data_2NZ6
# 
_entry.id   2NZ6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NZ6         
RCSB  RCSB040484   
WWPDB D_1000040484 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2CFV 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF HUMAN PROTEIN TYROSINE PHOSPHATASE RECEPTOR TYPE J' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2NZ6 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ugochukwu, E.'                        1  
'Barr, A.'                             2  
'Savitsky, P.'                         3  
'Pike, A.C.W.'                         4  
'Bunkoczi, G.'                         5  
'Sundstrom, M.'                        6  
'Weigelt, J.'                          7  
'Arrowsmith, C.H.'                     8  
'Edwards, A.'                          9  
'von Delft, F.'                        10 
'Knapp, S.'                            11 
'Structural Genomics Consortium (SGC)' 12 
# 
_citation.id                        primary 
_citation.title                     'Large-scale structural analysis of the classical human protein tyrosine phosphatome.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            136 
_citation.page_first                352 
_citation.page_last                 363 
_citation.year                      2009 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19167335 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2008.11.038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Barr, A.J.'          1  
primary 'Ugochukwu, E.'       2  
primary 'Lee, W.H.'           3  
primary 'King, O.N.'          4  
primary 'Filippakopoulos, P.' 5  
primary 'Alfano, I.'          6  
primary 'Savitsky, P.'        7  
primary 'Burgess-Brown, N.A.' 8  
primary 'Muller, S.'          9  
primary 'Knapp, S.'           10 
# 
_cell.entry_id           2NZ6 
_cell.length_a           88.521 
_cell.length_b           88.521 
_cell.length_c           118.950 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              9 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2NZ6 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Receptor-type tyrosine-protein phosphatase eta' 36866.551 1  3.1.3.48 C1239S 'Tyrosine-protein phosphatase' ? 
2 non-polymer syn 'NICKEL (II) ION'                                58.693    5  ?        ?      ?                              ? 
3 non-polymer syn 'PHOSPHATE ION'                                  94.971    1  ?        ?      ?                              ? 
4 non-polymer syn 'CHLORIDE ION'                                   35.453    1  ?        ?      ?                              ? 
5 water       nat water                                            18.015    94 ?        ?      ?                              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Protein-tyrosine phosphatase eta, R-PTP-eta, HPTP eta, Protein- tyrosine phosphatase receptor type J, Density-enhanced phosphatase 1, DEP-1, CD148 antigen
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVL
PYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPS
KQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPI
LVHSSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVL
PYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPS
KQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPI
LVHSSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  LYS n 
1 25  LEU n 
1 26  ILE n 
1 27  ARG n 
1 28  VAL n 
1 29  GLU n 
1 30  ASN n 
1 31  PHE n 
1 32  GLU n 
1 33  ALA n 
1 34  TYR n 
1 35  PHE n 
1 36  LYS n 
1 37  LYS n 
1 38  GLN n 
1 39  GLN n 
1 40  ALA n 
1 41  ASP n 
1 42  SER n 
1 43  ASN n 
1 44  CYS n 
1 45  GLY n 
1 46  PHE n 
1 47  ALA n 
1 48  GLU n 
1 49  GLU n 
1 50  TYR n 
1 51  GLU n 
1 52  ASP n 
1 53  LEU n 
1 54  LYS n 
1 55  LEU n 
1 56  VAL n 
1 57  GLY n 
1 58  ILE n 
1 59  SER n 
1 60  GLN n 
1 61  PRO n 
1 62  LYS n 
1 63  TYR n 
1 64  ALA n 
1 65  ALA n 
1 66  GLU n 
1 67  LEU n 
1 68  ALA n 
1 69  GLU n 
1 70  ASN n 
1 71  ARG n 
1 72  GLY n 
1 73  LYS n 
1 74  ASN n 
1 75  ARG n 
1 76  TYR n 
1 77  ASN n 
1 78  ASN n 
1 79  VAL n 
1 80  LEU n 
1 81  PRO n 
1 82  TYR n 
1 83  ASP n 
1 84  ILE n 
1 85  SER n 
1 86  ARG n 
1 87  VAL n 
1 88  LYS n 
1 89  LEU n 
1 90  SER n 
1 91  VAL n 
1 92  GLN n 
1 93  THR n 
1 94  HIS n 
1 95  SER n 
1 96  THR n 
1 97  ASP n 
1 98  ASP n 
1 99  TYR n 
1 100 ILE n 
1 101 ASN n 
1 102 ALA n 
1 103 ASN n 
1 104 TYR n 
1 105 MET n 
1 106 PRO n 
1 107 GLY n 
1 108 TYR n 
1 109 HIS n 
1 110 SER n 
1 111 LYS n 
1 112 LYS n 
1 113 ASP n 
1 114 PHE n 
1 115 ILE n 
1 116 ALA n 
1 117 THR n 
1 118 GLN n 
1 119 GLY n 
1 120 PRO n 
1 121 LEU n 
1 122 PRO n 
1 123 ASN n 
1 124 THR n 
1 125 LEU n 
1 126 LYS n 
1 127 ASP n 
1 128 PHE n 
1 129 TRP n 
1 130 ARG n 
1 131 MET n 
1 132 VAL n 
1 133 TRP n 
1 134 GLU n 
1 135 LYS n 
1 136 ASN n 
1 137 VAL n 
1 138 TYR n 
1 139 ALA n 
1 140 ILE n 
1 141 ILE n 
1 142 MET n 
1 143 LEU n 
1 144 THR n 
1 145 LYS n 
1 146 CYS n 
1 147 VAL n 
1 148 GLU n 
1 149 GLN n 
1 150 GLY n 
1 151 ARG n 
1 152 THR n 
1 153 LYS n 
1 154 CYS n 
1 155 GLU n 
1 156 GLU n 
1 157 TYR n 
1 158 TRP n 
1 159 PRO n 
1 160 SER n 
1 161 LYS n 
1 162 GLN n 
1 163 ALA n 
1 164 GLN n 
1 165 ASP n 
1 166 TYR n 
1 167 GLY n 
1 168 ASP n 
1 169 ILE n 
1 170 THR n 
1 171 VAL n 
1 172 ALA n 
1 173 MET n 
1 174 THR n 
1 175 SER n 
1 176 GLU n 
1 177 ILE n 
1 178 VAL n 
1 179 LEU n 
1 180 PRO n 
1 181 GLU n 
1 182 TRP n 
1 183 THR n 
1 184 ILE n 
1 185 ARG n 
1 186 ASP n 
1 187 PHE n 
1 188 THR n 
1 189 VAL n 
1 190 LYS n 
1 191 ASN n 
1 192 ILE n 
1 193 GLN n 
1 194 THR n 
1 195 SER n 
1 196 GLU n 
1 197 SER n 
1 198 HIS n 
1 199 PRO n 
1 200 LEU n 
1 201 ARG n 
1 202 GLN n 
1 203 PHE n 
1 204 HIS n 
1 205 PHE n 
1 206 THR n 
1 207 SER n 
1 208 TRP n 
1 209 PRO n 
1 210 ASP n 
1 211 HIS n 
1 212 GLY n 
1 213 VAL n 
1 214 PRO n 
1 215 ASP n 
1 216 THR n 
1 217 THR n 
1 218 ASP n 
1 219 LEU n 
1 220 LEU n 
1 221 ILE n 
1 222 ASN n 
1 223 PHE n 
1 224 ARG n 
1 225 TYR n 
1 226 LEU n 
1 227 VAL n 
1 228 ARG n 
1 229 ASP n 
1 230 TYR n 
1 231 MET n 
1 232 LYS n 
1 233 GLN n 
1 234 SER n 
1 235 PRO n 
1 236 PRO n 
1 237 GLU n 
1 238 SER n 
1 239 PRO n 
1 240 ILE n 
1 241 LEU n 
1 242 VAL n 
1 243 HIS n 
1 244 SER n 
1 245 SER n 
1 246 ALA n 
1 247 GLY n 
1 248 VAL n 
1 249 GLY n 
1 250 ARG n 
1 251 THR n 
1 252 GLY n 
1 253 THR n 
1 254 PHE n 
1 255 ILE n 
1 256 ALA n 
1 257 ILE n 
1 258 ASP n 
1 259 ARG n 
1 260 LEU n 
1 261 ILE n 
1 262 TYR n 
1 263 GLN n 
1 264 ILE n 
1 265 GLU n 
1 266 ASN n 
1 267 GLU n 
1 268 ASN n 
1 269 THR n 
1 270 VAL n 
1 271 ASP n 
1 272 VAL n 
1 273 TYR n 
1 274 GLY n 
1 275 ILE n 
1 276 VAL n 
1 277 TYR n 
1 278 ASP n 
1 279 LEU n 
1 280 ARG n 
1 281 MET n 
1 282 HIS n 
1 283 ARG n 
1 284 PRO n 
1 285 LEU n 
1 286 MET n 
1 287 VAL n 
1 288 GLN n 
1 289 THR n 
1 290 GLU n 
1 291 ASP n 
1 292 GLN n 
1 293 TYR n 
1 294 VAL n 
1 295 PHE n 
1 296 LEU n 
1 297 ASN n 
1 298 GLN n 
1 299 CYS n 
1 300 VAL n 
1 301 LEU n 
1 302 ASP n 
1 303 ILE n 
1 304 VAL n 
1 305 ARG n 
1 306 SER n 
1 307 GLN n 
1 308 LYS n 
1 309 ASP n 
1 310 SER n 
1 311 LYS n 
1 312 VAL n 
1 313 ASP n 
1 314 LEU n 
1 315 ILE n 
1 316 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PTPRJ 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTPRJ_HUMAN 
_struct_ref.pdbx_db_accession          Q12913 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINAN
YMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWT
IRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQ
IENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIY
;
_struct_ref.pdbx_align_begin           1019 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2NZ6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 24 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 316 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q12913 
_struct_ref_seq.db_align_beg                  1019 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1311 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1019 
_struct_ref_seq.pdbx_auth_seq_align_end       1311 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2NZ6 MET A 1   ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -22  1  
1 2NZ6 HIS A 2   ? UNP Q12913 ?   ?    'EXPRESSION TAG'   -21  2  
1 2NZ6 HIS A 3   ? UNP Q12913 ?   ?    'EXPRESSION TAG'   -20  3  
1 2NZ6 HIS A 4   ? UNP Q12913 ?   ?    'EXPRESSION TAG'   -19  4  
1 2NZ6 HIS A 5   ? UNP Q12913 ?   ?    'EXPRESSION TAG'   -18  5  
1 2NZ6 HIS A 6   ? UNP Q12913 ?   ?    'EXPRESSION TAG'   -17  6  
1 2NZ6 HIS A 7   ? UNP Q12913 ?   ?    'EXPRESSION TAG'   -16  7  
1 2NZ6 SER A 8   ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -15  8  
1 2NZ6 SER A 9   ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -14  9  
1 2NZ6 GLY A 10  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -13  10 
1 2NZ6 VAL A 11  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -12  11 
1 2NZ6 ASP A 12  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -11  12 
1 2NZ6 LEU A 13  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -10  13 
1 2NZ6 GLY A 14  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -9   14 
1 2NZ6 THR A 15  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -8   15 
1 2NZ6 GLU A 16  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -7   16 
1 2NZ6 ASN A 17  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -6   17 
1 2NZ6 LEU A 18  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -5   18 
1 2NZ6 TYR A 19  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -4   19 
1 2NZ6 PHE A 20  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -3   20 
1 2NZ6 GLN A 21  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -2   21 
1 2NZ6 SER A 22  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' -1   22 
1 2NZ6 MET A 23  ? UNP Q12913 ?   ?    'CLONING ARTIFACT' 0    23 
1 2NZ6 SER A 244 ? UNP Q12913 CYS 1239 ENGINEERED         1239 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'    ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
NI  non-polymer         . 'NICKEL (II) ION' ? 'Ni 2'           58.693  
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION'   ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2NZ6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.43 
_exptl_crystal.density_percent_sol   49.42 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    '0.01M NiCl2, 0.1M TRIS, pH 8.5, 1M Li2SO4, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-05-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             0.979 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2NZ6 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.3 
_reflns.d_resolution_low             46.98 
_reflns.number_all                   ? 
_reflns.number_obs                   15274 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            0.089 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.42 
_reflns_shell.percent_possible_all   95 
_reflns_shell.Rmerge_I_obs           0.387 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2NZ6 
_refine.ls_number_reflns_obs                     14581 
_refine.ls_number_reflns_all                     14581 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.98 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.15 
_refine.ls_R_factor_obs                          0.18399 
_refine.ls_R_factor_all                          0.18399 
_refine.ls_R_factor_R_work                       0.18179 
_refine.ls_R_factor_R_free                       0.2275 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  738 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.943 
_refine.correlation_coeff_Fo_to_Fc_free          0.912 
_refine.B_iso_mean                               22.442 
_refine.aniso_B[1][1]                            0.31 
_refine.aniso_B[2][2]                            0.31 
_refine.aniso_B[3][3]                            -0.47 
_refine.aniso_B[1][2]                            0.16 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'pdb entry 2CFV' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.315 
_refine.pdbx_overall_ESU_R_Free                  0.221 
_refine.overall_SU_ML                            0.158 
_refine.overall_SU_B                             11.948 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2380 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             94 
_refine_hist.number_atoms_total               2485 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        46.98 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011  0.021  ? 2458 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001  0.020  ? 1594 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.291  1.929  ? 3345 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        1.314  3.000  ? 3880 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.569  5.000  ? 292  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   38.257 24.240 ? 125  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   14.494 15.000 ? 392  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   16.095 15.000 ? 12   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.077  0.200  ? 366  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 2736 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 511  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.199  0.200  ? 444  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.198  0.200  ? 1603 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.175  0.200  ? 1202 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.087  0.200  ? 1217 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.147  0.200  ? 106  'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      0.042  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.180  0.200  ? 39   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.173  0.200  ? 38   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.078  0.200  ? 5    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.596  1.500  ? 1533 'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.107  1.500  ? 592  'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.978  2.000  ? 2398 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.391  3.000  ? 1087 'X-RAY DIFFRACTION' ? 
r_scangle_it             1.901  4.500  ? 947  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_R_work             968 
_refine_ls_shell.R_factor_R_work                  0.227 
_refine_ls_shell.percent_reflns_obs               89.60 
_refine_ls_shell.R_factor_R_free                  0.384 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             57 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NZ6 
_struct.title                     'Crystal structure of the PTPRJ inactivating mutant C1239S' 
_struct.pdbx_descriptor           'Receptor-type tyrosine-protein phosphatase eta (E.C.3.1.3.48)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NZ6 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HYDROLASE RECEPTOR TYPE TYROSINE PHOSPHATASE J, PTPRJ, GLYCOPROTEIN, PROTEIN PHOSPHATASE, Structural Genomics, Structural Genomics Consortium, SGC, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 12  ? GLN A 21  ? ASP A -11  GLN A -2   1 ? 10 
HELX_P HELX_P2 2 VAL A 28  ? LEU A 53  ? VAL A 1023 LEU A 1048 1 ? 26 
HELX_P HELX_P3 3 LEU A 67  ? ASN A 74  ? LEU A 1062 ASN A 1069 5 ? 8  
HELX_P HELX_P4 4 HIS A 94  ? TYR A 99  ? HIS A 1089 TYR A 1094 5 ? 6  
HELX_P HELX_P5 5 THR A 124 ? LYS A 135 ? THR A 1119 LYS A 1130 1 ? 12 
HELX_P HELX_P6 6 THR A 216 ? MET A 231 ? THR A 1211 MET A 1226 1 ? 16 
HELX_P HELX_P7 7 VAL A 248 ? GLU A 267 ? VAL A 1243 GLU A 1262 1 ? 20 
HELX_P HELX_P8 8 ASP A 271 ? MET A 281 ? ASP A 1266 MET A 1276 1 ? 11 
HELX_P HELX_P9 9 THR A 289 ? LYS A 308 ? THR A 1284 LYS A 1303 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B NI . NI ? ? ? 1_555 A HIS 7   NE2 ? ? A NI 201 A HIS -16  1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc2  metalc ? ? B NI . NI ? ? ? 1_555 A HIS 5   NE2 ? ? A NI 201 A HIS -18  1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc3  metalc ? ? C NI . NI ? ? ? 1_555 A HIS 211 NE2 ? ? A NI 203 A HIS 1206 1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc4  metalc ? ? D NI . NI ? ? ? 1_555 A HIS 3   N   ? ? A NI 204 A HIS -20  1_555 ? ? ? ? ? ? ? 2.016 ? 
metalc5  metalc ? ? D NI . NI ? ? ? 1_555 A HIS 2   N   ? ? A NI 204 A HIS -21  1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc6  metalc ? ? D NI . NI ? ? ? 1_555 A HIS 3   ND1 ? ? A NI 204 A HIS -20  1_555 ? ? ? ? ? ? ? 1.907 ? 
metalc7  metalc ? ? E NI . NI ? ? ? 1_555 A HIS 4   NE2 ? ? A NI 205 A HIS -19  1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc8  metalc ? ? E NI . NI ? ? ? 1_555 A HIS 6   NE2 ? ? A NI 205 A HIS -17  1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc9  metalc ? ? F NI . NI ? ? ? 1_555 I HOH .   O   ? ? A NI 206 A HOH 96   1_555 ? ? ? ? ? ? ? 2.546 ? 
metalc10 metalc ? ? F NI . NI ? ? ? 1_555 A HIS 3   NE2 ? ? A NI 206 A HIS -20  1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc11 metalc ? ? B NI . NI ? ? ? 1_555 A HIS 5   NE2 ? ? A NI 201 A HIS -18  2_665 ? ? ? ? ? ? ? 2.278 ? 
metalc12 metalc ? ? B NI . NI ? ? ? 1_555 A HIS 5   NE2 ? ? A NI 201 A HIS -18  3_565 ? ? ? ? ? ? ? 2.277 ? 
metalc13 metalc ? ? B NI . NI ? ? ? 1_555 A HIS 7   NE2 ? ? A NI 201 A HIS -16  2_665 ? ? ? ? ? ? ? 2.158 ? 
metalc14 metalc ? ? B NI . NI ? ? ? 1_555 A HIS 7   NE2 ? ? A NI 201 A HIS -16  3_565 ? ? ? ? ? ? ? 2.158 ? 
metalc15 metalc ? ? E NI . NI ? ? ? 1_555 A HIS 282 NE2 ? ? A NI 205 A HIS 1277 3_565 ? ? ? ? ? ? ? 2.285 ? 
metalc16 metalc ? ? E NI . NI ? ? ? 1_555 A LYS 111 NZ  ? ? A NI 205 A LYS 1106 3_565 ? ? ? ? ? ? ? 2.087 ? 
metalc17 metalc ? ? E NI . NI ? ? ? 1_555 A HIS 2   NE2 ? ? A NI 205 A HIS -21  2_665 ? ? ? ? ? ? ? 2.108 ? 
metalc18 metalc ? ? F NI . NI ? ? ? 1_555 A HIS 3   NE2 ? ? A NI 206 A HIS -20  2_665 ? ? ? ? ? ? ? 2.126 ? 
metalc19 metalc ? ? F NI . NI ? ? ? 1_555 A HIS 3   NE2 ? ? A NI 206 A HIS -20  3_565 ? ? ? ? ? ? ? 2.023 ? 
metalc20 metalc ? ? F NI . NI ? ? ? 1_555 I HOH .   O   ? ? A NI 206 A HOH 96   2_665 ? ? ? ? ? ? ? 2.622 ? 
metalc21 metalc ? ? F NI . NI ? ? ? 1_555 I HOH .   O   ? ? A NI 206 A HOH 96   3_565 ? ? ? ? ? ? ? 2.602 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 26  ? ARG A 27  ? ILE A 1021 ARG A 1022 
A 2 THR A 269 ? VAL A 270 ? THR A 1264 VAL A 1265 
B 1 ALA A 102 ? MET A 105 ? ALA A 1097 MET A 1100 
B 2 PHE A 114 ? GLN A 118 ? PHE A 1109 GLN A 1113 
B 3 ILE A 240 ? SER A 244 ? ILE A 1235 SER A 1239 
B 4 ALA A 139 ? LEU A 143 ? ALA A 1134 LEU A 1138 
B 5 SER A 197 ? PHE A 205 ? SER A 1192 PHE A 1200 
B 6 TRP A 182 ? ASN A 191 ? TRP A 1177 ASN A 1186 
B 7 ILE A 169 ? VAL A 178 ? ILE A 1164 VAL A 1173 
B 8 GLN A 164 ? TYR A 166 ? GLN A 1159 TYR A 1161 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 26  ? N ILE A 1021 O VAL A 270 ? O VAL A 1265 
B 1 2 N ASN A 103 ? N ASN A 1098 O ALA A 116 ? O ALA A 1111 
B 2 3 N ILE A 115 ? N ILE A 1110 O VAL A 242 ? O VAL A 1237 
B 3 4 O LEU A 241 ? O LEU A 1236 N ILE A 141 ? N ILE A 1136 
B 4 5 N ILE A 140 ? N ILE A 1135 O PHE A 203 ? O PHE A 1198 
B 5 6 O GLN A 202 ? O GLN A 1197 N ARG A 185 ? N ARG A 1180 
B 6 7 O ASP A 186 ? O ASP A 1181 N THR A 174 ? N THR A 1169 
B 7 8 O ILE A 169 ? O ILE A 1164 N TYR A 166 ? N TYR A 1161 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NI A 201'  
AC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NI A 203'  
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NI A 204'  
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NI A 205'  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NI A 206'  
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PO4 A 207' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  HIS A 5   ? HIS A -18  . ? 2_665 ? 
2  AC1 6  HIS A 5   ? HIS A -18  . ? 3_565 ? 
3  AC1 6  HIS A 7   ? HIS A -16  . ? 1_555 ? 
4  AC1 6  HIS A 7   ? HIS A -16  . ? 2_665 ? 
5  AC1 6  HIS A 7   ? HIS A -16  . ? 3_565 ? 
6  AC1 6  HIS A 5   ? HIS A -18  . ? 1_555 ? 
7  AC2 1  HIS A 211 ? HIS A 1206 . ? 1_555 ? 
8  AC3 3  HIS A 4   ? HIS A -19  . ? 1_555 ? 
9  AC3 3  HIS A 3   ? HIS A -20  . ? 1_555 ? 
10 AC3 3  HIS A 2   ? HIS A -21  . ? 1_555 ? 
11 AC4 5  HIS A 2   ? HIS A -21  . ? 2_665 ? 
12 AC4 5  HIS A 4   ? HIS A -19  . ? 1_555 ? 
13 AC4 5  HIS A 6   ? HIS A -17  . ? 1_555 ? 
14 AC4 5  LYS A 111 ? LYS A 1106 . ? 3_565 ? 
15 AC4 5  HIS A 282 ? HIS A 1277 . ? 3_565 ? 
16 AC5 6  HIS A 3   ? HIS A -20  . ? 2_665 ? 
17 AC5 6  HIS A 3   ? HIS A -20  . ? 3_565 ? 
18 AC5 6  HIS A 3   ? HIS A -20  . ? 1_555 ? 
19 AC5 6  HOH I .   ? HOH A 96   . ? 2_665 ? 
20 AC5 6  HOH I .   ? HOH A 96   . ? 3_565 ? 
21 AC5 6  HOH I .   ? HOH A 96   . ? 1_555 ? 
22 AC6 10 HOH I .   ? HOH A 45   . ? 1_555 ? 
23 AC6 10 ASP A 210 ? ASP A 1205 . ? 1_555 ? 
24 AC6 10 SER A 244 ? SER A 1239 . ? 1_555 ? 
25 AC6 10 SER A 245 ? SER A 1240 . ? 1_555 ? 
26 AC6 10 ALA A 246 ? ALA A 1241 . ? 1_555 ? 
27 AC6 10 GLY A 247 ? GLY A 1242 . ? 1_555 ? 
28 AC6 10 VAL A 248 ? VAL A 1243 . ? 1_555 ? 
29 AC6 10 GLY A 249 ? GLY A 1244 . ? 1_555 ? 
30 AC6 10 ARG A 250 ? ARG A 1245 . ? 1_555 ? 
31 AC6 10 TYR A 316 ? TYR A 1311 . ? 7_544 ? 
# 
_database_PDB_matrix.entry_id          2NZ6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2NZ6 
_atom_sites.fract_transf_matrix[1][1]   0.011297 
_atom_sites.fract_transf_matrix[1][2]   0.006522 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013044 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008407 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
NI 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 2   ? 5.184   56.912 -15.957 1.00 22.79 ? -21  HIS A N   1 
ATOM   2    C  CA  . HIS A 1 2   ? 5.220   57.329 -17.409 1.00 22.91 ? -21  HIS A CA  1 
ATOM   3    C  C   . HIS A 1 2   ? 4.559   56.362 -18.394 1.00 22.75 ? -21  HIS A C   1 
ATOM   4    O  O   . HIS A 1 2   ? 4.522   56.624 -19.579 1.00 23.58 ? -21  HIS A O   1 
ATOM   5    C  CB  . HIS A 1 2   ? 6.674   57.575 -17.843 1.00 23.12 ? -21  HIS A CB  1 
ATOM   6    C  CG  . HIS A 1 2   ? 7.579   56.404 -17.623 1.00 21.60 ? -21  HIS A CG  1 
ATOM   7    N  ND1 . HIS A 1 2   ? 8.630   56.441 -16.733 1.00 23.64 ? -21  HIS A ND1 1 
ATOM   8    C  CD2 . HIS A 1 2   ? 7.596   55.171 -18.177 1.00 19.58 ? -21  HIS A CD2 1 
ATOM   9    C  CE1 . HIS A 1 2   ? 9.258   55.279 -16.748 1.00 22.27 ? -21  HIS A CE1 1 
ATOM   10   N  NE2 . HIS A 1 2   ? 8.657   54.493 -17.626 1.00 21.88 ? -21  HIS A NE2 1 
ATOM   11   N  N   . HIS A 1 3   ? 4.020   55.258 -17.897 1.00 23.25 ? -20  HIS A N   1 
ATOM   12   C  CA  . HIS A 1 3   ? 3.421   54.183 -18.728 1.00 23.20 ? -20  HIS A CA  1 
ATOM   13   C  C   . HIS A 1 3   ? 1.905   54.354 -18.952 1.00 22.63 ? -20  HIS A C   1 
ATOM   14   O  O   . HIS A 1 3   ? 1.293   53.599 -19.704 1.00 22.38 ? -20  HIS A O   1 
ATOM   15   C  CB  . HIS A 1 3   ? 3.626   52.850 -18.038 1.00 23.19 ? -20  HIS A CB  1 
ATOM   16   C  CG  . HIS A 1 3   ? 2.835   52.711 -16.772 1.00 24.30 ? -20  HIS A CG  1 
ATOM   17   N  ND1 . HIS A 1 3   ? 2.984   53.573 -15.701 1.00 26.10 ? -20  HIS A ND1 1 
ATOM   18   C  CD2 . HIS A 1 3   ? 1.872   51.833 -16.418 1.00 24.04 ? -20  HIS A CD2 1 
ATOM   19   C  CE1 . HIS A 1 3   ? 2.140   53.231 -14.746 1.00 25.93 ? -20  HIS A CE1 1 
ATOM   20   N  NE2 . HIS A 1 3   ? 1.461   52.170 -15.154 1.00 26.45 ? -20  HIS A NE2 1 
ATOM   21   N  N   . HIS A 1 4   ? 1.318   55.335 -18.271 1.00 21.68 ? -19  HIS A N   1 
ATOM   22   C  CA  . HIS A 1 4   ? -0.098  55.586 -18.354 1.00 21.57 ? -19  HIS A CA  1 
ATOM   23   C  C   . HIS A 1 4   ? -0.365  56.355 -19.632 1.00 20.43 ? -19  HIS A C   1 
ATOM   24   O  O   . HIS A 1 4   ? 0.039   57.485 -19.773 1.00 20.44 ? -19  HIS A O   1 
ATOM   25   C  CB  . HIS A 1 4   ? -0.598  56.397 -17.143 1.00 21.54 ? -19  HIS A CB  1 
ATOM   26   C  CG  . HIS A 1 4   ? -2.094  56.534 -17.101 1.00 23.28 ? -19  HIS A CG  1 
ATOM   27   N  ND1 . HIS A 1 4   ? -2.881  55.861 -16.189 1.00 22.21 ? -19  HIS A ND1 1 
ATOM   28   C  CD2 . HIS A 1 4   ? -2.946  57.226 -17.898 1.00 23.96 ? -19  HIS A CD2 1 
ATOM   29   C  CE1 . HIS A 1 4   ? -4.149  56.161 -16.402 1.00 24.39 ? -19  HIS A CE1 1 
ATOM   30   N  NE2 . HIS A 1 4   ? -4.217  56.978 -17.441 1.00 25.91 ? -19  HIS A NE2 1 
ATOM   31   N  N   . HIS A 1 5   ? -1.020  55.719 -20.583 1.00 20.24 ? -18  HIS A N   1 
ATOM   32   C  CA  . HIS A 1 5   ? -1.382  56.415 -21.803 1.00 20.12 ? -18  HIS A CA  1 
ATOM   33   C  C   . HIS A 1 5   ? -2.706  55.852 -22.319 1.00 20.67 ? -18  HIS A C   1 
ATOM   34   O  O   . HIS A 1 5   ? -3.112  54.717 -21.978 1.00 20.89 ? -18  HIS A O   1 
ATOM   35   C  CB  . HIS A 1 5   ? -0.246  56.352 -22.861 1.00 19.54 ? -18  HIS A CB  1 
ATOM   36   C  CG  . HIS A 1 5   ? 0.062   54.972 -23.325 1.00 17.36 ? -18  HIS A CG  1 
ATOM   37   N  ND1 . HIS A 1 5   ? 0.959   54.161 -22.675 1.00 16.42 ? -18  HIS A ND1 1 
ATOM   38   C  CD2 . HIS A 1 5   ? -0.444  54.238 -24.340 1.00 18.61 ? -18  HIS A CD2 1 
ATOM   39   C  CE1 . HIS A 1 5   ? 1.016   52.995 -23.288 1.00 18.76 ? -18  HIS A CE1 1 
ATOM   40   N  NE2 . HIS A 1 5   ? 0.158   53.006 -24.291 1.00 16.94 ? -18  HIS A NE2 1 
ATOM   41   N  N   . HIS A 1 6   ? -3.375  56.698 -23.098 1.00 21.04 ? -17  HIS A N   1 
ATOM   42   C  CA  . HIS A 1 6   ? -4.649  56.400 -23.752 1.00 21.56 ? -17  HIS A CA  1 
ATOM   43   C  C   . HIS A 1 6   ? -4.362  56.269 -25.236 1.00 21.55 ? -17  HIS A C   1 
ATOM   44   O  O   . HIS A 1 6   ? -3.680  57.109 -25.775 1.00 22.93 ? -17  HIS A O   1 
ATOM   45   C  CB  . HIS A 1 6   ? -5.617  57.587 -23.629 1.00 21.24 ? -17  HIS A CB  1 
ATOM   46   C  CG  . HIS A 1 6   ? -5.971  57.984 -22.231 1.00 20.85 ? -17  HIS A CG  1 
ATOM   47   N  ND1 . HIS A 1 6   ? -6.984  58.881 -21.974 1.00 18.33 ? -17  HIS A ND1 1 
ATOM   48   C  CD2 . HIS A 1 6   ? -5.461  57.634 -21.024 1.00 19.93 ? -17  HIS A CD2 1 
ATOM   49   C  CE1 . HIS A 1 6   ? -7.087  59.060 -20.672 1.00 18.80 ? -17  HIS A CE1 1 
ATOM   50   N  NE2 . HIS A 1 6   ? -6.175  58.318 -20.072 1.00 17.21 ? -17  HIS A NE2 1 
ATOM   51   N  N   . HIS A 1 7   ? -4.892  55.263 -25.918 1.00 22.02 ? -16  HIS A N   1 
ATOM   52   C  CA  . HIS A 1 7   ? -4.687  55.177 -27.376 1.00 21.92 ? -16  HIS A CA  1 
ATOM   53   C  C   . HIS A 1 7   ? -5.727  55.915 -28.220 1.00 22.28 ? -16  HIS A C   1 
ATOM   54   O  O   . HIS A 1 7   ? -6.925  55.915 -27.896 1.00 21.95 ? -16  HIS A O   1 
ATOM   55   C  CB  . HIS A 1 7   ? -4.560  53.723 -27.821 1.00 22.04 ? -16  HIS A CB  1 
ATOM   56   C  CG  . HIS A 1 7   ? -3.216  53.169 -27.534 1.00 21.83 ? -16  HIS A CG  1 
ATOM   57   N  ND1 . HIS A 1 7   ? -2.078  53.717 -28.083 1.00 22.19 ? -16  HIS A ND1 1 
ATOM   58   C  CD2 . HIS A 1 7   ? -2.806  52.211 -26.675 1.00 20.00 ? -16  HIS A CD2 1 
ATOM   59   C  CE1 . HIS A 1 7   ? -1.026  53.079 -27.615 1.00 21.63 ? -16  HIS A CE1 1 
ATOM   60   N  NE2 . HIS A 1 7   ? -1.438  52.162 -26.757 1.00 21.69 ? -16  HIS A NE2 1 
ATOM   61   N  N   . SER A 1 8   ? -5.234  56.537 -29.294 1.00 22.50 ? -15  SER A N   1 
ATOM   62   C  CA  . SER A 1 8   ? -6.068  57.119 -30.356 1.00 23.21 ? -15  SER A CA  1 
ATOM   63   C  C   . SER A 1 8   ? -6.729  56.016 -31.145 1.00 23.11 ? -15  SER A C   1 
ATOM   64   O  O   . SER A 1 8   ? -6.260  54.880 -31.123 1.00 22.89 ? -15  SER A O   1 
ATOM   65   C  CB  . SER A 1 8   ? -5.221  57.944 -31.329 1.00 22.91 ? -15  SER A CB  1 
ATOM   66   O  OG  . SER A 1 8   ? -4.418  58.883 -30.637 1.00 24.99 ? -15  SER A OG  1 
ATOM   67   N  N   . SER A 1 9   ? -7.787  56.355 -31.879 1.00 23.12 ? -14  SER A N   1 
ATOM   68   C  CA  . SER A 1 9   ? -8.438  55.368 -32.716 1.00 23.47 ? -14  SER A CA  1 
ATOM   69   C  C   . SER A 1 9   ? -7.522  54.953 -33.881 1.00 23.64 ? -14  SER A C   1 
ATOM   70   O  O   . SER A 1 9   ? -6.650  55.721 -34.313 1.00 23.01 ? -14  SER A O   1 
ATOM   71   C  CB  . SER A 1 9   ? -9.791  55.862 -33.200 1.00 23.63 ? -14  SER A CB  1 
ATOM   72   O  OG  . SER A 1 9   ? -9.710  57.178 -33.702 1.00 27.62 ? -14  SER A OG  1 
ATOM   73   N  N   . GLY A 1 10  ? -7.684  53.710 -34.335 1.00 23.38 ? -13  GLY A N   1 
ATOM   74   C  CA  . GLY A 1 10  ? -6.920  53.202 -35.446 1.00 23.77 ? -13  GLY A CA  1 
ATOM   75   C  C   . GLY A 1 10  ? -5.528  52.698 -35.107 1.00 24.26 ? -13  GLY A C   1 
ATOM   76   O  O   . GLY A 1 10  ? -4.720  52.550 -36.012 1.00 26.01 ? -13  GLY A O   1 
ATOM   77   N  N   . VAL A 1 11  ? -5.236  52.434 -33.831 1.00 24.07 ? -12  VAL A N   1 
ATOM   78   C  CA  . VAL A 1 11  ? -3.899  52.009 -33.407 1.00 23.28 ? -12  VAL A CA  1 
ATOM   79   C  C   . VAL A 1 11  ? -3.912  50.523 -33.054 1.00 23.90 ? -12  VAL A C   1 
ATOM   80   O  O   . VAL A 1 11  ? -3.111  49.747 -33.586 1.00 24.21 ? -12  VAL A O   1 
ATOM   81   C  CB  . VAL A 1 11  ? -3.378  52.865 -32.210 1.00 23.53 ? -12  VAL A CB  1 
ATOM   82   C  CG1 . VAL A 1 11  ? -2.154  52.215 -31.538 1.00 21.42 ? -12  VAL A CG1 1 
ATOM   83   C  CG2 . VAL A 1 11  ? -3.062  54.280 -32.672 1.00 21.33 ? -12  VAL A CG2 1 
ATOM   84   N  N   . ASP A 1 12  ? -4.839  50.126 -32.175 1.00 23.82 ? -11  ASP A N   1 
ATOM   85   C  CA  . ASP A 1 12  ? -5.034  48.721 -31.819 1.00 23.88 ? -11  ASP A CA  1 
ATOM   86   C  C   . ASP A 1 12  ? -6.539  48.489 -31.629 1.00 23.59 ? -11  ASP A C   1 
ATOM   87   O  O   . ASP A 1 12  ? -7.140  49.039 -30.705 1.00 22.27 ? -11  ASP A O   1 
ATOM   88   C  CB  . ASP A 1 12  ? -4.243  48.411 -30.547 1.00 23.89 ? -11  ASP A CB  1 
ATOM   89   C  CG  . ASP A 1 12  ? -4.115  46.921 -30.243 1.00 25.36 ? -11  ASP A CG  1 
ATOM   90   O  OD1 . ASP A 1 12  ? -3.071  46.587 -29.649 1.00 27.09 ? -11  ASP A OD1 1 
ATOM   91   O  OD2 . ASP A 1 12  ? -5.018  46.090 -30.544 1.00 25.76 ? -11  ASP A OD2 1 
ATOM   92   N  N   . LEU A 1 13  ? -7.134  47.688 -32.520 1.00 23.84 ? -10  LEU A N   1 
ATOM   93   C  CA  . LEU A 1 13  ? -8.577  47.343 -32.441 1.00 23.85 ? -10  LEU A CA  1 
ATOM   94   C  C   . LEU A 1 13  ? -8.901  46.489 -31.210 1.00 24.04 ? -10  LEU A C   1 
ATOM   95   O  O   . LEU A 1 13  ? -9.987  46.585 -30.662 1.00 24.04 ? -10  LEU A O   1 
ATOM   96   C  CB  . LEU A 1 13  ? -9.071  46.681 -33.750 1.00 23.61 ? -10  LEU A CB  1 
ATOM   97   C  CG  . LEU A 1 13  ? -9.083  47.556 -35.040 1.00 23.25 ? -10  LEU A CG  1 
ATOM   98   C  CD1 . LEU A 1 13  ? -9.467  46.736 -36.246 1.00 20.70 ? -10  LEU A CD1 1 
ATOM   99   C  CD2 . LEU A 1 13  ? -9.994  48.773 -34.963 1.00 23.62 ? -10  LEU A CD2 1 
ATOM   100  N  N   . GLY A 1 14  ? -7.950  45.681 -30.738 1.00 24.98 ? -9   GLY A N   1 
ATOM   101  C  CA  . GLY A 1 14  ? -8.091  45.031 -29.420 1.00 24.81 ? -9   GLY A CA  1 
ATOM   102  C  C   . GLY A 1 14  ? -8.293  46.015 -28.269 1.00 24.98 ? -9   GLY A C   1 
ATOM   103  O  O   . GLY A 1 14  ? -9.145  45.820 -27.416 1.00 25.61 ? -9   GLY A O   1 
ATOM   104  N  N   . THR A 1 15  ? -7.497  47.069 -28.228 1.00 25.21 ? -8   THR A N   1 
ATOM   105  C  CA  . THR A 1 15  ? -7.598  48.072 -27.170 1.00 25.78 ? -8   THR A CA  1 
ATOM   106  C  C   . THR A 1 15  ? -8.924  48.830 -27.277 1.00 26.25 ? -8   THR A C   1 
ATOM   107  O  O   . THR A 1 15  ? -9.531  49.197 -26.267 1.00 26.38 ? -8   THR A O   1 
ATOM   108  C  CB  . THR A 1 15  ? -6.406  49.064 -27.230 1.00 26.09 ? -8   THR A CB  1 
ATOM   109  O  OG1 . THR A 1 15  ? -5.173  48.335 -27.319 1.00 26.37 ? -8   THR A OG1 1 
ATOM   110  C  CG2 . THR A 1 15  ? -6.361  49.960 -26.010 1.00 25.49 ? -8   THR A CG2 1 
ATOM   111  N  N   . GLU A 1 16  ? -9.375  49.064 -28.503 1.00 26.63 ? -7   GLU A N   1 
ATOM   112  C  CA  . GLU A 1 16  ? -10.630 49.778 -28.735 1.00 26.97 ? -7   GLU A CA  1 
ATOM   113  C  C   . GLU A 1 16  ? -11.838 49.009 -28.203 1.00 26.90 ? -7   GLU A C   1 
ATOM   114  O  O   . GLU A 1 16  ? -12.740 49.592 -27.597 1.00 26.61 ? -7   GLU A O   1 
ATOM   115  C  CB  . GLU A 1 16  ? -10.804 50.057 -30.212 1.00 26.70 ? -7   GLU A CB  1 
ATOM   116  C  CG  . GLU A 1 16  ? -9.890  51.180 -30.679 1.00 28.93 ? -7   GLU A CG  1 
ATOM   117  C  CD  . GLU A 1 16  ? -10.000 51.450 -32.163 1.00 29.28 ? -7   GLU A CD  1 
ATOM   118  O  OE1 . GLU A 1 16  ? -10.951 50.954 -32.780 1.00 33.84 ? -7   GLU A OE1 1 
ATOM   119  O  OE2 . GLU A 1 16  ? -9.150  52.166 -32.711 1.00 31.39 ? -7   GLU A OE2 1 
ATOM   120  N  N   . ASN A 1 17  ? -11.835 47.703 -28.444 1.00 26.86 ? -6   ASN A N   1 
ATOM   121  C  CA  . ASN A 1 17  ? -12.805 46.796 -27.858 1.00 27.20 ? -6   ASN A CA  1 
ATOM   122  C  C   . ASN A 1 17  ? -12.763 46.811 -26.327 1.00 26.38 ? -6   ASN A C   1 
ATOM   123  O  O   . ASN A 1 17  ? -13.801 46.860 -25.683 1.00 25.70 ? -6   ASN A O   1 
ATOM   124  C  CB  . ASN A 1 17  ? -12.582 45.373 -28.373 1.00 27.35 ? -6   ASN A CB  1 
ATOM   125  C  CG  . ASN A 1 17  ? -13.741 44.457 -28.023 1.00 29.24 ? -6   ASN A CG  1 
ATOM   126  O  OD1 . ASN A 1 17  ? -13.622 43.569 -27.161 1.00 28.42 ? -6   ASN A OD1 1 
ATOM   127  N  ND2 . ASN A 1 17  ? -14.890 44.693 -28.672 1.00 30.05 ? -6   ASN A ND2 1 
ATOM   128  N  N   . LEU A 1 18  ? -11.555 46.774 -25.763 1.00 25.90 ? -5   LEU A N   1 
ATOM   129  C  CA  . LEU A 1 18  ? -11.349 46.911 -24.318 1.00 25.45 ? -5   LEU A CA  1 
ATOM   130  C  C   . LEU A 1 18  ? -12.016 48.166 -23.713 1.00 25.44 ? -5   LEU A C   1 
ATOM   131  O  O   . LEU A 1 18  ? -12.651 48.113 -22.653 1.00 24.89 ? -5   LEU A O   1 
ATOM   132  C  CB  . LEU A 1 18  ? -9.848  46.901 -23.989 1.00 25.16 ? -5   LEU A CB  1 
ATOM   133  C  CG  . LEU A 1 18  ? -9.443  46.967 -22.506 1.00 25.49 ? -5   LEU A CG  1 
ATOM   134  C  CD1 . LEU A 1 18  ? -9.754  45.660 -21.785 1.00 22.71 ? -5   LEU A CD1 1 
ATOM   135  C  CD2 . LEU A 1 18  ? -7.963  47.341 -22.340 1.00 24.92 ? -5   LEU A CD2 1 
ATOM   136  N  N   . TYR A 1 19  ? -11.823 49.296 -24.368 1.00 25.48 ? -4   TYR A N   1 
ATOM   137  C  CA  . TYR A 1 19  ? -12.413 50.550 -23.932 1.00 26.00 ? -4   TYR A CA  1 
ATOM   138  C  C   . TYR A 1 19  ? -13.945 50.537 -24.105 1.00 26.95 ? -4   TYR A C   1 
ATOM   139  O  O   . TYR A 1 19  ? -14.664 51.162 -23.339 1.00 26.21 ? -4   TYR A O   1 
ATOM   140  C  CB  . TYR A 1 19  ? -11.874 51.697 -24.788 1.00 25.70 ? -4   TYR A CB  1 
ATOM   141  C  CG  . TYR A 1 19  ? -10.396 51.998 -24.720 1.00 24.87 ? -4   TYR A CG  1 
ATOM   142  C  CD1 . TYR A 1 19  ? -9.612  51.615 -23.623 1.00 24.73 ? -4   TYR A CD1 1 
ATOM   143  C  CD2 . TYR A 1 19  ? -9.787  52.721 -25.744 1.00 25.03 ? -4   TYR A CD2 1 
ATOM   144  C  CE1 . TYR A 1 19  ? -8.267  51.916 -23.572 1.00 25.42 ? -4   TYR A CE1 1 
ATOM   145  C  CE2 . TYR A 1 19  ? -8.426  53.041 -25.701 1.00 24.28 ? -4   TYR A CE2 1 
ATOM   146  C  CZ  . TYR A 1 19  ? -7.669  52.651 -24.614 1.00 25.23 ? -4   TYR A CZ  1 
ATOM   147  O  OH  . TYR A 1 19  ? -6.316  52.975 -24.562 1.00 24.58 ? -4   TYR A OH  1 
ATOM   148  N  N   . PHE A 1 20  ? -14.431 49.853 -25.144 1.00 27.83 ? -3   PHE A N   1 
ATOM   149  C  CA  . PHE A 1 20  ? -15.835 49.936 -25.529 1.00 28.56 ? -3   PHE A CA  1 
ATOM   150  C  C   . PHE A 1 20  ? -16.723 48.923 -24.785 1.00 29.31 ? -3   PHE A C   1 
ATOM   151  O  O   . PHE A 1 20  ? -17.673 49.307 -24.086 1.00 29.53 ? -3   PHE A O   1 
ATOM   152  C  CB  . PHE A 1 20  ? -15.921 49.800 -27.056 1.00 28.93 ? -3   PHE A CB  1 
ATOM   153  C  CG  . PHE A 1 20  ? -17.324 49.804 -27.624 1.00 28.96 ? -3   PHE A CG  1 
ATOM   154  C  CD1 . PHE A 1 20  ? -17.641 48.960 -28.686 1.00 30.62 ? -3   PHE A CD1 1 
ATOM   155  C  CD2 . PHE A 1 20  ? -18.307 50.632 -27.126 1.00 28.99 ? -3   PHE A CD2 1 
ATOM   156  C  CE1 . PHE A 1 20  ? -18.920 48.947 -29.231 1.00 30.66 ? -3   PHE A CE1 1 
ATOM   157  C  CE2 . PHE A 1 20  ? -19.586 50.632 -27.670 1.00 30.48 ? -3   PHE A CE2 1 
ATOM   158  C  CZ  . PHE A 1 20  ? -19.889 49.792 -28.731 1.00 30.17 ? -3   PHE A CZ  1 
ATOM   159  N  N   . GLN A 1 21  ? -16.426 47.636 -24.936 1.00 30.23 ? -2   GLN A N   1 
ATOM   160  C  CA  . GLN A 1 21  ? -17.335 46.583 -24.453 1.00 30.64 ? -2   GLN A CA  1 
ATOM   161  C  C   . GLN A 1 21  ? -16.597 45.375 -23.884 1.00 30.33 ? -2   GLN A C   1 
ATOM   162  O  O   . GLN A 1 21  ? -16.642 44.289 -24.453 1.00 31.74 ? -2   GLN A O   1 
ATOM   163  C  CB  . GLN A 1 21  ? -18.292 46.145 -25.572 1.00 30.62 ? -2   GLN A CB  1 
ATOM   164  N  N   . SER A 1 22  ? -15.946 45.572 -22.748 1.00 30.23 ? -1   SER A N   1 
ATOM   165  C  CA  . SER A 1 22  ? -15.270 44.495 -22.006 1.00 30.02 ? -1   SER A CA  1 
ATOM   166  C  C   . SER A 1 22  ? -15.908 44.234 -20.623 1.00 30.86 ? -1   SER A C   1 
ATOM   167  O  O   . SER A 1 22  ? -15.320 43.591 -19.739 1.00 30.58 ? -1   SER A O   1 
ATOM   168  C  CB  . SER A 1 22  ? -13.793 44.848 -21.847 1.00 29.84 ? -1   SER A CB  1 
ATOM   169  O  OG  . SER A 1 22  ? -13.655 46.120 -21.268 1.00 27.97 ? -1   SER A OG  1 
ATOM   170  N  N   . MET A 1 23  ? -17.125 44.724 -20.446 1.00 31.42 ? 0    MET A N   1 
ATOM   171  C  CA  . MET A 1 23  ? -17.784 44.653 -19.162 1.00 32.80 ? 0    MET A CA  1 
ATOM   172  C  C   . MET A 1 23  ? -19.299 44.601 -19.341 1.00 30.83 ? 0    MET A C   1 
ATOM   173  O  O   . MET A 1 23  ? -19.842 45.182 -20.271 1.00 30.41 ? 0    MET A O   1 
ATOM   174  C  CB  . MET A 1 23  ? -17.352 45.853 -18.323 1.00 32.83 ? 0    MET A CB  1 
ATOM   175  C  CG  . MET A 1 23  ? -18.424 46.432 -17.451 1.00 35.22 ? 0    MET A CG  1 
ATOM   176  S  SD  . MET A 1 23  ? -17.731 47.489 -16.187 1.00 39.52 ? 0    MET A SD  1 
ATOM   177  C  CE  . MET A 1 23  ? -19.234 48.279 -15.603 1.00 36.38 ? 0    MET A CE  1 
ATOM   178  N  N   . LYS A 1 24  ? -19.970 43.857 -18.468 1.00 29.70 ? 1019 LYS A N   1 
ATOM   179  C  CA  . LYS A 1 24  ? -21.422 43.896 -18.396 1.00 28.97 ? 1019 LYS A CA  1 
ATOM   180  C  C   . LYS A 1 24  ? -21.844 43.649 -16.946 1.00 28.02 ? 1019 LYS A C   1 
ATOM   181  O  O   . LYS A 1 24  ? -22.064 42.514 -16.514 1.00 27.88 ? 1019 LYS A O   1 
ATOM   182  C  CB  . LYS A 1 24  ? -22.030 42.901 -19.386 1.00 28.99 ? 1019 LYS A CB  1 
ATOM   183  C  CG  . LYS A 1 24  ? -23.478 43.148 -19.733 1.00 29.16 ? 1019 LYS A CG  1 
ATOM   184  C  CD  . LYS A 1 24  ? -24.002 42.019 -20.605 1.00 29.56 ? 1019 LYS A CD  1 
ATOM   185  C  CE  . LYS A 1 24  ? -25.476 42.162 -20.932 1.00 30.41 ? 1019 LYS A CE  1 
ATOM   186  N  NZ  . LYS A 1 24  ? -25.845 41.318 -22.125 1.00 31.88 ? 1019 LYS A NZ  1 
ATOM   187  N  N   . LEU A 1 25  ? -21.926 44.746 -16.206 1.00 27.26 ? 1020 LEU A N   1 
ATOM   188  C  CA  . LEU A 1 25  ? -22.142 44.741 -14.764 1.00 26.89 ? 1020 LEU A CA  1 
ATOM   189  C  C   . LEU A 1 25  ? -23.632 44.701 -14.366 1.00 26.19 ? 1020 LEU A C   1 
ATOM   190  O  O   . LEU A 1 25  ? -24.429 45.521 -14.830 1.00 24.90 ? 1020 LEU A O   1 
ATOM   191  C  CB  . LEU A 1 25  ? -21.473 45.982 -14.172 1.00 27.08 ? 1020 LEU A CB  1 
ATOM   192  C  CG  . LEU A 1 25  ? -21.202 46.059 -12.664 1.00 28.27 ? 1020 LEU A CG  1 
ATOM   193  C  CD1 . LEU A 1 25  ? -22.482 46.221 -11.870 1.00 27.42 ? 1020 LEU A CD1 1 
ATOM   194  C  CD2 . LEU A 1 25  ? -20.415 44.839 -12.228 1.00 28.74 ? 1020 LEU A CD2 1 
ATOM   195  N  N   . ILE A 1 26  ? -23.985 43.737 -13.498 1.00 25.27 ? 1021 ILE A N   1 
ATOM   196  C  CA  . ILE A 1 26  ? -25.369 43.515 -13.075 1.00 24.35 ? 1021 ILE A CA  1 
ATOM   197  C  C   . ILE A 1 26  ? -25.413 43.531 -11.545 1.00 24.47 ? 1021 ILE A C   1 
ATOM   198  O  O   . ILE A 1 26  ? -24.690 42.767 -10.902 1.00 24.70 ? 1021 ILE A O   1 
ATOM   199  C  CB  . ILE A 1 26  ? -25.939 42.134 -13.562 1.00 24.14 ? 1021 ILE A CB  1 
ATOM   200  C  CG1 . ILE A 1 26  ? -25.571 41.827 -15.027 1.00 22.91 ? 1021 ILE A CG1 1 
ATOM   201  C  CG2 . ILE A 1 26  ? -27.462 42.086 -13.366 1.00 22.92 ? 1021 ILE A CG2 1 
ATOM   202  C  CD1 . ILE A 1 26  ? -26.378 42.598 -16.075 1.00 20.94 ? 1021 ILE A CD1 1 
ATOM   203  N  N   . ARG A 1 27  ? -26.247 44.390 -10.962 1.00 23.98 ? 1022 ARG A N   1 
ATOM   204  C  CA  . ARG A 1 27  ? -26.444 44.379 -9.516  1.00 23.80 ? 1022 ARG A CA  1 
ATOM   205  C  C   . ARG A 1 27  ? -27.230 43.109 -9.126  1.00 23.92 ? 1022 ARG A C   1 
ATOM   206  O  O   . ARG A 1 27  ? -28.118 42.663 -9.875  1.00 23.18 ? 1022 ARG A O   1 
ATOM   207  C  CB  . ARG A 1 27  ? -27.161 45.655 -9.057  1.00 23.83 ? 1022 ARG A CB  1 
ATOM   208  C  CG  . ARG A 1 27  ? -26.346 46.957 -9.272  1.00 23.80 ? 1022 ARG A CG  1 
ATOM   209  C  CD  . ARG A 1 27  ? -26.703 48.044 -8.265  1.00 24.67 ? 1022 ARG A CD  1 
ATOM   210  N  N   . VAL A 1 28  ? -26.897 42.524 -7.968  1.00 24.12 ? 1023 VAL A N   1 
ATOM   211  C  CA  . VAL A 1 28  ? -27.527 41.256 -7.541  1.00 24.07 ? 1023 VAL A CA  1 
ATOM   212  C  C   . VAL A 1 28  ? -29.042 41.383 -7.408  1.00 24.08 ? 1023 VAL A C   1 
ATOM   213  O  O   . VAL A 1 28  ? -29.771 40.441 -7.725  1.00 24.34 ? 1023 VAL A O   1 
ATOM   214  C  CB  . VAL A 1 28  ? -26.900 40.639 -6.222  1.00 24.49 ? 1023 VAL A CB  1 
ATOM   215  C  CG1 . VAL A 1 28  ? -25.345 40.649 -6.275  1.00 23.69 ? 1023 VAL A CG1 1 
ATOM   216  C  CG2 . VAL A 1 28  ? -27.449 41.287 -4.972  1.00 23.42 ? 1023 VAL A CG2 1 
ATOM   217  N  N   . GLU A 1 29  ? -29.487 42.555 -6.939  1.00 23.95 ? 1024 GLU A N   1 
ATOM   218  C  CA  . GLU A 1 29  ? -30.916 42.950 -6.877  1.00 23.76 ? 1024 GLU A CA  1 
ATOM   219  C  C   . GLU A 1 29  ? -31.667 42.853 -8.230  1.00 23.31 ? 1024 GLU A C   1 
ATOM   220  O  O   . GLU A 1 29  ? -32.875 42.637 -8.255  1.00 23.72 ? 1024 GLU A O   1 
ATOM   221  C  CB  . GLU A 1 29  ? -31.091 44.374 -6.258  1.00 23.87 ? 1024 GLU A CB  1 
ATOM   222  C  CG  A GLU A 1 29  ? -29.978 45.354 -6.683  0.50 23.94 ? 1024 GLU A CG  1 
ATOM   223  C  CG  B GLU A 1 29  ? -30.082 45.454 -6.685  0.50 24.26 ? 1024 GLU A CG  1 
ATOM   224  C  CD  A GLU A 1 29  ? -30.392 46.800 -6.744  0.50 23.93 ? 1024 GLU A CD  1 
ATOM   225  C  CD  B GLU A 1 29  ? -28.855 45.547 -5.772  0.50 25.56 ? 1024 GLU A CD  1 
ATOM   226  O  OE1 A GLU A 1 29  ? -29.627 47.657 -6.252  0.50 23.49 ? 1024 GLU A OE1 1 
ATOM   227  O  OE1 B GLU A 1 29  ? -28.475 46.681 -5.404  0.50 27.51 ? 1024 GLU A OE1 1 
ATOM   228  O  OE2 A GLU A 1 29  ? -31.467 47.091 -7.301  0.50 26.21 ? 1024 GLU A OE2 1 
ATOM   229  O  OE2 B GLU A 1 29  ? -28.270 44.499 -5.426  0.50 23.84 ? 1024 GLU A OE2 1 
ATOM   230  N  N   . ASN A 1 30  ? -30.953 42.999 -9.338  1.00 22.98 ? 1025 ASN A N   1 
ATOM   231  C  CA  . ASN A 1 30  ? -31.521 42.829 -10.680 1.00 22.77 ? 1025 ASN A CA  1 
ATOM   232  C  C   . ASN A 1 30  ? -31.143 41.507 -11.374 1.00 22.70 ? 1025 ASN A C   1 
ATOM   233  O  O   . ASN A 1 30  ? -31.548 41.274 -12.504 1.00 22.54 ? 1025 ASN A O   1 
ATOM   234  C  CB  . ASN A 1 30  ? -31.073 43.993 -11.582 1.00 22.81 ? 1025 ASN A CB  1 
ATOM   235  C  CG  . ASN A 1 30  ? -31.554 45.357 -11.079 1.00 22.23 ? 1025 ASN A CG  1 
ATOM   236  O  OD1 . ASN A 1 30  ? -32.647 45.481 -10.518 1.00 22.91 ? 1025 ASN A OD1 1 
ATOM   237  N  ND2 . ASN A 1 30  ? -30.736 46.384 -11.290 1.00 19.87 ? 1025 ASN A ND2 1 
ATOM   238  N  N   . PHE A 1 31  ? -30.387 40.636 -10.707 1.00 22.97 ? 1026 PHE A N   1 
ATOM   239  C  CA  . PHE A 1 31  ? -29.829 39.461 -11.374 1.00 23.19 ? 1026 PHE A CA  1 
ATOM   240  C  C   . PHE A 1 31  ? -30.821 38.353 -11.700 1.00 23.79 ? 1026 PHE A C   1 
ATOM   241  O  O   . PHE A 1 31  ? -30.664 37.697 -12.727 1.00 23.74 ? 1026 PHE A O   1 
ATOM   242  C  CB  . PHE A 1 31  ? -28.662 38.857 -10.591 1.00 22.99 ? 1026 PHE A CB  1 
ATOM   243  C  CG  . PHE A 1 31  ? -27.895 37.838 -11.379 1.00 22.71 ? 1026 PHE A CG  1 
ATOM   244  C  CD1 . PHE A 1 31  ? -26.928 38.233 -12.275 1.00 21.49 ? 1026 PHE A CD1 1 
ATOM   245  C  CD2 . PHE A 1 31  ? -28.169 36.482 -11.246 1.00 23.21 ? 1026 PHE A CD2 1 
ATOM   246  C  CE1 . PHE A 1 31  ? -26.235 37.306 -13.029 1.00 22.23 ? 1026 PHE A CE1 1 
ATOM   247  C  CE2 . PHE A 1 31  ? -27.478 35.539 -12.000 1.00 21.89 ? 1026 PHE A CE2 1 
ATOM   248  C  CZ  . PHE A 1 31  ? -26.513 35.950 -12.888 1.00 22.57 ? 1026 PHE A CZ  1 
ATOM   249  N  N   . GLU A 1 32  ? -31.792 38.095 -10.819 1.00 24.44 ? 1027 GLU A N   1 
ATOM   250  C  CA  . GLU A 1 32  ? -32.808 37.092 -11.107 1.00 25.43 ? 1027 GLU A CA  1 
ATOM   251  C  C   . GLU A 1 32  ? -33.643 37.496 -12.326 1.00 25.42 ? 1027 GLU A C   1 
ATOM   252  O  O   . GLU A 1 32  ? -33.963 36.647 -13.163 1.00 26.15 ? 1027 GLU A O   1 
ATOM   253  C  CB  . GLU A 1 32  ? -33.723 36.852 -9.903  1.00 25.49 ? 1027 GLU A CB  1 
ATOM   254  C  CG  . GLU A 1 32  ? -33.027 36.200 -8.719  1.00 26.62 ? 1027 GLU A CG  1 
ATOM   255  C  CD  . GLU A 1 32  ? -33.980 35.969 -7.566  1.00 27.66 ? 1027 GLU A CD  1 
ATOM   256  O  OE1 . GLU A 1 32  ? -34.765 34.990 -7.620  1.00 30.03 ? 1027 GLU A OE1 1 
ATOM   257  O  OE2 . GLU A 1 32  ? -33.951 36.779 -6.610  1.00 30.71 ? 1027 GLU A OE2 1 
ATOM   258  N  N   . ALA A 1 33  ? -33.996 38.775 -12.433 1.00 25.02 ? 1028 ALA A N   1 
ATOM   259  C  CA  . ALA A 1 33  ? -34.765 39.231 -13.594 1.00 25.12 ? 1028 ALA A CA  1 
ATOM   260  C  C   . ALA A 1 33  ? -33.933 39.151 -14.879 1.00 24.94 ? 1028 ALA A C   1 
ATOM   261  O  O   . ALA A 1 33  ? -34.458 38.774 -15.929 1.00 24.95 ? 1028 ALA A O   1 
ATOM   262  C  CB  . ALA A 1 33  ? -35.315 40.640 -13.375 1.00 24.97 ? 1028 ALA A CB  1 
ATOM   263  N  N   . TYR A 1 34  ? -32.643 39.493 -14.786 1.00 25.05 ? 1029 TYR A N   1 
ATOM   264  C  CA  . TYR A 1 34  ? -31.711 39.421 -15.928 1.00 24.63 ? 1029 TYR A CA  1 
ATOM   265  C  C   . TYR A 1 34  ? -31.437 37.973 -16.338 1.00 24.53 ? 1029 TYR A C   1 
ATOM   266  O  O   . TYR A 1 34  ? -31.372 37.677 -17.519 1.00 24.27 ? 1029 TYR A O   1 
ATOM   267  C  CB  . TYR A 1 34  ? -30.397 40.197 -15.643 1.00 24.84 ? 1029 TYR A CB  1 
ATOM   268  C  CG  . TYR A 1 34  ? -29.165 39.728 -16.427 1.00 24.60 ? 1029 TYR A CG  1 
ATOM   269  C  CD1 . TYR A 1 34  ? -28.398 38.677 -15.954 1.00 24.69 ? 1029 TYR A CD1 1 
ATOM   270  C  CD2 . TYR A 1 34  ? -28.766 40.342 -17.612 1.00 24.93 ? 1029 TYR A CD2 1 
ATOM   271  C  CE1 . TYR A 1 34  ? -27.296 38.214 -16.630 1.00 25.41 ? 1029 TYR A CE1 1 
ATOM   272  C  CE2 . TYR A 1 34  ? -27.622 39.890 -18.312 1.00 25.51 ? 1029 TYR A CE2 1 
ATOM   273  C  CZ  . TYR A 1 34  ? -26.899 38.810 -17.800 1.00 25.87 ? 1029 TYR A CZ  1 
ATOM   274  O  OH  . TYR A 1 34  ? -25.775 38.287 -18.414 1.00 26.16 ? 1029 TYR A OH  1 
ATOM   275  N  N   . PHE A 1 35  ? -31.283 37.075 -15.369 1.00 24.63 ? 1030 PHE A N   1 
ATOM   276  C  CA  . PHE A 1 35  ? -31.069 35.662 -15.674 1.00 24.92 ? 1030 PHE A CA  1 
ATOM   277  C  C   . PHE A 1 35  ? -32.279 35.062 -16.406 1.00 25.35 ? 1030 PHE A C   1 
ATOM   278  O  O   . PHE A 1 35  ? -32.128 34.339 -17.383 1.00 25.60 ? 1030 PHE A O   1 
ATOM   279  C  CB  . PHE A 1 35  ? -30.755 34.853 -14.404 1.00 24.74 ? 1030 PHE A CB  1 
ATOM   280  C  CG  . PHE A 1 35  ? -30.473 33.399 -14.674 1.00 24.13 ? 1030 PHE A CG  1 
ATOM   281  C  CD1 . PHE A 1 35  ? -29.174 32.928 -14.700 1.00 24.47 ? 1030 PHE A CD1 1 
ATOM   282  C  CD2 . PHE A 1 35  ? -31.509 32.508 -14.930 1.00 23.76 ? 1030 PHE A CD2 1 
ATOM   283  C  CE1 . PHE A 1 35  ? -28.901 31.592 -14.970 1.00 23.76 ? 1030 PHE A CE1 1 
ATOM   284  C  CE2 . PHE A 1 35  ? -31.244 31.178 -15.206 1.00 24.10 ? 1030 PHE A CE2 1 
ATOM   285  C  CZ  . PHE A 1 35  ? -29.931 30.723 -15.230 1.00 23.93 ? 1030 PHE A CZ  1 
ATOM   286  N  N   . LYS A 1 36  ? -33.476 35.356 -15.931 1.00 26.04 ? 1031 LYS A N   1 
ATOM   287  C  CA  . LYS A 1 36  ? -34.691 34.908 -16.611 1.00 26.76 ? 1031 LYS A CA  1 
ATOM   288  C  C   . LYS A 1 36  ? -34.707 35.313 -18.100 1.00 27.10 ? 1031 LYS A C   1 
ATOM   289  O  O   . LYS A 1 36  ? -35.024 34.498 -18.966 1.00 27.37 ? 1031 LYS A O   1 
ATOM   290  C  CB  . LYS A 1 36  ? -35.928 35.443 -15.879 1.00 26.80 ? 1031 LYS A CB  1 
ATOM   291  C  CG  . LYS A 1 36  ? -37.242 34.857 -16.344 1.00 26.83 ? 1031 LYS A CG  1 
ATOM   292  C  CD  . LYS A 1 36  ? -38.416 35.609 -15.738 1.00 27.13 ? 1031 LYS A CD  1 
ATOM   293  N  N   . LYS A 1 37  ? -34.361 36.564 -18.387 1.00 27.58 ? 1032 LYS A N   1 
ATOM   294  C  CA  . LYS A 1 37  ? -34.312 37.075 -19.774 1.00 28.15 ? 1032 LYS A CA  1 
ATOM   295  C  C   . LYS A 1 37  ? -33.248 36.356 -20.624 1.00 27.32 ? 1032 LYS A C   1 
ATOM   296  O  O   . LYS A 1 37  ? -33.478 35.987 -21.780 1.00 26.78 ? 1032 LYS A O   1 
ATOM   297  C  CB  . LYS A 1 37  ? -34.024 38.586 -19.756 1.00 28.39 ? 1032 LYS A CB  1 
ATOM   298  C  CG  . LYS A 1 37  ? -34.253 39.336 -21.087 1.00 29.68 ? 1032 LYS A CG  1 
ATOM   299  C  CD  . LYS A 1 37  ? -33.369 40.610 -21.187 1.00 29.71 ? 1032 LYS A CD  1 
ATOM   300  N  N   . GLN A 1 38  ? -32.087 36.143 -20.027 1.00 27.08 ? 1033 GLN A N   1 
ATOM   301  C  CA  . GLN A 1 38  ? -30.939 35.584 -20.736 1.00 26.89 ? 1033 GLN A CA  1 
ATOM   302  C  C   . GLN A 1 38  ? -30.978 34.063 -20.945 1.00 27.26 ? 1033 GLN A C   1 
ATOM   303  O  O   . GLN A 1 38  ? -30.324 33.560 -21.872 1.00 27.19 ? 1033 GLN A O   1 
ATOM   304  C  CB  . GLN A 1 38  ? -29.654 35.992 -20.018 1.00 26.56 ? 1033 GLN A CB  1 
ATOM   305  C  CG  . GLN A 1 38  ? -29.399 37.485 -20.049 1.00 25.80 ? 1033 GLN A CG  1 
ATOM   306  C  CD  . GLN A 1 38  ? -29.184 38.025 -21.455 1.00 25.54 ? 1033 GLN A CD  1 
ATOM   307  O  OE1 . GLN A 1 38  ? -30.131 38.365 -22.159 1.00 23.94 ? 1033 GLN A OE1 1 
ATOM   308  N  NE2 . GLN A 1 38  ? -27.937 38.113 -21.861 1.00 24.19 ? 1033 GLN A NE2 1 
ATOM   309  N  N   . GLN A 1 39  ? -31.732 33.339 -20.105 1.00 27.54 ? 1034 GLN A N   1 
ATOM   310  C  CA  . GLN A 1 39  ? -31.872 31.885 -20.244 1.00 27.69 ? 1034 GLN A CA  1 
ATOM   311  C  C   . GLN A 1 39  ? -33.002 31.436 -21.191 1.00 27.62 ? 1034 GLN A C   1 
ATOM   312  O  O   . GLN A 1 39  ? -33.036 30.275 -21.601 1.00 26.79 ? 1034 GLN A O   1 
ATOM   313  C  CB  . GLN A 1 39  ? -32.032 31.218 -18.877 1.00 27.78 ? 1034 GLN A CB  1 
ATOM   314  C  CG  . GLN A 1 39  ? -33.429 31.228 -18.301 1.00 29.39 ? 1034 GLN A CG  1 
ATOM   315  C  CD  . GLN A 1 39  ? -33.926 29.841 -17.948 1.00 31.03 ? 1034 GLN A CD  1 
ATOM   316  O  OE1 . GLN A 1 39  ? -33.187 29.011 -17.389 1.00 32.22 ? 1034 GLN A OE1 1 
ATOM   317  N  NE2 . GLN A 1 39  ? -35.187 29.579 -18.270 1.00 30.45 ? 1034 GLN A NE2 1 
ATOM   318  N  N   . ALA A 1 40  ? -33.913 32.351 -21.526 1.00 28.00 ? 1035 ALA A N   1 
ATOM   319  C  CA  . ALA A 1 40  ? -35.017 32.073 -22.441 1.00 28.51 ? 1035 ALA A CA  1 
ATOM   320  C  C   . ALA A 1 40  ? -34.556 31.572 -23.822 1.00 29.15 ? 1035 ALA A C   1 
ATOM   321  O  O   . ALA A 1 40  ? -33.488 31.965 -24.317 1.00 29.44 ? 1035 ALA A O   1 
ATOM   322  C  CB  . ALA A 1 40  ? -35.894 33.325 -22.599 1.00 28.59 ? 1035 ALA A CB  1 
ATOM   323  N  N   . ASP A 1 41  ? -35.382 30.715 -24.427 1.00 29.80 ? 1036 ASP A N   1 
ATOM   324  C  CA  . ASP A 1 41  ? -35.158 30.144 -25.767 1.00 30.42 ? 1036 ASP A CA  1 
ATOM   325  C  C   . ASP A 1 41  ? -33.814 29.444 -25.881 1.00 30.50 ? 1036 ASP A C   1 
ATOM   326  O  O   . ASP A 1 41  ? -32.985 29.803 -26.724 1.00 30.19 ? 1036 ASP A O   1 
ATOM   327  C  CB  . ASP A 1 41  ? -35.267 31.200 -26.875 1.00 30.68 ? 1036 ASP A CB  1 
ATOM   328  C  CG  . ASP A 1 41  ? -36.637 31.836 -26.965 1.00 32.23 ? 1036 ASP A CG  1 
ATOM   329  O  OD1 . ASP A 1 41  ? -37.649 31.267 -26.471 1.00 33.41 ? 1036 ASP A OD1 1 
ATOM   330  O  OD2 . ASP A 1 41  ? -36.689 32.931 -27.559 1.00 34.30 ? 1036 ASP A OD2 1 
ATOM   331  N  N   . SER A 1 42  ? -33.611 28.429 -25.048 1.00 30.74 ? 1037 SER A N   1 
ATOM   332  C  CA  . SER A 1 42  ? -32.348 27.692 -25.039 1.00 30.83 ? 1037 SER A CA  1 
ATOM   333  C  C   . SER A 1 42  ? -31.149 28.639 -24.893 1.00 30.62 ? 1037 SER A C   1 
ATOM   334  O  O   . SER A 1 42  ? -30.245 28.617 -25.726 1.00 31.17 ? 1037 SER A O   1 
ATOM   335  C  CB  . SER A 1 42  ? -32.216 26.859 -26.321 1.00 31.01 ? 1037 SER A CB  1 
ATOM   336  N  N   . ASN A 1 43  ? -31.178 29.477 -23.848 1.00 30.24 ? 1038 ASN A N   1 
ATOM   337  C  CA  . ASN A 1 43  ? -30.070 30.383 -23.452 1.00 29.97 ? 1038 ASN A CA  1 
ATOM   338  C  C   . ASN A 1 43  ? -29.554 31.271 -24.555 1.00 30.08 ? 1038 ASN A C   1 
ATOM   339  O  O   . ASN A 1 43  ? -28.338 31.418 -24.715 1.00 29.85 ? 1038 ASN A O   1 
ATOM   340  C  CB  . ASN A 1 43  ? -28.876 29.612 -22.872 1.00 29.65 ? 1038 ASN A CB  1 
ATOM   341  C  CG  . ASN A 1 43  ? -29.277 28.619 -21.828 1.00 28.56 ? 1038 ASN A CG  1 
ATOM   342  O  OD1 . ASN A 1 43  ? -29.979 28.948 -20.880 1.00 29.53 ? 1038 ASN A OD1 1 
ATOM   343  N  ND2 . ASN A 1 43  ? -28.834 27.391 -21.993 1.00 25.49 ? 1038 ASN A ND2 1 
ATOM   344  N  N   . CYS A 1 44  ? -30.484 31.870 -25.298 1.00 30.33 ? 1039 CYS A N   1 
ATOM   345  C  CA  . CYS A 1 44  ? -30.149 32.729 -26.431 1.00 29.95 ? 1039 CYS A CA  1 
ATOM   346  C  C   . CYS A 1 44  ? -29.304 33.930 -26.007 1.00 29.15 ? 1039 CYS A C   1 
ATOM   347  O  O   . CYS A 1 44  ? -28.268 34.218 -26.624 1.00 29.31 ? 1039 CYS A O   1 
ATOM   348  C  CB  . CYS A 1 44  ? -31.440 33.177 -27.140 1.00 30.43 ? 1039 CYS A CB  1 
ATOM   349  S  SG  . CYS A 1 44  ? -31.229 33.940 -28.787 1.00 31.76 ? 1039 CYS A SG  1 
ATOM   350  N  N   . GLY A 1 45  ? -29.731 34.610 -24.944 1.00 28.45 ? 1040 GLY A N   1 
ATOM   351  C  CA  . GLY A 1 45  ? -29.044 35.805 -24.440 1.00 28.06 ? 1040 GLY A CA  1 
ATOM   352  C  C   . GLY A 1 45  ? -27.625 35.533 -23.945 1.00 27.66 ? 1040 GLY A C   1 
ATOM   353  O  O   . GLY A 1 45  ? -26.698 36.296 -24.232 1.00 27.52 ? 1040 GLY A O   1 
ATOM   354  N  N   . PHE A 1 46  ? -27.460 34.443 -23.202 1.00 27.19 ? 1041 PHE A N   1 
ATOM   355  C  CA  . PHE A 1 46  ? -26.146 34.025 -22.725 1.00 26.93 ? 1041 PHE A CA  1 
ATOM   356  C  C   . PHE A 1 46  ? -25.238 33.579 -23.887 1.00 27.42 ? 1041 PHE A C   1 
ATOM   357  O  O   . PHE A 1 46  ? -24.009 33.766 -23.840 1.00 27.08 ? 1041 PHE A O   1 
ATOM   358  C  CB  . PHE A 1 46  ? -26.285 32.877 -21.725 1.00 26.10 ? 1041 PHE A CB  1 
ATOM   359  C  CG  . PHE A 1 46  ? -26.823 33.289 -20.379 1.00 26.24 ? 1041 PHE A CG  1 
ATOM   360  C  CD1 . PHE A 1 46  ? -26.328 34.425 -19.719 1.00 24.59 ? 1041 PHE A CD1 1 
ATOM   361  C  CD2 . PHE A 1 46  ? -27.798 32.511 -19.736 1.00 24.06 ? 1041 PHE A CD2 1 
ATOM   362  C  CE1 . PHE A 1 46  ? -26.824 34.787 -18.475 1.00 23.85 ? 1041 PHE A CE1 1 
ATOM   363  C  CE2 . PHE A 1 46  ? -28.283 32.870 -18.492 1.00 23.37 ? 1041 PHE A CE2 1 
ATOM   364  C  CZ  . PHE A 1 46  ? -27.796 34.007 -17.859 1.00 24.40 ? 1041 PHE A CZ  1 
ATOM   365  N  N   . ALA A 1 47  ? -25.855 32.979 -24.909 1.00 27.56 ? 1042 ALA A N   1 
ATOM   366  C  CA  . ALA A 1 47  ? -25.155 32.499 -26.103 1.00 27.68 ? 1042 ALA A CA  1 
ATOM   367  C  C   . ALA A 1 47  ? -24.561 33.652 -26.918 1.00 28.12 ? 1042 ALA A C   1 
ATOM   368  O  O   . ALA A 1 47  ? -23.559 33.483 -27.607 1.00 28.19 ? 1042 ALA A O   1 
ATOM   369  C  CB  . ALA A 1 47  ? -26.103 31.684 -26.965 1.00 27.36 ? 1042 ALA A CB  1 
ATOM   370  N  N   . GLU A 1 48  ? -25.206 34.814 -26.834 1.00 28.70 ? 1043 GLU A N   1 
ATOM   371  C  CA  . GLU A 1 48  ? -24.804 36.012 -27.550 1.00 28.95 ? 1043 GLU A CA  1 
ATOM   372  C  C   . GLU A 1 48  ? -23.652 36.664 -26.794 1.00 29.10 ? 1043 GLU A C   1 
ATOM   373  O  O   . GLU A 1 48  ? -22.651 37.083 -27.391 1.00 29.33 ? 1043 GLU A O   1 
ATOM   374  C  CB  . GLU A 1 48  ? -26.022 36.948 -27.714 1.00 29.22 ? 1043 GLU A CB  1 
ATOM   375  C  CG  . GLU A 1 48  ? -25.719 38.385 -28.133 1.00 30.64 ? 1043 GLU A CG  1 
ATOM   376  N  N   . GLU A 1 49  ? -23.771 36.727 -25.470 1.00 28.98 ? 1044 GLU A N   1 
ATOM   377  C  CA  . GLU A 1 49  ? -22.645 37.140 -24.635 1.00 28.42 ? 1044 GLU A CA  1 
ATOM   378  C  C   . GLU A 1 49  ? -21.414 36.265 -24.894 1.00 28.29 ? 1044 GLU A C   1 
ATOM   379  O  O   . GLU A 1 49  ? -20.293 36.771 -25.015 1.00 28.69 ? 1044 GLU A O   1 
ATOM   380  C  CB  . GLU A 1 49  ? -23.017 37.063 -23.161 1.00 28.56 ? 1044 GLU A CB  1 
ATOM   381  C  CG  . GLU A 1 49  ? -24.039 38.099 -22.711 1.00 28.47 ? 1044 GLU A CG  1 
ATOM   382  C  CD  . GLU A 1 49  ? -24.395 37.961 -21.243 1.00 28.40 ? 1044 GLU A CD  1 
ATOM   383  O  OE1 . GLU A 1 49  ? -25.457 38.486 -20.856 1.00 26.68 ? 1044 GLU A OE1 1 
ATOM   384  O  OE2 . GLU A 1 49  ? -23.621 37.331 -20.482 1.00 26.62 ? 1044 GLU A OE2 1 
ATOM   385  N  N   . TYR A 1 50  ? -21.615 34.955 -24.963 1.00 27.56 ? 1045 TYR A N   1 
ATOM   386  C  CA  . TYR A 1 50  ? -20.493 34.034 -25.111 1.00 27.17 ? 1045 TYR A CA  1 
ATOM   387  C  C   . TYR A 1 50  ? -19.845 34.140 -26.503 1.00 27.61 ? 1045 TYR A C   1 
ATOM   388  O  O   . TYR A 1 50  ? -18.625 34.041 -26.643 1.00 26.89 ? 1045 TYR A O   1 
ATOM   389  C  CB  . TYR A 1 50  ? -20.932 32.594 -24.819 1.00 26.69 ? 1045 TYR A CB  1 
ATOM   390  C  CG  . TYR A 1 50  ? -19.766 31.649 -24.709 1.00 26.64 ? 1045 TYR A CG  1 
ATOM   391  C  CD1 . TYR A 1 50  ? -18.999 31.599 -23.546 1.00 25.54 ? 1045 TYR A CD1 1 
ATOM   392  C  CD2 . TYR A 1 50  ? -19.393 30.834 -25.780 1.00 26.28 ? 1045 TYR A CD2 1 
ATOM   393  C  CE1 . TYR A 1 50  ? -17.907 30.772 -23.446 1.00 25.09 ? 1045 TYR A CE1 1 
ATOM   394  C  CE2 . TYR A 1 50  ? -18.282 29.977 -25.675 1.00 26.07 ? 1045 TYR A CE2 1 
ATOM   395  C  CZ  . TYR A 1 50  ? -17.561 29.964 -24.504 1.00 25.50 ? 1045 TYR A CZ  1 
ATOM   396  O  OH  . TYR A 1 50  ? -16.488 29.145 -24.376 1.00 26.59 ? 1045 TYR A OH  1 
ATOM   397  N  N   . GLU A 1 51  ? -20.660 34.341 -27.536 1.00 28.17 ? 1046 GLU A N   1 
ATOM   398  C  CA  . GLU A 1 51  ? -20.129 34.461 -28.885 1.00 28.43 ? 1046 GLU A CA  1 
ATOM   399  C  C   . GLU A 1 51  ? -19.392 35.782 -29.094 1.00 28.30 ? 1046 GLU A C   1 
ATOM   400  O  O   . GLU A 1 51  ? -18.456 35.844 -29.891 1.00 28.49 ? 1046 GLU A O   1 
ATOM   401  C  CB  . GLU A 1 51  ? -21.217 34.235 -29.939 1.00 28.88 ? 1046 GLU A CB  1 
ATOM   402  C  CG  . GLU A 1 51  ? -21.261 32.776 -30.432 1.00 29.68 ? 1046 GLU A CG  1 
ATOM   403  N  N   . ASP A 1 52  ? -19.794 36.816 -28.356 1.00 28.21 ? 1047 ASP A N   1 
ATOM   404  C  CA  . ASP A 1 52  ? -19.090 38.099 -28.335 1.00 28.20 ? 1047 ASP A CA  1 
ATOM   405  C  C   . ASP A 1 52  ? -17.730 38.020 -27.661 1.00 27.49 ? 1047 ASP A C   1 
ATOM   406  O  O   . ASP A 1 52  ? -16.894 38.896 -27.874 1.00 28.19 ? 1047 ASP A O   1 
ATOM   407  C  CB  . ASP A 1 52  ? -19.899 39.175 -27.602 1.00 28.73 ? 1047 ASP A CB  1 
ATOM   408  C  CG  . ASP A 1 52  ? -21.049 39.716 -28.419 1.00 30.78 ? 1047 ASP A CG  1 
ATOM   409  O  OD1 . ASP A 1 52  ? -21.042 39.590 -29.666 1.00 32.80 ? 1047 ASP A OD1 1 
ATOM   410  O  OD2 . ASP A 1 52  ? -21.966 40.283 -27.789 1.00 32.49 ? 1047 ASP A OD2 1 
ATOM   411  N  N   . LEU A 1 53  ? -17.520 36.997 -26.841 1.00 26.41 ? 1048 LEU A N   1 
ATOM   412  C  CA  . LEU A 1 53  ? -16.238 36.773 -26.176 1.00 26.07 ? 1048 LEU A CA  1 
ATOM   413  C  C   . LEU A 1 53  ? -15.226 35.976 -27.028 1.00 26.36 ? 1048 LEU A C   1 
ATOM   414  O  O   . LEU A 1 53  ? -14.042 35.921 -26.684 1.00 25.07 ? 1048 LEU A O   1 
ATOM   415  C  CB  . LEU A 1 53  ? -16.452 36.041 -24.846 1.00 25.87 ? 1048 LEU A CB  1 
ATOM   416  C  CG  . LEU A 1 53  ? -17.031 36.845 -23.666 1.00 25.43 ? 1048 LEU A CG  1 
ATOM   417  C  CD1 . LEU A 1 53  ? -17.557 35.915 -22.575 1.00 21.94 ? 1048 LEU A CD1 1 
ATOM   418  C  CD2 . LEU A 1 53  ? -15.974 37.805 -23.125 1.00 23.02 ? 1048 LEU A CD2 1 
ATOM   419  N  N   . LYS A 1 54  ? -15.678 35.397 -28.143 1.00 27.01 ? 1049 LYS A N   1 
ATOM   420  C  CA  . LYS A 1 54  ? -14.900 34.354 -28.826 1.00 28.12 ? 1049 LYS A CA  1 
ATOM   421  C  C   . LYS A 1 54  ? -13.558 34.801 -29.398 1.00 28.01 ? 1049 LYS A C   1 
ATOM   422  O  O   . LYS A 1 54  ? -12.619 34.005 -29.424 1.00 28.30 ? 1049 LYS A O   1 
ATOM   423  C  CB  . LYS A 1 54  ? -15.733 33.649 -29.911 1.00 28.25 ? 1049 LYS A CB  1 
ATOM   424  C  CG  . LYS A 1 54  ? -16.007 34.509 -31.113 1.00 30.39 ? 1049 LYS A CG  1 
ATOM   425  N  N   . LEU A 1 55  ? -13.455 36.057 -29.841 1.00 28.25 ? 1050 LEU A N   1 
ATOM   426  C  CA  . LEU A 1 55  ? -12.203 36.542 -30.458 1.00 28.40 ? 1050 LEU A CA  1 
ATOM   427  C  C   . LEU A 1 55  ? -11.352 37.383 -29.528 1.00 27.70 ? 1050 LEU A C   1 
ATOM   428  O  O   . LEU A 1 55  ? -10.368 37.980 -29.968 1.00 27.98 ? 1050 LEU A O   1 
ATOM   429  C  CB  . LEU A 1 55  ? -12.488 37.353 -31.738 1.00 28.35 ? 1050 LEU A CB  1 
ATOM   430  C  CG  . LEU A 1 55  ? -13.196 36.595 -32.853 1.00 28.40 ? 1050 LEU A CG  1 
ATOM   431  C  CD1 . LEU A 1 55  ? -13.480 37.527 -33.974 1.00 28.16 ? 1050 LEU A CD1 1 
ATOM   432  C  CD2 . LEU A 1 55  ? -12.355 35.405 -33.308 1.00 30.71 ? 1050 LEU A CD2 1 
ATOM   433  N  N   . VAL A 1 56  ? -11.752 37.462 -28.264 1.00 27.25 ? 1051 VAL A N   1 
ATOM   434  C  CA  . VAL A 1 56  ? -11.092 38.332 -27.307 1.00 26.56 ? 1051 VAL A CA  1 
ATOM   435  C  C   . VAL A 1 56  ? -9.761  37.722 -26.894 1.00 26.40 ? 1051 VAL A C   1 
ATOM   436  O  O   . VAL A 1 56  ? -9.683  36.577 -26.441 1.00 26.82 ? 1051 VAL A O   1 
ATOM   437  C  CB  . VAL A 1 56  ? -11.953 38.586 -26.037 1.00 26.57 ? 1051 VAL A CB  1 
ATOM   438  C  CG1 . VAL A 1 56  ? -11.163 39.357 -25.017 1.00 25.03 ? 1051 VAL A CG1 1 
ATOM   439  C  CG2 . VAL A 1 56  ? -13.246 39.306 -26.367 1.00 25.57 ? 1051 VAL A CG2 1 
ATOM   440  N  N   . GLY A 1 57  ? -8.713  38.503 -27.086 1.00 26.14 ? 1052 GLY A N   1 
ATOM   441  C  CA  . GLY A 1 57  ? -7.399  38.153 -26.652 1.00 25.73 ? 1052 GLY A CA  1 
ATOM   442  C  C   . GLY A 1 57  ? -6.569  37.441 -27.685 1.00 25.56 ? 1052 GLY A C   1 
ATOM   443  O  O   . GLY A 1 57  ? -5.354  37.331 -27.511 1.00 24.83 ? 1052 GLY A O   1 
ATOM   444  N  N   . ILE A 1 58  ? -7.206  36.960 -28.755 1.00 25.67 ? 1053 ILE A N   1 
ATOM   445  C  CA  . ILE A 1 58  ? -6.556  35.980 -29.628 1.00 26.42 ? 1053 ILE A CA  1 
ATOM   446  C  C   . ILE A 1 58  ? -5.640  36.600 -30.681 1.00 26.44 ? 1053 ILE A C   1 
ATOM   447  O  O   . ILE A 1 58  ? -4.954  35.877 -31.351 1.00 26.57 ? 1053 ILE A O   1 
ATOM   448  C  CB  . ILE A 1 58  ? -7.550  34.950 -30.274 1.00 27.22 ? 1053 ILE A CB  1 
ATOM   449  C  CG1 . ILE A 1 58  ? -8.165  35.468 -31.580 1.00 27.07 ? 1053 ILE A CG1 1 
ATOM   450  C  CG2 . ILE A 1 58  ? -8.638  34.487 -29.261 1.00 26.66 ? 1053 ILE A CG2 1 
ATOM   451  C  CD1 . ILE A 1 58  ? -9.199  34.487 -32.168 1.00 26.39 ? 1053 ILE A CD1 1 
ATOM   452  N  N   . SER A 1 59  ? -5.608  37.928 -30.777 1.00 26.50 ? 1054 SER A N   1 
ATOM   453  C  CA  . SER A 1 59  ? -4.645  38.641 -31.613 1.00 26.84 ? 1054 SER A CA  1 
ATOM   454  C  C   . SER A 1 59  ? -3.272  38.898 -30.929 1.00 26.47 ? 1054 SER A C   1 
ATOM   455  O  O   . SER A 1 59  ? -2.379  39.464 -31.544 1.00 26.37 ? 1054 SER A O   1 
ATOM   456  C  CB  . SER A 1 59  ? -5.256  39.988 -32.034 1.00 27.31 ? 1054 SER A CB  1 
ATOM   457  O  OG  . SER A 1 59  ? -5.455  40.826 -30.883 1.00 27.76 ? 1054 SER A OG  1 
ATOM   458  N  N   . GLN A 1 60  ? -3.096  38.489 -29.676 1.00 26.16 ? 1055 GLN A N   1 
ATOM   459  C  CA  . GLN A 1 60  ? -1.850  38.789 -28.955 1.00 26.27 ? 1055 GLN A CA  1 
ATOM   460  C  C   . GLN A 1 60  ? -0.685  37.871 -29.351 1.00 26.77 ? 1055 GLN A C   1 
ATOM   461  O  O   . GLN A 1 60  ? -0.881  36.719 -29.709 1.00 27.61 ? 1055 GLN A O   1 
ATOM   462  C  CB  . GLN A 1 60  ? -2.070  38.693 -27.448 1.00 26.14 ? 1055 GLN A CB  1 
ATOM   463  C  CG  . GLN A 1 60  ? -3.155  39.591 -26.909 1.00 25.33 ? 1055 GLN A CG  1 
ATOM   464  C  CD  . GLN A 1 60  ? -3.424  39.341 -25.448 1.00 25.25 ? 1055 GLN A CD  1 
ATOM   465  O  OE1 . GLN A 1 60  ? -2.838  39.990 -24.578 1.00 24.32 ? 1055 GLN A OE1 1 
ATOM   466  N  NE2 . GLN A 1 60  ? -4.310  38.399 -25.165 1.00 25.37 ? 1055 GLN A NE2 1 
ATOM   467  N  N   . PRO A 1 61  ? 0.545   38.384 -29.290 1.00 27.56 ? 1056 PRO A N   1 
ATOM   468  C  CA  . PRO A 1 61  ? 1.669   37.508 -29.638 1.00 27.54 ? 1056 PRO A CA  1 
ATOM   469  C  C   . PRO A 1 61  ? 1.911   36.365 -28.633 1.00 27.98 ? 1056 PRO A C   1 
ATOM   470  O  O   . PRO A 1 61  ? 1.580   36.460 -27.444 1.00 27.40 ? 1056 PRO A O   1 
ATOM   471  C  CB  . PRO A 1 61  ? 2.868   38.472 -29.702 1.00 27.39 ? 1056 PRO A CB  1 
ATOM   472  C  CG  . PRO A 1 61  ? 2.461   39.650 -28.904 1.00 27.53 ? 1056 PRO A CG  1 
ATOM   473  C  CD  . PRO A 1 61  ? 0.977   39.746 -28.919 1.00 27.00 ? 1056 PRO A CD  1 
ATOM   474  N  N   . LYS A 1 62  ? 2.476   35.286 -29.159 1.00 28.95 ? 1057 LYS A N   1 
ATOM   475  C  CA  . LYS A 1 62  ? 2.840   34.106 -28.397 1.00 29.33 ? 1057 LYS A CA  1 
ATOM   476  C  C   . LYS A 1 62  ? 4.055   33.459 -29.024 1.00 29.22 ? 1057 LYS A C   1 
ATOM   477  O  O   . LYS A 1 62  ? 4.065   32.255 -29.210 1.00 29.61 ? 1057 LYS A O   1 
ATOM   478  C  CB  . LYS A 1 62  ? 1.675   33.118 -28.364 1.00 30.16 ? 1057 LYS A CB  1 
ATOM   479  C  CG  . LYS A 1 62  ? 1.005   32.876 -29.709 1.00 30.73 ? 1057 LYS A CG  1 
ATOM   480  C  CD  . LYS A 1 62  ? -0.280  32.142 -29.564 1.00 31.21 ? 1057 LYS A CD  1 
ATOM   481  C  CE  . LYS A 1 62  ? -0.836  31.749 -30.921 1.00 31.68 ? 1057 LYS A CE  1 
ATOM   482  N  NZ  . LYS A 1 62  ? -1.302  32.913 -31.668 1.00 31.19 ? 1057 LYS A NZ  1 
ATOM   483  N  N   . TYR A 1 63  ? 5.078   34.265 -29.312 1.00 28.87 ? 1058 TYR A N   1 
ATOM   484  C  CA  . TYR A 1 63  ? 6.314   33.801 -29.961 1.00 29.10 ? 1058 TYR A CA  1 
ATOM   485  C  C   . TYR A 1 63  ? 7.038   32.700 -29.207 1.00 28.56 ? 1058 TYR A C   1 
ATOM   486  O  O   . TYR A 1 63  ? 7.553   31.772 -29.825 1.00 28.83 ? 1058 TYR A O   1 
ATOM   487  C  CB  . TYR A 1 63  ? 7.309   34.968 -30.201 1.00 29.71 ? 1058 TYR A CB  1 
ATOM   488  C  CG  . TYR A 1 63  ? 6.789   36.032 -31.135 1.00 30.44 ? 1058 TYR A CG  1 
ATOM   489  C  CD1 . TYR A 1 63  ? 6.776   35.823 -32.512 1.00 31.72 ? 1058 TYR A CD1 1 
ATOM   490  C  CD2 . TYR A 1 63  ? 6.287   37.239 -30.646 1.00 30.52 ? 1058 TYR A CD2 1 
ATOM   491  C  CE1 . TYR A 1 63  ? 6.282   36.791 -33.380 1.00 31.33 ? 1058 TYR A CE1 1 
ATOM   492  C  CE2 . TYR A 1 63  ? 5.792   38.215 -31.498 1.00 29.71 ? 1058 TYR A CE2 1 
ATOM   493  C  CZ  . TYR A 1 63  ? 5.787   37.987 -32.865 1.00 31.86 ? 1058 TYR A CZ  1 
ATOM   494  O  OH  . TYR A 1 63  ? 5.285   38.955 -33.731 1.00 31.77 ? 1058 TYR A OH  1 
ATOM   495  N  N   . ALA A 1 64  ? 7.115   32.803 -27.882 1.00 28.28 ? 1059 ALA A N   1 
ATOM   496  C  CA  . ALA A 1 64  ? 7.837   31.794 -27.077 1.00 27.38 ? 1059 ALA A CA  1 
ATOM   497  C  C   . ALA A 1 64  ? 7.200   30.436 -27.239 1.00 26.66 ? 1059 ALA A C   1 
ATOM   498  O  O   . ALA A 1 64  ? 7.879   29.432 -27.389 1.00 26.84 ? 1059 ALA A O   1 
ATOM   499  C  CB  . ALA A 1 64  ? 7.845   32.184 -25.622 1.00 27.41 ? 1059 ALA A CB  1 
ATOM   500  N  N   . ALA A 1 65  ? 5.874   30.428 -27.235 1.00 26.05 ? 1060 ALA A N   1 
ATOM   501  C  CA  . ALA A 1 65  ? 5.086   29.212 -27.354 1.00 25.60 ? 1060 ALA A CA  1 
ATOM   502  C  C   . ALA A 1 65  ? 5.308   28.505 -28.704 1.00 25.52 ? 1060 ALA A C   1 
ATOM   503  O  O   . ALA A 1 65  ? 5.200   27.275 -28.798 1.00 24.06 ? 1060 ALA A O   1 
ATOM   504  C  CB  . ALA A 1 65  ? 3.606   29.539 -27.129 1.00 25.24 ? 1060 ALA A CB  1 
ATOM   505  N  N   . GLU A 1 66  ? 5.658   29.298 -29.727 1.00 25.83 ? 1061 GLU A N   1 
ATOM   506  C  CA  . GLU A 1 66  ? 5.862   28.821 -31.094 1.00 26.05 ? 1061 GLU A CA  1 
ATOM   507  C  C   . GLU A 1 66  ? 7.321   28.490 -31.475 1.00 25.07 ? 1061 GLU A C   1 
ATOM   508  O  O   . GLU A 1 66  ? 7.577   28.037 -32.594 1.00 23.62 ? 1061 GLU A O   1 
ATOM   509  C  CB  . GLU A 1 66  ? 5.299   29.852 -32.066 1.00 26.37 ? 1061 GLU A CB  1 
ATOM   510  C  CG  . GLU A 1 66  ? 3.795   30.108 -31.898 1.00 28.10 ? 1061 GLU A CG  1 
ATOM   511  C  CD  . GLU A 1 66  ? 3.292   31.250 -32.770 1.00 29.77 ? 1061 GLU A CD  1 
ATOM   512  O  OE1 . GLU A 1 66  ? 4.066   32.211 -33.036 1.00 37.16 ? 1061 GLU A OE1 1 
ATOM   513  O  OE2 . GLU A 1 66  ? 2.121   31.188 -33.206 1.00 35.97 ? 1061 GLU A OE2 1 
ATOM   514  N  N   . LEU A 1 67  ? 8.263   28.700 -30.547 1.00 24.44 ? 1062 LEU A N   1 
ATOM   515  C  CA  . LEU A 1 67  ? 9.651   28.288 -30.739 1.00 24.01 ? 1062 LEU A CA  1 
ATOM   516  C  C   . LEU A 1 67  ? 9.709   26.769 -30.880 1.00 24.30 ? 1062 LEU A C   1 
ATOM   517  O  O   . LEU A 1 67  ? 9.015   26.041 -30.168 1.00 24.30 ? 1062 LEU A O   1 
ATOM   518  C  CB  . LEU A 1 67  ? 10.536  28.753 -29.571 1.00 23.73 ? 1062 LEU A CB  1 
ATOM   519  C  CG  . LEU A 1 67  ? 10.810  30.263 -29.445 1.00 23.23 ? 1062 LEU A CG  1 
ATOM   520  C  CD1 . LEU A 1 67  ? 11.586  30.571 -28.159 1.00 19.22 ? 1062 LEU A CD1 1 
ATOM   521  C  CD2 . LEU A 1 67  ? 11.529  30.859 -30.695 1.00 20.91 ? 1062 LEU A CD2 1 
ATOM   522  N  N   . ALA A 1 68  ? 10.505  26.305 -31.834 1.00 24.45 ? 1063 ALA A N   1 
ATOM   523  C  CA  . ALA A 1 68  ? 10.681  24.878 -32.107 1.00 24.29 ? 1063 ALA A CA  1 
ATOM   524  C  C   . ALA A 1 68  ? 11.156  24.125 -30.868 1.00 24.45 ? 1063 ALA A C   1 
ATOM   525  O  O   . ALA A 1 68  ? 10.777  22.973 -30.658 1.00 23.61 ? 1063 ALA A O   1 
ATOM   526  C  CB  . ALA A 1 68  ? 11.688  24.680 -33.251 1.00 24.30 ? 1063 ALA A CB  1 
ATOM   527  N  N   . GLU A 1 69  ? 11.987  24.786 -30.062 1.00 24.63 ? 1064 GLU A N   1 
ATOM   528  C  CA  . GLU A 1 69  ? 12.518  24.207 -28.829 1.00 25.04 ? 1064 GLU A CA  1 
ATOM   529  C  C   . GLU A 1 69  ? 11.401  23.937 -27.809 1.00 24.86 ? 1064 GLU A C   1 
ATOM   530  O  O   . GLU A 1 69  ? 11.517  23.023 -26.998 1.00 24.69 ? 1064 GLU A O   1 
ATOM   531  C  CB  . GLU A 1 69  ? 13.576  25.129 -28.200 1.00 25.24 ? 1064 GLU A CB  1 
ATOM   532  C  CG  . GLU A 1 69  ? 14.824  25.417 -29.069 1.00 26.55 ? 1064 GLU A CG  1 
ATOM   533  C  CD  . GLU A 1 69  ? 14.677  26.632 -30.005 1.00 28.80 ? 1064 GLU A CD  1 
ATOM   534  O  OE1 . GLU A 1 69  ? 13.551  26.945 -30.448 1.00 27.01 ? 1064 GLU A OE1 1 
ATOM   535  O  OE2 . GLU A 1 69  ? 15.707  27.271 -30.318 1.00 31.57 ? 1064 GLU A OE2 1 
ATOM   536  N  N   . ASN A 1 70  ? 10.314  24.709 -27.883 1.00 24.59 ? 1065 ASN A N   1 
ATOM   537  C  CA  . ASN A 1 70  ? 9.195   24.595 -26.938 1.00 24.70 ? 1065 ASN A CA  1 
ATOM   538  C  C   . ASN A 1 70  ? 7.987   23.789 -27.425 1.00 25.65 ? 1065 ASN A C   1 
ATOM   539  O  O   . ASN A 1 70  ? 7.002   23.657 -26.697 1.00 26.16 ? 1065 ASN A O   1 
ATOM   540  C  CB  . ASN A 1 70  ? 8.746   25.986 -26.500 1.00 23.67 ? 1065 ASN A CB  1 
ATOM   541  C  CG  . ASN A 1 70  ? 9.818   26.722 -25.710 1.00 22.81 ? 1065 ASN A CG  1 
ATOM   542  O  OD1 . ASN A 1 70  ? 10.541  26.135 -24.894 1.00 22.07 ? 1065 ASN A OD1 1 
ATOM   543  N  ND2 . ASN A 1 70  ? 9.911   28.009 -25.927 1.00 20.78 ? 1065 ASN A ND2 1 
ATOM   544  N  N   . ARG A 1 71  ? 8.067   23.219 -28.623 1.00 26.47 ? 1066 ARG A N   1 
ATOM   545  C  CA  . ARG A 1 71  ? 6.937   22.468 -29.216 1.00 27.02 ? 1066 ARG A CA  1 
ATOM   546  C  C   . ARG A 1 71  ? 6.546   21.253 -28.358 1.00 26.98 ? 1066 ARG A C   1 
ATOM   547  O  O   . ARG A 1 71  ? 5.367   21.042 -28.062 1.00 27.30 ? 1066 ARG A O   1 
ATOM   548  C  CB  . ARG A 1 71  ? 7.307   22.051 -30.647 1.00 27.44 ? 1066 ARG A CB  1 
ATOM   549  C  CG  . ARG A 1 71  ? 6.264   21.251 -31.435 1.00 28.50 ? 1066 ARG A CG  1 
ATOM   550  C  CD  . ARG A 1 71  ? 6.703   21.084 -32.907 1.00 27.42 ? 1066 ARG A CD  1 
ATOM   551  N  N   . GLY A 1 72  ? 7.535   20.480 -27.919 1.00 26.76 ? 1067 GLY A N   1 
ATOM   552  C  CA  . GLY A 1 72  ? 7.280   19.312 -27.083 1.00 26.11 ? 1067 GLY A CA  1 
ATOM   553  C  C   . GLY A 1 72  ? 6.723   19.588 -25.693 1.00 25.66 ? 1067 GLY A C   1 
ATOM   554  O  O   . GLY A 1 72  ? 6.455   18.654 -24.948 1.00 25.17 ? 1067 GLY A O   1 
ATOM   555  N  N   . LYS A 1 73  ? 6.553   20.870 -25.356 1.00 25.55 ? 1068 LYS A N   1 
ATOM   556  C  CA  . LYS A 1 73  ? 6.171   21.330 -24.011 1.00 25.13 ? 1068 LYS A CA  1 
ATOM   557  C  C   . LYS A 1 73  ? 4.701   21.772 -23.910 1.00 25.53 ? 1068 LYS A C   1 
ATOM   558  O  O   . LYS A 1 73  ? 4.201   22.110 -22.830 1.00 25.52 ? 1068 LYS A O   1 
ATOM   559  C  CB  . LYS A 1 73  ? 7.101   22.487 -23.607 1.00 25.06 ? 1068 LYS A CB  1 
ATOM   560  C  CG  . LYS A 1 73  ? 8.590   22.133 -23.662 1.00 24.05 ? 1068 LYS A CG  1 
ATOM   561  C  CD  . LYS A 1 73  ? 9.457   23.273 -23.145 1.00 24.40 ? 1068 LYS A CD  1 
ATOM   562  C  CE  . LYS A 1 73  ? 10.944  22.947 -23.251 1.00 22.91 ? 1068 LYS A CE  1 
ATOM   563  N  NZ  . LYS A 1 73  ? 11.760  24.185 -23.293 1.00 23.31 ? 1068 LYS A NZ  1 
ATOM   564  N  N   . ASN A 1 74  ? 4.030   21.789 -25.055 1.00 26.21 ? 1069 ASN A N   1 
ATOM   565  C  CA  . ASN A 1 74  ? 2.612   22.086 -25.161 1.00 26.91 ? 1069 ASN A CA  1 
ATOM   566  C  C   . ASN A 1 74  ? 1.862   20.778 -25.382 1.00 27.28 ? 1069 ASN A C   1 
ATOM   567  O  O   . ASN A 1 74  ? 2.262   19.993 -26.245 1.00 27.05 ? 1069 ASN A O   1 
ATOM   568  C  CB  . ASN A 1 74  ? 2.375   23.030 -26.351 1.00 26.96 ? 1069 ASN A CB  1 
ATOM   569  C  CG  . ASN A 1 74  ? 3.189   24.302 -26.256 1.00 26.81 ? 1069 ASN A CG  1 
ATOM   570  O  OD1 . ASN A 1 74  ? 3.245   24.910 -25.205 1.00 26.91 ? 1069 ASN A OD1 1 
ATOM   571  N  ND2 . ASN A 1 74  ? 3.815   24.716 -27.364 1.00 26.17 ? 1069 ASN A ND2 1 
ATOM   572  N  N   . ARG A 1 75  ? 0.816   20.515 -24.593 1.00 27.91 ? 1070 ARG A N   1 
ATOM   573  C  CA  . ARG A 1 75  ? -0.040  19.337 -24.831 1.00 28.55 ? 1070 ARG A CA  1 
ATOM   574  C  C   . ARG A 1 75  ? -0.735  19.426 -26.204 1.00 28.73 ? 1070 ARG A C   1 
ATOM   575  O  O   . ARG A 1 75  ? -0.763  18.445 -26.957 1.00 28.31 ? 1070 ARG A O   1 
ATOM   576  C  CB  . ARG A 1 75  ? -1.091  19.138 -23.716 1.00 28.51 ? 1070 ARG A CB  1 
ATOM   577  C  CG  . ARG A 1 75  ? -1.982  17.892 -23.953 1.00 28.90 ? 1070 ARG A CG  1 
ATOM   578  C  CD  . ARG A 1 75  ? -2.833  17.476 -22.735 1.00 29.52 ? 1070 ARG A CD  1 
ATOM   579  N  NE  . ARG A 1 75  ? -2.040  16.664 -21.809 1.00 30.69 ? 1070 ARG A NE  1 
ATOM   580  C  CZ  . ARG A 1 75  ? -1.477  17.107 -20.692 1.00 29.68 ? 1070 ARG A CZ  1 
ATOM   581  N  NH1 . ARG A 1 75  ? -1.661  18.351 -20.303 1.00 31.22 ? 1070 ARG A NH1 1 
ATOM   582  N  NH2 . ARG A 1 75  ? -0.749  16.290 -19.949 1.00 29.58 ? 1070 ARG A NH2 1 
ATOM   583  N  N   . TYR A 1 76  ? -1.258  20.617 -26.528 1.00 29.39 ? 1071 TYR A N   1 
ATOM   584  C  CA  . TYR A 1 76  ? -1.965  20.872 -27.786 1.00 29.75 ? 1071 TYR A CA  1 
ATOM   585  C  C   . TYR A 1 76  ? -1.264  21.979 -28.559 1.00 30.43 ? 1071 TYR A C   1 
ATOM   586  O  O   . TYR A 1 76  ? -0.826  22.962 -27.957 1.00 31.04 ? 1071 TYR A O   1 
ATOM   587  C  CB  . TYR A 1 76  ? -3.405  21.271 -27.481 1.00 29.89 ? 1071 TYR A CB  1 
ATOM   588  C  CG  . TYR A 1 76  ? -4.119  20.278 -26.586 1.00 29.78 ? 1071 TYR A CG  1 
ATOM   589  C  CD1 . TYR A 1 76  ? -4.593  19.063 -27.095 1.00 30.03 ? 1071 TYR A CD1 1 
ATOM   590  C  CD2 . TYR A 1 76  ? -4.302  20.540 -25.234 1.00 29.65 ? 1071 TYR A CD2 1 
ATOM   591  C  CE1 . TYR A 1 76  ? -5.229  18.142 -26.276 1.00 30.26 ? 1071 TYR A CE1 1 
ATOM   592  C  CE2 . TYR A 1 76  ? -4.934  19.631 -24.411 1.00 29.23 ? 1071 TYR A CE2 1 
ATOM   593  C  CZ  . TYR A 1 76  ? -5.400  18.437 -24.935 1.00 30.54 ? 1071 TYR A CZ  1 
ATOM   594  O  OH  . TYR A 1 76  ? -6.032  17.539 -24.101 1.00 31.49 ? 1071 TYR A OH  1 
ATOM   595  N  N   . ASN A 1 77  ? -1.160  21.843 -29.884 1.00 31.17 ? 1072 ASN A N   1 
ATOM   596  C  CA  . ASN A 1 77  ? -0.457  22.851 -30.707 1.00 31.72 ? 1072 ASN A CA  1 
ATOM   597  C  C   . ASN A 1 77  ? -1.268  24.135 -30.901 1.00 31.47 ? 1072 ASN A C   1 
ATOM   598  O  O   . ASN A 1 77  ? -0.769  25.111 -31.453 1.00 31.84 ? 1072 ASN A O   1 
ATOM   599  C  CB  . ASN A 1 77  ? 0.061   22.263 -32.048 1.00 32.15 ? 1072 ASN A CB  1 
ATOM   600  C  CG  . ASN A 1 77  ? -1.046  22.053 -33.121 1.00 34.04 ? 1072 ASN A CG  1 
ATOM   601  O  OD1 . ASN A 1 77  ? -2.133  22.636 -33.065 1.00 37.29 ? 1072 ASN A OD1 1 
ATOM   602  N  ND2 . ASN A 1 77  ? -0.740  21.214 -34.115 1.00 35.45 ? 1072 ASN A ND2 1 
ATOM   603  N  N   . ASN A 1 78  ? -2.510  24.125 -30.418 1.00 31.36 ? 1073 ASN A N   1 
ATOM   604  C  CA  . ASN A 1 78  ? -3.409  25.266 -30.533 1.00 30.98 ? 1073 ASN A CA  1 
ATOM   605  C  C   . ASN A 1 78  ? -3.896  25.820 -29.186 1.00 29.85 ? 1073 ASN A C   1 
ATOM   606  O  O   . ASN A 1 78  ? -4.793  26.666 -29.145 1.00 30.37 ? 1073 ASN A O   1 
ATOM   607  C  CB  . ASN A 1 78  ? -4.591  24.933 -31.474 1.00 31.53 ? 1073 ASN A CB  1 
ATOM   608  C  CG  . ASN A 1 78  ? -5.403  23.728 -31.020 1.00 32.87 ? 1073 ASN A CG  1 
ATOM   609  O  OD1 . ASN A 1 78  ? -4.912  22.842 -30.319 1.00 35.18 ? 1073 ASN A OD1 1 
ATOM   610  N  ND2 . ASN A 1 78  ? -6.652  23.676 -31.452 1.00 35.12 ? 1073 ASN A ND2 1 
ATOM   611  N  N   . VAL A 1 79  ? -3.298  25.376 -28.087 1.00 28.42 ? 1074 VAL A N   1 
ATOM   612  C  CA  . VAL A 1 79  ? -3.495  26.044 -26.802 1.00 27.21 ? 1074 VAL A CA  1 
ATOM   613  C  C   . VAL A 1 79  ? -2.136  26.542 -26.331 1.00 26.71 ? 1074 VAL A C   1 
ATOM   614  O  O   . VAL A 1 79  ? -1.369  25.816 -25.715 1.00 26.31 ? 1074 VAL A O   1 
ATOM   615  C  CB  . VAL A 1 79  ? -4.192  25.124 -25.768 1.00 27.53 ? 1074 VAL A CB  1 
ATOM   616  C  CG1 . VAL A 1 79  ? -4.532  25.895 -24.502 1.00 25.52 ? 1074 VAL A CG1 1 
ATOM   617  C  CG2 . VAL A 1 79  ? -5.455  24.495 -26.389 1.00 26.10 ? 1074 VAL A CG2 1 
ATOM   618  N  N   . LEU A 1 80  ? -1.841  27.795 -26.662 1.00 26.28 ? 1075 LEU A N   1 
ATOM   619  C  CA  . LEU A 1 80  ? -0.518  28.379 -26.468 1.00 25.44 ? 1075 LEU A CA  1 
ATOM   620  C  C   . LEU A 1 80  ? -0.588  29.614 -25.565 1.00 25.70 ? 1075 LEU A C   1 
ATOM   621  O  O   . LEU A 1 80  ? -1.511  30.434 -25.684 1.00 26.82 ? 1075 LEU A O   1 
ATOM   622  C  CB  . LEU A 1 80  ? 0.071   28.738 -27.832 1.00 25.35 ? 1075 LEU A CB  1 
ATOM   623  C  CG  . LEU A 1 80  ? 0.225   27.606 -28.861 1.00 23.02 ? 1075 LEU A CG  1 
ATOM   624  C  CD1 . LEU A 1 80  ? 0.757   28.155 -30.183 1.00 20.18 ? 1075 LEU A CD1 1 
ATOM   625  C  CD2 . LEU A 1 80  ? 1.113   26.484 -28.340 1.00 19.30 ? 1075 LEU A CD2 1 
ATOM   626  N  N   . PRO A 1 81  ? 0.361   29.751 -24.627 1.00 25.42 ? 1076 PRO A N   1 
ATOM   627  C  CA  . PRO A 1 81  ? 0.302   30.931 -23.774 1.00 25.50 ? 1076 PRO A CA  1 
ATOM   628  C  C   . PRO A 1 81  ? 0.743   32.219 -24.473 1.00 25.56 ? 1076 PRO A C   1 
ATOM   629  O  O   . PRO A 1 81  ? 1.777   32.261 -25.167 1.00 26.22 ? 1076 PRO A O   1 
ATOM   630  C  CB  . PRO A 1 81  ? 1.272   30.579 -22.641 1.00 25.54 ? 1076 PRO A CB  1 
ATOM   631  C  CG  . PRO A 1 81  ? 2.282   29.720 -23.310 1.00 25.31 ? 1076 PRO A CG  1 
ATOM   632  C  CD  . PRO A 1 81  ? 1.480   28.875 -24.256 1.00 24.91 ? 1076 PRO A CD  1 
ATOM   633  N  N   . TYR A 1 82  ? -0.014  33.283 -24.241 1.00 25.35 ? 1077 TYR A N   1 
ATOM   634  C  CA  . TYR A 1 82  ? 0.389   34.597 -24.694 1.00 24.85 ? 1077 TYR A CA  1 
ATOM   635  C  C   . TYR A 1 82  ? 1.684   35.010 -23.980 1.00 24.45 ? 1077 TYR A C   1 
ATOM   636  O  O   . TYR A 1 82  ? 1.876   34.688 -22.834 1.00 23.76 ? 1077 TYR A O   1 
ATOM   637  C  CB  . TYR A 1 82  ? -0.729  35.613 -24.450 1.00 24.43 ? 1077 TYR A CB  1 
ATOM   638  C  CG  . TYR A 1 82  ? -2.049  35.247 -25.100 1.00 24.99 ? 1077 TYR A CG  1 
ATOM   639  C  CD1 . TYR A 1 82  ? -2.124  34.926 -26.455 1.00 23.81 ? 1077 TYR A CD1 1 
ATOM   640  C  CD2 . TYR A 1 82  ? -3.236  35.217 -24.352 1.00 23.95 ? 1077 TYR A CD2 1 
ATOM   641  C  CE1 . TYR A 1 82  ? -3.345  34.575 -27.046 1.00 22.62 ? 1077 TYR A CE1 1 
ATOM   642  C  CE2 . TYR A 1 82  ? -4.441  34.895 -24.941 1.00 22.69 ? 1077 TYR A CE2 1 
ATOM   643  C  CZ  . TYR A 1 82  ? -4.496  34.568 -26.287 1.00 22.95 ? 1077 TYR A CZ  1 
ATOM   644  O  OH  . TYR A 1 82  ? -5.713  34.222 -26.868 1.00 23.15 ? 1077 TYR A OH  1 
ATOM   645  N  N   . ASP A 1 83  ? 2.565   35.705 -24.702 1.00 24.68 ? 1078 ASP A N   1 
ATOM   646  C  CA  . ASP A 1 83  ? 3.857   36.170 -24.188 1.00 24.89 ? 1078 ASP A CA  1 
ATOM   647  C  C   . ASP A 1 83  ? 3.733   37.071 -22.954 1.00 24.81 ? 1078 ASP A C   1 
ATOM   648  O  O   . ASP A 1 83  ? 4.514   36.964 -22.004 1.00 24.67 ? 1078 ASP A O   1 
ATOM   649  C  CB  . ASP A 1 83  ? 4.596   36.972 -25.272 1.00 25.25 ? 1078 ASP A CB  1 
ATOM   650  C  CG  . ASP A 1 83  ? 5.177   36.103 -26.376 1.00 25.89 ? 1078 ASP A CG  1 
ATOM   651  O  OD1 . ASP A 1 83  ? 5.586   34.948 -26.128 1.00 27.55 ? 1078 ASP A OD1 1 
ATOM   652  O  OD2 . ASP A 1 83  ? 5.245   36.608 -27.504 1.00 26.62 ? 1078 ASP A OD2 1 
ATOM   653  N  N   . ILE A 1 84  ? 2.758   37.974 -22.995 1.00 24.67 ? 1079 ILE A N   1 
ATOM   654  C  CA  . ILE A 1 84  ? 2.612   39.031 -21.989 1.00 24.24 ? 1079 ILE A CA  1 
ATOM   655  C  C   . ILE A 1 84  ? 2.352   38.518 -20.545 1.00 23.79 ? 1079 ILE A C   1 
ATOM   656  O  O   . ILE A 1 84  ? 2.821   39.125 -19.573 1.00 22.69 ? 1079 ILE A O   1 
ATOM   657  C  CB  . ILE A 1 84  ? 1.516   40.031 -22.426 1.00 23.86 ? 1079 ILE A CB  1 
ATOM   658  C  CG1 . ILE A 1 84  ? 1.549   41.278 -21.542 1.00 25.12 ? 1079 ILE A CG1 1 
ATOM   659  C  CG2 . ILE A 1 84  ? 0.117   39.349 -22.440 1.00 23.81 ? 1079 ILE A CG2 1 
ATOM   660  C  CD1 . ILE A 1 84  ? 0.626   42.379 -22.035 1.00 24.95 ? 1079 ILE A CD1 1 
ATOM   661  N  N   . SER A 1 85  ? 1.626   37.410 -20.429 1.00 23.69 ? 1080 SER A N   1 
ATOM   662  C  CA  . SER A 1 85  ? 1.176   36.867 -19.132 1.00 23.63 ? 1080 SER A CA  1 
ATOM   663  C  C   . SER A 1 85  ? 1.808   35.513 -18.791 1.00 23.95 ? 1080 SER A C   1 
ATOM   664  O  O   . SER A 1 85  ? 1.519   34.930 -17.740 1.00 22.16 ? 1080 SER A O   1 
ATOM   665  C  CB  . SER A 1 85  ? -0.356  36.709 -19.145 1.00 23.84 ? 1080 SER A CB  1 
ATOM   666  O  OG  . SER A 1 85  ? -0.776  35.977 -20.290 1.00 22.59 ? 1080 SER A OG  1 
ATOM   667  N  N   . ARG A 1 86  ? 2.667   34.995 -19.675 1.00 24.73 ? 1081 ARG A N   1 
ATOM   668  C  CA  . ARG A 1 86  ? 3.191   33.662 -19.434 1.00 25.48 ? 1081 ARG A CA  1 
ATOM   669  C  C   . ARG A 1 86  ? 4.093   33.652 -18.200 1.00 25.50 ? 1081 ARG A C   1 
ATOM   670  O  O   . ARG A 1 86  ? 4.713   34.676 -17.869 1.00 25.78 ? 1081 ARG A O   1 
ATOM   671  C  CB  . ARG A 1 86  ? 3.867   33.052 -20.683 1.00 25.90 ? 1081 ARG A CB  1 
ATOM   672  C  CG  . ARG A 1 86  ? 5.160   33.678 -21.097 1.00 26.02 ? 1081 ARG A CG  1 
ATOM   673  C  CD  . ARG A 1 86  ? 5.757   32.936 -22.287 1.00 26.04 ? 1081 ARG A CD  1 
ATOM   674  N  NE  . ARG A 1 86  ? 7.110   33.420 -22.592 1.00 26.67 ? 1081 ARG A NE  1 
ATOM   675  C  CZ  . ARG A 1 86  ? 8.247   32.818 -22.221 1.00 26.02 ? 1081 ARG A CZ  1 
ATOM   676  N  NH1 . ARG A 1 86  ? 8.242   31.702 -21.505 1.00 26.01 ? 1081 ARG A NH1 1 
ATOM   677  N  NH2 . ARG A 1 86  ? 9.412   33.345 -22.576 1.00 26.64 ? 1081 ARG A NH2 1 
ATOM   678  N  N   . VAL A 1 87  ? 4.116   32.502 -17.509 1.00 25.38 ? 1082 VAL A N   1 
ATOM   679  C  CA  . VAL A 1 87  ? 5.001   32.275 -16.377 1.00 25.08 ? 1082 VAL A CA  1 
ATOM   680  C  C   . VAL A 1 87  ? 6.392   31.959 -16.898 1.00 25.64 ? 1082 VAL A C   1 
ATOM   681  O  O   . VAL A 1 87  ? 6.589   30.963 -17.581 1.00 27.04 ? 1082 VAL A O   1 
ATOM   682  C  CB  . VAL A 1 87  ? 4.520   31.127 -15.468 1.00 25.08 ? 1082 VAL A CB  1 
ATOM   683  C  CG1 . VAL A 1 87  ? 5.429   31.008 -14.238 1.00 24.57 ? 1082 VAL A CG1 1 
ATOM   684  C  CG2 . VAL A 1 87  ? 3.086   31.358 -15.051 1.00 23.53 ? 1082 VAL A CG2 1 
ATOM   685  N  N   . LYS A 1 88  ? 7.354   32.831 -16.602 1.00 25.86 ? 1083 LYS A N   1 
ATOM   686  C  CA  . LYS A 1 88  ? 8.710   32.653 -17.082 1.00 25.60 ? 1083 LYS A CA  1 
ATOM   687  C  C   . LYS A 1 88  ? 9.552   32.091 -15.954 1.00 24.98 ? 1083 LYS A C   1 
ATOM   688  O  O   . LYS A 1 88  ? 9.654   32.680 -14.891 1.00 24.82 ? 1083 LYS A O   1 
ATOM   689  C  CB  . LYS A 1 88  ? 9.322   33.971 -17.590 1.00 25.49 ? 1083 LYS A CB  1 
ATOM   690  C  CG  . LYS A 1 88  ? 8.586   34.617 -18.759 1.00 26.00 ? 1083 LYS A CG  1 
ATOM   691  C  CD  . LYS A 1 88  ? 8.986   36.091 -18.907 1.00 25.52 ? 1083 LYS A CD  1 
ATOM   692  N  N   . LEU A 1 89  ? 10.156  30.942 -16.213 1.00 24.90 ? 1084 LEU A N   1 
ATOM   693  C  CA  . LEU A 1 89  ? 10.963  30.251 -15.235 1.00 24.34 ? 1084 LEU A CA  1 
ATOM   694  C  C   . LEU A 1 89  ? 12.400  30.687 -15.385 1.00 24.18 ? 1084 LEU A C   1 
ATOM   695  O  O   . LEU A 1 89  ? 12.767  31.335 -16.364 1.00 23.95 ? 1084 LEU A O   1 
ATOM   696  C  CB  . LEU A 1 89  ? 10.828  28.743 -15.422 1.00 24.13 ? 1084 LEU A CB  1 
ATOM   697  C  CG  . LEU A 1 89  ? 9.408   28.201 -15.378 1.00 23.25 ? 1084 LEU A CG  1 
ATOM   698  C  CD1 . LEU A 1 89  ? 9.446   26.672 -15.500 1.00 21.55 ? 1084 LEU A CD1 1 
ATOM   699  C  CD2 . LEU A 1 89  ? 8.672   28.674 -14.111 1.00 20.56 ? 1084 LEU A CD2 1 
ATOM   700  N  N   . SER A 1 90  ? 13.205  30.362 -14.390 1.00 24.46 ? 1085 SER A N   1 
ATOM   701  C  CA  . SER A 1 90  ? 14.600  30.724 -14.413 1.00 25.00 ? 1085 SER A CA  1 
ATOM   702  C  C   . SER A 1 90  ? 15.335  29.845 -15.423 1.00 25.81 ? 1085 SER A C   1 
ATOM   703  O  O   . SER A 1 90  ? 14.845  28.802 -15.858 1.00 25.49 ? 1085 SER A O   1 
ATOM   704  C  CB  . SER A 1 90  ? 15.229  30.592 -13.016 1.00 25.07 ? 1085 SER A CB  1 
ATOM   705  O  OG  . SER A 1 90  ? 15.457  29.250 -12.648 1.00 24.17 ? 1085 SER A OG  1 
ATOM   706  N  N   . VAL A 1 91  ? 16.535  30.276 -15.765 1.00 26.98 ? 1086 VAL A N   1 
ATOM   707  C  CA  . VAL A 1 91  ? 17.302  29.680 -16.839 1.00 27.70 ? 1086 VAL A CA  1 
ATOM   708  C  C   . VAL A 1 91  ? 18.590  29.085 -16.266 1.00 28.86 ? 1086 VAL A C   1 
ATOM   709  O  O   . VAL A 1 91  ? 19.161  29.589 -15.303 1.00 27.88 ? 1086 VAL A O   1 
ATOM   710  C  CB  . VAL A 1 91  ? 17.528  30.749 -17.943 1.00 27.57 ? 1086 VAL A CB  1 
ATOM   711  C  CG1 . VAL A 1 91  ? 18.713  30.432 -18.830 1.00 27.15 ? 1086 VAL A CG1 1 
ATOM   712  C  CG2 . VAL A 1 91  ? 16.240  30.904 -18.761 1.00 26.80 ? 1086 VAL A CG2 1 
ATOM   713  N  N   . GLN A 1 92  ? 18.997  27.964 -16.837 1.00 31.04 ? 1087 GLN A N   1 
ATOM   714  C  CA  . GLN A 1 92  ? 20.290  27.350 -16.519 1.00 32.74 ? 1087 GLN A CA  1 
ATOM   715  C  C   . GLN A 1 92  ? 21.177  27.370 -17.765 1.00 33.60 ? 1087 GLN A C   1 
ATOM   716  O  O   . GLN A 1 92  ? 22.212  28.039 -17.777 1.00 34.16 ? 1087 GLN A O   1 
ATOM   717  C  CB  . GLN A 1 92  ? 20.136  25.924 -15.921 1.00 33.04 ? 1087 GLN A CB  1 
ATOM   718  C  CG  . GLN A 1 92  ? 18.816  25.133 -16.219 1.00 34.98 ? 1087 GLN A CG  1 
ATOM   719  C  CD  . GLN A 1 92  ? 17.712  25.345 -15.173 1.00 36.55 ? 1087 GLN A CD  1 
ATOM   720  O  OE1 . GLN A 1 92  ? 17.168  26.442 -15.048 1.00 37.28 ? 1087 GLN A OE1 1 
ATOM   721  N  NE2 . GLN A 1 92  ? 17.383  24.286 -14.417 1.00 36.84 ? 1087 GLN A NE2 1 
ATOM   722  N  N   . THR A 1 93  ? 20.732  26.697 -18.830 1.00 34.77 ? 1088 THR A N   1 
ATOM   723  C  CA  . THR A 1 93  ? 21.557  26.456 -20.034 1.00 35.33 ? 1088 THR A CA  1 
ATOM   724  C  C   . THR A 1 93  ? 21.191  27.299 -21.271 1.00 35.68 ? 1088 THR A C   1 
ATOM   725  O  O   . THR A 1 93  ? 22.093  27.845 -21.926 1.00 36.34 ? 1088 THR A O   1 
ATOM   726  C  CB  . THR A 1 93  ? 21.543  24.971 -20.402 1.00 35.20 ? 1088 THR A CB  1 
ATOM   727  O  OG1 . THR A 1 93  ? 22.647  24.323 -19.752 1.00 36.32 ? 1088 THR A OG1 1 
ATOM   728  C  CG2 . THR A 1 93  ? 21.658  24.786 -21.910 1.00 36.45 ? 1088 THR A CG2 1 
ATOM   729  N  N   . HIS A 1 94  ? 19.904  27.378 -21.624 1.00 35.43 ? 1089 HIS A N   1 
ATOM   730  C  CA  . HIS A 1 94  ? 19.462  28.378 -22.617 1.00 35.35 ? 1089 HIS A CA  1 
ATOM   731  C  C   . HIS A 1 94  ? 18.166  29.046 -22.240 1.00 33.63 ? 1089 HIS A C   1 
ATOM   732  O  O   . HIS A 1 94  ? 17.461  28.609 -21.344 1.00 33.25 ? 1089 HIS A O   1 
ATOM   733  C  CB  . HIS A 1 94  ? 19.366  27.834 -24.066 1.00 36.50 ? 1089 HIS A CB  1 
ATOM   734  C  CG  . HIS A 1 94  ? 19.359  28.927 -25.113 1.00 39.42 ? 1089 HIS A CG  1 
ATOM   735  N  ND1 . HIS A 1 94  ? 20.297  29.945 -25.138 1.00 40.19 ? 1089 HIS A ND1 1 
ATOM   736  C  CD2 . HIS A 1 94  ? 18.500  29.191 -26.131 1.00 41.97 ? 1089 HIS A CD2 1 
ATOM   737  C  CE1 . HIS A 1 94  ? 20.031  30.772 -26.131 1.00 41.61 ? 1089 HIS A CE1 1 
ATOM   738  N  NE2 . HIS A 1 94  ? 18.945  30.339 -26.751 1.00 43.04 ? 1089 HIS A NE2 1 
ATOM   739  N  N   . SER A 1 95  ? 17.891  30.137 -22.934 1.00 32.13 ? 1090 SER A N   1 
ATOM   740  C  CA  . SER A 1 95  ? 16.718  30.952 -22.715 1.00 31.14 ? 1090 SER A CA  1 
ATOM   741  C  C   . SER A 1 95  ? 15.411  30.159 -22.669 1.00 29.64 ? 1090 SER A C   1 
ATOM   742  O  O   . SER A 1 95  ? 14.539  30.486 -21.877 1.00 29.23 ? 1090 SER A O   1 
ATOM   743  C  CB  . SER A 1 95  ? 16.630  31.977 -23.835 1.00 31.29 ? 1090 SER A CB  1 
ATOM   744  O  OG  . SER A 1 95  ? 16.460  31.287 -25.062 1.00 32.69 ? 1090 SER A OG  1 
ATOM   745  N  N   . THR A 1 96  ? 15.277  29.138 -23.522 1.00 28.13 ? 1091 THR A N   1 
ATOM   746  C  CA  . THR A 1 96  ? 14.035  28.364 -23.626 1.00 26.91 ? 1091 THR A CA  1 
ATOM   747  C  C   . THR A 1 96  ? 13.785  27.474 -22.407 1.00 26.81 ? 1091 THR A C   1 
ATOM   748  O  O   . THR A 1 96  ? 12.715  26.873 -22.281 1.00 26.99 ? 1091 THR A O   1 
ATOM   749  C  CB  . THR A 1 96  ? 13.961  27.509 -24.930 1.00 26.65 ? 1091 THR A CB  1 
ATOM   750  O  OG1 . THR A 1 96  ? 15.006  26.541 -24.951 1.00 25.23 ? 1091 THR A OG1 1 
ATOM   751  C  CG2 . THR A 1 96  ? 14.038  28.392 -26.185 1.00 25.83 ? 1091 THR A CG2 1 
ATOM   752  N  N   . ASP A 1 97  ? 14.773  27.387 -21.514 1.00 26.83 ? 1092 ASP A N   1 
ATOM   753  C  CA  . ASP A 1 97  ? 14.596  26.783 -20.184 1.00 26.45 ? 1092 ASP A CA  1 
ATOM   754  C  C   . ASP A 1 97  ? 13.492  27.477 -19.407 1.00 26.26 ? 1092 ASP A C   1 
ATOM   755  O  O   . ASP A 1 97  ? 12.890  26.880 -18.500 1.00 26.03 ? 1092 ASP A O   1 
ATOM   756  C  CB  . ASP A 1 97  ? 15.883  26.878 -19.367 1.00 26.38 ? 1092 ASP A CB  1 
ATOM   757  C  CG  . ASP A 1 97  ? 16.964  25.973 -19.878 1.00 26.43 ? 1092 ASP A CG  1 
ATOM   758  O  OD1 . ASP A 1 97  ? 16.664  25.080 -20.694 1.00 27.58 ? 1092 ASP A OD1 1 
ATOM   759  O  OD2 . ASP A 1 97  ? 18.116  26.146 -19.446 1.00 26.84 ? 1092 ASP A OD2 1 
ATOM   760  N  N   . ASP A 1 98  ? 13.228  28.733 -19.779 1.00 25.70 ? 1093 ASP A N   1 
ATOM   761  C  CA  . ASP A 1 98  ? 12.199  29.539 -19.140 1.00 25.47 ? 1093 ASP A CA  1 
ATOM   762  C  C   . ASP A 1 98  ? 10.759  29.116 -19.450 1.00 24.63 ? 1093 ASP A C   1 
ATOM   763  O  O   . ASP A 1 98  ? 9.828   29.587 -18.793 1.00 24.98 ? 1093 ASP A O   1 
ATOM   764  C  CB  . ASP A 1 98  ? 12.428  31.048 -19.424 1.00 25.30 ? 1093 ASP A CB  1 
ATOM   765  C  CG  . ASP A 1 98  ? 11.833  31.539 -20.754 1.00 26.68 ? 1093 ASP A CG  1 
ATOM   766  O  OD1 . ASP A 1 98  ? 11.193  30.780 -21.521 1.00 28.19 ? 1093 ASP A OD1 1 
ATOM   767  O  OD2 . ASP A 1 98  ? 12.028  32.744 -21.044 1.00 26.29 ? 1093 ASP A OD2 1 
ATOM   768  N  N   . TYR A 1 99  ? 10.570  28.213 -20.408 1.00 23.81 ? 1094 TYR A N   1 
ATOM   769  C  CA  . TYR A 1 99  ? 9.220   27.935 -20.905 1.00 23.88 ? 1094 TYR A CA  1 
ATOM   770  C  C   . TYR A 1 99  ? 8.410   26.858 -20.173 1.00 23.43 ? 1094 TYR A C   1 
ATOM   771  O  O   . TYR A 1 99  ? 8.865   25.747 -19.926 1.00 23.27 ? 1094 TYR A O   1 
ATOM   772  C  CB  . TYR A 1 99  ? 9.234   27.595 -22.388 1.00 24.11 ? 1094 TYR A CB  1 
ATOM   773  C  CG  . TYR A 1 99  ? 7.831   27.525 -22.970 1.00 24.68 ? 1094 TYR A CG  1 
ATOM   774  C  CD1 . TYR A 1 99  ? 7.161   28.675 -23.353 1.00 22.91 ? 1094 TYR A CD1 1 
ATOM   775  C  CD2 . TYR A 1 99  ? 7.175   26.301 -23.108 1.00 24.23 ? 1094 TYR A CD2 1 
ATOM   776  C  CE1 . TYR A 1 99  ? 5.888   28.608 -23.856 1.00 23.99 ? 1094 TYR A CE1 1 
ATOM   777  C  CE2 . TYR A 1 99  ? 5.917   26.233 -23.614 1.00 24.24 ? 1094 TYR A CE2 1 
ATOM   778  C  CZ  . TYR A 1 99  ? 5.266   27.380 -23.989 1.00 24.88 ? 1094 TYR A CZ  1 
ATOM   779  O  OH  . TYR A 1 99  ? 3.984   27.297 -24.514 1.00 25.51 ? 1094 TYR A OH  1 
ATOM   780  N  N   . ILE A 1 100 ? 7.179   27.236 -19.858 1.00 23.53 ? 1095 ILE A N   1 
ATOM   781  C  CA  . ILE A 1 100 ? 6.149   26.324 -19.437 1.00 23.58 ? 1095 ILE A CA  1 
ATOM   782  C  C   . ILE A 1 100 ? 4.801   26.832 -19.999 1.00 23.13 ? 1095 ILE A C   1 
ATOM   783  O  O   . ILE A 1 100 ? 4.593   28.024 -20.101 1.00 22.61 ? 1095 ILE A O   1 
ATOM   784  C  CB  . ILE A 1 100 ? 6.146   26.172 -17.887 1.00 23.56 ? 1095 ILE A CB  1 
ATOM   785  C  CG1 . ILE A 1 100 ? 5.137   25.092 -17.460 1.00 23.67 ? 1095 ILE A CG1 1 
ATOM   786  C  CG2 . ILE A 1 100 ? 5.880   27.530 -17.201 1.00 23.97 ? 1095 ILE A CG2 1 
ATOM   787  C  CD1 . ILE A 1 100 ? 5.339   24.558 -16.042 1.00 22.63 ? 1095 ILE A CD1 1 
ATOM   788  N  N   . ASN A 1 101 ? 3.910   25.925 -20.390 1.00 23.73 ? 1096 ASN A N   1 
ATOM   789  C  CA  . ASN A 1 101 ? 2.552   26.319 -20.837 1.00 24.24 ? 1096 ASN A CA  1 
ATOM   790  C  C   . ASN A 1 101 ? 1.698   26.712 -19.630 1.00 24.64 ? 1096 ASN A C   1 
ATOM   791  O  O   . ASN A 1 101 ? 1.000   25.885 -19.041 1.00 25.43 ? 1096 ASN A O   1 
ATOM   792  C  CB  . ASN A 1 101 ? 1.903   25.198 -21.658 1.00 24.14 ? 1096 ASN A CB  1 
ATOM   793  C  CG  . ASN A 1 101 ? 0.691   25.665 -22.461 1.00 24.86 ? 1096 ASN A CG  1 
ATOM   794  O  OD1 . ASN A 1 101 ? -0.176  26.366 -21.947 1.00 27.30 ? 1096 ASN A OD1 1 
ATOM   795  N  ND2 . ASN A 1 101 ? 0.632   25.273 -23.725 1.00 22.40 ? 1096 ASN A ND2 1 
ATOM   796  N  N   . ALA A 1 102 ? 1.808   27.984 -19.245 1.00 25.15 ? 1097 ALA A N   1 
ATOM   797  C  CA  . ALA A 1 102 ? 1.175   28.533 -18.050 1.00 24.57 ? 1097 ALA A CA  1 
ATOM   798  C  C   . ALA A 1 102 ? 1.070   30.039 -18.194 1.00 24.88 ? 1097 ALA A C   1 
ATOM   799  O  O   . ALA A 1 102 ? 1.920   30.683 -18.827 1.00 24.76 ? 1097 ALA A O   1 
ATOM   800  C  CB  . ALA A 1 102 ? 1.994   28.202 -16.785 1.00 24.59 ? 1097 ALA A CB  1 
ATOM   801  N  N   . ASN A 1 103 ? 0.047   30.600 -17.563 1.00 25.06 ? 1098 ASN A N   1 
ATOM   802  C  CA  . ASN A 1 103 ? -0.177  32.030 -17.592 1.00 25.44 ? 1098 ASN A CA  1 
ATOM   803  C  C   . ASN A 1 103 ? -0.601  32.527 -16.229 1.00 25.46 ? 1098 ASN A C   1 
ATOM   804  O  O   . ASN A 1 103 ? -1.307  31.833 -15.506 1.00 26.08 ? 1098 ASN A O   1 
ATOM   805  C  CB  . ASN A 1 103 ? -1.250  32.404 -18.640 1.00 25.08 ? 1098 ASN A CB  1 
ATOM   806  C  CG  . ASN A 1 103 ? -0.776  32.220 -20.072 1.00 25.19 ? 1098 ASN A CG  1 
ATOM   807  O  OD1 . ASN A 1 103 ? -1.158  31.251 -20.740 1.00 27.16 ? 1098 ASN A OD1 1 
ATOM   808  N  ND2 . ASN A 1 103 ? 0.042   33.153 -20.563 1.00 21.28 ? 1098 ASN A ND2 1 
ATOM   809  N  N   . TYR A 1 104 ? -0.162  33.733 -15.889 1.00 25.85 ? 1099 TYR A N   1 
ATOM   810  C  CA  . TYR A 1 104 ? -0.693  34.464 -14.750 1.00 26.00 ? 1099 TYR A CA  1 
ATOM   811  C  C   . TYR A 1 104 ? -2.074  34.995 -15.079 1.00 26.15 ? 1099 TYR A C   1 
ATOM   812  O  O   . TYR A 1 104 ? -2.277  35.648 -16.102 1.00 25.27 ? 1099 TYR A O   1 
ATOM   813  C  CB  . TYR A 1 104 ? 0.227   35.620 -14.346 1.00 26.53 ? 1099 TYR A CB  1 
ATOM   814  C  CG  . TYR A 1 104 ? 1.500   35.204 -13.633 1.00 26.79 ? 1099 TYR A CG  1 
ATOM   815  C  CD1 . TYR A 1 104 ? 1.451   34.646 -12.357 1.00 26.33 ? 1099 TYR A CD1 1 
ATOM   816  C  CD2 . TYR A 1 104 ? 2.754   35.382 -14.226 1.00 26.85 ? 1099 TYR A CD2 1 
ATOM   817  C  CE1 . TYR A 1 104 ? 2.604   34.295 -11.689 1.00 26.61 ? 1099 TYR A CE1 1 
ATOM   818  C  CE2 . TYR A 1 104 ? 3.923   35.007 -13.568 1.00 26.83 ? 1099 TYR A CE2 1 
ATOM   819  C  CZ  . TYR A 1 104 ? 3.831   34.467 -12.300 1.00 27.17 ? 1099 TYR A CZ  1 
ATOM   820  O  OH  . TYR A 1 104 ? 4.959   34.096 -11.624 1.00 28.95 ? 1099 TYR A OH  1 
ATOM   821  N  N   . MET A 1 105 ? -3.024  34.671 -14.201 1.00 26.58 ? 1100 MET A N   1 
ATOM   822  C  CA  . MET A 1 105 ? -4.418  35.031 -14.365 1.00 26.99 ? 1100 MET A CA  1 
ATOM   823  C  C   . MET A 1 105 ? -4.840  35.909 -13.191 1.00 27.39 ? 1100 MET A C   1 
ATOM   824  O  O   . MET A 1 105 ? -4.607  35.542 -12.034 1.00 27.23 ? 1100 MET A O   1 
ATOM   825  C  CB  . MET A 1 105 ? -5.283  33.781 -14.379 1.00 27.36 ? 1100 MET A CB  1 
ATOM   826  C  CG  . MET A 1 105 ? -4.809  32.665 -15.331 1.00 29.23 ? 1100 MET A CG  1 
ATOM   827  S  SD  . MET A 1 105 ? -4.821  33.053 -17.107 1.00 29.94 ? 1100 MET A SD  1 
ATOM   828  C  CE  . MET A 1 105 ? -6.511  33.589 -17.322 1.00 29.88 ? 1100 MET A CE  1 
ATOM   829  N  N   . PRO A 1 106 ? -5.466  37.064 -13.481 1.00 27.30 ? 1101 PRO A N   1 
ATOM   830  C  CA  . PRO A 1 106 ? -5.961  37.897 -12.404 1.00 27.66 ? 1101 PRO A CA  1 
ATOM   831  C  C   . PRO A 1 106 ? -7.050  37.211 -11.592 1.00 27.03 ? 1101 PRO A C   1 
ATOM   832  O  O   . PRO A 1 106 ? -7.817  36.436 -12.112 1.00 26.99 ? 1101 PRO A O   1 
ATOM   833  C  CB  . PRO A 1 106 ? -6.560  39.125 -13.138 1.00 27.51 ? 1101 PRO A CB  1 
ATOM   834  C  CG  . PRO A 1 106 ? -5.950  39.116 -14.467 1.00 28.57 ? 1101 PRO A CG  1 
ATOM   835  C  CD  . PRO A 1 106 ? -5.751  37.657 -14.798 1.00 27.33 ? 1101 PRO A CD  1 
ATOM   836  N  N   . GLY A 1 107 ? -7.090  37.495 -10.310 1.00 27.12 ? 1102 GLY A N   1 
ATOM   837  C  CA  . GLY A 1 107 ? -8.227  37.137 -9.489  1.00 27.22 ? 1102 GLY A CA  1 
ATOM   838  C  C   . GLY A 1 107 ? -8.840  38.435 -9.012  1.00 27.34 ? 1102 GLY A C   1 
ATOM   839  O  O   . GLY A 1 107 ? -8.583  39.502 -9.574  1.00 26.81 ? 1102 GLY A O   1 
ATOM   840  N  N   . TYR A 1 108 ? -9.635  38.346 -7.959  1.00 28.09 ? 1103 TYR A N   1 
ATOM   841  C  CA  . TYR A 1 108 ? -10.335 39.512 -7.443  1.00 28.95 ? 1103 TYR A CA  1 
ATOM   842  C  C   . TYR A 1 108 ? -9.360  40.522 -6.806  1.00 29.65 ? 1103 TYR A C   1 
ATOM   843  O  O   . TYR A 1 108 ? -9.553  41.727 -6.922  1.00 29.68 ? 1103 TYR A O   1 
ATOM   844  C  CB  . TYR A 1 108 ? -11.421 39.071 -6.449  1.00 28.82 ? 1103 TYR A CB  1 
ATOM   845  C  CG  . TYR A 1 108 ? -12.231 40.215 -5.908  1.00 28.64 ? 1103 TYR A CG  1 
ATOM   846  C  CD1 . TYR A 1 108 ? -13.262 40.757 -6.653  1.00 29.51 ? 1103 TYR A CD1 1 
ATOM   847  C  CD2 . TYR A 1 108 ? -11.967 40.767 -4.666  1.00 28.77 ? 1103 TYR A CD2 1 
ATOM   848  C  CE1 . TYR A 1 108 ? -14.023 41.803 -6.182  1.00 28.14 ? 1103 TYR A CE1 1 
ATOM   849  C  CE2 . TYR A 1 108 ? -12.734 41.837 -4.178  1.00 29.02 ? 1103 TYR A CE2 1 
ATOM   850  C  CZ  . TYR A 1 108 ? -13.758 42.344 -4.963  1.00 29.03 ? 1103 TYR A CZ  1 
ATOM   851  O  OH  . TYR A 1 108 ? -14.527 43.412 -4.556  1.00 30.07 ? 1103 TYR A OH  1 
ATOM   852  N  N   . HIS A 1 109 ? -8.299  40.023 -6.171  1.00 30.83 ? 1104 HIS A N   1 
ATOM   853  C  CA  . HIS A 1 109 ? -7.366  40.865 -5.400  1.00 31.65 ? 1104 HIS A CA  1 
ATOM   854  C  C   . HIS A 1 109 ? -6.113  41.332 -6.124  1.00 32.27 ? 1104 HIS A C   1 
ATOM   855  O  O   . HIS A 1 109 ? -5.566  42.369 -5.765  1.00 32.75 ? 1104 HIS A O   1 
ATOM   856  C  CB  . HIS A 1 109 ? -6.949  40.137 -4.129  1.00 31.87 ? 1104 HIS A CB  1 
ATOM   857  C  CG  . HIS A 1 109 ? -8.110  39.741 -3.276  1.00 32.80 ? 1104 HIS A CG  1 
ATOM   858  N  ND1 . HIS A 1 109 ? -8.797  38.559 -3.462  1.00 32.46 ? 1104 HIS A ND1 1 
ATOM   859  C  CD2 . HIS A 1 109 ? -8.742  40.397 -2.275  1.00 33.38 ? 1104 HIS A CD2 1 
ATOM   860  C  CE1 . HIS A 1 109 ? -9.783  38.492 -2.589  1.00 33.35 ? 1104 HIS A CE1 1 
ATOM   861  N  NE2 . HIS A 1 109 ? -9.773  39.593 -1.858  1.00 33.89 ? 1104 HIS A NE2 1 
ATOM   862  N  N   . SER A 1 110 ? -5.639  40.580 -7.117  1.00 32.60 ? 1105 SER A N   1 
ATOM   863  C  CA  . SER A 1 110 ? -4.450  40.987 -7.858  1.00 32.54 ? 1105 SER A CA  1 
ATOM   864  C  C   . SER A 1 110 ? -4.290  40.245 -9.165  1.00 32.33 ? 1105 SER A C   1 
ATOM   865  O  O   . SER A 1 110 ? -4.975  39.268 -9.446  1.00 32.78 ? 1105 SER A O   1 
ATOM   866  C  CB  . SER A 1 110 ? -3.172  40.814 -7.010  1.00 32.71 ? 1105 SER A CB  1 
ATOM   867  O  OG  . SER A 1 110 ? -2.722  39.470 -7.013  1.00 33.46 ? 1105 SER A OG  1 
ATOM   868  N  N   . LYS A 1 111 ? -3.339  40.726 -9.950  1.00 32.27 ? 1106 LYS A N   1 
ATOM   869  C  CA  . LYS A 1 111 ? -3.059  40.206 -11.274 1.00 31.77 ? 1106 LYS A CA  1 
ATOM   870  C  C   . LYS A 1 111 ? -2.299  38.877 -11.293 1.00 31.34 ? 1106 LYS A C   1 
ATOM   871  O  O   . LYS A 1 111 ? -2.305  38.181 -12.300 1.00 31.65 ? 1106 LYS A O   1 
ATOM   872  C  CB  . LYS A 1 111 ? -2.283  41.265 -12.049 1.00 32.14 ? 1106 LYS A CB  1 
ATOM   873  C  CG  . LYS A 1 111 ? -3.068  42.556 -12.293 1.00 32.42 ? 1106 LYS A CG  1 
ATOM   874  C  CD  . LYS A 1 111 ? -4.086  42.409 -13.388 1.00 33.77 ? 1106 LYS A CD  1 
ATOM   875  C  CE  . LYS A 1 111 ? -3.396  42.071 -14.723 1.00 34.45 ? 1106 LYS A CE  1 
ATOM   876  N  NZ  . LYS A 1 111 ? -4.194  42.385 -15.930 1.00 34.21 ? 1106 LYS A NZ  1 
ATOM   877  N  N   . LYS A 1 112 ? -1.646  38.524 -10.191 1.00 31.13 ? 1107 LYS A N   1 
ATOM   878  C  CA  . LYS A 1 112 ? -0.956  37.240 -10.069 1.00 31.18 ? 1107 LYS A CA  1 
ATOM   879  C  C   . LYS A 1 112 ? -1.608  36.335 -9.010  1.00 30.17 ? 1107 LYS A C   1 
ATOM   880  O  O   . LYS A 1 112 ? -0.919  35.565 -8.332  1.00 29.82 ? 1107 LYS A O   1 
ATOM   881  C  CB  . LYS A 1 112 ? 0.531   37.469 -9.749  1.00 31.37 ? 1107 LYS A CB  1 
ATOM   882  C  CG  . LYS A 1 112 ? 1.293   38.199 -10.840 1.00 32.43 ? 1107 LYS A CG  1 
ATOM   883  C  CD  . LYS A 1 112 ? 2.809   38.191 -10.609 1.00 32.79 ? 1107 LYS A CD  1 
ATOM   884  C  CE  . LYS A 1 112 ? 3.538   38.390 -11.944 1.00 35.11 ? 1107 LYS A CE  1 
ATOM   885  N  NZ  . LYS A 1 112 ? 5.028   38.414 -11.802 1.00 36.10 ? 1107 LYS A NZ  1 
ATOM   886  N  N   . ASP A 1 113 ? -2.934  36.409 -8.886  1.00 29.35 ? 1108 ASP A N   1 
ATOM   887  C  CA  . ASP A 1 113 ? -3.655  35.562 -7.922  1.00 28.68 ? 1108 ASP A CA  1 
ATOM   888  C  C   . ASP A 1 113 ? -3.611  34.094 -8.297  1.00 28.30 ? 1108 ASP A C   1 
ATOM   889  O  O   . ASP A 1 113 ? -3.550  33.230 -7.409  1.00 28.12 ? 1108 ASP A O   1 
ATOM   890  C  CB  . ASP A 1 113 ? -5.119  35.970 -7.788  1.00 28.65 ? 1108 ASP A CB  1 
ATOM   891  C  CG  . ASP A 1 113 ? -5.322  37.155 -6.877  1.00 28.18 ? 1108 ASP A CG  1 
ATOM   892  O  OD1 . ASP A 1 113 ? -4.360  37.662 -6.243  1.00 29.70 ? 1108 ASP A OD1 1 
ATOM   893  O  OD2 . ASP A 1 113 ? -6.470  37.593 -6.800  1.00 28.30 ? 1108 ASP A OD2 1 
ATOM   894  N  N   . PHE A 1 114 ? -3.666  33.820 -9.603  1.00 27.50 ? 1109 PHE A N   1 
ATOM   895  C  CA  . PHE A 1 114 ? -3.610  32.459 -10.113 1.00 26.74 ? 1109 PHE A CA  1 
ATOM   896  C  C   . PHE A 1 114 ? -2.508  32.288 -11.149 1.00 26.18 ? 1109 PHE A C   1 
ATOM   897  O  O   . PHE A 1 114 ? -2.045  33.266 -11.755 1.00 26.44 ? 1109 PHE A O   1 
ATOM   898  C  CB  . PHE A 1 114 ? -4.957  32.057 -10.728 1.00 26.81 ? 1109 PHE A CB  1 
ATOM   899  C  CG  . PHE A 1 114 ? -6.113  32.144 -9.768  1.00 27.99 ? 1109 PHE A CG  1 
ATOM   900  C  CD1 . PHE A 1 114 ? -6.823  33.332 -9.610  1.00 27.62 ? 1109 PHE A CD1 1 
ATOM   901  C  CD2 . PHE A 1 114 ? -6.482  31.053 -9.011  1.00 27.37 ? 1109 PHE A CD2 1 
ATOM   902  C  CE1 . PHE A 1 114 ? -7.869  33.407 -8.715  1.00 26.14 ? 1109 PHE A CE1 1 
ATOM   903  C  CE2 . PHE A 1 114 ? -7.524  31.141 -8.126  1.00 26.42 ? 1109 PHE A CE2 1 
ATOM   904  C  CZ  . PHE A 1 114 ? -8.212  32.317 -7.984  1.00 26.42 ? 1109 PHE A CZ  1 
ATOM   905  N  N   . ILE A 1 115 ? -2.057  31.038 -11.292 1.00 25.45 ? 1110 ILE A N   1 
ATOM   906  C  CA  . ILE A 1 115 ? -1.408  30.543 -12.500 1.00 24.05 ? 1110 ILE A CA  1 
ATOM   907  C  C   . ILE A 1 115 ? -2.346  29.480 -13.082 1.00 24.10 ? 1110 ILE A C   1 
ATOM   908  O  O   . ILE A 1 115 ? -2.707  28.540 -12.379 1.00 24.24 ? 1110 ILE A O   1 
ATOM   909  C  CB  . ILE A 1 115 ? -0.028  29.895 -12.226 1.00 23.90 ? 1110 ILE A CB  1 
ATOM   910  C  CG1 . ILE A 1 115 ? 0.976   30.941 -11.713 1.00 24.10 ? 1110 ILE A CG1 1 
ATOM   911  C  CG2 . ILE A 1 115 ? 0.499   29.228 -13.507 1.00 21.64 ? 1110 ILE A CG2 1 
ATOM   912  C  CD1 . ILE A 1 115 ? 2.290   30.367 -11.085 1.00 23.28 ? 1110 ILE A CD1 1 
ATOM   913  N  N   . ALA A 1 116 ? -2.759  29.661 -14.340 1.00 23.41 ? 1111 ALA A N   1 
ATOM   914  C  CA  . ALA A 1 116 ? -3.516  28.653 -15.105 1.00 23.07 ? 1111 ALA A CA  1 
ATOM   915  C  C   . ALA A 1 116 ? -2.514  27.887 -15.964 1.00 22.78 ? 1111 ALA A C   1 
ATOM   916  O  O   . ALA A 1 116 ? -1.725  28.492 -16.688 1.00 22.68 ? 1111 ALA A O   1 
ATOM   917  C  CB  . ALA A 1 116 ? -4.594  29.331 -15.994 1.00 22.62 ? 1111 ALA A CB  1 
ATOM   918  N  N   . THR A 1 117 ? -2.509  26.567 -15.851 1.00 22.90 ? 1112 THR A N   1 
ATOM   919  C  CA  . THR A 1 117 ? -1.565  25.741 -16.581 1.00 23.33 ? 1112 THR A CA  1 
ATOM   920  C  C   . THR A 1 117 ? -2.236  24.438 -16.988 1.00 23.37 ? 1112 THR A C   1 
ATOM   921  O  O   . THR A 1 117 ? -3.279  24.071 -16.467 1.00 23.38 ? 1112 THR A O   1 
ATOM   922  C  CB  . THR A 1 117 ? -0.225  25.483 -15.763 1.00 23.55 ? 1112 THR A CB  1 
ATOM   923  O  OG1 . THR A 1 117 ? 0.756   24.843 -16.594 1.00 26.28 ? 1112 THR A OG1 1 
ATOM   924  C  CG2 . THR A 1 117 ? -0.422  24.614 -14.531 1.00 22.34 ? 1112 THR A CG2 1 
ATOM   925  N  N   . GLN A 1 118 ? -1.625  23.766 -17.952 1.00 23.64 ? 1113 GLN A N   1 
ATOM   926  C  CA  . GLN A 1 118 ? -1.991  22.420 -18.343 1.00 23.32 ? 1113 GLN A CA  1 
ATOM   927  C  C   . GLN A 1 118 ? -1.461  21.421 -17.326 1.00 24.27 ? 1113 GLN A C   1 
ATOM   928  O  O   . GLN A 1 118 ? -0.446  21.667 -16.649 1.00 24.22 ? 1113 GLN A O   1 
ATOM   929  C  CB  . GLN A 1 118 ? -1.384  22.098 -19.702 1.00 23.48 ? 1113 GLN A CB  1 
ATOM   930  C  CG  . GLN A 1 118 ? 0.178   22.122 -19.727 1.00 23.10 ? 1113 GLN A CG  1 
ATOM   931  C  CD  . GLN A 1 118 ? 0.736   21.786 -21.070 1.00 23.48 ? 1113 GLN A CD  1 
ATOM   932  O  OE1 . GLN A 1 118 ? 0.067   21.957 -22.091 1.00 24.29 ? 1113 GLN A OE1 1 
ATOM   933  N  NE2 . GLN A 1 118 ? 1.978   21.336 -21.093 1.00 21.24 ? 1113 GLN A NE2 1 
ATOM   934  N  N   . GLY A 1 119 ? -2.131  20.279 -17.224 1.00 25.16 ? 1114 GLY A N   1 
ATOM   935  C  CA  . GLY A 1 119 ? -1.604  19.169 -16.421 1.00 25.48 ? 1114 GLY A CA  1 
ATOM   936  C  C   . GLY A 1 119 ? -0.250  18.781 -17.002 1.00 25.66 ? 1114 GLY A C   1 
ATOM   937  O  O   . GLY A 1 119 ? -0.086  18.756 -18.206 1.00 26.08 ? 1114 GLY A O   1 
ATOM   938  N  N   . PRO A 1 120 ? 0.742   18.490 -16.157 1.00 25.95 ? 1115 PRO A N   1 
ATOM   939  C  CA  . PRO A 1 120 ? 2.041   18.302 -16.762 1.00 26.25 ? 1115 PRO A CA  1 
ATOM   940  C  C   . PRO A 1 120 ? 2.104   17.119 -17.758 1.00 26.53 ? 1115 PRO A C   1 
ATOM   941  O  O   . PRO A 1 120 ? 1.390   16.127 -17.600 1.00 26.69 ? 1115 PRO A O   1 
ATOM   942  C  CB  . PRO A 1 120 ? 2.943   18.059 -15.546 1.00 26.27 ? 1115 PRO A CB  1 
ATOM   943  C  CG  . PRO A 1 120 ? 2.055   17.552 -14.524 1.00 26.05 ? 1115 PRO A CG  1 
ATOM   944  C  CD  . PRO A 1 120 ? 0.793   18.299 -14.703 1.00 25.72 ? 1115 PRO A CD  1 
ATOM   945  N  N   . LEU A 1 121 ? 2.956   17.256 -18.773 1.00 26.79 ? 1116 LEU A N   1 
ATOM   946  C  CA  . LEU A 1 121 ? 3.370   16.144 -19.629 1.00 26.87 ? 1116 LEU A CA  1 
ATOM   947  C  C   . LEU A 1 121 ? 4.519   15.379 -18.951 1.00 27.07 ? 1116 LEU A C   1 
ATOM   948  O  O   . LEU A 1 121 ? 5.140   15.900 -18.014 1.00 27.36 ? 1116 LEU A O   1 
ATOM   949  C  CB  . LEU A 1 121 ? 3.850   16.689 -20.981 1.00 27.33 ? 1116 LEU A CB  1 
ATOM   950  C  CG  . LEU A 1 121 ? 2.829   17.321 -21.944 1.00 27.86 ? 1116 LEU A CG  1 
ATOM   951  C  CD1 . LEU A 1 121 ? 3.566   18.240 -22.915 1.00 28.15 ? 1116 LEU A CD1 1 
ATOM   952  C  CD2 . LEU A 1 121 ? 2.026   16.257 -22.711 1.00 26.91 ? 1116 LEU A CD2 1 
ATOM   953  N  N   . PRO A 1 122 ? 4.823   14.146 -19.417 1.00 27.00 ? 1117 PRO A N   1 
ATOM   954  C  CA  . PRO A 1 122 ? 6.010   13.419 -18.896 1.00 27.01 ? 1117 PRO A CA  1 
ATOM   955  C  C   . PRO A 1 122 ? 7.322   14.211 -19.020 1.00 26.69 ? 1117 PRO A C   1 
ATOM   956  O  O   . PRO A 1 122 ? 8.169   14.145 -18.129 1.00 26.84 ? 1117 PRO A O   1 
ATOM   957  C  CB  . PRO A 1 122 ? 6.081   12.165 -19.787 1.00 26.77 ? 1117 PRO A CB  1 
ATOM   958  C  CG  . PRO A 1 122 ? 4.699   11.983 -20.316 1.00 26.98 ? 1117 PRO A CG  1 
ATOM   959  C  CD  . PRO A 1 122 ? 4.106   13.357 -20.442 1.00 27.09 ? 1117 PRO A CD  1 
ATOM   960  N  N   . ASN A 1 123 ? 7.479   14.933 -20.125 1.00 26.11 ? 1118 ASN A N   1 
ATOM   961  C  CA  . ASN A 1 123 ? 8.706   15.681 -20.401 1.00 26.10 ? 1118 ASN A CA  1 
ATOM   962  C  C   . ASN A 1 123 ? 8.719   17.115 -19.836 1.00 25.77 ? 1118 ASN A C   1 
ATOM   963  O  O   . ASN A 1 123 ? 9.697   17.843 -20.041 1.00 26.27 ? 1118 ASN A O   1 
ATOM   964  C  CB  . ASN A 1 123 ? 8.990   15.709 -21.912 1.00 26.21 ? 1118 ASN A CB  1 
ATOM   965  C  CG  . ASN A 1 123 ? 7.831   16.286 -22.717 1.00 27.60 ? 1118 ASN A CG  1 
ATOM   966  O  OD1 . ASN A 1 123 ? 6.689   15.842 -22.569 1.00 29.34 ? 1118 ASN A OD1 1 
ATOM   967  N  ND2 . ASN A 1 123 ? 8.120   17.283 -23.570 1.00 26.11 ? 1118 ASN A ND2 1 
ATOM   968  N  N   . THR A 1 124 ? 7.643   17.515 -19.156 1.00 24.99 ? 1119 THR A N   1 
ATOM   969  C  CA  . THR A 1 124 ? 7.550   18.827 -18.518 1.00 24.64 ? 1119 THR A CA  1 
ATOM   970  C  C   . THR A 1 124 ? 7.307   18.710 -17.012 1.00 25.03 ? 1119 THR A C   1 
ATOM   971  O  O   . THR A 1 124 ? 7.072   19.702 -16.336 1.00 25.39 ? 1119 THR A O   1 
ATOM   972  C  CB  . THR A 1 124 ? 6.421   19.713 -19.173 1.00 24.49 ? 1119 THR A CB  1 
ATOM   973  O  OG1 . THR A 1 124 ? 5.112   19.206 -18.832 1.00 22.59 ? 1119 THR A OG1 1 
ATOM   974  C  CG2 . THR A 1 124 ? 6.594   19.774 -20.686 1.00 21.45 ? 1119 THR A CG2 1 
ATOM   975  N  N   . LEU A 1 125 ? 7.359   17.489 -16.499 1.00 25.69 ? 1120 LEU A N   1 
ATOM   976  C  CA  . LEU A 1 125 ? 7.169   17.210 -15.087 1.00 26.26 ? 1120 LEU A CA  1 
ATOM   977  C  C   . LEU A 1 125 ? 8.191   17.927 -14.179 1.00 26.43 ? 1120 LEU A C   1 
ATOM   978  O  O   . LEU A 1 125 ? 7.811   18.509 -13.156 1.00 26.51 ? 1120 LEU A O   1 
ATOM   979  C  CB  . LEU A 1 125 ? 7.236   15.701 -14.876 1.00 26.77 ? 1120 LEU A CB  1 
ATOM   980  C  CG  . LEU A 1 125 ? 6.641   15.082 -13.620 1.00 27.66 ? 1120 LEU A CG  1 
ATOM   981  C  CD1 . LEU A 1 125 ? 5.178   15.442 -13.529 1.00 29.90 ? 1120 LEU A CD1 1 
ATOM   982  C  CD2 . LEU A 1 125 ? 6.849   13.564 -13.666 1.00 27.14 ? 1120 LEU A CD2 1 
ATOM   983  N  N   . LYS A 1 126 ? 9.466   17.904 -14.558 1.00 26.63 ? 1121 LYS A N   1 
ATOM   984  C  CA  . LYS A 1 126 ? 10.504  18.631 -13.809 1.00 27.16 ? 1121 LYS A CA  1 
ATOM   985  C  C   . LYS A 1 126 ? 10.237  20.148 -13.831 1.00 27.02 ? 1121 LYS A C   1 
ATOM   986  O  O   . LYS A 1 126 ? 10.414  20.829 -12.823 1.00 27.31 ? 1121 LYS A O   1 
ATOM   987  C  CB  . LYS A 1 126 ? 11.917  18.351 -14.357 1.00 27.03 ? 1121 LYS A CB  1 
ATOM   988  C  CG  . LYS A 1 126 ? 12.303  16.883 -14.433 1.00 27.81 ? 1121 LYS A CG  1 
ATOM   989  C  CD  . LYS A 1 126 ? 13.797  16.670 -14.795 1.00 27.51 ? 1121 LYS A CD  1 
ATOM   990  N  N   . ASP A 1 127 ? 9.808   20.655 -14.985 1.00 26.66 ? 1122 ASP A N   1 
ATOM   991  C  CA  . ASP A 1 127 ? 9.470   22.071 -15.168 1.00 26.37 ? 1122 ASP A CA  1 
ATOM   992  C  C   . ASP A 1 127 ? 8.289   22.515 -14.320 1.00 25.48 ? 1122 ASP A C   1 
ATOM   993  O  O   . ASP A 1 127 ? 8.283   23.614 -13.781 1.00 25.35 ? 1122 ASP A O   1 
ATOM   994  C  CB  . ASP A 1 127 ? 9.107   22.358 -16.639 1.00 26.75 ? 1122 ASP A CB  1 
ATOM   995  C  CG  . ASP A 1 127 ? 10.228  22.017 -17.615 1.00 28.44 ? 1122 ASP A CG  1 
ATOM   996  O  OD1 . ASP A 1 127 ? 11.404  21.972 -17.191 1.00 30.36 ? 1122 ASP A OD1 1 
ATOM   997  O  OD2 . ASP A 1 127 ? 9.916   21.806 -18.820 1.00 33.12 ? 1122 ASP A OD2 1 
ATOM   998  N  N   . PHE A 1 128 ? 7.257   21.681 -14.274 1.00 24.76 ? 1123 PHE A N   1 
ATOM   999  C  CA  . PHE A 1 128 ? 6.052   21.949 -13.482 1.00 24.16 ? 1123 PHE A CA  1 
ATOM   1000 C  C   . PHE A 1 128 ? 6.383   22.110 -11.978 1.00 23.95 ? 1123 PHE A C   1 
ATOM   1001 O  O   . PHE A 1 128 ? 5.941   23.086 -11.342 1.00 23.89 ? 1123 PHE A O   1 
ATOM   1002 C  CB  . PHE A 1 128 ? 5.023   20.840 -13.756 1.00 24.34 ? 1123 PHE A CB  1 
ATOM   1003 C  CG  . PHE A 1 128 ? 3.814   20.846 -12.849 1.00 23.88 ? 1123 PHE A CG  1 
ATOM   1004 C  CD1 . PHE A 1 128 ? 2.629   21.448 -13.251 1.00 24.10 ? 1123 PHE A CD1 1 
ATOM   1005 C  CD2 . PHE A 1 128 ? 3.843   20.187 -11.620 1.00 23.46 ? 1123 PHE A CD2 1 
ATOM   1006 C  CE1 . PHE A 1 128 ? 1.513   21.429 -12.424 1.00 23.78 ? 1123 PHE A CE1 1 
ATOM   1007 C  CE2 . PHE A 1 128 ? 2.735   20.177 -10.786 1.00 22.46 ? 1123 PHE A CE2 1 
ATOM   1008 C  CZ  . PHE A 1 128 ? 1.573   20.780 -11.186 1.00 23.25 ? 1123 PHE A CZ  1 
ATOM   1009 N  N   . TRP A 1 129 ? 7.172   21.190 -11.426 1.00 23.38 ? 1124 TRP A N   1 
ATOM   1010 C  CA  . TRP A 1 129 ? 7.564   21.257 -10.013 1.00 23.37 ? 1124 TRP A CA  1 
ATOM   1011 C  C   . TRP A 1 129 ? 8.551   22.374 -9.736  1.00 23.56 ? 1124 TRP A C   1 
ATOM   1012 O  O   . TRP A 1 129 ? 8.573   22.939 -8.629  1.00 22.87 ? 1124 TRP A O   1 
ATOM   1013 C  CB  . TRP A 1 129 ? 8.148   19.928 -9.524  1.00 23.10 ? 1124 TRP A CB  1 
ATOM   1014 C  CG  . TRP A 1 129 ? 7.108   18.874 -9.299  1.00 22.39 ? 1124 TRP A CG  1 
ATOM   1015 C  CD1 . TRP A 1 129 ? 6.942   17.730 -10.016 1.00 22.10 ? 1124 TRP A CD1 1 
ATOM   1016 C  CD2 . TRP A 1 129 ? 6.080   18.876 -8.301  1.00 22.41 ? 1124 TRP A CD2 1 
ATOM   1017 N  NE1 . TRP A 1 129 ? 5.881   17.019 -9.529  1.00 22.27 ? 1124 TRP A NE1 1 
ATOM   1018 C  CE2 . TRP A 1 129 ? 5.336   17.694 -8.472  1.00 21.82 ? 1124 TRP A CE2 1 
ATOM   1019 C  CE3 . TRP A 1 129 ? 5.712   19.768 -7.279  1.00 22.46 ? 1124 TRP A CE3 1 
ATOM   1020 C  CZ2 . TRP A 1 129 ? 4.254   17.370 -7.661  1.00 22.36 ? 1124 TRP A CZ2 1 
ATOM   1021 C  CZ3 . TRP A 1 129 ? 4.630   19.445 -6.465  1.00 21.76 ? 1124 TRP A CZ3 1 
ATOM   1022 C  CH2 . TRP A 1 129 ? 3.918   18.260 -6.657  1.00 22.76 ? 1124 TRP A CH2 1 
ATOM   1023 N  N   . ARG A 1 130 ? 9.375   22.685 -10.736 1.00 23.98 ? 1125 ARG A N   1 
ATOM   1024 C  CA  . ARG A 1 130 ? 10.193  23.893 -10.681 1.00 24.41 ? 1125 ARG A CA  1 
ATOM   1025 C  C   . ARG A 1 130 ? 9.353   25.156 -10.571 1.00 23.90 ? 1125 ARG A C   1 
ATOM   1026 O  O   . ARG A 1 130 ? 9.651   26.049 -9.776  1.00 24.40 ? 1125 ARG A O   1 
ATOM   1027 C  CB  . ARG A 1 130 ? 11.109  24.027 -11.890 1.00 24.60 ? 1125 ARG A CB  1 
ATOM   1028 C  CG  . ARG A 1 130 ? 12.536  23.835 -11.542 1.00 25.57 ? 1125 ARG A CG  1 
ATOM   1029 C  CD  . ARG A 1 130 ? 13.426  24.707 -12.336 1.00 24.40 ? 1125 ARG A CD  1 
ATOM   1030 N  NE  . ARG A 1 130 ? 13.269  24.533 -13.772 1.00 23.86 ? 1125 ARG A NE  1 
ATOM   1031 C  CZ  . ARG A 1 130 ? 13.413  25.522 -14.652 1.00 24.79 ? 1125 ARG A CZ  1 
ATOM   1032 N  NH1 . ARG A 1 130 ? 13.669  26.761 -14.231 1.00 24.01 ? 1125 ARG A NH1 1 
ATOM   1033 N  NH2 . ARG A 1 130 ? 13.269  25.290 -15.956 1.00 24.15 ? 1125 ARG A NH2 1 
ATOM   1034 N  N   . MET A 1 131 ? 8.314   25.234 -11.371 1.00 23.37 ? 1126 MET A N   1 
ATOM   1035 C  CA  . MET A 1 131 ? 7.406   26.346 -11.277 1.00 23.70 ? 1126 MET A CA  1 
ATOM   1036 C  C   . MET A 1 131 ? 6.776   26.443 -9.890  1.00 23.17 ? 1126 MET A C   1 
ATOM   1037 O  O   . MET A 1 131 ? 6.759   27.498 -9.280  1.00 24.38 ? 1126 MET A O   1 
ATOM   1038 C  CB  . MET A 1 131 ? 6.338   26.253 -12.368 1.00 23.60 ? 1126 MET A CB  1 
ATOM   1039 C  CG  . MET A 1 131 ? 5.310   27.337 -12.252 1.00 24.00 ? 1126 MET A CG  1 
ATOM   1040 S  SD  . MET A 1 131 ? 4.237   27.422 -13.648 1.00 25.57 ? 1126 MET A SD  1 
ATOM   1041 C  CE  . MET A 1 131 ? 3.142   26.055 -13.255 1.00 25.22 ? 1126 MET A CE  1 
ATOM   1042 N  N   . VAL A 1 132 ? 6.253   25.341 -9.387  1.00 23.49 ? 1127 VAL A N   1 
ATOM   1043 C  CA  . VAL A 1 132 ? 5.757   25.270 -8.007  1.00 23.07 ? 1127 VAL A CA  1 
ATOM   1044 C  C   . VAL A 1 132 ? 6.790   25.808 -6.997  1.00 23.81 ? 1127 VAL A C   1 
ATOM   1045 O  O   . VAL A 1 132 ? 6.462   26.590 -6.093  1.00 24.03 ? 1127 VAL A O   1 
ATOM   1046 C  CB  . VAL A 1 132 ? 5.346   23.813 -7.639  1.00 22.60 ? 1127 VAL A CB  1 
ATOM   1047 C  CG1 . VAL A 1 132 ? 5.119   23.675 -6.157  1.00 20.29 ? 1127 VAL A CG1 1 
ATOM   1048 C  CG2 . VAL A 1 132 ? 4.091   23.394 -8.428  1.00 22.01 ? 1127 VAL A CG2 1 
ATOM   1049 N  N   . TRP A 1 133 ? 8.030   25.382 -7.154  1.00 24.10 ? 1128 TRP A N   1 
ATOM   1050 C  CA  . TRP A 1 133 ? 9.101   25.848 -6.284  1.00 25.06 ? 1128 TRP A CA  1 
ATOM   1051 C  C   . TRP A 1 133 ? 9.373   27.343 -6.481  1.00 24.81 ? 1128 TRP A C   1 
ATOM   1052 O  O   . TRP A 1 133 ? 9.141   28.139 -5.579  1.00 24.86 ? 1128 TRP A O   1 
ATOM   1053 C  CB  . TRP A 1 133 ? 10.387  25.015 -6.487  1.00 25.61 ? 1128 TRP A CB  1 
ATOM   1054 C  CG  . TRP A 1 133 ? 11.490  25.612 -5.752  1.00 26.58 ? 1128 TRP A CG  1 
ATOM   1055 C  CD1 . TRP A 1 133 ? 12.488  26.417 -6.249  1.00 27.24 ? 1128 TRP A CD1 1 
ATOM   1056 C  CD2 . TRP A 1 133 ? 11.681  25.546 -4.352  1.00 25.34 ? 1128 TRP A CD2 1 
ATOM   1057 N  NE1 . TRP A 1 133 ? 13.301  26.832 -5.229  1.00 27.15 ? 1128 TRP A NE1 1 
ATOM   1058 C  CE2 . TRP A 1 133 ? 12.823  26.317 -4.052  1.00 26.59 ? 1128 TRP A CE2 1 
ATOM   1059 C  CE3 . TRP A 1 133 ? 11.006  24.901 -3.324  1.00 25.64 ? 1128 TRP A CE3 1 
ATOM   1060 C  CZ2 . TRP A 1 133 ? 13.306  26.456 -2.759  1.00 27.08 ? 1128 TRP A CZ2 1 
ATOM   1061 C  CZ3 . TRP A 1 133 ? 11.482  25.025 -2.048  1.00 26.92 ? 1128 TRP A CZ3 1 
ATOM   1062 C  CH2 . TRP A 1 133 ? 12.623  25.803 -1.769  1.00 27.30 ? 1128 TRP A CH2 1 
ATOM   1063 N  N   . GLU A 1 134 ? 9.822   27.709 -7.679  1.00 25.19 ? 1129 GLU A N   1 
ATOM   1064 C  CA  . GLU A 1 134 ? 10.269  29.073 -7.991  1.00 25.10 ? 1129 GLU A CA  1 
ATOM   1065 C  C   . GLU A 1 134 ? 9.223   30.177 -7.801  1.00 25.69 ? 1129 GLU A C   1 
ATOM   1066 O  O   . GLU A 1 134 ? 9.578   31.336 -7.529  1.00 25.94 ? 1129 GLU A O   1 
ATOM   1067 C  CB  . GLU A 1 134 ? 10.771  29.136 -9.442  1.00 25.02 ? 1129 GLU A CB  1 
ATOM   1068 C  CG  . GLU A 1 134 ? 12.088  28.416 -9.694  1.00 24.14 ? 1129 GLU A CG  1 
ATOM   1069 C  CD  . GLU A 1 134 ? 12.606  28.634 -11.114 1.00 24.41 ? 1129 GLU A CD  1 
ATOM   1070 O  OE1 . GLU A 1 134 ? 11.956  29.370 -11.882 1.00 23.75 ? 1129 GLU A OE1 1 
ATOM   1071 O  OE2 . GLU A 1 134 ? 13.668  28.094 -11.465 1.00 22.80 ? 1129 GLU A OE2 1 
ATOM   1072 N  N   . LYS A 1 135 ? 7.948   29.841 -7.974  1.00 25.77 ? 1130 LYS A N   1 
ATOM   1073 C  CA  . LYS A 1 135 ? 6.886   30.826 -7.858  1.00 26.34 ? 1130 LYS A CA  1 
ATOM   1074 C  C   . LYS A 1 135 ? 6.156   30.766 -6.514  1.00 26.82 ? 1130 LYS A C   1 
ATOM   1075 O  O   . LYS A 1 135 ? 5.131   31.424 -6.339  1.00 27.05 ? 1130 LYS A O   1 
ATOM   1076 C  CB  . LYS A 1 135 ? 5.898   30.693 -9.024  1.00 26.43 ? 1130 LYS A CB  1 
ATOM   1077 C  CG  . LYS A 1 135 ? 6.540   30.810 -10.391 1.00 26.20 ? 1130 LYS A CG  1 
ATOM   1078 C  CD  . LYS A 1 135 ? 7.446   32.048 -10.518 1.00 26.71 ? 1130 LYS A CD  1 
ATOM   1079 C  CE  . LYS A 1 135 ? 8.114   32.118 -11.891 1.00 27.23 ? 1130 LYS A CE  1 
ATOM   1080 N  NZ  . LYS A 1 135 ? 9.026   33.298 -12.027 1.00 26.11 ? 1130 LYS A NZ  1 
ATOM   1081 N  N   . ASN A 1 136 ? 6.718   30.011 -5.566  1.00 27.50 ? 1131 ASN A N   1 
ATOM   1082 C  CA  . ASN A 1 136 ? 6.216   29.925 -4.200  1.00 27.95 ? 1131 ASN A CA  1 
ATOM   1083 C  C   . ASN A 1 136 ? 4.712   29.558 -4.147  1.00 27.36 ? 1131 ASN A C   1 
ATOM   1084 O  O   . ASN A 1 136 ? 3.930   30.187 -3.431  1.00 27.00 ? 1131 ASN A O   1 
ATOM   1085 C  CB  . ASN A 1 136 ? 6.506   31.237 -3.449  1.00 28.67 ? 1131 ASN A CB  1 
ATOM   1086 C  CG  . ASN A 1 136 ? 8.013   31.569 -3.363  1.00 31.64 ? 1131 ASN A CG  1 
ATOM   1087 O  OD1 . ASN A 1 136 ? 8.780   30.899 -2.652  1.00 36.45 ? 1131 ASN A OD1 1 
ATOM   1088 N  ND2 . ASN A 1 136 ? 8.428   32.635 -4.055  1.00 35.51 ? 1131 ASN A ND2 1 
ATOM   1089 N  N   . VAL A 1 137 ? 4.327   28.536 -4.915  1.00 26.51 ? 1132 VAL A N   1 
ATOM   1090 C  CA  . VAL A 1 137 ? 2.951   28.027 -4.908  1.00 25.81 ? 1132 VAL A CA  1 
ATOM   1091 C  C   . VAL A 1 137 ? 2.693   27.233 -3.616  1.00 25.39 ? 1132 VAL A C   1 
ATOM   1092 O  O   . VAL A 1 137 ? 3.474   26.364 -3.255  1.00 25.54 ? 1132 VAL A O   1 
ATOM   1093 C  CB  . VAL A 1 137 ? 2.650   27.161 -6.195  1.00 26.03 ? 1132 VAL A CB  1 
ATOM   1094 C  CG1 . VAL A 1 137 ? 1.303   26.461 -6.096  1.00 25.18 ? 1132 VAL A CG1 1 
ATOM   1095 C  CG2 . VAL A 1 137 ? 2.702   28.026 -7.499  1.00 23.42 ? 1132 VAL A CG2 1 
ATOM   1096 N  N   . TYR A 1 138 ? 1.624   27.563 -2.898  1.00 24.97 ? 1133 TYR A N   1 
ATOM   1097 C  CA  . TYR A 1 138 ? 1.226   26.794 -1.708  1.00 24.79 ? 1133 TYR A CA  1 
ATOM   1098 C  C   . TYR A 1 138 ? -0.045  25.979 -1.933  1.00 24.45 ? 1133 TYR A C   1 
ATOM   1099 O  O   . TYR A 1 138 ? -0.273  25.008 -1.246  1.00 25.46 ? 1133 TYR A O   1 
ATOM   1100 C  CB  . TYR A 1 138 ? 1.064   27.704 -0.478  1.00 24.67 ? 1133 TYR A CB  1 
ATOM   1101 N  N   . ALA A 1 139 ? -0.876  26.365 -2.887  1.00 24.16 ? 1134 ALA A N   1 
ATOM   1102 C  CA  . ALA A 1 139 ? -2.085  25.616 -3.190  1.00 23.43 ? 1134 ALA A CA  1 
ATOM   1103 C  C   . ALA A 1 139 ? -2.101  25.234 -4.661  1.00 22.97 ? 1134 ALA A C   1 
ATOM   1104 O  O   . ALA A 1 139 ? -1.812  26.082 -5.516  1.00 22.96 ? 1134 ALA A O   1 
ATOM   1105 C  CB  . ALA A 1 139 ? -3.310  26.439 -2.842  1.00 23.29 ? 1134 ALA A CB  1 
ATOM   1106 N  N   . ILE A 1 140 ? -2.400  23.960 -4.938  1.00 22.22 ? 1135 ILE A N   1 
ATOM   1107 C  CA  . ILE A 1 140 ? -2.680  23.476 -6.294  1.00 22.45 ? 1135 ILE A CA  1 
ATOM   1108 C  C   . ILE A 1 140 ? -4.132  23.001 -6.402  1.00 22.67 ? 1135 ILE A C   1 
ATOM   1109 O  O   . ILE A 1 140 ? -4.653  22.311 -5.521  1.00 21.53 ? 1135 ILE A O   1 
ATOM   1110 C  CB  . ILE A 1 140 ? -1.745  22.317 -6.740  1.00 22.20 ? 1135 ILE A CB  1 
ATOM   1111 C  CG1 . ILE A 1 140 ? -0.275  22.698 -6.640  1.00 22.19 ? 1135 ILE A CG1 1 
ATOM   1112 C  CG2 . ILE A 1 140 ? -2.017  21.921 -8.183  1.00 21.63 ? 1135 ILE A CG2 1 
ATOM   1113 C  CD1 . ILE A 1 140 ? 0.666   21.510 -6.881  1.00 21.97 ? 1135 ILE A CD1 1 
ATOM   1114 N  N   . ILE A 1 141 ? -4.792  23.392 -7.491  1.00 24.12 ? 1136 ILE A N   1 
ATOM   1115 C  CA  . ILE A 1 141 ? -6.177  22.966 -7.763  1.00 24.62 ? 1136 ILE A CA  1 
ATOM   1116 C  C   . ILE A 1 141 ? -6.168  22.116 -9.013  1.00 24.68 ? 1136 ILE A C   1 
ATOM   1117 O  O   . ILE A 1 141 ? -5.784  22.579 -10.059 1.00 24.46 ? 1136 ILE A O   1 
ATOM   1118 C  CB  . ILE A 1 141 ? -7.114  24.156 -7.993  1.00 25.06 ? 1136 ILE A CB  1 
ATOM   1119 C  CG1 . ILE A 1 141 ? -6.996  25.186 -6.855  1.00 26.34 ? 1136 ILE A CG1 1 
ATOM   1120 C  CG2 . ILE A 1 141 ? -8.549  23.682 -8.227  1.00 25.47 ? 1136 ILE A CG2 1 
ATOM   1121 C  CD1 . ILE A 1 141 ? -7.008  24.631 -5.481  1.00 28.58 ? 1136 ILE A CD1 1 
ATOM   1122 N  N   . MET A 1 142 ? -6.588  20.867 -8.888  1.00 25.54 ? 1137 MET A N   1 
ATOM   1123 C  CA  . MET A 1 142 ? -6.604  19.938 -9.995  1.00 26.50 ? 1137 MET A CA  1 
ATOM   1124 C  C   . MET A 1 142 ? -8.035  19.511 -10.316 1.00 27.13 ? 1137 MET A C   1 
ATOM   1125 O  O   . MET A 1 142 ? -8.742  18.975 -9.477  1.00 27.01 ? 1137 MET A O   1 
ATOM   1126 C  CB  . MET A 1 142 ? -5.747  18.731 -9.643  1.00 26.68 ? 1137 MET A CB  1 
ATOM   1127 C  CG  . MET A 1 142 ? -5.746  17.665 -10.705 1.00 27.51 ? 1137 MET A CG  1 
ATOM   1128 S  SD  . MET A 1 142 ? -4.647  16.339 -10.244 1.00 27.77 ? 1137 MET A SD  1 
ATOM   1129 C  CE  . MET A 1 142 ? -4.952  15.210 -11.619 1.00 26.73 ? 1137 MET A CE  1 
ATOM   1130 N  N   . LEU A 1 143 ? -8.450  19.763 -11.549 1.00 28.31 ? 1138 LEU A N   1 
ATOM   1131 C  CA  . LEU A 1 143 ? -9.817  19.515 -11.987 1.00 29.36 ? 1138 LEU A CA  1 
ATOM   1132 C  C   . LEU A 1 143 ? -9.779  18.463 -13.090 1.00 29.74 ? 1138 LEU A C   1 
ATOM   1133 O  O   . LEU A 1 143 ? -9.174  18.687 -14.118 1.00 30.43 ? 1138 LEU A O   1 
ATOM   1134 C  CB  . LEU A 1 143 ? -10.428 20.823 -12.502 1.00 29.51 ? 1138 LEU A CB  1 
ATOM   1135 C  CG  . LEU A 1 143 ? -10.286 22.049 -11.581 1.00 29.48 ? 1138 LEU A CG  1 
ATOM   1136 C  CD1 . LEU A 1 143 ? -10.387 23.341 -12.382 1.00 26.44 ? 1138 LEU A CD1 1 
ATOM   1137 C  CD2 . LEU A 1 143 ? -11.318 22.012 -10.450 1.00 26.96 ? 1138 LEU A CD2 1 
ATOM   1138 N  N   . THR A 1 144 ? -10.403 17.313 -12.851 1.00 30.84 ? 1139 THR A N   1 
ATOM   1139 C  CA  . THR A 1 144 ? -10.293 16.130 -13.727 1.00 31.14 ? 1139 THR A CA  1 
ATOM   1140 C  C   . THR A 1 144 ? -11.570 15.292 -13.684 1.00 31.89 ? 1139 THR A C   1 
ATOM   1141 O  O   . THR A 1 144 ? -12.425 15.505 -12.817 1.00 32.51 ? 1139 THR A O   1 
ATOM   1142 C  CB  . THR A 1 144 ? -9.138  15.169 -13.282 1.00 31.13 ? 1139 THR A CB  1 
ATOM   1143 O  OG1 . THR A 1 144 ? -9.466  14.546 -12.030 1.00 30.62 ? 1139 THR A OG1 1 
ATOM   1144 C  CG2 . THR A 1 144 ? -7.803  15.895 -13.163 1.00 30.08 ? 1139 THR A CG2 1 
ATOM   1145 N  N   . LYS A 1 145 ? -11.693 14.336 -14.605 1.00 32.38 ? 1140 LYS A N   1 
ATOM   1146 C  CA  . LYS A 1 145 ? -12.677 13.264 -14.463 1.00 33.02 ? 1140 LYS A CA  1 
ATOM   1147 C  C   . LYS A 1 145 ? -12.064 11.918 -14.841 1.00 33.53 ? 1140 LYS A C   1 
ATOM   1148 O  O   . LYS A 1 145 ? -11.745 11.680 -16.008 1.00 34.49 ? 1140 LYS A O   1 
ATOM   1149 C  CB  . LYS A 1 145 ? -13.934 13.540 -15.293 1.00 33.39 ? 1140 LYS A CB  1 
ATOM   1150 C  CG  . LYS A 1 145 ? -15.173 12.786 -14.805 1.00 33.40 ? 1140 LYS A CG  1 
ATOM   1151 N  N   . GLU A 1 156 ? -1.124  10.533 -12.349 1.00 30.65 ? 1151 GLU A N   1 
ATOM   1152 C  CA  . GLU A 1 156 ? -0.571  11.258 -11.210 1.00 30.49 ? 1151 GLU A CA  1 
ATOM   1153 C  C   . GLU A 1 156 ? 0.761   11.939 -11.597 1.00 29.53 ? 1151 GLU A C   1 
ATOM   1154 O  O   . GLU A 1 156 ? 1.538   11.381 -12.356 1.00 30.06 ? 1151 GLU A O   1 
ATOM   1155 C  CB  . GLU A 1 156 ? -0.334  10.329 -10.005 1.00 30.48 ? 1151 GLU A CB  1 
ATOM   1156 C  CG  . GLU A 1 156 ? -1.351  9.222  -9.744  1.00 31.93 ? 1151 GLU A CG  1 
ATOM   1157 C  CD  . GLU A 1 156 ? -2.729  9.720  -9.393  1.00 33.85 ? 1151 GLU A CD  1 
ATOM   1158 N  N   . TYR A 1 157 ? 1.027   13.125 -11.059 1.00 28.09 ? 1152 TYR A N   1 
ATOM   1159 C  CA  . TYR A 1 157 ? 2.342   13.777 -11.214 1.00 27.05 ? 1152 TYR A CA  1 
ATOM   1160 C  C   . TYR A 1 157 ? 3.109   13.921 -9.888  1.00 27.23 ? 1152 TYR A C   1 
ATOM   1161 O  O   . TYR A 1 157 ? 4.155   14.569 -9.822  1.00 27.10 ? 1152 TYR A O   1 
ATOM   1162 C  CB  . TYR A 1 157 ? 2.181   15.144 -11.867 1.00 25.93 ? 1152 TYR A CB  1 
ATOM   1163 C  CG  . TYR A 1 157 ? 1.224   16.067 -11.169 1.00 24.85 ? 1152 TYR A CG  1 
ATOM   1164 C  CD1 . TYR A 1 157 ? 1.642   16.835 -10.087 1.00 22.37 ? 1152 TYR A CD1 1 
ATOM   1165 C  CD2 . TYR A 1 157 ? -0.090  16.206 -11.617 1.00 23.72 ? 1152 TYR A CD2 1 
ATOM   1166 C  CE1 . TYR A 1 157 ? 0.793   17.687 -9.458  1.00 22.72 ? 1152 TYR A CE1 1 
ATOM   1167 C  CE2 . TYR A 1 157 ? -0.960  17.065 -10.989 1.00 23.77 ? 1152 TYR A CE2 1 
ATOM   1168 C  CZ  . TYR A 1 157 ? -0.517  17.805 -9.902  1.00 23.67 ? 1152 TYR A CZ  1 
ATOM   1169 O  OH  . TYR A 1 157 ? -1.367  18.676 -9.262  1.00 23.12 ? 1152 TYR A OH  1 
ATOM   1170 N  N   . TRP A 1 158 ? 2.585   13.296 -8.845  1.00 27.25 ? 1153 TRP A N   1 
ATOM   1171 C  CA  . TRP A 1 158 ? 3.069   13.486 -7.489  1.00 27.39 ? 1153 TRP A CA  1 
ATOM   1172 C  C   . TRP A 1 158 ? 3.435   12.103 -6.968  1.00 28.28 ? 1153 TRP A C   1 
ATOM   1173 O  O   . TRP A 1 158 ? 2.963   11.106 -7.501  1.00 28.29 ? 1153 TRP A O   1 
ATOM   1174 C  CB  . TRP A 1 158 ? 1.977   14.143 -6.613  1.00 26.81 ? 1153 TRP A CB  1 
ATOM   1175 C  CG  . TRP A 1 158 ? 0.696   13.338 -6.550  1.00 25.83 ? 1153 TRP A CG  1 
ATOM   1176 C  CD1 . TRP A 1 158 ? 0.412   12.313 -5.690  1.00 25.67 ? 1153 TRP A CD1 1 
ATOM   1177 C  CD2 . TRP A 1 158 ? -0.441  13.464 -7.408  1.00 23.98 ? 1153 TRP A CD2 1 
ATOM   1178 N  NE1 . TRP A 1 158 ? -0.832  11.807 -5.953  1.00 25.70 ? 1153 TRP A NE1 1 
ATOM   1179 C  CE2 . TRP A 1 158 ? -1.377  12.489 -7.009  1.00 25.36 ? 1153 TRP A CE2 1 
ATOM   1180 C  CE3 . TRP A 1 158 ? -0.750  14.288 -8.491  1.00 25.23 ? 1153 TRP A CE3 1 
ATOM   1181 C  CZ2 . TRP A 1 158 ? -2.615  12.333 -7.641  1.00 25.67 ? 1153 TRP A CZ2 1 
ATOM   1182 C  CZ3 . TRP A 1 158 ? -1.985  14.136 -9.121  1.00 25.71 ? 1153 TRP A CZ3 1 
ATOM   1183 C  CH2 . TRP A 1 158 ? -2.903  13.168 -8.690  1.00 25.78 ? 1153 TRP A CH2 1 
ATOM   1184 N  N   . PRO A 1 159 ? 4.294   12.045 -5.947  1.00 29.57 ? 1154 PRO A N   1 
ATOM   1185 C  CA  . PRO A 1 159 ? 4.578   10.807 -5.277  1.00 30.74 ? 1154 PRO A CA  1 
ATOM   1186 C  C   . PRO A 1 159 ? 3.512   10.526 -4.234  1.00 31.98 ? 1154 PRO A C   1 
ATOM   1187 O  O   . PRO A 1 159 ? 2.787   11.443 -3.804  1.00 32.50 ? 1154 PRO A O   1 
ATOM   1188 C  CB  . PRO A 1 159 ? 5.912   11.087 -4.595  1.00 30.84 ? 1154 PRO A CB  1 
ATOM   1189 C  CG  . PRO A 1 159 ? 5.847   12.526 -4.272  1.00 30.51 ? 1154 PRO A CG  1 
ATOM   1190 C  CD  . PRO A 1 159 ? 5.032   13.170 -5.350  1.00 29.78 ? 1154 PRO A CD  1 
ATOM   1191 N  N   . SER A 1 160 ? 3.423   9.265  -3.837  1.00 33.20 ? 1155 SER A N   1 
ATOM   1192 C  CA  . SER A 1 160 ? 2.567   8.852  -2.727  1.00 34.10 ? 1155 SER A CA  1 
ATOM   1193 C  C   . SER A 1 160 ? 3.296   7.919  -1.775  1.00 34.58 ? 1155 SER A C   1 
ATOM   1194 O  O   . SER A 1 160 ? 3.180   8.063  -0.557  1.00 34.92 ? 1155 SER A O   1 
ATOM   1195 C  CB  . SER A 1 160 ? 1.301   8.191  -3.261  1.00 34.24 ? 1155 SER A CB  1 
ATOM   1196 O  OG  . SER A 1 160 ? 1.496   7.794  -4.605  1.00 35.78 ? 1155 SER A OG  1 
ATOM   1197 N  N   . LYS A 1 161 ? 4.048   6.968  -2.323  1.00 35.23 ? 1156 LYS A N   1 
ATOM   1198 C  CA  . LYS A 1 161 ? 4.698   5.946  -1.508  1.00 35.85 ? 1156 LYS A CA  1 
ATOM   1199 C  C   . LYS A 1 161 ? 5.890   6.522  -0.719  1.00 35.98 ? 1156 LYS A C   1 
ATOM   1200 O  O   . LYS A 1 161 ? 5.920   6.442  0.518   1.00 36.26 ? 1156 LYS A O   1 
ATOM   1201 C  CB  . LYS A 1 161 ? 5.134   4.757  -2.386  1.00 36.09 ? 1156 LYS A CB  1 
ATOM   1202 N  N   . GLN A 1 162 ? 6.871   7.065  -1.444  1.00 35.59 ? 1157 GLN A N   1 
ATOM   1203 C  CA  . GLN A 1 162 ? 8.022   7.746  -0.832  1.00 35.37 ? 1157 GLN A CA  1 
ATOM   1204 C  C   . GLN A 1 162 ? 8.384   8.980  -1.652  1.00 34.50 ? 1157 GLN A C   1 
ATOM   1205 O  O   . GLN A 1 162 ? 7.736   9.265  -2.653  1.00 34.28 ? 1157 GLN A O   1 
ATOM   1206 C  CB  . GLN A 1 162 ? 9.250   6.810  -0.639  1.00 35.68 ? 1157 GLN A CB  1 
ATOM   1207 C  CG  . GLN A 1 162 ? 9.248   5.468  -1.386  1.00 37.14 ? 1157 GLN A CG  1 
ATOM   1208 C  CD  . GLN A 1 162 ? 9.398   5.618  -2.883  1.00 39.01 ? 1157 GLN A CD  1 
ATOM   1209 O  OE1 . GLN A 1 162 ? 8.441   5.961  -3.578  1.00 41.66 ? 1157 GLN A OE1 1 
ATOM   1210 N  NE2 . GLN A 1 162 ? 10.599  5.354  -3.393  1.00 39.95 ? 1157 GLN A NE2 1 
ATOM   1211 N  N   . ALA A 1 163 ? 9.402   9.710  -1.204  1.00 33.69 ? 1158 ALA A N   1 
ATOM   1212 C  CA  . ALA A 1 163 ? 9.835   10.929 -1.864  1.00 33.46 ? 1158 ALA A CA  1 
ATOM   1213 C  C   . ALA A 1 163 ? 10.379  10.642 -3.267  1.00 32.99 ? 1158 ALA A C   1 
ATOM   1214 O  O   . ALA A 1 163 ? 11.059  9.637  -3.479  1.00 32.74 ? 1158 ALA A O   1 
ATOM   1215 C  CB  . ALA A 1 163 ? 10.884  11.659 -1.005  1.00 33.22 ? 1158 ALA A CB  1 
ATOM   1216 N  N   . GLN A 1 164 ? 10.029  11.505 -4.223  1.00 32.51 ? 1159 GLN A N   1 
ATOM   1217 C  CA  . GLN A 1 164 ? 10.597  11.470 -5.576  1.00 32.38 ? 1159 GLN A CA  1 
ATOM   1218 C  C   . GLN A 1 164 ? 11.268  12.791 -5.907  1.00 31.97 ? 1159 GLN A C   1 
ATOM   1219 O  O   . GLN A 1 164 ? 10.742  13.873 -5.606  1.00 31.67 ? 1159 GLN A O   1 
ATOM   1220 C  CB  A GLN A 1 164 ? 9.506   11.146 -6.612  0.50 32.50 ? 1159 GLN A CB  1 
ATOM   1221 C  CB  B GLN A 1 164 ? 9.530   11.162 -6.638  0.50 32.52 ? 1159 GLN A CB  1 
ATOM   1222 C  CG  A GLN A 1 164 ? 9.249   9.641  -6.789  0.50 32.92 ? 1159 GLN A CG  1 
ATOM   1223 C  CG  B GLN A 1 164 ? 9.542   9.721  -7.152  0.50 33.05 ? 1159 GLN A CG  1 
ATOM   1224 C  CD  A GLN A 1 164 ? 7.817   9.304  -7.187  0.50 32.66 ? 1159 GLN A CD  1 
ATOM   1225 C  CD  B GLN A 1 164 ? 10.713  9.430  -8.084  0.50 32.83 ? 1159 GLN A CD  1 
ATOM   1226 O  OE1 A GLN A 1 164 ? 7.334   9.722  -8.239  0.50 32.02 ? 1159 GLN A OE1 1 
ATOM   1227 O  OE1 B GLN A 1 164 ? 11.636  8.697  -7.734  0.50 32.56 ? 1159 GLN A OE1 1 
ATOM   1228 N  NE2 A GLN A 1 164 ? 7.138   8.529  -6.345  0.50 32.98 ? 1159 GLN A NE2 1 
ATOM   1229 N  NE2 B GLN A 1 164 ? 10.674  10.008 -9.274  0.50 33.71 ? 1159 GLN A NE2 1 
ATOM   1230 N  N   . ASP A 1 165 ? 12.430  12.699 -6.540  1.00 31.88 ? 1160 ASP A N   1 
ATOM   1231 C  CA  . ASP A 1 165 ? 13.083  13.871 -7.117  1.00 31.72 ? 1160 ASP A CA  1 
ATOM   1232 C  C   . ASP A 1 165 ? 12.587  14.109 -8.529  1.00 31.27 ? 1160 ASP A C   1 
ATOM   1233 O  O   . ASP A 1 165 ? 12.460  13.180 -9.320  1.00 30.82 ? 1160 ASP A O   1 
ATOM   1234 C  CB  . ASP A 1 165 ? 14.607  13.733 -7.092  1.00 31.56 ? 1160 ASP A CB  1 
ATOM   1235 C  CG  . ASP A 1 165 ? 15.148  13.594 -5.681  1.00 32.34 ? 1160 ASP A CG  1 
ATOM   1236 O  OD1 . ASP A 1 165 ? 14.423  13.954 -4.718  1.00 31.41 ? 1160 ASP A OD1 1 
ATOM   1237 O  OD2 . ASP A 1 165 ? 16.291  13.107 -5.528  1.00 33.82 ? 1160 ASP A OD2 1 
ATOM   1238 N  N   . TYR A 1 166 ? 12.264  15.371 -8.797  1.00 31.37 ? 1161 TYR A N   1 
ATOM   1239 C  CA  . TYR A 1 166 ? 11.952  15.870 -10.123 1.00 31.27 ? 1161 TYR A CA  1 
ATOM   1240 C  C   . TYR A 1 166 ? 12.933  17.008 -10.369 1.00 31.40 ? 1161 TYR A C   1 
ATOM   1241 O  O   . TYR A 1 166 ? 12.688  18.135 -9.960  1.00 31.91 ? 1161 TYR A O   1 
ATOM   1242 C  CB  . TYR A 1 166 ? 10.511  16.382 -10.169 1.00 31.03 ? 1161 TYR A CB  1 
ATOM   1243 C  CG  . TYR A 1 166 ? 9.481   15.389 -9.677  1.00 30.76 ? 1161 TYR A CG  1 
ATOM   1244 C  CD1 . TYR A 1 166 ? 8.859   14.508 -10.563 1.00 30.91 ? 1161 TYR A CD1 1 
ATOM   1245 C  CD2 . TYR A 1 166 ? 9.126   15.330 -8.328  1.00 30.13 ? 1161 TYR A CD2 1 
ATOM   1246 C  CE1 . TYR A 1 166 ? 7.908   13.594 -10.119 1.00 30.50 ? 1161 TYR A CE1 1 
ATOM   1247 C  CE2 . TYR A 1 166 ? 8.180   14.407 -7.868  1.00 30.18 ? 1161 TYR A CE2 1 
ATOM   1248 C  CZ  . TYR A 1 166 ? 7.571   13.550 -8.769  1.00 30.68 ? 1161 TYR A CZ  1 
ATOM   1249 O  OH  . TYR A 1 166 ? 6.634   12.644 -8.331  1.00 30.50 ? 1161 TYR A OH  1 
ATOM   1250 N  N   . GLY A 1 167 ? 14.073  16.704 -10.982 1.00 31.57 ? 1162 GLY A N   1 
ATOM   1251 C  CA  . GLY A 1 167 ? 15.124  17.707 -11.168 1.00 31.55 ? 1162 GLY A CA  1 
ATOM   1252 C  C   . GLY A 1 167 ? 15.837  17.972 -9.857  1.00 31.62 ? 1162 GLY A C   1 
ATOM   1253 O  O   . GLY A 1 167 ? 16.300  17.032 -9.205  1.00 31.64 ? 1162 GLY A O   1 
ATOM   1254 N  N   . ASP A 1 168 ? 15.923  19.244 -9.453  1.00 31.51 ? 1163 ASP A N   1 
ATOM   1255 C  CA  . ASP A 1 168 ? 16.569  19.596 -8.174  1.00 31.03 ? 1163 ASP A CA  1 
ATOM   1256 C  C   . ASP A 1 168 ? 15.547  19.780 -7.027  1.00 30.22 ? 1163 ASP A C   1 
ATOM   1257 O  O   . ASP A 1 168 ? 15.909  20.236 -5.948  1.00 30.26 ? 1163 ASP A O   1 
ATOM   1258 C  CB  . ASP A 1 168 ? 17.452  20.847 -8.332  1.00 31.45 ? 1163 ASP A CB  1 
ATOM   1259 C  CG  . ASP A 1 168 ? 18.535  20.690 -9.418  1.00 31.86 ? 1163 ASP A CG  1 
ATOM   1260 O  OD1 . ASP A 1 168 ? 19.396  19.791 -9.314  1.00 34.30 ? 1163 ASP A OD1 1 
ATOM   1261 O  OD2 . ASP A 1 168 ? 18.539  21.496 -10.376 1.00 34.43 ? 1163 ASP A OD2 1 
ATOM   1262 N  N   . ILE A 1 169 ? 14.289  19.387 -7.258  1.00 29.28 ? 1164 ILE A N   1 
ATOM   1263 C  CA  . ILE A 1 169 ? 13.205  19.458 -6.256  1.00 28.34 ? 1164 ILE A CA  1 
ATOM   1264 C  C   . ILE A 1 169 ? 12.821  18.043 -5.814  1.00 27.62 ? 1164 ILE A C   1 
ATOM   1265 O  O   . ILE A 1 169 ? 12.601  17.176 -6.654  1.00 27.38 ? 1164 ILE A O   1 
ATOM   1266 C  CB  . ILE A 1 169 ? 11.923  20.133 -6.849  1.00 28.16 ? 1164 ILE A CB  1 
ATOM   1267 C  CG1 . ILE A 1 169 ? 12.215  21.552 -7.354  1.00 29.11 ? 1164 ILE A CG1 1 
ATOM   1268 C  CG2 . ILE A 1 169 ? 10.790  20.185 -5.833  1.00 27.61 ? 1164 ILE A CG2 1 
ATOM   1269 C  CD1 . ILE A 1 169 ? 12.745  22.499 -6.289  1.00 29.83 ? 1164 ILE A CD1 1 
ATOM   1270 N  N   . THR A 1 170 ? 12.739  17.828 -4.498  1.00 26.87 ? 1165 THR A N   1 
ATOM   1271 C  CA  . THR A 1 170 ? 12.216  16.595 -3.909  1.00 25.93 ? 1165 THR A CA  1 
ATOM   1272 C  C   . THR A 1 170 ? 10.789  16.824 -3.439  1.00 25.31 ? 1165 THR A C   1 
ATOM   1273 O  O   . THR A 1 170 ? 10.535  17.791 -2.717  1.00 25.30 ? 1165 THR A O   1 
ATOM   1274 C  CB  . THR A 1 170 ? 13.041  16.162 -2.686  1.00 26.02 ? 1165 THR A CB  1 
ATOM   1275 O  OG1 . THR A 1 170 ? 14.422  16.062 -3.047  1.00 26.23 ? 1165 THR A OG1 1 
ATOM   1276 C  CG2 . THR A 1 170 ? 12.553  14.810 -2.143  1.00 25.04 ? 1165 THR A CG2 1 
ATOM   1277 N  N   . VAL A 1 171 ? 9.864   15.940 -3.839  1.00 24.37 ? 1166 VAL A N   1 
ATOM   1278 C  CA  . VAL A 1 171 ? 8.473   15.984 -3.341  1.00 23.32 ? 1166 VAL A CA  1 
ATOM   1279 C  C   . VAL A 1 171 ? 8.140   14.771 -2.474  1.00 23.47 ? 1166 VAL A C   1 
ATOM   1280 O  O   . VAL A 1 171 ? 8.454   13.648 -2.821  1.00 23.59 ? 1166 VAL A O   1 
ATOM   1281 C  CB  . VAL A 1 171 ? 7.441   16.088 -4.473  1.00 23.13 ? 1166 VAL A CB  1 
ATOM   1282 C  CG1 . VAL A 1 171 ? 6.050   16.279 -3.900  1.00 20.61 ? 1166 VAL A CG1 1 
ATOM   1283 C  CG2 . VAL A 1 171 ? 7.818   17.229 -5.412  1.00 21.70 ? 1166 VAL A CG2 1 
ATOM   1284 N  N   . ALA A 1 172 ? 7.507   15.031 -1.332  1.00 23.49 ? 1167 ALA A N   1 
ATOM   1285 C  CA  . ALA A 1 172 ? 7.101   14.013 -0.389  1.00 23.49 ? 1167 ALA A CA  1 
ATOM   1286 C  C   . ALA A 1 172 ? 5.654   14.277 0.041   1.00 23.81 ? 1167 ALA A C   1 
ATOM   1287 O  O   . ALA A 1 172 ? 5.303   15.399 0.418   1.00 23.75 ? 1167 ALA A O   1 
ATOM   1288 C  CB  . ALA A 1 172 ? 8.020   14.033 0.820   1.00 23.01 ? 1167 ALA A CB  1 
ATOM   1289 N  N   . MET A 1 173 ? 4.823   13.241 0.006   1.00 23.65 ? 1168 MET A N   1 
ATOM   1290 C  CA  . MET A 1 173 ? 3.444   13.373 0.461   1.00 23.89 ? 1168 MET A CA  1 
ATOM   1291 C  C   . MET A 1 173 ? 3.376   13.265 1.979   1.00 22.21 ? 1168 MET A C   1 
ATOM   1292 O  O   . MET A 1 173 ? 4.032   12.420 2.564   1.00 21.25 ? 1168 MET A O   1 
ATOM   1293 C  CB  . MET A 1 173 ? 2.559   12.310 -0.184  1.00 24.00 ? 1168 MET A CB  1 
ATOM   1294 C  CG  . MET A 1 173 ? 1.080   12.445 0.147   1.00 25.29 ? 1168 MET A CG  1 
ATOM   1295 S  SD  . MET A 1 173 ? 0.104   11.154 -0.648  1.00 26.85 ? 1168 MET A SD  1 
ATOM   1296 C  CE  . MET A 1 173 ? -0.186  11.941 -2.168  1.00 20.34 ? 1168 MET A CE  1 
ATOM   1297 N  N   . THR A 1 174 ? 2.589   14.142 2.605   1.00 21.29 ? 1169 THR A N   1 
ATOM   1298 C  CA  . THR A 1 174 ? 2.438   14.133 4.062   1.00 20.96 ? 1169 THR A CA  1 
ATOM   1299 C  C   . THR A 1 174 ? 0.997   13.842 4.528   1.00 20.88 ? 1169 THR A C   1 
ATOM   1300 O  O   . THR A 1 174 ? 0.763   13.585 5.698   1.00 20.17 ? 1169 THR A O   1 
ATOM   1301 C  CB  . THR A 1 174 ? 2.916   15.471 4.659   1.00 20.95 ? 1169 THR A CB  1 
ATOM   1302 O  OG1 . THR A 1 174 ? 2.153   16.533 4.094   1.00 18.58 ? 1169 THR A OG1 1 
ATOM   1303 C  CG2 . THR A 1 174 ? 4.390   15.707 4.349   1.00 21.17 ? 1169 THR A CG2 1 
ATOM   1304 N  N   . SER A 1 175 ? 0.029   13.898 3.615   1.00 21.05 ? 1170 SER A N   1 
ATOM   1305 C  CA  . SER A 1 175 ? -1.359  13.588 3.966   1.00 21.24 ? 1170 SER A CA  1 
ATOM   1306 C  C   . SER A 1 175 ? -2.153  13.357 2.694   1.00 21.00 ? 1170 SER A C   1 
ATOM   1307 O  O   . SER A 1 175 ? -1.883  13.999 1.696   1.00 20.97 ? 1170 SER A O   1 
ATOM   1308 C  CB  . SER A 1 175 ? -1.993  14.743 4.766   1.00 21.13 ? 1170 SER A CB  1 
ATOM   1309 O  OG  . SER A 1 175 ? -3.259  14.388 5.291   1.00 21.48 ? 1170 SER A OG  1 
ATOM   1310 N  N   . GLU A 1 176 ? -3.111  12.432 2.749   1.00 21.12 ? 1171 GLU A N   1 
ATOM   1311 C  CA  . GLU A 1 176 ? -4.104  12.233 1.697   1.00 21.65 ? 1171 GLU A CA  1 
ATOM   1312 C  C   . GLU A 1 176 ? -5.458  11.967 2.313   1.00 21.60 ? 1171 GLU A C   1 
ATOM   1313 O  O   . GLU A 1 176 ? -5.626  10.965 2.992   1.00 22.21 ? 1171 GLU A O   1 
ATOM   1314 C  CB  . GLU A 1 176 ? -3.717  11.046 0.800   1.00 21.87 ? 1171 GLU A CB  1 
ATOM   1315 C  CG  . GLU A 1 176 ? -4.610  10.843 -0.437  1.00 21.41 ? 1171 GLU A CG  1 
ATOM   1316 C  CD  . GLU A 1 176 ? -4.020  9.827  -1.401  1.00 22.13 ? 1171 GLU A CD  1 
ATOM   1317 O  OE1 . GLU A 1 176 ? -3.625  8.743  -0.943  1.00 21.17 ? 1171 GLU A OE1 1 
ATOM   1318 O  OE2 . GLU A 1 176 ? -3.916  10.118 -2.617  1.00 25.27 ? 1171 GLU A OE2 1 
ATOM   1319 N  N   . ILE A 1 177 ? -6.415  12.863 2.092   1.00 22.13 ? 1172 ILE A N   1 
ATOM   1320 C  CA  . ILE A 1 177 ? -7.796  12.645 2.536   1.00 22.43 ? 1172 ILE A CA  1 
ATOM   1321 C  C   . ILE A 1 177 ? -8.713  12.525 1.314   1.00 23.01 ? 1172 ILE A C   1 
ATOM   1322 O  O   . ILE A 1 177 ? -8.924  13.503 0.561   1.00 21.71 ? 1172 ILE A O   1 
ATOM   1323 C  CB  . ILE A 1 177 ? -8.350  13.761 3.495   1.00 22.64 ? 1172 ILE A CB  1 
ATOM   1324 C  CG1 . ILE A 1 177 ? -7.309  14.199 4.537   1.00 22.30 ? 1172 ILE A CG1 1 
ATOM   1325 C  CG2 . ILE A 1 177 ? -9.613  13.244 4.225   1.00 22.65 ? 1172 ILE A CG2 1 
ATOM   1326 C  CD1 . ILE A 1 177 ? -6.983  13.154 5.573   1.00 20.89 ? 1172 ILE A CD1 1 
ATOM   1327 N  N   . VAL A 1 178 ? -9.243  11.311 1.115   1.00 23.48 ? 1173 VAL A N   1 
ATOM   1328 C  CA  . VAL A 1 178 ? -10.184 11.058 0.023   1.00 23.99 ? 1173 VAL A CA  1 
ATOM   1329 C  C   . VAL A 1 178 ? -11.624 11.225 0.504   1.00 24.18 ? 1173 VAL A C   1 
ATOM   1330 O  O   . VAL A 1 178 ? -12.063 10.557 1.436   1.00 24.58 ? 1173 VAL A O   1 
ATOM   1331 C  CB  . VAL A 1 178 ? -9.985  9.668  -0.603  1.00 24.28 ? 1173 VAL A CB  1 
ATOM   1332 C  CG1 . VAL A 1 178 ? -11.017 9.432  -1.709  1.00 24.65 ? 1173 VAL A CG1 1 
ATOM   1333 C  CG2 . VAL A 1 178 ? -8.571  9.538  -1.161  1.00 23.68 ? 1173 VAL A CG2 1 
ATOM   1334 N  N   . LEU A 1 179 ? -12.335 12.142 -0.145  1.00 24.77 ? 1174 LEU A N   1 
ATOM   1335 C  CA  . LEU A 1 179 ? -13.749 12.409 0.095   1.00 25.29 ? 1174 LEU A CA  1 
ATOM   1336 C  C   . LEU A 1 179 ? -14.522 12.040 -1.182  1.00 25.70 ? 1174 LEU A C   1 
ATOM   1337 O  O   . LEU A 1 179 ? -13.912 11.742 -2.214  1.00 25.79 ? 1174 LEU A O   1 
ATOM   1338 C  CB  . LEU A 1 179 ? -13.952 13.886 0.516   1.00 25.30 ? 1174 LEU A CB  1 
ATOM   1339 C  CG  . LEU A 1 179 ? -13.406 14.196 1.925   1.00 25.19 ? 1174 LEU A CG  1 
ATOM   1340 C  CD1 . LEU A 1 179 ? -13.083 15.651 2.203   1.00 24.80 ? 1174 LEU A CD1 1 
ATOM   1341 C  CD2 . LEU A 1 179 ? -14.400 13.681 2.950   1.00 26.53 ? 1174 LEU A CD2 1 
ATOM   1342 N  N   . PRO A 1 180 ? -15.863 11.971 -1.103  1.00 26.42 ? 1175 PRO A N   1 
ATOM   1343 C  CA  . PRO A 1 180 ? -16.645 11.544 -2.272  1.00 26.25 ? 1175 PRO A CA  1 
ATOM   1344 C  C   . PRO A 1 180 ? -16.471 12.413 -3.509  1.00 26.00 ? 1175 PRO A C   1 
ATOM   1345 O  O   . PRO A 1 180 ? -16.254 11.887 -4.598  1.00 26.36 ? 1175 PRO A O   1 
ATOM   1346 C  CB  . PRO A 1 180 ? -18.090 11.590 -1.759  1.00 26.47 ? 1175 PRO A CB  1 
ATOM   1347 C  CG  . PRO A 1 180 ? -17.948 11.359 -0.273  1.00 26.41 ? 1175 PRO A CG  1 
ATOM   1348 C  CD  . PRO A 1 180 ? -16.730 12.168 0.077   1.00 26.62 ? 1175 PRO A CD  1 
ATOM   1349 N  N   . GLU A 1 181 ? -16.536 13.727 -3.335  1.00 25.71 ? 1176 GLU A N   1 
ATOM   1350 C  CA  . GLU A 1 181 ? -16.448 14.657 -4.451  1.00 25.08 ? 1176 GLU A CA  1 
ATOM   1351 C  C   . GLU A 1 181 ? -15.014 15.142 -4.766  1.00 24.49 ? 1176 GLU A C   1 
ATOM   1352 O  O   . GLU A 1 181 ? -14.732 15.551 -5.912  1.00 24.00 ? 1176 GLU A O   1 
ATOM   1353 C  CB  . GLU A 1 181 ? -17.374 15.844 -4.170  1.00 25.71 ? 1176 GLU A CB  1 
ATOM   1354 N  N   . TRP A 1 182 ? -14.121 15.092 -3.768  1.00 23.43 ? 1177 TRP A N   1 
ATOM   1355 C  CA  . TRP A 1 182 ? -12.775 15.640 -3.903  1.00 22.77 ? 1177 TRP A CA  1 
ATOM   1356 C  C   . TRP A 1 182 ? -11.743 15.009 -2.970  1.00 22.21 ? 1177 TRP A C   1 
ATOM   1357 O  O   . TRP A 1 182 ? -12.083 14.442 -1.936  1.00 21.46 ? 1177 TRP A O   1 
ATOM   1358 C  CB  . TRP A 1 182 ? -12.778 17.173 -3.703  1.00 23.22 ? 1177 TRP A CB  1 
ATOM   1359 C  CG  . TRP A 1 182 ? -13.580 17.638 -2.543  1.00 23.40 ? 1177 TRP A CG  1 
ATOM   1360 C  CD1 . TRP A 1 182 ? -13.286 17.466 -1.233  1.00 24.14 ? 1177 TRP A CD1 1 
ATOM   1361 C  CD2 . TRP A 1 182 ? -14.837 18.325 -2.587  1.00 23.11 ? 1177 TRP A CD2 1 
ATOM   1362 N  NE1 . TRP A 1 182 ? -14.270 18.016 -0.449  1.00 24.10 ? 1177 TRP A NE1 1 
ATOM   1363 C  CE2 . TRP A 1 182 ? -15.233 18.552 -1.259  1.00 23.18 ? 1177 TRP A CE2 1 
ATOM   1364 C  CE3 . TRP A 1 182 ? -15.660 18.779 -3.627  1.00 23.68 ? 1177 TRP A CE3 1 
ATOM   1365 C  CZ2 . TRP A 1 182 ? -16.425 19.208 -0.932  1.00 24.35 ? 1177 TRP A CZ2 1 
ATOM   1366 C  CZ3 . TRP A 1 182 ? -16.830 19.431 -3.309  1.00 23.31 ? 1177 TRP A CZ3 1 
ATOM   1367 C  CH2 . TRP A 1 182 ? -17.204 19.649 -1.971  1.00 24.07 ? 1177 TRP A CH2 1 
ATOM   1368 N  N   . THR A 1 183 ? -10.474 15.117 -3.367  1.00 21.62 ? 1178 THR A N   1 
ATOM   1369 C  CA  . THR A 1 183 ? -9.356  14.672 -2.548  1.00 21.62 ? 1178 THR A CA  1 
ATOM   1370 C  C   . THR A 1 183 ? -8.426  15.844 -2.182  1.00 21.33 ? 1178 THR A C   1 
ATOM   1371 O  O   . THR A 1 183 ? -8.257  16.774 -2.959  1.00 21.50 ? 1178 THR A O   1 
ATOM   1372 C  CB  . THR A 1 183 ? -8.590  13.514 -3.242  1.00 21.44 ? 1178 THR A CB  1 
ATOM   1373 O  OG1 . THR A 1 183 ? -9.489  12.425 -3.408  1.00 21.33 ? 1178 THR A OG1 1 
ATOM   1374 C  CG2 . THR A 1 183 ? -7.402  13.027 -2.420  1.00 20.44 ? 1178 THR A CG2 1 
ATOM   1375 N  N   . ILE A 1 184 ? -7.881  15.793 -0.965  1.00 21.63 ? 1179 ILE A N   1 
ATOM   1376 C  CA  . ILE A 1 184 ? -6.957  16.793 -0.436  1.00 22.07 ? 1179 ILE A CA  1 
ATOM   1377 C  C   . ILE A 1 184 ? -5.649  16.116 -0.092  1.00 21.77 ? 1179 ILE A C   1 
ATOM   1378 O  O   . ILE A 1 184 ? -5.610  15.259 0.800   1.00 21.98 ? 1179 ILE A O   1 
ATOM   1379 C  CB  . ILE A 1 184 ? -7.472  17.459 0.882   1.00 22.35 ? 1179 ILE A CB  1 
ATOM   1380 C  CG1 . ILE A 1 184 ? -8.919  17.948 0.752   1.00 22.79 ? 1179 ILE A CG1 1 
ATOM   1381 C  CG2 . ILE A 1 184 ? -6.581  18.642 1.256   1.00 22.11 ? 1179 ILE A CG2 1 
ATOM   1382 C  CD1 . ILE A 1 184 ? -9.530  18.318 2.101   1.00 23.28 ? 1179 ILE A CD1 1 
ATOM   1383 N  N   . ARG A 1 185 ? -4.581  16.506 -0.780  1.00 21.64 ? 1180 ARG A N   1 
ATOM   1384 C  CA  . ARG A 1 185 ? -3.258  15.947 -0.529  1.00 21.74 ? 1180 ARG A CA  1 
ATOM   1385 C  C   . ARG A 1 185 ? -2.317  17.049 -0.045  1.00 21.77 ? 1180 ARG A C   1 
ATOM   1386 O  O   . ARG A 1 185 ? -2.323  18.152 -0.584  1.00 20.80 ? 1180 ARG A O   1 
ATOM   1387 C  CB  . ARG A 1 185 ? -2.680  15.288 -1.799  1.00 21.78 ? 1180 ARG A CB  1 
ATOM   1388 C  CG  . ARG A 1 185 ? -3.614  14.297 -2.462  1.00 21.51 ? 1180 ARG A CG  1 
ATOM   1389 C  CD  . ARG A 1 185 ? -2.952  13.521 -3.602  1.00 21.83 ? 1180 ARG A CD  1 
ATOM   1390 N  NE  . ARG A 1 185 ? -3.863  12.514 -4.190  1.00 22.20 ? 1180 ARG A NE  1 
ATOM   1391 C  CZ  . ARG A 1 185 ? -4.854  12.785 -5.042  1.00 20.90 ? 1180 ARG A CZ  1 
ATOM   1392 N  NH1 . ARG A 1 185 ? -5.087  14.023 -5.457  1.00 20.52 ? 1180 ARG A NH1 1 
ATOM   1393 N  NH2 . ARG A 1 185 ? -5.602  11.799 -5.507  1.00 20.37 ? 1180 ARG A NH2 1 
ATOM   1394 N  N   . ASP A 1 186 ? -1.505  16.723 0.963   1.00 21.69 ? 1181 ASP A N   1 
ATOM   1395 C  CA  . ASP A 1 186 ? -0.462  17.617 1.445   1.00 22.04 ? 1181 ASP A CA  1 
ATOM   1396 C  C   . ASP A 1 186 ? 0.921   17.112 1.028   1.00 22.21 ? 1181 ASP A C   1 
ATOM   1397 O  O   . ASP A 1 186 ? 1.194   15.920 1.088   1.00 22.22 ? 1181 ASP A O   1 
ATOM   1398 C  CB  . ASP A 1 186 ? -0.491  17.702 2.964   1.00 22.00 ? 1181 ASP A CB  1 
ATOM   1399 C  CG  . ASP A 1 186 ? -1.593  18.575 3.492   1.00 22.57 ? 1181 ASP A CG  1 
ATOM   1400 O  OD1 . ASP A 1 186 ? -2.680  18.659 2.894   1.00 22.82 ? 1181 ASP A OD1 1 
ATOM   1401 O  OD2 . ASP A 1 186 ? -1.364  19.168 4.564   1.00 27.17 ? 1181 ASP A OD2 1 
ATOM   1402 N  N   . PHE A 1 187 ? 1.799   18.031 0.637   1.00 22.57 ? 1182 PHE A N   1 
ATOM   1403 C  CA  . PHE A 1 187 ? 3.177   17.693 0.317   1.00 22.94 ? 1182 PHE A CA  1 
ATOM   1404 C  C   . PHE A 1 187 ? 4.180   18.660 0.947   1.00 23.58 ? 1182 PHE A C   1 
ATOM   1405 O  O   . PHE A 1 187 ? 3.823   19.715 1.479   1.00 23.47 ? 1182 PHE A O   1 
ATOM   1406 C  CB  . PHE A 1 187 ? 3.406   17.719 -1.188  1.00 22.82 ? 1182 PHE A CB  1 
ATOM   1407 C  CG  . PHE A 1 187 ? 2.444   16.883 -1.982  1.00 22.88 ? 1182 PHE A CG  1 
ATOM   1408 C  CD1 . PHE A 1 187 ? 2.725   15.543 -2.252  1.00 21.45 ? 1182 PHE A CD1 1 
ATOM   1409 C  CD2 . PHE A 1 187 ? 1.285   17.446 -2.510  1.00 22.50 ? 1182 PHE A CD2 1 
ATOM   1410 C  CE1 . PHE A 1 187 ? 1.861   14.782 -2.997  1.00 21.56 ? 1182 PHE A CE1 1 
ATOM   1411 C  CE2 . PHE A 1 187 ? 0.399   16.673 -3.254  1.00 22.49 ? 1182 PHE A CE2 1 
ATOM   1412 C  CZ  . PHE A 1 187 ? 0.693   15.344 -3.506  1.00 21.66 ? 1182 PHE A CZ  1 
ATOM   1413 N  N   . THR A 1 188 ? 5.443   18.255 0.895   1.00 24.53 ? 1183 THR A N   1 
ATOM   1414 C  CA  . THR A 1 188 ? 6.574   19.155 1.080   1.00 25.37 ? 1183 THR A CA  1 
ATOM   1415 C  C   . THR A 1 188 ? 7.317   19.235 -0.242  1.00 26.20 ? 1183 THR A C   1 
ATOM   1416 O  O   . THR A 1 188 ? 7.422   18.245 -0.954  1.00 26.02 ? 1183 THR A O   1 
ATOM   1417 C  CB  . THR A 1 188 ? 7.544   18.671 2.172   1.00 25.10 ? 1183 THR A CB  1 
ATOM   1418 O  OG1 . THR A 1 188 ? 8.025   17.361 1.842   1.00 24.31 ? 1183 THR A OG1 1 
ATOM   1419 C  CG2 . THR A 1 188 ? 6.852   18.656 3.529   1.00 25.35 ? 1183 THR A CG2 1 
ATOM   1420 N  N   . VAL A 1 189 ? 7.818   20.420 -0.566  1.00 27.91 ? 1184 VAL A N   1 
ATOM   1421 C  CA  . VAL A 1 189 ? 8.560   20.657 -1.802  1.00 29.22 ? 1184 VAL A CA  1 
ATOM   1422 C  C   . VAL A 1 189 ? 9.896   21.257 -1.379  1.00 30.15 ? 1184 VAL A C   1 
ATOM   1423 O  O   . VAL A 1 189 ? 9.935   22.356 -0.831  1.00 30.34 ? 1184 VAL A O   1 
ATOM   1424 C  CB  . VAL A 1 189 ? 7.777   21.619 -2.725  1.00 29.45 ? 1184 VAL A CB  1 
ATOM   1425 C  CG1 . VAL A 1 189 ? 8.464   21.788 -4.092  1.00 29.50 ? 1184 VAL A CG1 1 
ATOM   1426 C  CG2 . VAL A 1 189 ? 6.360   21.106 -2.910  1.00 30.35 ? 1184 VAL A CG2 1 
ATOM   1427 N  N   . LYS A 1 190 ? 10.979  20.520 -1.599  1.00 31.36 ? 1185 LYS A N   1 
ATOM   1428 C  CA  . LYS A 1 190 ? 12.283  20.879 -1.048  1.00 32.46 ? 1185 LYS A CA  1 
ATOM   1429 C  C   . LYS A 1 190 ? 13.346  21.000 -2.135  1.00 33.46 ? 1185 LYS A C   1 
ATOM   1430 O  O   . LYS A 1 190 ? 13.620  20.034 -2.837  1.00 33.95 ? 1185 LYS A O   1 
ATOM   1431 C  CB  . LYS A 1 190 ? 12.717  19.831 -0.026  1.00 32.47 ? 1185 LYS A CB  1 
ATOM   1432 C  CG  . LYS A 1 190 ? 14.064  20.096 0.665   1.00 32.84 ? 1185 LYS A CG  1 
ATOM   1433 C  CD  . LYS A 1 190 ? 14.617  18.812 1.287   1.00 33.10 ? 1185 LYS A CD  1 
ATOM   1434 C  CE  . LYS A 1 190 ? 16.129  18.907 1.559   1.00 35.52 ? 1185 LYS A CE  1 
ATOM   1435 N  NZ  . LYS A 1 190 ? 16.794  17.584 1.867   1.00 34.81 ? 1185 LYS A NZ  1 
ATOM   1436 N  N   . ASN A 1 191 ? 13.953  22.183 -2.247  1.00 34.57 ? 1186 ASN A N   1 
ATOM   1437 C  CA  . ASN A 1 191 ? 15.100  22.406 -3.130  1.00 35.46 ? 1186 ASN A CA  1 
ATOM   1438 C  C   . ASN A 1 191 ? 16.300  21.594 -2.641  1.00 36.06 ? 1186 ASN A C   1 
ATOM   1439 O  O   . ASN A 1 191 ? 16.850  21.878 -1.579  1.00 36.58 ? 1186 ASN A O   1 
ATOM   1440 C  CB  . ASN A 1 191 ? 15.430  23.903 -3.159  1.00 35.59 ? 1186 ASN A CB  1 
ATOM   1441 C  CG  . ASN A 1 191 ? 16.466  24.279 -4.223  1.00 36.25 ? 1186 ASN A CG  1 
ATOM   1442 O  OD1 . ASN A 1 191 ? 17.425  23.552 -4.472  1.00 36.83 ? 1186 ASN A OD1 1 
ATOM   1443 N  ND2 . ASN A 1 191 ? 16.283  25.443 -4.829  1.00 37.26 ? 1186 ASN A ND2 1 
ATOM   1444 N  N   . ILE A 1 192 ? 16.688  20.570 -3.401  1.00 36.70 ? 1187 ILE A N   1 
ATOM   1445 C  CA  . ILE A 1 192 ? 17.792  19.689 -3.013  1.00 37.29 ? 1187 ILE A CA  1 
ATOM   1446 C  C   . ILE A 1 192 ? 19.157  20.409 -3.001  1.00 37.80 ? 1187 ILE A C   1 
ATOM   1447 O  O   . ILE A 1 192 ? 20.042  20.036 -2.232  1.00 37.34 ? 1187 ILE A O   1 
ATOM   1448 C  CB  . ILE A 1 192 ? 17.864  18.436 -3.925  1.00 37.53 ? 1187 ILE A CB  1 
ATOM   1449 N  N   . GLN A 1 193 ? 19.313  21.428 -3.854  1.00 38.48 ? 1188 GLN A N   1 
ATOM   1450 C  CA  . GLN A 1 193 ? 20.506  22.297 -3.850  1.00 39.26 ? 1188 GLN A CA  1 
ATOM   1451 C  C   . GLN A 1 193 ? 20.595  23.199 -2.600  1.00 39.39 ? 1188 GLN A C   1 
ATOM   1452 O  O   . GLN A 1 193 ? 21.672  23.322 -2.012  1.00 39.32 ? 1188 GLN A O   1 
ATOM   1453 C  CB  . GLN A 1 193 ? 20.574  23.168 -5.124  1.00 39.31 ? 1188 GLN A CB  1 
ATOM   1454 C  CG  . GLN A 1 193 ? 21.472  22.615 -6.246  1.00 39.96 ? 1188 GLN A CG  1 
ATOM   1455 C  CD  . GLN A 1 193 ? 21.310  23.370 -7.571  1.00 40.27 ? 1188 GLN A CD  1 
ATOM   1456 O  OE1 . GLN A 1 193 ? 20.189  23.615 -8.035  1.00 40.98 ? 1188 GLN A OE1 1 
ATOM   1457 N  NE2 . GLN A 1 193 ? 22.437  23.737 -8.190  1.00 41.49 ? 1188 GLN A NE2 1 
ATOM   1458 N  N   . THR A 1 194 ? 19.480  23.824 -2.199  1.00 39.38 ? 1189 THR A N   1 
ATOM   1459 C  CA  . THR A 1 194 ? 19.488  24.791 -1.071  1.00 39.40 ? 1189 THR A CA  1 
ATOM   1460 C  C   . THR A 1 194 ? 18.933  24.253 0.276   1.00 39.48 ? 1189 THR A C   1 
ATOM   1461 O  O   . THR A 1 194 ? 19.174  24.855 1.321   1.00 39.69 ? 1189 THR A O   1 
ATOM   1462 C  CB  . THR A 1 194 ? 18.767  26.140 -1.444  1.00 39.52 ? 1189 THR A CB  1 
ATOM   1463 O  OG1 . THR A 1 194 ? 17.354  25.944 -1.572  1.00 39.11 ? 1189 THR A OG1 1 
ATOM   1464 C  CG2 . THR A 1 194 ? 19.317  26.731 -2.746  1.00 39.07 ? 1189 THR A CG2 1 
ATOM   1465 N  N   . SER A 1 195 ? 18.204  23.133 0.244   1.00 39.28 ? 1190 SER A N   1 
ATOM   1466 C  CA  . SER A 1 195 ? 17.638  22.472 1.451   1.00 39.18 ? 1190 SER A CA  1 
ATOM   1467 C  C   . SER A 1 195 ? 16.354  23.116 1.993   1.00 38.91 ? 1190 SER A C   1 
ATOM   1468 O  O   . SER A 1 195 ? 15.772  22.646 2.981   1.00 39.05 ? 1190 SER A O   1 
ATOM   1469 C  CB  . SER A 1 195 ? 18.675  22.372 2.573   1.00 38.90 ? 1190 SER A CB  1 
ATOM   1470 O  OG  . SER A 1 195 ? 19.891  21.876 2.062   1.00 39.24 ? 1190 SER A OG  1 
ATOM   1471 N  N   . GLU A 1 196 ? 15.920  24.181 1.335   1.00 38.66 ? 1191 GLU A N   1 
ATOM   1472 C  CA  . GLU A 1 196 ? 14.736  24.918 1.726   1.00 38.60 ? 1191 GLU A CA  1 
ATOM   1473 C  C   . GLU A 1 196 ? 13.475  24.129 1.320   1.00 37.58 ? 1191 GLU A C   1 
ATOM   1474 O  O   . GLU A 1 196 ? 13.352  23.681 0.181   1.00 37.51 ? 1191 GLU A O   1 
ATOM   1475 C  CB  . GLU A 1 196 ? 14.794  26.290 1.062   1.00 38.51 ? 1191 GLU A CB  1 
ATOM   1476 C  CG  . GLU A 1 196 ? 13.739  27.288 1.499   1.00 39.72 ? 1191 GLU A CG  1 
ATOM   1477 C  CD  . GLU A 1 196 ? 13.746  28.527 0.623   1.00 40.25 ? 1191 GLU A CD  1 
ATOM   1478 O  OE1 . GLU A 1 196 ? 14.750  28.722 -0.117  1.00 42.39 ? 1191 GLU A OE1 1 
ATOM   1479 O  OE2 . GLU A 1 196 ? 12.748  29.290 0.658   1.00 43.20 ? 1191 GLU A OE2 1 
ATOM   1480 N  N   . SER A 1 197 ? 12.566  23.947 2.275   1.00 36.47 ? 1192 SER A N   1 
ATOM   1481 C  CA  . SER A 1 197 ? 11.344  23.178 2.085   1.00 35.54 ? 1192 SER A CA  1 
ATOM   1482 C  C   . SER A 1 197 ? 10.129  24.097 2.253   1.00 34.86 ? 1192 SER A C   1 
ATOM   1483 O  O   . SER A 1 197 ? 10.119  24.929 3.157   1.00 34.95 ? 1192 SER A O   1 
ATOM   1484 C  CB  . SER A 1 197 ? 11.311  22.032 3.103   1.00 35.42 ? 1192 SER A CB  1 
ATOM   1485 O  OG  . SER A 1 197 ? 10.041  21.399 3.189   1.00 35.24 ? 1192 SER A OG  1 
ATOM   1486 N  N   . HIS A 1 198 ? 9.134   23.970 1.366   1.00 33.81 ? 1193 HIS A N   1 
ATOM   1487 C  CA  . HIS A 1 198 ? 7.838   24.648 1.516   1.00 33.00 ? 1193 HIS A CA  1 
ATOM   1488 C  C   . HIS A 1 198 ? 6.719   23.607 1.652   1.00 31.91 ? 1193 HIS A C   1 
ATOM   1489 O  O   . HIS A 1 198 ? 6.791   22.554 1.027   1.00 31.07 ? 1193 HIS A O   1 
ATOM   1490 C  CB  . HIS A 1 198 ? 7.491   25.513 0.295   1.00 33.78 ? 1193 HIS A CB  1 
ATOM   1491 C  CG  . HIS A 1 198 ? 8.595   26.409 -0.177  1.00 34.95 ? 1193 HIS A CG  1 
ATOM   1492 N  ND1 . HIS A 1 198 ? 8.683   26.838 -1.485  1.00 35.38 ? 1193 HIS A ND1 1 
ATOM   1493 C  CD2 . HIS A 1 198 ? 9.649   26.964 0.477   1.00 36.22 ? 1193 HIS A CD2 1 
ATOM   1494 C  CE1 . HIS A 1 198 ? 9.743   27.618 -1.617  1.00 36.51 ? 1193 HIS A CE1 1 
ATOM   1495 N  NE2 . HIS A 1 198 ? 10.351  27.703 -0.444  1.00 36.31 ? 1193 HIS A NE2 1 
ATOM   1496 N  N   . PRO A 1 199 ? 5.667   23.907 2.449   1.00 30.69 ? 1194 PRO A N   1 
ATOM   1497 C  CA  . PRO A 1 199 ? 4.444   23.097 2.405   1.00 29.70 ? 1194 PRO A CA  1 
ATOM   1498 C  C   . PRO A 1 199 ? 3.589   23.327 1.141   1.00 28.55 ? 1194 PRO A C   1 
ATOM   1499 O  O   . PRO A 1 199 ? 3.753   24.318 0.426   1.00 28.02 ? 1194 PRO A O   1 
ATOM   1500 C  CB  . PRO A 1 199 ? 3.670   23.509 3.670   1.00 29.93 ? 1194 PRO A CB  1 
ATOM   1501 C  CG  . PRO A 1 199 ? 4.419   24.617 4.309   1.00 30.22 ? 1194 PRO A CG  1 
ATOM   1502 C  CD  . PRO A 1 199 ? 5.579   24.999 3.438   1.00 31.04 ? 1194 PRO A CD  1 
ATOM   1503 N  N   . LEU A 1 200 ? 2.685   22.395 0.879   1.00 27.40 ? 1195 LEU A N   1 
ATOM   1504 C  CA  . LEU A 1 200 ? 1.873   22.426 -0.332  1.00 26.75 ? 1195 LEU A CA  1 
ATOM   1505 C  C   . LEU A 1 200 ? 0.608   21.641 -0.047  1.00 25.57 ? 1195 LEU A C   1 
ATOM   1506 O  O   . LEU A 1 200 ? 0.662   20.572 0.557   1.00 24.83 ? 1195 LEU A O   1 
ATOM   1507 C  CB  . LEU A 1 200 ? 2.647   21.801 -1.498  1.00 26.71 ? 1195 LEU A CB  1 
ATOM   1508 C  CG  . LEU A 1 200 ? 2.122   21.867 -2.933  1.00 28.08 ? 1195 LEU A CG  1 
ATOM   1509 C  CD1 . LEU A 1 200 ? 3.218   21.408 -3.887  1.00 30.49 ? 1195 LEU A CD1 1 
ATOM   1510 C  CD2 . LEU A 1 200 ? 0.880   21.012 -3.154  1.00 30.31 ? 1195 LEU A CD2 1 
ATOM   1511 N  N   . ARG A 1 201 ? -0.528  22.208 -0.434  1.00 24.40 ? 1196 ARG A N   1 
ATOM   1512 C  CA  . ARG A 1 201 ? -1.800  21.514 -0.357  1.00 23.57 ? 1196 ARG A CA  1 
ATOM   1513 C  C   . ARG A 1 201 ? -2.395  21.451 -1.749  1.00 23.00 ? 1196 ARG A C   1 
ATOM   1514 O  O   . ARG A 1 201 ? -2.454  22.449 -2.446  1.00 22.23 ? 1196 ARG A O   1 
ATOM   1515 C  CB  . ARG A 1 201 ? -2.769  22.219 0.601   1.00 23.22 ? 1196 ARG A CB  1 
ATOM   1516 C  CG  . ARG A 1 201 ? -4.089  21.450 0.776   1.00 23.55 ? 1196 ARG A CG  1 
ATOM   1517 C  CD  . ARG A 1 201 ? -4.780  21.751 2.088   1.00 22.65 ? 1196 ARG A CD  1 
ATOM   1518 N  NE  . ARG A 1 201 ? -3.980  21.263 3.201   1.00 24.42 ? 1196 ARG A NE  1 
ATOM   1519 C  CZ  . ARG A 1 201 ? -4.143  21.616 4.470   1.00 22.41 ? 1196 ARG A CZ  1 
ATOM   1520 N  NH1 . ARG A 1 201 ? -5.082  22.474 4.826   1.00 23.97 ? 1196 ARG A NH1 1 
ATOM   1521 N  NH2 . ARG A 1 201 ? -3.337  21.125 5.380   1.00 20.99 ? 1196 ARG A NH2 1 
ATOM   1522 N  N   . GLN A 1 202 ? -2.846  20.264 -2.136  1.00 22.84 ? 1197 GLN A N   1 
ATOM   1523 C  CA  . GLN A 1 202 ? -3.464  20.033 -3.447  1.00 22.44 ? 1197 GLN A CA  1 
ATOM   1524 C  C   . GLN A 1 202 ? -4.913  19.634 -3.222  1.00 21.80 ? 1197 GLN A C   1 
ATOM   1525 O  O   . GLN A 1 202 ? -5.214  18.769 -2.402  1.00 20.71 ? 1197 GLN A O   1 
ATOM   1526 C  CB  . GLN A 1 202 ? -2.724  18.923 -4.178  1.00 22.46 ? 1197 GLN A CB  1 
ATOM   1527 C  CG  . GLN A 1 202 ? -3.155  18.677 -5.610  1.00 24.32 ? 1197 GLN A CG  1 
ATOM   1528 C  CD  . GLN A 1 202 ? -2.872  17.259 -6.041  1.00 25.98 ? 1197 GLN A CD  1 
ATOM   1529 O  OE1 . GLN A 1 202 ? -3.309  16.321 -5.391  1.00 28.26 ? 1197 GLN A OE1 1 
ATOM   1530 N  NE2 . GLN A 1 202 ? -2.123  17.094 -7.119  1.00 27.14 ? 1197 GLN A NE2 1 
ATOM   1531 N  N   . PHE A 1 203 ? -5.789  20.310 -3.952  1.00 21.93 ? 1198 PHE A N   1 
ATOM   1532 C  CA  . PHE A 1 203 ? -7.226  20.143 -3.879  1.00 22.09 ? 1198 PHE A CA  1 
ATOM   1533 C  C   . PHE A 1 203 ? -7.634  19.579 -5.209  1.00 22.38 ? 1198 PHE A C   1 
ATOM   1534 O  O   . PHE A 1 203 ? -7.491  20.254 -6.226  1.00 22.27 ? 1198 PHE A O   1 
ATOM   1535 C  CB  . PHE A 1 203 ? -7.910  21.500 -3.661  1.00 22.07 ? 1198 PHE A CB  1 
ATOM   1536 C  CG  . PHE A 1 203 ? -7.518  22.177 -2.377  1.00 21.25 ? 1198 PHE A CG  1 
ATOM   1537 C  CD1 . PHE A 1 203 ? -8.188  21.906 -1.207  1.00 20.66 ? 1198 PHE A CD1 1 
ATOM   1538 C  CD2 . PHE A 1 203 ? -6.484  23.086 -2.346  1.00 21.41 ? 1198 PHE A CD2 1 
ATOM   1539 C  CE1 . PHE A 1 203 ? -7.828  22.533 -0.012  1.00 21.39 ? 1198 PHE A CE1 1 
ATOM   1540 C  CE2 . PHE A 1 203 ? -6.131  23.725 -1.154  1.00 21.63 ? 1198 PHE A CE2 1 
ATOM   1541 C  CZ  . PHE A 1 203 ? -6.809  23.446 0.003   1.00 21.66 ? 1198 PHE A CZ  1 
ATOM   1542 N  N   . HIS A 1 204 ? -8.108  18.335 -5.201  1.00 22.75 ? 1199 HIS A N   1 
ATOM   1543 C  CA  . HIS A 1 204 ? -8.398  17.605 -6.425  1.00 23.14 ? 1199 HIS A CA  1 
ATOM   1544 C  C   . HIS A 1 204 ? -9.905  17.340 -6.536  1.00 24.16 ? 1199 HIS A C   1 
ATOM   1545 O  O   . HIS A 1 204 ? -10.471 16.510 -5.801  1.00 23.94 ? 1199 HIS A O   1 
ATOM   1546 C  CB  . HIS A 1 204 ? -7.577  16.301 -6.452  1.00 23.20 ? 1199 HIS A CB  1 
ATOM   1547 C  CG  . HIS A 1 204 ? -7.737  15.499 -7.703  1.00 21.93 ? 1199 HIS A CG  1 
ATOM   1548 N  ND1 . HIS A 1 204 ? -7.158  14.261 -7.867  1.00 23.06 ? 1199 HIS A ND1 1 
ATOM   1549 C  CD2 . HIS A 1 204 ? -8.424  15.742 -8.841  1.00 22.34 ? 1199 HIS A CD2 1 
ATOM   1550 C  CE1 . HIS A 1 204 ? -7.473  13.778 -9.054  1.00 22.64 ? 1199 HIS A CE1 1 
ATOM   1551 N  NE2 . HIS A 1 204 ? -8.239  14.661 -9.669  1.00 23.92 ? 1199 HIS A NE2 1 
ATOM   1552 N  N   . PHE A 1 205 ? -10.552 18.065 -7.451  1.00 25.41 ? 1200 PHE A N   1 
ATOM   1553 C  CA  . PHE A 1 205 ? -11.946 17.810 -7.781  1.00 26.50 ? 1200 PHE A CA  1 
ATOM   1554 C  C   . PHE A 1 205 ? -11.977 16.678 -8.814  1.00 27.39 ? 1200 PHE A C   1 
ATOM   1555 O  O   . PHE A 1 205 ? -11.436 16.809 -9.899  1.00 27.19 ? 1200 PHE A O   1 
ATOM   1556 C  CB  . PHE A 1 205 ? -12.637 19.068 -8.317  1.00 26.68 ? 1200 PHE A CB  1 
ATOM   1557 C  CG  . PHE A 1 205 ? -14.129 18.949 -8.352  1.00 26.97 ? 1200 PHE A CG  1 
ATOM   1558 C  CD1 . PHE A 1 205 ? -14.901 19.483 -7.340  1.00 27.99 ? 1200 PHE A CD1 1 
ATOM   1559 C  CD2 . PHE A 1 205 ? -14.761 18.262 -9.380  1.00 26.95 ? 1200 PHE A CD2 1 
ATOM   1560 C  CE1 . PHE A 1 205 ? -16.273 19.356 -7.362  1.00 28.26 ? 1200 PHE A CE1 1 
ATOM   1561 C  CE2 . PHE A 1 205 ? -16.125 18.126 -9.407  1.00 26.85 ? 1200 PHE A CE2 1 
ATOM   1562 C  CZ  . PHE A 1 205 ? -16.886 18.672 -8.408  1.00 27.82 ? 1200 PHE A CZ  1 
ATOM   1563 N  N   . THR A 1 206 ? -12.639 15.580 -8.463  1.00 29.06 ? 1201 THR A N   1 
ATOM   1564 C  CA  . THR A 1 206 ? -12.426 14.295 -9.118  1.00 30.15 ? 1201 THR A CA  1 
ATOM   1565 C  C   . THR A 1 206 ? -13.477 13.866 -10.182 1.00 31.03 ? 1201 THR A C   1 
ATOM   1566 O  O   . THR A 1 206 ? -13.254 12.859 -10.866 1.00 31.38 ? 1201 THR A O   1 
ATOM   1567 C  CB  . THR A 1 206 ? -12.235 13.170 -8.048  1.00 30.28 ? 1201 THR A CB  1 
ATOM   1568 O  OG1 . THR A 1 206 ? -13.208 13.324 -7.003  1.00 30.93 ? 1201 THR A OG1 1 
ATOM   1569 C  CG2 . THR A 1 206 ? -10.811 13.228 -7.433  1.00 28.95 ? 1201 THR A CG2 1 
ATOM   1570 N  N   . SER A 1 207 ? -14.588 14.593 -10.345 1.00 31.35 ? 1202 SER A N   1 
ATOM   1571 C  CA  . SER A 1 207 ? -15.487 14.329 -11.498 1.00 31.96 ? 1202 SER A CA  1 
ATOM   1572 C  C   . SER A 1 207 ? -16.113 15.583 -12.099 1.00 31.60 ? 1202 SER A C   1 
ATOM   1573 O  O   . SER A 1 207 ? -17.322 15.810 -12.024 1.00 31.06 ? 1202 SER A O   1 
ATOM   1574 C  CB  . SER A 1 207 ? -16.557 13.260 -11.192 1.00 32.41 ? 1202 SER A CB  1 
ATOM   1575 O  OG  . SER A 1 207 ? -17.409 13.658 -10.133 1.00 34.40 ? 1202 SER A OG  1 
ATOM   1576 N  N   . TRP A 1 208 ? -15.235 16.378 -12.699 1.00 31.80 ? 1203 TRP A N   1 
ATOM   1577 C  CA  . TRP A 1 208 ? -15.587 17.468 -13.594 1.00 31.89 ? 1203 TRP A CA  1 
ATOM   1578 C  C   . TRP A 1 208 ? -15.226 17.016 -15.016 1.00 32.38 ? 1203 TRP A C   1 
ATOM   1579 O  O   . TRP A 1 208 ? -14.037 16.935 -15.354 1.00 33.10 ? 1203 TRP A O   1 
ATOM   1580 C  CB  . TRP A 1 208 ? -14.792 18.711 -13.221 1.00 31.06 ? 1203 TRP A CB  1 
ATOM   1581 C  CG  . TRP A 1 208 ? -15.278 19.967 -13.837 1.00 30.92 ? 1203 TRP A CG  1 
ATOM   1582 C  CD1 . TRP A 1 208 ? -15.983 20.107 -15.006 1.00 29.75 ? 1203 TRP A CD1 1 
ATOM   1583 C  CD2 . TRP A 1 208 ? -15.052 21.290 -13.344 1.00 29.83 ? 1203 TRP A CD2 1 
ATOM   1584 N  NE1 . TRP A 1 208 ? -16.229 21.431 -15.244 1.00 29.64 ? 1203 TRP A NE1 1 
ATOM   1585 C  CE2 . TRP A 1 208 ? -15.671 22.182 -14.249 1.00 28.45 ? 1203 TRP A CE2 1 
ATOM   1586 C  CE3 . TRP A 1 208 ? -14.393 21.807 -12.223 1.00 29.66 ? 1203 TRP A CE3 1 
ATOM   1587 C  CZ2 . TRP A 1 208 ? -15.659 23.559 -14.070 1.00 28.45 ? 1203 TRP A CZ2 1 
ATOM   1588 C  CZ3 . TRP A 1 208 ? -14.380 23.185 -12.041 1.00 30.05 ? 1203 TRP A CZ3 1 
ATOM   1589 C  CH2 . TRP A 1 208 ? -15.008 24.046 -12.968 1.00 29.53 ? 1203 TRP A CH2 1 
ATOM   1590 N  N   . PRO A 1 209 ? -16.236 16.686 -15.845 1.00 32.58 ? 1204 PRO A N   1 
ATOM   1591 C  CA  . PRO A 1 209 ? -15.985 16.201 -17.211 1.00 32.67 ? 1204 PRO A CA  1 
ATOM   1592 C  C   . PRO A 1 209 ? -15.359 17.247 -18.121 1.00 33.31 ? 1204 PRO A C   1 
ATOM   1593 O  O   . PRO A 1 209 ? -15.653 18.440 -18.000 1.00 32.72 ? 1204 PRO A O   1 
ATOM   1594 C  CB  . PRO A 1 209 ? -17.380 15.837 -17.740 1.00 32.54 ? 1204 PRO A CB  1 
ATOM   1595 C  CG  . PRO A 1 209 ? -18.269 15.786 -16.537 1.00 32.93 ? 1204 PRO A CG  1 
ATOM   1596 C  CD  . PRO A 1 209 ? -17.675 16.722 -15.528 1.00 32.86 ? 1204 PRO A CD  1 
ATOM   1597 N  N   . ASP A 1 210 ? -14.507 16.798 -19.038 1.00 34.33 ? 1205 ASP A N   1 
ATOM   1598 C  CA  . ASP A 1 210 ? -13.861 17.721 -19.965 1.00 35.36 ? 1205 ASP A CA  1 
ATOM   1599 C  C   . ASP A 1 210 ? -14.964 18.306 -20.848 1.00 35.19 ? 1205 ASP A C   1 
ATOM   1600 O  O   . ASP A 1 210 ? -15.881 17.589 -21.254 1.00 35.29 ? 1205 ASP A O   1 
ATOM   1601 C  CB  . ASP A 1 210 ? -12.777 17.016 -20.801 1.00 35.81 ? 1205 ASP A CB  1 
ATOM   1602 C  CG  . ASP A 1 210 ? -11.815 18.002 -21.476 1.00 37.05 ? 1205 ASP A CG  1 
ATOM   1603 O  OD1 . ASP A 1 210 ? -12.020 19.228 -21.371 1.00 38.45 ? 1205 ASP A OD1 1 
ATOM   1604 O  OD2 . ASP A 1 210 ? -10.846 17.545 -22.119 1.00 40.25 ? 1205 ASP A OD2 1 
ATOM   1605 N  N   . HIS A 1 211 ? -14.893 19.612 -21.092 1.00 35.00 ? 1206 HIS A N   1 
ATOM   1606 C  CA  . HIS A 1 211 ? -15.905 20.330 -21.882 1.00 34.53 ? 1206 HIS A CA  1 
ATOM   1607 C  C   . HIS A 1 211 ? -17.236 20.436 -21.162 1.00 34.05 ? 1206 HIS A C   1 
ATOM   1608 O  O   . HIS A 1 211 ? -18.192 20.996 -21.706 1.00 34.85 ? 1206 HIS A O   1 
ATOM   1609 C  CB  . HIS A 1 211 ? -16.123 19.669 -23.253 1.00 34.34 ? 1206 HIS A CB  1 
ATOM   1610 C  CG  . HIS A 1 211 ? -14.856 19.413 -24.000 1.00 34.37 ? 1206 HIS A CG  1 
ATOM   1611 N  ND1 . HIS A 1 211 ? -13.948 20.410 -24.281 1.00 33.64 ? 1206 HIS A ND1 1 
ATOM   1612 C  CD2 . HIS A 1 211 ? -14.344 18.277 -24.527 1.00 34.81 ? 1206 HIS A CD2 1 
ATOM   1613 C  CE1 . HIS A 1 211 ? -12.934 19.901 -24.956 1.00 33.88 ? 1206 HIS A CE1 1 
ATOM   1614 N  NE2 . HIS A 1 211 ? -13.151 18.608 -25.120 1.00 34.53 ? 1206 HIS A NE2 1 
ATOM   1615 N  N   . GLY A 1 212 ? -17.294 19.916 -19.942 1.00 33.35 ? 1207 GLY A N   1 
ATOM   1616 C  CA  . GLY A 1 212 ? -18.535 19.803 -19.204 1.00 32.66 ? 1207 GLY A CA  1 
ATOM   1617 C  C   . GLY A 1 212 ? -18.509 20.625 -17.937 1.00 32.09 ? 1207 GLY A C   1 
ATOM   1618 O  O   . GLY A 1 212 ? -17.681 21.526 -17.783 1.00 31.03 ? 1207 GLY A O   1 
ATOM   1619 N  N   . VAL A 1 213 ? -19.423 20.276 -17.029 1.00 31.77 ? 1208 VAL A N   1 
ATOM   1620 C  CA  . VAL A 1 213 ? -19.644 21.003 -15.778 1.00 31.19 ? 1208 VAL A CA  1 
ATOM   1621 C  C   . VAL A 1 213 ? -19.880 19.974 -14.666 1.00 31.48 ? 1208 VAL A C   1 
ATOM   1622 O  O   . VAL A 1 213 ? -20.298 18.850 -14.949 1.00 30.99 ? 1208 VAL A O   1 
ATOM   1623 C  CB  . VAL A 1 213 ? -20.873 21.957 -15.887 1.00 31.08 ? 1208 VAL A CB  1 
ATOM   1624 C  CG1 . VAL A 1 213 ? -20.574 23.108 -16.833 1.00 31.08 ? 1208 VAL A CG1 1 
ATOM   1625 C  CG2 . VAL A 1 213 ? -22.131 21.196 -16.346 1.00 29.31 ? 1208 VAL A CG2 1 
ATOM   1626 N  N   . PRO A 1 214 ? -19.606 20.347 -13.396 1.00 31.54 ? 1209 PRO A N   1 
ATOM   1627 C  CA  . PRO A 1 214 ? -20.009 19.472 -12.289 1.00 31.46 ? 1209 PRO A CA  1 
ATOM   1628 C  C   . PRO A 1 214 ? -21.514 19.185 -12.280 1.00 31.61 ? 1209 PRO A C   1 
ATOM   1629 O  O   . PRO A 1 214 ? -22.294 19.923 -12.896 1.00 31.62 ? 1209 PRO A O   1 
ATOM   1630 C  CB  . PRO A 1 214 ? -19.596 20.261 -11.037 1.00 31.60 ? 1209 PRO A CB  1 
ATOM   1631 C  CG  . PRO A 1 214 ? -18.532 21.220 -11.517 1.00 31.49 ? 1209 PRO A CG  1 
ATOM   1632 C  CD  . PRO A 1 214 ? -18.925 21.566 -12.917 1.00 31.54 ? 1209 PRO A CD  1 
ATOM   1633 N  N   . ASP A 1 215 ? -21.893 18.112 -11.584 1.00 31.84 ? 1210 ASP A N   1 
ATOM   1634 C  CA  . ASP A 1 215 ? -23.262 17.608 -11.563 1.00 32.18 ? 1210 ASP A CA  1 
ATOM   1635 C  C   . ASP A 1 215 ? -24.255 18.619 -10.975 1.00 31.77 ? 1210 ASP A C   1 
ATOM   1636 O  O   . ASP A 1 215 ? -25.426 18.651 -11.374 1.00 32.02 ? 1210 ASP A O   1 
ATOM   1637 C  CB  . ASP A 1 215 ? -23.337 16.288 -10.775 1.00 32.56 ? 1210 ASP A CB  1 
ATOM   1638 C  CG  . ASP A 1 215 ? -22.730 15.100 -11.535 1.00 34.54 ? 1210 ASP A CG  1 
ATOM   1639 O  OD1 . ASP A 1 215 ? -22.029 15.325 -12.553 1.00 35.76 ? 1210 ASP A OD1 1 
ATOM   1640 O  OD2 . ASP A 1 215 ? -22.951 13.936 -11.101 1.00 36.77 ? 1210 ASP A OD2 1 
ATOM   1641 N  N   . THR A 1 216 ? -23.785 19.420 -10.019 1.00 30.92 ? 1211 THR A N   1 
ATOM   1642 C  CA  . THR A 1 216 ? -24.604 20.441 -9.369  1.00 29.83 ? 1211 THR A CA  1 
ATOM   1643 C  C   . THR A 1 216 ? -23.765 21.699 -9.192  1.00 29.36 ? 1211 THR A C   1 
ATOM   1644 O  O   . THR A 1 216 ? -22.525 21.660 -9.283  1.00 29.43 ? 1211 THR A O   1 
ATOM   1645 C  CB  . THR A 1 216 ? -25.141 19.968 -7.982  1.00 29.86 ? 1211 THR A CB  1 
ATOM   1646 O  OG1 . THR A 1 216 ? -24.058 19.804 -7.054  1.00 28.50 ? 1211 THR A OG1 1 
ATOM   1647 C  CG2 . THR A 1 216 ? -25.918 18.654 -8.101  1.00 29.85 ? 1211 THR A CG2 1 
ATOM   1648 N  N   . THR A 1 217 ? -24.434 22.819 -8.950  1.00 28.72 ? 1212 THR A N   1 
ATOM   1649 C  CA  . THR A 1 217 ? -23.734 24.072 -8.666  1.00 28.36 ? 1212 THR A CA  1 
ATOM   1650 C  C   . THR A 1 217 ? -23.120 24.064 -7.251  1.00 28.04 ? 1212 THR A C   1 
ATOM   1651 O  O   . THR A 1 217 ? -22.058 24.645 -7.034  1.00 27.54 ? 1212 THR A O   1 
ATOM   1652 C  CB  . THR A 1 217 ? -24.668 25.298 -8.825  1.00 28.50 ? 1212 THR A CB  1 
ATOM   1653 O  OG1 . THR A 1 217 ? -25.731 25.220 -7.863  1.00 27.86 ? 1212 THR A OG1 1 
ATOM   1654 C  CG2 . THR A 1 217 ? -25.237 25.379 -10.273 1.00 27.03 ? 1212 THR A CG2 1 
ATOM   1655 N  N   . ASP A 1 218 ? -23.814 23.435 -6.302  1.00 27.70 ? 1213 ASP A N   1 
ATOM   1656 C  CA  . ASP A 1 218 ? -23.304 23.233 -4.939  1.00 27.75 ? 1213 ASP A CA  1 
ATOM   1657 C  C   . ASP A 1 218 ? -21.898 22.618 -4.942  1.00 27.20 ? 1213 ASP A C   1 
ATOM   1658 O  O   . ASP A 1 218 ? -21.040 23.025 -4.167  1.00 27.07 ? 1213 ASP A O   1 
ATOM   1659 C  CB  . ASP A 1 218 ? -24.254 22.326 -4.125  1.00 27.90 ? 1213 ASP A CB  1 
ATOM   1660 C  CG  . ASP A 1 218 ? -25.463 23.073 -3.554  1.00 29.57 ? 1213 ASP A CG  1 
ATOM   1661 O  OD1 . ASP A 1 218 ? -25.515 24.315 -3.634  1.00 33.36 ? 1213 ASP A OD1 1 
ATOM   1662 O  OD2 . ASP A 1 218 ? -26.370 22.413 -3.005  1.00 32.15 ? 1213 ASP A OD2 1 
ATOM   1663 N  N   . LEU A 1 219 ? -21.666 21.641 -5.811  1.00 26.71 ? 1214 LEU A N   1 
ATOM   1664 C  CA  . LEU A 1 219 ? -20.375 20.965 -5.866  1.00 26.73 ? 1214 LEU A CA  1 
ATOM   1665 C  C   . LEU A 1 219 ? -19.241 21.917 -6.185  1.00 26.34 ? 1214 LEU A C   1 
ATOM   1666 O  O   . LEU A 1 219 ? -18.194 21.851 -5.551  1.00 26.32 ? 1214 LEU A O   1 
ATOM   1667 C  CB  . LEU A 1 219 ? -20.387 19.824 -6.892  1.00 26.92 ? 1214 LEU A CB  1 
ATOM   1668 C  CG  . LEU A 1 219 ? -21.167 18.575 -6.496  1.00 27.51 ? 1214 LEU A CG  1 
ATOM   1669 C  CD1 . LEU A 1 219 ? -21.197 17.592 -7.657  1.00 28.93 ? 1214 LEU A CD1 1 
ATOM   1670 C  CD2 . LEU A 1 219 ? -20.596 17.927 -5.238  1.00 29.02 ? 1214 LEU A CD2 1 
ATOM   1671 N  N   . LEU A 1 220 ? -19.449 22.796 -7.170  1.00 26.08 ? 1215 LEU A N   1 
ATOM   1672 C  CA  . LEU A 1 220 ? -18.444 23.788 -7.541  1.00 25.94 ? 1215 LEU A CA  1 
ATOM   1673 C  C   . LEU A 1 220 ? -18.267 24.844 -6.457  1.00 25.31 ? 1215 LEU A C   1 
ATOM   1674 O  O   . LEU A 1 220 ? -17.136 25.191 -6.101  1.00 25.37 ? 1215 LEU A O   1 
ATOM   1675 C  CB  . LEU A 1 220 ? -18.797 24.469 -8.864  1.00 26.01 ? 1215 LEU A CB  1 
ATOM   1676 C  CG  . LEU A 1 220 ? -17.794 25.510 -9.370  1.00 26.32 ? 1215 LEU A CG  1 
ATOM   1677 C  CD1 . LEU A 1 220 ? -16.402 24.888 -9.591  1.00 28.10 ? 1215 LEU A CD1 1 
ATOM   1678 C  CD2 . LEU A 1 220 ? -18.301 26.181 -10.642 1.00 26.16 ? 1215 LEU A CD2 1 
ATOM   1679 N  N   . ILE A 1 221 ? -19.386 25.360 -5.966  1.00 24.58 ? 1216 ILE A N   1 
ATOM   1680 C  CA  . ILE A 1 221 ? -19.397 26.400 -4.940  1.00 24.21 ? 1216 ILE A CA  1 
ATOM   1681 C  C   . ILE A 1 221 ? -18.761 25.875 -3.657  1.00 24.09 ? 1216 ILE A C   1 
ATOM   1682 O  O   . ILE A 1 221 ? -17.917 26.542 -3.079  1.00 23.45 ? 1216 ILE A O   1 
ATOM   1683 C  CB  . ILE A 1 221 ? -20.866 26.914 -4.660  1.00 24.56 ? 1216 ILE A CB  1 
ATOM   1684 C  CG1 . ILE A 1 221 ? -21.444 27.629 -5.904  1.00 25.12 ? 1216 ILE A CG1 1 
ATOM   1685 C  CG2 . ILE A 1 221 ? -20.916 27.869 -3.463  1.00 23.39 ? 1216 ILE A CG2 1 
ATOM   1686 C  CD1 . ILE A 1 221 ? -22.992 27.811 -5.870  1.00 23.82 ? 1216 ILE A CD1 1 
ATOM   1687 N  N   . ASN A 1 222 ? -19.171 24.682 -3.217  1.00 24.45 ? 1217 ASN A N   1 
ATOM   1688 C  CA  . ASN A 1 222 ? -18.644 24.087 -1.995  1.00 24.84 ? 1217 ASN A CA  1 
ATOM   1689 C  C   . ASN A 1 222 ? -17.169 23.690 -2.132  1.00 25.03 ? 1217 ASN A C   1 
ATOM   1690 O  O   . ASN A 1 222 ? -16.417 23.799 -1.169  1.00 25.47 ? 1217 ASN A O   1 
ATOM   1691 C  CB  . ASN A 1 222 ? -19.472 22.874 -1.541  1.00 24.76 ? 1217 ASN A CB  1 
ATOM   1692 C  CG  . ASN A 1 222 ? -20.895 23.234 -1.141  1.00 25.79 ? 1217 ASN A CG  1 
ATOM   1693 O  OD1 . ASN A 1 222 ? -21.239 24.412 -0.997  1.00 28.02 ? 1217 ASN A OD1 1 
ATOM   1694 N  ND2 . ASN A 1 222 ? -21.740 22.211 -0.972  1.00 23.08 ? 1217 ASN A ND2 1 
ATOM   1695 N  N   . PHE A 1 223 ? -16.756 23.221 -3.306  1.00 25.51 ? 1218 PHE A N   1 
ATOM   1696 C  CA  . PHE A 1 223 ? -15.329 22.939 -3.562  1.00 26.21 ? 1218 PHE A CA  1 
ATOM   1697 C  C   . PHE A 1 223 ? -14.472 24.215 -3.474  1.00 26.89 ? 1218 PHE A C   1 
ATOM   1698 O  O   . PHE A 1 223 ? -13.426 24.233 -2.814  1.00 26.85 ? 1218 PHE A O   1 
ATOM   1699 C  CB  . PHE A 1 223 ? -15.135 22.258 -4.923  1.00 26.25 ? 1218 PHE A CB  1 
ATOM   1700 C  CG  . PHE A 1 223 ? -13.683 22.060 -5.307  1.00 26.52 ? 1218 PHE A CG  1 
ATOM   1701 C  CD1 . PHE A 1 223 ? -12.928 21.051 -4.724  1.00 25.65 ? 1218 PHE A CD1 1 
ATOM   1702 C  CD2 . PHE A 1 223 ? -13.076 22.886 -6.262  1.00 26.90 ? 1218 PHE A CD2 1 
ATOM   1703 C  CE1 . PHE A 1 223 ? -11.587 20.865 -5.082  1.00 25.98 ? 1218 PHE A CE1 1 
ATOM   1704 C  CE2 . PHE A 1 223 ? -11.729 22.707 -6.624  1.00 26.33 ? 1218 PHE A CE2 1 
ATOM   1705 C  CZ  . PHE A 1 223 ? -10.988 21.692 -6.028  1.00 25.80 ? 1218 PHE A CZ  1 
ATOM   1706 N  N   . ARG A 1 224 ? -14.933 25.285 -4.117  1.00 27.54 ? 1219 ARG A N   1 
ATOM   1707 C  CA  . ARG A 1 224 ? -14.268 26.587 -4.023  1.00 28.62 ? 1219 ARG A CA  1 
ATOM   1708 C  C   . ARG A 1 224 ? -14.123 27.070 -2.577  1.00 29.72 ? 1219 ARG A C   1 
ATOM   1709 O  O   . ARG A 1 224 ? -13.041 27.558 -2.178  1.00 29.62 ? 1219 ARG A O   1 
ATOM   1710 C  CB  . ARG A 1 224 ? -15.027 27.635 -4.847  1.00 28.52 ? 1219 ARG A CB  1 
ATOM   1711 C  CG  . ARG A 1 224 ? -14.449 29.032 -4.772  1.00 28.04 ? 1219 ARG A CG  1 
ATOM   1712 C  CD  . ARG A 1 224 ? -15.010 29.814 -3.593  1.00 28.28 ? 1219 ARG A CD  1 
ATOM   1713 N  NE  . ARG A 1 224 ? -14.501 31.175 -3.570  1.00 27.40 ? 1219 ARG A NE  1 
ATOM   1714 C  CZ  . ARG A 1 224 ? -14.720 32.043 -2.595  1.00 27.07 ? 1219 ARG A CZ  1 
ATOM   1715 N  NH1 . ARG A 1 224 ? -14.221 33.264 -2.683  1.00 28.83 ? 1219 ARG A NH1 1 
ATOM   1716 N  NH2 . ARG A 1 224 ? -15.445 31.707 -1.550  1.00 27.66 ? 1219 ARG A NH2 1 
ATOM   1717 N  N   . TYR A 1 225 ? -15.207 26.961 -1.806  1.00 30.69 ? 1220 TYR A N   1 
ATOM   1718 C  CA  . TYR A 1 225 ? -15.183 27.388 -0.401  1.00 31.94 ? 1220 TYR A CA  1 
ATOM   1719 C  C   . TYR A 1 225 ? -14.254 26.468 0.410   1.00 31.61 ? 1220 TYR A C   1 
ATOM   1720 O  O   . TYR A 1 225 ? -13.607 26.917 1.355   1.00 31.51 ? 1220 TYR A O   1 
ATOM   1721 C  CB  . TYR A 1 225 ? -16.599 27.442 0.220   1.00 33.32 ? 1220 TYR A CB  1 
ATOM   1722 C  CG  . TYR A 1 225 ? -17.368 28.757 0.015   1.00 35.39 ? 1220 TYR A CG  1 
ATOM   1723 C  CD1 . TYR A 1 225 ? -17.048 29.902 0.753   1.00 38.08 ? 1220 TYR A CD1 1 
ATOM   1724 C  CD2 . TYR A 1 225 ? -18.434 28.850 -0.892  1.00 37.10 ? 1220 TYR A CD2 1 
ATOM   1725 C  CE1 . TYR A 1 225 ? -17.764 31.120 0.582   1.00 37.50 ? 1220 TYR A CE1 1 
ATOM   1726 C  CE2 . TYR A 1 225 ? -19.155 30.061 -1.068  1.00 36.67 ? 1220 TYR A CE2 1 
ATOM   1727 C  CZ  . TYR A 1 225 ? -18.814 31.186 -0.325  1.00 36.90 ? 1220 TYR A CZ  1 
ATOM   1728 O  OH  . TYR A 1 225 ? -19.512 32.382 -0.485  1.00 37.19 ? 1220 TYR A OH  1 
ATOM   1729 N  N   . LEU A 1 226 ? -14.192 25.184 0.040   1.00 31.45 ? 1221 LEU A N   1 
ATOM   1730 C  CA  . LEU A 1 226 ? -13.208 24.257 0.622   1.00 31.22 ? 1221 LEU A CA  1 
ATOM   1731 C  C   . LEU A 1 226 ? -11.783 24.754 0.348   1.00 30.97 ? 1221 LEU A C   1 
ATOM   1732 O  O   . LEU A 1 226 ? -10.964 24.797 1.249   1.00 30.98 ? 1221 LEU A O   1 
ATOM   1733 C  CB  . LEU A 1 226 ? -13.369 22.845 0.056   1.00 31.14 ? 1221 LEU A CB  1 
ATOM   1734 C  CG  . LEU A 1 226 ? -12.399 21.785 0.600   1.00 31.23 ? 1221 LEU A CG  1 
ATOM   1735 C  CD1 . LEU A 1 226 ? -13.059 21.011 1.732   1.00 29.10 ? 1221 LEU A CD1 1 
ATOM   1736 C  CD2 . LEU A 1 226 ? -11.905 20.840 -0.506  1.00 30.29 ? 1221 LEU A CD2 1 
ATOM   1737 N  N   . VAL A 1 227 ? -11.507 25.144 -0.896  1.00 31.19 ? 1222 VAL A N   1 
ATOM   1738 C  CA  . VAL A 1 227 ? -10.183 25.678 -1.260  1.00 31.04 ? 1222 VAL A CA  1 
ATOM   1739 C  C   . VAL A 1 227 ? -9.843  26.889 -0.398  1.00 31.23 ? 1222 VAL A C   1 
ATOM   1740 O  O   . VAL A 1 227 ? -8.755  26.943 0.170   1.00 30.62 ? 1222 VAL A O   1 
ATOM   1741 C  CB  . VAL A 1 227 ? -10.056 25.999 -2.776  1.00 30.79 ? 1222 VAL A CB  1 
ATOM   1742 C  CG1 . VAL A 1 227 ? -8.698  26.623 -3.104  1.00 30.14 ? 1222 VAL A CG1 1 
ATOM   1743 C  CG2 . VAL A 1 227 ? -10.269 24.739 -3.590  1.00 30.11 ? 1222 VAL A CG2 1 
ATOM   1744 N  N   . ARG A 1 228 ? -10.783 27.827 -0.261  1.00 31.89 ? 1223 ARG A N   1 
ATOM   1745 C  CA  . ARG A 1 228 ? -10.535 29.056 0.525   1.00 32.44 ? 1223 ARG A CA  1 
ATOM   1746 C  C   . ARG A 1 228 ? -10.425 28.843 2.046   1.00 33.47 ? 1223 ARG A C   1 
ATOM   1747 O  O   . ARG A 1 228 ? -9.633  29.519 2.705   1.00 33.87 ? 1223 ARG A O   1 
ATOM   1748 C  CB  . ARG A 1 228 ? -11.589 30.130 0.207   1.00 32.18 ? 1223 ARG A CB  1 
ATOM   1749 C  CG  . ARG A 1 228 ? -11.495 30.660 -1.207  1.00 31.18 ? 1223 ARG A CG  1 
ATOM   1750 C  CD  . ARG A 1 228 ? -10.176 31.350 -1.387  1.00 30.67 ? 1223 ARG A CD  1 
ATOM   1751 N  NE  . ARG A 1 228 ? -10.006 31.950 -2.690  1.00 30.42 ? 1223 ARG A NE  1 
ATOM   1752 C  CZ  . ARG A 1 228 ? -8.931  32.642 -3.048  1.00 31.54 ? 1223 ARG A CZ  1 
ATOM   1753 N  NH1 . ARG A 1 228 ? -7.943  32.826 -2.196  1.00 33.50 ? 1223 ARG A NH1 1 
ATOM   1754 N  NH2 . ARG A 1 228 ? -8.842  33.160 -4.263  1.00 32.36 ? 1223 ARG A NH2 1 
ATOM   1755 N  N   . ASP A 1 229 ? -11.199 27.906 2.592   1.00 34.49 ? 1224 ASP A N   1 
ATOM   1756 C  CA  . ASP A 1 229 ? -11.165 27.609 4.036   1.00 35.30 ? 1224 ASP A CA  1 
ATOM   1757 C  C   . ASP A 1 229 ? -9.928  26.783 4.428   1.00 36.12 ? 1224 ASP A C   1 
ATOM   1758 O  O   . ASP A 1 229 ? -9.494  26.833 5.586   1.00 35.96 ? 1224 ASP A O   1 
ATOM   1759 C  CB  . ASP A 1 229 ? -12.448 26.878 4.459   1.00 35.21 ? 1224 ASP A CB  1 
ATOM   1760 C  CG  . ASP A 1 229 ? -12.556 26.693 5.965   1.00 35.74 ? 1224 ASP A CG  1 
ATOM   1761 N  N   . TYR A 1 230 ? -9.363  26.040 3.468   1.00 37.00 ? 1225 TYR A N   1 
ATOM   1762 C  CA  . TYR A 1 230 ? -8.241  25.120 3.741   1.00 37.97 ? 1225 TYR A CA  1 
ATOM   1763 C  C   . TYR A 1 230 ? -6.862  25.584 3.244   1.00 38.26 ? 1225 TYR A C   1 
ATOM   1764 O  O   . TYR A 1 230 ? -5.858  24.895 3.447   1.00 37.91 ? 1225 TYR A O   1 
ATOM   1765 C  CB  . TYR A 1 230 ? -8.556  23.718 3.206   1.00 38.51 ? 1225 TYR A CB  1 
ATOM   1766 C  CG  . TYR A 1 230 ? -9.414  22.914 4.149   1.00 39.01 ? 1225 TYR A CG  1 
ATOM   1767 C  CD1 . TYR A 1 230 ? -10.795 23.094 4.187   1.00 39.65 ? 1225 TYR A CD1 1 
ATOM   1768 C  CD2 . TYR A 1 230 ? -8.845  21.988 5.020   1.00 39.86 ? 1225 TYR A CD2 1 
ATOM   1769 C  CE1 . TYR A 1 230 ? -11.592 22.363 5.056   1.00 39.73 ? 1225 TYR A CE1 1 
ATOM   1770 C  CE2 . TYR A 1 230 ? -9.639  21.249 5.899   1.00 39.86 ? 1225 TYR A CE2 1 
ATOM   1771 C  CZ  . TYR A 1 230 ? -11.008 21.442 5.908   1.00 39.63 ? 1225 TYR A CZ  1 
ATOM   1772 O  OH  . TYR A 1 230 ? -11.798 20.717 6.770   1.00 39.43 ? 1225 TYR A OH  1 
ATOM   1773 N  N   . MET A 1 231 ? -6.813  26.757 2.631   1.00 38.79 ? 1226 MET A N   1 
ATOM   1774 C  CA  . MET A 1 231 ? -5.546  27.422 2.367   1.00 39.82 ? 1226 MET A CA  1 
ATOM   1775 C  C   . MET A 1 231 ? -5.046  28.016 3.667   1.00 39.84 ? 1226 MET A C   1 
ATOM   1776 O  O   . MET A 1 231 ? -5.756  28.806 4.283   1.00 40.24 ? 1226 MET A O   1 
ATOM   1777 C  CB  . MET A 1 231 ? -5.727  28.544 1.344   1.00 39.87 ? 1226 MET A CB  1 
ATOM   1778 C  CG  . MET A 1 231 ? -5.825  28.061 -0.095  1.00 40.55 ? 1226 MET A CG  1 
ATOM   1779 S  SD  . MET A 1 231 ? -6.249  29.406 -1.245  1.00 41.34 ? 1226 MET A SD  1 
ATOM   1780 C  CE  . MET A 1 231 ? -5.012  30.631 -0.768  1.00 40.87 ? 1226 MET A CE  1 
ATOM   1781 N  N   . GLU A 1 237 ? 0.709   37.248 -1.458  1.00 39.06 ? 1232 GLU A N   1 
ATOM   1782 C  CA  . GLU A 1 237 ? 1.923   37.150 -2.265  1.00 38.94 ? 1232 GLU A CA  1 
ATOM   1783 C  C   . GLU A 1 237 ? 1.943   35.980 -3.286  1.00 38.46 ? 1232 GLU A C   1 
ATOM   1784 O  O   . GLU A 1 237 ? 2.464   36.132 -4.396  1.00 39.21 ? 1232 GLU A O   1 
ATOM   1785 C  CB  . GLU A 1 237 ? 3.135   37.039 -1.329  1.00 39.25 ? 1232 GLU A CB  1 
ATOM   1786 N  N   . SER A 1 238 ? 1.365   34.833 -2.921  1.00 37.35 ? 1233 SER A N   1 
ATOM   1787 C  CA  . SER A 1 238 ? 1.653   33.544 -3.586  1.00 36.03 ? 1233 SER A CA  1 
ATOM   1788 C  C   . SER A 1 238 ? 0.523   33.087 -4.500  1.00 34.56 ? 1233 SER A C   1 
ATOM   1789 O  O   . SER A 1 238 ? -0.620  33.037 -4.054  1.00 34.79 ? 1233 SER A O   1 
ATOM   1790 C  CB  . SER A 1 238 ? 1.886   32.466 -2.520  1.00 36.08 ? 1233 SER A CB  1 
ATOM   1791 O  OG  . SER A 1 238 ? 3.096   32.701 -1.806  1.00 37.07 ? 1233 SER A OG  1 
ATOM   1792 N  N   . PRO A 1 239 ? 0.833   32.714 -5.766  1.00 32.99 ? 1234 PRO A N   1 
ATOM   1793 C  CA  . PRO A 1 239 ? -0.258  32.326 -6.691  1.00 31.54 ? 1234 PRO A CA  1 
ATOM   1794 C  C   . PRO A 1 239 ? -0.895  30.987 -6.354  1.00 30.08 ? 1234 PRO A C   1 
ATOM   1795 O  O   . PRO A 1 239 ? -0.228  30.103 -5.821  1.00 29.21 ? 1234 PRO A O   1 
ATOM   1796 C  CB  . PRO A 1 239 ? 0.433   32.243 -8.064  1.00 31.84 ? 1234 PRO A CB  1 
ATOM   1797 C  CG  . PRO A 1 239 ? 1.847   32.779 -7.863  1.00 32.57 ? 1234 PRO A CG  1 
ATOM   1798 C  CD  . PRO A 1 239 ? 2.159   32.619 -6.416  1.00 32.93 ? 1234 PRO A CD  1 
ATOM   1799 N  N   . ILE A 1 240 ? -2.184  30.859 -6.658  1.00 28.87 ? 1235 ILE A N   1 
ATOM   1800 C  CA  . ILE A 1 240 ? -2.877  29.575 -6.615  1.00 27.97 ? 1235 ILE A CA  1 
ATOM   1801 C  C   . ILE A 1 240 ? -2.740  28.983 -8.008  1.00 27.51 ? 1235 ILE A C   1 
ATOM   1802 O  O   . ILE A 1 240 ? -3.075  29.626 -8.995  1.00 26.96 ? 1235 ILE A O   1 
ATOM   1803 C  CB  . ILE A 1 240 ? -4.364  29.723 -6.219  1.00 27.76 ? 1235 ILE A CB  1 
ATOM   1804 C  CG1 . ILE A 1 240 ? -4.489  30.430 -4.860  1.00 28.51 ? 1235 ILE A CG1 1 
ATOM   1805 C  CG2 . ILE A 1 240 ? -5.068  28.359 -6.171  1.00 27.55 ? 1235 ILE A CG2 1 
ATOM   1806 C  CD1 . ILE A 1 240 ? -5.754  31.266 -4.693  1.00 28.05 ? 1235 ILE A CD1 1 
ATOM   1807 N  N   . LEU A 1 241 ? -2.213  27.766 -8.084  1.00 26.95 ? 1236 LEU A N   1 
ATOM   1808 C  CA  . LEU A 1 241 ? -2.018  27.074 -9.350  1.00 26.84 ? 1236 LEU A CA  1 
ATOM   1809 C  C   . LEU A 1 241 ? -3.251  26.196 -9.638  1.00 26.23 ? 1236 LEU A C   1 
ATOM   1810 O  O   . LEU A 1 241 ? -3.630  25.348 -8.844  1.00 25.22 ? 1236 LEU A O   1 
ATOM   1811 C  CB  . LEU A 1 241 ? -0.741  26.242 -9.287  1.00 27.03 ? 1236 LEU A CB  1 
ATOM   1812 C  CG  . LEU A 1 241 ? -0.250  25.484 -10.520 1.00 27.96 ? 1236 LEU A CG  1 
ATOM   1813 C  CD1 . LEU A 1 241 ? -0.157  26.381 -11.726 1.00 29.11 ? 1236 LEU A CD1 1 
ATOM   1814 C  CD2 . LEU A 1 241 ? 1.126   24.894 -10.209 1.00 28.01 ? 1236 LEU A CD2 1 
ATOM   1815 N  N   . VAL A 1 242 ? -3.910  26.471 -10.755 1.00 26.22 ? 1237 VAL A N   1 
ATOM   1816 C  CA  . VAL A 1 242 ? -5.069  25.709 -11.171 1.00 26.14 ? 1237 VAL A CA  1 
ATOM   1817 C  C   . VAL A 1 242 ? -4.696  25.011 -12.463 1.00 26.77 ? 1237 VAL A C   1 
ATOM   1818 O  O   . VAL A 1 242 ? -4.095  25.610 -13.371 1.00 26.95 ? 1237 VAL A O   1 
ATOM   1819 C  CB  . VAL A 1 242 ? -6.313  26.603 -11.390 1.00 26.12 ? 1237 VAL A CB  1 
ATOM   1820 C  CG1 . VAL A 1 242 ? -7.566  25.742 -11.519 1.00 24.35 ? 1237 VAL A CG1 1 
ATOM   1821 C  CG2 . VAL A 1 242 ? -6.466  27.598 -10.274 1.00 23.58 ? 1237 VAL A CG2 1 
ATOM   1822 N  N   . HIS A 1 243 ? -5.014  23.730 -12.548 1.00 27.42 ? 1238 HIS A N   1 
ATOM   1823 C  CA  . HIS A 1 243 ? -4.799  23.034 -13.793 1.00 27.53 ? 1238 HIS A CA  1 
ATOM   1824 C  C   . HIS A 1 243 ? -5.887  22.047 -14.144 1.00 27.92 ? 1238 HIS A C   1 
ATOM   1825 O  O   . HIS A 1 243 ? -6.631  21.547 -13.283 1.00 26.75 ? 1238 HIS A O   1 
ATOM   1826 C  CB  . HIS A 1 243 ? -3.418  22.381 -13.814 1.00 27.50 ? 1238 HIS A CB  1 
ATOM   1827 C  CG  . HIS A 1 243 ? -3.323  21.119 -13.026 1.00 27.12 ? 1238 HIS A CG  1 
ATOM   1828 N  ND1 . HIS A 1 243 ? -3.606  19.884 -13.569 1.00 27.56 ? 1238 HIS A ND1 1 
ATOM   1829 C  CD2 . HIS A 1 243 ? -2.935  20.894 -11.750 1.00 27.03 ? 1238 HIS A CD2 1 
ATOM   1830 C  CE1 . HIS A 1 243 ? -3.413  18.954 -12.652 1.00 27.59 ? 1238 HIS A CE1 1 
ATOM   1831 N  NE2 . HIS A 1 243 ? -3.009  19.541 -11.538 1.00 26.75 ? 1238 HIS A NE2 1 
ATOM   1832 N  N   . SER A 1 244 ? -5.960  21.814 -15.456 1.00 28.73 ? 1239 SER A N   1 
ATOM   1833 C  CA  . SER A 1 244 ? -6.802  20.803 -16.062 1.00 29.11 ? 1239 SER A CA  1 
ATOM   1834 C  C   . SER A 1 244 ? -6.050  20.359 -17.296 1.00 29.41 ? 1239 SER A C   1 
ATOM   1835 O  O   . SER A 1 244 ? -4.943  20.843 -17.548 1.00 30.41 ? 1239 SER A O   1 
ATOM   1836 C  CB  . SER A 1 244 ? -8.198  21.364 -16.380 1.00 29.16 ? 1239 SER A CB  1 
ATOM   1837 O  OG  . SER A 1 244 ? -8.160  22.499 -17.224 1.00 29.39 ? 1239 SER A OG  1 
ATOM   1838 N  N   . SER A 1 245 ? -6.606  19.432 -18.056 1.00 29.38 ? 1240 SER A N   1 
ATOM   1839 C  CA  . SER A 1 245 ? -5.883  18.867 -19.209 1.00 29.64 ? 1240 SER A CA  1 
ATOM   1840 C  C   . SER A 1 245 ? -5.255  19.944 -20.109 1.00 29.32 ? 1240 SER A C   1 
ATOM   1841 O  O   . SER A 1 245 ? -4.044  19.948 -20.336 1.00 29.73 ? 1240 SER A O   1 
ATOM   1842 C  CB  . SER A 1 245 ? -6.830  17.987 -20.033 1.00 29.97 ? 1240 SER A CB  1 
ATOM   1843 O  OG  . SER A 1 245 ? -6.146  17.288 -21.041 1.00 31.13 ? 1240 SER A OG  1 
ATOM   1844 N  N   . ALA A 1 246 ? -6.083  20.856 -20.617 1.00 28.50 ? 1241 ALA A N   1 
ATOM   1845 C  CA  . ALA A 1 246 ? -5.615  21.950 -21.481 1.00 27.73 ? 1241 ALA A CA  1 
ATOM   1846 C  C   . ALA A 1 246 ? -5.329  23.212 -20.695 1.00 27.02 ? 1241 ALA A C   1 
ATOM   1847 O  O   . ALA A 1 246 ? -4.614  24.068 -21.169 1.00 27.36 ? 1241 ALA A O   1 
ATOM   1848 C  CB  . ALA A 1 246 ? -6.636  22.243 -22.565 1.00 27.98 ? 1241 ALA A CB  1 
ATOM   1849 N  N   . GLY A 1 247 ? -5.896  23.331 -19.499 1.00 26.39 ? 1242 GLY A N   1 
ATOM   1850 C  CA  . GLY A 1 247 ? -5.613  24.465 -18.615 1.00 26.16 ? 1242 GLY A CA  1 
ATOM   1851 C  C   . GLY A 1 247 ? -6.420  25.700 -18.931 1.00 25.78 ? 1242 GLY A C   1 
ATOM   1852 O  O   . GLY A 1 247 ? -6.013  26.806 -18.585 1.00 25.06 ? 1242 GLY A O   1 
ATOM   1853 N  N   . VAL A 1 248 ? -7.579  25.497 -19.562 1.00 26.16 ? 1243 VAL A N   1 
ATOM   1854 C  CA  . VAL A 1 248 ? -8.442  26.587 -20.015 1.00 26.09 ? 1243 VAL A CA  1 
ATOM   1855 C  C   . VAL A 1 248 ? -9.897  26.485 -19.541 1.00 26.78 ? 1243 VAL A C   1 
ATOM   1856 O  O   . VAL A 1 248 ? -10.415 27.409 -18.883 1.00 27.34 ? 1243 VAL A O   1 
ATOM   1857 C  CB  . VAL A 1 248 ? -8.389  26.766 -21.555 1.00 25.97 ? 1243 VAL A CB  1 
ATOM   1858 C  CG1 . VAL A 1 248 ? -6.943  27.073 -22.012 1.00 24.74 ? 1243 VAL A CG1 1 
ATOM   1859 C  CG2 . VAL A 1 248 ? -8.934  25.600 -22.273 1.00 24.43 ? 1243 VAL A CG2 1 
ATOM   1860 N  N   . GLY A 1 249 ? -10.548 25.364 -19.839 1.00 26.95 ? 1244 GLY A N   1 
ATOM   1861 C  CA  . GLY A 1 249 ? -11.999 25.261 -19.708 1.00 26.53 ? 1244 GLY A CA  1 
ATOM   1862 C  C   . GLY A 1 249 ? -12.465 25.167 -18.283 1.00 26.30 ? 1244 GLY A C   1 
ATOM   1863 O  O   . GLY A 1 249 ? -13.127 26.061 -17.788 1.00 27.00 ? 1244 GLY A O   1 
ATOM   1864 N  N   . ARG A 1 250 ? -12.112 24.070 -17.621 1.00 26.31 ? 1245 ARG A N   1 
ATOM   1865 C  CA  . ARG A 1 250 ? -12.474 23.840 -16.215 1.00 25.60 ? 1245 ARG A CA  1 
ATOM   1866 C  C   . ARG A 1 250 ? -11.673 24.776 -15.308 1.00 24.79 ? 1245 ARG A C   1 
ATOM   1867 O  O   . ARG A 1 250 ? -12.167 25.285 -14.306 1.00 23.90 ? 1245 ARG A O   1 
ATOM   1868 C  CB  . ARG A 1 250 ? -12.216 22.369 -15.853 1.00 25.69 ? 1245 ARG A CB  1 
ATOM   1869 C  CG  . ARG A 1 250 ? -13.035 21.420 -16.697 1.00 26.73 ? 1245 ARG A CG  1 
ATOM   1870 C  CD  . ARG A 1 250 ? -12.637 19.984 -16.515 1.00 27.35 ? 1245 ARG A CD  1 
ATOM   1871 N  NE  . ARG A 1 250 ? -11.525 19.629 -17.389 1.00 27.81 ? 1245 ARG A NE  1 
ATOM   1872 C  CZ  . ARG A 1 250 ? -11.141 18.382 -17.655 1.00 26.67 ? 1245 ARG A CZ  1 
ATOM   1873 N  NH1 . ARG A 1 250 ? -10.118 18.180 -18.471 1.00 26.69 ? 1245 ARG A NH1 1 
ATOM   1874 N  NH2 . ARG A 1 250 ? -11.764 17.343 -17.106 1.00 26.57 ? 1245 ARG A NH2 1 
ATOM   1875 N  N   . THR A 1 251 ? -10.419 24.987 -15.677 1.00 24.55 ? 1246 THR A N   1 
ATOM   1876 C  CA  . THR A 1 251 ? -9.550  25.931 -14.975 1.00 24.77 ? 1246 THR A CA  1 
ATOM   1877 C  C   . THR A 1 251 ? -10.114 27.365 -14.957 1.00 24.69 ? 1246 THR A C   1 
ATOM   1878 O  O   . THR A 1 251 ? -10.127 28.007 -13.914 1.00 24.39 ? 1246 THR A O   1 
ATOM   1879 C  CB  . THR A 1 251 ? -8.135  25.908 -15.584 1.00 24.49 ? 1246 THR A CB  1 
ATOM   1880 O  OG1 . THR A 1 251 ? -7.587  24.597 -15.396 1.00 24.66 ? 1246 THR A OG1 1 
ATOM   1881 C  CG2 . THR A 1 251 ? -7.222  26.954 -14.935 1.00 23.86 ? 1246 THR A CG2 1 
ATOM   1882 N  N   . GLY A 1 252 ? -10.590 27.836 -16.106 1.00 24.94 ? 1247 GLY A N   1 
ATOM   1883 C  CA  . GLY A 1 252 ? -11.196 29.164 -16.225 1.00 25.32 ? 1247 GLY A CA  1 
ATOM   1884 C  C   . GLY A 1 252 ? -12.497 29.312 -15.446 1.00 25.12 ? 1247 GLY A C   1 
ATOM   1885 O  O   . GLY A 1 252 ? -12.740 30.334 -14.804 1.00 25.74 ? 1247 GLY A O   1 
ATOM   1886 N  N   . THR A 1 253 ? -13.322 28.280 -15.515 1.00 25.13 ? 1248 THR A N   1 
ATOM   1887 C  CA  . THR A 1 253 ? -14.598 28.206 -14.792 1.00 25.07 ? 1248 THR A CA  1 
ATOM   1888 C  C   . THR A 1 253 ? -14.373 28.246 -13.277 1.00 25.33 ? 1248 THR A C   1 
ATOM   1889 O  O   . THR A 1 253 ? -15.064 28.959 -12.555 1.00 25.15 ? 1248 THR A O   1 
ATOM   1890 C  CB  . THR A 1 253 ? -15.399 26.943 -15.265 1.00 25.18 ? 1248 THR A CB  1 
ATOM   1891 O  OG1 . THR A 1 253 ? -15.590 27.023 -16.689 1.00 24.75 ? 1248 THR A OG1 1 
ATOM   1892 C  CG2 . THR A 1 253 ? -16.788 26.802 -14.559 1.00 24.68 ? 1248 THR A CG2 1 
ATOM   1893 N  N   . PHE A 1 254 ? -13.369 27.519 -12.792 1.00 25.90 ? 1249 PHE A N   1 
ATOM   1894 C  CA  . PHE A 1 254 ? -13.014 27.601 -11.375 1.00 25.46 ? 1249 PHE A CA  1 
ATOM   1895 C  C   . PHE A 1 254 ? -12.632 29.014 -10.935 1.00 25.39 ? 1249 PHE A C   1 
ATOM   1896 O  O   . PHE A 1 254 ? -13.158 29.542 -9.972  1.00 25.38 ? 1249 PHE A O   1 
ATOM   1897 C  CB  . PHE A 1 254 ? -11.876 26.649 -11.019 1.00 25.12 ? 1249 PHE A CB  1 
ATOM   1898 C  CG  . PHE A 1 254 ? -11.507 26.722 -9.589  1.00 25.34 ? 1249 PHE A CG  1 
ATOM   1899 C  CD1 . PHE A 1 254 ? -12.307 26.110 -8.638  1.00 25.06 ? 1249 PHE A CD1 1 
ATOM   1900 C  CD2 . PHE A 1 254 ? -10.408 27.476 -9.171  1.00 25.27 ? 1249 PHE A CD2 1 
ATOM   1901 C  CE1 . PHE A 1 254 ? -12.001 26.211 -7.304  1.00 26.34 ? 1249 PHE A CE1 1 
ATOM   1902 C  CE2 . PHE A 1 254 ? -10.098 27.580 -7.839  1.00 25.01 ? 1249 PHE A CE2 1 
ATOM   1903 C  CZ  . PHE A 1 254 ? -10.900 26.953 -6.900  1.00 25.64 ? 1249 PHE A CZ  1 
ATOM   1904 N  N   . ILE A 1 255 ? -11.677 29.606 -11.631 1.00 25.77 ? 1250 ILE A N   1 
ATOM   1905 C  CA  . ILE A 1 255 ? -11.187 30.948 -11.307 1.00 25.55 ? 1250 ILE A CA  1 
ATOM   1906 C  C   . ILE A 1 255 ? -12.326 31.973 -11.356 1.00 25.17 ? 1250 ILE A C   1 
ATOM   1907 O  O   . ILE A 1 255 ? -12.450 32.843 -10.467 1.00 25.66 ? 1250 ILE A O   1 
ATOM   1908 C  CB  . ILE A 1 255 ? -10.038 31.351 -12.276 1.00 25.88 ? 1250 ILE A CB  1 
ATOM   1909 C  CG1 . ILE A 1 255 ? -8.812  30.463 -12.034 1.00 25.95 ? 1250 ILE A CG1 1 
ATOM   1910 C  CG2 . ILE A 1 255 ? -9.691  32.839 -12.141 1.00 25.95 ? 1250 ILE A CG2 1 
ATOM   1911 C  CD1 . ILE A 1 255 ? -7.789  30.432 -13.199 1.00 25.07 ? 1250 ILE A CD1 1 
ATOM   1912 N  N   . ALA A 1 256 ? -13.168 31.845 -12.373 1.00 24.44 ? 1251 ALA A N   1 
ATOM   1913 C  CA  . ALA A 1 256 ? -14.296 32.753 -12.577 1.00 24.44 ? 1251 ALA A CA  1 
ATOM   1914 C  C   . ALA A 1 256 ? -15.252 32.775 -11.396 1.00 24.54 ? 1251 ALA A C   1 
ATOM   1915 O  O   . ALA A 1 256 ? -15.667 33.835 -10.941 1.00 24.69 ? 1251 ALA A O   1 
ATOM   1916 C  CB  . ALA A 1 256 ? -15.047 32.389 -13.873 1.00 23.95 ? 1251 ALA A CB  1 
ATOM   1917 N  N   . ILE A 1 257 ? -15.610 31.597 -10.901 1.00 25.29 ? 1252 ILE A N   1 
ATOM   1918 C  CA  . ILE A 1 257 ? -16.558 31.497 -9.806  1.00 25.48 ? 1252 ILE A CA  1 
ATOM   1919 C  C   . ILE A 1 257 ? -15.955 32.077 -8.533  1.00 25.46 ? 1252 ILE A C   1 
ATOM   1920 O  O   . ILE A 1 257 ? -16.654 32.773 -7.769  1.00 26.21 ? 1252 ILE A O   1 
ATOM   1921 C  CB  . ILE A 1 257 ? -17.090 30.031 -9.596  1.00 25.62 ? 1252 ILE A CB  1 
ATOM   1922 C  CG1 . ILE A 1 257 ? -18.358 30.051 -8.742  1.00 26.14 ? 1252 ILE A CG1 1 
ATOM   1923 C  CG2 . ILE A 1 257 ? -16.041 29.128 -8.928  1.00 24.88 ? 1252 ILE A CG2 1 
ATOM   1924 C  CD1 . ILE A 1 257 ? -19.330 31.181 -9.085  1.00 27.92 ? 1252 ILE A CD1 1 
ATOM   1925 N  N   . ASP A 1 258 ? -14.664 31.836 -8.319  1.00 25.01 ? 1253 ASP A N   1 
ATOM   1926 C  CA  . ASP A 1 258 ? -13.966 32.443 -7.189  1.00 25.21 ? 1253 ASP A CA  1 
ATOM   1927 C  C   . ASP A 1 258 ? -14.014 33.993 -7.227  1.00 24.98 ? 1253 ASP A C   1 
ATOM   1928 O  O   . ASP A 1 258 ? -14.278 34.659 -6.222  1.00 24.72 ? 1253 ASP A O   1 
ATOM   1929 C  CB  . ASP A 1 258 ? -12.519 31.941 -7.136  1.00 25.47 ? 1253 ASP A CB  1 
ATOM   1930 C  CG  . ASP A 1 258 ? -11.749 32.498 -5.939  1.00 26.39 ? 1253 ASP A CG  1 
ATOM   1931 O  OD1 . ASP A 1 258 ? -12.132 32.195 -4.792  1.00 25.93 ? 1253 ASP A OD1 1 
ATOM   1932 O  OD2 . ASP A 1 258 ? -10.776 33.257 -6.150  1.00 26.22 ? 1253 ASP A OD2 1 
ATOM   1933 N  N   . ARG A 1 259 ? -13.764 34.554 -8.405  1.00 24.90 ? 1254 ARG A N   1 
ATOM   1934 C  CA  . ARG A 1 259 ? -13.819 35.995 -8.604  1.00 24.36 ? 1254 ARG A CA  1 
ATOM   1935 C  C   . ARG A 1 259 ? -15.246 36.512 -8.400  1.00 24.45 ? 1254 ARG A C   1 
ATOM   1936 O  O   . ARG A 1 259 ? -15.456 37.513 -7.721  1.00 24.66 ? 1254 ARG A O   1 
ATOM   1937 C  CB  . ARG A 1 259 ? -13.311 36.346 -10.006 1.00 24.06 ? 1254 ARG A CB  1 
ATOM   1938 C  CG  . ARG A 1 259 ? -11.827 36.069 -10.222 1.00 23.93 ? 1254 ARG A CG  1 
ATOM   1939 C  CD  . ARG A 1 259 ? -11.353 36.384 -11.632 1.00 24.43 ? 1254 ARG A CD  1 
ATOM   1940 N  NE  . ARG A 1 259 ? -11.484 37.812 -11.911 1.00 24.63 ? 1254 ARG A NE  1 
ATOM   1941 C  CZ  . ARG A 1 259 ? -10.845 38.485 -12.865 1.00 23.90 ? 1254 ARG A CZ  1 
ATOM   1942 N  NH1 . ARG A 1 259 ? -9.996  37.902 -13.680 1.00 25.86 ? 1254 ARG A NH1 1 
ATOM   1943 N  NH2 . ARG A 1 259 ? -11.085 39.773 -13.000 1.00 25.46 ? 1254 ARG A NH2 1 
ATOM   1944 N  N   . LEU A 1 260 ? -16.218 35.812 -8.979  1.00 24.57 ? 1255 LEU A N   1 
ATOM   1945 C  CA  . LEU A 1 260 ? -17.641 36.138 -8.816  1.00 24.77 ? 1255 LEU A CA  1 
ATOM   1946 C  C   . LEU A 1 260 ? -18.126 36.149 -7.373  1.00 25.07 ? 1255 LEU A C   1 
ATOM   1947 O  O   . LEU A 1 260 ? -18.898 37.033 -6.982  1.00 25.19 ? 1255 LEU A O   1 
ATOM   1948 C  CB  . LEU A 1 260 ? -18.516 35.146 -9.596  1.00 24.80 ? 1255 LEU A CB  1 
ATOM   1949 C  CG  . LEU A 1 260 ? -18.641 35.400 -11.088 1.00 24.81 ? 1255 LEU A CG  1 
ATOM   1950 C  CD1 . LEU A 1 260 ? -19.195 34.155 -11.784 1.00 24.27 ? 1255 LEU A CD1 1 
ATOM   1951 C  CD2 . LEU A 1 260 ? -19.510 36.647 -11.345 1.00 22.72 ? 1255 LEU A CD2 1 
ATOM   1952 N  N   . ILE A 1 261 ? -17.721 35.144 -6.595  1.00 25.26 ? 1256 ILE A N   1 
ATOM   1953 C  CA  . ILE A 1 261 ? -18.178 35.047 -5.211  1.00 25.52 ? 1256 ILE A CA  1 
ATOM   1954 C  C   . ILE A 1 261 ? -17.663 36.237 -4.391  1.00 25.66 ? 1256 ILE A C   1 
ATOM   1955 O  O   . ILE A 1 261 ? -18.433 36.847 -3.658  1.00 25.21 ? 1256 ILE A O   1 
ATOM   1956 C  CB  . ILE A 1 261 ? -17.805 33.681 -4.570  1.00 25.56 ? 1256 ILE A CB  1 
ATOM   1957 C  CG1 . ILE A 1 261 ? -18.687 32.568 -5.152  1.00 25.36 ? 1256 ILE A CG1 1 
ATOM   1958 C  CG2 . ILE A 1 261 ? -17.964 33.721 -3.067  1.00 25.56 ? 1256 ILE A CG2 1 
ATOM   1959 C  CD1 . ILE A 1 261 ? -18.100 31.184 -5.026  1.00 24.35 ? 1256 ILE A CD1 1 
ATOM   1960 N  N   . TYR A 1 262 ? -16.384 36.580 -4.558  1.00 25.98 ? 1257 TYR A N   1 
ATOM   1961 C  CA  . TYR A 1 262 ? -15.797 37.777 -3.946  1.00 26.48 ? 1257 TYR A CA  1 
ATOM   1962 C  C   . TYR A 1 262 ? -16.503 39.071 -4.385  1.00 26.88 ? 1257 TYR A C   1 
ATOM   1963 O  O   . TYR A 1 262 ? -16.742 39.958 -3.583  1.00 26.39 ? 1257 TYR A O   1 
ATOM   1964 C  CB  . TYR A 1 262 ? -14.314 37.903 -4.317  1.00 27.11 ? 1257 TYR A CB  1 
ATOM   1965 C  CG  . TYR A 1 262 ? -13.363 37.098 -3.473  1.00 27.34 ? 1257 TYR A CG  1 
ATOM   1966 C  CD1 . TYR A 1 262 ? -12.505 36.183 -4.060  1.00 28.08 ? 1257 TYR A CD1 1 
ATOM   1967 C  CD2 . TYR A 1 262 ? -13.289 37.279 -2.096  1.00 28.78 ? 1257 TYR A CD2 1 
ATOM   1968 C  CE1 . TYR A 1 262 ? -11.628 35.446 -3.311  1.00 28.39 ? 1257 TYR A CE1 1 
ATOM   1969 C  CE2 . TYR A 1 262 ? -12.400 36.529 -1.319  1.00 29.34 ? 1257 TYR A CE2 1 
ATOM   1970 C  CZ  . TYR A 1 262 ? -11.575 35.614 -1.949  1.00 28.18 ? 1257 TYR A CZ  1 
ATOM   1971 O  OH  . TYR A 1 262 ? -10.687 34.872 -1.238  1.00 28.34 ? 1257 TYR A OH  1 
ATOM   1972 N  N   . GLN A 1 263 ? -16.797 39.194 -5.671  1.00 27.51 ? 1258 GLN A N   1 
ATOM   1973 C  CA  . GLN A 1 263 ? -17.513 40.373 -6.154  1.00 27.88 ? 1258 GLN A CA  1 
ATOM   1974 C  C   . GLN A 1 263 ? -18.916 40.487 -5.553  1.00 27.77 ? 1258 GLN A C   1 
ATOM   1975 O  O   . GLN A 1 263 ? -19.345 41.578 -5.182  1.00 27.41 ? 1258 GLN A O   1 
ATOM   1976 C  CB  . GLN A 1 263 ? -17.571 40.401 -7.684  1.00 27.98 ? 1258 GLN A CB  1 
ATOM   1977 C  CG  . GLN A 1 263 ? -17.935 41.773 -8.211  1.00 29.72 ? 1258 GLN A CG  1 
ATOM   1978 C  CD  . GLN A 1 263 ? -18.067 41.825 -9.708  1.00 33.13 ? 1258 GLN A CD  1 
ATOM   1979 O  OE1 . GLN A 1 263 ? -17.610 40.914 -10.429 1.00 36.65 ? 1258 GLN A OE1 1 
ATOM   1980 N  NE2 . GLN A 1 263 ? -18.678 42.908 -10.205 1.00 31.88 ? 1258 GLN A NE2 1 
ATOM   1981 N  N   . ILE A 1 264 ? -19.630 39.369 -5.457  1.00 28.44 ? 1259 ILE A N   1 
ATOM   1982 C  CA  . ILE A 1 264 ? -20.962 39.338 -4.806  1.00 28.77 ? 1259 ILE A CA  1 
ATOM   1983 C  C   . ILE A 1 264 ? -20.885 39.681 -3.313  1.00 29.50 ? 1259 ILE A C   1 
ATOM   1984 O  O   . ILE A 1 264 ? -21.686 40.464 -2.810  1.00 29.72 ? 1259 ILE A O   1 
ATOM   1985 C  CB  . ILE A 1 264 ? -21.659 37.955 -4.979  1.00 28.83 ? 1259 ILE A CB  1 
ATOM   1986 C  CG1 . ILE A 1 264 ? -21.971 37.683 -6.455  1.00 28.64 ? 1259 ILE A CG1 1 
ATOM   1987 C  CG2 . ILE A 1 264 ? -22.958 37.873 -4.159  1.00 28.83 ? 1259 ILE A CG2 1 
ATOM   1988 C  CD1 . ILE A 1 264 ? -22.307 36.248 -6.761  1.00 28.36 ? 1259 ILE A CD1 1 
ATOM   1989 N  N   . GLU A 1 265 ? -19.933 39.086 -2.602  1.00 30.56 ? 1260 GLU A N   1 
ATOM   1990 C  CA  . GLU A 1 265 ? -19.773 39.329 -1.168  1.00 31.29 ? 1260 GLU A CA  1 
ATOM   1991 C  C   . GLU A 1 265 ? -19.357 40.767 -0.854  1.00 31.85 ? 1260 GLU A C   1 
ATOM   1992 O  O   . GLU A 1 265 ? -19.876 41.358 0.083   1.00 32.07 ? 1260 GLU A O   1 
ATOM   1993 C  CB  . GLU A 1 265 ? -18.732 38.378 -0.580  1.00 31.45 ? 1260 GLU A CB  1 
ATOM   1994 C  CG  . GLU A 1 265 ? -19.207 36.938 -0.407  1.00 32.27 ? 1260 GLU A CG  1 
ATOM   1995 C  CD  . GLU A 1 265 ? -18.068 35.982 -0.092  1.00 32.39 ? 1260 GLU A CD  1 
ATOM   1996 O  OE1 . GLU A 1 265 ? -16.893 36.407 -0.190  1.00 34.38 ? 1260 GLU A OE1 1 
ATOM   1997 O  OE2 . GLU A 1 265 ? -18.347 34.807 0.245   1.00 33.40 ? 1260 GLU A OE2 1 
ATOM   1998 N  N   . ASN A 1 266 ? -18.434 41.324 -1.645  1.00 32.50 ? 1261 ASN A N   1 
ATOM   1999 C  CA  . ASN A 1 266 ? -17.819 42.643 -1.363  1.00 32.96 ? 1261 ASN A CA  1 
ATOM   2000 C  C   . ASN A 1 266 ? -18.461 43.816 -2.090  1.00 33.03 ? 1261 ASN A C   1 
ATOM   2001 O  O   . ASN A 1 266 ? -18.660 44.872 -1.516  1.00 33.21 ? 1261 ASN A O   1 
ATOM   2002 C  CB  . ASN A 1 266 ? -16.323 42.602 -1.687  1.00 33.11 ? 1261 ASN A CB  1 
ATOM   2003 C  CG  . ASN A 1 266 ? -15.598 41.518 -0.908  1.00 33.55 ? 1261 ASN A CG  1 
ATOM   2004 O  OD1 . ASN A 1 266 ? -14.996 40.611 -1.483  1.00 36.38 ? 1261 ASN A OD1 1 
ATOM   2005 N  ND2 . ASN A 1 266 ? -15.679 41.594 0.402   1.00 33.53 ? 1261 ASN A ND2 1 
ATOM   2006 N  N   . GLU A 1 267 ? -18.722 43.646 -3.374  1.00 33.50 ? 1262 GLU A N   1 
ATOM   2007 C  CA  . GLU A 1 267 ? -19.577 44.561 -4.115  1.00 33.78 ? 1262 GLU A CA  1 
ATOM   2008 C  C   . GLU A 1 267 ? -20.932 43.904 -3.998  1.00 32.88 ? 1262 GLU A C   1 
ATOM   2009 O  O   . GLU A 1 267 ? -21.035 42.836 -3.424  1.00 33.64 ? 1262 GLU A O   1 
ATOM   2010 C  CB  . GLU A 1 267 ? -19.153 44.646 -5.586  1.00 33.82 ? 1262 GLU A CB  1 
ATOM   2011 C  CG  . GLU A 1 267 ? -18.104 45.691 -5.910  1.00 36.72 ? 1262 GLU A CG  1 
ATOM   2012 C  CD  . GLU A 1 267 ? -16.697 45.164 -5.785  1.00 40.08 ? 1262 GLU A CD  1 
ATOM   2013 O  OE1 . GLU A 1 267 ? -16.188 45.169 -4.641  1.00 43.94 ? 1262 GLU A OE1 1 
ATOM   2014 O  OE2 . GLU A 1 267 ? -16.106 44.753 -6.813  1.00 37.71 ? 1262 GLU A OE2 1 
ATOM   2015 N  N   . ASN A 1 268 ? -21.981 44.479 -4.552  1.00 31.85 ? 1263 ASN A N   1 
ATOM   2016 C  CA  . ASN A 1 268 ? -23.240 43.738 -4.568  1.00 31.11 ? 1263 ASN A CA  1 
ATOM   2017 C  C   . ASN A 1 268 ? -23.623 43.508 -6.025  1.00 29.65 ? 1263 ASN A C   1 
ATOM   2018 O  O   . ASN A 1 268 ? -24.763 43.726 -6.448  1.00 29.23 ? 1263 ASN A O   1 
ATOM   2019 C  CB  . ASN A 1 268 ? -24.300 44.505 -3.771  1.00 31.54 ? 1263 ASN A CB  1 
ATOM   2020 C  CG  . ASN A 1 268 ? -25.179 43.602 -2.955  1.00 32.51 ? 1263 ASN A CG  1 
ATOM   2021 O  OD1 . ASN A 1 268 ? -24.690 42.757 -2.211  1.00 35.12 ? 1263 ASN A OD1 1 
ATOM   2022 N  ND2 . ASN A 1 268 ? -26.491 43.796 -3.060  1.00 35.18 ? 1263 ASN A ND2 1 
ATOM   2023 N  N   . THR A 1 269 ? -22.632 43.066 -6.792  1.00 28.27 ? 1264 THR A N   1 
ATOM   2024 C  CA  . THR A 1 269 ? -22.717 43.072 -8.245  1.00 27.24 ? 1264 THR A CA  1 
ATOM   2025 C  C   . THR A 1 269 ? -22.099 41.815 -8.846  1.00 27.02 ? 1264 THR A C   1 
ATOM   2026 O  O   . THR A 1 269 ? -21.344 41.102 -8.182  1.00 26.02 ? 1264 THR A O   1 
ATOM   2027 C  CB  . THR A 1 269 ? -22.042 44.338 -8.855  1.00 27.19 ? 1264 THR A CB  1 
ATOM   2028 O  OG1 . THR A 1 269 ? -20.646 44.373 -8.529  1.00 25.73 ? 1264 THR A OG1 1 
ATOM   2029 C  CG2 . THR A 1 269 ? -22.718 45.628 -8.365  1.00 26.26 ? 1264 THR A CG2 1 
ATOM   2030 N  N   . VAL A 1 270 ? -22.436 41.572 -10.110 1.00 26.81 ? 1265 VAL A N   1 
ATOM   2031 C  CA  . VAL A 1 270 ? -21.990 40.396 -10.858 1.00 27.14 ? 1265 VAL A CA  1 
ATOM   2032 C  C   . VAL A 1 270 ? -21.490 40.869 -12.231 1.00 26.93 ? 1265 VAL A C   1 
ATOM   2033 O  O   . VAL A 1 270 ? -22.083 41.757 -12.827 1.00 27.71 ? 1265 VAL A O   1 
ATOM   2034 C  CB  . VAL A 1 270 ? -23.168 39.378 -11.051 1.00 27.14 ? 1265 VAL A CB  1 
ATOM   2035 C  CG1 . VAL A 1 270 ? -22.668 38.046 -11.576 1.00 26.88 ? 1265 VAL A CG1 1 
ATOM   2036 C  CG2 . VAL A 1 270 ? -23.935 39.181 -9.757  1.00 27.30 ? 1265 VAL A CG2 1 
ATOM   2037 N  N   . ASP A 1 271 ? -20.397 40.294 -12.720 1.00 27.01 ? 1266 ASP A N   1 
ATOM   2038 C  CA  . ASP A 1 271 ? -19.896 40.599 -14.068 1.00 26.70 ? 1266 ASP A CA  1 
ATOM   2039 C  C   . ASP A 1 271 ? -19.198 39.384 -14.630 1.00 26.48 ? 1266 ASP A C   1 
ATOM   2040 O  O   . ASP A 1 271 ? -17.968 39.355 -14.756 1.00 26.81 ? 1266 ASP A O   1 
ATOM   2041 C  CB  . ASP A 1 271 ? -18.950 41.806 -14.027 1.00 26.99 ? 1266 ASP A CB  1 
ATOM   2042 C  CG  . ASP A 1 271 ? -18.602 42.365 -15.417 1.00 27.18 ? 1266 ASP A CG  1 
ATOM   2043 O  OD1 . ASP A 1 271 ? -19.083 41.865 -16.459 1.00 26.06 ? 1266 ASP A OD1 1 
ATOM   2044 O  OD2 . ASP A 1 271 ? -17.804 43.329 -15.458 1.00 29.73 ? 1266 ASP A OD2 1 
ATOM   2045 N  N   . VAL A 1 272 ? -19.996 38.379 -14.976 1.00 26.82 ? 1267 VAL A N   1 
ATOM   2046 C  CA  . VAL A 1 272 ? -19.486 37.131 -15.570 1.00 26.72 ? 1267 VAL A CA  1 
ATOM   2047 C  C   . VAL A 1 272 ? -18.812 37.430 -16.905 1.00 26.60 ? 1267 VAL A C   1 
ATOM   2048 O  O   . VAL A 1 272 ? -17.698 36.953 -17.185 1.00 26.28 ? 1267 VAL A O   1 
ATOM   2049 C  CB  . VAL A 1 272 ? -20.620 36.072 -15.777 1.00 27.05 ? 1267 VAL A CB  1 
ATOM   2050 C  CG1 . VAL A 1 272 ? -20.054 34.746 -16.301 1.00 26.64 ? 1267 VAL A CG1 1 
ATOM   2051 C  CG2 . VAL A 1 272 ? -21.415 35.849 -14.480 1.00 26.53 ? 1267 VAL A CG2 1 
ATOM   2052 N  N   . TYR A 1 273 ? -19.488 38.233 -17.721 1.00 26.69 ? 1268 TYR A N   1 
ATOM   2053 C  CA  . TYR A 1 273 ? -18.939 38.641 -19.011 1.00 26.48 ? 1268 TYR A CA  1 
ATOM   2054 C  C   . TYR A 1 273 ? -17.571 39.298 -18.857 1.00 25.78 ? 1268 TYR A C   1 
ATOM   2055 O  O   . TYR A 1 273 ? -16.607 38.879 -19.499 1.00 25.58 ? 1268 TYR A O   1 
ATOM   2056 C  CB  . TYR A 1 273 ? -19.900 39.586 -19.747 1.00 27.22 ? 1268 TYR A CB  1 
ATOM   2057 C  CG  . TYR A 1 273 ? -19.423 39.940 -21.148 1.00 27.57 ? 1268 TYR A CG  1 
ATOM   2058 C  CD1 . TYR A 1 273 ? -19.777 39.164 -22.242 1.00 28.31 ? 1268 TYR A CD1 1 
ATOM   2059 C  CD2 . TYR A 1 273 ? -18.619 41.050 -21.364 1.00 28.15 ? 1268 TYR A CD2 1 
ATOM   2060 C  CE1 . TYR A 1 273 ? -19.337 39.487 -23.526 1.00 30.58 ? 1268 TYR A CE1 1 
ATOM   2061 C  CE2 . TYR A 1 273 ? -18.170 41.383 -22.631 1.00 29.24 ? 1268 TYR A CE2 1 
ATOM   2062 C  CZ  . TYR A 1 273 ? -18.531 40.603 -23.710 1.00 29.38 ? 1268 TYR A CZ  1 
ATOM   2063 O  OH  . TYR A 1 273 ? -18.081 40.933 -24.968 1.00 29.71 ? 1268 TYR A OH  1 
ATOM   2064 N  N   . GLY A 1 274 ? -17.492 40.314 -18.000 1.00 25.16 ? 1269 GLY A N   1 
ATOM   2065 C  CA  . GLY A 1 274 ? -16.226 41.018 -17.735 1.00 25.06 ? 1269 GLY A CA  1 
ATOM   2066 C  C   . GLY A 1 274 ? -15.088 40.209 -17.130 1.00 24.56 ? 1269 GLY A C   1 
ATOM   2067 O  O   . GLY A 1 274 ? -13.929 40.462 -17.407 1.00 24.77 ? 1269 GLY A O   1 
ATOM   2068 N  N   . ILE A 1 275 ? -15.418 39.238 -16.288 1.00 25.06 ? 1270 ILE A N   1 
ATOM   2069 C  CA  . ILE A 1 275 ? -14.416 38.378 -15.679 1.00 25.22 ? 1270 ILE A CA  1 
ATOM   2070 C  C   . ILE A 1 275 ? -13.859 37.399 -16.711 1.00 25.37 ? 1270 ILE A C   1 
ATOM   2071 O  O   . ILE A 1 275 ? -12.665 37.189 -16.768 1.00 25.46 ? 1270 ILE A O   1 
ATOM   2072 C  CB  . ILE A 1 275 ? -14.983 37.635 -14.451 1.00 25.69 ? 1270 ILE A CB  1 
ATOM   2073 C  CG1 . ILE A 1 275 ? -15.128 38.631 -13.276 1.00 25.72 ? 1270 ILE A CG1 1 
ATOM   2074 C  CG2 . ILE A 1 275 ? -14.095 36.433 -14.084 1.00 25.32 ? 1270 ILE A CG2 1 
ATOM   2075 C  CD1 . ILE A 1 275 ? -16.087 38.202 -12.186 1.00 24.92 ? 1270 ILE A CD1 1 
ATOM   2076 N  N   . VAL A 1 276 ? -14.723 36.816 -17.537 1.00 26.10 ? 1271 VAL A N   1 
ATOM   2077 C  CA  . VAL A 1 276 ? -14.276 35.908 -18.602 1.00 26.05 ? 1271 VAL A CA  1 
ATOM   2078 C  C   . VAL A 1 276 ? -13.499 36.685 -19.672 1.00 26.29 ? 1271 VAL A C   1 
ATOM   2079 O  O   . VAL A 1 276 ? -12.465 36.216 -20.146 1.00 27.99 ? 1271 VAL A O   1 
ATOM   2080 C  CB  . VAL A 1 276 ? -15.466 35.087 -19.230 1.00 26.00 ? 1271 VAL A CB  1 
ATOM   2081 C  CG1 . VAL A 1 276 ? -14.970 34.158 -20.346 1.00 25.22 ? 1271 VAL A CG1 1 
ATOM   2082 C  CG2 . VAL A 1 276 ? -16.162 34.250 -18.167 1.00 23.79 ? 1271 VAL A CG2 1 
ATOM   2083 N  N   . TYR A 1 277 ? -13.980 37.867 -20.044 1.00 26.21 ? 1272 TYR A N   1 
ATOM   2084 C  CA  . TYR A 1 277 ? -13.225 38.765 -20.934 1.00 25.94 ? 1272 TYR A CA  1 
ATOM   2085 C  C   . TYR A 1 277 ? -11.776 38.908 -20.446 1.00 26.37 ? 1272 TYR A C   1 
ATOM   2086 O  O   . TYR A 1 277 ? -10.826 38.673 -21.184 1.00 26.49 ? 1272 TYR A O   1 
ATOM   2087 C  CB  . TYR A 1 277 ? -13.899 40.146 -21.003 1.00 25.35 ? 1272 TYR A CB  1 
ATOM   2088 C  CG  . TYR A 1 277 ? -13.385 41.055 -22.110 1.00 24.18 ? 1272 TYR A CG  1 
ATOM   2089 C  CD1 . TYR A 1 277 ? -12.100 41.610 -22.050 1.00 24.14 ? 1272 TYR A CD1 1 
ATOM   2090 C  CD2 . TYR A 1 277 ? -14.175 41.344 -23.219 1.00 21.25 ? 1272 TYR A CD2 1 
ATOM   2091 C  CE1 . TYR A 1 277 ? -11.620 42.431 -23.064 1.00 22.19 ? 1272 TYR A CE1 1 
ATOM   2092 C  CE2 . TYR A 1 277 ? -13.712 42.158 -24.219 1.00 22.25 ? 1272 TYR A CE2 1 
ATOM   2093 C  CZ  . TYR A 1 277 ? -12.427 42.691 -24.146 1.00 22.97 ? 1272 TYR A CZ  1 
ATOM   2094 O  OH  . TYR A 1 277 ? -11.950 43.495 -25.148 1.00 22.88 ? 1272 TYR A OH  1 
ATOM   2095 N  N   . ASP A 1 278 ? -11.636 39.283 -19.180 1.00 27.03 ? 1273 ASP A N   1 
ATOM   2096 C  CA  . ASP A 1 278 ? -10.330 39.461 -18.533 1.00 27.20 ? 1273 ASP A CA  1 
ATOM   2097 C  C   . ASP A 1 278 ? -9.479  38.188 -18.523 1.00 27.28 ? 1273 ASP A C   1 
ATOM   2098 O  O   . ASP A 1 278 ? -8.277  38.242 -18.792 1.00 28.18 ? 1273 ASP A O   1 
ATOM   2099 C  CB  . ASP A 1 278 ? -10.550 39.959 -17.114 1.00 27.42 ? 1273 ASP A CB  1 
ATOM   2100 C  CG  . ASP A 1 278 ? -9.297  40.494 -16.456 1.00 28.46 ? 1273 ASP A CG  1 
ATOM   2101 O  OD1 . ASP A 1 278 ? -8.458  41.171 -17.097 1.00 31.14 ? 1273 ASP A OD1 1 
ATOM   2102 O  OD2 . ASP A 1 278 ? -9.183  40.281 -15.243 1.00 30.36 ? 1273 ASP A OD2 1 
ATOM   2103 N  N   . LEU A 1 279 ? -10.090 37.046 -18.236 1.00 26.46 ? 1274 LEU A N   1 
ATOM   2104 C  CA  . LEU A 1 279 ? -9.385  35.787 -18.353 1.00 26.27 ? 1274 LEU A CA  1 
ATOM   2105 C  C   . LEU A 1 279 ? -8.826  35.523 -19.753 1.00 25.86 ? 1274 LEU A C   1 
ATOM   2106 O  O   . LEU A 1 279 ? -7.667  35.176 -19.886 1.00 25.96 ? 1274 LEU A O   1 
ATOM   2107 C  CB  . LEU A 1 279 ? -10.273 34.615 -17.890 1.00 26.49 ? 1274 LEU A CB  1 
ATOM   2108 C  CG  . LEU A 1 279 ? -10.623 34.594 -16.405 1.00 25.42 ? 1274 LEU A CG  1 
ATOM   2109 C  CD1 . LEU A 1 279 ? -11.467 33.395 -16.061 1.00 24.89 ? 1274 LEU A CD1 1 
ATOM   2110 C  CD2 . LEU A 1 279 ? -9.358  34.637 -15.554 1.00 27.90 ? 1274 LEU A CD2 1 
ATOM   2111 N  N   . ARG A 1 280 ? -9.653  35.678 -20.783 1.00 26.18 ? 1275 ARG A N   1 
ATOM   2112 C  CA  . ARG A 1 280 ? -9.238  35.497 -22.183 1.00 25.71 ? 1275 ARG A CA  1 
ATOM   2113 C  C   . ARG A 1 280 ? -8.102  36.406 -22.606 1.00 25.22 ? 1275 ARG A C   1 
ATOM   2114 O  O   . ARG A 1 280 ? -7.337  36.054 -23.495 1.00 24.39 ? 1275 ARG A O   1 
ATOM   2115 C  CB  . ARG A 1 280 ? -10.391 35.783 -23.154 1.00 25.97 ? 1275 ARG A CB  1 
ATOM   2116 C  CG  . ARG A 1 280 ? -11.535 34.853 -23.075 1.00 25.72 ? 1275 ARG A CG  1 
ATOM   2117 C  CD  . ARG A 1 280 ? -11.194 33.531 -23.679 1.00 26.15 ? 1275 ARG A CD  1 
ATOM   2118 N  NE  . ARG A 1 280 ? -12.312 32.646 -23.474 1.00 24.96 ? 1275 ARG A NE  1 
ATOM   2119 C  CZ  . ARG A 1 280 ? -13.390 32.604 -24.238 1.00 27.08 ? 1275 ARG A CZ  1 
ATOM   2120 N  NH1 . ARG A 1 280 ? -13.499 33.355 -25.327 1.00 26.10 ? 1275 ARG A NH1 1 
ATOM   2121 N  NH2 . ARG A 1 280 ? -14.363 31.770 -23.905 1.00 28.70 ? 1275 ARG A NH2 1 
ATOM   2122 N  N   . MET A 1 281 ? -8.027  37.593 -22.008 1.00 25.19 ? 1276 MET A N   1 
ATOM   2123 C  CA  . MET A 1 281 ? -6.898  38.484 -22.236 1.00 25.02 ? 1276 MET A CA  1 
ATOM   2124 C  C   . MET A 1 281 ? -5.585  37.954 -21.692 1.00 24.59 ? 1276 MET A C   1 
ATOM   2125 O  O   . MET A 1 281 ? -4.538  38.448 -22.069 1.00 24.11 ? 1276 MET A O   1 
ATOM   2126 C  CB  . MET A 1 281 ? -7.160  39.876 -21.650 1.00 25.40 ? 1276 MET A CB  1 
ATOM   2127 C  CG  . MET A 1 281 ? -8.213  40.671 -22.428 1.00 26.07 ? 1276 MET A CG  1 
ATOM   2128 S  SD  . MET A 1 281 ? -7.913  40.852 -24.199 1.00 27.38 ? 1276 MET A SD  1 
ATOM   2129 C  CE  . MET A 1 281 ? -6.209  41.395 -24.173 1.00 24.93 ? 1276 MET A CE  1 
ATOM   2130 N  N   . HIS A 1 282 ? -5.624  36.944 -20.825 1.00 24.65 ? 1277 HIS A N   1 
ATOM   2131 C  CA  . HIS A 1 282 ? -4.389  36.392 -20.242 1.00 24.38 ? 1277 HIS A CA  1 
ATOM   2132 C  C   . HIS A 1 282 ? -4.054  34.957 -20.623 1.00 24.35 ? 1277 HIS A C   1 
ATOM   2133 O  O   . HIS A 1 282 ? -2.907  34.535 -20.467 1.00 24.60 ? 1277 HIS A O   1 
ATOM   2134 C  CB  . HIS A 1 282 ? -4.438  36.559 -18.725 1.00 24.35 ? 1277 HIS A CB  1 
ATOM   2135 C  CG  . HIS A 1 282 ? -4.571  37.984 -18.322 1.00 22.34 ? 1277 HIS A CG  1 
ATOM   2136 N  ND1 . HIS A 1 282 ? -5.791  38.616 -18.238 1.00 22.07 ? 1277 HIS A ND1 1 
ATOM   2137 C  CD2 . HIS A 1 282 ? -3.637  38.929 -18.091 1.00 21.51 ? 1277 HIS A CD2 1 
ATOM   2138 C  CE1 . HIS A 1 282 ? -5.604  39.881 -17.909 1.00 23.76 ? 1277 HIS A CE1 1 
ATOM   2139 N  NE2 . HIS A 1 282 ? -4.303  40.100 -17.821 1.00 23.36 ? 1277 HIS A NE2 1 
ATOM   2140 N  N   . ARG A 1 283 ? -5.030  34.229 -21.151 1.00 23.84 ? 1278 ARG A N   1 
ATOM   2141 C  CA  . ARG A 1 283 ? -4.785  32.900 -21.675 1.00 23.64 ? 1278 ARG A CA  1 
ATOM   2142 C  C   . ARG A 1 283 ? -5.923  32.566 -22.622 1.00 23.71 ? 1278 ARG A C   1 
ATOM   2143 O  O   . ARG A 1 283 ? -7.024  33.022 -22.403 1.00 23.09 ? 1278 ARG A O   1 
ATOM   2144 C  CB  . ARG A 1 283 ? -4.710  31.913 -20.508 1.00 23.63 ? 1278 ARG A CB  1 
ATOM   2145 C  CG  . ARG A 1 283 ? -4.398  30.474 -20.851 1.00 23.63 ? 1278 ARG A CG  1 
ATOM   2146 C  CD  . ARG A 1 283 ? -4.069  29.708 -19.596 1.00 22.35 ? 1278 ARG A CD  1 
ATOM   2147 N  NE  . ARG A 1 283 ? -3.931  28.275 -19.825 1.00 21.49 ? 1278 ARG A NE  1 
ATOM   2148 C  CZ  . ARG A 1 283 ? -2.857  27.693 -20.349 1.00 23.61 ? 1278 ARG A CZ  1 
ATOM   2149 N  NH1 . ARG A 1 283 ? -1.827  28.424 -20.768 1.00 24.57 ? 1278 ARG A NH1 1 
ATOM   2150 N  NH2 . ARG A 1 283 ? -2.834  26.368 -20.502 1.00 23.19 ? 1278 ARG A NH2 1 
ATOM   2151 N  N   . PRO A 1 284 ? -5.658  31.802 -23.699 1.00 24.40 ? 1279 PRO A N   1 
ATOM   2152 C  CA  . PRO A 1 284 ? -6.781  31.402 -24.561 1.00 25.03 ? 1279 PRO A CA  1 
ATOM   2153 C  C   . PRO A 1 284 ? -7.856  30.524 -23.911 1.00 25.18 ? 1279 PRO A C   1 
ATOM   2154 O  O   . PRO A 1 284 ? -7.597  29.820 -22.942 1.00 26.01 ? 1279 PRO A O   1 
ATOM   2155 C  CB  . PRO A 1 284 ? -6.102  30.623 -25.712 1.00 24.77 ? 1279 PRO A CB  1 
ATOM   2156 C  CG  . PRO A 1 284 ? -4.807  30.212 -25.181 1.00 25.42 ? 1279 PRO A CG  1 
ATOM   2157 C  CD  . PRO A 1 284 ? -4.373  31.308 -24.226 1.00 24.64 ? 1279 PRO A CD  1 
ATOM   2158 N  N   . LEU A 1 285 ? -9.057  30.582 -24.473 1.00 25.17 ? 1280 LEU A N   1 
ATOM   2159 C  CA  . LEU A 1 285 ? -10.084 29.584 -24.245 1.00 25.50 ? 1280 LEU A CA  1 
ATOM   2160 C  C   . LEU A 1 285 ? -10.656 29.503 -22.829 1.00 24.92 ? 1280 LEU A C   1 
ATOM   2161 O  O   . LEU A 1 285 ? -11.437 28.621 -22.561 1.00 24.52 ? 1280 LEU A O   1 
ATOM   2162 C  CB  . LEU A 1 285 ? -9.591  28.184 -24.699 1.00 25.44 ? 1280 LEU A CB  1 
ATOM   2163 C  CG  . LEU A 1 285 ? -9.308  27.995 -26.194 1.00 26.16 ? 1280 LEU A CG  1 
ATOM   2164 C  CD1 . LEU A 1 285 ? -8.651  26.645 -26.411 1.00 25.43 ? 1280 LEU A CD1 1 
ATOM   2165 C  CD2 . LEU A 1 285 ? -10.604 28.149 -27.063 1.00 26.13 ? 1280 LEU A CD2 1 
ATOM   2166 N  N   . MET A 1 286 ? -10.309 30.432 -21.944 1.00 25.57 ? 1281 MET A N   1 
ATOM   2167 C  CA  . MET A 1 286 ? -10.766 30.361 -20.547 1.00 25.80 ? 1281 MET A CA  1 
ATOM   2168 C  C   . MET A 1 286 ? -12.278 30.385 -20.488 1.00 26.33 ? 1281 MET A C   1 
ATOM   2169 O  O   . MET A 1 286 ? -12.893 31.326 -21.005 1.00 26.92 ? 1281 MET A O   1 
ATOM   2170 C  CB  . MET A 1 286 ? -10.209 31.513 -19.702 1.00 26.24 ? 1281 MET A CB  1 
ATOM   2171 C  CG  . MET A 1 286 ? -8.707  31.659 -19.753 1.00 25.19 ? 1281 MET A CG  1 
ATOM   2172 S  SD  . MET A 1 286 ? -7.802  30.150 -19.458 1.00 27.83 ? 1281 MET A SD  1 
ATOM   2173 C  CE  . MET A 1 286 ? -7.968  29.860 -17.707 1.00 22.40 ? 1281 MET A CE  1 
ATOM   2174 N  N   . VAL A 1 287 ? -12.851 29.360 -19.841 1.00 26.62 ? 1282 VAL A N   1 
ATOM   2175 C  CA  . VAL A 1 287 ? -14.268 29.033 -19.903 1.00 26.46 ? 1282 VAL A CA  1 
ATOM   2176 C  C   . VAL A 1 287 ? -14.574 28.638 -21.352 1.00 27.75 ? 1282 VAL A C   1 
ATOM   2177 O  O   . VAL A 1 287 ? -14.918 29.476 -22.198 1.00 28.66 ? 1282 VAL A O   1 
ATOM   2178 C  CB  . VAL A 1 287 ? -15.179 30.176 -19.346 1.00 26.53 ? 1282 VAL A CB  1 
ATOM   2179 C  CG1 . VAL A 1 287 ? -16.647 29.730 -19.281 1.00 24.42 ? 1282 VAL A CG1 1 
ATOM   2180 C  CG2 . VAL A 1 287 ? -14.681 30.612 -17.963 1.00 24.60 ? 1282 VAL A CG2 1 
ATOM   2181 N  N   . GLN A 1 288 ? -14.450 27.346 -21.629 1.00 28.17 ? 1283 GLN A N   1 
ATOM   2182 C  CA  . GLN A 1 288 ? -14.198 26.878 -22.990 1.00 28.86 ? 1283 GLN A CA  1 
ATOM   2183 C  C   . GLN A 1 288 ? -15.467 26.518 -23.795 1.00 29.04 ? 1283 GLN A C   1 
ATOM   2184 O  O   . GLN A 1 288 ? -15.419 26.450 -25.021 1.00 29.10 ? 1283 GLN A O   1 
ATOM   2185 C  CB  . GLN A 1 288 ? -13.204 25.707 -22.919 1.00 29.23 ? 1283 GLN A CB  1 
ATOM   2186 C  CG  . GLN A 1 288 ? -12.867 25.023 -24.234 1.00 29.86 ? 1283 GLN A CG  1 
ATOM   2187 C  CD  . GLN A 1 288 ? -13.739 23.831 -24.527 1.00 30.10 ? 1283 GLN A CD  1 
ATOM   2188 O  OE1 . GLN A 1 288 ? -14.087 23.068 -23.627 1.00 33.13 ? 1283 GLN A OE1 1 
ATOM   2189 N  NE2 . GLN A 1 288 ? -14.076 23.644 -25.793 1.00 28.05 ? 1283 GLN A NE2 1 
ATOM   2190 N  N   . THR A 1 289 ? -16.586 26.293 -23.106 1.00 29.23 ? 1284 THR A N   1 
ATOM   2191 C  CA  . THR A 1 289 ? -17.868 26.017 -23.742 1.00 28.95 ? 1284 THR A CA  1 
ATOM   2192 C  C   . THR A 1 289 ? -18.934 26.979 -23.218 1.00 28.88 ? 1284 THR A C   1 
ATOM   2193 O  O   . THR A 1 289 ? -18.784 27.597 -22.163 1.00 28.07 ? 1284 THR A O   1 
ATOM   2194 C  CB  . THR A 1 289 ? -18.380 24.566 -23.487 1.00 29.26 ? 1284 THR A CB  1 
ATOM   2195 O  OG1 . THR A 1 289 ? -18.787 24.434 -22.130 1.00 29.46 ? 1284 THR A OG1 1 
ATOM   2196 C  CG2 . THR A 1 289 ? -17.330 23.508 -23.797 1.00 29.29 ? 1284 THR A CG2 1 
ATOM   2197 N  N   . GLU A 1 290 ? -20.017 27.079 -23.982 1.00 29.25 ? 1285 GLU A N   1 
ATOM   2198 C  CA  . GLU A 1 290 ? -21.163 27.923 -23.664 1.00 29.69 ? 1285 GLU A CA  1 
ATOM   2199 C  C   . GLU A 1 290 ? -21.891 27.418 -22.427 1.00 29.18 ? 1285 GLU A C   1 
ATOM   2200 O  O   . GLU A 1 290 ? -22.408 28.210 -21.653 1.00 29.45 ? 1285 GLU A O   1 
ATOM   2201 C  CB  . GLU A 1 290 ? -22.117 27.973 -24.869 1.00 29.62 ? 1285 GLU A CB  1 
ATOM   2202 C  CG  . GLU A 1 290 ? -23.305 28.913 -24.716 1.00 30.66 ? 1285 GLU A CG  1 
ATOM   2203 C  CD  . GLU A 1 290 ? -24.451 28.548 -25.646 1.00 31.71 ? 1285 GLU A CD  1 
ATOM   2204 O  OE1 . GLU A 1 290 ? -24.204 28.379 -26.852 1.00 34.82 ? 1285 GLU A OE1 1 
ATOM   2205 O  OE2 . GLU A 1 290 ? -25.601 28.409 -25.173 1.00 36.29 ? 1285 GLU A OE2 1 
ATOM   2206 N  N   . ASP A 1 291 ? -21.910 26.101 -22.241 1.00 29.32 ? 1286 ASP A N   1 
ATOM   2207 C  CA  . ASP A 1 291 ? -22.529 25.489 -21.071 1.00 29.18 ? 1286 ASP A CA  1 
ATOM   2208 C  C   . ASP A 1 291 ? -21.791 25.838 -19.790 1.00 28.53 ? 1286 ASP A C   1 
ATOM   2209 O  O   . ASP A 1 291 ? -22.421 26.008 -18.739 1.00 28.54 ? 1286 ASP A O   1 
ATOM   2210 C  CB  . ASP A 1 291 ? -22.617 23.962 -21.224 1.00 29.52 ? 1286 ASP A CB  1 
ATOM   2211 C  CG  . ASP A 1 291 ? -23.659 23.526 -22.261 1.00 30.77 ? 1286 ASP A CG  1 
ATOM   2212 O  OD1 . ASP A 1 291 ? -24.458 24.362 -22.743 1.00 34.64 ? 1286 ASP A OD1 1 
ATOM   2213 O  OD2 . ASP A 1 291 ? -23.688 22.332 -22.592 1.00 32.53 ? 1286 ASP A OD2 1 
ATOM   2214 N  N   . GLN A 1 292 ? -20.467 25.948 -19.870 1.00 27.98 ? 1287 GLN A N   1 
ATOM   2215 C  CA  . GLN A 1 292 ? -19.662 26.324 -18.703 1.00 27.31 ? 1287 GLN A CA  1 
ATOM   2216 C  C   . GLN A 1 292 ? -19.962 27.762 -18.276 1.00 26.97 ? 1287 GLN A C   1 
ATOM   2217 O  O   . GLN A 1 292 ? -20.038 28.056 -17.080 1.00 27.14 ? 1287 GLN A O   1 
ATOM   2218 C  CB  . GLN A 1 292 ? -18.170 26.134 -18.988 1.00 27.78 ? 1287 GLN A CB  1 
ATOM   2219 C  CG  . GLN A 1 292 ? -17.729 24.675 -19.016 1.00 26.29 ? 1287 GLN A CG  1 
ATOM   2220 C  CD  . GLN A 1 292 ? -16.304 24.506 -19.434 1.00 26.64 ? 1287 GLN A CD  1 
ATOM   2221 O  OE1 . GLN A 1 292 ? -15.678 25.437 -19.969 1.00 29.59 ? 1287 GLN A OE1 1 
ATOM   2222 N  NE2 . GLN A 1 292 ? -15.766 23.319 -19.213 1.00 24.25 ? 1287 GLN A NE2 1 
ATOM   2223 N  N   . TYR A 1 293 ? -20.163 28.629 -19.277 1.00 26.50 ? 1288 TYR A N   1 
ATOM   2224 C  CA  . TYR A 1 293 ? -20.520 30.038 -19.100 1.00 25.49 ? 1288 TYR A CA  1 
ATOM   2225 C  C   . TYR A 1 293 ? -21.933 30.160 -18.537 1.00 25.35 ? 1288 TYR A C   1 
ATOM   2226 O  O   . TYR A 1 293 ? -22.173 30.898 -17.577 1.00 25.39 ? 1288 TYR A O   1 
ATOM   2227 C  CB  . TYR A 1 293 ? -20.420 30.756 -20.455 1.00 25.14 ? 1288 TYR A CB  1 
ATOM   2228 C  CG  . TYR A 1 293 ? -20.653 32.251 -20.394 1.00 24.28 ? 1288 TYR A CG  1 
ATOM   2229 C  CD1 . TYR A 1 293 ? -19.604 33.115 -20.090 1.00 23.28 ? 1288 TYR A CD1 1 
ATOM   2230 C  CD2 . TYR A 1 293 ? -21.909 32.806 -20.668 1.00 24.45 ? 1288 TYR A CD2 1 
ATOM   2231 C  CE1 . TYR A 1 293 ? -19.789 34.488 -20.033 1.00 23.60 ? 1288 TYR A CE1 1 
ATOM   2232 C  CE2 . TYR A 1 293 ? -22.110 34.208 -20.615 1.00 24.44 ? 1288 TYR A CE2 1 
ATOM   2233 C  CZ  . TYR A 1 293 ? -21.036 35.034 -20.295 1.00 24.22 ? 1288 TYR A CZ  1 
ATOM   2234 O  OH  . TYR A 1 293 ? -21.174 36.401 -20.224 1.00 23.46 ? 1288 TYR A OH  1 
ATOM   2235 N  N   . VAL A 1 294 ? -22.871 29.433 -19.135 1.00 25.07 ? 1289 VAL A N   1 
ATOM   2236 C  CA  . VAL A 1 294 ? -24.225 29.365 -18.594 1.00 25.32 ? 1289 VAL A CA  1 
ATOM   2237 C  C   . VAL A 1 294 ? -24.180 28.836 -17.159 1.00 25.37 ? 1289 VAL A C   1 
ATOM   2238 O  O   . VAL A 1 294 ? -24.836 29.389 -16.290 1.00 26.00 ? 1289 VAL A O   1 
ATOM   2239 C  CB  . VAL A 1 294 ? -25.159 28.509 -19.483 1.00 25.42 ? 1289 VAL A CB  1 
ATOM   2240 C  CG1 . VAL A 1 294 ? -26.487 28.220 -18.777 1.00 24.65 ? 1289 VAL A CG1 1 
ATOM   2241 C  CG2 . VAL A 1 294 ? -25.391 29.220 -20.822 1.00 25.74 ? 1289 VAL A CG2 1 
ATOM   2242 N  N   . PHE A 1 295 ? -23.366 27.809 -16.914 1.00 25.47 ? 1290 PHE A N   1 
ATOM   2243 C  CA  . PHE A 1 295 ? -23.188 27.220 -15.577 1.00 25.30 ? 1290 PHE A CA  1 
ATOM   2244 C  C   . PHE A 1 295 ? -22.709 28.251 -14.538 1.00 24.90 ? 1290 PHE A C   1 
ATOM   2245 O  O   . PHE A 1 295 ? -23.197 28.271 -13.405 1.00 25.26 ? 1290 PHE A O   1 
ATOM   2246 C  CB  . PHE A 1 295 ? -22.251 26.000 -15.648 1.00 25.38 ? 1290 PHE A CB  1 
ATOM   2247 C  CG  . PHE A 1 295 ? -22.205 25.176 -14.383 1.00 25.21 ? 1290 PHE A CG  1 
ATOM   2248 C  CD1 . PHE A 1 295 ? -21.150 25.306 -13.487 1.00 26.27 ? 1290 PHE A CD1 1 
ATOM   2249 C  CD2 . PHE A 1 295 ? -23.191 24.256 -14.104 1.00 25.21 ? 1290 PHE A CD2 1 
ATOM   2250 C  CE1 . PHE A 1 295 ? -21.105 24.538 -12.328 1.00 26.02 ? 1290 PHE A CE1 1 
ATOM   2251 C  CE2 . PHE A 1 295 ? -23.138 23.499 -12.946 1.00 26.13 ? 1290 PHE A CE2 1 
ATOM   2252 C  CZ  . PHE A 1 295 ? -22.087 23.645 -12.064 1.00 24.61 ? 1290 PHE A CZ  1 
ATOM   2253 N  N   . LEU A 1 296 ? -21.782 29.119 -14.925 1.00 24.67 ? 1291 LEU A N   1 
ATOM   2254 C  CA  . LEU A 1 296 ? -21.327 30.192 -14.030 1.00 24.25 ? 1291 LEU A CA  1 
ATOM   2255 C  C   . LEU A 1 296 ? -22.479 31.103 -13.614 1.00 23.91 ? 1291 LEU A C   1 
ATOM   2256 O  O   . LEU A 1 296 ? -22.517 31.619 -12.492 1.00 23.82 ? 1291 LEU A O   1 
ATOM   2257 C  CB  . LEU A 1 296 ? -20.222 31.026 -14.688 1.00 24.10 ? 1291 LEU A CB  1 
ATOM   2258 C  CG  . LEU A 1 296 ? -18.823 30.397 -14.732 1.00 24.70 ? 1291 LEU A CG  1 
ATOM   2259 C  CD1 . LEU A 1 296 ? -17.834 31.289 -15.500 1.00 22.74 ? 1291 LEU A CD1 1 
ATOM   2260 C  CD2 . LEU A 1 296 ? -18.282 30.079 -13.321 1.00 23.47 ? 1291 LEU A CD2 1 
ATOM   2261 N  N   . ASN A 1 297 ? -23.409 31.306 -14.543 1.00 23.58 ? 1292 ASN A N   1 
ATOM   2262 C  CA  . ASN A 1 297 ? -24.557 32.154 -14.323 1.00 22.85 ? 1292 ASN A CA  1 
ATOM   2263 C  C   . ASN A 1 297 ? -25.594 31.475 -13.418 1.00 22.96 ? 1292 ASN A C   1 
ATOM   2264 O  O   . ASN A 1 297 ? -26.207 32.147 -12.563 1.00 22.51 ? 1292 ASN A O   1 
ATOM   2265 C  CB  . ASN A 1 297 ? -25.158 32.581 -15.664 1.00 23.08 ? 1292 ASN A CB  1 
ATOM   2266 C  CG  . ASN A 1 297 ? -24.474 33.816 -16.245 1.00 22.87 ? 1292 ASN A CG  1 
ATOM   2267 O  OD1 . ASN A 1 297 ? -24.735 34.937 -15.806 1.00 21.34 ? 1292 ASN A OD1 1 
ATOM   2268 N  ND2 . ASN A 1 297 ? -23.586 33.611 -17.227 1.00 22.32 ? 1292 ASN A ND2 1 
ATOM   2269 N  N   . GLN A 1 298 ? -25.766 30.153 -13.591 1.00 22.65 ? 1293 GLN A N   1 
ATOM   2270 C  CA  . GLN A 1 298 ? -26.646 29.347 -12.726 1.00 21.99 ? 1293 GLN A CA  1 
ATOM   2271 C  C   . GLN A 1 298 ? -26.065 29.316 -11.292 1.00 22.57 ? 1293 GLN A C   1 
ATOM   2272 O  O   . GLN A 1 298 ? -26.789 29.540 -10.338 1.00 22.83 ? 1293 GLN A O   1 
ATOM   2273 C  CB  . GLN A 1 298 ? -26.962 27.918 -13.296 1.00 22.15 ? 1293 GLN A CB  1 
ATOM   2274 C  CG  A GLN A 1 298 ? -26.533 27.790 -14.795 0.50 21.49 ? 1293 GLN A CG  1 
ATOM   2275 C  CG  B GLN A 1 298 ? -27.806 27.156 -12.281 0.50 20.35 ? 1293 GLN A CG  1 
ATOM   2276 C  CD  A GLN A 1 298 ? -27.055 26.509 -15.510 0.50 21.14 ? 1293 GLN A CD  1 
ATOM   2277 C  CD  B GLN A 1 298 ? -29.263 27.552 -12.353 0.50 19.16 ? 1293 GLN A CD  1 
ATOM   2278 O  OE1 A GLN A 1 298 ? -26.309 25.537 -15.710 0.50 17.20 ? 1293 GLN A OE1 1 
ATOM   2279 O  OE1 B GLN A 1 298 ? -29.840 27.627 -13.439 0.50 18.30 ? 1293 GLN A OE1 1 
ATOM   2280 N  NE2 A GLN A 1 298 ? -28.335 26.529 -15.910 0.50 17.60 ? 1293 GLN A NE2 1 
ATOM   2281 N  NE2 B GLN A 1 298 ? -29.868 27.801 -11.203 0.50 18.32 ? 1293 GLN A NE2 1 
ATOM   2282 N  N   . CYS A 1 299 ? -24.762 29.086 -11.144 1.00 23.58 ? 1294 CYS A N   1 
ATOM   2283 C  CA  . CYS A 1 299 ? -24.067 29.292 -9.850  1.00 24.13 ? 1294 CYS A CA  1 
ATOM   2284 C  C   . CYS A 1 299 ? -24.422 30.624 -9.197  1.00 24.16 ? 1294 CYS A C   1 
ATOM   2285 O  O   . CYS A 1 299 ? -24.812 30.660 -8.023  1.00 24.66 ? 1294 CYS A O   1 
ATOM   2286 C  CB  . CYS A 1 299 ? -22.542 29.229 -10.013 1.00 24.57 ? 1294 CYS A CB  1 
ATOM   2287 S  SG  . CYS A 1 299 ? -21.861 27.587 -10.392 1.00 26.17 ? 1294 CYS A SG  1 
ATOM   2288 N  N   . VAL A 1 300 ? -24.308 31.716 -9.946  1.00 24.17 ? 1295 VAL A N   1 
ATOM   2289 C  CA  . VAL A 1 300 ? -24.639 33.042 -9.399  1.00 24.02 ? 1295 VAL A CA  1 
ATOM   2290 C  C   . VAL A 1 300 ? -26.108 33.104 -8.989  1.00 24.52 ? 1295 VAL A C   1 
ATOM   2291 O  O   . VAL A 1 300 ? -26.435 33.642 -7.930  1.00 24.58 ? 1295 VAL A O   1 
ATOM   2292 C  CB  . VAL A 1 300 ? -24.287 34.191 -10.397 1.00 24.32 ? 1295 VAL A CB  1 
ATOM   2293 C  CG1 . VAL A 1 300 ? -24.812 35.552 -9.913  1.00 22.92 ? 1295 VAL A CG1 1 
ATOM   2294 C  CG2 . VAL A 1 300 ? -22.792 34.237 -10.624 1.00 22.76 ? 1295 VAL A CG2 1 
ATOM   2295 N  N   . LEU A 1 301 ? -26.994 32.532 -9.808  1.00 24.80 ? 1296 LEU A N   1 
ATOM   2296 C  CA  . LEU A 1 301 ? -28.431 32.562 -9.497  1.00 24.91 ? 1296 LEU A CA  1 
ATOM   2297 C  C   . LEU A 1 301 ? -28.723 31.885 -8.181  1.00 25.37 ? 1296 LEU A C   1 
ATOM   2298 O  O   . LEU A 1 301 ? -29.492 32.392 -7.374  1.00 25.80 ? 1296 LEU A O   1 
ATOM   2299 C  CB  . LEU A 1 301 ? -29.262 31.886 -10.595 1.00 24.88 ? 1296 LEU A CB  1 
ATOM   2300 C  CG  . LEU A 1 301 ? -30.778 32.046 -10.497 1.00 23.21 ? 1296 LEU A CG  1 
ATOM   2301 C  CD1 . LEU A 1 301 ? -31.195 33.508 -10.560 1.00 22.87 ? 1296 LEU A CD1 1 
ATOM   2302 C  CD2 . LEU A 1 301 ? -31.437 31.254 -11.607 1.00 24.23 ? 1296 LEU A CD2 1 
ATOM   2303 N  N   . ASP A 1 302 ? -28.099 30.736 -7.970  1.00 26.43 ? 1297 ASP A N   1 
ATOM   2304 C  CA  . ASP A 1 302 ? -28.330 29.935 -6.770  1.00 27.01 ? 1297 ASP A CA  1 
ATOM   2305 C  C   . ASP A 1 302 ? -27.753 30.630 -5.526  1.00 27.25 ? 1297 ASP A C   1 
ATOM   2306 O  O   . ASP A 1 302 ? -28.371 30.627 -4.477  1.00 27.84 ? 1297 ASP A O   1 
ATOM   2307 C  CB  . ASP A 1 302 ? -27.775 28.509 -6.964  1.00 27.05 ? 1297 ASP A CB  1 
ATOM   2308 C  CG  . ASP A 1 302 ? -28.411 27.779 -8.172  1.00 28.02 ? 1297 ASP A CG  1 
ATOM   2309 O  OD1 . ASP A 1 302 ? -29.494 28.206 -8.637  1.00 31.13 ? 1297 ASP A OD1 1 
ATOM   2310 O  OD2 . ASP A 1 302 ? -27.852 26.763 -8.648  1.00 27.30 ? 1297 ASP A OD2 1 
ATOM   2311 N  N   . ILE A 1 303 ? -26.599 31.269 -5.658  1.00 28.05 ? 1298 ILE A N   1 
ATOM   2312 C  CA  . ILE A 1 303 ? -26.036 32.076 -4.572  1.00 28.65 ? 1298 ILE A CA  1 
ATOM   2313 C  C   . ILE A 1 303 ? -26.931 33.258 -4.225  1.00 29.28 ? 1298 ILE A C   1 
ATOM   2314 O  O   . ILE A 1 303 ? -27.138 33.542 -3.059  1.00 29.17 ? 1298 ILE A O   1 
ATOM   2315 C  CB  . ILE A 1 303 ? -24.640 32.620 -4.932  1.00 28.84 ? 1298 ILE A CB  1 
ATOM   2316 C  CG1 . ILE A 1 303 ? -23.621 31.478 -4.971  1.00 28.55 ? 1298 ILE A CG1 1 
ATOM   2317 C  CG2 . ILE A 1 303 ? -24.200 33.703 -3.927  1.00 29.23 ? 1298 ILE A CG2 1 
ATOM   2318 C  CD1 . ILE A 1 303 ? -22.417 31.797 -5.825  1.00 28.73 ? 1298 ILE A CD1 1 
ATOM   2319 N  N   . VAL A 1 304 ? -27.448 33.940 -5.248  1.00 30.14 ? 1299 VAL A N   1 
ATOM   2320 C  CA  . VAL A 1 304 ? -28.378 35.061 -5.076  1.00 30.67 ? 1299 VAL A CA  1 
ATOM   2321 C  C   . VAL A 1 304 ? -29.714 34.607 -4.455  1.00 31.70 ? 1299 VAL A C   1 
ATOM   2322 O  O   . VAL A 1 304 ? -30.219 35.237 -3.524  1.00 31.56 ? 1299 VAL A O   1 
ATOM   2323 C  CB  . VAL A 1 304 ? -28.617 35.825 -6.436  1.00 30.87 ? 1299 VAL A CB  1 
ATOM   2324 C  CG1 . VAL A 1 304 ? -29.730 36.863 -6.308  1.00 29.74 ? 1299 VAL A CG1 1 
ATOM   2325 C  CG2 . VAL A 1 304 ? -27.314 36.488 -6.932  1.00 29.94 ? 1299 VAL A CG2 1 
ATOM   2326 N  N   . ARG A 1 305 ? -30.286 33.515 -4.953  1.00 32.98 ? 1300 ARG A N   1 
ATOM   2327 C  CA  . ARG A 1 305 ? -31.549 32.991 -4.382  1.00 34.23 ? 1300 ARG A CA  1 
ATOM   2328 C  C   . ARG A 1 305 ? -31.458 32.565 -2.905  1.00 34.69 ? 1300 ARG A C   1 
ATOM   2329 O  O   . ARG A 1 305 ? -32.452 32.641 -2.182  1.00 34.98 ? 1300 ARG A O   1 
ATOM   2330 C  CB  . ARG A 1 305 ? -32.085 31.816 -5.212  1.00 34.16 ? 1300 ARG A CB  1 
ATOM   2331 C  CG  . ARG A 1 305 ? -32.716 32.241 -6.515  1.00 35.15 ? 1300 ARG A CG  1 
ATOM   2332 C  CD  . ARG A 1 305 ? -33.177 31.062 -7.357  1.00 35.78 ? 1300 ARG A CD  1 
ATOM   2333 N  NE  . ARG A 1 305 ? -34.192 31.498 -8.321  1.00 38.11 ? 1300 ARG A NE  1 
ATOM   2334 C  CZ  . ARG A 1 305 ? -34.492 30.891 -9.471  1.00 38.82 ? 1300 ARG A CZ  1 
ATOM   2335 N  NH1 . ARG A 1 305 ? -33.850 29.787 -9.863  1.00 40.16 ? 1300 ARG A NH1 1 
ATOM   2336 N  NH2 . ARG A 1 305 ? -35.441 31.408 -10.250 1.00 37.67 ? 1300 ARG A NH2 1 
ATOM   2337 N  N   . SER A 1 306 ? -30.285 32.103 -2.472  1.00 35.46 ? 1301 SER A N   1 
ATOM   2338 C  CA  . SER A 1 306 ? -30.094 31.631 -1.099  1.00 36.12 ? 1301 SER A CA  1 
ATOM   2339 C  C   . SER A 1 306 ? -29.740 32.758 -0.131  1.00 37.00 ? 1301 SER A C   1 
ATOM   2340 O  O   . SER A 1 306 ? -29.958 32.621 1.070   1.00 37.10 ? 1301 SER A O   1 
ATOM   2341 C  CB  . SER A 1 306 ? -29.008 30.548 -1.040  1.00 36.21 ? 1301 SER A CB  1 
ATOM   2342 O  OG  . SER A 1 306 ? -27.746 31.050 -1.449  1.00 35.44 ? 1301 SER A OG  1 
ATOM   2343 N  N   . GLN A 1 307 ? -29.187 33.857 -0.640  1.00 37.90 ? 1302 GLN A N   1 
ATOM   2344 C  CA  . GLN A 1 307 ? -28.854 35.016 0.200   1.00 38.84 ? 1302 GLN A CA  1 
ATOM   2345 C  C   . GLN A 1 307 ? -30.063 35.910 0.436   1.00 39.42 ? 1302 GLN A C   1 
ATOM   2346 O  O   . GLN A 1 307 ? -29.989 36.836 1.237   1.00 40.13 ? 1302 GLN A O   1 
ATOM   2347 C  CB  . GLN A 1 307 ? -27.727 35.866 -0.419  1.00 39.15 ? 1302 GLN A CB  1 
ATOM   2348 C  CG  . GLN A 1 307 ? -28.108 36.530 -1.744  1.00 39.45 ? 1302 GLN A CG  1 
ATOM   2349 C  CD  . GLN A 1 307 ? -27.574 37.937 -1.915  1.00 39.76 ? 1302 GLN A CD  1 
ATOM   2350 O  OE1 . GLN A 1 307 ? -28.331 38.904 -1.819  1.00 40.42 ? 1302 GLN A OE1 1 
ATOM   2351 N  NE2 . GLN A 1 307 ? -26.275 38.061 -2.187  1.00 38.73 ? 1302 GLN A NE2 1 
ATOM   2352 N  N   . LYS A 1 308 ? -31.158 35.667 -0.285  1.00 40.03 ? 1303 LYS A N   1 
ATOM   2353 C  CA  . LYS A 1 308 ? -32.401 36.410 -0.078  1.00 40.16 ? 1303 LYS A CA  1 
ATOM   2354 C  C   . LYS A 1 308 ? -33.061 35.962 1.220   1.00 40.29 ? 1303 LYS A C   1 
ATOM   2355 O  O   . LYS A 1 308 ? -33.903 36.666 1.776   1.00 40.71 ? 1303 LYS A O   1 
ATOM   2356 C  CB  . LYS A 1 308 ? -33.359 36.202 -1.255  1.00 40.32 ? 1303 LYS A CB  1 
ATOM   2357 N  N   . ASP A 1 313 ? -42.813 41.185 6.717   1.00 47.52 ? 1308 ASP A N   1 
ATOM   2358 C  CA  . ASP A 1 313 ? -43.386 42.417 7.271   1.00 47.59 ? 1308 ASP A CA  1 
ATOM   2359 C  C   . ASP A 1 313 ? -44.900 42.344 7.452   1.00 46.86 ? 1308 ASP A C   1 
ATOM   2360 O  O   . ASP A 1 313 ? -45.643 42.259 6.467   1.00 46.79 ? 1308 ASP A O   1 
ATOM   2361 C  CB  . ASP A 1 313 ? -43.066 43.613 6.373   1.00 47.84 ? 1308 ASP A CB  1 
ATOM   2362 C  CG  . ASP A 1 313 ? -41.645 44.080 6.516   1.00 49.38 ? 1308 ASP A CG  1 
ATOM   2363 O  OD1 . ASP A 1 313 ? -40.785 43.234 6.853   1.00 51.42 ? 1308 ASP A OD1 1 
ATOM   2364 O  OD2 . ASP A 1 313 ? -41.391 45.290 6.278   1.00 51.75 ? 1308 ASP A OD2 1 
ATOM   2365 N  N   . LEU A 1 314 ? -45.347 42.410 8.707   1.00 45.99 ? 1309 LEU A N   1 
ATOM   2366 C  CA  . LEU A 1 314 ? -46.783 42.438 9.017   1.00 45.39 ? 1309 LEU A CA  1 
ATOM   2367 C  C   . LEU A 1 314 ? -47.394 43.797 8.661   1.00 44.40 ? 1309 LEU A C   1 
ATOM   2368 O  O   . LEU A 1 314 ? -46.779 44.837 8.888   1.00 43.88 ? 1309 LEU A O   1 
ATOM   2369 C  CB  . LEU A 1 314 ? -47.039 42.102 10.493  1.00 45.40 ? 1309 LEU A CB  1 
ATOM   2370 C  CG  . LEU A 1 314 ? -47.033 40.619 10.908  1.00 46.08 ? 1309 LEU A CG  1 
ATOM   2371 C  CD1 . LEU A 1 314 ? -45.956 39.816 10.186  1.00 46.81 ? 1309 LEU A CD1 1 
ATOM   2372 C  CD2 . LEU A 1 314 ? -46.881 40.482 12.429  1.00 45.62 ? 1309 LEU A CD2 1 
ATOM   2373 N  N   . ILE A 1 315 ? -48.582 43.757 8.056   1.00 43.74 ? 1310 ILE A N   1 
ATOM   2374 C  CA  . ILE A 1 315 ? -49.405 44.941 7.805   1.00 43.30 ? 1310 ILE A CA  1 
ATOM   2375 C  C   . ILE A 1 315 ? -50.508 44.945 8.850   1.00 42.75 ? 1310 ILE A C   1 
ATOM   2376 O  O   . ILE A 1 315 ? -51.066 43.890 9.159   1.00 42.59 ? 1310 ILE A O   1 
ATOM   2377 C  CB  . ILE A 1 315 ? -50.063 44.920 6.393   1.00 43.58 ? 1310 ILE A CB  1 
ATOM   2378 C  CG1 . ILE A 1 315 ? -49.005 44.807 5.281   1.00 43.79 ? 1310 ILE A CG1 1 
ATOM   2379 C  CG2 . ILE A 1 315 ? -50.928 46.162 6.173   1.00 43.02 ? 1310 ILE A CG2 1 
ATOM   2380 C  CD1 . ILE A 1 315 ? -48.012 45.954 5.254   1.00 44.31 ? 1310 ILE A CD1 1 
ATOM   2381 N  N   . TYR A 1 316 ? -50.808 46.122 9.400   1.00 42.20 ? 1311 TYR A N   1 
ATOM   2382 C  CA  . TYR A 1 316 ? -51.847 46.267 10.423  1.00 41.77 ? 1311 TYR A CA  1 
ATOM   2383 C  C   . TYR A 1 316 ? -53.209 46.487 9.768   1.00 41.89 ? 1311 TYR A C   1 
ATOM   2384 O  O   . TYR A 1 316 ? -53.340 47.286 8.840   1.00 41.73 ? 1311 TYR A O   1 
ATOM   2385 C  CB  . TYR A 1 316 ? -51.514 47.429 11.388  1.00 41.24 ? 1311 TYR A CB  1 
ATOM   2386 C  CG  . TYR A 1 316 ? -52.452 47.533 12.581  1.00 39.96 ? 1311 TYR A CG  1 
ATOM   2387 C  CD1 . TYR A 1 316 ? -52.358 46.646 13.649  1.00 38.49 ? 1311 TYR A CD1 1 
ATOM   2388 C  CD2 . TYR A 1 316 ? -53.444 48.520 12.635  1.00 40.06 ? 1311 TYR A CD2 1 
ATOM   2389 C  CE1 . TYR A 1 316 ? -53.231 46.729 14.748  1.00 38.63 ? 1311 TYR A CE1 1 
ATOM   2390 C  CE2 . TYR A 1 316 ? -54.326 48.615 13.732  1.00 39.69 ? 1311 TYR A CE2 1 
ATOM   2391 C  CZ  . TYR A 1 316 ? -54.213 47.715 14.784  1.00 39.38 ? 1311 TYR A CZ  1 
ATOM   2392 O  OH  . TYR A 1 316 ? -55.073 47.807 15.861  1.00 38.61 ? 1311 TYR A OH  1 
ATOM   2393 O  OXT . TYR A 1 316 ? -54.211 45.879 10.165  1.00 42.25 ? 1311 TYR A OXT 1 
HETATM 2394 NI NI  . NI  B 2 .   ? 0.001   51.107 -25.540 0.33 17.16 ? 201  NI  A NI  1 
HETATM 2395 NI NI  . NI  C 2 .   ? -11.922 17.050 -26.236 1.00 58.08 ? 203  NI  A NI  1 
HETATM 2396 NI NI  . NI  D 2 .   ? 4.029   55.158 -15.884 1.00 24.10 ? 204  NI  A NI  1 
HETATM 2397 NI NI  . NI  E 2 .   ? -5.959  58.551 -17.880 1.00 20.90 ? 205  NI  A NI  1 
HETATM 2398 NI NI  . NI  F 2 .   ? 0.062   51.069 -14.160 0.33 25.70 ? 206  NI  A NI  1 
HETATM 2399 P  P   . PO4 G 3 .   ? -9.710  21.867 -19.971 1.00 21.09 ? 207  PO4 A P   1 
HETATM 2400 O  O1  . PO4 G 3 .   ? -8.620  22.850 -19.771 1.00 25.36 ? 207  PO4 A O1  1 
HETATM 2401 O  O2  . PO4 G 3 .   ? -10.599 22.388 -21.053 1.00 26.01 ? 207  PO4 A O2  1 
HETATM 2402 O  O3  . PO4 G 3 .   ? -9.125  20.550 -20.327 1.00 25.51 ? 207  PO4 A O3  1 
HETATM 2403 O  O4  . PO4 G 3 .   ? -10.523 21.773 -18.731 1.00 24.28 ? 207  PO4 A O4  1 
HETATM 2404 CL CL  . CL  H 4 .   ? -9.044  14.468 -17.435 1.00 41.34 ? 208  CL  A CL  1 
HETATM 2405 O  O   . HOH I 5 .   ? 2.661   35.042 -32.058 1.00 12.31 ? 2    HOH A O   1 
HETATM 2406 O  O   . HOH I 5 .   ? -22.239 39.878 -17.254 1.00 19.73 ? 4    HOH A O   1 
HETATM 2407 O  O   . HOH I 5 .   ? 4.351   32.483 -25.589 1.00 14.32 ? 5    HOH A O   1 
HETATM 2408 O  O   . HOH I 5 .   ? -3.713  34.000 -4.487  1.00 20.17 ? 7    HOH A O   1 
HETATM 2409 O  O   . HOH I 5 .   ? -5.145  46.493 -34.621 1.00 17.70 ? 8    HOH A O   1 
HETATM 2410 O  O   . HOH I 5 .   ? -9.966  31.990 -26.826 1.00 21.71 ? 9    HOH A O   1 
HETATM 2411 O  O   . HOH I 5 .   ? 1.301   38.620 -25.401 1.00 10.03 ? 10   HOH A O   1 
HETATM 2412 O  O   . HOH I 5 .   ? -8.995  42.549 -19.395 1.00 17.09 ? 11   HOH A O   1 
HETATM 2413 O  O   . HOH I 5 .   ? 6.388   25.367 -30.403 1.00 25.56 ? 12   HOH A O   1 
HETATM 2414 O  O   . HOH I 5 .   ? -15.074 38.440 -29.691 1.00 17.54 ? 14   HOH A O   1 
HETATM 2415 O  O   . HOH I 5 .   ? 6.347   30.086 -20.063 1.00 17.62 ? 15   HOH A O   1 
HETATM 2416 O  O   . HOH I 5 .   ? 8.408   31.986 -32.145 1.00 17.69 ? 16   HOH A O   1 
HETATM 2417 O  O   . HOH I 5 .   ? 14.896  26.408 -9.617  1.00 40.38 ? 17   HOH A O   1 
HETATM 2418 O  O   . HOH I 5 .   ? 11.796  28.462 -33.678 1.00 20.53 ? 18   HOH A O   1 
HETATM 2419 O  O   . HOH I 5 .   ? -3.258  30.598 -28.113 1.00 27.58 ? 20   HOH A O   1 
HETATM 2420 O  O   . HOH I 5 .   ? 4.944   23.130 -20.430 1.00 12.56 ? 21   HOH A O   1 
HETATM 2421 O  O   . HOH I 5 .   ? 18.462  29.236 -12.729 1.00 22.38 ? 22   HOH A O   1 
HETATM 2422 O  O   . HOH I 5 .   ? 11.286  24.905 -20.058 1.00 12.99 ? 23   HOH A O   1 
HETATM 2423 O  O   . HOH I 5 .   ? -6.758  52.166 -31.292 1.00 12.62 ? 24   HOH A O   1 
HETATM 2424 O  O   . HOH I 5 .   ? -4.547  15.837 3.120   1.00 23.11 ? 25   HOH A O   1 
HETATM 2425 O  O   . HOH I 5 .   ? -10.007 35.713 -6.783  1.00 16.38 ? 26   HOH A O   1 
HETATM 2426 O  O   . HOH I 5 .   ? -8.105  36.429 -5.071  1.00 20.20 ? 28   HOH A O   1 
HETATM 2427 O  O   . HOH I 5 .   ? 6.686   32.495 -33.944 1.00 21.36 ? 29   HOH A O   1 
HETATM 2428 O  O   . HOH I 5 .   ? -7.615  34.572 -25.468 1.00 18.59 ? 31   HOH A O   1 
HETATM 2429 O  O   . HOH I 5 .   ? 2.013   22.478 -16.615 1.00 18.34 ? 32   HOH A O   1 
HETATM 2430 O  O   . HOH I 5 .   ? -32.716 34.688 -24.399 1.00 26.63 ? 33   HOH A O   1 
HETATM 2431 O  O   . HOH I 5 .   ? -16.411 32.747 -26.057 1.00 21.04 ? 34   HOH A O   1 
HETATM 2432 O  O   . HOH I 5 .   ? 7.445   23.170 -19.948 1.00 21.10 ? 35   HOH A O   1 
HETATM 2433 O  O   . HOH I 5 .   ? 7.325   34.316 -36.164 1.00 25.15 ? 36   HOH A O   1 
HETATM 2434 O  O   . HOH I 5 .   ? 5.066   40.746 -19.823 1.00 25.92 ? 37   HOH A O   1 
HETATM 2435 O  O   . HOH I 5 .   ? -2.074  60.400 -25.220 1.00 29.70 ? 38   HOH A O   1 
HETATM 2436 O  O   . HOH I 5 .   ? -12.826 40.009 -10.355 1.00 23.18 ? 39   HOH A O   1 
HETATM 2437 O  O   . HOH I 5 .   ? -7.136  41.492 -10.697 1.00 36.76 ? 40   HOH A O   1 
HETATM 2438 O  O   . HOH I 5 .   ? 14.947  33.037 -28.176 1.00 32.62 ? 41   HOH A O   1 
HETATM 2439 O  O   . HOH I 5 .   ? -6.829  44.233 -16.106 1.00 24.70 ? 43   HOH A O   1 
HETATM 2440 O  O   . HOH I 5 .   ? -2.652  43.770 -9.092  1.00 35.51 ? 44   HOH A O   1 
HETATM 2441 O  O   . HOH I 5 .   ? -13.548 22.310 -20.796 1.00 26.89 ? 45   HOH A O   1 
HETATM 2442 O  O   . HOH I 5 .   ? -4.710  18.009 -15.506 1.00 18.73 ? 46   HOH A O   1 
HETATM 2443 O  O   . HOH I 5 .   ? -11.284 42.361 -9.636  1.00 38.99 ? 47   HOH A O   1 
HETATM 2444 O  O   . HOH I 5 .   ? 11.064  30.450 -24.206 1.00 23.60 ? 48   HOH A O   1 
HETATM 2445 O  O   . HOH I 5 .   ? -2.091  9.451  -4.610  1.00 27.79 ? 49   HOH A O   1 
HETATM 2446 O  O   . HOH I 5 .   ? -21.575 23.739 -24.812 1.00 33.93 ? 51   HOH A O   1 
HETATM 2447 O  O   . HOH I 5 .   ? -6.817  28.188 -29.384 1.00 28.15 ? 53   HOH A O   1 
HETATM 2448 O  O   . HOH I 5 .   ? -13.186 42.783 -18.198 1.00 17.32 ? 54   HOH A O   1 
HETATM 2449 O  O   . HOH I 5 .   ? -23.541 25.906 -2.124  1.00 46.72 ? 55   HOH A O   1 
HETATM 2450 O  O   . HOH I 5 .   ? -3.219  51.017 -37.123 1.00 39.20 ? 56   HOH A O   1 
HETATM 2451 O  O   . HOH I 5 .   ? 10.677  20.164 -20.838 1.00 31.07 ? 57   HOH A O   1 
HETATM 2452 O  O   . HOH I 5 .   ? -9.594  43.473 -26.289 1.00 24.30 ? 58   HOH A O   1 
HETATM 2453 O  O   . HOH I 5 .   ? -29.081 30.052 -28.263 1.00 36.50 ? 59   HOH A O   1 
HETATM 2454 O  O   . HOH I 5 .   ? -7.509  30.509 -29.251 1.00 29.52 ? 60   HOH A O   1 
HETATM 2455 O  O   . HOH I 5 .   ? -2.681  59.429 -22.770 1.00 14.82 ? 61   HOH A O   1 
HETATM 2456 O  O   . HOH I 5 .   ? 7.373   35.547 -14.850 1.00 18.62 ? 63   HOH A O   1 
HETATM 2457 O  O   . HOH I 5 .   ? -5.250  32.295 -28.743 1.00 16.38 ? 65   HOH A O   1 
HETATM 2458 O  O   . HOH I 5 .   ? -9.173  41.335 -27.719 1.00 17.94 ? 66   HOH A O   1 
HETATM 2459 O  O   . HOH I 5 .   ? -0.324  29.163 -3.588  1.00 29.92 ? 67   HOH A O   1 
HETATM 2460 O  O   . HOH I 5 .   ? -6.404  11.645 -11.839 1.00 31.72 ? 68   HOH A O   1 
HETATM 2461 O  O   . HOH I 5 .   ? -11.940 40.004 0.383   1.00 37.89 ? 69   HOH A O   1 
HETATM 2462 O  O   . HOH I 5 .   ? -4.056  59.514 -27.463 1.00 27.52 ? 70   HOH A O   1 
HETATM 2463 O  O   . HOH I 5 .   ? -6.869  43.861 -20.481 1.00 18.11 ? 71   HOH A O   1 
HETATM 2464 O  O   . HOH I 5 .   ? -12.957 52.038 -28.014 1.00 19.42 ? 72   HOH A O   1 
HETATM 2465 O  O   . HOH I 5 .   ? -34.102 40.816 -10.204 1.00 32.75 ? 73   HOH A O   1 
HETATM 2466 O  O   . HOH I 5 .   ? -18.682 34.875 -32.299 1.00 32.57 ? 74   HOH A O   1 
HETATM 2467 O  O   . HOH I 5 .   ? -8.281  39.529 -30.477 1.00 20.16 ? 75   HOH A O   1 
HETATM 2468 O  O   . HOH I 5 .   ? -0.279  41.063 -25.525 1.00 13.41 ? 76   HOH A O   1 
HETATM 2469 O  O   . HOH I 5 .   ? -1.271  23.047 -25.173 1.00 22.31 ? 77   HOH A O   1 
HETATM 2470 O  O   . HOH I 5 .   ? 13.938  33.745 -17.007 1.00 24.19 ? 78   HOH A O   1 
HETATM 2471 O  O   . HOH I 5 .   ? 15.122  24.545 -23.183 1.00 38.69 ? 79   HOH A O   1 
HETATM 2472 O  O   . HOH I 5 .   ? 12.182  20.389 -11.050 1.00 31.88 ? 80   HOH A O   1 
HETATM 2473 O  O   . HOH I 5 .   ? 11.607  32.102 -11.595 1.00 33.83 ? 81   HOH A O   1 
HETATM 2474 O  O   . HOH I 5 .   ? 5.587   10.738 -0.959  1.00 24.48 ? 82   HOH A O   1 
HETATM 2475 O  O   . HOH I 5 .   ? 2.958   19.433 4.197   1.00 28.93 ? 83   HOH A O   1 
HETATM 2476 O  O   . HOH I 5 .   ? 10.074  17.027 0.127   1.00 33.30 ? 84   HOH A O   1 
HETATM 2477 O  O   . HOH I 5 .   ? -15.136 34.474 0.229   1.00 30.35 ? 85   HOH A O   1 
HETATM 2478 O  O   . HOH I 5 .   ? -6.175  34.797 -3.574  1.00 30.49 ? 86   HOH A O   1 
HETATM 2479 O  O   . HOH I 5 .   ? -8.048  17.887 -16.374 1.00 34.93 ? 87   HOH A O   1 
HETATM 2480 O  O   . HOH I 5 .   ? -11.246 34.287 -27.138 1.00 23.12 ? 88   HOH A O   1 
HETATM 2481 O  O   . HOH I 5 .   ? -10.792 44.062 -18.228 1.00 25.27 ? 89   HOH A O   1 
HETATM 2482 O  O   . HOH I 5 .   ? 3.551   21.480 -18.724 1.00 20.43 ? 90   HOH A O   1 
HETATM 2483 O  O   . HOH I 5 .   ? -6.675  43.545 -9.069  1.00 32.07 ? 91   HOH A O   1 
HETATM 2484 O  O   . HOH I 5 .   ? -10.435 43.699 -11.788 1.00 36.96 ? 92   HOH A O   1 
HETATM 2485 O  O   . HOH I 5 .   ? -5.593  48.910 -36.164 1.00 37.28 ? 93   HOH A O   1 
HETATM 2486 O  O   . HOH I 5 .   ? -5.059  52.917 -22.387 1.00 22.30 ? 94   HOH A O   1 
HETATM 2487 O  O   . HOH I 5 .   ? 4.179   59.250 -20.244 1.00 21.05 ? 95   HOH A O   1 
HETATM 2488 O  O   . HOH I 5 .   ? 1.537   50.631 -12.132 1.00 24.86 ? 96   HOH A O   1 
HETATM 2489 O  O   . HOH I 5 .   ? -0.944  52.774 -20.409 1.00 29.41 ? 97   HOH A O   1 
HETATM 2490 O  O   . HOH I 5 .   ? -22.484 40.908 -25.407 1.00 29.02 ? 98   HOH A O   1 
HETATM 2491 O  O   . HOH I 5 .   ? -25.006 41.300 -24.772 1.00 40.07 ? 99   HOH A O   1 
HETATM 2492 O  O   . HOH I 5 .   ? 3.269   22.975 -29.858 1.00 28.75 ? 100  HOH A O   1 
HETATM 2493 O  O   . HOH I 5 .   ? 13.702  28.601 -32.402 1.00 22.59 ? 101  HOH A O   1 
HETATM 2494 O  O   . HOH I 5 .   ? 10.687  18.749 -17.234 1.00 32.79 ? 102  HOH A O   1 
HETATM 2495 O  O   . HOH I 5 .   ? 11.272  30.394 -3.702  1.00 31.79 ? 103  HOH A O   1 
HETATM 2496 O  O   . HOH I 5 .   ? -12.293 12.207 -4.412  1.00 26.34 ? 104  HOH A O   1 
HETATM 2497 O  O   . HOH I 5 .   ? -0.591  17.529 6.599   1.00 30.26 ? 105  HOH A O   1 
HETATM 2498 O  O   . HOH I 5 .   ? 8.016   21.962 4.586   1.00 28.59 ? 106  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -22  ?    ?   ?   A . n 
A 1 2   HIS 2   -21  -21  HIS HIS A . n 
A 1 3   HIS 3   -20  -20  HIS HIS A . n 
A 1 4   HIS 4   -19  -19  HIS HIS A . n 
A 1 5   HIS 5   -18  -18  HIS HIS A . n 
A 1 6   HIS 6   -17  -17  HIS HIS A . n 
A 1 7   HIS 7   -16  -16  HIS HIS A . n 
A 1 8   SER 8   -15  -15  SER SER A . n 
A 1 9   SER 9   -14  -14  SER SER A . n 
A 1 10  GLY 10  -13  -13  GLY GLY A . n 
A 1 11  VAL 11  -12  -12  VAL VAL A . n 
A 1 12  ASP 12  -11  -11  ASP ASP A . n 
A 1 13  LEU 13  -10  -10  LEU LEU A . n 
A 1 14  GLY 14  -9   -9   GLY GLY A . n 
A 1 15  THR 15  -8   -8   THR THR A . n 
A 1 16  GLU 16  -7   -7   GLU GLU A . n 
A 1 17  ASN 17  -6   -6   ASN ASN A . n 
A 1 18  LEU 18  -5   -5   LEU LEU A . n 
A 1 19  TYR 19  -4   -4   TYR TYR A . n 
A 1 20  PHE 20  -3   -3   PHE PHE A . n 
A 1 21  GLN 21  -2   -2   GLN GLN A . n 
A 1 22  SER 22  -1   -1   SER SER A . n 
A 1 23  MET 23  0    0    MET MET A . n 
A 1 24  LYS 24  1019 1019 LYS LYS A . n 
A 1 25  LEU 25  1020 1020 LEU LEU A . n 
A 1 26  ILE 26  1021 1021 ILE ILE A . n 
A 1 27  ARG 27  1022 1022 ARG ARG A . n 
A 1 28  VAL 28  1023 1023 VAL VAL A . n 
A 1 29  GLU 29  1024 1024 GLU GLU A . n 
A 1 30  ASN 30  1025 1025 ASN ASN A . n 
A 1 31  PHE 31  1026 1026 PHE PHE A . n 
A 1 32  GLU 32  1027 1027 GLU GLU A . n 
A 1 33  ALA 33  1028 1028 ALA ALA A . n 
A 1 34  TYR 34  1029 1029 TYR TYR A . n 
A 1 35  PHE 35  1030 1030 PHE PHE A . n 
A 1 36  LYS 36  1031 1031 LYS LYS A . n 
A 1 37  LYS 37  1032 1032 LYS LYS A . n 
A 1 38  GLN 38  1033 1033 GLN GLN A . n 
A 1 39  GLN 39  1034 1034 GLN GLN A . n 
A 1 40  ALA 40  1035 1035 ALA ALA A . n 
A 1 41  ASP 41  1036 1036 ASP ASP A . n 
A 1 42  SER 42  1037 1037 SER SER A . n 
A 1 43  ASN 43  1038 1038 ASN ASN A . n 
A 1 44  CYS 44  1039 1039 CYS CYS A . n 
A 1 45  GLY 45  1040 1040 GLY GLY A . n 
A 1 46  PHE 46  1041 1041 PHE PHE A . n 
A 1 47  ALA 47  1042 1042 ALA ALA A . n 
A 1 48  GLU 48  1043 1043 GLU GLU A . n 
A 1 49  GLU 49  1044 1044 GLU GLU A . n 
A 1 50  TYR 50  1045 1045 TYR TYR A . n 
A 1 51  GLU 51  1046 1046 GLU GLU A . n 
A 1 52  ASP 52  1047 1047 ASP ASP A . n 
A 1 53  LEU 53  1048 1048 LEU LEU A . n 
A 1 54  LYS 54  1049 1049 LYS LYS A . n 
A 1 55  LEU 55  1050 1050 LEU LEU A . n 
A 1 56  VAL 56  1051 1051 VAL VAL A . n 
A 1 57  GLY 57  1052 1052 GLY GLY A . n 
A 1 58  ILE 58  1053 1053 ILE ILE A . n 
A 1 59  SER 59  1054 1054 SER SER A . n 
A 1 60  GLN 60  1055 1055 GLN GLN A . n 
A 1 61  PRO 61  1056 1056 PRO PRO A . n 
A 1 62  LYS 62  1057 1057 LYS LYS A . n 
A 1 63  TYR 63  1058 1058 TYR TYR A . n 
A 1 64  ALA 64  1059 1059 ALA ALA A . n 
A 1 65  ALA 65  1060 1060 ALA ALA A . n 
A 1 66  GLU 66  1061 1061 GLU GLU A . n 
A 1 67  LEU 67  1062 1062 LEU LEU A . n 
A 1 68  ALA 68  1063 1063 ALA ALA A . n 
A 1 69  GLU 69  1064 1064 GLU GLU A . n 
A 1 70  ASN 70  1065 1065 ASN ASN A . n 
A 1 71  ARG 71  1066 1066 ARG ARG A . n 
A 1 72  GLY 72  1067 1067 GLY GLY A . n 
A 1 73  LYS 73  1068 1068 LYS LYS A . n 
A 1 74  ASN 74  1069 1069 ASN ASN A . n 
A 1 75  ARG 75  1070 1070 ARG ARG A . n 
A 1 76  TYR 76  1071 1071 TYR TYR A . n 
A 1 77  ASN 77  1072 1072 ASN ASN A . n 
A 1 78  ASN 78  1073 1073 ASN ASN A . n 
A 1 79  VAL 79  1074 1074 VAL VAL A . n 
A 1 80  LEU 80  1075 1075 LEU LEU A . n 
A 1 81  PRO 81  1076 1076 PRO PRO A . n 
A 1 82  TYR 82  1077 1077 TYR TYR A . n 
A 1 83  ASP 83  1078 1078 ASP ASP A . n 
A 1 84  ILE 84  1079 1079 ILE ILE A . n 
A 1 85  SER 85  1080 1080 SER SER A . n 
A 1 86  ARG 86  1081 1081 ARG ARG A . n 
A 1 87  VAL 87  1082 1082 VAL VAL A . n 
A 1 88  LYS 88  1083 1083 LYS LYS A . n 
A 1 89  LEU 89  1084 1084 LEU LEU A . n 
A 1 90  SER 90  1085 1085 SER SER A . n 
A 1 91  VAL 91  1086 1086 VAL VAL A . n 
A 1 92  GLN 92  1087 1087 GLN GLN A . n 
A 1 93  THR 93  1088 1088 THR THR A . n 
A 1 94  HIS 94  1089 1089 HIS HIS A . n 
A 1 95  SER 95  1090 1090 SER SER A . n 
A 1 96  THR 96  1091 1091 THR THR A . n 
A 1 97  ASP 97  1092 1092 ASP ASP A . n 
A 1 98  ASP 98  1093 1093 ASP ASP A . n 
A 1 99  TYR 99  1094 1094 TYR TYR A . n 
A 1 100 ILE 100 1095 1095 ILE ILE A . n 
A 1 101 ASN 101 1096 1096 ASN ASN A . n 
A 1 102 ALA 102 1097 1097 ALA ALA A . n 
A 1 103 ASN 103 1098 1098 ASN ASN A . n 
A 1 104 TYR 104 1099 1099 TYR TYR A . n 
A 1 105 MET 105 1100 1100 MET MET A . n 
A 1 106 PRO 106 1101 1101 PRO PRO A . n 
A 1 107 GLY 107 1102 1102 GLY GLY A . n 
A 1 108 TYR 108 1103 1103 TYR TYR A . n 
A 1 109 HIS 109 1104 1104 HIS HIS A . n 
A 1 110 SER 110 1105 1105 SER SER A . n 
A 1 111 LYS 111 1106 1106 LYS LYS A . n 
A 1 112 LYS 112 1107 1107 LYS LYS A . n 
A 1 113 ASP 113 1108 1108 ASP ASP A . n 
A 1 114 PHE 114 1109 1109 PHE PHE A . n 
A 1 115 ILE 115 1110 1110 ILE ILE A . n 
A 1 116 ALA 116 1111 1111 ALA ALA A . n 
A 1 117 THR 117 1112 1112 THR THR A . n 
A 1 118 GLN 118 1113 1113 GLN GLN A . n 
A 1 119 GLY 119 1114 1114 GLY GLY A . n 
A 1 120 PRO 120 1115 1115 PRO PRO A . n 
A 1 121 LEU 121 1116 1116 LEU LEU A . n 
A 1 122 PRO 122 1117 1117 PRO PRO A . n 
A 1 123 ASN 123 1118 1118 ASN ASN A . n 
A 1 124 THR 124 1119 1119 THR THR A . n 
A 1 125 LEU 125 1120 1120 LEU LEU A . n 
A 1 126 LYS 126 1121 1121 LYS LYS A . n 
A 1 127 ASP 127 1122 1122 ASP ASP A . n 
A 1 128 PHE 128 1123 1123 PHE PHE A . n 
A 1 129 TRP 129 1124 1124 TRP TRP A . n 
A 1 130 ARG 130 1125 1125 ARG ARG A . n 
A 1 131 MET 131 1126 1126 MET MET A . n 
A 1 132 VAL 132 1127 1127 VAL VAL A . n 
A 1 133 TRP 133 1128 1128 TRP TRP A . n 
A 1 134 GLU 134 1129 1129 GLU GLU A . n 
A 1 135 LYS 135 1130 1130 LYS LYS A . n 
A 1 136 ASN 136 1131 1131 ASN ASN A . n 
A 1 137 VAL 137 1132 1132 VAL VAL A . n 
A 1 138 TYR 138 1133 1133 TYR TYR A . n 
A 1 139 ALA 139 1134 1134 ALA ALA A . n 
A 1 140 ILE 140 1135 1135 ILE ILE A . n 
A 1 141 ILE 141 1136 1136 ILE ILE A . n 
A 1 142 MET 142 1137 1137 MET MET A . n 
A 1 143 LEU 143 1138 1138 LEU LEU A . n 
A 1 144 THR 144 1139 1139 THR THR A . n 
A 1 145 LYS 145 1140 1140 LYS LYS A . n 
A 1 146 CYS 146 1141 ?    ?   ?   A . n 
A 1 147 VAL 147 1142 ?    ?   ?   A . n 
A 1 148 GLU 148 1143 ?    ?   ?   A . n 
A 1 149 GLN 149 1144 ?    ?   ?   A . n 
A 1 150 GLY 150 1145 ?    ?   ?   A . n 
A 1 151 ARG 151 1146 ?    ?   ?   A . n 
A 1 152 THR 152 1147 ?    ?   ?   A . n 
A 1 153 LYS 153 1148 ?    ?   ?   A . n 
A 1 154 CYS 154 1149 ?    ?   ?   A . n 
A 1 155 GLU 155 1150 ?    ?   ?   A . n 
A 1 156 GLU 156 1151 1151 GLU GLU A . n 
A 1 157 TYR 157 1152 1152 TYR TYR A . n 
A 1 158 TRP 158 1153 1153 TRP TRP A . n 
A 1 159 PRO 159 1154 1154 PRO PRO A . n 
A 1 160 SER 160 1155 1155 SER SER A . n 
A 1 161 LYS 161 1156 1156 LYS LYS A . n 
A 1 162 GLN 162 1157 1157 GLN GLN A . n 
A 1 163 ALA 163 1158 1158 ALA ALA A . n 
A 1 164 GLN 164 1159 1159 GLN GLN A . n 
A 1 165 ASP 165 1160 1160 ASP ASP A . n 
A 1 166 TYR 166 1161 1161 TYR TYR A . n 
A 1 167 GLY 167 1162 1162 GLY GLY A . n 
A 1 168 ASP 168 1163 1163 ASP ASP A . n 
A 1 169 ILE 169 1164 1164 ILE ILE A . n 
A 1 170 THR 170 1165 1165 THR THR A . n 
A 1 171 VAL 171 1166 1166 VAL VAL A . n 
A 1 172 ALA 172 1167 1167 ALA ALA A . n 
A 1 173 MET 173 1168 1168 MET MET A . n 
A 1 174 THR 174 1169 1169 THR THR A . n 
A 1 175 SER 175 1170 1170 SER SER A . n 
A 1 176 GLU 176 1171 1171 GLU GLU A . n 
A 1 177 ILE 177 1172 1172 ILE ILE A . n 
A 1 178 VAL 178 1173 1173 VAL VAL A . n 
A 1 179 LEU 179 1174 1174 LEU LEU A . n 
A 1 180 PRO 180 1175 1175 PRO PRO A . n 
A 1 181 GLU 181 1176 1176 GLU GLU A . n 
A 1 182 TRP 182 1177 1177 TRP TRP A . n 
A 1 183 THR 183 1178 1178 THR THR A . n 
A 1 184 ILE 184 1179 1179 ILE ILE A . n 
A 1 185 ARG 185 1180 1180 ARG ARG A . n 
A 1 186 ASP 186 1181 1181 ASP ASP A . n 
A 1 187 PHE 187 1182 1182 PHE PHE A . n 
A 1 188 THR 188 1183 1183 THR THR A . n 
A 1 189 VAL 189 1184 1184 VAL VAL A . n 
A 1 190 LYS 190 1185 1185 LYS LYS A . n 
A 1 191 ASN 191 1186 1186 ASN ASN A . n 
A 1 192 ILE 192 1187 1187 ILE ILE A . n 
A 1 193 GLN 193 1188 1188 GLN GLN A . n 
A 1 194 THR 194 1189 1189 THR THR A . n 
A 1 195 SER 195 1190 1190 SER SER A . n 
A 1 196 GLU 196 1191 1191 GLU GLU A . n 
A 1 197 SER 197 1192 1192 SER SER A . n 
A 1 198 HIS 198 1193 1193 HIS HIS A . n 
A 1 199 PRO 199 1194 1194 PRO PRO A . n 
A 1 200 LEU 200 1195 1195 LEU LEU A . n 
A 1 201 ARG 201 1196 1196 ARG ARG A . n 
A 1 202 GLN 202 1197 1197 GLN GLN A . n 
A 1 203 PHE 203 1198 1198 PHE PHE A . n 
A 1 204 HIS 204 1199 1199 HIS HIS A . n 
A 1 205 PHE 205 1200 1200 PHE PHE A . n 
A 1 206 THR 206 1201 1201 THR THR A . n 
A 1 207 SER 207 1202 1202 SER SER A . n 
A 1 208 TRP 208 1203 1203 TRP TRP A . n 
A 1 209 PRO 209 1204 1204 PRO PRO A . n 
A 1 210 ASP 210 1205 1205 ASP ASP A . n 
A 1 211 HIS 211 1206 1206 HIS HIS A . n 
A 1 212 GLY 212 1207 1207 GLY GLY A . n 
A 1 213 VAL 213 1208 1208 VAL VAL A . n 
A 1 214 PRO 214 1209 1209 PRO PRO A . n 
A 1 215 ASP 215 1210 1210 ASP ASP A . n 
A 1 216 THR 216 1211 1211 THR THR A . n 
A 1 217 THR 217 1212 1212 THR THR A . n 
A 1 218 ASP 218 1213 1213 ASP ASP A . n 
A 1 219 LEU 219 1214 1214 LEU LEU A . n 
A 1 220 LEU 220 1215 1215 LEU LEU A . n 
A 1 221 ILE 221 1216 1216 ILE ILE A . n 
A 1 222 ASN 222 1217 1217 ASN ASN A . n 
A 1 223 PHE 223 1218 1218 PHE PHE A . n 
A 1 224 ARG 224 1219 1219 ARG ARG A . n 
A 1 225 TYR 225 1220 1220 TYR TYR A . n 
A 1 226 LEU 226 1221 1221 LEU LEU A . n 
A 1 227 VAL 227 1222 1222 VAL VAL A . n 
A 1 228 ARG 228 1223 1223 ARG ARG A . n 
A 1 229 ASP 229 1224 1224 ASP ASP A . n 
A 1 230 TYR 230 1225 1225 TYR TYR A . n 
A 1 231 MET 231 1226 1226 MET MET A . n 
A 1 232 LYS 232 1227 ?    ?   ?   A . n 
A 1 233 GLN 233 1228 ?    ?   ?   A . n 
A 1 234 SER 234 1229 ?    ?   ?   A . n 
A 1 235 PRO 235 1230 ?    ?   ?   A . n 
A 1 236 PRO 236 1231 ?    ?   ?   A . n 
A 1 237 GLU 237 1232 1232 GLU GLU A . n 
A 1 238 SER 238 1233 1233 SER SER A . n 
A 1 239 PRO 239 1234 1234 PRO PRO A . n 
A 1 240 ILE 240 1235 1235 ILE ILE A . n 
A 1 241 LEU 241 1236 1236 LEU LEU A . n 
A 1 242 VAL 242 1237 1237 VAL VAL A . n 
A 1 243 HIS 243 1238 1238 HIS HIS A . n 
A 1 244 SER 244 1239 1239 SER SER A . n 
A 1 245 SER 245 1240 1240 SER SER A . n 
A 1 246 ALA 246 1241 1241 ALA ALA A . n 
A 1 247 GLY 247 1242 1242 GLY GLY A . n 
A 1 248 VAL 248 1243 1243 VAL VAL A . n 
A 1 249 GLY 249 1244 1244 GLY GLY A . n 
A 1 250 ARG 250 1245 1245 ARG ARG A . n 
A 1 251 THR 251 1246 1246 THR THR A . n 
A 1 252 GLY 252 1247 1247 GLY GLY A . n 
A 1 253 THR 253 1248 1248 THR THR A . n 
A 1 254 PHE 254 1249 1249 PHE PHE A . n 
A 1 255 ILE 255 1250 1250 ILE ILE A . n 
A 1 256 ALA 256 1251 1251 ALA ALA A . n 
A 1 257 ILE 257 1252 1252 ILE ILE A . n 
A 1 258 ASP 258 1253 1253 ASP ASP A . n 
A 1 259 ARG 259 1254 1254 ARG ARG A . n 
A 1 260 LEU 260 1255 1255 LEU LEU A . n 
A 1 261 ILE 261 1256 1256 ILE ILE A . n 
A 1 262 TYR 262 1257 1257 TYR TYR A . n 
A 1 263 GLN 263 1258 1258 GLN GLN A . n 
A 1 264 ILE 264 1259 1259 ILE ILE A . n 
A 1 265 GLU 265 1260 1260 GLU GLU A . n 
A 1 266 ASN 266 1261 1261 ASN ASN A . n 
A 1 267 GLU 267 1262 1262 GLU GLU A . n 
A 1 268 ASN 268 1263 1263 ASN ASN A . n 
A 1 269 THR 269 1264 1264 THR THR A . n 
A 1 270 VAL 270 1265 1265 VAL VAL A . n 
A 1 271 ASP 271 1266 1266 ASP ASP A . n 
A 1 272 VAL 272 1267 1267 VAL VAL A . n 
A 1 273 TYR 273 1268 1268 TYR TYR A . n 
A 1 274 GLY 274 1269 1269 GLY GLY A . n 
A 1 275 ILE 275 1270 1270 ILE ILE A . n 
A 1 276 VAL 276 1271 1271 VAL VAL A . n 
A 1 277 TYR 277 1272 1272 TYR TYR A . n 
A 1 278 ASP 278 1273 1273 ASP ASP A . n 
A 1 279 LEU 279 1274 1274 LEU LEU A . n 
A 1 280 ARG 280 1275 1275 ARG ARG A . n 
A 1 281 MET 281 1276 1276 MET MET A . n 
A 1 282 HIS 282 1277 1277 HIS HIS A . n 
A 1 283 ARG 283 1278 1278 ARG ARG A . n 
A 1 284 PRO 284 1279 1279 PRO PRO A . n 
A 1 285 LEU 285 1280 1280 LEU LEU A . n 
A 1 286 MET 286 1281 1281 MET MET A . n 
A 1 287 VAL 287 1282 1282 VAL VAL A . n 
A 1 288 GLN 288 1283 1283 GLN GLN A . n 
A 1 289 THR 289 1284 1284 THR THR A . n 
A 1 290 GLU 290 1285 1285 GLU GLU A . n 
A 1 291 ASP 291 1286 1286 ASP ASP A . n 
A 1 292 GLN 292 1287 1287 GLN GLN A . n 
A 1 293 TYR 293 1288 1288 TYR TYR A . n 
A 1 294 VAL 294 1289 1289 VAL VAL A . n 
A 1 295 PHE 295 1290 1290 PHE PHE A . n 
A 1 296 LEU 296 1291 1291 LEU LEU A . n 
A 1 297 ASN 297 1292 1292 ASN ASN A . n 
A 1 298 GLN 298 1293 1293 GLN GLN A . n 
A 1 299 CYS 299 1294 1294 CYS CYS A . n 
A 1 300 VAL 300 1295 1295 VAL VAL A . n 
A 1 301 LEU 301 1296 1296 LEU LEU A . n 
A 1 302 ASP 302 1297 1297 ASP ASP A . n 
A 1 303 ILE 303 1298 1298 ILE ILE A . n 
A 1 304 VAL 304 1299 1299 VAL VAL A . n 
A 1 305 ARG 305 1300 1300 ARG ARG A . n 
A 1 306 SER 306 1301 1301 SER SER A . n 
A 1 307 GLN 307 1302 1302 GLN GLN A . n 
A 1 308 LYS 308 1303 1303 LYS LYS A . n 
A 1 309 ASP 309 1304 ?    ?   ?   A . n 
A 1 310 SER 310 1305 ?    ?   ?   A . n 
A 1 311 LYS 311 1306 ?    ?   ?   A . n 
A 1 312 VAL 312 1307 ?    ?   ?   A . n 
A 1 313 ASP 313 1308 1308 ASP ASP A . n 
A 1 314 LEU 314 1309 1309 LEU LEU A . n 
A 1 315 ILE 315 1310 1310 ILE ILE A . n 
A 1 316 TYR 316 1311 1311 TYR TYR A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NI  1  201 201 NI  NI  A . 
C 2 NI  1  203 203 NI  NI  A . 
D 2 NI  1  204 204 NI  NI  A . 
E 2 NI  1  205 205 NI  NI  A . 
F 2 NI  1  206 206 NI  NI  A . 
G 3 PO4 1  207 207 PO4 PO4 A . 
H 4 CL  1  208 208 CL  CL  A . 
I 5 HOH 1  2   2   HOH HOH A . 
I 5 HOH 2  4   4   HOH HOH A . 
I 5 HOH 3  5   5   HOH HOH A . 
I 5 HOH 4  7   7   HOH HOH A . 
I 5 HOH 5  8   8   HOH HOH A . 
I 5 HOH 6  9   9   HOH HOH A . 
I 5 HOH 7  10  10  HOH HOH A . 
I 5 HOH 8  11  11  HOH HOH A . 
I 5 HOH 9  12  12  HOH HOH A . 
I 5 HOH 10 14  14  HOH HOH A . 
I 5 HOH 11 15  15  HOH HOH A . 
I 5 HOH 12 16  16  HOH HOH A . 
I 5 HOH 13 17  17  HOH HOH A . 
I 5 HOH 14 18  18  HOH HOH A . 
I 5 HOH 15 20  20  HOH HOH A . 
I 5 HOH 16 21  21  HOH HOH A . 
I 5 HOH 17 22  22  HOH HOH A . 
I 5 HOH 18 23  23  HOH HOH A . 
I 5 HOH 19 24  24  HOH HOH A . 
I 5 HOH 20 25  25  HOH HOH A . 
I 5 HOH 21 26  26  HOH HOH A . 
I 5 HOH 22 28  28  HOH HOH A . 
I 5 HOH 23 29  29  HOH HOH A . 
I 5 HOH 24 31  31  HOH HOH A . 
I 5 HOH 25 32  32  HOH HOH A . 
I 5 HOH 26 33  33  HOH HOH A . 
I 5 HOH 27 34  34  HOH HOH A . 
I 5 HOH 28 35  35  HOH HOH A . 
I 5 HOH 29 36  36  HOH HOH A . 
I 5 HOH 30 37  37  HOH HOH A . 
I 5 HOH 31 38  38  HOH HOH A . 
I 5 HOH 32 39  39  HOH HOH A . 
I 5 HOH 33 40  40  HOH HOH A . 
I 5 HOH 34 41  41  HOH HOH A . 
I 5 HOH 35 43  43  HOH HOH A . 
I 5 HOH 36 44  44  HOH HOH A . 
I 5 HOH 37 45  45  HOH HOH A . 
I 5 HOH 38 46  46  HOH HOH A . 
I 5 HOH 39 47  47  HOH HOH A . 
I 5 HOH 40 48  48  HOH HOH A . 
I 5 HOH 41 49  49  HOH HOH A . 
I 5 HOH 42 51  51  HOH HOH A . 
I 5 HOH 43 53  53  HOH HOH A . 
I 5 HOH 44 54  54  HOH HOH A . 
I 5 HOH 45 55  55  HOH HOH A . 
I 5 HOH 46 56  56  HOH HOH A . 
I 5 HOH 47 57  57  HOH HOH A . 
I 5 HOH 48 58  58  HOH HOH A . 
I 5 HOH 49 59  59  HOH HOH A . 
I 5 HOH 50 60  60  HOH HOH A . 
I 5 HOH 51 61  61  HOH HOH A . 
I 5 HOH 52 63  63  HOH HOH A . 
I 5 HOH 53 65  65  HOH HOH A . 
I 5 HOH 54 66  66  HOH HOH A . 
I 5 HOH 55 67  67  HOH HOH A . 
I 5 HOH 56 68  68  HOH HOH A . 
I 5 HOH 57 69  69  HOH HOH A . 
I 5 HOH 58 70  70  HOH HOH A . 
I 5 HOH 59 71  71  HOH HOH A . 
I 5 HOH 60 72  72  HOH HOH A . 
I 5 HOH 61 73  73  HOH HOH A . 
I 5 HOH 62 74  74  HOH HOH A . 
I 5 HOH 63 75  75  HOH HOH A . 
I 5 HOH 64 76  76  HOH HOH A . 
I 5 HOH 65 77  77  HOH HOH A . 
I 5 HOH 66 78  78  HOH HOH A . 
I 5 HOH 67 79  79  HOH HOH A . 
I 5 HOH 68 80  80  HOH HOH A . 
I 5 HOH 69 81  81  HOH HOH A . 
I 5 HOH 70 82  82  HOH HOH A . 
I 5 HOH 71 83  83  HOH HOH A . 
I 5 HOH 72 84  84  HOH HOH A . 
I 5 HOH 73 85  85  HOH HOH A . 
I 5 HOH 74 86  86  HOH HOH A . 
I 5 HOH 75 87  87  HOH HOH A . 
I 5 HOH 76 88  88  HOH HOH A . 
I 5 HOH 77 89  89  HOH HOH A . 
I 5 HOH 78 90  90  HOH HOH A . 
I 5 HOH 79 91  91  HOH HOH A . 
I 5 HOH 80 92  92  HOH HOH A . 
I 5 HOH 81 93  93  HOH HOH A . 
I 5 HOH 82 94  94  HOH HOH A . 
I 5 HOH 83 95  95  HOH HOH A . 
I 5 HOH 84 96  96  HOH HOH A . 
I 5 HOH 85 97  97  HOH HOH A . 
I 5 HOH 86 98  98  HOH HOH A . 
I 5 HOH 87 99  99  HOH HOH A . 
I 5 HOH 88 100 100 HOH HOH A . 
I 5 HOH 89 101 101 HOH HOH A . 
I 5 HOH 90 102 102 HOH HOH A . 
I 5 HOH 91 103 103 HOH HOH A . 
I 5 HOH 92 104 104 HOH HOH A . 
I 5 HOH 93 105 105 HOH HOH A . 
I 5 HOH 94 106 106 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?        monomeric 1 
2 software_defined_assembly PISA,PQS trimeric  3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1     A,B,C,D,E,F,G,H,I 
2 1,2,3 A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 10470 ? 
2 MORE         -168  ? 
2 'SSA (A^2)'  36090 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 44.2605000000  0.8660254038  
-0.5000000000 0.0000000000 76.6614347684 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_565 -x+y,-x+1,z  -0.5000000000 0.8660254038  0.0000000000 -44.2605000000 -0.8660254038 
-0.5000000000 0.0000000000 76.6614347684 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A NI 201 ? B NI . 
2 1 A NI 206 ? F NI . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 7   ? A HIS -16  ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 5   ? A HIS -18  ? 1_555 87.0  ? 
2  NE2 ? A HIS 7   ? A HIS -16  ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 5   ? A HIS -18  ? 2_665 88.8  ? 
3  NE2 ? A HIS 5   ? A HIS -18  ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 5   ? A HIS -18  ? 2_665 92.8  ? 
4  NE2 ? A HIS 7   ? A HIS -16  ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 5   ? A HIS -18  ? 3_565 178.4 ? 
5  NE2 ? A HIS 5   ? A HIS -18  ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 5   ? A HIS -18  ? 3_565 92.8  ? 
6  NE2 ? A HIS 5   ? A HIS -18  ? 2_665 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 5   ? A HIS -18  ? 3_565 92.8  ? 
7  NE2 ? A HIS 7   ? A HIS -16  ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 7   ? A HIS -16  ? 2_665 91.3  ? 
8  NE2 ? A HIS 5   ? A HIS -18  ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 7   ? A HIS -16  ? 2_665 178.3 ? 
9  NE2 ? A HIS 5   ? A HIS -18  ? 2_665 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 7   ? A HIS -16  ? 2_665 87.0  ? 
10 NE2 ? A HIS 5   ? A HIS -18  ? 3_565 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 7   ? A HIS -16  ? 2_665 88.9  ? 
11 NE2 ? A HIS 7   ? A HIS -16  ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 7   ? A HIS -16  ? 3_565 91.3  ? 
12 NE2 ? A HIS 5   ? A HIS -18  ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 7   ? A HIS -16  ? 3_565 88.8  ? 
13 NE2 ? A HIS 5   ? A HIS -18  ? 2_665 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 7   ? A HIS -16  ? 3_565 178.4 ? 
14 NE2 ? A HIS 5   ? A HIS -18  ? 3_565 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 7   ? A HIS -16  ? 3_565 87.1  ? 
15 NE2 ? A HIS 7   ? A HIS -16  ? 2_665 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 7   ? A HIS -16  ? 3_565 91.4  ? 
16 N   ? A HIS 3   ? A HIS -20  ? 1_555 NI ? D NI . ? A NI 204 ? 1_555 N   ? A HIS 2   ? A HIS -21  ? 1_555 85.8  ? 
17 N   ? A HIS 3   ? A HIS -20  ? 1_555 NI ? D NI . ? A NI 204 ? 1_555 ND1 ? A HIS 3   ? A HIS -20  ? 1_555 97.7  ? 
18 N   ? A HIS 2   ? A HIS -21  ? 1_555 NI ? D NI . ? A NI 204 ? 1_555 ND1 ? A HIS 3   ? A HIS -20  ? 1_555 176.5 ? 
19 NE2 ? A HIS 4   ? A HIS -19  ? 1_555 NI ? E NI . ? A NI 205 ? 1_555 NE2 ? A HIS 6   ? A HIS -17  ? 1_555 100.6 ? 
20 NE2 ? A HIS 4   ? A HIS -19  ? 1_555 NI ? E NI . ? A NI 205 ? 1_555 NE2 ? A HIS 282 ? A HIS 1277 ? 3_565 164.7 ? 
21 NE2 ? A HIS 6   ? A HIS -17  ? 1_555 NI ? E NI . ? A NI 205 ? 1_555 NE2 ? A HIS 282 ? A HIS 1277 ? 3_565 92.7  ? 
22 NE2 ? A HIS 4   ? A HIS -19  ? 1_555 NI ? E NI . ? A NI 205 ? 1_555 NZ  ? A LYS 111 ? A LYS 1106 ? 3_565 80.0  ? 
23 NE2 ? A HIS 6   ? A HIS -17  ? 1_555 NI ? E NI . ? A NI 205 ? 1_555 NZ  ? A LYS 111 ? A LYS 1106 ? 3_565 167.3 ? 
24 NE2 ? A HIS 282 ? A HIS 1277 ? 3_565 NI ? E NI . ? A NI 205 ? 1_555 NZ  ? A LYS 111 ? A LYS 1106 ? 3_565 85.4  ? 
25 NE2 ? A HIS 4   ? A HIS -19  ? 1_555 NI ? E NI . ? A NI 205 ? 1_555 NE2 ? A HIS 2   ? A HIS -21  ? 2_665 85.2  ? 
26 NE2 ? A HIS 6   ? A HIS -17  ? 1_555 NI ? E NI . ? A NI 205 ? 1_555 NE2 ? A HIS 2   ? A HIS -21  ? 2_665 88.7  ? 
27 NE2 ? A HIS 282 ? A HIS 1277 ? 3_565 NI ? E NI . ? A NI 205 ? 1_555 NE2 ? A HIS 2   ? A HIS -21  ? 2_665 102.7 ? 
28 NZ  ? A LYS 111 ? A LYS 1106 ? 3_565 NI ? E NI . ? A NI 205 ? 1_555 NE2 ? A HIS 2   ? A HIS -21  ? 2_665 103.9 ? 
29 O   ? I HOH .   ? A HOH 96   ? 1_555 NI ? F NI . ? A NI 206 ? 1_555 NE2 ? A HIS 3   ? A HIS -20  ? 1_555 94.8  ? 
30 O   ? I HOH .   ? A HOH 96   ? 1_555 NI ? F NI . ? A NI 206 ? 1_555 NE2 ? A HIS 3   ? A HIS -20  ? 2_665 154.4 ? 
31 NE2 ? A HIS 3   ? A HIS -20  ? 1_555 NI ? F NI . ? A NI 206 ? 1_555 NE2 ? A HIS 3   ? A HIS -20  ? 2_665 97.4  ? 
32 O   ? I HOH .   ? A HOH 96   ? 1_555 NI ? F NI . ? A NI 206 ? 1_555 NE2 ? A HIS 3   ? A HIS -20  ? 3_565 101.9 ? 
33 NE2 ? A HIS 3   ? A HIS -20  ? 1_555 NI ? F NI . ? A NI 206 ? 1_555 NE2 ? A HIS 3   ? A HIS -20  ? 3_565 100.7 ? 
34 NE2 ? A HIS 3   ? A HIS -20  ? 2_665 NI ? F NI . ? A NI 206 ? 1_555 NE2 ? A HIS 3   ? A HIS -20  ? 3_565 97.9  ? 
35 O   ? I HOH .   ? A HOH 96   ? 1_555 NI ? F NI . ? A NI 206 ? 1_555 O   ? I HOH .   ? A HOH 96   ? 2_665 65.3  ? 
36 NE2 ? A HIS 3   ? A HIS -20  ? 1_555 NI ? F NI . ? A NI 206 ? 1_555 O   ? I HOH .   ? A HOH 96   ? 2_665 98.9  ? 
37 NE2 ? A HIS 3   ? A HIS -20  ? 2_665 NI ? F NI . ? A NI 206 ? 1_555 O   ? I HOH .   ? A HOH 96   ? 2_665 90.6  ? 
38 NE2 ? A HIS 3   ? A HIS -20  ? 3_565 NI ? F NI . ? A NI 206 ? 1_555 O   ? I HOH .   ? A HOH 96   ? 2_665 157.4 ? 
39 O   ? I HOH .   ? A HOH 96   ? 1_555 NI ? F NI . ? A NI 206 ? 1_555 O   ? I HOH .   ? A HOH 96   ? 3_565 65.6  ? 
40 NE2 ? A HIS 3   ? A HIS -20  ? 1_555 NI ? F NI . ? A NI 206 ? 1_555 O   ? I HOH .   ? A HOH 96   ? 3_565 157.9 ? 
41 NE2 ? A HIS 3   ? A HIS -20  ? 2_665 NI ? F NI . ? A NI 206 ? 1_555 O   ? I HOH .   ? A HOH 96   ? 3_565 97.3  ? 
42 NE2 ? A HIS 3   ? A HIS -20  ? 3_565 NI ? F NI . ? A NI 206 ? 1_555 O   ? I HOH .   ? A HOH 96   ? 3_565 93.5  ? 
43 O   ? I HOH .   ? A HOH 96   ? 2_665 NI ? F NI . ? A NI 206 ? 1_555 O   ? I HOH .   ? A HOH 96   ? 3_565 64.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-12 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Derived calculations'      
4 3 'Structure model' 'Refinement description'    
5 3 'Structure model' 'Version format compliance' 
6 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -7.3409 
_pdbx_refine_tls.origin_y         29.3880 
_pdbx_refine_tls.origin_z         -13.9498 
_pdbx_refine_tls.T[1][1]          -0.0848 
_pdbx_refine_tls.T[2][2]          -0.1260 
_pdbx_refine_tls.T[3][3]          -0.1298 
_pdbx_refine_tls.T[1][2]          -0.0195 
_pdbx_refine_tls.T[1][3]          0.0105 
_pdbx_refine_tls.T[2][3]          0.0067 
_pdbx_refine_tls.L[1][1]          0.9952 
_pdbx_refine_tls.L[2][2]          1.9150 
_pdbx_refine_tls.L[3][3]          1.4601 
_pdbx_refine_tls.L[1][2]          -0.2978 
_pdbx_refine_tls.L[1][3]          -0.1515 
_pdbx_refine_tls.L[2][3]          -0.6791 
_pdbx_refine_tls.S[1][1]          -0.0626 
_pdbx_refine_tls.S[2][2]          0.0587 
_pdbx_refine_tls.S[3][3]          0.0039 
_pdbx_refine_tls.S[1][2]          -0.1023 
_pdbx_refine_tls.S[1][3]          -0.1365 
_pdbx_refine_tls.S[2][3]          0.0983 
_pdbx_refine_tls.S[2][1]          0.1607 
_pdbx_refine_tls.S[3][1]          0.1221 
_pdbx_refine_tls.S[3][2]          -0.0931 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     -21 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     1303 
_pdbx_refine_tls_group.selection_details   ? 
_pdbx_refine_tls_group.beg_label_asym_id   . 
_pdbx_refine_tls_group.beg_label_seq_id    . 
_pdbx_refine_tls_group.end_label_asym_id   . 
_pdbx_refine_tls_group.end_label_seq_id    . 
_pdbx_refine_tls_group.selection           ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0019  ? 1 
MAR345 'data collection' .         ? 2 
MOSFLM 'data reduction'  .         ? 3 
CCP4   'data scaling'    '(SCALA)' ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 1057 ? ? -148.80 48.36  
2 1 SER A 1155 ? ? -133.72 -42.79 
3 1 SER A 1190 ? ? 79.43   -0.76  
4 1 VAL A 1243 ? ? -127.23 -55.76 
5 1 VAL A 1282 ? ? 64.44   90.73  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN -2   ? CG  ? A GLN 21  CG  
2  1 Y 1 A GLN -2   ? CD  ? A GLN 21  CD  
3  1 Y 1 A GLN -2   ? OE1 ? A GLN 21  OE1 
4  1 Y 1 A GLN -2   ? NE2 ? A GLN 21  NE2 
5  1 Y 1 A ARG 1022 ? NE  ? A ARG 27  NE  
6  1 Y 1 A ARG 1022 ? CZ  ? A ARG 27  CZ  
7  1 Y 1 A ARG 1022 ? NH1 ? A ARG 27  NH1 
8  1 Y 1 A ARG 1022 ? NH2 ? A ARG 27  NH2 
9  1 Y 1 A LYS 1031 ? CE  ? A LYS 36  CE  
10 1 Y 1 A LYS 1031 ? NZ  ? A LYS 36  NZ  
11 1 Y 1 A LYS 1032 ? CE  ? A LYS 37  CE  
12 1 Y 1 A LYS 1032 ? NZ  ? A LYS 37  NZ  
13 1 Y 1 A SER 1037 ? OG  ? A SER 42  OG  
14 1 Y 1 A GLU 1043 ? CD  ? A GLU 48  CD  
15 1 Y 1 A GLU 1043 ? OE1 ? A GLU 48  OE1 
16 1 Y 1 A GLU 1043 ? OE2 ? A GLU 48  OE2 
17 1 Y 1 A GLU 1046 ? CD  ? A GLU 51  CD  
18 1 Y 1 A GLU 1046 ? OE1 ? A GLU 51  OE1 
19 1 Y 1 A GLU 1046 ? OE2 ? A GLU 51  OE2 
20 1 Y 1 A LYS 1049 ? CD  ? A LYS 54  CD  
21 1 Y 1 A LYS 1049 ? CE  ? A LYS 54  CE  
22 1 Y 1 A LYS 1049 ? NZ  ? A LYS 54  NZ  
23 1 Y 1 A ARG 1066 ? NE  ? A ARG 71  NE  
24 1 Y 1 A ARG 1066 ? CZ  ? A ARG 71  CZ  
25 1 Y 1 A ARG 1066 ? NH1 ? A ARG 71  NH1 
26 1 Y 1 A ARG 1066 ? NH2 ? A ARG 71  NH2 
27 1 Y 1 A LYS 1083 ? CE  ? A LYS 88  CE  
28 1 Y 1 A LYS 1083 ? NZ  ? A LYS 88  NZ  
29 1 Y 1 A LYS 1121 ? CE  ? A LYS 126 CE  
30 1 Y 1 A LYS 1121 ? NZ  ? A LYS 126 NZ  
31 1 Y 1 A TYR 1133 ? CG  ? A TYR 138 CG  
32 1 Y 1 A TYR 1133 ? CD1 ? A TYR 138 CD1 
33 1 Y 1 A TYR 1133 ? CD2 ? A TYR 138 CD2 
34 1 Y 1 A TYR 1133 ? CE1 ? A TYR 138 CE1 
35 1 Y 1 A TYR 1133 ? CE2 ? A TYR 138 CE2 
36 1 Y 1 A TYR 1133 ? CZ  ? A TYR 138 CZ  
37 1 Y 1 A TYR 1133 ? OH  ? A TYR 138 OH  
38 1 Y 1 A LYS 1140 ? CD  ? A LYS 145 CD  
39 1 Y 1 A LYS 1140 ? CE  ? A LYS 145 CE  
40 1 Y 1 A LYS 1140 ? NZ  ? A LYS 145 NZ  
41 1 Y 1 A GLU 1151 ? OE1 ? A GLU 156 OE1 
42 1 Y 1 A GLU 1151 ? OE2 ? A GLU 156 OE2 
43 1 Y 1 A LYS 1156 ? CG  ? A LYS 161 CG  
44 1 Y 1 A LYS 1156 ? CD  ? A LYS 161 CD  
45 1 Y 1 A LYS 1156 ? CE  ? A LYS 161 CE  
46 1 Y 1 A LYS 1156 ? NZ  ? A LYS 161 NZ  
47 1 Y 1 A GLU 1176 ? CG  ? A GLU 181 CG  
48 1 Y 1 A GLU 1176 ? CD  ? A GLU 181 CD  
49 1 Y 1 A GLU 1176 ? OE1 ? A GLU 181 OE1 
50 1 Y 1 A GLU 1176 ? OE2 ? A GLU 181 OE2 
51 1 Y 1 A ILE 1187 ? CG1 ? A ILE 192 CG1 
52 1 Y 1 A ILE 1187 ? CG2 ? A ILE 192 CG2 
53 1 Y 1 A ILE 1187 ? CD1 ? A ILE 192 CD1 
54 1 Y 1 A ASP 1224 ? OD1 ? A ASP 229 OD1 
55 1 Y 1 A ASP 1224 ? OD2 ? A ASP 229 OD2 
56 1 Y 1 A GLU 1232 ? CG  ? A GLU 237 CG  
57 1 Y 1 A GLU 1232 ? CD  ? A GLU 237 CD  
58 1 Y 1 A GLU 1232 ? OE1 ? A GLU 237 OE1 
59 1 Y 1 A GLU 1232 ? OE2 ? A GLU 237 OE2 
60 1 Y 1 A LYS 1303 ? CG  ? A LYS 308 CG  
61 1 Y 1 A LYS 1303 ? CD  ? A LYS 308 CD  
62 1 Y 1 A LYS 1303 ? CE  ? A LYS 308 CE  
63 1 Y 1 A LYS 1303 ? NZ  ? A LYS 308 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -22  ? A MET 1   
2  1 Y 1 A CYS 1141 ? A CYS 146 
3  1 Y 1 A VAL 1142 ? A VAL 147 
4  1 Y 1 A GLU 1143 ? A GLU 148 
5  1 Y 1 A GLN 1144 ? A GLN 149 
6  1 Y 1 A GLY 1145 ? A GLY 150 
7  1 Y 1 A ARG 1146 ? A ARG 151 
8  1 Y 1 A THR 1147 ? A THR 152 
9  1 Y 1 A LYS 1148 ? A LYS 153 
10 1 Y 1 A CYS 1149 ? A CYS 154 
11 1 Y 1 A GLU 1150 ? A GLU 155 
12 1 Y 1 A LYS 1227 ? A LYS 232 
13 1 Y 1 A GLN 1228 ? A GLN 233 
14 1 Y 1 A SER 1229 ? A SER 234 
15 1 Y 1 A PRO 1230 ? A PRO 235 
16 1 Y 1 A PRO 1231 ? A PRO 236 
17 1 Y 1 A ASP 1304 ? A ASP 309 
18 1 Y 1 A SER 1305 ? A SER 310 
19 1 Y 1 A LYS 1306 ? A LYS 311 
20 1 Y 1 A VAL 1307 ? A VAL 312 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'NICKEL (II) ION' NI  
3 'PHOSPHATE ION'   PO4 
4 'CHLORIDE ION'    CL  
5 water             HOH 
#