C CA    . VAL A 1 297 ? -73.632  47.897 -4.325  1.00 45.17 ? 295  VAL A CA    1 
ATOM   2196 C C     . VAL A 1 297 ? -74.363  48.390 -3.074  1.00 44.21 ? 295  VAL A C     1 
ATOM   2197 O O     . VAL A 1 297 ? -74.220  47.805 -2.001  1.00 44.26 ? 295  VAL A O     1 
ATOM   2198 C CB    . VAL A 1 297 ? -73.623  46.363 -4.338  1.00 45.56 ? 295  VAL A CB    1 
ATOM   2199 C CG1   . VAL A 1 297 ? -75.033  45.827 -4.522  1.00 44.59 ? 295  VAL A CG1   1 
ATOM   2200 C CG2   . VAL A 1 297 ? -72.718  45.876 -5.438  1.00 45.17 ? 295  VAL A CG2   1 
ATOM   2201 N N     . SER A 1 298 ? -75.128  49.471 -3.232  1.00 43.52 ? 296  SER A N     1 
ATOM   2202 C CA    . SER A 1 298 ? -75.885  50.128 -2.157  1.00 42.86 ? 296  SER A CA    1 
ATOM   2203 C C     . SER A 1 298 ? -76.405  49.280 -0.999  1.00 41.81 ? 296  SER A C     1 
ATOM   2204 O O     . SER A 1 298 ? -75.990  49.462 0.141   1.00 41.87 ? 296  SER A O     1 
ATOM   2205 C CB    . SER A 1 298 ? -77.057  50.920 -2.753  1.00 44.08 ? 296  SER A CB    1 
ATOM   2206 O OG    . SER A 1 298 ? -77.873  50.101 -3.580  1.00 46.30 ? 296  SER A OG    1 
ATOM   2207 N N     . ASP A 1 299 ? -77.319  48.363 -1.275  1.00 40.63 ? 297  ASP A N     1 
ATOM   2208 C CA    . ASP A 1 299 ? -77.880  47.536 -0.212  1.00 40.36 ? 297  ASP A CA    1 
ATOM   2209 C C     . ASP A 1 299 ? -76.825  46.773 0.584   1.00 39.97 ? 297  ASP A C     1 
ATOM   2210 O O     . ASP A 1 299 ? -76.884  46.714 1.814   1.00 39.50 ? 297  ASP A O     1 
ATOM   2211 C CB    . ASP A 1 299 ? -78.896  46.555 -0.794  1.00 40.73 ? 297  ASP A CB    1 
ATOM   2212 C CG    . ASP A 1 299 ? -78.358  45.815 -1.993  1.00 41.33 ? 297  ASP A CG    1 
ATOM   2213 O OD1   . ASP A 1 299 ? -78.376  44.571 -1.977  1.00 42.01 ? 297  ASP A OD1   1 
ATOM   2214 O OD2   . ASP A 1 299 ? -77.921  46.486 -2.959  1.00 42.95 ? 297  ASP A OD2   1 
ATOM   2215 N N     . ILE A 1 300 ? -75.871  46.178 -0.123  1.00 39.09 ? 298  ILE A N     1 
ATOM   2216 C CA    . ILE A 1 300 ? -74.803  45.431 0.520   1.00 37.93 ? 298  ILE A CA    1 
ATOM   2217 C C     . ILE A 1 300 ? -73.938  46.369 1.363   1.00 37.32 ? 298  ILE A C     1 
ATOM   2218 O O     . ILE A 1 300 ? -73.557  46.022 2.481   1.00 36.11 ? 298  ILE A O     1 
ATOM   2219 C CB    . ILE A 1 300 ? -73.957  44.684 -0.541  1.00 38.42 ? 298  ILE A CB    1 
ATOM   2220 C CG1   . ILE A 1 300 ? -74.778  43.524 -1.108  1.00 38.26 ? 298  ILE A CG1   1 
ATOM   2221 C CG2   . ILE A 1 300 ? -72.676  44.148 0.069   1.00 38.15 ? 298  ILE A CG2   1 
ATOM   2222 C CD1   . ILE A 1 300 ? -75.084  42.436 -0.092  1.00 37.96 ? 298  ILE A CD1   1 
ATOM   2223 N N     . GLU A 1 301 ? -73.639  47.557 0.840   1.00 37.33 ? 299  GLU A N     1 
ATOM   2224 C CA    . GLU A 1 301 ? -72.852  48.517 1.603   1.00 38.23 ? 299  GLU A CA    1 
ATOM   2225 C C     . GLU A 1 301 ? -73.608  48.872 2.874   1.00 38.35 ? 299  GLU A C     1 
ATOM   2226 O O     . GLU A 1 301 ? -73.006  49.095 3.934   1.00 38.44 ? 299  GLU A O     1 
ATOM   2227 C CB    . GLU A 1 301 ? -72.622  49.797 0.812   1.00 40.17 ? 299  GLU A CB    1 
ATOM   2228 C CG    . GLU A 1 301 ? -71.687  49.654 -0.380  1.00 43.75 ? 299  GLU A CG    1 
ATOM   2229 C CD    . GLU A 1 301 ? -70.292  49.178 0.010   1.00 44.46 ? 299  GLU A CD    1 
ATOM   2230 O OE1   . GLU A 1 301 ? -69.810  49.542 1.107   1.00 43.51 ? 299  GLU A OE1   1 
ATOM   2231 O OE2   . GLU A 1 301 ? -69.674  48.450 -0.798  1.00 45.89 ? 299  GLU A OE2   1 
ATOM   2232 N N     . ALA A 1 302 ? -74.935  48.930 2.767   1.00 37.71 ? 300  ALA A N     1 
ATOM   2233 C CA    . ALA A 1 302 ? -75.771  49.264 3.916   1.00 36.33 ? 300  ALA A CA    1 
ATOM   2234 C C     . ALA A 1 302 ? -75.804  48.110 4.910   1.00 35.21 ? 300  ALA A C     1 
ATOM   2235 O O     . ALA A 1 302 ? -75.630  48.310 6.099   1.00 34.31 ? 300  ALA A O     1 
ATOM   2236 C CB    . ALA A 1 302 ? -77.186  49.612 3.452   1.00 36.54 ? 300  ALA A CB    1 
ATOM   2237 N N     . MET A 1 303 ? -76.024  46.896 4.422   1.00 36.08 ? 301  MET A N     1 
ATOM   2238 C CA    . MET A 1 303 ? -76.074  45.737 5.307   1.00 37.72 ? 301  MET A CA    1 
ATOM   2239 C C     . MET A 1 303 ? -74.776  45.497 6.071   1.00 37.76 ? 301  MET A C     1 
ATOM   2240 O O     . MET A 1 303 ? -74.786  44.923 7.161   1.00 36.88 ? 301  MET A O     1 
ATOM   2241 C CB    . MET A 1 303 ? -76.424  44.484 4.515   1.00 37.89 ? 301  MET A CB    1 
ATOM   2242 C CG    . MET A 1 303 ? -77.771  44.553 3.855   1.00 41.64 ? 301  MET A CG    1 
ATOM   2243 S SD    . MET A 1 303 ? -78.209  43.007 3.084   1.00 43.60 ? 301  MET A SD    1 
ATOM   2244 C CE    . MET A 1 303 ? -79.908  42.812 3.630   1.00 45.81 ? 301  MET A CE    1 
ATOM   2245 N N     . LEU A 1 304 ? -73.668  45.940 5.485   1.00 38.10 ? 302  LEU A N     1 
ATOM   2246 C CA    . LEU A 1 304 ? -72.347  45.785 6.080   1.00 39.68 ? 302  LEU A CA    1 
ATOM   2247 C C     . LEU A 1 304 ? -71.968  46.907 7.034   1.00 40.46 ? 302  LEU A C     1 
ATOM   2248 O O     . LEU A 1 304 ? -70.830  46.971 7.484   1.00 41.23 ? 302  LEU A O     1 
ATOM   2249 C CB    . LEU A 1 304 ? -71.277  45.677 4.978   1.00 38.83 ? 302  LEU A CB    1 
ATOM   2250 C CG    . LEU A 1 304 ? -71.328  44.370 4.173   1.00 38.27 ? 302  LEU A CG    1 
ATOM   2251 C CD1   . LEU A 1 304 ? -70.532  44.495 2.893   1.00 37.70 ? 302  LEU A CD1   1 
ATOM   2252 C CD2   . LEU A 1 304 ? -70.815  43.239 5.036   1.00 37.34 ? 302  LEU A CD2   1 
ATOM   2253 N N     . SER A 1 305 ? -72.893  47.807 7.340   1.00 40.91 ? 303  SER A N     1 
ATOM   2254 C CA    . SER A 1 305 ? -72.534  48.874 8.256   1.00 41.89 ? 303  SER A CA    1 
ATOM   2255 C C     . SER A 1 305 ? -73.601  49.342 9.214   1.00 42.59 ? 303  SER A C     1 
ATOM   2256 O O     . SER A 1 305 ? -74.779  48.977 9.102   1.00 42.54 ? 303  SER A O     1 
ATOM   2257 C CB    . SER A 1 305 ? -71.978  50.078 7.496   1.00 41.61 ? 303  SER A CB    1 
ATOM   2258 O OG    . SER A 1 305 ? -72.844  50.502 6.479   1.00 43.63 ? 303  SER A OG    1 
ATOM   2259 N N     . GLY A 1 306 ? -73.146  50.131 10.185  1.00 42.40 ? 304  GLY A N     1 
ATOM   2260 C CA    . GLY A 1 306 ? -74.024  50.698 11.180  1.00 41.71 ? 304  GLY A CA    1 
ATOM   2261 C C     . GLY A 1 306 ? -74.636  51.922 10.542  1.00 41.36 ? 304  GLY A C     1 
ATOM   2262 O O     . GLY A 1 306 ? -74.061  52.504 9.621   1.00 41.53 ? 304  GLY A O     1 
ATOM   2263 N N     . GLU A 1 307 ? -75.800  52.312 11.035  1.00 41.78 ? 305  GLU A N     1 
ATOM   2264 C CA    . GLU A 1 307 ? -76.527  53.458 10.501  1.00 42.47 ? 305  GLU A CA    1 
ATOM   2265 C C     . GLU A 1 307 ? -75.710  54.741 10.361  1.00 42.62 ? 305  GLU A C     1 
ATOM   2266 O O     . GLU A 1 307 ? -75.691  55.369 9.291   1.00 41.39 ? 305  GLU A O     1 
ATOM   2267 C CB    . GLU A 1 307 ? -77.736  53.734 11.382  1.00 42.07 ? 305  GLU A CB    1 
ATOM   2268 C CG    . GLU A 1 307 ? -78.810  54.539 10.706  1.00 42.56 ? 305  GLU A CG    1 
ATOM   2269 C CD    . GLU A 1 307 ? -79.901  54.937 11.666  1.00 42.30 ? 305  GLU A CD    1 
ATOM   2270 O OE1   . GLU A 1 307 ? -80.239  54.130 12.557  1.00 42.45 ? 305  GLU A OE1   1 
ATOM   2271 O OE2   . GLU A 1 307 ? -80.427  56.052 11.522  1.00 42.35 ? 305  GLU A OE2   1 
ATOM   2272 N N     . GLU A 1 308 ? -75.039  55.132 11.440  1.00 43.45 ? 306  GLU A N     1 
ATOM   2273 C CA    . GLU A 1 308 ? -74.253  56.362 11.430  1.00 44.97 ? 306  GLU A CA    1 
ATOM   2274 C C     . GLU A 1 308 ? -73.077  56.331 10.460  1.00 45.27 ? 306  GLU A C     1 
ATOM   2275 O O     . GLU A 1 308 ? -72.837  57.302 9.735   1.00 44.99 ? 306  GLU A O     1 
ATOM   2276 C CB    . GLU A 1 308 ? -73.767  56.686 12.843  1.00 46.62 ? 306  GLU A CB    1 
ATOM   2277 C CG    . GLU A 1 308 ? -74.893  56.852 13.871  1.00 49.56 ? 306  GLU A CG    1 
ATOM   2278 C CD    . GLU A 1 308 ? -75.978  57.827 13.418  1.00 51.86 ? 306  GLU A CD    1 
ATOM   2279 O OE1   . GLU A 1 308 ? -75.648  58.868 12.806  1.00 52.68 ? 306  GLU A OE1   1 
ATOM   2280 O OE2   . GLU A 1 308 ? -77.169  57.555 13.685  1.00 53.37 ? 306  GLU A OE2   1 
ATOM   2281 N N     . GLU A 1 309 ? -72.342  55.223 10.430  1.00 45.89 ? 307  GLU A N     1 
ATOM   2282 C CA    . GLU A 1 309 ? -71.220  55.140 9.508   1.00 46.50 ? 307  GLU A CA    1 
ATOM   2283 C C     . GLU A 1 309 ? -71.734  55.120 8.071   1.00 45.29 ? 307  GLU A C     1 
ATOM   2284 O O     . GLU A 1 309 ? -71.091  55.654 7.169   1.00 45.18 ? 307  GLU A O     1 
ATOM   2285 C CB    . GLU A 1 309 ? -70.353  53.908 9.797   1.00 48.03 ? 307  GLU A CB    1 
ATOM   2286 C CG    . GLU A 1 309 ? -71.095  52.597 9.781   1.00 51.77 ? 307  GLU A CG    1 
ATOM   2287 C CD    . GLU A 1 309 ? -70.160  51.396 9.862   1.00 53.20 ? 307  GLU A CD    1 
ATOM   2288 O OE1   . GLU A 1 309 ? -69.351  51.196 8.920   1.00 53.06 ? 307  GLU A OE1   1 
ATOM   2289 O OE2   . GLU A 1 309 ? -70.242  50.652 10.869  1.00 53.76 ? 307  GLU A OE2   1 
ATOM   2290 N N     . PHE A 1 310 ? -72.903  54.526 7.854   1.00 44.53 ? 308  PHE A N     1 
ATOM   2291 C CA    . PHE A 1 310 ? -73.463  54.500 6.502   1.00 43.67 ? 308  PHE A CA    1 
ATOM   2292 C C     . PHE A 1 310 ? -73.831  55.910 6.051   1.00 43.46 ? 308  PHE A C     1 
ATOM   2293 O O     . PHE A 1 310 ? -73.608  56.279 4.899   1.00 42.80 ? 308  PHE A O     1 
ATOM   2294 C CB    . PHE A 1 310 ? -74.707  53.623 6.433   1.00 42.04 ? 308  PHE A CB    1 
ATOM   2295 C CG    . PHE A 1 310 ? -75.272  53.495 5.046   1.00 40.98 ? 308  PHE A CG    1 
ATOM   2296 C CD1   . PHE A 1 310 ? -74.673  52.651 4.111   1.00 40.40 ? 308  PHE A CD1   1 
ATOM   2297 C CD2   . PHE A 1 310 ? -76.388  54.231 4.663   1.00 38.77 ? 308  PHE A CD2   1 
ATOM   2298 C CE1   . PHE A 1 310 ? -75.181  52.543 2.820   1.00 39.44 ? 308  PHE A CE1   1 
ATOM   2299 C CE2   . PHE A 1 310 ? -76.898  54.130 3.380   1.00 38.33 ? 308  PHE A CE2   1 
ATOM   2300 C CZ    . PHE A 1 310 ? -76.296  53.284 2.452   1.00 39.34 ? 308  PHE A CZ    1 
ATOM   2301 N N     . VAL A 1 311 ? -74.396  56.695 6.964   1.00 44.67 ? 309  VAL A N     1 
ATOM   2302 C CA    . VAL A 1 311 ? -74.793  58.070 6.654   1.00 46.45 ? 309  VAL A CA    1 
ATOM   2303 C C     . VAL A 1 311 ? -73.560  58.910 6.347   1.00 47.69 ? 309  VAL A C     1 
ATOM   2304 O O     . VAL A 1 311 ? -73.572  59.755 5.452   1.00 47.57 ? 309  VAL A O     1 
ATOM   2305 C CB    . VAL A 1 311 ? -75.548  58.728 7.848   1.00 46.73 ? 309  VAL A CB    1 
ATOM   2306 C CG1   . VAL A 1 311 ? -75.753  60.213 7.584   1.00 45.59 ? 309  VAL A CG1   1 
ATOM   2307 C CG2   . VAL A 1 311 ? -76.892  58.036 8.076   1.00 45.87 ? 309  VAL A CG2   1 
ATOM   2308 N N     . GLU A 1 312 ? -72.499  58.668 7.108   1.00 49.80 ? 310  GLU A N     1 
ATOM   2309 C CA    . GLU A 1 312 ? -71.242  59.386 6.952   1.00 51.71 ? 310  GLU A CA    1 
ATOM   2310 C C     . GLU A 1 312 ? -70.618  59.166 5.577   1.00 51.58 ? 310  GLU A C     1 
ATOM   2311 O O     . GLU A 1 312 ? -70.158  60.114 4.943   1.00 52.39 ? 310  GLU A O     1 
ATOM   2312 C CB    . GLU A 1 312 ? -70.272  58.946 8.053   1.00 54.35 ? 310  GLU A CB    1 
ATOM   2313 C CG    . GLU A 1 312 ? -68.798  59.198 7.761   1.00 59.01 ? 310  GLU A CG    1 
ATOM   2314 C CD    . GLU A 1 312 ? -67.881  58.228 8.510   1.00 61.92 ? 310  GLU A CD    1 
ATOM   2315 O OE1   . GLU A 1 312 ? -68.095  56.993 8.393   1.00 63.06 ? 310  GLU A OE1   1 
ATOM   2316 O OE2   . GLU A 1 312 ? -66.947  58.697 9.205   1.00 62.92 ? 310  GLU A OE2   1 
ATOM   2317 N N     . LYS A 1 313 ? -70.617  57.922 5.108   1.00 51.15 ? 311  LYS A N     1 
ATOM   2318 C CA    . LYS A 1 313 ? -70.020  57.607 3.813   1.00 51.12 ? 311  LYS A CA    1 
ATOM   2319 C C     . LYS A 1 313 ? -70.957  57.546 2.609   1.00 51.37 ? 311  LYS A C     1 
ATOM   2320 O O     . LYS A 1 313 ? -70.511  57.220 1.507   1.00 51.60 ? 311  LYS A O     1 
ATOM   2321 C CB    . LYS A 1 313 ? -69.256  56.287 3.895   1.00 50.73 ? 311  LYS A CB    1 
ATOM   2322 C CG    . LYS A 1 313 ? -70.110  55.088 4.205   1.00 51.66 ? 311  LYS A CG    1 
ATOM   2323 C CD    . LYS A 1 313 ? -69.245  53.860 4.370   1.00 52.68 ? 311  LYS A CD    1 
ATOM   2324 C CE    . LYS A 1 313 ? -70.074  52.649 4.713   1.00 53.94 ? 311  LYS A CE    1 
ATOM   2325 N NZ    . LYS A 1 313 ? -69.238  51.423 4.809   1.00 55.09 ? 311  LYS A NZ    1 
ATOM   2326 N N     . TYR A 1 314 ? -72.237  57.853 2.800   1.00 50.66 ? 312  TYR A N     1 
ATOM   2327 C CA    . TYR A 1 314 ? -73.179  57.803 1.690   1.00 50.22 ? 312  TYR A CA    1 
ATOM   2328 C C     . TYR A 1 314 ? -72.672  58.584 0.489   1.00 51.19 ? 312  TYR A C     1 
ATOM   2329 O O     . TYR A 1 314 ? -72.590  58.051 -0.617  1.00 50.70 ? 312  TYR A O     1 
ATOM   2330 C CB    . TYR A 1 314 ? -74.546  58.358 2.101   1.00 49.03 ? 312  TYR A CB    1 
ATOM   2331 C CG    . TYR A 1 314 ? -75.664  57.950 1.163   1.00 46.99 ? 312  TYR A CG    1 
ATOM   2332 C CD1   . TYR A 1 314 ? -76.041  56.609 1.041   1.00 45.69 ? 312  TYR A CD1   1 
ATOM   2333 C CD2   . TYR A 1 314 ? -76.366  58.903 0.426   1.00 46.37 ? 312  TYR A CD2   1 
ATOM   2334 C CE1   . TYR A 1 314 ? -77.095  56.227 0.213   1.00 45.00 ? 312  TYR A CE1   1 
ATOM   2335 C CE2   . TYR A 1 314 ? -77.424  58.532 -0.409  1.00 46.03 ? 312  TYR A CE2   1 
ATOM   2336 C CZ    . TYR A 1 314 ? -77.787  57.194 -0.506  1.00 46.14 ? 312  TYR A CZ    1 
ATOM   2337 O OH    . TYR A 1 314 ? -78.855  56.828 -1.303  1.00 44.48 ? 312  TYR A OH    1 
ATOM   2338 N N     . ARG A 1 315 ? -72.338  59.851 0.706   1.00 52.78 ? 313  ARG A N     1 
ATOM   2339 C CA    . ARG A 1 315 ? -71.844  60.699 -0.373  1.00 54.65 ? 313  ARG A CA    1 
ATOM   2340 C C     . ARG A 1 315 ? -70.686  60.094 -1.160  1.00 54.71 ? 313  ARG A C     1 
ATOM   2341 O O     . ARG A 1 315 ? -70.638  60.209 -2.386  1.00 54.86 ? 313  ARG A O     1 
ATOM   2342 C CB    . ARG A 1 315 ? -71.397  62.051 0.175   1.00 56.80 ? 313  ARG A CB    1 
ATOM   2343 C CG    . ARG A 1 315 ? -72.508  63.055 0.418   1.00 60.02 ? 313  ARG A CG    1 
ATOM   2344 C CD    . ARG A 1 315 ? -71.929  64.321 1.039   1.00 62.91 ? 313  ARG A CD    1 
ATOM   2345 N NE    . ARG A 1 315 ? -72.824  65.470 0.927   1.00 65.72 ? 313  ARG A NE    1 
ATOM   2346 C CZ    . ARG A 1 315 ? -73.171  66.041 -0.224  1.00 67.18 ? 313  ARG A CZ    1 
ATOM   2347 N NH1   . ARG A 1 315 ? -72.699  65.570 -1.373  1.00 67.94 ? 313  ARG A NH1   1 
ATOM   2348 N NH2   . ARG A 1 315 ? -73.991  67.089 -0.227  1.00 67.81 ? 313  ARG A NH2   1 
ATOM   2349 N N     . SER A 1 316 ? -69.753  59.452 -0.461  1.00 54.80 ? 314  SER A N     1 
ATOM   2350 C CA    . SER A 1 316 ? -68.588  58.870 -1.124  1.00 54.41 ? 314  SER A CA    1 
ATOM   2351 C C     . SER A 1 316 ? -68.903  57.625 -1.937  1.00 54.33 ? 314  SER A C     1 
ATOM   2352 O O     . SER A 1 316 ? -68.112  57.219 -2.786  1.00 54.01 ? 314  SER A O     1 
ATOM   2353 C CB    . SER A 1 316 ? -67.481  58.566 -0.103  1.00 54.01 ? 314  SER A CB    1 
ATOM   2354 O OG    . SER A 1 316 ? -67.882  57.599 0.848   1.00 53.89 ? 314  SER A OG    1 
ATOM   2355 N N     . LEU A 1 317 ? -70.060  57.023 -1.686  1.00 54.73 ? 315  LEU A N     1 
ATOM   2356 C CA    . LEU A 1 317 ? -70.460  55.828 -2.416  1.00 54.99 ? 315  LEU A CA    1 
ATOM   2357 C C     . LEU A 1 317 ? -70.988  56.205 -3.797  1.00 55.99 ? 315  LEU A C     1 
ATOM   2358 O O     . LEU A 1 317 ? -71.048  55.367 -4.699  1.00 55.72 ? 315  LEU A O     1 
ATOM   2359 C CB    . LEU A 1 317 ? -71.540  55.072 -1.640  1.00 53.82 ? 315  LEU A CB    1 
ATOM   2360 C CG    . LEU A 1 317 ? -71.158  54.545 -0.257  1.00 53.15 ? 315  LEU A CG    1 
ATOM   2361 C CD1   . LEU A 1 317 ? -72.385  53.948 0.422   1.00 51.93 ? 315  LEU A CD1   1 
ATOM   2362 C CD2   . LEU A 1 317 ? -70.060  53.507 -0.397  1.00 51.34 ? 315  LEU A CD2   1 
ATOM   2363 N N     . LEU A 1 318 ? -71.363  57.472 -3.952  1.00 57.25 ? 316  LEU A N     1 
ATOM   2364 C CA    . LEU A 1 318 ? -71.895  57.984 -5.211  1.00 59.52 ? 316  LEU A CA    1 
ATOM   2365 C C     . LEU A 1 318 ? -70.783  58.574 -6.079  1.00 62.21 ? 316  LEU A C     1 
ATOM   2366 O O     . LEU A 1 318 ? -69.719  58.933 -5.575  1.00 62.69 ? 316  LEU A O     1 
ATOM   2367 C CB    . LEU A 1 318 ? -72.956  59.049 -4.922  1.00 58.33 ? 316  LEU A CB    1 
ATOM   2368 C CG    . LEU A 1 318 ? -74.168  58.588 -4.097  1.00 57.15 ? 316  LEU A CG    1 
ATOM   2369 C CD1   . LEU A 1 318 ? -74.982  59.790 -3.683  1.00 56.88 ? 316  LEU A CD1   1 
ATOM   2370 C CD2   . LEU A 1 318 ? -75.018  57.611 -4.897  1.00 56.23 ? 316  LEU A CD2   1 
ATOM   2371 N N     . ASP A 1 319 ? -71.034  58.681 -7.381  1.00 64.99 ? 317  ASP A N     1 
ATOM   2372 C CA    . ASP A 1 319 ? -70.039  59.214 -8.305  1.00 67.94 ? 317  ASP A CA    1 
ATOM   2373 C C     . ASP A 1 319 ? -69.424  60.560 -7.930  1.00 70.17 ? 317  ASP A C     1 
ATOM   2374 O O     . ASP A 1 319 ? -68.503  60.615 -7.119  1.00 71.35 ? 317  ASP A O     1 
ATOM   2375 C CB    . ASP A 1 319 ? -70.609  59.292 -9.721  1.00 68.11 ? 317  ASP A CB    1 
ATOM   2376 C CG    . ASP A 1 319 ? -70.029  58.230 -10.641 1.00 68.84 ? 317  ASP A CG    1 
ATOM   2377 O OD1   . ASP A 1 319 ? -69.118  57.493 -10.205 1.00 69.24 ? 317  ASP A OD1   1 
ATOM   2378 O OD2   . ASP A 1 319 ? -70.477  58.134 -11.803 1.00 69.12 ? 317  ASP A OD2   1 
ATOM   2379 N N     . SER A 1 320 ? -69.925  61.642 -8.519  1.00 72.53 ? 318  SER A N     1 
ATOM   2380 C CA    . SER A 1 320 ? -69.384  62.984 -8.263  1.00 75.05 ? 318  SER A CA    1 
ATOM   2381 C C     . SER A 1 320 ? -69.627  63.572 -6.864  1.00 76.19 ? 318  SER A C     1 
ATOM   2382 O O     . SER A 1 320 ? -68.876  63.284 -5.930  1.00 76.72 ? 318  SER A O     1 
ATOM   2383 C CB    . SER A 1 320 ? -69.901  63.957 -9.332  1.00 75.79 ? 318  SER A CB    1 
ATOM   2384 O OG    . SER A 1 320 ? -71.312  63.869 -9.483  1.00 76.74 ? 318  SER A OG    1 
ATOM   2385 N N     . ASP A 1 321 ? -70.657  64.413 -6.748  1.00 77.45 ? 319  ASP A N     1 
ATOM   2386 C CA    . ASP A 1 321 ? -71.054  65.073 -5.495  1.00 78.37 ? 319  ASP A CA    1 
ATOM   2387 C C     . ASP A 1 321 ? -70.470  66.477 -5.299  1.00 78.87 ? 319  ASP A C     1 
ATOM   2388 O O     . ASP A 1 321 ? -69.671  66.937 -6.149  1.00 79.25 ? 319  ASP A O     1 
ATOM   2389 C CB    . ASP A 1 321 ? -70.704  64.193 -4.287  1.00 78.40 ? 319  ASP A CB    1 
HETATM 2390 P PB    . ADP B 2 .   ? -83.672  40.287 -5.788  1.00 43.16 ? 600  ADP A PB    1 
HETATM 2391 O O1B   . ADP B 2 .   ? -82.617  39.497 -5.093  1.00 44.76 ? 600  ADP A O1B   1 
HETATM 2392 O O2B   . ADP B 2 .   ? -83.966  39.789 -7.161  1.00 45.22 ? 600  ADP A O2B   1 
HETATM 2393 O O3B   . ADP B 2 .   ? -84.947  40.425 -4.873  1.00 44.07 ? 600  ADP A O3B   1 
HETATM 2394 P PA    . ADP B 2 .   ? -83.048  43.142 -5.553  1.00 46.19 ? 600  ADP A PA    1 
HETATM 2395 O O1A   . ADP B 2 .   ? -84.397  43.714 -5.710  1.00 48.14 ? 600  ADP A O1A   1 
HETATM 2396 O O2A   . ADP B 2 .   ? -82.464  43.297 -4.196  1.00 46.53 ? 600  ADP A O2A   1 
HETATM 2397 O O3A   . ADP B 2 .   ? -82.938  41.643 -5.995  1.00 45.24 ? 600  ADP A O3A   1 
HETATM 2398 O "O5'" . ADP B 2 .   ? -82.311  43.769 -6.804  1.00 48.74 ? 600  ADP A "O5'" 1 
HETATM 2399 C "C5'" . ADP B 2 .   ? -80.936  43.460 -7.158  1.00 45.32 ? 600  ADP A "C5'" 1 
HETATM 2400 C "C4'" . ADP B 2 .   ? -80.181  44.683 -7.643  1.00 45.98 ? 600  ADP A "C4'" 1 
HETATM 2401 O "O4'" . ADP B 2 .   ? -79.890  44.705 -9.085  1.00 45.96 ? 600  ADP A "O4'" 1 
HETATM 2402 C "C3'" . ADP B 2 .   ? -80.846  46.044 -7.422  1.00 45.61 ? 600  ADP A "C3'" 1 
HETATM 2403 O "O3'" . ADP B 2 .   ? -79.764  46.981 -7.272  1.00 47.22 ? 600  ADP A "O3'" 1 
HETATM 2404 C "C2'" . ADP B 2 .   ? -81.687  46.164 -8.695  1.00 45.79 ? 600  ADP A "C2'" 1 
HETATM 2405 O "O2'" . ADP B 2 .   ? -82.168  47.480 -8.998  1.00 44.79 ? 600  ADP A "O2'" 1 
HETATM 2406 C "C1'" . ADP B 2 .   ? -80.717  45.644 -9.772  1.00 45.67 ? 600  ADP A "C1'" 1 
HETATM 2407 N N9    . ADP B 2 .   ? -81.392  45.036 -10.975 1.00 45.99 ? 600  ADP A N9    1 
HETATM 2408 C C8    . ADP B 2 .   ? -82.496  44.234 -11.030 1.00 45.96 ? 600  ADP A C8    1 
HETATM 2409 N N7    . ADP B 2 .   ? -82.822  43.884 -12.293 1.00 45.24 ? 600  ADP A N7    1 
HETATM 2410 C C5    . ADP B 2 .   ? -81.879  44.493 -13.055 1.00 45.78 ? 600  ADP A C5    1 
HETATM 2411 C C6    . ADP B 2 .   ? -81.671  44.507 -14.493 1.00 47.23 ? 600  ADP A C6    1 
HETATM 2412 N N6    . ADP B 2 .   ? -82.398  43.905 -15.375 1.00 49.25 ? 600  ADP A N6    1 
HETATM 2413 N N1    . ADP B 2 .   ? -80.575  45.260 -14.897 1.00 47.00 ? 600  ADP A N1    1 
HETATM 2414 C C2    . ADP B 2 .   ? -79.738  45.944 -14.010 1.00 46.80 ? 600  ADP A C2    1 
HETATM 2415 N N3    . ADP B 2 .   ? -79.917  45.938 -12.682 1.00 45.77 ? 600  ADP A N3    1 
HETATM 2416 C C4    . ADP B 2 .   ? -80.984  45.211 -12.257 1.00 45.83 ? 600  ADP A C4    1 
HETATM 2417 C C     . TRS C 3 .   ? -80.485  40.983 -1.717  1.00 62.54 ? 1503 TRS A C     1 
HETATM 2418 C C1    . TRS C 3 .   ? -80.323  41.988 -0.556  1.00 62.32 ? 1503 TRS A C1    1 
HETATM 2419 C C2    . TRS C 3 .   ? -80.448  39.568 -1.122  1.00 62.81 ? 1503 TRS A C2    1 
HETATM 2420 C C3    . TRS C 3 .   ? -79.329  41.124 -2.739  1.00 62.48 ? 1503 TRS A C3    1 
HETATM 2421 N N     . TRS C 3 .   ? -81.783  41.204 -2.381  1.00 62.29 ? 1503 TRS A N     1 
HETATM 2422 O O1    . TRS C 3 .   ? -80.358  43.331 -1.036  1.00 61.29 ? 1503 TRS A O1    1 
HETATM 2423 O O2    . TRS C 3 .   ? -80.596  38.584 -2.151  1.00 63.24 ? 1503 TRS A O2    1 
HETATM 2424 O O3    . TRS C 3 .   ? -79.317  42.427 -3.332  1.00 62.08 ? 1503 TRS A O3    1 
HETATM 2425 O O     . HOH D 4 .   ? -86.277  41.590 -1.159  1.00 32.84 ? 1000 HOH A O     1 
HETATM 2426 O O     . HOH D 4 .   ? -87.735  36.420 9.053   1.00 36.91 ? 1001 HOH A O     1 
HETATM 2427 O O     . HOH D 4 .   ? -77.296  40.862 13.858  1.00 46.84 ? 1002 HOH A O     1 
HETATM 2428 O O     . HOH D 4 .   ? -89.879  61.476 -15.529 1.00 34.58 ? 1003 HOH A O     1 
HETATM 2429 O O     . HOH D 4 .   ? -91.926  44.668 14.889  1.00 34.54 ? 1004 HOH A O     1 
HETATM 2430 O O     . HOH D 4 .   ? -82.981  56.883 12.660  1.00 35.53 ? 1005 HOH A O     1 
HETATM 2431 O O     . HOH D 4 .   ? -78.834  52.467 14.369  1.00 38.74 ? 1006 HOH A O     1 
HETATM 2432 O O     . HOH D 4 .   ? -70.177  46.794 -2.786  1.00 39.30 ? 1007 HOH A O     1 
HETATM 2433 O O     . HOH D 4 .   ? -82.259  61.938 -7.319  1.00 40.46 ? 1008 HOH A O     1 
HETATM 2434 O O     . HOH D 4 .   ? -59.492  24.115 -1.662  1.00 62.68 ? 1009 HOH A O     1 
HETATM 2435 O O     . HOH D 4 .   ? -96.439  49.565 0.372   1.00 38.43 ? 1010 HOH A O     1 
HETATM 2436 O O     . HOH D 4 .   ? -94.820  45.272 -1.507  1.00 40.57 ? 1011 HOH A O     1 
HETATM 2437 O O     . HOH D 4 .   ? -84.702  66.186 10.841  1.00 58.39 ? 1012 HOH A O     1 
HETATM 2438 O O     . HOH D 4 .   ? -96.834  75.236 0.039   1.00 56.52 ? 1013 HOH A O     1 
HETATM 2439 O O     . HOH D 4 .   ? -100.828 69.789 -5.723  1.00 55.44 ? 1014 HOH A O     1 
HETATM 2440 O O     . HOH D 4 .   ? -98.834  53.075 -3.924  1.00 43.24 ? 1015 HOH A O     1 
HETATM 2441 O O     . HOH D 4 .   ? -65.401  45.326 5.125   1.00 38.83 ? 1016 HOH A O     1 
HETATM 2442 O O     . HOH D 4 .   ? -97.148  38.665 2.155   1.00 49.52 ? 1017 HOH A O     1 
HETATM 2443 O O     . HOH D 4 .   ? -84.882  55.836 17.622  1.00 41.14 ? 1018 HOH A O     1 
HETATM 2444 O O     . HOH D 4 .   ? -80.410  49.632 -2.400  1.00 42.53 ? 1019 HOH A O     1 
HETATM 2445 O O     . HOH D 4 .   ? -72.397  61.247 3.118   1.00 62.47 ? 1020 HOH A O     1 
HETATM 2446 O O     . HOH D 4 .   ? -96.248  49.662 9.660   1.00 65.08 ? 1021 HOH A O     1 
HETATM 2447 O O     . HOH D 4 .   ? -63.911  27.792 -3.968  1.00 63.22 ? 1022 HOH A O     1 
HETATM 2448 O O     . HOH D 4 .   ? -94.290  60.756 11.833  1.00 53.25 ? 1023 HOH A O     1 
HETATM 2449 O O     . HOH D 4 .   ? -62.121  43.911 1.904   1.00 59.59 ? 1024 HOH A O     1 
HETATM 2450 O O     . HOH D 4 .   ? -74.143  47.258 12.793  1.00 40.14 ? 1025 HOH A O     1 
HETATM 2451 O O     . HOH D 4 .   ? -75.366  65.840 -4.088  1.00 57.61 ? 1026 HOH A O     1 
HETATM 2452 O O     . HOH D 4 .   ? -93.099  56.636 -10.376 1.00 37.32 ? 1027 HOH A O     1 
HETATM 2453 O O     . HOH D 4 .   ? -88.396  49.750 19.332  1.00 47.16 ? 1028 HOH A O     1 
HETATM 2454 O O     . HOH D 4 .   ? -76.741  28.360 -3.333  1.00 65.29 ? 1029 HOH A O     1 
HETATM 2455 O O     . HOH D 4 .   ? -96.745  34.638 -8.863  1.00 61.52 ? 1030 HOH A O     1 
HETATM 2456 O O     . HOH D 4 .   ? -96.798  35.816 -0.464  1.00 60.14 ? 1031 HOH A O     1 
HETATM 2457 O O     . HOH D 4 .   ? -82.980  35.675 -3.995  1.00 68.88 ? 1032 HOH A O     1 
HETATM 2458 O O     . HOH D 4 .   ? -64.981  47.714 8.042   1.00 61.12 ? 1033 HOH A O     1 
HETATM 2459 O O     . HOH D 4 .   ? -57.775  34.677 11.267  1.00 60.13 ? 1034 HOH A O     1 
HETATM 2460 O O     . HOH D 4 .   ? -90.928  52.692 15.068  1.00 40.73 ? 1035 HOH A O     1 
HETATM 2461 O O     . HOH D 4 .   ? -96.752  45.707 8.909   1.00 54.82 ? 1036 HOH A O     1 
HETATM 2462 O O     . HOH D 4 .   ? -95.586  70.860 -14.859 1.00 61.71 ? 1037 HOH A O     1 
HETATM 2463 O O     . HOH D 4 .   ? -82.755  39.907 12.979  1.00 41.34 ? 1038 HOH A O     1 
HETATM 2464 O O     . HOH D 4 .   ? -68.916  61.025 2.318   1.00 65.30 ? 1039 HOH A O     1 
HETATM 2465 O O     . HOH D 4 .   ? -105.851 73.138 -3.473  1.00 58.17 ? 1040 HOH A O     1 
HETATM 2466 O O     . HOH D 4 .   ? -79.339  41.186 -19.864 1.00 64.61 ? 1041 HOH A O     1 
HETATM 2467 O O     . HOH D 4 .   ? -96.692  54.638 11.002  1.00 73.04 ? 1042 HOH A O     1 
HETATM 2468 O O     . HOH D 4 .   ? -85.782  71.813 -8.870  1.00 57.86 ? 1043 HOH A O     1 
HETATM 2469 O O     . HOH D 4 .   ? -90.376  54.421 -16.344 1.00 37.44 ? 1044 HOH A O     1 
HETATM 2470 O O     . HOH D 4 .   ? -79.635  63.526 -24.197 1.00 62.92 ? 1045 HOH A O     1 
HETATM 2471 O O     . HOH D 4 .   ? -69.826  16.022 10.844  1.00 61.65 ? 1046 HOH A O     1 
HETATM 2472 O O     . HOH D 4 .   ? -85.115  59.111 -21.224 1.00 65.94 ? 1047 HOH A O     1 
HETATM 2473 O O     . HOH D 4 .   ? -79.427  41.925 -10.747 1.00 56.25 ? 1048 HOH A O     1 
HETATM 2474 O O     . HOH D 4 .   ? -98.198  77.959 2.869   1.00 74.51 ? 1049 HOH A O     1 
HETATM 2475 O O     . HOH D 4 .   ? -78.250  62.433 14.091  1.00 62.41 ? 1050 HOH A O     1 
HETATM 2476 O O     . HOH D 4 .   ? -98.516  56.517 7.321   1.00 52.69 ? 1051 HOH A O     1 
HETATM 2477 O O     . HOH D 4 .   ? -94.159  72.292 -7.350  1.00 71.14 ? 1052 HOH A O     1 
HETATM 2478 O O     . HOH D 4 .   ? -87.913  33.876 -4.900  1.00 47.60 ? 1053 HOH A O     1 
HETATM 2479 O O     . HOH D 4 .   ? -95.556  67.182 -13.901 1.00 70.69 ? 1054 HOH A O     1 
HETATM 2480 O O     . HOH D 4 .   ? -86.152  71.113 2.804   1.00 46.33 ? 1055 HOH A O     1 
HETATM 2481 O O     . HOH D 4 .   ? -75.246  42.196 -12.329 1.00 71.39 ? 1056 HOH A O     1 
HETATM 2482 O O     . HOH D 4 .   ? -102.464 72.256 -4.895  1.00 68.78 ? 1057 HOH A O     1 
HETATM 2483 O O     . HOH D 4 .   ? -64.978  59.913 -10.138 1.00 74.58 ? 1058 HOH A O     1 
HETATM 2484 O O     . HOH D 4 .   ? -87.133  61.793 -16.786 1.00 49.23 ? 1059 HOH A O     1 
HETATM 2485 O O     . HOH D 4 .   ? -70.277  41.286 15.350  1.00 63.56 ? 1060 HOH A O     1 
HETATM 2486 O O     . HOH D 4 .   ? -84.336  33.330 -8.747  1.00 69.41 ? 1061 HOH A O     1 
HETATM 2487 O O     . HOH D 4 .   ? -97.983  65.192 -9.601  1.00 55.40 ? 1062 HOH A O     1 
HETATM 2488 O O     . HOH D 4 .   ? -60.101  19.764 0.737   1.00 46.00 ? 1063 HOH A O     1 
HETATM 2489 O O     . HOH D 4 .   ? -97.008  46.887 -12.312 1.00 43.57 ? 1064 HOH A O     1 
HETATM 2490 O O     . HOH D 4 .   ? -91.736  49.170 2.951   1.00 58.88 ? 1065 HOH A O     1 
HETATM 2491 O O     . HOH D 4 .   ? -85.660  76.842 8.794   1.00 66.41 ? 1066 HOH A O     1 
HETATM 2492 O O     . HOH D 4 .   ? -94.354  34.282 -6.631  1.00 57.22 ? 1067 HOH A O     1 
HETATM 2493 O O     . HOH D 4 .   ? -80.334  18.587 7.999   1.00 65.27 ? 1068 HOH A O     1 
HETATM 2494 O O     . HOH D 4 .   ? -82.477  44.750 0.459   1.00 41.11 ? 1069 HOH A O     1 
HETATM 2495 O O     . HOH D 4 .   ? -74.618  71.000 -3.896  1.00 68.91 ? 1070 HOH A O     1 
HETATM 2496 O O     . HOH D 4 .   ? -79.323  43.066 19.417  1.00 71.73 ? 1071 HOH A O     1 
HETATM 2497 O O     . HOH D 4 .   ? -85.181  61.206 -19.363 1.00 58.32 ? 1072 HOH A O     1 
HETATM 2498 O O     . HOH D 4 .   ? -79.056  35.722 -7.031  1.00 58.86 ? 1073 HOH A O     1 
HETATM 2499 O O     . HOH D 4 .   ? -89.712  70.650 -10.952 1.00 52.03 ? 1074 HOH A O     1 
HETATM 2500 O O     . HOH D 4 .   ? -77.187  66.973 -19.672 1.00 62.37 ? 1075 HOH A O     1 
HETATM 2501 O O     . HOH D 4 .   ? -66.861  51.917 1.509   1.00 63.99 ? 1076 HOH A O     1 
HETATM 2502 O O     . HOH D 4 .   ? -72.239  53.190 12.847  1.00 61.60 ? 1077 HOH A O     1 
HETATM 2503 O O     . HOH D 4 .   ? -61.745  11.897 3.523   1.00 65.31 ? 1078 HOH A O     1 
HETATM 2504 O O     . HOH D 4 .   ? -88.627  38.091 -15.335 1.00 59.76 ? 1079 HOH A O     1 
HETATM 2505 O O     . HOH D 4 .   ? -77.411  32.804 -3.466  1.00 61.46 ? 1080 HOH A O     1 
HETATM 2506 O O     . HOH D 4 .   ? -84.714  43.365 -8.045  1.00 33.25 ? 1081 HOH A O     1 
HETATM 2507 O O     . HOH D 4 .   ? -83.518  41.223 -9.115  1.00 44.89 ? 1082 HOH A O     1 
HETATM 2508 O O     . HOH D 4 .   ? -77.784  47.464 -5.484  1.00 55.23 ? 1083 HOH A O     1 
HETATM 2509 O O     . HOH D 4 .   ? -80.770  48.745 -6.380  1.00 40.08 ? 1084 HOH A O     1 
HETATM 2510 O O     . HOH D 4 .   ? -77.646  51.698 -8.281  1.00 54.84 ? 1085 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   ALA 2   0   ?   ?   ?   A . n 
A 1 3   MET 3   1   ?   ?   ?   A . n 
A 1 4   GLY 4   2   ?   ?   ?   A . n 
A 1 5   CYS 5   3   ?   ?   ?   A . n 
A 1 6   VAL 6   4   ?   ?   ?   A . n 
A 1 7   SER 7   5   ?   ?   ?   A . n 
A 1 8   SER 8   6   ?   ?   ?   A . n 
A 1 9   LYS 9   7   ?   ?   ?   A . n 
A 1 10  SER 10  8   ?   ?   ?   A . n 
A 1 11  THR 11  9   ?   ?   ?   A . n 
A 1 12  THR 12  10  ?   ?   ?   A . n 
A 1 13  VAL 13  11  ?   ?   ?   A . n 
A 1 14  LEU 14  12  ?   ?   ?   A . n 
A 1 15  SER 15  13  ?   ?   ?   A . n 
A 1 16  PRO 16  14  ?   ?   ?   A . n 
A 1 17  GLN 17  15  ?   ?   ?   A . n 
A 1 18  THR 18  16  16  THR ALA A . n 
A 1 19  SER 19  17  17  SER SER A . n 
A 1 20  PHE 20  18  18  PHE PHE A . n 
A 1 21  ASN 21  19  19  ASN ASN A . n 
A 1 22  GLU 22  20  20  GLU GLU A . n 
A 1 23  ALA 23  21  21  ALA ALA A . n 
A 1 24  SER 24  22  22  SER SER A . n 
A 1 25  ARG 25  23  23  ARG ARG A . n 
A 1 26  THR 26  24  24  THR THR A . n 
A 1 27  SER 27  25  25  SER SER A . n 
A 1 28  PHE 28  26  26  PHE PHE A . n 
A 1 29  ARG 29  27  27  ARG ARG A . n 
A 1 30  ALA 30  28  28  ALA ALA A . n 
A 1 31  LEU 31  29  29  LEU LEU A . n 
A 1 32  PRO 32  30  30  PRO PRO A . n 
A 1 33  GLY 33  31  31  GLY GLY A . n 
A 1 34  PRO 34  32  32  PRO PRO A . n 
A 1 35  SER 35  33  33  SER SER A . n 
A 1 36  GLN 36  34  34  GLN GLN A . n 
A 1 37  ARG 37  35  35  ARG ARG A . n 
A 1 38  GLN 38  36  36  GLN GLN A . n 
A 1 39  LEU 39  37  37  LEU LEU A . n 
A 1 40  GLU 40  38  38  GLU GLU A . n 
A 1 41  VAL 41  39  39  VAL VAL A . n 
A 1 42  TYR 42  40  40  TYR TYR A . n 
A 1 43  ASP 43  41  41  ASP ASP A . n 
A 1 44  GLN 44  42  42  GLN GLN A . n 
A 1 45  CYS 45  43  43  CYS CYS A . n 
A 1 46  LEU 46  44  44  LEU LEU A . n 
A 1 47  ILE 47  45  45  ILE ILE A . n 
A 1 48  GLY 48  46  46  GLY GLY A . n 
A 1 49  ALA 49  47  47  ALA ALA A . n 
A 1 50  ALA 50  48  48  ALA ALA A . n 
A 1 51  ARG 51  49  49  ARG ARG A . n 
A 1 52  TRP 52  50  50  TRP TRP A . n 
A 1 53  PRO 53  51  51  PRO PRO A . n 
A 1 54  ASP 54  52  52  ASP ASP A . n 
A 1 55  ASP 55  53  53  ASP ASP A . n 
A 1 56  SER 56  54  ?   ?   ?   A . n 
A 1 57  SER 57  55  ?   ?   ?   A . n 
A 1 58  LYS 58  56  ?   ?   ?   A . n 
A 1 59  SER 59  57  57  SER SER A . n 
A 1 60  ASN 60  58  58  ASN ASN A . n 
A 1 61  THR 61  59  59  THR THR A . n 
A 1 62  PRO 62  60  60  PRO PRO A . n 
A 1 63  GLU 63  61  61  GLU GLU A . n 
A 1 64  ASN 64  62  62  ASN ASN A . n 
A 1 65  ARG 65  63  63  ARG ARG A . n 
A 1 66  ALA 66  64  64  ALA ALA A . n 
A 1 67  TYR 67  65  65  TYR TYR A . n 
A 1 68  CYS 68  66  66  CYS CYS A . n 
A 1 69  GLN 69  67  67  GLN GLN A . n 
A 1 70  SER 70  68  68  SER SER A . n 
A 1 71  MET 71  69  69  MET MET A . n 
A 1 72  TYR 72  70  70  TYR TYR A . n 
A 1 73  ASN 73  71  71  ASN ASN A . n 
A 1 74  SER 74  72  72  SER SER A . n 
A 1 75  ILE 75  73  73  ILE ILE A . n 
A 1 76  ARG 76  74  74  ARG ARG A . n 
A 1 77  SER 77  75  75  SER SER A . n 
A 1 78  ALA 78  76  76  ALA ALA A . n 
A 1 79  GLY 79  77  77  GLY GLY A . n 
A 1 80  ASP 80  78  78  ASP ASP A . n 
A 1 81  GLU 81  79  79  GLU GLU A . n 
A 1 82  ILE 82  80  80  ILE ILE A . n 
A 1 83  SER 83  81  81  SER SER A . n 
A 1 84  ARG 84  82  82  ARG ARG A . n 
A 1 85  GLY 85  83  83  GLY GLY A . n 
A 1 86  GLY 86  84  84  GLY GLY A . n 
A 1 87  ILE 87  85  85  ILE ILE A . n 
A 1 88  THR 88  86  86  THR THR A . n 
A 1 89  SER 89  87  87  SER SER A . n 
A 1 90  PHE 90  88  88  PHE PHE A . n 
A 1 91  GLU 91  89  89  GLU GLU A . n 
A 1 92  GLU 92  90  90  GLU GLU A . n 
A 1 93  LEU 93  91  91  LEU LEU A . n 
A 1 94  TRP 94  92  92  TRP TRP A . n 
A 1 95  GLY 95  93  93  GLY GLY A . n 
A 1 96  ARG 96  94  94  ARG ARG A . n 
A 1 97  ALA 97  95  95  ALA ALA A . n 
A 1 98  THR 98  96  96  THR THR A . n 
A 1 99  GLU 99  97  97  GLU GLU A . n 
A 1 100 TRP 100 98  98  TRP TRP A . n 
A 1 101 ARG 101 99  99  ARG ARG A . n 
A 1 102 LEU 102 100 100 LEU LEU A . n 
A 1 103 SER 103 101 101 SER SER A . n 
A 1 104 LYS 104 102 102 LYS LYS A . n 
A 1 105 LEU 105 103 103 LEU LEU A . n 
A 1 106 GLN 106 104 104 GLN GLN A . n 
A 1 107 ARG 107 105 105 ARG ARG A . n 
A 1 108 GLY 108 106 106 GLY GLY A . n 
A 1 109 GLU 109 107 107 GLU GLU A . n 
A 1 110 PRO 110 108 108 PRO PRO A . n 
A 1 111 LEU 111 109 109 LEU LEU A . n 
A 1 112 TYR 112 110 110 TYR TYR A . n 
A 1 113 SER 113 111 111 SER SER A . n 
A 1 114 ALA 114 112 112 ALA ALA A . n 
A 1 115 PHE 115 113 113 PHE PHE A . n 
A 1 116 ALA 116 114 114 ALA ALA A . n 
A 1 117 SER 117 115 115 SER SER A . n 
A 1 118 GLU 118 116 116 GLU GLU A . n 
A 1 119 ARG 119 117 117 ARG ARG A . n 
A 1 120 THR 120 118 118 THR THR A . n 
A 1 121 SER 121 119 119 SER SER A . n 
A 1 122 ASP 122 120 120 ASP ASP A . n 
A 1 123 THR 123 121 121 THR THR A . n 
A 1 124 ASP 124 122 122 ASP ASP A . n 
A 1 125 ALA 125 123 123 ALA ALA A . n 
A 1 126 VAL 126 124 124 VAL VAL A . n 
A 1 127 THR 127 125 125 THR THR A . n 
A 1 128 PRO 128 126 126 PRO PRO A . n 
A 1 129 LEU 129 127 127 LEU LEU A . n 
A 1 130 VAL 130 128 128 VAL VAL A . n 
A 1 131 LYS 131 129 129 LYS LYS A . n 
A 1 132 PRO 132 130 130 PRO PRO A . n 
A 1 133 TYR 133 131 131 TYR TYR A . n 
A 1 134 LYS 134 132 132 LYS LYS A . n 
A 1 135 SER 135 133 133 SER SER A . n 
A 1 136 VAL 136 134 134 VAL VAL A . n 
A 1 137 LEU 137 135 135 LEU LEU A . n 
A 1 138 ALA 138 136 136 ALA ALA A . n 
A 1 139 ARG 139 137 137 ARG ARG A . n 
A 1 140 VAL 140 138 138 VAL VAL A . n 
A 1 141 VAL 141 139 139 VAL VAL A . n 
A 1 142 ASP 142 140 140 ASP ASP A . n 
A 1 143 HIS 143 141 141 HIS HIS A . n 
A 1 144 GLU 144 142 142 GLU GLU A . n 
A 1 145 ASP 145 143 143 ASP ASP A . n 
A 1 146 ALA 146 144 144 ALA ALA A . n 
A 1 147 HIS 147 145 145 HIS HIS A . n 
A 1 148 ASP 148 146 146 ASP ASP A . n 
A 1 149 GLU 149 147 147 GLU GLU A . n 
A 1 150 ILE 150 148 148 ILE ILE A . n 
A 1 151 MET 151 149 149 MET MET A . n 
A 1 152 GLN 152 150 150 GLN GLN A . n 
A 1 153 ASP 153 151 151 ASP ASP A . n 
A 1 154 ASN 154 152 152 ASN ASN A . n 
A 1 155 LEU 155 153 153 LEU LEU A . n 
A 1 156 PHE 156 154 154 PHE PHE A . n 
A 1 157 GLY 157 155 155 GLY GLY A . n 
A 1 158 ASP 158 156 156 ASP ASP A . n 
A 1 159 LEU 159 157 157 LEU LEU A . n 
A 1 160 ASN 160 158 158 ASN ASN A . n 
A 1 161 VAL 161 159 159 VAL VAL A . n 
A 1 162 LYS 162 160 160 LYS LYS A . n 
A 1 163 VAL 163 161 161 VAL VAL A . n 
A 1 164 TYR 164 162 162 TYR TYR A . n 
A 1 165 ARG 165 163 163 ARG ARG A . n 
A 1 166 GLN 166 164 164 GLN GLN A . n 
A 1 167 THR 167 165 165 THR THR A . n 
A 1 168 ALA 168 166 166 ALA ALA A . n 
A 1 169 TYR 169 167 167 TYR TYR A . n 
A 1 170 LEU 170 168 168 LEU LEU A . n 
A 1 171 HIS 171 169 169 HIS HIS A . n 
A 1 172 GLY 172 170 170 GLY GLY A . n 
A 1 173 ASN 173 171 171 ASN ASN A . n 
A 1 174 VAL 174 172 172 VAL VAL A . n 
A 1 175 ILE 175 173 173 ILE ILE A . n 
A 1 176 PRO 176 174 174 PRO PRO A . n 
A 1 177 LEU 177 175 175 LEU LEU A . n 
A 1 178 ASN 178 176 176 ASN ASN A . n 
A 1 179 THR 179 177 177 THR THR A . n 
A 1 180 PHE 180 178 178 PHE PHE A . n 
A 1 181 ARG 181 179 179 ARG ARG A . n 
A 1 182 VAL 182 180 180 VAL VAL A . n 
A 1 183 ALA 183 181 181 ALA ALA A . n 
A 1 184 THR 184 182 182 THR THR A . n 
A 1 185 ASP 185 183 183 ASP ASP A . n 
A 1 186 THR 186 184 184 THR THR A . n 
A 1 187 GLU 187 185 185 GLU GLU A . n 
A 1 188 TYR 188 186 186 TYR TYR A . n 
A 1 189 LEU 189 187 187 LEU LEU A . n 
A 1 190 ARG 190 188 188 ARG ARG A . n 
A 1 191 ASP 191 189 189 ASP ASP A . n 
A 1 192 ARG 192 190 190 ARG ARG A . n 
A 1 193 VAL 193 191 191 VAL VAL A . n 
A 1 194 ALA 194 192 192 ALA ALA A . n 
A 1 195 HIS 195 193 193 HIS HIS A . n 
A 1 196 LEU 196 194 194 LEU LEU A . n 
A 1 197 ARG 197 195 195 ARG ARG A . n 
A 1 198 THR 198 196 196 THR THR A . n 
A 1 199 GLU 199 197 197 GLU GLU A . n 
A 1 200 LEU 200 198 198 LEU LEU A . n 
A 1 201 GLY 201 199 199 GLY GLY A . n 
A 1 202 ALA 202 200 200 ALA ALA A . n 
A 1 203 LYS 203 201 201 LYS LYS A . n 
A 1 204 ALA 204 202 202 ALA ALA A . n 
A 1 205 LEU 205 203 203 LEU LEU A . n 
A 1 206 LYS 206 204 204 LYS LYS A . n 
A 1 207 GLN 207 205 205 GLN GLN A . n 
A 1 208 HIS 208 206 206 HIS HIS A . n 
A 1 209 LEU 209 207 207 LEU LEU A . n 
A 1 210 GLN 210 208 208 GLN GLN A . n 
A 1 211 ARG 211 209 209 ARG ARG A . n 
A 1 212 TYR 212 210 210 TYR TYR A . n 
A 1 213 ASN 213 211 211 ASN ASN A . n 
A 1 214 PRO 214 212 212 PRO PRO A . n 
A 1 215 ASP 215 213 213 ASP ASP A . n 
A 1 216 ARG 216 214 214 ARG ARG A . n 
A 1 217 ILE 217 215 215 ILE ILE A . n 
A 1 218 ASP 218 216 216 ASP ASP A . n 
A 1 219 HIS 219 217 217 HIS HIS A . n 
A 1 220 THR 220 218 218 THR THR A . n 
A 1 221 ASN 221 219 219 ASN ASN A . n 
A 1 222 ALA 222 220 220 ALA ALA A . n 
A 1 223 SER 223 221 221 SER SER A . n 
A 1 224 TYR 224 222 222 TYR TYR A . n 
A 1 225 LEU 225 223 223 LEU LEU A . n 
A 1 226 PRO 226 224 224 PRO PRO A . n 
A 1 227 ILE 227 225 225 ILE ILE A . n 
A 1 228 ILE 228 226 226 ILE ILE A . n 
A 1 229 LYS 229 227 227 LYS LYS A . n 
A 1 230 ASP 230 228 228 ASP ASP A . n 
A 1 231 HIS 231 229 229 HIS HIS A . n 
A 1 232 LEU 232 230 230 LEU LEU A . n 
A 1 233 ASN 233 231 231 ASN ASN A . n 
A 1 234 ASP 234 232 232 ASP ASP A . n 
A 1 235 LEU 235 233 233 LEU LEU A . n 
A 1 236 TYR 236 234 234 TYR TYR A . n 
A 1 237 ARG 237 235 235 ARG ARG A . n 
A 1 238 GLN 238 236 236 GLN GLN A . n 
A 1 239 ALA 239 237 237 ALA ALA A . n 
A 1 240 ILE 240 238 238 ILE ILE A . n 
A 1 241 SER 241 239 239 SER SER A . n 
A 1 242 SER 242 240 240 SER SER A . n 
A 1 243 ASP 243 241 241 ASP ASP A . n 
A 1 244 LEU 244 242 242 LEU LEU A . n 
A 1 245 SER 245 243 243 SER SER A . n 
A 1 246 GLN 246 244 244 GLN GLN A . n 
A 1 247 ALA 247 245 245 ALA ALA A . n 
A 1 248 GLU 248 246 246 GLU GLU A . n 
A 1 249 LEU 249 247 247 LEU LEU A . n 
A 1 250 ILE 250 248 248 ILE ILE A . n 
A 1 251 SER 251 249 249 SER SER A . n 
A 1 252 LEU 252 250 250 LEU LEU A . n 
A 1 253 ILE 253 251 251 ILE ILE A . n 
A 1 254 ALA 254 252 252 ALA ALA A . n 
A 1 255 ARG 255 253 253 ARG ARG A . n 
A 1 256 THR 256 254 254 THR THR A . n 
A 1 257 HIS 257 255 255 HIS HIS A . n 
A 1 258 TRP 258 256 256 TRP TRP A . n 
A 1 259 TRP 259 257 257 TRP TRP A . n 
A 1 260 ALA 260 258 258 ALA ALA A . n 
A 1 261 ALA 261 259 259 ALA ALA A . n 
A 1 262 SER 262 260 260 SER SER A . n 
A 1 263 ALA 263 261 261 ALA ALA A . n 
A 1 264 MET 264 262 262 MET MET A . n 
A 1 265 PRO 265 263 263 PRO PRO A . n 
A 1 266 ASP 266 264 264 ASP ASP A . n 
A 1 267 GLN 267 265 265 GLN GLN A . n 
A 1 268 ARG 268 266 266 ARG ARG A . n 
A 1 269 GLY 269 267 267 GLY GLY A . n 
A 1 270 SER 270 268 268 SER SER A . n 
A 1 271 ALA 271 269 269 ALA ALA A . n 
A 1 272 ALA 272 270 270 ALA ALA A . n 
A 1 273 LYS 273 271 271 LYS LYS A . n 
A 1 274 ALA 274 272 272 ALA ALA A . n 
A 1 275 GLU 275 273 273 GLU GLU A . n 
A 1 276 PHE 276 274 274 PHE PHE A . n 
A 1 277 ALA 277 275 275 ALA ALA A . n 
A 1 278 ALA 278 276 276 ALA ALA A . n 
A 1 279 ARG 279 277 277 ARG ARG A . n 
A 1 280 ALA 280 278 278 ALA ALA A . n 
A 1 281 ILE 281 279 279 ILE ILE A . n 
A 1 282 ALA 282 280 280 ALA ALA A . n 
A 1 283 SER 283 281 281 SER SER A . n 
A 1 284 ALA 284 282 282 ALA ALA A . n 
A 1 285 HIS 285 283 283 HIS HIS A . n 
A 1 286 GLY 286 284 284 GLY GLY A . n 
A 1 287 ILE 287 285 285 ILE ILE A . n 
A 1 288 GLU 288 286 286 GLU GLU A . n 
A 1 289 LEU 289 287 287 LEU LEU A . n 
A 1 290 PRO 290 288 288 PRO PRO A . n 
A 1 291 PRO 291 289 289 PRO PRO A . n 
A 1 292 PHE 292 290 290 PHE PHE A . n 
A 1 293 ARG 293 291 291 ARG ARG A . n 
A 1 294 ASN 294 292 292 ASN ASN A . n 
A 1 295 GLY 295 293 293 GLY GLY A . n 
A 1 296 ASN 296 294 294 ASN ASN A . n 
A 1 297 VAL 297 295 295 VAL VAL A . n 
A 1 298 SER 298 296 296 SER SER A . n 
A 1 299 ASP 299 297 297 ASP ASP A . n 
A 1 300 ILE 300 298 298 ILE ILE A . n 
A 1 301 GLU 301 299 299 GLU GLU A . n 
A 1 302 ALA 302 300 300 ALA ALA A . n 
A 1 303 MET 303 301 301 MET MET A . n 
A 1 304 LEU 304 302 302 LEU LEU A . n 
A 1 305 SER 305 303 303 SER SER A . n 
A 1 306 GLY 306 304 304 GLY GLY A . n 
A 1 307 GLU 307 305 305 GLU GLU A . n 
A 1 308 GLU 308 306 306 GLU GLU A . n 
A 1 309 GLU 309 307 307 GLU GLU A . n 
A 1 310 PHE 310 308 308 PHE PHE A . n 
A 1 311 VAL 311 309 309 VAL VAL A . n 
A 1 312 GLU 312 310 310 GLU GLU A . n 
A 1 313 LYS 313 311 311 LYS LYS A . n 
A 1 314 TYR 314 312 312 TYR TYR A . n 
A 1 315 ARG 315 313 313 ARG ARG A . n 
A 1 316 SER 316 314 314 SER SER A . n 
A 1 317 LEU 317 315 315 LEU LEU A . n 
A 1 318 LEU 318 316 316 LEU LEU A . n 
A 1 319 ASP 319 317 317 ASP ASP A . n 
A 1 320 SER 320 318 318 SER SER A . n 
A 1 321 ASP 321 319 319 ASP ALA A . n 
A 1 322 CYS 322 320 ?   ?   ?   A . n 
A 1 323 PHE 323 321 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ADP 1  600  600  ADP ADP A . 
C 3 TRS 1  1503 1503 TRS TMN A . 
D 4 HOH 1  1000 1000 HOH WAT A . 
D 4 HOH 2  1001 1001 HOH WAT A . 
D 4 HOH 3  1002 1002 HOH WAT A . 
D 4 HOH 4  1003 1003 HOH WAT A . 
D 4 HOH 5  1004 1004 HOH WAT A . 
D 4 HOH 6  1005 1005 HOH WAT A . 
D 4 HOH 7  1006 1006 HOH WAT A . 
D 4 HOH 8  1007 1007 HOH WAT A . 
D 4 HOH 9  1008 1008 HOH WAT A . 
D 4 HOH 10 1009 1009 HOH WAT A . 
D 4 HOH 11 1010 1010 HOH WAT A . 
D 4 HOH 12 1011 1011 HOH WAT A . 
D 4 HOH 13 1012 1012 HOH WAT A . 
D 4 HOH 14 1013 1013 HOH WAT A . 
D 4 HOH 15 1014 1014 HOH WAT A . 
D 4 HOH 16 1015 1015 HOH WAT A . 
D 4 HOH 17 1016 1016 HOH WAT A . 
D 4 HOH 18 1017 1017 HOH WAT A . 
D 4 HOH 19 1018 1018 HOH WAT A . 
D 4 HOH 20 1019 1019 HOH WAT A . 
D 4 HOH 21 1020 1020 HOH WAT A . 
D 4 HOH 22 1021 1021 HOH WAT A . 
D 4 HOH 23 1022 1022 HOH WAT A . 
D 4 HOH 24 1023 1023 HOH WAT A . 
D 4 HOH 25 1024 1024 HOH WAT A . 
D 4 HOH 26 1025 1025 HOH WAT A . 
D 4 HOH 27 1026 1026 HOH WAT A . 
D 4 HOH 28 1027 1027 HOH WAT A . 
D 4 HOH 29 1028 1028 HOH WAT A . 
D 4 HOH 30 1029 1029 HOH WAT A . 
D 4 HOH 31 1030 1030 HOH WAT A . 
D 4 HOH 32 1031 1031 HOH WAT A . 
D 4 HOH 33 1032 1032 HOH WAT A . 
D 4 HOH 34 1033 1033 HOH WAT A . 
D 4 HOH 35 1034 1034 HOH WAT A . 
D 4 HOH 36 1035 1035 HOH WAT A . 
D 4 HOH 37 1036 1036 HOH WAT A . 
D 4 HOH 38 1037 1037 HOH WAT A . 
D 4 HOH 39 1038 1038 HOH WAT A . 
D 4 HOH 40 1039 1039 HOH WAT A . 
D 4 HOH 41 1040 1040 HOH WAT A . 
D 4 HOH 42 1041 1041 HOH WAT A . 
D 4 HOH 43 1042 1042 HOH WAT A . 
D 4 HOH 44 1043 1043 HOH WAT A . 
D 4 HOH 45 1044 1044 HOH WAT A . 
D 4 HOH 46 1045 1045 HOH WAT A . 
D 4 HOH 47 1046 1046 HOH WAT A . 
D 4 HOH 48 1047 1047 HOH WAT A . 
D 4 HOH 49 1048 1048 HOH WAT A . 
D 4 HOH 50 1049 1049 HOH WAT A . 
D 4 HOH 51 1050 1050 HOH WAT A . 
D 4 HOH 52 1051 1051 HOH WAT A . 
D 4 HOH 53 1052 1052 HOH WAT A . 
D 4 HOH 54 1053 1053 HOH WAT A . 
D 4 HOH 55 1054 1054 HOH WAT A . 
D 4 HOH 56 1055 1055 HOH WAT A . 
D 4 HOH 57 1056 1056 HOH WAT A . 
D 4 HOH 58 1057 1057 HOH WAT A . 
D 4 HOH 59 1058 1058 HOH WAT A . 
D 4 HOH 60 1059 1059 HOH WAT A . 
D 4 HOH 61 1060 1060 HOH WAT A . 
D 4 HOH 62 1061 1061 HOH WAT A . 
D 4 HOH 63 1062 1062 HOH WAT A . 
D 4 HOH 64 1063 1063 HOH WAT A . 
D 4 HOH 65 1064 1064 HOH WAT A . 
D 4 HOH 66 1065 1065 HOH WAT A . 
D 4 HOH 67 1066 1066 HOH WAT A . 
D 4 HOH 68 1067 1067 HOH WAT A . 
D 4 HOH 69 1068 1068 HOH WAT A . 
D 4 HOH 70 1069 1069 HOH WAT A . 
D 4 HOH 71 1070 1070 HOH WAT A . 
D 4 HOH 72 1071 1071 HOH WAT A . 
D 4 HOH 73 1072 1072 HOH WAT A . 
D 4 HOH 74 1073 1073 HOH WAT A . 
D 4 HOH 75 1074 1074 HOH WAT A . 
D 4 HOH 76 1075 1075 HOH WAT A . 
D 4 HOH 77 1076 1076 HOH WAT A . 
D 4 HOH 78 1077 1077 HOH WAT A . 
D 4 HOH 79 1078 1078 HOH WAT A . 
D 4 HOH 80 1079 1079 HOH WAT A . 
D 4 HOH 81 1080 1080 HOH WAT A . 
D 4 HOH 82 1081 1081 HOH WAT A . 
D 4 HOH 83 1082 1082 HOH WAT A . 
D 4 HOH 84 1083 1083 HOH WAT A . 
D 4 HOH 85 1084 1084 HOH WAT A . 
D 4 HOH 86 1085 1085 HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-05-22 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    99 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1081 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 48  ? ? -67.05  -72.65  
2 1 ARG A 49  ? ? 77.77   47.36   
3 1 ASP A 52  ? ? -93.81  32.80   
4 1 ALA A 123 ? ? -146.24 25.33   
5 1 LEU A 153 ? ? -98.30  -78.44  
6 1 LEU A 175 ? ? -99.08  -106.40 
7 1 LYS A 201 ? ? -68.84  -76.37  
8 1 ASP A 317 ? ? -51.65  -98.59  
9 1 SER A 318 ? ? -69.20  -97.72  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A THR 16  ? OG1 ? A THR 18  OG1 
2 1 Y 1 A THR 16  ? CG2 ? A THR 18  CG2 
3 1 Y 1 A ASP 319 ? CG  ? A ASP 321 CG  
4 1 Y 1 A ASP 319 ? OD1 ? A ASP 321 OD1 
5 1 Y 1 A ASP 319 ? OD2 ? A ASP 321 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1  ? A GLY 1   
2  1 Y 1 A ALA 0   ? A ALA 2   
3  1 Y 1 A MET 1   ? A MET 3   
4  1 Y 1 A GLY 2   ? A GLY 4   
5  1 Y 1 A CYS 3   ? A CYS 5   
6  1 Y 1 A VAL 4   ? A VAL 6   
7  1 Y 1 A SER 5   ? A SER 7   
8  1 Y 1 A SER 6   ? A SER 8   
9  1 Y 1 A LYS 7   ? A LYS 9   
10 1 Y 1 A SER 8   ? A SER 10  
11 1 Y 1 A THR 9   ? A THR 11  
12 1 Y 1 A THR 10  ? A THR 12  
13 1 Y 1 A VAL 11  ? A VAL 13  
14 1 Y 1 A LEU 12  ? A LEU 14  
15 1 Y 1 A SER 13  ? A SER 15  
16 1 Y 1 A PRO 14  ? A PRO 16  
17 1 Y 1 A GLN 15  ? A GLN 17  
18 1 Y 1 A SER 54  ? A SER 56  
19 1 Y 1 A SER 55  ? A SER 57  
20 1 Y 1 A LYS 56  ? A LYS 58  
21 1 Y 1 A CYS 320 ? A CYS 322 
22 1 Y 1 A PHE 321 ? A PHE 323 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-5'-DIPHOSPHATE"               ADP 
3 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 
4 water                                    HOH 
#