data_2O94
# 
_entry.id   2O94 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2O94         
RCSB  RCSB040842   
WWPDB D_1000040842 
# 
_pdbx_database_status.entry_id                        2O94 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-12-13 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guo, L.'     1 
'Han, A.'     2 
'Bates, D.L.' 3 
'Chen, L.'    4 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of a conserved N-terminal domain of histone deacetylase 4 reveals functional insights into glutamine-rich domains.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            104 
_citation.page_first                4297 
_citation.page_last                 4302 
_citation.year                      2007 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17360518 
_citation.pdbx_database_id_DOI      10.1073/pnas.0608041104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Guo, L.'     1 
primary 'Han, A.'     2 
primary 'Bates, D.L.' 3 
primary 'Cao, J.'     4 
primary 'Chen, L.'    5 
# 
_cell.length_a           189.885 
_cell.length_b           61.023 
_cell.length_c           60.777 
_cell.angle_alpha        90.000 
_cell.angle_beta         108.610 
_cell.angle_gamma        90.000 
_cell.entry_id           2O94 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         2O94 
_symmetry.Int_Tables_number                5 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Histone deacetylase 4' 
_entity.formula_weight             13662.374 
_entity.pdbx_number_of_molecules   4 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              H97F 
_entity.pdbx_fragment              'N-terminal glutamine-rich domain, residues 62-129' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        HD4 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSHHHHHHSSGLVPRGSHMAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQLSRQHEAQLHEHIKQQQEMLAM
KHQQELLEHQRKLERHRQEQELEKQHREQKLQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSHHHHHHSSGLVPRGSHMAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQFEQLSRQHEAQLHEHIKQQQEMLAM
KHQQELLEHQRKLERHRQEQELEKQHREQKLQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  LEU n 
1 14  VAL n 
1 15  PRO n 
1 16  ARG n 
1 17  GLY n 
1 18  SER n 
1 19  HIS n 
1 20  MET n 
1 21  ALA n 
1 22  GLU n 
1 23  PRO n 
1 24  ALA n 
1 25  LEU n 
1 26  ARG n 
1 27  GLU n 
1 28  GLN n 
1 29  GLN n 
1 30  LEU n 
1 31  GLN n 
1 32  GLN n 
1 33  GLU n 
1 34  LEU n 
1 35  LEU n 
1 36  ALA n 
1 37  LEU n 
1 38  LYS n 
1 39  GLN n 
1 40  LYS n 
1 41  GLN n 
1 42  GLN n 
1 43  ILE n 
1 44  GLN n 
1 45  ARG n 
1 46  GLN n 
1 47  ILE n 
1 48  LEU n 
1 49  ILE n 
1 50  ALA n 
1 51  GLU n 
1 52  PHE n 
1 53  GLN n 
1 54  ARG n 
1 55  GLN n 
1 56  PHE n 
1 57  GLU n 
1 58  GLN n 
1 59  LEU n 
1 60  SER n 
1 61  ARG n 
1 62  GLN n 
1 63  HIS n 
1 64  GLU n 
1 65  ALA n 
1 66  GLN n 
1 67  LEU n 
1 68  HIS n 
1 69  GLU n 
1 70  HIS n 
1 71  ILE n 
1 72  LYS n 
1 73  GLN n 
1 74  GLN n 
1 75  GLN n 
1 76  GLU n 
1 77  MET n 
1 78  LEU n 
1 79  ALA n 
1 80  MET n 
1 81  LYS n 
1 82  HIS n 
1 83  GLN n 
1 84  GLN n 
1 85  GLU n 
1 86  LEU n 
1 87  LEU n 
1 88  GLU n 
1 89  HIS n 
1 90  GLN n 
1 91  ARG n 
1 92  LYS n 
1 93  LEU n 
1 94  GLU n 
1 95  ARG n 
1 96  HIS n 
1 97  ARG n 
1 98  GLN n 
1 99  GLU n 
1 100 GLN n 
1 101 GLU n 
1 102 LEU n 
1 103 GLU n 
1 104 LYS n 
1 105 GLN n 
1 106 HIS n 
1 107 ARG n 
1 108 GLU n 
1 109 GLN n 
1 110 LYS n 
1 111 LEU n 
1 112 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'HDAC4, KIAA0288' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta PlysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HDAC4_HUMAN 
_struct_ref.pdbx_db_accession          P56524 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQ
ELEKQHREQKLQ
;
_struct_ref.pdbx_align_begin           62 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2O94 A 21 ? 112 ? P56524 62 ? 153 ? 62 153 
2 1 2O94 B 21 ? 112 ? P56524 62 ? 153 ? 62 153 
3 1 2O94 C 21 ? 112 ? P56524 62 ? 153 ? 62 153 
4 1 2O94 D 21 ? 112 ? P56524 62 ? 153 ? 62 153 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2O94 GLY A 1  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 42 1  
1 2O94 SER A 2  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 43 2  
1 2O94 SER A 3  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 44 3  
1 2O94 HIS A 4  ? UNP P56524 ?   ?  'EXPRESSION TAG'   45 4  
1 2O94 HIS A 5  ? UNP P56524 ?   ?  'EXPRESSION TAG'   46 5  
1 2O94 HIS A 6  ? UNP P56524 ?   ?  'EXPRESSION TAG'   47 6  
1 2O94 HIS A 7  ? UNP P56524 ?   ?  'EXPRESSION TAG'   48 7  
1 2O94 HIS A 8  ? UNP P56524 ?   ?  'EXPRESSION TAG'   49 8  
1 2O94 HIS A 9  ? UNP P56524 ?   ?  'EXPRESSION TAG'   50 9  
1 2O94 SER A 10 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 51 10 
1 2O94 SER A 11 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 52 11 
1 2O94 GLY A 12 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 53 12 
1 2O94 LEU A 13 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 54 13 
1 2O94 VAL A 14 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 55 14 
1 2O94 PRO A 15 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 56 15 
1 2O94 ARG A 16 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 57 16 
1 2O94 GLY A 17 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 58 17 
1 2O94 SER A 18 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 59 18 
1 2O94 HIS A 19 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 60 19 
1 2O94 MET A 20 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 61 20 
1 2O94 PHE A 56 ? UNP P56524 HIS 97 ENGINEERED         97 21 
2 2O94 GLY B 1  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 42 22 
2 2O94 SER B 2  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 43 23 
2 2O94 SER B 3  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 44 24 
2 2O94 HIS B 4  ? UNP P56524 ?   ?  'EXPRESSION TAG'   45 25 
2 2O94 HIS B 5  ? UNP P56524 ?   ?  'EXPRESSION TAG'   46 26 
2 2O94 HIS B 6  ? UNP P56524 ?   ?  'EXPRESSION TAG'   47 27 
2 2O94 HIS B 7  ? UNP P56524 ?   ?  'EXPRESSION TAG'   48 28 
2 2O94 HIS B 8  ? UNP P56524 ?   ?  'EXPRESSION TAG'   49 29 
2 2O94 HIS B 9  ? UNP P56524 ?   ?  'EXPRESSION TAG'   50 30 
2 2O94 SER B 10 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 51 31 
2 2O94 SER B 11 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 52 32 
2 2O94 GLY B 12 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 53 33 
2 2O94 LEU B 13 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 54 34 
2 2O94 VAL B 14 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 55 35 
2 2O94 PRO B 15 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 56 36 
2 2O94 ARG B 16 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 57 37 
2 2O94 GLY B 17 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 58 38 
2 2O94 SER B 18 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 59 39 
2 2O94 HIS B 19 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 60 40 
2 2O94 MET B 20 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 61 41 
2 2O94 PHE B 56 ? UNP P56524 HIS 97 ENGINEERED         97 42 
3 2O94 GLY C 1  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 42 43 
3 2O94 SER C 2  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 43 44 
3 2O94 SER C 3  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 44 45 
3 2O94 HIS C 4  ? UNP P56524 ?   ?  'EXPRESSION TAG'   45 46 
3 2O94 HIS C 5  ? UNP P56524 ?   ?  'EXPRESSION TAG'   46 47 
3 2O94 HIS C 6  ? UNP P56524 ?   ?  'EXPRESSION TAG'   47 48 
3 2O94 HIS C 7  ? UNP P56524 ?   ?  'EXPRESSION TAG'   48 49 
3 2O94 HIS C 8  ? UNP P56524 ?   ?  'EXPRESSION TAG'   49 50 
3 2O94 HIS C 9  ? UNP P56524 ?   ?  'EXPRESSION TAG'   50 51 
3 2O94 SER C 10 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 51 52 
3 2O94 SER C 11 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 52 53 
3 2O94 GLY C 12 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 53 54 
3 2O94 LEU C 13 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 54 55 
3 2O94 VAL C 14 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 55 56 
3 2O94 PRO C 15 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 56 57 
3 2O94 ARG C 16 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 57 58 
3 2O94 GLY C 17 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 58 59 
3 2O94 SER C 18 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 59 60 
3 2O94 HIS C 19 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 60 61 
3 2O94 MET C 20 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 61 62 
3 2O94 PHE C 56 ? UNP P56524 HIS 97 ENGINEERED         97 63 
4 2O94 GLY D 1  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 42 64 
4 2O94 SER D 2  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 43 65 
4 2O94 SER D 3  ? UNP P56524 ?   ?  'CLONING ARTIFACT' 44 66 
4 2O94 HIS D 4  ? UNP P56524 ?   ?  'EXPRESSION TAG'   45 67 
4 2O94 HIS D 5  ? UNP P56524 ?   ?  'EXPRESSION TAG'   46 68 
4 2O94 HIS D 6  ? UNP P56524 ?   ?  'EXPRESSION TAG'   47 69 
4 2O94 HIS D 7  ? UNP P56524 ?   ?  'EXPRESSION TAG'   48 70 
4 2O94 HIS D 8  ? UNP P56524 ?   ?  'EXPRESSION TAG'   49 71 
4 2O94 HIS D 9  ? UNP P56524 ?   ?  'EXPRESSION TAG'   50 72 
4 2O94 SER D 10 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 51 73 
4 2O94 SER D 11 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 52 74 
4 2O94 GLY D 12 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 53 75 
4 2O94 LEU D 13 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 54 76 
4 2O94 VAL D 14 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 55 77 
4 2O94 PRO D 15 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 56 78 
4 2O94 ARG D 16 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 57 79 
4 2O94 GLY D 17 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 58 80 
4 2O94 SER D 18 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 59 81 
4 2O94 HIS D 19 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 60 82 
4 2O94 MET D 20 ? UNP P56524 ?   ?  'CLONING ARTIFACT' 61 83 
4 2O94 PHE D 56 ? UNP P56524 HIS 97 ENGINEERED         97 84 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2O94 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.05 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   59.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '0.540M LITHIUM SULFATE 55mM HEPES PH7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-11-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00000 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
# 
_reflns.entry_id                     2O94 
_reflns.observed_criterion_sigma_F   2 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            3 
_reflns.d_resolution_low             30 
_reflns.number_all                   13433 
_reflns.number_obs                   13083 
_reflns.percent_possible_obs         97.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.053 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.000 
_reflns_shell.d_res_low              3.19 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   97.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    1.99 
_reflns_shell.pdbx_Rsym_value        0.504 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2O94 
_refine.ls_d_res_high                            3.000 
_refine.ls_d_res_low                             30 
_refine.pdbx_ls_sigma_F                          1481.00 
_refine.ls_percent_reflns_obs                    75.100 
_refine.ls_number_reflns_obs                     10088 
_refine.ls_R_factor_R_work                       0.305 
_refine.ls_R_factor_R_free                       0.327 
_refine.ls_percent_reflns_R_free                 7.700 
_refine.ls_number_reflns_R_free                  1038 
_refine.B_iso_mean                               108.763 
_refine.solvent_model_param_bsol                 63.431 
_refine.aniso_B[1][1]                            -25.021 
_refine.aniso_B[2][2]                            16.219 
_refine.aniso_B[3][3]                            8.801 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -21.585 
_refine.aniso_B[2][3]                            0.000 
_refine.overall_FOM_work_R_set                   0.727 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.3239 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 2H8N' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2332 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2332 
_refine_hist.d_res_high                       3.000 
_refine_hist.d_res_low                        30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_mcbond_it  ? 5.273  1.500 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  ? 8.434  2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it ? 8.690  2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it ? 14.843 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
3.000 3.050   . . 214 . 0.441 0.421 . 24 . . 238 . 'X-RAY DIFFRACTION' 
3.050 3.110   . . .   . 0.369 0.446 . 25 . . 214 . 'X-RAY DIFFRACTION' 
3.110 3.170   . . .   . 0.42  0.251 . 29 . . 304 . 'X-RAY DIFFRACTION' 
3.170 3.230   . . .   . 0.33  0.264 . 37 . . 364 . 'X-RAY DIFFRACTION' 
3.230 3.300   . . .   . 0.34  0.298 . 34 . . 399 . 'X-RAY DIFFRACTION' 
3.300 3.380   . . .   . 0.313 0.293 . 45 . . 447 . 'X-RAY DIFFRACTION' 
3.380 3.460   . . .   . 0.32  0.313 . 49 . . 437 . 'X-RAY DIFFRACTION' 
3.460 3.560   . . .   . 0.354 0.332 . 66 . . 511 . 'X-RAY DIFFRACTION' 
3.560 3.660   . . .   . 0.349 0.374 . 52 . . 523 . 'X-RAY DIFFRACTION' 
3.660 3.780   . . .   . 0.335 0.357 . 49 . . 546 . 'X-RAY DIFFRACTION' 
3.780 3.910   . . .   . 0.323 0.333 . 61 . . 533 . 'X-RAY DIFFRACTION' 
3.910 4.070   . . .   . 0.271 0.348 . 54 . . 597 . 'X-RAY DIFFRACTION' 
4.070 4.260   . . .   . 0.214 0.217 . 59 . . 596 . 'X-RAY DIFFRACTION' 
4.260 4.480   . . .   . 0.244 0.287 . 64 . . 592 . 'X-RAY DIFFRACTION' 
4.480 4.760   . . .   . 0.239 0.35  . 62 . . 638 . 'X-RAY DIFFRACTION' 
4.760 5.130   . . .   . 0.257 0.265 . 53 . . 628 . 'X-RAY DIFFRACTION' 
5.130 5.650   . . .   . 0.32  0.387 . 70 . . 632 . 'X-RAY DIFFRACTION' 
5.650 6.460   . . .   . 0.318 0.357 . 71 . . 648 . 'X-RAY DIFFRACTION' 
6.460 8.140   . . .   . 0.325 0.315 . 76 . . 667 . 'X-RAY DIFFRACTION' 
8.140 500.010 . . .   . 0.369 0.36  . 58 . . 574 . 'X-RAY DIFFRACTION' 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       protein_rep.param 
_pdbx_xplor_file.topol_file       ? 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2O94 
_struct.title                     'The 97H/F mutant Structure of a glutamine-rich domain from histone deacetylase 4' 
_struct.pdbx_descriptor           'Histone deacetylase 4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2O94 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'alpha helix, polar zipper, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'The tetramer in the asymmetric unit is the biological assembly, no crystallographic symmetry is invovled in the tetramer formation.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 22 ? GLN A 84 ? GLU A 63  GLN A 125 1 ? 63 
HELX_P HELX_P2 2 GLU B 22 ? GLN B 84 ? GLU B 63  GLN B 125 1 ? 63 
HELX_P HELX_P3 3 GLU C 22 ? GLN C 84 ? GLU C 63  GLN C 125 1 ? 63 
HELX_P HELX_P4 4 GLU D 22 ? GLN D 84 ? GLU D 63  GLN D 125 1 ? 63 
HELX_P HELX_P5 5 GLU D 85 ? GLU D 88 ? GLU D 126 GLU D 129 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2O94 
_atom_sites.fract_transf_matrix[1][1]   0.005266 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001773 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016387 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017361 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ALA A 1 21 ? -28.992  14.015  13.288  1.00 135.39 ? 62  ALA A N   1 
ATOM 2    C CA  . ALA A 1 21 ? -28.937  12.646  12.695  1.00 134.40 ? 62  ALA A CA  1 
ATOM 3    C C   . ALA A 1 21 ? -29.008  12.716  11.168  1.00 135.79 ? 62  ALA A C   1 
ATOM 4    O O   . ALA A 1 21 ? -29.170  13.796  10.599  1.00 138.25 ? 62  ALA A O   1 
ATOM 5    C CB  . ALA A 1 21 ? -30.094  11.804  13.237  1.00 130.54 ? 62  ALA A CB  1 
ATOM 6    N N   . GLU A 1 22 ? -28.861  11.568  10.508  1.00 139.75 ? 63  GLU A N   1 
ATOM 7    C CA  . GLU A 1 22 ? -28.954  11.517  9.051   1.00 138.80 ? 63  GLU A CA  1 
ATOM 8    C C   . GLU A 1 22 ? -29.647  10.243  8.571   1.00 137.13 ? 63  GLU A C   1 
ATOM 9    O O   . GLU A 1 22 ? -30.762  10.296  8.047   1.00 138.91 ? 63  GLU A O   1 
ATOM 10   C CB  . GLU A 1 22 ? -27.579  11.623  8.384   1.00 135.75 ? 63  GLU A CB  1 
ATOM 11   C CG  . GLU A 1 22 ? -27.686  11.484  6.870   1.00 137.23 ? 63  GLU A CG  1 
ATOM 12   C CD  . GLU A 1 22 ? -26.353  11.527  6.164   1.00 139.82 ? 63  GLU A CD  1 
ATOM 13   O OE1 . GLU A 1 22 ? -25.612  12.516  6.356   1.00 141.74 ? 63  GLU A OE1 1 
ATOM 14   O OE2 . GLU A 1 22 ? -26.055  10.573  5.408   1.00 141.74 ? 63  GLU A OE2 1 
ATOM 15   N N   . PRO A 1 23 ? -28.992  9.076   8.730   1.00 138.96 ? 64  PRO A N   1 
ATOM 16   C CA  . PRO A 1 23 ? -29.678  7.868   8.265   1.00 141.04 ? 64  PRO A CA  1 
ATOM 17   C C   . PRO A 1 23 ? -30.963  7.660   9.060   1.00 140.01 ? 64  PRO A C   1 
ATOM 18   O O   . PRO A 1 23 ? -32.021  7.408   8.486   1.00 160.56 ? 64  PRO A O   1 
ATOM 19   C CB  . PRO A 1 23 ? -28.643  6.768   8.501   1.00 147.26 ? 64  PRO A CB  1 
ATOM 20   C CG  . PRO A 1 23 ? -27.903  7.265   9.709   1.00 141.01 ? 64  PRO A CG  1 
ATOM 21   C CD  . PRO A 1 23 ? -27.721  8.736   9.401   1.00 144.47 ? 64  PRO A CD  1 
ATOM 22   N N   . ALA A 1 24 ? -30.863  7.792   10.381  1.00 139.90 ? 65  ALA A N   1 
ATOM 23   C CA  . ALA A 1 24 ? -32.010  7.635   11.282  1.00 120.10 ? 65  ALA A CA  1 
ATOM 24   C C   . ALA A 1 24 ? -33.048  8.702   10.962  1.00 107.62 ? 65  ALA A C   1 
ATOM 25   O O   . ALA A 1 24 ? -34.123  8.765   11.573  1.00 93.62  ? 65  ALA A O   1 
ATOM 26   C CB  . ALA A 1 24 ? -31.561  7.763   12.739  1.00 115.73 ? 65  ALA A CB  1 
ATOM 27   N N   . LEU A 1 25 ? -32.700  9.547   10.001  1.00 96.10  ? 66  LEU A N   1 
ATOM 28   C CA  . LEU A 1 25 ? -33.575  10.612  9.557   1.00 97.13  ? 66  LEU A CA  1 
ATOM 29   C C   . LEU A 1 25 ? -34.214  10.101  8.262   1.00 99.35  ? 66  LEU A C   1 
ATOM 30   O O   . LEU A 1 25 ? -35.439  10.141  8.094   1.00 105.78 ? 66  LEU A O   1 
ATOM 31   C CB  . LEU A 1 25 ? -32.749  11.870  9.302   1.00 94.81  ? 66  LEU A CB  1 
ATOM 32   C CG  . LEU A 1 25 ? -33.364  13.238  9.606   1.00 87.74  ? 66  LEU A CG  1 
ATOM 33   C CD1 . LEU A 1 25 ? -33.528  13.446  11.114  1.00 83.76  ? 66  LEU A CD1 1 
ATOM 34   C CD2 . LEU A 1 25 ? -32.445  14.301  9.026   1.00 83.52  ? 66  LEU A CD2 1 
ATOM 35   N N   . ARG A 1 26 ? -33.371  9.601   7.357   1.00 101.01 ? 67  ARG A N   1 
ATOM 36   C CA  . ARG A 1 26 ? -33.847  9.053   6.092   1.00 96.38  ? 67  ARG A CA  1 
ATOM 37   C C   . ARG A 1 26 ? -34.806  7.918   6.453   1.00 94.15  ? 67  ARG A C   1 
ATOM 38   O O   . ARG A 1 26 ? -35.730  7.588   5.708   1.00 88.48  ? 67  ARG A O   1 
ATOM 39   C CB  . ARG A 1 26 ? -32.675  8.513   5.271   1.00 96.93  ? 67  ARG A CB  1 
ATOM 40   C CG  . ARG A 1 26 ? -32.910  8.559   3.767   1.00 102.57 ? 67  ARG A CG  1 
ATOM 41   C CD  . ARG A 1 26 ? -33.090  10.000  3.274   1.00 105.47 ? 67  ARG A CD  1 
ATOM 42   N NE  . ARG A 1 26 ? -31.917  10.524  2.571   1.00 107.45 ? 67  ARG A NE  1 
ATOM 43   C CZ  . ARG A 1 26 ? -30.712  10.699  3.113   1.00 108.46 ? 67  ARG A CZ  1 
ATOM 44   N NH1 . ARG A 1 26 ? -30.491  10.396  4.388   1.00 108.29 ? 67  ARG A NH1 1 
ATOM 45   N NH2 . ARG A 1 26 ? -29.719  11.182  2.376   1.00 107.68 ? 67  ARG A NH2 1 
ATOM 46   N N   . GLU A 1 27 ? -34.569  7.332   7.619   1.00 94.76  ? 68  GLU A N   1 
ATOM 47   C CA  . GLU A 1 27 ? -35.398  6.260   8.121   1.00 98.09  ? 68  GLU A CA  1 
ATOM 48   C C   . GLU A 1 27 ? -36.750  6.869   8.406   1.00 93.62  ? 68  GLU A C   1 
ATOM 49   O O   . GLU A 1 27 ? -37.769  6.369   7.943   1.00 88.17  ? 68  GLU A O   1 
ATOM 50   C CB  . GLU A 1 27 ? -34.800  5.691   9.409   1.00 111.09 ? 68  GLU A CB  1 
ATOM 51   C CG  . GLU A 1 27 ? -35.554  4.521   10.020  1.00 133.50 ? 68  GLU A CG  1 
ATOM 52   C CD  . GLU A 1 27 ? -34.888  4.002   11.286  1.00 145.10 ? 68  GLU A CD  1 
ATOM 53   O OE1 . GLU A 1 27 ? -33.724  3.551   11.211  1.00 150.60 ? 68  GLU A OE1 1 
ATOM 54   O OE2 . GLU A 1 27 ? -35.527  4.048   12.359  1.00 150.77 ? 68  GLU A OE2 1 
ATOM 55   N N   . GLN A 1 28 ? -36.752  7.968   9.156   1.00 91.66  ? 69  GLN A N   1 
ATOM 56   C CA  . GLN A 1 28 ? -37.995  8.640   9.515   1.00 92.19  ? 69  GLN A CA  1 
ATOM 57   C C   . GLN A 1 28 ? -38.734  9.094   8.278   1.00 88.35  ? 69  GLN A C   1 
ATOM 58   O O   . GLN A 1 28 ? -39.961  9.178   8.283   1.00 87.13  ? 69  GLN A O   1 
ATOM 59   C CB  . GLN A 1 28 ? -37.741  9.850   10.415  1.00 100.19 ? 69  GLN A CB  1 
ATOM 60   C CG  . GLN A 1 28 ? -39.029  10.417  11.025  1.00 111.06 ? 69  GLN A CG  1 
ATOM 61   C CD  . GLN A 1 28 ? -38.822  11.733  11.761  1.00 116.30 ? 69  GLN A CD  1 
ATOM 62   O OE1 . GLN A 1 28 ? -37.956  11.845  12.630  1.00 118.63 ? 69  GLN A OE1 1 
ATOM 63   N NE2 . GLN A 1 28 ? -39.629  12.734  11.419  1.00 118.35 ? 69  GLN A NE2 1 
ATOM 64   N N   . GLN A 1 29 ? -38.000  9.396   7.214   1.00 84.18  ? 70  GLN A N   1 
ATOM 65   C CA  . GLN A 1 29 ? -38.677  9.817   5.995   1.00 81.93  ? 70  GLN A CA  1 
ATOM 66   C C   . GLN A 1 29 ? -39.624  8.704   5.571   1.00 79.94  ? 70  GLN A C   1 
ATOM 67   O O   . GLN A 1 29 ? -40.849  8.865   5.672   1.00 78.90  ? 70  GLN A O   1 
ATOM 68   C CB  . GLN A 1 29 ? -37.678  10.110  4.877   1.00 83.88  ? 70  GLN A CB  1 
ATOM 69   C CG  . GLN A 1 29 ? -38.335  10.547  3.585   1.00 86.33  ? 70  GLN A CG  1 
ATOM 70   C CD  . GLN A 1 29 ? -37.372  11.274  2.662   1.00 89.29  ? 70  GLN A CD  1 
ATOM 71   O OE1 . GLN A 1 29 ? -36.164  11.019  2.674   1.00 91.12  ? 70  GLN A OE1 1 
ATOM 72   N NE2 . GLN A 1 29 ? -37.906  12.173  1.839   1.00 89.58  ? 70  GLN A NE2 1 
ATOM 73   N N   . LEU A 1 30 ? -39.048  7.573   5.130   1.00 78.35  ? 71  LEU A N   1 
ATOM 74   C CA  . LEU A 1 30 ? -39.810  6.403   4.690   1.00 74.68  ? 71  LEU A CA  1 
ATOM 75   C C   . LEU A 1 30 ? -40.924  6.040   5.653   1.00 76.10  ? 71  LEU A C   1 
ATOM 76   O O   . LEU A 1 30 ? -42.078  5.940   5.267   1.00 69.60  ? 71  LEU A O   1 
ATOM 77   C CB  . LEU A 1 30 ? -38.877  5.216   4.486   1.00 75.13  ? 71  LEU A CB  1 
ATOM 78   C CG  . LEU A 1 30 ? -37.943  5.386   3.276   1.00 80.15  ? 71  LEU A CG  1 
ATOM 79   C CD1 . LEU A 1 30 ? -37.197  4.073   3.007   1.00 81.94  ? 71  LEU A CD1 1 
ATOM 80   C CD2 . LEU A 1 30 ? -38.749  5.786   2.038   1.00 82.81  ? 71  LEU A CD2 1 
ATOM 81   N N   . GLN A 1 31 ? -40.594  5.857   6.914   1.00 85.79  ? 72  GLN A N   1 
ATOM 82   C CA  . GLN A 1 31 ? -41.628  5.528   7.879   1.00 100.63 ? 72  GLN A CA  1 
ATOM 83   C C   . GLN A 1 31 ? -42.839  6.435   7.674   1.00 97.82  ? 72  GLN A C   1 
ATOM 84   O O   . GLN A 1 31 ? -43.984  6.013   7.811   1.00 85.56  ? 72  GLN A O   1 
ATOM 85   C CB  . GLN A 1 31 ? -41.096  5.709   9.300   1.00 124.46 ? 72  GLN A CB  1 
ATOM 86   C CG  . GLN A 1 31 ? -39.853  4.897   9.605   1.00 165.28 ? 72  GLN A CG  1 
ATOM 87   C CD  . GLN A 1 31 ? -39.230  5.281   10.930  1.00 184.76 ? 72  GLN A CD  1 
ATOM 88   O OE1 . GLN A 1 31 ? -38.212  4.722   11.335  1.00 193.29 ? 72  GLN A OE1 1 
ATOM 89   N NE2 . GLN A 1 31 ? -39.839  6.242   11.612  1.00 193.22 ? 72  GLN A NE2 1 
ATOM 90   N N   . GLN A 1 32 ? -42.572  7.689   7.330   1.00 102.26 ? 73  GLN A N   1 
ATOM 91   C CA  . GLN A 1 32 ? -43.624  8.670   7.138   1.00 110.98 ? 73  GLN A CA  1 
ATOM 92   C C   . GLN A 1 32 ? -44.312  8.541   5.790   1.00 103.81 ? 73  GLN A C   1 
ATOM 93   O O   . GLN A 1 32 ? -45.537  8.520   5.726   1.00 98.32  ? 73  GLN A O   1 
ATOM 94   C CB  . GLN A 1 32 ? -43.045  10.075  7.313   1.00 131.75 ? 73  GLN A CB  1 
ATOM 95   C CG  . GLN A 1 32 ? -43.942  11.030  8.088   1.00 162.22 ? 73  GLN A CG  1 
ATOM 96   C CD  . GLN A 1 32 ? -43.151  12.093  8.836   1.00 175.15 ? 73  GLN A CD  1 
ATOM 97   O OE1 . GLN A 1 32 ? -42.396  11.787  9.761   1.00 179.28 ? 73  GLN A OE1 1 
ATOM 98   N NE2 . GLN A 1 32 ? -43.319  13.345  8.434   1.00 179.33 ? 73  GLN A NE2 1 
ATOM 99   N N   . GLU A 1 33 ? -43.533  8.449   4.715   1.00 97.74  ? 74  GLU A N   1 
ATOM 100  C CA  . GLU A 1 33 ? -44.101  8.320   3.371   1.00 95.75  ? 74  GLU A CA  1 
ATOM 101  C C   . GLU A 1 33 ? -45.082  7.149   3.301   1.00 94.84  ? 74  GLU A C   1 
ATOM 102  O O   . GLU A 1 33 ? -46.164  7.254   2.721   1.00 95.82  ? 74  GLU A O   1 
ATOM 103  C CB  . GLU A 1 33 ? -42.986  8.129   2.347   1.00 94.72  ? 74  GLU A CB  1 
ATOM 104  C CG  . GLU A 1 33 ? -41.793  9.007   2.634   1.00 95.46  ? 74  GLU A CG  1 
ATOM 105  C CD  . GLU A 1 33 ? -40.977  9.329   1.400   1.00 96.83  ? 74  GLU A CD  1 
ATOM 106  O OE1 . GLU A 1 33 ? -40.681  8.397   0.611   1.00 95.71  ? 74  GLU A OE1 1 
ATOM 107  O OE2 . GLU A 1 33 ? -40.623  10.522  1.230   1.00 97.62  ? 74  GLU A OE2 1 
ATOM 108  N N   . LEU A 1 34 ? -44.685  6.034   3.901   1.00 93.63  ? 75  LEU A N   1 
ATOM 109  C CA  . LEU A 1 34 ? -45.503  4.835   3.962   1.00 90.53  ? 75  LEU A CA  1 
ATOM 110  C C   . LEU A 1 34 ? -46.881  5.197   4.537   1.00 92.00  ? 75  LEU A C   1 
ATOM 111  O O   . LEU A 1 34 ? -47.890  5.068   3.850   1.00 87.96  ? 75  LEU A O   1 
ATOM 112  C CB  . LEU A 1 34 ? -44.791  3.813   4.846   1.00 88.01  ? 75  LEU A CB  1 
ATOM 113  C CG  . LEU A 1 34 ? -45.164  2.335   4.891   1.00 87.07  ? 75  LEU A CG  1 
ATOM 114  C CD1 . LEU A 1 34 ? -45.098  1.720   3.509   1.00 85.13  ? 75  LEU A CD1 1 
ATOM 115  C CD2 . LEU A 1 34 ? -44.198  1.641   5.835   1.00 84.81  ? 75  LEU A CD2 1 
ATOM 116  N N   . LEU A 1 35 ? -46.919  5.661   5.787   1.00 97.81  ? 76  LEU A N   1 
ATOM 117  C CA  . LEU A 1 35 ? -48.177  6.052   6.430   1.00 104.09 ? 76  LEU A CA  1 
ATOM 118  C C   . LEU A 1 35 ? -48.957  7.048   5.571   1.00 97.26  ? 76  LEU A C   1 
ATOM 119  O O   . LEU A 1 35 ? -50.125  7.344   5.840   1.00 90.80  ? 76  LEU A O   1 
ATOM 120  C CB  . LEU A 1 35 ? -47.920  6.674   7.807   1.00 124.45 ? 76  LEU A CB  1 
ATOM 121  C CG  . LEU A 1 35 ? -47.498  5.755   8.957   1.00 146.75 ? 76  LEU A CG  1 
ATOM 122  C CD1 . LEU A 1 35 ? -47.334  6.576   10.227  1.00 158.52 ? 76  LEU A CD1 1 
ATOM 123  C CD2 . LEU A 1 35 ? -48.545  4.672   9.168   1.00 158.69 ? 76  LEU A CD2 1 
ATOM 124  N N   . ALA A 1 36 ? -48.299  7.585   4.551   1.00 90.96  ? 77  ALA A N   1 
ATOM 125  C CA  . ALA A 1 36 ? -48.951  8.516   3.647   1.00 89.22  ? 77  ALA A CA  1 
ATOM 126  C C   . ALA A 1 36 ? -49.618  7.667   2.560   1.00 88.12  ? 77  ALA A C   1 
ATOM 127  O O   . ALA A 1 36 ? -50.794  7.859   2.224   1.00 90.07  ? 77  ALA A O   1 
ATOM 128  C CB  . ALA A 1 36 ? -47.928  9.446   3.040   1.00 88.71  ? 77  ALA A CB  1 
ATOM 129  N N   . LEU A 1 37 ? -48.850  6.711   2.035   1.00 84.55  ? 78  LEU A N   1 
ATOM 130  C CA  . LEU A 1 37 ? -49.321  5.791   1.003   1.00 79.66  ? 78  LEU A CA  1 
ATOM 131  C C   . LEU A 1 37 ? -50.634  5.185   1.436   1.00 82.95  ? 78  LEU A C   1 
ATOM 132  O O   . LEU A 1 37 ? -51.612  5.176   0.694   1.00 82.98  ? 78  LEU A O   1 
ATOM 133  C CB  . LEU A 1 37 ? -48.336  4.654   0.812   1.00 70.09  ? 78  LEU A CB  1 
ATOM 134  C CG  . LEU A 1 37 ? -48.190  4.306   -0.659  1.00 64.69  ? 78  LEU A CG  1 
ATOM 135  C CD1 . LEU A 1 37 ? -46.996  5.064   -1.177  1.00 59.61  ? 78  LEU A CD1 1 
ATOM 136  C CD2 . LEU A 1 37 ? -47.982  2.803   -0.892  1.00 62.76  ? 78  LEU A CD2 1 
ATOM 137  N N   . LYS A 1 38 ? -50.637  4.667   2.656   1.00 88.76  ? 79  LYS A N   1 
ATOM 138  C CA  . LYS A 1 38 ? -51.820  4.038   3.206   1.00 93.89  ? 79  LYS A CA  1 
ATOM 139  C C   . LYS A 1 38 ? -53.012  4.972   3.153   1.00 91.46  ? 79  LYS A C   1 
ATOM 140  O O   . LYS A 1 38 ? -54.051  4.631   2.589   1.00 84.15  ? 79  LYS A O   1 
ATOM 141  C CB  . LYS A 1 38 ? -51.571  3.603   4.657   1.00 104.19 ? 79  LYS A CB  1 
ATOM 142  C CG  . LYS A 1 38 ? -52.828  3.155   5.410   1.00 122.29 ? 79  LYS A CG  1 
ATOM 143  C CD  . LYS A 1 38 ? -52.546  2.933   6.893   1.00 131.98 ? 79  LYS A CD  1 
ATOM 144  C CE  . LYS A 1 38 ? -53.823  2.632   7.662   1.00 135.49 ? 79  LYS A CE  1 
ATOM 145  N NZ  . LYS A 1 38 ? -53.579  2.466   9.122   1.00 136.98 ? 79  LYS A NZ  1 
ATOM 146  N N   . GLN A 1 39 ? -52.857  6.158   3.732   1.00 91.82  ? 80  GLN A N   1 
ATOM 147  C CA  . GLN A 1 39 ? -53.952  7.113   3.784   1.00 92.93  ? 80  GLN A CA  1 
ATOM 148  C C   . GLN A 1 39 ? -54.460  7.469   2.396   1.00 80.73  ? 80  GLN A C   1 
ATOM 149  O O   . GLN A 1 39 ? -55.671  7.516   2.176   1.00 76.16  ? 80  GLN A O   1 
ATOM 150  C CB  . GLN A 1 39 ? -53.526  8.373   4.546   1.00 114.86 ? 80  GLN A CB  1 
ATOM 151  C CG  . GLN A 1 39 ? -54.705  9.225   4.996   1.00 144.30 ? 80  GLN A CG  1 
ATOM 152  C CD  . GLN A 1 39 ? -54.289  10.497  5.707   1.00 157.24 ? 80  GLN A CD  1 
ATOM 153  O OE1 . GLN A 1 39 ? -53.491  11.278  5.189   1.00 162.77 ? 80  GLN A OE1 1 
ATOM 154  N NE2 . GLN A 1 39 ? -54.839  10.718  6.895   1.00 162.44 ? 80  GLN A NE2 1 
ATOM 155  N N   . LYS A 1 40 ? -53.538  7.713   1.468   1.00 69.78  ? 81  LYS A N   1 
ATOM 156  C CA  . LYS A 1 40 ? -53.900  8.051   0.083   1.00 61.20  ? 81  LYS A CA  1 
ATOM 157  C C   . LYS A 1 40 ? -54.814  6.943   -0.446  1.00 58.92  ? 81  LYS A C   1 
ATOM 158  O O   . LYS A 1 40 ? -56.041  7.124   -0.566  1.00 55.51  ? 81  LYS A O   1 
ATOM 159  C CB  . LYS A 1 40 ? -52.628  8.143   -0.760  1.00 56.60  ? 81  LYS A CB  1 
ATOM 160  C CG  . LYS A 1 40 ? -52.794  8.445   -2.228  1.00 58.97  ? 81  LYS A CG  1 
ATOM 161  C CD  . LYS A 1 40 ? -51.753  9.516   -2.631  1.00 65.63  ? 81  LYS A CD  1 
ATOM 162  C CE  . LYS A 1 40 ? -51.328  9.470   -4.108  1.00 68.31  ? 81  LYS A CE  1 
ATOM 163  N NZ  . LYS A 1 40 ? -50.290  8.413   -4.355  1.00 68.89  ? 81  LYS A NZ  1 
ATOM 164  N N   . GLN A 1 41 ? -54.200  5.788   -0.710  1.00 57.24  ? 82  GLN A N   1 
ATOM 165  C CA  . GLN A 1 41 ? -54.882  4.593   -1.187  1.00 57.35  ? 82  GLN A CA  1 
ATOM 166  C C   . GLN A 1 41 ? -56.188  4.307   -0.492  1.00 61.36  ? 82  GLN A C   1 
ATOM 167  O O   . GLN A 1 41 ? -57.172  3.980   -1.134  1.00 63.29  ? 82  GLN A O   1 
ATOM 168  C CB  . GLN A 1 41 ? -53.994  3.387   -1.003  1.00 54.04  ? 82  GLN A CB  1 
ATOM 169  C CG  . GLN A 1 41 ? -52.758  3.438   -1.844  1.00 51.39  ? 82  GLN A CG  1 
ATOM 170  C CD  . GLN A 1 41 ? -52.024  2.131   -1.793  1.00 52.75  ? 82  GLN A CD  1 
ATOM 171  O OE1 . GLN A 1 41 ? -51.289  1.761   -2.722  1.00 51.75  ? 82  GLN A OE1 1 
ATOM 172  N NE2 . GLN A 1 41 ? -52.220  1.405   -0.693  1.00 53.76  ? 82  GLN A NE2 1 
ATOM 173  N N   . GLN A 1 42 ? -56.196  4.406   0.825   1.00 68.22  ? 83  GLN A N   1 
ATOM 174  C CA  . GLN A 1 42 ? -57.413  4.137   1.557   1.00 75.48  ? 83  GLN A CA  1 
ATOM 175  C C   . GLN A 1 42 ? -58.520  5.052   1.038   1.00 75.64  ? 83  GLN A C   1 
ATOM 176  O O   . GLN A 1 42 ? -59.707  4.710   1.121   1.00 71.92  ? 83  GLN A O   1 
ATOM 177  C CB  . GLN A 1 42 ? -57.191  4.354   3.053   1.00 85.20  ? 83  GLN A CB  1 
ATOM 178  C CG  . GLN A 1 42 ? -58.190  3.636   3.952   1.00 101.65 ? 83  GLN A CG  1 
ATOM 179  C CD  . GLN A 1 42 ? -59.539  4.330   4.059   1.00 109.41 ? 83  GLN A CD  1 
ATOM 180  O OE1 . GLN A 1 42 ? -60.456  3.808   4.688   1.00 113.13 ? 83  GLN A OE1 1 
ATOM 181  N NE2 . GLN A 1 42 ? -59.665  5.511   3.459   1.00 112.45 ? 83  GLN A NE2 1 
ATOM 182  N N   . ILE A 1 43 ? -58.141  6.219   0.512   1.00 75.81  ? 84  ILE A N   1 
ATOM 183  C CA  . ILE A 1 43 ? -59.136  7.139   -0.015  1.00 78.54  ? 84  ILE A CA  1 
ATOM 184  C C   . ILE A 1 43 ? -59.404  6.782   -1.459  1.00 74.63  ? 84  ILE A C   1 
ATOM 185  O O   . ILE A 1 43 ? -60.553  6.583   -1.833  1.00 74.52  ? 84  ILE A O   1 
ATOM 186  C CB  . ILE A 1 43 ? -58.695  8.628   0.072   1.00 86.56  ? 84  ILE A CB  1 
ATOM 187  C CG1 . ILE A 1 43 ? -58.688  9.094   1.528   1.00 93.72  ? 84  ILE A CG1 1 
ATOM 188  C CG2 . ILE A 1 43 ? -59.681  9.517   -0.688  1.00 91.78  ? 84  ILE A CG2 1 
ATOM 189  C CD1 . ILE A 1 43 ? -58.391  10.566  1.689   1.00 97.34  ? 84  ILE A CD1 1 
ATOM 190  N N   . GLN A 1 44 ? -58.359  6.700   -2.275  1.00 71.66  ? 85  GLN A N   1 
ATOM 191  C CA  . GLN A 1 44 ? -58.569  6.338   -3.664  1.00 70.58  ? 85  GLN A CA  1 
ATOM 192  C C   . GLN A 1 44 ? -59.628  5.209   -3.736  1.00 70.64  ? 85  GLN A C   1 
ATOM 193  O O   . GLN A 1 44 ? -60.598  5.302   -4.516  1.00 70.36  ? 85  GLN A O   1 
ATOM 194  C CB  . GLN A 1 44 ? -57.270  5.863   -4.316  1.00 71.17  ? 85  GLN A CB  1 
ATOM 195  C CG  . GLN A 1 44 ? -56.159  6.896   -4.408  1.00 78.39  ? 85  GLN A CG  1 
ATOM 196  C CD  . GLN A 1 44 ? -55.274  6.708   -5.653  1.00 83.84  ? 85  GLN A CD  1 
ATOM 197  O OE1 . GLN A 1 44 ? -54.057  6.915   -5.617  1.00 85.93  ? 85  GLN A OE1 1 
ATOM 198  N NE2 . GLN A 1 44 ? -55.896  6.332   -6.762  1.00 86.67  ? 85  GLN A NE2 1 
ATOM 199  N N   . ARG A 1 45 ? -59.457  4.157   -2.923  1.00 68.54  ? 86  ARG A N   1 
ATOM 200  C CA  . ARG A 1 45 ? -60.413  3.044   -2.904  1.00 67.17  ? 86  ARG A CA  1 
ATOM 201  C C   . ARG A 1 45 ? -61.824  3.535   -2.679  1.00 70.32  ? 86  ARG A C   1 
ATOM 202  O O   . ARG A 1 45 ? -62.768  3.019   -3.269  1.00 70.55  ? 86  ARG A O   1 
ATOM 203  C CB  . ARG A 1 45 ? -60.098  2.042   -1.799  1.00 64.48  ? 86  ARG A CB  1 
ATOM 204  C CG  . ARG A 1 45 ? -59.119  0.937   -2.187  1.00 60.94  ? 86  ARG A CG  1 
ATOM 205  C CD  . ARG A 1 45 ? -59.178  -0.124  -1.113  1.00 56.77  ? 86  ARG A CD  1 
ATOM 206  N NE  . ARG A 1 45 ? -58.479  0.216   0.134   1.00 55.26  ? 86  ARG A NE  1 
ATOM 207  C CZ  . ARG A 1 45 ? -57.146  0.291   0.236   1.00 56.07  ? 86  ARG A CZ  1 
ATOM 208  N NH1 . ARG A 1 45 ? -56.364  0.067   -0.842  1.00 51.80  ? 86  ARG A NH1 1 
ATOM 209  N NH2 . ARG A 1 45 ? -56.595  0.554   1.424   1.00 53.91  ? 86  ARG A NH2 1 
ATOM 210  N N   . GLN A 1 46 ? -61.975  4.525   -1.809  1.00 76.15  ? 87  GLN A N   1 
ATOM 211  C CA  . GLN A 1 46 ? -63.301  5.066   -1.529  1.00 81.37  ? 87  GLN A CA  1 
ATOM 212  C C   . GLN A 1 46 ? -63.845  5.824   -2.724  1.00 76.54  ? 87  GLN A C   1 
ATOM 213  O O   . GLN A 1 46 ? -65.053  5.914   -2.917  1.00 70.07  ? 87  GLN A O   1 
ATOM 214  C CB  . GLN A 1 46 ? -63.264  5.981   -0.314  1.00 93.02  ? 87  GLN A CB  1 
ATOM 215  C CG  . GLN A 1 46 ? -63.063  5.243   0.979   1.00 112.87 ? 87  GLN A CG  1 
ATOM 216  C CD  . GLN A 1 46 ? -63.220  6.148   2.174   1.00 122.36 ? 87  GLN A CD  1 
ATOM 217  O OE1 . GLN A 1 46 ? -63.083  5.714   3.318   1.00 125.14 ? 87  GLN A OE1 1 
ATOM 218  N NE2 . GLN A 1 46 ? -63.511  7.423   1.918   1.00 126.01 ? 87  GLN A NE2 1 
ATOM 219  N N   . ILE A 1 47 ? -62.951  6.377   -3.528  1.00 73.66  ? 88  ILE A N   1 
ATOM 220  C CA  . ILE A 1 47 ? -63.400  7.105   -4.697  1.00 76.05  ? 88  ILE A CA  1 
ATOM 221  C C   . ILE A 1 47 ? -63.868  6.072   -5.690  1.00 75.53  ? 88  ILE A C   1 
ATOM 222  O O   . ILE A 1 47 ? -64.962  6.202   -6.258  1.00 74.83  ? 88  ILE A O   1 
ATOM 223  C CB  . ILE A 1 47 ? -62.280  7.957   -5.299  1.00 78.18  ? 88  ILE A CB  1 
ATOM 224  C CG1 . ILE A 1 47 ? -61.917  9.069   -4.309  1.00 81.34  ? 88  ILE A CG1 1 
ATOM 225  C CG2 . ILE A 1 47 ? -62.724  8.533   -6.631  1.00 79.35  ? 88  ILE A CG2 1 
ATOM 226  C CD1 . ILE A 1 47 ? -60.626  9.765   -4.625  1.00 83.61  ? 88  ILE A CD1 1 
ATOM 227  N N   . LEU A 1 48 ? -63.052  5.034   -5.878  1.00 75.04  ? 89  LEU A N   1 
ATOM 228  C CA  . LEU A 1 48 ? -63.400  3.937   -6.786  1.00 73.78  ? 89  LEU A CA  1 
ATOM 229  C C   . LEU A 1 48 ? -64.811  3.409   -6.482  1.00 69.97  ? 89  LEU A C   1 
ATOM 230  O O   . LEU A 1 48 ? -65.652  3.272   -7.374  1.00 69.59  ? 89  LEU A O   1 
ATOM 231  C CB  . LEU A 1 48 ? -62.411  2.786   -6.646  1.00 77.25  ? 89  LEU A CB  1 
ATOM 232  C CG  . LEU A 1 48 ? -62.853  1.666   -7.575  1.00 81.99  ? 89  LEU A CG  1 
ATOM 233  C CD1 . LEU A 1 48 ? -62.681  2.155   -9.001  1.00 84.94  ? 89  LEU A CD1 1 
ATOM 234  C CD2 . LEU A 1 48 ? -62.053  0.397   -7.334  1.00 85.57  ? 89  LEU A CD2 1 
ATOM 235  N N   . ILE A 1 49 ? -65.057  3.121   -5.209  1.00 65.98  ? 90  ILE A N   1 
ATOM 236  C CA  . ILE A 1 49 ? -66.336  2.624   -4.782  1.00 63.04  ? 90  ILE A CA  1 
ATOM 237  C C   . ILE A 1 49 ? -67.485  3.602   -4.981  1.00 65.43  ? 90  ILE A C   1 
ATOM 238  O O   . ILE A 1 49 ? -68.545  3.218   -5.465  1.00 64.17  ? 90  ILE A O   1 
ATOM 239  C CB  . ILE A 1 49 ? -66.268  2.214   -3.332  1.00 59.61  ? 90  ILE A CB  1 
ATOM 240  C CG1 . ILE A 1 49 ? -65.647  0.837   -3.245  1.00 59.14  ? 90  ILE A CG1 1 
ATOM 241  C CG2 . ILE A 1 49 ? -67.661  2.147   -2.736  1.00 60.50  ? 90  ILE A CG2 1 
ATOM 242  C CD1 . ILE A 1 49 ? -66.403  -0.194  -4.011  1.00 58.30  ? 90  ILE A CD1 1 
ATOM 243  N N   . ALA A 1 50 ? -67.290  4.861   -4.596  1.00 68.50  ? 91  ALA A N   1 
ATOM 244  C CA  . ALA A 1 50 ? -68.344  5.861   -4.741  1.00 72.61  ? 91  ALA A CA  1 
ATOM 245  C C   . ALA A 1 50 ? -68.644  6.004   -6.218  1.00 77.98  ? 91  ALA A C   1 
ATOM 246  O O   . ALA A 1 50 ? -69.802  6.140   -6.619  1.00 72.83  ? 91  ALA A O   1 
ATOM 247  C CB  . ALA A 1 50 ? -67.901  7.173   -4.174  1.00 73.72  ? 91  ALA A CB  1 
ATOM 248  N N   . GLU A 1 51 ? -67.590  5.967   -7.023  1.00 87.86  ? 92  GLU A N   1 
ATOM 249  C CA  . GLU A 1 51 ? -67.742  6.055   -8.465  1.00 98.53  ? 92  GLU A CA  1 
ATOM 250  C C   . GLU A 1 51 ? -68.716  4.943   -8.912  1.00 87.25  ? 92  GLU A C   1 
ATOM 251  O O   . GLU A 1 51 ? -69.739  5.227   -9.556  1.00 79.89  ? 92  GLU A O   1 
ATOM 252  C CB  . GLU A 1 51 ? -66.380  5.869   -9.125  1.00 127.84 ? 92  GLU A CB  1 
ATOM 253  C CG  . GLU A 1 51 ? -66.357  6.056   -10.623 1.00 170.22 ? 92  GLU A CG  1 
ATOM 254  C CD  . GLU A 1 51 ? -65.011  5.683   -11.208 1.00 189.18 ? 92  GLU A CD  1 
ATOM 255  O OE1 . GLU A 1 51 ? -64.633  4.495   -11.116 1.00 195.67 ? 92  GLU A OE1 1 
ATOM 256  O OE2 . GLU A 1 51 ? -64.325  6.576   -11.749 1.00 195.84 ? 92  GLU A OE2 1 
ATOM 257  N N   . PHE A 1 52 ? -68.412  3.684   -8.558  1.00 75.38  ? 93  PHE A N   1 
ATOM 258  C CA  . PHE A 1 52 ? -69.270  2.556   -8.935  1.00 65.31  ? 93  PHE A CA  1 
ATOM 259  C C   . PHE A 1 52 ? -70.660  2.793   -8.390  1.00 63.40  ? 93  PHE A C   1 
ATOM 260  O O   . PHE A 1 52 ? -71.642  2.668   -9.106  1.00 55.16  ? 93  PHE A O   1 
ATOM 261  C CB  . PHE A 1 52 ? -68.757  1.246   -8.361  1.00 68.97  ? 93  PHE A CB  1 
ATOM 262  C CG  . PHE A 1 52 ? -69.615  0.068   -8.711  1.00 76.14  ? 93  PHE A CG  1 
ATOM 263  C CD1 . PHE A 1 52 ? -69.447  -0.591  -9.927  1.00 79.36  ? 93  PHE A CD1 1 
ATOM 264  C CD2 . PHE A 1 52 ? -70.606  -0.369  -7.845  1.00 79.44  ? 93  PHE A CD2 1 
ATOM 265  C CE1 . PHE A 1 52 ? -70.244  -1.666  -10.283 1.00 80.25  ? 93  PHE A CE1 1 
ATOM 266  C CE2 . PHE A 1 52 ? -71.418  -1.451  -8.193  1.00 82.50  ? 93  PHE A CE2 1 
ATOM 267  C CZ  . PHE A 1 52 ? -71.232  -2.099  -9.418  1.00 82.49  ? 93  PHE A CZ  1 
ATOM 268  N N   . GLN A 1 53 ? -70.742  3.128   -7.109  1.00 67.88  ? 94  GLN A N   1 
ATOM 269  C CA  . GLN A 1 53 ? -72.026  3.397   -6.498  1.00 77.72  ? 94  GLN A CA  1 
ATOM 270  C C   . GLN A 1 53 ? -72.885  4.225   -7.491  1.00 77.31  ? 94  GLN A C   1 
ATOM 271  O O   . GLN A 1 53 ? -73.976  3.807   -7.886  1.00 64.33  ? 94  GLN A O   1 
ATOM 272  C CB  . GLN A 1 53 ? -71.811  4.170   -5.187  1.00 93.29  ? 94  GLN A CB  1 
ATOM 273  C CG  . GLN A 1 53 ? -72.904  4.018   -4.124  1.00 121.99 ? 94  GLN A CG  1 
ATOM 274  C CD  . GLN A 1 53 ? -74.240  4.595   -4.546  1.00 135.78 ? 94  GLN A CD  1 
ATOM 275  O OE1 . GLN A 1 53 ? -74.324  5.721   -5.038  1.00 141.83 ? 94  GLN A OE1 1 
ATOM 276  N NE2 . GLN A 1 53 ? -75.299  3.825   -4.343  1.00 141.29 ? 94  GLN A NE2 1 
ATOM 277  N N   . ARG A 1 54 ? -72.381  5.386   -7.908  1.00 83.63  ? 95  ARG A N   1 
ATOM 278  C CA  . ARG A 1 54 ? -73.122  6.253   -8.831  1.00 95.94  ? 95  ARG A CA  1 
ATOM 279  C C   . ARG A 1 54 ? -73.492  5.575   -10.142 1.00 93.95  ? 95  ARG A C   1 
ATOM 280  O O   . ARG A 1 54 ? -74.668  5.504   -10.502 1.00 95.09  ? 95  ARG A O   1 
ATOM 281  C CB  . ARG A 1 54 ? -72.332  7.539   -9.122  1.00 111.39 ? 95  ARG A CB  1 
ATOM 282  C CG  . ARG A 1 54 ? -72.832  8.357   -10.322 1.00 130.49 ? 95  ARG A CG  1 
ATOM 283  C CD  . ARG A 1 54 ? -72.018  9.638   -10.495 1.00 142.88 ? 95  ARG A CD  1 
ATOM 284  N NE  . ARG A 1 54 ? -72.231  10.274  -11.793 1.00 149.80 ? 95  ARG A NE  1 
ATOM 285  C CZ  . ARG A 1 54 ? -71.746  9.811   -12.941 1.00 152.62 ? 95  ARG A CZ  1 
ATOM 286  N NH1 . ARG A 1 54 ? -71.015  8.704   -12.956 1.00 153.48 ? 95  ARG A NH1 1 
ATOM 287  N NH2 . ARG A 1 54 ? -71.990  10.456  -14.077 1.00 154.04 ? 95  ARG A NH2 1 
ATOM 288  N N   . GLN A 1 55 ? -72.503  5.076   -10.868 1.00 90.35  ? 96  GLN A N   1 
ATOM 289  C CA  . GLN A 1 55 ? -72.816  4.421   -12.127 1.00 89.12  ? 96  GLN A CA  1 
ATOM 290  C C   . GLN A 1 55 ? -73.820  3.282   -11.903 1.00 88.05  ? 96  GLN A C   1 
ATOM 291  O O   . GLN A 1 55 ? -74.401  2.748   -12.843 1.00 91.94  ? 96  GLN A O   1 
ATOM 292  C CB  . GLN A 1 55 ? -71.530  3.899   -12.771 1.00 88.21  ? 96  GLN A CB  1 
ATOM 293  C CG  . GLN A 1 55 ? -70.783  4.962   -13.573 1.00 86.51  ? 96  GLN A CG  1 
ATOM 294  C CD  . GLN A 1 55 ? -69.357  4.560   -13.914 1.00 87.08  ? 96  GLN A CD  1 
ATOM 295  O OE1 . GLN A 1 55 ? -68.471  4.593   -13.066 1.00 89.44  ? 96  GLN A OE1 1 
ATOM 296  N NE2 . GLN A 1 55 ? -69.134  4.171   -15.160 1.00 89.63  ? 96  GLN A NE2 1 
ATOM 297  N N   . PHE A 1 56 ? -74.046  2.941   -10.641 1.00 85.59  ? 97  PHE A N   1 
ATOM 298  C CA  . PHE A 1 56 ? -74.946  1.859   -10.301 1.00 77.21  ? 97  PHE A CA  1 
ATOM 299  C C   . PHE A 1 56 ? -76.373  2.292   -10.119 1.00 73.79  ? 97  PHE A C   1 
ATOM 300  O O   . PHE A 1 56 ? -77.280  1.618   -10.596 1.00 68.06  ? 97  PHE A O   1 
ATOM 301  C CB  . PHE A 1 56 ? -74.492  1.182   -9.017  1.00 76.80  ? 97  PHE A CB  1 
ATOM 302  C CG  . PHE A 1 56 ? -75.341  0.023   -8.617  1.00 75.02  ? 97  PHE A CG  1 
ATOM 303  C CD1 . PHE A 1 56 ? -75.436  -1.086  -9.434  1.00 75.90  ? 97  PHE A CD1 1 
ATOM 304  C CD2 . PHE A 1 56 ? -76.025  0.026   -7.421  1.00 73.06  ? 97  PHE A CD2 1 
ATOM 305  C CE1 . PHE A 1 56 ? -76.199  -2.184  -9.067  1.00 72.23  ? 97  PHE A CE1 1 
ATOM 306  C CE2 . PHE A 1 56 ? -76.792  -1.074  -7.045  1.00 70.44  ? 97  PHE A CE2 1 
ATOM 307  C CZ  . PHE A 1 56 ? -76.879  -2.190  -7.873  1.00 66.60  ? 97  PHE A CZ  1 
ATOM 308  N N   . GLU A 1 57 ? -76.591  3.390   -9.401  1.00 72.14  ? 98  GLU A N   1 
ATOM 309  C CA  . GLU A 1 57 ? -77.959  3.818   -9.188  1.00 72.58  ? 98  GLU A CA  1 
ATOM 310  C C   . GLU A 1 57 ? -78.414  4.399   -10.503 1.00 73.81  ? 98  GLU A C   1 
ATOM 311  O O   . GLU A 1 57 ? -79.592  4.300   -10.857 1.00 66.58  ? 98  GLU A O   1 
ATOM 312  C CB  . GLU A 1 57 ? -78.068  4.850   -8.065  1.00 77.22  ? 98  GLU A CB  1 
ATOM 313  C CG  . GLU A 1 57 ? -79.517  5.074   -7.564  1.00 89.91  ? 98  GLU A CG  1 
ATOM 314  C CD  . GLU A 1 57 ? -80.156  3.813   -6.946  1.00 97.40  ? 98  GLU A CD  1 
ATOM 315  O OE1 . GLU A 1 57 ? -79.620  3.287   -5.937  1.00 99.68  ? 98  GLU A OE1 1 
ATOM 316  O OE2 . GLU A 1 57 ? -81.199  3.344   -7.463  1.00 100.14 ? 98  GLU A OE2 1 
ATOM 317  N N   . GLN A 1 58 ? -77.463  4.966   -11.247 1.00 79.57  ? 99  GLN A N   1 
ATOM 318  C CA  . GLN A 1 58 ? -77.762  5.565   -12.552 1.00 87.64  ? 99  GLN A CA  1 
ATOM 319  C C   . GLN A 1 58 ? -78.397  4.518   -13.454 1.00 77.30  ? 99  GLN A C   1 
ATOM 320  O O   . GLN A 1 58 ? -79.548  4.680   -13.878 1.00 70.46  ? 99  GLN A O   1 
ATOM 321  C CB  . GLN A 1 58 ? -76.484  6.111   -13.196 1.00 112.36 ? 99  GLN A CB  1 
ATOM 322  C CG  . GLN A 1 58 ? -76.697  6.792   -14.539 1.00 147.11 ? 99  GLN A CG  1 
ATOM 323  C CD  . GLN A 1 58 ? -75.488  7.596   -14.974 1.00 163.17 ? 99  GLN A CD  1 
ATOM 324  O OE1 . GLN A 1 58 ? -75.164  8.621   -14.377 1.00 169.23 ? 99  GLN A OE1 1 
ATOM 325  N NE2 . GLN A 1 58 ? -74.809  7.128   -16.013 1.00 170.11 ? 99  GLN A NE2 1 
ATOM 326  N N   . LEU A 1 59 ? -77.654  3.442   -13.731 1.00 68.15  ? 100 LEU A N   1 
ATOM 327  C CA  . LEU A 1 59 ? -78.179  2.362   -14.550 1.00 62.03  ? 100 LEU A CA  1 
ATOM 328  C C   . LEU A 1 59 ? -79.507  1.936   -13.945 1.00 60.63  ? 100 LEU A C   1 
ATOM 329  O O   . LEU A 1 59 ? -80.544  1.892   -14.618 1.00 58.42  ? 100 LEU A O   1 
ATOM 330  C CB  . LEU A 1 59 ? -77.245  1.167   -14.562 1.00 61.83  ? 100 LEU A CB  1 
ATOM 331  C CG  . LEU A 1 59 ? -77.625  0.259   -15.727 1.00 68.24  ? 100 LEU A CG  1 
ATOM 332  C CD1 . LEU A 1 59 ? -77.642  1.115   -16.988 1.00 71.07  ? 100 LEU A CD1 1 
ATOM 333  C CD2 . LEU A 1 59 ? -76.646  -0.908  -15.888 1.00 72.80  ? 100 LEU A CD2 1 
ATOM 334  N N   . SER A 1 60 ? -79.487  1.665   -12.651 1.00 62.44  ? 101 SER A N   1 
ATOM 335  C CA  . SER A 1 60 ? -80.689  1.241   -11.963 1.00 68.33  ? 101 SER A CA  1 
ATOM 336  C C   . SER A 1 60 ? -81.906  2.119   -12.182 1.00 74.50  ? 101 SER A C   1 
ATOM 337  O O   . SER A 1 60 ? -83.013  1.599   -12.310 1.00 75.59  ? 101 SER A O   1 
ATOM 338  C CB  . SER A 1 60 ? -80.398  1.096   -10.483 1.00 66.16  ? 101 SER A CB  1 
ATOM 339  O OG  . SER A 1 60 ? -79.535  -0.012  -10.305 1.00 65.83  ? 101 SER A OG  1 
ATOM 340  N N   . ARG A 1 61 ? -81.721  3.436   -12.230 1.00 81.66  ? 102 ARG A N   1 
ATOM 341  C CA  . ARG A 1 61 ? -82.853  4.332   -12.442 1.00 88.43  ? 102 ARG A CA  1 
ATOM 342  C C   . ARG A 1 61 ? -83.264  4.317   -13.910 1.00 87.62  ? 102 ARG A C   1 
ATOM 343  O O   . ARG A 1 61 ? -84.448  4.455   -14.238 1.00 89.67  ? 102 ARG A O   1 
ATOM 344  C CB  . ARG A 1 61 ? -82.501  5.745   -11.997 1.00 96.19  ? 102 ARG A CB  1 
ATOM 345  C CG  . ARG A 1 61 ? -82.100  5.797   -10.551 1.00 103.57 ? 102 ARG A CG  1 
ATOM 346  C CD  . ARG A 1 61 ? -82.657  7.009   -9.839  1.00 107.76 ? 102 ARG A CD  1 
ATOM 347  N NE  . ARG A 1 61 ? -82.579  6.813   -8.394  1.00 111.27 ? 102 ARG A NE  1 
ATOM 348  C CZ  . ARG A 1 61 ? -83.040  7.668   -7.490  1.00 112.03 ? 102 ARG A CZ  1 
ATOM 349  N NH1 . ARG A 1 61 ? -83.623  8.799   -7.872  1.00 112.33 ? 102 ARG A NH1 1 
ATOM 350  N NH2 . ARG A 1 61 ? -82.918  7.387   -6.199  1.00 112.98 ? 102 ARG A NH2 1 
ATOM 351  N N   . GLN A 1 62 ? -82.288  4.154   -14.802 1.00 85.44  ? 103 GLN A N   1 
ATOM 352  C CA  . GLN A 1 62 ? -82.615  4.083   -16.215 1.00 79.96  ? 103 GLN A CA  1 
ATOM 353  C C   . GLN A 1 62 ? -83.446  2.821   -16.349 1.00 76.88  ? 103 GLN A C   1 
ATOM 354  O O   . GLN A 1 62 ? -84.678  2.896   -16.461 1.00 71.80  ? 103 GLN A O   1 
ATOM 355  C CB  . GLN A 1 62 ? -81.359  3.968   -17.078 1.00 78.52  ? 103 GLN A CB  1 
ATOM 356  C CG  . GLN A 1 62 ? -80.583  5.261   -17.218 1.00 84.77  ? 103 GLN A CG  1 
ATOM 357  C CD  . GLN A 1 62 ? -79.222  5.072   -17.889 1.00 87.99  ? 103 GLN A CD  1 
ATOM 358  O OE1 . GLN A 1 62 ? -78.397  5.991   -17.924 1.00 89.76  ? 103 GLN A OE1 1 
ATOM 359  N NE2 . GLN A 1 62 ? -78.983  3.880   -18.423 1.00 89.45  ? 103 GLN A NE2 1 
ATOM 360  N N   . HIS A 1 63 ? -82.771  1.670   -16.288 1.00 74.45  ? 104 HIS A N   1 
ATOM 361  C CA  . HIS A 1 63 ? -83.442  0.386   -16.427 1.00 74.95  ? 104 HIS A CA  1 
ATOM 362  C C   . HIS A 1 63 ? -84.842  0.430   -15.856 1.00 74.62  ? 104 HIS A C   1 
ATOM 363  O O   . HIS A 1 63 ? -85.809  0.052   -16.512 1.00 75.94  ? 104 HIS A O   1 
ATOM 364  C CB  . HIS A 1 63 ? -82.652  -0.724  -15.748 1.00 76.54  ? 104 HIS A CB  1 
ATOM 365  C CG  . HIS A 1 63 ? -81.433  -1.146  -16.506 1.00 82.31  ? 104 HIS A CG  1 
ATOM 366  N ND1 . HIS A 1 63 ? -80.649  -2.214  -16.119 1.00 85.85  ? 104 HIS A ND1 1 
ATOM 367  C CD2 . HIS A 1 63 ? -80.844  -0.630  -17.612 1.00 83.42  ? 104 HIS A CD2 1 
ATOM 368  C CE1 . HIS A 1 63 ? -79.628  -2.336  -16.953 1.00 85.31  ? 104 HIS A CE1 1 
ATOM 369  N NE2 . HIS A 1 63 ? -79.723  -1.386  -17.867 1.00 83.47  ? 104 HIS A NE2 1 
ATOM 370  N N   . GLU A 1 64 ? -84.955  0.923   -14.637 1.00 75.23  ? 105 GLU A N   1 
ATOM 371  C CA  . GLU A 1 64 ? -86.242  1.001   -13.977 1.00 76.25  ? 105 GLU A CA  1 
ATOM 372  C C   . GLU A 1 64 ? -87.253  1.810   -14.801 1.00 80.80  ? 105 GLU A C   1 
ATOM 373  O O   . GLU A 1 64 ? -88.272  1.264   -15.241 1.00 78.47  ? 105 GLU A O   1 
ATOM 374  C CB  . GLU A 1 64 ? -86.053  1.615   -12.597 1.00 72.99  ? 105 GLU A CB  1 
ATOM 375  C CG  . GLU A 1 64 ? -87.142  1.288   -11.633 1.00 75.56  ? 105 GLU A CG  1 
ATOM 376  C CD  . GLU A 1 64 ? -86.999  2.038   -10.315 1.00 78.29  ? 105 GLU A CD  1 
ATOM 377  O OE1 . GLU A 1 64 ? -87.102  3.298   -10.330 1.00 77.03  ? 105 GLU A OE1 1 
ATOM 378  O OE2 . GLU A 1 64 ? -86.784  1.358   -9.272  1.00 78.53  ? 105 GLU A OE2 1 
ATOM 379  N N   . ALA A 1 65 ? -86.961  3.095   -15.024 1.00 87.83  ? 106 ALA A N   1 
ATOM 380  C CA  . ALA A 1 65 ? -87.852  3.986   -15.780 1.00 94.69  ? 106 ALA A CA  1 
ATOM 381  C C   . ALA A 1 65 ? -88.380  3.299   -17.019 1.00 96.18  ? 106 ALA A C   1 
ATOM 382  O O   . ALA A 1 65 ? -89.568  3.366   -17.326 1.00 94.32  ? 106 ALA A O   1 
ATOM 383  C CB  . ALA A 1 65 ? -87.119  5.256   -16.174 1.00 104.02 ? 106 ALA A CB  1 
ATOM 384  N N   . GLN A 1 66 ? -87.476  2.640   -17.732 1.00 95.58  ? 107 GLN A N   1 
ATOM 385  C CA  . GLN A 1 66 ? -87.846  1.923   -18.931 1.00 95.23  ? 107 GLN A CA  1 
ATOM 386  C C   . GLN A 1 66 ? -88.883  0.887   -18.542 1.00 90.07  ? 107 GLN A C   1 
ATOM 387  O O   . GLN A 1 66 ? -90.014  0.926   -19.016 1.00 89.50  ? 107 GLN A O   1 
ATOM 388  C CB  . GLN A 1 66 ? -86.624  1.245   -19.533 1.00 101.84 ? 107 GLN A CB  1 
ATOM 389  C CG  . GLN A 1 66 ? -85.478  2.204   -19.771 1.00 111.63 ? 107 GLN A CG  1 
ATOM 390  C CD  . GLN A 1 66 ? -84.350  1.571   -20.553 1.00 116.22 ? 107 GLN A CD  1 
ATOM 391  O OE1 . GLN A 1 66 ? -83.790  0.550   -20.151 1.00 117.64 ? 107 GLN A OE1 1 
ATOM 392  N NE2 . GLN A 1 66 ? -84.009  2.175   -21.685 1.00 118.45 ? 107 GLN A NE2 1 
ATOM 393  N N   . LEU A 1 67 ? -88.500  -0.033  -17.664 1.00 84.74  ? 108 LEU A N   1 
ATOM 394  C CA  . LEU A 1 67 ? -89.416  -1.066  -17.219 1.00 79.23  ? 108 LEU A CA  1 
ATOM 395  C C   . LEU A 1 67 ? -90.737  -0.475  -16.781 1.00 80.10  ? 108 LEU A C   1 
ATOM 396  O O   . LEU A 1 67 ? -91.773  -1.128  -16.857 1.00 75.21  ? 108 LEU A O   1 
ATOM 397  C CB  . LEU A 1 67 ? -88.801  -1.857  -16.081 1.00 76.09  ? 108 LEU A CB  1 
ATOM 398  C CG  . LEU A 1 67 ? -88.376  -3.215  -16.621 1.00 77.33  ? 108 LEU A CG  1 
ATOM 399  C CD1 . LEU A 1 67 ? -87.555  -3.971  -15.589 1.00 76.89  ? 108 LEU A CD1 1 
ATOM 400  C CD2 . LEU A 1 67 ? -89.629  -3.984  -17.011 1.00 76.83  ? 108 LEU A CD2 1 
ATOM 401  N N   . HIS A 1 68 ? -90.698  0.765   -16.315 1.00 85.43  ? 109 HIS A N   1 
ATOM 402  C CA  . HIS A 1 68 ? -91.916  1.431   -15.892 1.00 94.17  ? 109 HIS A CA  1 
ATOM 403  C C   . HIS A 1 68 ? -92.605  1.975   -17.133 1.00 97.43  ? 109 HIS A C   1 
ATOM 404  O O   . HIS A 1 68 ? -93.832  1.886   -17.262 1.00 92.50  ? 109 HIS A O   1 
ATOM 405  C CB  . HIS A 1 68 ? -91.601  2.556   -14.909 1.00 101.88 ? 109 HIS A CB  1 
ATOM 406  C CG  . HIS A 1 68 ? -91.975  2.236   -13.495 1.00 112.81 ? 109 HIS A CG  1 
ATOM 407  N ND1 . HIS A 1 68 ? -91.531  1.102   -12.848 1.00 116.85 ? 109 HIS A ND1 1 
ATOM 408  C CD2 . HIS A 1 68 ? -92.766  2.889   -12.612 1.00 116.71 ? 109 HIS A CD2 1 
ATOM 409  C CE1 . HIS A 1 68 ? -92.034  1.070   -11.628 1.00 118.51 ? 109 HIS A CE1 1 
ATOM 410  N NE2 . HIS A 1 68 ? -92.787  2.142   -11.460 1.00 118.37 ? 109 HIS A NE2 1 
ATOM 411  N N   . GLU A 1 69 ? -91.805  2.528   -18.045 1.00 103.46 ? 110 GLU A N   1 
ATOM 412  C CA  . GLU A 1 69 ? -92.308  3.060   -19.312 1.00 111.70 ? 110 GLU A CA  1 
ATOM 413  C C   . GLU A 1 69 ? -93.163  1.952   -19.913 1.00 104.88 ? 110 GLU A C   1 
ATOM 414  O O   . GLU A 1 69 ? -94.337  2.154   -20.227 1.00 105.47 ? 110 GLU A O   1 
ATOM 415  C CB  . GLU A 1 69 ? -91.142  3.371   -20.256 1.00 130.55 ? 110 GLU A CB  1 
ATOM 416  C CG  . GLU A 1 69 ? -91.550  3.818   -21.656 1.00 153.32 ? 110 GLU A CG  1 
ATOM 417  C CD  . GLU A 1 69 ? -90.430  3.654   -22.679 1.00 163.22 ? 110 GLU A CD  1 
ATOM 418  O OE1 . GLU A 1 69 ? -90.614  4.067   -23.845 1.00 167.03 ? 110 GLU A OE1 1 
ATOM 419  O OE2 . GLU A 1 69 ? -89.365  3.106   -22.322 1.00 167.19 ? 110 GLU A OE2 1 
ATOM 420  N N   . HIS A 1 70 ? -92.555  0.777   -20.057 1.00 96.56  ? 111 HIS A N   1 
ATOM 421  C CA  . HIS A 1 70 ? -93.237  -0.388  -20.593 1.00 85.70  ? 111 HIS A CA  1 
ATOM 422  C C   . HIS A 1 70 ? -94.579  -0.489  -19.907 1.00 83.53  ? 111 HIS A C   1 
ATOM 423  O O   . HIS A 1 70 ? -95.608  -0.446  -20.561 1.00 80.40  ? 111 HIS A O   1 
ATOM 424  C CB  . HIS A 1 70 ? -92.411  -1.641  -20.335 1.00 83.02  ? 111 HIS A CB  1 
ATOM 425  C CG  . HIS A 1 70 ? -92.989  -2.891  -20.925 1.00 85.26  ? 111 HIS A CG  1 
ATOM 426  N ND1 . HIS A 1 70 ? -94.175  -3.444  -20.490 1.00 86.13  ? 111 HIS A ND1 1 
ATOM 427  C CD2 . HIS A 1 70 ? -92.512  -3.730  -21.878 1.00 86.90  ? 111 HIS A CD2 1 
ATOM 428  C CE1 . HIS A 1 70 ? -94.401  -4.571  -21.145 1.00 86.12  ? 111 HIS A CE1 1 
ATOM 429  N NE2 . HIS A 1 70 ? -93.406  -4.768  -21.991 1.00 86.13  ? 111 HIS A NE2 1 
ATOM 430  N N   . ILE A 1 71 ? -94.582  -0.592  -18.587 1.00 85.11  ? 112 ILE A N   1 
ATOM 431  C CA  . ILE A 1 71 ? -95.842  -0.683  -17.867 1.00 91.42  ? 112 ILE A CA  1 
ATOM 432  C C   . ILE A 1 71 ? -96.824  0.433   -18.234 1.00 95.09  ? 112 ILE A C   1 
ATOM 433  O O   . ILE A 1 71 ? -98.035  0.204   -18.293 1.00 89.01  ? 112 ILE A O   1 
ATOM 434  C CB  . ILE A 1 71 ? -95.619  -0.667  -16.329 1.00 96.16  ? 112 ILE A CB  1 
ATOM 435  C CG1 . ILE A 1 71 ? -95.072  -2.021  -15.890 1.00 101.36 ? 112 ILE A CG1 1 
ATOM 436  C CG2 . ILE A 1 71 ? -96.928  -0.315  -15.585 1.00 101.05 ? 112 ILE A CG2 1 
ATOM 437  C CD1 . ILE A 1 71 ? -95.402  -2.392  -14.470 1.00 106.15 ? 112 ILE A CD1 1 
ATOM 438  N N   . LYS A 1 72 ? -96.313  1.633   -18.482 1.00 102.67 ? 113 LYS A N   1 
ATOM 439  C CA  . LYS A 1 72 ? -97.183  2.755   -18.816 1.00 115.47 ? 113 LYS A CA  1 
ATOM 440  C C   . LYS A 1 72 ? -97.881  2.554   -20.163 1.00 119.05 ? 113 LYS A C   1 
ATOM 441  O O   . LYS A 1 72 ? -99.087  2.769   -20.286 1.00 118.55 ? 113 LYS A O   1 
ATOM 442  C CB  . LYS A 1 72 ? -96.378  4.062   -18.822 1.00 122.93 ? 113 LYS A CB  1 
ATOM 443  C CG  . LYS A 1 72 ? -97.203  5.311   -18.516 1.00 132.78 ? 113 LYS A CG  1 
ATOM 444  C CD  . LYS A 1 72 ? -96.322  6.522   -18.190 1.00 135.69 ? 113 LYS A CD  1 
ATOM 445  C CE  . LYS A 1 72 ? -95.689  7.142   -19.432 1.00 135.75 ? 113 LYS A CE  1 
ATOM 446  N NZ  . LYS A 1 72 ? -96.698  7.795   -20.325 1.00 135.68 ? 113 LYS A NZ  1 
ATOM 447  N N   . GLN A 1 73 ? -97.124  2.120   -21.166 1.00 122.35 ? 114 GLN A N   1 
ATOM 448  C CA  . GLN A 1 73 ? -97.669  1.904   -22.503 1.00 123.06 ? 114 GLN A CA  1 
ATOM 449  C C   . GLN A 1 73 ? -98.485  0.622   -22.652 1.00 116.42 ? 114 GLN A C   1 
ATOM 450  O O   . GLN A 1 73 ? -99.421  0.567   -23.451 1.00 114.52 ? 114 GLN A O   1 
ATOM 451  C CB  . GLN A 1 73 ? -96.533  1.920   -23.518 1.00 132.98 ? 114 GLN A CB  1 
ATOM 452  C CG  . GLN A 1 73 ? -95.862  3.271   -23.612 1.00 146.09 ? 114 GLN A CG  1 
ATOM 453  C CD  . GLN A 1 73 ? -94.423  3.175   -24.059 1.00 150.70 ? 114 GLN A CD  1 
ATOM 454  O OE1 . GLN A 1 73 ? -93.745  4.189   -24.242 1.00 150.83 ? 114 GLN A OE1 1 
ATOM 455  N NE2 . GLN A 1 73 ? -93.940  1.951   -24.230 1.00 150.59 ? 114 GLN A NE2 1 
ATOM 456  N N   . GLN A 1 74 ? -98.138  -0.411  -21.891 1.00 110.40 ? 115 GLN A N   1 
ATOM 457  C CA  . GLN A 1 74 ? -98.876  -1.664  -21.971 1.00 103.37 ? 115 GLN A CA  1 
ATOM 458  C C   . GLN A 1 74 ? -100.242 -1.404  -21.353 1.00 105.81 ? 115 GLN A C   1 
ATOM 459  O O   . GLN A 1 74 ? -101.107 -2.280  -21.324 1.00 99.34  ? 115 GLN A O   1 
ATOM 460  C CB  . GLN A 1 74 ? -98.145  -2.777  -21.212 1.00 95.64  ? 115 GLN A CB  1 
ATOM 461  C CG  . GLN A 1 74 ? -98.569  -4.179  -21.621 1.00 93.35  ? 115 GLN A CG  1 
ATOM 462  C CD  . GLN A 1 74 ? -99.375  -4.896  -20.555 1.00 92.39  ? 115 GLN A CD  1 
ATOM 463  O OE1 . GLN A 1 74 ? -100.329 -4.350  -20.001 1.00 90.59  ? 115 GLN A OE1 1 
ATOM 464  N NE2 . GLN A 1 74 ? -98.997  -6.137  -20.268 1.00 90.62  ? 115 GLN A NE2 1 
ATOM 465  N N   . GLN A 1 75 ? -100.427 -0.187  -20.849 1.00 112.11 ? 116 GLN A N   1 
ATOM 466  C CA  . GLN A 1 75 ? -101.691 0.198   -20.240 1.00 123.98 ? 116 GLN A CA  1 
ATOM 467  C C   . GLN A 1 75 ? -102.656 0.519   -21.357 1.00 126.43 ? 116 GLN A C   1 
ATOM 468  O O   . GLN A 1 75 ? -103.695 -0.129  -21.514 1.00 122.98 ? 116 GLN A O   1 
ATOM 469  C CB  . GLN A 1 75 ? -101.515 1.444   -19.377 1.00 135.06 ? 116 GLN A CB  1 
ATOM 470  C CG  . GLN A 1 75 ? -102.832 2.119   -19.017 1.00 149.04 ? 116 GLN A CG  1 
ATOM 471  C CD  . GLN A 1 75 ? -102.663 3.595   -18.706 1.00 154.31 ? 116 GLN A CD  1 
ATOM 472  O OE1 . GLN A 1 75 ? -101.962 3.966   -17.766 1.00 155.40 ? 116 GLN A OE1 1 
ATOM 473  N NE2 . GLN A 1 75 ? -103.303 4.447   -19.503 1.00 154.59 ? 116 GLN A NE2 1 
ATOM 474  N N   . GLU A 1 76 ? -102.285 1.541   -22.126 1.00 132.06 ? 117 GLU A N   1 
ATOM 475  C CA  . GLU A 1 76 ? -103.066 2.024   -23.258 1.00 135.74 ? 117 GLU A CA  1 
ATOM 476  C C   . GLU A 1 76 ? -103.425 0.893   -24.218 1.00 127.38 ? 117 GLU A C   1 
ATOM 477  O O   . GLU A 1 76 ? -104.566 0.806   -24.670 1.00 120.27 ? 117 GLU A O   1 
ATOM 478  C CB  . GLU A 1 76 ? -102.279 3.113   -23.981 1.00 151.03 ? 117 GLU A CB  1 
ATOM 479  C CG  . GLU A 1 76 ? -101.853 4.243   -23.058 1.00 177.09 ? 117 GLU A CG  1 
ATOM 480  C CD  . GLU A 1 76 ? -100.902 5.216   -23.721 1.00 188.77 ? 117 GLU A CD  1 
ATOM 481  O OE1 . GLU A 1 76 ? -101.279 5.810   -24.755 1.00 192.69 ? 117 GLU A OE1 1 
ATOM 482  O OE2 . GLU A 1 76 ? -99.776  5.388   -23.207 1.00 192.23 ? 117 GLU A OE2 1 
ATOM 483  N N   . MET A 1 77 ? -102.458 0.032   -24.531 1.00 119.74 ? 118 MET A N   1 
ATOM 484  C CA  . MET A 1 77 ? -102.719 -1.097  -25.419 1.00 115.74 ? 118 MET A CA  1 
ATOM 485  C C   . MET A 1 77 ? -103.961 -1.819  -24.899 1.00 115.71 ? 118 MET A C   1 
ATOM 486  O O   . MET A 1 77 ? -105.038 -1.694  -25.479 1.00 120.26 ? 118 MET A O   1 
ATOM 487  C CB  . MET A 1 77 ? -101.521 -2.061  -25.450 1.00 111.11 ? 118 MET A CB  1 
ATOM 488  C CG  . MET A 1 77 ? -101.740 -3.358  -26.255 1.00 103.77 ? 118 MET A CG  1 
ATOM 489  S SD  . MET A 1 77 ? -102.934 -4.552  -25.531 1.00 100.93 ? 118 MET A SD  1 
ATOM 490  C CE  . MET A 1 77 ? -101.996 -6.075  -25.495 1.00 97.12  ? 118 MET A CE  1 
ATOM 491  N N   . LEU A 1 78 ? -103.820 -2.556  -23.799 1.00 114.75 ? 119 LEU A N   1 
ATOM 492  C CA  . LEU A 1 78 ? -104.956 -3.280  -23.245 1.00 110.87 ? 119 LEU A CA  1 
ATOM 493  C C   . LEU A 1 78 ? -106.113 -2.344  -22.990 1.00 113.37 ? 119 LEU A C   1 
ATOM 494  O O   . LEU A 1 78 ? -107.268 -2.774  -22.906 1.00 114.59 ? 119 LEU A O   1 
ATOM 495  C CB  . LEU A 1 78 ? -104.591 -3.993  -21.947 1.00 100.61 ? 119 LEU A CB  1 
ATOM 496  C CG  . LEU A 1 78 ? -103.953 -5.373  -22.088 1.00 92.51  ? 119 LEU A CG  1 
ATOM 497  C CD1 . LEU A 1 78 ? -104.149 -6.139  -20.770 1.00 88.80  ? 119 LEU A CD1 1 
ATOM 498  C CD2 . LEU A 1 78 ? -104.596 -6.135  -23.245 1.00 88.84  ? 119 LEU A CD2 1 
ATOM 499  N N   . ALA A 1 79 ? -105.805 -1.060  -22.861 1.00 113.40 ? 120 ALA A N   1 
ATOM 500  C CA  . ALA A 1 79 ? -106.848 -0.078  -22.638 1.00 118.04 ? 120 ALA A CA  1 
ATOM 501  C C   . ALA A 1 79 ? -107.683 -0.007  -23.912 1.00 124.70 ? 120 ALA A C   1 
ATOM 502  O O   . ALA A 1 79 ? -108.810 -0.511  -23.966 1.00 126.94 ? 120 ALA A O   1 
ATOM 503  C CB  . ALA A 1 79 ? -106.238 1.287   -22.331 1.00 110.34 ? 120 ALA A CB  1 
ATOM 504  N N   . MET A 1 80 ? -107.091 0.594   -24.943 1.00 134.38 ? 121 MET A N   1 
ATOM 505  C CA  . MET A 1 80 ? -107.732 0.788   -26.238 1.00 139.88 ? 121 MET A CA  1 
ATOM 506  C C   . MET A 1 80 ? -108.208 -0.488  -26.925 1.00 134.20 ? 121 MET A C   1 
ATOM 507  O O   . MET A 1 80 ? -109.107 -0.436  -27.755 1.00 128.49 ? 121 MET A O   1 
ATOM 508  C CB  . MET A 1 80 ? -106.785 1.558   -27.156 1.00 155.06 ? 121 MET A CB  1 
ATOM 509  C CG  . MET A 1 80 ? -107.476 2.304   -28.272 1.00 177.30 ? 121 MET A CG  1 
ATOM 510  S SD  . MET A 1 80 ? -106.372 3.502   -29.037 1.00 189.19 ? 121 MET A SD  1 
ATOM 511  C CE  . MET A 1 80 ? -106.504 4.858   -27.873 1.00 193.51 ? 121 MET A CE  1 
ATOM 512  N N   . LYS A 1 81 ? -107.615 -1.632  -26.593 1.00 130.78 ? 122 LYS A N   1 
ATOM 513  C CA  . LYS A 1 81 ? -108.051 -2.876  -27.209 1.00 130.36 ? 122 LYS A CA  1 
ATOM 514  C C   . LYS A 1 81 ? -109.411 -3.224  -26.632 1.00 133.62 ? 122 LYS A C   1 
ATOM 515  O O   . LYS A 1 81 ? -110.080 -4.128  -27.127 1.00 129.37 ? 122 LYS A O   1 
ATOM 516  C CB  . LYS A 1 81 ? -107.069 -4.023  -26.939 1.00 128.20 ? 122 LYS A CB  1 
ATOM 517  C CG  . LYS A 1 81 ? -107.302 -4.807  -25.637 1.00 130.40 ? 122 LYS A CG  1 
ATOM 518  C CD  . LYS A 1 81 ? -108.419 -5.858  -25.739 1.00 130.76 ? 122 LYS A CD  1 
ATOM 519  C CE  . LYS A 1 81 ? -108.105 -6.959  -26.751 1.00 130.27 ? 122 LYS A CE  1 
ATOM 520  N NZ  . LYS A 1 81 ? -107.014 -7.880  -26.320 1.00 130.57 ? 122 LYS A NZ  1 
ATOM 521  N N   . HIS A 1 82 ? -109.820 -2.520  -25.578 1.00 141.68 ? 123 HIS A N   1 
ATOM 522  C CA  . HIS A 1 82 ? -111.123 -2.788  -24.975 1.00 154.14 ? 123 HIS A CA  1 
ATOM 523  C C   . HIS A 1 82 ? -111.913 -1.529  -24.618 1.00 161.91 ? 123 HIS A C   1 
ATOM 524  O O   . HIS A 1 82 ? -113.123 -1.599  -24.401 1.00 162.10 ? 123 HIS A O   1 
ATOM 525  C CB  . HIS A 1 82 ? -110.975 -3.666  -23.729 1.00 156.89 ? 123 HIS A CB  1 
ATOM 526  C CG  . HIS A 1 82 ? -112.077 -4.671  -23.567 1.00 161.25 ? 123 HIS A CG  1 
ATOM 527  N ND1 . HIS A 1 82 ? -112.061 -5.900  -24.192 1.00 163.62 ? 123 HIS A ND1 1 
ATOM 528  C CD2 . HIS A 1 82 ? -113.241 -4.617  -22.876 1.00 163.24 ? 123 HIS A CD2 1 
ATOM 529  C CE1 . HIS A 1 82 ? -113.166 -6.560  -23.891 1.00 165.27 ? 123 HIS A CE1 1 
ATOM 530  N NE2 . HIS A 1 82 ? -113.898 -5.804  -23.095 1.00 165.15 ? 123 HIS A NE2 1 
ATOM 531  N N   . GLN A 1 83 ? -111.235 -0.385  -24.553 1.00 171.52 ? 124 GLN A N   1 
ATOM 532  C CA  . GLN A 1 83 ? -111.900 0.878   -24.232 1.00 182.97 ? 124 GLN A CA  1 
ATOM 533  C C   . GLN A 1 83 ? -112.575 1.388   -25.500 1.00 186.16 ? 124 GLN A C   1 
ATOM 534  O O   . GLN A 1 83 ? -113.664 1.964   -25.454 1.00 189.13 ? 124 GLN A O   1 
ATOM 535  C CB  . GLN A 1 83 ? -110.886 1.917   -23.732 1.00 187.74 ? 124 GLN A CB  1 
ATOM 536  C CG  . GLN A 1 83 ? -110.048 2.577   -24.829 1.00 190.80 ? 124 GLN A CG  1 
ATOM 537  C CD  . GLN A 1 83 ? -108.995 3.529   -24.281 1.00 191.99 ? 124 GLN A CD  1 
ATOM 538  O OE1 . GLN A 1 83 ? -109.295 4.401   -23.466 1.00 192.60 ? 124 GLN A OE1 1 
ATOM 539  N NE2 . GLN A 1 83 ? -107.755 3.369   -24.734 1.00 192.21 ? 124 GLN A NE2 1 
ATOM 540  N N   . GLN A 1 84 ? -111.905 1.168   -26.629 1.00 186.22 ? 125 GLN A N   1 
ATOM 541  C CA  . GLN A 1 84 ? -112.403 1.573   -27.939 1.00 184.20 ? 125 GLN A CA  1 
ATOM 542  C C   . GLN A 1 84 ? -113.176 0.401   -28.522 1.00 184.20 ? 125 GLN A C   1 
ATOM 543  O O   . GLN A 1 84 ? -114.031 0.575   -29.389 1.00 189.96 ? 125 GLN A O   1 
ATOM 544  C CB  . GLN A 1 84 ? -111.239 1.920   -28.868 1.00 180.27 ? 125 GLN A CB  1 
ATOM 545  C CG  . GLN A 1 84 ? -111.660 2.343   -30.266 1.00 169.11 ? 125 GLN A CG  1 
ATOM 546  C CD  . GLN A 1 84 ? -110.502 2.337   -31.247 1.00 163.61 ? 125 GLN A CD  1 
ATOM 547  O OE1 . GLN A 1 84 ? -109.949 1.284   -31.567 1.00 160.77 ? 125 GLN A OE1 1 
ATOM 548  N NE2 . GLN A 1 84 ? -110.127 3.516   -31.726 1.00 160.73 ? 125 GLN A NE2 1 
ATOM 549  N N   . GLU A 1 85 ? -112.854 -0.795  -28.037 1.00 181.72 ? 126 GLU A N   1 
ATOM 550  C CA  . GLU A 1 85 ? -113.509 -2.014  -28.486 1.00 175.18 ? 126 GLU A CA  1 
ATOM 551  C C   . GLU A 1 85 ? -114.888 -2.115  -27.834 1.00 176.48 ? 126 GLU A C   1 
ATOM 552  O O   . GLU A 1 85 ? -115.620 -3.083  -28.038 1.00 177.16 ? 126 GLU A O   1 
ATOM 553  C CB  . GLU A 1 85 ? -112.644 -3.225  -28.133 1.00 164.70 ? 126 GLU A CB  1 
ATOM 554  C CG  . GLU A 1 85 ? -113.151 -4.549  -28.668 1.00 151.21 ? 126 GLU A CG  1 
ATOM 555  C CD  . GLU A 1 85 ? -113.803 -5.400  -27.593 1.00 145.56 ? 126 GLU A CD  1 
ATOM 556  O OE1 . GLU A 1 85 ? -114.820 -4.963  -27.012 1.00 142.99 ? 126 GLU A OE1 1 
ATOM 557  O OE2 . GLU A 1 85 ? -113.294 -6.510  -27.325 1.00 142.51 ? 126 GLU A OE2 1 
ATOM 558  N N   . LEU A 1 86 ? -115.238 -1.100  -27.047 1.00 175.24 ? 127 LEU A N   1 
ATOM 559  C CA  . LEU A 1 86 ? -116.544 -1.051  -26.396 1.00 176.06 ? 127 LEU A CA  1 
ATOM 560  C C   . LEU A 1 86 ? -117.490 -0.434  -27.428 1.00 184.14 ? 127 LEU A C   1 
ATOM 561  O O   . LEU A 1 86 ? -118.672 -0.779  -27.495 1.00 192.76 ? 127 LEU A O   1 
ATOM 562  C CB  . LEU A 1 86 ? -116.494 -0.175  -25.136 1.00 159.68 ? 127 LEU A CB  1 
ATOM 563  C CG  . LEU A 1 86 ? -117.683 -0.252  -24.167 1.00 139.81 ? 127 LEU A CG  1 
ATOM 564  C CD1 . LEU A 1 86 ? -117.791 -1.666  -23.584 1.00 127.47 ? 127 LEU A CD1 1 
ATOM 565  C CD2 . LEU A 1 86 ? -117.509 0.769   -23.050 1.00 127.22 ? 127 LEU A CD2 1 
ATOM 566  N N   . LEU A 1 87 ? -116.949 0.480   -28.235 1.00 188.72 ? 128 LEU A N   1 
ATOM 567  C CA  . LEU A 1 87 ? -117.717 1.141   -29.290 1.00 188.52 ? 128 LEU A CA  1 
ATOM 568  C C   . LEU A 1 87 ? -117.788 0.193   -30.487 1.00 192.05 ? 128 LEU A C   1 
ATOM 569  O O   . LEU A 1 87 ? -118.548 0.422   -31.430 1.00 195.45 ? 128 LEU A O   1 
ATOM 570  C CB  . LEU A 1 87 ? -117.044 2.456   -29.722 1.00 178.22 ? 128 LEU A CB  1 
ATOM 571  C CG  . LEU A 1 87 ? -116.720 3.520   -28.665 1.00 166.59 ? 128 LEU A CG  1 
ATOM 572  C CD1 . LEU A 1 87 ? -115.487 3.099   -27.877 1.00 157.85 ? 128 LEU A CD1 1 
ATOM 573  C CD2 . LEU A 1 87 ? -116.474 4.862   -29.343 1.00 158.64 ? 128 LEU A CD2 1 
ATOM 574  N N   . GLU A 1 88 ? -116.982 -0.868  -30.431 1.00 193.14 ? 129 GLU A N   1 
ATOM 575  C CA  . GLU A 1 88 ? -116.910 -1.885  -31.481 1.00 191.83 ? 129 GLU A CA  1 
ATOM 576  C C   . GLU A 1 88 ? -117.741 -3.113  -31.101 1.00 190.22 ? 129 GLU A C   1 
ATOM 577  O O   . GLU A 1 88 ? -118.384 -3.088  -30.030 1.00 190.55 ? 129 GLU A O   1 
ATOM 578  C CB  . GLU A 1 88 ? -115.450 -2.311  -31.711 1.00 193.81 ? 129 GLU A CB  1 
ATOM 579  C CG  . GLU A 1 88 ? -114.530 -1.213  -32.255 1.00 193.99 ? 129 GLU A CG  1 
ATOM 580  C CD  . GLU A 1 88 ? -113.049 -1.574  -32.171 1.00 194.23 ? 129 GLU A CD  1 
ATOM 581  O OE1 . GLU A 1 88 ? -112.218 -0.810  -32.709 1.00 194.63 ? 129 GLU A OE1 1 
ATOM 582  O OE2 . GLU A 1 88 ? -112.715 -2.615  -31.561 1.00 194.83 ? 129 GLU A OE2 1 
ATOM 583  N N   . ALA B 1 21 ? -24.591  -20.915 1.100   1.00 133.70 ? 62  ALA B N   1 
ATOM 584  C CA  . ALA B 1 21 ? -24.844  -19.524 1.577   1.00 135.49 ? 62  ALA B CA  1 
ATOM 585  C C   . ALA B 1 21 ? -25.917  -19.527 2.661   1.00 135.58 ? 62  ALA B C   1 
ATOM 586  O O   . ALA B 1 21 ? -26.303  -20.586 3.156   1.00 131.60 ? 62  ALA B O   1 
ATOM 587  C CB  . ALA B 1 21 ? -25.285  -18.647 0.409   1.00 140.91 ? 62  ALA B CB  1 
ATOM 588  N N   . GLU B 1 22 ? -26.383  -18.340 3.039   1.00 140.03 ? 63  GLU B N   1 
ATOM 589  C CA  . GLU B 1 22 ? -27.432  -18.221 4.046   1.00 143.75 ? 63  GLU B CA  1 
ATOM 590  C C   . GLU B 1 22 ? -28.228  -16.935 3.862   1.00 141.80 ? 63  GLU B C   1 
ATOM 591  O O   . GLU B 1 22 ? -29.422  -16.976 3.546   1.00 142.22 ? 63  GLU B O   1 
ATOM 592  C CB  . GLU B 1 22 ? -26.852  -18.277 5.460   1.00 146.55 ? 63  GLU B CB  1 
ATOM 593  C CG  . GLU B 1 22 ? -27.901  -18.026 6.528   1.00 155.85 ? 63  GLU B CG  1 
ATOM 594  C CD  . GLU B 1 22 ? -27.364  -18.199 7.925   1.00 161.51 ? 63  GLU B CD  1 
ATOM 595  O OE1 . GLU B 1 22 ? -26.849  -19.298 8.223   1.00 164.49 ? 63  GLU B OE1 1 
ATOM 596  O OE2 . GLU B 1 22 ? -27.462  -17.241 8.724   1.00 164.43 ? 63  GLU B OE2 1 
ATOM 597  N N   . PRO B 1 23 ? -27.588  -15.768 4.071   1.00 144.79 ? 64  PRO B N   1 
ATOM 598  C CA  . PRO B 1 23 ? -28.373  -14.547 3.882   1.00 147.91 ? 64  PRO B CA  1 
ATOM 599  C C   . PRO B 1 23 ? -28.922  -14.530 2.458   1.00 148.56 ? 64  PRO B C   1 
ATOM 600  O O   . PRO B 1 23 ? -30.114  -14.310 2.247   1.00 169.80 ? 64  PRO B O   1 
ATOM 601  C CB  . PRO B 1 23 ? -27.353  -13.439 4.140   1.00 152.12 ? 64  PRO B CB  1 
ATOM 602  C CG  . PRO B 1 23 ? -26.438  -14.069 5.162   1.00 144.60 ? 64  PRO B CG  1 
ATOM 603  C CD  . PRO B 1 23 ? -26.236  -15.449 4.568   1.00 147.94 ? 64  PRO B CD  1 
ATOM 604  N N   . ALA B 1 24 ? -28.044  -14.789 1.490   1.00 147.20 ? 65  ALA B N   1 
ATOM 605  C CA  . ALA B 1 24 ? -28.429  -14.821 0.082   1.00 127.61 ? 65  ALA B CA  1 
ATOM 606  C C   . ALA B 1 24 ? -29.543  -15.834 -0.103  1.00 115.12 ? 65  ALA B C   1 
ATOM 607  O O   . ALA B 1 24 ? -30.171  -15.893 -1.161  1.00 107.43 ? 65  ALA B O   1 
ATOM 608  C CB  . ALA B 1 24 ? -27.237  -15.192 -0.789  1.00 122.30 ? 65  ALA B CB  1 
ATOM 609  N N   . LEU B 1 25 ? -29.773  -16.639 0.931   1.00 103.38 ? 66  LEU B N   1 
ATOM 610  C CA  . LEU B 1 25 ? -30.829  -17.639 0.900   1.00 99.02  ? 66  LEU B CA  1 
ATOM 611  C C   . LEU B 1 25 ? -32.082  -17.047 1.533   1.00 101.12 ? 66  LEU B C   1 
ATOM 612  O O   . LEU B 1 25 ? -33.172  -17.124 0.960   1.00 102.31 ? 66  LEU B O   1 
ATOM 613  C CB  . LEU B 1 25 ? -30.403  -18.895 1.656   1.00 93.72  ? 66  LEU B CB  1 
ATOM 614  C CG  . LEU B 1 25 ? -29.990  -20.120 0.828   1.00 87.96  ? 66  LEU B CG  1 
ATOM 615  C CD1 . LEU B 1 25 ? -28.800  -19.816 -0.085  1.00 84.60  ? 66  LEU B CD1 1 
ATOM 616  C CD2 . LEU B 1 25 ? -29.656  -21.247 1.800   1.00 86.19  ? 66  LEU B CD2 1 
ATOM 617  N N   . ARG B 1 26 ? -31.922  -16.455 2.715   1.00 104.43 ? 67  ARG B N   1 
ATOM 618  C CA  . ARG B 1 26 ? -33.041  -15.822 3.413   1.00 106.58 ? 67  ARG B CA  1 
ATOM 619  C C   . ARG B 1 26 ? -33.604  -14.711 2.533   1.00 105.63 ? 67  ARG B C   1 
ATOM 620  O O   . ARG B 1 26 ? -34.796  -14.397 2.578   1.00 101.70 ? 67  ARG B O   1 
ATOM 621  C CB  . ARG B 1 26 ? -32.567  -15.240 4.742   1.00 111.12 ? 67  ARG B CB  1 
ATOM 622  C CG  . ARG B 1 26 ? -32.424  -16.277 5.830   1.00 118.96 ? 67  ARG B CG  1 
ATOM 623  C CD  . ARG B 1 26 ? -33.734  -16.469 6.575   1.00 123.32 ? 67  ARG B CD  1 
ATOM 624  N NE  . ARG B 1 26 ? -33.726  -17.653 7.432   1.00 125.72 ? 67  ARG B NE  1 
ATOM 625  C CZ  . ARG B 1 26 ? -32.703  -18.035 8.195   1.00 127.04 ? 67  ARG B CZ  1 
ATOM 626  N NH1 . ARG B 1 26 ? -31.573  -17.337 8.219   1.00 127.15 ? 67  ARG B NH1 1 
ATOM 627  N NH2 . ARG B 1 26 ? -32.817  -19.117 8.953   1.00 127.10 ? 67  ARG B NH2 1 
ATOM 628  N N   . GLU B 1 27 ? -32.719  -14.125 1.736   1.00 106.78 ? 68  GLU B N   1 
ATOM 629  C CA  . GLU B 1 27 ? -33.081  -13.064 0.816   1.00 108.99 ? 68  GLU B CA  1 
ATOM 630  C C   . GLU B 1 27 ? -34.017  -13.718 -0.176  1.00 103.55 ? 68  GLU B C   1 
ATOM 631  O O   . GLU B 1 27 ? -35.172  -13.321 -0.320  1.00 99.80  ? 68  GLU B O   1 
ATOM 632  C CB  . GLU B 1 27 ? -31.827  -12.558 0.103   1.00 120.96 ? 68  GLU B CB  1 
ATOM 633  C CG  . GLU B 1 27 ? -31.970  -11.231 -0.614  1.00 140.11 ? 68  GLU B CG  1 
ATOM 634  C CD  . GLU B 1 27 ? -30.621  -10.636 -0.983  1.00 149.72 ? 68  GLU B CD  1 
ATOM 635  O OE1 . GLU B 1 27 ? -29.984  -11.127 -1.940  1.00 153.88 ? 68  GLU B OE1 1 
ATOM 636  O OE2 . GLU B 1 27 ? -30.191  -9.682  -0.300  1.00 154.46 ? 68  GLU B OE2 1 
ATOM 637  N N   . GLN B 1 28 ? -33.500  -14.751 -0.830  1.00 99.55  ? 69  GLN B N   1 
ATOM 638  C CA  . GLN B 1 28 ? -34.239  -15.512 -1.829  1.00 96.73  ? 69  GLN B CA  1 
ATOM 639  C C   . GLN B 1 28 ? -35.570  -16.020 -1.271  1.00 91.20  ? 69  GLN B C   1 
ATOM 640  O O   . GLN B 1 28 ? -36.553  -16.152 -2.011  1.00 87.18  ? 69  GLN B O   1 
ATOM 641  C CB  . GLN B 1 28 ? -33.382  -16.689 -2.310  1.00 103.79 ? 69  GLN B CB  1 
ATOM 642  C CG  . GLN B 1 28 ? -33.879  -17.367 -3.583  1.00 115.83 ? 69  GLN B CG  1 
ATOM 643  C CD  . GLN B 1 28 ? -33.051  -18.593 -3.958  1.00 121.90 ? 69  GLN B CD  1 
ATOM 644  O OE1 . GLN B 1 28 ? -31.819  -18.541 -3.985  1.00 124.83 ? 69  GLN B OE1 1 
ATOM 645  N NE2 . GLN B 1 28 ? -33.729  -19.699 -4.256  1.00 124.09 ? 69  GLN B NE2 1 
ATOM 646  N N   . GLN B 1 29 ? -35.611  -16.302 0.030   1.00 87.24  ? 70  GLN B N   1 
ATOM 647  C CA  . GLN B 1 29 ? -36.852  -16.787 0.620   1.00 86.23  ? 70  GLN B CA  1 
ATOM 648  C C   . GLN B 1 29 ? -37.924  -15.746 0.361   1.00 85.31  ? 70  GLN B C   1 
ATOM 649  O O   . GLN B 1 29 ? -38.894  -16.016 -0.353  1.00 82.82  ? 70  GLN B O   1 
ATOM 650  C CB  . GLN B 1 29 ? -36.714  -17.017 2.131   1.00 88.11  ? 70  GLN B CB  1 
ATOM 651  C CG  . GLN B 1 29 ? -37.887  -17.811 2.724   1.00 93.97  ? 70  GLN B CG  1 
ATOM 652  C CD  . GLN B 1 29 ? -37.697  -18.172 4.195   1.00 97.49  ? 70  GLN B CD  1 
ATOM 653  O OE1 . GLN B 1 29 ? -36.570  -18.287 4.674   1.00 101.04 ? 70  GLN B OE1 1 
ATOM 654  N NE2 . GLN B 1 29 ? -38.805  -18.371 4.913   1.00 97.56  ? 70  GLN B NE2 1 
ATOM 655  N N   . LEU B 1 30 ? -37.710  -14.549 0.924   1.00 86.88  ? 71  LEU B N   1 
ATOM 656  C CA  . LEU B 1 30 ? -38.623  -13.406 0.806   1.00 87.18  ? 71  LEU B CA  1 
ATOM 657  C C   . LEU B 1 30 ? -38.917  -13.002 -0.628  1.00 89.14  ? 71  LEU B C   1 
ATOM 658  O O   . LEU B 1 30 ? -40.069  -12.883 -1.020  1.00 82.66  ? 71  LEU B O   1 
ATOM 659  C CB  . LEU B 1 30 ? -38.059  -12.213 1.573   1.00 88.46  ? 71  LEU B CB  1 
ATOM 660  C CG  . LEU B 1 30 ? -38.069  -12.358 3.099   1.00 91.95  ? 71  LEU B CG  1 
ATOM 661  C CD1 . LEU B 1 30 ? -37.489  -11.109 3.725   1.00 94.45  ? 71  LEU B CD1 1 
ATOM 662  C CD2 . LEU B 1 30 ? -39.486  -12.579 3.599   1.00 93.77  ? 71  LEU B CD2 1 
ATOM 663  N N   . GLN B 1 31 ? -37.876  -12.788 -1.414  1.00 97.43  ? 72  GLN B N   1 
ATOM 664  C CA  . GLN B 1 31 ? -38.080  -12.417 -2.806  1.00 109.47 ? 72  GLN B CA  1 
ATOM 665  C C   . GLN B 1 31 ? -39.148  -13.317 -3.416  1.00 106.09 ? 72  GLN B C   1 
ATOM 666  O O   . GLN B 1 31 ? -40.013  -12.860 -4.159  1.00 99.18  ? 72  GLN B O   1 
ATOM 667  C CB  . GLN B 1 31 ? -36.774  -12.552 -3.590  1.00 130.33 ? 72  GLN B CB  1 
ATOM 668  C CG  . GLN B 1 31 ? -35.656  -11.672 -3.061  1.00 163.68 ? 72  GLN B CG  1 
ATOM 669  C CD  . GLN B 1 31 ? -34.380  -11.813 -3.862  1.00 179.43 ? 72  GLN B CD  1 
ATOM 670  O OE1 . GLN B 1 31 ? -33.840  -12.911 -4.002  1.00 186.64 ? 72  GLN B OE1 1 
ATOM 671  N NE2 . GLN B 1 31 ? -33.888  -10.699 -4.391  1.00 186.90 ? 72  GLN B NE2 1 
ATOM 672  N N   . GLN B 1 32 ? -39.094  -14.602 -3.087  1.00 107.34 ? 73  GLN B N   1 
ATOM 673  C CA  . GLN B 1 32 ? -40.063  -15.544 -3.614  1.00 108.89 ? 73  GLN B CA  1 
ATOM 674  C C   . GLN B 1 32 ? -41.330  -15.467 -2.784  1.00 98.73  ? 73  GLN B C   1 
ATOM 675  O O   . GLN B 1 32 ? -42.433  -15.515 -3.316  1.00 89.62  ? 73  GLN B O   1 
ATOM 676  C CB  . GLN B 1 32 ? -39.476  -16.955 -3.594  1.00 127.92 ? 73  GLN B CB  1 
ATOM 677  C CG  . GLN B 1 32 ? -38.183  -17.069 -4.398  1.00 159.28 ? 73  GLN B CG  1 
ATOM 678  C CD  . GLN B 1 32 ? -37.649  -18.484 -4.466  1.00 172.85 ? 73  GLN B CD  1 
ATOM 679  O OE1 . GLN B 1 32 ? -36.613  -18.742 -5.080  1.00 176.93 ? 73  GLN B OE1 1 
ATOM 680  N NE2 . GLN B 1 32 ? -38.355  -19.411 -3.835  1.00 177.05 ? 73  GLN B NE2 1 
ATOM 681  N N   . GLU B 1 33 ? -41.165  -15.326 -1.477  1.00 92.47  ? 74  GLU B N   1 
ATOM 682  C CA  . GLU B 1 33 ? -42.293  -15.231 -0.557  1.00 91.94  ? 74  GLU B CA  1 
ATOM 683  C C   . GLU B 1 33 ? -43.249  -14.120 -0.988  1.00 90.02  ? 74  GLU B C   1 
ATOM 684  O O   . GLU B 1 33 ? -44.467  -14.302 -1.037  1.00 87.32  ? 74  GLU B O   1 
ATOM 685  C CB  . GLU B 1 33 ? -41.773  -14.937 0.842   1.00 95.63  ? 74  GLU B CB  1 
ATOM 686  C CG  . GLU B 1 33 ? -42.618  -15.514 1.933   1.00 104.03 ? 74  GLU B CG  1 
ATOM 687  C CD  . GLU B 1 33 ? -41.773  -15.982 3.090   1.00 108.45 ? 74  GLU B CD  1 
ATOM 688  O OE1 . GLU B 1 33 ? -41.387  -15.127 3.918   1.00 108.78 ? 74  GLU B OE1 1 
ATOM 689  O OE2 . GLU B 1 33 ? -41.480  -17.202 3.155   1.00 110.66 ? 74  GLU B OE2 1 
ATOM 690  N N   . LEU B 1 34 ? -42.666  -12.965 -1.294  1.00 88.52  ? 75  LEU B N   1 
ATOM 691  C CA  . LEU B 1 34 ? -43.385  -11.777 -1.743  1.00 87.47  ? 75  LEU B CA  1 
ATOM 692  C C   . LEU B 1 34 ? -44.120  -12.047 -3.064  1.00 89.13  ? 75  LEU B C   1 
ATOM 693  O O   . LEU B 1 34 ? -45.341  -11.940 -3.140  1.00 88.84  ? 75  LEU B O   1 
ATOM 694  C CB  . LEU B 1 34 ? -42.371  -10.642 -1.922  1.00 83.68  ? 75  LEU B CB  1 
ATOM 695  C CG  . LEU B 1 34 ? -42.741  -9.246  -2.412  1.00 78.94  ? 75  LEU B CG  1 
ATOM 696  C CD1 . LEU B 1 34 ? -43.542  -8.533  -1.350  1.00 74.79  ? 75  LEU B CD1 1 
ATOM 697  C CD2 . LEU B 1 34 ? -41.454  -8.487  -2.751  1.00 74.84  ? 75  LEU B CD2 1 
ATOM 698  N N   . LEU B 1 35 ? -43.358  -12.399 -4.097  1.00 92.49  ? 76  LEU B N   1 
ATOM 699  C CA  . LEU B 1 35 ? -43.901  -12.698 -5.419  1.00 94.92  ? 76  LEU B CA  1 
ATOM 700  C C   . LEU B 1 35 ? -44.997  -13.765 -5.286  1.00 90.58  ? 76  LEU B C   1 
ATOM 701  O O   . LEU B 1 35 ? -45.716  -14.085 -6.236  1.00 88.02  ? 76  LEU B O   1 
ATOM 702  C CB  . LEU B 1 35 ? -42.765  -13.183 -6.331  1.00 106.16 ? 76  LEU B CB  1 
ATOM 703  C CG  . LEU B 1 35 ? -42.874  -13.009 -7.850  1.00 117.33 ? 76  LEU B CG  1 
ATOM 704  C CD1 . LEU B 1 35 ? -41.481  -13.084 -8.474  1.00 124.12 ? 76  LEU B CD1 1 
ATOM 705  C CD2 . LEU B 1 35 ? -43.800  -14.065 -8.435  1.00 123.44 ? 76  LEU B CD2 1 
ATOM 706  N N   . ALA B 1 36 ? -45.120  -14.316 -4.090  1.00 85.40  ? 77  ALA B N   1 
ATOM 707  C CA  . ALA B 1 36 ? -46.135  -15.313 -3.834  1.00 82.68  ? 77  ALA B CA  1 
ATOM 708  C C   . ALA B 1 36 ? -47.329  -14.593 -3.230  1.00 82.82  ? 77  ALA B C   1 
ATOM 709  O O   . ALA B 1 36 ? -48.478  -14.975 -3.450  1.00 84.79  ? 77  ALA B O   1 
ATOM 710  C CB  . ALA B 1 36 ? -45.616  -16.328 -2.878  1.00 79.51  ? 77  ALA B CB  1 
ATOM 711  N N   . LEU B 1 37 ? -47.046  -13.541 -2.465  1.00 82.04  ? 78  LEU B N   1 
ATOM 712  C CA  . LEU B 1 37 ? -48.095  -12.756 -1.825  1.00 80.71  ? 78  LEU B CA  1 
ATOM 713  C C   . LEU B 1 37 ? -48.971  -12.097 -2.873  1.00 84.82  ? 78  LEU B C   1 
ATOM 714  O O   . LEU B 1 37 ? -50.186  -12.028 -2.714  1.00 84.55  ? 78  LEU B O   1 
ATOM 715  C CB  . LEU B 1 37 ? -47.495  -11.678 -0.932  1.00 72.16  ? 78  LEU B CB  1 
ATOM 716  C CG  . LEU B 1 37 ? -48.546  -11.134 0.038   1.00 66.55  ? 78  LEU B CG  1 
ATOM 717  C CD1 . LEU B 1 37 ? -48.926  -12.213 1.047   1.00 63.26  ? 78  LEU B CD1 1 
ATOM 718  C CD2 . LEU B 1 37 ? -48.010  -9.921  0.774   1.00 63.64  ? 78  LEU B CD2 1 
ATOM 719  N N   . LYS B 1 38 ? -48.343  -11.616 -3.944  1.00 90.74  ? 79  LYS B N   1 
ATOM 720  C CA  . LYS B 1 38 ? -49.056  -10.960 -5.040  1.00 96.10  ? 79  LYS B CA  1 
ATOM 721  C C   . LYS B 1 38 ? -50.033  -11.929 -5.692  1.00 95.71  ? 79  LYS B C   1 
ATOM 722  O O   . LYS B 1 38 ? -51.209  -11.604 -5.872  1.00 93.28  ? 79  LYS B O   1 
ATOM 723  C CB  . LYS B 1 38 ? -48.073  -10.447 -6.096  1.00 103.22 ? 79  LYS B CB  1 
ATOM 724  C CG  . LYS B 1 38 ? -48.744  -9.986  -7.388  1.00 114.46 ? 79  LYS B CG  1 
ATOM 725  C CD  . LYS B 1 38 ? -47.717  -9.661  -8.463  1.00 121.09 ? 79  LYS B CD  1 
ATOM 726  C CE  . LYS B 1 38 ? -48.378  -9.298  -9.789  1.00 123.75 ? 79  LYS B CE  1 
ATOM 727  N NZ  . LYS B 1 38 ? -47.368  -9.033  -10.865 1.00 125.96 ? 79  LYS B NZ  1 
ATOM 728  N N   . GLN B 1 39 ? -49.535  -13.114 -6.048  1.00 96.54  ? 80  GLN B N   1 
ATOM 729  C CA  . GLN B 1 39 ? -50.341  -14.159 -6.677  1.00 95.46  ? 80  GLN B CA  1 
ATOM 730  C C   . GLN B 1 39 ? -51.628  -14.374 -5.893  1.00 84.10  ? 80  GLN B C   1 
ATOM 731  O O   . GLN B 1 39 ? -52.735  -14.301 -6.437  1.00 77.62  ? 80  GLN B O   1 
ATOM 732  C CB  . GLN B 1 39 ? -49.552  -15.473 -6.707  1.00 115.16 ? 80  GLN B CB  1 
ATOM 733  C CG  . GLN B 1 39 ? -48.504  -15.580 -7.800  1.00 144.11 ? 80  GLN B CG  1 
ATOM 734  C CD  . GLN B 1 39 ? -49.119  -15.807 -9.168  1.00 157.81 ? 80  GLN B CD  1 
ATOM 735  O OE1 . GLN B 1 39 ? -49.862  -14.965 -9.675  1.00 163.75 ? 80  GLN B OE1 1 
ATOM 736  N NE2 . GLN B 1 39 ? -48.818  -16.955 -9.771  1.00 163.33 ? 80  GLN B NE2 1 
ATOM 737  N N   . LYS B 1 40 ? -51.459  -14.640 -4.605  1.00 74.55  ? 81  LYS B N   1 
ATOM 738  C CA  . LYS B 1 40 ? -52.576  -14.897 -3.710  1.00 70.73  ? 81  LYS B CA  1 
ATOM 739  C C   . LYS B 1 40 ? -53.603  -13.775 -3.838  1.00 70.29  ? 81  LYS B C   1 
ATOM 740  O O   . LYS B 1 40 ? -54.730  -13.988 -4.332  1.00 66.36  ? 81  LYS B O   1 
ATOM 741  C CB  . LYS B 1 40 ? -52.054  -14.980 -2.278  1.00 70.83  ? 81  LYS B CB  1 
ATOM 742  C CG  . LYS B 1 40 ? -53.010  -15.583 -1.264  1.00 77.51  ? 81  LYS B CG  1 
ATOM 743  C CD  . LYS B 1 40 ? -52.378  -15.532 0.136   1.00 82.53  ? 81  LYS B CD  1 
ATOM 744  C CE  . LYS B 1 40 ? -53.249  -16.188 1.200   1.00 86.18  ? 81  LYS B CE  1 
ATOM 745  N NZ  . LYS B 1 40 ? -52.909  -15.628 2.542   1.00 87.03  ? 81  LYS B NZ  1 
ATOM 746  N N   . GLN B 1 41 ? -53.178  -12.578 -3.409  1.00 71.14  ? 82  GLN B N   1 
ATOM 747  C CA  . GLN B 1 41 ? -53.979  -11.355 -3.439  1.00 73.11  ? 82  GLN B CA  1 
ATOM 748  C C   . GLN B 1 41 ? -54.622  -11.121 -4.782  1.00 73.48  ? 82  GLN B C   1 
ATOM 749  O O   . GLN B 1 41 ? -55.824  -10.910 -4.848  1.00 73.61  ? 82  GLN B O   1 
ATOM 750  C CB  . GLN B 1 41 ? -53.117  -10.146 -3.076  1.00 76.42  ? 82  GLN B CB  1 
ATOM 751  C CG  . GLN B 1 41 ? -52.896  -9.992  -1.575  1.00 78.81  ? 82  GLN B CG  1 
ATOM 752  C CD  . GLN B 1 41 ? -51.942  -8.855  -1.193  1.00 80.48  ? 82  GLN B CD  1 
ATOM 753  O OE1 . GLN B 1 41 ? -51.931  -8.413  -0.042  1.00 80.61  ? 82  GLN B OE1 1 
ATOM 754  N NE2 . GLN B 1 41 ? -51.132  -8.391  -2.148  1.00 80.34  ? 82  GLN B NE2 1 
ATOM 755  N N   . GLN B 1 42 ? -53.825  -11.170 -5.846  1.00 75.49  ? 83  GLN B N   1 
ATOM 756  C CA  . GLN B 1 42 ? -54.337  -10.953 -7.193  1.00 77.78  ? 83  GLN B CA  1 
ATOM 757  C C   . GLN B 1 42 ? -55.515  -11.876 -7.509  1.00 78.35  ? 83  GLN B C   1 
ATOM 758  O O   . GLN B 1 42 ? -56.401  -11.503 -8.282  1.00 75.57  ? 83  GLN B O   1 
ATOM 759  C CB  . GLN B 1 42 ? -53.230  -11.141 -8.228  1.00 82.23  ? 83  GLN B CB  1 
ATOM 760  C CG  . GLN B 1 42 ? -53.445  -10.366 -9.540  1.00 92.80  ? 83  GLN B CG  1 
ATOM 761  C CD  . GLN B 1 42 ? -54.549  -10.945 -10.432 1.00 97.84  ? 83  GLN B CD  1 
ATOM 762  O OE1 . GLN B 1 42 ? -54.343  -11.941 -11.137 1.00 101.63 ? 83  GLN B OE1 1 
ATOM 763  N NE2 . GLN B 1 42 ? -55.725  -10.317 -10.404 1.00 100.00 ? 83  GLN B NE2 1 
ATOM 764  N N   . ILE B 1 43 ? -55.538  -13.077 -6.922  1.00 78.34  ? 84  ILE B N   1 
ATOM 765  C CA  . ILE B 1 43 ? -56.659  -13.993 -7.150  1.00 78.79  ? 84  ILE B CA  1 
ATOM 766  C C   . ILE B 1 43 ? -57.758  -13.691 -6.140  1.00 75.85  ? 84  ILE B C   1 
ATOM 767  O O   . ILE B 1 43 ? -58.922  -13.565 -6.507  1.00 74.02  ? 84  ILE B O   1 
ATOM 768  C CB  . ILE B 1 43 ? -56.240  -15.491 -7.037  1.00 85.33  ? 84  ILE B CB  1 
ATOM 769  C CG1 . ILE B 1 43 ? -55.544  -15.931 -8.330  1.00 91.34  ? 84  ILE B CG1 1 
ATOM 770  C CG2 . ILE B 1 43 ? -57.465  -16.375 -6.811  1.00 88.47  ? 84  ILE B CG2 1 
ATOM 771  C CD1 . ILE B 1 43 ? -54.982  -17.332 -8.286  1.00 94.84  ? 84  ILE B CD1 1 
ATOM 772  N N   . GLN B 1 44 ? -57.391  -13.569 -4.871  1.00 75.71  ? 85  GLN B N   1 
ATOM 773  C CA  . GLN B 1 44 ? -58.375  -13.262 -3.851  1.00 77.26  ? 85  GLN B CA  1 
ATOM 774  C C   . GLN B 1 44 ? -59.325  -12.140 -4.358  1.00 75.25  ? 85  GLN B C   1 
ATOM 775  O O   . GLN B 1 44 ? -60.563  -12.256 -4.262  1.00 70.05  ? 85  GLN B O   1 
ATOM 776  C CB  . GLN B 1 44 ? -57.660  -12.832 -2.573  1.00 84.02  ? 85  GLN B CB  1 
ATOM 777  C CG  . GLN B 1 44 ? -57.998  -13.678 -1.361  1.00 98.92  ? 85  GLN B CG  1 
ATOM 778  C CD  . GLN B 1 44 ? -57.050  -13.440 -0.190  1.00 107.07 ? 85  GLN B CD  1 
ATOM 779  O OE1 . GLN B 1 44 ? -55.829  -13.557 -0.328  1.00 110.34 ? 85  GLN B OE1 1 
ATOM 780  N NE2 . GLN B 1 44 ? -57.612  -13.114 0.970   1.00 110.25 ? 85  GLN B NE2 1 
ATOM 781  N N   . ARG B 1 45 ? -58.748  -11.065 -4.907  1.00 72.87  ? 86  ARG B N   1 
ATOM 782  C CA  . ARG B 1 45 ? -59.534  -9.946  -5.442  1.00 72.75  ? 86  ARG B CA  1 
ATOM 783  C C   . ARG B 1 45 ? -60.540  -10.436 -6.462  1.00 74.82  ? 86  ARG B C   1 
ATOM 784  O O   . ARG B 1 45 ? -61.686  -9.978  -6.487  1.00 75.14  ? 86  ARG B O   1 
ATOM 785  C CB  . ARG B 1 45 ? -58.639  -8.909  -6.126  1.00 71.85  ? 86  ARG B CB  1 
ATOM 786  C CG  . ARG B 1 45 ? -58.061  -7.821  -5.217  1.00 65.09  ? 86  ARG B CG  1 
ATOM 787  C CD  . ARG B 1 45 ? -57.487  -6.744  -6.098  1.00 61.46  ? 86  ARG B CD  1 
ATOM 788  N NE  . ARG B 1 45 ? -56.179  -7.056  -6.670  1.00 60.00  ? 86  ARG B NE  1 
ATOM 789  C CZ  . ARG B 1 45 ? -55.071  -7.106  -5.937  1.00 61.15  ? 86  ARG B CZ  1 
ATOM 790  N NH1 . ARG B 1 45 ? -55.154  -6.874  -4.618  1.00 58.21  ? 86  ARG B NH1 1 
ATOM 791  N NH2 . ARG B 1 45 ? -53.889  -7.353  -6.513  1.00 60.45  ? 86  ARG B NH2 1 
ATOM 792  N N   . GLN B 1 46 ? -60.100  -11.357 -7.318  1.00 78.57  ? 87  GLN B N   1 
ATOM 793  C CA  . GLN B 1 46 ? -60.990  -11.907 -8.334  1.00 79.91  ? 87  GLN B CA  1 
ATOM 794  C C   . GLN B 1 46 ? -62.152  -12.660 -7.703  1.00 74.65  ? 87  GLN B C   1 
ATOM 795  O O   . GLN B 1 46 ? -63.255  -12.694 -8.259  1.00 69.05  ? 87  GLN B O   1 
ATOM 796  C CB  . GLN B 1 46 ? -60.234  -12.827 -9.282  1.00 88.83  ? 87  GLN B CB  1 
ATOM 797  C CG  . GLN B 1 46 ? -59.301  -12.084 -10.203 1.00 106.03 ? 87  GLN B CG  1 
ATOM 798  C CD  . GLN B 1 46 ? -58.681  -12.988 -11.240 1.00 114.41 ? 87  GLN B CD  1 
ATOM 799  O OE1 . GLN B 1 46 ? -57.867  -12.548 -12.048 1.00 117.37 ? 87  GLN B OE1 1 
ATOM 800  N NE2 . GLN B 1 46 ? -59.063  -14.262 -11.225 1.00 118.19 ? 87  GLN B NE2 1 
ATOM 801  N N   . ILE B 1 47 ? -61.915  -13.260 -6.541  1.00 70.29  ? 88  ILE B N   1 
ATOM 802  C CA  . ILE B 1 47 ? -62.987  -13.982 -5.882  1.00 69.48  ? 88  ILE B CA  1 
ATOM 803  C C   . ILE B 1 47 ? -63.961  -12.963 -5.348  1.00 69.66  ? 88  ILE B C   1 
ATOM 804  O O   . ILE B 1 47 ? -65.176  -13.133 -5.485  1.00 68.19  ? 88  ILE B O   1 
ATOM 805  C CB  . ILE B 1 47 ? -62.473  -14.863 -4.743  1.00 70.17  ? 88  ILE B CB  1 
ATOM 806  C CG1 . ILE B 1 47 ? -61.558  -15.946 -5.331  1.00 72.03  ? 88  ILE B CG1 1 
ATOM 807  C CG2 . ILE B 1 47 ? -63.653  -15.474 -3.986  1.00 68.72  ? 88  ILE B CG2 1 
ATOM 808  C CD1 . ILE B 1 47 ? -60.743  -16.701 -4.310  1.00 74.85  ? 88  ILE B CD1 1 
ATOM 809  N N   . LEU B 1 48 ? -63.427  -11.894 -4.757  1.00 70.71  ? 89  LEU B N   1 
ATOM 810  C CA  . LEU B 1 48 ? -64.264  -10.818 -4.221  1.00 71.42  ? 89  LEU B CA  1 
ATOM 811  C C   . LEU B 1 48 ? -65.216  -10.307 -5.302  1.00 69.86  ? 89  LEU B C   1 
ATOM 812  O O   . LEU B 1 48 ? -66.432  -10.197 -5.088  1.00 68.81  ? 89  LEU B O   1 
ATOM 813  C CB  . LEU B 1 48 ? -63.409  -9.650  -3.755  1.00 75.00  ? 89  LEU B CB  1 
ATOM 814  C CG  . LEU B 1 48 ? -64.346  -8.545  -3.279  1.00 78.10  ? 89  LEU B CG  1 
ATOM 815  C CD1 . LEU B 1 48 ? -65.070  -9.044  -2.029  1.00 78.13  ? 89  LEU B CD1 1 
ATOM 816  C CD2 . LEU B 1 48 ? -63.580  -7.253  -3.004  1.00 79.51  ? 89  LEU B CD2 1 
ATOM 817  N N   . ILE B 1 49 ? -64.640  -9.995  -6.465  1.00 67.86  ? 90  ILE B N   1 
ATOM 818  C CA  . ILE B 1 49 ? -65.402  -9.510  -7.599  1.00 64.88  ? 90  ILE B CA  1 
ATOM 819  C C   . ILE B 1 49 ? -66.437  -10.512 -8.127  1.00 64.97  ? 90  ILE B C   1 
ATOM 820  O O   . ILE B 1 49 ? -67.610  -10.158 -8.317  1.00 63.38  ? 90  ILE B O   1 
ATOM 821  C CB  . ILE B 1 49 ? -64.474  -9.105  -8.715  1.00 62.89  ? 90  ILE B CB  1 
ATOM 822  C CG1 . ILE B 1 49 ? -63.963  -7.708  -8.440  1.00 65.14  ? 90  ILE B CG1 1 
ATOM 823  C CG2 . ILE B 1 49 ? -65.216  -9.081  -10.024 1.00 66.98  ? 90  ILE B CG2 1 
ATOM 824  C CD1 . ILE B 1 49 ? -65.083  -6.706  -8.251  1.00 65.54  ? 90  ILE B CD1 1 
ATOM 825  N N   . ALA B 1 50 ? -66.016  -11.758 -8.366  1.00 63.83  ? 91  ALA B N   1 
ATOM 826  C CA  . ALA B 1 50 ? -66.945  -12.770 -8.861  1.00 63.70  ? 91  ALA B CA  1 
ATOM 827  C C   . ALA B 1 50 ? -68.065  -12.901 -7.848  1.00 68.86  ? 91  ALA B C   1 
ATOM 828  O O   . ALA B 1 50 ? -69.229  -13.028 -8.208  1.00 62.24  ? 91  ALA B O   1 
ATOM 829  C CB  . ALA B 1 50 ? -66.247  -14.081 -9.035  1.00 64.02  ? 91  ALA B CB  1 
ATOM 830  N N   . GLU B 1 51 ? -67.711  -12.852 -6.575  1.00 80.54  ? 92  GLU B N   1 
ATOM 831  C CA  . GLU B 1 51 ? -68.703  -12.950 -5.532  1.00 94.85  ? 92  GLU B CA  1 
ATOM 832  C C   . GLU B 1 51 ? -69.739  -11.842 -5.761  1.00 86.46  ? 92  GLU B C   1 
ATOM 833  O O   . GLU B 1 51 ? -70.952  -12.117 -5.837  1.00 75.43  ? 92  GLU B O   1 
ATOM 834  C CB  . GLU B 1 51 ? -68.028  -12.775 -4.177  1.00 125.35 ? 92  GLU B CB  1 
ATOM 835  C CG  . GLU B 1 51 ? -68.927  -12.964 -2.976  1.00 170.06 ? 92  GLU B CG  1 
ATOM 836  C CD  . GLU B 1 51 ? -68.219  -12.595 -1.684  1.00 189.68 ? 92  GLU B CD  1 
ATOM 837  O OE1 . GLU B 1 51 ? -67.869  -11.405 -1.517  1.00 195.99 ? 92  GLU B OE1 1 
ATOM 838  O OE2 . GLU B 1 51 ? -68.004  -13.491 -0.839  1.00 195.97 ? 92  GLU B OE2 1 
ATOM 839  N N   . PHE B 1 52 ? -69.273  -10.590 -5.884  1.00 79.37  ? 93  PHE B N   1 
ATOM 840  C CA  . PHE B 1 52 ? -70.195  -9.464  -6.087  1.00 76.89  ? 93  PHE B CA  1 
ATOM 841  C C   . PHE B 1 52 ? -70.994  -9.718  -7.338  1.00 74.14  ? 93  PHE B C   1 
ATOM 842  O O   . PHE B 1 52 ? -72.217  -9.625  -7.324  1.00 67.35  ? 93  PHE B O   1 
ATOM 843  C CB  . PHE B 1 52 ? -69.458  -8.141  -6.252  1.00 85.37  ? 93  PHE B CB  1 
ATOM 844  C CG  . PHE B 1 52 ? -70.376  -6.964  -6.467  1.00 97.33  ? 93  PHE B CG  1 
ATOM 845  C CD1 . PHE B 1 52 ? -71.017  -6.352  -5.391  1.00 102.43 ? 93  PHE B CD1 1 
ATOM 846  C CD2 . PHE B 1 52 ? -70.608  -6.470  -7.744  1.00 102.70 ? 93  PHE B CD2 1 
ATOM 847  C CE1 . PHE B 1 52 ? -71.872  -5.265  -5.583  1.00 104.25 ? 93  PHE B CE1 1 
ATOM 848  C CE2 . PHE B 1 52 ? -71.464  -5.383  -7.948  1.00 104.44 ? 93  PHE B CE2 1 
ATOM 849  C CZ  . PHE B 1 52 ? -72.094  -4.782  -6.863  1.00 105.21 ? 93  PHE B CZ  1 
ATOM 850  N N   . GLN B 1 53 ? -70.287  -10.046 -8.417  1.00 75.69  ? 94  GLN B N   1 
ATOM 851  C CA  . GLN B 1 53 ? -70.937  -10.334 -9.678  1.00 80.20  ? 94  GLN B CA  1 
ATOM 852  C C   . GLN B 1 53 ? -72.205  -11.167 -9.412  1.00 76.37  ? 94  GLN B C   1 
ATOM 853  O O   . GLN B 1 53 ? -73.321  -10.743 -9.730  1.00 66.73  ? 94  GLN B O   1 
ATOM 854  C CB  . GLN B 1 53 ? -69.971  -11.088 -10.597 1.00 95.94  ? 94  GLN B CB  1 
ATOM 855  C CG  . GLN B 1 53 ? -70.197  -10.903 -12.102 1.00 123.94 ? 94  GLN B CG  1 
ATOM 856  C CD  . GLN B 1 53 ? -71.517  -11.470 -12.587 1.00 137.49 ? 94  GLN B CD  1 
ATOM 857  O OE1 . GLN B 1 53 ? -71.892  -12.593 -12.249 1.00 143.55 ? 94  GLN B OE1 1 
ATOM 858  N NE2 . GLN B 1 53 ? -72.224  -10.696 -13.397 1.00 143.37 ? 94  GLN B NE2 1 
ATOM 859  N N   . ARG B 1 54 ? -72.049  -12.335 -8.801  1.00 79.02  ? 95  ARG B N   1 
ATOM 860  C CA  . ARG B 1 54 ? -73.208  -13.186 -8.523  1.00 87.26  ? 95  ARG B CA  1 
ATOM 861  C C   . ARG B 1 54 ? -74.307  -12.513 -7.690  1.00 86.17  ? 95  ARG B C   1 
ATOM 862  O O   . ARG B 1 54 ? -75.474  -12.484 -8.095  1.00 83.58  ? 95  ARG B O   1 
ATOM 863  C CB  . ARG B 1 54 ? -72.765  -14.487 -7.837  1.00 97.49  ? 95  ARG B CB  1 
ATOM 864  C CG  . ARG B 1 54 ? -73.896  -15.284 -7.165  1.00 113.82 ? 95  ARG B CG  1 
ATOM 865  C CD  . ARG B 1 54 ? -73.366  -16.567 -6.529  1.00 124.60 ? 95  ARG B CD  1 
ATOM 866  N NE  . ARG B 1 54 ? -74.327  -17.198 -5.627  1.00 130.53 ? 95  ARG B NE  1 
ATOM 867  C CZ  . ARG B 1 54 ? -74.641  -16.736 -4.419  1.00 133.15 ? 95  ARG B CZ  1 
ATOM 868  N NH1 . ARG B 1 54 ? -74.070  -15.631 -3.957  1.00 133.97 ? 95  ARG B NH1 1 
ATOM 869  N NH2 . ARG B 1 54 ? -75.520  -17.384 -3.665  1.00 134.12 ? 95  ARG B NH2 1 
ATOM 870  N N   . GLN B 1 55 ? -73.956  -11.986 -6.528  1.00 85.28  ? 96  GLN B N   1 
ATOM 871  C CA  . GLN B 1 55 ? -74.970  -11.345 -5.710  1.00 90.67  ? 96  GLN B CA  1 
ATOM 872  C C   . GLN B 1 55 ? -75.639  -10.213 -6.493  1.00 91.93  ? 96  GLN B C   1 
ATOM 873  O O   . GLN B 1 55 ? -76.688  -9.699  -6.102  1.00 97.59  ? 96  GLN B O   1 
ATOM 874  C CB  . GLN B 1 55 ? -74.340  -10.823 -4.415  1.00 92.54  ? 96  GLN B CB  1 
ATOM 875  C CG  . GLN B 1 55 ? -74.266  -11.868 -3.307  1.00 89.66  ? 96  GLN B CG  1 
ATOM 876  C CD  . GLN B 1 55 ? -73.343  -11.466 -2.172  1.00 89.75  ? 96  GLN B CD  1 
ATOM 877  O OE1 . GLN B 1 55 ? -72.121  -11.483 -2.317  1.00 91.45  ? 96  GLN B OE1 1 
ATOM 878  N NE2 . GLN B 1 55 ? -73.924  -11.099 -1.034  1.00 90.74  ? 96  GLN B NE2 1 
ATOM 879  N N   . PHE B 1 56 ? -75.038  -9.850  -7.622  1.00 91.88  ? 97  PHE B N   1 
ATOM 880  C CA  . PHE B 1 56 ? -75.561  -8.772  -8.444  1.00 84.52  ? 97  PHE B CA  1 
ATOM 881  C C   . PHE B 1 56 ? -76.592  -9.213  -9.435  1.00 81.28  ? 97  PHE B C   1 
ATOM 882  O O   . PHE B 1 56 ? -77.640  -8.589  -9.543  1.00 77.71  ? 97  PHE B O   1 
ATOM 883  C CB  . PHE B 1 56 ? -74.452  -8.097  -9.214  1.00 82.94  ? 97  PHE B CB  1 
ATOM 884  C CG  . PHE B 1 56 ? -74.917  -6.947  -10.035 1.00 80.30  ? 97  PHE B CG  1 
ATOM 885  C CD1 . PHE B 1 56 ? -75.612  -5.904  -9.447  1.00 79.70  ? 97  PHE B CD1 1 
ATOM 886  C CD2 . PHE B 1 56 ? -74.608  -6.867  -11.377 1.00 77.13  ? 97  PHE B CD2 1 
ATOM 887  C CE1 . PHE B 1 56 ? -75.984  -4.788  -10.189 1.00 74.76  ? 97  PHE B CE1 1 
ATOM 888  C CE2 . PHE B 1 56 ? -74.978  -5.751  -12.123 1.00 72.05  ? 97  PHE B CE2 1 
ATOM 889  C CZ  . PHE B 1 56 ? -75.666  -4.705  -11.526 1.00 67.37  ? 97  PHE B CZ  1 
ATOM 890  N N   . GLU B 1 57 ? -76.294  -10.268 -10.188 1.00 77.94  ? 98  GLU B N   1 
ATOM 891  C CA  . GLU B 1 57 ? -77.265  -10.721 -11.163 1.00 77.11  ? 98  GLU B CA  1 
ATOM 892  C C   . GLU B 1 57 ? -78.428  -11.320 -10.400 1.00 77.24  ? 98  GLU B C   1 
ATOM 893  O O   . GLU B 1 57 ? -79.575  -11.257 -10.848 1.00 71.78  ? 98  GLU B O   1 
ATOM 894  C CB  . GLU B 1 57 ? -76.662  -11.741 -12.134 1.00 80.12  ? 98  GLU B CB  1 
ATOM 895  C CG  . GLU B 1 57 ? -77.512  -11.958 -13.427 1.00 89.79  ? 98  GLU B CG  1 
ATOM 896  C CD  . GLU B 1 57 ? -77.655  -10.688 -14.316 1.00 94.69  ? 98  GLU B CD  1 
ATOM 897  O OE1 . GLU B 1 57 ? -76.623  -10.170 -14.831 1.00 94.70  ? 98  GLU B OE1 1 
ATOM 898  O OE2 . GLU B 1 57 ? -78.807  -10.211 -14.504 1.00 95.63  ? 98  GLU B OE2 1 
ATOM 899  N N   . GLN B 1 58 ? -78.129  -11.866 -9.225  1.00 81.60  ? 99  GLN B N   1 
ATOM 900  C CA  . GLN B 1 58 ? -79.154  -12.481 -8.389  1.00 87.80  ? 99  GLN B CA  1 
ATOM 901  C C   . GLN B 1 58 ? -80.209  -11.453 -8.038  1.00 78.17  ? 99  GLN B C   1 
ATOM 902  O O   . GLN B 1 58 ? -81.399  -11.648 -8.346  1.00 72.20  ? 99  GLN B O   1 
ATOM 903  C CB  . GLN B 1 58 ? -78.536  -13.057 -7.111  1.00 110.72 ? 99  GLN B CB  1 
ATOM 904  C CG  . GLN B 1 58 ? -79.533  -13.726 -6.167  1.00 143.84 ? 99  GLN B CG  1 
ATOM 905  C CD  . GLN B 1 58 ? -78.848  -14.542 -5.085  1.00 159.39 ? 99  GLN B CD  1 
ATOM 906  O OE1 . GLN B 1 58 ? -78.225  -15.566 -5.367  1.00 165.92 ? 99  GLN B OE1 1 
ATOM 907  N NE2 . GLN B 1 58 ? -78.955  -14.088 -3.841  1.00 166.31 ? 99  GLN B NE2 1 
ATOM 908  N N   . LEU B 1 59 ? -79.776  -10.355 -7.412  1.00 68.74  ? 100 LEU B N   1 
ATOM 909  C CA  . LEU B 1 59 ? -80.712  -9.307  -7.040  1.00 62.78  ? 100 LEU B CA  1 
ATOM 910  C C   . LEU B 1 59 ? -81.456  -8.885  -8.308  1.00 63.41  ? 100 LEU B C   1 
ATOM 911  O O   . LEU B 1 59 ? -82.715  -8.875  -8.374  1.00 58.80  ? 100 LEU B O   1 
ATOM 912  C CB  . LEU B 1 59 ? -79.988  -8.103  -6.457  1.00 58.02  ? 100 LEU B CB  1 
ATOM 913  C CG  . LEU B 1 59 ? -81.020  -7.232  -5.743  1.00 58.42  ? 100 LEU B CG  1 
ATOM 914  C CD1 . LEU B 1 59 ? -81.780  -8.118  -4.755  1.00 57.24  ? 100 LEU B CD1 1 
ATOM 915  C CD2 . LEU B 1 59 ? -80.374  -6.046  -5.040  1.00 60.21  ? 100 LEU B CD2 1 
ATOM 916  N N   . SER B 1 60 ? -80.660  -8.584  -9.333  1.00 65.50  ? 101 SER B N   1 
ATOM 917  C CA  . SER B 1 60 ? -81.190  -8.152  -10.615 1.00 69.77  ? 101 SER B CA  1 
ATOM 918  C C   . SER B 1 60 ? -82.274  -9.040  -11.193 1.00 73.98  ? 101 SER B C   1 
ATOM 919  O O   . SER B 1 60 ? -83.247  -8.534  -11.748 1.00 76.08  ? 101 SER B O   1 
ATOM 920  C CB  . SER B 1 60 ? -80.057  -7.975  -11.599 1.00 68.15  ? 101 SER B CB  1 
ATOM 921  O OG  . SER B 1 60 ? -79.353  -6.792  -11.254 1.00 68.52  ? 101 SER B OG  1 
ATOM 922  N N   . ARG B 1 61 ? -82.134  -10.355 -11.058 1.00 77.58  ? 102 ARG B N   1 
ATOM 923  C CA  . ARG B 1 61 ? -83.158  -11.249 -11.574 1.00 79.46  ? 102 ARG B CA  1 
ATOM 924  C C   . ARG B 1 61 ? -84.366  -11.227 -10.649 1.00 80.55  ? 102 ARG B C   1 
ATOM 925  O O   . ARG B 1 61 ? -85.506  -11.366 -11.107 1.00 78.50  ? 102 ARG B O   1 
ATOM 926  C CB  . ARG B 1 61 ? -82.609  -12.662 -11.704 1.00 82.92  ? 102 ARG B CB  1 
ATOM 927  C CG  . ARG B 1 61 ? -81.402  -12.706 -12.594 1.00 89.78  ? 102 ARG B CG  1 
ATOM 928  C CD  . ARG B 1 61 ? -81.415  -13.895 -13.524 1.00 91.91  ? 102 ARG B CD  1 
ATOM 929  N NE  . ARG B 1 61 ? -80.446  -13.692 -14.594 1.00 93.58  ? 102 ARG B NE  1 
ATOM 930  C CZ  . ARG B 1 61 ? -80.239  -14.543 -15.588 1.00 94.17  ? 102 ARG B CZ  1 
ATOM 931  N NH1 . ARG B 1 61 ? -80.936  -15.673 -15.662 1.00 94.29  ? 102 ARG B NH1 1 
ATOM 932  N NH2 . ARG B 1 61 ? -79.329  -14.259 -16.508 1.00 94.89  ? 102 ARG B NH2 1 
ATOM 933  N N   . GLN B 1 62 ? -84.125  -11.053 -9.348  1.00 82.84  ? 103 GLN B N   1 
ATOM 934  C CA  . GLN B 1 62 ? -85.238  -11.009 -8.415  1.00 84.70  ? 103 GLN B CA  1 
ATOM 935  C C   . GLN B 1 62 ? -86.011  -9.763  -8.753  1.00 82.08  ? 103 GLN B C   1 
ATOM 936  O O   . GLN B 1 62 ? -87.118  -9.839  -9.294  1.00 75.20  ? 103 GLN B O   1 
ATOM 937  C CB  . GLN B 1 62 ? -84.763  -10.925 -6.967  1.00 92.57  ? 103 GLN B CB  1 
ATOM 938  C CG  . GLN B 1 62 ? -84.203  -12.220 -6.404  1.00 108.36 ? 103 GLN B CG  1 
ATOM 939  C CD  . GLN B 1 62 ? -83.571  -12.042 -5.020  1.00 114.87 ? 103 GLN B CD  1 
ATOM 940  O OE1 . GLN B 1 62 ? -82.936  -12.961 -4.492  1.00 116.96 ? 103 GLN B OE1 1 
ATOM 941  N NE2 . GLN B 1 62 ? -83.744  -10.858 -4.431  1.00 116.36 ? 103 GLN B NE2 1 
ATOM 942  N N   . HIS B 1 63 ? -85.411  -8.614  -8.456  1.00 82.17  ? 104 HIS B N   1 
ATOM 943  C CA  . HIS B 1 63 ? -86.054  -7.334  -8.714  1.00 85.71  ? 104 HIS B CA  1 
ATOM 944  C C   . HIS B 1 63 ? -86.843  -7.393  -10.009 1.00 83.33  ? 104 HIS B C   1 
ATOM 945  O O   . HIS B 1 63 ? -88.034  -7.087  -10.040 1.00 83.19  ? 104 HIS B O   1 
ATOM 946  C CB  . HIS B 1 63 ? -85.014  -6.215  -8.779  1.00 93.11  ? 104 HIS B CB  1 
ATOM 947  C CG  . HIS B 1 63 ? -84.495  -5.793  -7.439  1.00 103.25 ? 104 HIS B CG  1 
ATOM 948  N ND1 . HIS B 1 63 ? -83.617  -4.741  -7.276  1.00 107.43 ? 104 HIS B ND1 1 
ATOM 949  C CD2 . HIS B 1 63 ? -84.723  -6.287  -6.197  1.00 106.36 ? 104 HIS B CD2 1 
ATOM 950  C CE1 . HIS B 1 63 ? -83.324  -4.608  -5.993  1.00 108.28 ? 104 HIS B CE1 1 
ATOM 951  N NE2 . HIS B 1 63 ? -83.982  -5.534  -5.318  1.00 107.34 ? 104 HIS B NE2 1 
ATOM 952  N N   . GLU B 1 64 ? -86.181  -7.828  -11.072 1.00 80.58  ? 105 GLU B N   1 
ATOM 953  C CA  . GLU B 1 64 ? -86.815  -7.926  -12.372 1.00 77.20  ? 105 GLU B CA  1 
ATOM 954  C C   . GLU B 1 64 ? -88.103  -8.748  -12.319 1.00 80.79  ? 105 GLU B C   1 
ATOM 955  O O   . GLU B 1 64 ? -89.187  -8.208  -12.535 1.00 80.10  ? 105 GLU B O   1 
ATOM 956  C CB  . GLU B 1 64 ? -85.839  -8.542  -13.356 1.00 71.73  ? 105 GLU B CB  1 
ATOM 957  C CG  . GLU B 1 64 ? -86.077  -8.181  -14.776 1.00 68.44  ? 105 GLU B CG  1 
ATOM 958  C CD  . GLU B 1 64 ? -85.128  -8.915  -15.711 1.00 69.98  ? 105 GLU B CD  1 
ATOM 959  O OE1 . GLU B 1 64 ? -85.207  -10.179 -15.753 1.00 67.46  ? 105 GLU B OE1 1 
ATOM 960  O OE2 . GLU B 1 64 ? -84.311  -8.224  -16.391 1.00 69.36  ? 105 GLU B OE2 1 
ATOM 961  N N   . ALA B 1 65 ? -87.985  -10.042 -12.020 1.00 87.40  ? 106 ALA B N   1 
ATOM 962  C CA  . ALA B 1 65 ? -89.148  -10.934 -11.962 1.00 91.92  ? 106 ALA B CA  1 
ATOM 963  C C   . ALA B 1 65 ? -90.328  -10.250 -11.301 1.00 93.80  ? 106 ALA B C   1 
ATOM 964  O O   . ALA B 1 65 ? -91.463  -10.313 -11.788 1.00 88.15  ? 106 ALA B O   1 
ATOM 965  C CB  . ALA B 1 65 ? -88.801  -12.207 -11.204 1.00 99.56  ? 106 ALA B CB  1 
ATOM 966  N N   . GLN B 1 66 ? -90.046  -9.590  -10.185 1.00 96.09  ? 107 GLN B N   1 
ATOM 967  C CA  . GLN B 1 66 ? -91.077  -8.886  -9.450  1.00 101.38 ? 107 GLN B CA  1 
ATOM 968  C C   . GLN B 1 66 ? -91.680  -7.845  -10.378 1.00 95.67  ? 107 GLN B C   1 
ATOM 969  O O   . GLN B 1 66 ? -92.881  -7.863  -10.657 1.00 93.37  ? 107 GLN B O   1 
ATOM 970  C CB  . GLN B 1 66 ? -90.478  -8.209  -8.220  1.00 113.53 ? 107 GLN B CB  1 
ATOM 971  C CG  . GLN B 1 66 ? -89.698  -9.152  -7.328  1.00 129.87 ? 107 GLN B CG  1 
ATOM 972  C CD  . GLN B 1 66 ? -89.297  -8.503  -6.024  1.00 136.83 ? 107 GLN B CD  1 
ATOM 973  O OE1 . GLN B 1 66 ? -88.600  -7.486  -6.006  1.00 138.60 ? 107 GLN B OE1 1 
ATOM 974  N NE2 . GLN B 1 66 ? -89.743  -9.086  -4.917  1.00 139.42 ? 107 GLN B NE2 1 
ATOM 975  N N   . LEU B 1 67 ? -90.833  -6.946  -10.864 1.00 88.81  ? 108 LEU B N   1 
ATOM 976  C CA  . LEU B 1 67 ? -91.289  -5.907  -11.767 1.00 82.92  ? 108 LEU B CA  1 
ATOM 977  C C   . LEU B 1 67 ? -92.112  -6.461  -12.911 1.00 85.16  ? 108 LEU B C   1 
ATOM 978  O O   . LEU B 1 67 ? -93.003  -5.785  -13.404 1.00 86.61  ? 108 LEU B O   1 
ATOM 979  C CB  . LEU B 1 67 ? -90.109  -5.115  -12.312 1.00 73.90  ? 108 LEU B CB  1 
ATOM 980  C CG  . LEU B 1 67 ? -90.077  -3.757  -11.626 1.00 65.82  ? 108 LEU B CG  1 
ATOM 981  C CD1 . LEU B 1 67 ? -88.791  -2.999  -11.965 1.00 59.49  ? 108 LEU B CD1 1 
ATOM 982  C CD2 . LEU B 1 67 ? -91.334  -2.993  -12.044 1.00 60.85  ? 108 LEU B CD2 1 
ATOM 983  N N   . HIS B 1 68 ? -91.821  -7.684  -13.343 1.00 91.01  ? 109 HIS B N   1 
ATOM 984  C CA  . HIS B 1 68 ? -92.595  -8.283  -14.427 1.00 97.39  ? 109 HIS B CA  1 
ATOM 985  C C   . HIS B 1 68 ? -93.908  -8.816  -13.859 1.00 103.63 ? 109 HIS B C   1 
ATOM 986  O O   . HIS B 1 68 ? -94.976  -8.668  -14.471 1.00 97.53  ? 109 HIS B O   1 
ATOM 987  C CB  . HIS B 1 68 ? -91.805  -9.408  -15.098 1.00 95.88  ? 109 HIS B CB  1 
ATOM 988  C CG  . HIS B 1 68 ? -90.931  -8.946  -16.226 1.00 98.95  ? 109 HIS B CG  1 
ATOM 989  N ND1 . HIS B 1 68 ? -90.395  -7.677  -16.283 1.00 99.89  ? 109 HIS B ND1 1 
ATOM 990  C CD2 . HIS B 1 68 ? -90.452  -9.605  -17.309 1.00 100.06 ? 109 HIS B CD2 1 
ATOM 991  C CE1 . HIS B 1 68 ? -89.621  -7.575  -17.349 1.00 100.60 ? 109 HIS B CE1 1 
ATOM 992  N NE2 . HIS B 1 68 ? -89.637  -8.732  -17.987 1.00 100.79 ? 109 HIS B NE2 1 
ATOM 993  N N   . GLU B 1 69 ? -93.816  -9.424  -12.676 1.00 111.26 ? 110 GLU B N   1 
ATOM 994  C CA  . GLU B 1 69 ? -94.980  -9.965  -11.977 1.00 123.21 ? 110 GLU B CA  1 
ATOM 995  C C   . GLU B 1 69 ? -96.037  -8.869  -11.904 1.00 120.85 ? 110 GLU B C   1 
ATOM 996  O O   . GLU B 1 69 ? -97.214  -9.106  -12.169 1.00 129.67 ? 110 GLU B O   1 
ATOM 997  C CB  . GLU B 1 69 ? -94.590  -10.391 -10.558 1.00 137.76 ? 110 GLU B CB  1 
ATOM 998  C CG  . GLU B 1 69 ? -95.760  -10.841 -9.685  1.00 149.28 ? 110 GLU B CG  1 
ATOM 999  C CD  . GLU B 1 69 ? -95.512  -10.599 -8.197  1.00 154.43 ? 110 GLU B CD  1 
ATOM 1000 O OE1 . GLU B 1 69 ? -96.375  -10.975 -7.373  1.00 157.29 ? 110 GLU B OE1 1 
ATOM 1001 O OE2 . GLU B 1 69 ? -94.457  -10.025 -7.851  1.00 157.62 ? 110 GLU B OE2 1 
ATOM 1002 N N   . HIS B 1 70 ? -95.602  -7.669  -11.533 1.00 114.00 ? 111 HIS B N   1 
ATOM 1003 C CA  . HIS B 1 70 ? -96.490  -6.521  -11.436 1.00 99.88  ? 111 HIS B CA  1 
ATOM 1004 C C   . HIS B 1 70 ? -97.173  -6.366  -12.768 1.00 96.28  ? 111 HIS B C   1 
ATOM 1005 O O   . HIS B 1 70 ? -98.376  -6.160  -12.823 1.00 95.32  ? 111 HIS B O   1 
ATOM 1006 C CB  . HIS B 1 70 ? -95.690  -5.263  -11.123 1.00 94.47  ? 111 HIS B CB  1 
ATOM 1007 C CG  . HIS B 1 70 ? -96.524  -4.041  -10.879 1.00 89.19  ? 111 HIS B CG  1 
ATOM 1008 N ND1 . HIS B 1 70 ? -96.720  -3.069  -11.837 1.00 87.18  ? 111 HIS B ND1 1 
ATOM 1009 C CD2 . HIS B 1 70 ? -97.148  -3.596  -9.762  1.00 88.72  ? 111 HIS B CD2 1 
ATOM 1010 C CE1 . HIS B 1 70 ? -97.422  -2.077  -11.320 1.00 87.80  ? 111 HIS B CE1 1 
ATOM 1011 N NE2 . HIS B 1 70 ? -97.693  -2.371  -10.062 1.00 89.02  ? 111 HIS B NE2 1 
ATOM 1012 N N   . ILE B 1 71 ? -96.409  -6.471  -13.849 1.00 93.91  ? 112 ILE B N   1 
ATOM 1013 C CA  . ILE B 1 71 ? -96.989  -6.344  -15.178 1.00 93.10  ? 112 ILE B CA  1 
ATOM 1014 C C   . ILE B 1 71 ? -98.043  -7.426  -15.495 1.00 92.70  ? 112 ILE B C   1 
ATOM 1015 O O   . ILE B 1 71 ? -99.099  -7.134  -16.073 1.00 86.24  ? 112 ILE B O   1 
ATOM 1016 C CB  . ILE B 1 71 ? -95.884  -6.346  -16.254 1.00 95.81  ? 112 ILE B CB  1 
ATOM 1017 C CG1 . ILE B 1 71 ? -95.208  -4.978  -16.262 1.00 98.84  ? 112 ILE B CG1 1 
ATOM 1018 C CG2 . ILE B 1 71 ? -96.462  -6.720  -17.628 1.00 99.06  ? 112 ILE B CG2 1 
ATOM 1019 C CD1 . ILE B 1 71 ? -94.410  -4.678  -17.494 1.00 103.40 ? 112 ILE B CD1 1 
ATOM 1020 N N   . LYS B 1 72 ? -97.761  -8.665  -15.105 1.00 94.52  ? 113 LYS B N   1 
ATOM 1021 C CA  . LYS B 1 72 ? -98.684  -9.771  -15.345 1.00 100.46 ? 113 LYS B CA  1 
ATOM 1022 C C   . LYS B 1 72 ? -99.941  -9.641  -14.473 1.00 102.30 ? 113 LYS B C   1 
ATOM 1023 O O   . LYS B 1 72 ? -100.833 -10.485 -14.520 1.00 102.16 ? 113 LYS B O   1 
ATOM 1024 C CB  . LYS B 1 72 ? -97.977  -11.104 -15.060 1.00 104.73 ? 113 LYS B CB  1 
ATOM 1025 C CG  . LYS B 1 72 ? -98.686  -12.342 -15.603 1.00 112.21 ? 113 LYS B CG  1 
ATOM 1026 C CD  . LYS B 1 72 ? -97.810  -13.602 -15.509 1.00 115.63 ? 113 LYS B CD  1 
ATOM 1027 C CE  . LYS B 1 72 ? -97.855  -14.257 -14.130 1.00 116.84 ? 113 LYS B CE  1 
ATOM 1028 N NZ  . LYS B 1 72 ? -99.203  -14.828 -13.825 1.00 116.99 ? 113 LYS B NZ  1 
ATOM 1029 N N   . GLN B 1 73 ? -100.014 -8.577  -13.680 1.00 104.72 ? 114 GLN B N   1 
ATOM 1030 C CA  . GLN B 1 73 ? -101.164 -8.371  -12.806 1.00 106.40 ? 114 GLN B CA  1 
ATOM 1031 C C   . GLN B 1 73 ? -101.830 -7.028  -13.048 1.00 104.72 ? 114 GLN B C   1 
ATOM 1032 O O   . GLN B 1 73 ? -103.016 -6.852  -12.768 1.00 102.59 ? 114 GLN B O   1 
ATOM 1033 C CB  . GLN B 1 73 ? -100.751 -8.469  -11.339 1.00 111.15 ? 114 GLN B CB  1 
ATOM 1034 C CG  . GLN B 1 73 ? -100.144 -9.796  -10.958 1.00 118.84 ? 114 GLN B CG  1 
ATOM 1035 C CD  . GLN B 1 73 ? -100.000 -9.947  -9.462  1.00 121.97 ? 114 GLN B CD  1 
ATOM 1036 O OE1 . GLN B 1 73 ? -99.406  -10.913 -8.975  1.00 122.98 ? 114 GLN B OE1 1 
ATOM 1037 N NE2 . GLN B 1 73 ? -100.553 -8.995  -8.718  1.00 122.32 ? 114 GLN B NE2 1 
ATOM 1038 N N   . GLN B 1 74 ? -101.071 -6.061  -13.540 1.00 104.17 ? 115 GLN B N   1 
ATOM 1039 C CA  . GLN B 1 74 ? -101.687 -4.787  -13.812 1.00 104.99 ? 115 GLN B CA  1 
ATOM 1040 C C   . GLN B 1 74 ? -102.437 -5.062  -15.094 1.00 108.98 ? 115 GLN B C   1 
ATOM 1041 O O   . GLN B 1 74 ? -103.171 -4.211  -15.595 1.00 104.36 ? 115 GLN B O   1 
ATOM 1042 C CB  . GLN B 1 74 ? -100.653 -3.693  -14.023 1.00 102.10 ? 115 GLN B CB  1 
ATOM 1043 C CG  . GLN B 1 74 ? -101.284 -2.317  -14.116 1.00 103.26 ? 115 GLN B CG  1 
ATOM 1044 C CD  . GLN B 1 74 ? -101.057 -1.660  -15.463 1.00 103.68 ? 115 GLN B CD  1 
ATOM 1045 O OE1 . GLN B 1 74 ? -101.329 -2.250  -16.511 1.00 102.86 ? 115 GLN B OE1 1 
ATOM 1046 N NE2 . GLN B 1 74 ? -100.552 -0.428  -15.442 1.00 103.09 ? 115 GLN B NE2 1 
ATOM 1047 N N   . GLN B 1 75 ? -102.232 -6.267  -15.624 1.00 114.84 ? 116 GLN B N   1 
ATOM 1048 C CA  . GLN B 1 75 ? -102.904 -6.702  -16.842 1.00 123.88 ? 116 GLN B CA  1 
ATOM 1049 C C   . GLN B 1 75 ? -104.293 -7.162  -16.446 1.00 123.87 ? 116 GLN B C   1 
ATOM 1050 O O   . GLN B 1 75 ? -105.294 -6.552  -16.824 1.00 121.54 ? 116 GLN B O   1 
ATOM 1051 C CB  . GLN B 1 75 ? -102.172 -7.879  -17.486 1.00 135.35 ? 116 GLN B CB  1 
ATOM 1052 C CG  . GLN B 1 75 ? -103.026 -8.624  -18.513 1.00 147.96 ? 116 GLN B CG  1 
ATOM 1053 C CD  . GLN B 1 75 ? -102.569 -10.054 -18.741 1.00 152.28 ? 116 GLN B CD  1 
ATOM 1054 O OE1 . GLN B 1 75 ? -101.478 -10.291 -19.255 1.00 152.56 ? 116 GLN B OE1 1 
ATOM 1055 N NE2 . GLN B 1 75 ? -103.404 -11.015 -18.354 1.00 152.00 ? 116 GLN B NE2 1 
ATOM 1056 N N   . GLU B 1 76 ? -104.331 -8.250  -15.678 1.00 128.31 ? 117 GLU B N   1 
ATOM 1057 C CA  . GLU B 1 76 ? -105.579 -8.834  -15.206 1.00 131.43 ? 117 GLU B CA  1 
ATOM 1058 C C   . GLU B 1 76 ? -106.551 -7.817  -14.620 1.00 127.94 ? 117 GLU B C   1 
ATOM 1059 O O   . GLU B 1 76 ? -107.755 -7.927  -14.836 1.00 119.72 ? 117 GLU B O   1 
ATOM 1060 C CB  . GLU B 1 76 ? -105.296 -9.926  -14.181 1.00 139.49 ? 117 GLU B CB  1 
ATOM 1061 C CG  . GLU B 1 76 ? -104.662 -11.162 -14.777 1.00 160.60 ? 117 GLU B CG  1 
ATOM 1062 C CD  . GLU B 1 76 ? -104.557 -12.292 -13.775 1.00 171.06 ? 117 GLU B CD  1 
ATOM 1063 O OE1 . GLU B 1 76 ? -105.597 -12.659 -13.179 1.00 175.11 ? 117 GLU B OE1 1 
ATOM 1064 O OE2 . GLU B 1 76 ? -103.437 -12.815 -13.585 1.00 175.30 ? 117 GLU B OE2 1 
ATOM 1065 N N   . MET B 1 77 ? -106.046 -6.836  -13.873 1.00 125.15 ? 118 MET B N   1 
ATOM 1066 C CA  . MET B 1 77 ? -106.918 -5.808  -13.304 1.00 129.76 ? 118 MET B CA  1 
ATOM 1067 C C   . MET B 1 77 ? -107.614 -5.107  -14.469 1.00 132.39 ? 118 MET B C   1 
ATOM 1068 O O   . MET B 1 77 ? -108.824 -5.246  -14.650 1.00 142.94 ? 118 MET B O   1 
ATOM 1069 C CB  . MET B 1 77 ? -106.103 -4.801  -12.475 1.00 128.45 ? 118 MET B CB  1 
ATOM 1070 C CG  . MET B 1 77 ? -106.861 -3.540  -12.014 1.00 118.46 ? 118 MET B CG  1 
ATOM 1071 S SD  . MET B 1 77 ? -107.129 -2.273  -13.309 1.00 113.45 ? 118 MET B SD  1 
ATOM 1072 C CE  . MET B 1 77 ? -106.053 -0.941  -12.802 1.00 108.23 ? 118 MET B CE  1 
ATOM 1073 N N   . LEU B 1 78 ? -106.846 -4.368  -15.267 1.00 130.99 ? 119 LEU B N   1 
ATOM 1074 C CA  . LEU B 1 78 ? -107.405 -3.674  -16.415 1.00 119.75 ? 119 LEU B CA  1 
ATOM 1075 C C   . LEU B 1 78 ? -108.128 -4.690  -17.263 1.00 117.42 ? 119 LEU B C   1 
ATOM 1076 O O   . LEU B 1 78 ? -109.082 -4.370  -17.979 1.00 118.49 ? 119 LEU B O   1 
ATOM 1077 C CB  . LEU B 1 78 ? -106.303 -3.013  -17.237 1.00 108.09 ? 119 LEU B CB  1 
ATOM 1078 C CG  . LEU B 1 78 ? -105.955 -1.605  -16.774 1.00 98.59  ? 119 LEU B CG  1 
ATOM 1079 C CD1 . LEU B 1 78 ? -104.989 -0.952  -17.766 1.00 92.99  ? 119 LEU B CD1 1 
ATOM 1080 C CD2 . LEU B 1 78 ? -107.242 -0.798  -16.672 1.00 92.71  ? 119 LEU B CD2 1 
ATOM 1081 N N   . ALA B 1 79 ? -107.660 -5.926  -17.174 1.00 111.90 ? 120 ALA B N   1 
ATOM 1082 C CA  . ALA B 1 79 ? -108.260 -7.010  -17.920 1.00 113.03 ? 120 ALA B CA  1 
ATOM 1083 C C   . ALA B 1 79 ? -109.682 -7.213  -17.420 1.00 120.50 ? 120 ALA B C   1 
ATOM 1084 O O   . ALA B 1 79 ? -110.629 -6.640  -17.967 1.00 125.29 ? 120 ALA B O   1 
ATOM 1085 C CB  . ALA B 1 79 ? -107.449 -8.285  -17.737 1.00 95.58  ? 120 ALA B CB  1 
ATOM 1086 N N   . MET B 1 80 ? -109.814 -8.015  -16.365 1.00 131.73 ? 121 MET B N   1 
ATOM 1087 C CA  . MET B 1 80 ? -111.107 -8.332  -15.771 1.00 141.08 ? 121 MET B CA  1 
ATOM 1088 C C   . MET B 1 80 ? -111.994 -7.101  -15.583 1.00 141.88 ? 121 MET B C   1 
ATOM 1089 O O   . MET B 1 80 ? -113.220 -7.212  -15.544 1.00 142.78 ? 121 MET B O   1 
ATOM 1090 C CB  . MET B 1 80 ? -110.902 -9.053  -14.437 1.00 149.57 ? 121 MET B CB  1 
ATOM 1091 C CG  . MET B 1 80 ? -112.084 -9.907  -14.016 1.00 158.87 ? 121 MET B CG  1 
ATOM 1092 S SD  . MET B 1 80 ? -111.770 -10.869 -12.525 1.00 165.05 ? 121 MET B SD  1 
ATOM 1093 C CE  . MET B 1 80 ? -112.628 -9.876  -11.286 1.00 168.61 ? 121 MET B CE  1 
ATOM 1094 N N   . LYS B 1 81 ? -111.379 -5.929  -15.474 1.00 140.97 ? 122 LYS B N   1 
ATOM 1095 C CA  . LYS B 1 81 ? -112.142 -4.699  -15.318 1.00 141.35 ? 122 LYS B CA  1 
ATOM 1096 C C   . LYS B 1 81 ? -113.047 -4.477  -16.520 1.00 147.34 ? 122 LYS B C   1 
ATOM 1097 O O   . LYS B 1 81 ? -114.256 -4.322  -16.366 1.00 147.61 ? 122 LYS B O   1 
ATOM 1098 C CB  . LYS B 1 81 ? -111.215 -3.498  -15.179 1.00 134.75 ? 122 LYS B CB  1 
ATOM 1099 C CG  . LYS B 1 81 ? -111.913 -2.164  -15.393 1.00 126.69 ? 122 LYS B CG  1 
ATOM 1100 C CD  . LYS B 1 81 ? -110.908 -1.027  -15.450 1.00 124.19 ? 122 LYS B CD  1 
ATOM 1101 C CE  . LYS B 1 81 ? -111.587 0.311   -15.653 1.00 123.65 ? 122 LYS B CE  1 
ATOM 1102 N NZ  . LYS B 1 81 ? -110.612 1.433   -15.589 1.00 123.91 ? 122 LYS B NZ  1 
ATOM 1103 N N   . HIS B 1 82 ? -112.464 -4.462  -17.717 1.00 157.32 ? 123 HIS B N   1 
ATOM 1104 C CA  . HIS B 1 82 ? -113.253 -4.238  -18.925 1.00 167.59 ? 123 HIS B CA  1 
ATOM 1105 C C   . HIS B 1 82 ? -113.647 -5.507  -19.687 1.00 171.47 ? 123 HIS B C   1 
ATOM 1106 O O   . HIS B 1 82 ? -114.579 -5.476  -20.490 1.00 170.19 ? 123 HIS B O   1 
ATOM 1107 C CB  . HIS B 1 82 ? -112.524 -3.265  -19.862 1.00 173.26 ? 123 HIS B CB  1 
ATOM 1108 C CG  . HIS B 1 82 ? -113.379 -2.125  -20.335 1.00 181.52 ? 123 HIS B CG  1 
ATOM 1109 N ND1 . HIS B 1 82 ? -114.065 -1.299  -19.469 1.00 185.65 ? 123 HIS B ND1 1 
ATOM 1110 C CD2 . HIS B 1 82 ? -113.643 -1.662  -21.580 1.00 185.34 ? 123 HIS B CD2 1 
ATOM 1111 C CE1 . HIS B 1 82 ? -114.712 -0.377  -20.160 1.00 188.49 ? 123 HIS B CE1 1 
ATOM 1112 N NE2 . HIS B 1 82 ? -114.472 -0.575  -21.444 1.00 188.37 ? 123 HIS B NE2 1 
ATOM 1113 N N   . GLN B 1 83 ? -112.950 -6.616  -19.442 1.00 175.61 ? 124 GLN B N   1 
ATOM 1114 C CA  . GLN B 1 83 ? -113.280 -7.875  -20.117 1.00 183.39 ? 124 GLN B CA  1 
ATOM 1115 C C   . GLN B 1 83 ? -114.633 -8.334  -19.582 1.00 188.61 ? 124 GLN B C   1 
ATOM 1116 O O   . GLN B 1 83 ? -115.423 -8.963  -20.289 1.00 194.75 ? 124 GLN B O   1 
ATOM 1117 C CB  . GLN B 1 83 ? -112.223 -8.955  -19.832 1.00 182.22 ? 124 GLN B CB  1 
ATOM 1118 C CG  . GLN B 1 83 ? -112.320 -9.594  -18.444 1.00 175.89 ? 124 GLN B CG  1 
ATOM 1119 C CD  . GLN B 1 83 ? -111.317 -10.722 -18.226 1.00 173.15 ? 124 GLN B CD  1 
ATOM 1120 O OE1 . GLN B 1 83 ? -110.103 -10.510 -18.252 1.00 172.61 ? 124 GLN B OE1 1 
ATOM 1121 N NE2 . GLN B 1 83 ? -111.826 -11.930 -18.008 1.00 172.65 ? 124 GLN B NE2 1 
ATOM 1122 N N   . GLN B 1 84 ? -114.878 -8.007  -18.316 1.00 190.93 ? 125 GLN B N   1 
ATOM 1123 C CA  . GLN B 1 84 ? -116.120 -8.347  -17.635 1.00 188.51 ? 125 GLN B CA  1 
ATOM 1124 C C   . GLN B 1 84 ? -117.066 -7.155  -17.733 1.00 185.63 ? 125 GLN B C   1 
ATOM 1125 O O   . GLN B 1 84 ? -118.233 -7.245  -17.358 1.00 190.10 ? 125 GLN B O   1 
ATOM 1126 C CB  . GLN B 1 84 ? -115.835 -8.673  -16.164 1.00 187.83 ? 125 GLN B CB  1 
ATOM 1127 C CG  . GLN B 1 84 ? -117.074 -8.895  -15.305 1.00 181.82 ? 125 GLN B CG  1 
ATOM 1128 C CD  . GLN B 1 84 ? -116.741 -9.103  -13.834 1.00 178.59 ? 125 GLN B CD  1 
ATOM 1129 O OE1 . GLN B 1 84 ? -117.628 -9.104  -12.978 1.00 177.05 ? 125 GLN B OE1 1 
ATOM 1130 N NE2 . GLN B 1 84 ? -115.460 -9.284  -13.535 1.00 176.64 ? 125 GLN B NE2 1 
ATOM 1131 N N   . GLU B 1 85 ? -116.552 -6.040  -18.246 1.00 179.68 ? 126 GLU B N   1 
ATOM 1132 C CA  . GLU B 1 85 ? -117.348 -4.829  -18.400 1.00 170.76 ? 126 GLU B CA  1 
ATOM 1133 C C   . GLU B 1 85 ? -118.213 -4.930  -19.641 1.00 173.03 ? 126 GLU B C   1 
ATOM 1134 O O   . GLU B 1 85 ? -118.788 -3.943  -20.102 1.00 175.10 ? 126 GLU B O   1 
ATOM 1135 C CB  . GLU B 1 85 ? -116.449 -3.604  -18.509 1.00 156.71 ? 126 GLU B CB  1 
ATOM 1136 C CG  . GLU B 1 85 ? -117.033 -2.386  -17.842 1.00 138.49 ? 126 GLU B CG  1 
ATOM 1137 C CD  . GLU B 1 85 ? -117.323 -2.638  -16.374 1.00 131.36 ? 126 GLU B CD  1 
ATOM 1138 O OE1 . GLU B 1 85 ? -117.744 -1.691  -15.680 1.00 128.97 ? 126 GLU B OE1 1 
ATOM 1139 O OE2 . GLU B 1 85 ? -117.131 -3.784  -15.908 1.00 128.02 ? 126 GLU B OE2 1 
ATOM 1140 N N   . LEU B 1 86 ? -118.278 -6.140  -20.183 1.00 171.91 ? 127 LEU B N   1 
ATOM 1141 C CA  . LEU B 1 86 ? -119.078 -6.429  -21.362 1.00 172.52 ? 127 LEU B CA  1 
ATOM 1142 C C   . LEU B 1 86 ? -120.396 -7.020  -20.857 1.00 181.39 ? 127 LEU B C   1 
ATOM 1143 O O   . LEU B 1 86 ? -121.460 -6.785  -21.436 1.00 192.11 ? 127 LEU B O   1 
ATOM 1144 C CB  . LEU B 1 86 ? -118.333 -7.425  -22.262 1.00 153.19 ? 127 LEU B CB  1 
ATOM 1145 C CG  . LEU B 1 86 ? -117.879 -6.947  -23.652 1.00 129.31 ? 127 LEU B CG  1 
ATOM 1146 C CD1 . LEU B 1 86 ? -117.286 -5.544  -23.579 1.00 114.41 ? 127 LEU B CD1 1 
ATOM 1147 C CD2 . LEU B 1 86 ? -116.868 -7.935  -24.221 1.00 114.31 ? 127 LEU B CD2 1 
ATOM 1148 N N   . LEU B 1 87 ? -120.313 -7.777  -19.763 1.00 185.16 ? 128 LEU B N   1 
ATOM 1149 C CA  . LEU B 1 87 ? -121.492 -8.383  -19.149 1.00 183.19 ? 128 LEU B CA  1 
ATOM 1150 C C   . LEU B 1 87 ? -122.104 -7.350  -18.205 1.00 188.48 ? 128 LEU B C   1 
ATOM 1151 O O   . LEU B 1 87 ? -123.191 -7.554  -17.665 1.00 194.08 ? 128 LEU B O   1 
ATOM 1152 C CB  . LEU B 1 87 ? -121.117 -9.645  -18.352 1.00 167.05 ? 128 LEU B CB  1 
ATOM 1153 C CG  . LEU B 1 87 ? -120.387 -10.807 -19.043 1.00 148.91 ? 128 LEU B CG  1 
ATOM 1154 C CD1 . LEU B 1 87 ? -118.899 -10.485 -19.175 1.00 136.65 ? 128 LEU B CD1 1 
ATOM 1155 C CD2 . LEU B 1 87 ? -120.564 -12.078 -18.226 1.00 136.82 ? 128 LEU B CD2 1 
ATOM 1156 N N   . GLU B 1 88 ? -121.390 -6.241  -18.017 1.00 190.69 ? 129 GLU B N   1 
ATOM 1157 C CA  . GLU B 1 88 ? -121.823 -5.149  -17.143 1.00 189.40 ? 129 GLU B CA  1 
ATOM 1158 C C   . GLU B 1 88 ? -122.161 -3.899  -17.965 1.00 188.03 ? 129 GLU B C   1 
ATOM 1159 O O   . GLU B 1 88 ? -123.231 -3.301  -17.727 1.00 188.69 ? 129 GLU B O   1 
ATOM 1160 C CB  . GLU B 1 88 ? -120.721 -4.811  -16.122 1.00 191.10 ? 129 GLU B CB  1 
ATOM 1161 C CG  . GLU B 1 88 ? -120.218 -6.001  -15.290 1.00 189.43 ? 129 GLU B CG  1 
ATOM 1162 C CD  . GLU B 1 88 ? -119.091 -5.631  -14.329 1.00 188.78 ? 129 GLU B CD  1 
ATOM 1163 O OE1 . GLU B 1 88 ? -119.341 -4.870  -13.370 1.00 188.98 ? 129 GLU B OE1 1 
ATOM 1164 O OE2 . GLU B 1 88 ? -117.952 -6.101  -14.534 1.00 188.93 ? 129 GLU B OE2 1 
ATOM 1165 N N   . ALA C 1 21 ? -105.466 -9.815  -37.984 1.00 144.47 ? 62  ALA C N   1 
ATOM 1166 C CA  . ALA C 1 21 ? -105.492 -9.332  -36.572 1.00 145.39 ? 62  ALA C CA  1 
ATOM 1167 C C   . ALA C 1 21 ? -104.932 -7.912  -36.469 1.00 146.41 ? 62  ALA C C   1 
ATOM 1168 O O   . ALA C 1 21 ? -104.232 -7.449  -37.369 1.00 145.63 ? 62  ALA C O   1 
ATOM 1169 C CB  . ALA C 1 21 ? -104.684 -10.277 -35.688 1.00 145.59 ? 62  ALA C CB  1 
ATOM 1170 N N   . GLU C 1 22 ? -105.250 -7.221  -35.375 1.00 150.61 ? 63  GLU C N   1 
ATOM 1171 C CA  . GLU C 1 22 ? -104.765 -5.859  -35.160 1.00 153.42 ? 63  GLU C CA  1 
ATOM 1172 C C   . GLU C 1 22 ? -104.370 -5.695  -33.687 1.00 153.51 ? 63  GLU C C   1 
ATOM 1173 O O   . GLU C 1 22 ? -103.184 -5.576  -33.367 1.00 153.66 ? 63  GLU C O   1 
ATOM 1174 C CB  . GLU C 1 22 ? -105.845 -4.837  -35.569 1.00 153.01 ? 63  GLU C CB  1 
ATOM 1175 C CG  . GLU C 1 22 ? -105.332 -3.435  -35.919 1.00 157.25 ? 63  GLU C CG  1 
ATOM 1176 C CD  . GLU C 1 22 ? -105.080 -2.555  -34.702 1.00 160.73 ? 63  GLU C CD  1 
ATOM 1177 O OE1 . GLU C 1 22 ? -104.267 -2.937  -33.839 1.00 162.90 ? 63  GLU C OE1 1 
ATOM 1178 O OE2 . GLU C 1 22 ? -105.693 -1.470  -34.612 1.00 163.03 ? 63  GLU C OE2 1 
ATOM 1179 N N   . PRO C 1 23 ? -105.353 -5.706  -32.764 1.00 155.90 ? 64  PRO C N   1 
ATOM 1180 C CA  . PRO C 1 23 ? -104.972 -5.551  -31.357 1.00 157.05 ? 64  PRO C CA  1 
ATOM 1181 C C   . PRO C 1 23 ? -104.087 -6.705  -30.889 1.00 152.32 ? 64  PRO C C   1 
ATOM 1182 O O   . PRO C 1 23 ? -102.961 -6.489  -30.441 1.00 169.85 ? 64  PRO C O   1 
ATOM 1183 C CB  . PRO C 1 23 ? -106.319 -5.505  -30.637 1.00 164.26 ? 64  PRO C CB  1 
ATOM 1184 C CG  . PRO C 1 23 ? -107.170 -6.393  -31.482 1.00 160.96 ? 64  PRO C CG  1 
ATOM 1185 C CD  . PRO C 1 23 ? -106.800 -5.968  -32.887 1.00 161.75 ? 64  PRO C CD  1 
ATOM 1186 N N   . ALA C 1 24 ? -104.598 -7.928  -31.009 1.00 145.03 ? 65  ALA C N   1 
ATOM 1187 C CA  . ALA C 1 24 ? -103.857 -9.128  -30.609 1.00 122.08 ? 65  ALA C CA  1 
ATOM 1188 C C   . ALA C 1 24 ? -102.516 -9.159  -31.327 1.00 108.99 ? 65  ALA C C   1 
ATOM 1189 O O   . ALA C 1 24 ? -101.651 -9.990  -31.043 1.00 99.13  ? 65  ALA C O   1 
ATOM 1190 C CB  . ALA C 1 24 ? -104.661 -10.385 -30.948 1.00 113.69 ? 65  ALA C CB  1 
ATOM 1191 N N   . LEU C 1 25 ? -102.363 -8.251  -32.279 1.00 98.53  ? 66  LEU C N   1 
ATOM 1192 C CA  . LEU C 1 25 ? -101.130 -8.160  -33.023 1.00 96.90  ? 66  LEU C CA  1 
ATOM 1193 C C   . LEU C 1 25 ? -100.284 -7.146  -32.254 1.00 101.13 ? 66  LEU C C   1 
ATOM 1194 O O   . LEU C 1 25 ? -99.092  -7.361  -32.014 1.00 103.61 ? 66  LEU C O   1 
ATOM 1195 C CB  . LEU C 1 25 ? -101.417 -7.676  -34.446 1.00 89.85  ? 66  LEU C CB  1 
ATOM 1196 C CG  . LEU C 1 25 ? -100.321 -7.936  -35.485 1.00 81.51  ? 66  LEU C CG  1 
ATOM 1197 C CD1 . LEU C 1 25 ? -100.418 -9.380  -35.981 1.00 76.57  ? 66  LEU C CD1 1 
ATOM 1198 C CD2 . LEU C 1 25 ? -100.476 -6.947  -36.641 1.00 77.46  ? 66  LEU C CD2 1 
ATOM 1199 N N   . ARG C 1 26 ? -100.926 -6.051  -31.849 1.00 105.57 ? 67  ARG C N   1 
ATOM 1200 C CA  . ARG C 1 26 ? -100.262 -5.000  -31.086 1.00 108.63 ? 67  ARG C CA  1 
ATOM 1201 C C   . ARG C 1 26 ? -99.792  -5.588  -29.753 1.00 106.35 ? 67  ARG C C   1 
ATOM 1202 O O   . ARG C 1 26 ? -98.785  -5.164  -29.185 1.00 105.68 ? 67  ARG C O   1 
ATOM 1203 C CB  . ARG C 1 26 ? -101.233 -3.842  -30.841 1.00 114.45 ? 67  ARG C CB  1 
ATOM 1204 C CG  . ARG C 1 26 ? -100.564 -2.478  -30.718 1.00 121.53 ? 67  ARG C CG  1 
ATOM 1205 C CD  . ARG C 1 26 ? -99.614  -2.242  -31.886 1.00 124.94 ? 67  ARG C CD  1 
ATOM 1206 N NE  . ARG C 1 26 ? -99.764  -0.929  -32.508 1.00 126.34 ? 67  ARG C NE  1 
ATOM 1207 C CZ  . ARG C 1 26 ? -100.859 -0.514  -33.141 1.00 126.97 ? 67  ARG C CZ  1 
ATOM 1208 N NH1 . ARG C 1 26 ? -101.921 -1.304  -33.238 1.00 126.92 ? 67  ARG C NH1 1 
ATOM 1209 N NH2 . ARG C 1 26 ? -100.888 0.690   -33.697 1.00 126.79 ? 67  ARG C NH2 1 
ATOM 1210 N N   . GLU C 1 27 ? -100.541 -6.575  -29.271 1.00 103.38 ? 68  GLU C N   1 
ATOM 1211 C CA  . GLU C 1 27 ? -100.239 -7.273  -28.031 1.00 98.46  ? 68  GLU C CA  1 
ATOM 1212 C C   . GLU C 1 27 ? -98.898  -7.975  -28.199 1.00 92.74  ? 68  GLU C C   1 
ATOM 1213 O O   . GLU C 1 27 ? -97.980  -7.799  -27.402 1.00 88.75  ? 68  GLU C O   1 
ATOM 1214 C CB  . GLU C 1 27 ? -101.349 -8.289  -27.750 1.00 104.26 ? 68  GLU C CB  1 
ATOM 1215 C CG  . GLU C 1 27 ? -101.197 -9.135  -26.501 1.00 117.23 ? 68  GLU C CG  1 
ATOM 1216 C CD  . GLU C 1 27 ? -102.507 -9.811  -26.115 1.00 124.39 ? 68  GLU C CD  1 
ATOM 1217 O OE1 . GLU C 1 27 ? -103.422 -9.098  -25.642 1.00 127.80 ? 68  GLU C OE1 1 
ATOM 1218 O OE2 . GLU C 1 27 ? -102.627 -11.044 -26.295 1.00 127.86 ? 68  GLU C OE2 1 
ATOM 1219 N N   . GLN C 1 28 ? -98.791  -8.762  -29.259 1.00 89.69  ? 69  GLN C N   1 
ATOM 1220 C CA  . GLN C 1 28 ? -97.567  -9.489  -29.551 1.00 88.64  ? 69  GLN C CA  1 
ATOM 1221 C C   . GLN C 1 28 ? -96.430  -8.491  -29.710 1.00 85.99  ? 69  GLN C C   1 
ATOM 1222 O O   . GLN C 1 28 ? -95.264  -8.829  -29.505 1.00 81.70  ? 69  GLN C O   1 
ATOM 1223 C CB  . GLN C 1 28 ? -97.724  -10.295 -30.846 1.00 93.90  ? 69  GLN C CB  1 
ATOM 1224 C CG  . GLN C 1 28 ? -96.611  -11.317 -31.095 1.00 104.14 ? 69  GLN C CG  1 
ATOM 1225 C CD  . GLN C 1 28 ? -96.728  -12.006 -32.454 1.00 109.37 ? 69  GLN C CD  1 
ATOM 1226 O OE1 . GLN C 1 28 ? -97.819  -12.402 -32.870 1.00 111.55 ? 69  GLN C OE1 1 
ATOM 1227 N NE2 . GLN C 1 28 ? -95.597  -12.161 -33.142 1.00 111.07 ? 69  GLN C NE2 1 
ATOM 1228 N N   . GLN C 1 29 ? -96.754  -7.256  -30.076 1.00 84.97  ? 70  GLN C N   1 
ATOM 1229 C CA  . GLN C 1 29 ? -95.684  -6.288  -30.234 1.00 88.64  ? 70  GLN C CA  1 
ATOM 1230 C C   . GLN C 1 29 ? -94.972  -6.132  -28.898 1.00 88.15  ? 70  GLN C C   1 
ATOM 1231 O O   . GLN C 1 29 ? -93.760  -6.376  -28.806 1.00 89.47  ? 70  GLN C O   1 
ATOM 1232 C CB  . GLN C 1 29 ? -96.204  -4.923  -30.704 1.00 91.11  ? 70  GLN C CB  1 
ATOM 1233 C CG  . GLN C 1 29 ? -95.250  -4.255  -31.704 1.00 93.19  ? 70  GLN C CG  1 
ATOM 1234 C CD  . GLN C 1 29 ? -95.467  -2.764  -31.858 1.00 94.82  ? 70  GLN C CD  1 
ATOM 1235 O OE1 . GLN C 1 29 ? -96.601  -2.293  -31.951 1.00 96.73  ? 70  GLN C OE1 1 
ATOM 1236 N NE2 . GLN C 1 29 ? -94.370  -2.007  -31.902 1.00 94.13  ? 70  GLN C NE2 1 
ATOM 1237 N N   . LEU C 1 30 ? -95.742  -5.753  -27.867 1.00 86.44  ? 71  LEU C N   1 
ATOM 1238 C CA  . LEU C 1 30 ? -95.236  -5.539  -26.507 1.00 82.19  ? 71  LEU C CA  1 
ATOM 1239 C C   . LEU C 1 30 ? -94.500  -6.726  -25.932 1.00 84.42  ? 71  LEU C C   1 
ATOM 1240 O O   . LEU C 1 30 ? -93.332  -6.630  -25.573 1.00 83.52  ? 71  LEU C O   1 
ATOM 1241 C CB  . LEU C 1 30 ? -96.379  -5.161  -25.578 1.00 76.01  ? 71  LEU C CB  1 
ATOM 1242 C CG  . LEU C 1 30 ? -96.963  -3.769  -25.866 1.00 72.89  ? 71  LEU C CG  1 
ATOM 1243 C CD1 . LEU C 1 30 ? -97.889  -3.375  -24.723 1.00 70.09  ? 71  LEU C CD1 1 
ATOM 1244 C CD2 . LEU C 1 30 ? -95.856  -2.719  -26.020 1.00 69.50  ? 71  LEU C CD2 1 
ATOM 1245 N N   . GLN C 1 31 ? -95.187  -7.849  -25.838 1.00 90.48  ? 72  GLN C N   1 
ATOM 1246 C CA  . GLN C 1 31 ? -94.569  -9.053  -25.313 1.00 98.36  ? 72  GLN C CA  1 
ATOM 1247 C C   . GLN C 1 31 ? -93.176  -9.256  -25.905 1.00 96.63  ? 72  GLN C C   1 
ATOM 1248 O O   . GLN C 1 31 ? -92.294  -9.840  -25.280 1.00 90.52  ? 72  GLN C O   1 
ATOM 1249 C CB  . GLN C 1 31 ? -95.455  -10.255 -25.629 1.00 112.83 ? 72  GLN C CB  1 
ATOM 1250 C CG  . GLN C 1 31 ? -96.821  -10.179 -24.969 1.00 137.76 ? 72  GLN C CG  1 
ATOM 1251 C CD  . GLN C 1 31 ? -97.822  -11.120 -25.597 1.00 150.28 ? 72  GLN C CD  1 
ATOM 1252 O OE1 . GLN C 1 31 ? -98.944  -11.262 -25.114 1.00 156.89 ? 72  GLN C OE1 1 
ATOM 1253 N NE2 . GLN C 1 31 ? -97.424  -11.766 -26.688 1.00 156.87 ? 72  GLN C NE2 1 
ATOM 1254 N N   . GLN C 1 32 ? -92.974  -8.773  -27.119 1.00 100.01 ? 73  GLN C N   1 
ATOM 1255 C CA  . GLN C 1 32 ? -91.683  -8.925  -27.751 1.00 106.06 ? 73  GLN C CA  1 
ATOM 1256 C C   . GLN C 1 32 ? -90.798  -7.766  -27.354 1.00 101.54 ? 73  GLN C C   1 
ATOM 1257 O O   . GLN C 1 32 ? -89.601  -7.940  -27.154 1.00 93.63  ? 73  GLN C O   1 
ATOM 1258 C CB  . GLN C 1 32 ? -91.854  -9.000  -29.265 1.00 121.63 ? 73  GLN C CB  1 
ATOM 1259 C CG  . GLN C 1 32 ? -92.558  -10.274 -29.716 1.00 147.12 ? 73  GLN C CG  1 
ATOM 1260 C CD  . GLN C 1 32 ? -92.763  -10.333 -31.213 1.00 158.47 ? 73  GLN C CD  1 
ATOM 1261 O OE1 . GLN C 1 32 ? -93.195  -11.354 -31.755 1.00 162.12 ? 73  GLN C OE1 1 
ATOM 1262 N NE2 . GLN C 1 32 ? -92.459  -9.235  -31.894 1.00 162.31 ? 73  GLN C NE2 1 
ATOM 1263 N N   . GLU C 1 33 ? -91.387  -6.580  -27.237 1.00 100.12 ? 74  GLU C N   1 
ATOM 1264 C CA  . GLU C 1 33 ? -90.641  -5.393  -26.825 1.00 102.40 ? 74  GLU C CA  1 
ATOM 1265 C C   . GLU C 1 33 ? -89.985  -5.701  -25.473 1.00 99.11  ? 74  GLU C C   1 
ATOM 1266 O O   . GLU C 1 33 ? -88.760  -5.649  -25.320 1.00 98.52  ? 74  GLU C O   1 
ATOM 1267 C CB  . GLU C 1 33 ? -91.597  -4.211  -26.679 1.00 109.18 ? 74  GLU C CB  1 
ATOM 1268 C CG  . GLU C 1 33 ? -91.247  -3.045  -27.565 1.00 119.45 ? 74  GLU C CG  1 
ATOM 1269 C CD  . GLU C 1 33 ? -92.451  -2.488  -28.292 1.00 123.75 ? 74  GLU C CD  1 
ATOM 1270 O OE1 . GLU C 1 33 ? -93.323  -1.878  -27.634 1.00 123.87 ? 74  GLU C OE1 1 
ATOM 1271 O OE2 . GLU C 1 33 ? -92.525  -2.668  -29.527 1.00 125.63 ? 74  GLU C OE2 1 
ATOM 1272 N N   . LEU C 1 34 ? -90.838  -6.031  -24.506 1.00 94.31  ? 75  LEU C N   1 
ATOM 1273 C CA  . LEU C 1 34 ? -90.446  -6.391  -23.149 1.00 88.35  ? 75  LEU C CA  1 
ATOM 1274 C C   . LEU C 1 34 ? -89.272  -7.373  -23.146 1.00 88.31  ? 75  LEU C C   1 
ATOM 1275 O O   . LEU C 1 34 ? -88.167  -7.037  -22.747 1.00 88.03  ? 75  LEU C O   1 
ATOM 1276 C CB  . LEU C 1 34 ? -91.654  -7.025  -22.455 1.00 82.74  ? 75  LEU C CB  1 
ATOM 1277 C CG  . LEU C 1 34 ? -91.649  -7.398  -20.976 1.00 77.67  ? 75  LEU C CG  1 
ATOM 1278 C CD1 . LEU C 1 34 ? -91.551  -6.144  -20.139 1.00 74.06  ? 75  LEU C CD1 1 
ATOM 1279 C CD2 . LEU C 1 34 ? -92.920  -8.166  -20.654 1.00 73.18  ? 75  LEU C CD2 1 
ATOM 1280 N N   . LEU C 1 35 ? -89.535  -8.594  -23.586 1.00 91.42  ? 76  LEU C N   1 
ATOM 1281 C CA  . LEU C 1 35 ? -88.530  -9.647  -23.650 1.00 94.56  ? 76  LEU C CA  1 
ATOM 1282 C C   . LEU C 1 35 ? -87.259  -9.156  -24.345 1.00 91.24  ? 76  LEU C C   1 
ATOM 1283 O O   . LEU C 1 35 ? -86.216  -9.815  -24.309 1.00 84.17  ? 76  LEU C O   1 
ATOM 1284 C CB  . LEU C 1 35 ? -89.108  -10.843 -24.407 1.00 107.46 ? 76  LEU C CB  1 
ATOM 1285 C CG  . LEU C 1 35 ? -88.401  -12.193 -24.329 1.00 122.63 ? 76  LEU C CG  1 
ATOM 1286 C CD1 . LEU C 1 35 ? -88.359  -12.664 -22.883 1.00 132.33 ? 76  LEU C CD1 1 
ATOM 1287 C CD2 . LEU C 1 35 ? -89.153  -13.202 -25.188 1.00 132.44 ? 76  LEU C CD2 1 
ATOM 1288 N N   . ALA C 1 36 ? -87.357  -8.006  -25.000 1.00 90.32  ? 77  ALA C N   1 
ATOM 1289 C CA  . ALA C 1 36 ? -86.211  -7.435  -25.692 1.00 93.79  ? 77  ALA C CA  1 
ATOM 1290 C C   . ALA C 1 36 ? -85.518  -6.506  -24.715 1.00 93.11  ? 77  ALA C C   1 
ATOM 1291 O O   . ALA C 1 36 ? -84.339  -6.193  -24.849 1.00 95.56  ? 77  ALA C O   1 
ATOM 1292 C CB  . ALA C 1 36 ? -86.668  -6.664  -26.912 1.00 98.32  ? 77  ALA C CB  1 
ATOM 1293 N N   . LEU C 1 37 ? -86.278  -6.070  -23.722 1.00 89.35  ? 78  LEU C N   1 
ATOM 1294 C CA  . LEU C 1 37 ? -85.778  -5.180  -22.697 1.00 85.26  ? 78  LEU C CA  1 
ATOM 1295 C C   . LEU C 1 37 ? -84.875  -5.955  -21.776 1.00 91.84  ? 78  LEU C C   1 
ATOM 1296 O O   . LEU C 1 37 ? -83.707  -5.622  -21.615 1.00 97.01  ? 78  LEU C O   1 
ATOM 1297 C CB  . LEU C 1 37 ? -86.932  -4.627  -21.895 1.00 68.20  ? 78  LEU C CB  1 
ATOM 1298 C CG  . LEU C 1 37 ? -86.596  -3.306  -21.242 1.00 53.10  ? 78  LEU C CG  1 
ATOM 1299 C CD1 . LEU C 1 37 ? -86.073  -2.350  -22.284 1.00 45.84  ? 78  LEU C CD1 1 
ATOM 1300 C CD2 . LEU C 1 37 ? -87.835  -2.724  -20.580 1.00 46.67  ? 78  LEU C CD2 1 
ATOM 1301 N N   . LYS C 1 38 ? -85.435  -6.996  -21.170 1.00 99.59  ? 79  LYS C N   1 
ATOM 1302 C CA  . LYS C 1 38 ? -84.691  -7.849  -20.255 1.00 105.67 ? 79  LYS C CA  1 
ATOM 1303 C C   . LYS C 1 38 ? -83.329  -8.234  -20.822 1.00 105.81 ? 79  LYS C C   1 
ATOM 1304 O O   . LYS C 1 38 ? -82.302  -8.054  -20.164 1.00 103.84 ? 79  LYS C O   1 
ATOM 1305 C CB  . LYS C 1 38 ? -85.481  -9.124  -19.952 1.00 111.75 ? 79  LYS C CB  1 
ATOM 1306 C CG  . LYS C 1 38 ? -84.652  -10.210 -19.270 1.00 121.07 ? 79  LYS C CG  1 
ATOM 1307 C CD  . LYS C 1 38 ? -85.391  -11.538 -19.235 1.00 127.23 ? 79  LYS C CD  1 
ATOM 1308 C CE  . LYS C 1 38 ? -84.523  -12.645 -18.660 1.00 130.25 ? 79  LYS C CE  1 
ATOM 1309 N NZ  . LYS C 1 38 ? -85.214  -13.966 -18.695 1.00 132.10 ? 79  LYS C NZ  1 
ATOM 1310 N N   . GLN C 1 39 ? -83.320  -8.764  -22.042 1.00 106.72 ? 80  GLN C N   1 
ATOM 1311 C CA  . GLN C 1 39 ? -82.076  -9.186  -22.668 1.00 106.49 ? 80  GLN C CA  1 
ATOM 1312 C C   . GLN C 1 39 ? -81.132  -8.009  -22.838 1.00 94.10  ? 80  GLN C C   1 
ATOM 1313 O O   . GLN C 1 39 ? -79.931  -8.137  -22.628 1.00 91.66  ? 80  GLN C O   1 
ATOM 1314 C CB  . GLN C 1 39 ? -82.343  -9.843  -24.025 1.00 125.86 ? 80  GLN C CB  1 
ATOM 1315 C CG  . GLN C 1 39 ? -81.222  -10.785 -24.459 1.00 152.23 ? 80  GLN C CG  1 
ATOM 1316 C CD  . GLN C 1 39 ? -81.397  -11.320 -25.867 1.00 164.54 ? 80  GLN C CD  1 
ATOM 1317 O OE1 . GLN C 1 39 ? -80.632  -12.174 -26.316 1.00 169.97 ? 80  GLN C OE1 1 
ATOM 1318 N NE2 . GLN C 1 39 ? -82.401  -10.815 -26.574 1.00 170.38 ? 80  GLN C NE2 1 
ATOM 1319 N N   . LYS C 1 40 ? -81.670  -6.859  -23.218 1.00 82.09  ? 81  LYS C N   1 
ATOM 1320 C CA  . LYS C 1 40 ? -80.831  -5.684  -23.386 1.00 72.85  ? 81  LYS C CA  1 
ATOM 1321 C C   . LYS C 1 40 ? -80.187  -5.363  -22.036 1.00 72.19  ? 81  LYS C C   1 
ATOM 1322 O O   . LYS C 1 40 ? -78.952  -5.418  -21.885 1.00 69.08  ? 81  LYS C O   1 
ATOM 1323 C CB  . LYS C 1 40 ? -81.669  -4.498  -23.841 1.00 67.52  ? 81  LYS C CB  1 
ATOM 1324 C CG  . LYS C 1 40 ? -80.866  -3.235  -24.082 1.00 66.73  ? 81  LYS C CG  1 
ATOM 1325 C CD  . LYS C 1 40 ? -81.783  -2.053  -24.425 1.00 68.88  ? 81  LYS C CD  1 
ATOM 1326 C CE  . LYS C 1 40 ? -80.991  -0.826  -24.914 1.00 73.08  ? 81  LYS C CE  1 
ATOM 1327 N NZ  . LYS C 1 40 ? -81.834  0.420   -24.931 1.00 73.79  ? 81  LYS C NZ  1 
ATOM 1328 N N   . GLN C 1 41 ? -81.037  -5.047  -21.055 1.00 70.98  ? 82  GLN C N   1 
ATOM 1329 C CA  . GLN C 1 41 ? -80.598  -4.729  -19.702 1.00 73.31  ? 82  GLN C CA  1 
ATOM 1330 C C   . GLN C 1 41 ? -79.599  -5.721  -19.138 1.00 76.19  ? 82  GLN C C   1 
ATOM 1331 O O   . GLN C 1 41 ? -78.548  -5.319  -18.643 1.00 79.15  ? 82  GLN C O   1 
ATOM 1332 C CB  . GLN C 1 41 ? -81.786  -4.648  -18.766 1.00 71.41  ? 82  GLN C CB  1 
ATOM 1333 C CG  . GLN C 1 41 ? -82.579  -3.384  -18.918 1.00 67.48  ? 82  GLN C CG  1 
ATOM 1334 C CD  . GLN C 1 41 ? -83.823  -3.380  -18.051 1.00 67.90  ? 82  GLN C CD  1 
ATOM 1335 O OE1 . GLN C 1 41 ? -84.449  -2.337  -17.852 1.00 67.53  ? 82  GLN C OE1 1 
ATOM 1336 N NE2 . GLN C 1 41 ? -84.199  -4.557  -17.539 1.00 68.68  ? 82  GLN C NE2 1 
ATOM 1337 N N   . GLN C 1 42 ? -79.908  -7.012  -19.195 1.00 79.28  ? 83  GLN C N   1 
ATOM 1338 C CA  . GLN C 1 42 ? -78.953  -7.972  -18.675 1.00 81.66  ? 83  GLN C CA  1 
ATOM 1339 C C   . GLN C 1 42 ? -77.573  -7.854  -19.347 1.00 81.78  ? 83  GLN C C   1 
ATOM 1340 O O   . GLN C 1 42 ? -76.572  -8.326  -18.801 1.00 78.03  ? 83  GLN C O   1 
ATOM 1341 C CB  . GLN C 1 42 ? -79.439  -9.406  -18.813 1.00 85.21  ? 83  GLN C CB  1 
ATOM 1342 C CG  . GLN C 1 42 ? -78.434  -10.363 -18.189 1.00 95.03  ? 83  GLN C CG  1 
ATOM 1343 C CD  . GLN C 1 42 ? -78.584  -11.788 -18.650 1.00 100.60 ? 83  GLN C CD  1 
ATOM 1344 O OE1 . GLN C 1 42 ? -79.634  -12.412 -18.457 1.00 102.80 ? 83  GLN C OE1 1 
ATOM 1345 N NE2 . GLN C 1 42 ? -77.528  -12.322 -19.264 1.00 102.07 ? 83  GLN C NE2 1 
ATOM 1346 N N   . ILE C 1 43 ? -77.497  -7.253  -20.533 1.00 82.30  ? 84  ILE C N   1 
ATOM 1347 C CA  . ILE C 1 43 ? -76.187  -7.111  -21.153 1.00 85.34  ? 84  ILE C CA  1 
ATOM 1348 C C   . ILE C 1 43 ? -75.578  -5.900  -20.494 1.00 82.84  ? 84  ILE C C   1 
ATOM 1349 O O   . ILE C 1 43 ? -74.446  -5.935  -20.026 1.00 82.16  ? 84  ILE C O   1 
ATOM 1350 C CB  . ILE C 1 43 ? -76.245  -6.837  -22.675 1.00 92.53  ? 84  ILE C CB  1 
ATOM 1351 C CG1 . ILE C 1 43 ? -76.786  -8.052  -23.430 1.00 98.77  ? 84  ILE C CG1 1 
ATOM 1352 C CG2 . ILE C 1 43 ? -74.835  -6.516  -23.186 1.00 97.14  ? 84  ILE C CG2 1 
ATOM 1353 C CD1 . ILE C 1 43 ? -75.801  -9.196  -23.561 1.00 103.95 ? 84  ILE C CD1 1 
ATOM 1354 N N   . GLN C 1 44 ? -76.346  -4.823  -20.453 1.00 81.46  ? 85  GLN C N   1 
ATOM 1355 C CA  . GLN C 1 44 ? -75.856  -3.606  -19.850 1.00 82.08  ? 85  GLN C CA  1 
ATOM 1356 C C   . GLN C 1 44 ? -75.234  -3.850  -18.470 1.00 80.66  ? 85  GLN C C   1 
ATOM 1357 O O   . GLN C 1 44 ? -74.073  -3.476  -18.228 1.00 79.92  ? 85  GLN C O   1 
ATOM 1358 C CB  . GLN C 1 44 ? -76.979  -2.570  -19.769 1.00 85.41  ? 85  GLN C CB  1 
ATOM 1359 C CG  . GLN C 1 44 ? -77.225  -1.887  -21.095 1.00 93.26  ? 85  GLN C CG  1 
ATOM 1360 C CD  . GLN C 1 44 ? -78.001  -0.592  -20.976 1.00 98.08  ? 85  GLN C CD  1 
ATOM 1361 O OE1 . GLN C 1 44 ? -79.235  -0.590  -20.931 1.00 101.52 ? 85  GLN C OE1 1 
ATOM 1362 N NE2 . GLN C 1 44 ? -77.278  0.524   -20.924 1.00 99.98  ? 85  GLN C NE2 1 
ATOM 1363 N N   . ARG C 1 45 ? -75.989  -4.481  -17.572 1.00 77.56  ? 86  ARG C N   1 
ATOM 1364 C CA  . ARG C 1 45 ? -75.474  -4.766  -16.235 1.00 74.81  ? 86  ARG C CA  1 
ATOM 1365 C C   . ARG C 1 45 ? -74.118  -5.427  -16.311 1.00 77.33  ? 86  ARG C C   1 
ATOM 1366 O O   . ARG C 1 45 ? -73.230  -5.121  -15.517 1.00 77.85  ? 86  ARG C O   1 
ATOM 1367 C CB  . ARG C 1 45 ? -76.400  -5.691  -15.468 1.00 70.49  ? 86  ARG C CB  1 
ATOM 1368 C CG  . ARG C 1 45 ? -77.556  -5.003  -14.791 1.00 64.34  ? 86  ARG C CG  1 
ATOM 1369 C CD  . ARG C 1 45 ? -78.146  -6.005  -13.852 1.00 63.04  ? 86  ARG C CD  1 
ATOM 1370 N NE  . ARG C 1 45 ? -79.037  -6.971  -14.491 1.00 61.59  ? 86  ARG C NE  1 
ATOM 1371 C CZ  . ARG C 1 45 ? -80.247  -6.647  -14.936 1.00 61.65  ? 86  ARG C CZ  1 
ATOM 1372 N NH1 . ARG C 1 45 ? -80.679  -5.382  -14.817 1.00 58.90  ? 86  ARG C NH1 1 
ATOM 1373 N NH2 . ARG C 1 45 ? -81.035  -7.586  -15.455 1.00 61.28  ? 86  ARG C NH2 1 
ATOM 1374 N N   . GLN C 1 46 ? -73.960  -6.342  -17.263 1.00 80.72  ? 87  GLN C N   1 
ATOM 1375 C CA  . GLN C 1 46 ? -72.683  -7.028  -17.423 1.00 83.27  ? 87  GLN C CA  1 
ATOM 1376 C C   . GLN C 1 46 ? -71.586  -6.070  -17.860 1.00 78.99  ? 87  GLN C C   1 
ATOM 1377 O O   . GLN C 1 46 ? -70.418  -6.259  -17.528 1.00 72.60  ? 87  GLN C O   1 
ATOM 1378 C CB  . GLN C 1 46 ? -72.801  -8.174  -18.424 1.00 93.30  ? 87  GLN C CB  1 
ATOM 1379 C CG  . GLN C 1 46 ? -73.616  -9.340  -17.908 1.00 110.74 ? 87  GLN C CG  1 
ATOM 1380 C CD  . GLN C 1 46 ? -73.574  -10.531 -18.841 1.00 119.22 ? 87  GLN C CD  1 
ATOM 1381 O OE1 . GLN C 1 46 ? -74.223  -11.549 -18.593 1.00 122.12 ? 87  GLN C OE1 1 
ATOM 1382 N NE2 . GLN C 1 46 ? -72.806  -10.413 -19.925 1.00 122.25 ? 87  GLN C NE2 1 
ATOM 1383 N N   . ILE C 1 47 ? -71.956  -5.039  -18.607 1.00 76.38  ? 88  ILE C N   1 
ATOM 1384 C CA  . ILE C 1 47 ? -70.960  -4.079  -19.044 1.00 76.98  ? 88  ILE C CA  1 
ATOM 1385 C C   . ILE C 1 47 ? -70.564  -3.260  -17.835 1.00 74.16  ? 88  ILE C C   1 
ATOM 1386 O O   . ILE C 1 47 ? -69.374  -3.014  -17.598 1.00 72.86  ? 88  ILE C O   1 
ATOM 1387 C CB  . ILE C 1 47 ? -71.497  -3.163  -20.143 1.00 81.21  ? 88  ILE C CB  1 
ATOM 1388 C CG1 . ILE C 1 47 ? -71.794  -4.000  -21.393 1.00 86.54  ? 88  ILE C CG1 1 
ATOM 1389 C CG2 . ILE C 1 47 ? -70.474  -2.072  -20.451 1.00 83.92  ? 88  ILE C CG2 1 
ATOM 1390 C CD1 . ILE C 1 47 ? -72.584  -3.274  -22.452 1.00 90.64  ? 88  ILE C CD1 1 
ATOM 1391 N N   . LEU C 1 48 ? -71.566  -2.856  -17.058 1.00 71.30  ? 89  LEU C N   1 
ATOM 1392 C CA  . LEU C 1 48 ? -71.320  -2.087  -15.838 1.00 69.32  ? 89  LEU C CA  1 
ATOM 1393 C C   . LEU C 1 48 ? -70.300  -2.812  -14.952 1.00 69.37  ? 89  LEU C C   1 
ATOM 1394 O O   . LEU C 1 48 ? -69.302  -2.229  -14.518 1.00 70.51  ? 89  LEU C O   1 
ATOM 1395 C CB  . LEU C 1 48 ? -72.611  -1.908  -15.048 1.00 66.92  ? 89  LEU C CB  1 
ATOM 1396 C CG  . LEU C 1 48 ? -72.270  -1.170  -13.761 1.00 66.20  ? 89  LEU C CG  1 
ATOM 1397 C CD1 . LEU C 1 48 ? -71.776  0.237   -14.135 1.00 66.13  ? 89  LEU C CD1 1 
ATOM 1398 C CD2 . LEU C 1 48 ? -73.486  -1.116  -12.817 1.00 65.86  ? 89  LEU C CD2 1 
ATOM 1399 N N   . ILE C 1 49 ? -70.569  -4.092  -14.696 1.00 67.82  ? 90  ILE C N   1 
ATOM 1400 C CA  . ILE C 1 49 ? -69.702  -4.916  -13.881 1.00 64.45  ? 90  ILE C CA  1 
ATOM 1401 C C   . ILE C 1 49 ? -68.311  -5.101  -14.461 1.00 63.68  ? 90  ILE C C   1 
ATOM 1402 O O   . ILE C 1 49 ? -67.327  -4.946  -13.747 1.00 62.83  ? 90  ILE C O   1 
ATOM 1403 C CB  . ILE C 1 49 ? -70.334  -6.270  -13.640 1.00 64.74  ? 90  ILE C CB  1 
ATOM 1404 C CG1 . ILE C 1 49 ? -71.339  -6.148  -12.514 1.00 68.39  ? 90  ILE C CG1 1 
ATOM 1405 C CG2 . ILE C 1 49 ? -69.293  -7.272  -13.237 1.00 67.93  ? 90  ILE C CG2 1 
ATOM 1406 C CD1 . ILE C 1 49 ? -70.733  -5.616  -11.251 1.00 70.88  ? 90  ILE C CD1 1 
ATOM 1407 N N   . ALA C 1 50 ? -68.212  -5.434  -15.746 1.00 63.88  ? 91  ALA C N   1 
ATOM 1408 C CA  . ALA C 1 50 ? -66.899  -5.628  -16.369 1.00 65.15  ? 91  ALA C CA  1 
ATOM 1409 C C   . ALA C 1 50 ? -66.139  -4.319  -16.276 1.00 70.78  ? 91  ALA C C   1 
ATOM 1410 O O   . ALA C 1 50 ? -64.926  -4.301  -16.038 1.00 63.94  ? 91  ALA C O   1 
ATOM 1411 C CB  . ALA C 1 50 ? -67.047  -6.032  -17.803 1.00 64.31  ? 91  ALA C CB  1 
ATOM 1412 N N   . GLU C 1 51 ? -66.862  -3.221  -16.458 1.00 81.86  ? 92  GLU C N   1 
ATOM 1413 C CA  . GLU C 1 51 ? -66.256  -1.908  -16.370 1.00 96.01  ? 92  GLU C CA  1 
ATOM 1414 C C   . GLU C 1 51 ? -65.604  -1.794  -14.985 1.00 87.55  ? 92  GLU C C   1 
ATOM 1415 O O   . GLU C 1 51 ? -64.402  -1.506  -14.886 1.00 80.07  ? 92  GLU C O   1 
ATOM 1416 C CB  . GLU C 1 51 ? -67.331  -0.844  -16.548 1.00 125.73 ? 92  GLU C CB  1 
ATOM 1417 C CG  . GLU C 1 51 ? -66.829  0.580   -16.597 1.00 167.88 ? 92  GLU C CG  1 
ATOM 1418 C CD  . GLU C 1 51 ? -67.977  1.573   -16.602 1.00 187.27 ? 92  GLU C CD  1 
ATOM 1419 O OE1 . GLU C 1 51 ? -68.725  1.621   -15.599 1.00 194.64 ? 92  GLU C OE1 1 
ATOM 1420 O OE2 . GLU C 1 51 ? -68.140  2.297   -17.609 1.00 194.71 ? 92  GLU C OE2 1 
ATOM 1421 N N   . PHE C 1 52 ? -66.385  -2.047  -13.922 1.00 79.39  ? 93  PHE C N   1 
ATOM 1422 C CA  . PHE C 1 52 ? -65.862  -1.963  -12.548 1.00 72.54  ? 93  PHE C CA  1 
ATOM 1423 C C   . PHE C 1 52 ? -64.703  -2.900  -12.409 1.00 70.33  ? 93  PHE C C   1 
ATOM 1424 O O   . PHE C 1 52 ? -63.647  -2.519  -11.940 1.00 64.45  ? 93  PHE C O   1 
ATOM 1425 C CB  . PHE C 1 52 ? -66.893  -2.362  -11.513 1.00 77.03  ? 93  PHE C CB  1 
ATOM 1426 C CG  . PHE C 1 52 ? -66.387  -2.262  -10.105 1.00 86.32  ? 93  PHE C CG  1 
ATOM 1427 C CD1 . PHE C 1 52 ? -66.354  -1.032  -9.443  1.00 90.13  ? 93  PHE C CD1 1 
ATOM 1428 C CD2 . PHE C 1 52 ? -65.935  -3.388  -9.439  1.00 90.88  ? 93  PHE C CD2 1 
ATOM 1429 C CE1 . PHE C 1 52 ? -65.883  -0.927  -8.141  1.00 91.19  ? 93  PHE C CE1 1 
ATOM 1430 C CE2 . PHE C 1 52 ? -65.459  -3.295  -8.130  1.00 93.00  ? 93  PHE C CE2 1 
ATOM 1431 C CZ  . PHE C 1 52 ? -65.435  -2.059  -7.483  1.00 93.35  ? 93  PHE C CZ  1 
ATOM 1432 N N   . GLN C 1 53 ? -64.911  -4.138  -12.823 1.00 73.90  ? 94  GLN C N   1 
ATOM 1433 C CA  . GLN C 1 53 ? -63.850  -5.118  -12.766 1.00 80.12  ? 94  GLN C CA  1 
ATOM 1434 C C   . GLN C 1 53 ? -62.520  -4.471  -13.216 1.00 78.24  ? 94  GLN C C   1 
ATOM 1435 O O   . GLN C 1 53 ? -61.549  -4.454  -12.469 1.00 68.49  ? 94  GLN C O   1 
ATOM 1436 C CB  . GLN C 1 53 ? -64.203  -6.312  -13.661 1.00 93.35  ? 94  GLN C CB  1 
ATOM 1437 C CG  . GLN C 1 53 ? -63.580  -7.659  -13.264 1.00 118.41 ? 94  GLN C CG  1 
ATOM 1438 C CD  . GLN C 1 53 ? -62.058  -7.686  -13.365 1.00 130.70 ? 94  GLN C CD  1 
ATOM 1439 O OE1 . GLN C 1 53 ? -61.470  -7.243  -14.353 1.00 135.83 ? 94  GLN C OE1 1 
ATOM 1440 N NE2 . GLN C 1 53 ? -61.417  -8.226  -12.341 1.00 136.26 ? 94  GLN C NE2 1 
ATOM 1441 N N   . ARG C 1 54 ? -62.477  -3.920  -14.424 1.00 82.78  ? 95  ARG C N   1 
ATOM 1442 C CA  . ARG C 1 54 ? -61.245  -3.303  -14.916 1.00 93.43  ? 95  ARG C CA  1 
ATOM 1443 C C   . ARG C 1 54 ? -60.722  -2.164  -14.040 1.00 94.65  ? 95  ARG C C   1 
ATOM 1444 O O   . ARG C 1 54 ? -59.568  -2.184  -13.612 1.00 96.88  ? 95  ARG C O   1 
ATOM 1445 C CB  . ARG C 1 54 ? -61.437  -2.802  -16.353 1.00 102.44 ? 95  ARG C CB  1 
ATOM 1446 C CG  . ARG C 1 54 ? -60.377  -1.808  -16.844 1.00 113.13 ? 95  ARG C CG  1 
ATOM 1447 C CD  . ARG C 1 54 ? -60.644  -1.398  -18.289 1.00 121.30 ? 95  ARG C CD  1 
ATOM 1448 N NE  . ARG C 1 54 ? -59.853  -0.243  -18.706 1.00 126.92 ? 95  ARG C NE  1 
ATOM 1449 C CZ  . ARG C 1 54 ? -60.079  1.005   -18.308 1.00 129.16 ? 95  ARG C CZ  1 
ATOM 1450 N NH1 . ARG C 1 54 ? -61.078  1.272   -17.476 1.00 129.60 ? 95  ARG C NH1 1 
ATOM 1451 N NH2 . ARG C 1 54 ? -59.309  1.992   -18.752 1.00 130.32 ? 95  ARG C NH2 1 
ATOM 1452 N N   . GLN C 1 55 ? -61.550  -1.166  -13.770 1.00 94.61  ? 96  GLN C N   1 
ATOM 1453 C CA  . GLN C 1 55 ? -61.085  -0.067  -12.938 1.00 96.93  ? 96  GLN C CA  1 
ATOM 1454 C C   . GLN C 1 55 ? -60.631  -0.594  -11.577 1.00 96.56  ? 96  GLN C C   1 
ATOM 1455 O O   . GLN C 1 55 ? -59.998  0.116   -10.802 1.00 100.79 ? 96  GLN C O   1 
ATOM 1456 C CB  . GLN C 1 55 ? -62.191  0.977   -12.765 1.00 99.17  ? 96  GLN C CB  1 
ATOM 1457 C CG  . GLN C 1 55 ? -62.275  1.977   -13.910 1.00 98.85  ? 96  GLN C CG  1 
ATOM 1458 C CD  . GLN C 1 55 ? -63.589  2.747   -13.930 1.00 99.93  ? 96  GLN C CD  1 
ATOM 1459 O OE1 . GLN C 1 55 ? -64.640  2.211   -14.286 1.00 101.07 ? 96  GLN C OE1 1 
ATOM 1460 N NE2 . GLN C 1 55 ? -63.533  4.012   -13.540 1.00 102.45 ? 96  GLN C NE2 1 
ATOM 1461 N N   . PHE C 1 56 ? -60.936  -1.856  -11.299 1.00 95.54  ? 97  PHE C N   1 
ATOM 1462 C CA  . PHE C 1 56 ? -60.575  -2.454  -10.030 1.00 87.66  ? 97  PHE C CA  1 
ATOM 1463 C C   . PHE C 1 56 ? -59.220  -3.086  -10.029 1.00 82.42  ? 97  PHE C C   1 
ATOM 1464 O O   . PHE C 1 56 ? -58.476  -2.911  -9.083  1.00 76.84  ? 97  PHE C O   1 
ATOM 1465 C CB  . PHE C 1 56 ? -61.572  -3.514  -9.630  1.00 90.77  ? 97  PHE C CB  1 
ATOM 1466 C CG  . PHE C 1 56 ? -61.265  -4.145  -8.322  1.00 94.79  ? 97  PHE C CG  1 
ATOM 1467 C CD1 . PHE C 1 56 ? -61.199  -3.376  -7.184  1.00 97.83  ? 97  PHE C CD1 1 
ATOM 1468 C CD2 . PHE C 1 56 ? -61.089  -5.509  -8.212  1.00 94.94  ? 97  PHE C CD2 1 
ATOM 1469 C CE1 . PHE C 1 56 ? -60.971  -3.959  -5.946  1.00 93.75  ? 97  PHE C CE1 1 
ATOM 1470 C CE2 . PHE C 1 56 ? -60.859  -6.098  -6.972  1.00 90.68  ? 97  PHE C CE2 1 
ATOM 1471 C CZ  . PHE C 1 56 ? -60.804  -5.323  -5.836  1.00 86.71  ? 97  PHE C CZ  1 
ATOM 1472 N N   . GLU C 1 57 ? -58.891  -3.850  -11.062 1.00 78.98  ? 98  GLU C N   1 
ATOM 1473 C CA  . GLU C 1 57 ? -57.585  -4.480  -11.067 1.00 80.61  ? 98  GLU C CA  1 
ATOM 1474 C C   . GLU C 1 57 ? -56.572  -3.390  -11.353 1.00 80.86  ? 98  GLU C C   1 
ATOM 1475 O O   . GLU C 1 57 ? -55.429  -3.447  -10.886 1.00 76.69  ? 98  GLU C O   1 
ATOM 1476 C CB  . GLU C 1 57 ? -57.499  -5.594  -12.118 1.00 85.53  ? 98  GLU C CB  1 
ATOM 1477 C CG  . GLU C 1 57 ? -56.287  -6.546  -11.934 1.00 96.78  ? 98  GLU C CG  1 
ATOM 1478 C CD  . GLU C 1 57 ? -56.315  -7.325  -10.606 1.00 102.41 ? 98  GLU C CD  1 
ATOM 1479 O OE1 . GLU C 1 57 ? -57.268  -8.110  -10.375 1.00 103.34 ? 98  GLU C OE1 1 
ATOM 1480 O OE2 . GLU C 1 57 ? -55.380  -7.153  -9.790  1.00 104.83 ? 98  GLU C OE2 1 
ATOM 1481 N N   . GLN C 1 58 ? -57.012  -2.380  -12.102 1.00 84.22  ? 99  GLN C N   1 
ATOM 1482 C CA  . GLN C 1 58 ? -56.148  -1.259  -12.468 1.00 88.54  ? 99  GLN C CA  1 
ATOM 1483 C C   . GLN C 1 58 ? -55.644  -0.576  -11.213 1.00 79.57  ? 99  GLN C C   1 
ATOM 1484 O O   . GLN C 1 58 ? -54.429  -0.471  -11.014 1.00 77.02  ? 99  GLN C O   1 
ATOM 1485 C CB  . GLN C 1 58 ? -56.906  -0.258  -13.345 1.00 107.26 ? 99  GLN C CB  1 
ATOM 1486 C CG  . GLN C 1 58 ? -56.085  0.953   -13.787 1.00 131.80 ? 99  GLN C CG  1 
ATOM 1487 C CD  . GLN C 1 58 ? -56.771  1.750   -14.885 1.00 144.06 ? 99  GLN C CD  1 
ATOM 1488 O OE1 . GLN C 1 58 ? -56.925  1.272   -16.009 1.00 149.31 ? 99  GLN C OE1 1 
ATOM 1489 N NE2 . GLN C 1 58 ? -57.191  2.966   -14.561 1.00 150.01 ? 99  GLN C NE2 1 
ATOM 1490 N N   . LEU C 1 59 ? -56.571  -0.125  -10.363 1.00 69.07  ? 100 LEU C N   1 
ATOM 1491 C CA  . LEU C 1 59 ? -56.182  0.524   -9.120  1.00 60.92  ? 100 LEU C CA  1 
ATOM 1492 C C   . LEU C 1 59 ? -55.254  -0.425  -8.384  1.00 62.71  ? 100 LEU C C   1 
ATOM 1493 O O   . LEU C 1 59 ? -54.096  -0.086  -8.032  1.00 61.04  ? 100 LEU C O   1 
ATOM 1494 C CB  . LEU C 1 59 ? -57.385  0.794   -8.235  1.00 51.37  ? 100 LEU C CB  1 
ATOM 1495 C CG  . LEU C 1 59 ? -56.989  1.820   -7.171  1.00 48.76  ? 100 LEU C CG  1 
ATOM 1496 C CD1 . LEU C 1 59 ? -56.325  3.004   -7.883  1.00 46.18  ? 100 LEU C CD1 1 
ATOM 1497 C CD2 . LEU C 1 59 ? -58.194  2.302   -6.345  1.00 49.22  ? 100 LEU C CD2 1 
ATOM 1498 N N   . SER C 1 60 ? -55.767  -1.639  -8.194  1.00 65.75  ? 101 SER C N   1 
ATOM 1499 C CA  . SER C 1 60 ? -55.038  -2.695  -7.511  1.00 69.83  ? 101 SER C CA  1 
ATOM 1500 C C   . SER C 1 60 ? -53.611  -2.900  -7.980  1.00 74.65  ? 101 SER C C   1 
ATOM 1501 O O   . SER C 1 60 ? -52.728  -3.115  -7.158  1.00 76.15  ? 101 SER C O   1 
ATOM 1502 C CB  . SER C 1 60 ? -55.816  -3.987  -7.599  1.00 66.46  ? 101 SER C CB  1 
ATOM 1503 O OG  . SER C 1 60 ? -56.936  -3.875  -6.739  1.00 66.67  ? 101 SER C OG  1 
ATOM 1504 N N   . ARG C 1 61 ? -53.369  -2.831  -9.283  1.00 80.60  ? 102 ARG C N   1 
ATOM 1505 C CA  . ARG C 1 61 ? -52.012  -3.005  -9.783  1.00 85.20  ? 102 ARG C CA  1 
ATOM 1506 C C   . ARG C 1 61 ? -51.197  -1.744  -9.504  1.00 85.33  ? 102 ARG C C   1 
ATOM 1507 O O   . ARG C 1 61 ? -49.988  -1.816  -9.269  1.00 84.23  ? 102 ARG C O   1 
ATOM 1508 C CB  . ARG C 1 61 ? -52.032  -3.307  -11.278 1.00 90.38  ? 102 ARG C CB  1 
ATOM 1509 C CG  . ARG C 1 61 ? -52.845  -4.527  -11.601 1.00 97.86  ? 102 ARG C CG  1 
ATOM 1510 C CD  . ARG C 1 61 ? -52.167  -5.412  -12.624 1.00 102.98 ? 102 ARG C CD  1 
ATOM 1511 N NE  . ARG C 1 61 ? -52.742  -6.756  -12.581 1.00 105.73 ? 102 ARG C NE  1 
ATOM 1512 C CZ  . ARG C 1 61 ? -52.348  -7.770  -13.341 1.00 106.33 ? 102 ARG C CZ  1 
ATOM 1513 N NH1 . ARG C 1 61 ? -51.365  -7.605  -14.225 1.00 105.75 ? 102 ARG C NH1 1 
ATOM 1514 N NH2 . ARG C 1 61 ? -52.935  -8.953  -13.202 1.00 106.75 ? 102 ARG C NH2 1 
ATOM 1515 N N   . GLN C 1 62 ? -51.856  -0.589  -9.536  1.00 85.45  ? 103 GLN C N   1 
ATOM 1516 C CA  . GLN C 1 62 ? -51.153  0.645   -9.255  1.00 85.16  ? 103 GLN C CA  1 
ATOM 1517 C C   . GLN C 1 62 ? -50.767  0.561   -7.795  1.00 80.21  ? 103 GLN C C   1 
ATOM 1518 O O   . GLN C 1 62 ? -49.589  0.351   -7.470  1.00 76.81  ? 103 GLN C O   1 
ATOM 1519 C CB  . GLN C 1 62 ? -52.051  1.861   -9.476  1.00 92.20  ? 103 GLN C CB  1 
ATOM 1520 C CG  . GLN C 1 62 ? -52.288  2.211   -10.937 1.00 102.48 ? 103 GLN C CG  1 
ATOM 1521 C CD  . GLN C 1 62 ? -53.313  3.325   -11.118 1.00 106.88 ? 103 GLN C CD  1 
ATOM 1522 O OE1 . GLN C 1 62 ? -53.717  3.637   -12.245 1.00 109.15 ? 103 GLN C OE1 1 
ATOM 1523 N NE2 . GLN C 1 62 ? -53.738  3.928   -10.010 1.00 108.14 ? 103 GLN C NE2 1 
ATOM 1524 N N   . HIS C 1 63 ? -51.767  0.693   -6.918  1.00 75.22  ? 104 HIS C N   1 
ATOM 1525 C CA  . HIS C 1 63 ? -51.521  0.650   -5.479  1.00 72.85  ? 104 HIS C CA  1 
ATOM 1526 C C   . HIS C 1 63 ? -50.404  -0.330  -5.149  1.00 73.87  ? 104 HIS C C   1 
ATOM 1527 O O   . HIS C 1 63 ? -49.446  0.014   -4.466  1.00 74.23  ? 104 HIS C O   1 
ATOM 1528 C CB  . HIS C 1 63 ? -52.793  0.273   -4.723  1.00 69.10  ? 104 HIS C CB  1 
ATOM 1529 C CG  . HIS C 1 63 ? -53.790  1.390   -4.625  1.00 71.32  ? 104 HIS C CG  1 
ATOM 1530 N ND1 . HIS C 1 63 ? -54.962  1.285   -3.898  1.00 73.23  ? 104 HIS C ND1 1 
ATOM 1531 C CD2 . HIS C 1 63 ? -53.795  2.635   -5.164  1.00 70.44  ? 104 HIS C CD2 1 
ATOM 1532 C CE1 . HIS C 1 63 ? -55.644  2.416   -3.995  1.00 71.76  ? 104 HIS C CE1 1 
ATOM 1533 N NE2 . HIS C 1 63 ? -54.958  3.250   -4.758  1.00 70.34  ? 104 HIS C NE2 1 
ATOM 1534 N N   . GLU C 1 64 ? -50.515  -1.541  -5.678  1.00 76.39  ? 105 GLU C N   1 
ATOM 1535 C CA  . GLU C 1 64 ? -49.531  -2.583  -5.452  1.00 78.45  ? 105 GLU C CA  1 
ATOM 1536 C C   . GLU C 1 64 ? -48.123  -2.140  -5.845  1.00 79.02  ? 105 GLU C C   1 
ATOM 1537 O O   . GLU C 1 64 ? -47.245  -2.033  -4.994  1.00 77.71  ? 105 GLU C O   1 
ATOM 1538 C CB  . GLU C 1 64 ? -49.930  -3.827  -6.234  1.00 81.91  ? 105 GLU C CB  1 
ATOM 1539 C CG  . GLU C 1 64 ? -49.396  -5.108  -5.662  1.00 89.94  ? 105 GLU C CG  1 
ATOM 1540 C CD  . GLU C 1 64 ? -49.718  -6.309  -6.525  1.00 93.45  ? 105 GLU C CD  1 
ATOM 1541 O OE1 . GLU C 1 64 ? -49.210  -6.369  -7.673  1.00 94.08  ? 105 GLU C OE1 1 
ATOM 1542 O OE2 . GLU C 1 64 ? -50.480  -7.187  -6.052  1.00 94.30  ? 105 GLU C OE2 1 
ATOM 1543 N N   . ALA C 1 65 ? -47.908  -1.871  -7.128  1.00 81.30  ? 106 ALA C N   1 
ATOM 1544 C CA  . ALA C 1 65 ? -46.585  -1.458  -7.612  1.00 85.09  ? 106 ALA C CA  1 
ATOM 1545 C C   . ALA C 1 65 ? -45.960  -0.441  -6.681  1.00 87.54  ? 106 ALA C C   1 
ATOM 1546 O O   . ALA C 1 65 ? -44.772  -0.514  -6.367  1.00 86.36  ? 106 ALA C O   1 
ATOM 1547 C CB  . ALA C 1 65 ? -46.686  -0.870  -9.020  1.00 85.07  ? 106 ALA C CB  1 
ATOM 1548 N N   . GLN C 1 66 ? -46.775  0.515   -6.254  1.00 90.96  ? 107 GLN C N   1 
ATOM 1549 C CA  . GLN C 1 66 ? -46.311  1.548   -5.358  1.00 94.47  ? 107 GLN C CA  1 
ATOM 1550 C C   . GLN C 1 66 ? -45.835  0.865   -4.091  1.00 89.85  ? 107 GLN C C   1 
ATOM 1551 O O   . GLN C 1 66 ? -44.655  0.955   -3.734  1.00 88.98  ? 107 GLN C O   1 
ATOM 1552 C CB  . GLN C 1 66 ? -47.439  2.520   -5.041  1.00 103.81 ? 107 GLN C CB  1 
ATOM 1553 C CG  . GLN C 1 66 ? -48.073  3.125   -6.276  1.00 116.45 ? 107 GLN C CG  1 
ATOM 1554 C CD  . GLN C 1 66 ? -49.037  4.239   -5.938  1.00 121.53 ? 107 GLN C CD  1 
ATOM 1555 O OE1 . GLN C 1 66 ? -49.999  4.047   -5.188  1.00 122.70 ? 107 GLN C OE1 1 
ATOM 1556 N NE2 . GLN C 1 66 ? -48.782  5.420   -6.489  1.00 123.41 ? 107 GLN C NE2 1 
ATOM 1557 N N   . LEU C 1 67 ? -46.747  0.171   -3.417  1.00 82.93  ? 108 LEU C N   1 
ATOM 1558 C CA  . LEU C 1 67 ? -46.394  -0.536  -2.199  1.00 76.92  ? 108 LEU C CA  1 
ATOM 1559 C C   . LEU C 1 67 ? -45.153  -1.375  -2.365  1.00 80.11  ? 108 LEU C C   1 
ATOM 1560 O O   . LEU C 1 67 ? -44.418  -1.585  -1.417  1.00 79.57  ? 108 LEU C O   1 
ATOM 1561 C CB  . LEU C 1 67 ? -47.532  -1.421  -1.755  1.00 69.62  ? 108 LEU C CB  1 
ATOM 1562 C CG  . LEU C 1 67 ? -48.182  -0.738  -0.567  1.00 67.71  ? 108 LEU C CG  1 
ATOM 1563 C CD1 . LEU C 1 67 ? -49.513  -1.405  -0.175  1.00 63.49  ? 108 LEU C CD1 1 
ATOM 1564 C CD2 . LEU C 1 67 ? -47.169  -0.772  0.562   1.00 65.07  ? 108 LEU C CD2 1 
ATOM 1565 N N   . HIS C 1 68 ? -44.919  -1.869  -3.571  1.00 88.57  ? 109 HIS C N   1 
ATOM 1566 C CA  . HIS C 1 68 ? -43.732  -2.670  -3.812  1.00 98.01  ? 109 HIS C CA  1 
ATOM 1567 C C   . HIS C 1 68 ? -42.547  -1.729  -3.978  1.00 103.14 ? 109 HIS C C   1 
ATOM 1568 O O   . HIS C 1 68 ? -41.535  -1.869  -3.284  1.00 97.61  ? 109 HIS C O   1 
ATOM 1569 C CB  . HIS C 1 68 ? -43.917  -3.544  -5.060  1.00 101.06 ? 109 HIS C CB  1 
ATOM 1570 C CG  . HIS C 1 68 ? -44.374  -4.941  -4.759  1.00 109.71 ? 109 HIS C CG  1 
ATOM 1571 N ND1 . HIS C 1 68 ? -45.354  -5.224  -3.831  1.00 113.17 ? 109 HIS C ND1 1 
ATOM 1572 C CD2 . HIS C 1 68 ? -44.001  -6.132  -5.286  1.00 112.94 ? 109 HIS C CD2 1 
ATOM 1573 C CE1 . HIS C 1 68 ? -45.566  -6.527  -3.799  1.00 114.71 ? 109 HIS C CE1 1 
ATOM 1574 N NE2 . HIS C 1 68 ? -44.758  -7.101  -4.673  1.00 114.77 ? 109 HIS C NE2 1 
ATOM 1575 N N   . GLU C 1 69 ? -42.681  -0.767  -4.890  1.00 108.70 ? 110 GLU C N   1 
ATOM 1576 C CA  . GLU C 1 69 ? -41.631  0.218   -5.133  1.00 120.59 ? 110 GLU C CA  1 
ATOM 1577 C C   . GLU C 1 69 ? -41.097  0.672   -3.781  1.00 120.98 ? 110 GLU C C   1 
ATOM 1578 O O   . GLU C 1 69 ? -39.889  0.723   -3.569  1.00 132.92 ? 110 GLU C O   1 
ATOM 1579 C CB  . GLU C 1 69 ? -42.195  1.420   -5.895  1.00 131.60 ? 110 GLU C CB  1 
ATOM 1580 C CG  . GLU C 1 69 ? -41.198  2.557   -6.115  1.00 135.83 ? 110 GLU C CG  1 
ATOM 1581 C CD  . GLU C 1 69 ? -41.744  3.926   -5.686  1.00 138.44 ? 110 GLU C CD  1 
ATOM 1582 O OE1 . GLU C 1 69 ? -41.019  4.936   -5.842  1.00 140.27 ? 110 GLU C OE1 1 
ATOM 1583 O OE2 . GLU C 1 69 ? -42.893  3.993   -5.189  1.00 140.66 ? 110 GLU C OE2 1 
ATOM 1584 N N   . HIS C 1 70 ? -42.015  0.995   -2.872  1.00 116.97 ? 111 HIS C N   1 
ATOM 1585 C CA  . HIS C 1 70 ? -41.659  1.424   -1.525  1.00 102.66 ? 111 HIS C CA  1 
ATOM 1586 C C   . HIS C 1 70 ? -40.645  0.443   -0.979  1.00 97.71  ? 111 HIS C C   1 
ATOM 1587 O O   . HIS C 1 70 ? -39.527  0.822   -0.647  1.00 93.80  ? 111 HIS C O   1 
ATOM 1588 C CB  . HIS C 1 70 ? -42.900  1.436   -0.639  1.00 98.33  ? 111 HIS C CB  1 
ATOM 1589 C CG  . HIS C 1 70 ? -42.641  1.837   0.781   1.00 97.74  ? 111 HIS C CG  1 
ATOM 1590 N ND1 . HIS C 1 70 ? -41.898  1.070   1.651   1.00 98.34  ? 111 HIS C ND1 1 
ATOM 1591 C CD2 . HIS C 1 70 ? -43.071  2.904   1.498   1.00 99.31  ? 111 HIS C CD2 1 
ATOM 1592 C CE1 . HIS C 1 70 ? -41.885  1.643   2.843   1.00 99.15  ? 111 HIS C CE1 1 
ATOM 1593 N NE2 . HIS C 1 70 ? -42.590  2.757   2.777   1.00 99.26  ? 111 HIS C NE2 1 
ATOM 1594 N N   . ILE C 1 71 ? -41.038  -0.824  -0.908  1.00 94.43  ? 112 ILE C N   1 
ATOM 1595 C CA  . ILE C 1 71 ? -40.171  -1.889  -0.413  1.00 94.27  ? 112 ILE C CA  1 
ATOM 1596 C C   . ILE C 1 71 ? -38.793  -1.906  -1.100  1.00 96.45  ? 112 ILE C C   1 
ATOM 1597 O O   . ILE C 1 71 ? -37.766  -2.175  -0.466  1.00 90.79  ? 112 ILE C O   1 
ATOM 1598 C CB  . ILE C 1 71 ? -40.885  -3.261  -0.572  1.00 95.40  ? 112 ILE C CB  1 
ATOM 1599 C CG1 . ILE C 1 71 ? -41.839  -3.454  0.601   1.00 97.33  ? 112 ILE C CG1 1 
ATOM 1600 C CG2 . ILE C 1 71 ? -39.880  -4.407  -0.686  1.00 96.33  ? 112 ILE C CG2 1 
ATOM 1601 C CD1 . ILE C 1 71 ? -42.396  -4.834  0.710   1.00 100.61 ? 112 ILE C CD1 1 
ATOM 1602 N N   . LYS C 1 72 ? -38.778  -1.599  -2.392  1.00 101.98 ? 113 LYS C N   1 
ATOM 1603 C CA  . LYS C 1 72 ? -37.544  -1.574  -3.172  1.00 111.35 ? 113 LYS C CA  1 
ATOM 1604 C C   . LYS C 1 72 ? -36.618  -0.424  -2.762  1.00 114.94 ? 113 LYS C C   1 
ATOM 1605 O O   . LYS C 1 72 ? -35.447  -0.390  -3.138  1.00 113.90 ? 113 LYS C O   1 
ATOM 1606 C CB  . LYS C 1 72 ? -37.893  -1.456  -4.660  1.00 116.04 ? 113 LYS C CB  1 
ATOM 1607 C CG  . LYS C 1 72 ? -36.702  -1.355  -5.597  1.00 123.44 ? 113 LYS C CG  1 
ATOM 1608 C CD  . LYS C 1 72 ? -37.164  -1.231  -7.044  1.00 126.32 ? 113 LYS C CD  1 
ATOM 1609 C CE  . LYS C 1 72 ? -35.985  -1.079  -7.994  1.00 127.01 ? 113 LYS C CE  1 
ATOM 1610 N NZ  . LYS C 1 72 ? -35.169  0.128   -7.684  1.00 127.55 ? 113 LYS C NZ  1 
ATOM 1611 N N   . GLN C 1 73 ? -37.145  0.517   -1.985  1.00 118.84 ? 114 GLN C N   1 
ATOM 1612 C CA  . GLN C 1 73 ? -36.358  1.664   -1.551  1.00 120.83 ? 114 GLN C CA  1 
ATOM 1613 C C   . GLN C 1 73 ? -36.091  1.669   -0.052  1.00 114.46 ? 114 GLN C C   1 
ATOM 1614 O O   . GLN C 1 73 ? -35.148  2.304   0.418   1.00 113.33 ? 114 GLN C O   1 
ATOM 1615 C CB  . GLN C 1 73 ? -37.053  2.958   -1.975  1.00 131.79 ? 114 GLN C CB  1 
ATOM 1616 C CG  . GLN C 1 73 ? -37.161  3.103   -3.482  1.00 145.03 ? 114 GLN C CG  1 
ATOM 1617 C CD  . GLN C 1 73 ? -37.948  4.324   -3.900  1.00 150.27 ? 114 GLN C CD  1 
ATOM 1618 O OE1 . GLN C 1 73 ? -38.175  4.555   -5.090  1.00 150.93 ? 114 GLN C OE1 1 
ATOM 1619 N NE2 . GLN C 1 73 ? -38.371  5.116   -2.923  1.00 151.32 ? 114 GLN C NE2 1 
ATOM 1620 N N   . GLN C 1 74 ? -36.926  0.976   0.708   1.00 107.97 ? 115 GLN C N   1 
ATOM 1621 C CA  . GLN C 1 74 ? -36.695  0.909   2.135   1.00 101.18 ? 115 GLN C CA  1 
ATOM 1622 C C   . GLN C 1 74 ? -35.583  -0.128  2.232   1.00 103.51 ? 115 GLN C C   1 
ATOM 1623 O O   . GLN C 1 74 ? -35.170  -0.534  3.320   1.00 97.31  ? 115 GLN C O   1 
ATOM 1624 C CB  . GLN C 1 74 ? -37.949  0.442   2.872   1.00 95.68  ? 115 GLN C CB  1 
ATOM 1625 C CG  . GLN C 1 74 ? -37.864  0.616   4.379   1.00 95.31  ? 115 GLN C CG  1 
ATOM 1626 C CD  . GLN C 1 74 ? -37.754  -0.705  5.131   1.00 95.16  ? 115 GLN C CD  1 
ATOM 1627 O OE1 . GLN C 1 74 ? -36.943  -1.569  4.785   1.00 93.65  ? 115 GLN C OE1 1 
ATOM 1628 N NE2 . GLN C 1 74 ? -38.569  -0.864  6.174   1.00 94.09  ? 115 GLN C NE2 1 
ATOM 1629 N N   . GLN C 1 75 ? -35.111  -0.557  1.062   1.00 109.96 ? 116 GLN C N   1 
ATOM 1630 C CA  . GLN C 1 75 ? -34.036  -1.536  0.958   1.00 119.96 ? 116 GLN C CA  1 
ATOM 1631 C C   . GLN C 1 75 ? -32.726  -0.774  0.947   1.00 121.07 ? 116 GLN C C   1 
ATOM 1632 O O   . GLN C 1 75 ? -31.906  -0.884  1.864   1.00 115.11 ? 116 GLN C O   1 
ATOM 1633 C CB  . GLN C 1 75 ? -34.151  -2.320  -0.351  1.00 130.47 ? 116 GLN C CB  1 
ATOM 1634 C CG  . GLN C 1 75 ? -32.866  -3.061  -0.735  1.00 148.09 ? 116 GLN C CG  1 
ATOM 1635 C CD  . GLN C 1 75 ? -32.773  -3.367  -2.224  1.00 154.88 ? 116 GLN C CD  1 
ATOM 1636 O OE1 . GLN C 1 75 ? -33.579  -4.122  -2.766  1.00 156.21 ? 116 GLN C OE1 1 
ATOM 1637 N NE2 . GLN C 1 75 ? -31.786  -2.775  -2.891  1.00 155.77 ? 116 GLN C NE2 1 
ATOM 1638 N N   . GLU C 1 76 ? -32.552  -0.005  -0.124  1.00 125.54 ? 117 GLU C N   1 
ATOM 1639 C CA  . GLU C 1 76 ? -31.369  0.811   -0.342  1.00 132.95 ? 117 GLU C CA  1 
ATOM 1640 C C   . GLU C 1 76 ? -31.056  1.709   0.850   1.00 130.18 ? 117 GLU C C   1 
ATOM 1641 O O   . GLU C 1 76 ? -29.891  1.978   1.133   1.00 129.13 ? 117 GLU C O   1 
ATOM 1642 C CB  . GLU C 1 76 ? -31.561  1.639   -1.608  1.00 143.94 ? 117 GLU C CB  1 
ATOM 1643 C CG  . GLU C 1 76 ? -31.669  0.776   -2.856  1.00 160.41 ? 117 GLU C CG  1 
ATOM 1644 C CD  . GLU C 1 76 ? -32.206  1.532   -4.053  1.00 168.15 ? 117 GLU C CD  1 
ATOM 1645 O OE1 . GLU C 1 76 ? -33.439  1.727   -4.130  1.00 171.36 ? 117 GLU C OE1 1 
ATOM 1646 O OE2 . GLU C 1 76 ? -31.394  1.939   -4.912  1.00 171.09 ? 117 GLU C OE2 1 
ATOM 1647 N N   . MET C 1 77 ? -32.090  2.180   1.544   1.00 126.82 ? 118 MET C N   1 
ATOM 1648 C CA  . MET C 1 77 ? -31.880  3.010   2.724   1.00 123.93 ? 118 MET C CA  1 
ATOM 1649 C C   . MET C 1 77 ? -31.169  2.120   3.740   1.00 126.52 ? 118 MET C C   1 
ATOM 1650 O O   . MET C 1 77 ? -30.003  2.349   4.054   1.00 133.70 ? 118 MET C O   1 
ATOM 1651 C CB  . MET C 1 77 ? -33.219  3.512   3.287   1.00 115.47 ? 118 MET C CB  1 
ATOM 1652 C CG  . MET C 1 77 ? -33.147  4.184   4.673   1.00 102.18 ? 118 MET C CG  1 
ATOM 1653 S SD  . MET C 1 77 ? -32.892  3.039   6.083   1.00 96.95  ? 118 MET C SD  1 
ATOM 1654 C CE  . MET C 1 77 ? -34.310  3.356   7.131   1.00 91.81  ? 118 MET C CE  1 
ATOM 1655 N N   . LEU C 1 78 ? -31.859  1.092   4.236   1.00 126.35 ? 119 LEU C N   1 
ATOM 1656 C CA  . LEU C 1 78 ? -31.245  0.191   5.202   1.00 122.35 ? 119 LEU C CA  1 
ATOM 1657 C C   . LEU C 1 78 ? -29.959  -0.350  4.613   1.00 126.48 ? 119 LEU C C   1 
ATOM 1658 O O   . LEU C 1 78 ? -29.074  -0.819  5.334   1.00 130.43 ? 119 LEU C O   1 
ATOM 1659 C CB  . LEU C 1 78 ? -32.182  -0.962  5.561   1.00 108.03 ? 119 LEU C CB  1 
ATOM 1660 C CG  . LEU C 1 78 ? -33.241  -0.630  6.616   1.00 94.56  ? 119 LEU C CG  1 
ATOM 1661 C CD1 . LEU C 1 78 ? -33.875  -1.926  7.143   1.00 87.15  ? 119 LEU C CD1 1 
ATOM 1662 C CD2 . LEU C 1 78 ? -32.594  0.141   7.767   1.00 87.78  ? 119 LEU C CD2 1 
ATOM 1663 N N   . ALA C 1 79 ? -29.859  -0.276  3.293   1.00 125.84 ? 120 ALA C N   1 
ATOM 1664 C CA  . ALA C 1 79 ? -28.666  -0.733  2.610   1.00 129.81 ? 120 ALA C CA  1 
ATOM 1665 C C   . ALA C 1 79 ? -27.537  0.238   2.964   1.00 135.55 ? 120 ALA C C   1 
ATOM 1666 O O   . ALA C 1 79 ? -26.648  -0.096  3.751   1.00 142.48 ? 120 ALA C O   1 
ATOM 1667 C CB  . ALA C 1 79 ? -28.904  -0.761  1.104   1.00 119.18 ? 120 ALA C CB  1 
ATOM 1668 N N   . MET C 1 80 ? -27.595  1.445   2.400   1.00 142.29 ? 121 MET C N   1 
ATOM 1669 C CA  . MET C 1 80 ? -26.592  2.488   2.640   1.00 142.62 ? 121 MET C CA  1 
ATOM 1670 C C   . MET C 1 80 ? -26.239  2.644   4.116   1.00 138.63 ? 121 MET C C   1 
ATOM 1671 O O   . MET C 1 80 ? -25.072  2.810   4.466   1.00 136.96 ? 121 MET C O   1 
ATOM 1672 C CB  . MET C 1 80 ? -27.096  3.831   2.107   1.00 149.65 ? 121 MET C CB  1 
ATOM 1673 C CG  . MET C 1 80 ? -27.288  3.889   0.601   1.00 159.92 ? 121 MET C CG  1 
ATOM 1674 S SD  . MET C 1 80 ? -25.789  4.331   -0.287  1.00 166.84 ? 121 MET C SD  1 
ATOM 1675 C CE  . MET C 1 80 ? -26.001  6.114   -0.434  1.00 170.58 ? 121 MET C CE  1 
ATOM 1676 N N   . LYS C 1 81 ? -27.252  2.594   4.975   1.00 134.50 ? 122 LYS C N   1 
ATOM 1677 C CA  . LYS C 1 81 ? -27.037  2.739   6.405   1.00 133.17 ? 122 LYS C CA  1 
ATOM 1678 C C   . LYS C 1 81 ? -26.071  1.713   6.979   1.00 139.84 ? 122 LYS C C   1 
ATOM 1679 O O   . LYS C 1 81 ? -25.427  1.980   7.991   1.00 139.23 ? 122 LYS C O   1 
ATOM 1680 C CB  . LYS C 1 81 ? -28.358  2.657   7.161   1.00 124.89 ? 122 LYS C CB  1 
ATOM 1681 C CG  . LYS C 1 81 ? -28.187  2.690   8.668   1.00 116.77 ? 122 LYS C CG  1 
ATOM 1682 C CD  . LYS C 1 81 ? -29.520  2.584   9.375   1.00 114.26 ? 122 LYS C CD  1 
ATOM 1683 C CE  . LYS C 1 81 ? -29.359  2.632   10.885  1.00 114.22 ? 122 LYS C CE  1 
ATOM 1684 N NZ  . LYS C 1 81 ? -30.679  2.640   11.587  1.00 114.59 ? 122 LYS C NZ  1 
ATOM 1685 N N   . HIS C 1 82 ? -25.965  0.541   6.358   1.00 149.71 ? 123 HIS C N   1 
ATOM 1686 C CA  . HIS C 1 82 ? -25.034  -0.463  6.871   1.00 162.65 ? 123 HIS C CA  1 
ATOM 1687 C C   . HIS C 1 82 ? -24.123  -1.107  5.822   1.00 169.90 ? 123 HIS C C   1 
ATOM 1688 O O   . HIS C 1 82 ? -23.219  -1.869  6.167   1.00 170.93 ? 123 HIS C O   1 
ATOM 1689 C CB  . HIS C 1 82 ? -25.784  -1.552  7.654   1.00 166.06 ? 123 HIS C CB  1 
ATOM 1690 C CG  . HIS C 1 82 ? -25.430  -1.600  9.114   1.00 170.43 ? 123 HIS C CG  1 
ATOM 1691 N ND1 . HIS C 1 82 ? -25.840  -0.639  10.015  1.00 173.08 ? 123 HIS C ND1 1 
ATOM 1692 C CD2 . HIS C 1 82 ? -24.692  -2.487  9.824   1.00 172.53 ? 123 HIS C CD2 1 
ATOM 1693 C CE1 . HIS C 1 82 ? -25.372  -0.934  11.216  1.00 175.49 ? 123 HIS C CE1 1 
ATOM 1694 N NE2 . HIS C 1 82 ? -24.672  -2.051  11.128  1.00 175.07 ? 123 HIS C NE2 1 
ATOM 1695 N N   . GLN C 1 83 ? -24.354  -0.798  4.548   1.00 177.85 ? 124 GLN C N   1 
ATOM 1696 C CA  . GLN C 1 83 ? -23.531  -1.338  3.464   1.00 187.07 ? 124 GLN C CA  1 
ATOM 1697 C C   . GLN C 1 83 ? -22.281  -0.472  3.369   1.00 190.12 ? 124 GLN C C   1 
ATOM 1698 O O   . GLN C 1 83 ? -21.205  -0.930  2.977   1.00 195.55 ? 124 GLN C O   1 
ATOM 1699 C CB  . GLN C 1 83 ? -24.289  -1.286  2.128   1.00 189.22 ? 124 GLN C CB  1 
ATOM 1700 C CG  . GLN C 1 83 ? -24.558  0.129   1.603   1.00 187.38 ? 124 GLN C CG  1 
ATOM 1701 C CD  . GLN C 1 83 ? -25.220  0.143   0.230   1.00 186.46 ? 124 GLN C CD  1 
ATOM 1702 O OE1 . GLN C 1 83 ? -24.668  -0.371  -0.743  1.00 186.67 ? 124 GLN C OE1 1 
ATOM 1703 N NE2 . GLN C 1 83 ? -26.405  0.737   0.147   1.00 186.29 ? 124 GLN C NE2 1 
ATOM 1704 N N   . GLN C 1 84 ? -22.458  0.791   3.740   1.00 188.82 ? 125 GLN C N   1 
ATOM 1705 C CA  . GLN C 1 84 ? -21.404  1.794   3.731   1.00 183.44 ? 125 GLN C CA  1 
ATOM 1706 C C   . GLN C 1 84 ? -20.936  1.969   5.171   1.00 181.07 ? 125 GLN C C   1 
ATOM 1707 O O   . GLN C 1 84 ? -20.027  2.747   5.455   1.00 186.62 ? 125 GLN C O   1 
ATOM 1708 C CB  . GLN C 1 84 ? -21.976  3.105   3.195   1.00 179.97 ? 125 GLN C CB  1 
ATOM 1709 C CG  . GLN C 1 84 ? -21.006  4.256   3.092   1.00 168.80 ? 125 GLN C CG  1 
ATOM 1710 C CD  . GLN C 1 84 ? -21.687  5.510   2.578   1.00 163.38 ? 125 GLN C CD  1 
ATOM 1711 O OE1 . GLN C 1 84 ? -22.585  6.055   3.226   1.00 160.65 ? 125 GLN C OE1 1 
ATOM 1712 N NE2 . GLN C 1 84 ? -21.272  5.968   1.402   1.00 160.46 ? 125 GLN C NE2 1 
ATOM 1713 N N   . GLU C 1 85 ? -21.578  1.228   6.069   1.00 176.23 ? 126 GLU C N   1 
ATOM 1714 C CA  . GLU C 1 85 ? -21.272  1.258   7.494   1.00 166.52 ? 126 GLU C CA  1 
ATOM 1715 C C   . GLU C 1 85 ? -20.011  0.461   7.796   1.00 166.69 ? 126 GLU C C   1 
ATOM 1716 O O   . GLU C 1 85 ? -19.715  0.155   8.952   1.00 166.05 ? 126 GLU C O   1 
ATOM 1717 C CB  . GLU C 1 85 ? -22.433  0.664   8.282   1.00 154.86 ? 126 GLU C CB  1 
ATOM 1718 C CG  . GLU C 1 85 ? -22.312  0.823   9.776   1.00 142.19 ? 126 GLU C CG  1 
ATOM 1719 C CD  . GLU C 1 85 ? -22.395  2.267   10.201  1.00 136.85 ? 126 GLU C CD  1 
ATOM 1720 O OE1 . GLU C 1 85 ? -22.339  2.519   11.423  1.00 134.88 ? 126 GLU C OE1 1 
ATOM 1721 O OE2 . GLU C 1 85 ? -22.519  3.147   9.316   1.00 134.68 ? 126 GLU C OE2 1 
ATOM 1722 N N   . LEU C 1 86 ? -19.277  0.115   6.746   1.00 164.25 ? 127 LEU C N   1 
ATOM 1723 C CA  . LEU C 1 86 ? -18.044  -0.643  6.890   1.00 166.12 ? 127 LEU C CA  1 
ATOM 1724 C C   . LEU C 1 86 ? -16.832  0.288   6.793   1.00 176.76 ? 127 LEU C C   1 
ATOM 1725 O O   . LEU C 1 86 ? -15.792  0.036   7.409   1.00 189.63 ? 127 LEU C O   1 
ATOM 1726 C CB  . LEU C 1 86 ? -17.990  -1.748  5.827   1.00 144.47 ? 127 LEU C CB  1 
ATOM 1727 C CG  . LEU C 1 86 ? -18.428  -3.157  6.272   1.00 117.97 ? 127 LEU C CG  1 
ATOM 1728 C CD1 . LEU C 1 86 ? -19.561  -3.091  7.303   1.00 101.30 ? 127 LEU C CD1 1 
ATOM 1729 C CD2 . LEU C 1 86 ? -18.835  -3.965  5.046   1.00 101.53 ? 127 LEU C CD2 1 
ATOM 1730 N N   . LEU C 1 87 ? -16.974  1.367   6.026   1.00 181.46 ? 128 LEU C N   1 
ATOM 1731 C CA  . LEU C 1 87 ? -15.899  2.346   5.885   1.00 179.62 ? 128 LEU C CA  1 
ATOM 1732 C C   . LEU C 1 87 ? -16.139  3.420   6.946   1.00 183.91 ? 128 LEU C C   1 
ATOM 1733 O O   . LEU C 1 87 ? -15.381  4.384   7.053   1.00 190.42 ? 128 LEU C O   1 
ATOM 1734 C CB  . LEU C 1 87 ? -15.914  2.993   4.490   1.00 165.82 ? 128 LEU C CB  1 
ATOM 1735 C CG  . LEU C 1 87 ? -15.981  2.113   3.233   1.00 148.72 ? 128 LEU C CG  1 
ATOM 1736 C CD1 . LEU C 1 87 ? -17.415  1.607   3.038   1.00 137.73 ? 128 LEU C CD1 1 
ATOM 1737 C CD2 . LEU C 1 87 ? -15.544  2.919   2.010   1.00 137.60 ? 128 LEU C CD2 1 
ATOM 1738 N N   . GLU C 1 88 ? -17.206  3.236   7.725   1.00 185.08 ? 129 GLU C N   1 
ATOM 1739 C CA  . GLU C 1 88 ? -17.592  4.169   8.785   1.00 181.75 ? 129 GLU C CA  1 
ATOM 1740 C C   . GLU C 1 88 ? -17.453  3.511   10.159  1.00 179.28 ? 129 GLU C C   1 
ATOM 1741 O O   . GLU C 1 88 ? -16.781  4.097   11.032  1.00 176.82 ? 129 GLU C O   1 
ATOM 1742 C CB  . GLU C 1 88 ? -19.046  4.629   8.581   1.00 182.73 ? 129 GLU C CB  1 
ATOM 1743 C CG  . GLU C 1 88 ? -19.342  5.210   7.191   1.00 183.29 ? 129 GLU C CG  1 
ATOM 1744 C CD  . GLU C 1 88 ? -20.817  5.543   6.971   1.00 183.48 ? 129 GLU C CD  1 
ATOM 1745 O OE1 . GLU C 1 88 ? -21.670  4.643   7.137   1.00 183.54 ? 129 GLU C OE1 1 
ATOM 1746 O OE2 . GLU C 1 88 ? -21.119  6.704   6.622   1.00 183.39 ? 129 GLU C OE2 1 
ATOM 1747 N N   . ALA D 1 21 ? -116.419 2.742   -4.605  1.00 125.89 ? 62  ALA D N   1 
ATOM 1748 C CA  . ALA D 1 21 ? -115.863 2.337   -5.934  1.00 129.45 ? 62  ALA D CA  1 
ATOM 1749 C C   . ALA D 1 21 ? -115.543 0.838   -5.980  1.00 130.85 ? 62  ALA D C   1 
ATOM 1750 O O   . ALA D 1 21 ? -115.948 0.076   -5.098  1.00 126.84 ? 62  ALA D O   1 
ATOM 1751 C CB  . ALA D 1 21 ? -114.605 3.156   -6.246  1.00 131.60 ? 62  ALA D CB  1 
ATOM 1752 N N   . GLU D 1 22 ? -114.819 0.420   -7.014  1.00 137.21 ? 63  GLU D N   1 
ATOM 1753 C CA  . GLU D 1 22 ? -114.455 -0.982  -7.166  1.00 145.01 ? 63  GLU D CA  1 
ATOM 1754 C C   . GLU D 1 22 ? -113.131 -1.120  -7.929  1.00 147.76 ? 63  GLU D C   1 
ATOM 1755 O O   . GLU D 1 22 ? -112.071 -1.269  -7.312  1.00 147.34 ? 63  GLU D O   1 
ATOM 1756 C CB  . GLU D 1 22 ? -115.599 -1.734  -7.866  1.00 146.50 ? 63  GLU D CB  1 
ATOM 1757 C CG  . GLU D 1 22 ? -115.298 -3.167  -8.286  1.00 152.92 ? 63  GLU D CG  1 
ATOM 1758 C CD  . GLU D 1 22 ? -115.025 -4.081  -7.115  1.00 157.11 ? 63  GLU D CD  1 
ATOM 1759 O OE1 . GLU D 1 22 ? -115.833 -4.085  -6.161  1.00 159.45 ? 63  GLU D OE1 1 
ATOM 1760 O OE2 . GLU D 1 22 ? -114.006 -4.801  -7.158  1.00 159.74 ? 63  GLU D OE2 1 
ATOM 1761 N N   . PRO D 1 23 ? -113.161 -1.052  -9.276  1.00 154.05 ? 64  PRO D N   1 
ATOM 1762 C CA  . PRO D 1 23 ? -111.871 -1.190  -9.956  1.00 156.33 ? 64  PRO D CA  1 
ATOM 1763 C C   . PRO D 1 23 ? -110.963 0.003   -9.675  1.00 151.62 ? 64  PRO D C   1 
ATOM 1764 O O   . PRO D 1 23 ? -109.766 -0.162  -9.446  1.00 170.03 ? 64  PRO D O   1 
ATOM 1765 C CB  . PRO D 1 23 ? -112.272 -1.299  -11.423 1.00 164.75 ? 64  PRO D CB  1 
ATOM 1766 C CG  . PRO D 1 23 ? -113.439 -0.385  -11.499 1.00 161.85 ? 64  PRO D CG  1 
ATOM 1767 C CD  . PRO D 1 23 ? -114.226 -0.734  -10.250 1.00 161.32 ? 64  PRO D CD  1 
ATOM 1768 N N   . ALA D 1 24 ? -111.544 1.201   -9.682  1.00 143.55 ? 65  ALA D N   1 
ATOM 1769 C CA  . ALA D 1 24 ? -110.798 2.433   -9.425  1.00 121.62 ? 65  ALA D CA  1 
ATOM 1770 C C   . ALA D 1 24 ? -110.025 2.315   -8.123  1.00 112.06 ? 65  ALA D C   1 
ATOM 1771 O O   . ALA D 1 24 ? -109.153 3.143   -7.824  1.00 105.03 ? 65  ALA D O   1 
ATOM 1772 C CB  . ALA D 1 24 ? -111.741 3.619   -9.358  1.00 105.95 ? 65  ALA D CB  1 
ATOM 1773 N N   . LEU D 1 25 ? -110.368 1.291   -7.348  1.00 104.32 ? 66  LEU D N   1 
ATOM 1774 C CA  . LEU D 1 25 ? -109.698 1.018   -6.088  1.00 103.85 ? 66  LEU D CA  1 
ATOM 1775 C C   . LEU D 1 25 ? -108.544 0.049   -6.365  1.00 105.87 ? 66  LEU D C   1 
ATOM 1776 O O   . LEU D 1 25 ? -107.400 0.305   -5.979  1.00 110.51 ? 66  LEU D O   1 
ATOM 1777 C CB  . LEU D 1 25 ? -110.678 0.404   -5.089  1.00 101.64 ? 66  LEU D CB  1 
ATOM 1778 C CG  . LEU D 1 25 ? -111.175 1.276   -3.932  1.00 94.70  ? 66  LEU D CG  1 
ATOM 1779 C CD1 . LEU D 1 25 ? -111.867 2.526   -4.446  1.00 91.04  ? 66  LEU D CD1 1 
ATOM 1780 C CD2 . LEU D 1 25 ? -112.126 0.448   -3.089  1.00 91.38  ? 66  LEU D CD2 1 
ATOM 1781 N N   . ARG D 1 26 ? -108.848 -1.058  -7.044  1.00 107.43 ? 67  ARG D N   1 
ATOM 1782 C CA  . ARG D 1 26 ? -107.818 -2.040  -7.381  1.00 103.80 ? 67  ARG D CA  1 
ATOM 1783 C C   . ARG D 1 26 ? -106.783 -1.370  -8.257  1.00 99.43  ? 67  ARG D C   1 
ATOM 1784 O O   . ARG D 1 26 ? -105.640 -1.811  -8.341  1.00 92.23  ? 67  ARG D O   1 
ATOM 1785 C CB  . ARG D 1 26 ? -108.419 -3.236  -8.110  1.00 108.25 ? 67  ARG D CB  1 
ATOM 1786 C CG  . ARG D 1 26 ? -109.322 -4.048  -7.226  1.00 118.86 ? 67  ARG D CG  1 
ATOM 1787 C CD  . ARG D 1 26 ? -109.810 -5.294  -7.913  1.00 125.42 ? 67  ARG D CD  1 
ATOM 1788 N NE  . ARG D 1 26 ? -110.687 -6.059  -7.036  1.00 127.73 ? 67  ARG D NE  1 
ATOM 1789 C CZ  . ARG D 1 26 ? -110.308 -6.554  -5.864  1.00 128.03 ? 67  ARG D CZ  1 
ATOM 1790 N NH1 . ARG D 1 26 ? -109.066 -6.360  -5.439  1.00 128.17 ? 67  ARG D NH1 1 
ATOM 1791 N NH2 . ARG D 1 26 ? -111.167 -7.238  -5.119  1.00 127.58 ? 67  ARG D NH2 1 
ATOM 1792 N N   . GLU D 1 27 ? -107.199 -0.294  -8.909  1.00 98.40  ? 68  GLU D N   1 
ATOM 1793 C CA  . GLU D 1 27 ? -106.301 0.456   -9.754  1.00 101.01 ? 68  GLU D CA  1 
ATOM 1794 C C   . GLU D 1 27 ? -105.395 1.234   -8.816  1.00 96.22  ? 68  GLU D C   1 
ATOM 1795 O O   . GLU D 1 27 ? -104.166 1.194   -8.941  1.00 90.98  ? 68  GLU D O   1 
ATOM 1796 C CB  . GLU D 1 27 ? -107.086 1.407   -10.657 1.00 112.58 ? 68  GLU D CB  1 
ATOM 1797 C CG  . GLU D 1 27 ? -106.225 2.222   -11.604 1.00 133.89 ? 68  GLU D CG  1 
ATOM 1798 C CD  . GLU D 1 27 ? -107.034 2.877   -12.704 1.00 144.50 ? 68  GLU D CD  1 
ATOM 1799 O OE1 . GLU D 1 27 ? -107.521 2.144   -13.591 1.00 149.27 ? 68  GLU D OE1 1 
ATOM 1800 O OE2 . GLU D 1 27 ? -107.187 4.117   -12.680 1.00 149.50 ? 68  GLU D OE2 1 
ATOM 1801 N N   . GLN D 1 28 ? -106.002 1.923   -7.856  1.00 92.55  ? 69  GLN D N   1 
ATOM 1802 C CA  . GLN D 1 28 ? -105.226 2.706   -6.909  1.00 92.79  ? 69  GLN D CA  1 
ATOM 1803 C C   . GLN D 1 28 ? -104.296 1.796   -6.130  1.00 90.38  ? 69  GLN D C   1 
ATOM 1804 O O   . GLN D 1 28 ? -103.196 2.200   -5.752  1.00 91.49  ? 69  GLN D O   1 
ATOM 1805 C CB  . GLN D 1 28 ? -106.132 3.449   -5.931  1.00 98.06  ? 69  GLN D CB  1 
ATOM 1806 C CG  . GLN D 1 28 ? -105.381 4.501   -5.128  1.00 103.82 ? 69  GLN D CG  1 
ATOM 1807 C CD  . GLN D 1 28 ? -106.175 5.040   -3.954  1.00 107.17 ? 69  GLN D CD  1 
ATOM 1808 O OE1 . GLN D 1 28 ? -107.320 5.475   -4.107  1.00 108.46 ? 69  GLN D OE1 1 
ATOM 1809 N NE2 . GLN D 1 28 ? -105.564 5.020   -2.769  1.00 107.83 ? 69  GLN D NE2 1 
ATOM 1810 N N   . GLN D 1 29 ? -104.739 0.566   -5.890  1.00 88.41  ? 70  GLN D N   1 
ATOM 1811 C CA  . GLN D 1 29 ? -103.923 -0.392  -5.152  1.00 85.62  ? 70  GLN D CA  1 
ATOM 1812 C C   . GLN D 1 29 ? -102.598 -0.667  -5.861  1.00 84.00  ? 70  GLN D C   1 
ATOM 1813 O O   . GLN D 1 29 ? -101.531 -0.568  -5.245  1.00 80.89  ? 70  GLN D O   1 
ATOM 1814 C CB  . GLN D 1 29 ? -104.691 -1.705  -4.945  1.00 87.34  ? 70  GLN D CB  1 
ATOM 1815 C CG  . GLN D 1 29 ? -103.863 -2.820  -4.316  1.00 92.53  ? 70  GLN D CG  1 
ATOM 1816 C CD  . GLN D 1 29 ? -104.706 -3.995  -3.832  1.00 95.93  ? 70  GLN D CD  1 
ATOM 1817 O OE1 . GLN D 1 29 ? -105.615 -4.455  -4.525  1.00 98.42  ? 70  GLN D OE1 1 
ATOM 1818 N NE2 . GLN D 1 29 ? -104.393 -4.495  -2.643  1.00 97.34  ? 70  GLN D NE2 1 
ATOM 1819 N N   . LEU D 1 30 ? -102.664 -1.003  -7.154  1.00 84.01  ? 71  LEU D N   1 
ATOM 1820 C CA  . LEU D 1 30 ? -101.461 -1.289  -7.929  1.00 84.64  ? 71  LEU D CA  1 
ATOM 1821 C C   . LEU D 1 30 ? -100.529 -0.096  -7.977  1.00 86.39  ? 71  LEU D C   1 
ATOM 1822 O O   . LEU D 1 30 ? -99.343  -0.223  -7.708  1.00 80.39  ? 71  LEU D O   1 
ATOM 1823 C CB  . LEU D 1 30 ? -101.817 -1.727  -9.347  1.00 87.88  ? 71  LEU D CB  1 
ATOM 1824 C CG  . LEU D 1 30 ? -102.516 -3.084  -9.477  1.00 93.34  ? 71  LEU D CG  1 
ATOM 1825 C CD1 . LEU D 1 30 ? -102.491 -3.497  -10.944 1.00 96.48  ? 71  LEU D CD1 1 
ATOM 1826 C CD2 . LEU D 1 30 ? -101.821 -4.143  -8.623  1.00 95.89  ? 71  LEU D CD2 1 
ATOM 1827 N N   . GLN D 1 31 ? -101.056 1.068   -8.320  1.00 94.77  ? 72  GLN D N   1 
ATOM 1828 C CA  . GLN D 1 31 ? -100.215 2.257   -8.369  1.00 106.91 ? 72  GLN D CA  1 
ATOM 1829 C C   . GLN D 1 31 ? -99.527  2.377   -7.022  1.00 102.08 ? 72  GLN D C   1 
ATOM 1830 O O   . GLN D 1 31 ? -98.363  2.767   -6.930  1.00 95.87  ? 72  GLN D O   1 
ATOM 1831 C CB  . GLN D 1 31 ? -101.070 3.490   -8.639  1.00 129.05 ? 72  GLN D CB  1 
ATOM 1832 C CG  . GLN D 1 31 ? -101.701 3.484   -10.015 1.00 163.89 ? 72  GLN D CG  1 
ATOM 1833 C CD  . GLN D 1 31 ? -102.954 4.321   -10.073 1.00 180.40 ? 72  GLN D CD  1 
ATOM 1834 O OE1 . GLN D 1 31 ? -102.949 5.494   -9.704  1.00 188.18 ? 72  GLN D OE1 1 
ATOM 1835 N NE2 . GLN D 1 31 ? -104.040 3.722   -10.541 1.00 188.24 ? 72  GLN D NE2 1 
ATOM 1836 N N   . GLN D 1 32 ? -100.270 2.021   -5.979  1.00 100.12 ? 73  GLN D N   1 
ATOM 1837 C CA  . GLN D 1 32 ? -99.772  2.058   -4.621  1.00 99.85  ? 73  GLN D CA  1 
ATOM 1838 C C   . GLN D 1 32 ? -98.611  1.073   -4.558  1.00 95.97  ? 73  GLN D C   1 
ATOM 1839 O O   . GLN D 1 32 ? -97.467  1.471   -4.359  1.00 92.29  ? 73  GLN D O   1 
ATOM 1840 C CB  . GLN D 1 32 ? -100.883 1.632   -3.661  1.00 108.26 ? 73  GLN D CB  1 
ATOM 1841 C CG  . GLN D 1 32 ? -100.878 2.318   -2.302  1.00 122.70 ? 73  GLN D CG  1 
ATOM 1842 C CD  . GLN D 1 32 ? -101.256 3.793   -2.377  1.00 129.48 ? 73  GLN D CD  1 
ATOM 1843 O OE1 . GLN D 1 32 ? -100.513 4.609   -2.925  1.00 132.10 ? 73  GLN D OE1 1 
ATOM 1844 N NE2 . GLN D 1 32 ? -102.418 4.138   -1.828  1.00 131.03 ? 73  GLN D NE2 1 
ATOM 1845 N N   . GLU D 1 33 ? -98.907  -0.210  -4.752  1.00 93.35  ? 74  GLU D N   1 
ATOM 1846 C CA  . GLU D 1 33 ? -97.885  -1.257  -4.714  1.00 94.90  ? 74  GLU D CA  1 
ATOM 1847 C C   . GLU D 1 33 ? -96.622  -0.947  -5.499  1.00 95.40  ? 74  GLU D C   1 
ATOM 1848 O O   . GLU D 1 33 ? -95.514  -1.076  -4.984  1.00 96.41  ? 74  GLU D O   1 
ATOM 1849 C CB  . GLU D 1 33 ? -98.471  -2.572  -5.204  1.00 95.56  ? 74  GLU D CB  1 
ATOM 1850 C CG  . GLU D 1 33 ? -99.195  -3.299  -4.115  1.00 97.73  ? 74  GLU D CG  1 
ATOM 1851 C CD  . GLU D 1 33 ? -100.154 -4.337  -4.633  1.00 98.99  ? 74  GLU D CD  1 
ATOM 1852 O OE1 . GLU D 1 33 ? -99.727  -5.227  -5.405  1.00 98.36  ? 74  GLU D OE1 1 
ATOM 1853 O OE2 . GLU D 1 33 ? -101.343 -4.261  -4.254  1.00 100.19 ? 74  GLU D OE2 1 
ATOM 1854 N N   . LEU D 1 34 ? -96.797  -0.547  -6.751  1.00 95.81  ? 75  LEU D N   1 
ATOM 1855 C CA  . LEU D 1 34 ? -95.683  -0.203  -7.621  1.00 94.74  ? 75  LEU D CA  1 
ATOM 1856 C C   . LEU D 1 34 ? -94.742  0.827   -6.950  1.00 96.70  ? 75  LEU D C   1 
ATOM 1857 O O   . LEU D 1 34 ? -93.552  0.556   -6.755  1.00 92.26  ? 75  LEU D O   1 
ATOM 1858 C CB  . LEU D 1 34 ? -96.249  0.334   -8.945  1.00 91.50  ? 75  LEU D CB  1 
ATOM 1859 C CG  . LEU D 1 34 ? -95.401  0.565   -10.198 1.00 90.28  ? 75  LEU D CG  1 
ATOM 1860 C CD1 . LEU D 1 34 ? -94.779  -0.729  -10.681 1.00 88.59  ? 75  LEU D CD1 1 
ATOM 1861 C CD2 . LEU D 1 34 ? -96.297  1.165   -11.263 1.00 89.02  ? 75  LEU D CD2 1 
ATOM 1862 N N   . LEU D 1 35 ? -95.275  1.996   -6.592  1.00 101.38 ? 76  LEU D N   1 
ATOM 1863 C CA  . LEU D 1 35 ? -94.474  3.037   -5.942  1.00 106.94 ? 76  LEU D CA  1 
ATOM 1864 C C   . LEU D 1 35 ? -93.805  2.473   -4.698  1.00 101.34 ? 76  LEU D C   1 
ATOM 1865 O O   . LEU D 1 35 ? -92.862  3.049   -4.161  1.00 99.79  ? 76  LEU D O   1 
ATOM 1866 C CB  . LEU D 1 35 ? -95.344  4.232   -5.534  1.00 122.69 ? 76  LEU D CB  1 
ATOM 1867 C CG  . LEU D 1 35 ? -95.872  5.190   -6.606  1.00 137.60 ? 76  LEU D CG  1 
ATOM 1868 C CD1 . LEU D 1 35 ? -96.641  6.322   -5.931  1.00 145.44 ? 76  LEU D CD1 1 
ATOM 1869 C CD2 . LEU D 1 35 ? -94.714  5.752   -7.425  1.00 146.00 ? 76  LEU D CD2 1 
ATOM 1870 N N   . ALA D 1 36 ? -94.317  1.344   -4.236  1.00 94.58  ? 77  ALA D N   1 
ATOM 1871 C CA  . ALA D 1 36 ? -93.770  0.697   -3.065  1.00 89.40  ? 77  ALA D CA  1 
ATOM 1872 C C   . ALA D 1 36 ? -92.645  -0.248  -3.492  1.00 88.06  ? 77  ALA D C   1 
ATOM 1873 O O   . ALA D 1 36 ? -91.625  -0.380  -2.808  1.00 87.95  ? 77  ALA D O   1 
ATOM 1874 C CB  . ALA D 1 36 ? -94.862  -0.064  -2.363  1.00 85.15  ? 77  ALA D CB  1 
ATOM 1875 N N   . LEU D 1 37 ? -92.832  -0.897  -4.639  1.00 86.53  ? 78  LEU D N   1 
ATOM 1876 C CA  . LEU D 1 37 ? -91.839  -1.825  -5.158  1.00 84.75  ? 78  LEU D CA  1 
ATOM 1877 C C   . LEU D 1 37 ? -90.542  -1.090  -5.445  1.00 88.62  ? 78  LEU D C   1 
ATOM 1878 O O   . LEU D 1 37 ? -89.466  -1.589  -5.141  1.00 88.86  ? 78  LEU D O   1 
ATOM 1879 C CB  . LEU D 1 37 ? -92.330  -2.481  -6.441  1.00 77.45  ? 78  LEU D CB  1 
ATOM 1880 C CG  . LEU D 1 37 ? -91.615  -3.803  -6.717  1.00 71.94  ? 78  LEU D CG  1 
ATOM 1881 C CD1 . LEU D 1 37 ? -92.430  -4.927  -6.106  1.00 68.05  ? 78  LEU D CD1 1 
ATOM 1882 C CD2 . LEU D 1 37 ? -91.445  -4.044  -8.210  1.00 68.45  ? 78  LEU D CD2 1 
ATOM 1883 N N   . LYS D 1 38 ? -90.646  0.099   -6.033  1.00 94.57  ? 79  LYS D N   1 
ATOM 1884 C CA  . LYS D 1 38 ? -89.461  0.891   -6.360  1.00 100.66 ? 79  LYS D CA  1 
ATOM 1885 C C   . LYS D 1 38 ? -88.742  1.300   -5.089  1.00 99.82  ? 79  LYS D C   1 
ATOM 1886 O O   . LYS D 1 38 ? -87.517  1.184   -4.981  1.00 96.23  ? 79  LYS D O   1 
ATOM 1887 C CB  . LYS D 1 38 ? -89.848  2.153   -7.134  1.00 108.36 ? 79  LYS D CB  1 
ATOM 1888 C CG  . LYS D 1 38 ? -88.735  3.204   -7.199  1.00 119.25 ? 79  LYS D CG  1 
ATOM 1889 C CD  . LYS D 1 38 ? -89.260  4.538   -7.711  1.00 125.25 ? 79  LYS D CD  1 
ATOM 1890 C CE  . LYS D 1 38 ? -88.193  5.620   -7.669  1.00 127.59 ? 79  LYS D CE  1 
ATOM 1891 N NZ  . LYS D 1 38 ? -88.719  6.955   -8.096  1.00 129.06 ? 79  LYS D NZ  1 
ATOM 1892 N N   . GLN D 1 39 ? -89.528  1.796   -4.140  1.00 99.92  ? 80  GLN D N   1 
ATOM 1893 C CA  . GLN D 1 39 ? -89.035  2.244   -2.845  1.00 99.69  ? 80  GLN D CA  1 
ATOM 1894 C C   . GLN D 1 39 ? -88.138  1.154   -2.278  1.00 88.09  ? 80  GLN D C   1 
ATOM 1895 O O   . GLN D 1 39 ? -86.966  1.381   -1.975  1.00 85.36  ? 80  GLN D O   1 
ATOM 1896 C CB  . GLN D 1 39 ? -90.229  2.480   -1.913  1.00 118.49 ? 80  GLN D CB  1 
ATOM 1897 C CG  . GLN D 1 39 ? -89.906  3.154   -0.594  1.00 143.03 ? 80  GLN D CG  1 
ATOM 1898 C CD  . GLN D 1 39 ? -89.641  4.639   -0.738  1.00 154.81 ? 80  GLN D CD  1 
ATOM 1899 O OE1 . GLN D 1 39 ? -88.751  5.056   -1.480  1.00 160.38 ? 80  GLN D OE1 1 
ATOM 1900 N NE2 . GLN D 1 39 ? -90.415  5.448   -0.024  1.00 160.57 ? 80  GLN D NE2 1 
ATOM 1901 N N   . LYS D 1 40 ? -88.714  -0.035  -2.161  1.00 77.28  ? 81  LYS D N   1 
ATOM 1902 C CA  . LYS D 1 40 ? -88.029  -1.201  -1.633  1.00 67.49  ? 81  LYS D CA  1 
ATOM 1903 C C   . LYS D 1 40 ? -86.698  -1.478  -2.336  1.00 66.26  ? 81  LYS D C   1 
ATOM 1904 O O   . LYS D 1 40 ? -85.611  -1.331  -1.738  1.00 62.64  ? 81  LYS D O   1 
ATOM 1905 C CB  . LYS D 1 40 ? -88.944  -2.404  -1.773  1.00 63.63  ? 81  LYS D CB  1 
ATOM 1906 C CG  . LYS D 1 40 ? -88.390  -3.693  -1.226  1.00 66.50  ? 81  LYS D CG  1 
ATOM 1907 C CD  . LYS D 1 40 ? -89.436  -4.808  -1.363  1.00 71.16  ? 81  LYS D CD  1 
ATOM 1908 C CE  . LYS D 1 40 ? -89.086  -6.037  -0.518  1.00 75.32  ? 81  LYS D CE  1 
ATOM 1909 N NZ  . LYS D 1 40 ? -89.781  -7.274  -1.001  1.00 75.94  ? 81  LYS D NZ  1 
ATOM 1910 N N   . GLN D 1 41 ? -86.801  -1.879  -3.606  1.00 65.81  ? 82  GLN D N   1 
ATOM 1911 C CA  . GLN D 1 41 ? -85.657  -2.193  -4.454  1.00 68.68  ? 82  GLN D CA  1 
ATOM 1912 C C   . GLN D 1 41 ? -84.573  -1.141  -4.409  1.00 72.86  ? 82  GLN D C   1 
ATOM 1913 O O   . GLN D 1 41 ? -83.384  -1.459  -4.364  1.00 72.74  ? 82  GLN D O   1 
ATOM 1914 C CB  . GLN D 1 41 ? -86.095  -2.335  -5.897  1.00 68.93  ? 82  GLN D CB  1 
ATOM 1915 C CG  . GLN D 1 41 ? -86.861  -3.592  -6.228  1.00 69.79  ? 82  GLN D CG  1 
ATOM 1916 C CD  . GLN D 1 41 ? -87.193  -3.680  -7.722  1.00 71.55  ? 82  GLN D CD  1 
ATOM 1917 O OE1 . GLN D 1 41 ? -87.499  -4.759  -8.244  1.00 71.72  ? 82  GLN D OE1 1 
ATOM 1918 N NE2 . GLN D 1 41 ? -87.139  -2.534  -8.411  1.00 72.63  ? 82  GLN D NE2 1 
ATOM 1919 N N   . GLN D 1 42 ? -84.984  0.117   -4.447  1.00 78.83  ? 83  GLN D N   1 
ATOM 1920 C CA  . GLN D 1 42 ? -84.021  1.195   -4.416  1.00 87.15  ? 83  GLN D CA  1 
ATOM 1921 C C   . GLN D 1 42 ? -83.153  1.060   -3.167  1.00 86.03  ? 83  GLN D C   1 
ATOM 1922 O O   . GLN D 1 42 ? -81.960  1.375   -3.202  1.00 84.61  ? 83  GLN D O   1 
ATOM 1923 C CB  . GLN D 1 42 ? -84.743  2.537   -4.433  1.00 96.92  ? 83  GLN D CB  1 
ATOM 1924 C CG  . GLN D 1 42 ? -83.869  3.721   -4.831  1.00 110.49 ? 83  GLN D CG  1 
ATOM 1925 C CD  . GLN D 1 42 ? -83.061  4.300   -3.682  1.00 116.58 ? 83  GLN D CD  1 
ATOM 1926 O OE1 . GLN D 1 42 ? -82.380  5.307   -3.850  1.00 120.29 ? 83  GLN D OE1 1 
ATOM 1927 N NE2 . GLN D 1 42 ? -83.137  3.673   -2.513  1.00 119.77 ? 83  GLN D NE2 1 
ATOM 1928 N N   . ILE D 1 43 ? -83.752  0.585   -2.070  1.00 84.16  ? 84  ILE D N   1 
ATOM 1929 C CA  . ILE D 1 43 ? -83.017  0.397   -0.819  1.00 80.85  ? 84  ILE D CA  1 
ATOM 1930 C C   . ILE D 1 43 ? -82.175  -0.865  -0.913  1.00 76.31  ? 84  ILE D C   1 
ATOM 1931 O O   . ILE D 1 43 ? -80.958  -0.814  -0.708  1.00 76.42  ? 84  ILE D O   1 
ATOM 1932 C CB  . ILE D 1 43 ? -83.964  0.298   0.423   1.00 84.17  ? 84  ILE D CB  1 
ATOM 1933 C CG1 . ILE D 1 43 ? -84.448  1.693   0.832   1.00 87.14  ? 84  ILE D CG1 1 
ATOM 1934 C CG2 . ILE D 1 43 ? -83.219  -0.300  1.611   1.00 85.24  ? 84  ILE D CG2 1 
ATOM 1935 C CD1 . ILE D 1 43 ? -85.449  1.693   1.966   1.00 89.18  ? 84  ILE D CD1 1 
ATOM 1936 N N   . GLN D 1 44 ? -82.805  -1.994  -1.226  1.00 72.02  ? 85  GLN D N   1 
ATOM 1937 C CA  . GLN D 1 44 ? -82.040  -3.222  -1.343  1.00 69.24  ? 85  GLN D CA  1 
ATOM 1938 C C   . GLN D 1 44 ? -80.714  -2.957  -2.099  1.00 68.66  ? 85  GLN D C   1 
ATOM 1939 O O   . GLN D 1 44 ? -79.628  -3.313  -1.618  1.00 64.74  ? 85  GLN D O   1 
ATOM 1940 C CB  . GLN D 1 44 ? -82.829  -4.290  -2.092  1.00 71.18  ? 85  GLN D CB  1 
ATOM 1941 C CG  . GLN D 1 44 ? -84.202  -4.601  -1.541  1.00 81.70  ? 85  GLN D CG  1 
ATOM 1942 C CD  . GLN D 1 44 ? -84.579  -6.069  -1.748  1.00 87.92  ? 85  GLN D CD  1 
ATOM 1943 O OE1 . GLN D 1 44 ? -85.758  -6.441  -1.732  1.00 91.36  ? 85  GLN D OE1 1 
ATOM 1944 N NE2 . GLN D 1 44 ? -83.567  -6.913  -1.928  1.00 91.11  ? 85  GLN D NE2 1 
ATOM 1945 N N   . ARG D 1 45 ? -80.794  -2.335  -3.280  1.00 68.19  ? 86  ARG D N   1 
ATOM 1946 C CA  . ARG D 1 45 ? -79.583  -2.039  -4.045  1.00 70.32  ? 86  ARG D CA  1 
ATOM 1947 C C   . ARG D 1 45 ? -78.536  -1.380  -3.168  1.00 73.23  ? 86  ARG D C   1 
ATOM 1948 O O   . ARG D 1 45 ? -77.334  -1.650  -3.301  1.00 71.90  ? 86  ARG D O   1 
ATOM 1949 C CB  . ARG D 1 45 ? -79.877  -1.098  -5.210  1.00 71.07  ? 86  ARG D CB  1 
ATOM 1950 C CG  . ARG D 1 45 ? -80.265  -1.775  -6.515  1.00 70.91  ? 86  ARG D CG  1 
ATOM 1951 C CD  . ARG D 1 45 ? -80.193  -0.752  -7.629  1.00 69.31  ? 86  ARG D CD  1 
ATOM 1952 N NE  . ARG D 1 45 ? -81.318  0.188   -7.663  1.00 69.68  ? 86  ARG D NE  1 
ATOM 1953 C CZ  . ARG D 1 45 ? -82.571  -0.158  -7.971  1.00 70.35  ? 86  ARG D CZ  1 
ATOM 1954 N NH1 . ARG D 1 45 ? -82.864  -1.434  -8.271  1.00 69.17  ? 86  ARG D NH1 1 
ATOM 1955 N NH2 . ARG D 1 45 ? -83.529  0.770   -7.989  1.00 68.34  ? 86  ARG D NH2 1 
ATOM 1956 N N   . GLN D 1 46 ? -78.993  -0.498  -2.281  1.00 77.53  ? 87  GLN D N   1 
ATOM 1957 C CA  . GLN D 1 46 ? -78.078  0.194   -1.389  1.00 81.92  ? 87  GLN D CA  1 
ATOM 1958 C C   . GLN D 1 46 ? -77.465  -0.765  -0.399  1.00 76.63  ? 87  GLN D C   1 
ATOM 1959 O O   . GLN D 1 46 ? -76.324  -0.587  0.018   1.00 74.97  ? 87  GLN D O   1 
ATOM 1960 C CB  . GLN D 1 46 ? -78.783  1.322   -0.655  1.00 92.01  ? 87  GLN D CB  1 
ATOM 1961 C CG  . GLN D 1 46 ? -79.079  2.497   -1.545  1.00 107.14 ? 87  GLN D CG  1 
ATOM 1962 C CD  . GLN D 1 46 ? -79.605  3.677   -0.773  1.00 114.24 ? 87  GLN D CD  1 
ATOM 1963 O OE1 . GLN D 1 46 ? -79.918  4.716   -1.351  1.00 116.96 ? 87  GLN D OE1 1 
ATOM 1964 N NE2 . GLN D 1 46 ? -79.706  3.528   0.548   1.00 116.98 ? 87  GLN D NE2 1 
ATOM 1965 N N   . ILE D 1 47 ? -78.216  -1.790  -0.025  1.00 71.34  ? 88  ILE D N   1 
ATOM 1966 C CA  . ILE D 1 47 ? -77.685  -2.762  0.913   1.00 67.87  ? 88  ILE D CA  1 
ATOM 1967 C C   . ILE D 1 47 ? -76.645  -3.583  0.192   1.00 67.78  ? 88  ILE D C   1 
ATOM 1968 O O   . ILE D 1 47 ? -75.562  -3.832  0.731   1.00 68.00  ? 88  ILE D O   1 
ATOM 1969 C CB  . ILE D 1 47 ? -78.780  -3.669  1.466   1.00 65.53  ? 88  ILE D CB  1 
ATOM 1970 C CG1 . ILE D 1 47 ? -79.740  -2.826  2.309   1.00 64.11  ? 88  ILE D CG1 1 
ATOM 1971 C CG2 . ILE D 1 47 ? -78.163  -4.797  2.276   1.00 63.62  ? 88  ILE D CG2 1 
ATOM 1972 C CD1 . ILE D 1 47 ? -81.009  -3.538  2.655   1.00 66.98  ? 88  ILE D CD1 1 
ATOM 1973 N N   . LEU D 1 48 ? -76.972  -3.985  -1.034  1.00 68.11  ? 89  LEU D N   1 
ATOM 1974 C CA  . LEU D 1 48 ? -76.049  -4.759  -1.854  1.00 68.97  ? 89  LEU D CA  1 
ATOM 1975 C C   . LEU D 1 48 ? -74.708  -4.024  -1.950  1.00 68.17  ? 89  LEU D C   1 
ATOM 1976 O O   . LEU D 1 48 ? -73.638  -4.612  -1.732  1.00 68.15  ? 89  LEU D O   1 
ATOM 1977 C CB  . LEU D 1 48 ? -76.605  -4.947  -3.263  1.00 72.64  ? 89  LEU D CB  1 
ATOM 1978 C CG  . LEU D 1 48 ? -75.558  -5.683  -4.097  1.00 77.04  ? 89  LEU D CG  1 
ATOM 1979 C CD1 . LEU D 1 48 ? -75.445  -7.106  -3.562  1.00 79.09  ? 89  LEU D CD1 1 
ATOM 1980 C CD2 . LEU D 1 48 ? -75.913  -5.673  -5.568  1.00 79.33  ? 89  LEU D CD2 1 
ATOM 1981 N N   . ILE D 1 49 ? -74.775  -2.734  -2.275  1.00 66.84  ? 90  ILE D N   1 
ATOM 1982 C CA  . ILE D 1 49 ? -73.581  -1.922  -2.400  1.00 66.30  ? 90  ILE D CA  1 
ATOM 1983 C C   . ILE D 1 49 ? -72.783  -1.739  -1.096  1.00 66.78  ? 90  ILE D C   1 
ATOM 1984 O O   . ILE D 1 49 ? -71.553  -1.869  -1.086  1.00 66.53  ? 90  ILE D O   1 
ATOM 1985 C CB  . ILE D 1 49 ? -73.942  -0.574  -2.979  1.00 64.91  ? 90  ILE D CB  1 
ATOM 1986 C CG1 . ILE D 1 49 ? -74.069  -0.711  -4.481  1.00 63.27  ? 90  ILE D CG1 1 
ATOM 1987 C CG2 . ILE D 1 49 ? -72.841  0.438   -2.677  1.00 66.80  ? 90  ILE D CG2 1 
ATOM 1988 C CD1 . ILE D 1 49 ? -72.795  -1.188  -5.125  1.00 62.44  ? 90  ILE D CD1 1 
ATOM 1989 N N   . ALA D 1 50 ? -73.483  -1.433  -0.003  1.00 65.64  ? 91  ALA D N   1 
ATOM 1990 C CA  . ALA D 1 50 ? -72.838  -1.247  1.292   1.00 66.55  ? 91  ALA D CA  1 
ATOM 1991 C C   . ALA D 1 50 ? -72.147  -2.542  1.645   1.00 72.30  ? 91  ALA D C   1 
ATOM 1992 O O   . ALA D 1 50 ? -71.010  -2.549  2.126   1.00 69.59  ? 91  ALA D O   1 
ATOM 1993 C CB  . ALA D 1 50 ? -73.855  -0.919  2.332   1.00 63.28  ? 91  ALA D CB  1 
ATOM 1994 N N   . GLU D 1 51 ? -72.850  -3.643  1.410   1.00 82.21  ? 92  GLU D N   1 
ATOM 1995 C CA  . GLU D 1 51 ? -72.293  -4.956  1.663   1.00 92.06  ? 92  GLU D CA  1 
ATOM 1996 C C   . GLU D 1 51 ? -70.935  -5.065  0.927   1.00 80.07  ? 92  GLU D C   1 
ATOM 1997 O O   . GLU D 1 51 ? -69.911  -5.393  1.545   1.00 70.00  ? 92  GLU D O   1 
ATOM 1998 C CB  . GLU D 1 51 ? -73.265  -6.014  1.150   1.00 122.45 ? 92  GLU D CB  1 
ATOM 1999 C CG  . GLU D 1 51 ? -72.891  -7.444  1.459   1.00 167.82 ? 92  GLU D CG  1 
ATOM 2000 C CD  . GLU D 1 51 ? -73.810  -8.429  0.757   1.00 188.34 ? 92  GLU D CD  1 
ATOM 2001 O OE1 . GLU D 1 51 ? -73.803  -8.462  -0.494  1.00 195.47 ? 92  GLU D OE1 1 
ATOM 2002 O OE2 . GLU D 1 51 ? -74.547  -9.162  1.452   1.00 195.52 ? 92  GLU D OE2 1 
ATOM 2003 N N   . PHE D 1 52 ? -70.918  -4.778  -0.385  1.00 68.75  ? 93  PHE D N   1 
ATOM 2004 C CA  . PHE D 1 52 ? -69.682  -4.879  -1.154  1.00 63.50  ? 93  PHE D CA  1 
ATOM 2005 C C   . PHE D 1 52 ? -68.662  -3.951  -0.568  1.00 68.67  ? 93  PHE D C   1 
ATOM 2006 O O   . PHE D 1 52 ? -67.510  -4.330  -0.356  1.00 61.92  ? 93  PHE D O   1 
ATOM 2007 C CB  . PHE D 1 52 ? -69.884  -4.486  -2.604  1.00 62.16  ? 93  PHE D CB  1 
ATOM 2008 C CG  . PHE D 1 52 ? -68.624  -4.561  -3.427  1.00 63.87  ? 93  PHE D CG  1 
ATOM 2009 C CD1 . PHE D 1 52 ? -68.184  -5.783  -3.949  1.00 65.85  ? 93  PHE D CD1 1 
ATOM 2010 C CD2 . PHE D 1 52 ? -67.865  -3.425  -3.664  1.00 65.00  ? 93  PHE D CD2 1 
ATOM 2011 C CE1 . PHE D 1 52 ? -67.002  -5.875  -4.700  1.00 66.60  ? 93  PHE D CE1 1 
ATOM 2012 C CE2 . PHE D 1 52 ? -66.677  -3.501  -4.413  1.00 67.22  ? 93  PHE D CE2 1 
ATOM 2013 C CZ  . PHE D 1 52 ? -66.248  -4.728  -4.930  1.00 68.09  ? 93  PHE D CZ  1 
ATOM 2014 N N   . GLN D 1 53 ? -69.092  -2.720  -0.315  1.00 80.06  ? 94  GLN D N   1 
ATOM 2015 C CA  . GLN D 1 53 ? -68.213  -1.725  0.261   1.00 93.43  ? 94  GLN D CA  1 
ATOM 2016 C C   . GLN D 1 53 ? -67.408  -2.381  1.396   1.00 87.89  ? 94  GLN D C   1 
ATOM 2017 O O   . GLN D 1 53 ? -66.170  -2.412  1.352   1.00 77.74  ? 94  GLN D O   1 
ATOM 2018 C CB  . GLN D 1 53 ? -69.044  -0.548  0.791   1.00 117.13 ? 94  GLN D CB  1 
ATOM 2019 C CG  . GLN D 1 53 ? -68.325  0.805   0.850   1.00 154.14 ? 94  GLN D CG  1 
ATOM 2020 C CD  . GLN D 1 53 ? -67.173  0.837   1.842   1.00 171.11 ? 94  GLN D CD  1 
ATOM 2021 O OE1 . GLN D 1 53 ? -67.310  0.416   2.992   1.00 177.34 ? 94  GLN D OE1 1 
ATOM 2022 N NE2 . GLN D 1 53 ? -66.033  1.353   1.402   1.00 177.46 ? 94  GLN D NE2 1 
ATOM 2023 N N   . ARG D 1 54 ? -68.105  -2.929  2.394   1.00 85.35  ? 95  ARG D N   1 
ATOM 2024 C CA  . ARG D 1 54 ? -67.435  -3.570  3.535   1.00 89.30  ? 95  ARG D CA  1 
ATOM 2025 C C   . ARG D 1 54 ? -66.488  -4.700  3.150   1.00 87.19  ? 95  ARG D C   1 
ATOM 2026 O O   . ARG D 1 54 ? -65.307  -4.680  3.507   1.00 88.99  ? 95  ARG D O   1 
ATOM 2027 C CB  . ARG D 1 54 ? -68.463  -4.096  4.545   1.00 97.00  ? 95  ARG D CB  1 
ATOM 2028 C CG  . ARG D 1 54 ? -67.917  -5.093  5.569   1.00 106.64 ? 95  ARG D CG  1 
ATOM 2029 C CD  . ARG D 1 54 ? -69.003  -5.495  6.564   1.00 115.54 ? 95  ARG D CD  1 
ATOM 2030 N NE  . ARG D 1 54 ? -68.639  -6.652  7.379   1.00 121.88 ? 95  ARG D NE  1 
ATOM 2031 C CZ  . ARG D 1 54 ? -68.567  -7.897  6.920   1.00 124.51 ? 95  ARG D CZ  1 
ATOM 2032 N NH1 . ARG D 1 54 ? -68.834  -8.152  5.645   1.00 125.20 ? 95  ARG D NH1 1 
ATOM 2033 N NH2 . ARG D 1 54 ? -68.238  -8.891  7.737   1.00 125.71 ? 95  ARG D NH2 1 
ATOM 2034 N N   . GLN D 1 55 ? -66.990  -5.691  2.430   1.00 85.03  ? 96  GLN D N   1 
ATOM 2035 C CA  . GLN D 1 55 ? -66.119  -6.784  2.034   1.00 83.88  ? 96  GLN D CA  1 
ATOM 2036 C C   . GLN D 1 55 ? -64.931  -6.244  1.236   1.00 82.05  ? 96  GLN D C   1 
ATOM 2037 O O   . GLN D 1 55 ? -63.956  -6.949  0.998   1.00 84.59  ? 96  GLN D O   1 
ATOM 2038 C CB  . GLN D 1 55 ? -66.898  -7.817  1.213   1.00 83.89  ? 96  GLN D CB  1 
ATOM 2039 C CG  . GLN D 1 55 ? -67.661  -8.822  2.066   1.00 85.46  ? 96  GLN D CG  1 
ATOM 2040 C CD  . GLN D 1 55 ? -68.716  -9.583  1.289   1.00 87.17  ? 96  GLN D CD  1 
ATOM 2041 O OE1 . GLN D 1 55 ? -69.765  -9.038  0.951   1.00 89.06  ? 96  GLN D OE1 1 
ATOM 2042 N NE2 . GLN D 1 55 ? -68.440  -10.849 0.997   1.00 90.26  ? 96  GLN D NE2 1 
ATOM 2043 N N   . PHE D 1 56 ? -65.009  -4.977  0.847   1.00 78.75  ? 97  PHE D N   1 
ATOM 2044 C CA  . PHE D 1 56 ? -63.951  -4.362  0.068   1.00 73.27  ? 97  PHE D CA  1 
ATOM 2045 C C   . PHE D 1 56 ? -62.865  -3.727  0.887   1.00 74.29  ? 97  PHE D C   1 
ATOM 2046 O O   . PHE D 1 56 ? -61.692  -3.866  0.555   1.00 71.65  ? 97  PHE D O   1 
ATOM 2047 C CB  . PHE D 1 56 ? -64.507  -3.286  -0.835  1.00 67.50  ? 97  PHE D CB  1 
ATOM 2048 C CG  . PHE D 1 56 ? -63.476  -2.635  -1.686  1.00 56.17  ? 97  PHE D CG  1 
ATOM 2049 C CD1 . PHE D 1 56 ? -62.728  -3.395  -2.563  1.00 54.18  ? 97  PHE D CD1 1 
ATOM 2050 C CD2 . PHE D 1 56 ? -63.304  -1.275  -1.670  1.00 48.45  ? 97  PHE D CD2 1 
ATOM 2051 C CE1 . PHE D 1 56 ? -61.801  -2.800  -3.455  1.00 50.75  ? 97  PHE D CE1 1 
ATOM 2052 C CE2 . PHE D 1 56 ? -62.393  -0.662  -2.540  1.00 46.75  ? 97  PHE D CE2 1 
ATOM 2053 C CZ  . PHE D 1 56 ? -61.625  -1.425  -3.458  1.00 43.10  ? 97  PHE D CZ  1 
ATOM 2054 N N   . GLU D 1 57 ? -63.241  -2.981  1.923   1.00 75.55  ? 98  GLU D N   1 
ATOM 2055 C CA  . GLU D 1 57 ? -62.209  -2.355  2.727   1.00 79.33  ? 98  GLU D CA  1 
ATOM 2056 C C   . GLU D 1 57 ? -61.572  -3.462  3.549   1.00 80.94  ? 98  GLU D C   1 
ATOM 2057 O O   . GLU D 1 57 ? -60.365  -3.432  3.831   1.00 77.15  ? 98  GLU D O   1 
ATOM 2058 C CB  . GLU D 1 57 ? -62.774  -1.251  3.632   1.00 82.91  ? 98  GLU D CB  1 
ATOM 2059 C CG  . GLU D 1 57 ? -61.685  -0.297  4.217   1.00 90.68  ? 98  GLU D CG  1 
ATOM 2060 C CD  . GLU D 1 57 ? -60.884  0.481   3.138   1.00 96.07  ? 98  GLU D CD  1 
ATOM 2061 O OE1 . GLU D 1 57 ? -61.495  1.271   2.371   1.00 97.73  ? 98  GLU D OE1 1 
ATOM 2062 O OE2 . GLU D 1 57 ? -59.639  0.308   3.059   1.00 96.50  ? 98  GLU D OE2 1 
ATOM 2063 N N   . GLN D 1 58 ? -62.387  -4.461  3.890   1.00 84.55  ? 99  GLN D N   1 
ATOM 2064 C CA  . GLN D 1 58 ? -61.917  -5.604  4.669   1.00 88.33  ? 99  GLN D CA  1 
ATOM 2065 C C   . GLN D 1 58 ? -60.749  -6.275  3.955   1.00 78.77  ? 99  GLN D C   1 
ATOM 2066 O O   . GLN D 1 58 ? -59.643  -6.366  4.508   1.00 72.91  ? 99  GLN D O   1 
ATOM 2067 C CB  . GLN D 1 58 ? -63.051  -6.608  4.879   1.00 108.19 ? 99  GLN D CB  1 
ATOM 2068 C CG  . GLN D 1 58 ? -62.671  -7.819  5.721   1.00 136.82 ? 99  GLN D CG  1 
ATOM 2069 C CD  . GLN D 1 58 ? -63.883  -8.612  6.171   1.00 150.69 ? 99  GLN D CD  1 
ATOM 2070 O OE1 . GLN D 1 58 ? -64.680  -8.140  6.984   1.00 156.68 ? 99  GLN D OE1 1 
ATOM 2071 N NE2 . GLN D 1 58 ? -64.032  -9.822  5.640   1.00 157.24 ? 99  GLN D NE2 1 
ATOM 2072 N N   . LEU D 1 59 ? -60.986  -6.731  2.727   1.00 69.45  ? 100 LEU D N   1 
ATOM 2073 C CA  . LEU D 1 59 ? -59.924  -7.366  1.982   1.00 63.86  ? 100 LEU D CA  1 
ATOM 2074 C C   . LEU D 1 59 ? -58.749  -6.392  1.921   1.00 64.87  ? 100 LEU D C   1 
ATOM 2075 O O   . LEU D 1 59 ? -57.587  -6.731  2.243   1.00 60.52  ? 100 LEU D O   1 
ATOM 2076 C CB  . LEU D 1 59 ? -60.372  -7.707  0.567   1.00 60.87  ? 100 LEU D CB  1 
ATOM 2077 C CG  . LEU D 1 59 ? -59.370  -8.665  -0.079  1.00 64.46  ? 100 LEU D CG  1 
ATOM 2078 C CD1 . LEU D 1 59 ? -59.220  -9.872  0.856   1.00 65.75  ? 100 LEU D CD1 1 
ATOM 2079 C CD2 . LEU D 1 59 ? -59.804  -9.103  -1.477  1.00 66.00  ? 100 LEU D CD2 1 
ATOM 2080 N N   . SER D 1 60 ? -59.062  -5.160  1.542   1.00 68.86  ? 101 SER D N   1 
ATOM 2081 C CA  . SER D 1 60 ? -58.045  -4.132  1.418   1.00 76.81  ? 101 SER D CA  1 
ATOM 2082 C C   . SER D 1 60 ? -57.185  -3.919  2.653   1.00 83.07  ? 101 SER D C   1 
ATOM 2083 O O   . SER D 1 60 ? -55.982  -3.662  2.528   1.00 86.70  ? 101 SER D O   1 
ATOM 2084 C CB  . SER D 1 60 ? -58.689  -2.833  0.974   1.00 75.24  ? 101 SER D CB  1 
ATOM 2085 O OG  . SER D 1 60 ? -59.035  -2.943  -0.401  1.00 70.06  ? 101 SER D OG  1 
ATOM 2086 N N   . ARG D 1 61 ? -57.773  -4.033  3.840   1.00 88.17  ? 102 ARG D N   1 
ATOM 2087 C CA  . ARG D 1 61 ? -56.988  -3.868  5.056   1.00 92.24  ? 102 ARG D CA  1 
ATOM 2088 C C   . ARG D 1 61 ? -56.163  -5.129  5.311   1.00 92.67  ? 102 ARG D C   1 
ATOM 2089 O O   . ARG D 1 61 ? -55.037  -5.059  5.813   1.00 95.95  ? 102 ARG D O   1 
ATOM 2090 C CB  . ARG D 1 61 ? -57.899  -3.568  6.239   1.00 95.61  ? 102 ARG D CB  1 
ATOM 2091 C CG  . ARG D 1 61 ? -58.695  -2.317  6.023   1.00 97.49  ? 102 ARG D CG  1 
ATOM 2092 C CD  . ARG D 1 61 ? -58.755  -1.444  7.257   1.00 98.57  ? 102 ARG D CD  1 
ATOM 2093 N NE  . ARG D 1 61 ? -59.187  -0.097  6.890   1.00 101.34 ? 102 ARG D NE  1 
ATOM 2094 C CZ  . ARG D 1 61 ? -59.348  0.906   7.745   1.00 101.75 ? 102 ARG D CZ  1 
ATOM 2095 N NH1 . ARG D 1 61 ? -59.112  0.730   9.039   1.00 101.46 ? 102 ARG D NH1 1 
ATOM 2096 N NH2 . ARG D 1 61 ? -59.758  2.088   7.301   1.00 102.74 ? 102 ARG D NH2 1 
ATOM 2097 N N   . GLN D 1 62 ? -56.718  -6.286  4.964   1.00 90.39  ? 103 GLN D N   1 
ATOM 2098 C CA  . GLN D 1 62 ? -55.968  -7.517  5.140   1.00 83.89  ? 103 GLN D CA  1 
ATOM 2099 C C   . GLN D 1 62 ? -54.782  -7.405  4.210   1.00 79.99  ? 103 GLN D C   1 
ATOM 2100 O O   . GLN D 1 62 ? -53.658  -7.183  4.661   1.00 74.69  ? 103 GLN D O   1 
ATOM 2101 C CB  . GLN D 1 62 ? -56.801  -8.743  4.758   1.00 84.23  ? 103 GLN D CB  1 
ATOM 2102 C CG  . GLN D 1 62 ? -57.902  -9.088  5.758   1.00 89.53  ? 103 GLN D CG  1 
ATOM 2103 C CD  . GLN D 1 62 ? -58.851  -10.176 5.258   1.00 91.52  ? 103 GLN D CD  1 
ATOM 2104 O OE1 . GLN D 1 62 ? -59.880  -10.456 5.886   1.00 92.20  ? 103 GLN D OE1 1 
ATOM 2105 N NE2 . GLN D 1 62 ? -58.509  -10.791 4.126   1.00 92.21  ? 103 GLN D NE2 1 
ATOM 2106 N N   . HIS D 1 63 ? -55.048  -7.519  2.908   1.00 77.90  ? 104 HIS D N   1 
ATOM 2107 C CA  . HIS D 1 63 ? -53.985  -7.458  1.912   1.00 79.70  ? 104 HIS D CA  1 
ATOM 2108 C C   . HIS D 1 63 ? -52.909  -6.468  2.316   1.00 80.86  ? 104 HIS D C   1 
ATOM 2109 O O   . HIS D 1 63 ? -51.714  -6.772  2.292   1.00 78.65  ? 104 HIS D O   1 
ATOM 2110 C CB  . HIS D 1 63 ? -54.535  -7.076  0.539   1.00 82.18  ? 104 HIS D CB  1 
ATOM 2111 C CG  . HIS D 1 63 ? -55.251  -8.188  -0.159  1.00 89.74  ? 104 HIS D CG  1 
ATOM 2112 N ND1 . HIS D 1 63 ? -55.712  -8.078  -1.455  1.00 93.50  ? 104 HIS D ND1 1 
ATOM 2113 C CD2 . HIS D 1 63 ? -55.617  -9.422  0.263   1.00 91.84  ? 104 HIS D CD2 1 
ATOM 2114 C CE1 . HIS D 1 63 ? -56.333  -9.193  -1.798  1.00 93.89  ? 104 HIS D CE1 1 
ATOM 2115 N NE2 . HIS D 1 63 ? -56.290  -10.024 -0.772  1.00 92.48  ? 104 HIS D NE2 1 
ATOM 2116 N N   . GLU D 1 64 ? -53.340  -5.283  2.713   1.00 84.02  ? 105 GLU D N   1 
ATOM 2117 C CA  . GLU D 1 64 ? -52.408  -4.250  3.109   1.00 87.71  ? 105 GLU D CA  1 
ATOM 2118 C C   . GLU D 1 64 ? -51.517  -4.721  4.262   1.00 87.40  ? 105 GLU D C   1 
ATOM 2119 O O   . GLU D 1 64 ? -50.302  -4.862  4.083   1.00 86.69  ? 105 GLU D O   1 
ATOM 2120 C CB  . GLU D 1 64 ? -53.182  -2.999  3.500   1.00 92.09  ? 105 GLU D CB  1 
ATOM 2121 C CG  . GLU D 1 64 ? -52.399  -1.725  3.388   1.00 98.39  ? 105 GLU D CG  1 
ATOM 2122 C CD  . GLU D 1 64 ? -53.190  -0.539  3.885   1.00 101.59 ? 105 GLU D CD  1 
ATOM 2123 O OE1 . GLU D 1 64 ? -53.523  -0.518  5.094   1.00 101.52 ? 105 GLU D OE1 1 
ATOM 2124 O OE2 . GLU D 1 64 ? -53.483  0.363   3.065   1.00 102.71 ? 105 GLU D OE2 1 
ATOM 2125 N N   . ALA D 1 65 ? -52.118  -4.986  5.428   1.00 86.29  ? 106 ALA D N   1 
ATOM 2126 C CA  . ALA D 1 65 ? -51.362  -5.427  6.616   1.00 86.18  ? 106 ALA D CA  1 
ATOM 2127 C C   . ALA D 1 65 ? -50.295  -6.436  6.250   1.00 88.50  ? 106 ALA D C   1 
ATOM 2128 O O   . ALA D 1 65 ? -49.150  -6.351  6.700   1.00 88.47  ? 106 ALA D O   1 
ATOM 2129 C CB  . ALA D 1 65 ? -52.294  -6.035  7.661   1.00 80.10  ? 106 ALA D CB  1 
ATOM 2130 N N   . GLN D 1 66 ? -50.689  -7.401  5.430   1.00 92.44  ? 107 GLN D N   1 
ATOM 2131 C CA  . GLN D 1 66 ? -49.770  -8.423  4.983   1.00 95.24  ? 107 GLN D CA  1 
ATOM 2132 C C   . GLN D 1 66 ? -48.622  -7.728  4.269   1.00 90.03  ? 107 GLN D C   1 
ATOM 2133 O O   . GLN D 1 66 ? -47.467  -7.840  4.678   1.00 88.97  ? 107 GLN D O   1 
ATOM 2134 C CB  . GLN D 1 66 ? -50.474  -9.379  4.030   1.00 105.20 ? 107 GLN D CB  1 
ATOM 2135 C CG  . GLN D 1 66 ? -51.747  -9.971  4.602   1.00 118.10 ? 107 GLN D CG  1 
ATOM 2136 C CD  . GLN D 1 66 ? -52.304  -11.082 3.735   1.00 123.96 ? 107 GLN D CD  1 
ATOM 2137 O OE1 . GLN D 1 66 ? -52.588  -10.884 2.551   1.00 125.34 ? 107 GLN D OE1 1 
ATOM 2138 N NE2 . GLN D 1 66 ? -52.459  -12.265 4.321   1.00 126.44 ? 107 GLN D NE2 1 
ATOM 2139 N N   . LEU D 1 67 ? -48.946  -6.997  3.208   1.00 83.08  ? 108 LEU D N   1 
ATOM 2140 C CA  . LEU D 1 67 ? -47.928  -6.293  2.458   1.00 77.26  ? 108 LEU D CA  1 
ATOM 2141 C C   . LEU D 1 67 ? -47.038  -5.471  3.364   1.00 80.09  ? 108 LEU D C   1 
ATOM 2142 O O   . LEU D 1 67 ? -45.868  -5.248  3.050   1.00 77.80  ? 108 LEU D O   1 
ATOM 2143 C CB  . LEU D 1 67 ? -48.567  -5.406  1.409   1.00 68.99  ? 108 LEU D CB  1 
ATOM 2144 C CG  . LEU D 1 67 ? -48.334  -6.047  0.049   1.00 64.66  ? 108 LEU D CG  1 
ATOM 2145 C CD1 . LEU D 1 67 ? -49.155  -5.326  -1.028  1.00 61.65  ? 108 LEU D CD1 1 
ATOM 2146 C CD2 . LEU D 1 67 ? -46.839  -6.017  -0.263  1.00 60.50  ? 108 LEU D CD2 1 
ATOM 2147 N N   . HIS D 1 68 ? -47.592  -5.028  4.492   1.00 87.11  ? 109 HIS D N   1 
ATOM 2148 C CA  . HIS D 1 68 ? -46.822  -4.235  5.446   1.00 96.70  ? 109 HIS D CA  1 
ATOM 2149 C C   . HIS D 1 68 ? -45.979  -5.158  6.320   1.00 100.50 ? 109 HIS D C   1 
ATOM 2150 O O   . HIS D 1 68 ? -44.774  -4.927  6.507   1.00 96.52  ? 109 HIS D O   1 
ATOM 2151 C CB  . HIS D 1 68 ? -47.755  -3.359  6.293   1.00 101.10 ? 109 HIS D CB  1 
ATOM 2152 C CG  . HIS D 1 68 ? -47.984  -1.992  5.715   1.00 108.45 ? 109 HIS D CG  1 
ATOM 2153 N ND1 . HIS D 1 68 ? -47.986  -1.747  4.357   1.00 110.64 ? 109 HIS D ND1 1 
ATOM 2154 C CD2 . HIS D 1 68 ? -48.238  -0.802  6.311   1.00 111.17 ? 109 HIS D CD2 1 
ATOM 2155 C CE1 . HIS D 1 68 ? -48.230  -0.467  4.141   1.00 111.49 ? 109 HIS D CE1 1 
ATOM 2156 N NE2 . HIS D 1 68 ? -48.388  0.129   5.309   1.00 111.94 ? 109 HIS D NE2 1 
ATOM 2157 N N   . GLU D 1 69 ? -46.614  -6.210  6.837   1.00 105.09 ? 110 GLU D N   1 
ATOM 2158 C CA  . GLU D 1 69 ? -45.924  -7.204  7.656   1.00 111.52 ? 110 GLU D CA  1 
ATOM 2159 C C   . GLU D 1 69 ? -44.679  -7.619  6.878   1.00 107.15 ? 110 GLU D C   1 
ATOM 2160 O O   . GLU D 1 69 ? -43.585  -7.683  7.430   1.00 111.87 ? 110 GLU D O   1 
ATOM 2161 C CB  . GLU D 1 69 ? -46.817  -8.426  7.875   1.00 124.52 ? 110 GLU D CB  1 
ATOM 2162 C CG  . GLU D 1 69 ? -46.142  -9.583  8.601   1.00 137.91 ? 110 GLU D CG  1 
ATOM 2163 C CD  . GLU D 1 69 ? -46.643  -10.947 8.129   1.00 144.39 ? 110 GLU D CD  1 
ATOM 2164 O OE1 . GLU D 1 69 ? -46.261  -11.971 8.738   1.00 147.46 ? 110 GLU D OE1 1 
ATOM 2165 O OE2 . GLU D 1 69 ? -47.411  -10.997 7.143   1.00 147.74 ? 110 GLU D OE2 1 
ATOM 2166 N N   . HIS D 1 70 ? -44.863  -7.895  5.589   1.00 101.43 ? 111 HIS D N   1 
ATOM 2167 C CA  . HIS D 1 70 ? -43.764  -8.284  4.727   1.00 91.66  ? 111 HIS D CA  1 
ATOM 2168 C C   . HIS D 1 70 ? -42.695  -7.217  4.774   1.00 91.79  ? 111 HIS D C   1 
ATOM 2169 O O   . HIS D 1 70 ? -41.510  -7.524  4.694   1.00 87.10  ? 111 HIS D O   1 
ATOM 2170 C CB  . HIS D 1 70 ? -44.240  -8.473  3.290   1.00 86.88  ? 111 HIS D CB  1 
ATOM 2171 C CG  . HIS D 1 70 ? -43.147  -8.822  2.323   1.00 86.89  ? 111 HIS D CG  1 
ATOM 2172 N ND1 . HIS D 1 70 ? -42.130  -7.950  1.998   1.00 87.86  ? 111 HIS D ND1 1 
ATOM 2173 C CD2 . HIS D 1 70 ? -42.934  -9.935  1.579   1.00 88.91  ? 111 HIS D CD2 1 
ATOM 2174 C CE1 . HIS D 1 70 ? -41.341  -8.507  1.094   1.00 88.19  ? 111 HIS D CE1 1 
ATOM 2175 N NE2 . HIS D 1 70 ? -41.807  -9.711  0.822   1.00 89.24  ? 111 HIS D NE2 1 
ATOM 2176 N N   . ILE D 1 71 ? -43.090  -5.957  4.911   1.00 94.35  ? 112 ILE D N   1 
ATOM 2177 C CA  . ILE D 1 71 ? -42.083  -4.909  4.974   1.00 102.55 ? 112 ILE D CA  1 
ATOM 2178 C C   . ILE D 1 71 ? -41.228  -5.039  6.244   1.00 102.43 ? 112 ILE D C   1 
ATOM 2179 O O   . ILE D 1 71 ? -40.010  -4.828  6.203   1.00 98.89  ? 112 ILE D O   1 
ATOM 2180 C CB  . ILE D 1 71 ? -42.729  -3.515  4.878   1.00 110.07 ? 112 ILE D CB  1 
ATOM 2181 C CG1 . ILE D 1 71 ? -43.173  -3.286  3.433   1.00 117.12 ? 112 ILE D CG1 1 
ATOM 2182 C CG2 . ILE D 1 71 ? -41.754  -2.431  5.353   1.00 116.94 ? 112 ILE D CG2 1 
ATOM 2183 C CD1 . ILE D 1 71 ? -43.372  -1.842  3.059   1.00 122.21 ? 112 ILE D CD1 1 
ATOM 2184 N N   . LYS D 1 72 ? -41.862  -5.398  7.359   1.00 104.19 ? 113 LYS D N   1 
ATOM 2185 C CA  . LYS D 1 72 ? -41.150  -5.591  8.623   1.00 107.67 ? 113 LYS D CA  1 
ATOM 2186 C C   . LYS D 1 72 ? -40.167  -6.761  8.520   1.00 109.14 ? 113 LYS D C   1 
ATOM 2187 O O   . LYS D 1 72 ? -39.070  -6.725  9.089   1.00 111.22 ? 113 LYS D O   1 
ATOM 2188 C CB  . LYS D 1 72 ? -42.130  -5.885  9.759   1.00 108.73 ? 113 LYS D CB  1 
ATOM 2189 C CG  . LYS D 1 72 ? -42.763  -4.667  10.407  1.00 110.63 ? 113 LYS D CG  1 
ATOM 2190 C CD  . LYS D 1 72 ? -43.651  -5.071  11.597  1.00 111.30 ? 113 LYS D CD  1 
ATOM 2191 C CE  . LYS D 1 72 ? -42.869  -5.852  12.664  1.00 111.57 ? 113 LYS D CE  1 
ATOM 2192 N NZ  . LYS D 1 72 ? -43.706  -6.265  13.830  1.00 111.77 ? 113 LYS D NZ  1 
ATOM 2193 N N   . GLN D 1 73 ? -40.569  -7.805  7.802   1.00 109.34 ? 114 GLN D N   1 
ATOM 2194 C CA  . GLN D 1 73 ? -39.718  -8.975  7.640   1.00 108.13 ? 114 GLN D CA  1 
ATOM 2195 C C   . GLN D 1 73 ? -38.503  -8.628  6.797   1.00 107.84 ? 114 GLN D C   1 
ATOM 2196 O O   . GLN D 1 73 ? -37.367  -8.789  7.233   1.00 107.33 ? 114 GLN D O   1 
ATOM 2197 C CB  . GLN D 1 73 ? -40.473  -10.118 6.957   1.00 107.84 ? 114 GLN D CB  1 
ATOM 2198 C CG  . GLN D 1 73 ? -41.899  -10.326 7.421   1.00 107.87 ? 114 GLN D CG  1 
ATOM 2199 C CD  . GLN D 1 73 ? -42.014  -10.607 8.897   1.00 109.43 ? 114 GLN D CD  1 
ATOM 2200 O OE1 . GLN D 1 73 ? -43.101  -10.908 9.398   1.00 110.30 ? 114 GLN D OE1 1 
ATOM 2201 N NE2 . GLN D 1 73 ? -40.898  -10.505 9.612   1.00 110.77 ? 114 GLN D NE2 1 
ATOM 2202 N N   . GLN D 1 74 ? -38.745  -8.147  5.585   1.00 107.75 ? 115 GLN D N   1 
ATOM 2203 C CA  . GLN D 1 74 ? -37.644  -7.812  4.706   1.00 108.49 ? 115 GLN D CA  1 
ATOM 2204 C C   . GLN D 1 74 ? -36.730  -6.811  5.386   1.00 111.76 ? 115 GLN D C   1 
ATOM 2205 O O   . GLN D 1 74 ? -35.644  -6.515  4.889   1.00 109.24 ? 115 GLN D O   1 
ATOM 2206 C CB  . GLN D 1 74 ? -38.156  -7.247  3.386   1.00 105.31 ? 115 GLN D CB  1 
ATOM 2207 C CG  . GLN D 1 74 ? -37.155  -7.406  2.259   1.00 104.46 ? 115 GLN D CG  1 
ATOM 2208 C CD  . GLN D 1 74 ? -36.579  -6.088  1.780   1.00 103.91 ? 115 GLN D CD  1 
ATOM 2209 O OE1 . GLN D 1 74 ? -36.219  -5.224  2.582   1.00 102.91 ? 115 GLN D OE1 1 
ATOM 2210 N NE2 . GLN D 1 74 ? -36.476  -5.931  0.461   1.00 102.90 ? 115 GLN D NE2 1 
ATOM 2211 N N   . GLN D 1 75 ? -37.169  -6.289  6.528   1.00 115.91 ? 116 GLN D N   1 
ATOM 2212 C CA  . GLN D 1 75 ? -36.368  -5.328  7.275   1.00 121.74 ? 116 GLN D CA  1 
ATOM 2213 C C   . GLN D 1 75 ? -35.310  -6.076  8.067   1.00 121.70 ? 116 GLN D C   1 
ATOM 2214 O O   . GLN D 1 75 ? -34.113  -6.001  7.768   1.00 119.66 ? 116 GLN D O   1 
ATOM 2215 C CB  . GLN D 1 75 ? -37.242  -4.534  8.244   1.00 128.93 ? 116 GLN D CB  1 
ATOM 2216 C CG  . GLN D 1 75 ? -36.444  -3.702  9.240   1.00 138.16 ? 116 GLN D CG  1 
ATOM 2217 C CD  . GLN D 1 75 ? -37.198  -3.471  10.536  1.00 141.69 ? 116 GLN D CD  1 
ATOM 2218 O OE1 . GLN D 1 75 ? -38.264  -2.859  10.544  1.00 142.21 ? 116 GLN D OE1 1 
ATOM 2219 N NE2 . GLN D 1 75 ? -36.649  -3.969  11.643  1.00 141.67 ? 116 GLN D NE2 1 
ATOM 2220 N N   . GLU D 1 76 ? -35.775  -6.796  9.086   1.00 123.89 ? 117 GLU D N   1 
ATOM 2221 C CA  . GLU D 1 76 ? -34.910  -7.579  9.959   1.00 125.26 ? 117 GLU D CA  1 
ATOM 2222 C C   . GLU D 1 76 ? -33.920  -8.434  9.175   1.00 123.42 ? 117 GLU D C   1 
ATOM 2223 O O   . GLU D 1 76 ? -32.783  -8.614  9.603   1.00 118.59 ? 117 GLU D O   1 
ATOM 2224 C CB  . GLU D 1 76 ? -35.765  -8.446  10.878  1.00 128.98 ? 117 GLU D CB  1 
ATOM 2225 C CG  . GLU D 1 76 ? -36.635  -7.619  11.806  1.00 140.03 ? 117 GLU D CG  1 
ATOM 2226 C CD  . GLU D 1 76 ? -37.597  -8.461  12.618  1.00 145.77 ? 117 GLU D CD  1 
ATOM 2227 O OE1 . GLU D 1 76 ? -37.148  -9.451  13.239  1.00 147.76 ? 117 GLU D OE1 1 
ATOM 2228 O OE2 . GLU D 1 76 ? -38.802  -8.125  12.641  1.00 147.87 ? 117 GLU D OE2 1 
ATOM 2229 N N   . MET D 1 77 ? -34.348  -8.962  8.030   1.00 122.07 ? 118 MET D N   1 
ATOM 2230 C CA  . MET D 1 77 ? -33.450  -9.759  7.200   1.00 124.32 ? 118 MET D CA  1 
ATOM 2231 C C   . MET D 1 77 ? -32.295  -8.836  6.826   1.00 126.21 ? 118 MET D C   1 
ATOM 2232 O O   . MET D 1 77 ? -31.195  -8.978  7.358   1.00 133.62 ? 118 MET D O   1 
ATOM 2233 C CB  . MET D 1 77 ? -34.169  -10.268 5.938   1.00 122.37 ? 118 MET D CB  1 
ATOM 2234 C CG  . MET D 1 77 ? -33.262  -10.915 4.869   1.00 114.19 ? 118 MET D CG  1 
ATOM 2235 S SD  . MET D 1 77 ? -32.259  -9.739  3.881   1.00 110.07 ? 118 MET D SD  1 
ATOM 2236 C CE  . MET D 1 77 ? -32.814  -10.046 2.241   1.00 106.56 ? 118 MET D CE  1 
ATOM 2237 N N   . LEU D 1 78 ? -32.549  -7.877  5.935   1.00 125.74 ? 119 LEU D N   1 
ATOM 2238 C CA  . LEU D 1 78 ? -31.506  -6.946  5.521   1.00 119.07 ? 119 LEU D CA  1 
ATOM 2239 C C   . LEU D 1 78 ? -30.802  -6.436  6.763   1.00 120.77 ? 119 LEU D C   1 
ATOM 2240 O O   . LEU D 1 78 ? -29.623  -6.062  6.728   1.00 122.48 ? 119 LEU D O   1 
ATOM 2241 C CB  . LEU D 1 78 ? -32.090  -5.768  4.735   1.00 105.84 ? 119 LEU D CB  1 
ATOM 2242 C CG  . LEU D 1 78 ? -32.277  -5.966  3.226   1.00 95.05  ? 119 LEU D CG  1 
ATOM 2243 C CD1 . LEU D 1 78 ? -32.563  -4.601  2.568   1.00 89.02  ? 119 LEU D CD1 1 
ATOM 2244 C CD2 . LEU D 1 78 ? -31.017  -6.599  2.618   1.00 89.24  ? 119 LEU D CD2 1 
ATOM 2245 N N   . ALA D 1 79 ? -31.538  -6.430  7.867   1.00 117.13 ? 120 ALA D N   1 
ATOM 2246 C CA  . ALA D 1 79 ? -30.984  -5.988  9.127   1.00 119.69 ? 120 ALA D CA  1 
ATOM 2247 C C   . ALA D 1 79 ? -29.865  -6.941  9.522   1.00 124.28 ? 120 ALA D C   1 
ATOM 2248 O O   . ALA D 1 79 ? -28.689  -6.671  9.269   1.00 133.51 ? 120 ALA D O   1 
ATOM 2249 C CB  . ALA D 1 79 ? -32.062  -5.972  10.199  1.00 108.84 ? 120 ALA D CB  1 
ATOM 2250 N N   . MET D 1 80 ? -30.248  -8.072  10.112  1.00 129.76 ? 121 MET D N   1 
ATOM 2251 C CA  . MET D 1 80 ? -29.295  -9.072  10.580  1.00 126.49 ? 121 MET D CA  1 
ATOM 2252 C C   . MET D 1 80 ? -28.242  -9.511  9.569   1.00 123.00 ? 121 MET D C   1 
ATOM 2253 O O   . MET D 1 80 ? -27.154  -9.910  9.964   1.00 117.61 ? 121 MET D O   1 
ATOM 2254 C CB  . MET D 1 80 ? -30.040  -10.289 11.125  1.00 130.80 ? 121 MET D CB  1 
ATOM 2255 C CG  . MET D 1 80 ? -29.206  -11.131 12.074  1.00 141.25 ? 121 MET D CG  1 
ATOM 2256 S SD  . MET D 1 80 ? -30.205  -12.251 13.090  1.00 149.15 ? 121 MET D SD  1 
ATOM 2257 C CE  . MET D 1 80 ? -30.736  -11.137 14.406  1.00 152.46 ? 121 MET D CE  1 
ATOM 2258 N N   . LYS D 1 81 ? -28.545  -9.439  8.274   1.00 121.77 ? 122 LYS D N   1 
ATOM 2259 C CA  . LYS D 1 81 ? -27.553  -9.828  7.278   1.00 125.25 ? 122 LYS D CA  1 
ATOM 2260 C C   . LYS D 1 81 ? -26.518  -8.727  7.215   1.00 131.29 ? 122 LYS D C   1 
ATOM 2261 O O   . LYS D 1 81 ? -25.718  -8.677  6.282   1.00 127.87 ? 122 LYS D O   1 
ATOM 2262 C CB  . LYS D 1 81 ? -28.155  -9.984  5.883   1.00 122.83 ? 122 LYS D CB  1 
ATOM 2263 C CG  . LYS D 1 81 ? -28.344  -8.655  5.152   1.00 123.36 ? 122 LYS D CG  1 
ATOM 2264 C CD  . LYS D 1 81 ? -28.243  -8.795  3.633   1.00 123.19 ? 122 LYS D CD  1 
ATOM 2265 C CE  . LYS D 1 81 ? -26.826  -9.119  3.183   1.00 122.70 ? 122 LYS D CE  1 
ATOM 2266 N NZ  . LYS D 1 81 ? -26.723  -9.132  1.694   1.00 122.71 ? 122 LYS D NZ  1 
ATOM 2267 N N   . HIS D 1 82 ? -26.556  -7.820  8.187   1.00 141.74 ? 123 HIS D N   1 
ATOM 2268 C CA  . HIS D 1 82 ? -25.588  -6.734  8.233   1.00 156.89 ? 123 HIS D CA  1 
ATOM 2269 C C   . HIS D 1 82 ? -25.538  -5.992  9.569   1.00 166.03 ? 123 HIS D C   1 
ATOM 2270 O O   . HIS D 1 82 ? -24.604  -5.228  9.814   1.00 168.09 ? 123 HIS D O   1 
ATOM 2271 C CB  . HIS D 1 82 ? -25.832  -5.746  7.083   1.00 159.07 ? 123 HIS D CB  1 
ATOM 2272 C CG  . HIS D 1 82 ? -24.574  -5.306  6.390   1.00 161.06 ? 123 HIS D CG  1 
ATOM 2273 N ND1 . HIS D 1 82 ? -24.402  -5.404  5.024   1.00 162.24 ? 123 HIS D ND1 1 
ATOM 2274 C CD2 . HIS D 1 82 ? -23.424  -4.779  6.875   1.00 161.83 ? 123 HIS D CD2 1 
ATOM 2275 C CE1 . HIS D 1 82 ? -23.201  -4.958  4.699   1.00 163.20 ? 123 HIS D CE1 1 
ATOM 2276 N NE2 . HIS D 1 82 ? -22.587  -4.573  5.803   1.00 163.24 ? 123 HIS D NE2 1 
ATOM 2277 N N   . GLN D 1 83 ? -26.521  -6.225  10.438  1.00 175.75 ? 124 GLN D N   1 
ATOM 2278 C CA  . GLN D 1 83 ? -26.549  -5.559  11.742  1.00 185.44 ? 124 GLN D CA  1 
ATOM 2279 C C   . GLN D 1 83 ? -25.475  -6.126  12.661  1.00 187.91 ? 124 GLN D C   1 
ATOM 2280 O O   . GLN D 1 83 ? -24.758  -5.374  13.323  1.00 192.43 ? 124 GLN D O   1 
ATOM 2281 C CB  . GLN D 1 83 ? -27.925  -5.695  12.408  1.00 188.23 ? 124 GLN D CB  1 
ATOM 2282 C CG  . GLN D 1 83 ? -28.319  -7.108  12.812  1.00 187.60 ? 124 GLN D CG  1 
ATOM 2283 C CD  . GLN D 1 83 ? -29.627  -7.146  13.584  1.00 187.05 ? 124 GLN D CD  1 
ATOM 2284 O OE1 . GLN D 1 83 ? -29.708  -6.657  14.712  1.00 186.71 ? 124 GLN D OE1 1 
ATOM 2285 N NE2 . GLN D 1 83 ? -30.660  -7.721  12.977  1.00 186.31 ? 124 GLN D NE2 1 
ATOM 2286 N N   . GLN D 1 84 ? -25.374  -7.452  12.709  1.00 186.06 ? 125 GLN D N   1 
ATOM 2287 C CA  . GLN D 1 84 ? -24.364  -8.106  13.532  1.00 181.41 ? 125 GLN D CA  1 
ATOM 2288 C C   . GLN D 1 84 ? -23.212  -8.488  12.607  1.00 179.96 ? 125 GLN D C   1 
ATOM 2289 O O   . GLN D 1 84 ? -22.275  -9.184  12.997  1.00 187.34 ? 125 GLN D O   1 
ATOM 2290 C CB  . GLN D 1 84 ? -24.966  -9.327  14.259  1.00 176.62 ? 125 GLN D CB  1 
ATOM 2291 C CG  . GLN D 1 84 ? -24.417  -10.704 13.897  1.00 164.07 ? 125 GLN D CG  1 
ATOM 2292 C CD  . GLN D 1 84 ? -24.972  -11.243 12.593  1.00 158.43 ? 125 GLN D CD  1 
ATOM 2293 O OE1 . GLN D 1 84 ? -24.666  -10.731 11.512  1.00 156.29 ? 125 GLN D OE1 1 
ATOM 2294 N NE2 . GLN D 1 84 ? -25.797  -12.284 12.688  1.00 155.69 ? 125 GLN D NE2 1 
ATOM 2295 N N   . GLU D 1 85 ? -23.300  -7.993  11.374  1.00 175.27 ? 126 GLU D N   1 
ATOM 2296 C CA  . GLU D 1 85 ? -22.293  -8.210  10.338  1.00 166.19 ? 126 GLU D CA  1 
ATOM 2297 C C   . GLU D 1 85 ? -20.987  -7.541  10.759  1.00 168.73 ? 126 GLU D C   1 
ATOM 2298 O O   . GLU D 1 85 ? -19.967  -7.637  10.073  1.00 170.45 ? 126 GLU D O   1 
ATOM 2299 C CB  . GLU D 1 85 ? -22.769  -7.593  9.029   1.00 150.81 ? 126 GLU D CB  1 
ATOM 2300 C CG  . GLU D 1 85 ? -21.783  -7.666  7.885   1.00 131.74 ? 126 GLU D CG  1 
ATOM 2301 C CD  . GLU D 1 85 ? -21.682  -9.050  7.294   1.00 123.58 ? 126 GLU D CD  1 
ATOM 2302 O OE1 . GLU D 1 85 ? -20.971  -9.200  6.276   1.00 120.62 ? 126 GLU D OE1 1 
ATOM 2303 O OE2 . GLU D 1 85 ? -22.313  -9.981  7.845   1.00 119.62 ? 126 GLU D OE2 1 
ATOM 2304 N N   . LEU D 1 86 ? -21.042  -6.838  11.884  1.00 167.28 ? 127 LEU D N   1 
ATOM 2305 C CA  . LEU D 1 86 ? -19.880  -6.158  12.438  1.00 168.14 ? 127 LEU D CA  1 
ATOM 2306 C C   . LEU D 1 86 ? -19.026  -7.214  13.129  1.00 174.63 ? 127 LEU D C   1 
ATOM 2307 O O   . LEU D 1 86 ? -17.794  -7.132  13.158  1.00 186.09 ? 127 LEU D O   1 
ATOM 2308 C CB  . LEU D 1 86 ? -20.338  -5.099  13.444  1.00 152.08 ? 127 LEU D CB  1 
ATOM 2309 C CG  . LEU D 1 86 ? -20.726  -3.711  12.915  1.00 130.97 ? 127 LEU D CG  1 
ATOM 2310 C CD1 . LEU D 1 86 ? -21.250  -3.787  11.480  1.00 117.39 ? 127 LEU D CD1 1 
ATOM 2311 C CD2 . LEU D 1 86 ? -21.744  -3.097  13.866  1.00 116.82 ? 127 LEU D CD2 1 
ATOM 2312 N N   . LEU D 1 87 ? -19.708  -8.212  13.682  1.00 175.46 ? 128 LEU D N   1 
ATOM 2313 C CA  . LEU D 1 87 ? -19.056  -9.317  14.364  1.00 168.35 ? 128 LEU D CA  1 
ATOM 2314 C C   . LEU D 1 87 ? -18.794  -10.409 13.324  1.00 170.48 ? 128 LEU D C   1 
ATOM 2315 O O   . LEU D 1 87 ? -18.802  -11.600 13.637  1.00 176.56 ? 128 LEU D O   1 
ATOM 2316 C CB  . LEU D 1 87 ? -19.961  -9.839  15.493  1.00 152.46 ? 128 LEU D CB  1 
ATOM 2317 C CG  . LEU D 1 87 ? -20.275  -8.839  16.620  1.00 135.60 ? 128 LEU D CG  1 
ATOM 2318 C CD1 . LEU D 1 87 ? -21.331  -9.395  17.577  1.00 124.00 ? 128 LEU D CD1 1 
ATOM 2319 C CD2 . LEU D 1 87 ? -18.983  -8.516  17.367  1.00 124.53 ? 128 LEU D CD2 1 
ATOM 2320 N N   . GLU D 1 88 ? -18.564  -9.980  12.083  1.00 170.12 ? 129 GLU D N   1 
ATOM 2321 C CA  . GLU D 1 88 ? -18.298  -10.884 10.962  1.00 165.23 ? 129 GLU D CA  1 
ATOM 2322 C C   . GLU D 1 88 ? -17.305  -10.253 9.980   1.00 160.90 ? 129 GLU D C   1 
ATOM 2323 O O   . GLU D 1 88 ? -16.325  -10.929 9.609   1.00 155.17 ? 129 GLU D O   1 
ATOM 2324 C CB  . GLU D 1 88 ? -19.606  -11.226 10.226  1.00 167.07 ? 129 GLU D CB  1 
ATOM 2325 C CG  . GLU D 1 88 ? -20.624  -12.021 11.058  1.00 173.08 ? 129 GLU D CG  1 
ATOM 2326 C CD  . GLU D 1 88 ? -21.941  -12.288 10.327  1.00 175.82 ? 129 GLU D CD  1 
ATOM 2327 O OE1 . GLU D 1 88 ? -22.817  -12.960 10.911  1.00 176.94 ? 129 GLU D OE1 1 
ATOM 2328 O OE2 . GLU D 1 88 ? -22.104  -11.832 9.177   1.00 176.59 ? 129 GLU D OE2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   42  ?   ?   ?   A . n 
A 1 2   SER 2   43  ?   ?   ?   A . n 
A 1 3   SER 3   44  ?   ?   ?   A . n 
A 1 4   HIS 4   45  ?   ?   ?   A . n 
A 1 5   HIS 5   46  ?   ?   ?   A . n 
A 1 6   HIS 6   47  ?   ?   ?   A . n 
A 1 7   HIS 7   48  ?   ?   ?   A . n 
A 1 8   HIS 8   49  ?   ?   ?   A . n 
A 1 9   HIS 9   50  ?   ?   ?   A . n 
A 1 10  SER 10  51  ?   ?   ?   A . n 
A 1 11  SER 11  52  ?   ?   ?   A . n 
A 1 12  GLY 12  53  ?   ?   ?   A . n 
A 1 13  LEU 13  54  ?   ?   ?   A . n 
A 1 14  VAL 14  55  ?   ?   ?   A . n 
A 1 15  PRO 15  56  ?   ?   ?   A . n 
A 1 16  ARG 16  57  ?   ?   ?   A . n 
A 1 17  GLY 17  58  ?   ?   ?   A . n 
A 1 18  SER 18  59  ?   ?   ?   A . n 
A 1 19  HIS 19  60  ?   ?   ?   A . n 
A 1 20  MET 20  61  ?   ?   ?   A . n 
A 1 21  ALA 21  62  62  ALA ALA A . n 
A 1 22  GLU 22  63  63  GLU GLU A . n 
A 1 23  PRO 23  64  64  PRO PRO A . n 
A 1 24  ALA 24  65  65  ALA ALA A . n 
A 1 25  LEU 25  66  66  LEU LEU A . n 
A 1 26  ARG 26  67  67  ARG ARG A . n 
A 1 27  GLU 27  68  68  GLU GLU A . n 
A 1 28  GLN 28  69  69  GLN GLN A . n 
A 1 29  GLN 29  70  70  GLN GLN A . n 
A 1 30  LEU 30  71  71  LEU LEU A . n 
A 1 31  GLN 31  72  72  GLN GLN A . n 
A 1 32  GLN 32  73  73  GLN GLN A . n 
A 1 33  GLU 33  74  74  GLU GLU A . n 
A 1 34  LEU 34  75  75  LEU LEU A . n 
A 1 35  LEU 35  76  76  LEU LEU A . n 
A 1 36  ALA 36  77  77  ALA ALA A . n 
A 1 37  LEU 37  78  78  LEU LEU A . n 
A 1 38  LYS 38  79  79  LYS LYS A . n 
A 1 39  GLN 39  80  80  GLN GLN A . n 
A 1 40  LYS 40  81  81  LYS LYS A . n 
A 1 41  GLN 41  82  82  GLN GLN A . n 
A 1 42  GLN 42  83  83  GLN GLN A . n 
A 1 43  ILE 43  84  84  ILE ILE A . n 
A 1 44  GLN 44  85  85  GLN GLN A . n 
A 1 45  ARG 45  86  86  ARG ARG A . n 
A 1 46  GLN 46  87  87  GLN GLN A . n 
A 1 47  ILE 47  88  88  ILE ILE A . n 
A 1 48  LEU 48  89  89  LEU LEU A . n 
A 1 49  ILE 49  90  90  ILE ILE A . n 
A 1 50  ALA 50  91  91  ALA ALA A . n 
A 1 51  GLU 51  92  92  GLU GLU A . n 
A 1 52  PHE 52  93  93  PHE PHE A . n 
A 1 53  GLN 53  94  94  GLN GLN A . n 
A 1 54  ARG 54  95  95  ARG ARG A . n 
A 1 55  GLN 55  96  96  GLN GLN A . n 
A 1 56  PHE 56  97  97  PHE PHE A . n 
A 1 57  GLU 57  98  98  GLU GLU A . n 
A 1 58  GLN 58  99  99  GLN GLN A . n 
A 1 59  LEU 59  100 100 LEU LEU A . n 
A 1 60  SER 60  101 101 SER SER A . n 
A 1 61  ARG 61  102 102 ARG ARG A . n 
A 1 62  GLN 62  103 103 GLN GLN A . n 
A 1 63  HIS 63  104 104 HIS HIS A . n 
A 1 64  GLU 64  105 105 GLU GLU A . n 
A 1 65  ALA 65  106 106 ALA ALA A . n 
A 1 66  GLN 66  107 107 GLN GLN A . n 
A 1 67  LEU 67  108 108 LEU LEU A . n 
A 1 68  HIS 68  109 109 HIS HIS A . n 
A 1 69  GLU 69  110 110 GLU GLU A . n 
A 1 70  HIS 70  111 111 HIS HIS A . n 
A 1 71  ILE 71  112 112 ILE ILE A . n 
A 1 72  LYS 72  113 113 LYS LYS A . n 
A 1 73  GLN 73  114 114 GLN GLN A . n 
A 1 74  GLN 74  115 115 GLN GLN A . n 
A 1 75  GLN 75  116 116 GLN GLN A . n 
A 1 76  GLU 76  117 117 GLU GLU A . n 
A 1 77  MET 77  118 118 MET MET A . n 
A 1 78  LEU 78  119 119 LEU LEU A . n 
A 1 79  ALA 79  120 120 ALA ALA A . n 
A 1 80  MET 80  121 121 MET MET A . n 
A 1 81  LYS 81  122 122 LYS LYS A . n 
A 1 82  HIS 82  123 123 HIS HIS A . n 
A 1 83  GLN 83  124 124 GLN GLN A . n 
A 1 84  GLN 84  125 125 GLN GLN A . n 
A 1 85  GLU 85  126 126 GLU GLU A . n 
A 1 86  LEU 86  127 127 LEU LEU A . n 
A 1 87  LEU 87  128 128 LEU LEU A . n 
A 1 88  GLU 88  129 129 GLU GLU A . n 
A 1 89  HIS 89  130 ?   ?   ?   A . n 
A 1 90  GLN 90  131 ?   ?   ?   A . n 
A 1 91  ARG 91  132 ?   ?   ?   A . n 
A 1 92  LYS 92  133 ?   ?   ?   A . n 
A 1 93  LEU 93  134 ?   ?   ?   A . n 
A 1 94  GLU 94  135 ?   ?   ?   A . n 
A 1 95  ARG 95  136 ?   ?   ?   A . n 
A 1 96  HIS 96  137 ?   ?   ?   A . n 
A 1 97  ARG 97  138 ?   ?   ?   A . n 
A 1 98  GLN 98  139 ?   ?   ?   A . n 
A 1 99  GLU 99  140 ?   ?   ?   A . n 
A 1 100 GLN 100 141 ?   ?   ?   A . n 
A 1 101 GLU 101 142 ?   ?   ?   A . n 
A 1 102 LEU 102 143 ?   ?   ?   A . n 
A 1 103 GLU 103 144 ?   ?   ?   A . n 
A 1 104 LYS 104 145 ?   ?   ?   A . n 
A 1 105 GLN 105 146 ?   ?   ?   A . n 
A 1 106 HIS 106 147 ?   ?   ?   A . n 
A 1 107 ARG 107 148 ?   ?   ?   A . n 
A 1 108 GLU 108 149 ?   ?   ?   A . n 
A 1 109 GLN 109 150 ?   ?   ?   A . n 
A 1 110 LYS 110 151 ?   ?   ?   A . n 
A 1 111 LEU 111 152 ?   ?   ?   A . n 
A 1 112 GLN 112 153 ?   ?   ?   A . n 
B 1 1   GLY 1   42  ?   ?   ?   B . n 
B 1 2   SER 2   43  ?   ?   ?   B . n 
B 1 3   SER 3   44  ?   ?   ?   B . n 
B 1 4   HIS 4   45  ?   ?   ?   B . n 
B 1 5   HIS 5   46  ?   ?   ?   B . n 
B 1 6   HIS 6   47  ?   ?   ?   B . n 
B 1 7   HIS 7   48  ?   ?   ?   B . n 
B 1 8   HIS 8   49  ?   ?   ?   B . n 
B 1 9   HIS 9   50  ?   ?   ?   B . n 
B 1 10  SER 10  51  ?   ?   ?   B . n 
B 1 11  SER 11  52  ?   ?   ?   B . n 
B 1 12  GLY 12  53  ?   ?   ?   B . n 
B 1 13  LEU 13  54  ?   ?   ?   B . n 
B 1 14  VAL 14  55  ?   ?   ?   B . n 
B 1 15  PRO 15  56  ?   ?   ?   B . n 
B 1 16  ARG 16  57  ?   ?   ?   B . n 
B 1 17  GLY 17  58  ?   ?   ?   B . n 
B 1 18  SER 18  59  ?   ?   ?   B . n 
B 1 19  HIS 19  60  ?   ?   ?   B . n 
B 1 20  MET 20  61  ?   ?   ?   B . n 
B 1 21  ALA 21  62  62  ALA ALA B . n 
B 1 22  GLU 22  63  63  GLU GLU B . n 
B 1 23  PRO 23  64  64  PRO PRO B . n 
B 1 24  ALA 24  65  65  ALA ALA B . n 
B 1 25  LEU 25  66  66  LEU LEU B . n 
B 1 26  ARG 26  67  67  ARG ARG B . n 
B 1 27  GLU 27  68  68  GLU GLU B . n 
B 1 28  GLN 28  69  69  GLN GLN B . n 
B 1 29  GLN 29  70  70  GLN GLN B . n 
B 1 30  LEU 30  71  71  LEU LEU B . n 
B 1 31  GLN 31  72  72  GLN GLN B . n 
B 1 32  GLN 32  73  73  GLN GLN B . n 
B 1 33  GLU 33  74  74  GLU GLU B . n 
B 1 34  LEU 34  75  75  LEU LEU B . n 
B 1 35  LEU 35  76  76  LEU LEU B . n 
B 1 36  ALA 36  77  77  ALA ALA B . n 
B 1 37  LEU 37  78  78  LEU LEU B . n 
B 1 38  LYS 38  79  79  LYS LYS B . n 
B 1 39  GLN 39  80  80  GLN GLN B . n 
B 1 40  LYS 40  81  81  LYS LYS B . n 
B 1 41  GLN 41  82  82  GLN GLN B . n 
B 1 42  GLN 42  83  83  GLN GLN B . n 
B 1 43  ILE 43  84  84  ILE ILE B . n 
B 1 44  GLN 44  85  85  GLN GLN B . n 
B 1 45  ARG 45  86  86  ARG ARG B . n 
B 1 46  GLN 46  87  87  GLN GLN B . n 
B 1 47  ILE 47  88  88  ILE ILE B . n 
B 1 48  LEU 48  89  89  LEU LEU B . n 
B 1 49  ILE 49  90  90  ILE ILE B . n 
B 1 50  ALA 50  91  91  ALA ALA B . n 
B 1 51  GLU 51  92  92  GLU GLU B . n 
B 1 52  PHE 52  93  93  PHE PHE B . n 
B 1 53  GLN 53  94  94  GLN GLN B . n 
B 1 54  ARG 54  95  95  ARG ARG B . n 
B 1 55  GLN 55  96  96  GLN GLN B . n 
B 1 56  PHE 56  97  97  PHE PHE B . n 
B 1 57  GLU 57  98  98  GLU GLU B . n 
B 1 58  GLN 58  99  99  GLN GLN B . n 
B 1 59  LEU 59  100 100 LEU LEU B . n 
B 1 60  SER 60  101 101 SER SER B . n 
B 1 61  ARG 61  102 102 ARG ARG B . n 
B 1 62  GLN 62  103 103 GLN GLN B . n 
B 1 63  HIS 63  104 104 HIS HIS B . n 
B 1 64  GLU 64  105 105 GLU GLU B . n 
B 1 65  ALA 65  106 106 ALA ALA B . n 
B 1 66  GLN 66  107 107 GLN GLN B . n 
B 1 67  LEU 67  108 108 LEU LEU B . n 
B 1 68  HIS 68  109 109 HIS HIS B . n 
B 1 69  GLU 69  110 110 GLU GLU B . n 
B 1 70  HIS 70  111 111 HIS HIS B . n 
B 1 71  ILE 71  112 112 ILE ILE B . n 
B 1 72  LYS 72  113 113 LYS LYS B . n 
B 1 73  GLN 73  114 114 GLN GLN B . n 
B 1 74  GLN 74  115 115 GLN GLN B . n 
B 1 75  GLN 75  116 116 GLN GLN B . n 
B 1 76  GLU 76  117 117 GLU GLU B . n 
B 1 77  MET 77  118 118 MET MET B . n 
B 1 78  LEU 78  119 119 LEU LEU B . n 
B 1 79  ALA 79  120 120 ALA ALA B . n 
B 1 80  MET 80  121 121 MET MET B . n 
B 1 81  LYS 81  122 122 LYS LYS B . n 
B 1 82  HIS 82  123 123 HIS HIS B . n 
B 1 83  GLN 83  124 124 GLN GLN B . n 
B 1 84  GLN 84  125 125 GLN GLN B . n 
B 1 85  GLU 85  126 126 GLU GLU B . n 
B 1 86  LEU 86  127 127 LEU LEU B . n 
B 1 87  LEU 87  128 128 LEU LEU B . n 
B 1 88  GLU 88  129 129 GLU GLU B . n 
B 1 89  HIS 89  130 ?   ?   ?   B . n 
B 1 90  GLN 90  131 ?   ?   ?   B . n 
B 1 91  ARG 91  132 ?   ?   ?   B . n 
B 1 92  LYS 92  133 ?   ?   ?   B . n 
B 1 93  LEU 93  134 ?   ?   ?   B . n 
B 1 94  GLU 94  135 ?   ?   ?   B . n 
B 1 95  ARG 95  136 ?   ?   ?   B . n 
B 1 96  HIS 96  137 ?   ?   ?   B . n 
B 1 97  ARG 97  138 ?   ?   ?   B . n 
B 1 98  GLN 98  139 ?   ?   ?   B . n 
B 1 99  GLU 99  140 ?   ?   ?   B . n 
B 1 100 GLN 100 141 ?   ?   ?   B . n 
B 1 101 GLU 101 142 ?   ?   ?   B . n 
B 1 102 LEU 102 143 ?   ?   ?   B . n 
B 1 103 GLU 103 144 ?   ?   ?   B . n 
B 1 104 LYS 104 145 ?   ?   ?   B . n 
B 1 105 GLN 105 146 ?   ?   ?   B . n 
B 1 106 HIS 106 147 ?   ?   ?   B . n 
B 1 107 ARG 107 148 ?   ?   ?   B . n 
B 1 108 GLU 108 149 ?   ?   ?   B . n 
B 1 109 GLN 109 150 ?   ?   ?   B . n 
B 1 110 LYS 110 151 ?   ?   ?   B . n 
B 1 111 LEU 111 152 ?   ?   ?   B . n 
B 1 112 GLN 112 153 ?   ?   ?   B . n 
C 1 1   GLY 1   42  ?   ?   ?   C . n 
C 1 2   SER 2   43  ?   ?   ?   C . n 
C 1 3   SER 3   44  ?   ?   ?   C . n 
C 1 4   HIS 4   45  ?   ?   ?   C . n 
C 1 5   HIS 5   46  ?   ?   ?   C . n 
C 1 6   HIS 6   47  ?   ?   ?   C . n 
C 1 7   HIS 7   48  ?   ?   ?   C . n 
C 1 8   HIS 8   49  ?   ?   ?   C . n 
C 1 9   HIS 9   50  ?   ?   ?   C . n 
C 1 10  SER 10  51  ?   ?   ?   C . n 
C 1 11  SER 11  52  ?   ?   ?   C . n 
C 1 12  GLY 12  53  ?   ?   ?   C . n 
C 1 13  LEU 13  54  ?   ?   ?   C . n 
C 1 14  VAL 14  55  ?   ?   ?   C . n 
C 1 15  PRO 15  56  ?   ?   ?   C . n 
C 1 16  ARG 16  57  ?   ?   ?   C . n 
C 1 17  GLY 17  58  ?   ?   ?   C . n 
C 1 18  SER 18  59  ?   ?   ?   C . n 
C 1 19  HIS 19  60  ?   ?   ?   C . n 
C 1 20  MET 20  61  ?   ?   ?   C . n 
C 1 21  ALA 21  62  62  ALA ALA C . n 
C 1 22  GLU 22  63  63  GLU GLU C . n 
C 1 23  PRO 23  64  64  PRO PRO C . n 
C 1 24  ALA 24  65  65  ALA ALA C . n 
C 1 25  LEU 25  66  66  LEU LEU C . n 
C 1 26  ARG 26  67  67  ARG ARG C . n 
C 1 27  GLU 27  68  68  GLU GLU C . n 
C 1 28  GLN 28  69  69  GLN GLN C . n 
C 1 29  GLN 29  70  70  GLN GLN C . n 
C 1 30  LEU 30  71  71  LEU LEU C . n 
C 1 31  GLN 31  72  72  GLN GLN C . n 
C 1 32  GLN 32  73  73  GLN GLN C . n 
C 1 33  GLU 33  74  74  GLU GLU C . n 
C 1 34  LEU 34  75  75  LEU LEU C . n 
C 1 35  LEU 35  76  76  LEU LEU C . n 
C 1 36  ALA 36  77  77  ALA ALA C . n 
C 1 37  LEU 37  78  78  LEU LEU C . n 
C 1 38  LYS 38  79  79  LYS LYS C . n 
C 1 39  GLN 39  80  80  GLN GLN C . n 
C 1 40  LYS 40  81  81  LYS LYS C . n 
C 1 41  GLN 41  82  82  GLN GLN C . n 
C 1 42  GLN 42  83  83  GLN GLN C . n 
C 1 43  ILE 43  84  84  ILE ILE C . n 
C 1 44  GLN 44  85  85  GLN GLN C . n 
C 1 45  ARG 45  86  86  ARG ARG C . n 
C 1 46  GLN 46  87  87  GLN GLN C . n 
C 1 47  ILE 47  88  88  ILE ILE C . n 
C 1 48  LEU 48  89  89  LEU LEU C . n 
C 1 49  ILE 49  90  90  ILE ILE C . n 
C 1 50  ALA 50  91  91  ALA ALA C . n 
C 1 51  GLU 51  92  92  GLU GLU C . n 
C 1 52  PHE 52  93  93  PHE PHE C . n 
C 1 53  GLN 53  94  94  GLN GLN C . n 
C 1 54  ARG 54  95  95  ARG ARG C . n 
C 1 55  GLN 55  96  96  GLN GLN C . n 
C 1 56  PHE 56  97  97  PHE PHE C . n 
C 1 57  GLU 57  98  98  GLU GLU C . n 
C 1 58  GLN 58  99  99  GLN GLN C . n 
C 1 59  LEU 59  100 100 LEU LEU C . n 
C 1 60  SER 60  101 101 SER SER C . n 
C 1 61  ARG 61  102 102 ARG ARG C . n 
C 1 62  GLN 62  103 103 GLN GLN C . n 
C 1 63  HIS 63  104 104 HIS HIS C . n 
C 1 64  GLU 64  105 105 GLU GLU C . n 
C 1 65  ALA 65  106 106 ALA ALA C . n 
C 1 66  GLN 66  107 107 GLN GLN C . n 
C 1 67  LEU 67  108 108 LEU LEU C . n 
C 1 68  HIS 68  109 109 HIS HIS C . n 
C 1 69  GLU 69  110 110 GLU GLU C . n 
C 1 70  HIS 70  111 111 HIS HIS C . n 
C 1 71  ILE 71  112 112 ILE ILE C . n 
C 1 72  LYS 72  113 113 LYS LYS C . n 
C 1 73  GLN 73  114 114 GLN GLN C . n 
C 1 74  GLN 74  115 115 GLN GLN C . n 
C 1 75  GLN 75  116 116 GLN GLN C . n 
C 1 76  GLU 76  117 117 GLU GLU C . n 
C 1 77  MET 77  118 118 MET MET C . n 
C 1 78  LEU 78  119 119 LEU LEU C . n 
C 1 79  ALA 79  120 120 ALA ALA C . n 
C 1 80  MET 80  121 121 MET MET C . n 
C 1 81  LYS 81  122 122 LYS LYS C . n 
C 1 82  HIS 82  123 123 HIS HIS C . n 
C 1 83  GLN 83  124 124 GLN GLN C . n 
C 1 84  GLN 84  125 125 GLN GLN C . n 
C 1 85  GLU 85  126 126 GLU GLU C . n 
C 1 86  LEU 86  127 127 LEU LEU C . n 
C 1 87  LEU 87  128 128 LEU LEU C . n 
C 1 88  GLU 88  129 129 GLU GLU C . n 
C 1 89  HIS 89  130 ?   ?   ?   C . n 
C 1 90  GLN 90  131 ?   ?   ?   C . n 
C 1 91  ARG 91  132 ?   ?   ?   C . n 
C 1 92  LYS 92  133 ?   ?   ?   C . n 
C 1 93  LEU 93  134 ?   ?   ?   C . n 
C 1 94  GLU 94  135 ?   ?   ?   C . n 
C 1 95  ARG 95  136 ?   ?   ?   C . n 
C 1 96  HIS 96  137 ?   ?   ?   C . n 
C 1 97  ARG 97  138 ?   ?   ?   C . n 
C 1 98  GLN 98  139 ?   ?   ?   C . n 
C 1 99  GLU 99  140 ?   ?   ?   C . n 
C 1 100 GLN 100 141 ?   ?   ?   C . n 
C 1 101 GLU 101 142 ?   ?   ?   C . n 
C 1 102 LEU 102 143 ?   ?   ?   C . n 
C 1 103 GLU 103 144 ?   ?   ?   C . n 
C 1 104 LYS 104 145 ?   ?   ?   C . n 
C 1 105 GLN 105 146 ?   ?   ?   C . n 
C 1 106 HIS 106 147 ?   ?   ?   C . n 
C 1 107 ARG 107 148 ?   ?   ?   C . n 
C 1 108 GLU 108 149 ?   ?   ?   C . n 
C 1 109 GLN 109 150 ?   ?   ?   C . n 
C 1 110 LYS 110 151 ?   ?   ?   C . n 
C 1 111 LEU 111 152 ?   ?   ?   C . n 
C 1 112 GLN 112 153 ?   ?   ?   C . n 
D 1 1   GLY 1   42  ?   ?   ?   D . n 
D 1 2   SER 2   43  ?   ?   ?   D . n 
D 1 3   SER 3   44  ?   ?   ?   D . n 
D 1 4   HIS 4   45  ?   ?   ?   D . n 
D 1 5   HIS 5   46  ?   ?   ?   D . n 
D 1 6   HIS 6   47  ?   ?   ?   D . n 
D 1 7   HIS 7   48  ?   ?   ?   D . n 
D 1 8   HIS 8   49  ?   ?   ?   D . n 
D 1 9   HIS 9   50  ?   ?   ?   D . n 
D 1 10  SER 10  51  ?   ?   ?   D . n 
D 1 11  SER 11  52  ?   ?   ?   D . n 
D 1 12  GLY 12  53  ?   ?   ?   D . n 
D 1 13  LEU 13  54  ?   ?   ?   D . n 
D 1 14  VAL 14  55  ?   ?   ?   D . n 
D 1 15  PRO 15  56  ?   ?   ?   D . n 
D 1 16  ARG 16  57  ?   ?   ?   D . n 
D 1 17  GLY 17  58  ?   ?   ?   D . n 
D 1 18  SER 18  59  ?   ?   ?   D . n 
D 1 19  HIS 19  60  ?   ?   ?   D . n 
D 1 20  MET 20  61  ?   ?   ?   D . n 
D 1 21  ALA 21  62  62  ALA ALA D . n 
D 1 22  GLU 22  63  63  GLU GLU D . n 
D 1 23  PRO 23  64  64  PRO PRO D . n 
D 1 24  ALA 24  65  65  ALA ALA D . n 
D 1 25  LEU 25  66  66  LEU LEU D . n 
D 1 26  ARG 26  67  67  ARG ARG D . n 
D 1 27  GLU 27  68  68  GLU GLU D . n 
D 1 28  GLN 28  69  69  GLN GLN D . n 
D 1 29  GLN 29  70  70  GLN GLN D . n 
D 1 30  LEU 30  71  71  LEU LEU D . n 
D 1 31  GLN 31  72  72  GLN GLN D . n 
D 1 32  GLN 32  73  73  GLN GLN D . n 
D 1 33  GLU 33  74  74  GLU GLU D . n 
D 1 34  LEU 34  75  75  LEU LEU D . n 
D 1 35  LEU 35  76  76  LEU LEU D . n 
D 1 36  ALA 36  77  77  ALA ALA D . n 
D 1 37  LEU 37  78  78  LEU LEU D . n 
D 1 38  LYS 38  79  79  LYS LYS D . n 
D 1 39  GLN 39  80  80  GLN GLN D . n 
D 1 40  LYS 40  81  81  LYS LYS D . n 
D 1 41  GLN 41  82  82  GLN GLN D . n 
D 1 42  GLN 42  83  83  GLN GLN D . n 
D 1 43  ILE 43  84  84  ILE ILE D . n 
D 1 44  GLN 44  85  85  GLN GLN D . n 
D 1 45  ARG 45  86  86  ARG ARG D . n 
D 1 46  GLN 46  87  87  GLN GLN D . n 
D 1 47  ILE 47  88  88  ILE ILE D . n 
D 1 48  LEU 48  89  89  LEU LEU D . n 
D 1 49  ILE 49  90  90  ILE ILE D . n 
D 1 50  ALA 50  91  91  ALA ALA D . n 
D 1 51  GLU 51  92  92  GLU GLU D . n 
D 1 52  PHE 52  93  93  PHE PHE D . n 
D 1 53  GLN 53  94  94  GLN GLN D . n 
D 1 54  ARG 54  95  95  ARG ARG D . n 
D 1 55  GLN 55  96  96  GLN GLN D . n 
D 1 56  PHE 56  97  97  PHE PHE D . n 
D 1 57  GLU 57  98  98  GLU GLU D . n 
D 1 58  GLN 58  99  99  GLN GLN D . n 
D 1 59  LEU 59  100 100 LEU LEU D . n 
D 1 60  SER 60  101 101 SER SER D . n 
D 1 61  ARG 61  102 102 ARG ARG D . n 
D 1 62  GLN 62  103 103 GLN GLN D . n 
D 1 63  HIS 63  104 104 HIS HIS D . n 
D 1 64  GLU 64  105 105 GLU GLU D . n 
D 1 65  ALA 65  106 106 ALA ALA D . n 
D 1 66  GLN 66  107 107 GLN GLN D . n 
D 1 67  LEU 67  108 108 LEU LEU D . n 
D 1 68  HIS 68  109 109 HIS HIS D . n 
D 1 69  GLU 69  110 110 GLU GLU D . n 
D 1 70  HIS 70  111 111 HIS HIS D . n 
D 1 71  ILE 71  112 112 ILE ILE D . n 
D 1 72  LYS 72  113 113 LYS LYS D . n 
D 1 73  GLN 73  114 114 GLN GLN D . n 
D 1 74  GLN 74  115 115 GLN GLN D . n 
D 1 75  GLN 75  116 116 GLN GLN D . n 
D 1 76  GLU 76  117 117 GLU GLU D . n 
D 1 77  MET 77  118 118 MET MET D . n 
D 1 78  LEU 78  119 119 LEU LEU D . n 
D 1 79  ALA 79  120 120 ALA ALA D . n 
D 1 80  MET 80  121 121 MET MET D . n 
D 1 81  LYS 81  122 122 LYS LYS D . n 
D 1 82  HIS 82  123 123 HIS HIS D . n 
D 1 83  GLN 83  124 124 GLN GLN D . n 
D 1 84  GLN 84  125 125 GLN GLN D . n 
D 1 85  GLU 85  126 126 GLU GLU D . n 
D 1 86  LEU 86  127 127 LEU LEU D . n 
D 1 87  LEU 87  128 128 LEU LEU D . n 
D 1 88  GLU 88  129 129 GLU GLU D . n 
D 1 89  HIS 89  130 ?   ?   ?   D . n 
D 1 90  GLN 90  131 ?   ?   ?   D . n 
D 1 91  ARG 91  132 ?   ?   ?   D . n 
D 1 92  LYS 92  133 ?   ?   ?   D . n 
D 1 93  LEU 93  134 ?   ?   ?   D . n 
D 1 94  GLU 94  135 ?   ?   ?   D . n 
D 1 95  ARG 95  136 ?   ?   ?   D . n 
D 1 96  HIS 96  137 ?   ?   ?   D . n 
D 1 97  ARG 97  138 ?   ?   ?   D . n 
D 1 98  GLN 98  139 ?   ?   ?   D . n 
D 1 99  GLU 99  140 ?   ?   ?   D . n 
D 1 100 GLN 100 141 ?   ?   ?   D . n 
D 1 101 GLU 101 142 ?   ?   ?   D . n 
D 1 102 LEU 102 143 ?   ?   ?   D . n 
D 1 103 GLU 103 144 ?   ?   ?   D . n 
D 1 104 LYS 104 145 ?   ?   ?   D . n 
D 1 105 GLN 105 146 ?   ?   ?   D . n 
D 1 106 HIS 106 147 ?   ?   ?   D . n 
D 1 107 ARG 107 148 ?   ?   ?   D . n 
D 1 108 GLU 108 149 ?   ?   ?   D . n 
D 1 109 GLN 109 150 ?   ?   ?   D . n 
D 1 110 LYS 110 151 ?   ?   ?   D . n 
D 1 111 LEU 111 152 ?   ?   ?   D . n 
D 1 112 GLN 112 153 ?   ?   ?   D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10730 ? 
1 MORE         -81   ? 
1 'SSA (A^2)'  17340 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-27 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             2.950 
_diffrn_reflns.pdbx_d_res_low              30.000 
_diffrn_reflns.pdbx_number_obs             13769 
_diffrn_reflns.pdbx_Rmerge_I_obs           0.053 
_diffrn_reflns.pdbx_Rsym_value             ? 
_diffrn_reflns.pdbx_chi_squared            1.02 
_diffrn_reflns.av_sigmaI_over_netI         11.00 
_diffrn_reflns.pdbx_redundancy             3.70 
_diffrn_reflns.pdbx_percent_possible_obs   97.50 
_diffrn_reflns.number                      50424 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 6.34 30.00 ? ? 0.030 ? 1.848 3.50 92.00 
1 5.04 6.34  ? ? 0.038 ? 1.447 3.60 99.30 
1 4.40 5.04  ? ? 0.042 ? 1.530 3.70 98.30 
1 4.00 4.40  ? ? 0.048 ? 1.083 3.70 99.10 
1 3.72 4.00  ? ? 0.060 ? 0.950 3.70 98.90 
1 3.50 3.72  ? ? 0.094 ? 0.748 3.70 98.70 
1 3.32 3.50  ? ? 0.135 ? 0.718 3.70 98.80 
1 3.18 3.32  ? ? 0.223 ? 0.663 3.70 98.70 
1 3.06 3.18  ? ? 0.504 ? 0.641 3.60 97.10 
1 2.95 3.06  ? ? 0.758 ? 0.584 3.60 94.20 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .       ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .       ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
CNS         .       ?                package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 3 
PDB_EXTRACT 2.000   'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
ADSC        QUANTUM ?                ?       ?                    ?                        'data collection' ? ?          ? 5 
HKL-2000    .       ?                ?       ?                    ?                        'data reduction'  ? ?          ? 6 
CNS         .       ?                ?       ?                    ?                        phasing           ? ?          ? 7 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 63  ? ? -142.70 -69.28 
2  1 LYS A 81  ? ? -54.70  -72.87 
3  1 GLN A 103 ? ? -64.44  -75.03 
4  1 MET A 118 ? ? -50.47  -74.11 
5  1 ALA A 120 ? ? -67.72  -72.56 
6  1 GLU B 63  ? ? -153.75 -66.34 
7  1 LEU B 76  ? ? -53.50  -8.18  
8  1 GLN B 103 ? ? -66.15  -70.10 
9  1 LYS B 113 ? ? -69.80  1.11   
10 1 ALA B 120 ? ? -64.53  -86.37 
11 1 GLU C 63  ? ? -139.43 -68.81 
12 1 ALA C 65  ? ? -55.20  -9.28  
13 1 LEU C 76  ? ? -49.66  -13.19 
14 1 GLN C 103 ? ? -66.92  -72.07 
15 1 ALA C 120 ? ? -69.07  -72.69 
16 1 GLU D 63  ? ? -151.30 -81.82 
17 1 GLN D 103 ? ? -64.39  -72.10 
18 1 GLN D 115 ? ? -56.51  -9.06  
19 1 MET D 118 ? ? -60.16  -72.68 
20 1 ALA D 120 ? ? -63.94  -81.82 
21 1 HIS D 123 ? ? -165.51 -12.39 
22 1 LEU D 128 ? ? -90.29  31.38  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 42  ? A GLY 1   
2   1 Y 1 A SER 43  ? A SER 2   
3   1 Y 1 A SER 44  ? A SER 3   
4   1 Y 1 A HIS 45  ? A HIS 4   
5   1 Y 1 A HIS 46  ? A HIS 5   
6   1 Y 1 A HIS 47  ? A HIS 6   
7   1 Y 1 A HIS 48  ? A HIS 7   
8   1 Y 1 A HIS 49  ? A HIS 8   
9   1 Y 1 A HIS 50  ? A HIS 9   
10  1 Y 1 A SER 51  ? A SER 10  
11  1 Y 1 A SER 52  ? A SER 11  
12  1 Y 1 A GLY 53  ? A GLY 12  
13  1 Y 1 A LEU 54  ? A LEU 13  
14  1 Y 1 A VAL 55  ? A VAL 14  
15  1 Y 1 A PRO 56  ? A PRO 15  
16  1 Y 1 A ARG 57  ? A ARG 16  
17  1 Y 1 A GLY 58  ? A GLY 17  
18  1 Y 1 A SER 59  ? A SER 18  
19  1 Y 1 A HIS 60  ? A HIS 19  
20  1 Y 1 A MET 61  ? A MET 20  
21  1 Y 1 A HIS 130 ? A HIS 89  
22  1 Y 1 A GLN 131 ? A GLN 90  
23  1 Y 1 A ARG 132 ? A ARG 91  
24  1 Y 1 A LYS 133 ? A LYS 92  
25  1 Y 1 A LEU 134 ? A LEU 93  
26  1 Y 1 A GLU 135 ? A GLU 94  
27  1 Y 1 A ARG 136 ? A ARG 95  
28  1 Y 1 A HIS 137 ? A HIS 96  
29  1 Y 1 A ARG 138 ? A ARG 97  
30  1 Y 1 A GLN 139 ? A GLN 98  
31  1 Y 1 A GLU 140 ? A GLU 99  
32  1 Y 1 A GLN 141 ? A GLN 100 
33  1 Y 1 A GLU 142 ? A GLU 101 
34  1 Y 1 A LEU 143 ? A LEU 102 
35  1 Y 1 A GLU 144 ? A GLU 103 
36  1 Y 1 A LYS 145 ? A LYS 104 
37  1 Y 1 A GLN 146 ? A GLN 105 
38  1 Y 1 A HIS 147 ? A HIS 106 
39  1 Y 1 A ARG 148 ? A ARG 107 
40  1 Y 1 A GLU 149 ? A GLU 108 
41  1 Y 1 A GLN 150 ? A GLN 109 
42  1 Y 1 A LYS 151 ? A LYS 110 
43  1 Y 1 A LEU 152 ? A LEU 111 
44  1 Y 1 A GLN 153 ? A GLN 112 
45  1 Y 1 B GLY 42  ? B GLY 1   
46  1 Y 1 B SER 43  ? B SER 2   
47  1 Y 1 B SER 44  ? B SER 3   
48  1 Y 1 B HIS 45  ? B HIS 4   
49  1 Y 1 B HIS 46  ? B HIS 5   
50  1 Y 1 B HIS 47  ? B HIS 6   
51  1 Y 1 B HIS 48  ? B HIS 7   
52  1 Y 1 B HIS 49  ? B HIS 8   
53  1 Y 1 B HIS 50  ? B HIS 9   
54  1 Y 1 B SER 51  ? B SER 10  
55  1 Y 1 B SER 52  ? B SER 11  
56  1 Y 1 B GLY 53  ? B GLY 12  
57  1 Y 1 B LEU 54  ? B LEU 13  
58  1 Y 1 B VAL 55  ? B VAL 14  
59  1 Y 1 B PRO 56  ? B PRO 15  
60  1 Y 1 B ARG 57  ? B ARG 16  
61  1 Y 1 B GLY 58  ? B GLY 17  
62  1 Y 1 B SER 59  ? B SER 18  
63  1 Y 1 B HIS 60  ? B HIS 19  
64  1 Y 1 B MET 61  ? B MET 20  
65  1 Y 1 B HIS 130 ? B HIS 89  
66  1 Y 1 B GLN 131 ? B GLN 90  
67  1 Y 1 B ARG 132 ? B ARG 91  
68  1 Y 1 B LYS 133 ? B LYS 92  
69  1 Y 1 B LEU 134 ? B LEU 93  
70  1 Y 1 B GLU 135 ? B GLU 94  
71  1 Y 1 B ARG 136 ? B ARG 95  
72  1 Y 1 B HIS 137 ? B HIS 96  
73  1 Y 1 B ARG 138 ? B ARG 97  
74  1 Y 1 B GLN 139 ? B GLN 98  
75  1 Y 1 B GLU 140 ? B GLU 99  
76  1 Y 1 B GLN 141 ? B GLN 100 
77  1 Y 1 B GLU 142 ? B GLU 101 
78  1 Y 1 B LEU 143 ? B LEU 102 
79  1 Y 1 B GLU 144 ? B GLU 103 
80  1 Y 1 B LYS 145 ? B LYS 104 
81  1 Y 1 B GLN 146 ? B GLN 105 
82  1 Y 1 B HIS 147 ? B HIS 106 
83  1 Y 1 B ARG 148 ? B ARG 107 
84  1 Y 1 B GLU 149 ? B GLU 108 
85  1 Y 1 B GLN 150 ? B GLN 109 
86  1 Y 1 B LYS 151 ? B LYS 110 
87  1 Y 1 B LEU 152 ? B LEU 111 
88  1 Y 1 B GLN 153 ? B GLN 112 
89  1 Y 1 C GLY 42  ? C GLY 1   
90  1 Y 1 C SER 43  ? C SER 2   
91  1 Y 1 C SER 44  ? C SER 3   
92  1 Y 1 C HIS 45  ? C HIS 4   
93  1 Y 1 C HIS 46  ? C HIS 5   
94  1 Y 1 C HIS 47  ? C HIS 6   
95  1 Y 1 C HIS 48  ? C HIS 7   
96  1 Y 1 C HIS 49  ? C HIS 8   
97  1 Y 1 C HIS 50  ? C HIS 9   
98  1 Y 1 C SER 51  ? C SER 10  
99  1 Y 1 C SER 52  ? C SER 11  
100 1 Y 1 C GLY 53  ? C GLY 12  
101 1 Y 1 C LEU 54  ? C LEU 13  
102 1 Y 1 C VAL 55  ? C VAL 14  
103 1 Y 1 C PRO 56  ? C PRO 15  
104 1 Y 1 C ARG 57  ? C ARG 16  
105 1 Y 1 C GLY 58  ? C GLY 17  
106 1 Y 1 C SER 59  ? C SER 18  
107 1 Y 1 C HIS 60  ? C HIS 19  
108 1 Y 1 C MET 61  ? C MET 20  
109 1 Y 1 C HIS 130 ? C HIS 89  
110 1 Y 1 C GLN 131 ? C GLN 90  
111 1 Y 1 C ARG 132 ? C ARG 91  
112 1 Y 1 C LYS 133 ? C LYS 92  
113 1 Y 1 C LEU 134 ? C LEU 93  
114 1 Y 1 C GLU 135 ? C GLU 94  
115 1 Y 1 C ARG 136 ? C ARG 95  
116 1 Y 1 C HIS 137 ? C HIS 96  
117 1 Y 1 C ARG 138 ? C ARG 97  
118 1 Y 1 C GLN 139 ? C GLN 98  
119 1 Y 1 C GLU 140 ? C GLU 99  
120 1 Y 1 C GLN 141 ? C GLN 100 
121 1 Y 1 C GLU 142 ? C GLU 101 
122 1 Y 1 C LEU 143 ? C LEU 102 
123 1 Y 1 C GLU 144 ? C GLU 103 
124 1 Y 1 C LYS 145 ? C LYS 104 
125 1 Y 1 C GLN 146 ? C GLN 105 
126 1 Y 1 C HIS 147 ? C HIS 106 
127 1 Y 1 C ARG 148 ? C ARG 107 
128 1 Y 1 C GLU 149 ? C GLU 108 
129 1 Y 1 C GLN 150 ? C GLN 109 
130 1 Y 1 C LYS 151 ? C LYS 110 
131 1 Y 1 C LEU 152 ? C LEU 111 
132 1 Y 1 C GLN 153 ? C GLN 112 
133 1 Y 1 D GLY 42  ? D GLY 1   
134 1 Y 1 D SER 43  ? D SER 2   
135 1 Y 1 D SER 44  ? D SER 3   
136 1 Y 1 D HIS 45  ? D HIS 4   
137 1 Y 1 D HIS 46  ? D HIS 5   
138 1 Y 1 D HIS 47  ? D HIS 6   
139 1 Y 1 D HIS 48  ? D HIS 7   
140 1 Y 1 D HIS 49  ? D HIS 8   
141 1 Y 1 D HIS 50  ? D HIS 9   
142 1 Y 1 D SER 51  ? D SER 10  
143 1 Y 1 D SER 52  ? D SER 11  
144 1 Y 1 D GLY 53  ? D GLY 12  
145 1 Y 1 D LEU 54  ? D LEU 13  
146 1 Y 1 D VAL 55  ? D VAL 14  
147 1 Y 1 D PRO 56  ? D PRO 15  
148 1 Y 1 D ARG 57  ? D ARG 16  
149 1 Y 1 D GLY 58  ? D GLY 17  
150 1 Y 1 D SER 59  ? D SER 18  
151 1 Y 1 D HIS 60  ? D HIS 19  
152 1 Y 1 D MET 61  ? D MET 20  
153 1 Y 1 D HIS 130 ? D HIS 89  
154 1 Y 1 D GLN 131 ? D GLN 90  
155 1 Y 1 D ARG 132 ? D ARG 91  
156 1 Y 1 D LYS 133 ? D LYS 92  
157 1 Y 1 D LEU 134 ? D LEU 93  
158 1 Y 1 D GLU 135 ? D GLU 94  
159 1 Y 1 D ARG 136 ? D ARG 95  
160 1 Y 1 D HIS 137 ? D HIS 96  
161 1 Y 1 D ARG 138 ? D ARG 97  
162 1 Y 1 D GLN 139 ? D GLN 98  
163 1 Y 1 D GLU 140 ? D GLU 99  
164 1 Y 1 D GLN 141 ? D GLN 100 
165 1 Y 1 D GLU 142 ? D GLU 101 
166 1 Y 1 D LEU 143 ? D LEU 102 
167 1 Y 1 D GLU 144 ? D GLU 103 
168 1 Y 1 D LYS 145 ? D LYS 104 
169 1 Y 1 D GLN 146 ? D GLN 105 
170 1 Y 1 D HIS 147 ? D HIS 106 
171 1 Y 1 D ARG 148 ? D ARG 107 
172 1 Y 1 D GLU 149 ? D GLU 108 
173 1 Y 1 D GLN 150 ? D GLN 109 
174 1 Y 1 D LYS 151 ? D LYS 110 
175 1 Y 1 D LEU 152 ? D LEU 111 
176 1 Y 1 D GLN 153 ? D GLN 112 
#