data_2ODE
# 
_entry.id   2ODE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ODE         
RCSB  RCSB040994   
WWPDB D_1000040994 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ODE 
_pdbx_database_status.recvd_initial_deposition_date   2006-12-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gileadi, C.'                          1  
'Soundararajan, M.'                    2  
'Turnbull, A.P.'                       3  
'Elkins, J.M.'                         4  
'Papagrigoriou, E.'                    5  
'Pike, A.C.W.'                         6  
'Bunkoczi, G.'                         7  
'Gorrec, F.'                           8  
'Umeano, C.'                           9  
'von Delft, F.'                        10 
'Weigelt, J.'                          11 
'Edwards, A.'                          12 
'Arrowsmith, C.H.'                     13 
'Sundstrom, M.'                        14 
'Doyle, D.A.'                          15 
'Structural Genomics Consortium (SGC)' 16 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Soundararajan, M.' 1  
primary 'Willard, F.S.'     2  
primary 'Kimple, A.J.'      3  
primary 'Turnbull, A.P.'    4  
primary 'Ball, L.J.'        5  
primary 'Schoch, G.A.'      6  
primary 'Gileadi, C.'       7  
primary 'Fedorov, O.Y.'     8  
primary 'Dowler, E.F.'      9  
primary 'Higman, V.A.'      10 
primary 'Hutsell, S.Q.'     11 
primary 'Sundstrom, M.'     12 
primary 'Doyle, D.A.'       13 
primary 'Siderovski, D.P.'  14 
# 
_cell.entry_id           2ODE 
_cell.length_a           112.837 
_cell.length_b           130.216 
_cell.length_c           68.519 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ODE 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Guanine nucleotide-binding protein G(k) subunit alpha' 40162.578 2   ? ? ?                 ? 
2 polymer     man 'Regulator of G-protein signaling 8'                    16618.889 2   ? ? 'residues 42-180' ? 
3 non-polymer syn 'TETRAFLUOROALUMINATE ION'                              102.975   2   ? ? ?                 ? 
4 non-polymer syn 'MAGNESIUM ION'                                         24.305    2   ? ? ?                 ? 
5 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"                              443.201   2   ? ? ?                 ? 
6 water       nat water                                                   18.015    655 ? ? ?                 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Gi, alpha-3' 
2 RGS8          
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SMTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSI
IAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDR
ISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMN
RMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYT
HFTCATDTKNVQFVFDAVTDVIIKNNLKES
;
;SMTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSI
IAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDR
ISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMN
RMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYT
HFTCATDTKNVQFVFDAVTDVIIKNNLKES
;
A,C ? 
2 'polypeptide(L)' no no 
;SMLKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPR
EVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
;
;SMLKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPR
EVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   THR n 
1 4   LEU n 
1 5   SER n 
1 6   ALA n 
1 7   GLU n 
1 8   ASP n 
1 9   LYS n 
1 10  ALA n 
1 11  ALA n 
1 12  VAL n 
1 13  GLU n 
1 14  ARG n 
1 15  SER n 
1 16  LYS n 
1 17  MET n 
1 18  ILE n 
1 19  ASP n 
1 20  ARG n 
1 21  ASN n 
1 22  LEU n 
1 23  ARG n 
1 24  GLU n 
1 25  ASP n 
1 26  GLY n 
1 27  GLU n 
1 28  LYS n 
1 29  ALA n 
1 30  ALA n 
1 31  LYS n 
1 32  GLU n 
1 33  VAL n 
1 34  LYS n 
1 35  LEU n 
1 36  LEU n 
1 37  LEU n 
1 38  LEU n 
1 39  GLY n 
1 40  ALA n 
1 41  GLY n 
1 42  GLU n 
1 43  SER n 
1 44  GLY n 
1 45  LYS n 
1 46  SER n 
1 47  THR n 
1 48  ILE n 
1 49  VAL n 
1 50  LYS n 
1 51  GLN n 
1 52  MET n 
1 53  LYS n 
1 54  ILE n 
1 55  ILE n 
1 56  HIS n 
1 57  GLU n 
1 58  ASP n 
1 59  GLY n 
1 60  TYR n 
1 61  SER n 
1 62  GLU n 
1 63  ASP n 
1 64  GLU n 
1 65  CYS n 
1 66  LYS n 
1 67  GLN n 
1 68  TYR n 
1 69  LYS n 
1 70  VAL n 
1 71  VAL n 
1 72  VAL n 
1 73  TYR n 
1 74  SER n 
1 75  ASN n 
1 76  THR n 
1 77  ILE n 
1 78  GLN n 
1 79  SER n 
1 80  ILE n 
1 81  ILE n 
1 82  ALA n 
1 83  ILE n 
1 84  ILE n 
1 85  ARG n 
1 86  ALA n 
1 87  MET n 
1 88  GLY n 
1 89  ARG n 
1 90  LEU n 
1 91  LYS n 
1 92  ILE n 
1 93  ASP n 
1 94  PHE n 
1 95  GLY n 
1 96  GLU n 
1 97  ALA n 
1 98  ALA n 
1 99  ARG n 
1 100 ALA n 
1 101 ASP n 
1 102 ASP n 
1 103 ALA n 
1 104 ARG n 
1 105 GLN n 
1 106 LEU n 
1 107 PHE n 
1 108 VAL n 
1 109 LEU n 
1 110 ALA n 
1 111 GLY n 
1 112 SER n 
1 113 ALA n 
1 114 GLU n 
1 115 GLU n 
1 116 GLY n 
1 117 VAL n 
1 118 MET n 
1 119 THR n 
1 120 PRO n 
1 121 GLU n 
1 122 LEU n 
1 123 ALA n 
1 124 GLY n 
1 125 VAL n 
1 126 ILE n 
1 127 LYS n 
1 128 ARG n 
1 129 LEU n 
1 130 TRP n 
1 131 ARG n 
1 132 ASP n 
1 133 GLY n 
1 134 GLY n 
1 135 VAL n 
1 136 GLN n 
1 137 ALA n 
1 138 CYS n 
1 139 PHE n 
1 140 SER n 
1 141 ARG n 
1 142 SER n 
1 143 ARG n 
1 144 GLU n 
1 145 TYR n 
1 146 GLN n 
1 147 LEU n 
1 148 ASN n 
1 149 ASP n 
1 150 SER n 
1 151 ALA n 
1 152 SER n 
1 153 TYR n 
1 154 TYR n 
1 155 LEU n 
1 156 ASN n 
1 157 ASP n 
1 158 LEU n 
1 159 ASP n 
1 160 ARG n 
1 161 ILE n 
1 162 SER n 
1 163 GLN n 
1 164 SER n 
1 165 ASN n 
1 166 TYR n 
1 167 ILE n 
1 168 PRO n 
1 169 THR n 
1 170 GLN n 
1 171 GLN n 
1 172 ASP n 
1 173 VAL n 
1 174 LEU n 
1 175 ARG n 
1 176 THR n 
1 177 ARG n 
1 178 VAL n 
1 179 LYS n 
1 180 THR n 
1 181 THR n 
1 182 GLY n 
1 183 ILE n 
1 184 VAL n 
1 185 GLU n 
1 186 THR n 
1 187 HIS n 
1 188 PHE n 
1 189 THR n 
1 190 PHE n 
1 191 LYS n 
1 192 ASP n 
1 193 LEU n 
1 194 TYR n 
1 195 PHE n 
1 196 LYS n 
1 197 MET n 
1 198 PHE n 
1 199 ASP n 
1 200 VAL n 
1 201 GLY n 
1 202 GLY n 
1 203 GLN n 
1 204 ARG n 
1 205 SER n 
1 206 GLU n 
1 207 ARG n 
1 208 LYS n 
1 209 LYS n 
1 210 TRP n 
1 211 ILE n 
1 212 HIS n 
1 213 CYS n 
1 214 PHE n 
1 215 GLU n 
1 216 GLY n 
1 217 VAL n 
1 218 THR n 
1 219 ALA n 
1 220 ILE n 
1 221 ILE n 
1 222 PHE n 
1 223 CYS n 
1 224 VAL n 
1 225 ALA n 
1 226 LEU n 
1 227 SER n 
1 228 ASP n 
1 229 TYR n 
1 230 ASP n 
1 231 LEU n 
1 232 VAL n 
1 233 LEU n 
1 234 ALA n 
1 235 GLU n 
1 236 ASP n 
1 237 GLU n 
1 238 GLU n 
1 239 MET n 
1 240 ASN n 
1 241 ARG n 
1 242 MET n 
1 243 HIS n 
1 244 GLU n 
1 245 SER n 
1 246 MET n 
1 247 LYS n 
1 248 LEU n 
1 249 PHE n 
1 250 ASP n 
1 251 SER n 
1 252 ILE n 
1 253 CYS n 
1 254 ASN n 
1 255 ASN n 
1 256 LYS n 
1 257 TRP n 
1 258 PHE n 
1 259 THR n 
1 260 GLU n 
1 261 THR n 
1 262 SER n 
1 263 ILE n 
1 264 ILE n 
1 265 LEU n 
1 266 PHE n 
1 267 LEU n 
1 268 ASN n 
1 269 LYS n 
1 270 LYS n 
1 271 ASP n 
1 272 LEU n 
1 273 PHE n 
1 274 GLU n 
1 275 GLU n 
1 276 LYS n 
1 277 ILE n 
1 278 LYS n 
1 279 ARG n 
1 280 SER n 
1 281 PRO n 
1 282 LEU n 
1 283 THR n 
1 284 ILE n 
1 285 CYS n 
1 286 TYR n 
1 287 PRO n 
1 288 GLU n 
1 289 TYR n 
1 290 THR n 
1 291 GLY n 
1 292 SER n 
1 293 ASN n 
1 294 THR n 
1 295 TYR n 
1 296 GLU n 
1 297 GLU n 
1 298 ALA n 
1 299 ALA n 
1 300 ALA n 
1 301 TYR n 
1 302 ILE n 
1 303 GLN n 
1 304 CYS n 
1 305 GLN n 
1 306 PHE n 
1 307 GLU n 
1 308 ASP n 
1 309 LEU n 
1 310 ASN n 
1 311 ARG n 
1 312 ARG n 
1 313 LYS n 
1 314 ASP n 
1 315 THR n 
1 316 LYS n 
1 317 GLU n 
1 318 ILE n 
1 319 TYR n 
1 320 THR n 
1 321 HIS n 
1 322 PHE n 
1 323 THR n 
1 324 CYS n 
1 325 ALA n 
1 326 THR n 
1 327 ASP n 
1 328 THR n 
1 329 LYS n 
1 330 ASN n 
1 331 VAL n 
1 332 GLN n 
1 333 PHE n 
1 334 VAL n 
1 335 PHE n 
1 336 ASP n 
1 337 ALA n 
1 338 VAL n 
1 339 THR n 
1 340 ASP n 
1 341 VAL n 
1 342 ILE n 
1 343 ILE n 
1 344 LYS n 
1 345 ASN n 
1 346 ASN n 
1 347 LEU n 
1 348 LYS n 
1 349 GLU n 
1 350 SER n 
2 1   SER n 
2 2   MET n 
2 3   LEU n 
2 4   LYS n 
2 5   ARG n 
2 6   LEU n 
2 7   SER n 
2 8   THR n 
2 9   GLU n 
2 10  GLU n 
2 11  ALA n 
2 12  THR n 
2 13  ARG n 
2 14  TRP n 
2 15  ALA n 
2 16  ASP n 
2 17  SER n 
2 18  PHE n 
2 19  ASP n 
2 20  VAL n 
2 21  LEU n 
2 22  LEU n 
2 23  SER n 
2 24  HIS n 
2 25  LYS n 
2 26  TYR n 
2 27  GLY n 
2 28  VAL n 
2 29  ALA n 
2 30  ALA n 
2 31  PHE n 
2 32  ARG n 
2 33  ALA n 
2 34  PHE n 
2 35  LEU n 
2 36  LYS n 
2 37  THR n 
2 38  GLU n 
2 39  PHE n 
2 40  SER n 
2 41  GLU n 
2 42  GLU n 
2 43  ASN n 
2 44  LEU n 
2 45  GLU n 
2 46  PHE n 
2 47  TRP n 
2 48  LEU n 
2 49  ALA n 
2 50  CYS n 
2 51  GLU n 
2 52  GLU n 
2 53  PHE n 
2 54  LYS n 
2 55  LYS n 
2 56  THR n 
2 57  ARG n 
2 58  SER n 
2 59  THR n 
2 60  ALA n 
2 61  LYS n 
2 62  LEU n 
2 63  VAL n 
2 64  SER n 
2 65  LYS n 
2 66  ALA n 
2 67  HIS n 
2 68  ARG n 
2 69  ILE n 
2 70  PHE n 
2 71  GLU n 
2 72  GLU n 
2 73  PHE n 
2 74  VAL n 
2 75  ASP n 
2 76  VAL n 
2 77  GLN n 
2 78  ALA n 
2 79  PRO n 
2 80  ARG n 
2 81  GLU n 
2 82  VAL n 
2 83  ASN n 
2 84  ILE n 
2 85  ASP n 
2 86  PHE n 
2 87  GLN n 
2 88  THR n 
2 89  ARG n 
2 90  GLU n 
2 91  ALA n 
2 92  THR n 
2 93  ARG n 
2 94  LYS n 
2 95  ASN n 
2 96  LEU n 
2 97  GLN n 
2 98  GLU n 
2 99  PRO n 
2 100 SER n 
2 101 LEU n 
2 102 THR n 
2 103 CYS n 
2 104 PHE n 
2 105 ASP n 
2 106 GLN n 
2 107 ALA n 
2 108 GLN n 
2 109 GLY n 
2 110 LYS n 
2 111 VAL n 
2 112 HIS n 
2 113 SER n 
2 114 LEU n 
2 115 MET n 
2 116 GLU n 
2 117 LYS n 
2 118 ASP n 
2 119 SER n 
2 120 TYR n 
2 121 PRO n 
2 122 ARG n 
2 123 PHE n 
2 124 LEU n 
2 125 ARG n 
2 126 SER n 
2 127 LYS n 
2 128 MET n 
2 129 TYR n 
2 130 LEU n 
2 131 ASP n 
2 132 LEU n 
2 133 LEU n 
2 134 SER n 
2 135 GLN n 
2 136 SER n 
2 137 GLN n 
2 138 ARG n 
2 139 ARG n 
2 140 LEU n 
2 141 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo GNAI3 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
'BL21(DE3)R3' ? ? ? ? ? ? ? PLASMID ? ? ? pNIC28-Bsa4 ? ? 
2 1 sample ? ? ? human Homo RGS8  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
'BL21(DE3)R3' ? ? ? ? ? ? ? PLASMID ? ? ? pNIC28-Bsa4 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GNAI3_HUMAN P08754 1 
;TLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIA
IIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRIS
QSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRM
HESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHF
TCATDTKNVQFVFDAVTDVIIKNNLKE
;
4  ? 
2 UNP RGS8_HUMAN  P57771 2 
;LKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREV
NIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
;
42 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ODE A 3 ? 349 ? P08754 4  ? 350 ? 4  350 
2 1 2ODE C 3 ? 349 ? P08754 4  ? 350 ? 4  350 
3 2 2ODE B 3 ? 141 ? P57771 42 ? 180 ? 42 180 
4 2 2ODE D 3 ? 141 ? P57771 42 ? 180 ? 42 180 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ODE SER A 1   ? UNP P08754 ? ? 'EXPRESSION TAG' 2   1  
1 2ODE MET A 2   ? UNP P08754 ? ? 'EXPRESSION TAG' 3   2  
1 2ODE SER A 350 ? UNP P08754 ? ? 'EXPRESSION TAG' 351 3  
2 2ODE SER C 1   ? UNP P08754 ? ? 'EXPRESSION TAG' 2   4  
2 2ODE MET C 2   ? UNP P08754 ? ? 'EXPRESSION TAG' 3   5  
2 2ODE SER C 350 ? UNP P08754 ? ? 'EXPRESSION TAG' 351 6  
3 2ODE SER B 1   ? UNP P57771 ? ? 'EXPRESSION TAG' 40  7  
3 2ODE MET B 2   ? UNP P57771 ? ? 'EXPRESSION TAG' 41  8  
4 2ODE SER D 1   ? UNP P57771 ? ? 'EXPRESSION TAG' 40  9  
4 2ODE MET D 2   ? UNP P57771 ? ? 'EXPRESSION TAG' 41  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ALF non-polymer         . 'TETRAFLUOROALUMINATE ION' ? 'Al F4 -1'          102.975 
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2ODE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.22 
_exptl_crystal.density_percent_sol   44.49 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    '0.20M NH4Cl, 20.0% PEG 6K, 10.0% EtGly, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-10-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97901 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97901 
# 
_reflns.entry_id                     2ODE 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.9 
_reflns.d_resolution_low             30 
_reflns.number_all                   80222 
_reflns.number_obs                   80222 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2ODE 
_refine.ls_number_reflns_obs                     76139 
_refine.ls_number_reflns_all                     76139 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.4 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    99.79 
_refine.ls_R_factor_obs                          0.18148 
_refine.ls_R_factor_all                          0.18148 
_refine.ls_R_factor_R_work                       0.17988 
_refine.ls_R_factor_R_free                       0.21105 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4021 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.953 
_refine.B_iso_mean                               27.626 
_refine.aniso_B[1][1]                            0.76 
_refine.aniso_B[2][2]                            -1.36 
_refine.aniso_B[3][3]                            0.60 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2IHB' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.144 
_refine.pdbx_overall_ESU_R_Free                  0.130 
_refine.overall_SU_ML                            0.098 
_refine.overall_SU_B                             5.958 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6980 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         68 
_refine_hist.number_atoms_solvent             655 
_refine_hist.number_atoms_total               7703 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        29.4 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 7238  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 4842  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.369  1.955  ? 9807  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.953  3.000  ? 11783 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.443  5.000  ? 896   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.161 24.265 ? 347   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.153 15.000 ? 1254  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.883 15.000 ? 42    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.081  0.200  ? 1096  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 8064  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1545  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.215  0.200  ? 1505  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.191  0.200  ? 5049  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.179  0.200  ? 3554  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.086  0.200  ? 3482  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.193  0.200  ? 524   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.247  0.200  ? 15    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.302  0.200  ? 35    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.209  0.200  ? 11    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.786  1.500  ? 4556  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.223  1.500  ? 1788  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.159  2.000  ? 7098  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.905  3.000  ? 3100  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.820  4.500  ? 2699  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1863 0.13 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 B 688  0.12 0.50  'medium positional' 2 'X-RAY DIFFRACTION' 2 ? ? ? 
1 A 2214 0.43 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 B 868  0.56 5.00  'loose positional'  2 'X-RAY DIFFRACTION' 4 ? ? ? 
1 A 1863 0.72 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 5 ? ? ? 
1 B 688  0.92 2.00  'medium thermal'    2 'X-RAY DIFFRACTION' 6 ? ? ? 
1 A 2214 1.22 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 7 ? ? ? 
1 B 868  1.15 10.00 'loose thermal'     2 'X-RAY DIFFRACTION' 8 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.899 
_refine_ls_shell.d_res_low                        1.949 
_refine_ls_shell.number_reflns_R_work             5455 
_refine_ls_shell.R_factor_R_work                  0.261 
_refine_ls_shell.percent_reflns_obs               97.71 
_refine_ls_shell.R_factor_R_free                  0.359 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             295 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 C 
2 1 B 
2 2 D 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 33 A 348 1 5 A GLU 32 ? A LEU 347 ? 1 ? 
2 C 33 C 347 1 5 C GLU 32 ? C ASN 346 ? 1 ? 
1 B 46 B 176 1 5 B SER 7  ? B GLN 137 ? 2 ? 
2 D 56 D 171 1 5 D SER 17 ? D LEU 132 ? 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  2ODE 
_struct.title                     'Crystal structure of the heterodimeric complex of human RGS8 and activated Gi alpha 3' 
_struct.pdbx_descriptor           'Guanine nucleotide-binding protein G(k) subunit alpha, Regulator of G-protein signaling 8' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ODE 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;G protein signalling, RGS, heterotrimeric G protein, signalling complex, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? GLU A 57  ? GLY A 45  GLU A 58  1 ? 14 
HELX_P HELX_P2  2  SER A 61  ? TYR A 68  ? SER A 62  TYR A 69  1 ? 8  
HELX_P HELX_P3  3  TYR A 68  ? LYS A 91  ? TYR A 69  LYS A 92  1 ? 24 
HELX_P HELX_P4  4  ALA A 98  ? ALA A 110 ? ALA A 99  ALA A 111 1 ? 13 
HELX_P HELX_P5  5  THR A 119 ? ARG A 131 ? THR A 120 ARG A 132 1 ? 13 
HELX_P HELX_P6  6  ASP A 132 ? ARG A 141 ? ASP A 133 ARG A 142 1 ? 10 
HELX_P HELX_P7  7  SER A 142 ? TYR A 145 ? SER A 143 TYR A 146 5 ? 4  
HELX_P HELX_P8  8  SER A 150 ? ASP A 157 ? SER A 151 ASP A 158 1 ? 8  
HELX_P HELX_P9  9  ASP A 157 ? SER A 162 ? ASP A 158 SER A 163 1 ? 6  
HELX_P HELX_P10 10 THR A 169 ? ARG A 175 ? THR A 170 ARG A 176 1 ? 7  
HELX_P HELX_P11 11 GLN A 203 ? PHE A 214 ? GLN A 204 PHE A 215 5 ? 12 
HELX_P HELX_P12 12 SER A 227 ? ASP A 230 ? SER A 228 ASP A 231 5 ? 4  
HELX_P HELX_P13 13 ARG A 241 ? ASN A 254 ? ARG A 242 ASN A 255 1 ? 14 
HELX_P HELX_P14 14 ASN A 255 ? THR A 259 ? ASN A 256 THR A 260 5 ? 5  
HELX_P HELX_P15 15 LYS A 269 ? LYS A 278 ? LYS A 270 LYS A 279 1 ? 10 
HELX_P HELX_P16 16 PRO A 281 ? CYS A 285 ? PRO A 282 CYS A 286 5 ? 5  
HELX_P HELX_P17 17 THR A 294 ? ASP A 308 ? THR A 295 ASP A 309 1 ? 15 
HELX_P HELX_P18 18 ASP A 327 ? ASN A 346 ? ASP A 328 ASN A 347 1 ? 20 
HELX_P HELX_P19 19 SER B 7   ? TRP B 14  ? SER B 46  TRP B 53  1 ? 8  
HELX_P HELX_P20 20 SER B 17  ? SER B 23  ? SER B 56  SER B 62  1 ? 7  
HELX_P HELX_P21 21 HIS B 24  ? GLU B 38  ? HIS B 63  GLU B 77  1 ? 15 
HELX_P HELX_P22 22 SER B 40  ? LYS B 54  ? SER B 79  LYS B 93  1 ? 15 
HELX_P HELX_P23 23 SER B 58  ? VAL B 74  ? SER B 97  VAL B 113 1 ? 17 
HELX_P HELX_P24 24 ASP B 85  ? LEU B 96  ? ASP B 124 LEU B 135 1 ? 12 
HELX_P HELX_P25 25 PHE B 104 ? ASP B 118 ? PHE B 143 ASP B 157 1 ? 15 
HELX_P HELX_P26 26 ASP B 118 ? SER B 126 ? ASP B 157 SER B 165 1 ? 9  
HELX_P HELX_P27 27 SER B 126 ? SER B 136 ? SER B 165 SER B 175 1 ? 11 
HELX_P HELX_P28 28 GLY C 44  ? GLU C 57  ? GLY C 45  GLU C 58  1 ? 14 
HELX_P HELX_P29 29 SER C 61  ? GLN C 67  ? SER C 62  GLN C 68  1 ? 7  
HELX_P HELX_P30 30 TYR C 68  ? LYS C 91  ? TYR C 69  LYS C 92  1 ? 24 
HELX_P HELX_P31 31 ALA C 98  ? ALA C 110 ? ALA C 99  ALA C 111 1 ? 13 
HELX_P HELX_P32 32 THR C 119 ? ARG C 131 ? THR C 120 ARG C 132 1 ? 13 
HELX_P HELX_P33 33 ASP C 132 ? ARG C 141 ? ASP C 133 ARG C 142 1 ? 10 
HELX_P HELX_P34 34 SER C 142 ? TYR C 145 ? SER C 143 TYR C 146 5 ? 4  
HELX_P HELX_P35 35 SER C 150 ? ASP C 157 ? SER C 151 ASP C 158 1 ? 8  
HELX_P HELX_P36 36 ASP C 157 ? SER C 162 ? ASP C 158 SER C 163 1 ? 6  
HELX_P HELX_P37 37 THR C 169 ? ARG C 175 ? THR C 170 ARG C 176 1 ? 7  
HELX_P HELX_P38 38 GLN C 203 ? PHE C 214 ? GLN C 204 PHE C 215 5 ? 12 
HELX_P HELX_P39 39 SER C 227 ? LEU C 231 ? SER C 228 LEU C 232 5 ? 5  
HELX_P HELX_P40 40 ASN C 240 ? ASN C 254 ? ASN C 241 ASN C 255 1 ? 15 
HELX_P HELX_P41 41 ASN C 255 ? THR C 259 ? ASN C 256 THR C 260 5 ? 5  
HELX_P HELX_P42 42 LYS C 269 ? ILE C 277 ? LYS C 270 ILE C 278 1 ? 9  
HELX_P HELX_P43 43 PRO C 281 ? CYS C 285 ? PRO C 282 CYS C 286 5 ? 5  
HELX_P HELX_P44 44 THR C 294 ? ASP C 308 ? THR C 295 ASP C 309 1 ? 15 
HELX_P HELX_P45 45 ASP C 327 ? ASN C 345 ? ASP C 328 ASN C 346 1 ? 19 
HELX_P HELX_P46 46 SER D 17  ? HIS D 24  ? SER D 56  HIS D 63  1 ? 8  
HELX_P HELX_P47 47 HIS D 24  ? GLU D 38  ? HIS D 63  GLU D 77  1 ? 15 
HELX_P HELX_P48 48 SER D 40  ? LYS D 54  ? SER D 79  LYS D 93  1 ? 15 
HELX_P HELX_P49 49 SER D 58  ? VAL D 74  ? SER D 97  VAL D 113 1 ? 17 
HELX_P HELX_P50 50 ASP D 85  ? LEU D 96  ? ASP D 124 LEU D 135 1 ? 12 
HELX_P HELX_P51 51 PHE D 104 ? ASP D 118 ? PHE D 143 ASP D 157 1 ? 15 
HELX_P HELX_P52 52 ASP D 118 ? ARG D 125 ? ASP D 157 ARG D 164 1 ? 8  
HELX_P HELX_P53 53 SER D 126 ? LEU D 132 ? SER D 165 LEU D 171 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A SER 46  OG  ? ? ? 1_555 F MG  . MG  ? ? A SER 47   A MG  3001 1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc2  metalc ? ? A THR 180 OG1 ? ? ? 1_555 F MG  . MG  ? ? A THR 181  A MG  3001 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc3  metalc ? ? C SER 46  OG  ? ? ? 1_555 I MG  . MG  ? ? C SER 47   C MG  3002 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc4  metalc ? ? C THR 180 OG1 ? ? ? 1_555 I MG  . MG  ? ? C THR 181  C MG  3002 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc5  metalc ? ? F MG  .   MG  ? ? ? 1_555 G GDP . O1B ? ? A MG  3001 A GDP 1001 1_555 ? ? ? ? ? ? ? 2.016 ? 
metalc6  metalc ? ? F MG  .   MG  ? ? ? 1_555 K HOH . O   ? ? A MG  3001 A HOH 3229 1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc7  metalc ? ? F MG  .   MG  ? ? ? 1_555 K HOH . O   ? ? A MG  3001 A HOH 3231 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc8  metalc ? ? I MG  .   MG  ? ? ? 1_555 M HOH . O   ? ? C MG  3002 C HOH 3187 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc9  metalc ? ? I MG  .   MG  ? ? ? 1_555 M HOH . O   ? ? C MG  3002 C HOH 3190 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc10 metalc ? ? I MG  .   MG  ? ? ? 1_555 J GDP . O1B ? ? C MG  3002 C GDP 1002 1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc11 metalc ? ? G GDP .   O2B ? ? ? 1_555 E ALF . AL  ? ? A GDP 1001 A ALF 2001 1_555 ? ? ? ? ? ? ? 1.952 ? 
metalc12 metalc ? ? E ALF .   AL  ? ? ? 1_555 G GDP . O1B ? ? A ALF 2001 A GDP 1001 1_555 ? ? ? ? ? ? ? 3.658 ? 
metalc13 metalc ? ? E ALF .   AL  ? ? ? 1_555 K HOH . O   ? ? A ALF 2001 A HOH 3236 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc14 metalc ? ? E ALF .   AL  ? ? ? 1_555 F MG  . MG  ? ? A ALF 2001 A MG  3001 1_555 ? ? ? ? ? ? ? 3.467 ? 
metalc15 metalc ? ? E ALF .   F3  ? ? ? 1_555 F MG  . MG  ? ? A ALF 2001 A MG  3001 1_555 ? ? ? ? ? ? ? 1.966 ? 
metalc16 metalc ? ? J GDP .   O2B ? ? ? 1_555 H ALF . AL  ? ? C GDP 1002 C ALF 2002 1_555 ? ? ? ? ? ? ? 1.952 ? 
metalc17 metalc ? ? H ALF .   AL  ? ? ? 1_555 J GDP . O1B ? ? C ALF 2002 C GDP 1002 1_555 ? ? ? ? ? ? ? 3.624 ? 
metalc18 metalc ? ? H ALF .   AL  ? ? ? 1_555 I MG  . MG  ? ? C ALF 2002 C MG  3002 1_555 ? ? ? ? ? ? ? 3.395 ? 
metalc19 metalc ? ? H ALF .   AL  ? ? ? 1_555 M HOH . O   ? ? C ALF 2002 C HOH 3194 1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc20 metalc ? ? H ALF .   F1  ? ? ? 1_555 I MG  . MG  ? ? C ALF 2002 C MG  3002 1_555 ? ? ? ? ? ? ? 1.967 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 183 ? PHE A 190 ? ILE A 184 PHE A 191 
A 2 LEU A 193 ? VAL A 200 ? LEU A 194 VAL A 201 
A 3 VAL A 33  ? LEU A 38  ? VAL A 34  LEU A 39  
A 4 ALA A 219 ? ALA A 225 ? ALA A 220 ALA A 226 
A 5 SER A 262 ? ASN A 268 ? SER A 263 ASN A 269 
A 6 ILE A 318 ? PHE A 322 ? ILE A 319 PHE A 323 
B 1 VAL A 232 ? LEU A 233 ? VAL A 233 LEU A 234 
B 2 ASP A 236 ? ASN A 240 ? ASP A 237 ASN A 241 
C 1 ILE C 183 ? PHE C 190 ? ILE C 184 PHE C 191 
C 2 LEU C 193 ? VAL C 200 ? LEU C 194 VAL C 201 
C 3 LYS C 31  ? GLY C 39  ? LYS C 32  GLY C 40  
C 4 ALA C 219 ? ALA C 225 ? ALA C 220 ALA C 226 
C 5 SER C 262 ? ASN C 268 ? SER C 263 ASN C 269 
C 6 ILE C 318 ? PHE C 322 ? ILE C 319 PHE C 323 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 188 ? N PHE A 189 O PHE A 195 ? O PHE A 196 
A 2 3 O LYS A 196 ? O LYS A 197 N VAL A 33  ? N VAL A 34  
A 3 4 N LEU A 38  ? N LEU A 39  O CYS A 223 ? O CYS A 224 
A 4 5 N PHE A 222 ? N PHE A 223 O ILE A 264 ? O ILE A 265 
A 5 6 N ILE A 263 ? N ILE A 264 O TYR A 319 ? O TYR A 320 
B 1 2 N LEU A 233 ? N LEU A 234 O MET A 239 ? O MET A 240 
C 1 2 N VAL C 184 ? N VAL C 185 O ASP C 199 ? O ASP C 200 
C 2 3 O TYR C 194 ? O TYR C 195 N LYS C 31  ? N LYS C 32  
C 3 4 N LEU C 38  ? N LEU C 39  O CYS C 223 ? O CYS C 224 
C 4 5 N PHE C 222 ? N PHE C 223 O ILE C 264 ? O ILE C 265 
C 5 6 N LEU C 265 ? N LEU C 266 O HIS C 321 ? O HIS C 322 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ALF A 2001' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ALF C 2002' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 3001'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG C 3002'  
AC5 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE GDP A 1001' 
AC6 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE GDP C 1002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 GLY A 41  ? GLY A 42   . ? 1_555 ? 
2  AC1 13 GLU A 42  ? GLU A 43   . ? 1_555 ? 
3  AC1 13 LYS A 45  ? LYS A 46   . ? 1_555 ? 
4  AC1 13 ARG A 177 ? ARG A 178  . ? 1_555 ? 
5  AC1 13 LYS A 179 ? LYS A 180  . ? 1_555 ? 
6  AC1 13 THR A 180 ? THR A 181  . ? 1_555 ? 
7  AC1 13 GLY A 202 ? GLY A 203  . ? 1_555 ? 
8  AC1 13 GLN A 203 ? GLN A 204  . ? 1_555 ? 
9  AC1 13 GDP G .   ? GDP A 1001 . ? 1_555 ? 
10 AC1 13 MG  F .   ? MG  A 3001 . ? 1_555 ? 
11 AC1 13 HOH K .   ? HOH A 3229 . ? 1_555 ? 
12 AC1 13 HOH K .   ? HOH A 3231 . ? 1_555 ? 
13 AC1 13 HOH K .   ? HOH A 3236 . ? 1_555 ? 
14 AC2 14 GLY C 41  ? GLY C 42   . ? 1_555 ? 
15 AC2 14 GLU C 42  ? GLU C 43   . ? 1_555 ? 
16 AC2 14 LYS C 45  ? LYS C 46   . ? 1_555 ? 
17 AC2 14 ARG C 177 ? ARG C 178  . ? 1_555 ? 
18 AC2 14 LYS C 179 ? LYS C 180  . ? 1_555 ? 
19 AC2 14 THR C 180 ? THR C 181  . ? 1_555 ? 
20 AC2 14 VAL C 200 ? VAL C 201  . ? 1_555 ? 
21 AC2 14 GLY C 202 ? GLY C 203  . ? 1_555 ? 
22 AC2 14 GLN C 203 ? GLN C 204  . ? 1_555 ? 
23 AC2 14 GDP J .   ? GDP C 1002 . ? 1_555 ? 
24 AC2 14 MG  I .   ? MG  C 3002 . ? 1_555 ? 
25 AC2 14 HOH M .   ? HOH C 3187 . ? 1_555 ? 
26 AC2 14 HOH M .   ? HOH C 3190 . ? 1_555 ? 
27 AC2 14 HOH M .   ? HOH C 3194 . ? 1_555 ? 
28 AC3 6  SER A 46  ? SER A 47   . ? 1_555 ? 
29 AC3 6  THR A 180 ? THR A 181  . ? 1_555 ? 
30 AC3 6  GDP G .   ? GDP A 1001 . ? 1_555 ? 
31 AC3 6  ALF E .   ? ALF A 2001 . ? 1_555 ? 
32 AC3 6  HOH K .   ? HOH A 3229 . ? 1_555 ? 
33 AC3 6  HOH K .   ? HOH A 3231 . ? 1_555 ? 
34 AC4 6  SER C 46  ? SER C 47   . ? 1_555 ? 
35 AC4 6  THR C 180 ? THR C 181  . ? 1_555 ? 
36 AC4 6  GDP J .   ? GDP C 1002 . ? 1_555 ? 
37 AC4 6  ALF H .   ? ALF C 2002 . ? 1_555 ? 
38 AC4 6  HOH M .   ? HOH C 3187 . ? 1_555 ? 
39 AC4 6  HOH M .   ? HOH C 3190 . ? 1_555 ? 
40 AC5 25 GLU A 42  ? GLU A 43   . ? 1_555 ? 
41 AC5 25 SER A 43  ? SER A 44   . ? 1_555 ? 
42 AC5 25 GLY A 44  ? GLY A 45   . ? 1_555 ? 
43 AC5 25 LYS A 45  ? LYS A 46   . ? 1_555 ? 
44 AC5 25 SER A 46  ? SER A 47   . ? 1_555 ? 
45 AC5 25 THR A 47  ? THR A 48   . ? 1_555 ? 
46 AC5 25 SER A 150 ? SER A 151  . ? 1_555 ? 
47 AC5 25 LEU A 174 ? LEU A 175  . ? 1_555 ? 
48 AC5 25 ARG A 175 ? ARG A 176  . ? 1_555 ? 
49 AC5 25 THR A 176 ? THR A 177  . ? 1_555 ? 
50 AC5 25 ARG A 177 ? ARG A 178  . ? 1_555 ? 
51 AC5 25 ASN A 268 ? ASN A 269  . ? 1_555 ? 
52 AC5 25 LYS A 269 ? LYS A 270  . ? 1_555 ? 
53 AC5 25 ASP A 271 ? ASP A 272  . ? 1_555 ? 
54 AC5 25 LEU A 272 ? LEU A 273  . ? 1_555 ? 
55 AC5 25 CYS A 324 ? CYS A 325  . ? 1_555 ? 
56 AC5 25 ALA A 325 ? ALA A 326  . ? 1_555 ? 
57 AC5 25 THR A 326 ? THR A 327  . ? 1_555 ? 
58 AC5 25 ALF E .   ? ALF A 2001 . ? 1_555 ? 
59 AC5 25 MG  F .   ? MG  A 3001 . ? 1_555 ? 
60 AC5 25 HOH K .   ? HOH A 3002 . ? 1_555 ? 
61 AC5 25 HOH K .   ? HOH A 3007 . ? 1_555 ? 
62 AC5 25 HOH K .   ? HOH A 3012 . ? 1_555 ? 
63 AC5 25 HOH K .   ? HOH A 3229 . ? 1_555 ? 
64 AC5 25 HOH K .   ? HOH A 3231 . ? 1_555 ? 
65 AC6 24 GLU C 42  ? GLU C 43   . ? 1_555 ? 
66 AC6 24 SER C 43  ? SER C 44   . ? 1_555 ? 
67 AC6 24 GLY C 44  ? GLY C 45   . ? 1_555 ? 
68 AC6 24 LYS C 45  ? LYS C 46   . ? 1_555 ? 
69 AC6 24 SER C 46  ? SER C 47   . ? 1_555 ? 
70 AC6 24 THR C 47  ? THR C 48   . ? 1_555 ? 
71 AC6 24 SER C 150 ? SER C 151  . ? 1_555 ? 
72 AC6 24 LEU C 174 ? LEU C 175  . ? 1_555 ? 
73 AC6 24 ARG C 175 ? ARG C 176  . ? 1_555 ? 
74 AC6 24 THR C 176 ? THR C 177  . ? 1_555 ? 
75 AC6 24 ARG C 177 ? ARG C 178  . ? 1_555 ? 
76 AC6 24 ASN C 268 ? ASN C 269  . ? 1_555 ? 
77 AC6 24 LYS C 269 ? LYS C 270  . ? 1_555 ? 
78 AC6 24 ASP C 271 ? ASP C 272  . ? 1_555 ? 
79 AC6 24 LEU C 272 ? LEU C 273  . ? 1_555 ? 
80 AC6 24 CYS C 324 ? CYS C 325  . ? 1_555 ? 
81 AC6 24 ALA C 325 ? ALA C 326  . ? 1_555 ? 
82 AC6 24 THR C 326 ? THR C 327  . ? 1_555 ? 
83 AC6 24 ALF H .   ? ALF C 2002 . ? 1_555 ? 
84 AC6 24 MG  I .   ? MG  C 3002 . ? 1_555 ? 
85 AC6 24 HOH M .   ? HOH C 3007 . ? 1_555 ? 
86 AC6 24 HOH M .   ? HOH C 3008 . ? 1_555 ? 
87 AC6 24 HOH M .   ? HOH C 3018 . ? 1_555 ? 
88 AC6 24 HOH M .   ? HOH C 3187 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ODE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ODE 
_atom_sites.fract_transf_matrix[1][1]   0.008862 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007680 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014594 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AL 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 32  ? 47.977  6.580   24.730  1.00 38.56 ? 33   GLU A N     1 
ATOM   2    C  CA    . GLU A 1 32  ? 46.895  7.580   25.040  1.00 39.46 ? 33   GLU A CA    1 
ATOM   3    C  C     . GLU A 1 32  ? 45.702  7.437   24.098  1.00 38.55 ? 33   GLU A C     1 
ATOM   4    O  O     . GLU A 1 32  ? 45.874  7.281   22.884  1.00 38.99 ? 33   GLU A O     1 
ATOM   5    C  CB    . GLU A 1 32  ? 47.418  9.017   24.930  1.00 39.63 ? 33   GLU A CB    1 
ATOM   6    C  CG    . GLU A 1 32  ? 48.461  9.422   25.980  1.00 42.15 ? 33   GLU A CG    1 
ATOM   7    C  CD    . GLU A 1 32  ? 48.271  10.851  26.483  1.00 43.57 ? 33   GLU A CD    1 
ATOM   8    O  OE1   . GLU A 1 32  ? 47.128  11.353  26.471  1.00 47.25 ? 33   GLU A OE1   1 
ATOM   9    O  OE2   . GLU A 1 32  ? 49.255  11.468  26.910  1.00 46.29 ? 33   GLU A OE2   1 
ATOM   10   N  N     . VAL A 1 33  ? 44.500  7.504   24.662  1.00 37.67 ? 34   VAL A N     1 
ATOM   11   C  CA    . VAL A 1 33  ? 43.267  7.476   23.888  1.00 36.74 ? 34   VAL A CA    1 
ATOM   12   C  C     . VAL A 1 33  ? 42.412  8.645   24.385  1.00 36.29 ? 34   VAL A C     1 
ATOM   13   O  O     . VAL A 1 33  ? 42.091  8.701   25.561  1.00 35.90 ? 34   VAL A O     1 
ATOM   14   C  CB    . VAL A 1 33  ? 42.481  6.164   24.116  1.00 37.04 ? 34   VAL A CB    1 
ATOM   15   C  CG1   . VAL A 1 33  ? 41.150  6.183   23.351  1.00 35.93 ? 34   VAL A CG1   1 
ATOM   16   C  CG2   . VAL A 1 33  ? 43.332  4.934   23.725  1.00 36.35 ? 34   VAL A CG2   1 
ATOM   17   N  N     . LYS A 1 34  ? 42.077  9.570   23.493  1.00 35.67 ? 35   LYS A N     1 
ATOM   18   C  CA    . LYS A 1 34  ? 41.149  10.652  23.812  1.00 35.08 ? 35   LYS A CA    1 
ATOM   19   C  C     . LYS A 1 34  ? 39.747  10.214  23.408  1.00 34.47 ? 35   LYS A C     1 
ATOM   20   O  O     . LYS A 1 34  ? 39.473  9.953   22.234  1.00 34.91 ? 35   LYS A O     1 
ATOM   21   C  CB    . LYS A 1 34  ? 41.535  11.937  23.083  1.00 35.24 ? 35   LYS A CB    1 
ATOM   22   C  CG    . LYS A 1 34  ? 40.539  13.081  23.242  1.00 33.94 ? 35   LYS A CG    1 
ATOM   23   C  CD    . LYS A 1 34  ? 41.147  14.399  22.845  1.00 35.82 ? 35   LYS A CD    1 
ATOM   24   C  CE    . LYS A 1 34  ? 40.143  15.537  22.963  1.00 34.92 ? 35   LYS A CE    1 
ATOM   25   N  NZ    . LYS A 1 34  ? 40.789  16.817  22.580  1.00 34.47 ? 35   LYS A NZ    1 
ATOM   26   N  N     . LEU A 1 35  ? 38.881  10.123  24.404  1.00 34.27 ? 36   LEU A N     1 
ATOM   27   C  CA    . LEU A 1 35  ? 37.553  9.570   24.255  1.00 34.36 ? 36   LEU A CA    1 
ATOM   28   C  C     . LEU A 1 35  ? 36.484  10.614  24.631  1.00 34.23 ? 36   LEU A C     1 
ATOM   29   O  O     . LEU A 1 35  ? 36.486  11.138  25.746  1.00 34.21 ? 36   LEU A O     1 
ATOM   30   C  CB    . LEU A 1 35  ? 37.430  8.358   25.165  1.00 34.62 ? 36   LEU A CB    1 
ATOM   31   C  CG    . LEU A 1 35  ? 36.048  7.766   25.406  1.00 35.43 ? 36   LEU A CG    1 
ATOM   32   C  CD1   . LEU A 1 35  ? 35.511  7.236   24.077  1.00 34.94 ? 36   LEU A CD1   1 
ATOM   33   C  CD2   . LEU A 1 35  ? 36.151  6.681   26.466  1.00 34.87 ? 36   LEU A CD2   1 
ATOM   34   N  N     . LEU A 1 36  ? 35.582  10.889  23.695  1.00 33.76 ? 37   LEU A N     1 
ATOM   35   C  CA    . LEU A 1 36  ? 34.503  11.825  23.878  1.00 34.79 ? 37   LEU A CA    1 
ATOM   36   C  C     . LEU A 1 36  ? 33.199  11.041  24.102  1.00 34.35 ? 37   LEU A C     1 
ATOM   37   O  O     . LEU A 1 36  ? 32.861  10.159  23.322  1.00 33.61 ? 37   LEU A O     1 
ATOM   38   C  CB    . LEU A 1 36  ? 34.346  12.688  22.622  1.00 35.70 ? 37   LEU A CB    1 
ATOM   39   C  CG    . LEU A 1 36  ? 34.973  14.077  22.486  1.00 36.81 ? 37   LEU A CG    1 
ATOM   40   C  CD1   . LEU A 1 36  ? 36.323  14.250  23.156  1.00 34.67 ? 37   LEU A CD1   1 
ATOM   41   C  CD2   . LEU A 1 36  ? 34.970  14.489  21.023  1.00 35.55 ? 37   LEU A CD2   1 
ATOM   42   N  N     . LEU A 1 37  ? 32.487  11.377  25.168  1.00 33.99 ? 38   LEU A N     1 
ATOM   43   C  CA    . LEU A 1 37  ? 31.100  10.929  25.350  1.00 34.54 ? 38   LEU A CA    1 
ATOM   44   C  C     . LEU A 1 37  ? 30.137  12.028  24.895  1.00 34.00 ? 38   LEU A C     1 
ATOM   45   O  O     . LEU A 1 37  ? 30.002  13.102  25.545  1.00 32.50 ? 38   LEU A O     1 
ATOM   46   C  CB    . LEU A 1 37  ? 30.841  10.572  26.799  1.00 35.00 ? 38   LEU A CB    1 
ATOM   47   C  CG    . LEU A 1 37  ? 31.170  9.131   27.228  1.00 37.64 ? 38   LEU A CG    1 
ATOM   48   C  CD1   . LEU A 1 37  ? 32.498  8.550   26.719  1.00 37.33 ? 38   LEU A CD1   1 
ATOM   49   C  CD2   . LEU A 1 37  ? 31.132  9.085   28.733  1.00 41.01 ? 38   LEU A CD2   1 
ATOM   50   N  N     . LEU A 1 38  ? 29.484  11.758  23.768  1.00 33.25 ? 39   LEU A N     1 
ATOM   51   C  CA    . LEU A 1 38  ? 28.571  12.706  23.139  1.00 32.74 ? 39   LEU A CA    1 
ATOM   52   C  C     . LEU A 1 38  ? 27.174  12.122  23.037  1.00 32.74 ? 39   LEU A C     1 
ATOM   53   O  O     . LEU A 1 38  ? 26.965  10.943  23.243  1.00 31.13 ? 39   LEU A O     1 
ATOM   54   C  CB    . LEU A 1 38  ? 29.054  13.074  21.714  1.00 32.34 ? 39   LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 38  ? 30.441  13.683  21.593  1.00 34.04 ? 39   LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 38  ? 30.733  13.999  20.108  1.00 32.89 ? 39   LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 38  ? 30.612  14.965  22.512  1.00 33.53 ? 39   LEU A CD2   1 
ATOM   58   N  N     . GLY A 1 39  ? 26.229  12.990  22.701  1.00 33.43 ? 40   GLY A N     1 
ATOM   59   C  CA    . GLY A 1 39  ? 24.831  12.649  22.644  1.00 33.48 ? 40   GLY A CA    1 
ATOM   60   C  C     . GLY A 1 39  ? 23.947  13.747  23.221  1.00 33.29 ? 40   GLY A C     1 
ATOM   61   O  O     . GLY A 1 39  ? 24.411  14.638  23.925  1.00 33.25 ? 40   GLY A O     1 
ATOM   62   N  N     . ALA A 1 40  ? 22.657  13.669  22.918  1.00 32.54 ? 41   ALA A N     1 
ATOM   63   C  CA    . ALA A 1 40  ? 21.690  14.645  23.383  1.00 33.12 ? 41   ALA A CA    1 
ATOM   64   C  C     . ALA A 1 40  ? 21.441  14.479  24.883  1.00 32.46 ? 41   ALA A C     1 
ATOM   65   O  O     . ALA A 1 40  ? 21.887  13.506  25.530  1.00 33.37 ? 41   ALA A O     1 
ATOM   66   C  CB    . ALA A 1 40  ? 20.362  14.570  22.559  1.00 32.17 ? 41   ALA A CB    1 
ATOM   67   N  N     . GLY A 1 41  ? 20.783  15.481  25.449  1.00 33.32 ? 42   GLY A N     1 
ATOM   68   C  CA    . GLY A 1 41  ? 20.436  15.451  26.867  1.00 33.76 ? 42   GLY A CA    1 
ATOM   69   C  C     . GLY A 1 41  ? 19.749  14.187  27.336  1.00 33.92 ? 42   GLY A C     1 
ATOM   70   O  O     . GLY A 1 41  ? 18.838  13.652  26.651  1.00 33.59 ? 42   GLY A O     1 
ATOM   71   N  N     . GLU A 1 42  ? 20.208  13.682  28.489  1.00 34.32 ? 43   GLU A N     1 
ATOM   72   C  CA    . GLU A 1 42  ? 19.641  12.494  29.150  1.00 35.33 ? 43   GLU A CA    1 
ATOM   73   C  C     . GLU A 1 42  ? 19.867  11.179  28.410  1.00 35.16 ? 43   GLU A C     1 
ATOM   74   O  O     . GLU A 1 42  ? 19.211  10.176  28.681  1.00 35.27 ? 43   GLU A O     1 
ATOM   75   C  CB    . GLU A 1 42  ? 18.128  12.709  29.444  1.00 35.63 ? 43   GLU A CB    1 
ATOM   76   C  CG    . GLU A 1 42  ? 17.931  13.857  30.416  1.00 38.48 ? 43   GLU A CG    1 
ATOM   77   C  CD    . GLU A 1 42  ? 16.479  13.964  30.927  1.00 41.48 ? 43   GLU A CD    1 
ATOM   78   O  OE1   . GLU A 1 42  ? 15.609  13.961  30.067  1.00 44.77 ? 43   GLU A OE1   1 
ATOM   79   O  OE2   . GLU A 1 42  ? 16.207  13.974  32.183  1.00 48.56 ? 43   GLU A OE2   1 
ATOM   80   N  N     . SER A 1 43  ? 20.826  11.147  27.492  1.00 34.44 ? 44   SER A N     1 
ATOM   81   C  CA    . SER A 1 43  ? 20.985  9.932   26.691  1.00 33.44 ? 44   SER A CA    1 
ATOM   82   C  C     . SER A 1 43  ? 21.730  8.810   27.451  1.00 33.26 ? 44   SER A C     1 
ATOM   83   O  O     . SER A 1 43  ? 21.686  7.633   27.055  1.00 34.22 ? 44   SER A O     1 
ATOM   84   C  CB    . SER A 1 43  ? 21.644  10.286  25.364  1.00 33.42 ? 44   SER A CB    1 
ATOM   85   O  OG    . SER A 1 43  ? 22.886  10.923  25.583  1.00 35.35 ? 44   SER A OG    1 
ATOM   86   N  N     . GLY A 1 44  ? 22.398  9.158   28.544  1.00 32.81 ? 45   GLY A N     1 
ATOM   87   C  CA    . GLY A 1 44  ? 23.164  8.187   29.327  1.00 32.51 ? 45   GLY A CA    1 
ATOM   88   C  C     . GLY A 1 44  ? 24.659  8.414   29.435  1.00 32.13 ? 45   GLY A C     1 
ATOM   89   O  O     . GLY A 1 44  ? 25.348  7.581   29.983  1.00 32.37 ? 45   GLY A O     1 
ATOM   90   N  N     . LYS A 1 45  ? 25.162  9.566   28.986  1.00 32.77 ? 46   LYS A N     1 
ATOM   91   C  CA    . LYS A 1 45  ? 26.615  9.810   28.936  1.00 31.89 ? 46   LYS A CA    1 
ATOM   92   C  C     . LYS A 1 45  ? 27.306  9.706   30.301  1.00 32.22 ? 46   LYS A C     1 
ATOM   93   O  O     . LYS A 1 45  ? 28.276  8.977   30.469  1.00 31.72 ? 46   LYS A O     1 
ATOM   94   C  CB    . LYS A 1 45  ? 26.910  11.200  28.354  1.00 31.86 ? 46   LYS A CB    1 
ATOM   95   C  CG    . LYS A 1 45  ? 26.384  11.399  26.955  1.00 30.75 ? 46   LYS A CG    1 
ATOM   96   C  CD    . LYS A 1 45  ? 26.661  12.812  26.409  1.00 31.77 ? 46   LYS A CD    1 
ATOM   97   C  CE    . LYS A 1 45  ? 25.856  13.892  27.090  1.00 31.73 ? 46   LYS A CE    1 
ATOM   98   N  NZ    . LYS A 1 45  ? 24.391  13.725  26.882  1.00 32.22 ? 46   LYS A NZ    1 
ATOM   99   N  N     . SER A 1 46  ? 26.787  10.453  31.267  1.00 32.08 ? 47   SER A N     1 
ATOM   100  C  CA    . SER A 1 46  ? 27.392  10.500  32.593  1.00 31.84 ? 47   SER A CA    1 
ATOM   101  C  C     . SER A 1 46  ? 27.243  9.186   33.320  1.00 31.92 ? 47   SER A C     1 
ATOM   102  O  O     . SER A 1 46  ? 28.049  8.872   34.183  1.00 31.18 ? 47   SER A O     1 
ATOM   103  C  CB    . SER A 1 46  ? 26.786  11.629  33.411  1.00 31.53 ? 47   SER A CB    1 
ATOM   104  O  OG    . SER A 1 46  ? 27.039  12.860  32.753  1.00 31.82 ? 47   SER A OG    1 
ATOM   105  N  N     . THR A 1 47  ? 26.234  8.417   32.950  1.00 32.59 ? 48   THR A N     1 
ATOM   106  C  CA    . THR A 1 47  ? 26.037  7.066   33.536  1.00 32.52 ? 48   THR A CA    1 
ATOM   107  C  C     . THR A 1 47  ? 27.134  6.093   33.046  1.00 33.01 ? 48   THR A C     1 
ATOM   108  O  O     . THR A 1 47  ? 27.675  5.279   33.831  1.00 32.19 ? 48   THR A O     1 
ATOM   109  C  CB    . THR A 1 47  ? 24.615  6.549   33.262  1.00 32.38 ? 48   THR A CB    1 
ATOM   110  O  OG1   . THR A 1 47  ? 23.660  7.527   33.671  1.00 32.78 ? 48   THR A OG1   1 
ATOM   111  C  CG2   . THR A 1 47  ? 24.328  5.224   34.001  1.00 31.58 ? 48   THR A CG2   1 
ATOM   112  N  N     . ILE A 1 48  ? 27.488  6.200   31.769  1.00 32.31 ? 49   ILE A N     1 
ATOM   113  C  CA    . ILE A 1 48  ? 28.638  5.486   31.244  1.00 32.30 ? 49   ILE A CA    1 
ATOM   114  C  C     . ILE A 1 48  ? 29.887  5.935   32.013  1.00 32.62 ? 49   ILE A C     1 
ATOM   115  O  O     . ILE A 1 48  ? 30.696  5.103   32.404  1.00 32.63 ? 49   ILE A O     1 
ATOM   116  C  CB    . ILE A 1 48  ? 28.786  5.671   29.691  1.00 31.98 ? 49   ILE A CB    1 
ATOM   117  C  CG1   . ILE A 1 48  ? 27.579  5.048   28.951  1.00 32.52 ? 49   ILE A CG1   1 
ATOM   118  C  CG2   . ILE A 1 48  ? 30.141  5.046   29.197  1.00 30.23 ? 49   ILE A CG2   1 
ATOM   119  C  CD1   . ILE A 1 48  ? 27.418  3.555   29.198  1.00 29.41 ? 49   ILE A CD1   1 
ATOM   120  N  N     . VAL A 1 49  ? 30.002  7.244   32.292  1.00 33.35 ? 50   VAL A N     1 
ATOM   121  C  CA    . VAL A 1 49  ? 31.152  7.757   33.057  1.00 33.14 ? 50   VAL A CA    1 
ATOM   122  C  C     . VAL A 1 49  ? 31.177  7.124   34.468  1.00 32.83 ? 50   VAL A C     1 
ATOM   123  O  O     . VAL A 1 49  ? 32.236  6.711   34.922  1.00 31.95 ? 50   VAL A O     1 
ATOM   124  C  CB    . VAL A 1 49  ? 31.221  9.353   33.094  1.00 33.48 ? 50   VAL A CB    1 
ATOM   125  C  CG1   . VAL A 1 49  ? 32.264  9.831   34.128  1.00 34.97 ? 50   VAL A CG1   1 
ATOM   126  C  CG2   . VAL A 1 49  ? 31.569  9.912   31.710  1.00 34.33 ? 50   VAL A CG2   1 
ATOM   127  N  N     . LYS A 1 50  ? 30.017  7.032   35.145  1.00 32.99 ? 51   LYS A N     1 
ATOM   128  C  CA    . LYS A 1 50  ? 29.952  6.362   36.475  1.00 32.61 ? 51   LYS A CA    1 
ATOM   129  C  C     . LYS A 1 50  ? 30.448  4.912   36.378  1.00 32.02 ? 51   LYS A C     1 
ATOM   130  O  O     . LYS A 1 50  ? 31.100  4.397   37.283  1.00 30.45 ? 51   LYS A O     1 
ATOM   131  C  CB    . LYS A 1 50  ? 28.507  6.341   37.034  1.00 32.49 ? 51   LYS A CB    1 
ATOM   132  C  CG    . LYS A 1 50  ? 27.990  7.736   37.440  1.00 33.93 ? 51   LYS A CG    1 
ATOM   133  C  CD    . LYS A 1 50  ? 26.715  7.683   38.295  1.00 32.40 ? 51   LYS A CD    1 
ATOM   134  C  CE    . LYS A 1 50  ? 26.318  9.024   38.777  1.00 32.73 ? 51   LYS A CE    1 
ATOM   135  N  NZ    . LYS A 1 50  ? 25.923  9.893   37.642  1.00 31.39 ? 51   LYS A NZ    1 
ATOM   136  N  N     . GLN A 1 51  ? 30.086  4.243   35.291  1.00 31.59 ? 52   GLN A N     1 
ATOM   137  C  CA    . GLN A 1 51  ? 30.521  2.860   35.092  1.00 31.55 ? 52   GLN A CA    1 
ATOM   138  C  C     . GLN A 1 51  ? 32.041  2.698   34.905  1.00 31.42 ? 52   GLN A C     1 
ATOM   139  O  O     . GLN A 1 51  ? 32.607  1.700   35.306  1.00 30.30 ? 52   GLN A O     1 
ATOM   140  C  CB    . GLN A 1 51  ? 29.748  2.231   33.932  1.00 32.22 ? 52   GLN A CB    1 
ATOM   141  C  CG    . GLN A 1 51  ? 28.262  2.102   34.238  1.00 30.08 ? 52   GLN A CG    1 
ATOM   142  C  CD    . GLN A 1 51  ? 27.881  0.970   35.204  1.00 30.12 ? 52   GLN A CD    1 
ATOM   143  O  OE1   . GLN A 1 51  ? 28.700  0.445   35.972  1.00 30.76 ? 52   GLN A OE1   1 
ATOM   144  N  NE2   . GLN A 1 51  ? 26.614  0.561   35.128  1.00 29.01 ? 52   GLN A NE2   1 
ATOM   145  N  N     . MET A 1 52  ? 32.693  3.682   34.297  1.00 31.82 ? 53   MET A N     1 
ATOM   146  C  CA    . MET A 1 52  ? 34.146  3.643   34.135  1.00 31.85 ? 53   MET A CA    1 
ATOM   147  C  C     . MET A 1 52  ? 34.830  3.751   35.500  1.00 31.80 ? 53   MET A C     1 
ATOM   148  O  O     . MET A 1 52  ? 35.839  3.110   35.749  1.00 31.90 ? 53   MET A O     1 
ATOM   149  C  CB    . MET A 1 52  ? 34.596  4.774   33.207  1.00 32.06 ? 53   MET A CB    1 
ATOM   150  C  CG    . MET A 1 52  ? 34.072  4.683   31.745  1.00 33.34 ? 53   MET A CG    1 
ATOM   151  S  SD    . MET A 1 52  ? 34.453  3.130   30.859  1.00 36.07 ? 53   MET A SD    1 
ATOM   152  C  CE    . MET A 1 52  ? 33.074  2.091   31.298  1.00 35.38 ? 53   MET A CE    1 
ATOM   153  N  N     . LYS A 1 53  ? 34.269  4.566   36.392  1.00 32.17 ? 54   LYS A N     1 
ATOM   154  C  CA    . LYS A 1 53  ? 34.745  4.663   37.796  1.00 32.85 ? 54   LYS A CA    1 
ATOM   155  C  C     . LYS A 1 53  ? 34.564  3.328   38.550  1.00 32.53 ? 54   LYS A C     1 
ATOM   156  O  O     . LYS A 1 53  ? 35.458  2.857   39.273  1.00 32.58 ? 54   LYS A O     1 
ATOM   157  C  CB    . LYS A 1 53  ? 34.031  5.836   38.492  1.00 32.57 ? 54   LYS A CB    1 
ATOM   158  C  CG    . LYS A 1 53  ? 34.192  5.919   39.996  1.00 34.09 ? 54   LYS A CG    1 
ATOM   159  C  CD    . LYS A 1 53  ? 33.641  7.219   40.509  1.00 33.86 ? 54   LYS A CD    1 
ATOM   160  C  CE    . LYS A 1 53  ? 33.606  7.240   42.021  1.00 34.73 ? 54   LYS A CE    1 
ATOM   161  N  NZ    . LYS A 1 53  ? 34.990  7.236   42.606  1.00 37.52 ? 54   LYS A NZ    1 
ATOM   162  N  N     . ILE A 1 54  ? 33.420  2.688   38.335  1.00 32.79 ? 55   ILE A N     1 
ATOM   163  C  CA    . ILE A 1 54  ? 33.081  1.404   38.951  1.00 32.78 ? 55   ILE A CA    1 
ATOM   164  C  C     . ILE A 1 54  ? 33.982  0.245   38.448  1.00 32.99 ? 55   ILE A C     1 
ATOM   165  O  O     . ILE A 1 54  ? 34.493  -0.576  39.240  1.00 32.52 ? 55   ILE A O     1 
ATOM   166  C  CB    . ILE A 1 54  ? 31.590  1.033   38.666  1.00 32.62 ? 55   ILE A CB    1 
ATOM   167  C  CG1   . ILE A 1 54  ? 30.650  1.927   39.474  1.00 32.53 ? 55   ILE A CG1   1 
ATOM   168  C  CG2   . ILE A 1 54  ? 31.341  -0.430  39.010  1.00 34.32 ? 55   ILE A CG2   1 
ATOM   169  C  CD1   . ILE A 1 54  ? 29.182  1.858   39.064  1.00 31.36 ? 55   ILE A CD1   1 
ATOM   170  N  N     . ILE A 1 55  ? 34.182  0.224   37.133  1.00 33.61 ? 56   ILE A N     1 
ATOM   171  C  CA    . ILE A 1 55  ? 34.915  -0.864  36.469  1.00 34.22 ? 56   ILE A CA    1 
ATOM   172  C  C     . ILE A 1 55  ? 36.423  -0.599  36.421  1.00 35.18 ? 56   ILE A C     1 
ATOM   173  O  O     . ILE A 1 55  ? 37.226  -1.508  36.693  1.00 35.59 ? 56   ILE A O     1 
ATOM   174  C  CB    . ILE A 1 55  ? 34.375  -1.096  35.016  1.00 33.31 ? 56   ILE A CB    1 
ATOM   175  C  CG1   . ILE A 1 55  ? 32.890  -1.424  35.027  1.00 32.67 ? 56   ILE A CG1   1 
ATOM   176  C  CG2   . ILE A 1 55  ? 35.075  -2.265  34.339  1.00 32.63 ? 56   ILE A CG2   1 
ATOM   177  C  CD1   . ILE A 1 55  ? 32.206  -1.071  33.714  1.00 31.47 ? 56   ILE A CD1   1 
ATOM   178  N  N     . HIS A 1 56  ? 36.812  0.637   36.097  1.00 36.37 ? 57   HIS A N     1 
ATOM   179  C  CA    . HIS A 1 56  ? 38.205  0.967   35.714  1.00 37.72 ? 57   HIS A CA    1 
ATOM   180  C  C     . HIS A 1 56  ? 38.941  1.986   36.567  1.00 38.87 ? 57   HIS A C     1 
ATOM   181  O  O     . HIS A 1 56  ? 40.139  2.203   36.390  1.00 39.45 ? 57   HIS A O     1 
ATOM   182  C  CB    . HIS A 1 56  ? 38.227  1.504   34.295  1.00 37.99 ? 57   HIS A CB    1 
ATOM   183  C  CG    . HIS A 1 56  ? 37.719  0.534   33.287  1.00 37.95 ? 57   HIS A CG    1 
ATOM   184  N  ND1   . HIS A 1 56  ? 38.298  -0.703  33.094  1.00 36.85 ? 57   HIS A ND1   1 
ATOM   185  C  CD2   . HIS A 1 56  ? 36.696  0.621   32.407  1.00 35.11 ? 57   HIS A CD2   1 
ATOM   186  C  CE1   . HIS A 1 56  ? 37.634  -1.339  32.145  1.00 37.15 ? 57   HIS A CE1   1 
ATOM   187  N  NE2   . HIS A 1 56  ? 36.663  -0.556  31.711  1.00 35.93 ? 57   HIS A NE2   1 
ATOM   188  N  N     . GLU A 1 57  ? 38.235  2.656   37.453  1.00 39.95 ? 58   GLU A N     1 
ATOM   189  C  CA    . GLU A 1 57  ? 38.876  3.596   38.360  1.00 40.71 ? 58   GLU A CA    1 
ATOM   190  C  C     . GLU A 1 57  ? 38.616  2.997   39.731  1.00 41.37 ? 58   GLU A C     1 
ATOM   191  O  O     . GLU A 1 57  ? 38.670  1.760   39.870  1.00 41.87 ? 58   GLU A O     1 
ATOM   192  C  CB    . GLU A 1 57  ? 38.333  5.014   38.167  1.00 40.19 ? 58   GLU A CB    1 
ATOM   193  N  N     . ASP A 1 58  ? 38.301  3.831   40.719  1.00 41.73 ? 59   ASP A N     1 
ATOM   194  C  CA    . ASP A 1 58  ? 38.292  3.386   42.127  1.00 41.71 ? 59   ASP A CA    1 
ATOM   195  C  C     . ASP A 1 58  ? 36.961  2.842   42.697  1.00 41.46 ? 59   ASP A C     1 
ATOM   196  O  O     . ASP A 1 58  ? 36.986  2.314   43.815  1.00 42.57 ? 59   ASP A O     1 
ATOM   197  C  CB    . ASP A 1 58  ? 38.844  4.515   43.049  1.00 42.31 ? 59   ASP A CB    1 
ATOM   198  N  N     . GLY A 1 59  ? 35.835  2.970   41.970  1.00 40.39 ? 60   GLY A N     1 
ATOM   199  C  CA    . GLY A 1 59  ? 34.484  2.563   42.456  1.00 38.76 ? 60   GLY A CA    1 
ATOM   200  C  C     . GLY A 1 59  ? 33.773  3.576   43.388  1.00 37.26 ? 60   GLY A C     1 
ATOM   201  O  O     . GLY A 1 59  ? 34.322  4.626   43.634  1.00 36.00 ? 60   GLY A O     1 
ATOM   202  N  N     . TYR A 1 60  ? 32.567  3.273   43.883  1.00 36.43 ? 61   TYR A N     1 
ATOM   203  C  CA    . TYR A 1 60  ? 31.844  4.147   44.855  1.00 36.31 ? 61   TYR A CA    1 
ATOM   204  C  C     . TYR A 1 60  ? 31.927  3.615   46.303  1.00 36.16 ? 61   TYR A C     1 
ATOM   205  O  O     . TYR A 1 60  ? 31.267  2.626   46.649  1.00 37.10 ? 61   TYR A O     1 
ATOM   206  C  CB    . TYR A 1 60  ? 30.367  4.401   44.466  1.00 35.79 ? 61   TYR A CB    1 
ATOM   207  C  CG    . TYR A 1 60  ? 30.234  5.284   43.246  1.00 35.10 ? 61   TYR A CG    1 
ATOM   208  C  CD1   . TYR A 1 60  ? 30.203  6.670   43.360  1.00 33.10 ? 61   TYR A CD1   1 
ATOM   209  C  CD2   . TYR A 1 60  ? 30.227  4.739   41.970  1.00 35.93 ? 61   TYR A CD2   1 
ATOM   210  C  CE1   . TYR A 1 60  ? 30.129  7.473   42.250  1.00 33.84 ? 61   TYR A CE1   1 
ATOM   211  C  CE2   . TYR A 1 60  ? 30.165  5.535   40.864  1.00 35.79 ? 61   TYR A CE2   1 
ATOM   212  C  CZ    . TYR A 1 60  ? 30.110  6.906   41.011  1.00 33.43 ? 61   TYR A CZ    1 
ATOM   213  O  OH    . TYR A 1 60  ? 30.068  7.675   39.895  1.00 34.69 ? 61   TYR A OH    1 
ATOM   214  N  N     . SER A 1 61  ? 32.738  4.267   47.137  1.00 34.19 ? 62   SER A N     1 
ATOM   215  C  CA    . SER A 1 61  ? 32.783  3.970   48.555  1.00 32.96 ? 62   SER A CA    1 
ATOM   216  C  C     . SER A 1 61  ? 31.443  4.266   49.179  1.00 32.54 ? 62   SER A C     1 
ATOM   217  O  O     . SER A 1 61  ? 30.605  4.975   48.602  1.00 32.36 ? 62   SER A O     1 
ATOM   218  C  CB    . SER A 1 61  ? 33.845  4.828   49.257  1.00 33.67 ? 62   SER A CB    1 
ATOM   219  O  OG    . SER A 1 61  ? 33.392  6.172   49.331  1.00 30.86 ? 62   SER A OG    1 
ATOM   220  N  N     . GLU A 1 62  ? 31.252  3.768   50.386  1.00 32.54 ? 63   GLU A N     1 
ATOM   221  C  CA    . GLU A 1 62  ? 30.036  4.056   51.116  1.00 33.63 ? 63   GLU A CA    1 
ATOM   222  C  C     . GLU A 1 62  ? 29.883  5.578   51.356  1.00 33.47 ? 63   GLU A C     1 
ATOM   223  O  O     . GLU A 1 62  ? 28.807  6.110   51.195  1.00 33.36 ? 63   GLU A O     1 
ATOM   224  C  CB    . GLU A 1 62  ? 30.030  3.325   52.452  1.00 33.34 ? 63   GLU A CB    1 
ATOM   225  C  CG    . GLU A 1 62  ? 28.719  3.435   53.166  1.00 35.67 ? 63   GLU A CG    1 
ATOM   226  C  CD    . GLU A 1 62  ? 28.742  2.785   54.521  1.00 37.63 ? 63   GLU A CD    1 
ATOM   227  O  OE1   . GLU A 1 62  ? 29.511  3.228   55.397  1.00 39.83 ? 63   GLU A OE1   1 
ATOM   228  O  OE2   . GLU A 1 62  ? 27.971  1.823   54.691  1.00 40.04 ? 63   GLU A OE2   1 
ATOM   229  N  N     . ASP A 1 63  ? 30.975  6.250   51.715  1.00 33.94 ? 64   ASP A N     1 
ATOM   230  C  CA    . ASP A 1 63  ? 30.948  7.710   51.917  1.00 34.62 ? 64   ASP A CA    1 
ATOM   231  C  C     . ASP A 1 63  ? 30.535  8.460   50.650  1.00 34.06 ? 64   ASP A C     1 
ATOM   232  O  O     . ASP A 1 63  ? 29.733  9.400   50.723  1.00 34.57 ? 64   ASP A O     1 
ATOM   233  C  CB    . ASP A 1 63  ? 32.290  8.210   52.482  1.00 35.03 ? 64   ASP A CB    1 
ATOM   234  C  CG    . ASP A 1 63  ? 32.434  7.929   53.983  1.00 38.39 ? 64   ASP A CG    1 
ATOM   235  O  OD1   . ASP A 1 63  ? 31.426  8.004   54.728  1.00 42.44 ? 64   ASP A OD1   1 
ATOM   236  O  OD2   . ASP A 1 63  ? 33.568  7.635   54.440  1.00 42.48 ? 64   ASP A OD2   1 
ATOM   237  N  N     . GLU A 1 64  ? 31.041  8.020   49.494  1.00 33.92 ? 65   GLU A N     1 
ATOM   238  C  CA    . GLU A 1 64  ? 30.615  8.562   48.198  1.00 34.49 ? 65   GLU A CA    1 
ATOM   239  C  C     . GLU A 1 64  ? 29.151  8.277   47.917  1.00 34.21 ? 65   GLU A C     1 
ATOM   240  O  O     . GLU A 1 64  ? 28.429  9.148   47.402  1.00 35.24 ? 65   GLU A O     1 
ATOM   241  C  CB    . GLU A 1 64  ? 31.490  8.058   47.049  1.00 34.18 ? 65   GLU A CB    1 
ATOM   242  C  CG    . GLU A 1 64  ? 32.914  8.610   47.108  1.00 34.87 ? 65   GLU A CG    1 
ATOM   243  C  CD    . GLU A 1 64  ? 33.870  7.915   46.156  1.00 37.10 ? 65   GLU A CD    1 
ATOM   244  O  OE1   . GLU A 1 64  ? 33.940  6.656   46.155  1.00 36.98 ? 65   GLU A OE1   1 
ATOM   245  O  OE2   . GLU A 1 64  ? 34.572  8.632   45.399  1.00 38.06 ? 65   GLU A OE2   1 
ATOM   246  N  N     . CYS A 1 65  ? 28.688  7.076   48.244  1.00 33.23 ? 66   CYS A N     1 
ATOM   247  C  CA    . CYS A 1 65  ? 27.254  6.792   48.151  1.00 33.04 ? 66   CYS A CA    1 
ATOM   248  C  C     . CYS A 1 65  ? 26.409  7.762   48.988  1.00 32.93 ? 66   CYS A C     1 
ATOM   249  O  O     . CYS A 1 65  ? 25.372  8.259   48.504  1.00 32.78 ? 66   CYS A O     1 
ATOM   250  C  CB    . CYS A 1 65  ? 26.952  5.334   48.535  1.00 32.90 ? 66   CYS A CB    1 
ATOM   251  S  SG    . CYS A 1 65  ? 27.496  4.211   47.211  1.00 33.01 ? 66   CYS A SG    1 
ATOM   252  N  N     . LYS A 1 66  ? 26.850  8.028   50.219  1.00 32.86 ? 67   LYS A N     1 
ATOM   253  C  CA    . LYS A 1 66  ? 26.111  8.893   51.146  1.00 34.01 ? 67   LYS A CA    1 
ATOM   254  C  C     . LYS A 1 66  ? 25.954  10.307  50.575  1.00 34.15 ? 67   LYS A C     1 
ATOM   255  O  O     . LYS A 1 66  ? 24.946  10.940  50.805  1.00 33.21 ? 67   LYS A O     1 
ATOM   256  C  CB    . LYS A 1 66  ? 26.784  8.984   52.517  1.00 33.95 ? 67   LYS A CB    1 
ATOM   257  C  CG    . LYS A 1 66  ? 26.707  7.709   53.357  1.00 35.98 ? 67   LYS A CG    1 
ATOM   258  C  CD    . LYS A 1 66  ? 27.563  7.841   54.605  1.00 37.74 ? 67   LYS A CD    1 
ATOM   259  C  CE    . LYS A 1 66  ? 27.268  6.736   55.616  1.00 38.79 ? 67   LYS A CE    1 
ATOM   260  N  NZ    . LYS A 1 66  ? 28.262  6.724   56.749  1.00 39.72 ? 67   LYS A NZ    1 
ATOM   261  N  N     . GLN A 1 67  ? 26.963  10.774  49.840  1.00 35.37 ? 68   GLN A N     1 
ATOM   262  C  CA    . GLN A 1 67  ? 26.915  12.060  49.141  1.00 36.06 ? 68   GLN A CA    1 
ATOM   263  C  C     . GLN A 1 67  ? 25.766  12.162  48.098  1.00 35.89 ? 68   GLN A C     1 
ATOM   264  O  O     . GLN A 1 67  ? 25.324  13.241  47.768  1.00 35.11 ? 68   GLN A O     1 
ATOM   265  C  CB    . GLN A 1 67  ? 28.274  12.356  48.487  1.00 36.33 ? 68   GLN A CB    1 
ATOM   266  C  CG    . GLN A 1 67  ? 29.364  12.790  49.498  1.00 38.35 ? 68   GLN A CG    1 
ATOM   267  C  CD    . GLN A 1 67  ? 30.787  12.775  48.918  1.00 39.88 ? 68   GLN A CD    1 
ATOM   268  O  OE1   . GLN A 1 67  ? 30.989  13.159  47.764  1.00 47.37 ? 68   GLN A OE1   1 
ATOM   269  N  NE2   . GLN A 1 67  ? 31.791  12.332  49.732  1.00 45.32 ? 68   GLN A NE2   1 
ATOM   270  N  N     . TYR A 1 68  ? 25.288  11.039  47.593  1.00 35.33 ? 69   TYR A N     1 
ATOM   271  C  CA    . TYR A 1 68  ? 24.166  11.034  46.653  1.00 35.43 ? 69   TYR A CA    1 
ATOM   272  C  C     . TYR A 1 68  ? 22.780  10.958  47.310  1.00 34.90 ? 69   TYR A C     1 
ATOM   273  O  O     . TYR A 1 68  ? 21.766  10.990  46.612  1.00 34.44 ? 69   TYR A O     1 
ATOM   274  C  CB    . TYR A 1 68  ? 24.338  9.872   45.657  1.00 36.23 ? 69   TYR A CB    1 
ATOM   275  C  CG    . TYR A 1 68  ? 25.272  10.189  44.518  1.00 36.77 ? 69   TYR A CG    1 
ATOM   276  C  CD1   . TYR A 1 68  ? 26.647  9.910   44.582  1.00 37.64 ? 69   TYR A CD1   1 
ATOM   277  C  CD2   . TYR A 1 68  ? 24.787  10.781  43.387  1.00 39.09 ? 69   TYR A CD2   1 
ATOM   278  C  CE1   . TYR A 1 68  ? 27.497  10.246  43.500  1.00 37.70 ? 69   TYR A CE1   1 
ATOM   279  C  CE2   . TYR A 1 68  ? 25.601  11.085  42.341  1.00 40.45 ? 69   TYR A CE2   1 
ATOM   280  C  CZ    . TYR A 1 68  ? 26.939  10.814  42.389  1.00 38.16 ? 69   TYR A CZ    1 
ATOM   281  O  OH    . TYR A 1 68  ? 27.659  11.190  41.262  1.00 42.39 ? 69   TYR A OH    1 
ATOM   282  N  N     . LYS A 1 69  ? 22.714  10.839  48.628  1.00 33.48 ? 70   LYS A N     1 
ATOM   283  C  CA    . LYS A 1 69  ? 21.405  10.770  49.290  1.00 34.40 ? 70   LYS A CA    1 
ATOM   284  C  C     . LYS A 1 69  ? 20.511  11.974  48.973  1.00 33.14 ? 70   LYS A C     1 
ATOM   285  O  O     . LYS A 1 69  ? 19.366  11.806  48.649  1.00 32.28 ? 70   LYS A O     1 
ATOM   286  C  CB    . LYS A 1 69  ? 21.542  10.593  50.803  1.00 34.42 ? 70   LYS A CB    1 
ATOM   287  C  CG    . LYS A 1 69  ? 20.201  10.442  51.519  1.00 36.15 ? 70   LYS A CG    1 
ATOM   288  C  CD    . LYS A 1 69  ? 20.336  9.989   52.964  1.00 36.23 ? 70   LYS A CD    1 
ATOM   289  C  CE    . LYS A 1 69  ? 21.099  11.006  53.801  1.00 38.78 ? 70   LYS A CE    1 
ATOM   290  N  NZ    . LYS A 1 69  ? 20.844  10.885  55.264  1.00 39.93 ? 70   LYS A NZ    1 
ATOM   291  N  N     . VAL A 1 70  ? 21.031  13.185  49.112  1.00 33.64 ? 71   VAL A N     1 
ATOM   292  C  CA    . VAL A 1 70  ? 20.218  14.378  48.840  1.00 34.20 ? 71   VAL A CA    1 
ATOM   293  C  C     . VAL A 1 70  ? 19.774  14.398  47.360  1.00 33.03 ? 71   VAL A C     1 
ATOM   294  O  O     . VAL A 1 70  ? 18.678  14.888  47.032  1.00 32.40 ? 71   VAL A O     1 
ATOM   295  C  CB    . VAL A 1 70  ? 20.954  15.685  49.217  1.00 34.16 ? 71   VAL A CB    1 
ATOM   296  C  CG1   . VAL A 1 70  ? 21.352  15.684  50.700  1.00 37.28 ? 71   VAL A CG1   1 
ATOM   297  C  CG2   . VAL A 1 70  ? 22.174  15.886  48.310  1.00 37.96 ? 71   VAL A CG2   1 
ATOM   298  N  N     . VAL A 1 71  ? 20.590  13.828  46.460  1.00 33.12 ? 72   VAL A N     1 
ATOM   299  C  CA    . VAL A 1 71  ? 20.187  13.736  45.030  1.00 32.75 ? 72   VAL A CA    1 
ATOM   300  C  C     . VAL A 1 71  ? 19.054  12.726  44.819  1.00 31.90 ? 72   VAL A C     1 
ATOM   301  O  O     . VAL A 1 71  ? 18.098  12.995  44.081  1.00 30.26 ? 72   VAL A O     1 
ATOM   302  C  CB    . VAL A 1 71  ? 21.381  13.373  44.082  1.00 33.38 ? 72   VAL A CB    1 
ATOM   303  C  CG1   . VAL A 1 71  ? 20.934  13.305  42.630  1.00 33.50 ? 72   VAL A CG1   1 
ATOM   304  C  CG2   . VAL A 1 71  ? 22.505  14.424  44.236  1.00 35.43 ? 72   VAL A CG2   1 
ATOM   305  N  N     . VAL A 1 72  ? 19.152  11.571  45.472  1.00 31.68 ? 73   VAL A N     1 
ATOM   306  C  CA    . VAL A 1 72  ? 18.068  10.577  45.409  1.00 30.72 ? 73   VAL A CA    1 
ATOM   307  C  C     . VAL A 1 72  ? 16.749  11.218  45.878  1.00 30.27 ? 73   VAL A C     1 
ATOM   308  O  O     . VAL A 1 72  ? 15.712  11.104  45.202  1.00 28.59 ? 73   VAL A O     1 
ATOM   309  C  CB    . VAL A 1 72  ? 18.386  9.300   46.240  1.00 32.21 ? 73   VAL A CB    1 
ATOM   310  C  CG1   . VAL A 1 72  ? 17.129  8.437   46.368  1.00 31.28 ? 73   VAL A CG1   1 
ATOM   311  C  CG2   . VAL A 1 72  ? 19.575  8.522   45.603  1.00 29.21 ? 73   VAL A CG2   1 
ATOM   312  N  N     . TYR A 1 73  ? 16.816  11.921  47.001  1.00 29.72 ? 74   TYR A N     1 
ATOM   313  C  CA    . TYR A 1 73  ? 15.643  12.582  47.583  1.00 30.64 ? 74   TYR A CA    1 
ATOM   314  C  C     . TYR A 1 73  ? 15.083  13.643  46.635  1.00 30.81 ? 74   TYR A C     1 
ATOM   315  O  O     . TYR A 1 73  ? 13.896  13.689  46.354  1.00 29.81 ? 74   TYR A O     1 
ATOM   316  C  CB    . TYR A 1 73  ? 15.985  13.145  48.980  1.00 31.38 ? 74   TYR A CB    1 
ATOM   317  C  CG    . TYR A 1 73  ? 16.112  12.097  50.076  1.00 31.66 ? 74   TYR A CG    1 
ATOM   318  C  CD1   . TYR A 1 73  ? 15.682  10.774  49.885  1.00 34.12 ? 74   TYR A CD1   1 
ATOM   319  C  CD2   . TYR A 1 73  ? 16.614  12.432  51.332  1.00 34.84 ? 74   TYR A CD2   1 
ATOM   320  C  CE1   . TYR A 1 73  ? 15.798  9.796   50.910  1.00 35.26 ? 74   TYR A CE1   1 
ATOM   321  C  CE2   . TYR A 1 73  ? 16.736  11.465  52.358  1.00 35.59 ? 74   TYR A CE2   1 
ATOM   322  C  CZ    . TYR A 1 73  ? 16.310  10.160  52.155  1.00 35.00 ? 74   TYR A CZ    1 
ATOM   323  O  OH    . TYR A 1 73  ? 16.432  9.244   53.212  1.00 36.96 ? 74   TYR A OH    1 
ATOM   324  N  N     . SER A 1 74  ? 15.964  14.487  46.109  1.00 31.47 ? 75   SER A N     1 
ATOM   325  C  CA    . SER A 1 74  ? 15.527  15.517  45.209  1.00 32.10 ? 75   SER A CA    1 
ATOM   326  C  C     . SER A 1 74  ? 14.898  14.945  43.949  1.00 31.37 ? 75   SER A C     1 
ATOM   327  O  O     . SER A 1 74  ? 13.866  15.432  43.535  1.00 31.90 ? 75   SER A O     1 
ATOM   328  C  CB    . SER A 1 74  ? 16.690  16.468  44.903  1.00 32.55 ? 75   SER A CB    1 
ATOM   329  O  OG    . SER A 1 74  ? 16.331  17.358  43.877  1.00 38.29 ? 75   SER A OG    1 
ATOM   330  N  N     . ASN A 1 75  ? 15.522  13.925  43.342  1.00 31.53 ? 76   ASN A N     1 
ATOM   331  C  CA    . ASN A 1 75  ? 14.992  13.257  42.164  1.00 32.22 ? 76   ASN A CA    1 
ATOM   332  C  C     . ASN A 1 75  ? 13.586  12.671  42.452  1.00 32.09 ? 76   ASN A C     1 
ATOM   333  O  O     . ASN A 1 75  ? 12.662  12.829  41.659  1.00 32.51 ? 76   ASN A O     1 
ATOM   334  C  CB    . ASN A 1 75  ? 15.871  12.072  41.741  1.00 32.31 ? 76   ASN A CB    1 
ATOM   335  C  CG    . ASN A 1 75  ? 17.167  12.454  41.008  1.00 31.69 ? 76   ASN A CG    1 
ATOM   336  O  OD1   . ASN A 1 75  ? 17.880  11.535  40.602  1.00 35.90 ? 76   ASN A OD1   1 
ATOM   337  N  ND2   . ASN A 1 75  ? 17.470  13.759  40.812  1.00 30.75 ? 76   ASN A ND2   1 
ATOM   338  N  N     . THR A 1 76  ? 13.442  12.034  43.613  1.00 31.31 ? 77   THR A N     1 
ATOM   339  C  CA    . THR A 1 76  ? 12.141  11.464  44.029  1.00 31.21 ? 77   THR A CA    1 
ATOM   340  C  C     . THR A 1 76  ? 11.064  12.554  44.182  1.00 31.33 ? 77   THR A C     1 
ATOM   341  O  O     . THR A 1 76  ? 9.955   12.463  43.608  1.00 32.15 ? 77   THR A O     1 
ATOM   342  C  CB    . THR A 1 76  ? 12.307  10.654  45.349  1.00 31.74 ? 77   THR A CB    1 
ATOM   343  O  OG1   . THR A 1 76  ? 13.354  9.666   45.207  1.00 29.30 ? 77   THR A OG1   1 
ATOM   344  C  CG2   . THR A 1 76  ? 10.981  9.972   45.783  1.00 30.41 ? 77   THR A CG2   1 
ATOM   345  N  N     . ILE A 1 77  ? 11.405  13.601  44.920  1.00 31.18 ? 78   ILE A N     1 
ATOM   346  C  CA    . ILE A 1 77  ? 10.462  14.701  45.237  1.00 30.76 ? 78   ILE A CA    1 
ATOM   347  C  C     . ILE A 1 77  ? 10.100  15.456  43.965  1.00 31.05 ? 78   ILE A C     1 
ATOM   348  O  O     . ILE A 1 77  ? 8.940   15.710  43.697  1.00 30.41 ? 78   ILE A O     1 
ATOM   349  C  CB    . ILE A 1 77  ? 11.068  15.677  46.300  1.00 31.26 ? 78   ILE A CB    1 
ATOM   350  C  CG1   . ILE A 1 77  ? 11.234  14.990  47.668  1.00 30.89 ? 78   ILE A CG1   1 
ATOM   351  C  CG2   . ILE A 1 77  ? 10.234  16.995  46.424  1.00 31.72 ? 78   ILE A CG2   1 
ATOM   352  C  CD1   . ILE A 1 77  ? 12.240  15.692  48.600  1.00 30.91 ? 78   ILE A CD1   1 
ATOM   353  N  N     . GLN A 1 78  ? 11.098  15.799  43.168  1.00 30.92 ? 79   GLN A N     1 
ATOM   354  C  CA    . GLN A 1 78  ? 10.848  16.497  41.906  1.00 32.34 ? 79   GLN A CA    1 
ATOM   355  C  C     . GLN A 1 78  ? 10.018  15.666  40.916  1.00 31.20 ? 79   GLN A C     1 
ATOM   356  O  O     . GLN A 1 78  ? 9.212   16.222  40.171  1.00 30.62 ? 79   GLN A O     1 
ATOM   357  C  CB    . GLN A 1 78  ? 12.175  16.968  41.267  1.00 33.34 ? 79   GLN A CB    1 
ATOM   358  C  CG    . GLN A 1 78  ? 12.852  18.093  42.079  1.00 37.92 ? 79   GLN A CG    1 
ATOM   359  C  CD    . GLN A 1 78  ? 11.908  19.281  42.371  1.00 43.61 ? 79   GLN A CD    1 
ATOM   360  O  OE1   . GLN A 1 78  ? 11.208  19.756  41.475  1.00 48.40 ? 79   GLN A OE1   1 
ATOM   361  N  NE2   . GLN A 1 78  ? 11.873  19.739  43.624  1.00 47.02 ? 79   GLN A NE2   1 
ATOM   362  N  N     . SER A 1 79  ? 10.213  14.355  40.912  1.00 31.28 ? 80   SER A N     1 
ATOM   363  C  CA    . SER A 1 79  ? 9.439   13.466  40.026  1.00 30.80 ? 80   SER A CA    1 
ATOM   364  C  C     . SER A 1 79  ? 7.948   13.420  40.409  1.00 30.91 ? 80   SER A C     1 
ATOM   365  O  O     . SER A 1 79  ? 7.084   13.543  39.559  1.00 29.49 ? 80   SER A O     1 
ATOM   366  C  CB    . SER A 1 79  ? 10.056  12.067  39.999  1.00 32.27 ? 80   SER A CB    1 
ATOM   367  O  OG    . SER A 1 79  ? 11.342  12.093  39.336  1.00 32.53 ? 80   SER A OG    1 
ATOM   368  N  N     . ILE A 1 80  ? 7.633   13.278  41.696  1.00 30.04 ? 81   ILE A N     1 
ATOM   369  C  CA    . ILE A 1 80  ? 6.220   13.198  42.080  1.00 29.92 ? 81   ILE A CA    1 
ATOM   370  C  C     . ILE A 1 80  ? 5.592   14.570  41.871  1.00 29.74 ? 81   ILE A C     1 
ATOM   371  O  O     . ILE A 1 80  ? 4.466   14.637  41.411  1.00 29.89 ? 81   ILE A O     1 
ATOM   372  C  CB    . ILE A 1 80  ? 6.016   12.608  43.534  1.00 29.26 ? 81   ILE A CB    1 
ATOM   373  C  CG1   . ILE A 1 80  ? 4.543   12.303  43.806  1.00 30.08 ? 81   ILE A CG1   1 
ATOM   374  C  CG2   . ILE A 1 80  ? 6.588   13.525  44.638  1.00 28.19 ? 81   ILE A CG2   1 
ATOM   375  C  CD1   . ILE A 1 80  ? 3.920   11.207  42.942  1.00 30.55 ? 81   ILE A CD1   1 
ATOM   376  N  N     . ILE A 1 81  ? 6.330   15.657  42.148  1.00 29.36 ? 82   ILE A N     1 
ATOM   377  C  CA    . ILE A 1 81  ? 5.832   17.014  41.853  1.00 30.52 ? 82   ILE A CA    1 
ATOM   378  C  C     . ILE A 1 81  ? 5.477   17.168  40.350  1.00 29.86 ? 82   ILE A C     1 
ATOM   379  O  O     . ILE A 1 81  ? 4.425   17.687  40.017  1.00 30.78 ? 82   ILE A O     1 
ATOM   380  C  CB    . ILE A 1 81  ? 6.811   18.121  42.305  1.00 30.13 ? 82   ILE A CB    1 
ATOM   381  C  CG1   . ILE A 1 81  ? 6.847   18.197  43.848  1.00 30.80 ? 82   ILE A CG1   1 
ATOM   382  C  CG2   . ILE A 1 81  ? 6.389   19.458  41.643  1.00 29.67 ? 82   ILE A CG2   1 
ATOM   383  C  CD1   . ILE A 1 81  ? 7.960   19.079  44.477  1.00 32.80 ? 82   ILE A CD1   1 
ATOM   384  N  N     . ALA A 1 82  ? 6.372   16.719  39.475  1.00 29.06 ? 83   ALA A N     1 
ATOM   385  C  CA    . ALA A 1 82  ? 6.178   16.789  38.029  1.00 29.52 ? 83   ALA A CA    1 
ATOM   386  C  C     . ALA A 1 82  ? 4.896   16.079  37.581  1.00 30.28 ? 83   ALA A C     1 
ATOM   387  O  O     . ALA A 1 82  ? 4.113   16.621  36.755  1.00 30.24 ? 83   ALA A O     1 
ATOM   388  C  CB    . ALA A 1 82  ? 7.402   16.212  37.277  1.00 28.98 ? 83   ALA A CB    1 
ATOM   389  N  N     . ILE A 1 83  ? 4.655   14.906  38.154  1.00 30.06 ? 84   ILE A N     1 
ATOM   390  C  CA    . ILE A 1 83  ? 3.436   14.130  37.813  1.00 30.69 ? 84   ILE A CA    1 
ATOM   391  C  C     . ILE A 1 83  ? 2.218   14.908  38.304  1.00 31.50 ? 84   ILE A C     1 
ATOM   392  O  O     . ILE A 1 83  ? 1.248   15.112  37.568  1.00 31.56 ? 84   ILE A O     1 
ATOM   393  C  CB    . ILE A 1 83  ? 3.474   12.716  38.437  1.00 30.51 ? 84   ILE A CB    1 
ATOM   394  C  CG1   . ILE A 1 83  ? 4.638   11.900  37.866  1.00 31.00 ? 84   ILE A CG1   1 
ATOM   395  C  CG2   . ILE A 1 83  ? 2.094   11.983  38.276  1.00 29.12 ? 84   ILE A CG2   1 
ATOM   396  C  CD1   . ILE A 1 83  ? 4.993   10.704  38.722  1.00 32.99 ? 84   ILE A CD1   1 
ATOM   397  N  N     . ILE A 1 84  ? 2.265   15.400  39.539  1.00 32.14 ? 85   ILE A N     1 
ATOM   398  C  CA    . ILE A 1 84  ? 1.104   16.127  40.058  1.00 32.56 ? 85   ILE A CA    1 
ATOM   399  C  C     . ILE A 1 84  ? 0.812   17.359  39.218  1.00 32.31 ? 85   ILE A C     1 
ATOM   400  O  O     . ILE A 1 84  ? -0.359  17.620  38.886  1.00 31.41 ? 85   ILE A O     1 
ATOM   401  C  CB    . ILE A 1 84  ? 1.257   16.533  41.560  1.00 32.55 ? 85   ILE A CB    1 
ATOM   402  C  CG1   . ILE A 1 84  ? 1.364   15.287  42.434  1.00 35.45 ? 85   ILE A CG1   1 
ATOM   403  C  CG2   . ILE A 1 84  ? 0.075   17.418  42.053  1.00 33.98 ? 85   ILE A CG2   1 
ATOM   404  C  CD1   . ILE A 1 84  ? 0.165   14.406  42.354  1.00 38.58 ? 85   ILE A CD1   1 
ATOM   405  N  N     . ARG A 1 85  ? 1.857   18.132  38.925  1.00 32.96 ? 86   ARG A N     1 
ATOM   406  C  CA    . ARG A 1 85  ? 1.712   19.338  38.109  1.00 34.18 ? 86   ARG A CA    1 
ATOM   407  C  C     . ARG A 1 85  ? 1.071   19.060  36.758  1.00 33.95 ? 86   ARG A C     1 
ATOM   408  O  O     . ARG A 1 85  ? 0.219   19.830  36.312  1.00 32.81 ? 86   ARG A O     1 
ATOM   409  C  CB    . ARG A 1 85  ? 3.037   20.030  37.864  1.00 35.33 ? 86   ARG A CB    1 
ATOM   410  C  CG    . ARG A 1 85  ? 3.427   21.003  38.906  1.00 40.62 ? 86   ARG A CG    1 
ATOM   411  C  CD    . ARG A 1 85  ? 4.493   21.984  38.365  1.00 44.95 ? 86   ARG A CD    1 
ATOM   412  N  NE    . ARG A 1 85  ? 4.921   22.820  39.475  1.00 48.50 ? 86   ARG A NE    1 
ATOM   413  C  CZ    . ARG A 1 85  ? 6.157   22.913  39.958  1.00 49.67 ? 86   ARG A CZ    1 
ATOM   414  N  NH1   . ARG A 1 85  ? 7.188   22.300  39.386  1.00 51.41 ? 86   ARG A NH1   1 
ATOM   415  N  NH2   . ARG A 1 85  ? 6.362   23.696  41.002  1.00 50.91 ? 86   ARG A NH2   1 
ATOM   416  N  N     . ALA A 1 86  ? 1.487   17.960  36.124  1.00 34.47 ? 87   ALA A N     1 
ATOM   417  C  CA    . ALA A 1 86  ? 0.995   17.576  34.802  1.00 35.09 ? 87   ALA A CA    1 
ATOM   418  C  C     . ALA A 1 86  ? -0.514  17.250  34.765  1.00 35.86 ? 87   ALA A C     1 
ATOM   419  O  O     . ALA A 1 86  ? -1.175  17.386  33.714  1.00 36.50 ? 87   ALA A O     1 
ATOM   420  C  CB    . ALA A 1 86  ? 1.859   16.393  34.245  1.00 34.71 ? 87   ALA A CB    1 
ATOM   421  N  N     . MET A 1 87  ? -1.060  16.844  35.906  1.00 36.29 ? 88   MET A N     1 
ATOM   422  C  CA    . MET A 1 87  ? -2.448  16.454  36.009  1.00 37.38 ? 88   MET A CA    1 
ATOM   423  C  C     . MET A 1 87  ? -3.414  17.585  35.614  1.00 39.80 ? 88   MET A C     1 
ATOM   424  O  O     . MET A 1 87  ? -4.488  17.303  35.112  1.00 39.97 ? 88   MET A O     1 
ATOM   425  C  CB    . MET A 1 87  ? -2.783  15.955  37.410  1.00 37.03 ? 88   MET A CB    1 
ATOM   426  C  CG    . MET A 1 87  ? -2.176  14.622  37.773  1.00 36.25 ? 88   MET A CG    1 
ATOM   427  S  SD    . MET A 1 87  ? -2.386  14.198  39.501  1.00 35.86 ? 88   MET A SD    1 
ATOM   428  C  CE    . MET A 1 87  ? -4.018  13.432  39.536  1.00 36.02 ? 88   MET A CE    1 
ATOM   429  N  N     . GLY A 1 88  ? -3.012  18.845  35.833  1.00 42.23 ? 89   GLY A N     1 
ATOM   430  C  CA    . GLY A 1 88  ? -3.714  20.005  35.282  1.00 43.02 ? 89   GLY A CA    1 
ATOM   431  C  C     . GLY A 1 88  ? -3.651  20.054  33.757  1.00 43.95 ? 89   GLY A C     1 
ATOM   432  O  O     . GLY A 1 88  ? -4.688  20.081  33.090  1.00 44.68 ? 89   GLY A O     1 
ATOM   433  N  N     . ARG A 1 89  ? -2.448  20.045  33.183  1.00 44.42 ? 90   ARG A N     1 
ATOM   434  C  CA    . ARG A 1 89  ? -2.333  20.091  31.721  1.00 44.43 ? 90   ARG A CA    1 
ATOM   435  C  C     . ARG A 1 89  ? -3.145  18.944  31.092  1.00 44.48 ? 90   ARG A C     1 
ATOM   436  O  O     . ARG A 1 89  ? -3.776  19.114  30.033  1.00 44.76 ? 90   ARG A O     1 
ATOM   437  C  CB    . ARG A 1 89  ? -0.854  20.059  31.274  1.00 44.67 ? 90   ARG A CB    1 
ATOM   438  C  CG    . ARG A 1 89  ? -0.630  19.917  29.750  1.00 44.90 ? 90   ARG A CG    1 
ATOM   439  C  CD    . ARG A 1 89  ? 0.837   19.585  29.396  1.00 45.17 ? 90   ARG A CD    1 
ATOM   440  N  N     . LEU A 1 90  ? -3.152  17.786  31.760  1.00 43.61 ? 91   LEU A N     1 
ATOM   441  C  CA    . LEU A 1 90  ? -3.719  16.564  31.198  1.00 42.55 ? 91   LEU A CA    1 
ATOM   442  C  C     . LEU A 1 90  ? -5.196  16.333  31.529  1.00 42.28 ? 91   LEU A C     1 
ATOM   443  O  O     . LEU A 1 90  ? -5.794  15.391  30.997  1.00 42.38 ? 91   LEU A O     1 
ATOM   444  C  CB    . LEU A 1 90  ? -2.868  15.364  31.592  1.00 42.16 ? 91   LEU A CB    1 
ATOM   445  C  CG    . LEU A 1 90  ? -1.649  15.133  30.689  1.00 41.16 ? 91   LEU A CG    1 
ATOM   446  C  CD1   . LEU A 1 90  ? -0.759  16.347  30.548  1.00 41.92 ? 91   LEU A CD1   1 
ATOM   447  C  CD2   . LEU A 1 90  ? -0.874  13.961  31.187  1.00 40.32 ? 91   LEU A CD2   1 
ATOM   448  N  N     . LYS A 1 91  ? -5.775  17.183  32.376  1.00 41.11 ? 92   LYS A N     1 
ATOM   449  C  CA    . LYS A 1 91  ? -7.179  17.071  32.765  1.00 40.90 ? 92   LYS A CA    1 
ATOM   450  C  C     . LYS A 1 91  ? -7.439  15.732  33.483  1.00 40.20 ? 92   LYS A C     1 
ATOM   451  O  O     . LYS A 1 91  ? -8.367  14.987  33.125  1.00 39.69 ? 92   LYS A O     1 
ATOM   452  C  CB    . LYS A 1 91  ? -8.088  17.243  31.537  1.00 40.90 ? 92   LYS A CB    1 
ATOM   453  N  N     . ILE A 1 92  ? -6.594  15.426  34.482  1.00 38.84 ? 93   ILE A N     1 
ATOM   454  C  CA    . ILE A 1 92  ? -6.690  14.187  35.271  1.00 37.89 ? 93   ILE A CA    1 
ATOM   455  C  C     . ILE A 1 92  ? -6.947  14.520  36.741  1.00 37.94 ? 93   ILE A C     1 
ATOM   456  O  O     . ILE A 1 92  ? -6.201  15.289  37.337  1.00 38.09 ? 93   ILE A O     1 
ATOM   457  C  CB    . ILE A 1 92  ? -5.389  13.322  35.175  1.00 37.78 ? 93   ILE A CB    1 
ATOM   458  C  CG1   . ILE A 1 92  ? -5.058  12.964  33.708  1.00 37.65 ? 93   ILE A CG1   1 
ATOM   459  C  CG2   . ILE A 1 92  ? -5.526  12.052  36.022  1.00 36.48 ? 93   ILE A CG2   1 
ATOM   460  C  CD1   . ILE A 1 92  ? -3.715  12.203  33.518  1.00 36.64 ? 93   ILE A CD1   1 
ATOM   461  N  N     . ASP A 1 93  ? -7.992  13.932  37.312  1.00 37.97 ? 94   ASP A N     1 
ATOM   462  C  CA    . ASP A 1 93  ? -8.343  14.120  38.732  1.00 38.25 ? 94   ASP A CA    1 
ATOM   463  C  C     . ASP A 1 93  ? -7.706  13.053  39.598  1.00 37.42 ? 94   ASP A C     1 
ATOM   464  O  O     . ASP A 1 93  ? -7.403  11.960  39.133  1.00 36.17 ? 94   ASP A O     1 
ATOM   465  C  CB    . ASP A 1 93  ? -9.856  14.023  38.954  1.00 39.32 ? 94   ASP A CB    1 
ATOM   466  C  CG    . ASP A 1 93  ? -10.607 15.220  38.431  1.00 41.30 ? 94   ASP A CG    1 
ATOM   467  O  OD1   . ASP A 1 93  ? -10.149 16.371  38.642  1.00 45.39 ? 94   ASP A OD1   1 
ATOM   468  O  OD2   . ASP A 1 93  ? -11.677 14.993  37.828  1.00 43.99 ? 94   ASP A OD2   1 
ATOM   469  N  N     . PHE A 1 94  ? -7.551  13.369  40.882  1.00 36.89 ? 95   PHE A N     1 
ATOM   470  C  CA    . PHE A 1 94  ? -7.093  12.384  41.857  1.00 36.32 ? 95   PHE A CA    1 
ATOM   471  C  C     . PHE A 1 94  ? -8.119  11.271  41.964  1.00 36.07 ? 95   PHE A C     1 
ATOM   472  O  O     . PHE A 1 94  ? -9.315  11.525  41.851  1.00 36.37 ? 95   PHE A O     1 
ATOM   473  C  CB    . PHE A 1 94  ? -6.898  13.030  43.232  1.00 36.02 ? 95   PHE A CB    1 
ATOM   474  C  CG    . PHE A 1 94  ? -5.733  13.968  43.296  1.00 35.83 ? 95   PHE A CG    1 
ATOM   475  C  CD1   . PHE A 1 94  ? -4.442  13.499  43.055  1.00 35.53 ? 95   PHE A CD1   1 
ATOM   476  C  CD2   . PHE A 1 94  ? -5.903  15.307  43.632  1.00 35.81 ? 95   PHE A CD2   1 
ATOM   477  C  CE1   . PHE A 1 94  ? -3.355  14.345  43.125  1.00 34.15 ? 95   PHE A CE1   1 
ATOM   478  C  CE2   . PHE A 1 94  ? -4.794  16.157  43.706  1.00 34.96 ? 95   PHE A CE2   1 
ATOM   479  C  CZ    . PHE A 1 94  ? -3.538  15.677  43.440  1.00 35.29 ? 95   PHE A CZ    1 
ATOM   480  N  N     . GLY A 1 95  ? -7.647  10.045  42.180  1.00 35.77 ? 96   GLY A N     1 
ATOM   481  C  CA    . GLY A 1 95  ? -8.514  8.898   42.460  1.00 35.52 ? 96   GLY A CA    1 
ATOM   482  C  C     . GLY A 1 95  ? -9.341  9.155   43.701  1.00 35.68 ? 96   GLY A C     1 
ATOM   483  O  O     . GLY A 1 95  ? -10.502 8.738   43.789  1.00 35.55 ? 96   GLY A O     1 
ATOM   484  N  N     . GLU A 1 96  ? -8.744  9.847   44.666  1.00 35.43 ? 97   GLU A N     1 
ATOM   485  C  CA    . GLU A 1 96  ? -9.435  10.234  45.873  1.00 35.99 ? 97   GLU A CA    1 
ATOM   486  C  C     . GLU A 1 96  ? -9.186  11.693  46.218  1.00 35.58 ? 97   GLU A C     1 
ATOM   487  O  O     . GLU A 1 96  ? -8.054  12.163  46.152  1.00 34.51 ? 97   GLU A O     1 
ATOM   488  C  CB    . GLU A 1 96  ? -9.023  9.309   47.011  1.00 36.26 ? 97   GLU A CB    1 
ATOM   489  C  CG    . GLU A 1 96  ? -9.756  7.985   46.920  1.00 38.93 ? 97   GLU A CG    1 
ATOM   490  C  CD    . GLU A 1 96  ? -9.148  6.891   47.753  1.00 41.68 ? 97   GLU A CD    1 
ATOM   491  O  OE1   . GLU A 1 96  ? -7.910  6.802   47.774  1.00 42.99 ? 97   GLU A OE1   1 
ATOM   492  O  OE2   . GLU A 1 96  ? -9.923  6.104   48.352  1.00 43.97 ? 97   GLU A OE2   1 
ATOM   493  N  N     . ALA A 1 97  ? -10.269 12.381  46.598  1.00 34.91 ? 98   ALA A N     1 
ATOM   494  C  CA    . ALA A 1 97  ? -10.269 13.806  46.943  1.00 34.86 ? 98   ALA A CA    1 
ATOM   495  C  C     . ALA A 1 97  ? -9.251  14.167  48.034  1.00 34.99 ? 98   ALA A C     1 
ATOM   496  O  O     . ALA A 1 97  ? -8.641  15.245  47.992  1.00 34.76 ? 98   ALA A O     1 
ATOM   497  C  CB    . ALA A 1 97  ? -11.695 14.248  47.387  1.00 35.38 ? 98   ALA A CB    1 
ATOM   498  N  N     . ALA A 1 98  ? -9.071  13.258  48.996  1.00 34.27 ? 99   ALA A N     1 
ATOM   499  C  CA    . ALA A 1 98  ? -8.128  13.453  50.105  1.00 33.62 ? 99   ALA A CA    1 
ATOM   500  C  C     . ALA A 1 98  ? -6.683  13.701  49.662  1.00 32.95 ? 99   ALA A C     1 
ATOM   501  O  O     . ALA A 1 98  ? -5.883  14.251  50.421  1.00 32.75 ? 99   ALA A O     1 
ATOM   502  C  CB    . ALA A 1 98  ? -8.192  12.263  51.066  1.00 33.21 ? 99   ALA A CB    1 
ATOM   503  N  N     . ARG A 1 99  ? -6.344  13.308  48.437  1.00 32.28 ? 100  ARG A N     1 
ATOM   504  C  CA    . ARG A 1 99  ? -4.998  13.536  47.910  1.00 32.02 ? 100  ARG A CA    1 
ATOM   505  C  C     . ARG A 1 99  ? -4.711  15.018  47.621  1.00 31.72 ? 100  ARG A C     1 
ATOM   506  O  O     . ARG A 1 99  ? -3.559  15.419  47.585  1.00 31.35 ? 100  ARG A O     1 
ATOM   507  C  CB    . ARG A 1 99  ? -4.763  12.694  46.660  1.00 31.44 ? 100  ARG A CB    1 
ATOM   508  C  CG    . ARG A 1 99  ? -4.944  11.218  46.879  1.00 30.02 ? 100  ARG A CG    1 
ATOM   509  C  CD    . ARG A 1 99  ? -3.898  10.592  47.786  1.00 29.23 ? 100  ARG A CD    1 
ATOM   510  N  NE    . ARG A 1 99  ? -4.091  10.786  49.215  1.00 29.01 ? 100  ARG A NE    1 
ATOM   511  C  CZ    . ARG A 1 99  ? -5.052  10.223  49.945  1.00 28.95 ? 100  ARG A CZ    1 
ATOM   512  N  NH1   . ARG A 1 99  ? -5.120  10.465  51.248  1.00 29.63 ? 100  ARG A NH1   1 
ATOM   513  N  NH2   . ARG A 1 99  ? -5.965  9.443   49.398  1.00 29.83 ? 100  ARG A NH2   1 
ATOM   514  N  N     . ALA A 1 100 ? -5.759  15.825  47.459  1.00 31.97 ? 101  ALA A N     1 
ATOM   515  C  CA    . ALA A 1 100 ? -5.594  17.262  47.195  1.00 31.75 ? 101  ALA A CA    1 
ATOM   516  C  C     . ALA A 1 100 ? -4.768  17.937  48.284  1.00 32.05 ? 101  ALA A C     1 
ATOM   517  O  O     . ALA A 1 100 ? -3.841  18.722  48.004  1.00 31.17 ? 101  ALA A O     1 
ATOM   518  C  CB    . ALA A 1 100 ? -6.949  17.929  47.077  1.00 31.23 ? 101  ALA A CB    1 
ATOM   519  N  N     . ASP A 1 101 ? -5.089  17.621  49.537  1.00 31.99 ? 102  ASP A N     1 
ATOM   520  C  CA    . ASP A 1 101 ? -4.319  18.168  50.652  1.00 33.01 ? 102  ASP A CA    1 
ATOM   521  C  C     . ASP A 1 101 ? -2.913  17.580  50.746  1.00 32.36 ? 102  ASP A C     1 
ATOM   522  O  O     . ASP A 1 101 ? -1.988  18.296  51.102  1.00 32.16 ? 102  ASP A O     1 
ATOM   523  C  CB    . ASP A 1 101 ? -5.069  18.002  51.973  1.00 32.90 ? 102  ASP A CB    1 
ATOM   524  C  CG    . ASP A 1 101 ? -6.342  18.823  52.008  1.00 37.77 ? 102  ASP A CG    1 
ATOM   525  O  OD1   . ASP A 1 101 ? -6.299  19.963  52.520  1.00 41.82 ? 102  ASP A OD1   1 
ATOM   526  O  OD2   . ASP A 1 101 ? -7.383  18.328  51.503  1.00 43.74 ? 102  ASP A OD2   1 
ATOM   527  N  N     . ASP A 1 102 ? -2.743  16.300  50.404  1.00 32.59 ? 103  ASP A N     1 
ATOM   528  C  CA    . ASP A 1 102 ? -1.385  15.717  50.283  1.00 32.20 ? 103  ASP A CA    1 
ATOM   529  C  C     . ASP A 1 102 ? -0.517  16.471  49.263  1.00 32.62 ? 103  ASP A C     1 
ATOM   530  O  O     . ASP A 1 102 ? 0.668   16.752  49.537  1.00 31.88 ? 103  ASP A O     1 
ATOM   531  C  CB    . ASP A 1 102 ? -1.420  14.217  49.920  1.00 32.40 ? 103  ASP A CB    1 
ATOM   532  C  CG    . ASP A 1 102 ? -1.866  13.325  51.089  1.00 33.08 ? 103  ASP A CG    1 
ATOM   533  O  OD1   . ASP A 1 102 ? -1.753  13.755  52.252  1.00 33.35 ? 103  ASP A OD1   1 
ATOM   534  O  OD2   . ASP A 1 102 ? -2.316  12.180  50.842  1.00 33.22 ? 103  ASP A OD2   1 
ATOM   535  N  N     . ALA A 1 103 ? -1.101  16.796  48.104  1.00 32.64 ? 104  ALA A N     1 
ATOM   536  C  CA    . ALA A 1 103 ? -0.434  17.598  47.081  1.00 33.00 ? 104  ALA A CA    1 
ATOM   537  C  C     . ALA A 1 103 ? 0.005   18.988  47.588  1.00 33.53 ? 104  ALA A C     1 
ATOM   538  O  O     . ALA A 1 103 ? 1.154   19.404  47.359  1.00 32.96 ? 104  ALA A O     1 
ATOM   539  C  CB    . ALA A 1 103 ? -1.304  17.731  45.852  1.00 33.26 ? 104  ALA A CB    1 
ATOM   540  N  N     . ARG A 1 104 ? -0.881  19.676  48.302  1.00 34.06 ? 105  ARG A N     1 
ATOM   541  C  CA    . ARG A 1 104 ? -0.523  20.974  48.923  1.00 35.32 ? 105  ARG A CA    1 
ATOM   542  C  C     . ARG A 1 104 ? 0.635   20.797  49.916  1.00 33.67 ? 105  ARG A C     1 
ATOM   543  O  O     . ARG A 1 104 ? 1.613   21.556  49.903  1.00 32.77 ? 105  ARG A O     1 
ATOM   544  C  CB    . ARG A 1 104 ? -1.732  21.596  49.632  1.00 35.56 ? 105  ARG A CB    1 
ATOM   545  C  CG    . ARG A 1 104 ? -2.792  22.110  48.688  1.00 38.25 ? 105  ARG A CG    1 
ATOM   546  C  CD    . ARG A 1 104 ? -4.032  22.604  49.417  1.00 40.30 ? 105  ARG A CD    1 
ATOM   547  N  NE    . ARG A 1 104 ? -5.197  22.519  48.521  1.00 46.11 ? 105  ARG A NE    1 
ATOM   548  C  CZ    . ARG A 1 104 ? -6.264  21.731  48.684  1.00 46.78 ? 105  ARG A CZ    1 
ATOM   549  N  NH1   . ARG A 1 104 ? -7.230  21.753  47.769  1.00 47.55 ? 105  ARG A NH1   1 
ATOM   550  N  NH2   . ARG A 1 104 ? -6.404  20.959  49.761  1.00 48.28 ? 105  ARG A NH2   1 
ATOM   551  N  N     . GLN A 1 105 ? 0.509   19.773  50.763  1.00 32.93 ? 106  GLN A N     1 
ATOM   552  C  CA    . GLN A 1 105 ? 1.546   19.416  51.729  1.00 32.68 ? 106  GLN A CA    1 
ATOM   553  C  C     . GLN A 1 105 ? 2.889   19.147  51.033  1.00 31.71 ? 106  GLN A C     1 
ATOM   554  O  O     . GLN A 1 105 ? 3.932   19.602  51.499  1.00 30.42 ? 106  GLN A O     1 
ATOM   555  C  CB    . GLN A 1 105 ? 1.110   18.175  52.524  1.00 32.77 ? 106  GLN A CB    1 
ATOM   556  C  CG    . GLN A 1 105 ? 1.797   18.011  53.855  1.00 34.66 ? 106  GLN A CG    1 
ATOM   557  C  CD    . GLN A 1 105 ? 1.351   19.038  54.853  1.00 35.16 ? 106  GLN A CD    1 
ATOM   558  O  OE1   . GLN A 1 105 ? 0.392   19.775  54.608  1.00 38.23 ? 106  GLN A OE1   1 
ATOM   559  N  NE2   . GLN A 1 105 ? 2.035   19.103  55.991  1.00 33.59 ? 106  GLN A NE2   1 
ATOM   560  N  N     . LEU A 1 106 ? 2.855   18.398  49.931  1.00 31.74 ? 107  LEU A N     1 
ATOM   561  C  CA    . LEU A 1 106 ? 4.068   18.065  49.138  1.00 32.11 ? 107  LEU A CA    1 
ATOM   562  C  C     . LEU A 1 106 ? 4.806   19.312  48.658  1.00 32.08 ? 107  LEU A C     1 
ATOM   563  O  O     . LEU A 1 106 ? 6.024   19.402  48.776  1.00 31.68 ? 107  LEU A O     1 
ATOM   564  C  CB    . LEU A 1 106 ? 3.733   17.178  47.917  1.00 31.84 ? 107  LEU A CB    1 
ATOM   565  C  CG    . LEU A 1 106 ? 4.811   16.976  46.852  1.00 32.03 ? 107  LEU A CG    1 
ATOM   566  C  CD1   . LEU A 1 106 ? 5.989   16.170  47.411  1.00 30.94 ? 107  LEU A CD1   1 
ATOM   567  C  CD2   . LEU A 1 106 ? 4.208   16.277  45.602  1.00 31.90 ? 107  LEU A CD2   1 
ATOM   568  N  N     . PHE A 1 107 ? 4.060   20.260  48.118  1.00 33.45 ? 108  PHE A N     1 
ATOM   569  C  CA    . PHE A 1 107 ? 4.658   21.490  47.639  1.00 35.93 ? 108  PHE A CA    1 
ATOM   570  C  C     . PHE A 1 107 ? 5.308   22.297  48.757  1.00 37.05 ? 108  PHE A C     1 
ATOM   571  O  O     . PHE A 1 107 ? 6.426   22.801  48.581  1.00 36.67 ? 108  PHE A O     1 
ATOM   572  C  CB    . PHE A 1 107 ? 3.645   22.309  46.851  1.00 37.53 ? 108  PHE A CB    1 
ATOM   573  C  CG    . PHE A 1 107 ? 3.419   21.777  45.460  1.00 38.78 ? 108  PHE A CG    1 
ATOM   574  C  CD1   . PHE A 1 107 ? 4.358   22.009  44.458  1.00 42.31 ? 108  PHE A CD1   1 
ATOM   575  C  CD2   . PHE A 1 107 ? 2.305   21.010  45.158  1.00 42.13 ? 108  PHE A CD2   1 
ATOM   576  C  CE1   . PHE A 1 107 ? 4.163   21.516  43.177  1.00 42.92 ? 108  PHE A CE1   1 
ATOM   577  C  CE2   . PHE A 1 107 ? 2.116   20.483  43.868  1.00 42.09 ? 108  PHE A CE2   1 
ATOM   578  C  CZ    . PHE A 1 107 ? 3.035   20.736  42.893  1.00 41.14 ? 108  PHE A CZ    1 
ATOM   579  N  N     . VAL A 1 108 ? 4.637   22.385  49.907  1.00 37.80 ? 109  VAL A N     1 
ATOM   580  C  CA    . VAL A 1 108 ? 5.208   23.096  51.064  1.00 38.96 ? 109  VAL A CA    1 
ATOM   581  C  C     . VAL A 1 108 ? 6.429   22.321  51.567  1.00 40.18 ? 109  VAL A C     1 
ATOM   582  O  O     . VAL A 1 108 ? 7.505   22.887  51.748  1.00 40.82 ? 109  VAL A O     1 
ATOM   583  C  CB    . VAL A 1 108 ? 4.184   23.323  52.223  1.00 38.56 ? 109  VAL A CB    1 
ATOM   584  C  CG1   . VAL A 1 108 ? 4.812   24.164  53.333  1.00 38.63 ? 109  VAL A CG1   1 
ATOM   585  C  CG2   . VAL A 1 108 ? 2.907   23.997  51.737  1.00 37.50 ? 109  VAL A CG2   1 
ATOM   586  N  N     . LEU A 1 109 ? 6.301   21.007  51.715  1.00 41.50 ? 110  LEU A N     1 
ATOM   587  C  CA    . LEU A 1 109 ? 7.410   20.218  52.238  1.00 42.20 ? 110  LEU A CA    1 
ATOM   588  C  C     . LEU A 1 109 ? 8.602   20.082  51.289  1.00 44.57 ? 110  LEU A C     1 
ATOM   589  O  O     . LEU A 1 109 ? 9.687   19.781  51.761  1.00 45.45 ? 110  LEU A O     1 
ATOM   590  C  CB    . LEU A 1 109 ? 6.944   18.834  52.702  1.00 41.69 ? 110  LEU A CB    1 
ATOM   591  C  CG    . LEU A 1 109 ? 5.945   18.817  53.873  1.00 39.70 ? 110  LEU A CG    1 
ATOM   592  C  CD1   . LEU A 1 109 ? 5.447   17.425  54.148  1.00 36.69 ? 110  LEU A CD1   1 
ATOM   593  C  CD2   . LEU A 1 109 ? 6.575   19.442  55.142  1.00 38.36 ? 110  LEU A CD2   1 
ATOM   594  N  N     . ALA A 1 110 ? 8.430   20.332  49.990  1.00 45.71 ? 111  ALA A N     1 
ATOM   595  C  CA    . ALA A 1 110 ? 9.465   19.986  48.984  1.00 47.96 ? 111  ALA A CA    1 
ATOM   596  C  C     . ALA A 1 110 ? 10.930  20.342  49.364  1.00 49.83 ? 111  ALA A C     1 
ATOM   597  O  O     . ALA A 1 110 ? 11.877  19.613  48.995  1.00 50.81 ? 111  ALA A O     1 
ATOM   598  C  CB    . ALA A 1 110 ? 9.112   20.563  47.626  1.00 47.45 ? 111  ALA A CB    1 
ATOM   599  N  N     . GLY A 1 111 ? 11.102  21.437  50.107  1.00 51.60 ? 112  GLY A N     1 
ATOM   600  C  CA    . GLY A 1 111 ? 12.424  21.844  50.672  1.00 52.50 ? 112  GLY A CA    1 
ATOM   601  C  C     . GLY A 1 111 ? 12.931  21.120  51.919  1.00 53.03 ? 112  GLY A C     1 
ATOM   602  O  O     . GLY A 1 111 ? 14.126  21.164  52.225  1.00 53.29 ? 112  GLY A O     1 
ATOM   603  N  N     . SER A 1 112 ? 12.022  20.454  52.633  1.00 53.46 ? 113  SER A N     1 
ATOM   604  C  CA    . SER A 1 112 ? 12.315  19.717  53.876  1.00 53.76 ? 113  SER A CA    1 
ATOM   605  C  C     . SER A 1 112 ? 13.472  18.682  53.775  1.00 53.77 ? 113  SER A C     1 
ATOM   606  O  O     . SER A 1 112 ? 14.115  18.364  54.794  1.00 53.33 ? 113  SER A O     1 
ATOM   607  C  CB    . SER A 1 112 ? 11.027  19.001  54.365  1.00 53.71 ? 113  SER A CB    1 
ATOM   608  O  OG    . SER A 1 112 ? 11.124  18.618  55.729  1.00 55.65 ? 113  SER A OG    1 
ATOM   609  N  N     . ALA A 1 113 ? 13.724  18.152  52.574  1.00 53.68 ? 114  ALA A N     1 
ATOM   610  C  CA    . ALA A 1 113 ? 14.735  17.110  52.390  1.00 54.16 ? 114  ALA A CA    1 
ATOM   611  C  C     . ALA A 1 113 ? 15.989  17.594  51.642  1.00 55.08 ? 114  ALA A C     1 
ATOM   612  O  O     . ALA A 1 113 ? 16.716  16.769  51.060  1.00 55.43 ? 114  ALA A O     1 
ATOM   613  C  CB    . ALA A 1 113 ? 14.118  15.900  51.678  1.00 54.16 ? 114  ALA A CB    1 
ATOM   614  N  N     . GLU A 1 114 ? 16.267  18.908  51.672  1.00 55.69 ? 115  GLU A N     1 
ATOM   615  C  CA    . GLU A 1 114 ? 17.447  19.465  50.950  1.00 56.16 ? 115  GLU A CA    1 
ATOM   616  C  C     . GLU A 1 114 ? 18.714  19.235  51.791  1.00 55.59 ? 115  GLU A C     1 
ATOM   617  O  O     . GLU A 1 114 ? 19.826  19.231  51.254  1.00 55.74 ? 115  GLU A O     1 
ATOM   618  C  CB    . GLU A 1 114 ? 17.292  20.968  50.569  1.00 56.49 ? 115  GLU A CB    1 
ATOM   619  C  CG    . GLU A 1 114 ? 15.888  21.415  50.077  1.00 57.70 ? 115  GLU A CG    1 
ATOM   620  C  CD    . GLU A 1 114 ? 15.784  21.831  48.609  1.00 61.00 ? 115  GLU A CD    1 
ATOM   621  O  OE1   . GLU A 1 114 ? 14.981  22.775  48.322  1.00 60.52 ? 115  GLU A OE1   1 
ATOM   622  O  OE2   . GLU A 1 114 ? 16.451  21.208  47.745  1.00 60.18 ? 115  GLU A OE2   1 
ATOM   623  N  N     . GLU A 1 115 ? 18.528  19.045  53.101  1.00 55.26 ? 116  GLU A N     1 
ATOM   624  C  CA    . GLU A 1 115 ? 19.597  18.615  54.015  1.00 54.89 ? 116  GLU A CA    1 
ATOM   625  C  C     . GLU A 1 115 ? 19.748  17.082  54.067  1.00 54.19 ? 116  GLU A C     1 
ATOM   626  O  O     . GLU A 1 115 ? 20.510  16.562  54.883  1.00 54.51 ? 116  GLU A O     1 
ATOM   627  C  CB    . GLU A 1 115 ? 19.359  19.166  55.437  1.00 54.71 ? 116  GLU A CB    1 
ATOM   628  N  N     . GLY A 1 116 ? 19.030  16.365  53.206  1.00 53.40 ? 117  GLY A N     1 
ATOM   629  C  CA    . GLY A 1 116 ? 19.111  14.902  53.153  1.00 52.71 ? 117  GLY A CA    1 
ATOM   630  C  C     . GLY A 1 116 ? 18.324  14.125  54.206  1.00 51.86 ? 117  GLY A C     1 
ATOM   631  O  O     . GLY A 1 116 ? 18.673  12.974  54.502  1.00 52.30 ? 117  GLY A O     1 
ATOM   632  N  N     . VAL A 1 117 ? 17.276  14.731  54.778  1.00 50.39 ? 118  VAL A N     1 
ATOM   633  C  CA    . VAL A 1 117 ? 16.335  14.002  55.641  1.00 49.60 ? 118  VAL A CA    1 
ATOM   634  C  C     . VAL A 1 117 ? 14.913  14.020  55.042  1.00 48.31 ? 118  VAL A C     1 
ATOM   635  O  O     . VAL A 1 117 ? 14.273  15.072  54.942  1.00 48.50 ? 118  VAL A O     1 
ATOM   636  C  CB    . VAL A 1 117 ? 16.300  14.548  57.089  1.00 49.66 ? 118  VAL A CB    1 
ATOM   637  C  CG1   . VAL A 1 117 ? 15.097  13.973  57.870  1.00 49.80 ? 118  VAL A CG1   1 
ATOM   638  C  CG2   . VAL A 1 117 ? 17.597  14.214  57.818  1.00 50.53 ? 118  VAL A CG2   1 
ATOM   639  N  N     . MET A 1 118 ? 14.428  12.848  54.645  1.00 46.50 ? 119  MET A N     1 
ATOM   640  C  CA    . MET A 1 118 ? 13.038  12.716  54.247  1.00 44.88 ? 119  MET A CA    1 
ATOM   641  C  C     . MET A 1 118 ? 12.231  12.391  55.477  1.00 43.57 ? 119  MET A C     1 
ATOM   642  O  O     . MET A 1 118 ? 12.348  11.284  56.058  1.00 42.82 ? 119  MET A O     1 
ATOM   643  C  CB    . MET A 1 118 ? 12.826  11.628  53.196  1.00 44.67 ? 119  MET A CB    1 
ATOM   644  C  CG    . MET A 1 118 ? 11.392  11.646  52.669  1.00 43.08 ? 119  MET A CG    1 
ATOM   645  S  SD    . MET A 1 118 ? 11.093  10.421  51.434  1.00 45.55 ? 119  MET A SD    1 
ATOM   646  C  CE    . MET A 1 118 ? 11.738  11.297  50.019  1.00 44.34 ? 119  MET A CE    1 
ATOM   647  N  N     . THR A 1 119 ? 11.416  13.357  55.888  1.00 42.16 ? 120  THR A N     1 
ATOM   648  C  CA    . THR A 1 119 ? 10.632  13.193  57.094  1.00 40.57 ? 120  THR A CA    1 
ATOM   649  C  C     . THR A 1 119 ? 9.638   12.050  56.871  1.00 40.22 ? 120  THR A C     1 
ATOM   650  O  O     . THR A 1 119 ? 9.241   11.769  55.733  1.00 40.31 ? 120  THR A O     1 
ATOM   651  C  CB    . THR A 1 119 ? 9.909   14.488  57.472  1.00 40.58 ? 120  THR A CB    1 
ATOM   652  O  OG1   . THR A 1 119 ? 9.011   14.871  56.427  1.00 36.32 ? 120  THR A OG1   1 
ATOM   653  C  CG2   . THR A 1 119 ? 10.938  15.631  57.719  1.00 40.61 ? 120  THR A CG2   1 
ATOM   654  N  N     . PRO A 1 120 ? 9.278   11.347  57.945  1.00 39.75 ? 121  PRO A N     1 
ATOM   655  C  CA    . PRO A 1 120 ? 8.167   10.416  57.841  1.00 39.26 ? 121  PRO A CA    1 
ATOM   656  C  C     . PRO A 1 120 ? 6.909   11.064  57.245  1.00 38.44 ? 121  PRO A C     1 
ATOM   657  O  O     . PRO A 1 120 ? 6.178   10.402  56.507  1.00 37.68 ? 121  PRO A O     1 
ATOM   658  C  CB    . PRO A 1 120 ? 7.941   9.995   59.282  1.00 39.22 ? 121  PRO A CB    1 
ATOM   659  C  CG    . PRO A 1 120 ? 9.295   10.137  59.907  1.00 39.66 ? 121  PRO A CG    1 
ATOM   660  C  CD    . PRO A 1 120 ? 9.883   11.338  59.290  1.00 39.40 ? 121  PRO A CD    1 
ATOM   661  N  N     . GLU A 1 121 ? 6.692   12.348  57.533  1.00 37.10 ? 122  GLU A N     1 
ATOM   662  C  CA    . GLU A 1 121 ? 5.532   13.073  57.015  1.00 36.49 ? 122  GLU A CA    1 
ATOM   663  C  C     . GLU A 1 121 ? 5.583   13.203  55.490  1.00 34.88 ? 122  GLU A C     1 
ATOM   664  O  O     . GLU A 1 121 ? 4.605   12.896  54.806  1.00 32.87 ? 122  GLU A O     1 
ATOM   665  C  CB    . GLU A 1 121 ? 5.434   14.469  57.637  1.00 36.11 ? 122  GLU A CB    1 
ATOM   666  C  CG    . GLU A 1 121 ? 4.096   15.159  57.369  1.00 37.34 ? 122  GLU A CG    1 
ATOM   667  C  CD    . GLU A 1 121 ? 4.117   16.668  57.644  1.00 39.13 ? 122  GLU A CD    1 
ATOM   668  O  OE1   . GLU A 1 121 ? 5.149   17.212  58.111  1.00 42.61 ? 122  GLU A OE1   1 
ATOM   669  O  OE2   . GLU A 1 121 ? 3.083   17.322  57.379  1.00 43.16 ? 122  GLU A OE2   1 
ATOM   670  N  N     . LEU A 1 122 ? 6.731   13.659  54.977  1.00 34.29 ? 123  LEU A N     1 
ATOM   671  C  CA    . LEU A 1 122 ? 6.948   13.763  53.540  1.00 33.33 ? 123  LEU A CA    1 
ATOM   672  C  C     . LEU A 1 122 ? 6.857   12.405  52.868  1.00 33.14 ? 123  LEU A C     1 
ATOM   673  O  O     . LEU A 1 122 ? 6.202   12.266  51.850  1.00 31.91 ? 123  LEU A O     1 
ATOM   674  C  CB    . LEU A 1 122 ? 8.317   14.381  53.236  1.00 33.31 ? 123  LEU A CB    1 
ATOM   675  C  CG    . LEU A 1 122 ? 8.638   14.632  51.756  1.00 32.50 ? 123  LEU A CG    1 
ATOM   676  C  CD1   . LEU A 1 122 ? 7.455   15.281  51.003  1.00 30.94 ? 123  LEU A CD1   1 
ATOM   677  C  CD2   . LEU A 1 122 ? 9.936   15.471  51.653  1.00 33.51 ? 123  LEU A CD2   1 
ATOM   678  N  N     . ALA A 1 123 ? 7.508   11.416  53.473  1.00 32.87 ? 124  ALA A N     1 
ATOM   679  C  CA    . ALA A 1 123 ? 7.512   10.037  52.987  1.00 33.12 ? 124  ALA A CA    1 
ATOM   680  C  C     . ALA A 1 123 ? 6.097   9.498   52.816  1.00 32.25 ? 124  ALA A C     1 
ATOM   681  O  O     . ALA A 1 123 ? 5.805   8.849   51.836  1.00 32.42 ? 124  ALA A O     1 
ATOM   682  C  CB    . ALA A 1 123 ? 8.328   9.131   53.934  1.00 33.07 ? 124  ALA A CB    1 
ATOM   683  N  N     . GLY A 1 124 ? 5.225   9.805   53.765  1.00 31.58 ? 125  GLY A N     1 
ATOM   684  C  CA    . GLY A 1 124 ? 3.852   9.324   53.746  1.00 31.38 ? 125  GLY A CA    1 
ATOM   685  C  C     . GLY A 1 124 ? 3.004   10.060  52.732  1.00 30.47 ? 125  GLY A C     1 
ATOM   686  O  O     . GLY A 1 124 ? 2.133   9.466   52.078  1.00 29.96 ? 125  GLY A O     1 
ATOM   687  N  N     . VAL A 1 125 ? 3.218   11.367  52.634  1.00 29.14 ? 126  VAL A N     1 
ATOM   688  C  CA    . VAL A 1 125 ? 2.575   12.171  51.600  1.00 29.04 ? 126  VAL A CA    1 
ATOM   689  C  C     . VAL A 1 125 ? 2.877   11.622  50.202  1.00 29.15 ? 126  VAL A C     1 
ATOM   690  O  O     . VAL A 1 125 ? 1.972   11.462  49.360  1.00 28.80 ? 126  VAL A O     1 
ATOM   691  C  CB    . VAL A 1 125 ? 3.030   13.659  51.714  1.00 29.08 ? 126  VAL A CB    1 
ATOM   692  C  CG1   . VAL A 1 125 ? 2.880   14.371  50.404  1.00 27.87 ? 126  VAL A CG1   1 
ATOM   693  C  CG2   . VAL A 1 125 ? 2.274   14.364  52.837  1.00 29.15 ? 126  VAL A CG2   1 
ATOM   694  N  N     . ILE A 1 126 ? 4.149   11.312  49.960  1.00 28.61 ? 127  ILE A N     1 
ATOM   695  C  CA    . ILE A 1 126 ? 4.586   10.851  48.651  1.00 28.80 ? 127  ILE A CA    1 
ATOM   696  C  C     . ILE A 1 126 ? 3.995   9.460   48.356  1.00 29.21 ? 127  ILE A C     1 
ATOM   697  O  O     . ILE A 1 126 ? 3.535   9.202   47.237  1.00 29.69 ? 127  ILE A O     1 
ATOM   698  C  CB    . ILE A 1 126 ? 6.115   10.824  48.549  1.00 28.05 ? 127  ILE A CB    1 
ATOM   699  C  CG1   . ILE A 1 126 ? 6.681   12.264  48.683  1.00 30.63 ? 127  ILE A CG1   1 
ATOM   700  C  CG2   . ILE A 1 126 ? 6.562   10.171  47.227  1.00 27.26 ? 127  ILE A CG2   1 
ATOM   701  C  CD1   . ILE A 1 126 ? 8.207   12.439  48.618  1.00 28.10 ? 127  ILE A CD1   1 
ATOM   702  N  N     . LYS A 1 127 ? 4.014   8.603   49.364  1.00 29.50 ? 128  LYS A N     1 
ATOM   703  C  CA    . LYS A 1 127 ? 3.491   7.249   49.261  1.00 30.82 ? 128  LYS A CA    1 
ATOM   704  C  C     . LYS A 1 127 ? 2.005   7.239   48.886  1.00 30.75 ? 128  LYS A C     1 
ATOM   705  O  O     . LYS A 1 127 ? 1.603   6.507   47.980  1.00 31.48 ? 128  LYS A O     1 
ATOM   706  C  CB    . LYS A 1 127 ? 3.709   6.506   50.574  1.00 30.78 ? 128  LYS A CB    1 
ATOM   707  C  CG    . LYS A 1 127 ? 3.514   5.003   50.493  1.00 35.06 ? 128  LYS A CG    1 
ATOM   708  C  CD    . LYS A 1 127 ? 3.115   4.411   51.838  1.00 38.71 ? 128  LYS A CD    1 
ATOM   709  C  CE    . LYS A 1 127 ? 3.598   2.970   51.974  1.00 41.06 ? 128  LYS A CE    1 
ATOM   710  N  NZ    . LYS A 1 127 ? 3.141   2.352   53.252  1.00 41.50 ? 128  LYS A NZ    1 
ATOM   711  N  N     . ARG A 1 128 ? 1.190   8.028   49.586  1.00 30.27 ? 129  ARG A N     1 
ATOM   712  C  CA    . ARG A 1 128 ? -0.240  8.133   49.255  1.00 30.47 ? 129  ARG A CA    1 
ATOM   713  C  C     . ARG A 1 128 ? -0.509  8.698   47.850  1.00 29.85 ? 129  ARG A C     1 
ATOM   714  O  O     . ARG A 1 128 ? -1.408  8.215   47.151  1.00 29.36 ? 129  ARG A O     1 
ATOM   715  C  CB    . ARG A 1 128 ? -0.965  8.970   50.306  1.00 31.04 ? 129  ARG A CB    1 
ATOM   716  C  CG    . ARG A 1 128 ? -0.952  8.353   51.699  1.00 31.56 ? 129  ARG A CG    1 
ATOM   717  C  CD    . ARG A 1 128 ? -1.919  9.054   52.641  1.00 35.33 ? 129  ARG A CD    1 
ATOM   718  N  NE    . ARG A 1 128 ? -1.506  10.417  52.970  1.00 36.34 ? 129  ARG A NE    1 
ATOM   719  C  CZ    . ARG A 1 128 ? -0.575  10.734  53.874  1.00 37.98 ? 129  ARG A CZ    1 
ATOM   720  N  NH1   . ARG A 1 128 ? 0.054   9.789   54.570  1.00 38.60 ? 129  ARG A NH1   1 
ATOM   721  N  NH2   . ARG A 1 128 ? -0.281  12.013  54.098  1.00 37.08 ? 129  ARG A NH2   1 
ATOM   722  N  N     . LEU A 1 129 ? 0.256   9.716   47.443  1.00 29.29 ? 130  LEU A N     1 
ATOM   723  C  CA    . LEU A 1 129 ? 0.120   10.283  46.110  1.00 30.03 ? 130  LEU A CA    1 
ATOM   724  C  C     . LEU A 1 129 ? 0.487   9.255   45.046  1.00 30.93 ? 130  LEU A C     1 
ATOM   725  O  O     . LEU A 1 129 ? -0.291  9.034   44.130  1.00 31.27 ? 130  LEU A O     1 
ATOM   726  C  CB    . LEU A 1 129 ? 0.966   11.558  45.939  1.00 29.64 ? 130  LEU A CB    1 
ATOM   727  C  CG    . LEU A 1 129 ? 0.455   12.796  46.692  1.00 29.64 ? 130  LEU A CG    1 
ATOM   728  C  CD1   . LEU A 1 129 ? 1.497   13.945  46.793  1.00 30.91 ? 130  LEU A CD1   1 
ATOM   729  C  CD2   . LEU A 1 129 ? -0.791  13.314  46.036  1.00 28.27 ? 130  LEU A CD2   1 
ATOM   730  N  N     . TRP A 1 130 ? 1.635   8.601   45.198  1.00 31.82 ? 131  TRP A N     1 
ATOM   731  C  CA    . TRP A 1 130 ? 2.125   7.607   44.219  1.00 32.48 ? 131  TRP A CA    1 
ATOM   732  C  C     . TRP A 1 130 ? 1.175   6.397   44.083  1.00 32.89 ? 131  TRP A C     1 
ATOM   733  O  O     . TRP A 1 130 ? 1.104   5.772   43.029  1.00 33.74 ? 131  TRP A O     1 
ATOM   734  C  CB    . TRP A 1 130 ? 3.514   7.131   44.634  1.00 32.99 ? 131  TRP A CB    1 
ATOM   735  C  CG    . TRP A 1 130 ? 4.175   6.138   43.710  1.00 32.52 ? 131  TRP A CG    1 
ATOM   736  C  CD1   . TRP A 1 130 ? 4.691   4.924   44.061  1.00 32.30 ? 131  TRP A CD1   1 
ATOM   737  C  CD2   . TRP A 1 130 ? 4.435   6.295   42.307  1.00 32.40 ? 131  TRP A CD2   1 
ATOM   738  N  NE1   . TRP A 1 130 ? 5.265   4.327   42.981  1.00 31.72 ? 131  TRP A NE1   1 
ATOM   739  C  CE2   . TRP A 1 130 ? 5.098   5.120   41.879  1.00 31.70 ? 131  TRP A CE2   1 
ATOM   740  C  CE3   . TRP A 1 130 ? 4.146   7.297   41.367  1.00 31.85 ? 131  TRP A CE3   1 
ATOM   741  C  CZ2   . TRP A 1 130 ? 5.494   4.920   40.556  1.00 32.09 ? 131  TRP A CZ2   1 
ATOM   742  C  CZ3   . TRP A 1 130 ? 4.542   7.111   40.056  1.00 33.45 ? 131  TRP A CZ3   1 
ATOM   743  C  CH2   . TRP A 1 130 ? 5.211   5.923   39.654  1.00 33.56 ? 131  TRP A CH2   1 
ATOM   744  N  N     . ARG A 1 131 ? 0.447   6.083   45.143  1.00 32.84 ? 132  ARG A N     1 
ATOM   745  C  CA    . ARG A 1 131 ? -0.501  4.964   45.101  1.00 33.48 ? 132  ARG A CA    1 
ATOM   746  C  C     . ARG A 1 131 ? -1.878  5.361   44.583  1.00 32.91 ? 132  ARG A C     1 
ATOM   747  O  O     . ARG A 1 131 ? -2.737  4.491   44.396  1.00 33.61 ? 132  ARG A O     1 
ATOM   748  C  CB    . ARG A 1 131 ? -0.600  4.326   46.476  1.00 34.48 ? 132  ARG A CB    1 
ATOM   749  C  CG    . ARG A 1 131 ? 0.698   3.658   46.892  1.00 37.31 ? 132  ARG A CG    1 
ATOM   750  C  CD    . ARG A 1 131 ? 0.597   3.024   48.263  1.00 44.44 ? 132  ARG A CD    1 
ATOM   751  N  NE    . ARG A 1 131 ? 1.537   1.910   48.385  1.00 46.70 ? 132  ARG A NE    1 
ATOM   752  C  CZ    . ARG A 1 131 ? 1.653   1.135   49.460  1.00 49.72 ? 132  ARG A CZ    1 
ATOM   753  N  NH1   . ARG A 1 131 ? 0.898   1.358   50.537  1.00 51.28 ? 132  ARG A NH1   1 
ATOM   754  N  NH2   . ARG A 1 131 ? 2.532   0.131   49.462  1.00 49.77 ? 132  ARG A NH2   1 
ATOM   755  N  N     . ASP A 1 132 ? -2.107  6.658   44.368  1.00 31.90 ? 133  ASP A N     1 
ATOM   756  C  CA    . ASP A 1 132 ? -3.415  7.139   43.904  1.00 31.14 ? 133  ASP A CA    1 
ATOM   757  C  C     . ASP A 1 132 ? -3.639  6.808   42.426  1.00 30.66 ? 133  ASP A C     1 
ATOM   758  O  O     . ASP A 1 132 ? -2.721  6.860   41.623  1.00 28.81 ? 133  ASP A O     1 
ATOM   759  C  CB    . ASP A 1 132 ? -3.533  8.638   44.112  1.00 31.23 ? 133  ASP A CB    1 
ATOM   760  C  CG    . ASP A 1 132 ? -4.848  9.190   43.635  1.00 30.51 ? 133  ASP A CG    1 
ATOM   761  O  OD1   . ASP A 1 132 ? -5.831  9.126   44.399  1.00 32.87 ? 133  ASP A OD1   1 
ATOM   762  O  OD2   . ASP A 1 132 ? -4.901  9.683   42.482  1.00 30.01 ? 133  ASP A OD2   1 
ATOM   763  N  N     . GLY A 1 133 ? -4.873  6.480   42.063  1.00 30.74 ? 134  GLY A N     1 
ATOM   764  C  CA    . GLY A 1 133 ? -5.155  6.007   40.713  1.00 31.25 ? 134  GLY A CA    1 
ATOM   765  C  C     . GLY A 1 133 ? -5.075  7.079   39.658  1.00 31.07 ? 134  GLY A C     1 
ATOM   766  O  O     . GLY A 1 133 ? -4.647  6.814   38.542  1.00 32.21 ? 134  GLY A O     1 
ATOM   767  N  N     . GLY A 1 134 ? -5.504  8.289   40.007  1.00 31.53 ? 135  GLY A N     1 
ATOM   768  C  CA    . GLY A 1 134 ? -5.294  9.468   39.160  1.00 31.73 ? 135  GLY A CA    1 
ATOM   769  C  C     . GLY A 1 134 ? -3.832  9.769   38.868  1.00 31.55 ? 135  GLY A C     1 
ATOM   770  O  O     . GLY A 1 134 ? -3.430  9.957   37.715  1.00 31.27 ? 135  GLY A O     1 
ATOM   771  N  N     . VAL A 1 135 ? -3.037  9.830   39.938  1.00 31.75 ? 136  VAL A N     1 
ATOM   772  C  CA    . VAL A 1 135 ? -1.577  9.972   39.841  1.00 31.20 ? 136  VAL A CA    1 
ATOM   773  C  C     . VAL A 1 135 ? -0.984  8.882   38.923  1.00 31.47 ? 136  VAL A C     1 
ATOM   774  O  O     . VAL A 1 135 ? -0.122  9.176   38.067  1.00 30.67 ? 136  VAL A O     1 
ATOM   775  C  CB    . VAL A 1 135 ? -0.934  9.926   41.256  1.00 30.96 ? 136  VAL A CB    1 
ATOM   776  C  CG1   . VAL A 1 135 ? 0.562   9.992   41.176  1.00 30.96 ? 136  VAL A CG1   1 
ATOM   777  C  CG2   . VAL A 1 135 ? -1.472  11.077  42.136  1.00 30.66 ? 136  VAL A CG2   1 
ATOM   778  N  N     . GLN A 1 136 ? -1.450  7.629   39.079  1.00 31.72 ? 137  GLN A N     1 
ATOM   779  C  CA    . GLN A 1 136 ? -0.904  6.537   38.259  1.00 32.37 ? 137  GLN A CA    1 
ATOM   780  C  C     . GLN A 1 136 ? -1.304  6.674   36.795  1.00 31.93 ? 137  GLN A C     1 
ATOM   781  O  O     . GLN A 1 136 ? -0.510  6.347   35.894  1.00 32.85 ? 137  GLN A O     1 
ATOM   782  C  CB    . GLN A 1 136 ? -1.297  5.166   38.827  1.00 32.99 ? 137  GLN A CB    1 
ATOM   783  C  CG    . GLN A 1 136 ? -0.442  4.706   39.998  1.00 33.69 ? 137  GLN A CG    1 
ATOM   784  C  CD    . GLN A 1 136 ? 1.020   4.543   39.632  1.00 35.47 ? 137  GLN A CD    1 
ATOM   785  O  OE1   . GLN A 1 136 ? 1.355   3.969   38.597  1.00 35.14 ? 137  GLN A OE1   1 
ATOM   786  N  NE2   . GLN A 1 136 ? 1.910   5.069   40.483  1.00 33.70 ? 137  GLN A NE2   1 
ATOM   787  N  N     . ALA A 1 137 ? -2.522  7.156   36.559  1.00 32.79 ? 138  ALA A N     1 
ATOM   788  C  CA    . ALA A 1 137 ? -3.013  7.439   35.193  1.00 32.59 ? 138  ALA A CA    1 
ATOM   789  C  C     . ALA A 1 137 ? -2.145  8.515   34.516  1.00 32.42 ? 138  ALA A C     1 
ATOM   790  O  O     . ALA A 1 137 ? -1.695  8.353   33.374  1.00 32.07 ? 138  ALA A O     1 
ATOM   791  C  CB    . ALA A 1 137 ? -4.494  7.838   35.240  1.00 32.59 ? 138  ALA A CB    1 
ATOM   792  N  N     . CYS A 1 138 ? -1.803  9.554   35.281  1.00 31.45 ? 139  CYS A N     1 
ATOM   793  C  CA    . CYS A 1 138 ? -0.867  10.573  34.825  1.00 31.34 ? 139  CYS A CA    1 
ATOM   794  C  C     . CYS A 1 138 ? 0.543   10.024  34.578  1.00 31.36 ? 139  CYS A C     1 
ATOM   795  O  O     . CYS A 1 138 ? 1.135   10.304  33.541  1.00 31.06 ? 139  CYS A O     1 
ATOM   796  C  CB    . CYS A 1 138 ? -0.839  11.740  35.825  1.00 30.81 ? 139  CYS A CB    1 
ATOM   797  S  SG    . CYS A 1 138 ? -0.102  13.169  35.089  1.00 32.48 ? 139  CYS A SG    1 
ATOM   798  N  N     . PHE A 1 139 ? 1.048   9.209   35.499  1.00 31.61 ? 140  PHE A N     1 
ATOM   799  C  CA    . PHE A 1 139 ? 2.333   8.561   35.331  1.00 32.10 ? 140  PHE A CA    1 
ATOM   800  C  C     . PHE A 1 139 ? 2.396   7.776   34.005  1.00 33.04 ? 140  PHE A C     1 
ATOM   801  O  O     . PHE A 1 139 ? 3.404   7.837   33.288  1.00 33.82 ? 140  PHE A O     1 
ATOM   802  C  CB    . PHE A 1 139 ? 2.654   7.620   36.520  1.00 32.67 ? 140  PHE A CB    1 
ATOM   803  C  CG    . PHE A 1 139 ? 3.891   6.793   36.303  1.00 31.42 ? 140  PHE A CG    1 
ATOM   804  C  CD1   . PHE A 1 139 ? 5.133   7.386   36.296  1.00 31.66 ? 140  PHE A CD1   1 
ATOM   805  C  CD2   . PHE A 1 139 ? 3.809   5.431   36.050  1.00 34.83 ? 140  PHE A CD2   1 
ATOM   806  C  CE1   . PHE A 1 139 ? 6.292   6.640   36.023  1.00 34.07 ? 140  PHE A CE1   1 
ATOM   807  C  CE2   . PHE A 1 139 ? 4.941   4.693   35.782  1.00 33.36 ? 140  PHE A CE2   1 
ATOM   808  C  CZ    . PHE A 1 139 ? 6.181   5.283   35.785  1.00 33.37 ? 140  PHE A CZ    1 
ATOM   809  N  N     . SER A 1 140 ? 1.300   7.079   33.684  1.00 34.05 ? 141  SER A N     1 
ATOM   810  C  CA    . SER A 1 140 ? 1.209   6.269   32.477  1.00 35.03 ? 141  SER A CA    1 
ATOM   811  C  C     . SER A 1 140 ? 1.328   7.090   31.216  1.00 34.79 ? 141  SER A C     1 
ATOM   812  O  O     . SER A 1 140 ? 1.748   6.578   30.176  1.00 34.41 ? 141  SER A O     1 
ATOM   813  C  CB    . SER A 1 140 ? -0.102  5.506   32.439  1.00 34.69 ? 141  SER A CB    1 
ATOM   814  O  OG    . SER A 1 140 ? -0.094  4.544   33.468  1.00 39.75 ? 141  SER A OG    1 
ATOM   815  N  N     . ARG A 1 141 ? 0.982   8.368   31.326  1.00 33.77 ? 142  ARG A N     1 
ATOM   816  C  CA    . ARG A 1 141 ? 1.036   9.303   30.204  1.00 33.90 ? 142  ARG A CA    1 
ATOM   817  C  C     . ARG A 1 141 ? 2.207   10.279  30.240  1.00 33.35 ? 142  ARG A C     1 
ATOM   818  O  O     . ARG A 1 141 ? 2.156   11.370  29.636  1.00 32.17 ? 142  ARG A O     1 
ATOM   819  C  CB    . ARG A 1 141 ? -0.275  10.068  30.176  1.00 33.18 ? 142  ARG A CB    1 
ATOM   820  C  CG    . ARG A 1 141 ? -1.443  9.191   29.746  1.00 33.20 ? 142  ARG A CG    1 
ATOM   821  C  CD    . ARG A 1 141 ? -2.745  9.889   30.060  1.00 33.19 ? 142  ARG A CD    1 
ATOM   822  N  NE    . ARG A 1 141 ? -2.884  11.111  29.279  1.00 34.19 ? 142  ARG A NE    1 
ATOM   823  C  CZ    . ARG A 1 141 ? -3.916  11.952  29.370  1.00 35.11 ? 142  ARG A CZ    1 
ATOM   824  N  NH1   . ARG A 1 141 ? -3.961  13.041  28.617  1.00 36.90 ? 142  ARG A NH1   1 
ATOM   825  N  NH2   . ARG A 1 141 ? -4.914  11.717  30.200  1.00 37.10 ? 142  ARG A NH2   1 
ATOM   826  N  N     . SER A 1 142 ? 3.291   9.872   30.896  1.00 33.86 ? 143  SER A N     1 
ATOM   827  C  CA    . SER A 1 142 ? 4.413   10.761  31.125  1.00 33.66 ? 143  SER A CA    1 
ATOM   828  C  C     . SER A 1 142 ? 5.103   11.259  29.846  1.00 34.48 ? 143  SER A C     1 
ATOM   829  O  O     . SER A 1 142 ? 5.797   12.279  29.877  1.00 33.01 ? 143  SER A O     1 
ATOM   830  C  CB    . SER A 1 142 ? 5.416   10.134  32.096  1.00 33.65 ? 143  SER A CB    1 
ATOM   831  O  OG    . SER A 1 142 ? 6.068   9.017   31.481  1.00 33.50 ? 143  SER A OG    1 
ATOM   832  N  N     . ARG A 1 143 ? 4.898   10.587  28.705  1.00 34.74 ? 144  ARG A N     1 
ATOM   833  C  CA    . ARG A 1 143 ? 5.437   11.137  27.439  1.00 35.26 ? 144  ARG A CA    1 
ATOM   834  C  C     . ARG A 1 143 ? 4.851   12.515  27.088  1.00 35.23 ? 144  ARG A C     1 
ATOM   835  O  O     . ARG A 1 143 ? 5.475   13.263  26.317  1.00 35.98 ? 144  ARG A O     1 
ATOM   836  C  CB    . ARG A 1 143 ? 5.253   10.175  26.273  1.00 35.62 ? 144  ARG A CB    1 
ATOM   837  C  CG    . ARG A 1 143 ? 3.793   9.981   25.819  1.00 36.91 ? 144  ARG A CG    1 
ATOM   838  C  CD    . ARG A 1 143 ? 3.738   9.076   24.663  1.00 40.74 ? 144  ARG A CD    1 
ATOM   839  N  NE    . ARG A 1 143 ? 4.197   9.784   23.491  1.00 44.11 ? 144  ARG A NE    1 
ATOM   840  C  CZ    . ARG A 1 143 ? 3.413   10.519  22.710  1.00 47.28 ? 144  ARG A CZ    1 
ATOM   841  N  NH1   . ARG A 1 143 ? 3.938   11.148  21.667  1.00 48.89 ? 144  ARG A NH1   1 
ATOM   842  N  NH2   . ARG A 1 143 ? 2.112   10.625  22.957  1.00 48.87 ? 144  ARG A NH2   1 
ATOM   843  N  N     . GLU A 1 144 ? 3.690   12.858  27.669  1.00 34.60 ? 145  GLU A N     1 
ATOM   844  C  CA    . GLU A 1 144 ? 3.034   14.143  27.433  1.00 34.37 ? 145  GLU A CA    1 
ATOM   845  C  C     . GLU A 1 144 ? 3.578   15.281  28.319  1.00 33.87 ? 145  GLU A C     1 
ATOM   846  O  O     . GLU A 1 144 ? 3.092   16.397  28.265  1.00 33.40 ? 145  GLU A O     1 
ATOM   847  C  CB    . GLU A 1 144 ? 1.531   14.007  27.634  1.00 34.83 ? 145  GLU A CB    1 
ATOM   848  C  CG    . GLU A 1 144 ? 0.870   12.912  26.770  1.00 35.37 ? 145  GLU A CG    1 
ATOM   849  C  CD    . GLU A 1 144 ? -0.612  12.736  27.088  1.00 35.90 ? 145  GLU A CD    1 
ATOM   850  O  OE1   . GLU A 1 144 ? -1.299  13.719  27.413  1.00 37.40 ? 145  GLU A OE1   1 
ATOM   851  O  OE2   . GLU A 1 144 ? -1.098  11.596  27.007  1.00 36.31 ? 145  GLU A OE2   1 
ATOM   852  N  N     . TYR A 1 145 ? 4.580   14.985  29.135  1.00 33.53 ? 146  TYR A N     1 
ATOM   853  C  CA    . TYR A 1 145 ? 5.263   16.007  29.927  1.00 33.16 ? 146  TYR A CA    1 
ATOM   854  C  C     . TYR A 1 145 ? 6.743   15.572  30.074  1.00 32.68 ? 146  TYR A C     1 
ATOM   855  O  O     . TYR A 1 145 ? 7.234   14.822  29.237  1.00 33.60 ? 146  TYR A O     1 
ATOM   856  C  CB    . TYR A 1 145 ? 4.534   16.297  31.253  1.00 33.11 ? 146  TYR A CB    1 
ATOM   857  C  CG    . TYR A 1 145 ? 4.200   15.092  32.107  1.00 31.73 ? 146  TYR A CG    1 
ATOM   858  C  CD1   . TYR A 1 145 ? 3.029   14.381  31.905  1.00 32.54 ? 146  TYR A CD1   1 
ATOM   859  C  CD2   . TYR A 1 145 ? 5.029   14.695  33.137  1.00 31.00 ? 146  TYR A CD2   1 
ATOM   860  C  CE1   . TYR A 1 145 ? 2.712   13.306  32.688  1.00 30.16 ? 146  TYR A CE1   1 
ATOM   861  C  CE2   . TYR A 1 145 ? 4.701   13.644  33.947  1.00 30.85 ? 146  TYR A CE2   1 
ATOM   862  C  CZ    . TYR A 1 145 ? 3.539   12.941  33.706  1.00 30.94 ? 146  TYR A CZ    1 
ATOM   863  O  OH    . TYR A 1 145 ? 3.219   11.845  34.454  1.00 30.38 ? 146  TYR A OH    1 
ATOM   864  N  N     . GLN A 1 146 ? 7.460   16.107  31.061  1.00 32.91 ? 147  GLN A N     1 
ATOM   865  C  CA    . GLN A 1 146 ? 8.877   15.794  31.273  1.00 32.63 ? 147  GLN A CA    1 
ATOM   866  C  C     . GLN A 1 146 ? 9.044   15.111  32.623  1.00 33.57 ? 147  GLN A C     1 
ATOM   867  O  O     . GLN A 1 146 ? 8.830   15.734  33.673  1.00 34.58 ? 147  GLN A O     1 
ATOM   868  C  CB    . GLN A 1 146 ? 9.715   17.071  31.222  1.00 32.87 ? 147  GLN A CB    1 
ATOM   869  C  CG    . GLN A 1 146 ? 9.701   17.776  29.891  1.00 33.86 ? 147  GLN A CG    1 
ATOM   870  C  CD    . GLN A 1 146 ? 10.290  16.922  28.763  1.00 32.14 ? 147  GLN A CD    1 
ATOM   871  O  OE1   . GLN A 1 146 ? 11.329  16.273  28.931  1.00 33.53 ? 147  GLN A OE1   1 
ATOM   872  N  NE2   . GLN A 1 146 ? 9.614   16.915  27.611  1.00 31.05 ? 147  GLN A NE2   1 
ATOM   873  N  N     . LEU A 1 147 ? 9.421   13.839  32.591  1.00 33.23 ? 148  LEU A N     1 
ATOM   874  C  CA    . LEU A 1 147 ? 9.598   13.026  33.800  1.00 32.75 ? 148  LEU A CA    1 
ATOM   875  C  C     . LEU A 1 147 ? 10.903  12.253  33.733  1.00 33.03 ? 148  LEU A C     1 
ATOM   876  O  O     . LEU A 1 147 ? 11.170  11.534  32.749  1.00 33.43 ? 148  LEU A O     1 
ATOM   877  C  CB    . LEU A 1 147 ? 8.429   12.058  33.967  1.00 33.21 ? 148  LEU A CB    1 
ATOM   878  C  CG    . LEU A 1 147 ? 8.317   11.233  35.267  1.00 31.04 ? 148  LEU A CG    1 
ATOM   879  C  CD1   . LEU A 1 147 ? 8.224   12.173  36.488  1.00 30.81 ? 148  LEU A CD1   1 
ATOM   880  C  CD2   . LEU A 1 147 ? 7.135   10.259  35.180  1.00 32.87 ? 148  LEU A CD2   1 
ATOM   881  N  N     . ASN A 1 148 ? 11.688  12.356  34.797  1.00 32.96 ? 149  ASN A N     1 
ATOM   882  C  CA    . ASN A 1 148 ? 12.921  11.570  34.937  1.00 34.01 ? 149  ASN A CA    1 
ATOM   883  C  C     . ASN A 1 148 ? 12.725  10.081  34.719  1.00 33.93 ? 149  ASN A C     1 
ATOM   884  O  O     . ASN A 1 148 ? 11.802  9.495   35.256  1.00 32.89 ? 149  ASN A O     1 
ATOM   885  C  CB    . ASN A 1 148 ? 13.528  11.759  36.309  1.00 34.25 ? 149  ASN A CB    1 
ATOM   886  C  CG    . ASN A 1 148 ? 14.194  13.092  36.489  1.00 37.85 ? 149  ASN A CG    1 
ATOM   887  O  OD1   . ASN A 1 148 ? 14.200  13.973  35.587  1.00 39.36 ? 149  ASN A OD1   1 
ATOM   888  N  ND2   . ASN A 1 148 ? 14.731  13.282  37.699  1.00 38.56 ? 149  ASN A ND2   1 
ATOM   889  N  N     . ASP A 1 149 ? 13.637  9.460   33.979  1.00 34.86 ? 150  ASP A N     1 
ATOM   890  C  CA    . ASP A 1 149 ? 13.554  8.027   33.792  1.00 36.80 ? 150  ASP A CA    1 
ATOM   891  C  C     . ASP A 1 149 ? 13.557  7.188   35.074  1.00 34.95 ? 150  ASP A C     1 
ATOM   892  O  O     . ASP A 1 149 ? 12.961  6.104   35.095  1.00 33.68 ? 150  ASP A O     1 
ATOM   893  C  CB    . ASP A 1 149 ? 14.660  7.551   32.845  1.00 39.43 ? 150  ASP A CB    1 
ATOM   894  C  CG    . ASP A 1 149 ? 14.245  7.693   31.349  1.00 44.51 ? 150  ASP A CG    1 
ATOM   895  O  OD1   . ASP A 1 149 ? 13.021  7.825   31.047  1.00 50.95 ? 150  ASP A OD1   1 
ATOM   896  O  OD2   . ASP A 1 149 ? 15.128  7.684   30.505  1.00 45.11 ? 150  ASP A OD2   1 
ATOM   897  N  N     . SER A 1 150 ? 14.239  7.656   36.123  1.00 33.14 ? 151  SER A N     1 
ATOM   898  C  CA    . SER A 1 150 ? 14.360  6.895   37.373  1.00 33.05 ? 151  SER A CA    1 
ATOM   899  C  C     . SER A 1 150 ? 13.206  7.174   38.347  1.00 33.02 ? 151  SER A C     1 
ATOM   900  O  O     . SER A 1 150 ? 13.214  6.654   39.461  1.00 32.32 ? 151  SER A O     1 
ATOM   901  C  CB    . SER A 1 150 ? 15.694  7.219   38.065  1.00 33.17 ? 151  SER A CB    1 
ATOM   902  O  OG    . SER A 1 150 ? 16.774  6.848   37.236  1.00 32.18 ? 151  SER A OG    1 
ATOM   903  N  N     . ALA A 1 151 ? 12.214  7.965   37.936  1.00 31.93 ? 152  ALA A N     1 
ATOM   904  C  CA    . ALA A 1 151 ? 11.078  8.290   38.827  1.00 31.89 ? 152  ALA A CA    1 
ATOM   905  C  C     . ALA A 1 151 ? 10.464  7.048   39.503  1.00 31.40 ? 152  ALA A C     1 
ATOM   906  O  O     . ALA A 1 151 ? 10.438  6.964   40.742  1.00 31.07 ? 152  ALA A O     1 
ATOM   907  C  CB    . ALA A 1 151 ? 9.983   9.122   38.051  1.00 30.64 ? 152  ALA A CB    1 
ATOM   908  N  N     . SER A 1 152 ? 9.981   6.080   38.711  1.00 31.89 ? 153  SER A N     1 
ATOM   909  C  CA    . SER A 1 152 ? 9.293   4.919   39.266  1.00 31.99 ? 153  SER A CA    1 
ATOM   910  C  C     . SER A 1 152 ? 10.263  4.006   40.036  1.00 31.97 ? 153  SER A C     1 
ATOM   911  O  O     . SER A 1 152 ? 9.867   3.398   41.057  1.00 30.92 ? 153  SER A O     1 
ATOM   912  C  CB    . SER A 1 152 ? 8.551   4.107   38.177  1.00 31.98 ? 153  SER A CB    1 
ATOM   913  O  OG    . SER A 1 152 ? 9.458   3.505   37.296  1.00 33.11 ? 153  SER A OG    1 
ATOM   914  N  N     . TYR A 1 153 ? 11.527  3.971   39.587  1.00 31.78 ? 154  TYR A N     1 
ATOM   915  C  CA    . TYR A 1 153 ? 12.582  3.236   40.298  1.00 31.81 ? 154  TYR A CA    1 
ATOM   916  C  C     . TYR A 1 153 ? 12.638  3.646   41.772  1.00 31.32 ? 154  TYR A C     1 
ATOM   917  O  O     . TYR A 1 153 ? 12.625  2.796   42.662  1.00 31.25 ? 154  TYR A O     1 
ATOM   918  C  CB    . TYR A 1 153 ? 13.958  3.406   39.615  1.00 31.88 ? 154  TYR A CB    1 
ATOM   919  C  CG    . TYR A 1 153 ? 15.115  2.802   40.426  1.00 31.41 ? 154  TYR A CG    1 
ATOM   920  C  CD1   . TYR A 1 153 ? 15.439  1.436   40.342  1.00 32.28 ? 154  TYR A CD1   1 
ATOM   921  C  CD2   . TYR A 1 153 ? 15.859  3.595   41.290  1.00 34.00 ? 154  TYR A CD2   1 
ATOM   922  C  CE1   . TYR A 1 153 ? 16.482  0.887   41.098  1.00 32.61 ? 154  TYR A CE1   1 
ATOM   923  C  CE2   . TYR A 1 153 ? 16.895  3.056   42.069  1.00 32.76 ? 154  TYR A CE2   1 
ATOM   924  C  CZ    . TYR A 1 153 ? 17.215  1.716   41.953  1.00 32.07 ? 154  TYR A CZ    1 
ATOM   925  O  OH    . TYR A 1 153 ? 18.252  1.209   42.715  1.00 33.31 ? 154  TYR A OH    1 
ATOM   926  N  N     . TYR A 1 154 ? 12.678  4.952   42.018  1.00 31.40 ? 155  TYR A N     1 
ATOM   927  C  CA    . TYR A 1 154 ? 12.773  5.469   43.343  1.00 31.00 ? 155  TYR A CA    1 
ATOM   928  C  C     . TYR A 1 154 ? 11.433  5.386   44.049  1.00 31.01 ? 155  TYR A C     1 
ATOM   929  O  O     . TYR A 1 154 ? 11.380  4.902   45.190  1.00 29.42 ? 155  TYR A O     1 
ATOM   930  C  CB    . TYR A 1 154 ? 13.295  6.899   43.329  1.00 31.98 ? 155  TYR A CB    1 
ATOM   931  C  CG    . TYR A 1 154 ? 14.749  7.050   42.915  1.00 31.09 ? 155  TYR A CG    1 
ATOM   932  C  CD1   . TYR A 1 154 ? 15.771  6.317   43.550  1.00 31.59 ? 155  TYR A CD1   1 
ATOM   933  C  CD2   . TYR A 1 154 ? 15.106  7.942   41.927  1.00 31.53 ? 155  TYR A CD2   1 
ATOM   934  C  CE1   . TYR A 1 154 ? 17.114  6.450   43.155  1.00 31.05 ? 155  TYR A CE1   1 
ATOM   935  C  CE2   . TYR A 1 154 ? 16.430  8.089   41.527  1.00 31.87 ? 155  TYR A CE2   1 
ATOM   936  C  CZ    . TYR A 1 154 ? 17.421  7.332   42.147  1.00 31.43 ? 155  TYR A CZ    1 
ATOM   937  O  OH    . TYR A 1 154 ? 18.722  7.534   41.787  1.00 31.36 ? 155  TYR A OH    1 
ATOM   938  N  N     . LEU A 1 155 ? 10.362  5.797   43.359  1.00 31.16 ? 156  LEU A N     1 
ATOM   939  C  CA    . LEU A 1 155 ? 9.026   5.862   43.974  1.00 31.92 ? 156  LEU A CA    1 
ATOM   940  C  C     . LEU A 1 155 ? 8.531   4.474   44.414  1.00 32.24 ? 156  LEU A C     1 
ATOM   941  O  O     . LEU A 1 155 ? 7.947   4.348   45.477  1.00 32.61 ? 156  LEU A O     1 
ATOM   942  C  CB    . LEU A 1 155 ? 7.991   6.567   43.068  1.00 31.69 ? 156  LEU A CB    1 
ATOM   943  C  CG    . LEU A 1 155 ? 8.186   8.091   42.976  1.00 31.54 ? 156  LEU A CG    1 
ATOM   944  C  CD1   . LEU A 1 155 ? 7.510   8.658   41.720  1.00 31.42 ? 156  LEU A CD1   1 
ATOM   945  C  CD2   . LEU A 1 155 ? 7.776   8.833   44.249  1.00 31.65 ? 156  LEU A CD2   1 
ATOM   946  N  N     . ASN A 1 156 ? 8.783   3.451   43.598  1.00 32.60 ? 157  ASN A N     1 
ATOM   947  C  CA    . ASN A 1 156 ? 8.500   2.066   43.972  1.00 33.00 ? 157  ASN A CA    1 
ATOM   948  C  C     . ASN A 1 156 ? 9.364   1.547   45.127  1.00 33.12 ? 157  ASN A C     1 
ATOM   949  O  O     . ASN A 1 156 ? 8.970   0.606   45.813  1.00 32.65 ? 157  ASN A O     1 
ATOM   950  C  CB    . ASN A 1 156 ? 8.622   1.134   42.764  1.00 32.81 ? 157  ASN A CB    1 
ATOM   951  C  CG    . ASN A 1 156 ? 7.521   1.348   41.748  1.00 33.62 ? 157  ASN A CG    1 
ATOM   952  O  OD1   . ASN A 1 156 ? 6.409   1.769   42.085  1.00 33.31 ? 157  ASN A OD1   1 
ATOM   953  N  ND2   . ASN A 1 156 ? 7.813   1.034   40.497  1.00 32.78 ? 157  ASN A ND2   1 
ATOM   954  N  N     . ASP A 1 157 ? 10.521  2.155   45.354  1.00 33.27 ? 158  ASP A N     1 
ATOM   955  C  CA    . ASP A 1 157 ? 11.374  1.823   46.507  1.00 34.21 ? 158  ASP A CA    1 
ATOM   956  C  C     . ASP A 1 157 ? 11.318  2.826   47.656  1.00 33.89 ? 158  ASP A C     1 
ATOM   957  O  O     . ASP A 1 157 ? 12.277  2.957   48.411  1.00 33.04 ? 158  ASP A O     1 
ATOM   958  C  CB    . ASP A 1 157 ? 12.833  1.691   46.052  1.00 34.98 ? 158  ASP A CB    1 
ATOM   959  C  CG    . ASP A 1 157 ? 13.109  0.381   45.324  1.00 40.27 ? 158  ASP A CG    1 
ATOM   960  O  OD1   . ASP A 1 157 ? 14.302  0.016   45.219  1.00 45.64 ? 158  ASP A OD1   1 
ATOM   961  O  OD2   . ASP A 1 157 ? 12.149  -0.290  44.877  1.00 44.01 ? 158  ASP A OD2   1 
ATOM   962  N  N     . LEU A 1 158 ? 10.178  3.477   47.843  1.00 34.65 ? 159  LEU A N     1 
ATOM   963  C  CA    . LEU A 1 158 ? 10.093  4.590   48.780  1.00 35.42 ? 159  LEU A CA    1 
ATOM   964  C  C     . LEU A 1 158 ? 10.316  4.175   50.246  1.00 35.18 ? 159  LEU A C     1 
ATOM   965  O  O     . LEU A 1 158 ? 10.982  4.877   51.010  1.00 34.81 ? 159  LEU A O     1 
ATOM   966  C  CB    . LEU A 1 158 ? 8.774   5.352   48.592  1.00 35.44 ? 159  LEU A CB    1 
ATOM   967  C  CG    . LEU A 1 158 ? 8.649   6.617   49.443  1.00 37.38 ? 159  LEU A CG    1 
ATOM   968  C  CD1   . LEU A 1 158 ? 9.773   7.605   49.116  1.00 37.34 ? 159  LEU A CD1   1 
ATOM   969  C  CD2   . LEU A 1 158 ? 7.262   7.252   49.267  1.00 36.58 ? 159  LEU A CD2   1 
ATOM   970  N  N     . ASP A 1 159 ? 9.756   3.033   50.628  1.00 35.56 ? 160  ASP A N     1 
ATOM   971  C  CA    . ASP A 1 159 ? 9.980   2.469   51.958  1.00 36.09 ? 160  ASP A CA    1 
ATOM   972  C  C     . ASP A 1 159 ? 11.456  2.354   52.302  1.00 35.48 ? 160  ASP A C     1 
ATOM   973  O  O     . ASP A 1 159 ? 11.869  2.784   53.373  1.00 35.90 ? 160  ASP A O     1 
ATOM   974  C  CB    . ASP A 1 159 ? 9.340   1.087   52.082  1.00 36.89 ? 160  ASP A CB    1 
ATOM   975  C  CG    . ASP A 1 159 ? 7.830   1.134   52.081  1.00 39.25 ? 160  ASP A CG    1 
ATOM   976  O  OD1   . ASP A 1 159 ? 7.270   2.244   51.918  1.00 42.36 ? 160  ASP A OD1   1 
ATOM   977  O  OD2   . ASP A 1 159 ? 7.208   0.056   52.238  1.00 42.59 ? 160  ASP A OD2   1 
ATOM   978  N  N     . ARG A 1 160 ? 12.243  1.776   51.398  1.00 34.99 ? 161  ARG A N     1 
ATOM   979  C  CA    . ARG A 1 160 ? 13.684  1.584   51.624  1.00 34.00 ? 161  ARG A CA    1 
ATOM   980  C  C     . ARG A 1 160 ? 14.395  2.922   51.707  1.00 33.78 ? 161  ARG A C     1 
ATOM   981  O  O     . ARG A 1 160 ? 15.148  3.170   52.634  1.00 33.30 ? 161  ARG A O     1 
ATOM   982  C  CB    . ARG A 1 160 ? 14.299  0.752   50.491  1.00 34.01 ? 161  ARG A CB    1 
ATOM   983  C  CG    . ARG A 1 160 ? 15.800  0.457   50.629  1.00 33.46 ? 161  ARG A CG    1 
ATOM   984  C  CD    . ARG A 1 160 ? 16.314  -0.476  49.516  1.00 32.15 ? 161  ARG A CD    1 
ATOM   985  N  NE    . ARG A 1 160 ? 16.129  0.053   48.170  1.00 30.90 ? 161  ARG A NE    1 
ATOM   986  C  CZ    . ARG A 1 160 ? 16.949  0.903   47.544  1.00 27.54 ? 161  ARG A CZ    1 
ATOM   987  N  NH1   . ARG A 1 160 ? 18.041  1.356   48.122  1.00 30.40 ? 161  ARG A NH1   1 
ATOM   988  N  NH2   . ARG A 1 160 ? 16.671  1.290   46.319  1.00 28.50 ? 161  ARG A NH2   1 
ATOM   989  N  N     . ILE A 1 161 ? 14.165  3.781   50.722  1.00 34.41 ? 162  ILE A N     1 
ATOM   990  C  CA    . ILE A 1 161 ? 14.946  5.029   50.621  1.00 34.34 ? 162  ILE A CA    1 
ATOM   991  C  C     . ILE A 1 161 ? 14.533  6.038   51.680  1.00 34.09 ? 162  ILE A C     1 
ATOM   992  O  O     . ILE A 1 161 ? 15.307  6.928   52.027  1.00 33.98 ? 162  ILE A O     1 
ATOM   993  C  CB    . ILE A 1 161 ? 14.950  5.658   49.200  1.00 34.31 ? 162  ILE A CB    1 
ATOM   994  C  CG1   . ILE A 1 161 ? 13.573  6.197   48.773  1.00 33.90 ? 162  ILE A CG1   1 
ATOM   995  C  CG2   . ILE A 1 161 ? 15.515  4.691   48.174  1.00 33.45 ? 162  ILE A CG2   1 
ATOM   996  C  CD1   . ILE A 1 161 ? 13.678  7.065   47.458  1.00 35.94 ? 162  ILE A CD1   1 
ATOM   997  N  N     . SER A 1 162 ? 13.343  5.884   52.247  1.00 34.40 ? 163  SER A N     1 
ATOM   998  C  CA    . SER A 1 162 ? 12.894  6.830   53.266  1.00 34.57 ? 163  SER A CA    1 
ATOM   999  C  C     . SER A 1 162 ? 13.327  6.515   54.701  1.00 34.96 ? 163  SER A C     1 
ATOM   1000 O  O     . SER A 1 162 ? 13.043  7.296   55.594  1.00 35.86 ? 163  SER A O     1 
ATOM   1001 C  CB    . SER A 1 162 ? 11.376  7.037   53.187  1.00 34.43 ? 163  SER A CB    1 
ATOM   1002 O  OG    . SER A 1 162 ? 10.663  5.909   53.634  1.00 34.43 ? 163  SER A OG    1 
ATOM   1003 N  N     . GLN A 1 163 ? 14.019  5.398   54.930  1.00 34.94 ? 164  GLN A N     1 
ATOM   1004 C  CA    . GLN A 1 163 ? 14.428  5.032   56.307  1.00 35.37 ? 164  GLN A CA    1 
ATOM   1005 C  C     . GLN A 1 163 ? 15.465  6.049   56.773  1.00 35.35 ? 164  GLN A C     1 
ATOM   1006 O  O     . GLN A 1 163 ? 16.230  6.556   55.963  1.00 34.22 ? 164  GLN A O     1 
ATOM   1007 C  CB    . GLN A 1 163 ? 15.016  3.626   56.340  1.00 35.17 ? 164  GLN A CB    1 
ATOM   1008 C  CG    . GLN A 1 163 ? 14.087  2.559   55.787  1.00 36.71 ? 164  GLN A CG    1 
ATOM   1009 C  CD    . GLN A 1 163 ? 12.797  2.497   56.562  1.00 39.37 ? 164  GLN A CD    1 
ATOM   1010 O  OE1   . GLN A 1 163 ? 12.741  1.863   57.596  1.00 41.52 ? 164  GLN A OE1   1 
ATOM   1011 N  NE2   . GLN A 1 163 ? 11.758  3.178   56.076  1.00 41.63 ? 164  GLN A NE2   1 
ATOM   1012 N  N     . SER A 1 164 ? 15.498  6.360   58.063  1.00 35.68 ? 165  SER A N     1 
ATOM   1013 C  CA    . SER A 1 164 ? 16.440  7.380   58.568  1.00 35.81 ? 165  SER A CA    1 
ATOM   1014 C  C     . SER A 1 164 ? 17.890  6.961   58.300  1.00 35.81 ? 165  SER A C     1 
ATOM   1015 O  O     . SER A 1 164 ? 18.743  7.802   58.026  1.00 36.08 ? 165  SER A O     1 
ATOM   1016 C  CB    . SER A 1 164 ? 16.220  7.669   60.063  1.00 35.89 ? 165  SER A CB    1 
ATOM   1017 O  OG    . SER A 1 164 ? 16.398  6.502   60.820  1.00 36.57 ? 165  SER A OG    1 
ATOM   1018 N  N     . ASN A 1 165 ? 18.142  5.658   58.322  1.00 35.62 ? 166  ASN A N     1 
ATOM   1019 C  CA    . ASN A 1 165 ? 19.494  5.112   58.139  1.00 35.90 ? 166  ASN A CA    1 
ATOM   1020 C  C     . ASN A 1 165 ? 19.883  4.834   56.699  1.00 35.03 ? 166  ASN A C     1 
ATOM   1021 O  O     . ASN A 1 165 ? 20.905  4.198   56.455  1.00 35.02 ? 166  ASN A O     1 
ATOM   1022 C  CB    . ASN A 1 165 ? 19.617  3.809   58.917  1.00 36.48 ? 166  ASN A CB    1 
ATOM   1023 C  CG    . ASN A 1 165 ? 18.441  2.872   58.672  1.00 38.11 ? 166  ASN A CG    1 
ATOM   1024 O  OD1   . ASN A 1 165 ? 18.059  2.600   57.529  1.00 41.13 ? 166  ASN A OD1   1 
ATOM   1025 N  ND2   . ASN A 1 165 ? 17.835  2.409   59.755  1.00 39.72 ? 166  ASN A ND2   1 
ATOM   1026 N  N     . TYR A 1 166 ? 19.075  5.293   55.752  1.00 34.41 ? 167  TYR A N     1 
ATOM   1027 C  CA    . TYR A 1 166 ? 19.272  4.989   54.334  1.00 33.19 ? 167  TYR A CA    1 
ATOM   1028 C  C     . TYR A 1 166 ? 20.644  5.410   53.813  1.00 33.25 ? 167  TYR A C     1 
ATOM   1029 O  O     . TYR A 1 166 ? 21.075  6.539   54.021  1.00 33.16 ? 167  TYR A O     1 
ATOM   1030 C  CB    . TYR A 1 166 ? 18.163  5.641   53.518  1.00 32.88 ? 167  TYR A CB    1 
ATOM   1031 C  CG    . TYR A 1 166 ? 18.379  5.671   52.025  1.00 31.60 ? 167  TYR A CG    1 
ATOM   1032 C  CD1   . TYR A 1 166 ? 18.478  4.488   51.287  1.00 31.70 ? 167  TYR A CD1   1 
ATOM   1033 C  CD2   . TYR A 1 166 ? 18.443  6.878   51.345  1.00 30.84 ? 167  TYR A CD2   1 
ATOM   1034 C  CE1   . TYR A 1 166 ? 18.667  4.526   49.923  1.00 31.26 ? 167  TYR A CE1   1 
ATOM   1035 C  CE2   . TYR A 1 166 ? 18.623  6.931   49.971  1.00 31.13 ? 167  TYR A CE2   1 
ATOM   1036 C  CZ    . TYR A 1 166 ? 18.723  5.752   49.267  1.00 31.94 ? 167  TYR A CZ    1 
ATOM   1037 O  OH    . TYR A 1 166 ? 18.900  5.793   47.924  1.00 29.64 ? 167  TYR A OH    1 
ATOM   1038 N  N     . ILE A 1 167 ? 21.331  4.473   53.169  1.00 33.54 ? 168  ILE A N     1 
ATOM   1039 C  CA    . ILE A 1 167 ? 22.557  4.739   52.415  1.00 33.57 ? 168  ILE A CA    1 
ATOM   1040 C  C     . ILE A 1 167 ? 22.282  4.280   50.988  1.00 33.05 ? 168  ILE A C     1 
ATOM   1041 O  O     . ILE A 1 167 ? 21.986  3.093   50.772  1.00 32.77 ? 168  ILE A O     1 
ATOM   1042 C  CB    . ILE A 1 167 ? 23.787  3.947   52.946  1.00 34.11 ? 168  ILE A CB    1 
ATOM   1043 C  CG1   . ILE A 1 167 ? 24.013  4.259   54.427  1.00 33.94 ? 168  ILE A CG1   1 
ATOM   1044 C  CG2   . ILE A 1 167 ? 25.048  4.330   52.143  1.00 33.08 ? 168  ILE A CG2   1 
ATOM   1045 C  CD1   . ILE A 1 167 ? 25.153  3.464   55.092  1.00 34.86 ? 168  ILE A CD1   1 
ATOM   1046 N  N     . PRO A 1 168 ? 22.367  5.206   50.019  1.00 32.49 ? 169  PRO A N     1 
ATOM   1047 C  CA    . PRO A 1 168 ? 22.214  4.794   48.630  1.00 32.47 ? 169  PRO A CA    1 
ATOM   1048 C  C     . PRO A 1 168 ? 23.146  3.630   48.228  1.00 32.73 ? 169  PRO A C     1 
ATOM   1049 O  O     . PRO A 1 168 ? 24.339  3.609   48.555  1.00 31.57 ? 169  PRO A O     1 
ATOM   1050 C  CB    . PRO A 1 168 ? 22.531  6.067   47.844  1.00 33.08 ? 169  PRO A CB    1 
ATOM   1051 C  CG    . PRO A 1 168 ? 22.247  7.183   48.801  1.00 33.09 ? 169  PRO A CG    1 
ATOM   1052 C  CD    . PRO A 1 168 ? 22.598  6.664   50.142  1.00 32.51 ? 169  PRO A CD    1 
ATOM   1053 N  N     . THR A 1 169 ? 22.573  2.682   47.497  1.00 32.55 ? 170  THR A N     1 
ATOM   1054 C  CA    . THR A 1 169 ? 23.310  1.567   46.952  1.00 32.25 ? 170  THR A CA    1 
ATOM   1055 C  C     . THR A 1 169 ? 24.004  2.075   45.699  1.00 32.23 ? 170  THR A C     1 
ATOM   1056 O  O     . THR A 1 169 ? 23.714  3.185   45.185  1.00 29.87 ? 170  THR A O     1 
ATOM   1057 C  CB    . THR A 1 169 ? 22.378  0.406   46.557  1.00 31.56 ? 170  THR A CB    1 
ATOM   1058 O  OG1   . THR A 1 169 ? 21.484  0.843   45.517  1.00 30.04 ? 170  THR A OG1   1 
ATOM   1059 C  CG2   . THR A 1 169 ? 21.595  -0.113  47.782  1.00 34.33 ? 170  THR A CG2   1 
ATOM   1060 N  N     . GLN A 1 170 ? 24.890  1.245   45.176  1.00 32.68 ? 171  GLN A N     1 
ATOM   1061 C  CA    . GLN A 1 170 ? 25.572  1.592   43.943  1.00 33.53 ? 171  GLN A CA    1 
ATOM   1062 C  C     . GLN A 1 170 ? 24.575  1.756   42.780  1.00 32.62 ? 171  GLN A C     1 
ATOM   1063 O  O     . GLN A 1 170 ? 24.728  2.677   41.981  1.00 31.59 ? 171  GLN A O     1 
ATOM   1064 C  CB    . GLN A 1 170 ? 26.660  0.564   43.615  1.00 34.69 ? 171  GLN A CB    1 
ATOM   1065 C  CG    . GLN A 1 170 ? 27.541  1.022   42.443  1.00 37.50 ? 171  GLN A CG    1 
ATOM   1066 C  CD    . GLN A 1 170 ? 28.854  0.276   42.404  1.00 35.95 ? 171  GLN A CD    1 
ATOM   1067 O  OE1   . GLN A 1 170 ? 29.833  0.659   43.064  1.00 40.22 ? 171  GLN A OE1   1 
ATOM   1068 N  NE2   . GLN A 1 170 ? 28.890  -0.765  41.627  1.00 34.46 ? 171  GLN A NE2   1 
ATOM   1069 N  N     . GLN A 1 171 ? 23.551  0.899   42.701  1.00 31.91 ? 172  GLN A N     1 
ATOM   1070 C  CA    . GLN A 1 171 ? 22.517  1.062   41.667  1.00 31.72 ? 172  GLN A CA    1 
ATOM   1071 C  C     . GLN A 1 171 ? 21.719  2.361   41.888  1.00 31.72 ? 172  GLN A C     1 
ATOM   1072 O  O     . GLN A 1 171 ? 21.403  3.060   40.928  1.00 29.71 ? 172  GLN A O     1 
ATOM   1073 C  CB    . GLN A 1 171 ? 21.597  -0.150  41.590  1.00 32.67 ? 172  GLN A CB    1 
ATOM   1074 C  CG    . GLN A 1 171 ? 20.427  -0.031  40.527  1.00 32.60 ? 172  GLN A CG    1 
ATOM   1075 C  CD    . GLN A 1 171 ? 20.866  -0.083  39.070  1.00 35.45 ? 172  GLN A CD    1 
ATOM   1076 O  OE1   . GLN A 1 171 ? 20.077  0.264   38.179  1.00 32.56 ? 172  GLN A OE1   1 
ATOM   1077 N  NE2   . GLN A 1 171 ? 22.096  -0.566  38.803  1.00 33.43 ? 172  GLN A NE2   1 
ATOM   1078 N  N     . ASP A 1 172 ? 21.386  2.688   43.141  1.00 30.68 ? 173  ASP A N     1 
ATOM   1079 C  CA    . ASP A 1 172 ? 20.734  3.980   43.427  1.00 30.06 ? 173  ASP A CA    1 
ATOM   1080 C  C     . ASP A 1 172 ? 21.549  5.154   42.860  1.00 29.68 ? 173  ASP A C     1 
ATOM   1081 O  O     . ASP A 1 172 ? 20.985  6.109   42.322  1.00 30.25 ? 173  ASP A O     1 
ATOM   1082 C  CB    . ASP A 1 172 ? 20.577  4.234   44.944  1.00 29.98 ? 173  ASP A CB    1 
ATOM   1083 C  CG    . ASP A 1 172 ? 19.553  3.348   45.609  1.00 29.25 ? 173  ASP A CG    1 
ATOM   1084 O  OD1   . ASP A 1 172 ? 18.742  2.706   44.906  1.00 30.73 ? 173  ASP A OD1   1 
ATOM   1085 O  OD2   . ASP A 1 172 ? 19.562  3.313   46.868  1.00 29.68 ? 173  ASP A OD2   1 
ATOM   1086 N  N     . VAL A 1 173 ? 22.874  5.082   42.989  1.00 29.51 ? 174  VAL A N     1 
ATOM   1087 C  CA    . VAL A 1 173 ? 23.783  6.130   42.488  1.00 29.87 ? 174  VAL A CA    1 
ATOM   1088 C  C     . VAL A 1 173 ? 23.724  6.195   40.968  1.00 30.43 ? 174  VAL A C     1 
ATOM   1089 O  O     . VAL A 1 173 ? 23.552  7.272   40.406  1.00 29.26 ? 174  VAL A O     1 
ATOM   1090 C  CB    . VAL A 1 173 ? 25.254  5.911   43.037  1.00 30.35 ? 174  VAL A CB    1 
ATOM   1091 C  CG1   . VAL A 1 173 ? 26.271  6.804   42.392  1.00 30.88 ? 174  VAL A CG1   1 
ATOM   1092 C  CG2   . VAL A 1 173 ? 25.280  6.053   44.554  1.00 28.04 ? 174  VAL A CG2   1 
ATOM   1093 N  N     . LEU A 1 174 ? 23.866  5.038   40.318  1.00 30.69 ? 175  LEU A N     1 
ATOM   1094 C  CA    . LEU A 1 174 ? 23.761  4.943   38.854  1.00 32.10 ? 175  LEU A CA    1 
ATOM   1095 C  C     . LEU A 1 174 ? 22.457  5.523   38.293  1.00 31.74 ? 175  LEU A C     1 
ATOM   1096 O  O     . LEU A 1 174 ? 22.452  6.157   37.217  1.00 33.89 ? 175  LEU A O     1 
ATOM   1097 C  CB    . LEU A 1 174 ? 23.916  3.492   38.404  1.00 31.58 ? 175  LEU A CB    1 
ATOM   1098 C  CG    . LEU A 1 174 ? 25.345  2.961   38.454  1.00 32.68 ? 175  LEU A CG    1 
ATOM   1099 C  CD1   . LEU A 1 174 ? 25.306  1.413   38.410  1.00 29.65 ? 175  LEU A CD1   1 
ATOM   1100 C  CD2   . LEU A 1 174 ? 26.227  3.563   37.373  1.00 31.07 ? 175  LEU A CD2   1 
ATOM   1101 N  N     . ARG A 1 175 ? 21.376  5.347   39.052  1.00 31.88 ? 176  ARG A N     1 
ATOM   1102 C  CA    . ARG A 1 175 ? 20.044  5.842   38.686  1.00 31.62 ? 176  ARG A CA    1 
ATOM   1103 C  C     . ARG A 1 175 ? 19.835  7.336   38.910  1.00 32.04 ? 176  ARG A C     1 
ATOM   1104 O  O     . ARG A 1 175 ? 18.849  7.881   38.443  1.00 33.91 ? 176  ARG A O     1 
ATOM   1105 C  CB    . ARG A 1 175 ? 18.980  5.095   39.503  1.00 30.76 ? 176  ARG A CB    1 
ATOM   1106 C  CG    . ARG A 1 175 ? 18.803  3.682   39.142  1.00 31.47 ? 176  ARG A CG    1 
ATOM   1107 C  CD    . ARG A 1 175 ? 18.055  3.456   37.827  1.00 32.16 ? 176  ARG A CD    1 
ATOM   1108 N  NE    . ARG A 1 175 ? 17.781  2.047   37.638  1.00 32.86 ? 176  ARG A NE    1 
ATOM   1109 C  CZ    . ARG A 1 175 ? 16.752  1.529   36.959  1.00 33.82 ? 176  ARG A CZ    1 
ATOM   1110 N  NH1   . ARG A 1 175 ? 15.852  2.279   36.392  1.00 33.73 ? 176  ARG A NH1   1 
ATOM   1111 N  NH2   . ARG A 1 175 ? 16.597  0.227   36.939  1.00 33.19 ? 176  ARG A NH2   1 
ATOM   1112 N  N     . THR A 1 176 ? 20.714  8.000   39.635  1.00 32.07 ? 177  THR A N     1 
ATOM   1113 C  CA    . THR A 1 176 ? 20.501  9.419   39.921  1.00 32.04 ? 177  THR A CA    1 
ATOM   1114 C  C     . THR A 1 176 ? 20.563  10.260  38.640  1.00 32.36 ? 177  THR A C     1 
ATOM   1115 O  O     . THR A 1 176 ? 21.285  9.933   37.691  1.00 32.12 ? 177  THR A O     1 
ATOM   1116 C  CB    . THR A 1 176 ? 21.503  10.029  40.956  1.00 31.97 ? 177  THR A CB    1 
ATOM   1117 O  OG1   . THR A 1 176 ? 22.856  9.836   40.531  1.00 31.41 ? 177  THR A OG1   1 
ATOM   1118 C  CG2   . THR A 1 176 ? 21.228  9.529   42.393  1.00 30.11 ? 177  THR A CG2   1 
ATOM   1119 N  N     . ARG A 1 177 ? 19.804  11.358  38.659  1.00 32.10 ? 178  ARG A N     1 
ATOM   1120 C  CA    . ARG A 1 177 ? 19.814  12.350  37.603  1.00 31.37 ? 178  ARG A CA    1 
ATOM   1121 C  C     . ARG A 1 177 ? 20.408  13.636  38.134  1.00 31.82 ? 178  ARG A C     1 
ATOM   1122 O  O     . ARG A 1 177 ? 19.842  14.264  39.060  1.00 31.76 ? 178  ARG A O     1 
ATOM   1123 C  CB    . ARG A 1 177 ? 18.389  12.571  37.103  1.00 31.73 ? 178  ARG A CB    1 
ATOM   1124 C  CG    . ARG A 1 177 ? 18.234  13.742  36.144  1.00 31.40 ? 178  ARG A CG    1 
ATOM   1125 C  CD    . ARG A 1 177 ? 18.950  13.450  34.869  1.00 34.11 ? 178  ARG A CD    1 
ATOM   1126 N  NE    . ARG A 1 177 ? 18.892  14.614  33.988  1.00 35.10 ? 178  ARG A NE    1 
ATOM   1127 C  CZ    . ARG A 1 177 ? 19.821  14.908  33.102  1.00 36.57 ? 178  ARG A CZ    1 
ATOM   1128 N  NH1   . ARG A 1 177 ? 20.887  14.131  32.978  1.00 34.53 ? 178  ARG A NH1   1 
ATOM   1129 N  NH2   . ARG A 1 177 ? 19.701  16.011  32.377  1.00 35.99 ? 178  ARG A NH2   1 
ATOM   1130 N  N     . VAL A 1 178 ? 21.575  13.990  37.596  1.00 31.24 ? 179  VAL A N     1 
ATOM   1131 C  CA    . VAL A 1 178 ? 22.224  15.293  37.770  1.00 32.01 ? 179  VAL A CA    1 
ATOM   1132 C  C     . VAL A 1 178 ? 22.601  15.792  36.361  1.00 32.76 ? 179  VAL A C     1 
ATOM   1133 O  O     . VAL A 1 178 ? 23.374  15.141  35.651  1.00 32.62 ? 179  VAL A O     1 
ATOM   1134 C  CB    . VAL A 1 178 ? 23.490  15.243  38.667  1.00 33.23 ? 179  VAL A CB    1 
ATOM   1135 C  CG1   . VAL A 1 178 ? 24.187  16.633  38.700  1.00 31.85 ? 179  VAL A CG1   1 
ATOM   1136 C  CG2   . VAL A 1 178 ? 23.112  14.762  40.092  1.00 32.77 ? 179  VAL A CG2   1 
ATOM   1137 N  N     . LYS A 1 179 ? 22.002  16.900  35.941  1.00 33.17 ? 180  LYS A N     1 
ATOM   1138 C  CA    . LYS A 1 179 ? 22.251  17.450  34.600  1.00 33.02 ? 180  LYS A CA    1 
ATOM   1139 C  C     . LYS A 1 179 ? 23.677  17.934  34.526  1.00 32.71 ? 180  LYS A C     1 
ATOM   1140 O  O     . LYS A 1 179 ? 24.159  18.672  35.412  1.00 31.60 ? 180  LYS A O     1 
ATOM   1141 C  CB    . LYS A 1 179 ? 21.317  18.631  34.250  1.00 32.81 ? 180  LYS A CB    1 
ATOM   1142 C  CG    . LYS A 1 179 ? 21.549  19.240  32.845  1.00 34.24 ? 180  LYS A CG    1 
ATOM   1143 C  CD    . LYS A 1 179 ? 20.231  19.874  32.234  1.00 35.60 ? 180  LYS A CD    1 
ATOM   1144 C  CE    . LYS A 1 179 ? 19.756  21.000  33.012  1.00 38.45 ? 180  LYS A CE    1 
ATOM   1145 N  NZ    . LYS A 1 179 ? 18.582  21.718  32.312  1.00 33.64 ? 180  LYS A NZ    1 
ATOM   1146 N  N     . THR A 1 180 ? 24.361  17.544  33.450  1.00 32.35 ? 181  THR A N     1 
ATOM   1147 C  CA    . THR A 1 180 ? 25.745  18.011  33.242  1.00 32.95 ? 181  THR A CA    1 
ATOM   1148 C  C     . THR A 1 180 ? 25.773  19.307  32.460  1.00 32.11 ? 181  THR A C     1 
ATOM   1149 O  O     . THR A 1 180 ? 25.107  19.440  31.434  1.00 32.58 ? 181  THR A O     1 
ATOM   1150 C  CB    . THR A 1 180 ? 26.611  16.979  32.475  1.00 33.58 ? 181  THR A CB    1 
ATOM   1151 O  OG1   . THR A 1 180 ? 26.400  15.665  33.002  1.00 31.01 ? 181  THR A OG1   1 
ATOM   1152 C  CG2   . THR A 1 180 ? 28.106  17.335  32.536  1.00 34.31 ? 181  THR A CG2   1 
ATOM   1153 N  N     . THR A 1 181 ? 26.586  20.241  32.939  1.00 32.34 ? 182  THR A N     1 
ATOM   1154 C  CA    . THR A 1 181 ? 26.884  21.473  32.224  1.00 32.27 ? 182  THR A CA    1 
ATOM   1155 C  C     . THR A 1 181 ? 28.398  21.608  31.975  1.00 32.38 ? 182  THR A C     1 
ATOM   1156 O  O     . THR A 1 181 ? 29.217  21.345  32.854  1.00 30.64 ? 182  THR A O     1 
ATOM   1157 C  CB    . THR A 1 181 ? 26.271  22.724  32.949  1.00 32.04 ? 182  THR A CB    1 
ATOM   1158 O  OG1   . THR A 1 181 ? 26.394  23.887  32.111  1.00 32.77 ? 182  THR A OG1   1 
ATOM   1159 C  CG2   . THR A 1 181 ? 26.925  22.959  34.358  1.00 31.42 ? 182  THR A CG2   1 
ATOM   1160 N  N     . GLY A 1 182 ? 28.764  21.979  30.749  1.00 31.44 ? 183  GLY A N     1 
ATOM   1161 C  CA    . GLY A 1 182 ? 30.165  22.193  30.413  1.00 31.03 ? 183  GLY A CA    1 
ATOM   1162 C  C     . GLY A 1 182 ? 30.840  20.957  29.855  1.00 30.94 ? 183  GLY A C     1 
ATOM   1163 O  O     . GLY A 1 182 ? 30.202  20.115  29.224  1.00 31.60 ? 183  GLY A O     1 
ATOM   1164 N  N     . ILE A 1 183 ? 32.140  20.865  30.074  1.00 31.40 ? 184  ILE A N     1 
ATOM   1165 C  CA    . ILE A 1 183 ? 32.952  19.748  29.585  1.00 31.89 ? 184  ILE A CA    1 
ATOM   1166 C  C     . ILE A 1 183 ? 33.786  19.268  30.766  1.00 31.66 ? 184  ILE A C     1 
ATOM   1167 O  O     . ILE A 1 183 ? 34.517  20.067  31.357  1.00 31.42 ? 184  ILE A O     1 
ATOM   1168 C  CB    . ILE A 1 183 ? 33.893  20.212  28.461  1.00 32.55 ? 184  ILE A CB    1 
ATOM   1169 C  CG1   . ILE A 1 183 ? 33.090  20.669  27.230  1.00 33.23 ? 184  ILE A CG1   1 
ATOM   1170 C  CG2   . ILE A 1 183 ? 34.821  19.076  28.056  1.00 33.35 ? 184  ILE A CG2   1 
ATOM   1171 C  CD1   . ILE A 1 183 ? 33.919  21.322  26.152  1.00 35.51 ? 184  ILE A CD1   1 
ATOM   1172 N  N     . VAL A 1 184 ? 33.681  17.979  31.094  1.00 32.08 ? 185  VAL A N     1 
ATOM   1173 C  CA    . VAL A 1 184 ? 34.365  17.405  32.241  1.00 32.78 ? 185  VAL A CA    1 
ATOM   1174 C  C     . VAL A 1 184 ? 35.310  16.298  31.791  1.00 34.06 ? 185  VAL A C     1 
ATOM   1175 O  O     . VAL A 1 184 ? 34.873  15.315  31.165  1.00 33.10 ? 185  VAL A O     1 
ATOM   1176 C  CB    . VAL A 1 184 ? 33.390  16.833  33.280  1.00 32.61 ? 185  VAL A CB    1 
ATOM   1177 C  CG1   . VAL A 1 184 ? 34.173  16.409  34.552  1.00 33.16 ? 185  VAL A CG1   1 
ATOM   1178 C  CG2   . VAL A 1 184 ? 32.289  17.863  33.610  1.00 32.74 ? 185  VAL A CG2   1 
ATOM   1179 N  N     . GLU A 1 185 ? 36.594  16.495  32.093  1.00 35.49 ? 186  GLU A N     1 
ATOM   1180 C  CA    . GLU A 1 185 ? 37.637  15.522  31.760  1.00 37.03 ? 186  GLU A CA    1 
ATOM   1181 C  C     . GLU A 1 185 ? 37.996  14.646  32.957  1.00 36.84 ? 186  GLU A C     1 
ATOM   1182 O  O     . GLU A 1 185 ? 38.231  15.145  34.044  1.00 37.37 ? 186  GLU A O     1 
ATOM   1183 C  CB    . GLU A 1 185 ? 38.884  16.249  31.281  1.00 37.35 ? 186  GLU A CB    1 
ATOM   1184 C  CG    . GLU A 1 185 ? 39.944  15.320  30.665  1.00 39.59 ? 186  GLU A CG    1 
ATOM   1185 C  CD    . GLU A 1 185 ? 41.220  16.040  30.327  1.00 42.15 ? 186  GLU A CD    1 
ATOM   1186 O  OE1   . GLU A 1 185 ? 41.270  17.299  30.401  1.00 43.97 ? 186  GLU A OE1   1 
ATOM   1187 O  OE2   . GLU A 1 185 ? 42.182  15.330  29.970  1.00 44.29 ? 186  GLU A OE2   1 
ATOM   1188 N  N     . THR A 1 186 ? 38.053  13.349  32.742  1.00 37.65 ? 187  THR A N     1 
ATOM   1189 C  CA    . THR A 1 186 ? 38.622  12.417  33.715  1.00 38.11 ? 187  THR A CA    1 
ATOM   1190 C  C     . THR A 1 186 ? 39.612  11.487  32.985  1.00 38.99 ? 187  THR A C     1 
ATOM   1191 O  O     . THR A 1 186 ? 39.731  11.528  31.744  1.00 39.62 ? 187  THR A O     1 
ATOM   1192 C  CB    . THR A 1 186 ? 37.523  11.577  34.390  1.00 38.49 ? 187  THR A CB    1 
ATOM   1193 O  OG1   . THR A 1 186 ? 36.786  10.866  33.394  1.00 39.14 ? 187  THR A OG1   1 
ATOM   1194 C  CG2   . THR A 1 186 ? 36.533  12.483  35.200  1.00 38.49 ? 187  THR A CG2   1 
ATOM   1195 N  N     . HIS A 1 187 ? 40.330  10.671  33.745  1.00 38.24 ? 188  HIS A N     1 
ATOM   1196 C  CA    . HIS A 1 187 ? 41.230  9.707   33.144  1.00 39.10 ? 188  HIS A CA    1 
ATOM   1197 C  C     . HIS A 1 187 ? 41.164  8.375   33.884  1.00 38.36 ? 188  HIS A C     1 
ATOM   1198 O  O     . HIS A 1 187 ? 40.677  8.303   35.009  1.00 38.94 ? 188  HIS A O     1 
ATOM   1199 C  CB    . HIS A 1 187 ? 42.660  10.259  33.065  1.00 39.20 ? 188  HIS A CB    1 
ATOM   1200 C  CG    . HIS A 1 187 ? 43.240  10.617  34.394  1.00 42.24 ? 188  HIS A CG    1 
ATOM   1201 N  ND1   . HIS A 1 187 ? 43.057  11.853  34.978  1.00 45.62 ? 188  HIS A ND1   1 
ATOM   1202 C  CD2   . HIS A 1 187 ? 44.007  9.901   35.255  1.00 45.04 ? 188  HIS A CD2   1 
ATOM   1203 C  CE1   . HIS A 1 187 ? 43.676  11.880  36.148  1.00 45.98 ? 188  HIS A CE1   1 
ATOM   1204 N  NE2   . HIS A 1 187 ? 44.265  10.710  36.337  1.00 46.32 ? 188  HIS A NE2   1 
ATOM   1205 N  N     . PHE A 1 188 ? 41.570  7.316   33.192  1.00 38.00 ? 189  PHE A N     1 
ATOM   1206 C  CA    . PHE A 1 188 ? 41.681  5.961   33.757  1.00 36.87 ? 189  PHE A CA    1 
ATOM   1207 C  C     . PHE A 1 188 ? 42.491  5.095   32.788  1.00 36.56 ? 189  PHE A C     1 
ATOM   1208 O  O     . PHE A 1 188 ? 42.697  5.456   31.617  1.00 36.12 ? 189  PHE A O     1 
ATOM   1209 C  CB    . PHE A 1 188 ? 40.302  5.327   34.049  1.00 37.32 ? 189  PHE A CB    1 
ATOM   1210 C  CG    . PHE A 1 188 ? 39.458  5.058   32.812  1.00 37.16 ? 189  PHE A CG    1 
ATOM   1211 C  CD1   . PHE A 1 188 ? 38.595  6.043   32.306  1.00 37.26 ? 189  PHE A CD1   1 
ATOM   1212 C  CD2   . PHE A 1 188 ? 39.500  3.816   32.174  1.00 36.54 ? 189  PHE A CD2   1 
ATOM   1213 C  CE1   . PHE A 1 188 ? 37.826  5.814   31.167  1.00 35.35 ? 189  PHE A CE1   1 
ATOM   1214 C  CE2   . PHE A 1 188 ? 38.716  3.575   31.042  1.00 36.73 ? 189  PHE A CE2   1 
ATOM   1215 C  CZ    . PHE A 1 188 ? 37.875  4.577   30.539  1.00 36.70 ? 189  PHE A CZ    1 
ATOM   1216 N  N     . THR A 1 189 ? 42.993  3.977   33.292  1.00 36.22 ? 190  THR A N     1 
ATOM   1217 C  CA    . THR A 1 189 ? 43.844  3.100   32.483  1.00 36.31 ? 190  THR A CA    1 
ATOM   1218 C  C     . THR A 1 189 ? 43.124  1.783   32.228  1.00 36.15 ? 190  THR A C     1 
ATOM   1219 O  O     . THR A 1 189 ? 42.364  1.315   33.064  1.00 37.35 ? 190  THR A O     1 
ATOM   1220 C  CB    . THR A 1 189 ? 45.222  2.875   33.151  1.00 36.54 ? 190  THR A CB    1 
ATOM   1221 O  OG1   . THR A 1 189 ? 45.865  4.145   33.335  1.00 35.10 ? 190  THR A OG1   1 
ATOM   1222 C  CG2   . THR A 1 189 ? 46.125  1.978   32.280  1.00 37.50 ? 190  THR A CG2   1 
ATOM   1223 N  N     . PHE A 1 190 ? 43.320  1.210   31.050  1.00 35.92 ? 191  PHE A N     1 
ATOM   1224 C  CA    . PHE A 1 190 ? 42.696  -0.069  30.728  1.00 35.87 ? 191  PHE A CA    1 
ATOM   1225 C  C     . PHE A 1 190 ? 43.414  -0.711  29.566  1.00 35.88 ? 191  PHE A C     1 
ATOM   1226 O  O     . PHE A 1 190 ? 43.625  -0.075  28.529  1.00 35.92 ? 191  PHE A O     1 
ATOM   1227 C  CB    . PHE A 1 190 ? 41.207  0.137   30.415  1.00 35.30 ? 191  PHE A CB    1 
ATOM   1228 C  CG    . PHE A 1 190 ? 40.460  -1.129  30.053  1.00 35.59 ? 191  PHE A CG    1 
ATOM   1229 C  CD1   . PHE A 1 190 ? 40.589  -2.288  30.817  1.00 35.89 ? 191  PHE A CD1   1 
ATOM   1230 C  CD2   . PHE A 1 190 ? 39.590  -1.146  28.965  1.00 34.21 ? 191  PHE A CD2   1 
ATOM   1231 C  CE1   . PHE A 1 190 ? 39.890  -3.443  30.481  1.00 36.02 ? 191  PHE A CE1   1 
ATOM   1232 C  CE2   . PHE A 1 190 ? 38.892  -2.295  28.635  1.00 35.41 ? 191  PHE A CE2   1 
ATOM   1233 C  CZ    . PHE A 1 190 ? 39.043  -3.443  29.398  1.00 34.89 ? 191  PHE A CZ    1 
ATOM   1234 N  N     . LYS A 1 191 ? 43.796  -1.975  29.750  1.00 36.89 ? 192  LYS A N     1 
ATOM   1235 C  CA    . LYS A 1 191 ? 44.574  -2.720  28.757  1.00 36.97 ? 192  LYS A CA    1 
ATOM   1236 C  C     . LYS A 1 191 ? 45.816  -1.925  28.367  1.00 37.23 ? 192  LYS A C     1 
ATOM   1237 O  O     . LYS A 1 191 ? 46.081  -1.715  27.183  1.00 37.41 ? 192  LYS A O     1 
ATOM   1238 C  CB    . LYS A 1 191 ? 43.735  -3.035  27.511  1.00 37.30 ? 192  LYS A CB    1 
ATOM   1239 C  CG    . LYS A 1 191 ? 42.426  -3.735  27.810  1.00 37.84 ? 192  LYS A CG    1 
ATOM   1240 C  CD    . LYS A 1 191 ? 41.954  -4.610  26.654  1.00 37.77 ? 192  LYS A CD    1 
ATOM   1241 C  CE    . LYS A 1 191 ? 40.680  -5.353  27.039  1.00 37.75 ? 192  LYS A CE    1 
ATOM   1242 N  NZ    . LYS A 1 191 ? 40.424  -6.548  26.199  1.00 37.40 ? 192  LYS A NZ    1 
ATOM   1243 N  N     . ASP A 1 192 ? 46.543  -1.447  29.375  1.00 37.51 ? 193  ASP A N     1 
ATOM   1244 C  CA    . ASP A 1 192 ? 47.758  -0.656  29.167  1.00 37.45 ? 193  ASP A CA    1 
ATOM   1245 C  C     . ASP A 1 192 ? 47.541  0.586   28.281  1.00 37.55 ? 193  ASP A C     1 
ATOM   1246 O  O     . ASP A 1 192 ? 48.473  1.074   27.647  1.00 36.62 ? 193  ASP A O     1 
ATOM   1247 C  CB    . ASP A 1 192 ? 48.889  -1.545  28.616  1.00 37.93 ? 193  ASP A CB    1 
ATOM   1248 N  N     . LEU A 1 193 ? 46.308  1.099   28.257  1.00 37.52 ? 194  LEU A N     1 
ATOM   1249 C  CA    . LEU A 1 193 ? 45.993  2.353   27.585  1.00 37.97 ? 194  LEU A CA    1 
ATOM   1250 C  C     . LEU A 1 193 ? 45.619  3.408   28.630  1.00 37.70 ? 194  LEU A C     1 
ATOM   1251 O  O     . LEU A 1 193 ? 44.992  3.088   29.637  1.00 36.73 ? 194  LEU A O     1 
ATOM   1252 C  CB    . LEU A 1 193 ? 44.814  2.173   26.624  1.00 38.35 ? 194  LEU A CB    1 
ATOM   1253 C  CG    . LEU A 1 193 ? 45.002  1.296   25.385  1.00 38.89 ? 194  LEU A CG    1 
ATOM   1254 C  CD1   . LEU A 1 193 ? 43.682  1.211   24.634  1.00 40.95 ? 194  LEU A CD1   1 
ATOM   1255 C  CD2   . LEU A 1 193 ? 46.069  1.866   24.491  1.00 38.95 ? 194  LEU A CD2   1 
ATOM   1256 N  N     . TYR A 1 194 ? 46.010  4.653   28.379  1.00 37.99 ? 195  TYR A N     1 
ATOM   1257 C  CA    . TYR A 1 194 ? 45.659  5.777   29.244  1.00 38.49 ? 195  TYR A CA    1 
ATOM   1258 C  C     . TYR A 1 194 ? 44.503  6.529   28.594  1.00 37.63 ? 195  TYR A C     1 
ATOM   1259 O  O     . TYR A 1 194 ? 44.678  7.141   27.540  1.00 37.03 ? 195  TYR A O     1 
ATOM   1260 C  CB    . TYR A 1 194 ? 46.870  6.705   29.444  1.00 40.28 ? 195  TYR A CB    1 
ATOM   1261 C  CG    . TYR A 1 194 ? 46.592  7.941   30.286  1.00 42.35 ? 195  TYR A CG    1 
ATOM   1262 C  CD1   . TYR A 1 194 ? 46.224  9.150   29.685  1.00 44.96 ? 195  TYR A CD1   1 
ATOM   1263 C  CD2   . TYR A 1 194 ? 46.692  7.902   31.681  1.00 44.65 ? 195  TYR A CD2   1 
ATOM   1264 C  CE1   . TYR A 1 194 ? 45.950  10.293  30.448  1.00 45.21 ? 195  TYR A CE1   1 
ATOM   1265 C  CE2   . TYR A 1 194 ? 46.427  9.050   32.461  1.00 45.07 ? 195  TYR A CE2   1 
ATOM   1266 C  CZ    . TYR A 1 194 ? 46.061  10.238  31.832  1.00 44.72 ? 195  TYR A CZ    1 
ATOM   1267 O  OH    . TYR A 1 194 ? 45.796  11.367  32.582  1.00 44.71 ? 195  TYR A OH    1 
ATOM   1268 N  N     . PHE A 1 195 ? 43.326  6.475   29.210  1.00 36.71 ? 196  PHE A N     1 
ATOM   1269 C  CA    . PHE A 1 195 ? 42.134  7.109   28.621  1.00 36.90 ? 196  PHE A CA    1 
ATOM   1270 C  C     . PHE A 1 195 ? 41.937  8.534   29.120  1.00 36.28 ? 196  PHE A C     1 
ATOM   1271 O  O     . PHE A 1 195 ? 41.903  8.756   30.306  1.00 36.18 ? 196  PHE A O     1 
ATOM   1272 C  CB    . PHE A 1 195 ? 40.868  6.302   28.914  1.00 36.97 ? 196  PHE A CB    1 
ATOM   1273 C  CG    . PHE A 1 195 ? 40.705  5.091   28.027  1.00 37.93 ? 196  PHE A CG    1 
ATOM   1274 C  CD1   . PHE A 1 195 ? 39.880  5.142   26.904  1.00 38.17 ? 196  PHE A CD1   1 
ATOM   1275 C  CD2   . PHE A 1 195 ? 41.360  3.907   28.321  1.00 36.63 ? 196  PHE A CD2   1 
ATOM   1276 C  CE1   . PHE A 1 195 ? 39.730  4.044   26.086  1.00 38.45 ? 196  PHE A CE1   1 
ATOM   1277 C  CE2   . PHE A 1 195 ? 41.216  2.789   27.503  1.00 38.81 ? 196  PHE A CE2   1 
ATOM   1278 C  CZ    . PHE A 1 195 ? 40.394  2.850   26.383  1.00 37.35 ? 196  PHE A CZ    1 
ATOM   1279 N  N     . LYS A 1 196 ? 41.841  9.490   28.205  1.00 36.10 ? 197  LYS A N     1 
ATOM   1280 C  CA    . LYS A 1 196 ? 41.469  10.850  28.554  1.00 36.30 ? 197  LYS A CA    1 
ATOM   1281 C  C     . LYS A 1 196 ? 40.029  11.020  28.089  1.00 35.56 ? 197  LYS A C     1 
ATOM   1282 O  O     . LYS A 1 196 ? 39.763  11.190  26.900  1.00 35.44 ? 197  LYS A O     1 
ATOM   1283 C  CB    . LYS A 1 196 ? 42.410  11.871  27.898  1.00 36.40 ? 197  LYS A CB    1 
ATOM   1284 N  N     . MET A 1 197 ? 39.108  10.965  29.051  1.00 35.44 ? 198  MET A N     1 
ATOM   1285 C  CA    . MET A 1 197 ? 37.689  10.902  28.784  1.00 34.93 ? 198  MET A CA    1 
ATOM   1286 C  C     . MET A 1 197 ? 36.975  12.255  29.018  1.00 34.56 ? 198  MET A C     1 
ATOM   1287 O  O     . MET A 1 197 ? 37.161  12.892  30.061  1.00 33.59 ? 198  MET A O     1 
ATOM   1288 C  CB    . MET A 1 197 ? 37.043  9.848   29.669  1.00 34.49 ? 198  MET A CB    1 
ATOM   1289 C  CG    . MET A 1 197 ? 35.527  9.684   29.418  1.00 35.07 ? 198  MET A CG    1 
ATOM   1290 S  SD    . MET A 1 197 ? 34.858  8.154   30.078  1.00 37.41 ? 198  MET A SD    1 
ATOM   1291 C  CE    . MET A 1 197 ? 35.074  8.450   31.828  1.00 34.64 ? 198  MET A CE    1 
ATOM   1292 N  N     . PHE A 1 198 ? 36.152  12.659  28.048  1.00 33.78 ? 199  PHE A N     1 
ATOM   1293 C  CA    . PHE A 1 198 ? 35.479  13.970  28.098  1.00 33.43 ? 199  PHE A CA    1 
ATOM   1294 C  C     . PHE A 1 198 ? 33.975  13.736  28.082  1.00 33.42 ? 199  PHE A C     1 
ATOM   1295 O  O     . PHE A 1 198 ? 33.434  13.104  27.173  1.00 32.61 ? 199  PHE A O     1 
ATOM   1296 C  CB    . PHE A 1 198 ? 35.913  14.866  26.927  1.00 34.09 ? 199  PHE A CB    1 
ATOM   1297 C  CG    . PHE A 1 198 ? 37.393  15.245  26.946  1.00 35.48 ? 199  PHE A CG    1 
ATOM   1298 C  CD1   . PHE A 1 198 ? 38.359  14.338  26.518  1.00 36.18 ? 199  PHE A CD1   1 
ATOM   1299 C  CD2   . PHE A 1 198 ? 37.815  16.495  27.391  1.00 33.70 ? 199  PHE A CD2   1 
ATOM   1300 C  CE1   . PHE A 1 198 ? 39.705  14.652  26.539  1.00 34.33 ? 199  PHE A CE1   1 
ATOM   1301 C  CE2   . PHE A 1 198 ? 39.169  16.825  27.412  1.00 35.20 ? 199  PHE A CE2   1 
ATOM   1302 C  CZ    . PHE A 1 198 ? 40.121  15.906  26.991  1.00 35.66 ? 199  PHE A CZ    1 
ATOM   1303 N  N     . ASP A 1 199 ? 33.313  14.217  29.124  1.00 32.60 ? 200  ASP A N     1 
ATOM   1304 C  CA    . ASP A 1 199 ? 31.884  14.112  29.287  1.00 32.29 ? 200  ASP A CA    1 
ATOM   1305 C  C     . ASP A 1 199 ? 31.365  15.531  29.127  1.00 31.74 ? 200  ASP A C     1 
ATOM   1306 O  O     . ASP A 1 199 ? 31.960  16.460  29.631  1.00 31.42 ? 200  ASP A O     1 
ATOM   1307 C  CB    . ASP A 1 199 ? 31.558  13.585  30.701  1.00 32.62 ? 200  ASP A CB    1 
ATOM   1308 C  CG    . ASP A 1 199 ? 30.071  13.259  30.896  1.00 33.51 ? 200  ASP A CG    1 
ATOM   1309 O  OD1   . ASP A 1 199 ? 29.367  13.015  29.896  1.00 34.53 ? 200  ASP A OD1   1 
ATOM   1310 O  OD2   . ASP A 1 199 ? 29.608  13.154  32.066  1.00 36.90 ? 200  ASP A OD2   1 
ATOM   1311 N  N     . VAL A 1 200 ? 30.269  15.685  28.398  1.00 31.86 ? 201  VAL A N     1 
ATOM   1312 C  CA    . VAL A 1 200 ? 29.751  17.002  28.025  1.00 32.38 ? 201  VAL A CA    1 
ATOM   1313 C  C     . VAL A 1 200 ? 28.259  17.094  28.322  1.00 32.06 ? 201  VAL A C     1 
ATOM   1314 O  O     . VAL A 1 200 ? 27.583  16.075  28.442  1.00 32.79 ? 201  VAL A O     1 
ATOM   1315 C  CB    . VAL A 1 200 ? 29.925  17.242  26.499  1.00 33.19 ? 201  VAL A CB    1 
ATOM   1316 C  CG1   . VAL A 1 200 ? 31.408  17.103  26.067  1.00 33.28 ? 201  VAL A CG1   1 
ATOM   1317 C  CG2   . VAL A 1 200 ? 29.028  16.269  25.694  1.00 31.03 ? 201  VAL A CG2   1 
ATOM   1318 N  N     . GLY A 1 201 ? 27.735  18.313  28.363  1.00 32.26 ? 202  GLY A N     1 
ATOM   1319 C  CA    . GLY A 1 201 ? 26.272  18.509  28.391  1.00 32.72 ? 202  GLY A CA    1 
ATOM   1320 C  C     . GLY A 1 201 ? 25.645  18.298  27.028  1.00 32.48 ? 202  GLY A C     1 
ATOM   1321 O  O     . GLY A 1 201 ? 26.247  18.671  26.022  1.00 32.33 ? 202  GLY A O     1 
ATOM   1322 N  N     . GLY A 1 202 ? 24.445  17.703  27.003  1.00 32.08 ? 203  GLY A N     1 
ATOM   1323 C  CA    . GLY A 1 202 ? 23.781  17.311  25.789  1.00 32.09 ? 203  GLY A CA    1 
ATOM   1324 C  C     . GLY A 1 202 ? 22.699  18.241  25.260  1.00 32.56 ? 203  GLY A C     1 
ATOM   1325 O  O     . GLY A 1 202 ? 22.320  18.143  24.090  1.00 33.03 ? 203  GLY A O     1 
ATOM   1326 N  N     . GLN A 1 203 ? 22.197  19.157  26.098  1.00 32.42 ? 204  GLN A N     1 
ATOM   1327 C  CA    . GLN A 1 203 ? 21.147  20.090  25.641  1.00 31.38 ? 204  GLN A CA    1 
ATOM   1328 C  C     . GLN A 1 203 ? 21.682  21.001  24.541  1.00 31.35 ? 204  GLN A C     1 
ATOM   1329 O  O     . GLN A 1 203 ? 22.886  21.282  24.461  1.00 29.98 ? 204  GLN A O     1 
ATOM   1330 C  CB    . GLN A 1 203 ? 20.588  20.960  26.787  1.00 31.20 ? 204  GLN A CB    1 
ATOM   1331 C  CG    . GLN A 1 203 ? 19.719  20.201  27.805  1.00 29.57 ? 204  GLN A CG    1 
ATOM   1332 C  CD    . GLN A 1 203 ? 20.488  19.197  28.657  1.00 29.93 ? 204  GLN A CD    1 
ATOM   1333 O  OE1   . GLN A 1 203 ? 21.670  19.393  28.970  1.00 32.49 ? 204  GLN A OE1   1 
ATOM   1334 N  NE2   . GLN A 1 203 ? 19.836  18.095  29.013  1.00 30.50 ? 204  GLN A NE2   1 
ATOM   1335 N  N     . ARG A 1 204 ? 20.763  21.500  23.730  1.00 31.17 ? 205  ARG A N     1 
ATOM   1336 C  CA    . ARG A 1 204 ? 21.084  22.398  22.643  1.00 30.71 ? 205  ARG A CA    1 
ATOM   1337 C  C     . ARG A 1 204 ? 21.999  23.521  23.094  1.00 31.40 ? 205  ARG A C     1 
ATOM   1338 O  O     . ARG A 1 204 ? 22.980  23.781  22.408  1.00 31.04 ? 205  ARG A O     1 
ATOM   1339 C  CB    . ARG A 1 204 ? 19.842  22.978  21.991  1.00 30.84 ? 205  ARG A CB    1 
ATOM   1340 C  CG    . ARG A 1 204 ? 19.016  21.943  21.228  1.00 30.03 ? 205  ARG A CG    1 
ATOM   1341 C  CD    . ARG A 1 204 ? 17.802  22.596  20.597  1.00 29.78 ? 205  ARG A CD    1 
ATOM   1342 N  NE    . ARG A 1 204 ? 17.081  21.666  19.712  1.00 32.99 ? 205  ARG A NE    1 
ATOM   1343 C  CZ    . ARG A 1 204 ? 15.974  21.997  19.046  1.00 31.62 ? 205  ARG A CZ    1 
ATOM   1344 N  NH1   . ARG A 1 204 ? 15.423  23.198  19.215  1.00 34.00 ? 205  ARG A NH1   1 
ATOM   1345 N  NH2   . ARG A 1 204 ? 15.388  21.111  18.253  1.00 33.16 ? 205  ARG A NH2   1 
ATOM   1346 N  N     . SER A 1 205 ? 21.710  24.159  24.249  1.00 31.18 ? 206  SER A N     1 
ATOM   1347 C  CA    . SER A 1 205 ? 22.494  25.320  24.734  1.00 31.34 ? 206  SER A CA    1 
ATOM   1348 C  C     . SER A 1 205 ? 23.958  24.965  24.937  1.00 30.62 ? 206  SER A C     1 
ATOM   1349 O  O     . SER A 1 205 ? 24.832  25.830  24.807  1.00 32.40 ? 206  SER A O     1 
ATOM   1350 C  CB    . SER A 1 205 ? 21.932  25.895  26.065  1.00 31.58 ? 206  SER A CB    1 
ATOM   1351 O  OG    . SER A 1 205 ? 22.058  25.004  27.139  1.00 30.71 ? 206  SER A OG    1 
ATOM   1352 N  N     . GLU A 1 206 ? 24.225  23.704  25.281  1.00 31.01 ? 207  GLU A N     1 
ATOM   1353 C  CA    . GLU A 1 206 ? 25.562  23.235  25.598  1.00 31.70 ? 207  GLU A CA    1 
ATOM   1354 C  C     . GLU A 1 206 ? 26.441  22.967  24.355  1.00 32.39 ? 207  GLU A C     1 
ATOM   1355 O  O     . GLU A 1 206 ? 27.659  23.018  24.450  1.00 31.74 ? 207  GLU A O     1 
ATOM   1356 C  CB    . GLU A 1 206 ? 25.508  21.934  26.421  1.00 32.04 ? 207  GLU A CB    1 
ATOM   1357 C  CG    . GLU A 1 206 ? 24.811  22.052  27.768  1.00 31.51 ? 207  GLU A CG    1 
ATOM   1358 C  CD    . GLU A 1 206 ? 25.664  22.710  28.833  1.00 31.49 ? 207  GLU A CD    1 
ATOM   1359 O  OE1   . GLU A 1 206 ? 26.919  22.765  28.697  1.00 34.24 ? 207  GLU A OE1   1 
ATOM   1360 O  OE2   . GLU A 1 206 ? 25.092  23.249  29.822  1.00 33.62 ? 207  GLU A OE2   1 
ATOM   1361 N  N     . ARG A 1 207 ? 25.818  22.684  23.217  1.00 32.80 ? 208  ARG A N     1 
ATOM   1362 C  CA    . ARG A 1 207 ? 26.528  22.082  22.084  1.00 32.82 ? 208  ARG A CA    1 
ATOM   1363 C  C     . ARG A 1 207 ? 27.544  23.006  21.375  1.00 32.70 ? 208  ARG A C     1 
ATOM   1364 O  O     . ARG A 1 207 ? 28.501  22.496  20.805  1.00 31.98 ? 208  ARG A O     1 
ATOM   1365 C  CB    . ARG A 1 207 ? 25.528  21.500  21.078  1.00 33.32 ? 208  ARG A CB    1 
ATOM   1366 C  CG    . ARG A 1 207 ? 24.714  20.379  21.649  1.00 34.39 ? 208  ARG A CG    1 
ATOM   1367 C  CD    . ARG A 1 207 ? 23.741  19.860  20.646  1.00 34.53 ? 208  ARG A CD    1 
ATOM   1368 N  NE    . ARG A 1 207 ? 22.676  19.102  21.326  1.00 32.58 ? 208  ARG A NE    1 
ATOM   1369 C  CZ    . ARG A 1 207 ? 21.454  18.932  20.837  1.00 33.90 ? 208  ARG A CZ    1 
ATOM   1370 N  NH1   . ARG A 1 207 ? 21.150  19.403  19.630  1.00 33.89 ? 208  ARG A NH1   1 
ATOM   1371 N  NH2   . ARG A 1 207 ? 20.524  18.272  21.549  1.00 33.01 ? 208  ARG A NH2   1 
ATOM   1372 N  N     . LYS A 1 208 ? 27.357  24.328  21.437  1.00 32.82 ? 209  LYS A N     1 
ATOM   1373 C  CA    . LYS A 1 208 ? 28.344  25.309  20.974  1.00 33.33 ? 209  LYS A CA    1 
ATOM   1374 C  C     . LYS A 1 208 ? 29.694  25.173  21.705  1.00 33.09 ? 209  LYS A C     1 
ATOM   1375 O  O     . LYS A 1 208 ? 30.676  25.717  21.250  1.00 32.50 ? 209  LYS A O     1 
ATOM   1376 C  CB    . LYS A 1 208 ? 27.824  26.769  21.157  1.00 33.10 ? 209  LYS A CB    1 
ATOM   1377 C  CG    . LYS A 1 208 ? 27.632  27.171  22.647  1.00 34.39 ? 209  LYS A CG    1 
ATOM   1378 C  CD    . LYS A 1 208 ? 27.350  28.640  22.930  1.00 35.15 ? 209  LYS A CD    1 
ATOM   1379 C  CE    . LYS A 1 208 ? 25.953  29.077  22.457  1.00 37.46 ? 209  LYS A CE    1 
ATOM   1380 N  NZ    . LYS A 1 208 ? 24.787  28.391  23.081  1.00 34.84 ? 209  LYS A NZ    1 
ATOM   1381 N  N     . LYS A 1 209 ? 29.712  24.512  22.864  1.00 32.88 ? 210  LYS A N     1 
ATOM   1382 C  CA    . LYS A 1 209 ? 30.955  24.285  23.630  1.00 32.61 ? 210  LYS A CA    1 
ATOM   1383 C  C     . LYS A 1 209 ? 31.769  23.077  23.186  1.00 32.30 ? 210  LYS A C     1 
ATOM   1384 O  O     . LYS A 1 209 ? 32.966  22.990  23.466  1.00 33.10 ? 210  LYS A O     1 
ATOM   1385 C  CB    . LYS A 1 209 ? 30.655  24.088  25.111  1.00 31.76 ? 210  LYS A CB    1 
ATOM   1386 C  CG    . LYS A 1 209 ? 29.835  25.155  25.767  1.00 31.43 ? 210  LYS A CG    1 
ATOM   1387 C  CD    . LYS A 1 209 ? 29.411  24.695  27.144  1.00 32.21 ? 210  LYS A CD    1 
ATOM   1388 C  CE    . LYS A 1 209 ? 28.544  25.739  27.840  1.00 31.82 ? 210  LYS A CE    1 
ATOM   1389 N  NZ    . LYS A 1 209 ? 28.201  25.380  29.255  1.00 30.78 ? 210  LYS A NZ    1 
ATOM   1390 N  N     . TRP A 1 210 ? 31.126  22.147  22.513  1.00 32.51 ? 211  TRP A N     1 
ATOM   1391 C  CA    . TRP A 1 210 ? 31.724  20.843  22.202  1.00 32.57 ? 211  TRP A CA    1 
ATOM   1392 C  C     . TRP A 1 210 ? 32.999  20.971  21.371  1.00 32.62 ? 211  TRP A C     1 
ATOM   1393 O  O     . TRP A 1 210 ? 33.926  20.193  21.560  1.00 32.89 ? 211  TRP A O     1 
ATOM   1394 C  CB    . TRP A 1 210 ? 30.732  19.991  21.429  1.00 32.15 ? 211  TRP A CB    1 
ATOM   1395 C  CG    . TRP A 1 210 ? 29.567  19.471  22.224  1.00 32.04 ? 211  TRP A CG    1 
ATOM   1396 C  CD1   . TRP A 1 210 ? 29.164  19.868  23.455  1.00 32.84 ? 211  TRP A CD1   1 
ATOM   1397 C  CD2   . TRP A 1 210 ? 28.658  18.455  21.804  1.00 31.28 ? 211  TRP A CD2   1 
ATOM   1398 N  NE1   . TRP A 1 210 ? 28.039  19.134  23.849  1.00 33.25 ? 211  TRP A NE1   1 
ATOM   1399 C  CE2   . TRP A 1 210 ? 27.715  18.263  22.843  1.00 33.20 ? 211  TRP A CE2   1 
ATOM   1400 C  CE3   . TRP A 1 210 ? 28.542  17.675  20.643  1.00 32.45 ? 211  TRP A CE3   1 
ATOM   1401 C  CZ2   . TRP A 1 210 ? 26.679  17.305  22.750  1.00 30.98 ? 211  TRP A CZ2   1 
ATOM   1402 C  CZ3   . TRP A 1 210 ? 27.520  16.756  20.553  1.00 31.79 ? 211  TRP A CZ3   1 
ATOM   1403 C  CH2   . TRP A 1 210 ? 26.604  16.575  21.604  1.00 32.88 ? 211  TRP A CH2   1 
ATOM   1404 N  N     . ILE A 1 211 ? 33.017  21.934  20.449  1.00 33.50 ? 212  ILE A N     1 
ATOM   1405 C  CA    . ILE A 1 211 ? 34.185  22.174  19.567  1.00 34.41 ? 212  ILE A CA    1 
ATOM   1406 C  C     . ILE A 1 211 ? 35.496  22.268  20.353  1.00 34.74 ? 212  ILE A C     1 
ATOM   1407 O  O     . ILE A 1 211 ? 36.549  21.842  19.856  1.00 34.88 ? 212  ILE A O     1 
ATOM   1408 C  CB    . ILE A 1 211 ? 34.002  23.461  18.687  1.00 34.65 ? 212  ILE A CB    1 
ATOM   1409 C  CG1   . ILE A 1 211 ? 35.194  23.686  17.714  1.00 35.15 ? 212  ILE A CG1   1 
ATOM   1410 C  CG2   . ILE A 1 211 ? 33.839  24.718  19.558  1.00 35.22 ? 212  ILE A CG2   1 
ATOM   1411 C  CD1   . ILE A 1 211 ? 35.087  22.961  16.379  1.00 35.95 ? 212  ILE A CD1   1 
ATOM   1412 N  N     . HIS A 1 212 ? 35.441  22.809  21.567  1.00 35.05 ? 213  HIS A N     1 
ATOM   1413 C  CA    . HIS A 1 212 ? 36.635  22.897  22.408  1.00 35.85 ? 213  HIS A CA    1 
ATOM   1414 C  C     . HIS A 1 212 ? 37.375  21.571  22.571  1.00 36.46 ? 213  HIS A C     1 
ATOM   1415 O  O     . HIS A 1 212 ? 38.586  21.563  22.746  1.00 35.74 ? 213  HIS A O     1 
ATOM   1416 C  CB    . HIS A 1 212 ? 36.314  23.469  23.784  1.00 36.48 ? 213  HIS A CB    1 
ATOM   1417 C  CG    . HIS A 1 212 ? 35.880  24.898  23.746  1.00 37.06 ? 213  HIS A CG    1 
ATOM   1418 N  ND1   . HIS A 1 212 ? 36.751  25.928  23.476  1.00 39.65 ? 213  HIS A ND1   1 
ATOM   1419 C  CD2   . HIS A 1 212 ? 34.665  25.470  23.939  1.00 38.35 ? 213  HIS A CD2   1 
ATOM   1420 C  CE1   . HIS A 1 212 ? 36.088  27.074  23.493  1.00 40.17 ? 213  HIS A CE1   1 
ATOM   1421 N  NE2   . HIS A 1 212 ? 34.819  26.822  23.766  1.00 38.05 ? 213  HIS A NE2   1 
ATOM   1422 N  N     . CYS A 1 213 ? 36.655  20.453  22.526  1.00 37.11 ? 214  CYS A N     1 
ATOM   1423 C  CA    . CYS A 1 213 ? 37.280  19.177  22.787  1.00 37.92 ? 214  CYS A CA    1 
ATOM   1424 C  C     . CYS A 1 213 ? 37.440  18.307  21.517  1.00 36.92 ? 214  CYS A C     1 
ATOM   1425 O  O     . CYS A 1 213 ? 37.765  17.128  21.624  1.00 36.93 ? 214  CYS A O     1 
ATOM   1426 C  CB    . CYS A 1 213 ? 36.528  18.456  23.909  1.00 38.39 ? 214  CYS A CB    1 
ATOM   1427 S  SG    . CYS A 1 213 ? 34.872  17.917  23.550  1.00 43.38 ? 214  CYS A SG    1 
ATOM   1428 N  N     . PHE A 1 214 ? 37.267  18.897  20.331  1.00 35.39 ? 215  PHE A N     1 
ATOM   1429 C  CA    . PHE A 1 214 ? 37.184  18.118  19.092  1.00 35.12 ? 215  PHE A CA    1 
ATOM   1430 C  C     . PHE A 1 214 ? 38.543  17.760  18.462  1.00 35.56 ? 215  PHE A C     1 
ATOM   1431 O  O     . PHE A 1 214 ? 38.576  17.053  17.455  1.00 35.63 ? 215  PHE A O     1 
ATOM   1432 C  CB    . PHE A 1 214 ? 36.330  18.858  18.050  1.00 35.43 ? 215  PHE A CB    1 
ATOM   1433 C  CG    . PHE A 1 214 ? 34.847  18.635  18.166  1.00 35.04 ? 215  PHE A CG    1 
ATOM   1434 C  CD1   . PHE A 1 214 ? 34.286  17.990  19.243  1.00 36.00 ? 215  PHE A CD1   1 
ATOM   1435 C  CD2   . PHE A 1 214 ? 34.011  19.095  17.172  1.00 36.32 ? 215  PHE A CD2   1 
ATOM   1436 C  CE1   . PHE A 1 214 ? 32.927  17.801  19.321  1.00 36.37 ? 215  PHE A CE1   1 
ATOM   1437 C  CE2   . PHE A 1 214 ? 32.657  18.898  17.242  1.00 35.76 ? 215  PHE A CE2   1 
ATOM   1438 C  CZ    . PHE A 1 214 ? 32.114  18.260  18.317  1.00 35.37 ? 215  PHE A CZ    1 
ATOM   1439 N  N     . GLU A 1 215 ? 39.637  18.247  19.043  1.00 34.84 ? 216  GLU A N     1 
ATOM   1440 C  CA    . GLU A 1 215 ? 40.975  18.011  18.507  1.00 35.82 ? 216  GLU A CA    1 
ATOM   1441 C  C     . GLU A 1 215 ? 41.560  16.667  18.895  1.00 34.88 ? 216  GLU A C     1 
ATOM   1442 O  O     . GLU A 1 215 ? 41.613  16.321  20.070  1.00 35.19 ? 216  GLU A O     1 
ATOM   1443 C  CB    . GLU A 1 215 ? 41.935  19.116  18.956  1.00 36.20 ? 216  GLU A CB    1 
ATOM   1444 C  CG    . GLU A 1 215 ? 42.255  20.096  17.877  1.00 39.74 ? 216  GLU A CG    1 
ATOM   1445 C  CD    . GLU A 1 215 ? 43.320  21.092  18.309  1.00 43.77 ? 216  GLU A CD    1 
ATOM   1446 O  OE1   . GLU A 1 215 ? 43.066  22.304  18.149  1.00 48.48 ? 216  GLU A OE1   1 
ATOM   1447 O  OE2   . GLU A 1 215 ? 44.387  20.669  18.821  1.00 44.93 ? 216  GLU A OE2   1 
ATOM   1448 N  N     . GLY A 1 216 ? 42.011  15.919  17.895  1.00 34.03 ? 217  GLY A N     1 
ATOM   1449 C  CA    . GLY A 1 216 ? 42.787  14.713  18.131  1.00 33.72 ? 217  GLY A CA    1 
ATOM   1450 C  C     . GLY A 1 216 ? 42.020  13.643  18.862  1.00 33.19 ? 217  GLY A C     1 
ATOM   1451 O  O     . GLY A 1 216 ? 42.544  13.032  19.805  1.00 32.70 ? 217  GLY A O     1 
ATOM   1452 N  N     . VAL A 1 217 ? 40.777  13.423  18.424  1.00 32.61 ? 218  VAL A N     1 
ATOM   1453 C  CA    . VAL A 1 217 ? 39.866  12.492  19.086  1.00 32.30 ? 218  VAL A CA    1 
ATOM   1454 C  C     . VAL A 1 217 ? 40.044  11.079  18.512  1.00 31.96 ? 218  VAL A C     1 
ATOM   1455 O  O     . VAL A 1 217 ? 39.822  10.837  17.323  1.00 32.20 ? 218  VAL A O     1 
ATOM   1456 C  CB    . VAL A 1 217 ? 38.369  12.944  18.976  1.00 32.23 ? 218  VAL A CB    1 
ATOM   1457 C  CG1   . VAL A 1 217 ? 37.414  11.906  19.569  1.00 30.55 ? 218  VAL A CG1   1 
ATOM   1458 C  CG2   . VAL A 1 217 ? 38.169  14.296  19.660  1.00 32.27 ? 218  VAL A CG2   1 
ATOM   1459 N  N     . THR A 1 218 ? 40.455  10.176  19.395  1.00 31.43 ? 219  THR A N     1 
ATOM   1460 C  CA    . THR A 1 218 ? 40.651  8.777   19.109  1.00 31.43 ? 219  THR A CA    1 
ATOM   1461 C  C     . THR A 1 218 ? 39.333  8.027   18.938  1.00 31.81 ? 219  THR A C     1 
ATOM   1462 O  O     . THR A 1 218 ? 39.200  7.203   18.035  1.00 32.44 ? 219  THR A O     1 
ATOM   1463 C  CB    . THR A 1 218 ? 41.435  8.110   20.254  1.00 31.24 ? 219  THR A CB    1 
ATOM   1464 O  OG1   . THR A 1 218 ? 42.523  8.968   20.639  1.00 28.37 ? 219  THR A OG1   1 
ATOM   1465 C  CG2   . THR A 1 218 ? 41.956  6.717   19.814  1.00 30.36 ? 219  THR A CG2   1 
ATOM   1466 N  N     . ALA A 1 219 ? 38.373  8.306   19.811  1.00 32.67 ? 220  ALA A N     1 
ATOM   1467 C  CA    . ALA A 1 219 ? 37.094  7.603   19.809  1.00 32.19 ? 220  ALA A CA    1 
ATOM   1468 C  C     . ALA A 1 219 ? 35.956  8.477   20.397  1.00 32.28 ? 220  ALA A C     1 
ATOM   1469 O  O     . ALA A 1 219 ? 36.197  9.306   21.282  1.00 30.99 ? 220  ALA A O     1 
ATOM   1470 C  CB    . ALA A 1 219 ? 37.246  6.271   20.585  1.00 32.62 ? 220  ALA A CB    1 
ATOM   1471 N  N     . ILE A 1 220 ? 34.753  8.317   19.838  1.00 31.17 ? 221  ILE A N     1 
ATOM   1472 C  CA    . ILE A 1 220 ? 33.513  8.907   20.354  1.00 31.76 ? 221  ILE A CA    1 
ATOM   1473 C  C     . ILE A 1 220 ? 32.577  7.740   20.716  1.00 32.13 ? 221  ILE A C     1 
ATOM   1474 O  O     . ILE A 1 220 ? 32.411  6.817   19.928  1.00 33.50 ? 221  ILE A O     1 
ATOM   1475 C  CB    . ILE A 1 220 ? 32.808  9.801   19.281  1.00 31.12 ? 221  ILE A CB    1 
ATOM   1476 C  CG1   . ILE A 1 220 ? 33.710  11.010  18.954  1.00 32.27 ? 221  ILE A CG1   1 
ATOM   1477 C  CG2   . ILE A 1 220 ? 31.378  10.219  19.774  1.00 32.30 ? 221  ILE A CG2   1 
ATOM   1478 C  CD1   . ILE A 1 220 ? 33.302  11.875  17.759  1.00 30.11 ? 221  ILE A CD1   1 
ATOM   1479 N  N     . ILE A 1 221 ? 32.037  7.757   21.930  1.00 32.68 ? 222  ILE A N     1 
ATOM   1480 C  CA    . ILE A 1 221 ? 30.882  6.957   22.263  1.00 32.95 ? 222  ILE A CA    1 
ATOM   1481 C  C     . ILE A 1 221 ? 29.684  7.922   22.191  1.00 32.98 ? 222  ILE A C     1 
ATOM   1482 O  O     . ILE A 1 221 ? 29.573  8.852   22.982  1.00 33.94 ? 222  ILE A O     1 
ATOM   1483 C  CB    . ILE A 1 221 ? 30.981  6.264   23.648  1.00 32.67 ? 222  ILE A CB    1 
ATOM   1484 C  CG1   . ILE A 1 221 ? 32.078  5.201   23.649  1.00 33.59 ? 222  ILE A CG1   1 
ATOM   1485 C  CG2   . ILE A 1 221 ? 29.663  5.567   23.999  1.00 32.56 ? 222  ILE A CG2   1 
ATOM   1486 C  CD1   . ILE A 1 221 ? 32.469  4.666   25.052  1.00 32.57 ? 222  ILE A CD1   1 
ATOM   1487 N  N     . PHE A 1 222 ? 28.819  7.715   21.193  1.00 32.98 ? 223  PHE A N     1 
ATOM   1488 C  CA    . PHE A 1 222 ? 27.661  8.553   20.980  1.00 32.19 ? 223  PHE A CA    1 
ATOM   1489 C  C     . PHE A 1 222 ? 26.473  7.817   21.539  1.00 32.78 ? 223  PHE A C     1 
ATOM   1490 O  O     . PHE A 1 222 ? 26.130  6.734   21.074  1.00 32.72 ? 223  PHE A O     1 
ATOM   1491 C  CB    . PHE A 1 222 ? 27.455  8.870   19.510  1.00 32.39 ? 223  PHE A CB    1 
ATOM   1492 C  CG    . PHE A 1 222 ? 26.403  9.912   19.249  1.00 32.36 ? 223  PHE A CG    1 
ATOM   1493 C  CD1   . PHE A 1 222 ? 26.768  11.245  19.050  1.00 33.03 ? 223  PHE A CD1   1 
ATOM   1494 C  CD2   . PHE A 1 222 ? 25.050  9.589   19.237  1.00 31.58 ? 223  PHE A CD2   1 
ATOM   1495 C  CE1   . PHE A 1 222 ? 25.844  12.209  18.810  1.00 33.87 ? 223  PHE A CE1   1 
ATOM   1496 C  CE2   . PHE A 1 222 ? 24.109  10.593  19.019  1.00 32.69 ? 223  PHE A CE2   1 
ATOM   1497 C  CZ    . PHE A 1 222 ? 24.510  11.897  18.810  1.00 32.03 ? 223  PHE A CZ    1 
ATOM   1498 N  N     . CYS A 1 223 ? 25.873  8.397   22.574  1.00 32.70 ? 224  CYS A N     1 
ATOM   1499 C  CA    . CYS A 1 223 ? 24.776  7.753   23.295  1.00 33.43 ? 224  CYS A CA    1 
ATOM   1500 C  C     . CYS A 1 223 ? 23.437  8.221   22.748  1.00 32.73 ? 224  CYS A C     1 
ATOM   1501 O  O     . CYS A 1 223 ? 23.224  9.421   22.562  1.00 33.68 ? 224  CYS A O     1 
ATOM   1502 C  CB    . CYS A 1 223 ? 24.839  8.066   24.802  1.00 32.23 ? 224  CYS A CB    1 
ATOM   1503 S  SG    . CYS A 1 223 ? 26.339  7.446   25.631  1.00 35.21 ? 224  CYS A SG    1 
ATOM   1504 N  N     . VAL A 1 224 ? 22.532  7.263   22.582  1.00 33.28 ? 225  VAL A N     1 
ATOM   1505 C  CA    . VAL A 1 224 ? 21.162  7.474   22.104  1.00 33.50 ? 225  VAL A CA    1 
ATOM   1506 C  C     . VAL A 1 224 ? 20.245  6.717   23.084  1.00 34.09 ? 225  VAL A C     1 
ATOM   1507 O  O     . VAL A 1 224 ? 20.431  5.520   23.338  1.00 35.09 ? 225  VAL A O     1 
ATOM   1508 C  CB    . VAL A 1 224 ? 20.962  6.901   20.661  1.00 34.21 ? 225  VAL A CB    1 
ATOM   1509 C  CG1   . VAL A 1 224 ? 19.461  6.933   20.249  1.00 32.36 ? 225  VAL A CG1   1 
ATOM   1510 C  CG2   . VAL A 1 224 ? 21.836  7.658   19.663  1.00 34.05 ? 225  VAL A CG2   1 
ATOM   1511 N  N     . ALA A 1 225 ? 19.304  7.427   23.682  1.00 34.39 ? 226  ALA A N     1 
ATOM   1512 C  CA    . ALA A 1 225 ? 18.261  6.817   24.505  1.00 33.71 ? 226  ALA A CA    1 
ATOM   1513 C  C     . ALA A 1 225 ? 17.231  6.162   23.571  1.00 34.54 ? 226  ALA A C     1 
ATOM   1514 O  O     . ALA A 1 225 ? 16.454  6.841   22.904  1.00 35.63 ? 226  ALA A O     1 
ATOM   1515 C  CB    . ALA A 1 225 ? 17.608  7.850   25.432  1.00 33.90 ? 226  ALA A CB    1 
ATOM   1516 N  N     . LEU A 1 226 ? 17.272  4.838   23.483  1.00 33.43 ? 227  LEU A N     1 
ATOM   1517 C  CA    . LEU A 1 226 ? 16.287  4.100   22.657  1.00 33.35 ? 227  LEU A CA    1 
ATOM   1518 C  C     . LEU A 1 226 ? 14.833  4.474   23.014  1.00 33.75 ? 227  LEU A C     1 
ATOM   1519 O  O     . LEU A 1 226 ? 13.959  4.558   22.126  1.00 34.34 ? 227  LEU A O     1 
ATOM   1520 C  CB    . LEU A 1 226 ? 16.458  2.584   22.845  1.00 33.46 ? 227  LEU A CB    1 
ATOM   1521 C  CG    . LEU A 1 226 ? 17.622  1.958   22.074  1.00 32.43 ? 227  LEU A CG    1 
ATOM   1522 C  CD1   . LEU A 1 226 ? 17.858  0.525   22.574  1.00 29.85 ? 227  LEU A CD1   1 
ATOM   1523 C  CD2   . LEU A 1 226 ? 17.289  1.967   20.563  1.00 33.35 ? 227  LEU A CD2   1 
ATOM   1524 N  N     . SER A 1 227 ? 14.619  4.713   24.306  1.00 34.28 ? 228  SER A N     1 
ATOM   1525 C  CA    . SER A 1 227 ? 13.297  4.989   24.885  1.00 36.00 ? 228  SER A CA    1 
ATOM   1526 C  C     . SER A 1 227 ? 12.805  6.425   24.633  1.00 36.46 ? 228  SER A C     1 
ATOM   1527 O  O     . SER A 1 227 ? 11.689  6.773   25.035  1.00 38.43 ? 228  SER A O     1 
ATOM   1528 C  CB    . SER A 1 227 ? 13.334  4.675   26.398  1.00 36.03 ? 228  SER A CB    1 
ATOM   1529 O  OG    . SER A 1 227 ? 14.506  5.211   26.982  1.00 34.59 ? 228  SER A OG    1 
ATOM   1530 N  N     . ASP A 1 228 ? 13.609  7.214   23.921  1.00 36.91 ? 229  ASP A N     1 
ATOM   1531 C  CA    . ASP A 1 228 ? 13.282  8.594   23.507  1.00 37.66 ? 229  ASP A CA    1 
ATOM   1532 C  C     . ASP A 1 228 ? 12.300  8.697   22.389  1.00 36.59 ? 229  ASP A C     1 
ATOM   1533 O  O     . ASP A 1 228 ? 11.858  9.814   22.090  1.00 35.66 ? 229  ASP A O     1 
ATOM   1534 C  CB    . ASP A 1 228 ? 14.531  9.308   22.940  1.00 37.88 ? 229  ASP A CB    1 
ATOM   1535 C  CG    . ASP A 1 228 ? 15.303  10.056  23.974  1.00 41.58 ? 229  ASP A CG    1 
ATOM   1536 O  OD1   . ASP A 1 228 ? 14.961  9.958   25.187  1.00 46.78 ? 229  ASP A OD1   1 
ATOM   1537 O  OD2   . ASP A 1 228 ? 16.250  10.746  23.543  1.00 40.28 ? 229  ASP A OD2   1 
ATOM   1538 N  N     . TYR A 1 229 ? 12.022  7.571   21.693  1.00 34.69 ? 230  TYR A N     1 
ATOM   1539 C  CA    . TYR A 1 229 ? 11.283  7.637   20.431  1.00 33.69 ? 230  TYR A CA    1 
ATOM   1540 C  C     . TYR A 1 229 ? 9.910   8.300   20.497  1.00 32.96 ? 230  TYR A C     1 
ATOM   1541 O  O     . TYR A 1 229 ? 9.400   8.797   19.480  1.00 32.47 ? 230  TYR A O     1 
ATOM   1542 C  CB    . TYR A 1 229 ? 11.157  6.231   19.799  1.00 33.52 ? 230  TYR A CB    1 
ATOM   1543 C  CG    . TYR A 1 229 ? 10.205  5.271   20.509  1.00 32.34 ? 230  TYR A CG    1 
ATOM   1544 C  CD1   . TYR A 1 229 ? 10.659  4.454   21.506  1.00 34.18 ? 230  TYR A CD1   1 
ATOM   1545 C  CD2   . TYR A 1 229 ? 8.852   5.194   20.170  1.00 34.07 ? 230  TYR A CD2   1 
ATOM   1546 C  CE1   . TYR A 1 229 ? 9.855   3.576   22.135  1.00 34.37 ? 230  TYR A CE1   1 
ATOM   1547 C  CE2   . TYR A 1 229 ? 8.014   4.294   20.800  1.00 33.80 ? 230  TYR A CE2   1 
ATOM   1548 C  CZ    . TYR A 1 229 ? 8.534   3.492   21.812  1.00 33.78 ? 230  TYR A CZ    1 
ATOM   1549 O  OH    . TYR A 1 229 ? 7.760   2.550   22.489  1.00 35.11 ? 230  TYR A OH    1 
ATOM   1550 N  N     . ASP A 1 230 ? 9.300   8.296   21.672  1.00 32.81 ? 231  ASP A N     1 
ATOM   1551 C  CA    . ASP A 1 230 ? 7.978   8.909   21.854  1.00 33.23 ? 231  ASP A CA    1 
ATOM   1552 C  C     . ASP A 1 230 ? 7.953   10.132  22.825  1.00 32.61 ? 231  ASP A C     1 
ATOM   1553 O  O     . ASP A 1 230 ? 6.891   10.553  23.297  1.00 31.83 ? 231  ASP A O     1 
ATOM   1554 C  CB    . ASP A 1 230 ? 6.984   7.829   22.264  1.00 34.02 ? 231  ASP A CB    1 
ATOM   1555 C  CG    . ASP A 1 230 ? 7.172   7.369   23.693  1.00 34.20 ? 231  ASP A CG    1 
ATOM   1556 O  OD1   . ASP A 1 230 ? 8.198   7.724   24.287  1.00 37.39 ? 231  ASP A OD1   1 
ATOM   1557 O  OD2   . ASP A 1 230 ? 6.317   6.586   24.176  1.00 34.77 ? 231  ASP A OD2   1 
ATOM   1558 N  N     . LEU A 1 231 ? 9.128   10.693  23.093  1.00 32.69 ? 232  LEU A N     1 
ATOM   1559 C  CA    . LEU A 1 231 ? 9.304   11.841  23.961  1.00 32.43 ? 232  LEU A CA    1 
ATOM   1560 C  C     . LEU A 1 231 ? 9.649   13.070  23.170  1.00 32.78 ? 232  LEU A C     1 
ATOM   1561 O  O     . LEU A 1 231 ? 10.127  12.992  22.024  1.00 32.84 ? 232  LEU A O     1 
ATOM   1562 C  CB    . LEU A 1 231 ? 10.447  11.586  24.968  1.00 33.18 ? 232  LEU A CB    1 
ATOM   1563 C  CG    . LEU A 1 231 ? 10.323  10.297  25.794  1.00 34.42 ? 232  LEU A CG    1 
ATOM   1564 C  CD1   . LEU A 1 231 ? 11.507  10.097  26.788  1.00 35.54 ? 232  LEU A CD1   1 
ATOM   1565 C  CD2   . LEU A 1 231 ? 8.965   10.295  26.506  1.00 33.78 ? 232  LEU A CD2   1 
ATOM   1566 N  N     . VAL A 1 232 ? 9.427   14.218  23.804  1.00 31.85 ? 233  VAL A N     1 
ATOM   1567 C  CA    . VAL A 1 232 ? 9.889   15.495  23.285  1.00 31.47 ? 233  VAL A CA    1 
ATOM   1568 C  C     . VAL A 1 232 ? 11.036  16.088  24.155  1.00 31.36 ? 233  VAL A C     1 
ATOM   1569 O  O     . VAL A 1 232 ? 11.228  15.720  25.326  1.00 31.99 ? 233  VAL A O     1 
ATOM   1570 C  CB    . VAL A 1 232 ? 8.725   16.484  23.073  1.00 30.98 ? 233  VAL A CB    1 
ATOM   1571 C  CG1   . VAL A 1 232 ? 7.747   15.964  21.981  1.00 29.33 ? 233  VAL A CG1   1 
ATOM   1572 C  CG2   . VAL A 1 232 ? 8.025   16.822  24.401  1.00 29.00 ? 233  VAL A CG2   1 
ATOM   1573 N  N     . LEU A 1 233 ? 11.823  16.953  23.531  1.00 31.37 ? 234  LEU A N     1 
ATOM   1574 C  CA    . LEU A 1 233 ? 12.931  17.656  24.198  1.00 31.35 ? 234  LEU A CA    1 
ATOM   1575 C  C     . LEU A 1 233 ? 12.413  18.567  25.323  1.00 30.67 ? 234  LEU A C     1 
ATOM   1576 O  O     . LEU A 1 233 ? 11.441  19.301  25.171  1.00 30.17 ? 234  LEU A O     1 
ATOM   1577 C  CB    . LEU A 1 233 ? 13.718  18.499  23.199  1.00 30.75 ? 234  LEU A CB    1 
ATOM   1578 C  CG    . LEU A 1 233 ? 14.489  17.833  22.059  1.00 31.75 ? 234  LEU A CG    1 
ATOM   1579 C  CD1   . LEU A 1 233 ? 15.089  18.922  21.187  1.00 31.02 ? 234  LEU A CD1   1 
ATOM   1580 C  CD2   . LEU A 1 233 ? 15.580  16.826  22.580  1.00 31.25 ? 234  LEU A CD2   1 
ATOM   1581 N  N     . ALA A 1 234 ? 13.081  18.492  26.471  1.00 31.27 ? 235  ALA A N     1 
ATOM   1582 C  CA    . ALA A 1 234 ? 12.822  19.425  27.561  1.00 31.30 ? 235  ALA A CA    1 
ATOM   1583 C  C     . ALA A 1 234 ? 13.037  20.888  27.112  1.00 30.41 ? 235  ALA A C     1 
ATOM   1584 O  O     . ALA A 1 234 ? 12.342  21.791  27.585  1.00 30.71 ? 235  ALA A O     1 
ATOM   1585 C  CB    . ALA A 1 234 ? 13.736  19.063  28.745  1.00 31.40 ? 235  ALA A CB    1 
ATOM   1586 N  N     . GLU A 1 235 ? 13.994  21.107  26.202  1.00 30.91 ? 236  GLU A N     1 
ATOM   1587 C  CA    . GLU A 1 235 ? 14.318  22.454  25.721  1.00 32.39 ? 236  GLU A CA    1 
ATOM   1588 C  C     . GLU A 1 235 ? 13.507  22.883  24.484  1.00 32.39 ? 236  GLU A C     1 
ATOM   1589 O  O     . GLU A 1 235 ? 13.589  24.019  24.030  1.00 32.54 ? 236  GLU A O     1 
ATOM   1590 C  CB    . GLU A 1 235 ? 15.833  22.594  25.451  1.00 32.85 ? 236  GLU A CB    1 
ATOM   1591 C  CG    . GLU A 1 235 ? 16.391  21.798  24.268  1.00 33.17 ? 236  GLU A CG    1 
ATOM   1592 C  CD    . GLU A 1 235 ? 16.969  20.425  24.669  1.00 33.52 ? 236  GLU A CD    1 
ATOM   1593 O  OE1   . GLU A 1 235 ? 16.291  19.694  25.430  1.00 34.43 ? 236  GLU A OE1   1 
ATOM   1594 O  OE2   . GLU A 1 235 ? 18.093  20.071  24.236  1.00 34.27 ? 236  GLU A OE2   1 
ATOM   1595 N  N     . ASP A 1 236 ? 12.699  21.979  23.945  1.00 31.77 ? 237  ASP A N     1 
ATOM   1596 C  CA    . ASP A 1 236 ? 11.832  22.274  22.799  1.00 31.92 ? 237  ASP A CA    1 
ATOM   1597 C  C     . ASP A 1 236 ? 10.786  21.177  22.737  1.00 31.99 ? 237  ASP A C     1 
ATOM   1598 O  O     . ASP A 1 236 ? 11.020  20.075  22.190  1.00 31.07 ? 237  ASP A O     1 
ATOM   1599 C  CB    . ASP A 1 236 ? 12.621  22.264  21.476  1.00 31.38 ? 237  ASP A CB    1 
ATOM   1600 C  CG    . ASP A 1 236 ? 11.752  22.607  20.253  1.00 34.47 ? 237  ASP A CG    1 
ATOM   1601 O  OD1   . ASP A 1 236 ? 10.484  22.593  20.311  1.00 33.03 ? 237  ASP A OD1   1 
ATOM   1602 O  OD2   . ASP A 1 236 ? 12.360  22.907  19.186  1.00 34.85 ? 237  ASP A OD2   1 
ATOM   1603 N  N     . GLU A 1 237 ? 9.623   21.492  23.272  1.00 31.45 ? 238  GLU A N     1 
ATOM   1604 C  CA    . GLU A 1 237 ? 8.622   20.446  23.488  1.00 32.13 ? 238  GLU A CA    1 
ATOM   1605 C  C     . GLU A 1 237 ? 7.873   20.084  22.205  1.00 32.48 ? 238  GLU A C     1 
ATOM   1606 O  O     . GLU A 1 237 ? 7.007   19.215  22.247  1.00 31.59 ? 238  GLU A O     1 
ATOM   1607 C  CB    . GLU A 1 237 ? 7.640   20.887  24.594  1.00 31.62 ? 238  GLU A CB    1 
ATOM   1608 C  CG    . GLU A 1 237 ? 8.333   21.105  25.936  1.00 34.19 ? 238  GLU A CG    1 
ATOM   1609 C  CD    . GLU A 1 237 ? 7.357   21.477  27.049  1.00 35.52 ? 238  GLU A CD    1 
ATOM   1610 O  OE1   . GLU A 1 237 ? 6.138   21.555  26.763  1.00 37.09 ? 238  GLU A OE1   1 
ATOM   1611 O  OE2   . GLU A 1 237 ? 7.801   21.684  28.208  1.00 38.22 ? 238  GLU A OE2   1 
ATOM   1612 N  N     . GLU A 1 238 ? 8.215   20.731  21.086  1.00 32.30 ? 239  GLU A N     1 
ATOM   1613 C  CA    . GLU A 1 238 ? 7.692   20.385  19.766  1.00 33.66 ? 239  GLU A CA    1 
ATOM   1614 C  C     . GLU A 1 238 ? 8.736   19.705  18.881  1.00 34.16 ? 239  GLU A C     1 
ATOM   1615 O  O     . GLU A 1 238 ? 8.610   19.752  17.611  1.00 35.42 ? 239  GLU A O     1 
ATOM   1616 C  CB    . GLU A 1 238 ? 7.223   21.634  19.018  1.00 33.22 ? 239  GLU A CB    1 
ATOM   1617 C  CG    . GLU A 1 238 ? 6.093   22.429  19.655  1.00 34.41 ? 239  GLU A CG    1 
ATOM   1618 C  CD    . GLU A 1 238 ? 6.505   23.146  20.937  1.00 34.99 ? 239  GLU A CD    1 
ATOM   1619 O  OE1   . GLU A 1 238 ? 7.596   23.779  20.999  1.00 35.00 ? 239  GLU A OE1   1 
ATOM   1620 O  OE2   . GLU A 1 238 ? 5.725   23.072  21.904  1.00 35.88 ? 239  GLU A OE2   1 
ATOM   1621 N  N     . MET A 1 239 ? 9.751   19.132  19.507  1.00 32.63 ? 240  MET A N     1 
ATOM   1622 C  CA    . MET A 1 239 ? 10.764  18.327  18.817  1.00 32.91 ? 240  MET A CA    1 
ATOM   1623 C  C     . MET A 1 239 ? 10.835  16.940  19.410  1.00 33.05 ? 240  MET A C     1 
ATOM   1624 O  O     . MET A 1 239 ? 11.157  16.765  20.571  1.00 32.31 ? 240  MET A O     1 
ATOM   1625 C  CB    . MET A 1 239 ? 12.156  18.971  18.868  1.00 32.19 ? 240  MET A CB    1 
ATOM   1626 C  CG    . MET A 1 239 ? 13.212  18.185  18.148  1.00 34.60 ? 240  MET A CG    1 
ATOM   1627 S  SD    . MET A 1 239 ? 12.856  18.011  16.346  1.00 38.12 ? 240  MET A SD    1 
ATOM   1628 C  CE    . MET A 1 239 ? 14.438  17.320  15.821  1.00 37.48 ? 240  MET A CE    1 
ATOM   1629 N  N     . ASN A 1 240 ? 10.575  15.932  18.579  1.00 31.56 ? 241  ASN A N     1 
ATOM   1630 C  CA    . ASN A 1 240 ? 10.793  14.554  18.980  1.00 31.93 ? 241  ASN A CA    1 
ATOM   1631 C  C     . ASN A 1 240 ? 12.260  14.287  19.358  1.00 31.24 ? 241  ASN A C     1 
ATOM   1632 O  O     . ASN A 1 240 ? 13.169  14.652  18.605  1.00 31.46 ? 241  ASN A O     1 
ATOM   1633 C  CB    . ASN A 1 240 ? 10.345  13.611  17.847  1.00 31.49 ? 241  ASN A CB    1 
ATOM   1634 C  CG    . ASN A 1 240 ? 10.505  12.176  18.202  1.00 32.35 ? 241  ASN A CG    1 
ATOM   1635 O  OD1   . ASN A 1 240 ? 11.616  11.646  18.196  1.00 31.94 ? 241  ASN A OD1   1 
ATOM   1636 N  ND2   . ASN A 1 240 ? 9.379   11.510  18.486  1.00 32.45 ? 241  ASN A ND2   1 
ATOM   1637 N  N     . ARG A 1 241 ? 12.464  13.670  20.513  1.00 31.63 ? 242  ARG A N     1 
ATOM   1638 C  CA    . ARG A 1 241 ? 13.816  13.497  21.087  1.00 32.15 ? 242  ARG A CA    1 
ATOM   1639 C  C     . ARG A 1 241 ? 14.718  12.603  20.209  1.00 32.22 ? 242  ARG A C     1 
ATOM   1640 O  O     . ARG A 1 241 ? 15.941  12.832  20.075  1.00 31.80 ? 242  ARG A O     1 
ATOM   1641 C  CB    . ARG A 1 241 ? 13.712  12.856  22.447  1.00 32.66 ? 242  ARG A CB    1 
ATOM   1642 C  CG    . ARG A 1 241 ? 13.285  13.780  23.557  1.00 33.00 ? 242  ARG A CG    1 
ATOM   1643 C  CD    . ARG A 1 241 ? 13.841  13.299  24.852  1.00 34.54 ? 242  ARG A CD    1 
ATOM   1644 N  NE    . ARG A 1 241 ? 13.455  14.188  25.966  1.00 36.75 ? 242  ARG A NE    1 
ATOM   1645 C  CZ    . ARG A 1 241 ? 14.032  14.163  27.163  1.00 37.92 ? 242  ARG A CZ    1 
ATOM   1646 N  NH1   . ARG A 1 241 ? 15.045  13.340  27.409  1.00 40.74 ? 242  ARG A NH1   1 
ATOM   1647 N  NH2   . ARG A 1 241 ? 13.601  14.967  28.108  1.00 38.70 ? 242  ARG A NH2   1 
ATOM   1648 N  N     . MET A 1 242 ? 14.106  11.583  19.608  1.00 32.51 ? 243  MET A N     1 
ATOM   1649 C  CA    . MET A 1 242 ? 14.898  10.694  18.726  1.00 32.31 ? 243  MET A CA    1 
ATOM   1650 C  C     . MET A 1 242 ? 15.242  11.365  17.394  1.00 32.09 ? 243  MET A C     1 
ATOM   1651 O  O     . MET A 1 242 ? 16.317  11.165  16.832  1.00 30.84 ? 243  MET A O     1 
ATOM   1652 C  CB    . MET A 1 242 ? 14.177  9.368   18.546  1.00 32.88 ? 243  MET A CB    1 
ATOM   1653 C  CG    . MET A 1 242 ? 15.050  8.332   17.806  1.00 32.29 ? 243  MET A CG    1 
ATOM   1654 S  SD    . MET A 1 242 ? 14.459  6.655   17.948  1.00 37.75 ? 243  MET A SD    1 
ATOM   1655 C  CE    . MET A 1 242 ? 15.227  6.250   19.535  1.00 37.44 ? 243  MET A CE    1 
ATOM   1656 N  N     . HIS A 1 243 ? 14.319  12.140  16.845  1.00 31.76 ? 244  HIS A N     1 
ATOM   1657 C  CA    . HIS A 1 243 ? 14.620  12.936  15.688  1.00 31.78 ? 244  HIS A CA    1 
ATOM   1658 C  C     . HIS A 1 243 ? 15.808  13.887  15.965  1.00 31.07 ? 244  HIS A C     1 
ATOM   1659 O  O     . HIS A 1 243 ? 16.645  14.103  15.095  1.00 30.05 ? 244  HIS A O     1 
ATOM   1660 C  CB    . HIS A 1 243 ? 13.411  13.771  15.267  1.00 32.94 ? 244  HIS A CB    1 
ATOM   1661 C  CG    . HIS A 1 243 ? 12.271  12.966  14.731  1.00 33.06 ? 244  HIS A CG    1 
ATOM   1662 N  ND1   . HIS A 1 243 ? 11.081  13.545  14.330  1.00 34.35 ? 244  HIS A ND1   1 
ATOM   1663 C  CD2   . HIS A 1 243 ? 12.122  11.629  14.556  1.00 33.96 ? 244  HIS A CD2   1 
ATOM   1664 C  CE1   . HIS A 1 243 ? 10.255  12.595  13.911  1.00 36.92 ? 244  HIS A CE1   1 
ATOM   1665 N  NE2   . HIS A 1 243 ? 10.860  11.425  14.043  1.00 35.20 ? 244  HIS A NE2   1 
ATOM   1666 N  N     . GLU A 1 244 ? 15.845  14.458  17.174  1.00 30.81 ? 245  GLU A N     1 
ATOM   1667 C  CA    . GLU A 1 244 ? 16.888  15.374  17.570  1.00 31.96 ? 245  GLU A CA    1 
ATOM   1668 C  C     . GLU A 1 244 ? 18.180  14.604  17.597  1.00 32.02 ? 245  GLU A C     1 
ATOM   1669 O  O     . GLU A 1 244 ? 19.166  15.102  17.064  1.00 32.03 ? 245  GLU A O     1 
ATOM   1670 C  CB    . GLU A 1 244 ? 16.615  16.014  18.947  1.00 31.29 ? 245  GLU A CB    1 
ATOM   1671 C  CG    . GLU A 1 244 ? 17.776  16.939  19.391  1.00 34.30 ? 245  GLU A CG    1 
ATOM   1672 C  CD    . GLU A 1 244 ? 17.676  18.333  18.843  1.00 32.23 ? 245  GLU A CD    1 
ATOM   1673 O  OE1   . GLU A 1 244 ? 16.856  18.606  17.908  1.00 31.05 ? 245  GLU A OE1   1 
ATOM   1674 O  OE2   . GLU A 1 244 ? 18.430  19.195  19.381  1.00 33.28 ? 245  GLU A OE2   1 
ATOM   1675 N  N     . SER A 1 245 ? 18.152  13.399  18.182  1.00 32.27 ? 246  SER A N     1 
ATOM   1676 C  CA    A SER A 1 245 ? 19.332  12.540  18.303  0.50 32.69 ? 246  SER A CA    1 
ATOM   1677 C  CA    B SER A 1 245 ? 19.359  12.578  18.290  0.50 33.03 ? 246  SER A CA    1 
ATOM   1678 C  C     . SER A 1 245 ? 19.874  12.138  16.923  1.00 32.94 ? 246  SER A C     1 
ATOM   1679 O  O     . SER A 1 245 ? 21.114  12.115  16.679  1.00 32.63 ? 246  SER A O     1 
ATOM   1680 C  CB    A SER A 1 245 ? 18.978  11.292  19.123  0.50 32.86 ? 246  SER A CB    1 
ATOM   1681 C  CB    B SER A 1 245 ? 19.125  11.365  19.184  0.50 33.26 ? 246  SER A CB    1 
ATOM   1682 O  OG    A SER A 1 245 ? 20.131  10.545  19.466  0.50 31.87 ? 246  SER A OG    1 
ATOM   1683 O  OG    B SER A 1 245 ? 19.207  11.748  20.538  0.50 34.34 ? 246  SER A OG    1 
ATOM   1684 N  N     . MET A 1 246 ? 18.962  11.829  16.018  1.00 32.42 ? 247  MET A N     1 
ATOM   1685 C  CA    . MET A 1 246 ? 19.354  11.519  14.626  1.00 33.48 ? 247  MET A CA    1 
ATOM   1686 C  C     . MET A 1 246 ? 20.084  12.688  13.943  1.00 32.92 ? 247  MET A C     1 
ATOM   1687 O  O     . MET A 1 246 ? 21.132  12.505  13.334  1.00 32.89 ? 247  MET A O     1 
ATOM   1688 C  CB    . MET A 1 246 ? 18.123  11.140  13.801  1.00 33.63 ? 247  MET A CB    1 
ATOM   1689 C  CG    . MET A 1 246 ? 17.595  9.784   14.154  1.00 34.19 ? 247  MET A CG    1 
ATOM   1690 S  SD    . MET A 1 246 ? 16.101  9.399   13.245  1.00 37.63 ? 247  MET A SD    1 
ATOM   1691 C  CE    . MET A 1 246 ? 16.724  9.154   11.604  1.00 35.35 ? 247  MET A CE    1 
ATOM   1692 N  N     . LYS A 1 247 ? 19.532  13.889  14.047  1.00 33.18 ? 248  LYS A N     1 
ATOM   1693 C  CA    . LYS A 1 247 ? 20.152  15.083  13.481  1.00 33.92 ? 248  LYS A CA    1 
ATOM   1694 C  C     . LYS A 1 247 ? 21.562  15.269  14.074  1.00 33.65 ? 248  LYS A C     1 
ATOM   1695 O  O     . LYS A 1 247 ? 22.529  15.529  13.377  1.00 32.00 ? 248  LYS A O     1 
ATOM   1696 C  CB    . LYS A 1 247 ? 19.275  16.318  13.752  1.00 34.38 ? 248  LYS A CB    1 
ATOM   1697 C  CG    . LYS A 1 247 ? 18.050  16.420  12.832  1.00 35.44 ? 248  LYS A CG    1 
ATOM   1698 C  CD    . LYS A 1 247 ? 17.262  17.686  13.133  1.00 37.11 ? 248  LYS A CD    1 
ATOM   1699 N  N     . LEU A 1 248 ? 21.650  15.130  15.387  1.00 33.60 ? 249  LEU A N     1 
ATOM   1700 C  CA    . LEU A 1 248 ? 22.919  15.284  16.074  1.00 33.80 ? 249  LEU A CA    1 
ATOM   1701 C  C     . LEU A 1 248 ? 23.958  14.213  15.661  1.00 33.45 ? 249  LEU A C     1 
ATOM   1702 O  O     . LEU A 1 248 ? 25.147  14.520  15.465  1.00 33.06 ? 249  LEU A O     1 
ATOM   1703 C  CB    . LEU A 1 248 ? 22.669  15.267  17.578  1.00 33.00 ? 249  LEU A CB    1 
ATOM   1704 C  CG    . LEU A 1 248 ? 23.793  15.647  18.524  1.00 34.15 ? 249  LEU A CG    1 
ATOM   1705 C  CD1   . LEU A 1 248 ? 24.368  17.035  18.143  1.00 33.82 ? 249  LEU A CD1   1 
ATOM   1706 C  CD2   . LEU A 1 248 ? 23.274  15.586  19.981  1.00 32.57 ? 249  LEU A CD2   1 
ATOM   1707 N  N     . PHE A 1 249 ? 23.530  12.966  15.571  1.00 32.54 ? 250  PHE A N     1 
ATOM   1708 C  CA    . PHE A 1 249 ? 24.417  11.901  15.100  1.00 32.54 ? 250  PHE A CA    1 
ATOM   1709 C  C     . PHE A 1 249 ? 24.857  12.132  13.651  1.00 32.03 ? 250  PHE A C     1 
ATOM   1710 O  O     . PHE A 1 249 ? 26.021  11.889  13.285  1.00 30.06 ? 250  PHE A O     1 
ATOM   1711 C  CB    . PHE A 1 249 ? 23.755  10.518  15.198  1.00 32.60 ? 250  PHE A CB    1 
ATOM   1712 C  CG    . PHE A 1 249 ? 24.710  9.378   14.907  1.00 33.21 ? 250  PHE A CG    1 
ATOM   1713 C  CD1   . PHE A 1 249 ? 25.779  9.111   15.771  1.00 32.96 ? 250  PHE A CD1   1 
ATOM   1714 C  CD2   . PHE A 1 249 ? 24.577  8.614   13.764  1.00 34.48 ? 250  PHE A CD2   1 
ATOM   1715 C  CE1   . PHE A 1 249 ? 26.692  8.061   15.496  1.00 33.92 ? 250  PHE A CE1   1 
ATOM   1716 C  CE2   . PHE A 1 249 ? 25.467  7.565   13.486  1.00 33.59 ? 250  PHE A CE2   1 
ATOM   1717 C  CZ    . PHE A 1 249 ? 26.526  7.290   14.363  1.00 32.70 ? 250  PHE A CZ    1 
ATOM   1718 N  N     . ASP A 1 250 ? 23.922  12.587  12.822  1.00 32.08 ? 251  ASP A N     1 
ATOM   1719 C  CA    . ASP A 1 250 ? 24.273  12.945  11.452  1.00 32.89 ? 251  ASP A CA    1 
ATOM   1720 C  C     . ASP A 1 250 ? 25.437  13.948  11.466  1.00 33.10 ? 251  ASP A C     1 
ATOM   1721 O  O     . ASP A 1 250 ? 26.475  13.763  10.798  1.00 33.95 ? 251  ASP A O     1 
ATOM   1722 C  CB    . ASP A 1 250 ? 23.059  13.526  10.727  1.00 32.44 ? 251  ASP A CB    1 
ATOM   1723 C  CG    . ASP A 1 250 ? 23.299  13.731  9.245   1.00 35.31 ? 251  ASP A CG    1 
ATOM   1724 O  OD1   . ASP A 1 250 ? 24.455  13.688  8.776   1.00 35.17 ? 251  ASP A OD1   1 
ATOM   1725 O  OD2   . ASP A 1 250 ? 22.306  13.939  8.533   1.00 36.51 ? 251  ASP A OD2   1 
ATOM   1726 N  N     . SER A 1 251 ? 25.242  15.010  12.236  1.00 34.53 ? 252  SER A N     1 
ATOM   1727 C  CA    . SER A 1 251 ? 26.245  16.037  12.388  1.00 34.20 ? 252  SER A CA    1 
ATOM   1728 C  C     . SER A 1 251 ? 27.595  15.477  12.855  1.00 34.47 ? 252  SER A C     1 
ATOM   1729 O  O     . SER A 1 251 ? 28.619  15.806  12.270  1.00 34.34 ? 252  SER A O     1 
ATOM   1730 C  CB    . SER A 1 251 ? 25.762  17.120  13.364  1.00 33.83 ? 252  SER A CB    1 
ATOM   1731 O  OG    . SER A 1 251 ? 26.724  18.170  13.393  1.00 35.78 ? 252  SER A OG    1 
ATOM   1732 N  N     . ILE A 1 252 ? 27.596  14.661  13.914  1.00 34.94 ? 253  ILE A N     1 
ATOM   1733 C  CA    . ILE A 1 252 ? 28.844  14.165  14.501  1.00 35.19 ? 253  ILE A CA    1 
ATOM   1734 C  C     . ILE A 1 252 ? 29.522  13.131  13.603  1.00 35.47 ? 253  ILE A C     1 
ATOM   1735 O  O     . ILE A 1 252 ? 30.720  13.214  13.334  1.00 34.05 ? 253  ILE A O     1 
ATOM   1736 C  CB    . ILE A 1 252 ? 28.605  13.564  15.927  1.00 36.01 ? 253  ILE A CB    1 
ATOM   1737 C  CG1   . ILE A 1 252 ? 28.201  14.659  16.929  1.00 35.05 ? 253  ILE A CG1   1 
ATOM   1738 C  CG2   . ILE A 1 252 ? 29.849  12.765  16.407  1.00 34.24 ? 253  ILE A CG2   1 
ATOM   1739 C  CD1   . ILE A 1 252 ? 29.215  15.811  17.068  1.00 34.59 ? 253  ILE A CD1   1 
ATOM   1740 N  N     . CYS A 1 253 ? 28.749  12.147  13.150  1.00 36.50 ? 254  CYS A N     1 
ATOM   1741 C  CA    . CYS A 1 253 ? 29.300  10.995  12.438  1.00 36.55 ? 254  CYS A CA    1 
ATOM   1742 C  C     . CYS A 1 253 ? 30.051  11.434  11.183  1.00 35.97 ? 254  CYS A C     1 
ATOM   1743 O  O     . CYS A 1 253 ? 31.065  10.851  10.827  1.00 35.74 ? 254  CYS A O     1 
ATOM   1744 C  CB    . CYS A 1 253 ? 28.174  10.015  12.049  1.00 36.61 ? 254  CYS A CB    1 
ATOM   1745 S  SG    . CYS A 1 253 ? 28.719  8.551   11.231  1.00 39.77 ? 254  CYS A SG    1 
ATOM   1746 N  N     . ASN A 1 254 ? 29.524  12.457  10.522  1.00 35.70 ? 255  ASN A N     1 
ATOM   1747 C  CA    . ASN A 1 254 ? 30.042  12.934  9.262   1.00 36.02 ? 255  ASN A CA    1 
ATOM   1748 C  C     . ASN A 1 254 ? 30.955  14.167  9.359   1.00 36.08 ? 255  ASN A C     1 
ATOM   1749 O  O     . ASN A 1 254 ? 31.419  14.660  8.345   1.00 35.11 ? 255  ASN A O     1 
ATOM   1750 C  CB    . ASN A 1 254 ? 28.860  13.168  8.321   1.00 35.95 ? 255  ASN A CB    1 
ATOM   1751 C  CG    . ASN A 1 254 ? 28.124  11.872  8.009   1.00 36.90 ? 255  ASN A CG    1 
ATOM   1752 O  OD1   . ASN A 1 254 ? 28.733  10.900  7.545   1.00 35.19 ? 255  ASN A OD1   1 
ATOM   1753 N  ND2   . ASN A 1 254 ? 26.822  11.843  8.285   1.00 33.12 ? 255  ASN A ND2   1 
ATOM   1754 N  N     . ASN A 1 255 ? 31.241  14.608  10.584  1.00 36.25 ? 256  ASN A N     1 
ATOM   1755 C  CA    . ASN A 1 255 ? 32.099  15.766  10.837  1.00 36.40 ? 256  ASN A CA    1 
ATOM   1756 C  C     . ASN A 1 255 ? 33.522  15.434  10.433  1.00 36.55 ? 256  ASN A C     1 
ATOM   1757 O  O     . ASN A 1 255 ? 34.051  14.352  10.759  1.00 36.10 ? 256  ASN A O     1 
ATOM   1758 C  CB    . ASN A 1 255 ? 32.039  16.175  12.321  1.00 36.35 ? 256  ASN A CB    1 
ATOM   1759 C  CG    . ASN A 1 255 ? 32.640  17.543  12.597  1.00 36.30 ? 256  ASN A CG    1 
ATOM   1760 O  OD1   . ASN A 1 255 ? 33.787  17.838  12.212  1.00 35.07 ? 256  ASN A OD1   1 
ATOM   1761 N  ND2   . ASN A 1 255 ? 31.876  18.389  13.282  1.00 33.93 ? 256  ASN A ND2   1 
ATOM   1762 N  N     . LYS A 1 256 ? 34.132  16.356  9.691   1.00 37.04 ? 257  LYS A N     1 
ATOM   1763 C  CA    . LYS A 1 256 ? 35.460  16.120  9.142   1.00 37.40 ? 257  LYS A CA    1 
ATOM   1764 C  C     . LYS A 1 256 ? 36.502  16.000  10.267  1.00 37.53 ? 257  LYS A C     1 
ATOM   1765 O  O     . LYS A 1 256 ? 37.557  15.394  10.073  1.00 37.84 ? 257  LYS A O     1 
ATOM   1766 C  CB    . LYS A 1 256 ? 35.839  17.211  8.133   1.00 37.71 ? 257  LYS A CB    1 
ATOM   1767 N  N     . TRP A 1 257 ? 36.189  16.537  11.448  1.00 37.48 ? 258  TRP A N     1 
ATOM   1768 C  CA    . TRP A 1 257 ? 37.062  16.381  12.602  1.00 37.74 ? 258  TRP A CA    1 
ATOM   1769 C  C     . TRP A 1 257 ? 37.278  14.915  12.960  1.00 37.13 ? 258  TRP A C     1 
ATOM   1770 O  O     . TRP A 1 257 ? 38.277  14.580  13.602  1.00 36.24 ? 258  TRP A O     1 
ATOM   1771 C  CB    . TRP A 1 257 ? 36.498  17.090  13.840  1.00 38.91 ? 258  TRP A CB    1 
ATOM   1772 C  CG    . TRP A 1 257 ? 36.789  18.537  13.921  1.00 39.82 ? 258  TRP A CG    1 
ATOM   1773 C  CD1   . TRP A 1 257 ? 35.910  19.562  13.750  1.00 40.98 ? 258  TRP A CD1   1 
ATOM   1774 C  CD2   . TRP A 1 257 ? 38.056  19.133  14.225  1.00 40.25 ? 258  TRP A CD2   1 
ATOM   1775 N  NE1   . TRP A 1 257 ? 36.553  20.768  13.916  1.00 41.64 ? 258  TRP A NE1   1 
ATOM   1776 C  CE2   . TRP A 1 257 ? 37.871  20.533  14.215  1.00 41.51 ? 258  TRP A CE2   1 
ATOM   1777 C  CE3   . TRP A 1 257 ? 39.326  18.620  14.507  1.00 40.73 ? 258  TRP A CE3   1 
ATOM   1778 C  CZ2   . TRP A 1 257 ? 38.912  21.430  14.480  1.00 40.85 ? 258  TRP A CZ2   1 
ATOM   1779 C  CZ3   . TRP A 1 257 ? 40.372  19.517  14.763  1.00 41.21 ? 258  TRP A CZ3   1 
ATOM   1780 C  CH2   . TRP A 1 257 ? 40.153  20.905  14.743  1.00 40.91 ? 258  TRP A CH2   1 
ATOM   1781 N  N     . PHE A 1 258 ? 36.322  14.064  12.573  1.00 36.11 ? 259  PHE A N     1 
ATOM   1782 C  CA    . PHE A 1 258 ? 36.262  12.681  13.061  1.00 35.77 ? 259  PHE A CA    1 
ATOM   1783 C  C     . PHE A 1 258 ? 36.490  11.616  11.986  1.00 35.32 ? 259  PHE A C     1 
ATOM   1784 O  O     . PHE A 1 258 ? 36.156  10.446  12.179  1.00 34.97 ? 259  PHE A O     1 
ATOM   1785 C  CB    . PHE A 1 258 ? 34.921  12.476  13.772  1.00 35.37 ? 259  PHE A CB    1 
ATOM   1786 C  CG    . PHE A 1 258 ? 34.657  13.503  14.845  1.00 34.81 ? 259  PHE A CG    1 
ATOM   1787 C  CD1   . PHE A 1 258 ? 35.659  13.857  15.747  1.00 35.20 ? 259  PHE A CD1   1 
ATOM   1788 C  CD2   . PHE A 1 258 ? 33.445  14.150  14.919  1.00 34.20 ? 259  PHE A CD2   1 
ATOM   1789 C  CE1   . PHE A 1 258 ? 35.438  14.827  16.714  1.00 33.93 ? 259  PHE A CE1   1 
ATOM   1790 C  CE2   . PHE A 1 258 ? 33.212  15.117  15.899  1.00 34.26 ? 259  PHE A CE2   1 
ATOM   1791 C  CZ    . PHE A 1 258 ? 34.208  15.448  16.791  1.00 34.46 ? 259  PHE A CZ    1 
ATOM   1792 N  N     . THR A 1 259 ? 37.101  12.016  10.873  1.00 35.28 ? 260  THR A N     1 
ATOM   1793 C  CA    . THR A 1 259 ? 37.346  11.112  9.765   1.00 35.58 ? 260  THR A CA    1 
ATOM   1794 C  C     . THR A 1 259 ? 38.075  9.844   10.212  1.00 35.87 ? 260  THR A C     1 
ATOM   1795 O  O     . THR A 1 259 ? 37.726  8.726   9.790   1.00 35.79 ? 260  THR A O     1 
ATOM   1796 C  CB    . THR A 1 259 ? 38.163  11.820  8.666   1.00 35.67 ? 260  THR A CB    1 
ATOM   1797 O  OG1   . THR A 1 259 ? 37.367  12.860  8.081   1.00 35.75 ? 260  THR A OG1   1 
ATOM   1798 C  CG2   . THR A 1 259 ? 38.597  10.831  7.578   1.00 35.79 ? 260  THR A CG2   1 
ATOM   1799 N  N     . GLU A 1 260 ? 39.067  10.022  11.080  1.00 36.04 ? 261  GLU A N     1 
ATOM   1800 C  CA    . GLU A 1 260 ? 39.893  8.922   11.562  1.00 36.41 ? 261  GLU A CA    1 
ATOM   1801 C  C     . GLU A 1 260 ? 39.508  8.446   12.969  1.00 36.21 ? 261  GLU A C     1 
ATOM   1802 O  O     . GLU A 1 260 ? 40.145  7.534   13.503  1.00 37.44 ? 261  GLU A O     1 
ATOM   1803 C  CB    . GLU A 1 260 ? 41.363  9.349   11.562  1.00 37.45 ? 261  GLU A CB    1 
ATOM   1804 C  CG    . GLU A 1 260 ? 41.882  9.805   10.217  1.00 38.96 ? 261  GLU A CG    1 
ATOM   1805 C  CD    . GLU A 1 260 ? 41.719  8.750   9.154   1.00 42.68 ? 261  GLU A CD    1 
ATOM   1806 O  OE1   . GLU A 1 260 ? 42.084  7.576   9.411   1.00 44.24 ? 261  GLU A OE1   1 
ATOM   1807 O  OE2   . GLU A 1 260 ? 41.214  9.097   8.066   1.00 45.41 ? 261  GLU A OE2   1 
ATOM   1808 N  N     . THR A 1 261 ? 38.478  9.058   13.557  1.00 34.50 ? 262  THR A N     1 
ATOM   1809 C  CA    . THR A 1 261 ? 38.020  8.728   14.894  1.00 33.18 ? 262  THR A CA    1 
ATOM   1810 C  C     . THR A 1 261 ? 37.142  7.480   14.813  1.00 32.99 ? 262  THR A C     1 
ATOM   1811 O  O     . THR A 1 261 ? 36.310  7.381   13.912  1.00 32.46 ? 262  THR A O     1 
ATOM   1812 C  CB    . THR A 1 261 ? 37.196  9.906   15.456  1.00 33.60 ? 262  THR A CB    1 
ATOM   1813 O  OG1   . THR A 1 261 ? 38.032  11.064  15.488  1.00 30.20 ? 262  THR A OG1   1 
ATOM   1814 C  CG2   . THR A 1 261 ? 36.612  9.601   16.854  1.00 31.51 ? 262  THR A CG2   1 
ATOM   1815 N  N     . SER A 1 262 ? 37.338  6.527   15.721  1.00 32.10 ? 263  SER A N     1 
ATOM   1816 C  CA    . SER A 1 262 ? 36.407  5.394   15.829  1.00 32.58 ? 263  SER A CA    1 
ATOM   1817 C  C     . SER A 1 262 ? 35.062  5.905   16.366  1.00 32.72 ? 263  SER A C     1 
ATOM   1818 O  O     . SER A 1 262 ? 35.020  6.468   17.458  1.00 31.68 ? 263  SER A O     1 
ATOM   1819 C  CB    . SER A 1 262 ? 36.955  4.320   16.773  1.00 32.80 ? 263  SER A CB    1 
ATOM   1820 O  OG    . SER A 1 262 ? 38.115  3.701   16.252  1.00 32.81 ? 263  SER A OG    1 
ATOM   1821 N  N     . ILE A 1 263 ? 33.990  5.729   15.589  1.00 32.72 ? 264  ILE A N     1 
ATOM   1822 C  CA    . ILE A 1 263 ? 32.654  6.136   15.983  1.00 33.19 ? 264  ILE A CA    1 
ATOM   1823 C  C     . ILE A 1 263 ? 31.867  4.941   16.559  1.00 32.67 ? 264  ILE A C     1 
ATOM   1824 O  O     . ILE A 1 263 ? 31.506  4.005   15.848  1.00 32.67 ? 264  ILE A O     1 
ATOM   1825 C  CB    . ILE A 1 263 ? 31.859  6.762   14.807  1.00 33.28 ? 264  ILE A CB    1 
ATOM   1826 C  CG1   . ILE A 1 263 ? 32.642  7.925   14.157  1.00 34.52 ? 264  ILE A CG1   1 
ATOM   1827 C  CG2   . ILE A 1 263 ? 30.462  7.225   15.301  1.00 33.05 ? 264  ILE A CG2   1 
ATOM   1828 C  CD1   . ILE A 1 263 ? 32.819  9.127   15.009  1.00 35.09 ? 264  ILE A CD1   1 
ATOM   1829 N  N     . ILE A 1 264 ? 31.634  4.995   17.866  1.00 33.01 ? 265  ILE A N     1 
ATOM   1830 C  CA    . ILE A 1 264 ? 30.914  3.977   18.615  1.00 32.29 ? 265  ILE A CA    1 
ATOM   1831 C  C     . ILE A 1 264 ? 29.520  4.546   18.950  1.00 32.56 ? 265  ILE A C     1 
ATOM   1832 O  O     . ILE A 1 264 ? 29.380  5.694   19.407  1.00 31.96 ? 265  ILE A O     1 
ATOM   1833 C  CB    . ILE A 1 264 ? 31.689  3.564   19.911  1.00 33.11 ? 265  ILE A CB    1 
ATOM   1834 C  CG1   . ILE A 1 264 ? 33.067  2.984   19.563  1.00 34.36 ? 265  ILE A CG1   1 
ATOM   1835 C  CG2   . ILE A 1 264 ? 30.889  2.574   20.802  1.00 33.36 ? 265  ILE A CG2   1 
ATOM   1836 C  CD1   . ILE A 1 264 ? 34.172  3.900   19.924  1.00 35.78 ? 265  ILE A CD1   1 
ATOM   1837 N  N     . LEU A 1 265 ? 28.495  3.754   18.637  1.00 32.45 ? 266  LEU A N     1 
ATOM   1838 C  CA    . LEU A 1 265 ? 27.110  4.123   18.894  1.00 32.96 ? 266  LEU A CA    1 
ATOM   1839 C  C     . LEU A 1 265 ? 26.549  3.201   19.990  1.00 32.62 ? 266  LEU A C     1 
ATOM   1840 O  O     . LEU A 1 265 ? 26.472  2.002   19.801  1.00 32.57 ? 266  LEU A O     1 
ATOM   1841 C  CB    . LEU A 1 265 ? 26.284  3.980   17.613  1.00 32.83 ? 266  LEU A CB    1 
ATOM   1842 C  CG    . LEU A 1 265 ? 24.789  4.315   17.639  1.00 31.75 ? 266  LEU A CG    1 
ATOM   1843 C  CD1   . LEU A 1 265 ? 24.545  5.780   17.953  1.00 29.87 ? 266  LEU A CD1   1 
ATOM   1844 C  CD2   . LEU A 1 265 ? 24.198  3.959   16.288  1.00 32.94 ? 266  LEU A CD2   1 
ATOM   1845 N  N     . PHE A 1 266 ? 26.192  3.802   21.128  1.00 32.75 ? 267  PHE A N     1 
ATOM   1846 C  CA    . PHE A 1 266 ? 25.484  3.114   22.208  1.00 32.65 ? 267  PHE A CA    1 
ATOM   1847 C  C     . PHE A 1 266 ? 24.007  3.452   22.050  1.00 31.70 ? 267  PHE A C     1 
ATOM   1848 O  O     . PHE A 1 266 ? 23.584  4.582   22.339  1.00 32.55 ? 267  PHE A O     1 
ATOM   1849 C  CB    . PHE A 1 266 ? 25.978  3.555   23.586  1.00 32.47 ? 267  PHE A CB    1 
ATOM   1850 C  CG    . PHE A 1 266 ? 27.277  2.947   24.019  1.00 32.62 ? 267  PHE A CG    1 
ATOM   1851 C  CD1   . PHE A 1 266 ? 28.057  2.157   23.166  1.00 32.86 ? 267  PHE A CD1   1 
ATOM   1852 C  CD2   . PHE A 1 266 ? 27.751  3.203   25.306  1.00 32.53 ? 267  PHE A CD2   1 
ATOM   1853 C  CE1   . PHE A 1 266 ? 29.265  1.598   23.605  1.00 33.28 ? 267  PHE A CE1   1 
ATOM   1854 C  CE2   . PHE A 1 266 ? 28.974  2.631   25.744  1.00 33.29 ? 267  PHE A CE2   1 
ATOM   1855 C  CZ    . PHE A 1 266 ? 29.726  1.853   24.882  1.00 32.38 ? 267  PHE A CZ    1 
ATOM   1856 N  N     . LEU A 1 267 ? 23.254  2.473   21.557  1.00 32.02 ? 268  LEU A N     1 
ATOM   1857 C  CA    . LEU A 1 267 ? 21.793  2.489   21.577  1.00 32.49 ? 268  LEU A CA    1 
ATOM   1858 C  C     . LEU A 1 267 ? 21.392  2.049   22.984  1.00 32.47 ? 268  LEU A C     1 
ATOM   1859 O  O     . LEU A 1 267 ? 21.242  0.875   23.292  1.00 32.80 ? 268  LEU A O     1 
ATOM   1860 C  CB    . LEU A 1 267 ? 21.216  1.605   20.480  1.00 32.64 ? 268  LEU A CB    1 
ATOM   1861 C  CG    . LEU A 1 267 ? 21.537  2.066   19.043  1.00 32.35 ? 268  LEU A CG    1 
ATOM   1862 C  CD1   . LEU A 1 267 ? 21.032  1.032   18.012  1.00 32.21 ? 268  LEU A CD1   1 
ATOM   1863 C  CD2   . LEU A 1 267 ? 20.993  3.500   18.740  1.00 32.19 ? 268  LEU A CD2   1 
ATOM   1864 N  N     . ASN A 1 268 ? 21.271  3.057   23.828  1.00 32.56 ? 269  ASN A N     1 
ATOM   1865 C  CA    . ASN A 1 268 ? 21.165  2.914   25.266  1.00 31.65 ? 269  ASN A CA    1 
ATOM   1866 C  C     . ASN A 1 268 ? 19.711  2.866   25.770  1.00 31.38 ? 269  ASN A C     1 
ATOM   1867 O  O     . ASN A 1 268 ? 18.772  2.989   24.993  1.00 31.17 ? 269  ASN A O     1 
ATOM   1868 C  CB    . ASN A 1 268 ? 21.928  4.064   25.891  1.00 32.19 ? 269  ASN A CB    1 
ATOM   1869 C  CG    . ASN A 1 268 ? 22.138  3.893   27.358  1.00 31.83 ? 269  ASN A CG    1 
ATOM   1870 O  OD1   . ASN A 1 268 ? 22.485  2.809   27.827  1.00 32.60 ? 269  ASN A OD1   1 
ATOM   1871 N  ND2   . ASN A 1 268 ? 21.914  4.975   28.111  1.00 33.30 ? 269  ASN A ND2   1 
ATOM   1872 N  N     . LYS A 1 269 ? 19.553  2.643   27.069  1.00 31.77 ? 270  LYS A N     1 
ATOM   1873 C  CA    . LYS A 1 269 ? 18.260  2.450   27.725  1.00 32.53 ? 270  LYS A CA    1 
ATOM   1874 C  C     . LYS A 1 269 ? 17.472  1.296   27.106  1.00 33.14 ? 270  LYS A C     1 
ATOM   1875 O  O     . LYS A 1 269 ? 16.246  1.363   26.992  1.00 33.88 ? 270  LYS A O     1 
ATOM   1876 C  CB    . LYS A 1 269 ? 17.462  3.777   27.743  1.00 32.59 ? 270  LYS A CB    1 
ATOM   1877 C  CG    . LYS A 1 269 ? 18.162  4.880   28.454  1.00 33.14 ? 270  LYS A CG    1 
ATOM   1878 C  CD    . LYS A 1 269 ? 17.308  6.110   28.661  1.00 34.71 ? 270  LYS A CD    1 
ATOM   1879 C  CE    . LYS A 1 269 ? 18.063  7.159   29.444  1.00 40.33 ? 270  LYS A CE    1 
ATOM   1880 N  NZ    . LYS A 1 269 ? 17.316  8.462   29.642  1.00 38.85 ? 270  LYS A NZ    1 
ATOM   1881 N  N     . LYS A 1 270 ? 18.190  0.235   26.728  1.00 33.26 ? 271  LYS A N     1 
ATOM   1882 C  CA    . LYS A 1 270 ? 17.578  -0.953  26.160  1.00 33.18 ? 271  LYS A CA    1 
ATOM   1883 C  C     . LYS A 1 270 ? 16.509  -1.553  27.097  1.00 32.86 ? 271  LYS A C     1 
ATOM   1884 O  O     . LYS A 1 270 ? 15.521  -2.096  26.642  1.00 32.53 ? 271  LYS A O     1 
ATOM   1885 C  CB    . LYS A 1 270 ? 18.632  -1.984  25.742  1.00 33.75 ? 271  LYS A CB    1 
ATOM   1886 C  CG    . LYS A 1 270 ? 19.286  -2.818  26.835  1.00 33.60 ? 271  LYS A CG    1 
ATOM   1887 C  CD    . LYS A 1 270 ? 20.441  -3.631  26.260  1.00 34.11 ? 271  LYS A CD    1 
ATOM   1888 C  CE    . LYS A 1 270 ? 20.820  -4.797  27.183  1.00 35.59 ? 271  LYS A CE    1 
ATOM   1889 N  NZ    . LYS A 1 270 ? 21.843  -5.643  26.552  1.00 42.19 ? 271  LYS A NZ    1 
ATOM   1890 N  N     . ASP A 1 271 ? 16.724  -1.441  28.397  1.00 32.89 ? 272  ASP A N     1 
ATOM   1891 C  CA    . ASP A 1 271 ? 15.792  -1.979  29.389  1.00 33.07 ? 272  ASP A CA    1 
ATOM   1892 C  C     . ASP A 1 271 ? 14.476  -1.227  29.399  1.00 33.20 ? 272  ASP A C     1 
ATOM   1893 O  O     . ASP A 1 271 ? 13.380  -1.825  29.360  1.00 33.72 ? 272  ASP A O     1 
ATOM   1894 C  CB    . ASP A 1 271 ? 16.455  -2.001  30.782  1.00 34.05 ? 272  ASP A CB    1 
ATOM   1895 C  CG    . ASP A 1 271 ? 16.921  -0.617  31.282  1.00 34.93 ? 272  ASP A CG    1 
ATOM   1896 O  OD1   . ASP A 1 271 ? 17.486  0.212   30.504  1.00 33.44 ? 272  ASP A OD1   1 
ATOM   1897 O  OD2   . ASP A 1 271 ? 16.742  -0.378  32.502  1.00 36.62 ? 272  ASP A OD2   1 
ATOM   1898 N  N     . LEU A 1 272 ? 14.570  0.092   29.376  1.00 34.00 ? 273  LEU A N     1 
ATOM   1899 C  CA    . LEU A 1 272 ? 13.385  0.950   29.362  1.00 34.21 ? 273  LEU A CA    1 
ATOM   1900 C  C     . LEU A 1 272 ? 12.616  0.787   28.032  1.00 34.27 ? 273  LEU A C     1 
ATOM   1901 O  O     . LEU A 1 272 ? 11.390  0.751   27.998  1.00 33.34 ? 273  LEU A O     1 
ATOM   1902 C  CB    . LEU A 1 272 ? 13.809  2.409   29.579  1.00 34.74 ? 273  LEU A CB    1 
ATOM   1903 C  CG    . LEU A 1 272 ? 14.418  2.758   30.953  1.00 34.54 ? 273  LEU A CG    1 
ATOM   1904 C  CD1   . LEU A 1 272 ? 14.715  4.280   31.021  1.00 34.95 ? 273  LEU A CD1   1 
ATOM   1905 C  CD2   . LEU A 1 272 ? 13.482  2.286   32.090  1.00 38.36 ? 273  LEU A CD2   1 
ATOM   1906 N  N     . PHE A 1 273 ? 13.376  0.660   26.950  1.00 34.14 ? 274  PHE A N     1 
ATOM   1907 C  CA    . PHE A 1 273 ? 12.845  0.486   25.603  1.00 33.85 ? 274  PHE A CA    1 
ATOM   1908 C  C     . PHE A 1 273 ? 12.052  -0.832  25.497  1.00 34.64 ? 274  PHE A C     1 
ATOM   1909 O  O     . PHE A 1 273 ? 10.951  -0.855  24.968  1.00 34.24 ? 274  PHE A O     1 
ATOM   1910 C  CB    . PHE A 1 273 ? 13.985  0.498   24.566  1.00 33.62 ? 274  PHE A CB    1 
ATOM   1911 C  CG    . PHE A 1 273 ? 13.508  0.316   23.157  1.00 32.91 ? 274  PHE A CG    1 
ATOM   1912 C  CD1   . PHE A 1 273 ? 12.867  1.361   22.501  1.00 33.29 ? 274  PHE A CD1   1 
ATOM   1913 C  CD2   . PHE A 1 273 ? 13.627  -0.910  22.502  1.00 31.90 ? 274  PHE A CD2   1 
ATOM   1914 C  CE1   . PHE A 1 273 ? 12.373  1.197   21.218  1.00 30.66 ? 274  PHE A CE1   1 
ATOM   1915 C  CE2   . PHE A 1 273 ? 13.144  -1.077  21.209  1.00 32.05 ? 274  PHE A CE2   1 
ATOM   1916 C  CZ    . PHE A 1 273 ? 12.524  -0.011  20.565  1.00 31.75 ? 274  PHE A CZ    1 
ATOM   1917 N  N     . GLU A 1 274 ? 12.639  -1.919  25.989  1.00 35.84 ? 275  GLU A N     1 
ATOM   1918 C  CA    . GLU A 1 274 ? 11.975  -3.232  26.032  1.00 36.79 ? 275  GLU A CA    1 
ATOM   1919 C  C     . GLU A 1 274 ? 10.582  -3.137  26.662  1.00 36.77 ? 275  GLU A C     1 
ATOM   1920 O  O     . GLU A 1 274 ? 9.634   -3.706  26.147  1.00 34.96 ? 275  GLU A O     1 
ATOM   1921 C  CB    . GLU A 1 274 ? 12.827  -4.234  26.820  1.00 36.40 ? 275  GLU A CB    1 
ATOM   1922 C  CG    . GLU A 1 274 ? 12.313  -5.677  26.787  1.00 38.27 ? 275  GLU A CG    1 
ATOM   1923 C  CD    . GLU A 1 274 ? 13.128  -6.599  27.665  1.00 40.54 ? 275  GLU A CD    1 
ATOM   1924 O  OE1   . GLU A 1 274 ? 14.006  -6.085  28.409  1.00 46.32 ? 275  GLU A OE1   1 
ATOM   1925 O  OE2   . GLU A 1 274 ? 12.902  -7.834  27.619  1.00 46.13 ? 275  GLU A OE2   1 
ATOM   1926 N  N     . GLU A 1 275 ? 10.476  -2.401  27.765  1.00 37.08 ? 276  GLU A N     1 
ATOM   1927 C  CA    . GLU A 1 275 ? 9.197   -2.229  28.475  1.00 38.53 ? 276  GLU A CA    1 
ATOM   1928 C  C     . GLU A 1 275 ? 8.244   -1.317  27.716  1.00 37.32 ? 276  GLU A C     1 
ATOM   1929 O  O     . GLU A 1 275 ? 7.086   -1.644  27.544  1.00 37.93 ? 276  GLU A O     1 
ATOM   1930 C  CB    . GLU A 1 275 ? 9.428   -1.685  29.897  1.00 39.47 ? 276  GLU A CB    1 
ATOM   1931 C  CG    . GLU A 1 275 ? 10.044  -2.707  30.861  1.00 44.61 ? 276  GLU A CG    1 
ATOM   1932 C  CD    . GLU A 1 275 ? 9.236   -4.018  30.977  1.00 50.98 ? 276  GLU A CD    1 
ATOM   1933 O  OE1   . GLU A 1 275 ? 9.729   -5.093  30.532  1.00 54.33 ? 276  GLU A OE1   1 
ATOM   1934 O  OE2   . GLU A 1 275 ? 8.087   -3.983  31.498  1.00 55.66 ? 276  GLU A OE2   1 
ATOM   1935 N  N     . LYS A 1 276 ? 8.753   -0.195  27.228  1.00 37.57 ? 277  LYS A N     1 
ATOM   1936 C  CA    . LYS A 1 276 ? 7.935   0.815   26.564  1.00 37.27 ? 277  LYS A CA    1 
ATOM   1937 C  C     . LYS A 1 276 ? 7.392   0.357   25.226  1.00 36.29 ? 277  LYS A C     1 
ATOM   1938 O  O     . LYS A 1 276 ? 6.268   0.723   24.852  1.00 34.35 ? 277  LYS A O     1 
ATOM   1939 C  CB    . LYS A 1 276 ? 8.745   2.118   26.386  1.00 37.76 ? 277  LYS A CB    1 
ATOM   1940 C  CG    . LYS A 1 276 ? 8.033   3.186   25.645  1.00 38.66 ? 277  LYS A CG    1 
ATOM   1941 C  CD    . LYS A 1 276 ? 8.878   4.452   25.539  1.00 36.42 ? 277  LYS A CD    1 
ATOM   1942 C  CE    . LYS A 1 276 ? 8.819   5.262   26.728  1.00 36.20 ? 277  LYS A CE    1 
ATOM   1943 N  NZ    . LYS A 1 276 ? 9.353   6.622   26.427  1.00 32.85 ? 277  LYS A NZ    1 
ATOM   1944 N  N     . ILE A 1 277 ? 8.184   -0.420  24.484  1.00 35.85 ? 278  ILE A N     1 
ATOM   1945 C  CA    . ILE A 1 277 ? 7.783   -0.808  23.135  1.00 37.04 ? 278  ILE A CA    1 
ATOM   1946 C  C     . ILE A 1 277 ? 6.476   -1.619  23.095  1.00 38.45 ? 278  ILE A C     1 
ATOM   1947 O  O     . ILE A 1 277 ? 5.722   -1.501  22.140  1.00 37.57 ? 278  ILE A O     1 
ATOM   1948 C  CB    . ILE A 1 277 ? 8.940   -1.522  22.364  1.00 36.71 ? 278  ILE A CB    1 
ATOM   1949 C  CG1   . ILE A 1 277 ? 8.610   -1.617  20.864  1.00 36.86 ? 278  ILE A CG1   1 
ATOM   1950 C  CG2   . ILE A 1 277 ? 9.275   -2.900  22.970  1.00 35.72 ? 278  ILE A CG2   1 
ATOM   1951 C  CD1   . ILE A 1 277 ? 8.510   -0.264  20.166  1.00 35.55 ? 278  ILE A CD1   1 
ATOM   1952 N  N     . LYS A 1 278 ? 6.222   -2.404  24.151  1.00 39.76 ? 279  LYS A N     1 
ATOM   1953 C  CA    . LYS A 1 278 ? 4.962   -3.139  24.343  1.00 41.37 ? 279  LYS A CA    1 
ATOM   1954 C  C     . LYS A 1 278 ? 3.732   -2.240  24.569  1.00 42.02 ? 279  LYS A C     1 
ATOM   1955 O  O     . LYS A 1 278 ? 2.629   -2.760  24.651  1.00 41.08 ? 279  LYS A O     1 
ATOM   1956 C  CB    . LYS A 1 278 ? 5.012   -4.038  25.591  1.00 41.82 ? 279  LYS A CB    1 
ATOM   1957 C  CG    . LYS A 1 278 ? 6.150   -5.042  25.759  1.00 44.34 ? 279  LYS A CG    1 
ATOM   1958 C  CD    . LYS A 1 278 ? 6.313   -5.259  27.280  1.00 46.48 ? 279  LYS A CD    1 
ATOM   1959 C  CE    . LYS A 1 278 ? 7.166   -6.451  27.658  1.00 47.88 ? 279  LYS A CE    1 
ATOM   1960 N  NZ    . LYS A 1 278 ? 7.971   -6.080  28.884  1.00 49.74 ? 279  LYS A NZ    1 
ATOM   1961 N  N     . ARG A 1 279 ? 3.910   -0.930  24.751  1.00 42.54 ? 280  ARG A N     1 
ATOM   1962 C  CA    . ARG A 1 279 ? 2.746   -0.042  24.967  1.00 44.09 ? 280  ARG A CA    1 
ATOM   1963 C  C     . ARG A 1 279 ? 2.720   1.279   24.196  1.00 42.47 ? 280  ARG A C     1 
ATOM   1964 O  O     . ARG A 1 279 ? 1.711   1.989   24.233  1.00 44.15 ? 280  ARG A O     1 
ATOM   1965 C  CB    . ARG A 1 279 ? 2.571   0.233   26.467  1.00 44.79 ? 280  ARG A CB    1 
ATOM   1966 C  CG    . ARG A 1 279 ? 3.445   1.311   27.047  1.00 49.66 ? 280  ARG A CG    1 
ATOM   1967 C  CD    . ARG A 1 279 ? 3.232   1.369   28.554  1.00 55.44 ? 280  ARG A CD    1 
ATOM   1968 N  NE    . ARG A 1 279 ? 4.084   0.419   29.274  1.00 57.80 ? 280  ARG A NE    1 
ATOM   1969 C  CZ    . ARG A 1 279 ? 5.163   0.751   29.987  1.00 60.87 ? 280  ARG A CZ    1 
ATOM   1970 N  NH1   . ARG A 1 279 ? 5.560   2.017   30.083  1.00 63.48 ? 280  ARG A NH1   1 
ATOM   1971 N  NH2   . ARG A 1 279 ? 5.871   -0.192  30.612  1.00 61.84 ? 280  ARG A NH2   1 
ATOM   1972 N  N     . SER A 1 280 ? 3.797   1.607   23.493  1.00 40.08 ? 281  SER A N     1 
ATOM   1973 C  CA    . SER A 1 280 ? 3.848   2.838   22.738  1.00 38.25 ? 281  SER A CA    1 
ATOM   1974 C  C     . SER A 1 280 ? 4.470   2.515   21.377  1.00 37.26 ? 281  SER A C     1 
ATOM   1975 O  O     . SER A 1 280 ? 5.589   2.024   21.314  1.00 36.15 ? 281  SER A O     1 
ATOM   1976 C  CB    . SER A 1 280 ? 4.643   3.892   23.502  1.00 37.68 ? 281  SER A CB    1 
ATOM   1977 O  OG    . SER A 1 280 ? 4.437   5.172   22.924  1.00 37.25 ? 281  SER A OG    1 
ATOM   1978 N  N     . PRO A 1 281 ? 3.732   2.762   20.295  1.00 36.52 ? 282  PRO A N     1 
ATOM   1979 C  CA    . PRO A 1 281 ? 4.162   2.272   18.990  1.00 35.76 ? 282  PRO A CA    1 
ATOM   1980 C  C     . PRO A 1 281 ? 5.307   3.082   18.413  1.00 35.39 ? 282  PRO A C     1 
ATOM   1981 O  O     . PRO A 1 281 ? 5.388   4.302   18.643  1.00 34.48 ? 282  PRO A O     1 
ATOM   1982 C  CB    . PRO A 1 281 ? 2.899   2.395   18.130  1.00 36.59 ? 282  PRO A CB    1 
ATOM   1983 C  CG    . PRO A 1 281 ? 2.119   3.519   18.760  1.00 36.38 ? 282  PRO A CG    1 
ATOM   1984 C  CD    . PRO A 1 281 ? 2.423   3.454   20.234  1.00 36.58 ? 282  PRO A CD    1 
ATOM   1985 N  N     . LEU A 1 282 ? 6.200   2.402   17.686  1.00 33.91 ? 283  LEU A N     1 
ATOM   1986 C  CA    . LEU A 1 282 ? 7.381   3.050   17.096  1.00 33.41 ? 283  LEU A CA    1 
ATOM   1987 C  C     . LEU A 1 282 ? 7.008   4.075   16.034  1.00 32.33 ? 283  LEU A C     1 
ATOM   1988 O  O     . LEU A 1 282 ? 7.754   5.042   15.803  1.00 31.21 ? 283  LEU A O     1 
ATOM   1989 C  CB    . LEU A 1 282 ? 8.354   2.020   16.515  1.00 33.44 ? 283  LEU A CB    1 
ATOM   1990 C  CG    . LEU A 1 282 ? 9.729   2.603   16.151  1.00 34.13 ? 283  LEU A CG    1 
ATOM   1991 C  CD1   . LEU A 1 282 ? 10.427  3.342   17.329  1.00 35.37 ? 283  LEU A CD1   1 
ATOM   1992 C  CD2   . LEU A 1 282 ? 10.654  1.506   15.528  1.00 34.85 ? 283  LEU A CD2   1 
ATOM   1993 N  N     . THR A 1 283 ? 5.832   3.883   15.426  1.00 31.92 ? 284  THR A N     1 
ATOM   1994 C  CA    . THR A 1 283 ? 5.306   4.800   14.404  1.00 32.28 ? 284  THR A CA    1 
ATOM   1995 C  C     . THR A 1 283 ? 5.150   6.246   14.876  1.00 33.38 ? 284  THR A C     1 
ATOM   1996 O  O     . THR A 1 283 ? 5.083   7.164   14.049  1.00 33.27 ? 284  THR A O     1 
ATOM   1997 C  CB    . THR A 1 283 ? 3.942   4.322   13.858  1.00 31.78 ? 284  THR A CB    1 
ATOM   1998 O  OG1   . THR A 1 283 ? 3.101   3.928   14.955  1.00 30.56 ? 284  THR A OG1   1 
ATOM   1999 C  CG2   . THR A 1 283 ? 4.129   3.153   12.919  1.00 30.60 ? 284  THR A CG2   1 
ATOM   2000 N  N     . ILE A 1 284 ? 5.099   6.454   16.191  1.00 34.78 ? 285  ILE A N     1 
ATOM   2001 C  CA    . ILE A 1 284 ? 5.137   7.813   16.757  1.00 36.23 ? 285  ILE A CA    1 
ATOM   2002 C  C     . ILE A 1 284 ? 6.376   8.547   16.241  1.00 35.94 ? 285  ILE A C     1 
ATOM   2003 O  O     . ILE A 1 284 ? 6.318   9.718   15.864  1.00 37.06 ? 285  ILE A O     1 
ATOM   2004 C  CB    . ILE A 1 284 ? 5.079   7.774   18.331  1.00 36.45 ? 285  ILE A CB    1 
ATOM   2005 C  CG1   . ILE A 1 284 ? 3.670   7.369   18.791  1.00 38.28 ? 285  ILE A CG1   1 
ATOM   2006 C  CG2   . ILE A 1 284 ? 5.408   9.137   18.963  1.00 38.62 ? 285  ILE A CG2   1 
ATOM   2007 C  CD1   . ILE A 1 284 ? 3.518   7.148   20.292  1.00 37.58 ? 285  ILE A CD1   1 
ATOM   2008 N  N     . CYS A 1 285 ? 7.499   7.845   16.213  1.00 35.23 ? 286  CYS A N     1 
ATOM   2009 C  CA    . CYS A 1 285 ? 8.759   8.387   15.749  1.00 34.56 ? 286  CYS A CA    1 
ATOM   2010 C  C     . CYS A 1 285 ? 8.949   8.217   14.240  1.00 33.76 ? 286  CYS A C     1 
ATOM   2011 O  O     . CYS A 1 285 ? 9.311   9.169   13.520  1.00 34.19 ? 286  CYS A O     1 
ATOM   2012 C  CB    . CYS A 1 285 ? 9.913   7.692   16.505  1.00 33.97 ? 286  CYS A CB    1 
ATOM   2013 S  SG    . CYS A 1 285 ? 11.531  8.385   16.114  1.00 35.45 ? 286  CYS A SG    1 
ATOM   2014 N  N     . TYR A 1 286 ? 8.684   7.007   13.764  1.00 33.66 ? 287  TYR A N     1 
ATOM   2015 C  CA    . TYR A 1 286 ? 8.877   6.647   12.363  1.00 33.06 ? 287  TYR A CA    1 
ATOM   2016 C  C     . TYR A 1 286 ? 7.541   6.213   11.741  1.00 33.26 ? 287  TYR A C     1 
ATOM   2017 O  O     . TYR A 1 286 ? 7.163   5.034   11.814  1.00 31.40 ? 287  TYR A O     1 
ATOM   2018 C  CB    . TYR A 1 286 ? 9.885   5.510   12.242  1.00 33.97 ? 287  TYR A CB    1 
ATOM   2019 C  CG    . TYR A 1 286 ? 11.248  5.812   12.812  1.00 34.26 ? 287  TYR A CG    1 
ATOM   2020 C  CD1   . TYR A 1 286 ? 11.720  5.121   13.914  1.00 34.66 ? 287  TYR A CD1   1 
ATOM   2021 C  CD2   . TYR A 1 286 ? 12.080  6.777   12.228  1.00 33.93 ? 287  TYR A CD2   1 
ATOM   2022 C  CE1   . TYR A 1 286 ? 12.982  5.391   14.436  1.00 35.69 ? 287  TYR A CE1   1 
ATOM   2023 C  CE2   . TYR A 1 286 ? 13.346  7.058   12.755  1.00 34.39 ? 287  TYR A CE2   1 
ATOM   2024 C  CZ    . TYR A 1 286 ? 13.785  6.357   13.840  1.00 34.63 ? 287  TYR A CZ    1 
ATOM   2025 O  OH    . TYR A 1 286 ? 15.026  6.620   14.356  1.00 35.97 ? 287  TYR A OH    1 
ATOM   2026 N  N     . PRO A 1 287 ? 6.796   7.176   11.149  1.00 33.33 ? 288  PRO A N     1 
ATOM   2027 C  CA    . PRO A 1 287 ? 5.451   6.894   10.674  1.00 33.20 ? 288  PRO A CA    1 
ATOM   2028 C  C     . PRO A 1 287 ? 5.388   5.844   9.563   1.00 32.94 ? 288  PRO A C     1 
ATOM   2029 O  O     . PRO A 1 287 ? 4.332   5.251   9.340   1.00 33.34 ? 288  PRO A O     1 
ATOM   2030 C  CB    . PRO A 1 287 ? 4.977   8.256   10.164  1.00 33.51 ? 288  PRO A CB    1 
ATOM   2031 C  CG    . PRO A 1 287 ? 5.774   9.225   10.837  1.00 34.14 ? 288  PRO A CG    1 
ATOM   2032 C  CD    . PRO A 1 287 ? 7.130   8.603   10.982  1.00 33.49 ? 288  PRO A CD    1 
ATOM   2033 N  N     . GLU A 1 288 ? 6.520   5.620   8.896   1.00 32.94 ? 289  GLU A N     1 
ATOM   2034 C  CA    . GLU A 1 288 ? 6.668   4.640   7.827   1.00 33.45 ? 289  GLU A CA    1 
ATOM   2035 C  C     . GLU A 1 288 ? 6.951   3.199   8.309   1.00 33.16 ? 289  GLU A C     1 
ATOM   2036 O  O     . GLU A 1 288 ? 6.944   2.262   7.516   1.00 32.69 ? 289  GLU A O     1 
ATOM   2037 C  CB    . GLU A 1 288 ? 7.801   5.093   6.880   1.00 34.30 ? 289  GLU A CB    1 
ATOM   2038 N  N     . TYR A 1 289 ? 7.196   3.021   9.599   1.00 33.04 ? 290  TYR A N     1 
ATOM   2039 C  CA    . TYR A 1 289 ? 7.580   1.709   10.119  1.00 33.12 ? 290  TYR A CA    1 
ATOM   2040 C  C     . TYR A 1 289 ? 6.401   0.718   9.992   1.00 32.96 ? 290  TYR A C     1 
ATOM   2041 O  O     . TYR A 1 289 ? 5.291   0.997   10.437  1.00 32.10 ? 290  TYR A O     1 
ATOM   2042 C  CB    . TYR A 1 289 ? 8.073   1.835   11.567  1.00 33.00 ? 290  TYR A CB    1 
ATOM   2043 C  CG    . TYR A 1 289 ? 8.490   0.536   12.227  1.00 32.64 ? 290  TYR A CG    1 
ATOM   2044 C  CD1   . TYR A 1 289 ? 9.569   -0.210  11.742  1.00 31.03 ? 290  TYR A CD1   1 
ATOM   2045 C  CD2   . TYR A 1 289 ? 7.800   0.045   13.341  1.00 32.99 ? 290  TYR A CD2   1 
ATOM   2046 C  CE1   . TYR A 1 289 ? 9.955   -1.405  12.357  1.00 33.11 ? 290  TYR A CE1   1 
ATOM   2047 C  CE2   . TYR A 1 289 ? 8.184   -1.148  13.973  1.00 32.82 ? 290  TYR A CE2   1 
ATOM   2048 C  CZ    . TYR A 1 289 ? 9.264   -1.856  13.492  1.00 33.52 ? 290  TYR A CZ    1 
ATOM   2049 O  OH    . TYR A 1 289 ? 9.641   -3.041  14.110  1.00 33.85 ? 290  TYR A OH    1 
ATOM   2050 N  N     . THR A 1 290 ? 6.658   -0.424  9.358   1.00 33.01 ? 291  THR A N     1 
ATOM   2051 C  CA    . THR A 1 290 ? 5.654   -1.481  9.228   1.00 33.78 ? 291  THR A CA    1 
ATOM   2052 C  C     . THR A 1 290 ? 6.065   -2.779  9.946   1.00 34.11 ? 291  THR A C     1 
ATOM   2053 O  O     . THR A 1 290 ? 5.439   -3.809  9.752   1.00 34.50 ? 291  THR A O     1 
ATOM   2054 C  CB    . THR A 1 290 ? 5.372   -1.819  7.744   1.00 34.11 ? 291  THR A CB    1 
ATOM   2055 O  OG1   . THR A 1 290 ? 6.604   -2.137  7.080   1.00 33.39 ? 291  THR A OG1   1 
ATOM   2056 C  CG2   . THR A 1 290 ? 4.687   -0.672  7.053   1.00 34.15 ? 291  THR A CG2   1 
ATOM   2057 N  N     . GLY A 1 291 ? 7.118   -2.735  10.761  1.00 34.71 ? 292  GLY A N     1 
ATOM   2058 C  CA    . GLY A 1 291 ? 7.518   -3.899  11.551  1.00 35.11 ? 292  GLY A CA    1 
ATOM   2059 C  C     . GLY A 1 291 ? 6.699   -4.018  12.828  1.00 35.88 ? 292  GLY A C     1 
ATOM   2060 O  O     . GLY A 1 291 ? 5.747   -3.264  13.049  1.00 35.38 ? 292  GLY A O     1 
ATOM   2061 N  N     . SER A 1 292 ? 7.095   -4.954  13.690  1.00 36.72 ? 293  SER A N     1 
ATOM   2062 C  CA    . SER A 1 292 ? 6.396   -5.188  14.955  1.00 36.79 ? 293  SER A CA    1 
ATOM   2063 C  C     . SER A 1 292 ? 6.864   -4.251  16.029  1.00 36.36 ? 293  SER A C     1 
ATOM   2064 O  O     . SER A 1 292 ? 8.019   -3.812  16.041  1.00 36.34 ? 293  SER A O     1 
ATOM   2065 C  CB    . SER A 1 292 ? 6.616   -6.622  15.455  1.00 35.91 ? 293  SER A CB    1 
ATOM   2066 O  OG    . SER A 1 292 ? 6.074   -7.531  14.557  1.00 36.70 ? 293  SER A OG    1 
ATOM   2067 N  N     . ASN A 1 293 ? 5.963   -3.991  16.973  1.00 36.57 ? 294  ASN A N     1 
ATOM   2068 C  CA    . ASN A 1 293 ? 6.307   -3.337  18.215  1.00 36.58 ? 294  ASN A CA    1 
ATOM   2069 C  C     . ASN A 1 293 ? 6.838   -4.305  19.238  1.00 37.03 ? 294  ASN A C     1 
ATOM   2070 O  O     . ASN A 1 293 ? 6.263   -4.478  20.327  1.00 37.31 ? 294  ASN A O     1 
ATOM   2071 C  CB    . ASN A 1 293 ? 5.104   -2.584  18.769  1.00 37.08 ? 294  ASN A CB    1 
ATOM   2072 C  CG    . ASN A 1 293 ? 4.799   -1.351  17.972  1.00 36.96 ? 294  ASN A CG    1 
ATOM   2073 O  OD1   . ASN A 1 293 ? 5.704   -0.582  17.602  1.00 37.33 ? 294  ASN A OD1   1 
ATOM   2074 N  ND2   . ASN A 1 293 ? 3.528   -1.146  17.688  1.00 37.81 ? 294  ASN A ND2   1 
ATOM   2075 N  N     . THR A 1 294 ? 7.959   -4.930  18.882  1.00 36.67 ? 295  THR A N     1 
ATOM   2076 C  CA    . THR A 1 294 ? 8.663   -5.853  19.751  1.00 36.48 ? 295  THR A CA    1 
ATOM   2077 C  C     . THR A 1 294 ? 10.082  -5.336  19.881  1.00 35.89 ? 295  THR A C     1 
ATOM   2078 O  O     . THR A 1 294 ? 10.551  -4.611  19.012  1.00 35.75 ? 295  THR A O     1 
ATOM   2079 C  CB    . THR A 1 294 ? 8.640   -7.284  19.194  1.00 36.39 ? 295  THR A CB    1 
ATOM   2080 O  OG1   . THR A 1 294 ? 9.266   -7.316  17.908  1.00 36.93 ? 295  THR A OG1   1 
ATOM   2081 C  CG2   . THR A 1 294 ? 7.200   -7.785  19.065  1.00 35.85 ? 295  THR A CG2   1 
ATOM   2082 N  N     . TYR A 1 295 ? 10.752  -5.708  20.964  1.00 35.85 ? 296  TYR A N     1 
ATOM   2083 C  CA    . TYR A 1 295 ? 12.102  -5.219  21.247  1.00 36.28 ? 296  TYR A CA    1 
ATOM   2084 C  C     . TYR A 1 295 ? 13.047  -5.487  20.058  1.00 35.47 ? 296  TYR A C     1 
ATOM   2085 O  O     . TYR A 1 295 ? 13.664  -4.557  19.548  1.00 35.24 ? 296  TYR A O     1 
ATOM   2086 C  CB    . TYR A 1 295 ? 12.699  -5.836  22.537  1.00 36.59 ? 296  TYR A CB    1 
ATOM   2087 C  CG    . TYR A 1 295 ? 14.171  -5.484  22.683  1.00 38.52 ? 296  TYR A CG    1 
ATOM   2088 C  CD1   . TYR A 1 295 ? 14.555  -4.324  23.333  1.00 37.52 ? 296  TYR A CD1   1 
ATOM   2089 C  CD2   . TYR A 1 295 ? 15.174  -6.279  22.104  1.00 38.90 ? 296  TYR A CD2   1 
ATOM   2090 C  CE1   . TYR A 1 295 ? 15.902  -3.966  23.459  1.00 38.76 ? 296  TYR A CE1   1 
ATOM   2091 C  CE2   . TYR A 1 295 ? 16.545  -5.914  22.200  1.00 41.18 ? 296  TYR A CE2   1 
ATOM   2092 C  CZ    . TYR A 1 295 ? 16.893  -4.749  22.893  1.00 39.53 ? 296  TYR A CZ    1 
ATOM   2093 O  OH    . TYR A 1 295 ? 18.220  -4.357  23.022  1.00 40.91 ? 296  TYR A OH    1 
ATOM   2094 N  N     . GLU A 1 296 ? 13.127  -6.735  19.612  1.00 35.22 ? 297  GLU A N     1 
ATOM   2095 C  CA    . GLU A 1 296 ? 14.139  -7.132  18.611  1.00 35.54 ? 297  GLU A CA    1 
ATOM   2096 C  C     . GLU A 1 296 ? 13.971  -6.395  17.267  1.00 34.03 ? 297  GLU A C     1 
ATOM   2097 O  O     . GLU A 1 296 ? 14.958  -5.852  16.722  1.00 33.42 ? 297  GLU A O     1 
ATOM   2098 C  CB    . GLU A 1 296 ? 14.167  -8.643  18.413  1.00 36.20 ? 297  GLU A CB    1 
ATOM   2099 C  CG    . GLU A 1 296 ? 14.598  -9.454  19.658  1.00 41.99 ? 297  GLU A CG    1 
ATOM   2100 C  CD    . GLU A 1 296 ? 16.032  -9.166  20.142  1.00 49.97 ? 297  GLU A CD    1 
ATOM   2101 O  OE1   . GLU A 1 296 ? 16.297  -9.321  21.376  1.00 53.62 ? 297  GLU A OE1   1 
ATOM   2102 O  OE2   . GLU A 1 296 ? 16.884  -8.779  19.297  1.00 55.17 ? 297  GLU A OE2   1 
ATOM   2103 N  N     . GLU A 1 297 ? 12.731  -6.316  16.790  1.00 32.43 ? 298  GLU A N     1 
ATOM   2104 C  CA    . GLU A 1 297 ? 12.429  -5.694  15.490  1.00 32.57 ? 298  GLU A CA    1 
ATOM   2105 C  C     . GLU A 1 297 ? 12.529  -4.178  15.535  1.00 31.48 ? 298  GLU A C     1 
ATOM   2106 O  O     . GLU A 1 297 ? 13.158  -3.536  14.675  1.00 30.16 ? 298  GLU A O     1 
ATOM   2107 C  CB    . GLU A 1 297 ? 11.036  -6.129  14.995  1.00 32.31 ? 298  GLU A CB    1 
ATOM   2108 C  CG    . GLU A 1 297 ? 10.982  -7.589  14.627  1.00 34.04 ? 298  GLU A CG    1 
ATOM   2109 C  CD    . GLU A 1 297 ? 9.666   -8.037  13.977  1.00 33.83 ? 298  GLU A CD    1 
ATOM   2110 O  OE1   . GLU A 1 297 ? 9.395   -9.260  14.029  1.00 35.97 ? 298  GLU A OE1   1 
ATOM   2111 O  OE2   . GLU A 1 297 ? 8.927   -7.181  13.408  1.00 35.17 ? 298  GLU A OE2   1 
ATOM   2112 N  N     . ALA A 1 298 ? 11.946  -3.591  16.574  1.00 31.38 ? 299  ALA A N     1 
ATOM   2113 C  CA    . ALA A 1 298 ? 11.943  -2.159  16.710  1.00 31.63 ? 299  ALA A CA    1 
ATOM   2114 C  C     . ALA A 1 298 ? 13.366  -1.614  16.990  1.00 32.39 ? 299  ALA A C     1 
ATOM   2115 O  O     . ALA A 1 298 ? 13.775  -0.577  16.462  1.00 31.44 ? 299  ALA A O     1 
ATOM   2116 C  CB    . ALA A 1 298 ? 10.975  -1.768  17.803  1.00 31.25 ? 299  ALA A CB    1 
ATOM   2117 N  N     . ALA A 1 299 ? 14.112  -2.325  17.835  1.00 32.71 ? 300  ALA A N     1 
ATOM   2118 C  CA    . ALA A 1 299 ? 15.493  -1.963  18.133  1.00 32.24 ? 300  ALA A CA    1 
ATOM   2119 C  C     . ALA A 1 299 ? 16.348  -1.991  16.846  1.00 32.21 ? 300  ALA A C     1 
ATOM   2120 O  O     . ALA A 1 299 ? 17.163  -1.081  16.605  1.00 32.29 ? 300  ALA A O     1 
ATOM   2121 C  CB    . ALA A 1 299 ? 16.074  -2.937  19.190  1.00 32.31 ? 300  ALA A CB    1 
ATOM   2122 N  N     . ALA A 1 300 ? 16.173  -3.057  16.063  1.00 32.08 ? 301  ALA A N     1 
ATOM   2123 C  CA    . ALA A 1 300 ? 16.899  -3.279  14.814  1.00 31.70 ? 301  ALA A CA    1 
ATOM   2124 C  C     . ALA A 1 300 ? 16.607  -2.139  13.833  1.00 32.20 ? 301  ALA A C     1 
ATOM   2125 O  O     . ALA A 1 300 ? 17.513  -1.619  13.191  1.00 31.78 ? 301  ALA A O     1 
ATOM   2126 C  CB    . ALA A 1 300 ? 16.529  -4.646  14.204  1.00 31.38 ? 301  ALA A CB    1 
ATOM   2127 N  N     . TYR A 1 301 ? 15.339  -1.735  13.740  1.00 31.80 ? 302  TYR A N     1 
ATOM   2128 C  CA    . TYR A 1 301 ? 14.946  -0.635  12.861  1.00 31.28 ? 302  TYR A CA    1 
ATOM   2129 C  C     . TYR A 1 301 ? 15.614  0.694   13.252  1.00 30.68 ? 302  TYR A C     1 
ATOM   2130 O  O     . TYR A 1 301 ? 16.137  1.400   12.374  1.00 29.18 ? 302  TYR A O     1 
ATOM   2131 C  CB    . TYR A 1 301 ? 13.428  -0.480  12.842  1.00 31.70 ? 302  TYR A CB    1 
ATOM   2132 C  CG    . TYR A 1 301 ? 12.915  0.428   11.736  1.00 31.69 ? 302  TYR A CG    1 
ATOM   2133 C  CD1   . TYR A 1 301 ? 12.885  -0.002  10.408  1.00 32.76 ? 302  TYR A CD1   1 
ATOM   2134 C  CD2   . TYR A 1 301 ? 12.501  1.726   12.012  1.00 31.26 ? 302  TYR A CD2   1 
ATOM   2135 C  CE1   . TYR A 1 301 ? 12.414  0.828   9.398   1.00 32.12 ? 302  TYR A CE1   1 
ATOM   2136 C  CE2   . TYR A 1 301 ? 12.028  2.563   11.003  1.00 31.27 ? 302  TYR A CE2   1 
ATOM   2137 C  CZ    . TYR A 1 301 ? 11.990  2.111   9.706   1.00 32.64 ? 302  TYR A CZ    1 
ATOM   2138 O  OH    . TYR A 1 301 ? 11.531  2.939   8.706   1.00 33.98 ? 302  TYR A OH    1 
ATOM   2139 N  N     . ILE A 1 302 ? 15.630  1.012   14.555  1.00 29.94 ? 303  ILE A N     1 
ATOM   2140 C  CA    . ILE A 1 302 ? 16.286  2.236   15.051  1.00 30.17 ? 303  ILE A CA    1 
ATOM   2141 C  C     . ILE A 1 302 ? 17.783  2.197   14.677  1.00 31.02 ? 303  ILE A C     1 
ATOM   2142 O  O     . ILE A 1 302 ? 18.352  3.204   14.220  1.00 29.78 ? 303  ILE A O     1 
ATOM   2143 C  CB    . ILE A 1 302 ? 16.101  2.445   16.574  1.00 29.66 ? 303  ILE A CB    1 
ATOM   2144 C  CG1   . ILE A 1 302 ? 14.605  2.660   16.921  1.00 29.64 ? 303  ILE A CG1   1 
ATOM   2145 C  CG2   . ILE A 1 302 ? 16.928  3.641   17.076  1.00 28.64 ? 303  ILE A CG2   1 
ATOM   2146 C  CD1   . ILE A 1 302 ? 14.213  2.586   18.447  1.00 30.81 ? 303  ILE A CD1   1 
ATOM   2147 N  N     . GLN A 1 303 ? 18.402  1.027   14.847  1.00 30.95 ? 304  GLN A N     1 
ATOM   2148 C  CA    . GLN A 1 303 ? 19.828  0.892   14.523  1.00 31.06 ? 304  GLN A CA    1 
ATOM   2149 C  C     . GLN A 1 303 ? 20.053  1.241   13.068  1.00 31.18 ? 304  GLN A C     1 
ATOM   2150 O  O     . GLN A 1 303 ? 20.964  2.012   12.739  1.00 30.57 ? 304  GLN A O     1 
ATOM   2151 C  CB    . GLN A 1 303 ? 20.318  -0.515  14.797  1.00 30.98 ? 304  GLN A CB    1 
ATOM   2152 C  CG    . GLN A 1 303 ? 21.747  -0.781  14.291  1.00 31.65 ? 304  GLN A CG    1 
ATOM   2153 C  CD    . GLN A 1 303 ? 22.192  -2.162  14.584  1.00 32.94 ? 304  GLN A CD    1 
ATOM   2154 O  OE1   . GLN A 1 303 ? 21.394  -2.998  15.009  1.00 33.00 ? 304  GLN A OE1   1 
ATOM   2155 N  NE2   . GLN A 1 303 ? 23.470  -2.438  14.350  1.00 33.78 ? 304  GLN A NE2   1 
ATOM   2156 N  N     . CYS A 1 304 ? 19.191  0.693   12.209  1.00 30.95 ? 305  CYS A N     1 
ATOM   2157 C  CA    A CYS A 1 304 ? 19.262  0.959   10.779  0.50 31.07 ? 305  CYS A CA    1 
ATOM   2158 C  CA    B CYS A 1 304 ? 19.247  0.940   10.777  0.50 31.51 ? 305  CYS A CA    1 
ATOM   2159 C  C     . CYS A 1 304 ? 19.119  2.433   10.438  1.00 31.28 ? 305  CYS A C     1 
ATOM   2160 O  O     . CYS A 1 304 ? 19.858  2.946   9.596   1.00 30.42 ? 305  CYS A O     1 
ATOM   2161 C  CB    A CYS A 1 304 ? 18.213  0.146   10.019  0.50 30.97 ? 305  CYS A CB    1 
ATOM   2162 C  CB    B CYS A 1 304 ? 18.160  0.113   10.065  0.50 31.48 ? 305  CYS A CB    1 
ATOM   2163 S  SG    A CYS A 1 304 ? 18.684  -1.549  9.840   0.50 29.54 ? 305  CYS A SG    1 
ATOM   2164 S  SG    B CYS A 1 304 ? 18.185  0.181   8.265   0.50 32.81 ? 305  CYS A SG    1 
ATOM   2165 N  N     . GLN A 1 305 ? 18.171  3.114   11.089  1.00 31.96 ? 306  GLN A N     1 
ATOM   2166 C  CA    . GLN A 1 305 ? 17.934  4.544   10.836  1.00 32.07 ? 306  GLN A CA    1 
ATOM   2167 C  C     . GLN A 1 305 ? 19.151  5.411   11.198  1.00 32.28 ? 306  GLN A C     1 
ATOM   2168 O  O     . GLN A 1 305 ? 19.473  6.383   10.486  1.00 33.26 ? 306  GLN A O     1 
ATOM   2169 C  CB    . GLN A 1 305 ? 16.684  5.024   11.564  1.00 32.90 ? 306  GLN A CB    1 
ATOM   2170 C  CG    . GLN A 1 305 ? 15.392  4.240   11.254  1.00 34.03 ? 306  GLN A CG    1 
ATOM   2171 C  CD    . GLN A 1 305 ? 15.233  3.885   9.814   1.00 37.44 ? 306  GLN A CD    1 
ATOM   2172 O  OE1   . GLN A 1 305 ? 15.203  4.763   8.970   1.00 40.71 ? 306  GLN A OE1   1 
ATOM   2173 N  NE2   . GLN A 1 305 ? 15.145  2.576   9.504   1.00 38.51 ? 306  GLN A NE2   1 
ATOM   2174 N  N     . PHE A 1 306 ? 19.831  5.064   12.284  1.00 31.37 ? 307  PHE A N     1 
ATOM   2175 C  CA    . PHE A 1 306 ? 21.013  5.804   12.704  1.00 31.86 ? 307  PHE A CA    1 
ATOM   2176 C  C     . PHE A 1 306 ? 22.185  5.478   11.817  1.00 31.97 ? 307  PHE A C     1 
ATOM   2177 O  O     . PHE A 1 306 ? 22.880  6.377   11.402  1.00 31.33 ? 307  PHE A O     1 
ATOM   2178 C  CB    . PHE A 1 306 ? 21.348  5.578   14.191  1.00 31.48 ? 307  PHE A CB    1 
ATOM   2179 C  CG    . PHE A 1 306 ? 20.577  6.464   15.104  1.00 32.87 ? 307  PHE A CG    1 
ATOM   2180 C  CD1   . PHE A 1 306 ? 19.277  6.142   15.478  1.00 33.13 ? 307  PHE A CD1   1 
ATOM   2181 C  CD2   . PHE A 1 306 ? 21.112  7.651   15.554  1.00 29.79 ? 307  PHE A CD2   1 
ATOM   2182 C  CE1   . PHE A 1 306 ? 18.544  6.985   16.319  1.00 33.26 ? 307  PHE A CE1   1 
ATOM   2183 C  CE2   . PHE A 1 306 ? 20.381  8.486   16.369  1.00 32.90 ? 307  PHE A CE2   1 
ATOM   2184 C  CZ    . PHE A 1 306 ? 19.100  8.155   16.757  1.00 31.79 ? 307  PHE A CZ    1 
ATOM   2185 N  N     . GLU A 1 307 ? 22.354  4.201   11.461  1.00 32.81 ? 308  GLU A N     1 
ATOM   2186 C  CA    . GLU A 1 307 ? 23.502  3.792   10.653  1.00 33.50 ? 308  GLU A CA    1 
ATOM   2187 C  C     . GLU A 1 307 ? 23.366  4.331   9.222   1.00 33.43 ? 308  GLU A C     1 
ATOM   2188 O  O     . GLU A 1 307 ? 24.359  4.643   8.577   1.00 33.33 ? 308  GLU A O     1 
ATOM   2189 C  CB    . GLU A 1 307 ? 23.712  2.275   10.738  1.00 33.57 ? 308  GLU A CB    1 
ATOM   2190 C  CG    . GLU A 1 307 ? 24.280  1.836   12.117  1.00 34.22 ? 308  GLU A CG    1 
ATOM   2191 C  CD    . GLU A 1 307 ? 24.480  0.319   12.238  1.00 35.04 ? 308  GLU A CD    1 
ATOM   2192 O  OE1   . GLU A 1 307 ? 24.179  -0.421  11.275  1.00 34.93 ? 308  GLU A OE1   1 
ATOM   2193 O  OE2   . GLU A 1 307 ? 24.939  -0.134  13.307  1.00 38.16 ? 308  GLU A OE2   1 
ATOM   2194 N  N     . ASP A 1 308 ? 22.133  4.512   8.759   1.00 33.91 ? 309  ASP A N     1 
ATOM   2195 C  CA    . ASP A 1 308 ? 21.910  5.115   7.441   1.00 34.31 ? 309  ASP A CA    1 
ATOM   2196 C  C     . ASP A 1 308 ? 22.386  6.561   7.334   1.00 33.89 ? 309  ASP A C     1 
ATOM   2197 O  O     . ASP A 1 308 ? 22.625  7.037   6.236   1.00 32.92 ? 309  ASP A O     1 
ATOM   2198 C  CB    . ASP A 1 308 ? 20.437  5.029   7.032   1.00 34.79 ? 309  ASP A CB    1 
ATOM   2199 C  CG    . ASP A 1 308 ? 20.029  3.629   6.579   1.00 37.37 ? 309  ASP A CG    1 
ATOM   2200 O  OD1   . ASP A 1 308 ? 20.900  2.726   6.417   1.00 38.61 ? 309  ASP A OD1   1 
ATOM   2201 O  OD2   . ASP A 1 308 ? 18.810  3.444   6.368   1.00 41.80 ? 309  ASP A OD2   1 
ATOM   2202 N  N     . LEU A 1 309 ? 22.522  7.254   8.464   1.00 33.75 ? 310  LEU A N     1 
ATOM   2203 C  CA    . LEU A 1 309 ? 22.979  8.655   8.471   1.00 34.38 ? 310  LEU A CA    1 
ATOM   2204 C  C     . LEU A 1 309 ? 24.474  8.812   8.100   1.00 34.81 ? 310  LEU A C     1 
ATOM   2205 O  O     . LEU A 1 309 ? 24.925  9.908   7.793   1.00 35.45 ? 310  LEU A O     1 
ATOM   2206 C  CB    . LEU A 1 309 ? 22.650  9.320   9.813   1.00 33.61 ? 310  LEU A CB    1 
ATOM   2207 C  CG    . LEU A 1 309 ? 21.132  9.391   10.109  1.00 33.69 ? 310  LEU A CG    1 
ATOM   2208 C  CD1   . LEU A 1 309 ? 20.821  9.713   11.587  1.00 33.40 ? 310  LEU A CD1   1 
ATOM   2209 C  CD2   . LEU A 1 309 ? 20.418  10.390  9.145   1.00 34.43 ? 310  LEU A CD2   1 
ATOM   2210 N  N     . ASN A 1 310 ? 25.221  7.712   8.121   1.00 35.51 ? 311  ASN A N     1 
ATOM   2211 C  CA    . ASN A 1 310 ? 26.613  7.691   7.684   1.00 36.40 ? 311  ASN A CA    1 
ATOM   2212 C  C     . ASN A 1 310 ? 26.642  7.956   6.170   1.00 37.26 ? 311  ASN A C     1 
ATOM   2213 O  O     . ASN A 1 310 ? 26.139  7.151   5.381   1.00 36.85 ? 311  ASN A O     1 
ATOM   2214 C  CB    . ASN A 1 310 ? 27.228  6.322   8.059   1.00 36.08 ? 311  ASN A CB    1 
ATOM   2215 C  CG    . ASN A 1 310 ? 28.732  6.198   7.730   1.00 36.28 ? 311  ASN A CG    1 
ATOM   2216 O  OD1   . ASN A 1 310 ? 29.373  7.137   7.244   1.00 36.45 ? 311  ASN A OD1   1 
ATOM   2217 N  ND2   . ASN A 1 310 ? 29.291  5.024   8.011   1.00 31.18 ? 311  ASN A ND2   1 
ATOM   2218 N  N     . ARG A 1 311 ? 27.191  9.110   5.766   1.00 38.28 ? 312  ARG A N     1 
ATOM   2219 C  CA    . ARG A 1 311 ? 27.287  9.445   4.318   1.00 39.17 ? 312  ARG A CA    1 
ATOM   2220 C  C     . ARG A 1 311 ? 28.620  8.996   3.710   1.00 39.54 ? 312  ARG A C     1 
ATOM   2221 O  O     . ARG A 1 311 ? 28.934  9.318   2.545   1.00 39.94 ? 312  ARG A O     1 
ATOM   2222 C  CB    . ARG A 1 311 ? 27.072  10.944  4.069   1.00 38.98 ? 312  ARG A CB    1 
ATOM   2223 C  CG    . ARG A 1 311 ? 25.865  11.559  4.789   1.00 40.40 ? 312  ARG A CG    1 
ATOM   2224 C  CD    . ARG A 1 311 ? 25.824  13.095  4.630   1.00 39.99 ? 312  ARG A CD    1 
ATOM   2225 N  NE    . ARG A 1 311 ? 25.159  13.748  5.756   1.00 41.06 ? 312  ARG A NE    1 
ATOM   2226 N  N     . ARG A 1 312 ? 29.415  8.251   4.478   1.00 40.16 ? 313  ARG A N     1 
ATOM   2227 C  CA    . ARG A 1 312 ? 30.653  7.644   3.943   1.00 40.10 ? 313  ARG A CA    1 
ATOM   2228 C  C     . ARG A 1 312 ? 30.756  6.161   4.339   1.00 40.28 ? 313  ARG A C     1 
ATOM   2229 O  O     . ARG A 1 312 ? 31.784  5.708   4.873   1.00 39.28 ? 313  ARG A O     1 
ATOM   2230 C  CB    . ARG A 1 312 ? 31.874  8.425   4.446   1.00 40.56 ? 313  ARG A CB    1 
ATOM   2231 C  CG    . ARG A 1 312 ? 31.788  9.937   4.232   1.00 40.27 ? 313  ARG A CG    1 
ATOM   2232 N  N     . LYS A 1 313 ? 29.682  5.418   4.056   1.00 40.73 ? 314  LYS A N     1 
ATOM   2233 C  CA    . LYS A 1 313 ? 29.584  3.979   4.364   1.00 41.69 ? 314  LYS A CA    1 
ATOM   2234 C  C     . LYS A 1 313 ? 30.657  3.104   3.700   1.00 41.77 ? 314  LYS A C     1 
ATOM   2235 O  O     . LYS A 1 313 ? 31.010  2.060   4.239   1.00 42.04 ? 314  LYS A O     1 
ATOM   2236 C  CB    . LYS A 1 313 ? 28.215  3.425   3.938   1.00 41.90 ? 314  LYS A CB    1 
ATOM   2237 C  CG    . LYS A 1 313 ? 27.048  3.798   4.820   1.00 41.93 ? 314  LYS A CG    1 
ATOM   2238 C  CD    . LYS A 1 313 ? 25.710  3.448   4.135   1.00 42.50 ? 314  LYS A CD    1 
ATOM   2239 C  CE    . LYS A 1 313 ? 24.503  4.013   4.896   1.00 43.85 ? 314  LYS A CE    1 
ATOM   2240 N  NZ    . LYS A 1 313 ? 23.829  5.193   4.227   1.00 42.46 ? 314  LYS A NZ    1 
ATOM   2241 N  N     . ASP A 1 314 ? 31.151  3.509   2.531   1.00 41.90 ? 315  ASP A N     1 
ATOM   2242 C  CA    . ASP A 1 314 ? 32.218  2.773   1.838   1.00 42.18 ? 315  ASP A CA    1 
ATOM   2243 C  C     . ASP A 1 314 ? 33.560  2.934   2.546   1.00 42.29 ? 315  ASP A C     1 
ATOM   2244 O  O     . ASP A 1 314 ? 34.481  2.135   2.322   1.00 41.55 ? 315  ASP A O     1 
ATOM   2245 C  CB    . ASP A 1 314 ? 32.360  3.256   0.386   1.00 41.92 ? 315  ASP A CB    1 
ATOM   2246 N  N     . THR A 1 315 ? 33.637  3.955   3.406   1.00 41.60 ? 316  THR A N     1 
ATOM   2247 C  CA    . THR A 1 315 ? 34.879  4.461   3.987   1.00 41.92 ? 316  THR A CA    1 
ATOM   2248 C  C     . THR A 1 315 ? 34.974  4.312   5.519   1.00 41.22 ? 316  THR A C     1 
ATOM   2249 O  O     . THR A 1 315 ? 36.080  4.223   6.067   1.00 41.70 ? 316  THR A O     1 
ATOM   2250 C  CB    . THR A 1 315 ? 35.017  5.971   3.638   1.00 41.71 ? 316  THR A CB    1 
ATOM   2251 O  OG1   . THR A 1 315 ? 35.290  6.114   2.236   1.00 44.66 ? 316  THR A OG1   1 
ATOM   2252 C  CG2   . THR A 1 315 ? 36.134  6.626   4.434   1.00 43.09 ? 316  THR A CG2   1 
ATOM   2253 N  N     . LYS A 1 316 ? 33.830  4.286   6.205   1.00 39.92 ? 317  LYS A N     1 
ATOM   2254 C  CA    . LYS A 1 316 ? 33.821  4.411   7.655   1.00 39.11 ? 317  LYS A CA    1 
ATOM   2255 C  C     . LYS A 1 316 ? 32.790  3.485   8.329   1.00 38.06 ? 317  LYS A C     1 
ATOM   2256 O  O     . LYS A 1 316 ? 31.644  3.417   7.900   1.00 36.72 ? 317  LYS A O     1 
ATOM   2257 C  CB    . LYS A 1 316 ? 33.554  5.870   8.005   1.00 39.00 ? 317  LYS A CB    1 
ATOM   2258 C  CG    . LYS A 1 316 ? 33.627  6.211   9.494   1.00 40.30 ? 317  LYS A CG    1 
ATOM   2259 C  CD    . LYS A 1 316 ? 33.734  7.730   9.673   1.00 40.23 ? 317  LYS A CD    1 
ATOM   2260 C  CE    . LYS A 1 316 ? 34.177  8.122   11.063  1.00 39.59 ? 317  LYS A CE    1 
ATOM   2261 N  NZ    . LYS A 1 316 ? 35.473  7.519   11.447  1.00 38.01 ? 317  LYS A NZ    1 
ATOM   2262 N  N     . GLU A 1 317 ? 33.235  2.765   9.359   1.00 37.46 ? 318  GLU A N     1 
ATOM   2263 C  CA    . GLU A 1 317 ? 32.369  1.918   10.195  1.00 37.62 ? 318  GLU A CA    1 
ATOM   2264 C  C     . GLU A 1 317 ? 31.750  2.712   11.337  1.00 36.61 ? 318  GLU A C     1 
ATOM   2265 O  O     . GLU A 1 317 ? 32.365  3.674   11.830  1.00 35.91 ? 318  GLU A O     1 
ATOM   2266 C  CB    . GLU A 1 317 ? 33.191  0.782   10.824  1.00 37.87 ? 318  GLU A CB    1 
ATOM   2267 C  CG    . GLU A 1 317 ? 33.815  -0.177  9.861   1.00 40.33 ? 318  GLU A CG    1 
ATOM   2268 C  CD    . GLU A 1 317 ? 32.826  -1.174  9.322   1.00 41.61 ? 318  GLU A CD    1 
ATOM   2269 O  OE1   . GLU A 1 317 ? 31.623  -1.032  9.604   1.00 44.38 ? 318  GLU A OE1   1 
ATOM   2270 O  OE2   . GLU A 1 317 ? 33.250  -2.109  8.644   1.00 39.73 ? 318  GLU A OE2   1 
ATOM   2271 N  N     . ILE A 1 318 ? 30.529  2.316   11.735  1.00 35.28 ? 319  ILE A N     1 
ATOM   2272 C  CA    . ILE A 1 318 ? 29.930  2.668   13.021  1.00 34.47 ? 319  ILE A CA    1 
ATOM   2273 C  C     . ILE A 1 318 ? 29.875  1.376   13.829  1.00 33.89 ? 319  ILE A C     1 
ATOM   2274 O  O     . ILE A 1 318 ? 29.361  0.343   13.341  1.00 33.30 ? 319  ILE A O     1 
ATOM   2275 C  CB    . ILE A 1 318 ? 28.457  3.232   12.944  1.00 34.46 ? 319  ILE A CB    1 
ATOM   2276 C  CG1   . ILE A 1 318 ? 28.317  4.480   12.070  1.00 33.63 ? 319  ILE A CG1   1 
ATOM   2277 C  CG2   . ILE A 1 318 ? 27.921  3.560   14.356  1.00 34.12 ? 319  ILE A CG2   1 
ATOM   2278 C  CD1   . ILE A 1 318 ? 29.536  5.382   12.068  1.00 37.49 ? 319  ILE A CD1   1 
ATOM   2279 N  N     . TYR A 1 319 ? 30.412  1.435   15.047  1.00 33.46 ? 320  TYR A N     1 
ATOM   2280 C  CA    . TYR A 1 319 ? 30.438  0.290   15.965  1.00 33.77 ? 320  TYR A CA    1 
ATOM   2281 C  C     . TYR A 1 319 ? 29.300  0.359   16.976  1.00 33.31 ? 320  TYR A C     1 
ATOM   2282 O  O     . TYR A 1 319 ? 29.369  1.053   18.026  1.00 32.88 ? 320  TYR A O     1 
ATOM   2283 C  CB    . TYR A 1 319 ? 31.803  0.150   16.649  1.00 35.17 ? 320  TYR A CB    1 
ATOM   2284 C  CG    . TYR A 1 319 ? 32.921  0.179   15.649  1.00 35.53 ? 320  TYR A CG    1 
ATOM   2285 C  CD1   . TYR A 1 319 ? 33.276  -0.957  14.956  1.00 36.54 ? 320  TYR A CD1   1 
ATOM   2286 C  CD2   . TYR A 1 319 ? 33.583  1.369   15.352  1.00 37.08 ? 320  TYR A CD2   1 
ATOM   2287 C  CE1   . TYR A 1 319 ? 34.284  -0.929  14.013  1.00 37.22 ? 320  TYR A CE1   1 
ATOM   2288 C  CE2   . TYR A 1 319 ? 34.609  1.400   14.413  1.00 36.83 ? 320  TYR A CE2   1 
ATOM   2289 C  CZ    . TYR A 1 319 ? 34.943  0.251   13.749  1.00 36.47 ? 320  TYR A CZ    1 
ATOM   2290 O  OH    . TYR A 1 319 ? 35.961  0.251   12.810  1.00 38.55 ? 320  TYR A OH    1 
ATOM   2291 N  N     . THR A 1 320 ? 28.224  -0.354  16.648  1.00 32.49 ? 321  THR A N     1 
ATOM   2292 C  CA    . THR A 1 320 ? 26.976  -0.194  17.414  1.00 31.98 ? 321  THR A CA    1 
ATOM   2293 C  C     . THR A 1 320 ? 26.806  -1.270  18.473  1.00 31.55 ? 321  THR A C     1 
ATOM   2294 O  O     . THR A 1 320 ? 27.059  -2.433  18.218  1.00 30.54 ? 321  THR A O     1 
ATOM   2295 C  CB    . THR A 1 320 ? 25.764  -0.196  16.471  1.00 31.89 ? 321  THR A CB    1 
ATOM   2296 O  OG1   . THR A 1 320 ? 25.914  0.873   15.529  1.00 33.15 ? 321  THR A OG1   1 
ATOM   2297 C  CG2   . THR A 1 320 ? 24.460  0.006   17.247  1.00 30.67 ? 321  THR A CG2   1 
ATOM   2298 N  N     . HIS A 1 321 ? 26.351  -0.855  19.662  1.00 32.17 ? 322  HIS A N     1 
ATOM   2299 C  CA    . HIS A 1 321 ? 26.057  -1.758  20.750  1.00 32.81 ? 322  HIS A CA    1 
ATOM   2300 C  C     . HIS A 1 321 ? 24.764  -1.335  21.381  1.00 32.42 ? 322  HIS A C     1 
ATOM   2301 O  O     . HIS A 1 321 ? 24.504  -0.140  21.560  1.00 32.42 ? 322  HIS A O     1 
ATOM   2302 C  CB    . HIS A 1 321 ? 27.180  -1.735  21.802  1.00 33.16 ? 322  HIS A CB    1 
ATOM   2303 C  CG    . HIS A 1 321 ? 28.468  -2.289  21.285  1.00 35.28 ? 322  HIS A CG    1 
ATOM   2304 N  ND1   . HIS A 1 321 ? 28.818  -3.613  21.426  1.00 37.36 ? 322  HIS A ND1   1 
ATOM   2305 C  CD2   . HIS A 1 321 ? 29.450  -1.711  20.560  1.00 36.85 ? 322  HIS A CD2   1 
ATOM   2306 C  CE1   . HIS A 1 321 ? 29.977  -3.823  20.825  1.00 40.08 ? 322  HIS A CE1   1 
ATOM   2307 N  NE2   . HIS A 1 321 ? 30.385  -2.679  20.299  1.00 38.28 ? 322  HIS A NE2   1 
ATOM   2308 N  N     . PHE A 1 322 ? 23.952  -2.316  21.734  1.00 32.91 ? 323  PHE A N     1 
ATOM   2309 C  CA    . PHE A 1 322 ? 22.783  -2.048  22.553  1.00 32.35 ? 323  PHE A CA    1 
ATOM   2310 C  C     . PHE A 1 322 ? 23.208  -2.103  24.006  1.00 33.05 ? 323  PHE A C     1 
ATOM   2311 O  O     . PHE A 1 322 ? 23.880  -3.047  24.429  1.00 32.56 ? 323  PHE A O     1 
ATOM   2312 C  CB    . PHE A 1 322 ? 21.666  -3.039  22.244  1.00 32.90 ? 323  PHE A CB    1 
ATOM   2313 C  CG    . PHE A 1 322 ? 21.085  -2.863  20.877  1.00 33.19 ? 323  PHE A CG    1 
ATOM   2314 C  CD1   . PHE A 1 322 ? 21.567  -3.586  19.802  1.00 35.70 ? 323  PHE A CD1   1 
ATOM   2315 C  CD2   . PHE A 1 322 ? 20.076  -1.944  20.660  1.00 31.83 ? 323  PHE A CD2   1 
ATOM   2316 C  CE1   . PHE A 1 322 ? 21.017  -3.420  18.522  1.00 35.98 ? 323  PHE A CE1   1 
ATOM   2317 C  CE2   . PHE A 1 322 ? 19.544  -1.773  19.405  1.00 30.64 ? 323  PHE A CE2   1 
ATOM   2318 C  CZ    . PHE A 1 322 ? 20.019  -2.500  18.335  1.00 32.46 ? 323  PHE A CZ    1 
ATOM   2319 N  N     . THR A 1 323 ? 22.858  -1.074  24.762  1.00 32.68 ? 324  THR A N     1 
ATOM   2320 C  CA    . THR A 1 323 ? 23.369  -0.943  26.125  1.00 33.64 ? 324  THR A CA    1 
ATOM   2321 C  C     . THR A 1 323 ? 22.277  -0.637  27.137  1.00 33.43 ? 324  THR A C     1 
ATOM   2322 O  O     . THR A 1 323 ? 21.241  -0.030  26.827  1.00 33.45 ? 324  THR A O     1 
ATOM   2323 C  CB    . THR A 1 323 ? 24.506  0.160   26.267  1.00 32.68 ? 324  THR A CB    1 
ATOM   2324 O  OG1   . THR A 1 323 ? 23.996  1.472   26.011  1.00 32.63 ? 324  THR A OG1   1 
ATOM   2325 C  CG2   . THR A 1 323 ? 25.682  -0.110  25.318  1.00 34.16 ? 324  THR A CG2   1 
ATOM   2326 N  N     . CYS A 1 324 ? 22.548  -1.065  28.362  1.00 33.65 ? 325  CYS A N     1 
ATOM   2327 C  CA    . CYS A 1 324 ? 21.870  -0.565  29.536  1.00 33.28 ? 325  CYS A CA    1 
ATOM   2328 C  C     . CYS A 1 324 ? 22.958  0.051   30.397  1.00 32.90 ? 325  CYS A C     1 
ATOM   2329 O  O     . CYS A 1 324 ? 23.728  -0.679  31.026  1.00 32.62 ? 325  CYS A O     1 
ATOM   2330 C  CB    . CYS A 1 324 ? 21.163  -1.725  30.262  1.00 33.98 ? 325  CYS A CB    1 
ATOM   2331 S  SG    . CYS A 1 324 ? 20.392  -1.151  31.808  1.00 35.69 ? 325  CYS A SG    1 
ATOM   2332 N  N     . ALA A 1 325 ? 23.066  1.380   30.378  1.00 32.27 ? 326  ALA A N     1 
ATOM   2333 C  CA    . ALA A 1 325 ? 24.162  2.105   31.068  1.00 33.11 ? 326  ALA A CA    1 
ATOM   2334 C  C     . ALA A 1 325 ? 24.167  1.906   32.586  1.00 32.88 ? 326  ALA A C     1 
ATOM   2335 O  O     . ALA A 1 325 ? 25.190  2.024   33.213  1.00 33.69 ? 326  ALA A O     1 
ATOM   2336 C  CB    . ALA A 1 325 ? 24.102  3.575   30.744  1.00 31.66 ? 326  ALA A CB    1 
ATOM   2337 N  N     . THR A 1 326 ? 23.017  1.566   33.153  1.00 33.80 ? 327  THR A N     1 
ATOM   2338 C  CA    . THR A 1 326 ? 22.908  1.326   34.585  1.00 34.16 ? 327  THR A CA    1 
ATOM   2339 C  C     . THR A 1 326 ? 23.288  -0.119  34.963  1.00 34.14 ? 327  THR A C     1 
ATOM   2340 O  O     . THR A 1 326 ? 23.305  -0.474  36.141  1.00 34.62 ? 327  THR A O     1 
ATOM   2341 C  CB    . THR A 1 326 ? 21.490  1.693   35.107  1.00 34.39 ? 327  THR A CB    1 
ATOM   2342 O  OG1   . THR A 1 326 ? 20.487  1.011   34.345  1.00 34.82 ? 327  THR A OG1   1 
ATOM   2343 C  CG2   . THR A 1 326 ? 21.264  3.221   35.039  1.00 34.76 ? 327  THR A CG2   1 
ATOM   2344 N  N     . ASP A 1 327 ? 23.585  -0.959  33.966  1.00 34.19 ? 328  ASP A N     1 
ATOM   2345 C  CA    . ASP A 1 327 ? 23.922  -2.358  34.213  1.00 34.26 ? 328  ASP A CA    1 
ATOM   2346 C  C     . ASP A 1 327 ? 25.426  -2.484  34.077  1.00 33.71 ? 328  ASP A C     1 
ATOM   2347 O  O     . ASP A 1 327 ? 25.947  -2.514  32.977  1.00 32.67 ? 328  ASP A O     1 
ATOM   2348 C  CB    . ASP A 1 327 ? 23.143  -3.256  33.223  1.00 33.79 ? 328  ASP A CB    1 
ATOM   2349 C  CG    . ASP A 1 327 ? 23.443  -4.743  33.350  1.00 35.44 ? 328  ASP A CG    1 
ATOM   2350 O  OD1   . ASP A 1 327 ? 24.476  -5.182  33.875  1.00 34.56 ? 328  ASP A OD1   1 
ATOM   2351 O  OD2   . ASP A 1 327 ? 22.622  -5.496  32.806  1.00 38.59 ? 328  ASP A OD2   1 
ATOM   2352 N  N     . THR A 1 328 ? 26.116  -2.591  35.211  1.00 34.13 ? 329  THR A N     1 
ATOM   2353 C  CA    . THR A 1 328 ? 27.592  -2.711  35.224  1.00 33.68 ? 329  THR A CA    1 
ATOM   2354 C  C     . THR A 1 328 ? 28.157  -3.858  34.354  1.00 34.17 ? 329  THR A C     1 
ATOM   2355 O  O     . THR A 1 328 ? 29.024  -3.624  33.505  1.00 33.73 ? 329  THR A O     1 
ATOM   2356 C  CB    . THR A 1 328 ? 28.121  -2.800  36.699  1.00 34.24 ? 329  THR A CB    1 
ATOM   2357 O  OG1   . THR A 1 328 ? 27.717  -1.616  37.414  1.00 32.70 ? 329  THR A OG1   1 
ATOM   2358 C  CG2   . THR A 1 328 ? 29.634  -2.948  36.741  1.00 32.59 ? 329  THR A CG2   1 
ATOM   2359 N  N     . LYS A 1 329 ? 27.657  -5.077  34.555  1.00 34.02 ? 330  LYS A N     1 
ATOM   2360 C  CA    . LYS A 1 329 ? 28.087  -6.240  33.756  1.00 34.41 ? 330  LYS A CA    1 
ATOM   2361 C  C     . LYS A 1 329 ? 27.988  -5.966  32.240  1.00 33.92 ? 330  LYS A C     1 
ATOM   2362 O  O     . LYS A 1 329 ? 28.923  -6.239  31.478  1.00 33.25 ? 330  LYS A O     1 
ATOM   2363 C  CB    . LYS A 1 329 ? 27.279  -7.476  34.146  1.00 34.50 ? 330  LYS A CB    1 
ATOM   2364 C  CG    . LYS A 1 329 ? 27.875  -8.786  33.703  1.00 37.84 ? 330  LYS A CG    1 
ATOM   2365 N  N     . ASN A 1 330 ? 26.879  -5.373  31.818  1.00 33.69 ? 331  ASN A N     1 
ATOM   2366 C  CA    . ASN A 1 330 ? 26.680  -5.056  30.397  1.00 33.66 ? 331  ASN A CA    1 
ATOM   2367 C  C     . ASN A 1 330 ? 27.696  -4.019  29.865  1.00 33.43 ? 331  ASN A C     1 
ATOM   2368 O  O     . ASN A 1 330 ? 28.320  -4.194  28.812  1.00 32.73 ? 331  ASN A O     1 
ATOM   2369 C  CB    . ASN A 1 330 ? 25.240  -4.584  30.179  1.00 33.63 ? 331  ASN A CB    1 
ATOM   2370 C  CG    . ASN A 1 330 ? 24.938  -4.310  28.725  1.00 35.20 ? 331  ASN A CG    1 
ATOM   2371 O  OD1   . ASN A 1 330 ? 24.501  -3.225  28.390  1.00 36.41 ? 331  ASN A OD1   1 
ATOM   2372 N  ND2   . ASN A 1 330 ? 25.199  -5.300  27.846  1.00 36.11 ? 331  ASN A ND2   1 
ATOM   2373 N  N     . VAL A 1 331 ? 27.871  -2.931  30.604  1.00 33.85 ? 332  VAL A N     1 
ATOM   2374 C  CA    . VAL A 1 331 ? 28.769  -1.871  30.172  1.00 33.41 ? 332  VAL A CA    1 
ATOM   2375 C  C     . VAL A 1 331 ? 30.221  -2.381  30.169  1.00 33.61 ? 332  VAL A C     1 
ATOM   2376 O  O     . VAL A 1 331 ? 31.011  -2.007  29.309  1.00 34.03 ? 332  VAL A O     1 
ATOM   2377 C  CB    . VAL A 1 331 ? 28.605  -0.610  31.092  1.00 33.16 ? 332  VAL A CB    1 
ATOM   2378 C  CG1   . VAL A 1 331 ? 29.653  0.372   30.821  1.00 32.93 ? 332  VAL A CG1   1 
ATOM   2379 C  CG2   . VAL A 1 331 ? 27.242  0.036   30.909  1.00 34.05 ? 332  VAL A CG2   1 
ATOM   2380 N  N     . GLN A 1 332 ? 30.584  -3.225  31.134  1.00 33.87 ? 333  GLN A N     1 
ATOM   2381 C  CA    . GLN A 1 332 ? 31.942  -3.779  31.183  1.00 35.12 ? 333  GLN A CA    1 
ATOM   2382 C  C     . GLN A 1 332 ? 32.226  -4.610  29.937  1.00 34.78 ? 333  GLN A C     1 
ATOM   2383 O  O     . GLN A 1 332 ? 33.264  -4.454  29.294  1.00 34.67 ? 333  GLN A O     1 
ATOM   2384 C  CB    . GLN A 1 332 ? 32.133  -4.620  32.436  1.00 35.65 ? 333  GLN A CB    1 
ATOM   2385 C  CG    . GLN A 1 332 ? 33.508  -5.266  32.545  1.00 37.91 ? 333  GLN A CG    1 
ATOM   2386 C  CD    . GLN A 1 332 ? 33.707  -5.983  33.861  1.00 41.41 ? 333  GLN A CD    1 
ATOM   2387 O  OE1   . GLN A 1 332 ? 32.748  -6.245  34.587  1.00 45.60 ? 333  GLN A OE1   1 
ATOM   2388 N  NE2   . GLN A 1 332 ? 34.959  -6.287  34.192  1.00 42.28 ? 333  GLN A NE2   1 
ATOM   2389 N  N     . PHE A 1 333 ? 31.276  -5.476  29.594  1.00 35.04 ? 334  PHE A N     1 
ATOM   2390 C  CA    . PHE A 1 333 ? 31.386  -6.312  28.403  1.00 35.77 ? 334  PHE A CA    1 
ATOM   2391 C  C     . PHE A 1 333 ? 31.473  -5.461  27.117  1.00 35.14 ? 334  PHE A C     1 
ATOM   2392 O  O     . PHE A 1 333 ? 32.318  -5.701  26.253  1.00 34.38 ? 334  PHE A O     1 
ATOM   2393 C  CB    . PHE A 1 333 ? 30.197  -7.266  28.346  1.00 36.94 ? 334  PHE A CB    1 
ATOM   2394 C  CG    . PHE A 1 333 ? 30.108  -8.036  27.078  1.00 39.23 ? 334  PHE A CG    1 
ATOM   2395 C  CD1   . PHE A 1 333 ? 30.642  -9.323  26.994  1.00 40.59 ? 334  PHE A CD1   1 
ATOM   2396 C  CD2   . PHE A 1 333 ? 29.489  -7.479  25.958  1.00 41.17 ? 334  PHE A CD2   1 
ATOM   2397 C  CE1   . PHE A 1 333 ? 30.572  -10.053 25.806  1.00 42.53 ? 334  PHE A CE1   1 
ATOM   2398 C  CE2   . PHE A 1 333 ? 29.426  -8.207  24.760  1.00 41.93 ? 334  PHE A CE2   1 
ATOM   2399 C  CZ    . PHE A 1 333 ? 29.960  -9.479  24.687  1.00 41.00 ? 334  PHE A CZ    1 
ATOM   2400 N  N     . VAL A 1 334 ? 30.572  -4.498  26.989  1.00 34.05 ? 335  VAL A N     1 
ATOM   2401 C  CA    . VAL A 1 334 ? 30.539  -3.627  25.818  1.00 33.81 ? 335  VAL A CA    1 
ATOM   2402 C  C     . VAL A 1 334 ? 31.790  -2.758  25.711  1.00 33.47 ? 335  VAL A C     1 
ATOM   2403 O  O     . VAL A 1 334 ? 32.354  -2.629  24.641  1.00 32.77 ? 335  VAL A O     1 
ATOM   2404 C  CB    . VAL A 1 334 ? 29.250  -2.758  25.783  1.00 33.94 ? 335  VAL A CB    1 
ATOM   2405 C  CG1   . VAL A 1 334 ? 29.408  -1.548  24.848  1.00 35.03 ? 335  VAL A CG1   1 
ATOM   2406 C  CG2   . VAL A 1 334 ? 28.037  -3.629  25.372  1.00 32.91 ? 335  VAL A CG2   1 
ATOM   2407 N  N     . PHE A 1 335 ? 32.222  -2.163  26.821  1.00 33.61 ? 336  PHE A N     1 
ATOM   2408 C  CA    . PHE A 1 335 ? 33.420  -1.316  26.806  1.00 34.46 ? 336  PHE A CA    1 
ATOM   2409 C  C     . PHE A 1 335 ? 34.704  -2.098  26.522  1.00 33.95 ? 336  PHE A C     1 
ATOM   2410 O  O     . PHE A 1 335 ? 35.634  -1.582  25.890  1.00 33.79 ? 336  PHE A O     1 
ATOM   2411 C  CB    . PHE A 1 335 ? 33.588  -0.533  28.110  1.00 34.94 ? 336  PHE A CB    1 
ATOM   2412 C  CG    . PHE A 1 335 ? 34.596  0.564   27.990  1.00 36.24 ? 336  PHE A CG    1 
ATOM   2413 C  CD1   . PHE A 1 335 ? 34.239  1.775   27.397  1.00 37.15 ? 336  PHE A CD1   1 
ATOM   2414 C  CD2   . PHE A 1 335 ? 35.896  0.382   28.431  1.00 36.31 ? 336  PHE A CD2   1 
ATOM   2415 C  CE1   . PHE A 1 335 ? 35.168  2.789   27.249  1.00 38.37 ? 336  PHE A CE1   1 
ATOM   2416 C  CE2   . PHE A 1 335 ? 36.831  1.382   28.297  1.00 37.63 ? 336  PHE A CE2   1 
ATOM   2417 C  CZ    . PHE A 1 335 ? 36.475  2.601   27.698  1.00 37.43 ? 336  PHE A CZ    1 
ATOM   2418 N  N     . ASP A 1 336 ? 34.767  -3.336  26.999  1.00 34.34 ? 337  ASP A N     1 
ATOM   2419 C  CA    . ASP A 1 336 ? 35.872  -4.216  26.627  1.00 34.01 ? 337  ASP A CA    1 
ATOM   2420 C  C     . ASP A 1 336 ? 35.960  -4.388  25.109  1.00 34.08 ? 337  ASP A C     1 
ATOM   2421 O  O     . ASP A 1 336 ? 37.055  -4.308  24.513  1.00 33.01 ? 337  ASP A O     1 
ATOM   2422 C  CB    . ASP A 1 336 ? 35.735  -5.586  27.287  1.00 34.61 ? 337  ASP A CB    1 
ATOM   2423 C  CG    . ASP A 1 336 ? 36.836  -6.549  26.861  1.00 36.18 ? 337  ASP A CG    1 
ATOM   2424 O  OD1   . ASP A 1 336 ? 36.712  -7.184  25.790  1.00 40.67 ? 337  ASP A OD1   1 
ATOM   2425 O  OD2   . ASP A 1 336 ? 37.837  -6.671  27.593  1.00 35.81 ? 337  ASP A OD2   1 
ATOM   2426 N  N     . ALA A 1 337 ? 34.807  -4.651  24.505  1.00 34.13 ? 338  ALA A N     1 
ATOM   2427 C  CA    . ALA A 1 337 ? 34.688  -4.828  23.055  1.00 34.44 ? 338  ALA A CA    1 
ATOM   2428 C  C     . ALA A 1 337 ? 35.085  -3.556  22.321  1.00 34.35 ? 338  ALA A C     1 
ATOM   2429 O  O     . ALA A 1 337 ? 35.772  -3.599  21.294  1.00 32.90 ? 338  ALA A O     1 
ATOM   2430 C  CB    . ALA A 1 337 ? 33.236  -5.220  22.698  1.00 34.63 ? 338  ALA A CB    1 
ATOM   2431 N  N     . VAL A 1 338 ? 34.638  -2.425  22.859  1.00 35.10 ? 339  VAL A N     1 
ATOM   2432 C  CA    . VAL A 1 338 ? 34.952  -1.110  22.294  1.00 36.02 ? 339  VAL A CA    1 
ATOM   2433 C  C     . VAL A 1 338 ? 36.452  -0.826  22.298  1.00 35.68 ? 339  VAL A C     1 
ATOM   2434 O  O     . VAL A 1 338 ? 36.987  -0.292  21.324  1.00 34.90 ? 339  VAL A O     1 
ATOM   2435 C  CB    . VAL A 1 338 ? 34.260  0.028   23.079  1.00 36.70 ? 339  VAL A CB    1 
ATOM   2436 C  CG1   . VAL A 1 338 ? 34.874  1.391   22.710  1.00 37.07 ? 339  VAL A CG1   1 
ATOM   2437 C  CG2   . VAL A 1 338 ? 32.757  0.008   22.830  1.00 38.18 ? 339  VAL A CG2   1 
ATOM   2438 N  N     . THR A 1 339 ? 37.101  -1.167  23.411  1.00 35.25 ? 340  THR A N     1 
ATOM   2439 C  CA    . THR A 1 339 ? 38.529  -0.958  23.587  1.00 35.16 ? 340  THR A CA    1 
ATOM   2440 C  C     . THR A 1 339 ? 39.322  -1.764  22.563  1.00 34.92 ? 340  THR A C     1 
ATOM   2441 O  O     . THR A 1 339 ? 40.298  -1.269  22.005  1.00 34.80 ? 340  THR A O     1 
ATOM   2442 C  CB    . THR A 1 339 ? 38.960  -1.337  25.023  1.00 35.35 ? 340  THR A CB    1 
ATOM   2443 O  OG1   . THR A 1 339 ? 38.296  -0.481  25.954  1.00 36.38 ? 340  THR A OG1   1 
ATOM   2444 C  CG2   . THR A 1 339 ? 40.484  -1.207  25.227  1.00 35.15 ? 340  THR A CG2   1 
ATOM   2445 N  N     . ASP A 1 340 ? 38.881  -3.001  22.327  1.00 34.72 ? 341  ASP A N     1 
ATOM   2446 C  CA    . ASP A 1 340 ? 39.457  -3.875  21.306  1.00 34.93 ? 341  ASP A CA    1 
ATOM   2447 C  C     . ASP A 1 340 ? 39.357  -3.224  19.934  1.00 34.37 ? 341  ASP A C     1 
ATOM   2448 O  O     . ASP A 1 340 ? 40.328  -3.210  19.195  1.00 32.73 ? 341  ASP A O     1 
ATOM   2449 C  CB    . ASP A 1 340 ? 38.778  -5.256  21.323  1.00 35.02 ? 341  ASP A CB    1 
ATOM   2450 C  CG    . ASP A 1 340 ? 39.266  -6.146  22.480  1.00 36.92 ? 341  ASP A CG    1 
ATOM   2451 O  OD1   . ASP A 1 340 ? 40.275  -5.789  23.125  1.00 36.32 ? 341  ASP A OD1   1 
ATOM   2452 O  OD2   . ASP A 1 340 ? 38.632  -7.203  22.740  1.00 39.90 ? 341  ASP A OD2   1 
ATOM   2453 N  N     . VAL A 1 341 ? 38.202  -2.632  19.620  1.00 34.12 ? 342  VAL A N     1 
ATOM   2454 C  CA    . VAL A 1 341 ? 38.052  -1.918  18.339  1.00 34.34 ? 342  VAL A CA    1 
ATOM   2455 C  C     . VAL A 1 341 ? 39.063  -0.755  18.206  1.00 34.18 ? 342  VAL A C     1 
ATOM   2456 O  O     . VAL A 1 341 ? 39.700  -0.582  17.161  1.00 33.86 ? 342  VAL A O     1 
ATOM   2457 C  CB    . VAL A 1 341 ? 36.601  -1.427  18.139  1.00 34.13 ? 342  VAL A CB    1 
ATOM   2458 C  CG1   . VAL A 1 341 ? 36.531  -0.338  17.050  1.00 34.29 ? 342  VAL A CG1   1 
ATOM   2459 C  CG2   . VAL A 1 341 ? 35.699  -2.609  17.810  1.00 34.93 ? 342  VAL A CG2   1 
ATOM   2460 N  N     . ILE A 1 342 ? 39.213  0.019   19.282  1.00 34.73 ? 343  ILE A N     1 
ATOM   2461 C  CA    . ILE A 1 342 ? 40.146  1.158   19.314  1.00 34.60 ? 343  ILE A CA    1 
ATOM   2462 C  C     . ILE A 1 342 ? 41.604  0.702   19.162  1.00 34.90 ? 343  ILE A C     1 
ATOM   2463 O  O     . ILE A 1 342 ? 42.343  1.276   18.367  1.00 34.86 ? 343  ILE A O     1 
ATOM   2464 C  CB    . ILE A 1 342 ? 39.995  1.972   20.624  1.00 34.33 ? 343  ILE A CB    1 
ATOM   2465 C  CG1   . ILE A 1 342 ? 38.618  2.629   20.713  1.00 35.26 ? 343  ILE A CG1   1 
ATOM   2466 C  CG2   . ILE A 1 342 ? 41.044  3.083   20.724  1.00 34.25 ? 343  ILE A CG2   1 
ATOM   2467 C  CD1   . ILE A 1 342 ? 38.332  3.233   22.103  1.00 35.01 ? 343  ILE A CD1   1 
ATOM   2468 N  N     . ILE A 1 343 ? 42.010  -0.331  19.910  1.00 35.44 ? 344  ILE A N     1 
ATOM   2469 C  CA    . ILE A 1 343 ? 43.363  -0.927  19.751  1.00 35.97 ? 344  ILE A CA    1 
ATOM   2470 C  C     . ILE A 1 343 ? 43.587  -1.360  18.302  1.00 36.78 ? 344  ILE A C     1 
ATOM   2471 O  O     . ILE A 1 343 ? 44.581  -0.995  17.675  1.00 37.26 ? 344  ILE A O     1 
ATOM   2472 C  CB    . ILE A 1 343 ? 43.573  -2.167  20.671  1.00 35.43 ? 344  ILE A CB    1 
ATOM   2473 C  CG1   . ILE A 1 343 ? 43.597  -1.768  22.143  1.00 35.44 ? 344  ILE A CG1   1 
ATOM   2474 C  CG2   . ILE A 1 343 ? 44.866  -2.908  20.321  1.00 35.41 ? 344  ILE A CG2   1 
ATOM   2475 C  CD1   . ILE A 1 343 ? 43.518  -2.971  23.067  1.00 34.75 ? 344  ILE A CD1   1 
ATOM   2476 N  N     . LYS A 1 344 ? 42.643  -2.128  17.772  1.00 37.68 ? 345  LYS A N     1 
ATOM   2477 C  CA    . LYS A 1 344 ? 42.743  -2.652  16.413  1.00 38.62 ? 345  LYS A CA    1 
ATOM   2478 C  C     . LYS A 1 344 ? 42.817  -1.533  15.370  1.00 39.13 ? 345  LYS A C     1 
ATOM   2479 O  O     . LYS A 1 344 ? 43.510  -1.664  14.360  1.00 37.88 ? 345  LYS A O     1 
ATOM   2480 C  CB    . LYS A 1 344 ? 41.546  -3.551  16.128  1.00 39.05 ? 345  LYS A CB    1 
ATOM   2481 C  CG    . LYS A 1 344 ? 41.805  -4.674  15.210  1.00 40.62 ? 345  LYS A CG    1 
ATOM   2482 C  CD    . LYS A 1 344 ? 40.697  -5.694  15.334  1.00 43.09 ? 345  LYS A CD    1 
ATOM   2483 C  CE    . LYS A 1 344 ? 41.030  -6.925  14.540  1.00 44.88 ? 345  LYS A CE    1 
ATOM   2484 N  NZ    . LYS A 1 344 ? 40.049  -8.002  14.826  1.00 47.57 ? 345  LYS A NZ    1 
ATOM   2485 N  N     . ASN A 1 345 ? 42.102  -0.436  15.624  1.00 39.54 ? 346  ASN A N     1 
ATOM   2486 C  CA    . ASN A 1 345 ? 42.093  0.727   14.728  1.00 40.62 ? 346  ASN A CA    1 
ATOM   2487 C  C     . ASN A 1 345 ? 43.284  1.677   14.915  1.00 42.09 ? 346  ASN A C     1 
ATOM   2488 O  O     . ASN A 1 345 ? 43.471  2.562   14.086  1.00 42.35 ? 346  ASN A O     1 
ATOM   2489 C  CB    . ASN A 1 345 ? 40.781  1.529   14.879  1.00 40.22 ? 346  ASN A CB    1 
ATOM   2490 C  CG    . ASN A 1 345 ? 39.591  0.851   14.216  1.00 39.34 ? 346  ASN A CG    1 
ATOM   2491 O  OD1   . ASN A 1 345 ? 39.729  -0.160  13.528  1.00 36.62 ? 346  ASN A OD1   1 
ATOM   2492 N  ND2   . ASN A 1 345 ? 38.400  1.414   14.433  1.00 40.67 ? 346  ASN A ND2   1 
ATOM   2493 N  N     . ASN A 1 346 ? 44.076  1.511   15.982  1.00 43.76 ? 347  ASN A N     1 
ATOM   2494 C  CA    . ASN A 1 346 ? 45.335  2.285   16.152  1.00 45.16 ? 347  ASN A CA    1 
ATOM   2495 C  C     . ASN A 1 346 ? 46.640  1.483   15.967  1.00 45.46 ? 347  ASN A C     1 
ATOM   2496 O  O     . ASN A 1 346 ? 47.689  1.910   16.444  1.00 45.90 ? 347  ASN A O     1 
ATOM   2497 C  CB    . ASN A 1 346 ? 45.381  2.974   17.532  1.00 45.28 ? 347  ASN A CB    1 
ATOM   2498 C  CG    . ASN A 1 346 ? 44.742  4.368   17.537  1.00 47.65 ? 347  ASN A CG    1 
ATOM   2499 O  OD1   . ASN A 1 346 ? 44.370  4.921   16.489  1.00 49.22 ? 347  ASN A OD1   1 
ATOM   2500 N  ND2   . ASN A 1 346 ? 44.591  4.931   18.739  1.00 48.60 ? 347  ASN A ND2   1 
ATOM   2501 N  N     . LEU A 1 347 ? 46.594  0.347   15.273  1.00 46.02 ? 348  LEU A N     1 
ATOM   2502 C  CA    . LEU A 1 347 ? 47.772  -0.530  15.171  1.00 46.33 ? 348  LEU A CA    1 
ATOM   2503 C  C     . LEU A 1 347 ? 48.914  0.123   14.397  1.00 46.47 ? 348  LEU A C     1 
ATOM   2504 O  O     . LEU A 1 347 ? 48.764  0.458   13.223  1.00 46.72 ? 348  LEU A O     1 
ATOM   2505 C  CB    . LEU A 1 347 ? 47.406  -1.871  14.520  1.00 46.49 ? 348  LEU A CB    1 
ATOM   2506 C  CG    . LEU A 1 347 ? 46.518  -2.803  15.357  1.00 46.85 ? 348  LEU A CG    1 
ATOM   2507 C  CD1   . LEU A 1 347 ? 45.892  -3.909  14.500  1.00 46.54 ? 348  LEU A CD1   1 
ATOM   2508 C  CD2   . LEU A 1 347 ? 47.313  -3.397  16.523  1.00 47.06 ? 348  LEU A CD2   1 
ATOM   2509 N  N     . SER B 2 7   ? 42.639  32.484  56.387  1.00 39.14 ? 46   SER B N     1 
ATOM   2510 C  CA    . SER B 2 7   ? 42.604  32.056  54.970  1.00 38.92 ? 46   SER B CA    1 
ATOM   2511 C  C     . SER B 2 7   ? 42.179  30.602  54.884  1.00 38.96 ? 46   SER B C     1 
ATOM   2512 O  O     . SER B 2 7   ? 41.336  30.286  54.076  1.00 38.23 ? 46   SER B O     1 
ATOM   2513 C  CB    . SER B 2 7   ? 43.966  32.233  54.288  1.00 38.32 ? 46   SER B CB    1 
ATOM   2514 O  OG    . SER B 2 7   ? 43.864  33.108  53.076  1.00 40.48 ? 46   SER B OG    1 
ATOM   2515 N  N     . THR B 2 8   ? 42.758  29.720  55.700  1.00 38.93 ? 47   THR B N     1 
ATOM   2516 C  CA    . THR B 2 8   ? 42.361  28.303  55.624  1.00 39.51 ? 47   THR B CA    1 
ATOM   2517 C  C     . THR B 2 8   ? 40.934  28.083  56.182  1.00 39.46 ? 47   THR B C     1 
ATOM   2518 O  O     . THR B 2 8   ? 40.186  27.229  55.682  1.00 37.84 ? 47   THR B O     1 
ATOM   2519 C  CB    . THR B 2 8   ? 43.406  27.322  56.264  1.00 39.09 ? 47   THR B CB    1 
ATOM   2520 O  OG1   . THR B 2 8   ? 43.297  27.317  57.686  1.00 41.95 ? 47   THR B OG1   1 
ATOM   2521 C  CG2   . THR B 2 8   ? 44.807  27.702  55.880  1.00 38.49 ? 47   THR B CG2   1 
ATOM   2522 N  N     . GLU B 2 9   ? 40.558  28.861  57.200  1.00 39.93 ? 48   GLU B N     1 
ATOM   2523 C  CA    . GLU B 2 9   ? 39.194  28.797  57.722  1.00 40.60 ? 48   GLU B CA    1 
ATOM   2524 C  C     . GLU B 2 9   ? 38.214  29.278  56.659  1.00 40.47 ? 48   GLU B C     1 
ATOM   2525 O  O     . GLU B 2 9   ? 37.127  28.709  56.537  1.00 40.79 ? 48   GLU B O     1 
ATOM   2526 C  CB    . GLU B 2 9   ? 39.025  29.596  59.020  1.00 41.00 ? 48   GLU B CB    1 
ATOM   2527 C  CG    . GLU B 2 9   ? 37.603  29.515  59.653  1.00 43.45 ? 48   GLU B CG    1 
ATOM   2528 C  CD    . GLU B 2 9   ? 37.398  28.311  60.594  1.00 46.43 ? 48   GLU B CD    1 
ATOM   2529 O  OE1   . GLU B 2 9   ? 37.791  27.176  60.237  1.00 48.06 ? 48   GLU B OE1   1 
ATOM   2530 O  OE2   . GLU B 2 9   ? 36.830  28.503  61.697  1.00 48.35 ? 48   GLU B OE2   1 
ATOM   2531 N  N     . GLU B 2 10  ? 38.592  30.296  55.877  1.00 39.98 ? 49   GLU B N     1 
ATOM   2532 C  CA    . GLU B 2 10  ? 37.726  30.755  54.799  1.00 39.79 ? 49   GLU B CA    1 
ATOM   2533 C  C     . GLU B 2 10  ? 37.650  29.768  53.644  1.00 38.77 ? 49   GLU B C     1 
ATOM   2534 O  O     . GLU B 2 10  ? 36.559  29.479  53.146  1.00 38.59 ? 49   GLU B O     1 
ATOM   2535 C  CB    . GLU B 2 10  ? 38.123  32.133  54.258  1.00 40.29 ? 49   GLU B CB    1 
ATOM   2536 C  CG    . GLU B 2 10  ? 36.882  32.837  53.656  1.00 41.64 ? 49   GLU B CG    1 
ATOM   2537 C  CD    . GLU B 2 10  ? 37.187  33.760  52.503  1.00 42.29 ? 49   GLU B CD    1 
ATOM   2538 O  OE1   . GLU B 2 10  ? 38.090  34.604  52.650  1.00 44.56 ? 49   GLU B OE1   1 
ATOM   2539 O  OE2   . GLU B 2 10  ? 36.493  33.664  51.473  1.00 40.62 ? 49   GLU B OE2   1 
ATOM   2540 N  N     . ALA B 2 11  ? 38.799  29.255  53.207  1.00 37.50 ? 50   ALA B N     1 
ATOM   2541 C  CA    . ALA B 2 11  ? 38.805  28.284  52.109  1.00 36.58 ? 50   ALA B CA    1 
ATOM   2542 C  C     . ALA B 2 11  ? 38.043  27.004  52.476  1.00 36.27 ? 50   ALA B C     1 
ATOM   2543 O  O     . ALA B 2 11  ? 37.327  26.444  51.629  1.00 35.27 ? 50   ALA B O     1 
ATOM   2544 C  CB    . ALA B 2 11  ? 40.226  27.963  51.663  1.00 36.02 ? 50   ALA B CB    1 
ATOM   2545 N  N     . THR B 2 12  ? 38.181  26.555  53.725  1.00 36.25 ? 51   THR B N     1 
ATOM   2546 C  CA    . THR B 2 12  ? 37.437  25.378  54.203  1.00 36.54 ? 51   THR B CA    1 
ATOM   2547 C  C     . THR B 2 12  ? 35.923  25.706  54.368  1.00 36.89 ? 51   THR B C     1 
ATOM   2548 O  O     . THR B 2 12  ? 35.071  24.817  54.246  1.00 36.93 ? 51   THR B O     1 
ATOM   2549 C  CB    . THR B 2 12  ? 38.027  24.773  55.525  1.00 36.97 ? 51   THR B CB    1 
ATOM   2550 O  OG1   . THR B 2 12  ? 37.883  25.703  56.597  1.00 35.03 ? 51   THR B OG1   1 
ATOM   2551 C  CG2   . THR B 2 12  ? 39.529  24.390  55.386  1.00 36.40 ? 51   THR B CG2   1 
ATOM   2552 N  N     . ARG B 2 13  ? 35.599  26.976  54.628  1.00 36.90 ? 52   ARG B N     1 
ATOM   2553 C  CA    . ARG B 2 13  ? 34.197  27.400  54.754  1.00 36.91 ? 52   ARG B CA    1 
ATOM   2554 C  C     . ARG B 2 13  ? 33.445  27.259  53.429  1.00 36.22 ? 52   ARG B C     1 
ATOM   2555 O  O     . ARG B 2 13  ? 32.245  27.076  53.436  1.00 35.55 ? 52   ARG B O     1 
ATOM   2556 C  CB    . ARG B 2 13  ? 34.086  28.851  55.235  1.00 37.39 ? 52   ARG B CB    1 
ATOM   2557 C  CG    . ARG B 2 13  ? 32.685  29.260  55.741  1.00 39.53 ? 52   ARG B CG    1 
ATOM   2558 C  CD    . ARG B 2 13  ? 32.429  28.997  57.235  1.00 44.26 ? 52   ARG B CD    1 
ATOM   2559 N  NE    . ARG B 2 13  ? 31.117  29.567  57.602  1.00 47.41 ? 52   ARG B NE    1 
ATOM   2560 C  CZ    . ARG B 2 13  ? 29.921  29.031  57.313  1.00 46.16 ? 52   ARG B CZ    1 
ATOM   2561 N  NH1   . ARG B 2 13  ? 29.828  27.866  56.694  1.00 47.13 ? 52   ARG B NH1   1 
ATOM   2562 N  NH2   . ARG B 2 13  ? 28.808  29.652  57.674  1.00 44.96 ? 52   ARG B NH2   1 
ATOM   2563 N  N     . TRP B 2 14  ? 34.149  27.352  52.310  1.00 35.86 ? 53   TRP B N     1 
ATOM   2564 C  CA    . TRP B 2 14  ? 33.513  27.217  50.994  1.00 36.16 ? 53   TRP B CA    1 
ATOM   2565 C  C     . TRP B 2 14  ? 32.858  25.858  50.774  1.00 35.94 ? 53   TRP B C     1 
ATOM   2566 O  O     . TRP B 2 14  ? 31.901  25.746  49.982  1.00 36.67 ? 53   TRP B O     1 
ATOM   2567 C  CB    . TRP B 2 14  ? 34.508  27.442  49.865  1.00 35.85 ? 53   TRP B CB    1 
ATOM   2568 C  CG    . TRP B 2 14  ? 35.184  28.761  49.875  1.00 35.94 ? 53   TRP B CG    1 
ATOM   2569 C  CD1   . TRP B 2 14  ? 34.817  29.888  50.568  1.00 36.07 ? 53   TRP B CD1   1 
ATOM   2570 C  CD2   . TRP B 2 14  ? 36.352  29.104  49.137  1.00 35.83 ? 53   TRP B CD2   1 
ATOM   2571 N  NE1   . TRP B 2 14  ? 35.708  30.905  50.314  1.00 36.27 ? 53   TRP B NE1   1 
ATOM   2572 C  CE2   . TRP B 2 14  ? 36.661  30.452  49.440  1.00 36.22 ? 53   TRP B CE2   1 
ATOM   2573 C  CE3   . TRP B 2 14  ? 37.169  28.406  48.241  1.00 35.76 ? 53   TRP B CE3   1 
ATOM   2574 C  CZ2   . TRP B 2 14  ? 37.759  31.111  48.880  1.00 36.70 ? 53   TRP B CZ2   1 
ATOM   2575 C  CZ3   . TRP B 2 14  ? 38.274  29.062  47.696  1.00 36.07 ? 53   TRP B CZ3   1 
ATOM   2576 C  CH2   . TRP B 2 14  ? 38.548  30.397  48.005  1.00 35.91 ? 53   TRP B CH2   1 
ATOM   2577 N  N     . ALA B 2 15  ? 33.398  24.850  51.464  1.00 35.74 ? 54   ALA B N     1 
ATOM   2578 C  CA    . ALA B 2 15  ? 32.936  23.469  51.417  1.00 35.34 ? 54   ALA B CA    1 
ATOM   2579 C  C     . ALA B 2 15  ? 31.743  23.201  52.340  1.00 35.30 ? 54   ALA B C     1 
ATOM   2580 O  O     . ALA B 2 15  ? 31.189  22.101  52.326  1.00 35.69 ? 54   ALA B O     1 
ATOM   2581 C  CB    . ALA B 2 15  ? 34.089  22.521  51.787  1.00 35.10 ? 54   ALA B CB    1 
ATOM   2582 N  N     . ASP B 2 16  ? 31.330  24.196  53.119  1.00 34.61 ? 55   ASP B N     1 
ATOM   2583 C  CA    . ASP B 2 16  ? 30.227  23.996  54.053  1.00 34.56 ? 55   ASP B CA    1 
ATOM   2584 C  C     . ASP B 2 16  ? 28.922  23.875  53.310  1.00 33.43 ? 55   ASP B C     1 
ATOM   2585 O  O     . ASP B 2 16  ? 28.122  23.018  53.642  1.00 33.11 ? 55   ASP B O     1 
ATOM   2586 C  CB    . ASP B 2 16  ? 30.160  25.103  55.095  1.00 34.49 ? 55   ASP B CB    1 
ATOM   2587 C  CG    . ASP B 2 16  ? 31.200  24.944  56.172  1.00 36.70 ? 55   ASP B CG    1 
ATOM   2588 O  OD1   . ASP B 2 16  ? 31.812  23.860  56.298  1.00 40.30 ? 55   ASP B OD1   1 
ATOM   2589 O  OD2   . ASP B 2 16  ? 31.397  25.904  56.917  1.00 33.91 ? 55   ASP B OD2   1 
ATOM   2590 N  N     . SER B 2 17  ? 28.732  24.714  52.293  1.00 33.07 ? 56   SER B N     1 
ATOM   2591 C  CA    . SER B 2 17  ? 27.656  24.565  51.335  1.00 32.96 ? 56   SER B CA    1 
ATOM   2592 C  C     . SER B 2 17  ? 27.905  25.517  50.159  1.00 32.74 ? 56   SER B C     1 
ATOM   2593 O  O     . SER B 2 17  ? 28.687  26.472  50.260  1.00 32.22 ? 56   SER B O     1 
ATOM   2594 C  CB    . SER B 2 17  ? 26.303  24.883  51.943  1.00 33.14 ? 56   SER B CB    1 
ATOM   2595 O  OG    . SER B 2 17  ? 26.223  26.255  52.251  1.00 34.23 ? 56   SER B OG    1 
ATOM   2596 N  N     . PHE B 2 18  ? 27.222  25.257  49.062  1.00 32.58 ? 57   PHE B N     1 
ATOM   2597 C  CA    . PHE B 2 18  ? 27.332  26.120  47.876  1.00 33.01 ? 57   PHE B CA    1 
ATOM   2598 C  C     . PHE B 2 18  ? 26.983  27.595  48.216  1.00 33.73 ? 57   PHE B C     1 
ATOM   2599 O  O     . PHE B 2 18  ? 27.646  28.532  47.778  1.00 33.60 ? 57   PHE B O     1 
ATOM   2600 C  CB    . PHE B 2 18  ? 26.450  25.575  46.758  1.00 32.64 ? 57   PHE B CB    1 
ATOM   2601 C  CG    . PHE B 2 18  ? 26.630  26.271  45.448  1.00 33.40 ? 57   PHE B CG    1 
ATOM   2602 C  CD1   . PHE B 2 18  ? 27.898  26.557  44.963  1.00 32.91 ? 57   PHE B CD1   1 
ATOM   2603 C  CD2   . PHE B 2 18  ? 25.524  26.680  44.710  1.00 32.49 ? 57   PHE B CD2   1 
ATOM   2604 C  CE1   . PHE B 2 18  ? 28.049  27.232  43.754  1.00 34.87 ? 57   PHE B CE1   1 
ATOM   2605 C  CE2   . PHE B 2 18  ? 25.672  27.351  43.524  1.00 34.21 ? 57   PHE B CE2   1 
ATOM   2606 C  CZ    . PHE B 2 18  ? 26.930  27.617  43.032  1.00 34.17 ? 57   PHE B CZ    1 
ATOM   2607 N  N     . ASP B 2 19  ? 25.947  27.788  49.014  1.00 34.35 ? 58   ASP B N     1 
ATOM   2608 C  CA    . ASP B 2 19  ? 25.508  29.139  49.337  1.00 35.04 ? 58   ASP B CA    1 
ATOM   2609 C  C     . ASP B 2 19  ? 26.508  29.871  50.204  1.00 34.64 ? 58   ASP B C     1 
ATOM   2610 O  O     . ASP B 2 19  ? 26.632  31.083  50.090  1.00 33.96 ? 58   ASP B O     1 
ATOM   2611 C  CB    . ASP B 2 19  ? 24.134  29.101  49.979  1.00 35.97 ? 58   ASP B CB    1 
ATOM   2612 C  CG    . ASP B 2 19  ? 23.036  28.848  48.962  1.00 38.90 ? 58   ASP B CG    1 
ATOM   2613 O  OD1   . ASP B 2 19  ? 23.242  29.132  47.755  1.00 39.06 ? 58   ASP B OD1   1 
ATOM   2614 O  OD2   . ASP B 2 19  ? 21.977  28.345  49.381  1.00 43.80 ? 58   ASP B OD2   1 
ATOM   2615 N  N     . VAL B 2 20  ? 27.246  29.140  51.037  1.00 34.50 ? 59   VAL B N     1 
ATOM   2616 C  CA    . VAL B 2 20  ? 28.324  29.759  51.845  1.00 35.15 ? 59   VAL B CA    1 
ATOM   2617 C  C     . VAL B 2 20  ? 29.449  30.165  50.898  1.00 35.54 ? 59   VAL B C     1 
ATOM   2618 O  O     . VAL B 2 20  ? 29.976  31.246  51.033  1.00 36.04 ? 59   VAL B O     1 
ATOM   2619 C  CB    . VAL B 2 20  ? 28.846  28.865  52.971  1.00 33.92 ? 59   VAL B CB    1 
ATOM   2620 C  CG1   . VAL B 2 20  ? 30.119  29.483  53.627  1.00 35.16 ? 59   VAL B CG1   1 
ATOM   2621 C  CG2   . VAL B 2 20  ? 27.767  28.644  54.021  1.00 33.71 ? 59   VAL B CG2   1 
ATOM   2622 N  N     . LEU B 2 21  ? 29.783  29.324  49.925  1.00 35.73 ? 60   LEU B N     1 
ATOM   2623 C  CA    . LEU B 2 21  ? 30.774  29.694  48.906  1.00 36.34 ? 60   LEU B CA    1 
ATOM   2624 C  C     . LEU B 2 21  ? 30.379  30.988  48.200  1.00 36.78 ? 60   LEU B C     1 
ATOM   2625 O  O     . LEU B 2 21  ? 31.177  31.941  48.146  1.00 37.09 ? 60   LEU B O     1 
ATOM   2626 C  CB    . LEU B 2 21  ? 30.980  28.573  47.896  1.00 36.30 ? 60   LEU B CB    1 
ATOM   2627 C  CG    . LEU B 2 21  ? 31.960  28.783  46.737  1.00 37.39 ? 60   LEU B CG    1 
ATOM   2628 C  CD1   . LEU B 2 21  ? 32.317  27.460  46.091  1.00 38.71 ? 60   LEU B CD1   1 
ATOM   2629 C  CD2   . LEU B 2 21  ? 31.408  29.747  45.678  1.00 36.39 ? 60   LEU B CD2   1 
ATOM   2630 N  N     . LEU B 2 22  ? 29.134  31.039  47.718  1.00 37.09 ? 61   LEU B N     1 
ATOM   2631 C  CA    . LEU B 2 22  ? 28.594  32.225  47.031  1.00 38.07 ? 61   LEU B CA    1 
ATOM   2632 C  C     . LEU B 2 22  ? 28.563  33.518  47.887  1.00 38.47 ? 61   LEU B C     1 
ATOM   2633 O  O     . LEU B 2 22  ? 28.536  34.627  47.347  1.00 39.36 ? 61   LEU B O     1 
ATOM   2634 C  CB    . LEU B 2 22  ? 27.188  31.919  46.495  1.00 38.47 ? 61   LEU B CB    1 
ATOM   2635 C  CG    . LEU B 2 22  ? 27.087  30.896  45.360  1.00 40.10 ? 61   LEU B CG    1 
ATOM   2636 C  CD1   . LEU B 2 22  ? 25.617  30.502  45.137  1.00 38.93 ? 61   LEU B CD1   1 
ATOM   2637 C  CD2   . LEU B 2 22  ? 27.748  31.404  44.043  1.00 39.16 ? 61   LEU B CD2   1 
ATOM   2638 N  N     . SER B 2 23  ? 28.593  33.384  49.210  1.00 38.07 ? 62   SER B N     1 
ATOM   2639 C  CA    . SER B 2 23  ? 28.518  34.539  50.100  1.00 38.13 ? 62   SER B CA    1 
ATOM   2640 C  C     . SER B 2 23  ? 29.906  35.139  50.358  1.00 37.99 ? 62   SER B C     1 
ATOM   2641 O  O     . SER B 2 23  ? 30.026  36.168  51.018  1.00 38.35 ? 62   SER B O     1 
ATOM   2642 C  CB    . SER B 2 23  ? 27.819  34.160  51.413  1.00 37.56 ? 62   SER B CB    1 
ATOM   2643 O  OG    . SER B 2 23  ? 28.664  33.419  52.262  1.00 40.51 ? 62   SER B OG    1 
ATOM   2644 N  N     . HIS B 2 24  ? 30.945  34.473  49.846  1.00 37.73 ? 63   HIS B N     1 
ATOM   2645 C  CA    . HIS B 2 24  ? 32.322  34.931  49.950  1.00 37.69 ? 63   HIS B CA    1 
ATOM   2646 C  C     . HIS B 2 24  ? 32.880  35.385  48.598  1.00 37.30 ? 63   HIS B C     1 
ATOM   2647 O  O     . HIS B 2 24  ? 32.996  34.596  47.681  1.00 36.23 ? 63   HIS B O     1 
ATOM   2648 C  CB    . HIS B 2 24  ? 33.189  33.809  50.525  1.00 38.33 ? 63   HIS B CB    1 
ATOM   2649 C  CG    . HIS B 2 24  ? 33.011  33.606  51.998  1.00 39.28 ? 63   HIS B CG    1 
ATOM   2650 N  ND1   . HIS B 2 24  ? 32.160  32.654  52.520  1.00 42.64 ? 63   HIS B ND1   1 
ATOM   2651 C  CD2   . HIS B 2 24  ? 33.550  34.248  53.060  1.00 40.93 ? 63   HIS B CD2   1 
ATOM   2652 C  CE1   . HIS B 2 24  ? 32.192  32.711  53.840  1.00 40.09 ? 63   HIS B CE1   1 
ATOM   2653 N  NE2   . HIS B 2 24  ? 33.034  33.664  54.191  1.00 41.84 ? 63   HIS B NE2   1 
ATOM   2654 N  N     . LYS B 2 25  ? 33.260  36.658  48.490  1.00 37.20 ? 64   LYS B N     1 
ATOM   2655 C  CA    . LYS B 2 25  ? 33.892  37.192  47.263  1.00 37.85 ? 64   LYS B CA    1 
ATOM   2656 C  C     . LYS B 2 25  ? 35.025  36.306  46.710  1.00 37.00 ? 64   LYS B C     1 
ATOM   2657 O  O     . LYS B 2 25  ? 35.081  36.035  45.515  1.00 36.48 ? 64   LYS B O     1 
ATOM   2658 C  CB    . LYS B 2 25  ? 34.432  38.601  47.517  1.00 38.93 ? 64   LYS B CB    1 
ATOM   2659 C  CG    . LYS B 2 25  ? 35.338  39.147  46.405  1.00 41.67 ? 64   LYS B CG    1 
ATOM   2660 N  N     . TYR B 2 26  ? 35.924  35.858  47.578  1.00 36.31 ? 65   TYR B N     1 
ATOM   2661 C  CA    . TYR B 2 26  ? 37.056  35.046  47.129  1.00 35.87 ? 65   TYR B CA    1 
ATOM   2662 C  C     . TYR B 2 26  ? 36.602  33.627  46.738  1.00 34.39 ? 65   TYR B C     1 
ATOM   2663 O  O     . TYR B 2 26  ? 37.232  32.989  45.906  1.00 34.01 ? 65   TYR B O     1 
ATOM   2664 C  CB    . TYR B 2 26  ? 38.163  34.980  48.183  1.00 36.76 ? 65   TYR B CB    1 
ATOM   2665 C  CG    . TYR B 2 26  ? 38.774  36.329  48.583  1.00 38.36 ? 65   TYR B CG    1 
ATOM   2666 C  CD1   . TYR B 2 26  ? 39.054  37.324  47.638  1.00 39.17 ? 65   TYR B CD1   1 
ATOM   2667 C  CD2   . TYR B 2 26  ? 39.094  36.591  49.910  1.00 39.84 ? 65   TYR B CD2   1 
ATOM   2668 C  CE1   . TYR B 2 26  ? 39.617  38.559  48.021  1.00 40.30 ? 65   TYR B CE1   1 
ATOM   2669 C  CE2   . TYR B 2 26  ? 39.667  37.812  50.303  1.00 40.83 ? 65   TYR B CE2   1 
ATOM   2670 C  CZ    . TYR B 2 26  ? 39.922  38.790  49.358  1.00 39.31 ? 65   TYR B CZ    1 
ATOM   2671 O  OH    . TYR B 2 26  ? 40.479  39.991  49.781  1.00 41.42 ? 65   TYR B OH    1 
ATOM   2672 N  N     . GLY B 2 27  ? 35.527  33.138  47.346  1.00 33.05 ? 66   GLY B N     1 
ATOM   2673 C  CA    . GLY B 2 27  ? 34.941  31.859  46.951  1.00 33.12 ? 66   GLY B CA    1 
ATOM   2674 C  C     . GLY B 2 27  ? 34.324  31.949  45.573  1.00 32.54 ? 66   GLY B C     1 
ATOM   2675 O  O     . GLY B 2 27  ? 34.530  31.085  44.731  1.00 31.52 ? 66   GLY B O     1 
ATOM   2676 N  N     . VAL B 2 28  ? 33.577  33.028  45.331  1.00 32.84 ? 67   VAL B N     1 
ATOM   2677 C  CA    . VAL B 2 28  ? 33.043  33.301  44.002  1.00 33.31 ? 67   VAL B CA    1 
ATOM   2678 C  C     . VAL B 2 28  ? 34.155  33.354  42.936  1.00 32.14 ? 67   VAL B C     1 
ATOM   2679 O  O     . VAL B 2 28  ? 34.011  32.785  41.875  1.00 31.68 ? 67   VAL B O     1 
ATOM   2680 C  CB    . VAL B 2 28  ? 32.184  34.604  43.966  1.00 33.83 ? 67   VAL B CB    1 
ATOM   2681 C  CG1   . VAL B 2 28  ? 31.662  34.846  42.564  1.00 34.35 ? 67   VAL B CG1   1 
ATOM   2682 C  CG2   . VAL B 2 28  ? 30.982  34.471  44.910  1.00 35.57 ? 67   VAL B CG2   1 
ATOM   2683 N  N     . ALA B 2 29  ? 35.252  34.044  43.227  1.00 32.06 ? 68   ALA B N     1 
ATOM   2684 C  CA    . ALA B 2 29  ? 36.347  34.190  42.277  1.00 31.80 ? 68   ALA B CA    1 
ATOM   2685 C  C     . ALA B 2 29  ? 36.992  32.846  41.965  1.00 32.15 ? 68   ALA B C     1 
ATOM   2686 O  O     . ALA B 2 29  ? 37.333  32.558  40.804  1.00 32.53 ? 68   ALA B O     1 
ATOM   2687 C  CB    . ALA B 2 29  ? 37.404  35.185  42.813  1.00 31.39 ? 68   ALA B CB    1 
ATOM   2688 N  N     . ALA B 2 30  ? 37.215  32.039  43.004  1.00 33.06 ? 69   ALA B N     1 
ATOM   2689 C  CA    . ALA B 2 30  ? 37.780  30.699  42.811  1.00 32.37 ? 69   ALA B CA    1 
ATOM   2690 C  C     . ALA B 2 30  ? 36.823  29.831  41.977  1.00 33.11 ? 69   ALA B C     1 
ATOM   2691 O  O     . ALA B 2 30  ? 37.250  29.164  41.030  1.00 31.65 ? 69   ALA B O     1 
ATOM   2692 C  CB    . ALA B 2 30  ? 38.100  30.042  44.165  1.00 33.41 ? 69   ALA B CB    1 
ATOM   2693 N  N     . PHE B 2 31  ? 35.532  29.847  42.308  1.00 32.44 ? 70   PHE B N     1 
ATOM   2694 C  CA    . PHE B 2 31  ? 34.560  29.028  41.592  1.00 32.61 ? 70   PHE B CA    1 
ATOM   2695 C  C     . PHE B 2 31  ? 34.464  29.449  40.113  1.00 32.53 ? 70   PHE B C     1 
ATOM   2696 O  O     . PHE B 2 31  ? 34.302  28.608  39.225  1.00 31.82 ? 70   PHE B O     1 
ATOM   2697 C  CB    . PHE B 2 31  ? 33.194  29.108  42.321  1.00 32.97 ? 70   PHE B CB    1 
ATOM   2698 C  CG    . PHE B 2 31  ? 32.172  28.141  41.836  1.00 31.95 ? 70   PHE B CG    1 
ATOM   2699 C  CD1   . PHE B 2 31  ? 32.432  26.779  41.820  1.00 32.41 ? 70   PHE B CD1   1 
ATOM   2700 C  CD2   . PHE B 2 31  ? 30.936  28.590  41.357  1.00 34.85 ? 70   PHE B CD2   1 
ATOM   2701 C  CE1   . PHE B 2 31  ? 31.481  25.877  41.364  1.00 33.57 ? 70   PHE B CE1   1 
ATOM   2702 C  CE2   . PHE B 2 31  ? 29.981  27.666  40.880  1.00 33.09 ? 70   PHE B CE2   1 
ATOM   2703 C  CZ    . PHE B 2 31  ? 30.261  26.326  40.901  1.00 33.81 ? 70   PHE B CZ    1 
ATOM   2704 N  N     . ARG B 2 32  ? 34.596  30.744  39.857  1.00 32.14 ? 71   ARG B N     1 
ATOM   2705 C  CA    . ARG B 2 32  ? 34.626  31.288  38.486  1.00 33.34 ? 71   ARG B CA    1 
ATOM   2706 C  C     . ARG B 2 32  ? 35.790  30.749  37.676  1.00 32.28 ? 71   ARG B C     1 
ATOM   2707 O  O     . ARG B 2 32  ? 35.607  30.321  36.546  1.00 31.65 ? 71   ARG B O     1 
ATOM   2708 C  CB    . ARG B 2 32  ? 34.678  32.826  38.508  1.00 33.41 ? 71   ARG B CB    1 
ATOM   2709 C  CG    . ARG B 2 32  ? 34.719  33.478  37.123  1.00 35.19 ? 71   ARG B CG    1 
ATOM   2710 C  CD    . ARG B 2 32  ? 34.984  34.983  37.209  1.00 36.64 ? 71   ARG B CD    1 
ATOM   2711 N  NE    . ARG B 2 32  ? 33.757  35.653  37.588  1.00 40.52 ? 71   ARG B NE    1 
ATOM   2712 C  CZ    . ARG B 2 32  ? 33.527  36.261  38.747  1.00 43.04 ? 71   ARG B CZ    1 
ATOM   2713 N  NH1   . ARG B 2 32  ? 34.471  36.393  39.688  1.00 43.18 ? 71   ARG B NH1   1 
ATOM   2714 N  NH2   . ARG B 2 32  ? 32.325  36.804  38.942  1.00 43.36 ? 71   ARG B NH2   1 
ATOM   2715 N  N     . ALA B 2 33  ? 36.990  30.787  38.254  1.00 32.17 ? 72   ALA B N     1 
ATOM   2716 C  CA    . ALA B 2 33  ? 38.163  30.232  37.597  1.00 31.72 ? 72   ALA B CA    1 
ATOM   2717 C  C     . ALA B 2 33  ? 37.922  28.739  37.310  1.00 31.29 ? 72   ALA B C     1 
ATOM   2718 O  O     . ALA B 2 33  ? 38.230  28.256  36.215  1.00 31.26 ? 72   ALA B O     1 
ATOM   2719 C  CB    . ALA B 2 33  ? 39.418  30.448  38.440  1.00 31.61 ? 72   ALA B CB    1 
ATOM   2720 N  N     . PHE B 2 34  ? 37.340  28.023  38.272  1.00 31.84 ? 73   PHE B N     1 
ATOM   2721 C  CA    . PHE B 2 34  ? 37.051  26.592  38.081  1.00 31.99 ? 73   PHE B CA    1 
ATOM   2722 C  C     . PHE B 2 34  ? 36.056  26.346  36.931  1.00 31.91 ? 73   PHE B C     1 
ATOM   2723 O  O     . PHE B 2 34  ? 36.304  25.501  36.058  1.00 31.58 ? 73   PHE B O     1 
ATOM   2724 C  CB    . PHE B 2 34  ? 36.542  25.915  39.368  1.00 32.98 ? 73   PHE B CB    1 
ATOM   2725 C  CG    . PHE B 2 34  ? 36.187  24.445  39.168  1.00 32.75 ? 73   PHE B CG    1 
ATOM   2726 C  CD1   . PHE B 2 34  ? 37.188  23.499  38.939  1.00 35.22 ? 73   PHE B CD1   1 
ATOM   2727 C  CD2   . PHE B 2 34  ? 34.875  24.027  39.158  1.00 33.19 ? 73   PHE B CD2   1 
ATOM   2728 C  CE1   . PHE B 2 34  ? 36.867  22.153  38.731  1.00 35.45 ? 73   PHE B CE1   1 
ATOM   2729 C  CE2   . PHE B 2 34  ? 34.547  22.690  38.964  1.00 33.23 ? 73   PHE B CE2   1 
ATOM   2730 C  CZ    . PHE B 2 34  ? 35.523  21.758  38.759  1.00 32.68 ? 73   PHE B CZ    1 
ATOM   2731 N  N     . LEU B 2 35  ? 34.934  27.063  36.951  1.00 31.02 ? 74   LEU B N     1 
ATOM   2732 C  CA    . LEU B 2 35  ? 33.946  26.960  35.885  1.00 32.08 ? 74   LEU B CA    1 
ATOM   2733 C  C     . LEU B 2 35  ? 34.511  27.299  34.496  1.00 31.79 ? 74   LEU B C     1 
ATOM   2734 O  O     . LEU B 2 35  ? 34.074  26.742  33.501  1.00 33.15 ? 74   LEU B O     1 
ATOM   2735 C  CB    . LEU B 2 35  ? 32.709  27.835  36.180  1.00 30.36 ? 74   LEU B CB    1 
ATOM   2736 C  CG    . LEU B 2 35  ? 31.880  27.510  37.410  1.00 31.83 ? 74   LEU B CG    1 
ATOM   2737 C  CD1   . LEU B 2 35  ? 30.548  28.322  37.327  1.00 29.86 ? 74   LEU B CD1   1 
ATOM   2738 C  CD2   . LEU B 2 35  ? 31.609  25.926  37.581  1.00 30.08 ? 74   LEU B CD2   1 
ATOM   2739 N  N     . LYS B 2 36  ? 35.474  28.216  34.410  1.00 32.82 ? 75   LYS B N     1 
ATOM   2740 C  CA    . LYS B 2 36  ? 36.114  28.482  33.109  1.00 32.92 ? 75   LYS B CA    1 
ATOM   2741 C  C     . LYS B 2 36  ? 36.821  27.227  32.546  1.00 32.01 ? 75   LYS B C     1 
ATOM   2742 O  O     . LYS B 2 36  ? 36.774  26.947  31.339  1.00 30.66 ? 75   LYS B O     1 
ATOM   2743 C  CB    . LYS B 2 36  ? 37.086  29.677  33.203  1.00 33.92 ? 75   LYS B CB    1 
ATOM   2744 C  CG    . LYS B 2 36  ? 36.408  31.022  33.265  1.00 35.51 ? 75   LYS B CG    1 
ATOM   2745 C  CD    . LYS B 2 36  ? 37.417  32.135  33.495  1.00 40.79 ? 75   LYS B CD    1 
ATOM   2746 C  CE    . LYS B 2 36  ? 36.854  33.551  33.280  1.00 41.91 ? 75   LYS B CE    1 
ATOM   2747 N  NZ    . LYS B 2 36  ? 37.858  34.578  33.648  1.00 45.88 ? 75   LYS B NZ    1 
ATOM   2748 N  N     . THR B 2 37  ? 37.416  26.442  33.435  1.00 31.64 ? 76   THR B N     1 
ATOM   2749 C  CA    . THR B 2 37  ? 38.112  25.226  33.019  1.00 31.41 ? 76   THR B CA    1 
ATOM   2750 C  C     . THR B 2 37  ? 37.120  24.160  32.519  1.00 31.45 ? 76   THR B C     1 
ATOM   2751 O  O     . THR B 2 37  ? 37.520  23.293  31.746  1.00 31.35 ? 76   THR B O     1 
ATOM   2752 C  CB    . THR B 2 37  ? 39.009  24.637  34.147  1.00 30.89 ? 76   THR B CB    1 
ATOM   2753 O  OG1   . THR B 2 37  ? 38.209  24.076  35.196  1.00 31.32 ? 76   THR B OG1   1 
ATOM   2754 C  CG2   . THR B 2 37  ? 39.948  25.723  34.731  1.00 31.27 ? 76   THR B CG2   1 
ATOM   2755 N  N     . GLU B 2 38  ? 35.850  24.249  32.929  1.00 32.38 ? 77   GLU B N     1 
ATOM   2756 C  CA    . GLU B 2 38  ? 34.799  23.319  32.478  1.00 32.17 ? 77   GLU B CA    1 
ATOM   2757 C  C     . GLU B 2 38  ? 33.819  23.958  31.447  1.00 32.94 ? 77   GLU B C     1 
ATOM   2758 O  O     . GLU B 2 38  ? 32.847  23.314  31.047  1.00 32.52 ? 77   GLU B O     1 
ATOM   2759 C  CB    . GLU B 2 38  ? 33.993  22.762  33.669  1.00 32.84 ? 77   GLU B CB    1 
ATOM   2760 C  CG    . GLU B 2 38  ? 34.778  21.961  34.726  1.00 31.43 ? 77   GLU B CG    1 
ATOM   2761 C  CD    . GLU B 2 38  ? 33.917  21.105  35.632  1.00 31.60 ? 77   GLU B CD    1 
ATOM   2762 O  OE1   . GLU B 2 38  ? 32.731  21.437  35.856  1.00 34.31 ? 77   GLU B OE1   1 
ATOM   2763 O  OE2   . GLU B 2 38  ? 34.422  20.071  36.128  1.00 30.99 ? 77   GLU B OE2   1 
ATOM   2764 N  N     . PHE B 2 39  ? 34.109  25.177  30.997  1.00 31.80 ? 78   PHE B N     1 
ATOM   2765 C  CA    . PHE B 2 39  ? 33.294  25.868  29.989  1.00 33.37 ? 78   PHE B CA    1 
ATOM   2766 C  C     . PHE B 2 39  ? 31.830  25.964  30.433  1.00 32.68 ? 78   PHE B C     1 
ATOM   2767 O  O     . PHE B 2 39  ? 30.908  25.686  29.683  1.00 35.15 ? 78   PHE B O     1 
ATOM   2768 C  CB    . PHE B 2 39  ? 33.431  25.201  28.616  1.00 33.05 ? 78   PHE B CB    1 
ATOM   2769 C  CG    . PHE B 2 39  ? 34.823  25.144  28.126  1.00 35.02 ? 78   PHE B CG    1 
ATOM   2770 C  CD1   . PHE B 2 39  ? 35.354  26.180  27.386  1.00 34.17 ? 78   PHE B CD1   1 
ATOM   2771 C  CD2   . PHE B 2 39  ? 35.641  24.069  28.445  1.00 34.92 ? 78   PHE B CD2   1 
ATOM   2772 C  CE1   . PHE B 2 39  ? 36.644  26.129  26.955  1.00 35.79 ? 78   PHE B CE1   1 
ATOM   2773 C  CE2   . PHE B 2 39  ? 36.923  24.017  27.996  1.00 34.62 ? 78   PHE B CE2   1 
ATOM   2774 C  CZ    . PHE B 2 39  ? 37.434  25.047  27.256  1.00 34.98 ? 78   PHE B CZ    1 
ATOM   2775 N  N     . SER B 2 40  ? 31.621  26.357  31.678  1.00 33.66 ? 79   SER B N     1 
ATOM   2776 C  CA    . SER B 2 40  ? 30.257  26.516  32.220  1.00 33.03 ? 79   SER B CA    1 
ATOM   2777 C  C     . SER B 2 40  ? 30.145  27.816  33.069  1.00 33.13 ? 79   SER B C     1 
ATOM   2778 O  O     . SER B 2 40  ? 29.238  27.956  33.877  1.00 32.41 ? 79   SER B O     1 
ATOM   2779 C  CB    . SER B 2 40  ? 29.843  25.270  32.987  1.00 32.83 ? 79   SER B CB    1 
ATOM   2780 O  OG    . SER B 2 40  ? 30.610  25.118  34.194  1.00 32.65 ? 79   SER B OG    1 
ATOM   2781 N  N     . GLU B 2 41  ? 31.008  28.794  32.789  1.00 34.33 ? 80   GLU B N     1 
ATOM   2782 C  CA    A GLU B 2 41  ? 31.030  29.998  33.612  0.50 34.51 ? 80   GLU B CA    1 
ATOM   2783 C  CA    B GLU B 2 41  ? 31.064  30.063  33.555  0.50 35.01 ? 80   GLU B CA    1 
ATOM   2784 C  C     . GLU B 2 41  ? 29.781  30.865  33.397  1.00 34.82 ? 80   GLU B C     1 
ATOM   2785 O  O     . GLU B 2 41  ? 29.452  31.694  34.249  1.00 34.86 ? 80   GLU B O     1 
ATOM   2786 C  CB    A GLU B 2 41  ? 32.370  30.751  33.494  0.50 34.33 ? 80   GLU B CB    1 
ATOM   2787 C  CB    B GLU B 2 41  ? 32.274  30.928  33.148  0.50 35.02 ? 80   GLU B CB    1 
ATOM   2788 C  CG    A GLU B 2 41  ? 32.661  31.527  32.198  0.50 33.96 ? 80   GLU B CG    1 
ATOM   2789 C  CG    B GLU B 2 41  ? 32.601  32.114  34.116  0.50 35.10 ? 80   GLU B CG    1 
ATOM   2790 C  CD    A GLU B 2 41  ? 33.091  30.671  31.011  0.50 33.75 ? 80   GLU B CD    1 
ATOM   2791 C  CD    B GLU B 2 41  ? 33.429  33.235  33.483  0.50 37.05 ? 80   GLU B CD    1 
ATOM   2792 O  OE1   A GLU B 2 41  ? 33.043  29.415  31.063  0.50 32.60 ? 80   GLU B OE1   1 
ATOM   2793 O  OE1   B GLU B 2 41  ? 33.283  34.433  33.897  0.50 33.34 ? 80   GLU B OE1   1 
ATOM   2794 O  OE2   A GLU B 2 41  ? 33.488  31.285  29.999  0.50 31.98 ? 80   GLU B OE2   1 
ATOM   2795 O  OE2   B GLU B 2 41  ? 34.234  32.918  32.573  0.50 39.84 ? 80   GLU B OE2   1 
ATOM   2796 N  N     . GLU B 2 42  ? 29.047  30.629  32.301  1.00 34.54 ? 81   GLU B N     1 
ATOM   2797 C  CA    . GLU B 2 42  ? 27.812  31.415  32.023  1.00 34.66 ? 81   GLU B CA    1 
ATOM   2798 C  C     . GLU B 2 42  ? 26.817  31.258  33.159  1.00 34.16 ? 81   GLU B C     1 
ATOM   2799 O  O     . GLU B 2 42  ? 26.067  32.196  33.477  1.00 33.94 ? 81   GLU B O     1 
ATOM   2800 C  CB    . GLU B 2 42  ? 27.160  31.080  30.656  1.00 34.62 ? 81   GLU B CB    1 
ATOM   2801 C  CG    . GLU B 2 42  ? 26.416  29.742  30.554  1.00 34.25 ? 81   GLU B CG    1 
ATOM   2802 C  CD    . GLU B 2 42  ? 27.330  28.521  30.380  1.00 36.52 ? 81   GLU B CD    1 
ATOM   2803 O  OE1   . GLU B 2 42  ? 28.586  28.664  30.269  1.00 36.90 ? 81   GLU B OE1   1 
ATOM   2804 O  OE2   . GLU B 2 42  ? 26.755  27.419  30.315  1.00 39.48 ? 81   GLU B OE2   1 
ATOM   2805 N  N     . ASN B 2 43  ? 26.845  30.091  33.807  1.00 33.58 ? 82   ASN B N     1 
ATOM   2806 C  CA    . ASN B 2 43  ? 25.928  29.844  34.901  1.00 33.56 ? 82   ASN B CA    1 
ATOM   2807 C  C     . ASN B 2 43  ? 26.142  30.786  36.046  1.00 33.73 ? 82   ASN B C     1 
ATOM   2808 O  O     . ASN B 2 43  ? 25.169  31.349  36.593  1.00 33.21 ? 82   ASN B O     1 
ATOM   2809 C  CB    . ASN B 2 43  ? 26.021  28.385  35.354  1.00 33.13 ? 82   ASN B CB    1 
ATOM   2810 C  CG    . ASN B 2 43  ? 25.508  27.432  34.321  1.00 35.42 ? 82   ASN B CG    1 
ATOM   2811 O  OD1   . ASN B 2 43  ? 24.487  27.703  33.660  1.00 35.27 ? 82   ASN B OD1   1 
ATOM   2812 N  ND2   . ASN B 2 43  ? 26.193  26.287  34.175  1.00 31.81 ? 82   ASN B ND2   1 
ATOM   2813 N  N     . LEU B 2 44  ? 27.414  30.972  36.422  1.00 32.94 ? 83   LEU B N     1 
ATOM   2814 C  CA    . LEU B 2 44  ? 27.739  31.888  37.485  1.00 33.09 ? 83   LEU B CA    1 
ATOM   2815 C  C     . LEU B 2 44  ? 27.533  33.344  37.102  1.00 33.65 ? 83   LEU B C     1 
ATOM   2816 O  O     . LEU B 2 44  ? 27.053  34.137  37.924  1.00 33.29 ? 83   LEU B O     1 
ATOM   2817 C  CB    . LEU B 2 44  ? 29.185  31.677  37.926  1.00 33.62 ? 83   LEU B CB    1 
ATOM   2818 C  CG    . LEU B 2 44  ? 29.643  32.584  39.062  1.00 33.49 ? 83   LEU B CG    1 
ATOM   2819 C  CD1   . LEU B 2 44  ? 28.819  32.335  40.336  1.00 35.44 ? 83   LEU B CD1   1 
ATOM   2820 C  CD2   . LEU B 2 44  ? 31.152  32.434  39.307  1.00 33.21 ? 83   LEU B CD2   1 
ATOM   2821 N  N     . GLU B 2 45  ? 27.901  33.708  35.878  1.00 33.12 ? 84   GLU B N     1 
ATOM   2822 C  CA    A GLU B 2 45  ? 27.698  35.084  35.478  0.50 34.15 ? 84   GLU B CA    1 
ATOM   2823 C  CA    B GLU B 2 45  ? 27.688  35.049  35.349  0.50 34.23 ? 84   GLU B CA    1 
ATOM   2824 C  C     . GLU B 2 45  ? 26.209  35.425  35.362  1.00 33.08 ? 84   GLU B C     1 
ATOM   2825 O  O     . GLU B 2 45  ? 25.821  36.546  35.711  1.00 33.31 ? 84   GLU B O     1 
ATOM   2826 C  CB    A GLU B 2 45  ? 28.512  35.465  34.234  0.50 34.05 ? 84   GLU B CB    1 
ATOM   2827 C  CB    B GLU B 2 45  ? 28.244  35.137  33.924  0.50 33.73 ? 84   GLU B CB    1 
ATOM   2828 C  CG    A GLU B 2 45  ? 30.043  35.121  34.301  0.50 35.49 ? 84   GLU B CG    1 
ATOM   2829 C  CG    B GLU B 2 45  ? 29.794  35.030  33.830  0.50 35.49 ? 84   GLU B CG    1 
ATOM   2830 C  CD    A GLU B 2 45  ? 30.748  35.401  35.646  0.50 38.70 ? 84   GLU B CD    1 
ATOM   2831 C  CD    B GLU B 2 45  ? 30.286  34.646  32.433  0.50 35.62 ? 84   GLU B CD    1 
ATOM   2832 O  OE1   A GLU B 2 45  ? 31.822  34.798  35.869  0.50 41.24 ? 84   GLU B OE1   1 
ATOM   2833 O  OE1   B GLU B 2 45  ? 29.453  34.327  31.576  0.50 39.58 ? 84   GLU B OE1   1 
ATOM   2834 O  OE2   A GLU B 2 45  ? 30.273  36.211  36.476  0.50 38.62 ? 84   GLU B OE2   1 
ATOM   2835 O  OE2   B GLU B 2 45  ? 31.504  34.661  32.177  0.50 41.57 ? 84   GLU B OE2   1 
ATOM   2836 N  N     . PHE B 2 46  ? 25.380  34.483  34.948  1.00 33.99 ? 85   PHE B N     1 
ATOM   2837 C  CA    . PHE B 2 46  ? 23.930  34.701  34.955  1.00 33.29 ? 85   PHE B CA    1 
ATOM   2838 C  C     . PHE B 2 46  ? 23.403  34.845  36.370  1.00 34.05 ? 85   PHE B C     1 
ATOM   2839 O  O     . PHE B 2 46  ? 22.652  35.768  36.659  1.00 32.99 ? 85   PHE B O     1 
ATOM   2840 C  CB    . PHE B 2 46  ? 23.194  33.554  34.261  1.00 34.05 ? 85   PHE B CB    1 
ATOM   2841 C  CG    . PHE B 2 46  ? 21.684  33.620  34.388  1.00 33.89 ? 85   PHE B CG    1 
ATOM   2842 C  CD1   . PHE B 2 46  ? 20.972  34.663  33.828  1.00 34.85 ? 85   PHE B CD1   1 
ATOM   2843 C  CD2   . PHE B 2 46  ? 20.991  32.620  35.061  1.00 33.47 ? 85   PHE B CD2   1 
ATOM   2844 C  CE1   . PHE B 2 46  ? 19.555  34.687  33.901  1.00 34.11 ? 85   PHE B CE1   1 
ATOM   2845 C  CE2   . PHE B 2 46  ? 19.595  32.632  35.176  1.00 34.30 ? 85   PHE B CE2   1 
ATOM   2846 C  CZ    . PHE B 2 46  ? 18.866  33.669  34.587  1.00 36.19 ? 85   PHE B CZ    1 
ATOM   2847 N  N     . TRP B 2 47  ? 23.800  33.924  37.253  1.00 33.95 ? 86   TRP B N     1 
ATOM   2848 C  CA    . TRP B 2 47  ? 23.410  33.991  38.658  1.00 34.32 ? 86   TRP B CA    1 
ATOM   2849 C  C     . TRP B 2 47  ? 23.787  35.329  39.321  1.00 34.26 ? 86   TRP B C     1 
ATOM   2850 O  O     . TRP B 2 47  ? 22.973  35.959  39.997  1.00 33.76 ? 86   TRP B O     1 
ATOM   2851 C  CB    . TRP B 2 47  ? 24.011  32.803  39.422  1.00 35.24 ? 86   TRP B CB    1 
ATOM   2852 C  CG    . TRP B 2 47  ? 23.413  32.678  40.799  1.00 36.24 ? 86   TRP B CG    1 
ATOM   2853 C  CD1   . TRP B 2 47  ? 22.272  31.977  41.142  1.00 35.75 ? 86   TRP B CD1   1 
ATOM   2854 C  CD2   . TRP B 2 47  ? 23.876  33.302  41.994  1.00 37.51 ? 86   TRP B CD2   1 
ATOM   2855 N  NE1   . TRP B 2 47  ? 22.017  32.131  42.483  1.00 37.39 ? 86   TRP B NE1   1 
ATOM   2856 C  CE2   . TRP B 2 47  ? 22.976  32.936  43.034  1.00 36.13 ? 86   TRP B CE2   1 
ATOM   2857 C  CE3   . TRP B 2 47  ? 24.968  34.135  42.302  1.00 36.02 ? 86   TRP B CE3   1 
ATOM   2858 C  CZ2   . TRP B 2 47  ? 23.145  33.352  44.357  1.00 37.22 ? 86   TRP B CZ2   1 
ATOM   2859 C  CZ3   . TRP B 2 47  ? 25.145  34.532  43.619  1.00 37.01 ? 86   TRP B CZ3   1 
ATOM   2860 C  CH2   . TRP B 2 47  ? 24.229  34.155  44.635  1.00 36.93 ? 86   TRP B CH2   1 
ATOM   2861 N  N     . LEU B 2 48  ? 25.020  35.777  39.116  1.00 33.74 ? 87   LEU B N     1 
ATOM   2862 C  CA    . LEU B 2 48  ? 25.470  37.057  39.658  1.00 32.91 ? 87   LEU B CA    1 
ATOM   2863 C  C     . LEU B 2 48  ? 24.703  38.243  39.059  1.00 32.73 ? 87   LEU B C     1 
ATOM   2864 O  O     . LEU B 2 48  ? 24.363  39.184  39.793  1.00 30.21 ? 87   LEU B O     1 
ATOM   2865 C  CB    . LEU B 2 48  ? 26.961  37.241  39.437  1.00 32.46 ? 87   LEU B CB    1 
ATOM   2866 C  CG    . LEU B 2 48  ? 27.826  36.305  40.288  1.00 31.60 ? 87   LEU B CG    1 
ATOM   2867 C  CD1   . LEU B 2 48  ? 29.246  36.345  39.754  1.00 31.04 ? 87   LEU B CD1   1 
ATOM   2868 C  CD2   . LEU B 2 48  ? 27.710  36.729  41.759  1.00 31.66 ? 87   LEU B CD2   1 
ATOM   2869 N  N     . ALA B 2 49  ? 24.398  38.158  37.758  1.00 32.49 ? 88   ALA B N     1 
ATOM   2870 C  CA    . ALA B 2 49  ? 23.624  39.196  37.064  1.00 32.53 ? 88   ALA B CA    1 
ATOM   2871 C  C     . ALA B 2 49  ? 22.239  39.328  37.687  1.00 32.54 ? 88   ALA B C     1 
ATOM   2872 O  O     . ALA B 2 49  ? 21.753  40.428  37.897  1.00 31.42 ? 88   ALA B O     1 
ATOM   2873 C  CB    . ALA B 2 49  ? 23.493  38.876  35.558  1.00 32.85 ? 88   ALA B CB    1 
ATOM   2874 N  N     . CYS B 2 50  ? 21.613  38.193  37.972  1.00 32.79 ? 89   CYS B N     1 
ATOM   2875 C  CA    . CYS B 2 50  ? 20.329  38.175  38.640  1.00 32.77 ? 89   CYS B CA    1 
ATOM   2876 C  C     . CYS B 2 50  ? 20.392  38.754  40.064  1.00 33.66 ? 89   CYS B C     1 
ATOM   2877 O  O     . CYS B 2 50  ? 19.493  39.485  40.479  1.00 33.51 ? 89   CYS B O     1 
ATOM   2878 C  CB    . CYS B 2 50  ? 19.769  36.751  38.670  1.00 32.58 ? 89   CYS B CB    1 
ATOM   2879 S  SG    . CYS B 2 50  ? 19.339  36.069  37.052  1.00 34.08 ? 89   CYS B SG    1 
ATOM   2880 N  N     . GLU B 2 51  ? 21.444  38.433  40.812  1.00 34.59 ? 90   GLU B N     1 
ATOM   2881 C  CA    . GLU B 2 51  ? 21.621  39.054  42.137  1.00 34.86 ? 90   GLU B CA    1 
ATOM   2882 C  C     . GLU B 2 51  ? 21.712  40.568  42.051  1.00 34.73 ? 90   GLU B C     1 
ATOM   2883 O  O     . GLU B 2 51  ? 21.076  41.283  42.818  1.00 35.38 ? 90   GLU B O     1 
ATOM   2884 C  CB    . GLU B 2 51  ? 22.860  38.485  42.858  1.00 35.77 ? 90   GLU B CB    1 
ATOM   2885 C  CG    . GLU B 2 51  ? 22.681  37.058  43.319  1.00 35.87 ? 90   GLU B CG    1 
ATOM   2886 C  CD    . GLU B 2 51  ? 21.530  36.925  44.292  1.00 38.34 ? 90   GLU B CD    1 
ATOM   2887 O  OE1   . GLU B 2 51  ? 21.690  37.378  45.436  1.00 38.55 ? 90   GLU B OE1   1 
ATOM   2888 O  OE2   . GLU B 2 51  ? 20.455  36.416  43.911  1.00 37.70 ? 90   GLU B OE2   1 
ATOM   2889 N  N     . GLU B 2 52  ? 22.491  41.057  41.097  1.00 34.67 ? 91   GLU B N     1 
ATOM   2890 C  CA    . GLU B 2 52  ? 22.617  42.492  40.856  1.00 35.10 ? 91   GLU B CA    1 
ATOM   2891 C  C     . GLU B 2 52  ? 21.280  43.123  40.427  1.00 34.56 ? 91   GLU B C     1 
ATOM   2892 O  O     . GLU B 2 52  ? 20.890  44.179  40.890  1.00 33.31 ? 91   GLU B O     1 
ATOM   2893 C  CB    . GLU B 2 52  ? 23.672  42.738  39.768  1.00 35.35 ? 91   GLU B CB    1 
ATOM   2894 C  CG    . GLU B 2 52  ? 25.098  42.320  40.163  1.00 37.51 ? 91   GLU B CG    1 
ATOM   2895 N  N     . PHE B 2 53  ? 20.601  42.480  39.502  1.00 34.27 ? 92   PHE B N     1 
ATOM   2896 C  CA    . PHE B 2 53  ? 19.270  42.911  39.063  1.00 34.00 ? 92   PHE B CA    1 
ATOM   2897 C  C     . PHE B 2 53  ? 18.290  43.158  40.232  1.00 34.80 ? 92   PHE B C     1 
ATOM   2898 O  O     . PHE B 2 53  ? 17.574  44.172  40.248  1.00 34.28 ? 92   PHE B O     1 
ATOM   2899 C  CB    . PHE B 2 53  ? 18.702  41.891  38.071  1.00 33.93 ? 92   PHE B CB    1 
ATOM   2900 C  CG    . PHE B 2 53  ? 17.262  42.124  37.688  1.00 34.23 ? 92   PHE B CG    1 
ATOM   2901 C  CD1   . PHE B 2 53  ? 16.917  43.107  36.768  1.00 35.01 ? 92   PHE B CD1   1 
ATOM   2902 C  CD2   . PHE B 2 53  ? 16.243  41.333  38.215  1.00 33.58 ? 92   PHE B CD2   1 
ATOM   2903 C  CE1   . PHE B 2 53  ? 15.583  43.309  36.386  1.00 33.05 ? 92   PHE B CE1   1 
ATOM   2904 C  CE2   . PHE B 2 53  ? 14.907  41.538  37.837  1.00 32.31 ? 92   PHE B CE2   1 
ATOM   2905 C  CZ    . PHE B 2 53  ? 14.579  42.557  36.942  1.00 32.82 ? 92   PHE B CZ    1 
ATOM   2906 N  N     . LYS B 2 54  ? 18.285  42.255  41.211  1.00 36.00 ? 93   LYS B N     1 
ATOM   2907 C  CA    . LYS B 2 54  ? 17.376  42.350  42.376  1.00 37.39 ? 93   LYS B CA    1 
ATOM   2908 C  C     . LYS B 2 54  ? 17.631  43.568  43.270  1.00 37.43 ? 93   LYS B C     1 
ATOM   2909 O  O     . LYS B 2 54  ? 16.789  43.927  44.090  1.00 36.87 ? 93   LYS B O     1 
ATOM   2910 C  CB    . LYS B 2 54  ? 17.432  41.055  43.208  1.00 37.45 ? 93   LYS B CB    1 
ATOM   2911 C  CG    . LYS B 2 54  ? 16.575  39.926  42.624  1.00 39.37 ? 93   LYS B CG    1 
ATOM   2912 C  CD    . LYS B 2 54  ? 16.572  38.662  43.496  1.00 40.40 ? 93   LYS B CD    1 
ATOM   2913 C  CE    . LYS B 2 54  ? 17.685  37.699  43.122  1.00 40.86 ? 93   LYS B CE    1 
ATOM   2914 N  NZ    . LYS B 2 54  ? 17.862  36.595  44.126  1.00 41.18 ? 93   LYS B NZ    1 
ATOM   2915 N  N     . LYS B 2 55  ? 18.791  44.202  43.091  1.00 37.83 ? 94   LYS B N     1 
ATOM   2916 C  CA    . LYS B 2 55  ? 19.170  45.397  43.836  1.00 38.01 ? 94   LYS B CA    1 
ATOM   2917 C  C     . LYS B 2 55  ? 18.740  46.691  43.142  1.00 37.90 ? 94   LYS B C     1 
ATOM   2918 O  O     . LYS B 2 55  ? 18.961  47.773  43.679  1.00 36.98 ? 94   LYS B O     1 
ATOM   2919 C  CB    . LYS B 2 55  ? 20.685  45.436  44.045  1.00 38.20 ? 94   LYS B CB    1 
ATOM   2920 C  CG    . LYS B 2 55  ? 21.257  44.223  44.748  1.00 39.44 ? 94   LYS B CG    1 
ATOM   2921 C  CD    . LYS B 2 55  ? 22.741  44.414  45.050  1.00 42.14 ? 94   LYS B CD    1 
ATOM   2922 C  CE    . LYS B 2 55  ? 23.462  43.075  45.245  1.00 44.71 ? 94   LYS B CE    1 
ATOM   2923 N  NZ    . LYS B 2 55  ? 24.922  43.262  45.608  1.00 44.56 ? 94   LYS B NZ    1 
ATOM   2924 N  N     . THR B 2 56  ? 18.125  46.588  41.961  1.00 37.57 ? 95   THR B N     1 
ATOM   2925 C  CA    . THR B 2 56  ? 17.852  47.769  41.146  1.00 37.66 ? 95   THR B CA    1 
ATOM   2926 C  C     . THR B 2 56  ? 16.744  48.628  41.764  1.00 37.88 ? 95   THR B C     1 
ATOM   2927 O  O     . THR B 2 56  ? 15.727  48.109  42.229  1.00 38.40 ? 95   THR B O     1 
ATOM   2928 C  CB    . THR B 2 56  ? 17.505  47.374  39.697  1.00 37.91 ? 95   THR B CB    1 
ATOM   2929 O  OG1   . THR B 2 56  ? 18.539  46.519  39.174  1.00 38.85 ? 95   THR B OG1   1 
ATOM   2930 C  CG2   . THR B 2 56  ? 17.365  48.599  38.826  1.00 37.85 ? 95   THR B CG2   1 
ATOM   2931 N  N     . ARG B 2 57  ? 16.949  49.940  41.768  1.00 37.69 ? 96   ARG B N     1 
ATOM   2932 C  CA    . ARG B 2 57  ? 16.043  50.858  42.465  1.00 38.04 ? 96   ARG B CA    1 
ATOM   2933 C  C     . ARG B 2 57  ? 15.064  51.620  41.556  1.00 37.70 ? 96   ARG B C     1 
ATOM   2934 O  O     . ARG B 2 57  ? 14.076  52.147  42.059  1.00 39.55 ? 96   ARG B O     1 
ATOM   2935 C  CB    . ARG B 2 57  ? 16.853  51.845  43.324  1.00 38.05 ? 96   ARG B CB    1 
ATOM   2936 C  CG    . ARG B 2 57  ? 17.732  51.177  44.395  1.00 38.76 ? 96   ARG B CG    1 
ATOM   2937 C  CD    . ARG B 2 57  ? 18.244  52.174  45.428  1.00 38.81 ? 96   ARG B CD    1 
ATOM   2938 N  N     . SER B 2 58  ? 15.327  51.707  40.252  1.00 37.23 ? 97   SER B N     1 
ATOM   2939 C  CA    . SER B 2 58  ? 14.426  52.411  39.323  1.00 37.09 ? 97   SER B CA    1 
ATOM   2940 C  C     . SER B 2 58  ? 13.838  51.513  38.245  1.00 36.86 ? 97   SER B C     1 
ATOM   2941 O  O     . SER B 2 58  ? 14.468  50.555  37.819  1.00 35.69 ? 97   SER B O     1 
ATOM   2942 C  CB    . SER B 2 58  ? 15.146  53.584  38.651  1.00 37.33 ? 97   SER B CB    1 
ATOM   2943 O  OG    . SER B 2 58  ? 16.394  53.179  38.110  1.00 38.80 ? 97   SER B OG    1 
ATOM   2944 N  N     . THR B 2 59  ? 12.647  51.881  37.771  1.00 37.02 ? 98   THR B N     1 
ATOM   2945 C  CA    . THR B 2 59  ? 11.929  51.082  36.773  1.00 37.35 ? 98   THR B CA    1 
ATOM   2946 C  C     . THR B 2 59  ? 12.608  51.100  35.397  1.00 36.66 ? 98   THR B C     1 
ATOM   2947 O  O     . THR B 2 59  ? 12.777  50.061  34.800  1.00 37.85 ? 98   THR B O     1 
ATOM   2948 C  CB    . THR B 2 59  ? 10.477  51.536  36.643  1.00 37.63 ? 98   THR B CB    1 
ATOM   2949 O  OG1   . THR B 2 59  ? 9.950   51.793  37.951  1.00 40.96 ? 98   THR B OG1   1 
ATOM   2950 C  CG2   . THR B 2 59  ? 9.617   50.483  35.950  1.00 38.90 ? 98   THR B CG2   1 
ATOM   2951 N  N     . ALA B 2 60  ? 13.009  52.270  34.897  1.00 36.69 ? 99   ALA B N     1 
ATOM   2952 C  CA    . ALA B 2 60  ? 13.775  52.314  33.641  1.00 35.81 ? 99   ALA B CA    1 
ATOM   2953 C  C     . ALA B 2 60  ? 15.045  51.434  33.706  1.00 35.22 ? 99   ALA B C     1 
ATOM   2954 O  O     . ALA B 2 60  ? 15.358  50.724  32.750  1.00 34.72 ? 99   ALA B O     1 
ATOM   2955 C  CB    . ALA B 2 60  ? 14.130  53.734  33.278  1.00 35.69 ? 99   ALA B CB    1 
ATOM   2956 N  N     . LYS B 2 61  ? 15.768  51.489  34.827  1.00 34.77 ? 100  LYS B N     1 
ATOM   2957 C  CA    . LYS B 2 61  ? 16.984  50.688  34.994  1.00 34.92 ? 100  LYS B CA    1 
ATOM   2958 C  C     . LYS B 2 61  ? 16.636  49.200  35.051  1.00 34.44 ? 100  LYS B C     1 
ATOM   2959 O  O     . LYS B 2 61  ? 17.320  48.371  34.469  1.00 34.90 ? 100  LYS B O     1 
ATOM   2960 C  CB    . LYS B 2 61  ? 17.762  51.119  36.251  1.00 35.43 ? 100  LYS B CB    1 
ATOM   2961 N  N     . LEU B 2 62  ? 15.558  48.885  35.757  1.00 34.59 ? 101  LEU B N     1 
ATOM   2962 C  CA    . LEU B 2 62  ? 15.057  47.516  35.886  1.00 34.42 ? 101  LEU B CA    1 
ATOM   2963 C  C     . LEU B 2 62  ? 14.671  46.914  34.531  1.00 33.91 ? 101  LEU B C     1 
ATOM   2964 O  O     . LEU B 2 62  ? 15.146  45.833  34.179  1.00 33.85 ? 101  LEU B O     1 
ATOM   2965 C  CB    . LEU B 2 62  ? 13.842  47.521  36.814  1.00 34.80 ? 101  LEU B CB    1 
ATOM   2966 C  CG    . LEU B 2 62  ? 13.253  46.176  37.225  1.00 36.00 ? 101  LEU B CG    1 
ATOM   2967 C  CD1   . LEU B 2 62  ? 12.309  46.415  38.361  1.00 36.03 ? 101  LEU B CD1   1 
ATOM   2968 C  CD2   . LEU B 2 62  ? 12.529  45.479  36.069  1.00 38.66 ? 101  LEU B CD2   1 
ATOM   2969 N  N     . VAL B 2 63  ? 13.829  47.631  33.779  1.00 34.26 ? 102  VAL B N     1 
ATOM   2970 C  CA    . VAL B 2 63  ? 13.423  47.212  32.433  1.00 33.71 ? 102  VAL B CA    1 
ATOM   2971 C  C     . VAL B 2 63  ? 14.652  47.006  31.527  1.00 33.72 ? 102  VAL B C     1 
ATOM   2972 O  O     . VAL B 2 63  ? 14.738  45.986  30.857  1.00 32.39 ? 102  VAL B O     1 
ATOM   2973 C  CB    . VAL B 2 63  ? 12.397  48.192  31.777  1.00 34.30 ? 102  VAL B CB    1 
ATOM   2974 C  CG1   . VAL B 2 63  ? 12.037  47.760  30.344  1.00 34.23 ? 102  VAL B CG1   1 
ATOM   2975 C  CG2   . VAL B 2 63  ? 11.117  48.303  32.625  1.00 35.15 ? 102  VAL B CG2   1 
ATOM   2976 N  N     . SER B 2 64  ? 15.614  47.931  31.509  1.00 34.05 ? 103  SER B N     1 
ATOM   2977 C  CA    . SER B 2 64  ? 16.773  47.746  30.613  1.00 34.91 ? 103  SER B CA    1 
ATOM   2978 C  C     . SER B 2 64  ? 17.611  46.540  31.005  1.00 34.35 ? 103  SER B C     1 
ATOM   2979 O  O     . SER B 2 64  ? 17.960  45.724  30.148  1.00 34.55 ? 103  SER B O     1 
ATOM   2980 C  CB    . SER B 2 64  ? 17.658  48.994  30.473  1.00 35.26 ? 103  SER B CB    1 
ATOM   2981 O  OG    . SER B 2 64  ? 18.269  49.392  31.688  1.00 40.02 ? 103  SER B OG    1 
ATOM   2982 N  N     . LYS B 2 65  ? 17.924  46.419  32.296  1.00 34.00 ? 104  LYS B N     1 
ATOM   2983 C  CA    . LYS B 2 65  ? 18.748  45.323  32.761  1.00 33.40 ? 104  LYS B CA    1 
ATOM   2984 C  C     . LYS B 2 65  ? 18.076  43.985  32.541  1.00 32.86 ? 104  LYS B C     1 
ATOM   2985 O  O     . LYS B 2 65  ? 18.753  43.024  32.198  1.00 32.74 ? 104  LYS B O     1 
ATOM   2986 C  CB    . LYS B 2 65  ? 19.179  45.499  34.226  1.00 33.66 ? 104  LYS B CB    1 
ATOM   2987 C  CG    . LYS B 2 65  ? 20.037  44.331  34.723  1.00 35.57 ? 104  LYS B CG    1 
ATOM   2988 N  N     . ALA B 2 66  ? 16.755  43.913  32.714  1.00 32.04 ? 105  ALA B N     1 
ATOM   2989 C  CA    . ALA B 2 66  ? 16.034  42.664  32.437  1.00 31.96 ? 105  ALA B CA    1 
ATOM   2990 C  C     . ALA B 2 66  ? 16.175  42.242  30.972  1.00 31.63 ? 105  ALA B C     1 
ATOM   2991 O  O     . ALA B 2 66  ? 16.440  41.068  30.675  1.00 30.61 ? 105  ALA B O     1 
ATOM   2992 C  CB    . ALA B 2 66  ? 14.567  42.761  32.830  1.00 31.66 ? 105  ALA B CB    1 
ATOM   2993 N  N     . HIS B 2 67  ? 16.032  43.194  30.066  1.00 32.73 ? 106  HIS B N     1 
ATOM   2994 C  CA    . HIS B 2 67  ? 16.275  42.934  28.669  1.00 32.80 ? 106  HIS B CA    1 
ATOM   2995 C  C     . HIS B 2 67  ? 17.662  42.516  28.283  1.00 32.10 ? 106  HIS B C     1 
ATOM   2996 O  O     . HIS B 2 67  ? 17.815  41.652  27.491  1.00 30.74 ? 106  HIS B O     1 
ATOM   2997 C  CB    . HIS B 2 67  ? 15.792  44.077  27.790  1.00 33.95 ? 106  HIS B CB    1 
ATOM   2998 C  CG    . HIS B 2 67  ? 14.319  44.110  27.630  1.00 36.05 ? 106  HIS B CG    1 
ATOM   2999 N  ND1   . HIS B 2 67  ? 13.493  44.677  28.560  1.00 40.36 ? 106  HIS B ND1   1 
ATOM   3000 C  CD2   . HIS B 2 67  ? 13.517  43.589  26.686  1.00 39.31 ? 106  HIS B CD2   1 
ATOM   3001 C  CE1   . HIS B 2 67  ? 12.244  44.530  28.187  1.00 41.65 ? 106  HIS B CE1   1 
ATOM   3002 N  NE2   . HIS B 2 67  ? 12.230  43.868  27.055  1.00 40.89 ? 106  HIS B NE2   1 
ATOM   3003 N  N     . ARG B 2 68  ? 18.664  43.150  28.868  1.00 32.13 ? 107  ARG B N     1 
ATOM   3004 C  CA    . ARG B 2 68  ? 20.082  42.770  28.656  1.00 32.09 ? 107  ARG B CA    1 
ATOM   3005 C  C     . ARG B 2 68  ? 20.408  41.366  29.165  1.00 32.42 ? 107  ARG B C     1 
ATOM   3006 O  O     . ARG B 2 68  ? 21.063  40.566  28.470  1.00 32.58 ? 107  ARG B O     1 
ATOM   3007 C  CB    . ARG B 2 68  ? 21.037  43.778  29.343  1.00 32.71 ? 107  ARG B CB    1 
ATOM   3008 N  N     . ILE B 2 69  ? 19.959  41.059  30.383  1.00 31.08 ? 108  ILE B N     1 
ATOM   3009 C  CA    . ILE B 2 69  ? 20.165  39.723  30.959  1.00 31.69 ? 108  ILE B CA    1 
ATOM   3010 C  C     . ILE B 2 69  ? 19.493  38.666  30.063  1.00 30.04 ? 108  ILE B C     1 
ATOM   3011 O  O     . ILE B 2 69  ? 20.076  37.635  29.761  1.00 30.35 ? 108  ILE B O     1 
ATOM   3012 C  CB    . ILE B 2 69  ? 19.621  39.650  32.415  1.00 30.47 ? 108  ILE B CB    1 
ATOM   3013 C  CG1   . ILE B 2 69  ? 20.478  40.521  33.349  1.00 32.65 ? 108  ILE B CG1   1 
ATOM   3014 C  CG2   . ILE B 2 69  ? 19.521  38.181  32.926  1.00 32.02 ? 108  ILE B CG2   1 
ATOM   3015 C  CD1   . ILE B 2 69  ? 19.908  40.604  34.762  1.00 32.47 ? 108  ILE B CD1   1 
ATOM   3016 N  N     . PHE B 2 70  ? 18.283  38.951  29.607  1.00 30.56 ? 109  PHE B N     1 
ATOM   3017 C  CA    . PHE B 2 70  ? 17.550  37.995  28.770  1.00 30.27 ? 109  PHE B CA    1 
ATOM   3018 C  C     . PHE B 2 70  ? 18.275  37.759  27.435  1.00 30.12 ? 109  PHE B C     1 
ATOM   3019 O  O     . PHE B 2 70  ? 18.392  36.626  26.992  1.00 29.43 ? 109  PHE B O     1 
ATOM   3020 C  CB    . PHE B 2 70  ? 16.085  38.426  28.535  1.00 31.16 ? 109  PHE B CB    1 
ATOM   3021 C  CG    . PHE B 2 70  ? 15.217  37.326  27.932  1.00 32.55 ? 109  PHE B CG    1 
ATOM   3022 C  CD1   . PHE B 2 70  ? 14.427  36.521  28.737  1.00 32.76 ? 109  PHE B CD1   1 
ATOM   3023 C  CD2   . PHE B 2 70  ? 15.249  37.069  26.557  1.00 32.53 ? 109  PHE B CD2   1 
ATOM   3024 C  CE1   . PHE B 2 70  ? 13.648  35.485  28.172  1.00 34.28 ? 109  PHE B CE1   1 
ATOM   3025 C  CE2   . PHE B 2 70  ? 14.500  36.029  25.995  1.00 33.56 ? 109  PHE B CE2   1 
ATOM   3026 C  CZ    . PHE B 2 70  ? 13.699  35.247  26.796  1.00 33.06 ? 109  PHE B CZ    1 
ATOM   3027 N  N     . GLU B 2 71  ? 18.702  38.838  26.784  1.00 29.61 ? 110  GLU B N     1 
ATOM   3028 C  CA    . GLU B 2 71  ? 19.408  38.741  25.505  1.00 30.52 ? 110  GLU B CA    1 
ATOM   3029 C  C     . GLU B 2 71  ? 20.761  38.019  25.630  1.00 31.48 ? 110  GLU B C     1 
ATOM   3030 O  O     . GLU B 2 71  ? 21.194  37.298  24.721  1.00 31.59 ? 110  GLU B O     1 
ATOM   3031 C  CB    . GLU B 2 71  ? 19.686  40.119  24.938  1.00 30.55 ? 110  GLU B CB    1 
ATOM   3032 C  CG    . GLU B 2 71  ? 18.521  40.851  24.322  1.00 31.68 ? 110  GLU B CG    1 
ATOM   3033 C  CD    . GLU B 2 71  ? 18.899  42.138  23.594  1.00 29.69 ? 110  GLU B CD    1 
ATOM   3034 O  OE1   . GLU B 2 71  ? 20.109  42.380  23.248  1.00 29.14 ? 110  GLU B OE1   1 
ATOM   3035 O  OE2   . GLU B 2 71  ? 17.972  42.954  23.369  1.00 27.18 ? 110  GLU B OE2   1 
ATOM   3036 N  N     . GLU B 2 72  ? 21.440  38.257  26.743  1.00 31.44 ? 111  GLU B N     1 
ATOM   3037 C  CA    . GLU B 2 72  ? 22.789  37.711  26.978  1.00 32.80 ? 111  GLU B CA    1 
ATOM   3038 C  C     . GLU B 2 72  ? 22.789  36.238  27.422  1.00 32.07 ? 111  GLU B C     1 
ATOM   3039 O  O     . GLU B 2 72  ? 23.652  35.447  27.001  1.00 32.27 ? 111  GLU B O     1 
ATOM   3040 C  CB    . GLU B 2 72  ? 23.490  38.575  28.034  1.00 33.83 ? 111  GLU B CB    1 
ATOM   3041 C  CG    . GLU B 2 72  ? 24.953  38.180  28.267  1.00 37.23 ? 111  GLU B CG    1 
ATOM   3042 C  CD    . GLU B 2 72  ? 25.887  38.514  27.073  1.00 41.52 ? 111  GLU B CD    1 
ATOM   3043 O  OE1   . GLU B 2 72  ? 25.519  39.284  26.153  1.00 45.27 ? 111  GLU B OE1   1 
ATOM   3044 O  OE2   . GLU B 2 72  ? 27.018  38.004  27.069  1.00 45.69 ? 111  GLU B OE2   1 
ATOM   3045 N  N     . PHE B 2 73  ? 21.811  35.871  28.256  1.00 32.64 ? 112  PHE B N     1 
ATOM   3046 C  CA    . PHE B 2 73  ? 21.786  34.570  28.925  1.00 32.71 ? 112  PHE B CA    1 
ATOM   3047 C  C     . PHE B 2 73  ? 20.579  33.662  28.712  1.00 32.81 ? 112  PHE B C     1 
ATOM   3048 O  O     . PHE B 2 73  ? 20.690  32.445  28.933  1.00 33.33 ? 112  PHE B O     1 
ATOM   3049 C  CB    . PHE B 2 73  ? 21.906  34.755  30.449  1.00 32.45 ? 112  PHE B CB    1 
ATOM   3050 C  CG    . PHE B 2 73  ? 23.136  35.462  30.894  1.00 32.62 ? 112  PHE B CG    1 
ATOM   3051 C  CD1   . PHE B 2 73  ? 24.363  34.855  30.799  1.00 32.76 ? 112  PHE B CD1   1 
ATOM   3052 C  CD2   . PHE B 2 73  ? 23.063  36.741  31.420  1.00 32.52 ? 112  PHE B CD2   1 
ATOM   3053 C  CE1   . PHE B 2 73  ? 25.508  35.503  31.233  1.00 33.59 ? 112  PHE B CE1   1 
ATOM   3054 C  CE2   . PHE B 2 73  ? 24.210  37.405  31.846  1.00 32.63 ? 112  PHE B CE2   1 
ATOM   3055 C  CZ    . PHE B 2 73  ? 25.426  36.777  31.752  1.00 32.57 ? 112  PHE B CZ    1 
ATOM   3056 N  N     . VAL B 2 74  ? 19.415  34.212  28.362  1.00 33.15 ? 113  VAL B N     1 
ATOM   3057 C  CA    . VAL B 2 74  ? 18.173  33.407  28.416  1.00 33.05 ? 113  VAL B CA    1 
ATOM   3058 C  C     . VAL B 2 74  ? 17.622  33.018  27.038  1.00 33.81 ? 113  VAL B C     1 
ATOM   3059 O  O     . VAL B 2 74  ? 17.210  31.866  26.834  1.00 33.53 ? 113  VAL B O     1 
ATOM   3060 C  CB    . VAL B 2 74  ? 17.079  34.111  29.258  1.00 32.88 ? 113  VAL B CB    1 
ATOM   3061 C  CG1   . VAL B 2 74  ? 15.826  33.247  29.405  1.00 31.78 ? 113  VAL B CG1   1 
ATOM   3062 C  CG2   . VAL B 2 74  ? 17.630  34.514  30.621  1.00 32.33 ? 113  VAL B CG2   1 
ATOM   3063 N  N     . ASP B 2 75  ? 17.633  33.957  26.101  1.00 33.25 ? 114  ASP B N     1 
ATOM   3064 C  CA    . ASP B 2 75  ? 17.157  33.703  24.750  1.00 34.48 ? 114  ASP B CA    1 
ATOM   3065 C  C     . ASP B 2 75  ? 17.908  32.487  24.150  1.00 35.43 ? 114  ASP B C     1 
ATOM   3066 O  O     . ASP B 2 75  ? 19.107  32.274  24.408  1.00 34.69 ? 114  ASP B O     1 
ATOM   3067 C  CB    . ASP B 2 75  ? 17.379  34.957  23.901  1.00 33.85 ? 114  ASP B CB    1 
ATOM   3068 C  CG    . ASP B 2 75  ? 16.638  34.946  22.557  1.00 37.21 ? 114  ASP B CG    1 
ATOM   3069 O  OD1   . ASP B 2 75  ? 17.013  34.118  21.683  1.00 41.83 ? 114  ASP B OD1   1 
ATOM   3070 O  OD2   . ASP B 2 75  ? 15.796  35.853  22.318  1.00 34.74 ? 114  ASP B OD2   1 
ATOM   3071 N  N     . VAL B 2 76  ? 17.192  31.686  23.371  1.00 36.12 ? 115  VAL B N     1 
ATOM   3072 C  CA    . VAL B 2 76  ? 17.804  30.533  22.655  1.00 37.56 ? 115  VAL B CA    1 
ATOM   3073 C  C     . VAL B 2 76  ? 19.037  30.907  21.807  1.00 38.23 ? 115  VAL B C     1 
ATOM   3074 O  O     . VAL B 2 76  ? 19.990  30.129  21.711  1.00 39.00 ? 115  VAL B O     1 
ATOM   3075 C  CB    . VAL B 2 76  ? 16.733  29.773  21.861  1.00 38.12 ? 115  VAL B CB    1 
ATOM   3076 C  CG1   . VAL B 2 76  ? 17.354  28.860  20.788  1.00 41.81 ? 115  VAL B CG1   1 
ATOM   3077 C  CG2   . VAL B 2 76  ? 15.820  29.003  22.880  1.00 38.35 ? 115  VAL B CG2   1 
ATOM   3078 N  N     . GLN B 2 77  ? 19.049  32.109  21.243  1.00 37.76 ? 116  GLN B N     1 
ATOM   3079 C  CA    . GLN B 2 77  ? 20.214  32.549  20.490  1.00 39.14 ? 116  GLN B CA    1 
ATOM   3080 C  C     . GLN B 2 77  ? 21.265  33.285  21.344  1.00 38.17 ? 116  GLN B C     1 
ATOM   3081 O  O     . GLN B 2 77  ? 22.217  33.890  20.806  1.00 38.75 ? 116  GLN B O     1 
ATOM   3082 C  CB    . GLN B 2 77  ? 19.755  33.448  19.346  1.00 39.82 ? 116  GLN B CB    1 
ATOM   3083 C  CG    . GLN B 2 77  ? 18.697  32.809  18.449  1.00 42.77 ? 116  GLN B CG    1 
ATOM   3084 C  CD    . GLN B 2 77  ? 19.295  31.864  17.404  1.00 48.41 ? 116  GLN B CD    1 
ATOM   3085 O  OE1   . GLN B 2 77  ? 19.687  30.736  17.721  1.00 52.68 ? 116  GLN B OE1   1 
ATOM   3086 N  NE2   . GLN B 2 77  ? 19.353  32.325  16.144  1.00 50.15 ? 116  GLN B NE2   1 
ATOM   3087 N  N     . ALA B 2 78  ? 21.101  33.267  22.662  1.00 36.37 ? 117  ALA B N     1 
ATOM   3088 C  CA    . ALA B 2 78  ? 21.954  34.068  23.492  1.00 35.49 ? 117  ALA B CA    1 
ATOM   3089 C  C     . ALA B 2 78  ? 23.383  33.536  23.381  1.00 35.59 ? 117  ALA B C     1 
ATOM   3090 O  O     . ALA B 2 78  ? 23.603  32.319  23.360  1.00 33.86 ? 117  ALA B O     1 
ATOM   3091 C  CB    . ALA B 2 78  ? 21.480  34.059  24.935  1.00 34.53 ? 117  ALA B CB    1 
ATOM   3092 N  N     . PRO B 2 79  ? 24.355  34.451  23.323  1.00 35.78 ? 118  PRO B N     1 
ATOM   3093 C  CA    . PRO B 2 79  ? 25.757  34.044  23.263  1.00 36.55 ? 118  PRO B CA    1 
ATOM   3094 C  C     . PRO B 2 79  ? 26.211  33.237  24.475  1.00 36.88 ? 118  PRO B C     1 
ATOM   3095 O  O     . PRO B 2 79  ? 27.001  32.315  24.320  1.00 38.11 ? 118  PRO B O     1 
ATOM   3096 C  CB    . PRO B 2 79  ? 26.513  35.377  23.145  1.00 36.39 ? 118  PRO B CB    1 
ATOM   3097 C  CG    . PRO B 2 79  ? 25.581  36.400  23.592  1.00 37.50 ? 118  PRO B CG    1 
ATOM   3098 C  CD    . PRO B 2 79  ? 24.205  35.915  23.271  1.00 36.26 ? 118  PRO B CD    1 
ATOM   3099 N  N     . ARG B 2 80  ? 25.653  33.544  25.646  1.00 36.24 ? 119  ARG B N     1 
ATOM   3100 C  CA    . ARG B 2 80  ? 25.949  32.815  26.870  1.00 36.48 ? 119  ARG B CA    1 
ATOM   3101 C  C     . ARG B 2 80  ? 24.713  32.116  27.452  1.00 35.26 ? 119  ARG B C     1 
ATOM   3102 O  O     . ARG B 2 80  ? 24.460  32.144  28.672  1.00 35.01 ? 119  ARG B O     1 
ATOM   3103 C  CB    . ARG B 2 80  ? 26.579  33.774  27.867  1.00 36.85 ? 119  ARG B CB    1 
ATOM   3104 C  CG    . ARG B 2 80  ? 27.924  34.298  27.401  1.00 40.18 ? 119  ARG B CG    1 
ATOM   3105 C  CD    . ARG B 2 80  ? 28.636  35.006  28.536  1.00 44.51 ? 119  ARG B CD    1 
ATOM   3106 N  NE    . ARG B 2 80  ? 28.139  36.368  28.705  1.00 46.70 ? 119  ARG B NE    1 
ATOM   3107 C  CZ    . ARG B 2 80  ? 28.468  37.169  29.719  1.00 48.32 ? 119  ARG B CZ    1 
ATOM   3108 N  NH1   . ARG B 2 80  ? 29.259  36.738  30.685  1.00 51.04 ? 119  ARG B NH1   1 
ATOM   3109 N  NH2   . ARG B 2 80  ? 27.974  38.392  29.796  1.00 48.45 ? 119  ARG B NH2   1 
ATOM   3110 N  N     . GLU B 2 81  ? 23.978  31.464  26.554  1.00 35.03 ? 120  GLU B N     1 
ATOM   3111 C  CA    . GLU B 2 81  ? 22.715  30.827  26.880  1.00 34.70 ? 120  GLU B CA    1 
ATOM   3112 C  C     . GLU B 2 81  ? 22.888  29.805  27.986  1.00 34.62 ? 120  GLU B C     1 
ATOM   3113 O  O     . GLU B 2 81  ? 23.703  28.885  27.862  1.00 35.24 ? 120  GLU B O     1 
ATOM   3114 C  CB    . GLU B 2 81  ? 22.125  30.147  25.647  1.00 34.83 ? 120  GLU B CB    1 
ATOM   3115 C  CG    . GLU B 2 81  ? 20.698  29.691  25.854  1.00 35.47 ? 120  GLU B CG    1 
ATOM   3116 C  CD    . GLU B 2 81  ? 20.223  28.682  24.847  1.00 36.65 ? 120  GLU B CD    1 
ATOM   3117 O  OE1   . GLU B 2 81  ? 20.974  28.355  23.915  1.00 36.02 ? 120  GLU B OE1   1 
ATOM   3118 O  OE2   . GLU B 2 81  ? 19.076  28.217  25.021  1.00 39.27 ? 120  GLU B OE2   1 
ATOM   3119 N  N     . VAL B 2 82  ? 22.107  29.981  29.067  1.00 33.49 ? 121  VAL B N     1 
ATOM   3120 C  CA    . VAL B 2 82  ? 22.102  29.064  30.169  1.00 33.68 ? 121  VAL B CA    1 
ATOM   3121 C  C     . VAL B 2 82  ? 21.207  27.863  29.870  1.00 33.81 ? 121  VAL B C     1 
ATOM   3122 O  O     . VAL B 2 82  ? 20.218  27.932  29.107  1.00 33.16 ? 121  VAL B O     1 
ATOM   3123 C  CB    . VAL B 2 82  ? 21.702  29.728  31.530  1.00 33.21 ? 121  VAL B CB    1 
ATOM   3124 C  CG1   . VAL B 2 82  ? 22.804  30.764  32.002  1.00 32.11 ? 121  VAL B CG1   1 
ATOM   3125 C  CG2   . VAL B 2 82  ? 20.316  30.300  31.461  1.00 32.18 ? 121  VAL B CG2   1 
ATOM   3126 N  N     . ASN B 2 83  ? 21.591  26.758  30.485  1.00 33.61 ? 122  ASN B N     1 
ATOM   3127 C  CA    . ASN B 2 83  ? 20.954  25.458  30.293  1.00 33.26 ? 122  ASN B CA    1 
ATOM   3128 C  C     . ASN B 2 83  ? 19.727  25.343  31.198  1.00 33.13 ? 122  ASN B C     1 
ATOM   3129 O  O     . ASN B 2 83  ? 19.802  24.892  32.334  1.00 32.51 ? 122  ASN B O     1 
ATOM   3130 C  CB    . ASN B 2 83  ? 21.983  24.335  30.550  1.00 32.71 ? 122  ASN B CB    1 
ATOM   3131 C  CG    . ASN B 2 83  ? 21.486  22.952  30.153  1.00 31.15 ? 122  ASN B CG    1 
ATOM   3132 O  OD1   . ASN B 2 83  ? 20.295  22.730  29.976  1.00 32.12 ? 122  ASN B OD1   1 
ATOM   3133 N  ND2   . ASN B 2 83  ? 22.418  21.992  30.039  1.00 30.90 ? 122  ASN B ND2   1 
ATOM   3134 N  N     . ILE B 2 84  ? 18.584  25.763  30.644  1.00 32.02 ? 123  ILE B N     1 
ATOM   3135 C  CA    . ILE B 2 84  ? 17.320  25.714  31.339  1.00 32.26 ? 123  ILE B CA    1 
ATOM   3136 C  C     . ILE B 2 84  ? 16.320  25.137  30.343  1.00 32.11 ? 123  ILE B C     1 
ATOM   3137 O  O     . ILE B 2 84  ? 16.520  25.264  29.124  1.00 33.18 ? 123  ILE B O     1 
ATOM   3138 C  CB    . ILE B 2 84  ? 16.841  27.090  31.901  1.00 31.52 ? 123  ILE B CB    1 
ATOM   3139 C  CG1   . ILE B 2 84  ? 16.716  28.161  30.816  1.00 34.59 ? 123  ILE B CG1   1 
ATOM   3140 C  CG2   . ILE B 2 84  ? 17.753  27.601  33.091  1.00 32.43 ? 123  ILE B CG2   1 
ATOM   3141 C  CD1   . ILE B 2 84  ? 16.017  29.434  31.348  1.00 33.00 ? 123  ILE B CD1   1 
ATOM   3142 N  N     . ASP B 2 85  ? 15.281  24.506  30.853  1.00 31.62 ? 124  ASP B N     1 
ATOM   3143 C  CA    . ASP B 2 85  ? 14.266  23.909  30.002  1.00 31.53 ? 124  ASP B CA    1 
ATOM   3144 C  C     . ASP B 2 85  ? 13.317  24.950  29.408  1.00 30.71 ? 124  ASP B C     1 
ATOM   3145 O  O     . ASP B 2 85  ? 13.351  26.135  29.752  1.00 31.32 ? 124  ASP B O     1 
ATOM   3146 C  CB    . ASP B 2 85  ? 13.528  22.783  30.702  1.00 31.65 ? 124  ASP B CB    1 
ATOM   3147 C  CG    . ASP B 2 85  ? 12.721  23.219  31.948  1.00 34.15 ? 124  ASP B CG    1 
ATOM   3148 O  OD1   . ASP B 2 85  ? 12.430  24.405  32.175  1.00 33.55 ? 124  ASP B OD1   1 
ATOM   3149 O  OD2   . ASP B 2 85  ? 12.381  22.310  32.717  1.00 35.46 ? 124  ASP B OD2   1 
ATOM   3150 N  N     . PHE B 2 86  ? 12.506  24.493  28.476  1.00 30.84 ? 125  PHE B N     1 
ATOM   3151 C  CA    . PHE B 2 86  ? 11.558  25.367  27.814  1.00 30.04 ? 125  PHE B CA    1 
ATOM   3152 C  C     . PHE B 2 86  ? 10.574  25.998  28.821  1.00 30.36 ? 125  PHE B C     1 
ATOM   3153 O  O     . PHE B 2 86  ? 10.342  27.203  28.794  1.00 30.38 ? 125  PHE B O     1 
ATOM   3154 C  CB    . PHE B 2 86  ? 10.777  24.608  26.776  1.00 29.69 ? 125  PHE B CB    1 
ATOM   3155 C  CG    . PHE B 2 86  ? 9.645   25.402  26.243  1.00 28.63 ? 125  PHE B CG    1 
ATOM   3156 C  CD1   . PHE B 2 86  ? 8.359   25.146  26.640  1.00 30.10 ? 125  PHE B CD1   1 
ATOM   3157 C  CD2   . PHE B 2 86  ? 9.904   26.512  25.444  1.00 33.17 ? 125  PHE B CD2   1 
ATOM   3158 C  CE1   . PHE B 2 86  ? 7.312   25.925  26.207  1.00 30.03 ? 125  PHE B CE1   1 
ATOM   3159 C  CE2   . PHE B 2 86  ? 8.841   27.317  24.982  1.00 33.09 ? 125  PHE B CE2   1 
ATOM   3160 C  CZ    . PHE B 2 86  ? 7.555   27.007  25.357  1.00 30.33 ? 125  PHE B CZ    1 
ATOM   3161 N  N     . GLN B 2 87  ? 10.023  25.179  29.718  1.00 30.72 ? 126  GLN B N     1 
ATOM   3162 C  CA    . GLN B 2 87  ? 9.094   25.718  30.719  1.00 31.00 ? 126  GLN B CA    1 
ATOM   3163 C  C     . GLN B 2 87  ? 9.721   26.890  31.439  1.00 30.98 ? 126  GLN B C     1 
ATOM   3164 O  O     . GLN B 2 87  ? 9.091   27.914  31.579  1.00 30.83 ? 126  GLN B O     1 
ATOM   3165 C  CB    . GLN B 2 87  ? 8.626   24.643  31.702  1.00 31.63 ? 126  GLN B CB    1 
ATOM   3166 C  CG    . GLN B 2 87  ? 7.761   23.615  31.077  1.00 33.38 ? 126  GLN B CG    1 
ATOM   3167 C  CD    . GLN B 2 87  ? 6.469   24.186  30.569  1.00 35.25 ? 126  GLN B CD    1 
ATOM   3168 O  OE1   . GLN B 2 87  ? 5.862   25.050  31.217  1.00 36.54 ? 126  GLN B OE1   1 
ATOM   3169 N  NE2   . GLN B 2 87  ? 6.040   23.733  29.421  1.00 32.55 ? 126  GLN B NE2   1 
ATOM   3170 N  N     . THR B 2 88  ? 10.973  26.774  31.859  1.00 31.46 ? 127  THR B N     1 
ATOM   3171 C  CA    . THR B 2 88  ? 11.620  27.826  32.628  1.00 32.12 ? 127  THR B CA    1 
ATOM   3172 C  C     . THR B 2 88  ? 11.928  29.059  31.771  1.00 32.17 ? 127  THR B C     1 
ATOM   3173 O  O     . THR B 2 88  ? 11.685  30.194  32.180  1.00 30.04 ? 127  THR B O     1 
ATOM   3174 C  CB    . THR B 2 88  ? 12.872  27.296  33.364  1.00 32.19 ? 127  THR B CB    1 
ATOM   3175 O  OG1   . THR B 2 88  ? 12.493  26.124  34.141  1.00 32.87 ? 127  THR B OG1   1 
ATOM   3176 C  CG2   . THR B 2 88  ? 13.467  28.368  34.244  1.00 33.79 ? 127  THR B CG2   1 
ATOM   3177 N  N     . ARG B 2 89  ? 12.395  28.819  30.561  1.00 31.77 ? 128  ARG B N     1 
ATOM   3178 C  CA    . ARG B 2 89  ? 12.733  29.901  29.639  1.00 31.34 ? 128  ARG B CA    1 
ATOM   3179 C  C     . ARG B 2 89  ? 11.486  30.707  29.236  1.00 30.66 ? 128  ARG B C     1 
ATOM   3180 O  O     . ARG B 2 89  ? 11.525  31.928  29.231  1.00 31.26 ? 128  ARG B O     1 
ATOM   3181 C  CB    . ARG B 2 89  ? 13.414  29.304  28.437  1.00 31.92 ? 128  ARG B CB    1 
ATOM   3182 C  CG    . ARG B 2 89  ? 14.067  30.289  27.482  1.00 37.54 ? 128  ARG B CG    1 
ATOM   3183 C  CD    . ARG B 2 89  ? 14.700  29.574  26.305  1.00 41.63 ? 128  ARG B CD    1 
ATOM   3184 N  NE    . ARG B 2 89  ? 13.701  29.411  25.281  1.00 48.56 ? 128  ARG B NE    1 
ATOM   3185 C  CZ    . ARG B 2 89  ? 13.283  28.269  24.725  1.00 48.03 ? 128  ARG B CZ    1 
ATOM   3186 N  NH1   . ARG B 2 89  ? 13.800  27.063  25.009  1.00 47.48 ? 128  ARG B NH1   1 
ATOM   3187 N  NH2   . ARG B 2 89  ? 12.343  28.366  23.812  1.00 48.49 ? 128  ARG B NH2   1 
ATOM   3188 N  N     . GLU B 2 90  ? 10.393  30.001  28.978  1.00 30.52 ? 129  GLU B N     1 
ATOM   3189 C  CA    . GLU B 2 90  ? 9.118   30.595  28.587  1.00 31.36 ? 129  GLU B CA    1 
ATOM   3190 C  C     . GLU B 2 90  ? 8.468   31.410  29.714  1.00 30.73 ? 129  GLU B C     1 
ATOM   3191 O  O     . GLU B 2 90  ? 7.895   32.479  29.445  1.00 29.76 ? 129  GLU B O     1 
ATOM   3192 C  CB    . GLU B 2 90  ? 8.152   29.501  28.094  1.00 31.39 ? 129  GLU B CB    1 
ATOM   3193 C  CG    . GLU B 2 90  ? 6.822   30.033  27.626  1.00 33.10 ? 129  GLU B CG    1 
ATOM   3194 C  CD    . GLU B 2 90  ? 6.918   30.995  26.414  1.00 35.17 ? 129  GLU B CD    1 
ATOM   3195 O  OE1   . GLU B 2 90  ? 5.881   31.565  26.073  1.00 34.69 ? 129  GLU B OE1   1 
ATOM   3196 O  OE2   . GLU B 2 90  ? 7.984   31.161  25.772  1.00 33.18 ? 129  GLU B OE2   1 
ATOM   3197 N  N     . ALA B 2 91  ? 8.536   30.902  30.948  1.00 31.01 ? 130  ALA B N     1 
ATOM   3198 C  CA    . ALA B 2 91  ? 8.058   31.659  32.103  1.00 31.17 ? 130  ALA B CA    1 
ATOM   3199 C  C     . ALA B 2 91  ? 8.816   32.975  32.200  1.00 30.97 ? 130  ALA B C     1 
ATOM   3200 O  O     . ALA B 2 91  ? 8.236   34.034  32.476  1.00 30.75 ? 130  ALA B O     1 
ATOM   3201 C  CB    . ALA B 2 91  ? 8.205   30.826  33.386  1.00 30.60 ? 130  ALA B CB    1 
ATOM   3202 N  N     . THR B 2 92  ? 10.114  32.906  31.938  1.00 31.97 ? 131  THR B N     1 
ATOM   3203 C  CA    . THR B 2 92  ? 10.996  34.076  32.001  1.00 31.87 ? 131  THR B CA    1 
ATOM   3204 C  C     . THR B 2 92  ? 10.615  35.074  30.919  1.00 32.35 ? 131  THR B C     1 
ATOM   3205 O  O     . THR B 2 92  ? 10.475  36.275  31.182  1.00 30.97 ? 131  THR B O     1 
ATOM   3206 C  CB    . THR B 2 92  ? 12.506  33.666  31.946  1.00 31.52 ? 131  THR B CB    1 
ATOM   3207 O  OG1   . THR B 2 92  ? 12.780  32.676  32.968  1.00 32.58 ? 131  THR B OG1   1 
ATOM   3208 C  CG2   . THR B 2 92  ? 13.426  34.875  32.175  1.00 32.59 ? 131  THR B CG2   1 
ATOM   3209 N  N     . ARG B 2 93  ? 10.432  34.571  29.701  1.00 32.65 ? 132  ARG B N     1 
ATOM   3210 C  CA    . ARG B 2 93  ? 9.964   35.372  28.556  1.00 31.99 ? 132  ARG B CA    1 
ATOM   3211 C  C     . ARG B 2 93  ? 8.673   36.107  28.879  1.00 32.53 ? 132  ARG B C     1 
ATOM   3212 O  O     . ARG B 2 93  ? 8.535   37.299  28.602  1.00 30.81 ? 132  ARG B O     1 
ATOM   3213 C  CB    . ARG B 2 93  ? 9.746   34.485  27.336  1.00 32.57 ? 132  ARG B CB    1 
ATOM   3214 C  CG    . ARG B 2 93  ? 9.774   35.258  26.017  1.00 32.40 ? 132  ARG B CG    1 
ATOM   3215 C  CD    . ARG B 2 93  ? 9.341   34.453  24.812  1.00 32.54 ? 132  ARG B CD    1 
ATOM   3216 N  NE    . ARG B 2 93  ? 7.967   33.953  24.909  1.00 32.65 ? 132  ARG B NE    1 
ATOM   3217 C  CZ    . ARG B 2 93  ? 6.851   34.673  24.791  1.00 33.25 ? 132  ARG B CZ    1 
ATOM   3218 N  NH1   . ARG B 2 93  ? 6.865   35.982  24.566  1.00 32.50 ? 132  ARG B NH1   1 
ATOM   3219 N  NH2   . ARG B 2 93  ? 5.679   34.071  24.939  1.00 33.31 ? 132  ARG B NH2   1 
ATOM   3220 N  N     . LYS B 2 94  ? 7.724   35.407  29.485  1.00 32.92 ? 133  LYS B N     1 
ATOM   3221 C  CA    . LYS B 2 94  ? 6.450   36.017  29.841  1.00 34.44 ? 133  LYS B CA    1 
ATOM   3222 C  C     . LYS B 2 94  ? 6.596   37.084  30.920  1.00 34.35 ? 133  LYS B C     1 
ATOM   3223 O  O     . LYS B 2 94  ? 5.953   38.141  30.863  1.00 33.08 ? 133  LYS B O     1 
ATOM   3224 C  CB    . LYS B 2 94  ? 5.465   34.947  30.293  1.00 34.39 ? 133  LYS B CB    1 
ATOM   3225 C  CG    . LYS B 2 94  ? 4.993   34.059  29.142  1.00 38.03 ? 133  LYS B CG    1 
ATOM   3226 C  CD    . LYS B 2 94  ? 3.692   33.363  29.560  1.00 42.87 ? 133  LYS B CD    1 
ATOM   3227 C  CE    . LYS B 2 94  ? 3.531   31.987  28.966  1.00 44.92 ? 133  LYS B CE    1 
ATOM   3228 N  NZ    . LYS B 2 94  ? 2.912   31.067  29.983  1.00 45.98 ? 133  LYS B NZ    1 
ATOM   3229 N  N     . ASN B 2 95  ? 7.479   36.808  31.874  1.00 35.05 ? 134  ASN B N     1 
ATOM   3230 C  CA    . ASN B 2 95  ? 7.780   37.756  32.958  1.00 35.52 ? 134  ASN B CA    1 
ATOM   3231 C  C     . ASN B 2 95  ? 8.395   39.053  32.432  1.00 36.22 ? 134  ASN B C     1 
ATOM   3232 O  O     . ASN B 2 95  ? 8.191   40.119  33.022  1.00 37.32 ? 134  ASN B O     1 
ATOM   3233 C  CB    . ASN B 2 95  ? 8.761   37.146  33.956  1.00 34.65 ? 134  ASN B CB    1 
ATOM   3234 C  CG    . ASN B 2 95  ? 8.159   36.042  34.784  1.00 34.52 ? 134  ASN B CG    1 
ATOM   3235 O  OD1   . ASN B 2 95  ? 6.953   35.824  34.756  1.00 33.36 ? 134  ASN B OD1   1 
ATOM   3236 N  ND2   . ASN B 2 95  ? 9.004   35.341  35.547  1.00 32.82 ? 134  ASN B ND2   1 
ATOM   3237 N  N     . LEU B 2 96  ? 9.162   38.948  31.344  1.00 37.06 ? 135  LEU B N     1 
ATOM   3238 C  CA    . LEU B 2 96  ? 9.848   40.095  30.719  1.00 38.29 ? 135  LEU B CA    1 
ATOM   3239 C  C     . LEU B 2 96  ? 8.891   41.142  30.085  1.00 39.20 ? 135  LEU B C     1 
ATOM   3240 O  O     . LEU B 2 96  ? 9.290   42.260  29.801  1.00 39.49 ? 135  LEU B O     1 
ATOM   3241 C  CB    . LEU B 2 96  ? 10.866  39.594  29.680  1.00 38.43 ? 135  LEU B CB    1 
ATOM   3242 C  CG    . LEU B 2 96  ? 11.878  40.597  29.105  1.00 39.94 ? 135  LEU B CG    1 
ATOM   3243 C  CD1   . LEU B 2 96  ? 12.824  41.154  30.195  1.00 41.38 ? 135  LEU B CD1   1 
ATOM   3244 C  CD2   . LEU B 2 96  ? 12.695  39.989  27.969  1.00 38.07 ? 135  LEU B CD2   1 
ATOM   3245 N  N     . GLN B 2 97  ? 7.629   40.781  29.893  1.00 40.09 ? 136  GLN B N     1 
ATOM   3246 C  CA    . GLN B 2 97  ? 6.641   41.690  29.341  1.00 41.80 ? 136  GLN B CA    1 
ATOM   3247 C  C     . GLN B 2 97  ? 6.283   42.797  30.337  1.00 41.21 ? 136  GLN B C     1 
ATOM   3248 O  O     . GLN B 2 97  ? 6.053   43.936  29.930  1.00 41.72 ? 136  GLN B O     1 
ATOM   3249 C  CB    . GLN B 2 97  ? 5.405   40.907  28.891  1.00 41.62 ? 136  GLN B CB    1 
ATOM   3250 C  CG    . GLN B 2 97  ? 5.731   39.949  27.728  1.00 44.55 ? 136  GLN B CG    1 
ATOM   3251 C  CD    . GLN B 2 97  ? 4.627   38.924  27.434  1.00 46.52 ? 136  GLN B CD    1 
ATOM   3252 O  OE1   . GLN B 2 97  ? 3.703   38.729  28.236  1.00 52.82 ? 136  GLN B OE1   1 
ATOM   3253 N  NE2   . GLN B 2 97  ? 4.739   38.245  26.287  1.00 51.11 ? 136  GLN B NE2   1 
ATOM   3254 N  N     . GLU B 2 98  ? 6.244   42.475  31.627  1.00 40.87 ? 137  GLU B N     1 
ATOM   3255 C  CA    . GLU B 2 98  ? 6.111   43.497  32.665  1.00 41.42 ? 137  GLU B CA    1 
ATOM   3256 C  C     . GLU B 2 98  ? 7.123   43.222  33.759  1.00 40.16 ? 137  GLU B C     1 
ATOM   3257 O  O     . GLU B 2 98  ? 6.774   42.650  34.797  1.00 39.87 ? 137  GLU B O     1 
ATOM   3258 C  CB    . GLU B 2 98  ? 4.691   43.503  33.220  1.00 41.92 ? 137  GLU B CB    1 
ATOM   3259 C  CG    . GLU B 2 98  ? 3.716   44.187  32.304  1.00 45.58 ? 137  GLU B CG    1 
ATOM   3260 C  CD    . GLU B 2 98  ? 2.303   44.093  32.821  1.00 48.32 ? 137  GLU B CD    1 
ATOM   3261 O  OE1   . GLU B 2 98  ? 1.719   45.148  33.143  1.00 50.04 ? 137  GLU B OE1   1 
ATOM   3262 O  OE2   . GLU B 2 98  ? 1.799   42.952  32.925  1.00 51.75 ? 137  GLU B OE2   1 
ATOM   3263 N  N     . PRO B 2 99  ? 8.396   43.591  33.506  1.00 38.98 ? 138  PRO B N     1 
ATOM   3264 C  CA    . PRO B 2 99  ? 9.483   43.158  34.385  1.00 38.42 ? 138  PRO B CA    1 
ATOM   3265 C  C     . PRO B 2 99  ? 9.276   43.622  35.824  1.00 37.10 ? 138  PRO B C     1 
ATOM   3266 O  O     . PRO B 2 99  ? 8.864   44.754  36.048  1.00 36.45 ? 138  PRO B O     1 
ATOM   3267 C  CB    . PRO B 2 99  ? 10.732  43.799  33.760  1.00 38.61 ? 138  PRO B CB    1 
ATOM   3268 C  CG    . PRO B 2 99  ? 10.359  44.166  32.397  1.00 38.91 ? 138  PRO B CG    1 
ATOM   3269 C  CD    . PRO B 2 99  ? 8.891   44.416  32.392  1.00 39.04 ? 138  PRO B CD    1 
ATOM   3270 N  N     . SER B 2 100 ? 9.507   42.724  36.773  1.00 36.10 ? 139  SER B N     1 
ATOM   3271 C  CA    . SER B 2 100 ? 9.579   43.069  38.188  1.00 35.81 ? 139  SER B CA    1 
ATOM   3272 C  C     . SER B 2 100 ? 10.861  42.483  38.733  1.00 35.36 ? 139  SER B C     1 
ATOM   3273 O  O     . SER B 2 100 ? 11.589  41.807  37.996  1.00 35.28 ? 139  SER B O     1 
ATOM   3274 C  CB    . SER B 2 100 ? 8.387   42.489  38.945  1.00 36.16 ? 139  SER B CB    1 
ATOM   3275 O  OG    . SER B 2 100 ? 8.516   41.088  39.103  1.00 37.21 ? 139  SER B OG    1 
ATOM   3276 N  N     . LEU B 2 101 ? 11.116  42.693  40.022  1.00 34.90 ? 140  LEU B N     1 
ATOM   3277 C  CA    . LEU B 2 101 ? 12.333  42.178  40.653  1.00 34.88 ? 140  LEU B CA    1 
ATOM   3278 C  C     . LEU B 2 101 ? 12.404  40.647  40.727  1.00 34.76 ? 140  LEU B C     1 
ATOM   3279 O  O     . LEU B 2 101 ? 13.485  40.100  40.885  1.00 34.52 ? 140  LEU B O     1 
ATOM   3280 C  CB    . LEU B 2 101 ? 12.520  42.799  42.050  1.00 35.35 ? 140  LEU B CB    1 
ATOM   3281 C  CG    . LEU B 2 101 ? 12.828  44.299  42.080  1.00 34.67 ? 140  LEU B CG    1 
ATOM   3282 C  CD1   . LEU B 2 101 ? 12.767  44.840  43.526  1.00 32.72 ? 140  LEU B CD1   1 
ATOM   3283 C  CD2   . LEU B 2 101 ? 14.190  44.560  41.454  1.00 36.04 ? 140  LEU B CD2   1 
ATOM   3284 N  N     . THR B 2 102 ? 11.270  39.960  40.565  1.00 34.86 ? 141  THR B N     1 
ATOM   3285 C  CA    . THR B 2 102 ? 11.248  38.484  40.584  1.00 33.82 ? 141  THR B CA    1 
ATOM   3286 C  C     . THR B 2 102 ? 11.283  37.847  39.174  1.00 33.82 ? 141  THR B C     1 
ATOM   3287 O  O     . THR B 2 102 ? 11.144  36.618  39.013  1.00 31.27 ? 141  THR B O     1 
ATOM   3288 C  CB    . THR B 2 102 ? 10.030  37.969  41.396  1.00 34.54 ? 141  THR B CB    1 
ATOM   3289 O  OG1   . THR B 2 102 ? 8.808   38.338  40.750  1.00 34.31 ? 141  THR B OG1   1 
ATOM   3290 C  CG2   . THR B 2 102 ? 10.040  38.558  42.795  1.00 34.84 ? 141  THR B CG2   1 
ATOM   3291 N  N     . CYS B 2 103 ? 11.482  38.685  38.156  1.00 33.56 ? 142  CYS B N     1 
ATOM   3292 C  CA    . CYS B 2 103 ? 11.479  38.244  36.747  1.00 33.69 ? 142  CYS B CA    1 
ATOM   3293 C  C     . CYS B 2 103 ? 12.295  36.954  36.482  1.00 32.97 ? 142  CYS B C     1 
ATOM   3294 O  O     . CYS B 2 103 ? 11.876  36.048  35.714  1.00 34.49 ? 142  CYS B O     1 
ATOM   3295 C  CB    . CYS B 2 103 ? 12.040  39.369  35.889  1.00 33.38 ? 142  CYS B CB    1 
ATOM   3296 S  SG    . CYS B 2 103 ? 12.043  39.090  34.105  1.00 36.31 ? 142  CYS B SG    1 
ATOM   3297 N  N     . PHE B 2 104 ? 13.463  36.863  37.091  1.00 32.09 ? 143  PHE B N     1 
ATOM   3298 C  CA    . PHE B 2 104 ? 14.391  35.773  36.816  1.00 32.62 ? 143  PHE B CA    1 
ATOM   3299 C  C     . PHE B 2 104 ? 14.431  34.705  37.895  1.00 32.49 ? 143  PHE B C     1 
ATOM   3300 O  O     . PHE B 2 104 ? 15.290  33.838  37.864  1.00 32.05 ? 143  PHE B O     1 
ATOM   3301 C  CB    . PHE B 2 104 ? 15.793  36.352  36.588  1.00 32.80 ? 143  PHE B CB    1 
ATOM   3302 C  CG    . PHE B 2 104 ? 15.869  37.246  35.392  1.00 31.95 ? 143  PHE B CG    1 
ATOM   3303 C  CD1   . PHE B 2 104 ? 15.859  36.697  34.106  1.00 31.86 ? 143  PHE B CD1   1 
ATOM   3304 C  CD2   . PHE B 2 104 ? 15.898  38.646  35.542  1.00 31.66 ? 143  PHE B CD2   1 
ATOM   3305 C  CE1   . PHE B 2 104 ? 15.892  37.515  32.993  1.00 30.55 ? 143  PHE B CE1   1 
ATOM   3306 C  CE2   . PHE B 2 104 ? 15.970  39.479  34.435  1.00 32.60 ? 143  PHE B CE2   1 
ATOM   3307 C  CZ    . PHE B 2 104 ? 15.965  38.911  33.141  1.00 30.34 ? 143  PHE B CZ    1 
ATOM   3308 N  N     . ASP B 2 105 ? 13.554  34.808  38.886  1.00 33.32 ? 144  ASP B N     1 
ATOM   3309 C  CA    . ASP B 2 105 ? 13.639  33.895  40.031  1.00 33.88 ? 144  ASP B CA    1 
ATOM   3310 C  C     . ASP B 2 105 ? 13.622  32.418  39.643  1.00 33.64 ? 144  ASP B C     1 
ATOM   3311 O  O     . ASP B 2 105 ? 14.355  31.615  40.223  1.00 31.86 ? 144  ASP B O     1 
ATOM   3312 C  CB    . ASP B 2 105 ? 12.534  34.151  41.043  1.00 34.24 ? 144  ASP B CB    1 
ATOM   3313 C  CG    . ASP B 2 105 ? 12.833  35.329  41.971  1.00 34.73 ? 144  ASP B CG    1 
ATOM   3314 O  OD1   . ASP B 2 105 ? 13.910  35.949  41.888  1.00 35.02 ? 144  ASP B OD1   1 
ATOM   3315 O  OD2   . ASP B 2 105 ? 11.968  35.613  42.786  1.00 36.55 ? 144  ASP B OD2   1 
ATOM   3316 N  N     . GLN B 2 106 ? 12.756  32.061  38.713  1.00 32.78 ? 145  GLN B N     1 
ATOM   3317 C  CA    . GLN B 2 106 ? 12.615  30.645  38.305  1.00 34.73 ? 145  GLN B CA    1 
ATOM   3318 C  C     . GLN B 2 106 ? 13.891  30.167  37.600  1.00 33.69 ? 145  GLN B C     1 
ATOM   3319 O  O     . GLN B 2 106 ? 14.475  29.135  37.965  1.00 33.68 ? 145  GLN B O     1 
ATOM   3320 C  CB    . GLN B 2 106 ? 11.386  30.496  37.392  1.00 35.32 ? 145  GLN B CB    1 
ATOM   3321 C  CG    . GLN B 2 106 ? 10.436  29.441  37.784  1.00 40.53 ? 145  GLN B CG    1 
ATOM   3322 C  CD    . GLN B 2 106 ? 9.261   29.346  36.827  1.00 40.26 ? 145  GLN B CD    1 
ATOM   3323 O  OE1   . GLN B 2 106 ? 8.386   30.237  36.796  1.00 41.63 ? 145  GLN B OE1   1 
ATOM   3324 N  NE2   . GLN B 2 106 ? 9.221   28.260  36.058  1.00 40.19 ? 145  GLN B NE2   1 
ATOM   3325 N  N     . ALA B 2 107 ? 14.338  30.935  36.612  1.00 32.93 ? 146  ALA B N     1 
ATOM   3326 C  CA    . ALA B 2 107 ? 15.561  30.666  35.868  1.00 33.22 ? 146  ALA B CA    1 
ATOM   3327 C  C     . ALA B 2 107 ? 16.835  30.696  36.758  1.00 32.41 ? 146  ALA B C     1 
ATOM   3328 O  O     . ALA B 2 107 ? 17.701  29.829  36.647  1.00 32.09 ? 146  ALA B O     1 
ATOM   3329 C  CB    . ALA B 2 107 ? 15.711  31.680  34.716  1.00 32.78 ? 146  ALA B CB    1 
ATOM   3330 N  N     . GLN B 2 108 ? 16.917  31.688  37.634  1.00 32.78 ? 147  GLN B N     1 
ATOM   3331 C  CA    . GLN B 2 108 ? 18.018  31.774  38.593  1.00 33.28 ? 147  GLN B CA    1 
ATOM   3332 C  C     . GLN B 2 108 ? 18.053  30.544  39.523  1.00 32.81 ? 147  GLN B C     1 
ATOM   3333 O  O     . GLN B 2 108 ? 19.115  30.011  39.768  1.00 34.55 ? 147  GLN B O     1 
ATOM   3334 C  CB    . GLN B 2 108 ? 17.962  33.056  39.412  1.00 32.94 ? 147  GLN B CB    1 
ATOM   3335 C  CG    . GLN B 2 108 ? 19.195  33.226  40.276  1.00 32.95 ? 147  GLN B CG    1 
ATOM   3336 C  CD    . GLN B 2 108 ? 19.133  34.389  41.241  1.00 32.81 ? 147  GLN B CD    1 
ATOM   3337 O  OE1   . GLN B 2 108 ? 18.062  34.880  41.595  1.00 34.73 ? 147  GLN B OE1   1 
ATOM   3338 N  NE2   . GLN B 2 108 ? 20.314  34.816  41.721  1.00 33.87 ? 147  GLN B NE2   1 
ATOM   3339 N  N     . GLY B 2 109 ? 16.896  30.096  40.016  1.00 33.00 ? 148  GLY B N     1 
ATOM   3340 C  CA    . GLY B 2 109 ? 16.808  28.900  40.870  1.00 33.25 ? 148  GLY B CA    1 
ATOM   3341 C  C     . GLY B 2 109 ? 17.297  27.659  40.158  1.00 32.58 ? 148  GLY B C     1 
ATOM   3342 O  O     . GLY B 2 109 ? 18.069  26.826  40.729  1.00 33.88 ? 148  GLY B O     1 
ATOM   3343 N  N     . LYS B 2 110 ? 16.880  27.514  38.900  1.00 33.33 ? 149  LYS B N     1 
ATOM   3344 C  CA    . LYS B 2 110 ? 17.303  26.367  38.079  1.00 32.87 ? 149  LYS B CA    1 
ATOM   3345 C  C     . LYS B 2 110 ? 18.815  26.338  37.865  1.00 32.78 ? 149  LYS B C     1 
ATOM   3346 O  O     . LYS B 2 110 ? 19.456  25.276  37.960  1.00 31.78 ? 149  LYS B O     1 
ATOM   3347 C  CB    . LYS B 2 110 ? 16.567  26.327  36.716  1.00 33.50 ? 149  LYS B CB    1 
ATOM   3348 C  CG    . LYS B 2 110 ? 15.092  25.938  36.800  1.00 33.80 ? 149  LYS B CG    1 
ATOM   3349 C  CD    . LYS B 2 110 ? 14.931  24.551  37.317  1.00 38.64 ? 149  LYS B CD    1 
ATOM   3350 C  CE    . LYS B 2 110 ? 13.578  23.934  36.949  1.00 42.31 ? 149  LYS B CE    1 
ATOM   3351 N  NZ    . LYS B 2 110 ? 13.478  22.528  37.457  1.00 41.84 ? 149  LYS B NZ    1 
ATOM   3352 N  N     . VAL B 2 111 ? 19.378  27.495  37.578  1.00 32.94 ? 150  VAL B N     1 
ATOM   3353 C  CA    . VAL B 2 111 ? 20.809  27.628  37.339  1.00 34.22 ? 150  VAL B CA    1 
ATOM   3354 C  C     . VAL B 2 111 ? 21.580  27.427  38.650  1.00 33.58 ? 150  VAL B C     1 
ATOM   3355 O  O     . VAL B 2 111 ? 22.644  26.851  38.629  1.00 34.76 ? 150  VAL B O     1 
ATOM   3356 C  CB    . VAL B 2 111 ? 21.142  28.945  36.600  1.00 34.87 ? 150  VAL B CB    1 
ATOM   3357 C  CG1   . VAL B 2 111 ? 22.662  29.167  36.487  1.00 34.37 ? 150  VAL B CG1   1 
ATOM   3358 C  CG2   . VAL B 2 111 ? 20.499  28.874  35.121  1.00 32.96 ? 150  VAL B CG2   1 
ATOM   3359 N  N     . HIS B 2 112 ? 21.034  27.910  39.754  1.00 33.45 ? 151  HIS B N     1 
ATOM   3360 C  CA    . HIS B 2 112 ? 21.626  27.680  41.074  1.00 33.05 ? 151  HIS B CA    1 
ATOM   3361 C  C     . HIS B 2 112 ? 21.703  26.176  41.361  1.00 33.16 ? 151  HIS B C     1 
ATOM   3362 O  O     . HIS B 2 112 ? 22.760  25.676  41.762  1.00 32.63 ? 151  HIS B O     1 
ATOM   3363 C  CB    . HIS B 2 112 ? 20.829  28.437  42.154  1.00 32.61 ? 151  HIS B CB    1 
ATOM   3364 C  CG    . HIS B 2 112 ? 21.299  28.180  43.558  1.00 34.02 ? 151  HIS B CG    1 
ATOM   3365 N  ND1   . HIS B 2 112 ? 20.837  27.124  44.308  1.00 34.36 ? 151  HIS B ND1   1 
ATOM   3366 C  CD2   . HIS B 2 112 ? 22.152  28.867  44.360  1.00 35.30 ? 151  HIS B CD2   1 
ATOM   3367 C  CE1   . HIS B 2 112 ? 21.407  27.153  45.504  1.00 34.66 ? 151  HIS B CE1   1 
ATOM   3368 N  NE2   . HIS B 2 112 ? 22.210  28.203  45.557  1.00 34.53 ? 151  HIS B NE2   1 
ATOM   3369 N  N     . SER B 2 113 ? 20.598  25.457  41.117  1.00 32.91 ? 152  SER B N     1 
ATOM   3370 C  CA    A SER B 2 113 ? 20.542  24.015  41.326  0.50 33.68 ? 152  SER B CA    1 
ATOM   3371 C  CA    B SER B 2 113 ? 20.566  24.003  41.335  0.50 33.80 ? 152  SER B CA    1 
ATOM   3372 C  C     . SER B 2 113 ? 21.573  23.291  40.423  1.00 33.58 ? 152  SER B C     1 
ATOM   3373 O  O     . SER B 2 113 ? 22.237  22.377  40.848  1.00 33.51 ? 152  SER B O     1 
ATOM   3374 C  CB    A SER B 2 113 ? 19.116  23.514  41.059  0.50 33.36 ? 152  SER B CB    1 
ATOM   3375 C  CB    B SER B 2 113 ? 19.163  23.425  41.118  0.50 33.48 ? 152  SER B CB    1 
ATOM   3376 O  OG    A SER B 2 113 ? 18.979  22.166  41.418  0.50 34.02 ? 152  SER B OG    1 
ATOM   3377 O  OG    B SER B 2 113 ? 18.302  23.822  42.159  0.50 34.90 ? 152  SER B OG    1 
ATOM   3378 N  N     . LEU B 2 114 ? 21.678  23.726  39.162  1.00 33.88 ? 153  LEU B N     1 
ATOM   3379 C  CA    . LEU B 2 114 ? 22.605  23.140  38.191  1.00 34.45 ? 153  LEU B CA    1 
ATOM   3380 C  C     . LEU B 2 114 ? 24.067  23.232  38.674  1.00 33.65 ? 153  LEU B C     1 
ATOM   3381 O  O     . LEU B 2 114 ? 24.766  22.207  38.720  1.00 33.70 ? 153  LEU B O     1 
ATOM   3382 C  CB    . LEU B 2 114 ? 22.430  23.788  36.829  1.00 34.22 ? 153  LEU B CB    1 
ATOM   3383 C  CG    . LEU B 2 114 ? 23.308  23.387  35.648  1.00 35.19 ? 153  LEU B CG    1 
ATOM   3384 C  CD1   . LEU B 2 114 ? 23.160  21.880  35.355  1.00 35.54 ? 153  LEU B CD1   1 
ATOM   3385 C  CD2   . LEU B 2 114 ? 22.930  24.242  34.434  1.00 34.63 ? 153  LEU B CD2   1 
ATOM   3386 N  N     . MET B 2 115 ? 24.483  24.427  39.082  1.00 32.94 ? 154  MET B N     1 
ATOM   3387 C  CA    . MET B 2 115 ? 25.836  24.654  39.655  1.00 34.12 ? 154  MET B CA    1 
ATOM   3388 C  C     . MET B 2 115 ? 26.018  23.857  40.948  1.00 33.57 ? 154  MET B C     1 
ATOM   3389 O  O     . MET B 2 115 ? 27.044  23.240  41.136  1.00 33.31 ? 154  MET B O     1 
ATOM   3390 C  CB    . MET B 2 115 ? 26.073  26.119  39.969  1.00 33.47 ? 154  MET B CB    1 
ATOM   3391 C  CG    . MET B 2 115 ? 26.140  27.031  38.727  1.00 35.61 ? 154  MET B CG    1 
ATOM   3392 S  SD    . MET B 2 115 ? 26.644  28.701  39.039  1.00 35.18 ? 154  MET B SD    1 
ATOM   3393 C  CE    . MET B 2 115 ? 25.207  29.363  39.882  1.00 33.14 ? 154  MET B CE    1 
ATOM   3394 N  N     . GLU B 2 116 ? 25.013  23.878  41.823  1.00 34.33 ? 155  GLU B N     1 
ATOM   3395 C  CA    . GLU B 2 116 ? 25.119  23.271  43.161  1.00 34.10 ? 155  GLU B CA    1 
ATOM   3396 C  C     . GLU B 2 116 ? 25.337  21.747  43.079  1.00 33.76 ? 155  GLU B C     1 
ATOM   3397 O  O     . GLU B 2 116 ? 26.114  21.178  43.837  1.00 30.82 ? 155  GLU B O     1 
ATOM   3398 C  CB    . GLU B 2 116 ? 23.874  23.565  44.009  1.00 34.43 ? 155  GLU B CB    1 
ATOM   3399 C  CG    . GLU B 2 116 ? 24.009  22.989  45.439  1.00 35.10 ? 155  GLU B CG    1 
ATOM   3400 C  CD    . GLU B 2 116 ? 23.033  23.560  46.495  1.00 38.23 ? 155  GLU B CD    1 
ATOM   3401 O  OE1   . GLU B 2 116 ? 22.007  24.166  46.131  1.00 44.09 ? 155  GLU B OE1   1 
ATOM   3402 O  OE2   . GLU B 2 116 ? 23.275  23.342  47.706  1.00 45.93 ? 155  GLU B OE2   1 
ATOM   3403 N  N     . LYS B 2 117 ? 24.580  21.108  42.185  1.00 33.31 ? 156  LYS B N     1 
ATOM   3404 C  CA    . LYS B 2 117 ? 24.554  19.655  42.076  1.00 33.66 ? 156  LYS B CA    1 
ATOM   3405 C  C     . LYS B 2 117 ? 25.612  19.091  41.144  1.00 32.58 ? 156  LYS B C     1 
ATOM   3406 O  O     . LYS B 2 117 ? 26.033  17.986  41.335  1.00 32.81 ? 156  LYS B O     1 
ATOM   3407 C  CB    . LYS B 2 117 ? 23.157  19.202  41.655  1.00 34.30 ? 156  LYS B CB    1 
ATOM   3408 C  CG    . LYS B 2 117 ? 22.064  19.569  42.692  1.00 35.09 ? 156  LYS B CG    1 
ATOM   3409 C  CD    . LYS B 2 117 ? 20.649  19.233  42.177  1.00 37.99 ? 156  LYS B CD    1 
ATOM   3410 C  CE    . LYS B 2 117 ? 19.573  19.706  43.206  1.00 41.07 ? 156  LYS B CE    1 
ATOM   3411 N  NZ    . LYS B 2 117 ? 18.414  18.769  43.224  1.00 46.38 ? 156  LYS B NZ    1 
ATOM   3412 N  N     . ASP B 2 118 ? 26.003  19.838  40.119  1.00 33.11 ? 157  ASP B N     1 
ATOM   3413 C  CA    . ASP B 2 118 ? 26.926  19.339  39.116  1.00 33.04 ? 157  ASP B CA    1 
ATOM   3414 C  C     . ASP B 2 118 ? 28.359  19.883  39.303  1.00 33.49 ? 157  ASP B C     1 
ATOM   3415 O  O     . ASP B 2 118 ? 29.238  19.147  39.725  1.00 32.58 ? 157  ASP B O     1 
ATOM   3416 C  CB    . ASP B 2 118 ? 26.404  19.575  37.717  1.00 32.47 ? 157  ASP B CB    1 
ATOM   3417 C  CG    . ASP B 2 118 ? 27.242  18.871  36.673  1.00 32.00 ? 157  ASP B CG    1 
ATOM   3418 O  OD1   . ASP B 2 118 ? 27.448  17.664  36.824  1.00 31.37 ? 157  ASP B OD1   1 
ATOM   3419 O  OD2   . ASP B 2 118 ? 27.746  19.536  35.736  1.00 33.99 ? 157  ASP B OD2   1 
ATOM   3420 N  N     . SER B 2 119 ? 28.550  21.173  39.068  1.00 33.30 ? 158  SER B N     1 
ATOM   3421 C  CA    . SER B 2 119 ? 29.864  21.792  39.103  1.00 32.51 ? 158  SER B CA    1 
ATOM   3422 C  C     . SER B 2 119 ? 30.492  21.878  40.505  1.00 32.44 ? 158  SER B C     1 
ATOM   3423 O  O     . SER B 2 119 ? 31.688  21.626  40.664  1.00 30.72 ? 158  SER B O     1 
ATOM   3424 C  CB    . SER B 2 119 ? 29.769  23.195  38.490  1.00 33.84 ? 158  SER B CB    1 
ATOM   3425 O  OG    . SER B 2 119 ? 29.040  23.152  37.292  1.00 34.48 ? 158  SER B OG    1 
ATOM   3426 N  N     . TYR B 2 120 ? 29.691  22.219  41.521  1.00 32.51 ? 159  TYR B N     1 
ATOM   3427 C  CA    . TYR B 2 120 ? 30.231  22.492  42.879  1.00 32.27 ? 159  TYR B CA    1 
ATOM   3428 C  C     . TYR B 2 120 ? 30.858  21.259  43.560  1.00 32.47 ? 159  TYR B C     1 
ATOM   3429 O  O     . TYR B 2 120 ? 31.927  21.384  44.154  1.00 32.10 ? 159  TYR B O     1 
ATOM   3430 C  CB    . TYR B 2 120 ? 29.156  23.163  43.749  1.00 31.73 ? 159  TYR B CB    1 
ATOM   3431 C  CG    . TYR B 2 120 ? 29.464  23.318  45.219  1.00 31.40 ? 159  TYR B CG    1 
ATOM   3432 C  CD1   . TYR B 2 120 ? 30.448  24.221  45.669  1.00 32.28 ? 159  TYR B CD1   1 
ATOM   3433 C  CD2   . TYR B 2 120 ? 28.782  22.574  46.163  1.00 32.35 ? 159  TYR B CD2   1 
ATOM   3434 C  CE1   . TYR B 2 120 ? 30.706  24.372  47.015  1.00 31.27 ? 159  TYR B CE1   1 
ATOM   3435 C  CE2   . TYR B 2 120 ? 29.024  22.721  47.508  1.00 31.68 ? 159  TYR B CE2   1 
ATOM   3436 C  CZ    . TYR B 2 120 ? 29.992  23.615  47.935  1.00 33.01 ? 159  TYR B CZ    1 
ATOM   3437 O  OH    . TYR B 2 120 ? 30.223  23.749  49.269  1.00 29.96 ? 159  TYR B OH    1 
ATOM   3438 N  N     . PRO B 2 121 ? 30.220  20.061  43.482  1.00 32.28 ? 160  PRO B N     1 
ATOM   3439 C  CA    . PRO B 2 121 ? 30.939  18.918  44.045  1.00 32.90 ? 160  PRO B CA    1 
ATOM   3440 C  C     . PRO B 2 121 ? 32.301  18.651  43.382  1.00 32.58 ? 160  PRO B C     1 
ATOM   3441 O  O     . PRO B 2 121 ? 33.279  18.336  44.069  1.00 33.97 ? 160  PRO B O     1 
ATOM   3442 C  CB    . PRO B 2 121 ? 29.944  17.754  43.856  1.00 33.69 ? 160  PRO B CB    1 
ATOM   3443 C  CG    . PRO B 2 121 ? 28.605  18.423  43.822  1.00 32.11 ? 160  PRO B CG    1 
ATOM   3444 C  CD    . PRO B 2 121 ? 28.881  19.658  43.020  1.00 33.49 ? 160  PRO B CD    1 
ATOM   3445 N  N     . ARG B 2 122 ? 32.401  18.874  42.081  1.00 32.16 ? 161  ARG B N     1 
ATOM   3446 C  CA    . ARG B 2 122 ? 33.668  18.678  41.405  1.00 32.82 ? 161  ARG B CA    1 
ATOM   3447 C  C     . ARG B 2 122 ? 34.670  19.773  41.817  1.00 32.51 ? 161  ARG B C     1 
ATOM   3448 O  O     . ARG B 2 122 ? 35.859  19.518  41.931  1.00 32.35 ? 161  ARG B O     1 
ATOM   3449 C  CB    . ARG B 2 122 ? 33.469  18.677  39.892  1.00 32.66 ? 161  ARG B CB    1 
ATOM   3450 C  CG    . ARG B 2 122 ? 32.759  17.465  39.384  1.00 33.32 ? 161  ARG B CG    1 
ATOM   3451 C  CD    . ARG B 2 122 ? 32.979  17.309  37.910  1.00 33.00 ? 161  ARG B CD    1 
ATOM   3452 N  NE    . ARG B 2 122 ? 32.315  18.378  37.190  1.00 32.55 ? 161  ARG B NE    1 
ATOM   3453 C  CZ    . ARG B 2 122 ? 31.050  18.364  36.774  1.00 33.92 ? 161  ARG B CZ    1 
ATOM   3454 N  NH1   . ARG B 2 122 ? 30.256  17.323  36.990  1.00 35.44 ? 161  ARG B NH1   1 
ATOM   3455 N  NH2   . ARG B 2 122 ? 30.576  19.420  36.153  1.00 32.58 ? 161  ARG B NH2   1 
ATOM   3456 N  N     . PHE B 2 123 ? 34.174  20.985  42.028  1.00 32.31 ? 162  PHE B N     1 
ATOM   3457 C  CA    . PHE B 2 123 ? 35.034  22.064  42.543  1.00 32.46 ? 162  PHE B CA    1 
ATOM   3458 C  C     . PHE B 2 123 ? 35.707  21.646  43.844  1.00 32.05 ? 162  PHE B C     1 
ATOM   3459 O  O     . PHE B 2 123 ? 36.929  21.815  44.017  1.00 32.03 ? 162  PHE B O     1 
ATOM   3460 C  CB    . PHE B 2 123 ? 34.248  23.368  42.744  1.00 32.25 ? 162  PHE B CB    1 
ATOM   3461 C  CG    . PHE B 2 123 ? 35.039  24.441  43.437  1.00 31.24 ? 162  PHE B CG    1 
ATOM   3462 C  CD1   . PHE B 2 123 ? 36.020  25.150  42.747  1.00 31.82 ? 162  PHE B CD1   1 
ATOM   3463 C  CD2   . PHE B 2 123 ? 34.817  24.743  44.769  1.00 34.09 ? 162  PHE B CD2   1 
ATOM   3464 C  CE1   . PHE B 2 123 ? 36.762  26.163  43.352  1.00 32.60 ? 162  PHE B CE1   1 
ATOM   3465 C  CE2   . PHE B 2 123 ? 35.563  25.744  45.395  1.00 33.86 ? 162  PHE B CE2   1 
ATOM   3466 C  CZ    . PHE B 2 123 ? 36.549  26.459  44.671  1.00 32.58 ? 162  PHE B CZ    1 
ATOM   3467 N  N     . LEU B 2 124 ? 34.924  21.086  44.757  1.00 31.53 ? 163  LEU B N     1 
ATOM   3468 C  CA    . LEU B 2 124 ? 35.443  20.699  46.048  1.00 31.42 ? 163  LEU B CA    1 
ATOM   3469 C  C     . LEU B 2 124 ? 36.480  19.562  45.996  1.00 32.19 ? 163  LEU B C     1 
ATOM   3470 O  O     . LEU B 2 124 ? 37.214  19.372  46.926  1.00 31.59 ? 163  LEU B O     1 
ATOM   3471 C  CB    . LEU B 2 124 ? 34.301  20.343  46.988  1.00 31.55 ? 163  LEU B CB    1 
ATOM   3472 C  CG    . LEU B 2 124 ? 33.379  21.488  47.407  1.00 31.40 ? 163  LEU B CG    1 
ATOM   3473 C  CD1   . LEU B 2 124 ? 32.401  20.981  48.443  1.00 33.02 ? 163  LEU B CD1   1 
ATOM   3474 C  CD2   . LEU B 2 124 ? 34.145  22.716  47.935  1.00 29.01 ? 163  LEU B CD2   1 
ATOM   3475 N  N     . ARG B 2 125 ? 36.509  18.811  44.905  1.00 33.69 ? 164  ARG B N     1 
ATOM   3476 C  CA    . ARG B 2 125 ? 37.498  17.771  44.683  1.00 34.08 ? 164  ARG B CA    1 
ATOM   3477 C  C     . ARG B 2 125 ? 38.618  18.166  43.712  1.00 34.26 ? 164  ARG B C     1 
ATOM   3478 O  O     . ARG B 2 125 ? 39.521  17.341  43.426  1.00 33.79 ? 164  ARG B O     1 
ATOM   3479 C  CB    . ARG B 2 125 ? 36.798  16.533  44.142  1.00 35.79 ? 164  ARG B CB    1 
ATOM   3480 C  CG    . ARG B 2 125 ? 35.973  15.785  45.172  1.00 38.53 ? 164  ARG B CG    1 
ATOM   3481 C  CD    . ARG B 2 125 ? 36.167  14.307  44.952  1.00 44.05 ? 164  ARG B CD    1 
ATOM   3482 N  NE    . ARG B 2 125 ? 35.722  13.440  46.042  1.00 45.38 ? 164  ARG B NE    1 
ATOM   3483 C  CZ    . ARG B 2 125 ? 35.401  12.148  45.875  1.00 48.48 ? 164  ARG B CZ    1 
ATOM   3484 N  NH1   . ARG B 2 125 ? 35.450  11.584  44.663  1.00 49.37 ? 164  ARG B NH1   1 
ATOM   3485 N  NH2   . ARG B 2 125 ? 35.025  11.409  46.916  1.00 47.32 ? 164  ARG B NH2   1 
ATOM   3486 N  N     . SER B 2 126 ? 38.589  19.405  43.235  1.00 33.17 ? 165  SER B N     1 
ATOM   3487 C  CA    . SER B 2 126 ? 39.463  19.848  42.158  1.00 33.41 ? 165  SER B CA    1 
ATOM   3488 C  C     . SER B 2 126 ? 40.895  20.074  42.634  1.00 34.10 ? 165  SER B C     1 
ATOM   3489 O  O     . SER B 2 126 ? 41.138  20.364  43.811  1.00 33.94 ? 165  SER B O     1 
ATOM   3490 C  CB    . SER B 2 126 ? 38.917  21.148  41.515  1.00 33.19 ? 165  SER B CB    1 
ATOM   3491 O  OG    . SER B 2 126 ? 39.030  22.292  42.364  1.00 31.44 ? 165  SER B OG    1 
ATOM   3492 N  N     . LYS B 2 127 ? 41.832  19.933  41.708  1.00 34.52 ? 166  LYS B N     1 
ATOM   3493 C  CA    . LYS B 2 127 ? 43.205  20.356  41.937  1.00 34.71 ? 166  LYS B CA    1 
ATOM   3494 C  C     . LYS B 2 127 ? 43.269  21.848  42.323  1.00 35.02 ? 166  LYS B C     1 
ATOM   3495 O  O     . LYS B 2 127 ? 43.999  22.231  43.243  1.00 32.79 ? 166  LYS B O     1 
ATOM   3496 C  CB    . LYS B 2 127 ? 44.065  20.069  40.699  1.00 35.10 ? 166  LYS B CB    1 
ATOM   3497 N  N     . MET B 2 128 ? 42.498  22.679  41.616  1.00 35.65 ? 167  MET B N     1 
ATOM   3498 C  CA    . MET B 2 128 ? 42.433  24.111  41.880  1.00 37.24 ? 167  MET B CA    1 
ATOM   3499 C  C     . MET B 2 128 ? 42.086  24.430  43.343  1.00 36.59 ? 167  MET B C     1 
ATOM   3500 O  O     . MET B 2 128 ? 42.767  25.228  43.984  1.00 36.42 ? 167  MET B O     1 
ATOM   3501 C  CB    . MET B 2 128 ? 41.396  24.770  40.982  1.00 37.74 ? 167  MET B CB    1 
ATOM   3502 C  CG    . MET B 2 128 ? 41.143  26.235  41.322  1.00 39.33 ? 167  MET B CG    1 
ATOM   3503 S  SD    . MET B 2 128 ? 40.048  27.050  40.161  1.00 43.13 ? 167  MET B SD    1 
ATOM   3504 C  CE    . MET B 2 128 ? 40.859  26.693  38.581  1.00 39.01 ? 167  MET B CE    1 
ATOM   3505 N  N     . TYR B 2 129 ? 41.014  23.831  43.851  1.00 35.58 ? 168  TYR B N     1 
ATOM   3506 C  CA    . TYR B 2 129 ? 40.600  24.062  45.239  1.00 34.90 ? 168  TYR B CA    1 
ATOM   3507 C  C     . TYR B 2 129 ? 41.610  23.474  46.225  1.00 34.86 ? 168  TYR B C     1 
ATOM   3508 O  O     . TYR B 2 129 ? 41.968  24.125  47.220  1.00 33.57 ? 168  TYR B O     1 
ATOM   3509 C  CB    . TYR B 2 129 ? 39.212  23.486  45.493  1.00 34.28 ? 168  TYR B CB    1 
ATOM   3510 C  CG    . TYR B 2 129 ? 38.707  23.637  46.928  1.00 34.34 ? 168  TYR B CG    1 
ATOM   3511 C  CD1   . TYR B 2 129 ? 38.545  24.899  47.529  1.00 34.17 ? 168  TYR B CD1   1 
ATOM   3512 C  CD2   . TYR B 2 129 ? 38.395  22.526  47.678  1.00 33.63 ? 168  TYR B CD2   1 
ATOM   3513 C  CE1   . TYR B 2 129 ? 38.061  25.017  48.832  1.00 33.36 ? 168  TYR B CE1   1 
ATOM   3514 C  CE2   . TYR B 2 129 ? 37.937  22.632  48.971  1.00 33.72 ? 168  TYR B CE2   1 
ATOM   3515 C  CZ    . TYR B 2 129 ? 37.759  23.873  49.543  1.00 34.40 ? 168  TYR B CZ    1 
ATOM   3516 O  OH    . TYR B 2 129 ? 37.297  23.908  50.835  1.00 33.77 ? 168  TYR B OH    1 
ATOM   3517 N  N     . LEU B 2 130 ? 42.095  22.262  45.933  1.00 34.33 ? 169  LEU B N     1 
ATOM   3518 C  CA    . LEU B 2 130 ? 43.082  21.613  46.812  1.00 33.90 ? 169  LEU B CA    1 
ATOM   3519 C  C     . LEU B 2 130 ? 44.367  22.438  46.906  1.00 33.90 ? 169  LEU B C     1 
ATOM   3520 O  O     . LEU B 2 130 ? 44.920  22.563  47.994  1.00 32.29 ? 169  LEU B O     1 
ATOM   3521 C  CB    . LEU B 2 130 ? 43.382  20.182  46.367  1.00 34.05 ? 169  LEU B CB    1 
ATOM   3522 N  N     . ASP B 2 131 ? 44.814  23.023  45.792  1.00 33.62 ? 170  ASP B N     1 
ATOM   3523 C  CA    . ASP B 2 131 ? 45.967  23.943  45.809  1.00 33.99 ? 170  ASP B CA    1 
ATOM   3524 C  C     . ASP B 2 131 ? 45.682  25.176  46.663  1.00 33.11 ? 170  ASP B C     1 
ATOM   3525 O  O     . ASP B 2 131 ? 46.506  25.572  47.452  1.00 31.50 ? 170  ASP B O     1 
ATOM   3526 C  CB    . ASP B 2 131 ? 46.346  24.428  44.405  1.00 34.45 ? 170  ASP B CB    1 
ATOM   3527 C  CG    . ASP B 2 131 ? 47.011  23.353  43.549  1.00 37.90 ? 170  ASP B CG    1 
ATOM   3528 O  OD1   . ASP B 2 131 ? 47.513  22.330  44.079  1.00 39.55 ? 170  ASP B OD1   1 
ATOM   3529 O  OD2   . ASP B 2 131 ? 47.006  23.543  42.308  1.00 42.42 ? 170  ASP B OD2   1 
ATOM   3530 N  N     . LEU B 2 132 ? 44.511  25.793  46.483  1.00 32.92 ? 171  LEU B N     1 
ATOM   3531 C  CA    . LEU B 2 132 ? 44.142  26.936  47.312  1.00 32.61 ? 171  LEU B CA    1 
ATOM   3532 C  C     . LEU B 2 132 ? 44.205  26.607  48.808  1.00 32.23 ? 171  LEU B C     1 
ATOM   3533 O  O     . LEU B 2 132 ? 44.745  27.387  49.592  1.00 30.86 ? 171  LEU B O     1 
ATOM   3534 C  CB    . LEU B 2 132 ? 42.749  27.474  46.934  1.00 32.23 ? 171  LEU B CB    1 
ATOM   3535 C  CG    . LEU B 2 132 ? 42.725  28.186  45.583  1.00 32.98 ? 171  LEU B CG    1 
ATOM   3536 C  CD1   . LEU B 2 132 ? 41.267  28.260  44.982  1.00 31.55 ? 171  LEU B CD1   1 
ATOM   3537 C  CD2   . LEU B 2 132 ? 43.401  29.559  45.676  1.00 34.32 ? 171  LEU B CD2   1 
ATOM   3538 N  N     . LEU B 2 133 ? 43.638  25.462  49.191  1.00 32.05 ? 172  LEU B N     1 
ATOM   3539 C  CA    . LEU B 2 133 ? 43.686  24.987  50.580  1.00 32.64 ? 172  LEU B CA    1 
ATOM   3540 C  C     . LEU B 2 133 ? 45.081  24.790  51.094  1.00 32.68 ? 172  LEU B C     1 
ATOM   3541 O  O     . LEU B 2 133 ? 45.395  25.196  52.218  1.00 31.57 ? 172  LEU B O     1 
ATOM   3542 C  CB    . LEU B 2 133 ? 42.993  23.638  50.723  1.00 33.64 ? 172  LEU B CB    1 
ATOM   3543 C  CG    . LEU B 2 133 ? 41.508  23.644  51.066  1.00 34.23 ? 172  LEU B CG    1 
ATOM   3544 C  CD1   . LEU B 2 133 ? 40.974  22.257  50.813  1.00 35.86 ? 172  LEU B CD1   1 
ATOM   3545 C  CD2   . LEU B 2 133 ? 41.339  24.053  52.538  1.00 36.57 ? 172  LEU B CD2   1 
ATOM   3546 N  N     . SER B 2 134 ? 45.903  24.105  50.307  1.00 32.83 ? 173  SER B N     1 
ATOM   3547 C  CA    . SER B 2 134 ? 47.256  23.780  50.755  1.00 33.99 ? 173  SER B CA    1 
ATOM   3548 C  C     . SER B 2 134 ? 48.147  25.035  50.830  1.00 34.17 ? 173  SER B C     1 
ATOM   3549 O  O     . SER B 2 134 ? 49.057  25.114  51.664  1.00 34.71 ? 173  SER B O     1 
ATOM   3550 C  CB    . SER B 2 134 ? 47.854  22.682  49.866  1.00 34.16 ? 173  SER B CB    1 
ATOM   3551 O  OG    . SER B 2 134 ? 48.121  23.145  48.568  1.00 35.91 ? 173  SER B OG    1 
ATOM   3552 N  N     . GLN B 2 135 ? 47.859  26.023  49.988  1.00 34.54 ? 174  GLN B N     1 
ATOM   3553 C  CA    . GLN B 2 135 ? 48.577  27.298  49.998  1.00 35.14 ? 174  GLN B CA    1 
ATOM   3554 C  C     . GLN B 2 135 ? 48.077  28.293  51.074  1.00 35.49 ? 174  GLN B C     1 
ATOM   3555 O  O     . GLN B 2 135 ? 48.849  29.135  51.541  1.00 35.32 ? 174  GLN B O     1 
ATOM   3556 C  CB    . GLN B 2 135 ? 48.496  27.943  48.610  1.00 35.23 ? 174  GLN B CB    1 
ATOM   3557 C  CG    . GLN B 2 135 ? 49.222  27.159  47.526  1.00 35.32 ? 174  GLN B CG    1 
ATOM   3558 N  N     . SER B 2 136 ? 46.803  28.177  51.460  1.00 36.01 ? 175  SER B N     1 
ATOM   3559 C  CA    . SER B 2 136 ? 46.146  29.078  52.434  1.00 36.39 ? 175  SER B CA    1 
ATOM   3560 C  C     . SER B 2 136 ? 46.926  29.295  53.747  1.00 37.16 ? 175  SER B C     1 
ATOM   3561 O  O     . SER B 2 136 ? 47.565  28.375  54.263  1.00 36.64 ? 175  SER B O     1 
ATOM   3562 C  CB    . SER B 2 136 ? 44.733  28.552  52.751  1.00 36.51 ? 175  SER B CB    1 
ATOM   3563 O  OG    . SER B 2 136 ? 44.792  27.354  53.514  1.00 35.64 ? 175  SER B OG    1 
ATOM   3564 N  N     . GLN B 2 137 ? 46.838  30.524  54.268  1.00 37.90 ? 176  GLN B N     1 
ATOM   3565 C  CA    . GLN B 2 137 ? 47.632  31.034  55.385  1.00 39.04 ? 176  GLN B CA    1 
ATOM   3566 C  C     . GLN B 2 137 ? 49.099  31.200  54.940  1.00 38.85 ? 176  GLN B C     1 
ATOM   3567 O  O     . GLN B 2 137 ? 50.011  31.378  55.747  1.00 39.71 ? 176  GLN B O     1 
ATOM   3568 C  CB    . GLN B 2 137 ? 47.491  30.176  56.662  1.00 39.31 ? 176  GLN B CB    1 
ATOM   3569 C  CG    . GLN B 2 137 ? 46.229  30.462  57.497  1.00 40.02 ? 176  GLN B CG    1 
ATOM   3570 C  CD    . GLN B 2 137 ? 46.420  30.027  58.968  1.00 39.30 ? 176  GLN B CD    1 
ATOM   3571 O  OE1   . GLN B 2 137 ? 46.546  30.933  59.886  1.00 40.68 ? 176  GLN B OE1   1 
ATOM   3572 N  NE2   . GLN B 2 137 ? 46.447  28.663  59.199  1.00 40.09 ? 176  GLN B NE2   1 
ATOM   3573 N  N     . ALA C 1 30  ? 31.060  48.117  -21.030 1.00 43.35 ? 31   ALA C N     1 
ATOM   3574 C  CA    . ALA C 1 30  ? 30.316  48.117  -19.740 1.00 43.65 ? 31   ALA C CA    1 
ATOM   3575 C  C     . ALA C 1 30  ? 30.924  47.108  -18.760 1.00 43.35 ? 31   ALA C C     1 
ATOM   3576 O  O     . ALA C 1 30  ? 30.889  45.881  -19.009 1.00 43.02 ? 31   ALA C O     1 
ATOM   3577 C  CB    . ALA C 1 30  ? 28.838  47.802  -19.971 1.00 43.82 ? 31   ALA C CB    1 
ATOM   3578 N  N     . LYS C 1 31  ? 31.460  47.616  -17.638 1.00 43.28 ? 32   LYS C N     1 
ATOM   3579 C  CA    . LYS C 1 31  ? 32.043  46.740  -16.610 1.00 42.74 ? 32   LYS C CA    1 
ATOM   3580 C  C     . LYS C 1 31  ? 30.931  46.252  -15.719 1.00 41.97 ? 32   LYS C C     1 
ATOM   3581 O  O     . LYS C 1 31  ? 30.081  47.039  -15.306 1.00 42.27 ? 32   LYS C O     1 
ATOM   3582 C  CB    . LYS C 1 31  ? 33.094  47.473  -15.773 1.00 42.82 ? 32   LYS C CB    1 
ATOM   3583 C  CG    . LYS C 1 31  ? 34.287  46.597  -15.386 1.00 43.64 ? 32   LYS C CG    1 
ATOM   3584 N  N     . GLU C 1 32  ? 30.933  44.963  -15.401 1.00 41.13 ? 33   GLU C N     1 
ATOM   3585 C  CA    . GLU C 1 32  ? 29.884  44.398  -14.551 1.00 40.12 ? 33   GLU C CA    1 
ATOM   3586 C  C     . GLU C 1 32  ? 30.256  44.454  -13.082 1.00 39.28 ? 33   GLU C C     1 
ATOM   3587 O  O     . GLU C 1 32  ? 31.395  44.184  -12.710 1.00 38.54 ? 33   GLU C O     1 
ATOM   3588 C  CB    . GLU C 1 32  ? 29.570  42.951  -14.930 1.00 40.65 ? 33   GLU C CB    1 
ATOM   3589 C  CG    . GLU C 1 32  ? 28.882  42.802  -16.276 1.00 41.40 ? 33   GLU C CG    1 
ATOM   3590 C  CD    . GLU C 1 32  ? 28.495  41.369  -16.588 1.00 41.44 ? 33   GLU C CD    1 
ATOM   3591 O  OE1   . GLU C 1 32  ? 28.063  40.632  -15.673 1.00 43.15 ? 33   GLU C OE1   1 
ATOM   3592 O  OE2   . GLU C 1 32  ? 28.639  40.987  -17.761 1.00 44.53 ? 33   GLU C OE2   1 
ATOM   3593 N  N     . VAL C 1 33  ? 29.258  44.792  -12.261 1.00 37.65 ? 34   VAL C N     1 
ATOM   3594 C  CA    . VAL C 1 33  ? 29.395  44.885  -10.819 1.00 37.24 ? 34   VAL C CA    1 
ATOM   3595 C  C     . VAL C 1 33  ? 28.312  43.988  -10.223 1.00 36.38 ? 34   VAL C C     1 
ATOM   3596 O  O     . VAL C 1 33  ? 27.150  44.088  -10.634 1.00 36.19 ? 34   VAL C O     1 
ATOM   3597 C  CB    . VAL C 1 33  ? 29.201  46.364  -10.318 1.00 36.59 ? 34   VAL C CB    1 
ATOM   3598 C  CG1   . VAL C 1 33  ? 28.957  46.417  -8.816  1.00 37.43 ? 34   VAL C CG1   1 
ATOM   3599 C  CG2   . VAL C 1 33  ? 30.419  47.235  -10.697 1.00 38.14 ? 34   VAL C CG2   1 
ATOM   3600 N  N     . LYS C 1 34  ? 28.693  43.127  -9.269  1.00 35.84 ? 35   LYS C N     1 
ATOM   3601 C  CA    . LYS C 1 34  ? 27.702  42.374  -8.455  1.00 34.86 ? 35   LYS C CA    1 
ATOM   3602 C  C     . LYS C 1 34  ? 27.474  43.038  -7.098  1.00 34.48 ? 35   LYS C C     1 
ATOM   3603 O  O     . LYS C 1 34  ? 28.385  43.107  -6.247  1.00 33.48 ? 35   LYS C O     1 
ATOM   3604 C  CB    . LYS C 1 34  ? 28.144  40.916  -8.264  1.00 34.92 ? 35   LYS C CB    1 
ATOM   3605 C  CG    . LYS C 1 34  ? 27.144  40.056  -7.500  1.00 34.53 ? 35   LYS C CG    1 
ATOM   3606 C  CD    . LYS C 1 34  ? 27.483  38.563  -7.578  1.00 34.39 ? 35   LYS C CD    1 
ATOM   3607 C  CE    . LYS C 1 34  ? 26.500  37.699  -6.778  1.00 34.40 ? 35   LYS C CE    1 
ATOM   3608 N  NZ    . LYS C 1 34  ? 26.880  36.235  -6.801  1.00 33.28 ? 35   LYS C NZ    1 
ATOM   3609 N  N     . LEU C 1 35  ? 26.240  43.508  -6.893  1.00 34.15 ? 36   LEU C N     1 
ATOM   3610 C  CA    . LEU C 1 35  ? 25.857  44.306  -5.734  1.00 33.83 ? 36   LEU C CA    1 
ATOM   3611 C  C     . LEU C 1 35  ? 24.801  43.565  -4.896  1.00 33.84 ? 36   LEU C C     1 
ATOM   3612 O  O     . LEU C 1 35  ? 23.721  43.278  -5.404  1.00 33.12 ? 36   LEU C O     1 
ATOM   3613 C  CB    . LEU C 1 35  ? 25.251  45.624  -6.224  1.00 34.02 ? 36   LEU C CB    1 
ATOM   3614 C  CG    . LEU C 1 35  ? 24.541  46.515  -5.215  1.00 33.42 ? 36   LEU C CG    1 
ATOM   3615 C  CD1   . LEU C 1 35  ? 25.521  46.922  -4.152  1.00 34.17 ? 36   LEU C CD1   1 
ATOM   3616 C  CD2   . LEU C 1 35  ? 23.933  47.711  -5.895  1.00 34.06 ? 36   LEU C CD2   1 
ATOM   3617 N  N     . LEU C 1 36  ? 25.116  43.260  -3.632  1.00 33.88 ? 37   LEU C N     1 
ATOM   3618 C  CA    . LEU C 1 36  ? 24.116  42.736  -2.688  1.00 33.55 ? 37   LEU C CA    1 
ATOM   3619 C  C     . LEU C 1 36  ? 23.558  43.838  -1.816  1.00 33.74 ? 37   LEU C C     1 
ATOM   3620 O  O     . LEU C 1 36  ? 24.297  44.644  -1.250  1.00 32.21 ? 37   LEU C O     1 
ATOM   3621 C  CB    . LEU C 1 36  ? 24.689  41.645  -1.744  1.00 34.18 ? 37   LEU C CB    1 
ATOM   3622 C  CG    . LEU C 1 36  ? 25.501  40.486  -2.304  1.00 32.70 ? 37   LEU C CG    1 
ATOM   3623 C  CD1   . LEU C 1 36  ? 25.809  39.491  -1.234  1.00 29.37 ? 37   LEU C CD1   1 
ATOM   3624 C  CD2   . LEU C 1 36  ? 24.751  39.850  -3.464  1.00 35.83 ? 37   LEU C CD2   1 
ATOM   3625 N  N     . LEU C 1 37  ? 22.239  43.824  -1.699  1.00 34.48 ? 38   LEU C N     1 
ATOM   3626 C  CA    . LEU C 1 37  ? 21.499  44.575  -0.678  1.00 34.89 ? 38   LEU C CA    1 
ATOM   3627 C  C     . LEU C 1 37  ? 21.200  43.633  0.471   1.00 34.43 ? 38   LEU C C     1 
ATOM   3628 O  O     . LEU C 1 37  ? 20.394  42.713  0.337   1.00 34.80 ? 38   LEU C O     1 
ATOM   3629 C  CB    . LEU C 1 37  ? 20.198  45.135  -1.256  1.00 35.17 ? 38   LEU C CB    1 
ATOM   3630 C  CG    . LEU C 1 37  ? 20.262  46.481  -1.992  1.00 38.69 ? 38   LEU C CG    1 
ATOM   3631 C  CD1   . LEU C 1 37  ? 21.540  46.756  -2.748  1.00 39.23 ? 38   LEU C CD1   1 
ATOM   3632 C  CD2   . LEU C 1 37  ? 19.052  46.608  -2.909  1.00 42.57 ? 38   LEU C CD2   1 
ATOM   3633 N  N     . LEU C 1 38  ? 21.884  43.861  1.591   1.00 33.72 ? 39   LEU C N     1 
ATOM   3634 C  CA    . LEU C 1 38  ? 21.754  43.049  2.786   1.00 33.37 ? 39   LEU C CA    1 
ATOM   3635 C  C     . LEU C 1 38  ? 21.324  43.902  3.982   1.00 33.52 ? 39   LEU C C     1 
ATOM   3636 O  O     . LEU C 1 38  ? 21.416  45.149  3.985   1.00 34.27 ? 39   LEU C O     1 
ATOM   3637 C  CB    . LEU C 1 38  ? 23.093  42.320  3.057   1.00 32.57 ? 39   LEU C CB    1 
ATOM   3638 C  CG    . LEU C 1 38  ? 23.606  41.411  1.925   1.00 32.15 ? 39   LEU C CG    1 
ATOM   3639 C  CD1   . LEU C 1 38  ? 24.943  40.818  2.342   1.00 33.75 ? 39   LEU C CD1   1 
ATOM   3640 C  CD2   . LEU C 1 38  ? 22.626  40.276  1.528   1.00 30.62 ? 39   LEU C CD2   1 
ATOM   3641 N  N     . GLY C 1 39  ? 20.853  43.217  5.010   1.00 34.17 ? 40   GLY C N     1 
ATOM   3642 C  CA    . GLY C 1 39  ? 20.371  43.874  6.197   1.00 34.21 ? 40   GLY C CA    1 
ATOM   3643 C  C     . GLY C 1 39  ? 19.201  43.108  6.781   1.00 34.26 ? 40   GLY C C     1 
ATOM   3644 O  O     . GLY C 1 39  ? 18.561  42.266  6.114   1.00 34.75 ? 40   GLY C O     1 
ATOM   3645 N  N     . ALA C 1 40  ? 18.932  43.411  8.046   1.00 34.17 ? 41   ALA C N     1 
ATOM   3646 C  CA    . ALA C 1 40  ? 17.850  42.797  8.774   1.00 33.85 ? 41   ALA C CA    1 
ATOM   3647 C  C     . ALA C 1 40  ? 16.493  43.194  8.156   1.00 33.31 ? 41   ALA C C     1 
ATOM   3648 O  O     . ALA C 1 40  ? 16.379  44.099  7.311   1.00 32.68 ? 41   ALA C O     1 
ATOM   3649 C  CB    . ALA C 1 40  ? 17.932  43.179  10.318  1.00 33.63 ? 41   ALA C CB    1 
ATOM   3650 N  N     . GLY C 1 41  ? 15.452  42.473  8.552   1.00 33.32 ? 42   GLY C N     1 
ATOM   3651 C  CA    . GLY C 1 41  ? 14.111  42.803  8.115   1.00 33.95 ? 42   GLY C CA    1 
ATOM   3652 C  C     . GLY C 1 41  ? 13.717  44.254  8.343   1.00 34.54 ? 42   GLY C C     1 
ATOM   3653 O  O     . GLY C 1 41  ? 14.063  44.846  9.379   1.00 33.72 ? 42   GLY C O     1 
ATOM   3654 N  N     . GLU C 1 42  ? 13.045  44.793  7.322   1.00 33.69 ? 43   GLU C N     1 
ATOM   3655 C  CA    A GLU C 1 42  ? 12.471  46.136  7.323   0.50 34.44 ? 43   GLU C CA    1 
ATOM   3656 C  CA    B GLU C 1 42  ? 12.478  46.139  7.322   0.50 34.40 ? 43   GLU C CA    1 
ATOM   3657 C  C     . GLU C 1 42  ? 13.528  47.235  7.357   1.00 34.43 ? 43   GLU C C     1 
ATOM   3658 O  O     . GLU C 1 42  ? 13.213  48.374  7.636   1.00 35.23 ? 43   GLU C O     1 
ATOM   3659 C  CB    A GLU C 1 42  ? 11.435  46.305  8.469   0.50 34.07 ? 43   GLU C CB    1 
ATOM   3660 C  CB    B GLU C 1 42  ? 11.497  46.322  8.496   0.50 34.23 ? 43   GLU C CB    1 
ATOM   3661 C  CG    A GLU C 1 42  ? 10.140  45.570  8.169   0.50 34.19 ? 43   GLU C CG    1 
ATOM   3662 C  CG    B GLU C 1 42  ? 10.336  45.367  8.435   0.50 34.99 ? 43   GLU C CG    1 
ATOM   3663 C  CD    A GLU C 1 42  ? 9.058   45.720  9.239   0.50 35.51 ? 43   GLU C CD    1 
ATOM   3664 C  CD    B GLU C 1 42  ? 9.596   45.272  9.750   0.50 37.31 ? 43   GLU C CD    1 
ATOM   3665 O  OE1   A GLU C 1 42  ? 9.373   45.487  10.424  0.50 39.37 ? 43   GLU C OE1   1 
ATOM   3666 O  OE1   B GLU C 1 42  ? 9.157   44.152  10.089  0.50 40.10 ? 43   GLU C OE1   1 
ATOM   3667 O  OE2   A GLU C 1 42  ? 7.905   46.075  8.900   0.50 34.50 ? 43   GLU C OE2   1 
ATOM   3668 O  OE2   B GLU C 1 42  ? 9.472   46.323  10.449  0.50 35.77 ? 43   GLU C OE2   1 
ATOM   3669 N  N     . SER C 1 43  ? 14.782  46.909  7.030   1.00 34.42 ? 44   SER C N     1 
ATOM   3670 C  CA    . SER C 1 43  ? 15.844  47.937  7.096   1.00 34.23 ? 44   SER C CA    1 
ATOM   3671 C  C     . SER C 1 43  ? 15.804  48.967  5.940   1.00 33.48 ? 44   SER C C     1 
ATOM   3672 O  O     . SER C 1 43  ? 16.388  50.057  6.040   1.00 33.62 ? 44   SER C O     1 
ATOM   3673 C  CB    . SER C 1 43  ? 17.230  47.305  7.224   1.00 34.61 ? 44   SER C CB    1 
ATOM   3674 O  OG    . SER C 1 43  ? 17.532  46.345  6.225   1.00 37.57 ? 44   SER C OG    1 
ATOM   3675 N  N     . GLY C 1 44  ? 15.117  48.638  4.854   1.00 33.48 ? 45   GLY C N     1 
ATOM   3676 C  CA    . GLY C 1 44  ? 14.999  49.538  3.711   1.00 33.62 ? 45   GLY C CA    1 
ATOM   3677 C  C     . GLY C 1 44  ? 15.571  49.058  2.380   1.00 32.72 ? 45   GLY C C     1 
ATOM   3678 O  O     . GLY C 1 44  ? 15.579  49.819  1.412   1.00 32.33 ? 45   GLY C O     1 
ATOM   3679 N  N     . LYS C 1 45  ? 15.990  47.793  2.323   1.00 32.95 ? 46   LYS C N     1 
ATOM   3680 C  CA    . LYS C 1 45  ? 16.652  47.201  1.142   1.00 32.58 ? 46   LYS C CA    1 
ATOM   3681 C  C     . LYS C 1 45  ? 15.782  47.315  -0.122  1.00 32.34 ? 46   LYS C C     1 
ATOM   3682 O  O     . LYS C 1 45  ? 16.227  47.832  -1.139  1.00 33.07 ? 46   LYS C O     1 
ATOM   3683 C  CB    . LYS C 1 45  ? 16.976  45.731  1.405   1.00 32.03 ? 46   LYS C CB    1 
ATOM   3684 C  CG    . LYS C 1 45  ? 17.904  45.456  2.575   1.00 33.30 ? 46   LYS C CG    1 
ATOM   3685 C  CD    . LYS C 1 45  ? 18.155  43.922  2.778   1.00 32.59 ? 46   LYS C CD    1 
ATOM   3686 C  CE    . LYS C 1 45  ? 16.912  43.151  3.178   1.00 32.46 ? 46   LYS C CE    1 
ATOM   3687 N  NZ    . LYS C 1 45  ? 16.354  43.565  4.501   1.00 32.03 ? 46   LYS C NZ    1 
ATOM   3688 N  N     . SER C 1 46  ? 14.504  46.934  -0.039  1.00 32.30 ? 47   SER C N     1 
ATOM   3689 C  CA    . SER C 1 46  ? 13.619  46.947  -1.203  1.00 31.44 ? 47   SER C CA    1 
ATOM   3690 C  C     . SER C 1 46  ? 13.240  48.351  -1.633  1.00 31.57 ? 47   SER C C     1 
ATOM   3691 O  O     . SER C 1 46  ? 12.903  48.568  -2.812  1.00 31.32 ? 47   SER C O     1 
ATOM   3692 C  CB    . SER C 1 46  ? 12.355  46.128  -0.959  1.00 31.23 ? 47   SER C CB    1 
ATOM   3693 O  OG    . SER C 1 46  ? 12.667  44.770  -0.746  1.00 30.75 ? 47   SER C OG    1 
ATOM   3694 N  N     . THR C 1 47  ? 13.337  49.291  -0.695  1.00 32.01 ? 48   THR C N     1 
ATOM   3695 C  CA    . THR C 1 47  ? 13.039  50.703  -0.974  1.00 32.41 ? 48   THR C CA    1 
ATOM   3696 C  C     . THR C 1 47  ? 14.208  51.301  -1.802  1.00 32.48 ? 48   THR C C     1 
ATOM   3697 O  O     . THR C 1 47  ? 13.974  52.002  -2.762  1.00 31.57 ? 48   THR C O     1 
ATOM   3698 C  CB    . THR C 1 47  ? 12.755  51.477  0.298   1.00 32.01 ? 48   THR C CB    1 
ATOM   3699 O  OG1   . THR C 1 47  ? 11.710  50.792  1.016   1.00 34.07 ? 48   THR C OG1   1 
ATOM   3700 C  CG2   . THR C 1 47  ? 12.292  52.924  -0.039  1.00 31.51 ? 48   THR C CG2   1 
ATOM   3701 N  N     . ILE C 1 48  ? 15.447  50.965  -1.427  1.00 32.62 ? 49   ILE C N     1 
ATOM   3702 C  CA    . ILE C 1 48  ? 16.607  51.309  -2.215  1.00 32.48 ? 49   ILE C CA    1 
ATOM   3703 C  C     . ILE C 1 48  ? 16.486  50.753  -3.629  1.00 32.65 ? 49   ILE C C     1 
ATOM   3704 O  O     . ILE C 1 48  ? 16.889  51.421  -4.588  1.00 33.36 ? 49   ILE C O     1 
ATOM   3705 C  CB    . ILE C 1 48  ? 17.925  50.859  -1.558  1.00 33.03 ? 49   ILE C CB    1 
ATOM   3706 C  CG1   . ILE C 1 48  ? 18.173  51.635  -0.251  1.00 33.71 ? 49   ILE C CG1   1 
ATOM   3707 C  CG2   . ILE C 1 48  ? 19.113  51.023  -2.598  1.00 33.43 ? 49   ILE C CG2   1 
ATOM   3708 C  CD1   . ILE C 1 48  ? 18.306  53.174  -0.437  1.00 32.16 ? 49   ILE C CD1   1 
ATOM   3709 N  N     . VAL C 1 49  ? 15.939  49.534  -3.757  1.00 32.45 ? 50   VAL C N     1 
ATOM   3710 C  CA    . VAL C 1 49  ? 15.692  48.898  -5.053  1.00 32.31 ? 50   VAL C CA    1 
ATOM   3711 C  C     . VAL C 1 49  ? 14.686  49.669  -5.899  1.00 32.50 ? 50   VAL C C     1 
ATOM   3712 O  O     . VAL C 1 49  ? 14.943  49.953  -7.100  1.00 31.06 ? 50   VAL C O     1 
ATOM   3713 C  CB    . VAL C 1 49  ? 15.266  47.402  -4.922  1.00 32.54 ? 50   VAL C CB    1 
ATOM   3714 C  CG1   . VAL C 1 49  ? 14.944  46.817  -6.302  1.00 33.32 ? 50   VAL C CG1   1 
ATOM   3715 C  CG2   . VAL C 1 49  ? 16.388  46.625  -4.277  1.00 32.88 ? 50   VAL C CG2   1 
ATOM   3716 N  N     . LYS C 1 50  ? 13.571  50.046  -5.286  1.00 32.06 ? 51   LYS C N     1 
ATOM   3717 C  CA    . LYS C 1 50  ? 12.604  50.929  -5.958  1.00 32.45 ? 51   LYS C CA    1 
ATOM   3718 C  C     . LYS C 1 50  ? 13.239  52.244  -6.448  1.00 32.39 ? 51   LYS C C     1 
ATOM   3719 O  O     . LYS C 1 50  ? 12.890  52.735  -7.521  1.00 31.11 ? 51   LYS C O     1 
ATOM   3720 C  CB    . LYS C 1 50  ? 11.457  51.292  -5.038  1.00 32.97 ? 51   LYS C CB    1 
ATOM   3721 C  CG    . LYS C 1 50  ? 10.517  50.175  -4.656  1.00 34.14 ? 51   LYS C CG    1 
ATOM   3722 C  CD    . LYS C 1 50  ? 9.304   50.804  -3.951  1.00 34.74 ? 51   LYS C CD    1 
ATOM   3723 C  CE    . LYS C 1 50  ? 8.254   49.773  -3.654  1.00 35.53 ? 51   LYS C CE    1 
ATOM   3724 N  NZ    . LYS C 1 50  ? 8.790   48.796  -2.689  1.00 31.38 ? 51   LYS C NZ    1 
ATOM   3725 N  N     . GLN C 1 51  ? 14.159  52.810  -5.653  1.00 32.44 ? 52   GLN C N     1 
ATOM   3726 C  CA    . GLN C 1 51  ? 14.839  54.048  -6.018  1.00 32.34 ? 52   GLN C CA    1 
ATOM   3727 C  C     . GLN C 1 51  ? 15.808  53.866  -7.204  1.00 32.74 ? 52   GLN C C     1 
ATOM   3728 O  O     . GLN C 1 51  ? 15.913  54.750  -8.018  1.00 31.99 ? 52   GLN C O     1 
ATOM   3729 C  CB    . GLN C 1 51  ? 15.553  54.669  -4.808  1.00 33.54 ? 52   GLN C CB    1 
ATOM   3730 C  CG    . GLN C 1 51  ? 14.617  55.135  -3.677  1.00 34.08 ? 52   GLN C CG    1 
ATOM   3731 C  CD    . GLN C 1 51  ? 13.866  56.433  -3.973  1.00 35.63 ? 52   GLN C CD    1 
ATOM   3732 O  OE1   . GLN C 1 51  ? 13.612  56.789  -5.134  1.00 33.15 ? 52   GLN C OE1   1 
ATOM   3733 N  NE2   . GLN C 1 51  ? 13.491  57.145  -2.901  1.00 35.13 ? 52   GLN C NE2   1 
ATOM   3734 N  N     . MET C 1 52  ? 16.485  52.723  -7.312  1.00 32.82 ? 53   MET C N     1 
ATOM   3735 C  CA    . MET C 1 52  ? 17.328  52.442  -8.491  1.00 32.61 ? 53   MET C CA    1 
ATOM   3736 C  C     . MET C 1 52  ? 16.456  52.423  -9.748  1.00 32.03 ? 53   MET C C     1 
ATOM   3737 O  O     . MET C 1 52  ? 16.861  52.937  -10.801 1.00 33.48 ? 53   MET C O     1 
ATOM   3738 C  CB    . MET C 1 52  ? 18.061  51.124  -8.323  1.00 32.43 ? 53   MET C CB    1 
ATOM   3739 C  CG    . MET C 1 52  ? 19.065  51.127  -7.138  1.00 34.12 ? 53   MET C CG    1 
ATOM   3740 S  SD    . MET C 1 52  ? 20.349  52.401  -7.255  1.00 33.95 ? 53   MET C SD    1 
ATOM   3741 C  CE    . MET C 1 52  ? 19.678  53.746  -6.243  1.00 34.80 ? 53   MET C CE    1 
ATOM   3742 N  N     . LYS C 1 53  ? 15.248  51.879  -9.628  1.00 31.45 ? 54   LYS C N     1 
ATOM   3743 C  CA    . LYS C 1 53  ? 14.275  51.903  -10.711 1.00 32.20 ? 54   LYS C CA    1 
ATOM   3744 C  C     . LYS C 1 53  ? 13.859  53.311  -11.110 1.00 32.18 ? 54   LYS C C     1 
ATOM   3745 O  O     . LYS C 1 53  ? 13.906  53.649  -12.289 1.00 31.47 ? 54   LYS C O     1 
ATOM   3746 C  CB    . LYS C 1 53  ? 13.063  51.043  -10.377 1.00 32.37 ? 54   LYS C CB    1 
ATOM   3747 C  CG    . LYS C 1 53  ? 11.901  51.166  -11.356 1.00 33.67 ? 54   LYS C CG    1 
ATOM   3748 C  CD    . LYS C 1 53  ? 10.896  50.060  -11.068 1.00 36.15 ? 54   LYS C CD    1 
ATOM   3749 C  CE    . LYS C 1 53  ? 9.517   50.382  -11.615 1.00 37.89 ? 54   LYS C CE    1 
ATOM   3750 N  NZ    . LYS C 1 53  ? 9.443   50.242  -13.078 1.00 38.48 ? 54   LYS C NZ    1 
ATOM   3751 N  N     . ILE C 1 54  ? 13.502  54.134  -10.130 1.00 32.02 ? 55   ILE C N     1 
ATOM   3752 C  CA    . ILE C 1 54  ? 13.138  55.547  -10.371 1.00 32.70 ? 55   ILE C CA    1 
ATOM   3753 C  C     . ILE C 1 54  ? 14.298  56.334  -10.969 1.00 32.52 ? 55   ILE C C     1 
ATOM   3754 O  O     . ILE C 1 54  ? 14.111  57.028  -11.947 1.00 32.28 ? 55   ILE C O     1 
ATOM   3755 C  CB    . ILE C 1 54  ? 12.706  56.272  -9.059  1.00 33.21 ? 55   ILE C CB    1 
ATOM   3756 C  CG1   . ILE C 1 54  ? 11.379  55.710  -8.532  1.00 33.95 ? 55   ILE C CG1   1 
ATOM   3757 C  CG2   . ILE C 1 54  ? 12.615  57.820  -9.274  1.00 32.76 ? 55   ILE C CG2   1 
ATOM   3758 C  CD1   . ILE C 1 54  ? 11.122  56.002  -7.026  1.00 32.62 ? 55   ILE C CD1   1 
ATOM   3759 N  N     . ILE C 1 55  ? 15.484  56.196  -10.368 1.00 32.92 ? 56   ILE C N     1 
ATOM   3760 C  CA    . ILE C 1 55  ? 16.667  56.996  -10.711 1.00 33.54 ? 56   ILE C CA    1 
ATOM   3761 C  C     . ILE C 1 55  ? 17.459  56.492  -11.919 1.00 34.58 ? 56   ILE C C     1 
ATOM   3762 O  O     . ILE C 1 55  ? 17.901  57.306  -12.758 1.00 34.14 ? 56   ILE C O     1 
ATOM   3763 C  CB    . ILE C 1 55  ? 17.651  57.090  -9.518  1.00 33.26 ? 56   ILE C CB    1 
ATOM   3764 C  CG1   . ILE C 1 55  ? 16.970  57.714  -8.288  1.00 32.68 ? 56   ILE C CG1   1 
ATOM   3765 C  CG2   . ILE C 1 55  ? 18.899  57.893  -9.904  1.00 33.24 ? 56   ILE C CG2   1 
ATOM   3766 C  CD1   . ILE C 1 55  ? 17.579  57.270  -6.974  1.00 31.54 ? 56   ILE C CD1   1 
ATOM   3767 N  N     . HIS C 1 56  ? 17.604  55.186  -12.039 1.00 35.45 ? 57   HIS C N     1 
ATOM   3768 C  CA    . HIS C 1 56  ? 18.497  54.625  -12.999 1.00 36.59 ? 57   HIS C CA    1 
ATOM   3769 C  C     . HIS C 1 56  ? 17.851  53.639  -13.968 1.00 37.07 ? 57   HIS C C     1 
ATOM   3770 O  O     . HIS C 1 56  ? 18.526  53.070  -14.756 1.00 36.77 ? 57   HIS C O     1 
ATOM   3771 C  CB    . HIS C 1 56  ? 19.633  53.927  -12.294 1.00 37.28 ? 57   HIS C CB    1 
ATOM   3772 C  CG    . HIS C 1 56  ? 20.530  54.826  -11.510 1.00 37.94 ? 57   HIS C CG    1 
ATOM   3773 N  ND1   . HIS C 1 56  ? 21.211  55.872  -12.071 1.00 41.07 ? 57   HIS C ND1   1 
ATOM   3774 C  CD2   . HIS C 1 56  ? 20.883  54.805  -10.205 1.00 37.25 ? 57   HIS C CD2   1 
ATOM   3775 C  CE1   . HIS C 1 56  ? 21.934  56.467  -11.146 1.00 40.12 ? 57   HIS C CE1   1 
ATOM   3776 N  NE2   . HIS C 1 56  ? 21.749  55.843  -10.003 1.00 39.71 ? 57   HIS C NE2   1 
ATOM   3777 N  N     . GLU C 1 57  ? 16.563  53.399  -13.871 1.00 37.75 ? 58   GLU C N     1 
ATOM   3778 C  CA    . GLU C 1 57  ? 15.843  52.521  -14.801 1.00 39.22 ? 58   GLU C CA    1 
ATOM   3779 C  C     . GLU C 1 57  ? 14.649  53.307  -15.307 1.00 39.81 ? 58   GLU C C     1 
ATOM   3780 O  O     . GLU C 1 57  ? 14.763  54.518  -15.508 1.00 40.55 ? 58   GLU C O     1 
ATOM   3781 C  CB    . GLU C 1 57  ? 15.422  51.188  -14.166 1.00 38.91 ? 58   GLU C CB    1 
ATOM   3782 C  CG    . GLU C 1 57  ? 16.535  50.410  -13.439 1.00 39.86 ? 58   GLU C CG    1 
ATOM   3783 C  CD    . GLU C 1 57  ? 15.992  49.337  -12.489 1.00 41.50 ? 58   GLU C CD    1 
ATOM   3784 O  OE1   . GLU C 1 57  ? 14.775  49.057  -12.535 1.00 45.44 ? 58   GLU C OE1   1 
ATOM   3785 O  OE2   . GLU C 1 57  ? 16.770  48.782  -11.683 1.00 45.29 ? 58   GLU C OE2   1 
ATOM   3786 N  N     . ASP C 1 58  ? 13.511  52.648  -15.508 1.00 40.31 ? 59   ASP C N     1 
ATOM   3787 C  CA    . ASP C 1 58  ? 12.420  53.251  -16.268 1.00 41.05 ? 59   ASP C CA    1 
ATOM   3788 C  C     . ASP C 1 58  ? 11.334  53.938  -15.426 1.00 41.17 ? 59   ASP C C     1 
ATOM   3789 O  O     . ASP C 1 58  ? 10.368  54.471  -15.979 1.00 41.51 ? 59   ASP C O     1 
ATOM   3790 C  CB    . ASP C 1 58  ? 11.827  52.192  -17.201 1.00 41.52 ? 59   ASP C CB    1 
ATOM   3791 C  CG    . ASP C 1 58  ? 12.832  51.737  -18.275 1.00 42.42 ? 59   ASP C CG    1 
ATOM   3792 O  OD1   . ASP C 1 58  ? 13.132  50.514  -18.344 1.00 44.21 ? 59   ASP C OD1   1 
ATOM   3793 O  OD2   . ASP C 1 58  ? 13.352  52.609  -19.015 1.00 42.40 ? 59   ASP C OD2   1 
ATOM   3794 N  N     . GLY C 1 59  ? 11.500  53.952  -14.101 1.00 40.90 ? 60   GLY C N     1 
ATOM   3795 C  CA    . GLY C 1 59  ? 10.571  54.656  -13.223 1.00 40.78 ? 60   GLY C CA    1 
ATOM   3796 C  C     . GLY C 1 59  ? 9.240   53.953  -13.024 1.00 40.49 ? 60   GLY C C     1 
ATOM   3797 O  O     . GLY C 1 59  ? 9.064   52.816  -13.469 1.00 40.87 ? 60   GLY C O     1 
ATOM   3798 N  N     . TYR C 1 60  ? 8.311   54.623  -12.337 1.00 39.91 ? 61   TYR C N     1 
ATOM   3799 C  CA    . TYR C 1 60  ? 6.944   54.110  -12.170 1.00 39.51 ? 61   TYR C CA    1 
ATOM   3800 C  C     . TYR C 1 60  ? 5.968   54.838  -13.092 1.00 39.17 ? 61   TYR C C     1 
ATOM   3801 O  O     . TYR C 1 60  ? 5.858   56.076  -13.071 1.00 39.58 ? 61   TYR C O     1 
ATOM   3802 C  CB    . TYR C 1 60  ? 6.498   54.182  -10.695 1.00 39.77 ? 61   TYR C CB    1 
ATOM   3803 C  CG    . TYR C 1 60  ? 7.223   53.171  -9.822  1.00 40.09 ? 61   TYR C CG    1 
ATOM   3804 C  CD1   . TYR C 1 60  ? 6.676   51.908  -9.586  1.00 39.94 ? 61   TYR C CD1   1 
ATOM   3805 C  CD2   . TYR C 1 60  ? 8.476   53.452  -9.293  1.00 39.08 ? 61   TYR C CD2   1 
ATOM   3806 C  CE1   . TYR C 1 60  ? 7.342   50.972  -8.829  1.00 40.19 ? 61   TYR C CE1   1 
ATOM   3807 C  CE2   . TYR C 1 60  ? 9.163   52.502  -8.524  1.00 39.62 ? 61   TYR C CE2   1 
ATOM   3808 C  CZ    . TYR C 1 60  ? 8.586   51.273  -8.297  1.00 38.94 ? 61   TYR C CZ    1 
ATOM   3809 O  OH    . TYR C 1 60  ? 9.252   50.333  -7.549  1.00 41.01 ? 61   TYR C OH    1 
ATOM   3810 N  N     . SER C 1 61  ? 5.290   54.065  -13.939 1.00 38.51 ? 62   SER C N     1 
ATOM   3811 C  CA    . SER C 1 61  ? 4.249   54.595  -14.818 1.00 37.66 ? 62   SER C CA    1 
ATOM   3812 C  C     . SER C 1 61  ? 2.994   54.880  -13.992 1.00 37.75 ? 62   SER C C     1 
ATOM   3813 O  O     . SER C 1 61  ? 2.969   54.601  -12.798 1.00 37.60 ? 62   SER C O     1 
ATOM   3814 C  CB    . SER C 1 61  ? 3.932   53.600  -15.945 1.00 37.39 ? 62   SER C CB    1 
ATOM   3815 O  OG    . SER C 1 61  ? 3.537   52.340  -15.437 1.00 35.29 ? 62   SER C OG    1 
ATOM   3816 N  N     . GLU C 1 62  ? 1.969   55.441  -14.627 1.00 38.09 ? 63   GLU C N     1 
ATOM   3817 C  CA    . GLU C 1 62  ? 0.658   55.574  -13.995 1.00 38.79 ? 63   GLU C CA    1 
ATOM   3818 C  C     . GLU C 1 62  ? 0.092   54.182  -13.671 1.00 38.62 ? 63   GLU C C     1 
ATOM   3819 O  O     . GLU C 1 62  ? -0.356  53.930  -12.559 1.00 38.76 ? 63   GLU C O     1 
ATOM   3820 C  CB    . GLU C 1 62  ? -0.304  56.347  -14.896 1.00 39.24 ? 63   GLU C CB    1 
ATOM   3821 C  CG    . GLU C 1 62  ? -1.201  57.334  -14.154 1.00 41.35 ? 63   GLU C CG    1 
ATOM   3822 C  CD    . GLU C 1 62  ? -2.435  57.701  -14.964 1.00 44.54 ? 63   GLU C CD    1 
ATOM   3823 O  OE1   . GLU C 1 62  ? -3.320  56.825  -15.123 1.00 46.50 ? 63   GLU C OE1   1 
ATOM   3824 O  OE2   . GLU C 1 62  ? -2.521  58.856  -15.457 1.00 47.23 ? 63   GLU C OE2   1 
ATOM   3825 N  N     . ASP C 1 63  ? 0.142   53.276  -14.645 1.00 38.73 ? 64   ASP C N     1 
ATOM   3826 C  CA    . ASP C 1 63  ? -0.305  51.883  -14.446 1.00 38.61 ? 64   ASP C CA    1 
ATOM   3827 C  C     . ASP C 1 63  ? 0.391   51.171  -13.283 1.00 38.47 ? 64   ASP C C     1 
ATOM   3828 O  O     . ASP C 1 63  ? -0.257  50.438  -12.516 1.00 38.25 ? 64   ASP C O     1 
ATOM   3829 C  CB    . ASP C 1 63  ? -0.103  51.065  -15.733 1.00 38.67 ? 64   ASP C CB    1 
ATOM   3830 N  N     . GLU C 1 64  ? 1.710   51.359  -13.160 1.00 38.26 ? 65   GLU C N     1 
ATOM   3831 C  CA    . GLU C 1 64  ? 2.464   50.713  -12.093 1.00 38.50 ? 65   GLU C CA    1 
ATOM   3832 C  C     . GLU C 1 64  ? 2.011   51.244  -10.720 1.00 37.70 ? 65   GLU C C     1 
ATOM   3833 O  O     . GLU C 1 64  ? 1.829   50.478  -9.786  1.00 37.43 ? 65   GLU C O     1 
ATOM   3834 C  CB    . GLU C 1 64  ? 3.973   50.898  -12.297 1.00 38.57 ? 65   GLU C CB    1 
ATOM   3835 C  CG    . GLU C 1 64  ? 4.552   50.016  -13.417 1.00 40.61 ? 65   GLU C CG    1 
ATOM   3836 C  CD    . GLU C 1 64  ? 5.940   50.454  -13.866 1.00 40.55 ? 65   GLU C CD    1 
ATOM   3837 O  OE1   . GLU C 1 64  ? 6.050   51.504  -14.537 1.00 43.40 ? 65   GLU C OE1   1 
ATOM   3838 O  OE2   . GLU C 1 64  ? 6.918   49.737  -13.571 1.00 44.14 ? 65   GLU C OE2   1 
ATOM   3839 N  N     . CYS C 1 65  ? 1.796   52.554  -10.625 1.00 37.75 ? 66   CYS C N     1 
ATOM   3840 C  CA    . CYS C 1 65  ? 1.294   53.168  -9.388  1.00 37.20 ? 66   CYS C CA    1 
ATOM   3841 C  C     . CYS C 1 65  ? -0.067  52.619  -8.991  1.00 36.90 ? 66   CYS C C     1 
ATOM   3842 O  O     . CYS C 1 65  ? -0.294  52.350  -7.823  1.00 37.36 ? 66   CYS C O     1 
ATOM   3843 C  CB    . CYS C 1 65  ? 1.243   54.685  -9.517  1.00 37.07 ? 66   CYS C CB    1 
ATOM   3844 S  SG    . CYS C 1 65  ? 2.888   55.399  -9.659  1.00 39.18 ? 66   CYS C SG    1 
ATOM   3845 N  N     . LYS C 1 66  ? -0.952  52.421  -9.963  1.00 36.55 ? 67   LYS C N     1 
ATOM   3846 C  CA    . LYS C 1 66  ? -2.306  51.892  -9.724  1.00 36.42 ? 67   LYS C CA    1 
ATOM   3847 C  C     . LYS C 1 66  ? -2.315  50.512  -9.078  1.00 36.52 ? 67   LYS C C     1 
ATOM   3848 O  O     . LYS C 1 66  ? -3.115  50.254  -8.175  1.00 36.91 ? 67   LYS C O     1 
ATOM   3849 C  CB    . LYS C 1 66  ? -3.107  51.874  -11.039 1.00 36.23 ? 67   LYS C CB    1 
ATOM   3850 C  CG    . LYS C 1 66  ? -3.444  53.253  -11.534 1.00 37.12 ? 67   LYS C CG    1 
ATOM   3851 N  N     . GLN C 1 67  ? -1.380  49.649  -9.484  1.00 36.99 ? 68   GLN C N     1 
ATOM   3852 C  CA    . GLN C 1 67  ? -1.196  48.324  -8.856  1.00 37.09 ? 68   GLN C CA    1 
ATOM   3853 C  C     . GLN C 1 67  ? -0.699  48.392  -7.402  1.00 37.12 ? 68   GLN C C     1 
ATOM   3854 O  O     . GLN C 1 67  ? -0.618  47.374  -6.720  1.00 37.30 ? 68   GLN C O     1 
ATOM   3855 C  CB    . GLN C 1 67  ? -0.205  47.477  -9.660  1.00 37.44 ? 68   GLN C CB    1 
ATOM   3856 N  N     . TYR C 1 68  ? -0.302  49.575  -6.957  1.00 37.59 ? 69   TYR C N     1 
ATOM   3857 C  CA    . TYR C 1 68  ? 0.044   49.802  -5.554  1.00 37.58 ? 69   TYR C CA    1 
ATOM   3858 C  C     . TYR C 1 68  ? -1.116  50.330  -4.681  1.00 36.99 ? 69   TYR C C     1 
ATOM   3859 O  O     . TYR C 1 68  ? -0.948  50.488  -3.479  1.00 36.60 ? 69   TYR C O     1 
ATOM   3860 C  CB    . TYR C 1 68  ? 1.266   50.711  -5.457  1.00 38.94 ? 69   TYR C CB    1 
ATOM   3861 C  CG    . TYR C 1 68  ? 2.561   49.933  -5.616  1.00 39.94 ? 69   TYR C CG    1 
ATOM   3862 C  CD1   . TYR C 1 68  ? 3.225   49.882  -6.848  1.00 40.82 ? 69   TYR C CD1   1 
ATOM   3863 C  CD2   . TYR C 1 68  ? 3.089   49.216  -4.554  1.00 40.80 ? 69   TYR C CD2   1 
ATOM   3864 C  CE1   . TYR C 1 68  ? 4.391   49.155  -7.008  1.00 40.35 ? 69   TYR C CE1   1 
ATOM   3865 C  CE2   . TYR C 1 68  ? 4.269   48.487  -4.697  1.00 41.94 ? 69   TYR C CE2   1 
ATOM   3866 C  CZ    . TYR C 1 68  ? 4.917   48.474  -5.924  1.00 41.03 ? 69   TYR C CZ    1 
ATOM   3867 O  OH    . TYR C 1 68  ? 6.087   47.746  -6.043  1.00 43.66 ? 69   TYR C OH    1 
ATOM   3868 N  N     . LYS C 1 69  ? -2.295  50.562  -5.258  1.00 35.80 ? 70   LYS C N     1 
ATOM   3869 C  CA    . LYS C 1 69  ? -3.445  51.025  -4.465  1.00 35.41 ? 70   LYS C CA    1 
ATOM   3870 C  C     . LYS C 1 69  ? -3.855  49.989  -3.425  1.00 35.21 ? 70   LYS C C     1 
ATOM   3871 O  O     . LYS C 1 69  ? -4.019  50.318  -2.246  1.00 34.87 ? 70   LYS C O     1 
ATOM   3872 C  CB    . LYS C 1 69  ? -4.642  51.397  -5.350  1.00 35.31 ? 70   LYS C CB    1 
ATOM   3873 C  CG    . LYS C 1 69  ? -5.774  52.078  -4.583  1.00 35.39 ? 70   LYS C CG    1 
ATOM   3874 C  CD    . LYS C 1 69  ? -6.845  52.690  -5.509  1.00 34.92 ? 70   LYS C CD    1 
ATOM   3875 N  N     . VAL C 1 70  ? -4.018  48.737  -3.851  1.00 34.68 ? 71   VAL C N     1 
ATOM   3876 C  CA    . VAL C 1 70  ? -4.409  47.678  -2.913  1.00 34.45 ? 71   VAL C CA    1 
ATOM   3877 C  C     . VAL C 1 70  ? -3.380  47.478  -1.808  1.00 34.10 ? 71   VAL C C     1 
ATOM   3878 O  O     . VAL C 1 70  ? -3.734  47.014  -0.730  1.00 34.20 ? 71   VAL C O     1 
ATOM   3879 C  CB    . VAL C 1 70  ? -4.638  46.307  -3.571  1.00 34.03 ? 71   VAL C CB    1 
ATOM   3880 C  CG1   . VAL C 1 70  ? -5.808  46.374  -4.565  1.00 35.09 ? 71   VAL C CG1   1 
ATOM   3881 C  CG2   . VAL C 1 70  ? -3.358  45.790  -4.246  1.00 34.82 ? 71   VAL C CG2   1 
ATOM   3882 N  N     . VAL C 1 71  ? -2.115  47.780  -2.097  1.00 34.15 ? 72   VAL C N     1 
ATOM   3883 C  CA    . VAL C 1 71  ? -1.035  47.633  -1.110  1.00 33.37 ? 72   VAL C CA    1 
ATOM   3884 C  C     . VAL C 1 71  ? -1.129  48.758  -0.081  1.00 33.63 ? 72   VAL C C     1 
ATOM   3885 O  O     . VAL C 1 71  ? -1.015  48.528  1.118   1.00 33.43 ? 72   VAL C O     1 
ATOM   3886 C  CB    . VAL C 1 71  ? 0.392   47.694  -1.753  1.00 33.32 ? 72   VAL C CB    1 
ATOM   3887 C  CG1   . VAL C 1 71  ? 1.474   47.384  -0.692  1.00 31.54 ? 72   VAL C CG1   1 
ATOM   3888 C  CG2   . VAL C 1 71  ? 0.529   46.751  -2.963  1.00 33.58 ? 72   VAL C CG2   1 
ATOM   3889 N  N     . VAL C 1 72  ? -1.294  49.981  -0.562  1.00 34.80 ? 73   VAL C N     1 
ATOM   3890 C  CA    . VAL C 1 72  ? -1.582  51.121  0.332   1.00 34.67 ? 73   VAL C CA    1 
ATOM   3891 C  C     . VAL C 1 72  ? -2.760  50.804  1.255   1.00 34.39 ? 73   VAL C C     1 
ATOM   3892 O  O     . VAL C 1 72  ? -2.695  51.039  2.461   1.00 33.26 ? 73   VAL C O     1 
ATOM   3893 C  CB    . VAL C 1 72  ? -1.875  52.395  -0.469  1.00 35.32 ? 73   VAL C CB    1 
ATOM   3894 C  CG1   . VAL C 1 72  ? -2.536  53.475  0.447   1.00 35.31 ? 73   VAL C CG1   1 
ATOM   3895 C  CG2   . VAL C 1 72  ? -0.583  52.918  -1.114  1.00 34.74 ? 73   VAL C CG2   1 
ATOM   3896 N  N     . TYR C 1 73  ? -3.848  50.269  0.690   1.00 33.65 ? 74   TYR C N     1 
ATOM   3897 C  CA    . TYR C 1 73  ? -5.058  49.989  1.490   1.00 33.04 ? 74   TYR C CA    1 
ATOM   3898 C  C     . TYR C 1 73  ? -4.847  48.854  2.514   1.00 33.06 ? 74   TYR C C     1 
ATOM   3899 O  O     . TYR C 1 73  ? -5.248  48.975  3.670   1.00 31.27 ? 74   TYR C O     1 
ATOM   3900 C  CB    . TYR C 1 73  ? -6.279  49.728  0.586   1.00 33.53 ? 74   TYR C CB    1 
ATOM   3901 C  CG    . TYR C 1 73  ? -6.818  50.941  -0.156  1.00 33.39 ? 74   TYR C CG    1 
ATOM   3902 C  CD1   . TYR C 1 73  ? -6.378  52.237  0.139   1.00 33.58 ? 74   TYR C CD1   1 
ATOM   3903 C  CD2   . TYR C 1 73  ? -7.813  50.798  -1.118  1.00 33.89 ? 74   TYR C CD2   1 
ATOM   3904 C  CE1   . TYR C 1 73  ? -6.888  53.334  -0.524  1.00 33.11 ? 74   TYR C CE1   1 
ATOM   3905 C  CE2   . TYR C 1 73  ? -8.349  51.901  -1.776  1.00 34.67 ? 74   TYR C CE2   1 
ATOM   3906 C  CZ    . TYR C 1 73  ? -7.882  53.161  -1.484  1.00 35.17 ? 74   TYR C CZ    1 
ATOM   3907 O  OH    . TYR C 1 73  ? -8.402  54.257  -2.133  1.00 33.50 ? 74   TYR C OH    1 
ATOM   3908 N  N     . SER C 1 74  ? -4.184  47.772  2.090   1.00 32.99 ? 75   SER C N     1 
ATOM   3909 C  CA    . SER C 1 74  ? -3.826  46.698  3.006   1.00 33.24 ? 75   SER C CA    1 
ATOM   3910 C  C     . SER C 1 74  ? -2.893  47.215  4.155   1.00 32.57 ? 75   SER C C     1 
ATOM   3911 O  O     . SER C 1 74  ? -3.132  46.919  5.339   1.00 31.56 ? 75   SER C O     1 
ATOM   3912 C  CB    . SER C 1 74  ? -3.147  45.563  2.224   1.00 33.40 ? 75   SER C CB    1 
ATOM   3913 O  OG    . SER C 1 74  ? -2.735  44.532  3.091   1.00 36.39 ? 75   SER C OG    1 
ATOM   3914 N  N     . ASN C 1 75  ? -1.884  48.008  3.800   1.00 32.26 ? 76   ASN C N     1 
ATOM   3915 C  CA    . ASN C 1 75  ? -0.946  48.553  4.790   1.00 32.79 ? 76   ASN C CA    1 
ATOM   3916 C  C     . ASN C 1 75  ? -1.715  49.408  5.818   1.00 32.43 ? 76   ASN C C     1 
ATOM   3917 O  O     . ASN C 1 75  ? -1.498  49.285  7.018   1.00 32.87 ? 76   ASN C O     1 
ATOM   3918 C  CB    . ASN C 1 75  ? 0.118   49.461  4.160   1.00 33.06 ? 76   ASN C CB    1 
ATOM   3919 C  CG    . ASN C 1 75  ? 1.269   48.725  3.470   1.00 33.70 ? 76   ASN C CG    1 
ATOM   3920 O  OD1   . ASN C 1 75  ? 2.163   49.398  2.967   1.00 35.73 ? 76   ASN C OD1   1 
ATOM   3921 N  ND2   . ASN C 1 75  ? 1.261   47.394  3.442   1.00 31.52 ? 76   ASN C ND2   1 
ATOM   3922 N  N     . THR C 1 76  ? -2.628  50.242  5.317   1.00 32.92 ? 77   THR C N     1 
ATOM   3923 C  CA    . THR C 1 76  ? -3.403  51.171  6.156   1.00 31.19 ? 77   THR C CA    1 
ATOM   3924 C  C     . THR C 1 76  ? -4.313  50.392  7.103   1.00 31.79 ? 77   THR C C     1 
ATOM   3925 O  O     . THR C 1 76  ? -4.321  50.630  8.336   1.00 30.45 ? 77   THR C O     1 
ATOM   3926 C  CB    . THR C 1 76  ? -4.251  52.118  5.300   1.00 31.70 ? 77   THR C CB    1 
ATOM   3927 O  OG1   . THR C 1 76  ? -3.412  52.951  4.499   1.00 30.85 ? 77   THR C OG1   1 
ATOM   3928 C  CG2   . THR C 1 76  ? -5.171  53.012  6.170   1.00 27.48 ? 77   THR C CG2   1 
ATOM   3929 N  N     . ILE C 1 77  ? -5.075  49.451  6.525   1.00 30.69 ? 78   ILE C N     1 
ATOM   3930 C  CA    . ILE C 1 77  ? -6.031  48.671  7.294   1.00 31.33 ? 78   ILE C CA    1 
ATOM   3931 C  C     . ILE C 1 77  ? -5.297  47.827  8.304   1.00 31.20 ? 78   ILE C C     1 
ATOM   3932 O  O     . ILE C 1 77  ? -5.686  47.778  9.465   1.00 30.42 ? 78   ILE C O     1 
ATOM   3933 C  CB    . ILE C 1 77  ? -6.919  47.766  6.396   1.00 30.82 ? 78   ILE C CB    1 
ATOM   3934 C  CG1   . ILE C 1 77  ? -7.857  48.644  5.546   1.00 30.83 ? 78   ILE C CG1   1 
ATOM   3935 C  CG2   . ILE C 1 77  ? -7.710  46.829  7.248   1.00 31.11 ? 78   ILE C CG2   1 
ATOM   3936 C  CD1   . ILE C 1 77  ? -8.520  47.900  4.374   1.00 32.91 ? 78   ILE C CD1   1 
ATOM   3937 N  N     . GLN C 1 78  ? -4.209  47.178  7.880   1.00 31.92 ? 79   GLN C N     1 
ATOM   3938 C  CA    . GLN C 1 78  ? -3.455  46.352  8.830   1.00 32.79 ? 79   GLN C CA    1 
ATOM   3939 C  C     . GLN C 1 78  ? -2.791  47.157  9.951   1.00 32.24 ? 79   GLN C C     1 
ATOM   3940 O  O     . GLN C 1 78  ? -2.709  46.695  11.078  1.00 32.54 ? 79   GLN C O     1 
ATOM   3941 C  CB    . GLN C 1 78  ? -2.444  45.450  8.129   1.00 33.94 ? 79   GLN C CB    1 
ATOM   3942 C  CG    . GLN C 1 78  ? -3.096  44.263  7.376   1.00 37.20 ? 79   GLN C CG    1 
ATOM   3943 C  CD    . GLN C 1 78  ? -4.206  43.520  8.156   1.00 43.32 ? 79   GLN C CD    1 
ATOM   3944 O  OE1   . GLN C 1 78  ? -4.022  43.096  9.311   1.00 48.56 ? 79   GLN C OE1   1 
ATOM   3945 N  NE2   . GLN C 1 78  ? -5.379  43.377  7.520   1.00 45.64 ? 79   GLN C NE2   1 
ATOM   3946 N  N     . SER C 1 79  ? -2.372  48.377  9.655   1.00 31.77 ? 80   SER C N     1 
ATOM   3947 C  CA    . SER C 1 79  ? -1.791  49.243  10.675  1.00 31.63 ? 80   SER C CA    1 
ATOM   3948 C  C     . SER C 1 79  ? -2.794  49.648  11.730  1.00 30.74 ? 80   SER C C     1 
ATOM   3949 O  O     . SER C 1 79  ? -2.521  49.488  12.926  1.00 30.74 ? 80   SER C O     1 
ATOM   3950 C  CB    . SER C 1 79  ? -1.125  50.456  10.022  1.00 31.23 ? 80   SER C CB    1 
ATOM   3951 O  OG    . SER C 1 79  ? -0.006  49.979  9.292   1.00 32.29 ? 80   SER C OG    1 
ATOM   3952 N  N     . ILE C 1 80  ? -3.959  50.153  11.335  1.00 30.72 ? 81   ILE C N     1 
ATOM   3953 C  CA    . ILE C 1 80  ? -4.931  50.554  12.352  1.00 30.58 ? 81   ILE C CA    1 
ATOM   3954 C  C     . ILE C 1 80  ? -5.377  49.338  13.203  1.00 30.95 ? 81   ILE C C     1 
ATOM   3955 O  O     . ILE C 1 80  ? -5.501  49.430  14.435  1.00 30.37 ? 81   ILE C O     1 
ATOM   3956 C  CB    . ILE C 1 80  ? -6.111  51.395  11.764  1.00 30.06 ? 81   ILE C CB    1 
ATOM   3957 C  CG1   . ILE C 1 80  ? -6.977  51.993  12.888  1.00 30.78 ? 81   ILE C CG1   1 
ATOM   3958 C  CG2   . ILE C 1 80  ? -6.960  50.563  10.805  1.00 30.54 ? 81   ILE C CG2   1 
ATOM   3959 C  CD1   . ILE C 1 80  ? -6.296  53.058  13.717  1.00 30.62 ? 81   ILE C CD1   1 
ATOM   3960 N  N     . ILE C 1 81  ? -5.517  48.177  12.565  1.00 30.93 ? 82   ILE C N     1 
ATOM   3961 C  CA    . ILE C 1 81  ? -5.867  46.963  13.303  1.00 31.72 ? 82   ILE C CA    1 
ATOM   3962 C  C     . ILE C 1 81  ? -4.796  46.607  14.347  1.00 30.79 ? 82   ILE C C     1 
ATOM   3963 O  O     . ILE C 1 81  ? -5.131  46.243  15.465  1.00 31.48 ? 82   ILE C O     1 
ATOM   3964 C  CB    . ILE C 1 81  ? -6.121  45.746  12.351  1.00 31.97 ? 82   ILE C CB    1 
ATOM   3965 C  CG1   . ILE C 1 81  ? -7.514  45.827  11.684  1.00 32.68 ? 82   ILE C CG1   1 
ATOM   3966 C  CG2   . ILE C 1 81  ? -6.032  44.441  13.139  1.00 32.96 ? 82   ILE C CG2   1 
ATOM   3967 C  CD1   . ILE C 1 81  ? -7.728  44.821  10.463  1.00 32.77 ? 82   ILE C CD1   1 
ATOM   3968 N  N     . ALA C 1 82  ? -3.519  46.731  13.982  1.00 30.88 ? 83   ALA C N     1 
ATOM   3969 C  CA    . ALA C 1 82  ? -2.388  46.501  14.897  1.00 30.45 ? 83   ALA C CA    1 
ATOM   3970 C  C     . ALA C 1 82  ? -2.491  47.365  16.155  1.00 30.03 ? 83   ALA C C     1 
ATOM   3971 O  O     . ALA C 1 82  ? -2.208  46.893  17.245  1.00 30.19 ? 83   ALA C O     1 
ATOM   3972 C  CB    . ALA C 1 82  ? -1.023  46.761  14.180  1.00 30.09 ? 83   ALA C CB    1 
ATOM   3973 N  N     . ILE C 1 83  ? -2.849  48.640  15.984  1.00 29.70 ? 84   ILE C N     1 
ATOM   3974 C  CA    . ILE C 1 83  ? -2.867  49.601  17.088  1.00 29.27 ? 84   ILE C CA    1 
ATOM   3975 C  C     . ILE C 1 83  ? -4.029  49.217  17.977  1.00 29.17 ? 84   ILE C C     1 
ATOM   3976 O  O     . ILE C 1 83  ? -3.913  49.205  19.192  1.00 30.19 ? 84   ILE C O     1 
ATOM   3977 C  CB    . ILE C 1 83  ? -3.023  51.074  16.586  1.00 29.26 ? 84   ILE C CB    1 
ATOM   3978 C  CG1   . ILE C 1 83  ? -1.811  51.468  15.685  1.00 29.42 ? 84   ILE C CG1   1 
ATOM   3979 C  CG2   . ILE C 1 83  ? -3.209  52.023  17.804  1.00 30.25 ? 84   ILE C CG2   1 
ATOM   3980 C  CD1   . ILE C 1 83  ? -2.019  52.735  14.823  1.00 28.81 ? 84   ILE C CD1   1 
ATOM   3981 N  N     . ILE C 1 84  ? -5.154  48.886  17.359  1.00 30.15 ? 85   ILE C N     1 
ATOM   3982 C  CA    . ILE C 1 84  ? -6.344  48.486  18.128  1.00 30.77 ? 85   ILE C CA    1 
ATOM   3983 C  C     . ILE C 1 84  ? -6.064  47.202  18.929  1.00 30.66 ? 85   ILE C C     1 
ATOM   3984 O  O     . ILE C 1 84  ? -6.293  47.162  20.146  1.00 29.88 ? 85   ILE C O     1 
ATOM   3985 C  CB    . ILE C 1 84  ? -7.600  48.368  17.224  1.00 29.71 ? 85   ILE C CB    1 
ATOM   3986 C  CG1   . ILE C 1 84  ? -7.954  49.742  16.631  1.00 30.84 ? 85   ILE C CG1   1 
ATOM   3987 C  CG2   . ILE C 1 84  ? -8.822  47.842  18.022  1.00 32.89 ? 85   ILE C CG2   1 
ATOM   3988 C  CD1   . ILE C 1 84  ? -8.175  50.800  17.661  1.00 30.15 ? 85   ILE C CD1   1 
ATOM   3989 N  N     . ARG C 1 85  ? -5.516  46.183  18.262  1.00 31.25 ? 86   ARG C N     1 
ATOM   3990 C  CA    . ARG C 1 85  ? -5.159  44.945  18.959  1.00 32.33 ? 86   ARG C CA    1 
ATOM   3991 C  C     . ARG C 1 85  ? -4.242  45.223  20.156  1.00 32.13 ? 86   ARG C C     1 
ATOM   3992 O  O     . ARG C 1 85  ? -4.425  44.672  21.226  1.00 31.43 ? 86   ARG C O     1 
ATOM   3993 C  CB    . ARG C 1 85  ? -4.488  43.943  18.022  1.00 32.45 ? 86   ARG C CB    1 
ATOM   3994 C  CG    . ARG C 1 85  ? -5.419  43.326  16.978  1.00 34.70 ? 86   ARG C CG    1 
ATOM   3995 C  CD    . ARG C 1 85  ? -4.817  42.060  16.364  1.00 37.90 ? 86   ARG C CD    1 
ATOM   3996 N  NE    . ARG C 1 85  ? -5.720  41.396  15.423  1.00 39.03 ? 86   ARG C NE    1 
ATOM   3997 C  CZ    . ARG C 1 85  ? -5.429  41.045  14.164  1.00 41.24 ? 86   ARG C CZ    1 
ATOM   3998 N  NH1   . ARG C 1 85  ? -4.248  41.286  13.600  1.00 42.17 ? 86   ARG C NH1   1 
ATOM   3999 N  NH2   . ARG C 1 85  ? -6.350  40.420  13.451  1.00 40.78 ? 86   ARG C NH2   1 
ATOM   4000 N  N     . ALA C 1 86  ? -3.267  46.101  19.978  1.00 32.91 ? 87   ALA C N     1 
ATOM   4001 C  CA    . ALA C 1 86  ? -2.317  46.399  21.033  1.00 33.34 ? 87   ALA C CA    1 
ATOM   4002 C  C     . ALA C 1 86  ? -2.972  47.080  22.237  1.00 34.49 ? 87   ALA C C     1 
ATOM   4003 O  O     . ALA C 1 86  ? -2.525  46.931  23.379  1.00 34.23 ? 87   ALA C O     1 
ATOM   4004 C  CB    . ALA C 1 86  ? -1.193  47.237  20.478  1.00 33.07 ? 87   ALA C CB    1 
ATOM   4005 N  N     . MET C 1 87  ? -4.047  47.826  22.008  1.00 35.52 ? 88   MET C N     1 
ATOM   4006 C  CA    . MET C 1 87  ? -4.704  48.531  23.099  1.00 36.12 ? 88   MET C CA    1 
ATOM   4007 C  C     . MET C 1 87  ? -5.234  47.530  24.117  1.00 37.58 ? 88   MET C C     1 
ATOM   4008 O  O     . MET C 1 87  ? -5.219  47.792  25.316  1.00 37.10 ? 88   MET C O     1 
ATOM   4009 C  CB    . MET C 1 87  ? -5.872  49.370  22.584  1.00 36.00 ? 88   MET C CB    1 
ATOM   4010 C  CG    . MET C 1 87  ? -5.491  50.524  21.702  1.00 35.14 ? 88   MET C CG    1 
ATOM   4011 S  SD    . MET C 1 87  ? -6.946  51.480  21.205  1.00 36.45 ? 88   MET C SD    1 
ATOM   4012 C  CE    . MET C 1 87  ? -7.522  52.185  22.751  1.00 35.92 ? 88   MET C CE    1 
ATOM   4013 N  N     . GLY C 1 88  ? -5.713  46.392  23.619  1.00 39.47 ? 89   GLY C N     1 
ATOM   4014 C  CA    . GLY C 1 88  ? -6.170  45.307  24.474  1.00 41.20 ? 89   GLY C CA    1 
ATOM   4015 C  C     . GLY C 1 88  ? -5.013  44.834  25.326  1.00 42.61 ? 89   GLY C C     1 
ATOM   4016 O  O     . GLY C 1 88  ? -5.108  44.825  26.546  1.00 43.02 ? 89   GLY C O     1 
ATOM   4017 N  N     . ARG C 1 89  ? -3.904  44.498  24.666  1.00 44.22 ? 90   ARG C N     1 
ATOM   4018 C  CA    . ARG C 1 89  ? -2.726  43.942  25.340  1.00 45.30 ? 90   ARG C CA    1 
ATOM   4019 C  C     . ARG C 1 89  ? -2.028  44.947  26.250  1.00 44.61 ? 90   ARG C C     1 
ATOM   4020 O  O     . ARG C 1 89  ? -1.449  44.534  27.240  1.00 45.48 ? 90   ARG C O     1 
ATOM   4021 C  CB    . ARG C 1 89  ? -1.735  43.383  24.312  1.00 45.45 ? 90   ARG C CB    1 
ATOM   4022 C  CG    . ARG C 1 89  ? -2.394  42.396  23.327  1.00 47.50 ? 90   ARG C CG    1 
ATOM   4023 C  CD    . ARG C 1 89  ? -1.400  41.722  22.407  1.00 48.16 ? 90   ARG C CD    1 
ATOM   4024 N  NE    . ARG C 1 89  ? -0.524  42.689  21.756  1.00 50.74 ? 90   ARG C NE    1 
ATOM   4025 C  CZ    . ARG C 1 89  ? -0.546  42.998  20.458  1.00 49.14 ? 90   ARG C CZ    1 
ATOM   4026 N  NH1   . ARG C 1 89  ? 0.300   43.887  20.008  1.00 50.58 ? 90   ARG C NH1   1 
ATOM   4027 N  NH2   . ARG C 1 89  ? -1.390  42.410  19.618  1.00 51.79 ? 90   ARG C NH2   1 
ATOM   4028 N  N     . LEU C 1 90  ? -2.079  46.248  25.925  1.00 43.64 ? 91   LEU C N     1 
ATOM   4029 C  CA    . LEU C 1 90  ? -1.432  47.301  26.740  1.00 42.55 ? 91   LEU C CA    1 
ATOM   4030 C  C     . LEU C 1 90  ? -2.368  47.957  27.780  1.00 42.25 ? 91   LEU C C     1 
ATOM   4031 O  O     . LEU C 1 90  ? -1.959  48.856  28.512  1.00 41.61 ? 91   LEU C O     1 
ATOM   4032 C  CB    . LEU C 1 90  ? -0.833  48.398  25.841  1.00 42.39 ? 91   LEU C CB    1 
ATOM   4033 C  CG    . LEU C 1 90  ? 0.286   48.001  24.868  1.00 42.60 ? 91   LEU C CG    1 
ATOM   4034 C  CD1   . LEU C 1 90  ? 0.777   49.236  24.063  1.00 41.98 ? 91   LEU C CD1   1 
ATOM   4035 C  CD2   . LEU C 1 90  ? 1.419   47.327  25.638  1.00 43.97 ? 91   LEU C CD2   1 
ATOM   4036 N  N     . LYS C 1 91  ? -3.622  47.526  27.823  1.00 41.62 ? 92   LYS C N     1 
ATOM   4037 C  CA    . LYS C 1 91  ? -4.595  48.114  28.739  1.00 41.29 ? 92   LYS C CA    1 
ATOM   4038 C  C     . LYS C 1 91  ? -4.728  49.654  28.597  1.00 40.55 ? 92   LYS C C     1 
ATOM   4039 O  O     . LYS C 1 91  ? -4.653  50.406  29.577  1.00 40.89 ? 92   LYS C O     1 
ATOM   4040 C  CB    . LYS C 1 91  ? -4.277  47.691  30.184  1.00 41.27 ? 92   LYS C CB    1 
ATOM   4041 N  N     . ILE C 1 92  ? -4.971  50.090  27.365  1.00 39.46 ? 93   ILE C N     1 
ATOM   4042 C  CA    . ILE C 1 92  ? -5.264  51.492  27.027  1.00 38.55 ? 93   ILE C CA    1 
ATOM   4043 C  C     . ILE C 1 92  ? -6.724  51.591  26.601  1.00 38.42 ? 93   ILE C C     1 
ATOM   4044 O  O     . ILE C 1 92  ? -7.165  50.814  25.751  1.00 38.65 ? 93   ILE C O     1 
ATOM   4045 C  CB    . ILE C 1 92  ? -4.360  51.992  25.843  1.00 38.36 ? 93   ILE C CB    1 
ATOM   4046 C  CG1   . ILE C 1 92  ? -2.873  51.867  26.214  1.00 37.66 ? 93   ILE C CG1   1 
ATOM   4047 C  CG2   . ILE C 1 92  ? -4.703  53.442  25.476  1.00 38.57 ? 93   ILE C CG2   1 
ATOM   4048 C  CD1   . ILE C 1 92  ? -1.882  51.925  25.037  1.00 37.18 ? 93   ILE C CD1   1 
ATOM   4049 N  N     . ASP C 1 93  ? -7.461  52.536  27.191  1.00 38.03 ? 94   ASP C N     1 
ATOM   4050 C  CA    . ASP C 1 93  ? -8.876  52.756  26.870  1.00 37.72 ? 94   ASP C CA    1 
ATOM   4051 C  C     . ASP C 1 93  ? -9.037  53.689  25.685  1.00 36.99 ? 94   ASP C C     1 
ATOM   4052 O  O     . ASP C 1 93  ? -8.165  54.496  25.412  1.00 36.36 ? 94   ASP C O     1 
ATOM   4053 C  CB    . ASP C 1 93  ? -9.615  53.372  28.072  1.00 38.21 ? 94   ASP C CB    1 
ATOM   4054 C  CG    . ASP C 1 93  ? -9.896  52.360  29.173  1.00 38.85 ? 94   ASP C CG    1 
ATOM   4055 O  OD1   . ASP C 1 93  ? -10.111 51.168  28.866  1.00 40.90 ? 94   ASP C OD1   1 
ATOM   4056 O  OD2   . ASP C 1 93  ? -9.910  52.759  30.353  1.00 43.32 ? 94   ASP C OD2   1 
ATOM   4057 N  N     . PHE C 1 94  ? -10.158 53.567  24.989  1.00 36.31 ? 95   PHE C N     1 
ATOM   4058 C  CA    . PHE C 1 94  ? -10.547 54.555  23.988  1.00 36.43 ? 95   PHE C CA    1 
ATOM   4059 C  C     . PHE C 1 94  ? -10.776 55.903  24.647  1.00 36.11 ? 95   PHE C C     1 
ATOM   4060 O  O     . PHE C 1 94  ? -11.248 55.964  25.773  1.00 35.98 ? 95   PHE C O     1 
ATOM   4061 C  CB    . PHE C 1 94  ? -11.827 54.125  23.262  1.00 36.25 ? 95   PHE C CB    1 
ATOM   4062 C  CG    . PHE C 1 94  ? -11.618 53.034  22.252  1.00 36.06 ? 95   PHE C CG    1 
ATOM   4063 C  CD1   . PHE C 1 94  ? -10.777 53.231  21.175  1.00 36.37 ? 95   PHE C CD1   1 
ATOM   4064 C  CD2   . PHE C 1 94  ? -12.285 51.824  22.358  1.00 37.22 ? 95   PHE C CD2   1 
ATOM   4065 C  CE1   . PHE C 1 94  ? -10.577 52.230  20.227  1.00 37.54 ? 95   PHE C CE1   1 
ATOM   4066 C  CE2   . PHE C 1 94  ? -12.081 50.812  21.423  1.00 35.73 ? 95   PHE C CE2   1 
ATOM   4067 C  CZ    . PHE C 1 94  ? -11.237 51.019  20.348  1.00 37.35 ? 95   PHE C CZ    1 
ATOM   4068 N  N     . GLY C 1 95  ? -10.426 56.981  23.958  1.00 36.07 ? 96   GLY C N     1 
ATOM   4069 C  CA    . GLY C 1 95  ? -10.825 58.320  24.392  1.00 36.46 ? 96   GLY C CA    1 
ATOM   4070 C  C     . GLY C 1 95  ? -12.346 58.510  24.440  1.00 36.20 ? 96   GLY C C     1 
ATOM   4071 O  O     . GLY C 1 95  ? -12.869 59.122  25.361  1.00 36.37 ? 96   GLY C O     1 
ATOM   4072 N  N     . GLU C 1 96  ? -13.054 57.973  23.448  1.00 36.30 ? 97   GLU C N     1 
ATOM   4073 C  CA    . GLU C 1 96  ? -14.519 57.962  23.446  1.00 36.94 ? 97   GLU C CA    1 
ATOM   4074 C  C     . GLU C 1 96  ? -15.061 56.528  23.359  1.00 36.17 ? 97   GLU C C     1 
ATOM   4075 O  O     . GLU C 1 96  ? -14.694 55.779  22.468  1.00 36.22 ? 97   GLU C O     1 
ATOM   4076 C  CB    . GLU C 1 96  ? -15.055 58.812  22.288  1.00 36.80 ? 97   GLU C CB    1 
ATOM   4077 C  CG    . GLU C 1 96  ? -14.744 60.296  22.414  1.00 38.77 ? 97   GLU C CG    1 
ATOM   4078 C  CD    . GLU C 1 96  ? -15.364 61.131  21.292  1.00 38.69 ? 97   GLU C CD    1 
ATOM   4079 O  OE1   . GLU C 1 96  ? -14.655 61.429  20.303  1.00 42.59 ? 97   GLU C OE1   1 
ATOM   4080 O  OE2   . GLU C 1 96  ? -16.554 61.467  21.390  1.00 40.99 ? 97   GLU C OE2   1 
ATOM   4081 N  N     . ALA C 1 97  ? -15.954 56.170  24.286  1.00 35.97 ? 98   ALA C N     1 
ATOM   4082 C  CA    . ALA C 1 97  ? -16.563 54.828  24.352  1.00 35.60 ? 98   ALA C CA    1 
ATOM   4083 C  C     . ALA C 1 97  ? -17.187 54.345  23.032  1.00 35.58 ? 98   ALA C C     1 
ATOM   4084 O  O     . ALA C 1 97  ? -17.143 53.147  22.722  1.00 35.71 ? 98   ALA C O     1 
ATOM   4085 C  CB    . ALA C 1 97  ? -17.606 54.787  25.476  1.00 35.88 ? 98   ALA C CB    1 
ATOM   4086 N  N     . ALA C 1 98  ? -17.756 55.273  22.260  1.00 35.29 ? 99   ALA C N     1 
ATOM   4087 C  CA    . ALA C 1 98  ? -18.385 54.954  20.971  1.00 34.72 ? 99   ALA C CA    1 
ATOM   4088 C  C     . ALA C 1 98  ? -17.429 54.385  19.936  1.00 34.48 ? 99   ALA C C     1 
ATOM   4089 O  O     . ALA C 1 98  ? -17.872 53.735  18.990  1.00 34.62 ? 99   ALA C O     1 
ATOM   4090 C  CB    . ALA C 1 98  ? -19.088 56.185  20.401  1.00 34.47 ? 99   ALA C CB    1 
ATOM   4091 N  N     . ARG C 1 99  ? -16.126 54.632  20.095  1.00 34.15 ? 100  ARG C N     1 
ATOM   4092 C  CA    . ARG C 1 99  ? -15.142 54.096  19.163  1.00 34.20 ? 100  ARG C CA    1 
ATOM   4093 C  C     . ARG C 1 99  ? -15.122 52.579  19.252  1.00 33.81 ? 100  ARG C C     1 
ATOM   4094 O  O     . ARG C 1 99  ? -14.677 51.929  18.325  1.00 34.01 ? 100  ARG C O     1 
ATOM   4095 C  CB    . ARG C 1 99  ? -13.736 54.653  19.415  1.00 34.30 ? 100  ARG C CB    1 
ATOM   4096 C  CG    . ARG C 1 99  ? -13.608 56.165  19.400  1.00 34.52 ? 100  ARG C CG    1 
ATOM   4097 C  CD    . ARG C 1 99  ? -13.686 56.744  18.000  1.00 34.81 ? 100  ARG C CD    1 
ATOM   4098 N  NE    . ARG C 1 99  ? -15.045 56.753  17.456  1.00 34.87 ? 100  ARG C NE    1 
ATOM   4099 C  CZ    . ARG C 1 99  ? -16.030 57.537  17.878  1.00 35.02 ? 100  ARG C CZ    1 
ATOM   4100 N  NH1   . ARG C 1 99  ? -17.233 57.457  17.309  1.00 34.90 ? 100  ARG C NH1   1 
ATOM   4101 N  NH2   . ARG C 1 99  ? -15.839 58.400  18.870  1.00 36.90 ? 100  ARG C NH2   1 
ATOM   4102 N  N     . ALA C 1 100 ? -15.614 52.033  20.368  1.00 33.89 ? 101  ALA C N     1 
ATOM   4103 C  CA    . ALA C 1 100 ? -15.858 50.582  20.500  1.00 33.60 ? 101  ALA C CA    1 
ATOM   4104 C  C     . ALA C 1 100 ? -16.698 50.017  19.339  1.00 33.80 ? 101  ALA C C     1 
ATOM   4105 O  O     . ALA C 1 100 ? -16.414 48.929  18.832  1.00 34.29 ? 101  ALA C O     1 
ATOM   4106 C  CB    . ALA C 1 100 ? -16.519 50.288  21.826  1.00 33.76 ? 101  ALA C CB    1 
ATOM   4107 N  N     . ASP C 1 101 ? -17.709 50.772  18.901  1.00 33.66 ? 102  ASP C N     1 
ATOM   4108 C  CA    . ASP C 1 101 ? -18.544 50.364  17.759  1.00 33.81 ? 102  ASP C CA    1 
ATOM   4109 C  C     . ASP C 1 101 ? -17.798 50.441  16.436  1.00 33.72 ? 102  ASP C C     1 
ATOM   4110 O  O     . ASP C 1 101 ? -17.943 49.567  15.576  1.00 33.25 ? 102  ASP C O     1 
ATOM   4111 C  CB    . ASP C 1 101 ? -19.799 51.226  17.688  1.00 33.99 ? 102  ASP C CB    1 
ATOM   4112 C  CG    . ASP C 1 101 ? -20.730 51.003  18.875  1.00 34.85 ? 102  ASP C CG    1 
ATOM   4113 O  OD1   . ASP C 1 101 ? -21.533 51.901  19.160  1.00 36.56 ? 102  ASP C OD1   1 
ATOM   4114 O  OD2   . ASP C 1 101 ? -20.668 49.933  19.513  1.00 36.33 ? 102  ASP C OD2   1 
ATOM   4115 N  N     . ASP C 1 102 ? -17.007 51.503  16.280  1.00 33.90 ? 103  ASP C N     1 
ATOM   4116 C  CA    . ASP C 1 102 ? -16.123 51.659  15.130  1.00 33.56 ? 103  ASP C CA    1 
ATOM   4117 C  C     . ASP C 1 102 ? -15.085 50.540  15.091  1.00 33.48 ? 103  ASP C C     1 
ATOM   4118 O  O     . ASP C 1 102 ? -14.746 50.044  14.022  1.00 33.96 ? 103  ASP C O     1 
ATOM   4119 C  CB    . ASP C 1 102 ? -15.399 53.011  15.187  1.00 33.62 ? 103  ASP C CB    1 
ATOM   4120 C  CG    . ASP C 1 102 ? -16.314 54.186  14.938  1.00 33.08 ? 103  ASP C CG    1 
ATOM   4121 O  OD1   . ASP C 1 102 ? -17.307 54.057  14.185  1.00 32.43 ? 103  ASP C OD1   1 
ATOM   4122 O  OD2   . ASP C 1 102 ? -16.026 55.261  15.500  1.00 31.42 ? 103  ASP C OD2   1 
ATOM   4123 N  N     . ALA C 1 103 ? -14.576 50.150  16.256  1.00 33.60 ? 104  ALA C N     1 
ATOM   4124 C  CA    . ALA C 1 103 ? -13.633 49.036  16.334  1.00 34.27 ? 104  ALA C CA    1 
ATOM   4125 C  C     . ALA C 1 103 ? -14.191 47.739  15.729  1.00 34.69 ? 104  ALA C C     1 
ATOM   4126 O  O     . ALA C 1 103 ? -13.521 47.111  14.908  1.00 34.92 ? 104  ALA C O     1 
ATOM   4127 C  CB    . ALA C 1 103 ? -13.180 48.812  17.774  1.00 33.91 ? 104  ALA C CB    1 
ATOM   4128 N  N     . ARG C 1 104 ? -15.409 47.338  16.113  1.00 35.42 ? 105  ARG C N     1 
ATOM   4129 C  CA    . ARG C 1 104 ? -15.978 46.094  15.581  1.00 35.79 ? 105  ARG C CA    1 
ATOM   4130 C  C     . ARG C 1 104 ? -16.230 46.232  14.073  1.00 35.58 ? 105  ARG C C     1 
ATOM   4131 O  O     . ARG C 1 104 ? -15.954 45.322  13.308  1.00 35.45 ? 105  ARG C O     1 
ATOM   4132 C  CB    . ARG C 1 104 ? -17.249 45.663  16.345  1.00 36.53 ? 105  ARG C CB    1 
ATOM   4133 C  CG    . ARG C 1 104 ? -18.537 46.020  15.678  1.00 38.29 ? 105  ARG C CG    1 
ATOM   4134 C  CD    . ARG C 1 104 ? -19.699 45.197  16.187  1.00 40.77 ? 105  ARG C CD    1 
ATOM   4135 N  NE    . ARG C 1 104 ? -20.869 46.047  16.257  1.00 43.07 ? 105  ARG C NE    1 
ATOM   4136 C  CZ    . ARG C 1 104 ? -21.154 46.862  17.275  1.00 44.51 ? 105  ARG C CZ    1 
ATOM   4137 N  NH1   . ARG C 1 104 ? -22.251 47.603  17.225  1.00 44.95 ? 105  ARG C NH1   1 
ATOM   4138 N  NH2   . ARG C 1 104 ? -20.355 46.944  18.341  1.00 45.45 ? 105  ARG C NH2   1 
ATOM   4139 N  N     . GLN C 1 105 ? -16.731 47.391  13.653  1.00 35.88 ? 106  GLN C N     1 
ATOM   4140 C  CA    . GLN C 1 105 ? -16.960 47.654  12.237  1.00 36.02 ? 106  GLN C CA    1 
ATOM   4141 C  C     . GLN C 1 105 ? -15.694 47.550  11.416  1.00 35.94 ? 106  GLN C C     1 
ATOM   4142 O  O     . GLN C 1 105 ? -15.738 47.124  10.251  1.00 35.36 ? 106  GLN C O     1 
ATOM   4143 C  CB    . GLN C 1 105 ? -17.570 49.047  12.033  1.00 36.64 ? 106  GLN C CB    1 
ATOM   4144 C  CG    . GLN C 1 105 ? -18.516 49.114  10.868  1.00 37.81 ? 106  GLN C CG    1 
ATOM   4145 C  CD    . GLN C 1 105 ? -19.685 48.150  11.029  1.00 39.28 ? 106  GLN C CD    1 
ATOM   4146 O  OE1   . GLN C 1 105 ? -20.392 48.175  12.047  1.00 42.63 ? 106  GLN C OE1   1 
ATOM   4147 N  NE2   . GLN C 1 105 ? -19.895 47.296  10.029  1.00 38.10 ? 106  GLN C NE2   1 
ATOM   4148 N  N     . LEU C 1 106 ? -14.569 47.950  12.014  1.00 36.31 ? 107  LEU C N     1 
ATOM   4149 C  CA    . LEU C 1 106 ? -13.270 47.823  11.371  1.00 36.62 ? 107  LEU C CA    1 
ATOM   4150 C  C     . LEU C 1 106 ? -12.973 46.360  11.039  1.00 37.08 ? 107  LEU C C     1 
ATOM   4151 O  O     . LEU C 1 106 ? -12.546 46.042  9.924   1.00 37.41 ? 107  LEU C O     1 
ATOM   4152 C  CB    . LEU C 1 106 ? -12.145 48.402  12.254  1.00 36.77 ? 107  LEU C CB    1 
ATOM   4153 C  CG    . LEU C 1 106 ? -10.697 48.209  11.791  1.00 37.13 ? 107  LEU C CG    1 
ATOM   4154 C  CD1   . LEU C 1 106 ? -10.426 48.948  10.480  1.00 38.57 ? 107  LEU C CD1   1 
ATOM   4155 C  CD2   . LEU C 1 106 ? -9.725  48.656  12.888  1.00 35.60 ? 107  LEU C CD2   1 
ATOM   4156 N  N     . PHE C 1 107 ? -13.196 45.475  12.000  1.00 38.06 ? 108  PHE C N     1 
ATOM   4157 C  CA    . PHE C 1 107 ? -12.999 44.033  11.759  1.00 39.20 ? 108  PHE C CA    1 
ATOM   4158 C  C     . PHE C 1 107 ? -14.025 43.463  10.736  1.00 39.89 ? 108  PHE C C     1 
ATOM   4159 O  O     . PHE C 1 107 ? -13.691 42.582  9.928   1.00 40.18 ? 108  PHE C O     1 
ATOM   4160 C  CB    . PHE C 1 107 ? -13.010 43.253  13.085  1.00 39.55 ? 108  PHE C CB    1 
ATOM   4161 C  CG    . PHE C 1 107 ? -11.811 43.526  13.945  1.00 39.40 ? 108  PHE C CG    1 
ATOM   4162 C  CD1   . PHE C 1 107 ? -10.551 43.083  13.561  1.00 39.45 ? 108  PHE C CD1   1 
ATOM   4163 C  CD2   . PHE C 1 107 ? -11.928 44.249  15.115  1.00 39.57 ? 108  PHE C CD2   1 
ATOM   4164 C  CE1   . PHE C 1 107 ? -9.419  43.368  14.351  1.00 39.67 ? 108  PHE C CE1   1 
ATOM   4165 C  CE2   . PHE C 1 107 ? -10.817 44.534  15.902  1.00 37.78 ? 108  PHE C CE2   1 
ATOM   4166 C  CZ    . PHE C 1 107 ? -9.552  44.094  15.516  1.00 40.21 ? 108  PHE C CZ    1 
ATOM   4167 N  N     . VAL C 1 108 ? -15.233 44.008  10.730  1.00 40.79 ? 109  VAL C N     1 
ATOM   4168 C  CA    . VAL C 1 108 ? -16.245 43.614  9.749   1.00 41.78 ? 109  VAL C CA    1 
ATOM   4169 C  C     . VAL C 1 108 ? -15.782 43.954  8.317   1.00 43.02 ? 109  VAL C C     1 
ATOM   4170 O  O     . VAL C 1 108 ? -15.818 43.103  7.417   1.00 43.18 ? 109  VAL C O     1 
ATOM   4171 C  CB    . VAL C 1 108 ? -17.575 44.298  10.032  1.00 41.97 ? 109  VAL C CB    1 
ATOM   4172 C  CG1   . VAL C 1 108 ? -18.593 43.918  8.979   1.00 43.13 ? 109  VAL C CG1   1 
ATOM   4173 C  CG2   . VAL C 1 108 ? -18.088 43.938  11.438  1.00 41.58 ? 109  VAL C CG2   1 
ATOM   4174 N  N     . LEU C 1 109 ? -15.309 45.180  8.112   1.00 43.82 ? 110  LEU C N     1 
ATOM   4175 C  CA    . LEU C 1 109 ? -14.998 45.670  6.761   1.00 44.39 ? 110  LEU C CA    1 
ATOM   4176 C  C     . LEU C 1 109 ? -13.557 45.449  6.290   1.00 45.34 ? 110  LEU C C     1 
ATOM   4177 O  O     . LEU C 1 109 ? -13.211 45.880  5.187   1.00 45.63 ? 110  LEU C O     1 
ATOM   4178 C  CB    . LEU C 1 109 ? -15.345 47.165  6.661   1.00 44.42 ? 110  LEU C CB    1 
ATOM   4179 C  CG    . LEU C 1 109 ? -16.804 47.523  6.989   1.00 43.81 ? 110  LEU C CG    1 
ATOM   4180 C  CD1   . LEU C 1 109 ? -17.045 49.011  6.879   1.00 43.63 ? 110  LEU C CD1   1 
ATOM   4181 C  CD2   . LEU C 1 109 ? -17.758 46.773  6.085   1.00 44.77 ? 110  LEU C CD2   1 
ATOM   4182 N  N     . ALA C 1 110 ? -12.737 44.760  7.089   1.00 46.16 ? 111  ALA C N     1 
ATOM   4183 C  CA    . ALA C 1 110 ? -11.272 44.744  6.895   1.00 47.05 ? 111  ALA C CA    1 
ATOM   4184 C  C     . ALA C 1 110 ? -10.792 44.202  5.527   1.00 48.13 ? 111  ALA C C     1 
ATOM   4185 O  O     . ALA C 1 110 ? -9.659  44.473  5.113   1.00 47.33 ? 111  ALA C O     1 
ATOM   4186 C  CB    . ALA C 1 110 ? -10.600 43.971  8.034   1.00 46.90 ? 111  ALA C CB    1 
ATOM   4187 N  N     . GLY C 1 111 ? -11.644 43.430  4.850   1.00 48.94 ? 112  GLY C N     1 
ATOM   4188 C  CA    . GLY C 1 111 ? -11.331 42.908  3.517   1.00 50.03 ? 112  GLY C CA    1 
ATOM   4189 C  C     . GLY C 1 111 ? -12.222 43.473  2.421   1.00 50.83 ? 112  GLY C C     1 
ATOM   4190 O  O     . GLY C 1 111 ? -12.272 42.927  1.324   1.00 51.49 ? 112  GLY C O     1 
ATOM   4191 N  N     . SER C 1 112 ? -12.934 44.563  2.713   1.00 51.31 ? 113  SER C N     1 
ATOM   4192 C  CA    . SER C 1 112 ? -13.735 45.253  1.697   1.00 51.36 ? 113  SER C CA    1 
ATOM   4193 C  C     . SER C 1 112 ? -12.855 46.020  0.683   1.00 51.89 ? 113  SER C C     1 
ATOM   4194 O  O     . SER C 1 112 ? -13.318 46.352  -0.414  1.00 51.40 ? 113  SER C O     1 
ATOM   4195 C  CB    . SER C 1 112 ? -14.735 46.213  2.362   1.00 51.38 ? 113  SER C CB    1 
ATOM   4196 O  OG    . SER C 1 112 ? -14.088 47.364  2.889   1.00 49.38 ? 113  SER C OG    1 
ATOM   4197 N  N     . ALA C 1 113 ? -11.595 46.294  1.053   1.00 52.21 ? 114  ALA C N     1 
ATOM   4198 C  CA    . ALA C 1 113 ? -10.662 47.036  0.203   1.00 52.68 ? 114  ALA C CA    1 
ATOM   4199 C  C     . ALA C 1 113 ? -9.770  46.115  -0.626  1.00 53.45 ? 114  ALA C C     1 
ATOM   4200 O  O     . ALA C 1 113 ? -8.691  46.523  -1.069  1.00 53.48 ? 114  ALA C O     1 
ATOM   4201 C  CB    . ALA C 1 113 ? -9.803  47.948  1.059   1.00 52.53 ? 114  ALA C CB    1 
ATOM   4202 N  N     . GLU C 1 114 ? -10.215 44.879  -0.833  1.00 54.30 ? 115  GLU C N     1 
ATOM   4203 C  CA    . GLU C 1 114 ? -9.378  43.857  -1.479  1.00 55.00 ? 115  GLU C CA    1 
ATOM   4204 C  C     . GLU C 1 114 ? -9.232  44.129  -2.973  1.00 54.79 ? 115  GLU C C     1 
ATOM   4205 O  O     . GLU C 1 114 ? -8.136  44.033  -3.523  1.00 55.52 ? 115  GLU C O     1 
ATOM   4206 C  CB    . GLU C 1 114 ? -9.976  42.451  -1.286  1.00 55.41 ? 115  GLU C CB    1 
ATOM   4207 C  CG    . GLU C 1 114 ? -8.975  41.406  -0.800  1.00 56.18 ? 115  GLU C CG    1 
ATOM   4208 C  CD    . GLU C 1 114 ? -8.962  41.285  0.708   1.00 56.52 ? 115  GLU C CD    1 
ATOM   4209 O  OE1   . GLU C 1 114 ? -9.914  40.690  1.259   1.00 57.94 ? 115  GLU C OE1   1 
ATOM   4210 O  OE2   . GLU C 1 114 ? -8.004  41.771  1.340   1.00 57.19 ? 115  GLU C OE2   1 
ATOM   4211 N  N     . GLU C 1 115 ? -10.339 44.469  -3.623  1.00 54.43 ? 116  GLU C N     1 
ATOM   4212 C  CA    . GLU C 1 115 ? -10.336 44.762  -5.061  1.00 54.20 ? 116  GLU C CA    1 
ATOM   4213 C  C     . GLU C 1 115 ? -10.040 46.250  -5.344  1.00 53.72 ? 116  GLU C C     1 
ATOM   4214 O  O     . GLU C 1 115 ? -10.456 46.783  -6.392  1.00 53.69 ? 116  GLU C O     1 
ATOM   4215 C  CB    . GLU C 1 115 ? -11.673 44.338  -5.699  1.00 53.95 ? 116  GLU C CB    1 
ATOM   4216 N  N     . GLY C 1 116 ? -9.352  46.908  -4.397  1.00 52.83 ? 117  GLY C N     1 
ATOM   4217 C  CA    . GLY C 1 116 ? -8.837  48.277  -4.561  1.00 51.95 ? 117  GLY C CA    1 
ATOM   4218 C  C     . GLY C 1 116 ? -9.758  49.439  -4.201  1.00 51.04 ? 117  GLY C C     1 
ATOM   4219 O  O     . GLY C 1 116 ? -9.404  50.594  -4.443  1.00 51.47 ? 117  GLY C O     1 
ATOM   4220 N  N     . VAL C 1 117 ? -10.927 49.155  -3.630  1.00 49.61 ? 118  VAL C N     1 
ATOM   4221 C  CA    . VAL C 1 117 ? -11.899 50.202  -3.302  1.00 48.55 ? 118  VAL C CA    1 
ATOM   4222 C  C     . VAL C 1 117 ? -12.026 50.317  -1.786  1.00 47.48 ? 118  VAL C C     1 
ATOM   4223 O  O     . VAL C 1 117 ? -12.350 49.345  -1.111  1.00 47.36 ? 118  VAL C O     1 
ATOM   4224 C  CB    . VAL C 1 117 ? -13.305 49.915  -3.934  1.00 48.43 ? 118  VAL C CB    1 
ATOM   4225 N  N     . MET C 1 118 ? -11.737 51.496  -1.246  1.00 46.09 ? 119  MET C N     1 
ATOM   4226 C  CA    . MET C 1 118 ? -11.970 51.749  0.174   1.00 44.92 ? 119  MET C CA    1 
ATOM   4227 C  C     . MET C 1 118 ? -13.266 52.524  0.289   1.00 44.00 ? 119  MET C C     1 
ATOM   4228 O  O     . MET C 1 118 ? -13.344 53.673  -0.169  1.00 43.65 ? 119  MET C O     1 
ATOM   4229 C  CB    . MET C 1 118 ? -10.841 52.553  0.813   1.00 44.80 ? 119  MET C CB    1 
ATOM   4230 C  CG    . MET C 1 118 ? -11.121 52.876  2.288   1.00 44.49 ? 119  MET C CG    1 
ATOM   4231 S  SD    . MET C 1 118 ? -9.882  53.907  3.069   1.00 44.43 ? 119  MET C SD    1 
ATOM   4232 C  CE    . MET C 1 118 ? -8.559  52.723  3.358   1.00 38.69 ? 119  MET C CE    1 
ATOM   4233 N  N     . THR C 1 119 ? -14.265 51.907  0.916   1.00 43.00 ? 120  THR C N     1 
ATOM   4234 C  CA    . THR C 1 119 ? -15.580 52.514  1.040   1.00 42.88 ? 120  THR C CA    1 
ATOM   4235 C  C     . THR C 1 119 ? -15.559 53.719  1.961   1.00 42.27 ? 120  THR C C     1 
ATOM   4236 O  O     . THR C 1 119 ? -14.739 53.786  2.880   1.00 41.33 ? 120  THR C O     1 
ATOM   4237 C  CB    . THR C 1 119 ? -16.621 51.528  1.597   1.00 43.06 ? 120  THR C CB    1 
ATOM   4238 O  OG1   . THR C 1 119 ? -16.206 51.078  2.894   1.00 43.38 ? 120  THR C OG1   1 
ATOM   4239 C  CG2   . THR C 1 119 ? -16.786 50.334  0.648   1.00 43.17 ? 120  THR C CG2   1 
ATOM   4240 N  N     . PRO C 1 120 ? -16.459 54.684  1.708   1.00 41.46 ? 121  PRO C N     1 
ATOM   4241 C  CA    . PRO C 1 120 ? -16.655 55.777  2.650   1.00 41.16 ? 121  PRO C CA    1 
ATOM   4242 C  C     . PRO C 1 120 ? -16.849 55.319  4.096   1.00 40.47 ? 121  PRO C C     1 
ATOM   4243 O  O     . PRO C 1 120 ? -16.353 55.973  5.014   1.00 39.80 ? 121  PRO C O     1 
ATOM   4244 C  CB    . PRO C 1 120 ? -17.928 56.449  2.147   1.00 41.28 ? 121  PRO C CB    1 
ATOM   4245 C  CG    . PRO C 1 120 ? -17.946 56.173  0.673   1.00 41.81 ? 121  PRO C CG    1 
ATOM   4246 C  CD    . PRO C 1 120 ? -17.294 54.833  0.499   1.00 41.84 ? 121  PRO C CD    1 
ATOM   4247 N  N     . GLU C 1 121 ? -17.578 54.218  4.288   1.00 39.56 ? 122  GLU C N     1 
ATOM   4248 C  CA    . GLU C 1 121 ? -17.863 53.728  5.633   1.00 39.03 ? 122  GLU C CA    1 
ATOM   4249 C  C     . GLU C 1 121 ? -16.609 53.217  6.337   1.00 37.57 ? 122  GLU C C     1 
ATOM   4250 O  O     . GLU C 1 121 ? -16.418 53.502  7.521   1.00 37.40 ? 122  GLU C O     1 
ATOM   4251 C  CB    . GLU C 1 121 ? -18.936 52.631  5.637   1.00 38.87 ? 122  GLU C CB    1 
ATOM   4252 C  CG    . GLU C 1 121 ? -19.164 52.053  7.045   1.00 39.79 ? 122  GLU C CG    1 
ATOM   4253 C  CD    . GLU C 1 121 ? -20.244 51.006  7.112   1.00 40.69 ? 122  GLU C CD    1 
ATOM   4254 O  OE1   . GLU C 1 121 ? -20.347 50.200  6.163   1.00 44.81 ? 122  GLU C OE1   1 
ATOM   4255 O  OE2   . GLU C 1 121 ? -20.983 50.987  8.125   1.00 43.82 ? 122  GLU C OE2   1 
ATOM   4256 N  N     . LEU C 1 122 ? -15.775 52.447  5.624   1.00 36.73 ? 123  LEU C N     1 
ATOM   4257 C  CA    . LEU C 1 122 ? -14.504 51.993  6.180   1.00 35.53 ? 123  LEU C CA    1 
ATOM   4258 C  C     . LEU C 1 122 ? -13.604 53.194  6.421   1.00 35.17 ? 123  LEU C C     1 
ATOM   4259 O  O     . LEU C 1 122 ? -12.986 53.303  7.488   1.00 34.17 ? 123  LEU C O     1 
ATOM   4260 C  CB    . LEU C 1 122 ? -13.793 51.003  5.252   1.00 35.85 ? 123  LEU C CB    1 
ATOM   4261 C  CG    . LEU C 1 122 ? -12.470 50.416  5.751   1.00 35.81 ? 123  LEU C CG    1 
ATOM   4262 C  CD1   . LEU C 1 122 ? -12.667 49.662  7.068   1.00 33.20 ? 123  LEU C CD1   1 
ATOM   4263 C  CD2   . LEU C 1 122 ? -11.863 49.511  4.665   1.00 34.47 ? 123  LEU C CD2   1 
ATOM   4264 N  N     . ALA C 1 123 ? -13.545 54.091  5.435   1.00 34.54 ? 124  ALA C N     1 
ATOM   4265 C  CA    . ALA C 1 123 ? -12.766 55.320  5.563   1.00 34.49 ? 124  ALA C CA    1 
ATOM   4266 C  C     . ALA C 1 123 ? -13.182 56.107  6.820   1.00 33.59 ? 124  ALA C C     1 
ATOM   4267 O  O     . ALA C 1 123 ? -12.327 56.592  7.550   1.00 33.87 ? 124  ALA C O     1 
ATOM   4268 C  CB    . ALA C 1 123 ? -12.931 56.182  4.329   1.00 34.46 ? 124  ALA C CB    1 
ATOM   4269 N  N     . GLY C 1 124 ? -14.488 56.210  7.073   1.00 33.13 ? 125  GLY C N     1 
ATOM   4270 C  CA    . GLY C 1 124 ? -14.989 56.951  8.242   1.00 31.78 ? 125  GLY C CA    1 
ATOM   4271 C  C     . GLY C 1 124 ? -14.558 56.292  9.537   1.00 30.79 ? 125  GLY C C     1 
ATOM   4272 O  O     . GLY C 1 124 ? -14.080 56.954  10.465  1.00 29.68 ? 125  GLY C O     1 
ATOM   4273 N  N     . VAL C 1 125 ? -14.708 54.976  9.590   1.00 30.02 ? 126  VAL C N     1 
ATOM   4274 C  CA    . VAL C 1 125 ? -14.319 54.204  10.768  1.00 30.09 ? 126  VAL C CA    1 
ATOM   4275 C  C     . VAL C 1 125 ? -12.829 54.355  11.088  1.00 30.08 ? 126  VAL C C     1 
ATOM   4276 O  O     . VAL C 1 125 ? -12.468 54.610  12.224  1.00 30.39 ? 126  VAL C O     1 
ATOM   4277 C  CB    . VAL C 1 125 ? -14.688 52.703  10.614  1.00 29.78 ? 126  VAL C CB    1 
ATOM   4278 C  CG1   . VAL C 1 125 ? -13.915 51.845  11.635  1.00 30.32 ? 126  VAL C CG1   1 
ATOM   4279 C  CG2   . VAL C 1 125 ? -16.224 52.521  10.757  1.00 29.41 ? 126  VAL C CG2   1 
ATOM   4280 N  N     . ILE C 1 126 ? -11.975 54.234  10.084  1.00 30.50 ? 127  ILE C N     1 
ATOM   4281 C  CA    . ILE C 1 126 ? -10.531 54.344  10.314  1.00 30.43 ? 127  ILE C CA    1 
ATOM   4282 C  C     . ILE C 1 126 ? -10.137 55.740  10.853  1.00 30.98 ? 127  ILE C C     1 
ATOM   4283 O  O     . ILE C 1 126 ? -9.334  55.843  11.787  1.00 31.08 ? 127  ILE C O     1 
ATOM   4284 C  CB    . ILE C 1 126 ? -9.735  54.010  9.053   1.00 30.83 ? 127  ILE C CB    1 
ATOM   4285 C  CG1   . ILE C 1 126 ? -9.987  52.547  8.643   1.00 30.94 ? 127  ILE C CG1   1 
ATOM   4286 C  CG2   . ILE C 1 126 ? -8.243  54.274  9.299   1.00 27.54 ? 127  ILE C CG2   1 
ATOM   4287 C  CD1   . ILE C 1 126 ? -9.352  52.138  7.289   1.00 31.54 ? 127  ILE C CD1   1 
ATOM   4288 N  N     . LYS C 1 127 ? -10.696 56.780  10.237  1.00 31.10 ? 128  LYS C N     1 
ATOM   4289 C  CA    . LYS C 1 127 ? -10.549 58.195  10.661  1.00 31.15 ? 128  LYS C CA    1 
ATOM   4290 C  C     . LYS C 1 127 ? -10.915 58.411  12.129  1.00 29.92 ? 128  LYS C C     1 
ATOM   4291 O  O     . LYS C 1 127 ? -10.123 58.949  12.909  1.00 29.93 ? 128  LYS C O     1 
ATOM   4292 C  CB    . LYS C 1 127 ? -11.390 59.118  9.750   1.00 30.94 ? 128  LYS C CB    1 
ATOM   4293 C  CG    . LYS C 1 127 ? -11.456 60.609  10.202  1.00 32.06 ? 128  LYS C CG    1 
ATOM   4294 C  CD    . LYS C 1 127 ? -12.254 61.513  9.281   1.00 32.51 ? 128  LYS C CD    1 
ATOM   4295 C  CE    . LYS C 1 127 ? -13.747 61.585  9.684   1.00 32.04 ? 128  LYS C CE    1 
ATOM   4296 N  NZ    . LYS C 1 127 ? -14.609 62.523  8.891   1.00 32.30 ? 128  LYS C NZ    1 
ATOM   4297 N  N     . ARG C 1 128 ? -12.099 57.966  12.523  1.00 28.26 ? 129  ARG C N     1 
ATOM   4298 C  CA    . ARG C 1 128 ? -12.529 58.181  13.885  1.00 27.83 ? 129  ARG C CA    1 
ATOM   4299 C  C     . ARG C 1 128 ? -11.635 57.470  14.876  1.00 27.03 ? 129  ARG C C     1 
ATOM   4300 O  O     . ARG C 1 128 ? -11.289 58.038  15.895  1.00 25.31 ? 129  ARG C O     1 
ATOM   4301 C  CB    . ARG C 1 128 ? -13.984 57.776  14.080  1.00 28.07 ? 129  ARG C CB    1 
ATOM   4302 C  CG    . ARG C 1 128 ? -14.958 58.732  13.417  1.00 28.67 ? 129  ARG C CG    1 
ATOM   4303 C  CD    . ARG C 1 128 ? -16.380 58.369  13.779  1.00 31.59 ? 129  ARG C CD    1 
ATOM   4304 N  NE    . ARG C 1 128 ? -16.782 57.126  13.124  1.00 31.93 ? 129  ARG C NE    1 
ATOM   4305 C  CZ    . ARG C 1 128 ? -17.339 57.046  11.919  1.00 32.95 ? 129  ARG C CZ    1 
ATOM   4306 N  NH1   . ARG C 1 128 ? -17.555 58.137  11.189  1.00 32.40 ? 129  ARG C NH1   1 
ATOM   4307 N  NH2   . ARG C 1 128 ? -17.670 55.852  11.432  1.00 33.08 ? 129  ARG C NH2   1 
ATOM   4308 N  N     . LEU C 1 129 ? -11.232 56.243  14.551  1.00 27.85 ? 130  LEU C N     1 
ATOM   4309 C  CA    . LEU C 1 129 ? -10.285 55.503  15.392  1.00 28.72 ? 130  LEU C CA    1 
ATOM   4310 C  C     . LEU C 1 129 ? -8.929  56.200  15.480  1.00 28.57 ? 130  LEU C C     1 
ATOM   4311 O  O     . LEU C 1 129 ? -8.429  56.456  16.563  1.00 28.67 ? 130  LEU C O     1 
ATOM   4312 C  CB    . LEU C 1 129 ? -10.123 54.073  14.890  1.00 28.56 ? 130  LEU C CB    1 
ATOM   4313 C  CG    . LEU C 1 129 ? -11.363 53.216  15.090  1.00 29.58 ? 130  LEU C CG    1 
ATOM   4314 C  CD1   . LEU C 1 129 ? -11.190 51.914  14.298  1.00 28.46 ? 130  LEU C CD1   1 
ATOM   4315 C  CD2   . LEU C 1 129 ? -11.543 52.957  16.559  1.00 29.35 ? 130  LEU C CD2   1 
ATOM   4316 N  N     . TRP C 1 130 ? -8.354  56.518  14.337  1.00 29.24 ? 131  TRP C N     1 
ATOM   4317 C  CA    . TRP C 1 130 ? -7.065  57.180  14.282  1.00 30.05 ? 131  TRP C CA    1 
ATOM   4318 C  C     . TRP C 1 130 ? -7.018  58.495  15.061  1.00 30.73 ? 131  TRP C C     1 
ATOM   4319 O  O     . TRP C 1 130 ? -6.012  58.796  15.710  1.00 30.89 ? 131  TRP C O     1 
ATOM   4320 C  CB    . TRP C 1 130 ? -6.663  57.373  12.814  1.00 30.16 ? 131  TRP C CB    1 
ATOM   4321 C  CG    . TRP C 1 130 ? -5.339  58.034  12.582  1.00 30.32 ? 131  TRP C CG    1 
ATOM   4322 C  CD1   . TRP C 1 130 ? -5.122  59.163  11.844  1.00 31.43 ? 131  TRP C CD1   1 
ATOM   4323 C  CD2   . TRP C 1 130 ? -4.047  57.628  13.074  1.00 30.28 ? 131  TRP C CD2   1 
ATOM   4324 N  NE1   . TRP C 1 130 ? -3.789  59.472  11.825  1.00 29.94 ? 131  TRP C NE1   1 
ATOM   4325 C  CE2   . TRP C 1 130 ? -3.108  58.566  12.592  1.00 30.52 ? 131  TRP C CE2   1 
ATOM   4326 C  CE3   . TRP C 1 130 ? -3.591  56.568  13.864  1.00 30.52 ? 131  TRP C CE3   1 
ATOM   4327 C  CZ2   . TRP C 1 130 ? -1.752  58.469  12.863  1.00 29.13 ? 131  TRP C CZ2   1 
ATOM   4328 C  CZ3   . TRP C 1 130 ? -2.227  56.476  14.134  1.00 30.29 ? 131  TRP C CZ3   1 
ATOM   4329 C  CH2   . TRP C 1 130 ? -1.331  57.427  13.639  1.00 30.57 ? 131  TRP C CH2   1 
ATOM   4330 N  N     . ARG C 1 131 ? -8.112  59.256  15.030  1.00 31.82 ? 132  ARG C N     1 
ATOM   4331 C  CA    . ARG C 1 131 ? -8.172  60.535  15.753  1.00 32.45 ? 132  ARG C CA    1 
ATOM   4332 C  C     . ARG C 1 131 ? -8.569  60.418  17.211  1.00 32.24 ? 132  ARG C C     1 
ATOM   4333 O  O     . ARG C 1 131 ? -8.583  61.414  17.923  1.00 32.99 ? 132  ARG C O     1 
ATOM   4334 C  CB    . ARG C 1 131 ? -9.111  61.477  15.050  1.00 33.09 ? 132  ARG C CB    1 
ATOM   4335 C  CG    . ARG C 1 131 ? -8.679  61.767  13.663  1.00 35.18 ? 132  ARG C CG    1 
ATOM   4336 C  CD    . ARG C 1 131 ? -9.821  62.374  12.965  1.00 38.70 ? 132  ARG C CD    1 
ATOM   4337 N  NE    . ARG C 1 131 ? -9.382  63.105  11.795  1.00 40.75 ? 132  ARG C NE    1 
ATOM   4338 C  CZ    . ARG C 1 131 ? -10.074 64.101  11.257  1.00 41.93 ? 132  ARG C CZ    1 
ATOM   4339 N  NH1   . ARG C 1 131 ? -11.243 64.479  11.785  1.00 40.73 ? 132  ARG C NH1   1 
ATOM   4340 N  NH2   . ARG C 1 131 ? -9.577  64.720  10.200  1.00 42.80 ? 132  ARG C NH2   1 
ATOM   4341 N  N     . ASP C 1 132 ? -8.891  59.212  17.666  1.00 31.90 ? 133  ASP C N     1 
ATOM   4342 C  CA    . ASP C 1 132 ? -9.207  58.996  19.067  1.00 32.55 ? 133  ASP C CA    1 
ATOM   4343 C  C     . ASP C 1 132 ? -7.957  59.109  19.953  1.00 32.17 ? 133  ASP C C     1 
ATOM   4344 O  O     . ASP C 1 132 ? -6.887  58.623  19.589  1.00 31.37 ? 133  ASP C O     1 
ATOM   4345 C  CB    . ASP C 1 132 ? -9.875  57.634  19.263  1.00 32.62 ? 133  ASP C CB    1 
ATOM   4346 C  CG    . ASP C 1 132 ? -10.184 57.338  20.718  1.00 33.34 ? 133  ASP C CG    1 
ATOM   4347 O  OD1   . ASP C 1 132 ? -11.250 57.754  21.221  1.00 30.58 ? 133  ASP C OD1   1 
ATOM   4348 O  OD2   . ASP C 1 132 ? -9.351  56.660  21.356  1.00 33.09 ? 133  ASP C OD2   1 
ATOM   4349 N  N     . GLY C 1 133 ? -8.136  59.734  21.126  1.00 32.48 ? 134  GLY C N     1 
ATOM   4350 C  CA    . GLY C 1 133 ? -7.043  60.005  22.076  1.00 32.72 ? 134  GLY C CA    1 
ATOM   4351 C  C     . GLY C 1 133 ? -6.356  58.764  22.614  1.00 32.77 ? 134  GLY C C     1 
ATOM   4352 O  O     . GLY C 1 133 ? -5.143  58.746  22.837  1.00 33.08 ? 134  GLY C O     1 
ATOM   4353 N  N     . GLY C 1 134 ? -7.151  57.726  22.851  1.00 32.54 ? 135  GLY C N     1 
ATOM   4354 C  CA    . GLY C 1 134 ? -6.633  56.433  23.288  1.00 32.26 ? 135  GLY C CA    1 
ATOM   4355 C  C     . GLY C 1 134 ? -5.879  55.713  22.198  1.00 31.59 ? 135  GLY C C     1 
ATOM   4356 O  O     . GLY C 1 134 ? -4.845  55.064  22.448  1.00 31.33 ? 135  GLY C O     1 
ATOM   4357 N  N     . VAL C 1 135 ? -6.387  55.802  20.973  1.00 31.16 ? 136  VAL C N     1 
ATOM   4358 C  CA    . VAL C 1 135 ? -5.680  55.184  19.848  1.00 30.13 ? 136  VAL C CA    1 
ATOM   4359 C  C     . VAL C 1 135 ? -4.333  55.877  19.655  1.00 30.56 ? 136  VAL C C     1 
ATOM   4360 O  O     . VAL C 1 135 ? -3.300  55.222  19.411  1.00 29.18 ? 136  VAL C O     1 
ATOM   4361 C  CB    . VAL C 1 135 ? -6.548  55.197  18.572  1.00 30.34 ? 136  VAL C CB    1 
ATOM   4362 C  CG1   . VAL C 1 135 ? -5.742  54.788  17.342  1.00 26.31 ? 136  VAL C CG1   1 
ATOM   4363 C  CG2   . VAL C 1 135 ? -7.804  54.266  18.792  1.00 29.12 ? 136  VAL C CG2   1 
ATOM   4364 N  N     . GLN C 1 136 ? -4.338  57.200  19.806  1.00 30.50 ? 137  GLN C N     1 
ATOM   4365 C  CA    . GLN C 1 136 ? -3.127  57.975  19.627  1.00 31.34 ? 137  GLN C CA    1 
ATOM   4366 C  C     . GLN C 1 136 ? -2.103  57.701  20.719  1.00 31.32 ? 137  GLN C C     1 
ATOM   4367 O  O     . GLN C 1 136 ? -0.910  57.652  20.447  1.00 32.13 ? 137  GLN C O     1 
ATOM   4368 C  CB    . GLN C 1 136 ? -3.462  59.457  19.517  1.00 31.70 ? 137  GLN C CB    1 
ATOM   4369 C  CG    . GLN C 1 136 ? -3.965  59.839  18.150  1.00 32.67 ? 137  GLN C CG    1 
ATOM   4370 C  CD    . GLN C 1 136 ? -2.886  59.670  17.120  1.00 34.04 ? 137  GLN C CD    1 
ATOM   4371 O  OE1   . GLN C 1 136 ? -1.733  59.967  17.398  1.00 35.93 ? 137  GLN C OE1   1 
ATOM   4372 N  NE2   . GLN C 1 136 ? -3.231  59.096  15.953  1.00 32.51 ? 137  GLN C NE2   1 
ATOM   4373 N  N     . ALA C 1 137 ? -2.580  57.529  21.950  1.00 31.52 ? 138  ALA C N     1 
ATOM   4374 C  CA    . ALA C 1 137 ? -1.747  57.112  23.060  1.00 31.37 ? 138  ALA C CA    1 
ATOM   4375 C  C     . ALA C 1 137 ? -1.092  55.727  22.772  1.00 31.29 ? 138  ALA C C     1 
ATOM   4376 O  O     . ALA C 1 137 ? 0.111   55.510  23.026  1.00 30.15 ? 138  ALA C O     1 
ATOM   4377 C  CB    . ALA C 1 137 ? -2.569  57.110  24.364  1.00 31.17 ? 138  ALA C CB    1 
ATOM   4378 N  N     . CYS C 1 138 ? -1.853  54.807  22.182  1.00 30.71 ? 139  CYS C N     1 
ATOM   4379 C  CA    . CYS C 1 138 ? -1.290  53.507  21.845  1.00 31.25 ? 139  CYS C CA    1 
ATOM   4380 C  C     . CYS C 1 138 ? -0.284  53.644  20.697  1.00 31.26 ? 139  CYS C C     1 
ATOM   4381 O  O     . CYS C 1 138 ? 0.812   53.054  20.734  1.00 31.64 ? 139  CYS C O     1 
ATOM   4382 C  CB    . CYS C 1 138 ? -2.398  52.520  21.477  1.00 31.65 ? 139  CYS C CB    1 
ATOM   4383 S  SG    . CYS C 1 138 ? -1.800  50.824  21.295  1.00 30.22 ? 139  CYS C SG    1 
ATOM   4384 N  N     . PHE C 1 139 ? -0.647  54.420  19.676  1.00 31.16 ? 140  PHE C N     1 
ATOM   4385 C  CA    . PHE C 1 139 ? 0.276   54.712  18.596  1.00 31.94 ? 140  PHE C CA    1 
ATOM   4386 C  C     . PHE C 1 139 ? 1.634   55.191  19.127  1.00 32.90 ? 140  PHE C C     1 
ATOM   4387 O  O     . PHE C 1 139 ? 2.695   54.730  18.665  1.00 31.45 ? 140  PHE C O     1 
ATOM   4388 C  CB    . PHE C 1 139 ? -0.312  55.739  17.623  1.00 32.41 ? 140  PHE C CB    1 
ATOM   4389 C  CG    . PHE C 1 139 ? 0.678   56.225  16.627  1.00 32.05 ? 140  PHE C CG    1 
ATOM   4390 C  CD1   . PHE C 1 139 ? 1.126   55.379  15.638  1.00 32.32 ? 140  PHE C CD1   1 
ATOM   4391 C  CD2   . PHE C 1 139 ? 1.217   57.508  16.715  1.00 33.01 ? 140  PHE C CD2   1 
ATOM   4392 C  CE1   . PHE C 1 139 ? 2.060   55.799  14.717  1.00 34.39 ? 140  PHE C CE1   1 
ATOM   4393 C  CE2   . PHE C 1 139 ? 2.164   57.934  15.799  1.00 34.12 ? 140  PHE C CE2   1 
ATOM   4394 C  CZ    . PHE C 1 139 ? 2.586   57.099  14.816  1.00 34.07 ? 140  PHE C CZ    1 
ATOM   4395 N  N     . SER C 1 140 ? 1.590   56.091  20.107  1.00 34.45 ? 141  SER C N     1 
ATOM   4396 C  CA    . SER C 1 140 ? 2.815   56.659  20.717  1.00 36.65 ? 141  SER C CA    1 
ATOM   4397 C  C     . SER C 1 140 ? 3.677   55.595  21.397  1.00 36.22 ? 141  SER C C     1 
ATOM   4398 O  O     . SER C 1 140 ? 4.891   55.781  21.552  1.00 37.88 ? 141  SER C O     1 
ATOM   4399 C  CB    . SER C 1 140 ? 2.486   57.751  21.732  1.00 36.33 ? 141  SER C CB    1 
ATOM   4400 O  OG    . SER C 1 140 ? 1.854   58.860  21.100  1.00 40.64 ? 141  SER C OG    1 
ATOM   4401 N  N     . ARG C 1 141 ? 3.052   54.484  21.769  1.00 34.72 ? 142  ARG C N     1 
ATOM   4402 C  CA    . ARG C 1 141 ? 3.732   53.386  22.421  1.00 34.41 ? 142  ARG C CA    1 
ATOM   4403 C  C     . ARG C 1 141 ? 4.001   52.215  21.472  1.00 34.20 ? 142  ARG C C     1 
ATOM   4404 O  O     . ARG C 1 141 ? 4.131   51.082  21.909  1.00 33.46 ? 142  ARG C O     1 
ATOM   4405 C  CB    . ARG C 1 141 ? 2.899   52.952  23.635  1.00 34.48 ? 142  ARG C CB    1 
ATOM   4406 C  CG    . ARG C 1 141 ? 2.977   53.948  24.763  1.00 34.96 ? 142  ARG C CG    1 
ATOM   4407 C  CD    . ARG C 1 141 ? 2.001   53.645  25.899  1.00 35.18 ? 142  ARG C CD    1 
ATOM   4408 N  NE    . ARG C 1 141 ? 2.250   52.326  26.452  1.00 35.80 ? 142  ARG C NE    1 
ATOM   4409 C  CZ    . ARG C 1 141 ? 1.465   51.691  27.315  1.00 35.91 ? 142  ARG C CZ    1 
ATOM   4410 N  NH1   . ARG C 1 141 ? 1.815   50.490  27.738  1.00 36.34 ? 142  ARG C NH1   1 
ATOM   4411 N  NH2   . ARG C 1 141 ? 0.336   52.222  27.747  1.00 36.43 ? 142  ARG C NH2   1 
ATOM   4412 N  N     . SER C 1 142 ? 4.112   52.504  20.170  1.00 33.45 ? 143  SER C N     1 
ATOM   4413 C  CA    . SER C 1 142 ? 4.240   51.468  19.140  1.00 34.43 ? 143  SER C CA    1 
ATOM   4414 C  C     . SER C 1 142 ? 5.537   50.656  19.264  1.00 34.89 ? 143  SER C C     1 
ATOM   4415 O  O     . SER C 1 142 ? 5.562   49.531  18.862  1.00 34.41 ? 143  SER C O     1 
ATOM   4416 C  CB    . SER C 1 142 ? 4.096   52.053  17.718  1.00 33.90 ? 143  SER C CB    1 
ATOM   4417 O  OG    . SER C 1 142 ? 5.194   52.874  17.356  1.00 32.89 ? 143  SER C OG    1 
ATOM   4418 N  N     . ARG C 1 143 ? 6.571   51.192  19.904  1.00 35.74 ? 144  ARG C N     1 
ATOM   4419 C  CA    . ARG C 1 143 ? 7.742   50.348  20.198  1.00 36.83 ? 144  ARG C CA    1 
ATOM   4420 C  C     . ARG C 1 143 ? 7.434   49.088  21.044  1.00 36.15 ? 144  ARG C C     1 
ATOM   4421 O  O     . ARG C 1 143 ? 8.237   48.148  21.101  1.00 35.61 ? 144  ARG C O     1 
ATOM   4422 C  CB    . ARG C 1 143 ? 8.847   51.169  20.835  1.00 37.27 ? 144  ARG C CB    1 
ATOM   4423 C  CG    . ARG C 1 143 ? 8.668   51.462  22.283  1.00 39.73 ? 144  ARG C CG    1 
ATOM   4424 C  CD    . ARG C 1 143 ? 9.808   52.283  22.749  1.00 44.62 ? 144  ARG C CD    1 
ATOM   4425 N  NE    . ARG C 1 143 ? 9.929   52.211  24.175  1.00 49.81 ? 144  ARG C NE    1 
ATOM   4426 C  CZ    . ARG C 1 143 ? 10.687  51.335  24.835  1.00 53.53 ? 144  ARG C CZ    1 
ATOM   4427 N  NH1   . ARG C 1 143 ? 11.445  50.442  24.195  1.00 53.89 ? 144  ARG C NH1   1 
ATOM   4428 N  NH2   . ARG C 1 143 ? 10.702  51.379  26.162  1.00 54.05 ? 144  ARG C NH2   1 
ATOM   4429 N  N     . GLU C 1 144 ? 6.271   49.064  21.696  1.00 35.80 ? 145  GLU C N     1 
ATOM   4430 C  CA    . GLU C 1 144 ? 5.893   47.944  22.509  1.00 35.37 ? 145  GLU C CA    1 
ATOM   4431 C  C     . GLU C 1 144 ? 5.220   46.829  21.707  1.00 35.16 ? 145  GLU C C     1 
ATOM   4432 O  O     . GLU C 1 144 ? 4.891   45.786  22.272  1.00 36.22 ? 145  GLU C O     1 
ATOM   4433 C  CB    . GLU C 1 144 ? 4.994   48.404  23.664  1.00 35.11 ? 145  GLU C CB    1 
ATOM   4434 C  CG    . GLU C 1 144 ? 5.730   49.356  24.615  1.00 36.85 ? 145  GLU C CG    1 
ATOM   4435 C  CD    . GLU C 1 144 ? 4.876   49.899  25.749  1.00 36.86 ? 145  GLU C CD    1 
ATOM   4436 O  OE1   . GLU C 1 144 ? 4.084   49.146  26.343  1.00 38.82 ? 145  GLU C OE1   1 
ATOM   4437 O  OE2   . GLU C 1 144 ? 5.012   51.106  26.038  1.00 38.36 ? 145  GLU C OE2   1 
ATOM   4438 N  N     . TYR C 1 145 ? 4.986   47.041  20.415  1.00 33.57 ? 146  TYR C N     1 
ATOM   4439 C  CA    . TYR C 1 145 ? 4.364   46.018  19.592  1.00 32.85 ? 146  TYR C CA    1 
ATOM   4440 C  C     . TYR C 1 145 ? 5.002   46.143  18.208  1.00 32.64 ? 146  TYR C C     1 
ATOM   4441 O  O     . TYR C 1 145 ? 6.093   46.686  18.110  1.00 33.96 ? 146  TYR C O     1 
ATOM   4442 C  CB    . TYR C 1 145 ? 2.829   46.104  19.632  1.00 32.36 ? 146  TYR C CB    1 
ATOM   4443 C  CG    . TYR C 1 145 ? 2.228   47.452  19.356  1.00 31.42 ? 146  TYR C CG    1 
ATOM   4444 C  CD1   . TYR C 1 145 ? 2.112   48.388  20.357  1.00 32.07 ? 146  TYR C CD1   1 
ATOM   4445 C  CD2   . TYR C 1 145 ? 1.787   47.805  18.059  1.00 31.95 ? 146  TYR C CD2   1 
ATOM   4446 C  CE1   . TYR C 1 145 ? 1.562   49.648  20.107  1.00 31.98 ? 146  TYR C CE1   1 
ATOM   4447 C  CE2   . TYR C 1 145 ? 1.240   49.054  17.800  1.00 31.75 ? 146  TYR C CE2   1 
ATOM   4448 C  CZ    . TYR C 1 145 ? 1.133   49.968  18.809  1.00 32.12 ? 146  TYR C CZ    1 
ATOM   4449 O  OH    . TYR C 1 145 ? 0.601   51.227  18.554  1.00 33.19 ? 146  TYR C OH    1 
ATOM   4450 N  N     . GLN C 1 146 ? 4.364   45.667  17.164  1.00 32.19 ? 147  GLN C N     1 
ATOM   4451 C  CA    . GLN C 1 146 ? 4.931   45.702  15.830  1.00 32.51 ? 147  GLN C CA    1 
ATOM   4452 C  C     . GLN C 1 146 ? 4.017   46.520  14.919  1.00 33.08 ? 147  GLN C C     1 
ATOM   4453 O  O     . GLN C 1 146 ? 2.896   46.117  14.658  1.00 33.54 ? 147  GLN C O     1 
ATOM   4454 C  CB    . GLN C 1 146 ? 5.079   44.289  15.266  1.00 32.66 ? 147  GLN C CB    1 
ATOM   4455 C  CG    . GLN C 1 146 ? 6.020   43.393  16.035  1.00 32.50 ? 147  GLN C CG    1 
ATOM   4456 C  CD    . GLN C 1 146 ? 7.471   43.842  15.978  1.00 32.38 ? 147  GLN C CD    1 
ATOM   4457 O  OE1   . GLN C 1 146 ? 7.981   44.306  14.936  1.00 31.46 ? 147  GLN C OE1   1 
ATOM   4458 N  NE2   . GLN C 1 146 ? 8.145   43.736  17.130  1.00 33.36 ? 147  GLN C NE2   1 
ATOM   4459 N  N     . LEU C 1 147 ? 4.500   47.669  14.486  1.00 32.52 ? 148  LEU C N     1 
ATOM   4460 C  CA    . LEU C 1 147 ? 3.739   48.568  13.637  1.00 32.05 ? 148  LEU C CA    1 
ATOM   4461 C  C     . LEU C 1 147 ? 4.586   49.022  12.459  1.00 32.81 ? 148  LEU C C     1 
ATOM   4462 O  O     . LEU C 1 147 ? 5.738   49.436  12.651  1.00 33.20 ? 148  LEU C O     1 
ATOM   4463 C  CB    . LEU C 1 147 ? 3.307   49.786  14.441  1.00 32.13 ? 148  LEU C CB    1 
ATOM   4464 C  CG    . LEU C 1 147 ? 2.367   50.790  13.741  1.00 30.55 ? 148  LEU C CG    1 
ATOM   4465 C  CD1   . LEU C 1 147 ? 1.020   50.116  13.478  1.00 30.61 ? 148  LEU C CD1   1 
ATOM   4466 C  CD2   . LEU C 1 147 ? 2.200   52.060  14.588  1.00 31.33 ? 148  LEU C CD2   1 
ATOM   4467 N  N     . ASN C 1 148 ? 4.004   48.974  11.252  1.00 33.71 ? 149  ASN C N     1 
ATOM   4468 C  CA    . ASN C 1 148 ? 4.686   49.410  10.025  1.00 34.41 ? 149  ASN C CA    1 
ATOM   4469 C  C     . ASN C 1 148 ? 5.125   50.861  10.142  1.00 33.66 ? 149  ASN C C     1 
ATOM   4470 O  O     . ASN C 1 148 ? 4.362   51.719  10.608  1.00 30.73 ? 149  ASN C O     1 
ATOM   4471 C  CB    . ASN C 1 148 ? 3.748   49.339  8.811   1.00 35.75 ? 149  ASN C CB    1 
ATOM   4472 C  CG    . ASN C 1 148 ? 3.483   47.937  8.342   1.00 37.68 ? 149  ASN C CG    1 
ATOM   4473 O  OD1   . ASN C 1 148 ? 4.037   46.955  8.856   1.00 40.71 ? 149  ASN C OD1   1 
ATOM   4474 N  ND2   . ASN C 1 148 ? 2.589   47.829  7.375   1.00 39.42 ? 149  ASN C ND2   1 
ATOM   4475 N  N     . ASP C 1 149 ? 6.330   51.163  9.677   1.00 33.92 ? 150  ASP C N     1 
ATOM   4476 C  CA    . ASP C 1 149 ? 6.789   52.550  9.749   1.00 35.93 ? 150  ASP C CA    1 
ATOM   4477 C  C     . ASP C 1 149 ? 5.936   53.549  8.995   1.00 34.43 ? 150  ASP C C     1 
ATOM   4478 O  O     . ASP C 1 149 ? 5.892   54.729  9.368   1.00 34.60 ? 150  ASP C O     1 
ATOM   4479 C  CB    . ASP C 1 149 ? 8.218   52.683  9.267   1.00 37.13 ? 150  ASP C CB    1 
ATOM   4480 C  CG    . ASP C 1 149 ? 9.229   52.452  10.386  1.00 42.05 ? 150  ASP C CG    1 
ATOM   4481 O  OD1   . ASP C 1 149 ? 8.848   52.554  11.584  1.00 46.49 ? 150  ASP C OD1   1 
ATOM   4482 O  OD2   . ASP C 1 149 ? 10.381  52.126  10.040  1.00 43.60 ? 150  ASP C OD2   1 
ATOM   4483 N  N     . SER C 1 150 ? 5.260   53.097  7.941   1.00 33.42 ? 151  SER C N     1 
ATOM   4484 C  CA    . SER C 1 150 ? 4.445   54.013  7.131   1.00 32.64 ? 151  SER C CA    1 
ATOM   4485 C  C     . SER C 1 150 ? 3.003   54.199  7.655   1.00 32.17 ? 151  SER C C     1 
ATOM   4486 O  O     . SER C 1 150 ? 2.192   54.873  7.003   1.00 31.54 ? 151  SER C O     1 
ATOM   4487 C  CB    . SER C 1 150 ? 4.421   53.568  5.677   1.00 32.85 ? 151  SER C CB    1 
ATOM   4488 O  OG    . SER C 1 150 ? 5.729   53.526  5.151   1.00 31.91 ? 151  SER C OG    1 
ATOM   4489 N  N     . ALA C 1 151 ? 2.710   53.604  8.811   1.00 30.53 ? 152  ALA C N     1 
ATOM   4490 C  CA    . ALA C 1 151 ? 1.362   53.649  9.400   1.00 30.73 ? 152  ALA C CA    1 
ATOM   4491 C  C     . ALA C 1 151 ? 0.820   55.067  9.447   1.00 30.12 ? 152  ALA C C     1 
ATOM   4492 O  O     . ALA C 1 151 ? -0.253  55.358  8.885   1.00 29.50 ? 152  ALA C O     1 
ATOM   4493 C  CB    . ALA C 1 151 ? 1.355   53.006  10.846  1.00 29.65 ? 152  ALA C CB    1 
ATOM   4494 N  N     . SER C 1 152 ? 1.566   55.956  10.098  1.00 30.54 ? 153  SER C N     1 
ATOM   4495 C  CA    . SER C 1 152 ? 1.096   57.322  10.301  1.00 31.08 ? 153  SER C CA    1 
ATOM   4496 C  C     . SER C 1 152 ? 1.107   58.115  8.956   1.00 30.48 ? 153  SER C C     1 
ATOM   4497 O  O     . SER C 1 152 ? 0.276   59.014  8.747   1.00 29.69 ? 153  SER C O     1 
ATOM   4498 C  CB    . SER C 1 152 ? 1.899   58.054  11.388  1.00 30.38 ? 153  SER C CB    1 
ATOM   4499 O  OG    . SER C 1 152 ? 3.268   58.193  11.036  1.00 33.70 ? 153  SER C OG    1 
ATOM   4500 N  N     . TYR C 1 153 ? 2.051   57.805  8.071   1.00 30.17 ? 154  TYR C N     1 
ATOM   4501 C  CA    . TYR C 1 153 ? 2.066   58.417  6.746   1.00 30.67 ? 154  TYR C CA    1 
ATOM   4502 C  C     . TYR C 1 153 ? 0.711   58.253  6.000   1.00 30.23 ? 154  TYR C C     1 
ATOM   4503 O  O     . TYR C 1 153 ? 0.122   59.232  5.471   1.00 30.37 ? 154  TYR C O     1 
ATOM   4504 C  CB    . TYR C 1 153 ? 3.242   57.895  5.911   1.00 31.41 ? 154  TYR C CB    1 
ATOM   4505 C  CG    . TYR C 1 153 ? 3.234   58.394  4.495   1.00 31.63 ? 154  TYR C CG    1 
ATOM   4506 C  CD1   . TYR C 1 153 ? 3.907   59.557  4.148   1.00 35.35 ? 154  TYR C CD1   1 
ATOM   4507 C  CD2   . TYR C 1 153 ? 2.572   57.690  3.496   1.00 33.31 ? 154  TYR C CD2   1 
ATOM   4508 C  CE1   . TYR C 1 153 ? 3.906   60.041  2.827   1.00 33.48 ? 154  TYR C CE1   1 
ATOM   4509 C  CE2   . TYR C 1 153 ? 2.571   58.153  2.158   1.00 34.70 ? 154  TYR C CE2   1 
ATOM   4510 C  CZ    . TYR C 1 153 ? 3.254   59.323  1.838   1.00 33.85 ? 154  TYR C CZ    1 
ATOM   4511 O  OH    . TYR C 1 153 ? 3.228   59.809  0.543   1.00 33.19 ? 154  TYR C OH    1 
ATOM   4512 N  N     . TYR C 1 154 ? 0.186   57.042  6.000   1.00 29.89 ? 155  TYR C N     1 
ATOM   4513 C  CA    . TYR C 1 154 ? -1.069  56.783  5.306   1.00 30.44 ? 155  TYR C CA    1 
ATOM   4514 C  C     . TYR C 1 154 ? -2.283  57.226  6.104   1.00 30.65 ? 155  TYR C C     1 
ATOM   4515 O  O     . TYR C 1 154 ? -3.232  57.758  5.532   1.00 29.70 ? 155  TYR C O     1 
ATOM   4516 C  CB    . TYR C 1 154 ? -1.207  55.286  4.972   1.00 31.11 ? 155  TYR C CB    1 
ATOM   4517 C  CG    . TYR C 1 154 ? -0.213  54.746  3.944   1.00 31.38 ? 155  TYR C CG    1 
ATOM   4518 C  CD1   . TYR C 1 154 ? -0.083  55.332  2.688   1.00 32.83 ? 155  TYR C CD1   1 
ATOM   4519 C  CD2   . TYR C 1 154 ? 0.566   53.635  4.223   1.00 33.67 ? 155  TYR C CD2   1 
ATOM   4520 C  CE1   . TYR C 1 154 ? 0.814   54.848  1.762   1.00 32.77 ? 155  TYR C CE1   1 
ATOM   4521 C  CE2   . TYR C 1 154 ? 1.466   53.117  3.285   1.00 32.56 ? 155  TYR C CE2   1 
ATOM   4522 C  CZ    . TYR C 1 154 ? 1.579   53.721  2.049   1.00 34.04 ? 155  TYR C CZ    1 
ATOM   4523 O  OH    . TYR C 1 154 ? 2.488   53.217  1.132   1.00 32.97 ? 155  TYR C OH    1 
ATOM   4524 N  N     . LEU C 1 155 ? -2.273  56.955  7.422   1.00 29.97 ? 156  LEU C N     1 
ATOM   4525 C  CA    . LEU C 1 155 ? -3.420  57.273  8.278   1.00 30.07 ? 156  LEU C CA    1 
ATOM   4526 C  C     . LEU C 1 155 ? -3.633  58.791  8.355   1.00 30.44 ? 156  LEU C C     1 
ATOM   4527 O  O     . LEU C 1 155 ? -4.771  59.263  8.326   1.00 30.13 ? 156  LEU C O     1 
ATOM   4528 C  CB    . LEU C 1 155 ? -3.263  56.634  9.658   1.00 30.31 ? 156  LEU C CB    1 
ATOM   4529 C  CG    . LEU C 1 155 ? -3.455  55.103  9.663   1.00 28.95 ? 156  LEU C CG    1 
ATOM   4530 C  CD1   . LEU C 1 155 ? -2.944  54.464  10.947  1.00 31.99 ? 156  LEU C CD1   1 
ATOM   4531 C  CD2   . LEU C 1 155 ? -4.942  54.759  9.440   1.00 28.32 ? 156  LEU C CD2   1 
ATOM   4532 N  N     . ASN C 1 156 ? -2.539  59.557  8.360   1.00 30.34 ? 157  ASN C N     1 
ATOM   4533 C  CA    . ASN C 1 156 ? -2.635  61.044  8.349   1.00 30.04 ? 157  ASN C CA    1 
ATOM   4534 C  C     . ASN C 1 156 ? -3.136  61.653  7.025   1.00 30.78 ? 157  ASN C C     1 
ATOM   4535 O  O     . ASN C 1 156 ? -3.616  62.781  6.995   1.00 30.33 ? 157  ASN C O     1 
ATOM   4536 C  CB    . ASN C 1 156 ? -1.274  61.644  8.735   1.00 30.49 ? 157  ASN C CB    1 
ATOM   4537 C  CG    . ASN C 1 156 ? -1.016  61.575  10.245  1.00 27.00 ? 157  ASN C CG    1 
ATOM   4538 O  OD1   . ASN C 1 156 ? -1.953  61.560  11.029  1.00 30.56 ? 157  ASN C OD1   1 
ATOM   4539 N  ND2   . ASN C 1 156 ? 0.249   61.579  10.646  1.00 28.60 ? 157  ASN C ND2   1 
ATOM   4540 N  N     . ASP C 1 157 ? -3.022  60.887  5.945   1.00 31.07 ? 158  ASP C N     1 
ATOM   4541 C  CA    . ASP C 1 157 ? -3.382  61.320  4.585   1.00 32.57 ? 158  ASP C CA    1 
ATOM   4542 C  C     . ASP C 1 157 ? -4.592  60.485  4.138   1.00 32.64 ? 158  ASP C C     1 
ATOM   4543 O  O     . ASP C 1 157 ? -4.792  60.236  2.933   1.00 32.82 ? 158  ASP C O     1 
ATOM   4544 C  CB    . ASP C 1 157 ? -2.167  61.107  3.654   1.00 31.83 ? 158  ASP C CB    1 
ATOM   4545 C  CG    . ASP C 1 157 ? -1.636  62.389  3.024   1.00 36.80 ? 158  ASP C CG    1 
ATOM   4546 O  OD1   . ASP C 1 157 ? -2.411  63.330  2.609   1.00 37.91 ? 158  ASP C OD1   1 
ATOM   4547 O  OD2   . ASP C 1 157 ? -0.403  62.400  2.812   1.00 43.78 ? 158  ASP C OD2   1 
ATOM   4548 N  N     . LEU C 1 158 ? -5.413  60.074  5.112   1.00 33.02 ? 159  LEU C N     1 
ATOM   4549 C  CA    . LEU C 1 158 ? -6.564  59.214  4.854   1.00 34.20 ? 159  LEU C CA    1 
ATOM   4550 C  C     . LEU C 1 158 ? -7.581  59.866  3.917   1.00 34.07 ? 159  LEU C C     1 
ATOM   4551 O  O     . LEU C 1 158 ? -8.122  59.197  3.045   1.00 34.28 ? 159  LEU C O     1 
ATOM   4552 C  CB    . LEU C 1 158 ? -7.277  58.795  6.148   1.00 34.32 ? 159  LEU C CB    1 
ATOM   4553 C  CG    . LEU C 1 158 ? -8.372  57.724  5.977   1.00 34.96 ? 159  LEU C CG    1 
ATOM   4554 C  CD1   . LEU C 1 158 ? -7.776  56.373  5.570   1.00 35.79 ? 159  LEU C CD1   1 
ATOM   4555 C  CD2   . LEU C 1 158 ? -9.172  57.588  7.267   1.00 35.24 ? 159  LEU C CD2   1 
ATOM   4556 N  N     . ASP C 1 159 ? -7.831  61.162  4.096   1.00 34.03 ? 160  ASP C N     1 
ATOM   4557 C  CA    . ASP C 1 159 ? -8.790  61.852  3.240   1.00 34.69 ? 160  ASP C CA    1 
ATOM   4558 C  C     . ASP C 1 159 ? -8.372  61.773  1.773   1.00 34.03 ? 160  ASP C C     1 
ATOM   4559 O  O     . ASP C 1 159 ? -9.206  61.536  0.913   1.00 34.49 ? 160  ASP C O     1 
ATOM   4560 C  CB    . ASP C 1 159 ? -8.963  63.314  3.660   1.00 35.37 ? 160  ASP C CB    1 
ATOM   4561 C  CG    . ASP C 1 159 ? -9.663  63.473  5.019   1.00 38.21 ? 160  ASP C CG    1 
ATOM   4562 O  OD1   . ASP C 1 159 ? -10.242 62.497  5.573   1.00 42.08 ? 160  ASP C OD1   1 
ATOM   4563 O  OD2   . ASP C 1 159 ? -9.619  64.602  5.547   1.00 44.38 ? 160  ASP C OD2   1 
ATOM   4564 N  N     . ARG C 1 160 ? -7.092  61.987  1.491   1.00 33.50 ? 161  ARG C N     1 
ATOM   4565 C  CA    . ARG C 1 160 ? -6.579  61.880  0.127   1.00 34.04 ? 161  ARG C CA    1 
ATOM   4566 C  C     . ARG C 1 160 ? -6.618  60.462  -0.434  1.00 33.46 ? 161  ARG C C     1 
ATOM   4567 O  O     . ARG C 1 160 ? -7.111  60.229  -1.550  1.00 33.80 ? 161  ARG C O     1 
ATOM   4568 C  CB    . ARG C 1 160 ? -5.155  62.426  0.025   1.00 34.13 ? 161  ARG C CB    1 
ATOM   4569 C  CG    . ARG C 1 160 ? -4.528  62.257  -1.381  1.00 35.11 ? 161  ARG C CG    1 
ATOM   4570 C  CD    . ARG C 1 160 ? -3.159  62.893  -1.455  1.00 34.76 ? 161  ARG C CD    1 
ATOM   4571 N  NE    . ARG C 1 160 ? -2.185  62.232  -0.587  1.00 35.78 ? 161  ARG C NE    1 
ATOM   4572 C  CZ    . ARG C 1 160 ? -1.541  61.103  -0.875  1.00 35.19 ? 161  ARG C CZ    1 
ATOM   4573 N  NH1   . ARG C 1 160 ? -1.753  60.467  -2.016  1.00 33.84 ? 161  ARG C NH1   1 
ATOM   4574 N  NH2   . ARG C 1 160 ? -0.667  60.596  -0.004  1.00 35.32 ? 161  ARG C NH2   1 
ATOM   4575 N  N     . ILE C 1 161 ? -6.108  59.515  0.334   1.00 32.90 ? 162  ILE C N     1 
ATOM   4576 C  CA    A ILE C 1 161 ? -5.962  58.134  -0.097  0.50 33.27 ? 162  ILE C CA    1 
ATOM   4577 C  CA    B ILE C 1 161 ? -5.970  58.155  -0.170  0.50 32.42 ? 162  ILE C CA    1 
ATOM   4578 C  C     . ILE C 1 161 ? -7.295  57.404  -0.260  1.00 33.11 ? 162  ILE C C     1 
ATOM   4579 O  O     . ILE C 1 161 ? -7.409  56.468  -1.051  1.00 32.86 ? 162  ILE C O     1 
ATOM   4580 C  CB    A ILE C 1 161 ? -5.096  57.343  0.914   0.50 33.32 ? 162  ILE C CB    1 
ATOM   4581 C  CB    B ILE C 1 161 ? -4.909  57.324  0.604   0.50 32.41 ? 162  ILE C CB    1 
ATOM   4582 C  CG1   A ILE C 1 161 ? -3.696  57.965  1.073   0.50 33.75 ? 162  ILE C CG1   1 
ATOM   4583 C  CG1   B ILE C 1 161 ? -5.375  56.982  2.028   0.50 31.31 ? 162  ILE C CG1   1 
ATOM   4584 C  CG2   A ILE C 1 161 ? -4.975  55.893  0.500   0.50 34.43 ? 162  ILE C CG2   1 
ATOM   4585 C  CG2   B ILE C 1 161 ? -3.553  58.056  0.590   0.50 31.07 ? 162  ILE C CG2   1 
ATOM   4586 C  CD1   A ILE C 1 161 ? -2.991  58.294  -0.171  0.50 33.25 ? 162  ILE C CD1   1 
ATOM   4587 C  CD1   B ILE C 1 161 ? -4.449  56.027  2.763   0.50 31.07 ? 162  ILE C CD1   1 
ATOM   4588 N  N     . SER C 1 162 ? -8.306  57.817  0.503   1.00 33.81 ? 163  SER C N     1 
ATOM   4589 C  CA    . SER C 1 162 ? -9.607  57.149  0.438   1.00 34.63 ? 163  SER C CA    1 
ATOM   4590 C  C     . SER C 1 162 ? -10.521 57.625  -0.714  1.00 35.09 ? 163  SER C C     1 
ATOM   4591 O  O     . SER C 1 162 ? -11.613 57.079  -0.896  1.00 35.78 ? 163  SER C O     1 
ATOM   4592 C  CB    . SER C 1 162 ? -10.333 57.284  1.776   1.00 34.58 ? 163  SER C CB    1 
ATOM   4593 O  OG    . SER C 1 162 ? -10.831 58.589  1.937   1.00 35.65 ? 163  SER C OG    1 
ATOM   4594 N  N     . GLN C 1 163 ? -10.108 58.646  -1.468  1.00 35.37 ? 164  GLN C N     1 
ATOM   4595 C  CA    . GLN C 1 163 ? -10.916 59.126  -2.594  1.00 35.59 ? 164  GLN C CA    1 
ATOM   4596 C  C     . GLN C 1 163 ? -11.102 58.000  -3.604  1.00 35.66 ? 164  GLN C C     1 
ATOM   4597 O  O     . GLN C 1 163 ? -10.164 57.259  -3.901  1.00 35.22 ? 164  GLN C O     1 
ATOM   4598 C  CB    . GLN C 1 163 ? -10.290 60.352  -3.287  1.00 35.67 ? 164  GLN C CB    1 
ATOM   4599 C  CG    . GLN C 1 163 ? -10.074 61.573  -2.391  1.00 35.30 ? 164  GLN C CG    1 
ATOM   4600 C  CD    . GLN C 1 163 ? -11.361 62.102  -1.795  1.00 35.09 ? 164  GLN C CD    1 
ATOM   4601 O  OE1   . GLN C 1 163 ? -12.251 62.531  -2.523  1.00 32.82 ? 164  GLN C OE1   1 
ATOM   4602 N  NE2   . GLN C 1 163 ? -11.465 62.076  -0.460  1.00 34.20 ? 164  GLN C NE2   1 
ATOM   4603 N  N     . SER C 1 164 ? -12.311 57.889  -4.146  1.00 36.05 ? 165  SER C N     1 
ATOM   4604 C  CA    . SER C 1 164 ? -12.640 56.803  -5.073  1.00 36.25 ? 165  SER C CA    1 
ATOM   4605 C  C     . SER C 1 164 ? -11.693 56.739  -6.284  1.00 36.15 ? 165  SER C C     1 
ATOM   4606 O  O     . SER C 1 164 ? -11.406 55.661  -6.812  1.00 36.16 ? 165  SER C O     1 
ATOM   4607 C  CB    . SER C 1 164 ? -14.086 56.952  -5.554  1.00 36.48 ? 165  SER C CB    1 
ATOM   4608 O  OG    . SER C 1 164 ? -14.240 58.086  -6.393  1.00 37.59 ? 165  SER C OG    1 
ATOM   4609 N  N     . ASN C 1 165 ? -11.205 57.901  -6.700  1.00 35.96 ? 166  ASN C N     1 
ATOM   4610 C  CA    . ASN C 1 165 ? -10.318 58.019  -7.834  1.00 35.91 ? 166  ASN C CA    1 
ATOM   4611 C  C     . ASN C 1 165 ? -8.835  57.978  -7.451  1.00 35.17 ? 166  ASN C C     1 
ATOM   4612 O  O     . ASN C 1 165 ? -7.977  58.301  -8.280  1.00 34.36 ? 166  ASN C O     1 
ATOM   4613 C  CB    . ASN C 1 165 ? -10.625 59.333  -8.554  1.00 36.27 ? 166  ASN C CB    1 
ATOM   4614 C  CG    . ASN C 1 165 ? -10.164 60.544  -7.756  1.00 38.49 ? 166  ASN C CG    1 
ATOM   4615 O  OD1   . ASN C 1 165 ? -10.176 60.528  -6.526  1.00 41.14 ? 166  ASN C OD1   1 
ATOM   4616 N  ND2   . ASN C 1 165 ? -9.737  61.589  -8.452  1.00 42.39 ? 166  ASN C ND2   1 
ATOM   4617 N  N     . TYR C 1 166 ? -8.526  57.596  -6.201  1.00 34.81 ? 167  TYR C N     1 
ATOM   4618 C  CA    . TYR C 1 166 ? -7.151  57.612  -5.706  1.00 34.45 ? 167  TYR C CA    1 
ATOM   4619 C  C     . TYR C 1 166 ? -6.189  56.835  -6.609  1.00 34.30 ? 167  TYR C C     1 
ATOM   4620 O  O     . TYR C 1 166 ? -6.389  55.645  -6.860  1.00 33.53 ? 167  TYR C O     1 
ATOM   4621 C  CB    . TYR C 1 166 ? -7.092  57.030  -4.290  1.00 34.09 ? 167  TYR C CB    1 
ATOM   4622 C  CG    . TYR C 1 166 ? -5.700  56.773  -3.742  1.00 34.39 ? 167  TYR C CG    1 
ATOM   4623 C  CD1   . TYR C 1 166 ? -4.750  57.796  -3.645  1.00 33.84 ? 167  TYR C CD1   1 
ATOM   4624 C  CD2   . TYR C 1 166 ? -5.333  55.508  -3.315  1.00 34.10 ? 167  TYR C CD2   1 
ATOM   4625 C  CE1   . TYR C 1 166 ? -3.464  57.548  -3.147  1.00 33.19 ? 167  TYR C CE1   1 
ATOM   4626 C  CE2   . TYR C 1 166 ? -4.036  55.254  -2.784  1.00 34.31 ? 167  TYR C CE2   1 
ATOM   4627 C  CZ    . TYR C 1 166 ? -3.118  56.279  -2.715  1.00 34.17 ? 167  TYR C CZ    1 
ATOM   4628 O  OH    . TYR C 1 166 ? -1.863  56.040  -2.181  1.00 33.27 ? 167  TYR C OH    1 
ATOM   4629 N  N     . ILE C 1 167 ? -5.153  57.525  -7.083  1.00 34.66 ? 168  ILE C N     1 
ATOM   4630 C  CA    . ILE C 1 167 ? -3.969  56.866  -7.654  1.00 34.98 ? 168  ILE C CA    1 
ATOM   4631 C  C     . ILE C 1 167 ? -2.731  57.179  -6.807  1.00 34.89 ? 168  ILE C C     1 
ATOM   4632 O  O     . ILE C 1 167 ? -2.409  58.357  -6.618  1.00 36.01 ? 168  ILE C O     1 
ATOM   4633 C  CB    . ILE C 1 167 ? -3.681  57.341  -9.088  1.00 34.91 ? 168  ILE C CB    1 
ATOM   4634 C  CG1   . ILE C 1 167 ? -4.907  57.109  -9.973  1.00 35.73 ? 168  ILE C CG1   1 
ATOM   4635 C  CG2   . ILE C 1 167 ? -2.433  56.627  -9.644  1.00 34.79 ? 168  ILE C CG2   1 
ATOM   4636 C  CD1   . ILE C 1 167 ? -4.778  57.694  -11.370 1.00 35.33 ? 168  ILE C CD1   1 
ATOM   4637 N  N     . PRO C 1 168 ? -2.031  56.142  -6.309  1.00 34.47 ? 169  PRO C N     1 
ATOM   4638 C  CA    . PRO C 1 168 ? -0.817  56.385  -5.507  1.00 34.18 ? 169  PRO C CA    1 
ATOM   4639 C  C     . PRO C 1 168 ? 0.254   57.252  -6.160  1.00 34.12 ? 169  PRO C C     1 
ATOM   4640 O  O     . PRO C 1 168 ? 0.549   57.126  -7.337  1.00 34.08 ? 169  PRO C O     1 
ATOM   4641 C  CB    . PRO C 1 168 ? -0.277  54.972  -5.223  1.00 33.88 ? 169  PRO C CB    1 
ATOM   4642 C  CG    . PRO C 1 168 ? -1.429  54.093  -5.327  1.00 34.03 ? 169  PRO C CG    1 
ATOM   4643 C  CD    . PRO C 1 168 ? -2.337  54.700  -6.395  1.00 34.37 ? 169  PRO C CD    1 
ATOM   4644 N  N     . THR C 1 169 ? 0.798   58.169  -5.380  1.00 34.51 ? 170  THR C N     1 
ATOM   4645 C  CA    . THR C 1 169 ? 1.923   58.967  -5.815  1.00 34.66 ? 170  THR C CA    1 
ATOM   4646 C  C     . THR C 1 169 ? 3.167   58.108  -5.711  1.00 34.80 ? 170  THR C C     1 
ATOM   4647 O  O     . THR C 1 169 ? 3.152   57.013  -5.103  1.00 33.81 ? 170  THR C O     1 
ATOM   4648 C  CB    . THR C 1 169 ? 2.078   60.245  -4.948  1.00 35.43 ? 170  THR C CB    1 
ATOM   4649 O  OG1   . THR C 1 169 ? 2.365   59.896  -3.580  1.00 34.37 ? 170  THR C OG1   1 
ATOM   4650 C  CG2   . THR C 1 169 ? 0.784   61.098  -5.013  1.00 35.80 ? 170  THR C CG2   1 
ATOM   4651 N  N     . GLN C 1 170 ? 4.247   58.611  -6.287  1.00 34.75 ? 171  GLN C N     1 
ATOM   4652 C  CA    . GLN C 1 170 ? 5.520   57.920  -6.202  1.00 35.78 ? 171  GLN C CA    1 
ATOM   4653 C  C     . GLN C 1 170 ? 5.942   57.743  -4.726  1.00 34.79 ? 171  GLN C C     1 
ATOM   4654 O  O     . GLN C 1 170 ? 6.413   56.685  -4.344  1.00 34.50 ? 171  GLN C O     1 
ATOM   4655 C  CB    . GLN C 1 170 ? 6.585   58.638  -7.034  1.00 36.35 ? 171  GLN C CB    1 
ATOM   4656 C  CG    . GLN C 1 170 ? 7.826   57.786  -7.300  1.00 39.42 ? 171  GLN C CG    1 
ATOM   4657 C  CD    . GLN C 1 170 ? 8.539   58.144  -8.605  1.00 41.87 ? 171  GLN C CD    1 
ATOM   4658 O  OE1   . GLN C 1 170 ? 8.298   57.526  -9.654  1.00 42.91 ? 171  GLN C OE1   1 
ATOM   4659 N  NE2   . GLN C 1 170 ? 9.411   59.149  -8.548  1.00 43.15 ? 171  GLN C NE2   1 
ATOM   4660 N  N     . GLN C 1 171 ? 5.753   58.767  -3.889  1.00 34.27 ? 172  GLN C N     1 
ATOM   4661 C  CA    . GLN C 1 171 ? 6.097   58.633  -2.471  1.00 33.56 ? 172  GLN C CA    1 
ATOM   4662 C  C     . GLN C 1 171 ? 5.190   57.599  -1.819  1.00 32.97 ? 172  GLN C C     1 
ATOM   4663 O  O     . GLN C 1 171 ? 5.658   56.807  -1.021  1.00 31.61 ? 172  GLN C O     1 
ATOM   4664 C  CB    . GLN C 1 171 ? 6.033   60.000  -1.766  1.00 34.14 ? 172  GLN C CB    1 
ATOM   4665 C  CG    . GLN C 1 171 ? 6.405   60.030  -0.300  1.00 35.43 ? 172  GLN C CG    1 
ATOM   4666 C  CD    . GLN C 1 171 ? 7.878   59.732  0.015   1.00 36.30 ? 172  GLN C CD    1 
ATOM   4667 O  OE1   . GLN C 1 171 ? 8.184   59.383  1.147   1.00 36.16 ? 172  GLN C OE1   1 
ATOM   4668 N  NE2   . GLN C 1 171 ? 8.780   59.859  -0.978  1.00 34.72 ? 172  GLN C NE2   1 
ATOM   4669 N  N     . ASP C 1 172 ? 3.902   57.578  -2.169  1.00 32.53 ? 173  ASP C N     1 
ATOM   4670 C  CA    . ASP C 1 172 ? 3.011   56.503  -1.706  1.00 32.85 ? 173  ASP C CA    1 
ATOM   4671 C  C     . ASP C 1 172 ? 3.545   55.089  -2.009  1.00 33.13 ? 173  ASP C C     1 
ATOM   4672 O  O     . ASP C 1 172 ? 3.475   54.193  -1.174  1.00 32.73 ? 173  ASP C O     1 
ATOM   4673 C  CB    . ASP C 1 172 ? 1.612   56.627  -2.300  1.00 32.74 ? 173  ASP C CB    1 
ATOM   4674 C  CG    . ASP C 1 172 ? 0.857   57.857  -1.828  1.00 33.41 ? 173  ASP C CG    1 
ATOM   4675 O  OD1   . ASP C 1 172 ? 1.250   58.539  -0.834  1.00 33.33 ? 173  ASP C OD1   1 
ATOM   4676 O  OD2   . ASP C 1 172 ? -0.166  58.141  -2.494  1.00 32.92 ? 173  ASP C OD2   1 
ATOM   4677 N  N     . VAL C 1 173 ? 4.034   54.879  -3.228  1.00 33.42 ? 174  VAL C N     1 
ATOM   4678 C  CA    . VAL C 1 173 ? 4.616   53.598  -3.626  1.00 32.99 ? 174  VAL C CA    1 
ATOM   4679 C  C     . VAL C 1 173 ? 5.902   53.294  -2.823  1.00 31.76 ? 174  VAL C C     1 
ATOM   4680 O  O     . VAL C 1 173 ? 6.100   52.174  -2.354  1.00 32.57 ? 174  VAL C O     1 
ATOM   4681 C  CB    . VAL C 1 173 ? 4.931   53.590  -5.150  1.00 33.63 ? 174  VAL C CB    1 
ATOM   4682 C  CG1   . VAL C 1 173 ? 5.660   52.320  -5.560  1.00 34.07 ? 174  VAL C CG1   1 
ATOM   4683 C  CG2   . VAL C 1 173 ? 3.645   53.794  -5.986  1.00 31.95 ? 174  VAL C CG2   1 
ATOM   4684 N  N     . LEU C 1 174 ? 6.769   54.283  -2.682  1.00 31.64 ? 175  LEU C N     1 
ATOM   4685 C  CA    . LEU C 1 174 ? 8.018   54.128  -1.913  1.00 32.55 ? 175  LEU C CA    1 
ATOM   4686 C  C     . LEU C 1 174 ? 7.730   53.742  -0.479  1.00 32.67 ? 175  LEU C C     1 
ATOM   4687 O  O     . LEU C 1 174 ? 8.478   52.975  0.118   1.00 33.52 ? 175  LEU C O     1 
ATOM   4688 C  CB    . LEU C 1 174 ? 8.883   55.393  -1.973  1.00 32.70 ? 175  LEU C CB    1 
ATOM   4689 C  CG    . LEU C 1 174 ? 9.566   55.607  -3.337  1.00 32.50 ? 175  LEU C CG    1 
ATOM   4690 C  CD1   . LEU C 1 174 ? 9.896   57.063  -3.561  1.00 29.46 ? 175  LEU C CD1   1 
ATOM   4691 C  CD2   . LEU C 1 174 ? 10.818  54.709  -3.446  1.00 33.12 ? 175  LEU C CD2   1 
ATOM   4692 N  N     . ARG C 1 175 ? 6.623   54.254  0.049   1.00 32.51 ? 176  ARG C N     1 
ATOM   4693 C  CA    . ARG C 1 175 ? 6.220   54.006  1.434   1.00 32.85 ? 176  ARG C CA    1 
ATOM   4694 C  C     . ARG C 1 175 ? 5.522   52.654  1.648   1.00 32.64 ? 176  ARG C C     1 
ATOM   4695 O  O     . ARG C 1 175 ? 5.316   52.257  2.797   1.00 34.74 ? 176  ARG C O     1 
ATOM   4696 C  CB    . ARG C 1 175 ? 5.306   55.118  1.922   1.00 32.09 ? 176  ARG C CB    1 
ATOM   4697 C  CG    . ARG C 1 175 ? 5.946   56.476  2.049   1.00 32.80 ? 176  ARG C CG    1 
ATOM   4698 C  CD    . ARG C 1 175 ? 6.662   56.645  3.355   1.00 33.18 ? 176  ARG C CD    1 
ATOM   4699 N  NE    . ARG C 1 175 ? 7.072   58.025  3.534   1.00 33.75 ? 176  ARG C NE    1 
ATOM   4700 C  CZ    . ARG C 1 175 ? 7.276   58.638  4.692   1.00 32.75 ? 176  ARG C CZ    1 
ATOM   4701 N  NH1   . ARG C 1 175 ? 7.132   58.023  5.844   1.00 32.62 ? 176  ARG C NH1   1 
ATOM   4702 N  NH2   . ARG C 1 175 ? 7.604   59.919  4.674   1.00 33.42 ? 176  ARG C NH2   1 
ATOM   4703 N  N     . THR C 1 176 ? 5.133   51.945  0.585   1.00 32.86 ? 177  THR C N     1 
ATOM   4704 C  CA    . THR C 1 176 ? 4.479   50.656  0.791   1.00 32.79 ? 177  THR C CA    1 
ATOM   4705 C  C     . THR C 1 176 ? 5.406   49.621  1.439   1.00 32.52 ? 177  THR C C     1 
ATOM   4706 O  O     . THR C 1 176 ? 6.615   49.637  1.259   1.00 32.23 ? 177  THR C O     1 
ATOM   4707 C  CB    . THR C 1 176 ? 3.826   50.031  -0.493  1.00 33.09 ? 177  THR C CB    1 
ATOM   4708 O  OG1   . THR C 1 176 ? 4.815   49.855  -1.510  1.00 33.79 ? 177  THR C OG1   1 
ATOM   4709 C  CG2   . THR C 1 176 ? 2.688   50.877  -0.998  1.00 31.66 ? 177  THR C CG2   1 
ATOM   4710 N  N     . ARG C 1 177 ? 4.778   48.757  2.233   1.00 32.53 ? 178  ARG C N     1 
ATOM   4711 C  CA    . ARG C 1 177 ? 5.410   47.632  2.897   1.00 32.16 ? 178  ARG C CA    1 
ATOM   4712 C  C     . ARG C 1 177 ? 4.968   46.317  2.255   1.00 31.36 ? 178  ARG C C     1 
ATOM   4713 O  O     . ARG C 1 177 ? 3.796   45.976  2.287   1.00 30.35 ? 178  ARG C O     1 
ATOM   4714 C  CB    . ARG C 1 177 ? 5.021   47.628  4.370   1.00 32.62 ? 178  ARG C CB    1 
ATOM   4715 C  CG    . ARG C 1 177 ? 5.535   46.437  5.172   1.00 33.76 ? 178  ARG C CG    1 
ATOM   4716 C  CD    . ARG C 1 177 ? 7.096   46.321  5.116   1.00 34.25 ? 178  ARG C CD    1 
ATOM   4717 N  NE    . ARG C 1 177 ? 7.495   45.058  5.724   1.00 35.19 ? 178  ARG C NE    1 
ATOM   4718 C  CZ    . ARG C 1 177 ? 8.600   44.385  5.430   1.00 35.53 ? 178  ARG C CZ    1 
ATOM   4719 N  NH1   . ARG C 1 177 ? 9.453   44.843  4.525   1.00 33.13 ? 178  ARG C NH1   1 
ATOM   4720 N  NH2   . ARG C 1 177 ? 8.837   43.250  6.050   1.00 32.01 ? 178  ARG C NH2   1 
ATOM   4721 N  N     . VAL C 1 178 ? 5.918   45.590  1.671   1.00 30.65 ? 179  VAL C N     1 
ATOM   4722 C  CA    . VAL C 1 178 ? 5.710   44.219  1.179   1.00 30.29 ? 179  VAL C CA    1 
ATOM   4723 C  C     . VAL C 1 178 ? 6.969   43.464  1.595   1.00 31.79 ? 179  VAL C C     1 
ATOM   4724 O  O     . VAL C 1 178 ? 8.097   43.788  1.152   1.00 30.84 ? 179  VAL C O     1 
ATOM   4725 C  CB    . VAL C 1 178 ? 5.491   44.101  -0.336  1.00 30.92 ? 179  VAL C CB    1 
ATOM   4726 C  CG1   . VAL C 1 178 ? 5.358   42.579  -0.780  1.00 27.30 ? 179  VAL C CG1   1 
ATOM   4727 C  CG2   . VAL C 1 178 ? 4.272   44.856  -0.742  1.00 30.38 ? 179  VAL C CG2   1 
ATOM   4728 N  N     . LYS C 1 179 ? 6.787   42.478  2.475   1.00 30.65 ? 180  LYS C N     1 
ATOM   4729 C  CA    . LYS C 1 179 ? 7.907   41.672  2.903   1.00 30.80 ? 180  LYS C CA    1 
ATOM   4730 C  C     . LYS C 1 179 ? 8.502   40.839  1.764   1.00 29.61 ? 180  LYS C C     1 
ATOM   4731 O  O     . LYS C 1 179 ? 7.764   40.164  1.018   1.00 28.66 ? 180  LYS C O     1 
ATOM   4732 C  CB    . LYS C 1 179 ? 7.497   40.769  4.056   1.00 31.42 ? 180  LYS C CB    1 
ATOM   4733 C  CG    . LYS C 1 179 ? 8.587   39.900  4.605   1.00 34.61 ? 180  LYS C CG    1 
ATOM   4734 C  CD    . LYS C 1 179 ? 8.246   39.403  6.045   1.00 35.82 ? 180  LYS C CD    1 
ATOM   4735 C  CE    . LYS C 1 179 ? 7.180   38.379  6.128   1.00 38.52 ? 180  LYS C CE    1 
ATOM   4736 N  NZ    . LYS C 1 179 ? 7.084   38.015  7.615   1.00 35.48 ? 180  LYS C NZ    1 
ATOM   4737 N  N     . THR C 1 180 ? 9.830   40.914  1.625   1.00 30.27 ? 181  THR C N     1 
ATOM   4738 C  CA    . THR C 1 180 ? 10.557  40.162  0.593   1.00 31.64 ? 181  THR C CA    1 
ATOM   4739 C  C     . THR C 1 180 ? 10.889  38.790  1.162   1.00 31.05 ? 181  THR C C     1 
ATOM   4740 O  O     . THR C 1 180 ? 11.364  38.697  2.299   1.00 32.24 ? 181  THR C O     1 
ATOM   4741 C  CB    . THR C 1 180 ? 11.884  40.871  0.156   1.00 31.31 ? 181  THR C CB    1 
ATOM   4742 O  OG1   . THR C 1 180 ? 11.612  42.256  -0.103  1.00 32.14 ? 181  THR C OG1   1 
ATOM   4743 C  CG2   . THR C 1 180 ? 12.457  40.226  -1.096  1.00 32.04 ? 181  THR C CG2   1 
ATOM   4744 N  N     . THR C 1 181 ? 10.655  37.762  0.365   1.00 31.43 ? 182  THR C N     1 
ATOM   4745 C  CA    . THR C 1 181 ? 11.132  36.403  0.642   1.00 31.01 ? 182  THR C CA    1 
ATOM   4746 C  C     . THR C 1 181 ? 11.990  35.921  -0.519  1.00 31.36 ? 182  THR C C     1 
ATOM   4747 O  O     . THR C 1 181 ? 11.663  36.108  -1.698  1.00 29.75 ? 182  THR C O     1 
ATOM   4748 C  CB    . THR C 1 181 ? 9.933   35.433  1.000   1.00 30.94 ? 182  THR C CB    1 
ATOM   4749 O  OG1   . THR C 1 181 ? 10.397  34.121  1.372   1.00 28.79 ? 182  THR C OG1   1 
ATOM   4750 C  CG2   . THR C 1 181 ? 8.927   35.318  -0.146  1.00 31.10 ? 182  THR C CG2   1 
ATOM   4751 N  N     . GLY C 1 182 ? 13.111  35.291  -0.173  1.00 31.55 ? 183  GLY C N     1 
ATOM   4752 C  CA    . GLY C 1 182 ? 13.984  34.736  -1.170  1.00 31.45 ? 183  GLY C CA    1 
ATOM   4753 C  C     . GLY C 1 182 ? 15.048  35.732  -1.602  1.00 31.28 ? 183  GLY C C     1 
ATOM   4754 O  O     . GLY C 1 182 ? 15.412  36.637  -0.856  1.00 31.38 ? 183  GLY C O     1 
ATOM   4755 N  N     . ILE C 1 183 ? 15.555  35.504  -2.813  1.00 32.02 ? 184  ILE C N     1 
ATOM   4756 C  CA    . ILE C 1 183 ? 16.595  36.326  -3.435  1.00 32.13 ? 184  ILE C CA    1 
ATOM   4757 C  C     . ILE C 1 183 ? 16.078  36.797  -4.798  1.00 31.56 ? 184  ILE C C     1 
ATOM   4758 O  O     . ILE C 1 183 ? 15.689  36.001  -5.601  1.00 30.80 ? 184  ILE C O     1 
ATOM   4759 C  CB    . ILE C 1 183 ? 17.913  35.522  -3.596  1.00 32.18 ? 184  ILE C CB    1 
ATOM   4760 C  CG1   . ILE C 1 183 ? 18.334  34.988  -2.223  1.00 32.80 ? 184  ILE C CG1   1 
ATOM   4761 C  CG2   . ILE C 1 183 ? 19.015  36.429  -4.248  1.00 32.03 ? 184  ILE C CG2   1 
ATOM   4762 C  CD1   . ILE C 1 183 ? 19.598  34.139  -2.232  1.00 33.09 ? 184  ILE C CD1   1 
ATOM   4763 N  N     . VAL C 1 184 ? 16.064  38.109  -5.020  1.00 32.39 ? 185  VAL C N     1 
ATOM   4764 C  CA    . VAL C 1 184 ? 15.551  38.707  -6.260  1.00 32.95 ? 185  VAL C CA    1 
ATOM   4765 C  C     . VAL C 1 184 ? 16.662  39.528  -6.958  1.00 33.75 ? 185  VAL C C     1 
ATOM   4766 O  O     . VAL C 1 184 ? 17.226  40.444  -6.395  1.00 33.00 ? 185  VAL C O     1 
ATOM   4767 C  CB    . VAL C 1 184 ? 14.359  39.655  -5.998  1.00 33.00 ? 185  VAL C CB    1 
ATOM   4768 C  CG1   . VAL C 1 184 ? 13.727  40.081  -7.306  1.00 32.90 ? 185  VAL C CG1   1 
ATOM   4769 C  CG2   . VAL C 1 184 ? 13.333  38.990  -5.083  1.00 34.27 ? 185  VAL C CG2   1 
ATOM   4770 N  N     . GLU C 1 185 ? 16.938  39.173  -8.195  1.00 34.31 ? 186  GLU C N     1 
ATOM   4771 C  CA    . GLU C 1 185 ? 18.020  39.780  -8.974  1.00 36.01 ? 186  GLU C CA    1 
ATOM   4772 C  C     . GLU C 1 185 ? 17.409  40.766  -9.958  1.00 36.47 ? 186  GLU C C     1 
ATOM   4773 O  O     . GLU C 1 185 ? 16.436  40.456  -10.648 1.00 35.80 ? 186  GLU C O     1 
ATOM   4774 C  CB    . GLU C 1 185 ? 18.771  38.708  -9.733  1.00 36.04 ? 186  GLU C CB    1 
ATOM   4775 C  CG    . GLU C 1 185 ? 19.998  39.214  -10.493 1.00 39.10 ? 186  GLU C CG    1 
ATOM   4776 C  CD    . GLU C 1 185 ? 20.652  38.150  -11.322 1.00 42.00 ? 186  GLU C CD    1 
ATOM   4777 O  OE1   . GLU C 1 185 ? 20.282  36.964  -11.191 1.00 45.73 ? 186  GLU C OE1   1 
ATOM   4778 O  OE2   . GLU C 1 185 ? 21.549  38.501  -12.122 1.00 43.50 ? 186  GLU C OE2   1 
ATOM   4779 N  N     . THR C 1 186 ? 17.980  41.962  -10.009 1.00 37.14 ? 187  THR C N     1 
ATOM   4780 C  CA    . THR C 1 186 ? 17.564  42.958  -10.974 1.00 37.68 ? 187  THR C CA    1 
ATOM   4781 C  C     . THR C 1 186 ? 18.828  43.546  -11.603 1.00 37.77 ? 187  THR C C     1 
ATOM   4782 O  O     . THR C 1 186 ? 19.937  43.277  -11.124 1.00 38.14 ? 187  THR C O     1 
ATOM   4783 C  CB    . THR C 1 186 ? 16.699  44.041  -10.275 1.00 38.24 ? 187  THR C CB    1 
ATOM   4784 O  OG1   . THR C 1 186 ? 16.046  44.831  -11.271 1.00 43.51 ? 187  THR C OG1   1 
ATOM   4785 C  CG2   . THR C 1 186 ? 17.519  44.923  -9.420  1.00 36.19 ? 187  THR C CG2   1 
ATOM   4786 N  N     . HIS C 1 187 ? 18.672  44.317  -12.675 1.00 37.07 ? 188  HIS C N     1 
ATOM   4787 C  CA    . HIS C 1 187 ? 19.824  44.984  -13.300 1.00 37.00 ? 188  HIS C CA    1 
ATOM   4788 C  C     . HIS C 1 187 ? 19.509  46.397  -13.784 1.00 35.99 ? 188  HIS C C     1 
ATOM   4789 O  O     . HIS C 1 187 ? 18.358  46.753  -14.070 1.00 35.63 ? 188  HIS C O     1 
ATOM   4790 C  CB    . HIS C 1 187 ? 20.412  44.132  -14.417 1.00 37.61 ? 188  HIS C CB    1 
ATOM   4791 C  CG    . HIS C 1 187 ? 19.470  43.872  -15.548 1.00 39.09 ? 188  HIS C CG    1 
ATOM   4792 N  ND1   . HIS C 1 187 ? 19.435  44.654  -16.687 1.00 41.73 ? 188  HIS C ND1   1 
ATOM   4793 C  CD2   . HIS C 1 187 ? 18.565  42.885  -15.743 1.00 40.33 ? 188  HIS C CD2   1 
ATOM   4794 C  CE1   . HIS C 1 187 ? 18.527  44.177  -17.520 1.00 39.93 ? 188  HIS C CE1   1 
ATOM   4795 N  NE2   . HIS C 1 187 ? 17.983  43.104  -16.970 1.00 39.67 ? 188  HIS C NE2   1 
ATOM   4796 N  N     . PHE C 1 188 ? 20.552  47.213  -13.786 1.00 34.85 ? 189  PHE C N     1 
ATOM   4797 C  CA    . PHE C 1 188 ? 20.503  48.566  -14.331 1.00 34.73 ? 189  PHE C CA    1 
ATOM   4798 C  C     . PHE C 1 188 ? 21.924  48.973  -14.685 1.00 34.14 ? 189  PHE C C     1 
ATOM   4799 O  O     . PHE C 1 188 ? 22.868  48.305  -14.264 1.00 33.78 ? 189  PHE C O     1 
ATOM   4800 C  CB    . PHE C 1 188 ? 19.831  49.556  -13.352 1.00 33.73 ? 189  PHE C CB    1 
ATOM   4801 C  CG    . PHE C 1 188 ? 20.565  49.738  -12.045 1.00 33.06 ? 189  PHE C CG    1 
ATOM   4802 C  CD1   . PHE C 1 188 ? 20.351  48.860  -10.991 1.00 32.20 ? 189  PHE C CD1   1 
ATOM   4803 C  CD2   . PHE C 1 188 ? 21.459  50.792  -11.871 1.00 34.09 ? 189  PHE C CD2   1 
ATOM   4804 C  CE1   . PHE C 1 188 ? 21.022  49.023  -9.766  1.00 30.28 ? 189  PHE C CE1   1 
ATOM   4805 C  CE2   . PHE C 1 188 ? 22.133  50.978  -10.646 1.00 33.13 ? 189  PHE C CE2   1 
ATOM   4806 C  CZ    . PHE C 1 188 ? 21.925  50.089  -9.608  1.00 31.78 ? 189  PHE C CZ    1 
ATOM   4807 N  N     . THR C 1 189 ? 22.061  50.050  -15.456 1.00 34.30 ? 190  THR C N     1 
ATOM   4808 C  CA    . THR C 1 189 ? 23.375  50.629  -15.811 1.00 34.24 ? 190  THR C CA    1 
ATOM   4809 C  C     . THR C 1 189 ? 23.520  52.072  -15.302 1.00 34.20 ? 190  THR C C     1 
ATOM   4810 O  O     . THR C 1 189 ? 22.553  52.831  -15.236 1.00 34.68 ? 190  THR C O     1 
ATOM   4811 C  CB    . THR C 1 189 ? 23.626  50.536  -17.328 1.00 34.10 ? 190  THR C CB    1 
ATOM   4812 O  OG1   . THR C 1 189 ? 23.638  49.157  -17.697 1.00 33.42 ? 190  THR C OG1   1 
ATOM   4813 C  CG2   . THR C 1 189 ? 24.968  51.169  -17.747 1.00 34.91 ? 190  THR C CG2   1 
ATOM   4814 N  N     . PHE C 1 190 ? 24.736  52.423  -14.903 1.00 34.02 ? 191  PHE C N     1 
ATOM   4815 C  CA    . PHE C 1 190 ? 25.042  53.767  -14.428 1.00 33.94 ? 191  PHE C CA    1 
ATOM   4816 C  C     . PHE C 1 190 ? 26.546  53.965  -14.518 1.00 33.95 ? 191  PHE C C     1 
ATOM   4817 O  O     . PHE C 1 190 ? 27.322  53.083  -14.125 1.00 32.91 ? 191  PHE C O     1 
ATOM   4818 C  CB    . PHE C 1 190 ? 24.518  53.950  -12.970 1.00 33.68 ? 191  PHE C CB    1 
ATOM   4819 C  CG    . PHE C 1 190 ? 24.824  55.300  -12.356 1.00 32.77 ? 191  PHE C CG    1 
ATOM   4820 C  CD1   . PHE C 1 190 ? 24.546  56.470  -13.042 1.00 34.30 ? 191  PHE C CD1   1 
ATOM   4821 C  CD2   . PHE C 1 190 ? 25.359  55.389  -11.060 1.00 34.13 ? 191  PHE C CD2   1 
ATOM   4822 C  CE1   . PHE C 1 190 ? 24.829  57.719  -12.477 1.00 34.73 ? 191  PHE C CE1   1 
ATOM   4823 C  CE2   . PHE C 1 190 ? 25.630  56.626  -10.479 1.00 32.61 ? 191  PHE C CE2   1 
ATOM   4824 C  CZ    . PHE C 1 190 ? 25.360  57.793  -11.185 1.00 34.12 ? 191  PHE C CZ    1 
ATOM   4825 N  N     . LYS C 1 191 ? 26.950  55.107  -15.073 1.00 35.02 ? 192  LYS C N     1 
ATOM   4826 C  CA    . LYS C 1 191 ? 28.360  55.458  -15.204 1.00 35.31 ? 192  LYS C CA    1 
ATOM   4827 C  C     . LYS C 1 191 ? 29.129  54.288  -15.807 1.00 35.83 ? 192  LYS C C     1 
ATOM   4828 O  O     . LYS C 1 191 ? 30.142  53.805  -15.212 1.00 36.44 ? 192  LYS C O     1 
ATOM   4829 C  CB    . LYS C 1 191 ? 28.938  55.832  -13.827 1.00 35.41 ? 192  LYS C CB    1 
ATOM   4830 N  N     . ASP C 1 192 ? 28.621  53.806  -16.957 1.00 36.75 ? 193  ASP C N     1 
ATOM   4831 C  CA    . ASP C 1 192 ? 29.232  52.687  -17.706 1.00 37.30 ? 193  ASP C CA    1 
ATOM   4832 C  C     . ASP C 1 192 ? 29.493  51.421  -16.856 1.00 37.32 ? 193  ASP C C     1 
ATOM   4833 O  O     . ASP C 1 192 ? 30.350  50.594  -17.185 1.00 37.62 ? 193  ASP C O     1 
ATOM   4834 C  CB    . ASP C 1 192 ? 30.536  53.143  -18.386 1.00 37.60 ? 193  ASP C CB    1 
ATOM   4835 C  CG    . ASP C 1 192 ? 30.327  54.302  -19.359 1.00 38.83 ? 193  ASP C CG    1 
ATOM   4836 O  OD1   . ASP C 1 192 ? 29.240  54.404  -20.002 1.00 40.99 ? 193  ASP C OD1   1 
ATOM   4837 O  OD2   . ASP C 1 192 ? 31.272  55.119  -19.488 1.00 41.42 ? 193  ASP C OD2   1 
ATOM   4838 N  N     . LEU C 1 193 ? 28.760  51.266  -15.763 1.00 37.04 ? 194  LEU C N     1 
ATOM   4839 C  CA    . LEU C 1 193 ? 28.852  50.061  -14.978 1.00 37.47 ? 194  LEU C CA    1 
ATOM   4840 C  C     . LEU C 1 193 ? 27.511  49.346  -15.096 1.00 37.27 ? 194  LEU C C     1 
ATOM   4841 O  O     . LEU C 1 193 ? 26.452  49.974  -15.005 1.00 36.45 ? 194  LEU C O     1 
ATOM   4842 C  CB    . LEU C 1 193 ? 29.154  50.364  -13.510 1.00 38.20 ? 194  LEU C CB    1 
ATOM   4843 C  CG    . LEU C 1 193 ? 30.507  50.965  -13.122 1.00 38.49 ? 194  LEU C CG    1 
ATOM   4844 C  CD1   . LEU C 1 193 ? 30.471  51.241  -11.624 1.00 39.46 ? 194  LEU C CD1   1 
ATOM   4845 C  CD2   . LEU C 1 193 ? 31.664  50.046  -13.480 1.00 39.01 ? 194  LEU C CD2   1 
ATOM   4846 N  N     . TYR C 1 194 ? 27.576  48.042  -15.331 1.00 37.45 ? 195  TYR C N     1 
ATOM   4847 C  CA    . TYR C 1 194 ? 26.391  47.195  -15.427 1.00 38.11 ? 195  TYR C CA    1 
ATOM   4848 C  C     . TYR C 1 194 ? 26.172  46.528  -14.072 1.00 37.24 ? 195  TYR C C     1 
ATOM   4849 O  O     . TYR C 1 194 ? 26.940  45.647  -13.672 1.00 36.52 ? 195  TYR C O     1 
ATOM   4850 C  CB    . TYR C 1 194 ? 26.563  46.138  -16.528 1.00 39.43 ? 195  TYR C CB    1 
ATOM   4851 C  CG    . TYR C 1 194 ? 25.377  45.207  -16.648 1.00 41.07 ? 195  TYR C CG    1 
ATOM   4852 C  CD1   . TYR C 1 194 ? 25.380  43.961  -16.025 1.00 42.31 ? 195  TYR C CD1   1 
ATOM   4853 C  CD2   . TYR C 1 194 ? 24.243  45.583  -17.371 1.00 42.98 ? 195  TYR C CD2   1 
ATOM   4854 C  CE1   . TYR C 1 194 ? 24.285  43.109  -16.116 1.00 43.06 ? 195  TYR C CE1   1 
ATOM   4855 C  CE2   . TYR C 1 194 ? 23.150  44.735  -17.480 1.00 43.25 ? 195  TYR C CE2   1 
ATOM   4856 C  CZ    . TYR C 1 194 ? 23.177  43.501  -16.848 1.00 43.01 ? 195  TYR C CZ    1 
ATOM   4857 O  OH    . TYR C 1 194 ? 22.098  42.654  -16.954 1.00 42.41 ? 195  TYR C OH    1 
ATOM   4858 N  N     . PHE C 1 195 ? 25.124  46.955  -13.377 1.00 36.48 ? 196  PHE C N     1 
ATOM   4859 C  CA    . PHE C 1 195 ? 24.855  46.488  -12.024 1.00 36.02 ? 196  PHE C CA    1 
ATOM   4860 C  C     . PHE C 1 195 ? 23.940  45.259  -12.050 1.00 35.92 ? 196  PHE C C     1 
ATOM   4861 O  O     . PHE C 1 195 ? 22.844  45.292  -12.594 1.00 35.66 ? 196  PHE C O     1 
ATOM   4862 C  CB    . PHE C 1 195 ? 24.205  47.576  -11.157 1.00 36.21 ? 196  PHE C CB    1 
ATOM   4863 C  CG    . PHE C 1 195 ? 25.139  48.689  -10.751 1.00 36.11 ? 196  PHE C CG    1 
ATOM   4864 C  CD1   . PHE C 1 195 ? 25.811  48.646  -9.525  1.00 36.18 ? 196  PHE C CD1   1 
ATOM   4865 C  CD2   . PHE C 1 195 ? 25.304  49.799  -11.562 1.00 35.12 ? 196  PHE C CD2   1 
ATOM   4866 C  CE1   . PHE C 1 195 ? 26.648  49.689  -9.129  1.00 37.14 ? 196  PHE C CE1   1 
ATOM   4867 C  CE2   . PHE C 1 195 ? 26.144  50.860  -11.178 1.00 35.68 ? 196  PHE C CE2   1 
ATOM   4868 C  CZ    . PHE C 1 195 ? 26.825  50.801  -9.969  1.00 36.77 ? 196  PHE C CZ    1 
ATOM   4869 N  N     . LYS C 1 196 ? 24.433  44.169  -11.483 1.00 35.55 ? 197  LYS C N     1 
ATOM   4870 C  CA    . LYS C 1 196 ? 23.608  43.014  -11.185 1.00 35.68 ? 197  LYS C CA    1 
ATOM   4871 C  C     . LYS C 1 196 ? 23.307  43.122  -9.709  1.00 34.76 ? 197  LYS C C     1 
ATOM   4872 O  O     . LYS C 1 196 ? 24.195  42.885  -8.884  1.00 34.58 ? 197  LYS C O     1 
ATOM   4873 C  CB    . LYS C 1 196 ? 24.373  41.735  -11.484 1.00 35.51 ? 197  LYS C CB    1 
ATOM   4874 C  CG    . LYS C 1 196 ? 24.847  41.615  -12.916 1.00 36.12 ? 197  LYS C CG    1 
ATOM   4875 C  CD    . LYS C 1 196 ? 25.805  40.440  -13.090 1.00 38.25 ? 197  LYS C CD    1 
ATOM   4876 N  N     . MET C 1 197 ? 22.084  43.540  -9.377  1.00 34.90 ? 198  MET C N     1 
ATOM   4877 C  CA    . MET C 1 197 ? 21.689  43.832  -8.005  1.00 34.28 ? 198  MET C CA    1 
ATOM   4878 C  C     . MET C 1 197 ? 20.784  42.739  -7.411  1.00 34.76 ? 198  MET C C     1 
ATOM   4879 O  O     . MET C 1 197 ? 19.784  42.345  -8.022  1.00 35.05 ? 198  MET C O     1 
ATOM   4880 C  CB    . MET C 1 197 ? 20.967  45.180  -7.952  1.00 34.68 ? 198  MET C CB    1 
ATOM   4881 C  CG    . MET C 1 197 ? 20.541  45.612  -6.580  1.00 34.31 ? 198  MET C CG    1 
ATOM   4882 S  SD    . MET C 1 197 ? 19.962  47.320  -6.495  1.00 35.07 ? 198  MET C SD    1 
ATOM   4883 C  CE    . MET C 1 197 ? 18.551  47.302  -7.629  1.00 30.97 ? 198  MET C CE    1 
ATOM   4884 N  N     . PHE C 1 198 ? 21.140  42.288  -6.207  1.00 33.79 ? 199  PHE C N     1 
ATOM   4885 C  CA    . PHE C 1 198 ? 20.455  41.188  -5.539  1.00 33.67 ? 199  PHE C CA    1 
ATOM   4886 C  C     . PHE C 1 198 ? 19.844  41.709  -4.235  1.00 33.40 ? 199  PHE C C     1 
ATOM   4887 O  O     . PHE C 1 198 ? 20.548  42.172  -3.326  1.00 34.68 ? 199  PHE C O     1 
ATOM   4888 C  CB    . PHE C 1 198 ? 21.391  39.998  -5.270  1.00 32.78 ? 199  PHE C CB    1 
ATOM   4889 C  CG    . PHE C 1 198 ? 21.961  39.358  -6.509  1.00 33.90 ? 199  PHE C CG    1 
ATOM   4890 C  CD1   . PHE C 1 198 ? 23.021  39.962  -7.188  1.00 33.66 ? 199  PHE C CD1   1 
ATOM   4891 C  CD2   . PHE C 1 198 ? 21.481  38.133  -6.978  1.00 33.48 ? 199  PHE C CD2   1 
ATOM   4892 C  CE1   . PHE C 1 198 ? 23.568  39.375  -8.310  1.00 32.55 ? 199  PHE C CE1   1 
ATOM   4893 C  CE2   . PHE C 1 198 ? 22.058  37.521  -8.127  1.00 33.47 ? 199  PHE C CE2   1 
ATOM   4894 C  CZ    . PHE C 1 198 ? 23.095  38.148  -8.774  1.00 32.72 ? 199  PHE C CZ    1 
ATOM   4895 N  N     . ASP C 1 199 ? 18.519  41.655  -4.174  1.00 32.35 ? 200  ASP C N     1 
ATOM   4896 C  CA    . ASP C 1 199 ? 17.744  42.010  -2.975  1.00 32.07 ? 200  ASP C CA    1 
ATOM   4897 C  C     . ASP C 1 199 ? 17.300  40.700  -2.279  1.00 31.90 ? 200  ASP C C     1 
ATOM   4898 O  O     . ASP C 1 199 ? 16.876  39.769  -2.943  1.00 32.42 ? 200  ASP C O     1 
ATOM   4899 C  CB    . ASP C 1 199 ? 16.520  42.802  -3.426  1.00 30.93 ? 200  ASP C CB    1 
ATOM   4900 C  CG    . ASP C 1 199 ? 15.792  43.468  -2.308  1.00 32.71 ? 200  ASP C CG    1 
ATOM   4901 O  OD1   . ASP C 1 199 ? 16.364  43.675  -1.198  1.00 34.78 ? 200  ASP C OD1   1 
ATOM   4902 O  OD2   . ASP C 1 199 ? 14.619  43.796  -2.547  1.00 34.23 ? 200  ASP C OD2   1 
ATOM   4903 N  N     . VAL C 1 200 ? 17.412  40.669  -0.951  1.00 31.43 ? 201  VAL C N     1 
ATOM   4904 C  CA    . VAL C 1 200 ? 17.226  39.463  -0.136  1.00 30.91 ? 201  VAL C CA    1 
ATOM   4905 C  C     . VAL C 1 200 ? 16.212  39.779  0.989   1.00 31.07 ? 201  VAL C C     1 
ATOM   4906 O  O     . VAL C 1 200 ? 16.027  40.947  1.357   1.00 31.00 ? 201  VAL C O     1 
ATOM   4907 C  CB    . VAL C 1 200 ? 18.558  38.922  0.457   1.00 30.83 ? 201  VAL C CB    1 
ATOM   4908 C  CG1   . VAL C 1 200 ? 19.621  38.748  -0.648  1.00 31.58 ? 201  VAL C CG1   1 
ATOM   4909 C  CG2   . VAL C 1 200 ? 19.099  39.842  1.609   1.00 29.47 ? 201  VAL C CG2   1 
ATOM   4910 N  N     . GLY C 1 201 ? 15.550  38.741  1.504   1.00 31.79 ? 202  GLY C N     1 
ATOM   4911 C  CA    . GLY C 1 201 ? 14.746  38.845  2.728   1.00 32.23 ? 202  GLY C CA    1 
ATOM   4912 C  C     . GLY C 1 201 ? 15.684  38.904  3.912   1.00 33.01 ? 202  GLY C C     1 
ATOM   4913 O  O     . GLY C 1 201 ? 16.749  38.252  3.890   1.00 32.05 ? 202  GLY C O     1 
ATOM   4914 N  N     . GLY C 1 202 ? 15.315  39.690  4.928   1.00 32.69 ? 203  GLY C N     1 
ATOM   4915 C  CA    . GLY C 1 202 ? 16.204  39.986  6.054   1.00 32.21 ? 203  GLY C CA    1 
ATOM   4916 C  C     . GLY C 1 202 ? 15.889  39.325  7.371   1.00 32.36 ? 203  GLY C C     1 
ATOM   4917 O  O     . GLY C 1 202 ? 16.726  39.335  8.299   1.00 32.31 ? 203  GLY C O     1 
ATOM   4918 N  N     . GLN C 1 203 ? 14.678  38.760  7.486   1.00 32.88 ? 204  GLN C N     1 
ATOM   4919 C  CA    . GLN C 1 203 ? 14.302  38.021  8.707   1.00 31.86 ? 204  GLN C CA    1 
ATOM   4920 C  C     . GLN C 1 203 ? 15.270  36.857  8.949   1.00 31.72 ? 204  GLN C C     1 
ATOM   4921 O  O     . GLN C 1 203 ? 15.874  36.335  8.022   1.00 32.13 ? 204  GLN C O     1 
ATOM   4922 C  CB    . GLN C 1 203 ? 12.859  37.489  8.648   1.00 31.23 ? 204  GLN C CB    1 
ATOM   4923 C  CG    . GLN C 1 203 ? 11.791  38.558  8.824   1.00 33.15 ? 204  GLN C CG    1 
ATOM   4924 C  CD    . GLN C 1 203 ? 11.717  39.481  7.664   1.00 30.59 ? 204  GLN C CD    1 
ATOM   4925 O  OE1   . GLN C 1 203 ? 11.958  39.076  6.539   1.00 33.04 ? 204  GLN C OE1   1 
ATOM   4926 N  NE2   . GLN C 1 203 ? 11.391  40.726  7.915   1.00 31.51 ? 204  GLN C NE2   1 
ATOM   4927 N  N     . ARG C 1 204 ? 15.431  36.462  10.203  1.00 32.05 ? 205  ARG C N     1 
ATOM   4928 C  CA    . ARG C 1 204 ? 16.308  35.353  10.555  1.00 31.54 ? 205  ARG C CA    1 
ATOM   4929 C  C     . ARG C 1 204 ? 16.100  34.102  9.679   1.00 31.27 ? 205  ARG C C     1 
ATOM   4930 O  O     . ARG C 1 204 ? 17.062  33.502  9.247   1.00 30.53 ? 205  ARG C O     1 
ATOM   4931 C  CB    . ARG C 1 204 ? 16.148  34.938  12.018  1.00 32.29 ? 205  ARG C CB    1 
ATOM   4932 C  CG    . ARG C 1 204 ? 16.677  35.959  13.024  1.00 32.25 ? 205  ARG C CG    1 
ATOM   4933 C  CD    . ARG C 1 204 ? 16.484  35.438  14.464  1.00 33.56 ? 205  ARG C CD    1 
ATOM   4934 N  NE    . ARG C 1 204 ? 17.057  36.383  15.409  1.00 34.50 ? 205  ARG C NE    1 
ATOM   4935 C  CZ    . ARG C 1 204 ? 16.964  36.257  16.719  1.00 35.93 ? 205  ARG C CZ    1 
ATOM   4936 N  NH1   . ARG C 1 204 ? 16.264  35.264  17.270  1.00 33.20 ? 205  ARG C NH1   1 
ATOM   4937 N  NH2   . ARG C 1 204 ? 17.556  37.157  17.475  1.00 36.67 ? 205  ARG C NH2   1 
ATOM   4938 N  N     . SER C 1 205 ? 14.845  33.729  9.397   1.00 30.52 ? 206  SER C N     1 
ATOM   4939 C  CA    . SER C 1 205 ? 14.534  32.512  8.627   1.00 30.27 ? 206  SER C CA    1 
ATOM   4940 C  C     . SER C 1 205 ? 15.117  32.576  7.227   1.00 30.14 ? 206  SER C C     1 
ATOM   4941 O  O     . SER C 1 205 ? 15.384  31.529  6.637   1.00 29.63 ? 206  SER C O     1 
ATOM   4942 C  CB    . SER C 1 205 ? 13.027  32.234  8.515   1.00 29.99 ? 206  SER C CB    1 
ATOM   4943 O  OG    . SER C 1 205 ? 12.376  33.279  7.802   1.00 29.62 ? 206  SER C OG    1 
ATOM   4944 N  N     . GLU C 1 206 ? 15.257  33.788  6.690   1.00 31.21 ? 207  GLU C N     1 
ATOM   4945 C  CA    . GLU C 1 206 ? 15.727  33.984  5.297   1.00 31.22 ? 207  GLU C CA    1 
ATOM   4946 C  C     . GLU C 1 206 ? 17.247  33.878  5.154   1.00 32.45 ? 207  GLU C C     1 
ATOM   4947 O  O     . GLU C 1 206 ? 17.742  33.604  4.082   1.00 31.75 ? 207  GLU C O     1 
ATOM   4948 C  CB    . GLU C 1 206 ? 15.309  35.359  4.803   1.00 31.49 ? 207  GLU C CB    1 
ATOM   4949 C  CG    . GLU C 1 206 ? 13.807  35.603  4.775   1.00 31.40 ? 207  GLU C CG    1 
ATOM   4950 C  CD    . GLU C 1 206 ? 13.168  34.949  3.577   1.00 31.27 ? 207  GLU C CD    1 
ATOM   4951 O  OE1   . GLU C 1 206 ? 13.887  34.689  2.598   1.00 31.34 ? 207  GLU C OE1   1 
ATOM   4952 O  OE2   . GLU C 1 206 ? 11.951  34.732  3.580   1.00 30.57 ? 207  GLU C OE2   1 
ATOM   4953 N  N     . ARG C 1 207 ? 17.967  34.116  6.245   1.00 33.19 ? 208  ARG C N     1 
ATOM   4954 C  CA    . ARG C 1 207 ? 19.442  34.303  6.187   1.00 33.30 ? 208  ARG C CA    1 
ATOM   4955 C  C     . ARG C 1 207 ? 20.271  33.086  5.801   1.00 33.38 ? 208  ARG C C     1 
ATOM   4956 O  O     . ARG C 1 207 ? 21.354  33.253  5.213   1.00 33.49 ? 208  ARG C O     1 
ATOM   4957 C  CB    . ARG C 1 207 ? 19.955  34.935  7.488   1.00 33.22 ? 208  ARG C CB    1 
ATOM   4958 C  CG    . ARG C 1 207 ? 19.337  36.271  7.740   1.00 34.44 ? 208  ARG C CG    1 
ATOM   4959 C  CD    . ARG C 1 207 ? 19.738  36.825  9.098   1.00 35.07 ? 208  ARG C CD    1 
ATOM   4960 N  NE    . ARG C 1 207 ? 18.833  37.850  9.544   1.00 35.01 ? 208  ARG C NE    1 
ATOM   4961 C  CZ    . ARG C 1 207 ? 18.805  38.305  10.788  1.00 34.84 ? 208  ARG C CZ    1 
ATOM   4962 N  NH1   . ARG C 1 207 ? 19.674  37.834  11.668  1.00 33.41 ? 208  ARG C NH1   1 
ATOM   4963 N  NH2   . ARG C 1 207 ? 17.919  39.226  11.143  1.00 32.82 ? 208  ARG C NH2   1 
ATOM   4964 N  N     . LYS C 1 208 ? 19.777  31.881  6.089   1.00 33.31 ? 209  LYS C N     1 
ATOM   4965 C  CA    . LYS C 1 208 ? 20.354  30.646  5.543   1.00 33.58 ? 209  LYS C CA    1 
ATOM   4966 C  C     . LYS C 1 208 ? 20.443  30.654  4.005   1.00 33.35 ? 209  LYS C C     1 
ATOM   4967 O  O     . LYS C 1 208 ? 21.221  29.892  3.416   1.00 33.11 ? 209  LYS C O     1 
ATOM   4968 C  CB    . LYS C 1 208 ? 19.605  29.388  6.028   1.00 33.99 ? 209  LYS C CB    1 
ATOM   4969 C  CG    . LYS C 1 208 ? 18.199  29.171  5.406   1.00 34.68 ? 209  LYS C CG    1 
ATOM   4970 C  CD    . LYS C 1 208 ? 17.529  27.878  5.851   1.00 34.63 ? 209  LYS C CD    1 
ATOM   4971 C  CE    . LYS C 1 208 ? 17.194  27.789  7.353   1.00 36.07 ? 209  LYS C CE    1 
ATOM   4972 N  NZ    . LYS C 1 208 ? 16.281  28.823  7.916   1.00 35.40 ? 209  LYS C NZ    1 
ATOM   4973 N  N     . LYS C 1 209 ? 19.648  31.497  3.362   1.00 32.83 ? 210  LYS C N     1 
ATOM   4974 C  CA    . LYS C 1 209 ? 19.604  31.532  1.898   1.00 32.61 ? 210  LYS C CA    1 
ATOM   4975 C  C     . LYS C 1 209 ? 20.666  32.422  1.295   1.00 32.25 ? 210  LYS C C     1 
ATOM   4976 O  O     . LYS C 1 209 ? 20.975  32.290  0.114   1.00 32.21 ? 210  LYS C O     1 
ATOM   4977 C  CB    . LYS C 1 209 ? 18.255  32.024  1.405   1.00 32.10 ? 210  LYS C CB    1 
ATOM   4978 C  CG    . LYS C 1 209 ? 17.053  31.228  1.878   1.00 32.53 ? 210  LYS C CG    1 
ATOM   4979 C  CD    . LYS C 1 209 ? 15.820  31.946  1.416   1.00 30.84 ? 210  LYS C CD    1 
ATOM   4980 C  CE    . LYS C 1 209 ? 14.533  31.317  1.972   1.00 31.63 ? 210  LYS C CE    1 
ATOM   4981 N  NZ    . LYS C 1 209 ? 13.342  32.045  1.408   1.00 28.40 ? 210  LYS C NZ    1 
ATOM   4982 N  N     . TRP C 1 210 ? 21.243  33.298  2.101   1.00 32.23 ? 211  TRP C N     1 
ATOM   4983 C  CA    . TRP C 1 210 ? 22.077  34.375  1.580   1.00 32.65 ? 211  TRP C CA    1 
ATOM   4984 C  C     . TRP C 1 210 ? 23.333  33.866  0.889   1.00 32.12 ? 211  TRP C C     1 
ATOM   4985 O  O     . TRP C 1 210 ? 23.787  34.469  -0.090  1.00 31.60 ? 211  TRP C O     1 
ATOM   4986 C  CB    . TRP C 1 210 ? 22.493  35.322  2.708   1.00 33.19 ? 211  TRP C CB    1 
ATOM   4987 C  CG    . TRP C 1 210 ? 21.396  36.212  3.201   1.00 33.97 ? 211  TRP C CG    1 
ATOM   4988 C  CD1   . TRP C 1 210 ? 20.056  36.097  2.947   1.00 33.90 ? 211  TRP C CD1   1 
ATOM   4989 C  CD2   . TRP C 1 210 ? 21.553  37.347  4.049   1.00 34.34 ? 211  TRP C CD2   1 
ATOM   4990 N  NE1   . TRP C 1 210 ? 19.369  37.103  3.579   1.00 34.78 ? 211  TRP C NE1   1 
ATOM   4991 C  CE2   . TRP C 1 210 ? 20.257  37.876  4.285   1.00 35.97 ? 211  TRP C CE2   1 
ATOM   4992 C  CE3   . TRP C 1 210 ? 22.664  37.981  4.625   1.00 34.25 ? 211  TRP C CE3   1 
ATOM   4993 C  CZ2   . TRP C 1 210 ? 20.045  39.025  5.072   1.00 34.45 ? 211  TRP C CZ2   1 
ATOM   4994 C  CZ3   . TRP C 1 210 ? 22.456  39.105  5.421   1.00 34.52 ? 211  TRP C CZ3   1 
ATOM   4995 C  CH2   . TRP C 1 210 ? 21.152  39.627  5.624   1.00 33.85 ? 211  TRP C CH2   1 
ATOM   4996 N  N     . ILE C 1 211 ? 23.870  32.770  1.422   1.00 32.34 ? 212  ILE C N     1 
ATOM   4997 C  CA    . ILE C 1 211 ? 25.068  32.106  0.884   1.00 33.00 ? 212  ILE C CA    1 
ATOM   4998 C  C     . ILE C 1 211 ? 25.004  31.848  -0.637  1.00 33.20 ? 212  ILE C C     1 
ATOM   4999 O  O     . ILE C 1 211 ? 26.020  31.923  -1.316  1.00 33.44 ? 212  ILE C O     1 
ATOM   5000 C  CB    . ILE C 1 211 ? 25.359  30.787  1.653   1.00 32.55 ? 212  ILE C CB    1 
ATOM   5001 C  CG1   . ILE C 1 211 ? 26.775  30.265  1.363   1.00 34.94 ? 212  ILE C CG1   1 
ATOM   5002 C  CG2   . ILE C 1 211 ? 24.271  29.709  1.315   1.00 32.60 ? 212  ILE C CG2   1 
ATOM   5003 C  CD1   . ILE C 1 211 ? 27.892  31.201  1.715   1.00 35.80 ? 212  ILE C CD1   1 
ATOM   5004 N  N     . HIS C 1 212 ? 23.811  31.606  -1.178  1.00 34.47 ? 213  HIS C N     1 
ATOM   5005 C  CA    . HIS C 1 212 ? 23.641  31.446  -2.630  1.00 34.77 ? 213  HIS C CA    1 
ATOM   5006 C  C     . HIS C 1 212 ? 24.124  32.636  -3.462  1.00 35.41 ? 213  HIS C C     1 
ATOM   5007 O  O     . HIS C 1 212 ? 24.517  32.460  -4.612  1.00 34.04 ? 213  HIS C O     1 
ATOM   5008 C  CB    . HIS C 1 212 ? 22.187  31.126  -2.982  1.00 35.85 ? 213  HIS C CB    1 
ATOM   5009 C  CG    . HIS C 1 212 ? 21.720  29.799  -2.460  1.00 36.35 ? 213  HIS C CG    1 
ATOM   5010 N  ND1   . HIS C 1 212 ? 22.162  28.601  -2.974  1.00 38.39 ? 213  HIS C ND1   1 
ATOM   5011 C  CD2   . HIS C 1 212 ? 20.845  29.483  -1.471  1.00 37.51 ? 213  HIS C CD2   1 
ATOM   5012 C  CE1   . HIS C 1 212 ? 21.588  27.600  -2.326  1.00 38.11 ? 213  HIS C CE1   1 
ATOM   5013 N  NE2   . HIS C 1 212 ? 20.782  28.106  -1.410  1.00 36.65 ? 213  HIS C NE2   1 
ATOM   5014 N  N     . CYS C 1 213 ? 24.110  33.852  -2.919  1.00 35.56 ? 214  CYS C N     1 
ATOM   5015 C  CA    . CYS C 1 213 ? 24.518  35.008  -3.745  1.00 36.75 ? 214  CYS C CA    1 
ATOM   5016 C  C     . CYS C 1 213 ? 25.906  35.577  -3.367  1.00 36.32 ? 214  CYS C C     1 
ATOM   5017 O  O     . CYS C 1 213 ? 26.307  36.620  -3.847  1.00 36.44 ? 214  CYS C O     1 
ATOM   5018 C  CB    . CYS C 1 213 ? 23.398  36.066  -3.744  1.00 37.72 ? 214  CYS C CB    1 
ATOM   5019 S  SG    . CYS C 1 213 ? 23.125  36.850  -2.196  1.00 39.34 ? 214  CYS C SG    1 
ATOM   5020 N  N     . PHE C 1 214 ? 26.663  34.840  -2.557  1.00 35.50 ? 215  PHE C N     1 
ATOM   5021 C  CA    . PHE C 1 214 ? 27.882  35.354  -1.916  1.00 34.87 ? 215  PHE C CA    1 
ATOM   5022 C  C     . PHE C 1 214 ? 29.174  35.286  -2.764  1.00 35.15 ? 215  PHE C C     1 
ATOM   5023 O  O     . PHE C 1 214 ? 30.196  35.887  -2.391  1.00 35.33 ? 215  PHE C O     1 
ATOM   5024 C  CB    . PHE C 1 214 ? 28.102  34.592  -0.600  1.00 35.13 ? 215  PHE C CB    1 
ATOM   5025 C  CG    . PHE C 1 214 ? 27.387  35.170  0.585   1.00 33.80 ? 215  PHE C CG    1 
ATOM   5026 C  CD1   . PHE C 1 214 ? 26.327  36.075  0.443   1.00 34.26 ? 215  PHE C CD1   1 
ATOM   5027 C  CD2   . PHE C 1 214 ? 27.779  34.801  1.864   1.00 34.21 ? 215  PHE C CD2   1 
ATOM   5028 C  CE1   . PHE C 1 214 ? 25.705  36.603  1.544   1.00 35.06 ? 215  PHE C CE1   1 
ATOM   5029 C  CE2   . PHE C 1 214 ? 27.137  35.334  2.992   1.00 35.37 ? 215  PHE C CE2   1 
ATOM   5030 C  CZ    . PHE C 1 214 ? 26.107  36.225  2.828   1.00 35.63 ? 215  PHE C CZ    1 
ATOM   5031 N  N     . GLU C 1 215 ? 29.116  34.586  -3.895  1.00 34.37 ? 216  GLU C N     1 
ATOM   5032 C  CA    . GLU C 1 215 ? 30.255  34.443  -4.800  1.00 34.31 ? 216  GLU C CA    1 
ATOM   5033 C  C     . GLU C 1 215 ? 30.452  35.676  -5.707  1.00 34.12 ? 216  GLU C C     1 
ATOM   5034 O  O     . GLU C 1 215 ? 29.497  36.204  -6.293  1.00 34.82 ? 216  GLU C O     1 
ATOM   5035 C  CB    . GLU C 1 215 ? 30.043  33.198  -5.665  1.00 34.00 ? 216  GLU C CB    1 
ATOM   5036 N  N     . GLY C 1 216 ? 31.690  36.143  -5.788  1.00 34.29 ? 217  GLY C N     1 
ATOM   5037 C  CA    . GLY C 1 216 ? 32.092  37.231  -6.704  1.00 34.13 ? 217  GLY C CA    1 
ATOM   5038 C  C     . GLY C 1 216 ? 31.386  38.553  -6.455  1.00 33.41 ? 217  GLY C C     1 
ATOM   5039 O  O     . GLY C 1 216 ? 30.983  39.241  -7.400  1.00 32.91 ? 217  GLY C O     1 
ATOM   5040 N  N     . VAL C 1 217 ? 31.213  38.907  -5.183  1.00 32.64 ? 218  VAL C N     1 
ATOM   5041 C  CA    . VAL C 1 217 ? 30.491  40.123  -4.853  1.00 32.35 ? 218  VAL C CA    1 
ATOM   5042 C  C     . VAL C 1 217 ? 31.436  41.338  -4.948  1.00 31.85 ? 218  VAL C C     1 
ATOM   5043 O  O     . VAL C 1 217 ? 32.443  41.425  -4.237  1.00 31.73 ? 218  VAL C O     1 
ATOM   5044 C  CB    . VAL C 1 217 ? 29.817  40.030  -3.453  1.00 31.46 ? 218  VAL C CB    1 
ATOM   5045 C  CG1   . VAL C 1 217 ? 29.146  41.366  -3.077  1.00 32.50 ? 218  VAL C CG1   1 
ATOM   5046 C  CG2   . VAL C 1 217 ? 28.794  38.899  -3.419  1.00 31.25 ? 218  VAL C CG2   1 
ATOM   5047 N  N     . THR C 1 218 ? 31.093  42.276  -5.820  1.00 31.43 ? 219  THR C N     1 
ATOM   5048 C  CA    . THR C 1 218 ? 31.812  43.558  -5.920  1.00 31.18 ? 219  THR C CA    1 
ATOM   5049 C  C     . THR C 1 218 ? 31.570  44.526  -4.778  1.00 31.49 ? 219  THR C C     1 
ATOM   5050 O  O     . THR C 1 218 ? 32.522  45.152  -4.283  1.00 30.59 ? 219  THR C O     1 
ATOM   5051 C  CB    . THR C 1 218 ? 31.460  44.281  -7.219  1.00 31.38 ? 219  THR C CB    1 
ATOM   5052 O  OG1   . THR C 1 218 ? 31.476  43.323  -8.275  1.00 29.24 ? 219  THR C OG1   1 
ATOM   5053 C  CG2   . THR C 1 218 ? 32.485  45.412  -7.522  1.00 31.26 ? 219  THR C CG2   1 
ATOM   5054 N  N     . ALA C 1 219 ? 30.298  44.677  -4.378  1.00 31.12 ? 220  ALA C N     1 
ATOM   5055 C  CA    . ALA C 1 219 ? 29.927  45.607  -3.327  1.00 31.45 ? 220  ALA C CA    1 
ATOM   5056 C  C     . ALA C 1 219 ? 28.679  45.129  -2.616  1.00 31.65 ? 220  ALA C C     1 
ATOM   5057 O  O     . ALA C 1 219 ? 27.812  44.488  -3.229  1.00 32.13 ? 220  ALA C O     1 
ATOM   5058 C  CB    . ALA C 1 219 ? 29.704  47.010  -3.888  1.00 30.84 ? 220  ALA C CB    1 
ATOM   5059 N  N     . ILE C 1 220 ? 28.629  45.416  -1.311  1.00 32.22 ? 221  ILE C N     1 
ATOM   5060 C  CA    . ILE C 1 220 ? 27.468  45.211  -0.483  1.00 32.69 ? 221  ILE C CA    1 
ATOM   5061 C  C     . ILE C 1 220 ? 26.997  46.570  0.035   1.00 32.72 ? 221  ILE C C     1 
ATOM   5062 O  O     . ILE C 1 220 ? 27.795  47.364  0.503   1.00 32.65 ? 221  ILE C O     1 
ATOM   5063 C  CB    . ILE C 1 220 ? 27.790  44.282  0.742   1.00 33.51 ? 221  ILE C CB    1 
ATOM   5064 C  CG1   . ILE C 1 220 ? 28.158  42.863  0.296   1.00 33.21 ? 221  ILE C CG1   1 
ATOM   5065 C  CG2   . ILE C 1 220 ? 26.605  44.211  1.710   1.00 33.81 ? 221  ILE C CG2   1 
ATOM   5066 C  CD1   . ILE C 1 220 ? 28.815  42.005  1.409   1.00 34.20 ? 221  ILE C CD1   1 
ATOM   5067 N  N     . ILE C 1 221 ? 25.696  46.820  -0.066  1.00 32.06 ? 222  ILE C N     1 
ATOM   5068 C  CA    . ILE C 1 221 ? 25.059  47.929  0.648   1.00 32.26 ? 222  ILE C CA    1 
ATOM   5069 C  C     . ILE C 1 221 ? 24.337  47.255  1.809   1.00 31.59 ? 222  ILE C C     1 
ATOM   5070 O  O     . ILE C 1 221 ? 23.371  46.513  1.605   1.00 30.60 ? 222  ILE C O     1 
ATOM   5071 C  CB    . ILE C 1 221 ? 24.117  48.760  -0.254  1.00 31.63 ? 222  ILE C CB    1 
ATOM   5072 C  CG1   . ILE C 1 221 ? 24.923  49.553  -1.288  1.00 33.70 ? 222  ILE C CG1   1 
ATOM   5073 C  CG2   . ILE C 1 221 ? 23.225  49.720  0.610   1.00 32.66 ? 222  ILE C CG2   1 
ATOM   5074 C  CD1   . ILE C 1 221 ? 24.075  50.170  -2.411  1.00 31.55 ? 222  ILE C CD1   1 
ATOM   5075 N  N     . PHE C 1 222 ? 24.873  47.443  3.013   1.00 31.85 ? 223  PHE C N     1 
ATOM   5076 C  CA    . PHE C 1 222 ? 24.285  46.870  4.214   1.00 32.94 ? 223  PHE C CA    1 
ATOM   5077 C  C     . PHE C 1 222 ? 23.397  47.947  4.866   1.00 33.10 ? 223  PHE C C     1 
ATOM   5078 O  O     . PHE C 1 222 ? 23.870  49.021  5.228   1.00 32.62 ? 223  PHE C O     1 
ATOM   5079 C  CB    . PHE C 1 222 ? 25.366  46.328  5.175   1.00 33.13 ? 223  PHE C CB    1 
ATOM   5080 C  CG    . PHE C 1 222 ? 24.797  45.545  6.314   1.00 34.39 ? 223  PHE C CG    1 
ATOM   5081 C  CD1   . PHE C 1 222 ? 24.792  44.148  6.291   1.00 34.04 ? 223  PHE C CD1   1 
ATOM   5082 C  CD2   . PHE C 1 222 ? 24.200  46.192  7.389   1.00 33.76 ? 223  PHE C CD2   1 
ATOM   5083 C  CE1   . PHE C 1 222 ? 24.205  43.417  7.342   1.00 34.55 ? 223  PHE C CE1   1 
ATOM   5084 C  CE2   . PHE C 1 222 ? 23.613  45.452  8.422   1.00 33.72 ? 223  PHE C CE2   1 
ATOM   5085 C  CZ    . PHE C 1 222 ? 23.660  44.074  8.406   1.00 33.42 ? 223  PHE C CZ    1 
ATOM   5086 N  N     . CYS C 1 223 ? 22.100  47.647  4.965   1.00 33.93 ? 224  CYS C N     1 
ATOM   5087 C  CA    . CYS C 1 223 ? 21.112  48.610  5.444   1.00 34.00 ? 224  CYS C CA    1 
ATOM   5088 C  C     . CYS C 1 223 ? 20.825  48.382  6.900   1.00 33.67 ? 224  CYS C C     1 
ATOM   5089 O  O     . CYS C 1 223 ? 20.583  47.234  7.322   1.00 33.81 ? 224  CYS C O     1 
ATOM   5090 C  CB    . CYS C 1 223 ? 19.807  48.473  4.681   1.00 34.78 ? 224  CYS C CB    1 
ATOM   5091 S  SG    . CYS C 1 223 ? 19.932  49.005  2.988   1.00 35.46 ? 224  CYS C SG    1 
ATOM   5092 N  N     . VAL C 1 224 ? 20.834  49.488  7.645   1.00 33.74 ? 225  VAL C N     1 
ATOM   5093 C  CA    . VAL C 1 224 ? 20.515  49.520  9.081   1.00 34.52 ? 225  VAL C CA    1 
ATOM   5094 C  C     . VAL C 1 224 ? 19.418  50.606  9.280   1.00 34.32 ? 225  VAL C C     1 
ATOM   5095 O  O     . VAL C 1 224 ? 19.582  51.732  8.833   1.00 35.56 ? 225  VAL C O     1 
ATOM   5096 C  CB    . VAL C 1 224 ? 21.791  49.815  9.941   1.00 35.24 ? 225  VAL C CB    1 
ATOM   5097 C  CG1   . VAL C 1 224 ? 21.470  50.062  11.456  1.00 35.83 ? 225  VAL C CG1   1 
ATOM   5098 C  CG2   . VAL C 1 224 ? 22.830  48.700  9.799   1.00 34.45 ? 225  VAL C CG2   1 
ATOM   5099 N  N     . ALA C 1 225 ? 18.297  50.254  9.885   1.00 34.01 ? 226  ALA C N     1 
ATOM   5100 C  CA    . ALA C 1 225 ? 17.272  51.262  10.276  1.00 32.97 ? 226  ALA C CA    1 
ATOM   5101 C  C     . ALA C 1 225 ? 17.755  51.935  11.549  1.00 33.16 ? 226  ALA C C     1 
ATOM   5102 O  O     . ALA C 1 225 ? 17.798  51.314  12.602  1.00 34.34 ? 226  ALA C O     1 
ATOM   5103 C  CB    . ALA C 1 225 ? 15.897  50.607  10.490  1.00 33.53 ? 226  ALA C CB    1 
ATOM   5104 N  N     . LEU C 1 226 ? 18.152  53.192  11.448  1.00 32.24 ? 227  LEU C N     1 
ATOM   5105 C  CA    . LEU C 1 226 ? 18.566  53.943  12.601  1.00 32.28 ? 227  LEU C CA    1 
ATOM   5106 C  C     . LEU C 1 226 ? 17.491  53.975  13.694  1.00 32.83 ? 227  LEU C C     1 
ATOM   5107 O  O     . LEU C 1 226 ? 17.782  53.938  14.905  1.00 31.80 ? 227  LEU C O     1 
ATOM   5108 C  CB    . LEU C 1 226 ? 18.888  55.366  12.177  1.00 32.47 ? 227  LEU C CB    1 
ATOM   5109 C  CG    . LEU C 1 226 ? 20.224  55.630  11.499  1.00 32.61 ? 227  LEU C CG    1 
ATOM   5110 C  CD1   . LEU C 1 226 ? 20.209  56.973  10.758  1.00 30.77 ? 227  LEU C CD1   1 
ATOM   5111 C  CD2   . LEU C 1 226 ? 21.305  55.571  12.561  1.00 30.58 ? 227  LEU C CD2   1 
ATOM   5112 N  N     . SER C 1 227 ? 16.244  54.010  13.229  1.00 34.57 ? 228  SER C N     1 
ATOM   5113 C  CA    . SER C 1 227 ? 15.064  54.134  14.106  1.00 35.44 ? 228  SER C CA    1 
ATOM   5114 C  C     . SER C 1 227 ? 14.700  52.821  14.823  1.00 35.75 ? 228  SER C C     1 
ATOM   5115 O  O     . SER C 1 227 ? 13.748  52.800  15.587  1.00 37.47 ? 228  SER C O     1 
ATOM   5116 C  CB    . SER C 1 227 ? 13.866  54.669  13.255  1.00 35.41 ? 228  SER C CB    1 
ATOM   5117 O  OG    . SER C 1 227 ? 13.728  53.944  12.051  1.00 36.02 ? 228  SER C OG    1 
ATOM   5118 N  N     . ASP C 1 228 ? 15.518  51.773  14.640  1.00 35.72 ? 229  ASP C N     1 
ATOM   5119 C  CA    . ASP C 1 228 ? 15.369  50.424  15.287  1.00 36.05 ? 229  ASP C CA    1 
ATOM   5120 C  C     . ASP C 1 228 ? 15.883  50.363  16.707  1.00 34.85 ? 229  ASP C C     1 
ATOM   5121 O  O     . ASP C 1 228 ? 15.803  49.315  17.339  1.00 32.82 ? 229  ASP C O     1 
ATOM   5122 C  CB    . ASP C 1 228 ? 16.224  49.356  14.557  1.00 36.60 ? 229  ASP C CB    1 
ATOM   5123 C  CG    . ASP C 1 228 ? 15.506  48.636  13.465  1.00 38.94 ? 229  ASP C CG    1 
ATOM   5124 O  OD1   . ASP C 1 228 ? 14.340  48.935  13.149  1.00 41.15 ? 229  ASP C OD1   1 
ATOM   5125 O  OD2   . ASP C 1 228 ? 16.158  47.717  12.930  1.00 42.75 ? 229  ASP C OD2   1 
ATOM   5126 N  N     . TYR C 1 229 ? 16.464  51.449  17.206  1.00 34.22 ? 230  TYR C N     1 
ATOM   5127 C  CA    . TYR C 1 229 ? 17.267  51.357  18.406  1.00 33.99 ? 230  TYR C CA    1 
ATOM   5128 C  C     . TYR C 1 229 ? 16.424  51.073  19.624  1.00 33.75 ? 230  TYR C C     1 
ATOM   5129 O  O     . TYR C 1 229 ? 16.961  50.628  20.603  1.00 33.03 ? 230  TYR C O     1 
ATOM   5130 C  CB    . TYR C 1 229 ? 18.084  52.630  18.635  1.00 33.78 ? 230  TYR C CB    1 
ATOM   5131 C  CG    . TYR C 1 229 ? 17.242  53.854  18.961  1.00 32.09 ? 230  TYR C CG    1 
ATOM   5132 C  CD1   . TYR C 1 229 ? 16.722  54.660  17.943  1.00 33.50 ? 230  TYR C CD1   1 
ATOM   5133 C  CD2   . TYR C 1 229 ? 16.984  54.220  20.282  1.00 32.30 ? 230  TYR C CD2   1 
ATOM   5134 C  CE1   . TYR C 1 229 ? 15.982  55.807  18.229  1.00 34.96 ? 230  TYR C CE1   1 
ATOM   5135 C  CE2   . TYR C 1 229 ? 16.233  55.363  20.577  1.00 34.47 ? 230  TYR C CE2   1 
ATOM   5136 C  CZ    . TYR C 1 229 ? 15.723  56.139  19.536  1.00 35.33 ? 230  TYR C CZ    1 
ATOM   5137 O  OH    . TYR C 1 229 ? 14.982  57.281  19.801  1.00 36.78 ? 230  TYR C OH    1 
ATOM   5138 N  N     . ASP C 1 230 ? 15.122  51.393  19.577  1.00 33.96 ? 231  ASP C N     1 
ATOM   5139 C  CA    . ASP C 1 230 ? 14.235  51.078  20.700  1.00 34.23 ? 231  ASP C CA    1 
ATOM   5140 C  C     . ASP C 1 230 ? 13.141  50.059  20.341  1.00 33.27 ? 231  ASP C C     1 
ATOM   5141 O  O     . ASP C 1 230 ? 12.157  49.959  21.064  1.00 32.61 ? 231  ASP C O     1 
ATOM   5142 C  CB    . ASP C 1 230 ? 13.589  52.369  21.245  1.00 34.46 ? 231  ASP C CB    1 
ATOM   5143 C  CG    . ASP C 1 230 ? 12.640  53.024  20.241  1.00 34.18 ? 231  ASP C CG    1 
ATOM   5144 O  OD1   . ASP C 1 230 ? 12.603  52.622  19.067  1.00 33.07 ? 231  ASP C OD1   1 
ATOM   5145 O  OD2   . ASP C 1 230 ? 11.927  53.984  20.607  1.00 37.71 ? 231  ASP C OD2   1 
ATOM   5146 N  N     . LEU C 1 231 ? 13.316  49.319  19.248  1.00 33.11 ? 232  LEU C N     1 
ATOM   5147 C  CA    . LEU C 1 231 ? 12.359  48.292  18.801  1.00 32.73 ? 232  LEU C CA    1 
ATOM   5148 C  C     . LEU C 1 231 ? 12.890  46.876  19.049  1.00 33.33 ? 232  LEU C C     1 
ATOM   5149 O  O     . LEU C 1 231 ? 14.072  46.687  19.230  1.00 32.11 ? 232  LEU C O     1 
ATOM   5150 C  CB    . LEU C 1 231 ? 12.084  48.455  17.290  1.00 32.63 ? 232  LEU C CB    1 
ATOM   5151 C  CG    . LEU C 1 231 ? 11.666  49.848  16.778  1.00 33.44 ? 232  LEU C CG    1 
ATOM   5152 C  CD1   . LEU C 1 231 ? 11.380  49.871  15.263  1.00 35.47 ? 232  LEU C CD1   1 
ATOM   5153 C  CD2   . LEU C 1 231 ? 10.431  50.265  17.602  1.00 35.73 ? 232  LEU C CD2   1 
ATOM   5154 N  N     . VAL C 1 232 ? 11.974  45.899  19.018  1.00 32.64 ? 233  VAL C N     1 
ATOM   5155 C  CA    . VAL C 1 232 ? 12.292  44.500  19.037  1.00 32.03 ? 233  VAL C CA    1 
ATOM   5156 C  C     . VAL C 1 232 ? 11.914  43.833  17.699  1.00 32.16 ? 233  VAL C C     1 
ATOM   5157 O  O     . VAL C 1 232 ? 11.040  44.314  16.944  1.00 32.11 ? 233  VAL C O     1 
ATOM   5158 C  CB    . VAL C 1 232 ? 11.634  43.803  20.231  1.00 31.97 ? 233  VAL C CB    1 
ATOM   5159 C  CG1   . VAL C 1 232 ? 12.160  44.412  21.603  1.00 32.08 ? 233  VAL C CG1   1 
ATOM   5160 C  CG2   . VAL C 1 232 ? 10.096  43.834  20.151  1.00 30.64 ? 233  VAL C CG2   1 
ATOM   5161 N  N     . LEU C 1 233 ? 12.604  42.737  17.410  1.00 31.15 ? 234  LEU C N     1 
ATOM   5162 C  CA    . LEU C 1 233 ? 12.380  41.952  16.189  1.00 31.37 ? 234  LEU C CA    1 
ATOM   5163 C  C     . LEU C 1 233 ? 10.977  41.356  16.175  1.00 31.26 ? 234  LEU C C     1 
ATOM   5164 O  O     . LEU C 1 233 ? 10.503  40.878  17.191  1.00 29.87 ? 234  LEU C O     1 
ATOM   5165 C  CB    . LEU C 1 233 ? 13.381  40.796  16.081  1.00 30.64 ? 234  LEU C CB    1 
ATOM   5166 C  CG    . LEU C 1 233 ? 14.845  41.145  15.941  1.00 32.41 ? 234  LEU C CG    1 
ATOM   5167 C  CD1   . LEU C 1 233 ? 15.701  39.918  16.062  1.00 34.27 ? 234  LEU C CD1   1 
ATOM   5168 C  CD2   . LEU C 1 233 ? 15.086  41.862  14.590  1.00 32.81 ? 234  LEU C CD2   1 
ATOM   5169 N  N     . ALA C 1 234 ? 10.331  41.386  15.009  1.00 30.69 ? 235  ALA C N     1 
ATOM   5170 C  CA    . ALA C 1 234 ? 9.049   40.690  14.796  1.00 30.88 ? 235  ALA C CA    1 
ATOM   5171 C  C     . ALA C 1 234 ? 9.190   39.155  15.010  1.00 30.64 ? 235  ALA C C     1 
ATOM   5172 O  O     . ALA C 1 234 ? 8.280   38.517  15.510  1.00 29.96 ? 235  ALA C O     1 
ATOM   5173 C  CB    . ALA C 1 234 ? 8.502   41.007  13.375  1.00 31.15 ? 235  ALA C CB    1 
ATOM   5174 N  N     . GLU C 1 235 ? 10.361  38.596  14.690  1.00 29.95 ? 236  GLU C N     1 
ATOM   5175 C  CA    . GLU C 1 235 ? 10.614  37.163  14.818  1.00 31.29 ? 236  GLU C CA    1 
ATOM   5176 C  C     . GLU C 1 235 ? 11.182  36.788  16.216  1.00 31.15 ? 236  GLU C C     1 
ATOM   5177 O  O     . GLU C 1 235 ? 11.300  35.625  16.553  1.00 31.29 ? 236  GLU C O     1 
ATOM   5178 C  CB    . GLU C 1 235 ? 11.519  36.632  13.684  1.00 31.34 ? 236  GLU C CB    1 
ATOM   5179 C  CG    . GLU C 1 235 ? 12.969  37.144  13.685  1.00 31.98 ? 236  GLU C CG    1 
ATOM   5180 C  CD    . GLU C 1 235 ? 13.156  38.417  12.804  1.00 34.97 ? 236  GLU C CD    1 
ATOM   5181 O  OE1   . GLU C 1 235 ? 12.332  39.372  12.924  1.00 33.38 ? 236  GLU C OE1   1 
ATOM   5182 O  OE2   . GLU C 1 235 ? 14.112  38.464  12.005  1.00 33.53 ? 236  GLU C OE2   1 
ATOM   5183 N  N     . ASP C 1 236 ? 11.503  37.787  17.022  1.00 31.26 ? 237  ASP C N     1 
ATOM   5184 C  CA    . ASP C 1 236 ? 11.991  37.574  18.408  1.00 31.60 ? 237  ASP C CA    1 
ATOM   5185 C  C     . ASP C 1 236 ? 11.763  38.824  19.190  1.00 30.53 ? 237  ASP C C     1 
ATOM   5186 O  O     . ASP C 1 236 ? 12.566  39.761  19.142  1.00 31.02 ? 237  ASP C O     1 
ATOM   5187 C  CB    . ASP C 1 236 ? 13.486  37.230  18.458  1.00 31.98 ? 237  ASP C CB    1 
ATOM   5188 C  CG    . ASP C 1 236 ? 13.965  36.857  19.855  1.00 32.82 ? 237  ASP C CG    1 
ATOM   5189 O  OD1   . ASP C 1 236 ? 13.318  37.211  20.882  1.00 33.70 ? 237  ASP C OD1   1 
ATOM   5190 O  OD2   . ASP C 1 236 ? 15.024  36.177  19.932  1.00 34.83 ? 237  ASP C OD2   1 
ATOM   5191 N  N     . GLU C 1 237 ? 10.673  38.841  19.932  1.00 30.10 ? 238  GLU C N     1 
ATOM   5192 C  CA    . GLU C 1 237 ? 10.240  40.088  20.556  1.00 31.05 ? 238  GLU C CA    1 
ATOM   5193 C  C     . GLU C 1 237 ? 11.060  40.436  21.815  1.00 31.16 ? 238  GLU C C     1 
ATOM   5194 O  O     . GLU C 1 237 ? 10.825  41.485  22.436  1.00 31.25 ? 238  GLU C O     1 
ATOM   5195 C  CB    . GLU C 1 237 ? 8.757   40.011  20.903  1.00 31.44 ? 238  GLU C CB    1 
ATOM   5196 C  CG    . GLU C 1 237 ? 7.856   39.858  19.672  1.00 32.79 ? 238  GLU C CG    1 
ATOM   5197 C  CD    . GLU C 1 237 ? 6.403   39.695  20.054  1.00 37.49 ? 238  GLU C CD    1 
ATOM   5198 O  OE1   . GLU C 1 237 ? 6.111   39.625  21.276  1.00 41.66 ? 238  GLU C OE1   1 
ATOM   5199 O  OE2   . GLU C 1 237 ? 5.554   39.610  19.150  1.00 37.79 ? 238  GLU C OE2   1 
ATOM   5200 N  N     . GLU C 1 238 ? 11.993  39.556  22.181  1.00 30.52 ? 239  GLU C N     1 
ATOM   5201 C  CA    . GLU C 1 238 ? 12.916  39.791  23.300  1.00 31.07 ? 239  GLU C CA    1 
ATOM   5202 C  C     . GLU C 1 238 ? 14.320  40.219  22.817  1.00 31.91 ? 239  GLU C C     1 
ATOM   5203 O  O     . GLU C 1 238 ? 15.257  40.287  23.605  1.00 33.56 ? 239  GLU C O     1 
ATOM   5204 C  CB    . GLU C 1 238 ? 12.991  38.565  24.174  1.00 30.17 ? 239  GLU C CB    1 
ATOM   5205 C  CG    . GLU C 1 238 ? 11.666  38.269  24.929  1.00 30.80 ? 239  GLU C CG    1 
ATOM   5206 C  CD    . GLU C 1 238 ? 10.626  37.642  24.010  1.00 31.65 ? 239  GLU C CD    1 
ATOM   5207 O  OE1   . GLU C 1 238 ? 11.011  36.802  23.162  1.00 31.66 ? 239  GLU C OE1   1 
ATOM   5208 O  OE2   . GLU C 1 238 ? 9.444   37.984  24.138  1.00 34.28 ? 239  GLU C OE2   1 
ATOM   5209 N  N     . MET C 1 239 ? 14.452  40.504  21.532  1.00 31.74 ? 240  MET C N     1 
ATOM   5210 C  CA    . MET C 1 239 ? 15.712  40.956  20.943  1.00 31.98 ? 240  MET C CA    1 
ATOM   5211 C  C     . MET C 1 239 ? 15.563  42.362  20.388  1.00 31.53 ? 240  MET C C     1 
ATOM   5212 O  O     . MET C 1 239 ? 14.757  42.607  19.479  1.00 30.78 ? 240  MET C O     1 
ATOM   5213 C  CB    . MET C 1 239 ? 16.176  39.997  19.821  1.00 32.05 ? 240  MET C CB    1 
ATOM   5214 C  CG    . MET C 1 239 ? 17.453  40.423  19.141  1.00 31.70 ? 240  MET C CG    1 
ATOM   5215 S  SD    . MET C 1 239 ? 18.840  40.370  20.333  1.00 39.06 ? 240  MET C SD    1 
ATOM   5216 C  CE    . MET C 1 239 ? 20.227  40.664  19.217  1.00 38.02 ? 240  MET C CE    1 
ATOM   5217 N  N     . ASN C 1 240 ? 16.386  43.274  20.919  1.00 30.81 ? 241  ASN C N     1 
ATOM   5218 C  CA    . ASN C 1 240 ? 16.536  44.617  20.373  1.00 30.71 ? 241  ASN C CA    1 
ATOM   5219 C  C     . ASN C 1 240 ? 16.996  44.593  18.898  1.00 30.26 ? 241  ASN C C     1 
ATOM   5220 O  O     . ASN C 1 240 ? 17.966  43.913  18.558  1.00 31.68 ? 241  ASN C O     1 
ATOM   5221 C  CB    . ASN C 1 240 ? 17.533  45.415  21.216  1.00 30.28 ? 241  ASN C CB    1 
ATOM   5222 C  CG    . ASN C 1 240 ? 17.719  46.842  20.705  1.00 30.44 ? 241  ASN C CG    1 
ATOM   5223 O  OD1   . ASN C 1 240 ? 18.363  47.070  19.693  1.00 30.96 ? 241  ASN C OD1   1 
ATOM   5224 N  ND2   . ASN C 1 240 ? 17.093  47.804  21.389  1.00 30.12 ? 241  ASN C ND2   1 
ATOM   5225 N  N     . ARG C 1 241 ? 16.290  45.316  18.045  1.00 30.49 ? 242  ARG C N     1 
ATOM   5226 C  CA    . ARG C 1 241 ? 16.490  45.256  16.579  1.00 31.80 ? 242  ARG C CA    1 
ATOM   5227 C  C     . ARG C 1 241 ? 17.860  45.743  16.134  1.00 32.65 ? 242  ARG C C     1 
ATOM   5228 O  O     . ARG C 1 241 ? 18.482  45.194  15.207  1.00 32.84 ? 242  ARG C O     1 
ATOM   5229 C  CB    . ARG C 1 241 ? 15.455  46.070  15.852  1.00 32.77 ? 242  ARG C CB    1 
ATOM   5230 C  CG    . ARG C 1 241 ? 14.060  45.468  15.855  1.00 31.75 ? 242  ARG C CG    1 
ATOM   5231 C  CD    . ARG C 1 241 ? 13.321  46.036  14.610  1.00 33.71 ? 242  ARG C CD    1 
ATOM   5232 N  NE    . ARG C 1 241 ? 12.001  45.445  14.456  1.00 36.02 ? 242  ARG C NE    1 
ATOM   5233 C  CZ    . ARG C 1 241 ? 11.268  45.539  13.344  1.00 37.44 ? 242  ARG C CZ    1 
ATOM   5234 N  NH1   . ARG C 1 241 ? 11.729  46.209  12.308  1.00 38.67 ? 242  ARG C NH1   1 
ATOM   5235 N  NH2   . ARG C 1 241 ? 10.092  44.948  13.282  1.00 38.74 ? 242  ARG C NH2   1 
ATOM   5236 N  N     . MET C 1 242 ? 18.347  46.761  16.823  1.00 32.64 ? 243  MET C N     1 
ATOM   5237 C  CA    A MET C 1 242 ? 19.647  47.312  16.485  0.50 31.41 ? 243  MET C CA    1 
ATOM   5238 C  CA    B MET C 1 242 ? 19.646  47.319  16.501  0.50 32.80 ? 243  MET C CA    1 
ATOM   5239 C  C     . MET C 1 242 ? 20.751  46.401  16.999  1.00 32.13 ? 243  MET C C     1 
ATOM   5240 O  O     . MET C 1 242 ? 21.783  46.273  16.344  1.00 32.44 ? 243  MET C O     1 
ATOM   5241 C  CB    A MET C 1 242 ? 19.800  48.749  16.998  0.50 30.80 ? 243  MET C CB    1 
ATOM   5242 C  CB    B MET C 1 242 ? 19.783  48.726  17.083  0.50 32.54 ? 243  MET C CB    1 
ATOM   5243 C  CG    A MET C 1 242 ? 21.109  49.404  16.568  0.50 30.93 ? 243  MET C CG    1 
ATOM   5244 C  CG    B MET C 1 242 ? 21.061  49.433  16.681  0.50 35.04 ? 243  MET C CG    1 
ATOM   5245 S  SD    A MET C 1 242 ? 21.111  51.225  16.661  0.50 27.28 ? 243  MET C SD    1 
ATOM   5246 S  SD    B MET C 1 242 ? 21.081  49.931  14.949  0.50 38.33 ? 243  MET C SD    1 
ATOM   5247 C  CE    A MET C 1 242 ? 20.644  51.658  14.982  0.50 27.37 ? 243  MET C CE    1 
ATOM   5248 C  CE    B MET C 1 242 ? 20.004  51.379  14.982  0.50 35.82 ? 243  MET C CE    1 
ATOM   5249 N  N     . HIS C 1 243 ? 20.539  45.752  18.163  1.00 32.06 ? 244  HIS C N     1 
ATOM   5250 C  CA    . HIS C 1 243 ? 21.494  44.738  18.619  1.00 31.08 ? 244  HIS C CA    1 
ATOM   5251 C  C     . HIS C 1 243 ? 21.605  43.656  17.558  1.00 31.24 ? 244  HIS C C     1 
ATOM   5252 O  O     . HIS C 1 243 ? 22.696  43.205  17.253  1.00 31.09 ? 244  HIS C O     1 
ATOM   5253 C  CB    . HIS C 1 243 ? 21.115  44.146  19.980  1.00 31.20 ? 244  HIS C CB    1 
ATOM   5254 C  CG    . HIS C 1 243 ? 21.246  45.108  21.131  1.00 29.98 ? 244  HIS C CG    1 
ATOM   5255 N  ND1   . HIS C 1 243 ? 20.941  44.764  22.431  1.00 33.14 ? 244  HIS C ND1   1 
ATOM   5256 C  CD2   . HIS C 1 243 ? 21.619  46.414  21.167  1.00 32.51 ? 244  HIS C CD2   1 
ATOM   5257 C  CE1   . HIS C 1 243 ? 21.136  45.812  23.221  1.00 35.51 ? 244  HIS C CE1   1 
ATOM   5258 N  NE2   . HIS C 1 243 ? 21.544  46.829  22.474  1.00 31.41 ? 244  HIS C NE2   1 
ATOM   5259 N  N     . GLU C 1 244 ? 20.463  43.236  17.006  1.00 31.20 ? 245  GLU C N     1 
ATOM   5260 C  CA    . GLU C 1 244 ? 20.398  42.203  15.950  1.00 32.62 ? 245  GLU C CA    1 
ATOM   5261 C  C     . GLU C 1 244 ? 21.161  42.651  14.704  1.00 33.43 ? 245  GLU C C     1 
ATOM   5262 O  O     . GLU C 1 244 ? 21.970  41.881  14.153  1.00 34.03 ? 245  GLU C O     1 
ATOM   5263 C  CB    . GLU C 1 244 ? 18.941  41.922  15.538  1.00 32.30 ? 245  GLU C CB    1 
ATOM   5264 C  CG    . GLU C 1 244 ? 18.780  40.840  14.462  1.00 34.57 ? 245  GLU C CG    1 
ATOM   5265 C  CD    . GLU C 1 244 ? 18.932  39.423  14.938  1.00 34.87 ? 245  GLU C CD    1 
ATOM   5266 O  OE1   . GLU C 1 244 ? 19.410  39.155  16.049  1.00 36.27 ? 245  GLU C OE1   1 
ATOM   5267 O  OE2   . GLU C 1 244 ? 18.535  38.515  14.183  1.00 36.11 ? 245  GLU C OE2   1 
ATOM   5268 N  N     . SER C 1 245 ? 20.888  43.882  14.264  1.00 33.49 ? 246  SER C N     1 
ATOM   5269 C  CA    . SER C 1 245 ? 21.634  44.516  13.147  1.00 34.49 ? 246  SER C CA    1 
ATOM   5270 C  C     . SER C 1 245 ? 23.137  44.586  13.367  1.00 33.42 ? 246  SER C C     1 
ATOM   5271 O  O     . SER C 1 245 ? 23.875  44.313  12.453  1.00 33.27 ? 246  SER C O     1 
ATOM   5272 C  CB    . SER C 1 245 ? 21.129  45.908  12.829  1.00 34.32 ? 246  SER C CB    1 
ATOM   5273 O  OG    . SER C 1 245 ? 19.858  45.792  12.243  1.00 42.42 ? 246  SER C OG    1 
ATOM   5274 N  N     . MET C 1 246 ? 23.574  44.948  14.576  1.00 33.64 ? 247  MET C N     1 
ATOM   5275 C  CA    . MET C 1 246 ? 25.009  44.879  14.918  1.00 33.29 ? 247  MET C CA    1 
ATOM   5276 C  C     . MET C 1 246 ? 25.619  43.482  14.740  1.00 33.33 ? 247  MET C C     1 
ATOM   5277 O  O     . MET C 1 246 ? 26.677  43.351  14.136  1.00 32.87 ? 247  MET C O     1 
ATOM   5278 C  CB    . MET C 1 246 ? 25.251  45.392  16.324  1.00 33.40 ? 247  MET C CB    1 
ATOM   5279 C  CG    . MET C 1 246 ? 25.019  46.890  16.478  1.00 32.61 ? 247  MET C CG    1 
ATOM   5280 S  SD    . MET C 1 246 ? 25.229  47.406  18.169  1.00 37.10 ? 247  MET C SD    1 
ATOM   5281 C  CE    . MET C 1 246 ? 26.988  47.265  18.377  1.00 34.56 ? 247  MET C CE    1 
ATOM   5282 N  N     . LYS C 1 247 ? 24.964  42.447  15.255  1.00 33.20 ? 248  LYS C N     1 
ATOM   5283 C  CA    . LYS C 1 247 ? 25.507  41.085  15.186  1.00 35.10 ? 248  LYS C CA    1 
ATOM   5284 C  C     . LYS C 1 247 ? 25.586  40.662  13.725  1.00 33.88 ? 248  LYS C C     1 
ATOM   5285 O  O     . LYS C 1 247 ? 26.562  40.072  13.285  1.00 32.51 ? 248  LYS C O     1 
ATOM   5286 C  CB    . LYS C 1 247 ? 24.614  40.121  15.973  1.00 35.13 ? 248  LYS C CB    1 
ATOM   5287 C  CG    . LYS C 1 247 ? 24.723  40.325  17.499  1.00 39.18 ? 248  LYS C CG    1 
ATOM   5288 C  CD    . LYS C 1 247 ? 23.688  39.471  18.300  1.00 39.60 ? 248  LYS C CD    1 
ATOM   5289 C  CE    . LYS C 1 247 ? 23.861  37.980  18.047  1.00 43.03 ? 248  LYS C CE    1 
ATOM   5290 N  NZ    . LYS C 1 247 ? 22.843  37.085  18.750  1.00 46.73 ? 248  LYS C NZ    1 
ATOM   5291 N  N     . LEU C 1 248 ? 24.547  41.015  12.972  1.00 33.81 ? 249  LEU C N     1 
ATOM   5292 C  CA    . LEU C 1 248 ? 24.473  40.670  11.541  1.00 33.92 ? 249  LEU C CA    1 
ATOM   5293 C  C     . LEU C 1 248 ? 25.529  41.423  10.714  1.00 33.63 ? 249  LEU C C     1 
ATOM   5294 O  O     . LEU C 1 248 ? 26.155  40.850  9.784   1.00 32.54 ? 249  LEU C O     1 
ATOM   5295 C  CB    . LEU C 1 248 ? 23.065  40.968  11.006  1.00 34.11 ? 249  LEU C CB    1 
ATOM   5296 C  CG    . LEU C 1 248 ? 22.674  40.564  9.589   1.00 34.58 ? 249  LEU C CG    1 
ATOM   5297 C  CD1   . LEU C 1 248 ? 22.923  39.063  9.366   1.00 33.55 ? 249  LEU C CD1   1 
ATOM   5298 C  CD2   . LEU C 1 248 ? 21.165  40.894  9.395   1.00 34.97 ? 249  LEU C CD2   1 
ATOM   5299 N  N     . PHE C 1 249 ? 25.730  42.707  11.018  1.00 33.11 ? 250  PHE C N     1 
ATOM   5300 C  CA    . PHE C 1 249 ? 26.777  43.455  10.335  1.00 33.81 ? 250  PHE C CA    1 
ATOM   5301 C  C     . PHE C 1 249 ? 28.191  42.923  10.661  1.00 32.84 ? 250  PHE C C     1 
ATOM   5302 O  O     . PHE C 1 249 ? 29.030  42.850  9.798   1.00 32.16 ? 250  PHE C O     1 
ATOM   5303 C  CB    . PHE C 1 249 ? 26.703  44.961  10.641  1.00 33.14 ? 250  PHE C CB    1 
ATOM   5304 C  CG    . PHE C 1 249 ? 27.718  45.770  9.878   1.00 35.31 ? 250  PHE C CG    1 
ATOM   5305 C  CD1   . PHE C 1 249 ? 27.631  45.902  8.495   1.00 33.66 ? 250  PHE C CD1   1 
ATOM   5306 C  CD2   . PHE C 1 249 ? 28.776  46.387  10.535  1.00 35.92 ? 250  PHE C CD2   1 
ATOM   5307 C  CE1   . PHE C 1 249 ? 28.561  46.660  7.788   1.00 34.25 ? 250  PHE C CE1   1 
ATOM   5308 C  CE2   . PHE C 1 249 ? 29.724  47.136  9.812   1.00 35.57 ? 250  PHE C CE2   1 
ATOM   5309 C  CZ    . PHE C 1 249 ? 29.595  47.271  8.431   1.00 32.74 ? 250  PHE C CZ    1 
ATOM   5310 N  N     . ASP C 1 250 ? 28.428  42.565  11.916  1.00 33.65 ? 251  ASP C N     1 
ATOM   5311 C  CA    . ASP C 1 250 ? 29.682  41.927  12.330  1.00 34.08 ? 251  ASP C CA    1 
ATOM   5312 C  C     . ASP C 1 250 ? 29.938  40.670  11.464  1.00 34.21 ? 251  ASP C C     1 
ATOM   5313 O  O     . ASP C 1 250 ? 31.011  40.508  10.845  1.00 34.17 ? 251  ASP C O     1 
ATOM   5314 C  CB    . ASP C 1 250 ? 29.576  41.618  13.827  1.00 34.32 ? 251  ASP C CB    1 
ATOM   5315 C  CG    . ASP C 1 250 ? 30.875  41.134  14.452  1.00 35.26 ? 251  ASP C CG    1 
ATOM   5316 O  OD1   . ASP C 1 250 ? 31.881  40.890  13.765  1.00 36.32 ? 251  ASP C OD1   1 
ATOM   5317 O  OD2   . ASP C 1 250 ? 30.859  40.984  15.683  1.00 38.13 ? 251  ASP C OD2   1 
ATOM   5318 N  N     . SER C 1 251 ? 28.935  39.808  11.386  1.00 35.13 ? 252  SER C N     1 
ATOM   5319 C  CA    . SER C 1 251 ? 29.003  38.593  10.570  1.00 35.05 ? 252  SER C CA    1 
ATOM   5320 C  C     . SER C 1 251 ? 29.337  38.889  9.102   1.00 35.25 ? 252  SER C C     1 
ATOM   5321 O  O     . SER C 1 251 ? 30.242  38.290  8.542   1.00 34.38 ? 252  SER C O     1 
ATOM   5322 C  CB    . SER C 1 251 ? 27.697  37.814  10.655  1.00 35.21 ? 252  SER C CB    1 
ATOM   5323 O  OG    . SER C 1 251 ? 27.808  36.614  9.940   1.00 37.21 ? 252  SER C OG    1 
ATOM   5324 N  N     . ILE C 1 252 ? 28.642  39.835  8.490   1.00 34.66 ? 253  ILE C N     1 
ATOM   5325 C  CA    . ILE C 1 252 ? 28.896  40.159  7.072   1.00 34.70 ? 253  ILE C CA    1 
ATOM   5326 C  C     . ILE C 1 252 ? 30.250  40.884  6.835   1.00 35.07 ? 253  ILE C C     1 
ATOM   5327 O  O     . ILE C 1 252 ? 31.062  40.475  5.989   1.00 33.09 ? 253  ILE C O     1 
ATOM   5328 C  CB    . ILE C 1 252 ? 27.709  40.991  6.455   1.00 35.16 ? 253  ILE C CB    1 
ATOM   5329 C  CG1   . ILE C 1 252 ? 26.405  40.172  6.493   1.00 34.33 ? 253  ILE C CG1   1 
ATOM   5330 C  CG2   . ILE C 1 252 ? 28.044  41.466  5.027   1.00 34.18 ? 253  ILE C CG2   1 
ATOM   5331 C  CD1   . ILE C 1 252 ? 26.386  38.857  5.623   1.00 34.33 ? 253  ILE C CD1   1 
ATOM   5332 N  N     . CYS C 1 253 ? 30.482  41.965  7.577   1.00 36.79 ? 254  CYS C N     1 
ATOM   5333 C  CA    . CYS C 1 253 ? 31.662  42.802  7.400   1.00 36.63 ? 254  CYS C CA    1 
ATOM   5334 C  C     . CYS C 1 253 ? 32.950  41.959  7.397   1.00 36.65 ? 254  CYS C C     1 
ATOM   5335 O  O     . CYS C 1 253 ? 33.862  42.184  6.597   1.00 35.64 ? 254  CYS C O     1 
ATOM   5336 C  CB    . CYS C 1 253 ? 31.720  43.806  8.560   1.00 36.59 ? 254  CYS C CB    1 
ATOM   5337 S  SG    . CYS C 1 253 ? 32.952  44.934  8.439   1.00 43.48 ? 254  CYS C SG    1 
ATOM   5338 N  N     . ASN C 1 254 ? 32.987  40.987  8.306   1.00 36.70 ? 255  ASN C N     1 
ATOM   5339 C  CA    . ASN C 1 254 ? 34.164  40.178  8.590   1.00 36.30 ? 255  ASN C CA    1 
ATOM   5340 C  C     . ASN C 1 254 ? 34.170  38.815  7.929   1.00 36.78 ? 255  ASN C C     1 
ATOM   5341 O  O     . ASN C 1 254 ? 35.050  37.970  8.210   1.00 36.72 ? 255  ASN C O     1 
ATOM   5342 C  CB    . ASN C 1 254 ? 34.258  40.015  10.097  1.00 36.60 ? 255  ASN C CB    1 
ATOM   5343 C  CG    . ASN C 1 254 ? 34.470  41.342  10.799  1.00 36.05 ? 255  ASN C CG    1 
ATOM   5344 O  OD1   . ASN C 1 254 ? 35.447  42.042  10.526  1.00 36.26 ? 255  ASN C OD1   1 
ATOM   5345 N  ND2   . ASN C 1 254 ? 33.568  41.690  11.706  1.00 33.86 ? 255  ASN C ND2   1 
ATOM   5346 N  N     . ASN C 1 255 ? 33.222  38.597  7.024   1.00 36.92 ? 256  ASN C N     1 
ATOM   5347 C  CA    . ASN C 1 255 ? 33.123  37.336  6.301   1.00 37.83 ? 256  ASN C CA    1 
ATOM   5348 C  C     . ASN C 1 255 ? 34.227  37.235  5.251   1.00 37.94 ? 256  ASN C C     1 
ATOM   5349 O  O     . ASN C 1 255 ? 34.477  38.189  4.516   1.00 37.74 ? 256  ASN C O     1 
ATOM   5350 C  CB    . ASN C 1 255 ? 31.747  37.247  5.640   1.00 37.90 ? 256  ASN C CB    1 
ATOM   5351 C  CG    . ASN C 1 255 ? 31.432  35.877  5.128   1.00 39.57 ? 256  ASN C CG    1 
ATOM   5352 O  OD1   . ASN C 1 255 ? 32.253  35.229  4.463   1.00 38.39 ? 256  ASN C OD1   1 
ATOM   5353 N  ND2   . ASN C 1 255 ? 30.219  35.425  5.411   1.00 42.71 ? 256  ASN C ND2   1 
ATOM   5354 N  N     . LYS C 1 256 ? 34.870  36.066  5.178   1.00 38.74 ? 257  LYS C N     1 
ATOM   5355 C  CA    . LYS C 1 256 ? 35.956  35.826  4.224   1.00 38.69 ? 257  LYS C CA    1 
ATOM   5356 C  C     . LYS C 1 256 ? 35.517  36.011  2.771   1.00 38.67 ? 257  LYS C C     1 
ATOM   5357 O  O     . LYS C 1 256 ? 36.329  36.387  1.927   1.00 38.51 ? 257  LYS C O     1 
ATOM   5358 C  CB    . LYS C 1 256 ? 36.570  34.427  4.421   1.00 39.48 ? 257  LYS C CB    1 
ATOM   5359 N  N     . TRP C 1 257 ? 34.230  35.781  2.492   1.00 38.68 ? 258  TRP C N     1 
ATOM   5360 C  CA    . TRP C 1 257 ? 33.669  36.016  1.155   1.00 38.46 ? 258  TRP C CA    1 
ATOM   5361 C  C     . TRP C 1 257 ? 33.860  37.464  0.694   1.00 37.76 ? 258  TRP C C     1 
ATOM   5362 O  O     . TRP C 1 257 ? 33.894  37.727  -0.506  1.00 36.52 ? 258  TRP C O     1 
ATOM   5363 C  CB    . TRP C 1 257 ? 32.169  35.688  1.133   1.00 39.41 ? 258  TRP C CB    1 
ATOM   5364 C  CG    . TRP C 1 257 ? 31.851  34.215  1.028   1.00 40.72 ? 258  TRP C CG    1 
ATOM   5365 C  CD1   . TRP C 1 257 ? 31.401  33.396  2.024   1.00 41.20 ? 258  TRP C CD1   1 
ATOM   5366 C  CD2   . TRP C 1 257 ? 31.957  33.398  -0.146  1.00 41.77 ? 258  TRP C CD2   1 
ATOM   5367 N  NE1   . TRP C 1 257 ? 31.231  32.119  1.545   1.00 41.56 ? 258  TRP C NE1   1 
ATOM   5368 C  CE2   . TRP C 1 257 ? 31.554  32.094  0.215   1.00 41.74 ? 258  TRP C CE2   1 
ATOM   5369 C  CE3   . TRP C 1 257 ? 32.365  33.640  -1.468  1.00 41.94 ? 258  TRP C CE3   1 
ATOM   5370 C  CZ2   . TRP C 1 257 ? 31.547  31.028  -0.697  1.00 42.12 ? 258  TRP C CZ2   1 
ATOM   5371 C  CZ3   . TRP C 1 257 ? 32.350  32.587  -2.375  1.00 42.27 ? 258  TRP C CZ3   1 
ATOM   5372 C  CH2   . TRP C 1 257 ? 31.947  31.290  -1.981  1.00 42.02 ? 258  TRP C CH2   1 
ATOM   5373 N  N     . PHE C 1 258 ? 33.932  38.400  1.653   1.00 37.06 ? 259  PHE C N     1 
ATOM   5374 C  CA    . PHE C 1 258 ? 33.888  39.824  1.343   1.00 36.44 ? 259  PHE C CA    1 
ATOM   5375 C  C     . PHE C 1 258 ? 35.167  40.573  1.693   1.00 36.67 ? 259  PHE C C     1 
ATOM   5376 O  O     . PHE C 1 258 ? 35.142  41.790  1.879   1.00 36.74 ? 259  PHE C O     1 
ATOM   5377 C  CB    . PHE C 1 258 ? 32.688  40.470  2.040   1.00 36.66 ? 259  PHE C CB    1 
ATOM   5378 C  CG    . PHE C 1 258 ? 31.407  39.725  1.828   1.00 35.43 ? 259  PHE C CG    1 
ATOM   5379 C  CD1   . PHE C 1 258 ? 31.043  39.291  0.552   1.00 37.06 ? 259  PHE C CD1   1 
ATOM   5380 C  CD2   . PHE C 1 258 ? 30.589  39.422  2.892   1.00 37.07 ? 259  PHE C CD2   1 
ATOM   5381 C  CE1   . PHE C 1 258 ? 29.859  38.579  0.352   1.00 36.64 ? 259  PHE C CE1   1 
ATOM   5382 C  CE2   . PHE C 1 258 ? 29.399  38.726  2.708   1.00 36.60 ? 259  PHE C CE2   1 
ATOM   5383 C  CZ    . PHE C 1 258 ? 29.033  38.306  1.436   1.00 35.89 ? 259  PHE C CZ    1 
ATOM   5384 N  N     . THR C 1 259 ? 36.293  39.867  1.730   1.00 36.78 ? 260  THR C N     1 
ATOM   5385 C  CA    . THR C 1 259 ? 37.556  40.518  2.010   1.00 36.71 ? 260  THR C CA    1 
ATOM   5386 C  C     . THR C 1 259 ? 37.838  41.602  0.964   1.00 36.95 ? 260  THR C C     1 
ATOM   5387 O  O     . THR C 1 259 ? 38.232  42.711  1.327   1.00 37.22 ? 260  THR C O     1 
ATOM   5388 C  CB    . THR C 1 259 ? 38.735  39.524  2.102   1.00 36.80 ? 260  THR C CB    1 
ATOM   5389 O  OG1   . THR C 1 259 ? 38.372  38.413  2.930   1.00 37.48 ? 260  THR C OG1   1 
ATOM   5390 C  CG2   . THR C 1 259 ? 39.960  40.228  2.713   1.00 38.67 ? 260  THR C CG2   1 
ATOM   5391 N  N     . GLU C 1 260 ? 37.633  41.303  -0.320  1.00 36.57 ? 261  GLU C N     1 
ATOM   5392 C  CA    . GLU C 1 260 ? 37.930  42.282  -1.382  1.00 36.64 ? 261  GLU C CA    1 
ATOM   5393 C  C     . GLU C 1 260 ? 36.688  43.063  -1.829  1.00 36.25 ? 261  GLU C C     1 
ATOM   5394 O  O     . GLU C 1 260 ? 36.770  43.931  -2.709  1.00 37.73 ? 261  GLU C O     1 
ATOM   5395 C  CB    . GLU C 1 260 ? 38.629  41.616  -2.584  1.00 37.26 ? 261  GLU C CB    1 
ATOM   5396 N  N     . THR C 1 261 ? 35.567  42.796  -1.179  1.00 34.88 ? 262  THR C N     1 
ATOM   5397 C  CA    . THR C 1 261 ? 34.299  43.441  -1.483  1.00 34.15 ? 262  THR C CA    1 
ATOM   5398 C  C     . THR C 1 261 ? 34.240  44.826  -0.824  1.00 33.58 ? 262  THR C C     1 
ATOM   5399 O  O     . THR C 1 261 ? 34.678  44.984  0.320   1.00 33.80 ? 262  THR C O     1 
ATOM   5400 C  CB    . THR C 1 261 ? 33.155  42.556  -0.957  1.00 34.06 ? 262  THR C CB    1 
ATOM   5401 O  OG1   . THR C 1 261 ? 33.274  41.254  -1.560  1.00 33.42 ? 262  THR C OG1   1 
ATOM   5402 C  CG2   . THR C 1 261 ? 31.761  43.184  -1.229  1.00 32.21 ? 262  THR C CG2   1 
ATOM   5403 N  N     . SER C 1 262 ? 33.761  45.832  -1.553  1.00 33.17 ? 263  SER C N     1 
ATOM   5404 C  CA    . SER C 1 262 ? 33.484  47.155  -0.939  1.00 33.09 ? 263  SER C CA    1 
ATOM   5405 C  C     . SER C 1 262 ? 32.243  47.073  -0.039  1.00 33.07 ? 263  SER C C     1 
ATOM   5406 O  O     . SER C 1 262 ? 31.146  46.748  -0.509  1.00 33.41 ? 263  SER C O     1 
ATOM   5407 C  CB    . SER C 1 262 ? 33.284  48.240  -2.002  1.00 33.05 ? 263  SER C CB    1 
ATOM   5408 O  OG    . SER C 1 262 ? 34.485  48.486  -2.695  1.00 32.45 ? 263  SER C OG    1 
ATOM   5409 N  N     . ILE C 1 263 ? 32.424  47.339  1.259   1.00 32.95 ? 264  ILE C N     1 
ATOM   5410 C  CA    . ILE C 1 263 ? 31.330  47.264  2.222   1.00 33.94 ? 264  ILE C CA    1 
ATOM   5411 C  C     . ILE C 1 263 ? 30.791  48.680  2.483   1.00 33.92 ? 264  ILE C C     1 
ATOM   5412 O  O     . ILE C 1 263 ? 31.456  49.523  3.108   1.00 33.45 ? 264  ILE C O     1 
ATOM   5413 C  CB    . ILE C 1 263 ? 31.752  46.588  3.542   1.00 34.00 ? 264  ILE C CB    1 
ATOM   5414 C  CG1   . ILE C 1 263 ? 32.391  45.229  3.276   1.00 34.93 ? 264  ILE C CG1   1 
ATOM   5415 C  CG2   . ILE C 1 263 ? 30.526  46.373  4.449   1.00 34.11 ? 264  ILE C CG2   1 
ATOM   5416 C  CD1   . ILE C 1 263 ? 31.442  44.141  3.008   1.00 32.11 ? 264  ILE C CD1   1 
ATOM   5417 N  N     . ILE C 1 264 ? 29.605  48.935  1.941   1.00 34.40 ? 265  ILE C N     1 
ATOM   5418 C  CA    . ILE C 1 264 ? 28.881  50.183  2.148   1.00 34.25 ? 265  ILE C CA    1 
ATOM   5419 C  C     . ILE C 1 264 ? 27.789  50.012  3.221   1.00 33.85 ? 265  ILE C C     1 
ATOM   5420 O  O     . ILE C 1 264 ? 26.968  49.066  3.170   1.00 33.34 ? 265  ILE C O     1 
ATOM   5421 C  CB    . ILE C 1 264 ? 28.267  50.690  0.803   1.00 34.20 ? 265  ILE C CB    1 
ATOM   5422 C  CG1   . ILE C 1 264 ? 29.375  51.054  -0.196  1.00 37.17 ? 265  ILE C CG1   1 
ATOM   5423 C  CG2   . ILE C 1 264 ? 27.335  51.859  1.043   1.00 35.45 ? 265  ILE C CG2   1 
ATOM   5424 C  CD1   . ILE C 1 264 ? 29.825  49.930  -1.014  1.00 39.51 ? 265  ILE C CD1   1 
ATOM   5425 N  N     . LEU C 1 265 ? 27.789  50.915  4.199   1.00 32.72 ? 266  LEU C N     1 
ATOM   5426 C  CA    . LEU C 1 265 ? 26.818  50.894  5.292   1.00 32.51 ? 266  LEU C CA    1 
ATOM   5427 C  C     . LEU C 1 265 ? 25.864  52.073  5.108   1.00 31.60 ? 266  LEU C C     1 
ATOM   5428 O  O     . LEU C 1 265 ? 26.291  53.220  5.107   1.00 31.71 ? 266  LEU C O     1 
ATOM   5429 C  CB    . LEU C 1 265 ? 27.545  51.000  6.637   1.00 32.37 ? 266  LEU C CB    1 
ATOM   5430 C  CG    . LEU C 1 265 ? 26.699  51.034  7.915   1.00 32.74 ? 266  LEU C CG    1 
ATOM   5431 C  CD1   . LEU C 1 265 ? 25.880  49.740  8.116   1.00 30.05 ? 266  LEU C CD1   1 
ATOM   5432 C  CD2   . LEU C 1 265 ? 27.595  51.353  9.165   1.00 34.32 ? 266  LEU C CD2   1 
ATOM   5433 N  N     . PHE C 1 266 ? 24.585  51.771  4.882   1.00 32.22 ? 267  PHE C N     1 
ATOM   5434 C  CA    . PHE C 1 266 ? 23.524  52.778  4.883   1.00 31.93 ? 267  PHE C CA    1 
ATOM   5435 C  C     . PHE C 1 266 ? 22.887  52.751  6.254   1.00 31.46 ? 267  PHE C C     1 
ATOM   5436 O  O     . PHE C 1 266 ? 22.180  51.782  6.621   1.00 30.64 ? 267  PHE C O     1 
ATOM   5437 C  CB    . PHE C 1 266 ? 22.422  52.494  3.849   1.00 31.34 ? 267  PHE C CB    1 
ATOM   5438 C  CG    . PHE C 1 266 ? 22.761  52.858  2.413   1.00 31.39 ? 267  PHE C CG    1 
ATOM   5439 C  CD1   . PHE C 1 266 ? 24.034  53.232  2.002   1.00 31.85 ? 267  PHE C CD1   1 
ATOM   5440 C  CD2   . PHE C 1 266 ? 21.746  52.807  1.455   1.00 30.95 ? 267  PHE C CD2   1 
ATOM   5441 C  CE1   . PHE C 1 266 ? 24.284  53.579  0.653   1.00 33.04 ? 267  PHE C CE1   1 
ATOM   5442 C  CE2   . PHE C 1 266 ? 21.988  53.129  0.114   1.00 32.09 ? 267  PHE C CE2   1 
ATOM   5443 C  CZ    . PHE C 1 266 ? 23.239  53.515  -0.288  1.00 29.59 ? 267  PHE C CZ    1 
ATOM   5444 N  N     . LEU C 1 267 ? 23.083  53.839  6.982   1.00 32.18 ? 268  LEU C N     1 
ATOM   5445 C  CA    . LEU C 1 267 ? 22.382  54.071  8.218   1.00 31.70 ? 268  LEU C CA    1 
ATOM   5446 C  C     . LEU C 1 267 ? 21.105  54.825  7.815   1.00 32.39 ? 268  LEU C C     1 
ATOM   5447 O  O     . LEU C 1 267 ? 21.093  56.052  7.660   1.00 32.89 ? 268  LEU C O     1 
ATOM   5448 C  CB    . LEU C 1 267 ? 23.263  54.829  9.189   1.00 32.87 ? 268  LEU C CB    1 
ATOM   5449 C  CG    . LEU C 1 267 ? 24.526  54.059  9.616   1.00 32.54 ? 268  LEU C CG    1 
ATOM   5450 C  CD1   . LEU C 1 267 ? 25.501  54.986  10.349  1.00 31.76 ? 268  LEU C CD1   1 
ATOM   5451 C  CD2   . LEU C 1 267 ? 24.182  52.829  10.465  1.00 34.12 ? 268  LEU C CD2   1 
ATOM   5452 N  N     . ASN C 1 268 ? 20.053  54.026  7.614   1.00 32.05 ? 269  ASN C N     1 
ATOM   5453 C  CA    . ASN C 1 268 ? 18.833  54.416  6.939   1.00 32.59 ? 269  ASN C CA    1 
ATOM   5454 C  C     . ASN C 1 268 ? 17.756  54.866  7.926   1.00 32.88 ? 269  ASN C C     1 
ATOM   5455 O  O     . ASN C 1 268 ? 17.948  54.795  9.134   1.00 32.52 ? 269  ASN C O     1 
ATOM   5456 C  CB    . ASN C 1 268 ? 18.372  53.242  6.052   1.00 32.65 ? 269  ASN C CB    1 
ATOM   5457 C  CG    . ASN C 1 268 ? 17.246  53.605  5.086   1.00 32.38 ? 269  ASN C CG    1 
ATOM   5458 O  OD1   . ASN C 1 268 ? 17.255  54.664  4.478   1.00 33.83 ? 269  ASN C OD1   1 
ATOM   5459 N  ND2   . ASN C 1 268 ? 16.218  52.737  5.013   1.00 32.34 ? 269  ASN C ND2   1 
ATOM   5460 N  N     . LYS C 1 269 ? 16.635  55.360  7.396   1.00 33.19 ? 270  LYS C N     1 
ATOM   5461 C  CA    . LYS C 1 269 ? 15.529  55.908  8.179   1.00 33.14 ? 270  LYS C CA    1 
ATOM   5462 C  C     . LYS C 1 269 ? 15.996  57.084  9.033   1.00 32.76 ? 270  LYS C C     1 
ATOM   5463 O  O     . LYS C 1 269 ? 15.543  57.235  10.164  1.00 32.56 ? 270  LYS C O     1 
ATOM   5464 C  CB    . LYS C 1 269 ? 14.831  54.825  8.998   1.00 32.81 ? 270  LYS C CB    1 
ATOM   5465 C  CG    . LYS C 1 269 ? 14.323  53.654  8.175   1.00 34.76 ? 270  LYS C CG    1 
ATOM   5466 C  CD    . LYS C 1 269 ? 13.415  52.705  8.965   1.00 35.50 ? 270  LYS C CD    1 
ATOM   5467 C  CE    . LYS C 1 269 ? 12.800  51.686  8.024   1.00 41.10 ? 270  LYS C CE    1 
ATOM   5468 N  NZ    . LYS C 1 269 ? 11.772  50.728  8.613   1.00 40.42 ? 270  LYS C NZ    1 
ATOM   5469 N  N     . LYS C 1 270 ? 16.916  57.891  8.487   1.00 33.37 ? 271  LYS C N     1 
ATOM   5470 C  CA    . LYS C 1 270 ? 17.426  59.066  9.216   1.00 33.59 ? 271  LYS C CA    1 
ATOM   5471 C  C     . LYS C 1 270 ? 16.326  60.075  9.528   1.00 33.48 ? 271  LYS C C     1 
ATOM   5472 O  O     . LYS C 1 270 ? 16.398  60.768  10.551  1.00 34.27 ? 271  LYS C O     1 
ATOM   5473 C  CB    . LYS C 1 270 ? 18.604  59.733  8.509   1.00 34.38 ? 271  LYS C CB    1 
ATOM   5474 C  CG    . LYS C 1 270 ? 18.253  60.459  7.214   1.00 33.58 ? 271  LYS C CG    1 
ATOM   5475 C  CD    . LYS C 1 270 ? 19.472  61.084  6.627   1.00 35.79 ? 271  LYS C CD    1 
ATOM   5476 C  CE    . LYS C 1 270 ? 19.221  61.562  5.235   1.00 35.31 ? 271  LYS C CE    1 
ATOM   5477 N  NZ    . LYS C 1 270 ? 19.048  62.984  5.235   1.00 36.98 ? 271  LYS C NZ    1 
ATOM   5478 N  N     . ASP C 1 271 ? 15.307  60.141  8.671   1.00 33.71 ? 272  ASP C N     1 
ATOM   5479 C  CA    . ASP C 1 271 ? 14.140  60.995  8.917   1.00 33.76 ? 272  ASP C CA    1 
ATOM   5480 C  C     . ASP C 1 271 ? 13.331  60.538  10.134  1.00 33.39 ? 272  ASP C C     1 
ATOM   5481 O  O     . ASP C 1 271 ? 12.968  61.355  11.003  1.00 34.00 ? 272  ASP C O     1 
ATOM   5482 C  CB    . ASP C 1 271 ? 13.240  61.075  7.668   1.00 33.61 ? 272  ASP C CB    1 
ATOM   5483 C  CG    . ASP C 1 271 ? 12.648  59.726  7.250   1.00 35.06 ? 272  ASP C CG    1 
ATOM   5484 O  OD1   . ASP C 1 271 ? 13.343  58.677  7.337   1.00 30.19 ? 272  ASP C OD1   1 
ATOM   5485 O  OD2   . ASP C 1 271 ? 11.471  59.736  6.775   1.00 35.08 ? 272  ASP C OD2   1 
ATOM   5486 N  N     . LEU C 1 272 ? 13.087  59.225  10.215  1.00 33.62 ? 273  LEU C N     1 
ATOM   5487 C  CA    . LEU C 1 272 ? 12.353  58.647  11.320  1.00 33.82 ? 273  LEU C CA    1 
ATOM   5488 C  C     . LEU C 1 272 ? 13.182  58.788  12.609  1.00 33.10 ? 273  LEU C C     1 
ATOM   5489 O  O     . LEU C 1 272 ? 12.649  59.099  13.680  1.00 32.20 ? 273  LEU C O     1 
ATOM   5490 C  CB    . LEU C 1 272 ? 11.993  57.174  11.030  1.00 33.74 ? 273  LEU C CB    1 
ATOM   5491 C  CG    . LEU C 1 272 ? 11.020  56.986  9.851   1.00 34.66 ? 273  LEU C CG    1 
ATOM   5492 C  CD1   . LEU C 1 272 ? 10.744  55.491  9.651   1.00 35.30 ? 273  LEU C CD1   1 
ATOM   5493 C  CD2   . LEU C 1 272 ? 9.715   57.771  10.031  1.00 37.37 ? 273  LEU C CD2   1 
ATOM   5494 N  N     . PHE C 1 273 ? 14.487  58.584  12.475  1.00 32.15 ? 274  PHE C N     1 
ATOM   5495 C  CA    . PHE C 1 273 ? 15.417  58.713  13.582  1.00 33.10 ? 274  PHE C CA    1 
ATOM   5496 C  C     . PHE C 1 273 ? 15.436  60.130  14.177  1.00 33.20 ? 274  PHE C C     1 
ATOM   5497 O  O     . PHE C 1 273 ? 15.423  60.289  15.424  1.00 33.13 ? 274  PHE C O     1 
ATOM   5498 C  CB    . PHE C 1 273 ? 16.826  58.266  13.157  1.00 32.95 ? 274  PHE C CB    1 
ATOM   5499 C  CG    . PHE C 1 273 ? 17.834  58.310  14.280  1.00 33.78 ? 274  PHE C CG    1 
ATOM   5500 C  CD1   . PHE C 1 273 ? 17.829  57.324  15.272  1.00 33.82 ? 274  PHE C CD1   1 
ATOM   5501 C  CD2   . PHE C 1 273 ? 18.788  59.313  14.346  1.00 33.95 ? 274  PHE C CD2   1 
ATOM   5502 C  CE1   . PHE C 1 273 ? 18.735  57.369  16.315  1.00 31.90 ? 274  PHE C CE1   1 
ATOM   5503 C  CE2   . PHE C 1 273 ? 19.700  59.355  15.379  1.00 33.04 ? 274  PHE C CE2   1 
ATOM   5504 C  CZ    . PHE C 1 273 ? 19.670  58.368  16.366  1.00 32.39 ? 274  PHE C CZ    1 
ATOM   5505 N  N     . GLU C 1 274 ? 15.480  61.150  13.312  1.00 34.64 ? 275  GLU C N     1 
ATOM   5506 C  CA    . GLU C 1 274 ? 15.489  62.554  13.747  1.00 35.63 ? 275  GLU C CA    1 
ATOM   5507 C  C     . GLU C 1 274 ? 14.276  62.871  14.619  1.00 36.03 ? 275  GLU C C     1 
ATOM   5508 O  O     . GLU C 1 274 ? 14.392  63.571  15.620  1.00 34.93 ? 275  GLU C O     1 
ATOM   5509 C  CB    . GLU C 1 274 ? 15.530  63.516  12.545  1.00 35.87 ? 275  GLU C CB    1 
ATOM   5510 C  CG    . GLU C 1 274 ? 15.437  65.002  12.934  1.00 35.84 ? 275  GLU C CG    1 
ATOM   5511 C  CD    . GLU C 1 274 ? 15.592  65.959  11.775  1.00 37.49 ? 275  GLU C CD    1 
ATOM   5512 O  OE1   . GLU C 1 274 ? 15.420  65.530  10.630  1.00 40.96 ? 275  GLU C OE1   1 
ATOM   5513 O  OE2   . GLU C 1 274 ? 15.821  67.176  12.014  1.00 40.39 ? 275  GLU C OE2   1 
ATOM   5514 N  N     . GLU C 1 275 ? 13.124  62.334  14.227  1.00 36.96 ? 276  GLU C N     1 
ATOM   5515 C  CA    . GLU C 1 275 ? 11.857  62.544  14.946  1.00 38.43 ? 276  GLU C CA    1 
ATOM   5516 C  C     . GLU C 1 275 ? 11.867  61.824  16.299  1.00 38.47 ? 276  GLU C C     1 
ATOM   5517 O  O     . GLU C 1 275 ? 11.469  62.368  17.332  1.00 39.71 ? 276  GLU C O     1 
ATOM   5518 C  CB    . GLU C 1 275 ? 10.688  62.018  14.080  1.00 38.98 ? 276  GLU C CB    1 
ATOM   5519 C  CG    . GLU C 1 275 ? 9.651   63.042  13.714  1.00 41.69 ? 276  GLU C CG    1 
ATOM   5520 N  N     . LYS C 1 276 ? 12.358  60.600  16.318  1.00 37.85 ? 277  LYS C N     1 
ATOM   5521 C  CA    . LYS C 1 276 ? 12.102  59.759  17.484  1.00 38.47 ? 277  LYS C CA    1 
ATOM   5522 C  C     . LYS C 1 276 ? 13.163  59.933  18.574  1.00 37.57 ? 277  LYS C C     1 
ATOM   5523 O  O     . LYS C 1 276 ? 12.879  59.770  19.759  1.00 37.75 ? 277  LYS C O     1 
ATOM   5524 C  CB    . LYS C 1 276 ? 11.860  58.312  17.058  1.00 38.28 ? 277  LYS C CB    1 
ATOM   5525 C  CG    . LYS C 1 276 ? 13.040  57.461  16.977  1.00 39.82 ? 277  LYS C CG    1 
ATOM   5526 C  CD    . LYS C 1 276 ? 12.688  56.028  16.397  1.00 41.20 ? 277  LYS C CD    1 
ATOM   5527 C  CE    . LYS C 1 276 ? 11.831  55.188  17.335  1.00 39.32 ? 277  LYS C CE    1 
ATOM   5528 N  NZ    . LYS C 1 276 ? 11.634  53.784  16.891  1.00 35.38 ? 277  LYS C NZ    1 
ATOM   5529 N  N     . ILE C 1 277 ? 14.358  60.356  18.192  1.00 37.28 ? 278  ILE C N     1 
ATOM   5530 C  CA    . ILE C 1 277 ? 15.429  60.562  19.163  1.00 37.30 ? 278  ILE C CA    1 
ATOM   5531 C  C     . ILE C 1 277 ? 15.058  61.617  20.232  1.00 39.00 ? 278  ILE C C     1 
ATOM   5532 O  O     . ILE C 1 277 ? 15.506  61.539  21.372  1.00 39.04 ? 278  ILE C O     1 
ATOM   5533 C  CB    . ILE C 1 277 ? 16.770  60.905  18.460  1.00 37.26 ? 278  ILE C CB    1 
ATOM   5534 C  CG1   . ILE C 1 277 ? 17.951  60.661  19.427  1.00 35.38 ? 278  ILE C CG1   1 
ATOM   5535 C  CG2   . ILE C 1 277 ? 16.762  62.350  17.839  1.00 34.19 ? 278  ILE C CG2   1 
ATOM   5536 C  CD1   . ILE C 1 277 ? 18.027  59.211  19.970  1.00 34.80 ? 278  ILE C CD1   1 
ATOM   5537 N  N     . LYS C 1 278 ? 14.186  62.547  19.868  1.00 40.12 ? 279  LYS C N     1 
ATOM   5538 C  CA    . LYS C 1 278 ? 13.688  63.570  20.788  1.00 42.10 ? 279  LYS C CA    1 
ATOM   5539 C  C     . LYS C 1 278 ? 12.796  63.003  21.924  1.00 43.23 ? 279  LYS C C     1 
ATOM   5540 O  O     . LYS C 1 278 ? 12.715  63.597  23.008  1.00 43.82 ? 279  LYS C O     1 
ATOM   5541 C  CB    . LYS C 1 278 ? 12.927  64.653  20.001  1.00 42.58 ? 279  LYS C CB    1 
ATOM   5542 C  CG    . LYS C 1 278 ? 13.657  65.158  18.731  1.00 44.27 ? 279  LYS C CG    1 
ATOM   5543 N  N     . ARG C 1 279 ? 12.164  61.857  21.678  1.00 43.61 ? 280  ARG C N     1 
ATOM   5544 C  CA    . ARG C 1 279 ? 11.146  61.260  22.544  1.00 44.90 ? 280  ARG C CA    1 
ATOM   5545 C  C     . ARG C 1 279 ? 11.609  59.973  23.229  1.00 43.71 ? 280  ARG C C     1 
ATOM   5546 O  O     . ARG C 1 279 ? 10.991  59.541  24.218  1.00 44.52 ? 280  ARG C O     1 
ATOM   5547 C  CB    . ARG C 1 279 ? 9.954   60.819  21.675  1.00 45.25 ? 280  ARG C CB    1 
ATOM   5548 C  CG    . ARG C 1 279 ? 9.010   61.905  21.211  1.00 48.68 ? 280  ARG C CG    1 
ATOM   5549 C  CD    . ARG C 1 279 ? 8.145   61.439  20.003  1.00 49.94 ? 280  ARG C CD    1 
ATOM   5550 N  NE    . ARG C 1 279 ? 8.527   62.113  18.755  1.00 55.91 ? 280  ARG C NE    1 
ATOM   5551 C  CZ    . ARG C 1 279 ? 8.358   63.417  18.509  1.00 56.11 ? 280  ARG C CZ    1 
ATOM   5552 N  NH1   . ARG C 1 279 ? 7.792   64.220  19.420  1.00 58.63 ? 280  ARG C NH1   1 
ATOM   5553 N  NH2   . ARG C 1 279 ? 8.758   63.927  17.346  1.00 56.59 ? 280  ARG C NH2   1 
ATOM   5554 N  N     . SER C 1 280 ? 12.624  59.314  22.669  1.00 41.82 ? 281  SER C N     1 
ATOM   5555 C  CA    . SER C 1 280 ? 13.018  57.968  23.128  1.00 40.92 ? 281  SER C CA    1 
ATOM   5556 C  C     . SER C 1 280 ? 14.545  57.920  23.166  1.00 39.80 ? 281  SER C C     1 
ATOM   5557 O  O     . SER C 1 280 ? 15.180  58.027  22.135  1.00 39.50 ? 281  SER C O     1 
ATOM   5558 C  CB    . SER C 1 280 ? 12.429  56.906  22.219  1.00 41.46 ? 281  SER C CB    1 
ATOM   5559 O  OG    . SER C 1 280 ? 12.567  55.604  22.778  1.00 42.06 ? 281  SER C OG    1 
ATOM   5560 N  N     . PRO C 1 281 ? 15.138  57.766  24.365  1.00 38.73 ? 282  PRO C N     1 
ATOM   5561 C  CA    . PRO C 1 281 ? 16.580  57.939  24.500  1.00 37.81 ? 282  PRO C CA    1 
ATOM   5562 C  C     . PRO C 1 281 ? 17.362  56.749  23.955  1.00 36.65 ? 282  PRO C C     1 
ATOM   5563 O  O     . PRO C 1 281 ? 16.922  55.592  24.059  1.00 37.00 ? 282  PRO C O     1 
ATOM   5564 C  CB    . PRO C 1 281 ? 16.771  58.052  26.009  1.00 37.54 ? 282  PRO C CB    1 
ATOM   5565 C  CG    . PRO C 1 281 ? 15.708  57.147  26.556  1.00 38.53 ? 282  PRO C CG    1 
ATOM   5566 C  CD    . PRO C 1 281 ? 14.520  57.386  25.656  1.00 38.97 ? 282  PRO C CD    1 
ATOM   5567 N  N     . LEU C 1 282 ? 18.526  57.050  23.401  1.00 35.26 ? 283  LEU C N     1 
ATOM   5568 C  CA    . LEU C 1 282 ? 19.403  56.061  22.783  1.00 34.51 ? 283  LEU C CA    1 
ATOM   5569 C  C     . LEU C 1 282 ? 19.995  55.073  23.822  1.00 34.05 ? 283  LEU C C     1 
ATOM   5570 O  O     . LEU C 1 282 ? 20.445  53.999  23.456  1.00 32.85 ? 283  LEU C O     1 
ATOM   5571 C  CB    . LEU C 1 282 ? 20.540  56.771  22.013  1.00 33.88 ? 283  LEU C CB    1 
ATOM   5572 C  CG    . LEU C 1 282 ? 21.451  55.910  21.140  1.00 33.89 ? 283  LEU C CG    1 
ATOM   5573 C  CD1   . LEU C 1 282 ? 20.700  55.182  20.032  1.00 33.17 ? 283  LEU C CD1   1 
ATOM   5574 C  CD2   . LEU C 1 282 ? 22.661  56.712  20.599  1.00 33.29 ? 283  LEU C CD2   1 
ATOM   5575 N  N     . THR C 1 283 ? 19.990  55.462  25.092  1.00 33.57 ? 284  THR C N     1 
ATOM   5576 C  CA    . THR C 1 283 ? 20.419  54.599  26.190  1.00 33.94 ? 284  THR C CA    1 
ATOM   5577 C  C     . THR C 1 283 ? 19.606  53.296  26.248  1.00 34.28 ? 284  THR C C     1 
ATOM   5578 O  O     . THR C 1 283 ? 20.035  52.340  26.887  1.00 34.17 ? 284  THR C O     1 
ATOM   5579 C  CB    . THR C 1 283 ? 20.293  55.314  27.586  1.00 33.41 ? 284  THR C CB    1 
ATOM   5580 O  OG1   . THR C 1 283 ? 19.008  55.957  27.661  1.00 33.67 ? 284  THR C OG1   1 
ATOM   5581 C  CG2   . THR C 1 283 ? 21.380  56.328  27.801  1.00 32.58 ? 284  THR C CG2   1 
ATOM   5582 N  N     . ILE C 1 284 ? 18.430  53.283  25.617  1.00 35.24 ? 285  ILE C N     1 
ATOM   5583 C  CA    . ILE C 1 284 ? 17.620  52.072  25.481  1.00 35.93 ? 285  ILE C CA    1 
ATOM   5584 C  C     . ILE C 1 284 ? 18.421  50.981  24.772  1.00 35.74 ? 285  ILE C C     1 
ATOM   5585 O  O     . ILE C 1 284 ? 18.355  49.792  25.129  1.00 36.41 ? 285  ILE C O     1 
ATOM   5586 C  CB    . ILE C 1 284 ? 16.289  52.353  24.707  1.00 35.67 ? 285  ILE C CB    1 
ATOM   5587 C  CG1   . ILE C 1 284 ? 15.353  53.191  25.591  1.00 37.12 ? 285  ILE C CG1   1 
ATOM   5588 C  CG2   . ILE C 1 284 ? 15.609  51.022  24.275  1.00 37.95 ? 285  ILE C CG2   1 
ATOM   5589 C  CD1   . ILE C 1 284 ? 14.062  53.624  24.938  1.00 37.42 ? 285  ILE C CD1   1 
ATOM   5590 N  N     . CYS C 1 285 ? 19.163  51.387  23.748  1.00 35.18 ? 286  CYS C N     1 
ATOM   5591 C  CA    . CYS C 1 285 ? 20.020  50.495  23.005  1.00 34.87 ? 286  CYS C CA    1 
ATOM   5592 C  C     . CYS C 1 285 ? 21.429  50.419  23.588  1.00 34.11 ? 286  CYS C C     1 
ATOM   5593 O  O     . CYS C 1 285 ? 22.031  49.351  23.630  1.00 34.23 ? 286  CYS C O     1 
ATOM   5594 C  CB    . CYS C 1 285 ? 20.088  50.962  21.559  1.00 34.53 ? 286  CYS C CB    1 
ATOM   5595 S  SG    . CYS C 1 285 ? 20.946  49.906  20.399  1.00 35.65 ? 286  CYS C SG    1 
ATOM   5596 N  N     . TYR C 1 286 ? 21.972  51.573  23.975  1.00 33.85 ? 287  TYR C N     1 
ATOM   5597 C  CA    . TYR C 1 286 ? 23.356  51.664  24.444  1.00 33.27 ? 287  TYR C CA    1 
ATOM   5598 C  C     . TYR C 1 286 ? 23.328  52.299  25.811  1.00 32.92 ? 287  TYR C C     1 
ATOM   5599 O  O     . TYR C 1 286 ? 23.370  53.544  25.936  1.00 31.06 ? 287  TYR C O     1 
ATOM   5600 C  CB    . TYR C 1 286 ? 24.215  52.514  23.488  1.00 33.83 ? 287  TYR C CB    1 
ATOM   5601 C  CG    . TYR C 1 286 ? 24.279  51.976  22.078  1.00 34.58 ? 287  TYR C CG    1 
ATOM   5602 C  CD1   . TYR C 1 286 ? 23.676  52.661  21.022  1.00 36.23 ? 287  TYR C CD1   1 
ATOM   5603 C  CD2   . TYR C 1 286 ? 24.971  50.789  21.783  1.00 36.43 ? 287  TYR C CD2   1 
ATOM   5604 C  CE1   . TYR C 1 286 ? 23.722  52.177  19.723  1.00 36.38 ? 287  TYR C CE1   1 
ATOM   5605 C  CE2   . TYR C 1 286 ? 25.042  50.302  20.471  1.00 36.07 ? 287  TYR C CE2   1 
ATOM   5606 C  CZ    . TYR C 1 286 ? 24.417  51.004  19.448  1.00 35.93 ? 287  TYR C CZ    1 
ATOM   5607 O  OH    . TYR C 1 286 ? 24.459  50.547  18.150  1.00 35.62 ? 287  TYR C OH    1 
ATOM   5608 N  N     . PRO C 1 287 ? 23.240  51.464  26.854  1.00 32.35 ? 288  PRO C N     1 
ATOM   5609 C  CA    . PRO C 1 287 ? 23.107  52.023  28.194  1.00 32.77 ? 288  PRO C CA    1 
ATOM   5610 C  C     . PRO C 1 287 ? 24.300  52.890  28.666  1.00 31.71 ? 288  PRO C C     1 
ATOM   5611 O  O     . PRO C 1 287 ? 24.117  53.715  29.523  1.00 32.20 ? 288  PRO C O     1 
ATOM   5612 C  CB    . PRO C 1 287 ? 22.944  50.778  29.089  1.00 32.97 ? 288  PRO C CB    1 
ATOM   5613 C  CG    . PRO C 1 287 ? 22.659  49.666  28.204  1.00 34.01 ? 288  PRO C CG    1 
ATOM   5614 C  CD    . PRO C 1 287 ? 23.219  49.987  26.862  1.00 33.57 ? 288  PRO C CD    1 
ATOM   5615 N  N     . GLU C 1 288 ? 25.476  52.692  28.094  1.00 31.64 ? 289  GLU C N     1 
ATOM   5616 C  CA    . GLU C 1 288 ? 26.667  53.479  28.405  1.00 32.94 ? 289  GLU C CA    1 
ATOM   5617 C  C     . GLU C 1 288 ? 26.702  54.873  27.749  1.00 32.67 ? 289  GLU C C     1 
ATOM   5618 O  O     . GLU C 1 288 ? 27.556  55.667  28.057  1.00 32.01 ? 289  GLU C O     1 
ATOM   5619 C  CB    . GLU C 1 288 ? 27.919  52.691  27.954  1.00 33.89 ? 289  GLU C CB    1 
ATOM   5620 C  CG    . GLU C 1 288 ? 28.223  52.729  26.382  1.00 36.27 ? 289  GLU C CG    1 
ATOM   5621 C  CD    . GLU C 1 288 ? 27.331  51.815  25.469  1.00 39.22 ? 289  GLU C CD    1 
ATOM   5622 O  OE1   . GLU C 1 288 ? 27.604  51.821  24.242  1.00 40.47 ? 289  GLU C OE1   1 
ATOM   5623 O  OE2   . GLU C 1 288 ? 26.395  51.095  25.942  1.00 37.91 ? 289  GLU C OE2   1 
ATOM   5624 N  N     . TYR C 1 289 ? 25.819  55.139  26.796  1.00 32.86 ? 290  TYR C N     1 
ATOM   5625 C  CA    . TYR C 1 289 ? 25.864  56.414  26.032  1.00 33.33 ? 290  TYR C CA    1 
ATOM   5626 C  C     . TYR C 1 289 ? 25.602  57.635  26.919  1.00 33.34 ? 290  TYR C C     1 
ATOM   5627 O  O     . TYR C 1 289 ? 24.569  57.718  27.578  1.00 33.26 ? 290  TYR C O     1 
ATOM   5628 C  CB    . TYR C 1 289 ? 24.859  56.386  24.907  1.00 33.36 ? 290  TYR C CB    1 
ATOM   5629 C  CG    . TYR C 1 289 ? 24.846  57.632  24.018  1.00 33.91 ? 290  TYR C CG    1 
ATOM   5630 C  CD1   . TYR C 1 289 ? 25.957  58.001  23.274  1.00 32.42 ? 290  TYR C CD1   1 
ATOM   5631 C  CD2   . TYR C 1 289 ? 23.698  58.393  23.887  1.00 34.88 ? 290  TYR C CD2   1 
ATOM   5632 C  CE1   . TYR C 1 289 ? 25.931  59.144  22.446  1.00 31.88 ? 290  TYR C CE1   1 
ATOM   5633 C  CE2   . TYR C 1 289 ? 23.657  59.526  23.059  1.00 33.12 ? 290  TYR C CE2   1 
ATOM   5634 C  CZ    . TYR C 1 289 ? 24.766  59.877  22.334  1.00 32.18 ? 290  TYR C CZ    1 
ATOM   5635 O  OH    . TYR C 1 289 ? 24.686  60.993  21.520  1.00 35.23 ? 290  TYR C OH    1 
ATOM   5636 N  N     . THR C 1 290 ? 26.529  58.587  26.894  1.00 34.15 ? 291  THR C N     1 
ATOM   5637 C  CA    . THR C 1 290 ? 26.444  59.802  27.722  1.00 34.74 ? 291  THR C CA    1 
ATOM   5638 C  C     . THR C 1 290 ? 26.147  61.095  26.919  1.00 35.51 ? 291  THR C C     1 
ATOM   5639 O  O     . THR C 1 290 ? 26.013  62.168  27.526  1.00 35.22 ? 291  THR C O     1 
ATOM   5640 C  CB    . THR C 1 290 ? 27.724  60.002  28.597  1.00 35.29 ? 291  THR C CB    1 
ATOM   5641 O  OG1   . THR C 1 290 ? 28.908  60.002  27.789  1.00 36.47 ? 291  THR C OG1   1 
ATOM   5642 C  CG2   . THR C 1 290 ? 27.840  58.897  29.642  1.00 34.11 ? 291  THR C CG2   1 
ATOM   5643 N  N     . GLY C 1 291 ? 26.008  60.992  25.591  1.00 35.61 ? 292  GLY C N     1 
ATOM   5644 C  CA    . GLY C 1 291 ? 25.736  62.170  24.733  1.00 36.15 ? 292  GLY C CA    1 
ATOM   5645 C  C     . GLY C 1 291 ? 24.276  62.528  24.598  1.00 37.30 ? 292  GLY C C     1 
ATOM   5646 O  O     . GLY C 1 291 ? 23.403  61.893  25.201  1.00 38.01 ? 292  GLY C O     1 
ATOM   5647 N  N     . SER C 1 292 ? 23.968  63.527  23.769  1.00 38.36 ? 293  SER C N     1 
ATOM   5648 C  CA    . SER C 1 292 ? 22.580  63.992  23.642  1.00 38.02 ? 293  SER C CA    1 
ATOM   5649 C  C     . SER C 1 292 ? 21.722  63.118  22.772  1.00 38.89 ? 293  SER C C     1 
ATOM   5650 O  O     . SER C 1 292 ? 22.192  62.476  21.814  1.00 39.77 ? 293  SER C O     1 
ATOM   5651 C  CB    . SER C 1 292 ? 22.503  65.478  23.166  1.00 38.18 ? 293  SER C CB    1 
ATOM   5652 O  OG    . SER C 1 292 ? 22.998  65.656  21.856  1.00 34.91 ? 293  SER C OG    1 
ATOM   5653 N  N     . ASN C 1 293 ? 20.437  63.106  23.106  1.00 39.43 ? 294  ASN C N     1 
ATOM   5654 C  CA    . ASN C 1 293 ? 19.439  62.518  22.268  1.00 40.75 ? 294  ASN C CA    1 
ATOM   5655 C  C     . ASN C 1 293 ? 19.028  63.537  21.228  1.00 39.98 ? 294  ASN C C     1 
ATOM   5656 O  O     . ASN C 1 293 ? 17.874  64.003  21.199  1.00 41.32 ? 294  ASN C O     1 
ATOM   5657 C  CB    . ASN C 1 293 ? 18.234  62.032  23.081  1.00 41.37 ? 294  ASN C CB    1 
ATOM   5658 C  CG    . ASN C 1 293 ? 18.602  60.932  24.025  1.00 41.85 ? 294  ASN C CG    1 
ATOM   5659 O  OD1   . ASN C 1 293 ? 19.204  59.929  23.605  1.00 38.43 ? 294  ASN C OD1   1 
ATOM   5660 N  ND2   . ASN C 1 293 ? 18.279  61.117  25.321  1.00 42.73 ? 294  ASN C ND2   1 
ATOM   5661 N  N     . THR C 1 294 ? 19.987  63.853  20.361  1.00 38.81 ? 295  THR C N     1 
ATOM   5662 C  CA    . THR C 1 294 ? 19.755  64.730  19.226  1.00 37.60 ? 295  THR C CA    1 
ATOM   5663 C  C     . THR C 1 294 ? 20.318  64.057  17.993  1.00 36.99 ? 295  THR C C     1 
ATOM   5664 O  O     . THR C 1 294 ? 21.262  63.260  18.103  1.00 36.47 ? 295  THR C O     1 
ATOM   5665 C  CB    . THR C 1 294 ? 20.408  66.138  19.432  1.00 37.51 ? 295  THR C CB    1 
ATOM   5666 O  OG1   . THR C 1 294 ? 21.834  66.022  19.491  1.00 36.44 ? 295  THR C OG1   1 
ATOM   5667 C  CG2   . THR C 1 294 ? 19.869  66.837  20.705  1.00 36.39 ? 295  THR C CG2   1 
ATOM   5668 N  N     . TYR C 1 295 ? 19.741  64.393  16.833  1.00 35.83 ? 296  TYR C N     1 
ATOM   5669 C  CA    . TYR C 1 295 ? 20.017  63.724  15.572  1.00 35.62 ? 296  TYR C CA    1 
ATOM   5670 C  C     . TYR C 1 295 ? 21.512  63.479  15.288  1.00 33.89 ? 296  TYR C C     1 
ATOM   5671 O  O     . TYR C 1 295 ? 21.950  62.348  15.189  1.00 32.90 ? 296  TYR C O     1 
ATOM   5672 C  CB    . TYR C 1 295 ? 19.338  64.465  14.374  1.00 36.64 ? 296  TYR C CB    1 
ATOM   5673 C  CG    . TYR C 1 295 ? 19.751  63.846  13.067  1.00 37.82 ? 296  TYR C CG    1 
ATOM   5674 C  CD1   . TYR C 1 295 ? 19.290  62.610  12.724  1.00 38.33 ? 296  TYR C CD1   1 
ATOM   5675 C  CD2   . TYR C 1 295 ? 20.670  64.466  12.209  1.00 41.34 ? 296  TYR C CD2   1 
ATOM   5676 C  CE1   . TYR C 1 295 ? 19.686  61.974  11.572  1.00 41.66 ? 296  TYR C CE1   1 
ATOM   5677 C  CE2   . TYR C 1 295 ? 21.101  63.820  11.013  1.00 40.66 ? 296  TYR C CE2   1 
ATOM   5678 C  CZ    . TYR C 1 295 ? 20.581  62.561  10.707  1.00 42.75 ? 296  TYR C CZ    1 
ATOM   5679 O  OH    . TYR C 1 295 ? 20.970  61.822  9.571   1.00 41.46 ? 296  TYR C OH    1 
ATOM   5680 N  N     . GLU C 1 296 ? 22.292  64.542  15.153  1.00 33.27 ? 297  GLU C N     1 
ATOM   5681 C  CA    . GLU C 1 296 ? 23.674  64.373  14.644  1.00 32.71 ? 297  GLU C CA    1 
ATOM   5682 C  C     . GLU C 1 296 ? 24.563  63.617  15.634  1.00 31.83 ? 297  GLU C C     1 
ATOM   5683 O  O     . GLU C 1 296 ? 25.280  62.716  15.238  1.00 30.86 ? 297  GLU C O     1 
ATOM   5684 C  CB    . GLU C 1 296 ? 24.297  65.709  14.236  1.00 32.51 ? 297  GLU C CB    1 
ATOM   5685 C  CG    . GLU C 1 296 ? 23.516  66.473  13.175  1.00 34.56 ? 297  GLU C CG    1 
ATOM   5686 C  CD    . GLU C 1 296 ? 23.759  65.955  11.762  1.00 37.84 ? 297  GLU C CD    1 
ATOM   5687 N  N     . GLU C 1 297 ? 24.475  63.957  16.917  1.00 31.60 ? 298  GLU C N     1 
ATOM   5688 C  CA    . GLU C 1 297 ? 25.319  63.312  17.960  1.00 31.69 ? 298  GLU C CA    1 
ATOM   5689 C  C     . GLU C 1 297 ? 25.004  61.826  18.144  1.00 31.30 ? 298  GLU C C     1 
ATOM   5690 O  O     . GLU C 1 297 ? 25.904  60.986  18.153  1.00 30.61 ? 298  GLU C O     1 
ATOM   5691 C  CB    . GLU C 1 297 ? 25.191  64.060  19.306  1.00 31.14 ? 298  GLU C CB    1 
ATOM   5692 C  CG    . GLU C 1 297 ? 25.780  65.452  19.302  1.00 31.33 ? 298  GLU C CG    1 
ATOM   5693 C  CD    . GLU C 1 297 ? 27.286  65.469  19.249  1.00 31.68 ? 298  GLU C CD    1 
ATOM   5694 O  OE1   . GLU C 1 297 ? 27.863  66.567  19.088  1.00 31.44 ? 298  GLU C OE1   1 
ATOM   5695 O  OE2   . GLU C 1 297 ? 27.898  64.392  19.376  1.00 30.50 ? 298  GLU C OE2   1 
ATOM   5696 N  N     . ALA C 1 298 ? 23.721  61.494  18.245  1.00 32.32 ? 299  ALA C N     1 
ATOM   5697 C  CA    . ALA C 1 298 ? 23.285  60.110  18.425  1.00 31.86 ? 299  ALA C CA    1 
ATOM   5698 C  C     . ALA C 1 298 ? 23.538  59.254  17.191  1.00 32.71 ? 299  ALA C C     1 
ATOM   5699 O  O     . ALA C 1 298 ? 23.914  58.083  17.313  1.00 32.51 ? 299  ALA C O     1 
ATOM   5700 C  CB    . ALA C 1 298 ? 21.833  60.049  18.834  1.00 31.36 ? 299  ALA C CB    1 
ATOM   5701 N  N     . ALA C 1 299 ? 23.340  59.835  16.003  1.00 32.42 ? 300  ALA C N     1 
ATOM   5702 C  CA    . ALA C 1 299 ? 23.593  59.152  14.736  1.00 32.50 ? 300  ALA C CA    1 
ATOM   5703 C  C     . ALA C 1 299 ? 25.071  58.791  14.571  1.00 31.74 ? 300  ALA C C     1 
ATOM   5704 O  O     . ALA C 1 299 ? 25.395  57.673  14.147  1.00 31.64 ? 300  ALA C O     1 
ATOM   5705 C  CB    . ALA C 1 299 ? 23.142  60.028  13.556  1.00 32.56 ? 300  ALA C CB    1 
ATOM   5706 N  N     . ALA C 1 300 ? 25.933  59.760  14.874  1.00 31.64 ? 301  ALA C N     1 
ATOM   5707 C  CA    . ALA C 1 300 ? 27.392  59.590  14.873  1.00 31.83 ? 301  ALA C CA    1 
ATOM   5708 C  C     . ALA C 1 300 ? 27.835  58.459  15.815  1.00 31.89 ? 301  ALA C C     1 
ATOM   5709 O  O     . ALA C 1 300 ? 28.702  57.642  15.461  1.00 32.61 ? 301  ALA C O     1 
ATOM   5710 C  CB    . ALA C 1 300 ? 28.106  60.943  15.255  1.00 31.88 ? 301  ALA C CB    1 
ATOM   5711 N  N     . TYR C 1 301 ? 27.240  58.408  17.003  1.00 32.21 ? 302  TYR C N     1 
ATOM   5712 C  CA    . TYR C 1 301 ? 27.541  57.338  17.979  1.00 31.95 ? 302  TYR C CA    1 
ATOM   5713 C  C     . TYR C 1 301 ? 27.199  55.957  17.435  1.00 31.66 ? 302  TYR C C     1 
ATOM   5714 O  O     . TYR C 1 301 ? 28.018  55.037  17.523  1.00 30.86 ? 302  TYR C O     1 
ATOM   5715 C  CB    . TYR C 1 301 ? 26.818  57.584  19.303  1.00 32.61 ? 302  TYR C CB    1 
ATOM   5716 C  CG    . TYR C 1 301 ? 27.264  56.664  20.430  1.00 33.24 ? 302  TYR C CG    1 
ATOM   5717 C  CD1   . TYR C 1 301 ? 28.405  56.944  21.171  1.00 33.28 ? 302  TYR C CD1   1 
ATOM   5718 C  CD2   . TYR C 1 301 ? 26.544  55.494  20.728  1.00 33.41 ? 302  TYR C CD2   1 
ATOM   5719 C  CE1   . TYR C 1 301 ? 28.824  56.111  22.189  1.00 33.46 ? 302  TYR C CE1   1 
ATOM   5720 C  CE2   . TYR C 1 301 ? 26.949  54.656  21.747  1.00 32.88 ? 302  TYR C CE2   1 
ATOM   5721 C  CZ    . TYR C 1 301 ? 28.081  54.966  22.469  1.00 33.49 ? 302  TYR C CZ    1 
ATOM   5722 O  OH    . TYR C 1 301 ? 28.498  54.159  23.478  1.00 34.29 ? 302  TYR C OH    1 
ATOM   5723 N  N     . ILE C 1 302 ? 25.998  55.816  16.862  1.00 31.04 ? 303  ILE C N     1 
ATOM   5724 C  CA    . ILE C 1 302 ? 25.582  54.565  16.234  1.00 30.55 ? 303  ILE C CA    1 
ATOM   5725 C  C     . ILE C 1 302 ? 26.583  54.184  15.146  1.00 30.18 ? 303  ILE C C     1 
ATOM   5726 O  O     . ILE C 1 302 ? 27.001  53.017  15.051  1.00 30.31 ? 303  ILE C O     1 
ATOM   5727 C  CB    . ILE C 1 302 ? 24.147  54.682  15.651  1.00 30.62 ? 303  ILE C CB    1 
ATOM   5728 C  CG1   . ILE C 1 302 ? 23.133  54.887  16.803  1.00 29.98 ? 303  ILE C CG1   1 
ATOM   5729 C  CG2   . ILE C 1 302 ? 23.802  53.447  14.760  1.00 30.37 ? 303  ILE C CG2   1 
ATOM   5730 C  CD1   . ILE C 1 302 ? 21.727  55.302  16.369  1.00 30.92 ? 303  ILE C CD1   1 
ATOM   5731 N  N     . GLN C 1 303 ? 26.927  55.145  14.294  1.00 29.93 ? 304  GLN C N     1 
ATOM   5732 C  CA    . GLN C 1 303 ? 27.924  54.924  13.237  1.00 30.24 ? 304  GLN C CA    1 
ATOM   5733 C  C     . GLN C 1 303 ? 29.222  54.340  13.825  1.00 30.91 ? 304  GLN C C     1 
ATOM   5734 O  O     . GLN C 1 303 ? 29.775  53.387  13.278  1.00 31.07 ? 304  GLN C O     1 
ATOM   5735 C  CB    . GLN C 1 303 ? 28.256  56.213  12.490  1.00 30.99 ? 304  GLN C CB    1 
ATOM   5736 C  CG    . GLN C 1 303 ? 29.414  56.041  11.466  1.00 30.79 ? 304  GLN C CG    1 
ATOM   5737 C  CD    . GLN C 1 303 ? 29.728  57.289  10.718  1.00 32.28 ? 304  GLN C CD    1 
ATOM   5738 O  OE1   . GLN C 1 303 ? 29.196  58.352  11.019  1.00 33.55 ? 304  GLN C OE1   1 
ATOM   5739 N  NE2   . GLN C 1 303 ? 30.616  57.182  9.738   1.00 31.69 ? 304  GLN C NE2   1 
ATOM   5740 N  N     . CYS C 1 304 ? 29.692  54.909  14.935  1.00 31.52 ? 305  CYS C N     1 
ATOM   5741 C  CA    A CYS C 1 304 ? 30.923  54.446  15.587  0.50 31.71 ? 305  CYS C CA    1 
ATOM   5742 C  CA    B CYS C 1 304 ? 30.933  54.439  15.563  0.50 32.08 ? 305  CYS C CA    1 
ATOM   5743 C  C     . CYS C 1 304 ? 30.753  53.001  16.082  1.00 32.19 ? 305  CYS C C     1 
ATOM   5744 O  O     . CYS C 1 304 ? 31.644  52.157  15.930  1.00 31.71 ? 305  CYS C O     1 
ATOM   5745 C  CB    A CYS C 1 304 ? 31.275  55.373  16.745  0.50 31.54 ? 305  CYS C CB    1 
ATOM   5746 C  CB    B CYS C 1 304 ? 31.380  55.389  16.677  0.50 31.96 ? 305  CYS C CB    1 
ATOM   5747 S  SG    A CYS C 1 304 ? 32.859  55.040  17.522  0.50 31.68 ? 305  CYS C SG    1 
ATOM   5748 S  SG    B CYS C 1 304 ? 32.015  57.004  16.093  0.50 34.33 ? 305  CYS C SG    1 
ATOM   5749 N  N     . GLN C 1 305 ? 29.583  52.704  16.645  1.00 32.76 ? 306  GLN C N     1 
ATOM   5750 C  CA    . GLN C 1 305 ? 29.339  51.368  17.179  1.00 33.07 ? 306  GLN C CA    1 
ATOM   5751 C  C     . GLN C 1 305 ? 29.358  50.322  16.066  1.00 33.27 ? 306  GLN C C     1 
ATOM   5752 O  O     . GLN C 1 305 ? 29.895  49.231  16.258  1.00 33.43 ? 306  GLN C O     1 
ATOM   5753 C  CB    . GLN C 1 305 ? 28.029  51.306  17.967  1.00 32.93 ? 306  GLN C CB    1 
ATOM   5754 C  CG    . GLN C 1 305 ? 27.925  52.282  19.150  1.00 32.08 ? 306  GLN C CG    1 
ATOM   5755 C  CD    . GLN C 1 305 ? 29.239  52.525  19.857  1.00 36.27 ? 306  GLN C CD    1 
ATOM   5756 O  OE1   . GLN C 1 305 ? 29.747  51.637  20.521  1.00 34.07 ? 306  GLN C OE1   1 
ATOM   5757 N  NE2   . GLN C 1 305 ? 29.799  53.752  19.725  1.00 36.08 ? 306  GLN C NE2   1 
ATOM   5758 N  N     . PHE C 1 306 ? 28.794  50.657  14.903  1.00 32.77 ? 307  PHE C N     1 
ATOM   5759 C  CA    . PHE C 1 306 ? 28.859  49.759  13.765  1.00 33.51 ? 307  PHE C CA    1 
ATOM   5760 C  C     . PHE C 1 306 ? 30.244  49.634  13.159  1.00 33.19 ? 307  PHE C C     1 
ATOM   5761 O  O     . PHE C 1 306 ? 30.677  48.526  12.884  1.00 32.40 ? 307  PHE C O     1 
ATOM   5762 C  CB    . PHE C 1 306 ? 27.825  50.098  12.666  1.00 33.49 ? 307  PHE C CB    1 
ATOM   5763 C  CG    . PHE C 1 306 ? 26.451  49.553  12.954  1.00 33.10 ? 307  PHE C CG    1 
ATOM   5764 C  CD1   . PHE C 1 306 ? 25.627  50.186  13.888  1.00 32.35 ? 307  PHE C CD1   1 
ATOM   5765 C  CD2   . PHE C 1 306 ? 25.977  48.376  12.334  1.00 34.24 ? 307  PHE C CD2   1 
ATOM   5766 C  CE1   . PHE C 1 306 ? 24.362  49.672  14.173  1.00 34.34 ? 307  PHE C CE1   1 
ATOM   5767 C  CE2   . PHE C 1 306 ? 24.710  47.888  12.613  1.00 33.67 ? 307  PHE C CE2   1 
ATOM   5768 C  CZ    . PHE C 1 306 ? 23.912  48.539  13.535  1.00 33.56 ? 307  PHE C CZ    1 
ATOM   5769 N  N     . GLU C 1 307 ? 30.924  50.760  12.926  1.00 33.55 ? 308  GLU C N     1 
ATOM   5770 C  CA    . GLU C 1 307 ? 32.256  50.721  12.334  1.00 33.58 ? 308  GLU C CA    1 
ATOM   5771 C  C     . GLU C 1 307 ? 33.257  49.970  13.241  1.00 33.61 ? 308  GLU C C     1 
ATOM   5772 O  O     . GLU C 1 307 ? 34.210  49.329  12.745  1.00 33.36 ? 308  GLU C O     1 
ATOM   5773 C  CB    . GLU C 1 307 ? 32.709  52.150  11.970  1.00 34.10 ? 308  GLU C CB    1 
ATOM   5774 C  CG    . GLU C 1 307 ? 31.934  52.724  10.739  1.00 34.26 ? 308  GLU C CG    1 
ATOM   5775 C  CD    . GLU C 1 307 ? 32.348  54.121  10.324  1.00 35.36 ? 308  GLU C CD    1 
ATOM   5776 O  OE1   . GLU C 1 307 ? 33.164  54.744  11.038  1.00 37.87 ? 308  GLU C OE1   1 
ATOM   5777 O  OE2   . GLU C 1 307 ? 31.836  54.614  9.285   1.00 35.81 ? 308  GLU C OE2   1 
ATOM   5778 N  N     . ASP C 1 308 ? 33.045  50.023  14.556  1.00 33.36 ? 309  ASP C N     1 
ATOM   5779 C  CA    . ASP C 1 308 ? 33.943  49.338  15.499  1.00 34.52 ? 309  ASP C CA    1 
ATOM   5780 C  C     . ASP C 1 308 ? 33.940  47.799  15.329  1.00 34.14 ? 309  ASP C C     1 
ATOM   5781 O  O     . ASP C 1 308 ? 34.922  47.148  15.680  1.00 33.18 ? 309  ASP C O     1 
ATOM   5782 C  CB    . ASP C 1 308 ? 33.615  49.716  16.947  1.00 35.07 ? 309  ASP C CB    1 
ATOM   5783 C  CG    . ASP C 1 308 ? 34.134  51.112  17.343  1.00 39.13 ? 309  ASP C CG    1 
ATOM   5784 O  OD1   . ASP C 1 308 ? 35.027  51.657  16.653  1.00 43.21 ? 309  ASP C OD1   1 
ATOM   5785 O  OD2   . ASP C 1 308 ? 33.647  51.663  18.368  1.00 42.43 ? 309  ASP C OD2   1 
ATOM   5786 N  N     . LEU C 1 309 ? 32.854  47.252  14.775  1.00 33.56 ? 310  LEU C N     1 
ATOM   5787 C  CA    . LEU C 1 309 ? 32.679  45.791  14.540  1.00 34.46 ? 310  LEU C CA    1 
ATOM   5788 C  C     . LEU C 1 309 ? 33.599  45.226  13.452  1.00 35.16 ? 310  LEU C C     1 
ATOM   5789 O  O     . LEU C 1 309 ? 33.824  44.022  13.390  1.00 36.07 ? 310  LEU C O     1 
ATOM   5790 C  CB    . LEU C 1 309 ? 31.224  45.448  14.200  1.00 33.83 ? 310  LEU C CB    1 
ATOM   5791 C  CG    . LEU C 1 309 ? 30.181  45.877  15.252  1.00 33.40 ? 310  LEU C CG    1 
ATOM   5792 C  CD1   . LEU C 1 309 ? 28.740  45.878  14.744  1.00 34.10 ? 310  LEU C CD1   1 
ATOM   5793 C  CD2   . LEU C 1 309 ? 30.328  44.994  16.500  1.00 35.58 ? 310  LEU C CD2   1 
ATOM   5794 N  N     . ASN C 1 310 ? 34.108  46.095  12.592  1.00 36.07 ? 311  ASN C N     1 
ATOM   5795 C  CA    . ASN C 1 310 ? 35.177  45.751  11.675  1.00 37.17 ? 311  ASN C CA    1 
ATOM   5796 C  C     . ASN C 1 310 ? 36.440  45.236  12.395  1.00 37.60 ? 311  ASN C C     1 
ATOM   5797 O  O     . ASN C 1 310 ? 37.055  45.969  13.152  1.00 37.78 ? 311  ASN C O     1 
ATOM   5798 C  CB    . ASN C 1 310 ? 35.538  47.003  10.880  1.00 37.53 ? 311  ASN C CB    1 
ATOM   5799 C  CG    . ASN C 1 310 ? 36.544  46.739  9.796   1.00 36.65 ? 311  ASN C CG    1 
ATOM   5800 O  OD1   . ASN C 1 310 ? 36.974  45.607  9.591   1.00 36.74 ? 311  ASN C OD1   1 
ATOM   5801 N  ND2   . ASN C 1 310 ? 36.904  47.790  9.066   1.00 36.26 ? 311  ASN C ND2   1 
ATOM   5802 N  N     . ARG C 1 311 ? 36.844  43.992  12.147  1.00 38.80 ? 312  ARG C N     1 
ATOM   5803 C  CA    . ARG C 1 311 ? 38.080  43.459  12.769  1.00 39.57 ? 312  ARG C CA    1 
ATOM   5804 C  C     . ARG C 1 311 ? 39.255  43.398  11.788  1.00 39.89 ? 312  ARG C C     1 
ATOM   5805 O  O     . ARG C 1 311 ? 40.255  42.706  12.040  1.00 39.07 ? 312  ARG C O     1 
ATOM   5806 C  CB    . ARG C 1 311 ? 37.876  42.073  13.395  1.00 40.10 ? 312  ARG C CB    1 
ATOM   5807 C  CG    . ARG C 1 311 ? 36.539  41.894  13.999  1.00 42.87 ? 312  ARG C CG    1 
ATOM   5808 C  CD    . ARG C 1 311 ? 36.514  41.184  15.310  1.00 47.24 ? 312  ARG C CD    1 
ATOM   5809 N  NE    . ARG C 1 311 ? 35.133  41.232  15.790  1.00 52.36 ? 312  ARG C NE    1 
ATOM   5810 C  CZ    . ARG C 1 311 ? 34.536  42.324  16.286  1.00 53.90 ? 312  ARG C CZ    1 
ATOM   5811 N  NH1   . ARG C 1 311 ? 35.196  43.486  16.433  1.00 55.66 ? 312  ARG C NH1   1 
ATOM   5812 N  NH2   . ARG C 1 311 ? 33.272  42.249  16.669  1.00 52.31 ? 312  ARG C NH2   1 
ATOM   5813 N  N     . ARG C 1 312 ? 39.131  44.110  10.671  1.00 40.12 ? 313  ARG C N     1 
ATOM   5814 C  CA    . ARG C 1 312 ? 40.265  44.290  9.765   1.00 40.51 ? 313  ARG C CA    1 
ATOM   5815 C  C     . ARG C 1 312 ? 40.435  45.768  9.430   1.00 40.45 ? 313  ARG C C     1 
ATOM   5816 O  O     . ARG C 1 312 ? 40.596  46.123  8.268   1.00 39.94 ? 313  ARG C O     1 
ATOM   5817 C  CB    . ARG C 1 312 ? 40.041  43.469  8.489   1.00 40.62 ? 313  ARG C CB    1 
ATOM   5818 C  CG    . ARG C 1 312 ? 39.639  42.036  8.740   1.00 41.42 ? 313  ARG C CG    1 
ATOM   5819 N  N     . LYS C 1 313 ? 40.385  46.629  10.446  1.00 41.08 ? 314  LYS C N     1 
ATOM   5820 C  CA    . LYS C 1 313 ? 40.457  48.094  10.238  1.00 41.99 ? 314  LYS C CA    1 
ATOM   5821 C  C     . LYS C 1 313 ? 41.705  48.574  9.464   1.00 42.25 ? 314  LYS C C     1 
ATOM   5822 O  O     . LYS C 1 313 ? 41.650  49.595  8.772   1.00 42.27 ? 314  LYS C O     1 
ATOM   5823 C  CB    . LYS C 1 313 ? 40.357  48.838  11.578  1.00 42.06 ? 314  LYS C CB    1 
ATOM   5824 C  CG    . LYS C 1 313 ? 38.951  48.769  12.221  1.00 42.31 ? 314  LYS C CG    1 
ATOM   5825 C  CD    . LYS C 1 313 ? 38.908  49.550  13.549  1.00 42.58 ? 314  LYS C CD    1 
ATOM   5826 C  CE    . LYS C 1 313 ? 37.611  49.337  14.344  1.00 43.28 ? 314  LYS C CE    1 
ATOM   5827 N  NZ    . LYS C 1 313 ? 37.480  47.946  14.939  1.00 43.08 ? 314  LYS C NZ    1 
ATOM   5828 N  N     . ASP C 1 314 ? 42.812  47.838  9.590   1.00 42.58 ? 315  ASP C N     1 
ATOM   5829 C  CA    . ASP C 1 314 ? 44.064  48.132  8.869   1.00 42.90 ? 315  ASP C CA    1 
ATOM   5830 C  C     . ASP C 1 314 ? 44.084  47.588  7.427   1.00 43.04 ? 315  ASP C C     1 
ATOM   5831 O  O     . ASP C 1 314 ? 44.957  47.932  6.636   1.00 43.39 ? 315  ASP C O     1 
ATOM   5832 C  CB    . ASP C 1 314 ? 45.255  47.553  9.648   1.00 42.81 ? 315  ASP C CB    1 
ATOM   5833 N  N     . THR C 1 315 ? 43.139  46.712  7.119   1.00 43.17 ? 316  THR C N     1 
ATOM   5834 C  CA    . THR C 1 315 ? 42.983  46.081  5.808   1.00 43.55 ? 316  THR C CA    1 
ATOM   5835 C  C     . THR C 1 315 ? 41.858  46.750  5.003   1.00 43.24 ? 316  THR C C     1 
ATOM   5836 O  O     . THR C 1 315 ? 42.025  47.084  3.829   1.00 43.60 ? 316  THR C O     1 
ATOM   5837 C  CB    . THR C 1 315 ? 42.563  44.586  6.005   1.00 43.67 ? 316  THR C CB    1 
ATOM   5838 O  OG1   . THR C 1 315 ? 43.547  43.897  6.792   1.00 45.67 ? 316  THR C OG1   1 
ATOM   5839 C  CG2   . THR C 1 315 ? 42.362  43.868  4.678   1.00 45.03 ? 316  THR C CG2   1 
ATOM   5840 N  N     . LYS C 1 316 ? 40.734  46.977  5.684   1.00 42.15 ? 317  LYS C N     1 
ATOM   5841 C  CA    . LYS C 1 316 ? 39.441  47.215  5.071   1.00 42.00 ? 317  LYS C CA    1 
ATOM   5842 C  C     . LYS C 1 316 ? 38.720  48.435  5.687   1.00 40.94 ? 317  LYS C C     1 
ATOM   5843 O  O     . LYS C 1 316 ? 38.711  48.620  6.913   1.00 40.43 ? 317  LYS C O     1 
ATOM   5844 C  CB    . LYS C 1 316 ? 38.599  45.950  5.270   1.00 41.92 ? 317  LYS C CB    1 
ATOM   5845 C  CG    . LYS C 1 316 ? 37.207  45.981  4.708   1.00 43.29 ? 317  LYS C CG    1 
ATOM   5846 C  CD    . LYS C 1 316 ? 36.569  44.593  4.791   1.00 43.35 ? 317  LYS C CD    1 
ATOM   5847 C  CE    . LYS C 1 316 ? 35.637  44.371  3.640   1.00 42.46 ? 317  LYS C CE    1 
ATOM   5848 N  NZ    . LYS C 1 316 ? 36.335  44.401  2.344   1.00 37.95 ? 317  LYS C NZ    1 
ATOM   5849 N  N     . GLU C 1 317 ? 38.111  49.239  4.814   1.00 39.82 ? 318  GLU C N     1 
ATOM   5850 C  CA    . GLU C 1 317 ? 37.355  50.428  5.187   1.00 39.60 ? 318  GLU C CA    1 
ATOM   5851 C  C     . GLU C 1 317 ? 35.837  50.182  5.021   1.00 37.53 ? 318  GLU C C     1 
ATOM   5852 O  O     . GLU C 1 317 ? 35.426  49.550  4.072   1.00 37.50 ? 318  GLU C O     1 
ATOM   5853 C  CB    . GLU C 1 317 ? 37.809  51.572  4.283   1.00 39.62 ? 318  GLU C CB    1 
ATOM   5854 C  CG    . GLU C 1 317 ? 37.061  52.878  4.425   1.00 42.35 ? 318  GLU C CG    1 
ATOM   5855 C  CD    . GLU C 1 317 ? 37.805  54.032  3.758   1.00 42.93 ? 318  GLU C CD    1 
ATOM   5856 O  OE1   . GLU C 1 317 ? 38.860  53.777  3.126   1.00 47.37 ? 318  GLU C OE1   1 
ATOM   5857 O  OE2   . GLU C 1 317 ? 37.334  55.193  3.855   1.00 48.33 ? 318  GLU C OE2   1 
ATOM   5858 N  N     . ILE C 1 318 ? 35.027  50.674  5.953   1.00 36.05 ? 319  ILE C N     1 
ATOM   5859 C  CA    . ILE C 1 318 ? 33.567  50.718  5.780   1.00 35.28 ? 319  ILE C CA    1 
ATOM   5860 C  C     . ILE C 1 318 ? 33.195  52.096  5.213   1.00 34.99 ? 319  ILE C C     1 
ATOM   5861 O  O     . ILE C 1 318 ? 33.726  53.114  5.667   1.00 33.89 ? 319  ILE C O     1 
ATOM   5862 C  CB    . ILE C 1 318 ? 32.815  50.502  7.117   1.00 35.48 ? 319  ILE C CB    1 
ATOM   5863 C  CG1   . ILE C 1 318 ? 33.212  49.179  7.770   1.00 35.51 ? 319  ILE C CG1   1 
ATOM   5864 C  CG2   . ILE C 1 318 ? 31.285  50.592  6.900   1.00 32.55 ? 319  ILE C CG2   1 
ATOM   5865 C  CD1   . ILE C 1 318 ? 33.367  48.025  6.792   1.00 37.75 ? 319  ILE C CD1   1 
ATOM   5866 N  N     . TYR C 1 319 ? 32.303  52.118  4.218   1.00 34.16 ? 320  TYR C N     1 
ATOM   5867 C  CA    . TYR C 1 319 ? 31.869  53.364  3.578   1.00 34.40 ? 320  TYR C CA    1 
ATOM   5868 C  C     . TYR C 1 319 ? 30.447  53.730  3.987   1.00 34.14 ? 320  TYR C C     1 
ATOM   5869 O  O     . TYR C 1 319 ? 29.446  53.198  3.444   1.00 33.38 ? 320  TYR C O     1 
ATOM   5870 C  CB    . TYR C 1 319 ? 32.003  53.229  2.066   1.00 35.50 ? 320  TYR C CB    1 
ATOM   5871 C  CG    . TYR C 1 319 ? 33.397  52.783  1.659   1.00 35.93 ? 320  TYR C CG    1 
ATOM   5872 C  CD1   . TYR C 1 319 ? 34.445  53.698  1.573   1.00 37.88 ? 320  TYR C CD1   1 
ATOM   5873 C  CD2   . TYR C 1 319 ? 33.675  51.447  1.398   1.00 36.35 ? 320  TYR C CD2   1 
ATOM   5874 C  CE1   . TYR C 1 319 ? 35.737  53.298  1.224   1.00 37.11 ? 320  TYR C CE1   1 
ATOM   5875 C  CE2   . TYR C 1 319 ? 34.979  51.038  1.042   1.00 36.62 ? 320  TYR C CE2   1 
ATOM   5876 C  CZ    . TYR C 1 319 ? 35.993  51.966  0.959   1.00 37.17 ? 320  TYR C CZ    1 
ATOM   5877 O  OH    . TYR C 1 319 ? 37.281  51.574  0.598   1.00 37.97 ? 320  TYR C OH    1 
ATOM   5878 N  N     . THR C 1 320 ? 30.354  54.635  4.952   1.00 33.43 ? 321  THR C N     1 
ATOM   5879 C  CA    . THR C 1 320 ? 29.126  54.820  5.691   1.00 33.40 ? 321  THR C CA    1 
ATOM   5880 C  C     . THR C 1 320 ? 28.388  56.045  5.155   1.00 33.12 ? 321  THR C C     1 
ATOM   5881 O  O     . THR C 1 320 ? 28.999  57.110  4.909   1.00 31.46 ? 321  THR C O     1 
ATOM   5882 C  CB    . THR C 1 320 ? 29.371  54.930  7.235   1.00 34.09 ? 321  THR C CB    1 
ATOM   5883 O  OG1   . THR C 1 320 ? 29.922  53.705  7.736   1.00 36.28 ? 321  THR C OG1   1 
ATOM   5884 C  CG2   . THR C 1 320 ? 28.069  55.194  7.984   1.00 34.55 ? 321  THR C CG2   1 
ATOM   5885 N  N     . HIS C 1 321 ? 27.073  55.897  4.989   1.00 33.27 ? 322  HIS C N     1 
ATOM   5886 C  CA    . HIS C 1 321 ? 26.224  57.013  4.555   1.00 34.15 ? 322  HIS C CA    1 
ATOM   5887 C  C     . HIS C 1 321 ? 24.935  57.004  5.324   1.00 33.86 ? 322  HIS C C     1 
ATOM   5888 O  O     . HIS C 1 321 ? 24.398  55.943  5.612   1.00 32.72 ? 322  HIS C O     1 
ATOM   5889 C  CB    . HIS C 1 321 ? 25.932  56.939  3.052   1.00 34.54 ? 322  HIS C CB    1 
ATOM   5890 C  CG    . HIS C 1 321 ? 27.143  57.132  2.199   1.00 36.60 ? 322  HIS C CG    1 
ATOM   5891 N  ND1   . HIS C 1 321 ? 27.556  58.373  1.768   1.00 35.80 ? 322  HIS C ND1   1 
ATOM   5892 C  CD2   . HIS C 1 321 ? 28.021  56.239  1.682   1.00 37.47 ? 322  HIS C CD2   1 
ATOM   5893 C  CE1   . HIS C 1 321 ? 28.645  58.235  1.032   1.00 39.26 ? 322  HIS C CE1   1 
ATOM   5894 N  NE2   . HIS C 1 321 ? 28.947  56.951  0.968   1.00 38.54 ? 322  HIS C NE2   1 
ATOM   5895 N  N     . PHE C 1 322 ? 24.451  58.203  5.649   1.00 32.82 ? 323  PHE C N     1 
ATOM   5896 C  CA    . PHE C 1 322 ? 23.158  58.355  6.296   1.00 32.97 ? 323  PHE C CA    1 
ATOM   5897 C  C     . PHE C 1 322 ? 22.139  58.550  5.198   1.00 32.29 ? 323  PHE C C     1 
ATOM   5898 O  O     . PHE C 1 322 ? 22.387  59.330  4.281   1.00 33.06 ? 323  PHE C O     1 
ATOM   5899 C  CB    . PHE C 1 322 ? 23.204  59.519  7.273   1.00 33.19 ? 323  PHE C CB    1 
ATOM   5900 C  CG    . PHE C 1 322 ? 24.151  59.279  8.408   1.00 33.31 ? 323  PHE C CG    1 
ATOM   5901 C  CD1   . PHE C 1 322 ? 25.455  59.721  8.337   1.00 36.72 ? 323  PHE C CD1   1 
ATOM   5902 C  CD2   . PHE C 1 322 ? 23.745  58.566  9.522   1.00 33.95 ? 323  PHE C CD2   1 
ATOM   5903 C  CE1   . PHE C 1 322 ? 26.357  59.479  9.393   1.00 37.84 ? 323  PHE C CE1   1 
ATOM   5904 C  CE2   . PHE C 1 322 ? 24.622  58.316  10.568  1.00 34.68 ? 323  PHE C CE2   1 
ATOM   5905 C  CZ    . PHE C 1 322 ? 25.918  58.777  10.511  1.00 34.29 ? 323  PHE C CZ    1 
ATOM   5906 N  N     . THR C 1 323 ? 21.051  57.781  5.230   1.00 32.29 ? 324  THR C N     1 
ATOM   5907 C  CA    . THR C 1 323 ? 20.082  57.813  4.129   1.00 31.46 ? 324  THR C CA    1 
ATOM   5908 C  C     . THR C 1 323 ? 18.652  57.915  4.630   1.00 33.01 ? 324  THR C C     1 
ATOM   5909 O  O     . THR C 1 323 ? 18.329  57.532  5.754   1.00 32.20 ? 324  THR C O     1 
ATOM   5910 C  CB    . THR C 1 323 ? 20.216  56.546  3.218   1.00 32.51 ? 324  THR C CB    1 
ATOM   5911 O  OG1   . THR C 1 323 ? 19.880  55.373  3.961   1.00 31.35 ? 324  THR C OG1   1 
ATOM   5912 C  CG2   . THR C 1 323 ? 21.625  56.378  2.659   1.00 31.01 ? 324  THR C CG2   1 
ATOM   5913 N  N     . CYS C 1 324 ? 17.800  58.440  3.772   1.00 33.68 ? 325  CYS C N     1 
ATOM   5914 C  CA    . CYS C 1 324 ? 16.362  58.303  3.907   1.00 33.66 ? 325  CYS C CA    1 
ATOM   5915 C  C     . CYS C 1 324 ? 15.956  57.608  2.610   1.00 33.04 ? 325  CYS C C     1 
ATOM   5916 O  O     . CYS C 1 324 ? 15.910  58.234  1.566   1.00 33.14 ? 325  CYS C O     1 
ATOM   5917 C  CB    . CYS C 1 324 ? 15.675  59.666  4.048   1.00 33.07 ? 325  CYS C CB    1 
ATOM   5918 S  SG    . CYS C 1 324 ? 13.918  59.510  3.904   1.00 36.34 ? 325  CYS C SG    1 
ATOM   5919 N  N     . ALA C 1 325 ? 15.714  56.311  2.675   1.00 32.01 ? 326  ALA C N     1 
ATOM   5920 C  CA    . ALA C 1 325 ? 15.542  55.518  1.451   1.00 32.69 ? 326  ALA C CA    1 
ATOM   5921 C  C     . ALA C 1 325 ? 14.300  55.912  0.631   1.00 31.71 ? 326  ALA C C     1 
ATOM   5922 O  O     . ALA C 1 325 ? 14.231  55.631  -0.566  1.00 31.40 ? 326  ALA C O     1 
ATOM   5923 C  CB    . ALA C 1 325 ? 15.519  54.031  1.775   1.00 31.23 ? 326  ALA C CB    1 
ATOM   5924 N  N     . THR C 1 326 ? 13.316  56.528  1.296   1.00 31.92 ? 327  THR C N     1 
ATOM   5925 C  CA    . THR C 1 326 ? 12.118  57.017  0.646   1.00 32.18 ? 327  THR C CA    1 
ATOM   5926 C  C     . THR C 1 326 ? 12.287  58.380  -0.057  1.00 33.06 ? 327  THR C C     1 
ATOM   5927 O  O     . THR C 1 326 ? 11.374  58.833  -0.758  1.00 33.82 ? 327  THR C O     1 
ATOM   5928 C  CB    . THR C 1 326 ? 10.923  57.052  1.624   1.00 31.70 ? 327  THR C CB    1 
ATOM   5929 O  OG1   . THR C 1 326 ? 11.215  57.825  2.810   1.00 33.56 ? 327  THR C OG1   1 
ATOM   5930 C  CG2   . THR C 1 326 ? 10.526  55.629  2.032   1.00 29.85 ? 327  THR C CG2   1 
ATOM   5931 N  N     . ASP C 1 327 ? 13.448  59.021  0.124   1.00 33.51 ? 328  ASP C N     1 
ATOM   5932 C  CA    . ASP C 1 327 ? 13.758  60.318  -0.459  1.00 33.53 ? 328  ASP C CA    1 
ATOM   5933 C  C     . ASP C 1 327 ? 14.619  60.091  -1.698  1.00 33.11 ? 328  ASP C C     1 
ATOM   5934 O  O     . ASP C 1 327 ? 15.803  59.797  -1.598  1.00 32.43 ? 328  ASP C O     1 
ATOM   5935 C  CB    . ASP C 1 327 ? 14.530  61.175  0.547   1.00 33.85 ? 328  ASP C CB    1 
ATOM   5936 C  CG    . ASP C 1 327 ? 14.828  62.578  0.047   1.00 36.28 ? 328  ASP C CG    1 
ATOM   5937 O  OD1   . ASP C 1 327 ? 14.835  62.835  -1.170  1.00 36.26 ? 328  ASP C OD1   1 
ATOM   5938 O  OD2   . ASP C 1 327 ? 15.075  63.439  0.897   1.00 39.28 ? 328  ASP C OD2   1 
ATOM   5939 N  N     . THR C 1 328 ? 14.022  60.265  -2.864  1.00 32.57 ? 329  THR C N     1 
ATOM   5940 C  CA    . THR C 1 328 ? 14.721  60.013  -4.129  1.00 32.82 ? 329  THR C CA    1 
ATOM   5941 C  C     . THR C 1 328 ? 15.977  60.857  -4.266  1.00 32.53 ? 329  THR C C     1 
ATOM   5942 O  O     . THR C 1 328 ? 17.024  60.334  -4.591  1.00 33.28 ? 329  THR C O     1 
ATOM   5943 C  CB    . THR C 1 328 ? 13.761  60.212  -5.308  1.00 32.14 ? 329  THR C CB    1 
ATOM   5944 O  OG1   . THR C 1 328 ? 12.668  59.296  -5.137  1.00 34.12 ? 329  THR C OG1   1 
ATOM   5945 C  CG2   . THR C 1 328 ? 14.447  59.989  -6.654  1.00 31.46 ? 329  THR C CG2   1 
ATOM   5946 N  N     . LYS C 1 329 ? 15.885  62.162  -4.002  1.00 33.06 ? 330  LYS C N     1 
ATOM   5947 C  CA    . LYS C 1 329 ? 17.035  63.038  -4.142  1.00 32.66 ? 330  LYS C CA    1 
ATOM   5948 C  C     . LYS C 1 329 ? 18.180  62.603  -3.235  1.00 33.00 ? 330  LYS C C     1 
ATOM   5949 O  O     . LYS C 1 329 ? 19.323  62.589  -3.653  1.00 32.95 ? 330  LYS C O     1 
ATOM   5950 C  CB    . LYS C 1 329 ? 16.644  64.514  -3.872  1.00 34.62 ? 330  LYS C CB    1 
ATOM   5951 N  N     . ASN C 1 330 ? 17.886  62.196  -2.007  1.00 33.04 ? 331  ASN C N     1 
ATOM   5952 C  CA    . ASN C 1 330 ? 18.954  61.743  -1.106  1.00 33.32 ? 331  ASN C CA    1 
ATOM   5953 C  C     . ASN C 1 330 ? 19.611  60.458  -1.639  1.00 33.07 ? 331  ASN C C     1 
ATOM   5954 O  O     . ASN C 1 330 ? 20.829  60.347  -1.739  1.00 32.30 ? 331  ASN C O     1 
ATOM   5955 C  CB    . ASN C 1 330 ? 18.387  61.512  0.282   1.00 33.37 ? 331  ASN C CB    1 
ATOM   5956 C  CG    . ASN C 1 330 ? 19.424  61.013  1.273   1.00 32.94 ? 331  ASN C CG    1 
ATOM   5957 O  OD1   . ASN C 1 330 ? 19.289  59.931  1.793   1.00 33.25 ? 331  ASN C OD1   1 
ATOM   5958 N  ND2   . ASN C 1 330 ? 20.462  61.804  1.525   1.00 31.72 ? 331  ASN C ND2   1 
ATOM   5959 N  N     . VAL C 1 331 ? 18.779  59.486  -2.006  1.00 34.05 ? 332  VAL C N     1 
ATOM   5960 C  CA    . VAL C 1 331 ? 19.299  58.220  -2.527  1.00 33.19 ? 332  VAL C CA    1 
ATOM   5961 C  C     . VAL C 1 331 ? 20.115  58.399  -3.802  1.00 33.18 ? 332  VAL C C     1 
ATOM   5962 O  O     . VAL C 1 331 ? 21.163  57.766  -3.965  1.00 33.18 ? 332  VAL C O     1 
ATOM   5963 C  CB    . VAL C 1 331 ? 18.193  57.162  -2.711  1.00 32.25 ? 332  VAL C CB    1 
ATOM   5964 C  CG1   . VAL C 1 331 ? 18.799  55.889  -3.327  1.00 31.62 ? 332  VAL C CG1   1 
ATOM   5965 C  CG2   . VAL C 1 331 ? 17.527  56.861  -1.336  1.00 31.16 ? 332  VAL C CG2   1 
ATOM   5966 N  N     . GLN C 1 332 ? 19.656  59.252  -4.706  1.00 34.20 ? 333  GLN C N     1 
ATOM   5967 C  CA    . GLN C 1 332 ? 20.428  59.570  -5.903  1.00 34.75 ? 333  GLN C CA    1 
ATOM   5968 C  C     . GLN C 1 332 ? 21.856  60.066  -5.557  1.00 34.39 ? 333  GLN C C     1 
ATOM   5969 O  O     . GLN C 1 332 ? 22.837  59.550  -6.073  1.00 33.84 ? 333  GLN C O     1 
ATOM   5970 C  CB    . GLN C 1 332 ? 19.640  60.575  -6.763  1.00 35.04 ? 333  GLN C CB    1 
ATOM   5971 C  CG    . GLN C 1 332 ? 20.249  60.962  -8.089  1.00 37.08 ? 333  GLN C CG    1 
ATOM   5972 C  CD    . GLN C 1 332 ? 19.402  62.017  -8.804  1.00 36.97 ? 333  GLN C CD    1 
ATOM   5973 O  OE1   . GLN C 1 332 ? 18.176  61.906  -8.871  1.00 42.98 ? 333  GLN C OE1   1 
ATOM   5974 N  NE2   . GLN C 1 332 ? 20.041  63.049  -9.295  1.00 39.02 ? 333  GLN C NE2   1 
ATOM   5975 N  N     . PHE C 1 333 ? 21.970  61.035  -4.656  1.00 33.97 ? 334  PHE C N     1 
ATOM   5976 C  CA    . PHE C 1 333 ? 23.267  61.635  -4.339  1.00 33.76 ? 334  PHE C CA    1 
ATOM   5977 C  C     . PHE C 1 333 ? 24.187  60.682  -3.550  1.00 32.87 ? 334  PHE C C     1 
ATOM   5978 O  O     . PHE C 1 333 ? 25.422  60.646  -3.759  1.00 31.39 ? 334  PHE C O     1 
ATOM   5979 C  CB    . PHE C 1 333 ? 23.062  62.980  -3.626  1.00 34.31 ? 334  PHE C CB    1 
ATOM   5980 C  CG    . PHE C 1 333 ? 22.562  64.077  -4.547  1.00 36.86 ? 334  PHE C CG    1 
ATOM   5981 C  CD1   . PHE C 1 333 ? 23.431  65.049  -5.026  1.00 37.75 ? 334  PHE C CD1   1 
ATOM   5982 C  CD2   . PHE C 1 333 ? 21.228  64.114  -4.973  1.00 38.37 ? 334  PHE C CD2   1 
ATOM   5983 C  CE1   . PHE C 1 333 ? 22.980  66.051  -5.883  1.00 38.65 ? 334  PHE C CE1   1 
ATOM   5984 C  CE2   . PHE C 1 333 ? 20.762  65.100  -5.828  1.00 36.57 ? 334  PHE C CE2   1 
ATOM   5985 C  CZ    . PHE C 1 333 ? 21.635  66.079  -6.286  1.00 38.19 ? 334  PHE C CZ    1 
ATOM   5986 N  N     . VAL C 1 334 ? 23.582  59.890  -2.675  1.00 32.19 ? 335  VAL C N     1 
ATOM   5987 C  CA    . VAL C 1 334 ? 24.323  58.878  -1.920  1.00 32.20 ? 335  VAL C CA    1 
ATOM   5988 C  C     . VAL C 1 334 ? 24.830  57.804  -2.874  1.00 31.66 ? 335  VAL C C     1 
ATOM   5989 O  O     . VAL C 1 334 ? 25.994  57.414  -2.804  1.00 30.74 ? 335  VAL C O     1 
ATOM   5990 C  CB    . VAL C 1 334 ? 23.460  58.266  -0.773  1.00 32.87 ? 335  VAL C CB    1 
ATOM   5991 C  CG1   . VAL C 1 334 ? 24.153  57.076  -0.124  1.00 31.78 ? 335  VAL C CG1   1 
ATOM   5992 C  CG2   . VAL C 1 334 ? 23.169  59.335  0.254   1.00 32.82 ? 335  VAL C CG2   1 
ATOM   5993 N  N     . PHE C 1 335 ? 23.973  57.364  -3.797  1.00 31.54 ? 336  PHE C N     1 
ATOM   5994 C  CA    . PHE C 1 335 ? 24.343  56.298  -4.700  1.00 31.75 ? 336  PHE C CA    1 
ATOM   5995 C  C     . PHE C 1 335 ? 25.454  56.760  -5.660  1.00 31.37 ? 336  PHE C C     1 
ATOM   5996 O  O     . PHE C 1 335 ? 26.318  55.981  -6.031  1.00 31.00 ? 336  PHE C O     1 
ATOM   5997 C  CB    . PHE C 1 335 ? 23.145  55.738  -5.455  1.00 32.05 ? 336  PHE C CB    1 
ATOM   5998 C  CG    . PHE C 1 335 ? 23.454  54.434  -6.143  1.00 32.69 ? 336  PHE C CG    1 
ATOM   5999 C  CD1   . PHE C 1 335 ? 23.481  53.252  -5.409  1.00 33.27 ? 336  PHE C CD1   1 
ATOM   6000 C  CD2   . PHE C 1 335 ? 23.760  54.393  -7.497  1.00 32.84 ? 336  PHE C CD2   1 
ATOM   6001 C  CE1   . PHE C 1 335 ? 23.807  52.060  -6.019  1.00 34.25 ? 336  PHE C CE1   1 
ATOM   6002 C  CE2   . PHE C 1 335 ? 24.088  53.207  -8.115  1.00 32.45 ? 336  PHE C CE2   1 
ATOM   6003 C  CZ    . PHE C 1 335 ? 24.114  52.031  -7.361  1.00 33.17 ? 336  PHE C CZ    1 
ATOM   6004 N  N     . ASP C 1 336 ? 25.430  58.036  -6.028  1.00 31.61 ? 337  ASP C N     1 
ATOM   6005 C  CA    . ASP C 1 336 ? 26.555  58.657  -6.742  1.00 31.81 ? 337  ASP C CA    1 
ATOM   6006 C  C     . ASP C 1 336 ? 27.889  58.398  -6.026  1.00 32.06 ? 337  ASP C C     1 
ATOM   6007 O  O     . ASP C 1 336 ? 28.863  57.924  -6.627  1.00 31.21 ? 337  ASP C O     1 
ATOM   6008 C  CB    . ASP C 1 336 ? 26.370  60.179  -6.853  1.00 32.63 ? 337  ASP C CB    1 
ATOM   6009 C  CG    . ASP C 1 336 ? 25.306  60.595  -7.869  1.00 34.46 ? 337  ASP C CG    1 
ATOM   6010 O  OD1   . ASP C 1 336 ? 24.805  59.754  -8.661  1.00 34.60 ? 337  ASP C OD1   1 
ATOM   6011 O  OD2   . ASP C 1 336 ? 24.964  61.796  -7.840  1.00 36.25 ? 337  ASP C OD2   1 
ATOM   6012 N  N     . ALA C 1 337 ? 27.930  58.744  -4.739  1.00 32.37 ? 338  ALA C N     1 
ATOM   6013 C  CA    . ALA C 1 337 ? 29.101  58.493  -3.898  1.00 32.70 ? 338  ALA C CA    1 
ATOM   6014 C  C     . ALA C 1 337 ? 29.462  57.003  -3.839  1.00 32.76 ? 338  ALA C C     1 
ATOM   6015 O  O     . ALA C 1 337 ? 30.629  56.657  -3.918  1.00 32.70 ? 338  ALA C O     1 
ATOM   6016 C  CB    . ALA C 1 337 ? 28.868  59.036  -2.501  1.00 32.70 ? 338  ALA C CB    1 
ATOM   6017 N  N     . VAL C 1 338 ? 28.463  56.127  -3.720  1.00 32.67 ? 339  VAL C N     1 
ATOM   6018 C  CA    . VAL C 1 338 ? 28.696  54.670  -3.707  1.00 32.85 ? 339  VAL C CA    1 
ATOM   6019 C  C     . VAL C 1 338 ? 29.375  54.182  -5.013  1.00 33.09 ? 339  VAL C C     1 
ATOM   6020 O  O     . VAL C 1 338 ? 30.384  53.449  -4.996  1.00 32.65 ? 339  VAL C O     1 
ATOM   6021 C  CB    . VAL C 1 338 ? 27.359  53.883  -3.443  1.00 32.70 ? 339  VAL C CB    1 
ATOM   6022 C  CG1   . VAL C 1 338 ? 27.531  52.340  -3.665  1.00 31.93 ? 339  VAL C CG1   1 
ATOM   6023 C  CG2   . VAL C 1 338 ? 26.828  54.179  -2.041  1.00 32.40 ? 339  VAL C CG2   1 
ATOM   6024 N  N     . THR C 1 339 ? 28.827  54.610  -6.142  1.00 33.20 ? 340  THR C N     1 
ATOM   6025 C  CA    . THR C 1 339 ? 29.382  54.280  -7.439  1.00 33.42 ? 340  THR C CA    1 
ATOM   6026 C  C     . THR C 1 339 ? 30.871  54.721  -7.560  1.00 33.69 ? 340  THR C C     1 
ATOM   6027 O  O     . THR C 1 339 ? 31.695  53.949  -8.016  1.00 32.86 ? 340  THR C O     1 
ATOM   6028 C  CB    . THR C 1 339 ? 28.502  54.873  -8.553  1.00 33.36 ? 340  THR C CB    1 
ATOM   6029 O  OG1   . THR C 1 339 ? 27.165  54.368  -8.400  1.00 33.28 ? 340  THR C OG1   1 
ATOM   6030 C  CG2   . THR C 1 339 ? 29.040  54.501  -9.935  1.00 33.57 ? 340  THR C CG2   1 
ATOM   6031 N  N     . ASP C 1 340 ? 31.197  55.930  -7.096  1.00 34.16 ? 341  ASP C N     1 
ATOM   6032 C  CA    . ASP C 1 340 ? 32.591  56.418  -7.034  1.00 35.02 ? 341  ASP C CA    1 
ATOM   6033 C  C     . ASP C 1 340 ? 33.537  55.439  -6.323  1.00 34.62 ? 341  ASP C C     1 
ATOM   6034 O  O     . ASP C 1 340 ? 34.655  55.184  -6.801  1.00 33.31 ? 341  ASP C O     1 
ATOM   6035 C  CB    . ASP C 1 340 ? 32.691  57.745  -6.264  1.00 35.65 ? 341  ASP C CB    1 
ATOM   6036 C  CG    . ASP C 1 340 ? 32.070  58.918  -6.990  1.00 39.03 ? 341  ASP C CG    1 
ATOM   6037 O  OD1   . ASP C 1 340 ? 32.213  59.011  -8.225  1.00 40.69 ? 341  ASP C OD1   1 
ATOM   6038 O  OD2   . ASP C 1 340 ? 31.454  59.770  -6.291  1.00 44.31 ? 341  ASP C OD2   1 
ATOM   6039 N  N     . VAL C 1 341 ? 33.101  54.953  -5.156  1.00 34.42 ? 342  VAL C N     1 
ATOM   6040 C  CA    . VAL C 1 341 ? 33.903  54.045  -4.330  1.00 34.73 ? 342  VAL C CA    1 
ATOM   6041 C  C     . VAL C 1 341 ? 34.157  52.728  -5.054  1.00 34.68 ? 342  VAL C C     1 
ATOM   6042 O  O     . VAL C 1 341 ? 35.299  52.229  -5.077  1.00 34.02 ? 342  VAL C O     1 
ATOM   6043 C  CB    . VAL C 1 341 ? 33.240  53.732  -2.963  1.00 35.00 ? 342  VAL C CB    1 
ATOM   6044 C  CG1   . VAL C 1 341 ? 33.970  52.581  -2.254  1.00 35.54 ? 342  VAL C CG1   1 
ATOM   6045 C  CG2   . VAL C 1 341 ? 33.193  54.978  -2.072  1.00 34.84 ? 342  VAL C CG2   1 
ATOM   6046 N  N     . ILE C 1 342 ? 33.101  52.177  -5.652  1.00 34.39 ? 343  ILE C N     1 
ATOM   6047 C  CA    . ILE C 1 342 ? 33.228  50.953  -6.445  1.00 34.44 ? 343  ILE C CA    1 
ATOM   6048 C  C     . ILE C 1 342 ? 34.222  51.165  -7.594  1.00 34.71 ? 343  ILE C C     1 
ATOM   6049 O  O     . ILE C 1 342 ? 35.114  50.335  -7.810  1.00 34.18 ? 343  ILE C O     1 
ATOM   6050 C  CB    . ILE C 1 342 ? 31.854  50.465  -6.984  1.00 34.45 ? 343  ILE C CB    1 
ATOM   6051 C  CG1   . ILE C 1 342 ? 30.934  50.048  -5.833  1.00 33.68 ? 343  ILE C CG1   1 
ATOM   6052 C  CG2   . ILE C 1 342 ? 32.036  49.272  -7.929  1.00 34.09 ? 343  ILE C CG2   1 
ATOM   6053 C  CD1   . ILE C 1 342 ? 29.458  49.990  -6.214  1.00 34.32 ? 343  ILE C CD1   1 
ATOM   6054 N  N     . ILE C 1 343 ? 34.091  52.289  -8.298  1.00 35.31 ? 344  ILE C N     1 
ATOM   6055 C  CA    . ILE C 1 343 ? 34.977  52.583  -9.429  1.00 36.07 ? 344  ILE C CA    1 
ATOM   6056 C  C     . ILE C 1 343 ? 36.431  52.752  -8.961  1.00 36.85 ? 344  ILE C C     1 
ATOM   6057 O  O     . ILE C 1 343 ? 37.361  52.222  -9.584  1.00 37.04 ? 344  ILE C O     1 
ATOM   6058 C  CB    . ILE C 1 343 ? 34.493  53.831  -10.229 1.00 36.02 ? 344  ILE C CB    1 
ATOM   6059 C  CG1   . ILE C 1 343 ? 33.175  53.517  -10.952 1.00 36.08 ? 344  ILE C CG1   1 
ATOM   6060 C  CG2   . ILE C 1 343 ? 35.561  54.306  -11.222 1.00 35.67 ? 344  ILE C CG2   1 
ATOM   6061 C  CD1   . ILE C 1 343 ? 32.513  54.707  -11.586 1.00 36.06 ? 344  ILE C CD1   1 
ATOM   6062 N  N     . LYS C 1 344 ? 36.606  53.487  -7.866  1.00 37.76 ? 345  LYS C N     1 
ATOM   6063 C  CA    . LYS C 1 344 ? 37.911  53.675  -7.235  1.00 38.79 ? 345  LYS C CA    1 
ATOM   6064 C  C     . LYS C 1 344 ? 38.513  52.337  -6.764  1.00 39.47 ? 345  LYS C C     1 
ATOM   6065 O  O     . LYS C 1 344 ? 39.707  52.103  -6.943  1.00 38.92 ? 345  LYS C O     1 
ATOM   6066 C  CB    . LYS C 1 344 ? 37.784  54.664  -6.064  1.00 38.73 ? 345  LYS C CB    1 
ATOM   6067 C  CG    . LYS C 1 344 ? 39.089  55.014  -5.377  1.00 39.12 ? 345  LYS C CG    1 
ATOM   6068 N  N     . ASN C 1 345 ? 37.684  51.463  -6.190  1.00 40.58 ? 346  ASN C N     1 
ATOM   6069 C  CA    . ASN C 1 345 ? 38.145  50.144  -5.725  1.00 41.95 ? 346  ASN C CA    1 
ATOM   6070 C  C     . ASN C 1 345 ? 38.170  49.063  -6.824  1.00 43.23 ? 346  ASN C C     1 
ATOM   6071 O  O     . ASN C 1 345 ? 38.172  47.872  -6.519  1.00 44.24 ? 346  ASN C O     1 
ATOM   6072 C  CB    . ASN C 1 345 ? 37.299  49.654  -4.543  1.00 41.91 ? 346  ASN C CB    1 
ATOM   6073 C  CG    . ASN C 1 345 ? 37.405  50.554  -3.311  1.00 42.14 ? 346  ASN C CG    1 
ATOM   6074 O  OD1   . ASN C 1 345 ? 38.277  51.432  -3.218  1.00 41.58 ? 346  ASN C OD1   1 
ATOM   6075 N  ND2   . ASN C 1 345 ? 36.508  50.329  -2.346  1.00 41.91 ? 346  ASN C ND2   1 
ATOM   6076 N  N     . ASN C 1 346 ? 38.171  49.481  -8.090  1.00 44.30 ? 347  ASN C N     1 
ATOM   6077 C  CA    . ASN C 1 346 ? 38.248  48.582  -9.246  1.00 45.24 ? 347  ASN C CA    1 
ATOM   6078 C  C     . ASN C 1 346 ? 39.241  49.134  -10.248 1.00 45.30 ? 347  ASN C C     1 
ATOM   6079 O  O     . ASN C 1 346 ? 39.441  48.549  -11.313 1.00 46.18 ? 347  ASN C O     1 
ATOM   6080 C  CB    . ASN C 1 346 ? 36.871  48.440  -9.922  1.00 45.61 ? 347  ASN C CB    1 
ATOM   6081 C  CG    . ASN C 1 346 ? 36.313  47.020  -9.853  1.00 47.06 ? 347  ASN C CG    1 
ATOM   6082 O  OD1   . ASN C 1 346 ? 37.001  46.042  -10.203 1.00 49.49 ? 347  ASN C OD1   1 
ATOM   6083 N  ND2   . ASN C 1 346 ? 35.044  46.900  -9.439  1.00 48.26 ? 347  ASN C ND2   1 
ATOM   6084 N  N     . SER D 2 17  ? -5.571  35.909  -10.731 1.00 34.80 ? 56   SER D N     1 
ATOM   6085 C  CA    . SER D 2 17  ? -5.886  35.347  -9.388  1.00 34.32 ? 56   SER D CA    1 
ATOM   6086 C  C     . SER D 2 17  ? -4.971  34.184  -9.019  1.00 34.54 ? 56   SER D C     1 
ATOM   6087 O  O     . SER D 2 17  ? -4.775  33.163  -9.736  1.00 33.80 ? 56   SER D O     1 
ATOM   6088 C  CB    . SER D 2 17  ? -7.343  34.963  -9.205  1.00 34.64 ? 56   SER D CB    1 
ATOM   6089 O  OG    . SER D 2 17  ? -7.621  34.552  -7.871  1.00 32.79 ? 56   SER D OG    1 
ATOM   6090 N  N     . PHE D 2 18  ? -4.396  34.406  -7.868  1.00 33.70 ? 57   PHE D N     1 
ATOM   6091 C  CA    . PHE D 2 18  ? -3.397  33.558  -7.308  1.00 34.19 ? 57   PHE D CA    1 
ATOM   6092 C  C     . PHE D 2 18  ? -4.039  32.279  -6.855  1.00 33.83 ? 57   PHE D C     1 
ATOM   6093 O  O     . PHE D 2 18  ? -3.436  31.239  -6.981  1.00 33.65 ? 57   PHE D O     1 
ATOM   6094 C  CB    . PHE D 2 18  ? -2.757  34.301  -6.147  1.00 33.40 ? 57   PHE D CB    1 
ATOM   6095 C  CG    . PHE D 2 18  ? -1.664  33.563  -5.486  1.00 34.30 ? 57   PHE D CG    1 
ATOM   6096 C  CD1   . PHE D 2 18  ? -0.600  33.063  -6.223  1.00 34.06 ? 57   PHE D CD1   1 
ATOM   6097 C  CD2   . PHE D 2 18  ? -1.673  33.386  -4.114  1.00 32.98 ? 57   PHE D CD2   1 
ATOM   6098 C  CE1   . PHE D 2 18  ? 0.451   32.407  -5.604  1.00 34.86 ? 57   PHE D CE1   1 
ATOM   6099 C  CE2   . PHE D 2 18  ? -0.636  32.693  -3.481  1.00 35.22 ? 57   PHE D CE2   1 
ATOM   6100 C  CZ    . PHE D 2 18  ? 0.444   32.206  -4.244  1.00 33.47 ? 57   PHE D CZ    1 
ATOM   6101 N  N     . ASP D 2 19  ? -5.275  32.357  -6.346  1.00 34.62 ? 58   ASP D N     1 
ATOM   6102 C  CA    . ASP D 2 19  ? -5.965  31.173  -5.856  1.00 35.20 ? 58   ASP D CA    1 
ATOM   6103 C  C     . ASP D 2 19  ? -6.395  30.263  -6.995  1.00 34.63 ? 58   ASP D C     1 
ATOM   6104 O  O     . ASP D 2 19  ? -6.377  29.045  -6.835  1.00 34.10 ? 58   ASP D O     1 
ATOM   6105 C  CB    . ASP D 2 19  ? -7.157  31.542  -4.948  1.00 35.83 ? 58   ASP D CB    1 
ATOM   6106 C  CG    . ASP D 2 19  ? -6.705  32.105  -3.598  1.00 37.86 ? 58   ASP D CG    1 
ATOM   6107 O  OD1   . ASP D 2 19  ? -5.639  31.707  -3.084  1.00 39.40 ? 58   ASP D OD1   1 
ATOM   6108 O  OD2   . ASP D 2 19  ? -7.408  32.963  -3.058  1.00 42.05 ? 58   ASP D OD2   1 
ATOM   6109 N  N     . VAL D 2 20  ? -6.762  30.851  -8.130  1.00 35.12 ? 59   VAL D N     1 
ATOM   6110 C  CA    . VAL D 2 20  ? -7.028  30.080  -9.337  1.00 35.81 ? 59   VAL D CA    1 
ATOM   6111 C  C     . VAL D 2 20  ? -5.731  29.340  -9.760  1.00 36.08 ? 59   VAL D C     1 
ATOM   6112 O  O     . VAL D 2 20  ? -5.754  28.133  -9.990  1.00 36.75 ? 59   VAL D O     1 
ATOM   6113 C  CB    . VAL D 2 20  ? -7.623  30.983  -10.471 1.00 35.77 ? 59   VAL D CB    1 
ATOM   6114 C  CG1   . VAL D 2 20  ? -7.786  30.211  -11.805 1.00 35.69 ? 59   VAL D CG1   1 
ATOM   6115 C  CG2   . VAL D 2 20  ? -8.977  31.565  -10.029 1.00 36.27 ? 59   VAL D CG2   1 
ATOM   6116 N  N     . LEU D 2 21  ? -4.608  30.048  -9.807  1.00 36.34 ? 60   LEU D N     1 
ATOM   6117 C  CA    . LEU D 2 21  ? -3.307  29.418  -10.092 1.00 36.54 ? 60   LEU D CA    1 
ATOM   6118 C  C     . LEU D 2 21  ? -3.065  28.185  -9.210  1.00 36.58 ? 60   LEU D C     1 
ATOM   6119 O  O     . LEU D 2 21  ? -2.769  27.118  -9.714  1.00 36.53 ? 60   LEU D O     1 
ATOM   6120 C  CB    . LEU D 2 21  ? -2.147  30.435  -9.943  1.00 36.96 ? 60   LEU D CB    1 
ATOM   6121 C  CG    . LEU D 2 21  ? -0.688  30.008  -10.275 1.00 36.59 ? 60   LEU D CG    1 
ATOM   6122 C  CD1   . LEU D 2 21  ? -0.480  29.902  -11.776 1.00 38.08 ? 60   LEU D CD1   1 
ATOM   6123 C  CD2   . LEU D 2 21  ? 0.344   30.963  -9.699  1.00 36.00 ? 60   LEU D CD2   1 
ATOM   6124 N  N     . LEU D 2 22  ? -3.229  28.334  -7.892  1.00 36.89 ? 61   LEU D N     1 
ATOM   6125 C  CA    . LEU D 2 22  ? -2.931  27.278  -6.939  1.00 37.15 ? 61   LEU D CA    1 
ATOM   6126 C  C     . LEU D 2 22  ? -3.938  26.118  -7.026  1.00 37.55 ? 61   LEU D C     1 
ATOM   6127 O  O     . LEU D 2 22  ? -3.688  25.035  -6.487  1.00 38.27 ? 61   LEU D O     1 
ATOM   6128 C  CB    . LEU D 2 22  ? -2.921  27.845  -5.502  1.00 36.80 ? 61   LEU D CB    1 
ATOM   6129 C  CG    . LEU D 2 22  ? -1.864  28.894  -5.110  1.00 38.93 ? 61   LEU D CG    1 
ATOM   6130 C  CD1   . LEU D 2 22  ? -1.938  29.253  -3.632  1.00 38.18 ? 61   LEU D CD1   1 
ATOM   6131 C  CD2   . LEU D 2 22  ? -0.472  28.402  -5.410  1.00 39.65 ? 61   LEU D CD2   1 
ATOM   6132 N  N     . SER D 2 23  ? -5.069  26.374  -7.673  1.00 37.51 ? 62   SER D N     1 
ATOM   6133 C  CA    . SER D 2 23  ? -6.125  25.393  -7.890  1.00 37.82 ? 62   SER D CA    1 
ATOM   6134 C  C     . SER D 2 23  ? -5.809  24.374  -8.993  1.00 37.84 ? 62   SER D C     1 
ATOM   6135 O  O     . SER D 2 23  ? -6.479  23.338  -9.074  1.00 38.93 ? 62   SER D O     1 
ATOM   6136 C  CB    . SER D 2 23  ? -7.441  26.114  -8.226  1.00 37.41 ? 62   SER D CB    1 
ATOM   6137 O  OG    . SER D 2 23  ? -7.579  26.367  -9.614  1.00 37.13 ? 62   SER D OG    1 
ATOM   6138 N  N     . HIS D 2 24  ? -4.831  24.656  -9.853  1.00 37.53 ? 63   HIS D N     1 
ATOM   6139 C  CA    . HIS D 2 24  ? -4.456  23.726  -10.914 1.00 37.67 ? 63   HIS D CA    1 
ATOM   6140 C  C     . HIS D 2 24  ? -3.075  23.095  -10.645 1.00 37.25 ? 63   HIS D C     1 
ATOM   6141 O  O     . HIS D 2 24  ? -2.126  23.790  -10.277 1.00 34.76 ? 63   HIS D O     1 
ATOM   6142 C  CB    . HIS D 2 24  ? -4.436  24.435  -12.269 1.00 38.36 ? 63   HIS D CB    1 
ATOM   6143 C  CG    . HIS D 2 24  ? -5.728  25.105  -12.650 1.00 39.66 ? 63   HIS D CG    1 
ATOM   6144 N  ND1   . HIS D 2 24  ? -6.937  24.441  -12.702 1.00 42.07 ? 63   HIS D ND1   1 
ATOM   6145 C  CD2   . HIS D 2 24  ? -5.983  26.374  -13.049 1.00 41.44 ? 63   HIS D CD2   1 
ATOM   6146 C  CE1   . HIS D 2 24  ? -7.881  25.278  -13.098 1.00 43.06 ? 63   HIS D CE1   1 
ATOM   6147 N  NE2   . HIS D 2 24  ? -7.326  26.456  -13.320 1.00 43.63 ? 63   HIS D NE2   1 
ATOM   6148 N  N     . LYS D 2 25  ? -2.942  21.787  -10.874 1.00 36.64 ? 64   LYS D N     1 
ATOM   6149 C  CA    . LYS D 2 25  ? -1.637  21.110  -10.664 1.00 36.76 ? 64   LYS D CA    1 
ATOM   6150 C  C     . LYS D 2 25  ? -0.538  21.746  -11.537 1.00 35.62 ? 64   LYS D C     1 
ATOM   6151 O  O     . LYS D 2 25  ? 0.620   21.807  -11.157 1.00 34.03 ? 64   LYS D O     1 
ATOM   6152 C  CB    . LYS D 2 25  ? -1.732  19.601  -10.962 1.00 37.28 ? 64   LYS D CB    1 
ATOM   6153 C  CG    . LYS D 2 25  ? -2.221  18.757  -9.781  1.00 39.10 ? 64   LYS D CG    1 
ATOM   6154 N  N     . TYR D 2 26  ? -0.911  22.224  -12.708 1.00 34.84 ? 65   TYR D N     1 
ATOM   6155 C  CA    . TYR D 2 26  ? 0.088   22.847  -13.587 1.00 35.26 ? 65   TYR D CA    1 
ATOM   6156 C  C     . TYR D 2 26  ? 0.397   24.293  -13.203 1.00 33.89 ? 65   TYR D C     1 
ATOM   6157 O  O     . TYR D 2 26  ? 1.466   24.804  -13.528 1.00 33.86 ? 65   TYR D O     1 
ATOM   6158 C  CB    . TYR D 2 26  ? -0.342  22.764  -15.040 1.00 36.04 ? 65   TYR D CB    1 
ATOM   6159 C  CG    . TYR D 2 26  ? -1.689  23.344  -15.316 1.00 37.05 ? 65   TYR D CG    1 
ATOM   6160 C  CD1   . TYR D 2 26  ? -1.830  24.686  -15.618 1.00 38.17 ? 65   TYR D CD1   1 
ATOM   6161 C  CD2   . TYR D 2 26  ? -2.824  22.542  -15.302 1.00 38.45 ? 65   TYR D CD2   1 
ATOM   6162 C  CE1   . TYR D 2 26  ? -3.071  25.227  -15.895 1.00 39.36 ? 65   TYR D CE1   1 
ATOM   6163 C  CE2   . TYR D 2 26  ? -4.063  23.065  -15.588 1.00 40.99 ? 65   TYR D CE2   1 
ATOM   6164 C  CZ    . TYR D 2 26  ? -4.183  24.416  -15.884 1.00 40.13 ? 65   TYR D CZ    1 
ATOM   6165 O  OH    . TYR D 2 26  ? -5.417  24.954  -16.202 1.00 40.74 ? 65   TYR D OH    1 
ATOM   6166 N  N     . GLY D 2 27  ? -0.541  24.949  -12.526 1.00 32.98 ? 66   GLY D N     1 
ATOM   6167 C  CA    . GLY D 2 27  ? -0.299  26.292  -11.964 1.00 32.24 ? 66   GLY D CA    1 
ATOM   6168 C  C     . GLY D 2 27  ? 0.678   26.193  -10.820 1.00 31.83 ? 66   GLY D C     1 
ATOM   6169 O  O     . GLY D 2 27  ? 1.637   26.978  -10.725 1.00 30.56 ? 66   GLY D O     1 
ATOM   6170 N  N     . VAL D 2 28  ? 0.432   25.207  -9.957  1.00 31.28 ? 67   VAL D N     1 
ATOM   6171 C  CA    . VAL D 2 28  ? 1.312   24.899  -8.845  1.00 31.42 ? 67   VAL D CA    1 
ATOM   6172 C  C     . VAL D 2 28  ? 2.755   24.576  -9.317  1.00 30.96 ? 67   VAL D C     1 
ATOM   6173 O  O     . VAL D 2 28  ? 3.718   25.089  -8.727  1.00 30.70 ? 67   VAL D O     1 
ATOM   6174 C  CB    . VAL D 2 28  ? 0.715   23.752  -7.995  1.00 32.44 ? 67   VAL D CB    1 
ATOM   6175 C  CG1   . VAL D 2 28  ? 1.739   23.150  -7.054  1.00 33.21 ? 67   VAL D CG1   1 
ATOM   6176 C  CG2   . VAL D 2 28  ? -0.510  24.271  -7.214  1.00 31.44 ? 67   VAL D CG2   1 
ATOM   6177 N  N     . ALA D 2 29  ? 2.877   23.715  -10.334 1.00 30.51 ? 68   ALA D N     1 
ATOM   6178 C  CA    . ALA D 2 29  ? 4.174   23.310  -10.871 1.00 30.42 ? 68   ALA D CA    1 
ATOM   6179 C  C     . ALA D 2 29  ? 4.949   24.510  -11.417 1.00 30.47 ? 68   ALA D C     1 
ATOM   6180 O  O     . ALA D 2 29  ? 6.152   24.629  -11.178 1.00 29.42 ? 68   ALA D O     1 
ATOM   6181 C  CB    . ALA D 2 29  ? 3.993   22.257  -11.958 1.00 29.83 ? 68   ALA D CB    1 
ATOM   6182 N  N     . ALA D 2 30  ? 4.255   25.375  -12.168 1.00 30.30 ? 69   ALA D N     1 
ATOM   6183 C  CA    . ALA D 2 30  ? 4.856   26.571  -12.756 1.00 30.50 ? 69   ALA D CA    1 
ATOM   6184 C  C     . ALA D 2 30  ? 5.308   27.564  -11.673 1.00 31.21 ? 69   ALA D C     1 
ATOM   6185 O  O     . ALA D 2 30  ? 6.434   28.092  -11.723 1.00 29.96 ? 69   ALA D O     1 
ATOM   6186 C  CB    . ALA D 2 30  ? 3.881   27.243  -13.762 1.00 29.94 ? 69   ALA D CB    1 
ATOM   6187 N  N     . PHE D 2 31  ? 4.455   27.783  -10.670 1.00 31.56 ? 70   PHE D N     1 
ATOM   6188 C  CA    . PHE D 2 31  ? 4.807   28.679  -9.585  1.00 32.16 ? 70   PHE D CA    1 
ATOM   6189 C  C     . PHE D 2 31  ? 5.994   28.103  -8.799  1.00 32.27 ? 70   PHE D C     1 
ATOM   6190 O  O     . PHE D 2 31  ? 6.892   28.837  -8.411  1.00 33.04 ? 70   PHE D O     1 
ATOM   6191 C  CB    . PHE D 2 31  ? 3.594   28.923  -8.675  1.00 32.49 ? 70   PHE D CB    1 
ATOM   6192 C  CG    . PHE D 2 31  ? 3.732   30.123  -7.765  1.00 31.39 ? 70   PHE D CG    1 
ATOM   6193 C  CD1   . PHE D 2 31  ? 4.064   31.388  -8.271  1.00 32.31 ? 70   PHE D CD1   1 
ATOM   6194 C  CD2   . PHE D 2 31  ? 3.524   29.995  -6.396  1.00 33.69 ? 70   PHE D CD2   1 
ATOM   6195 C  CE1   . PHE D 2 31  ? 4.208   32.501  -7.405  1.00 32.23 ? 70   PHE D CE1   1 
ATOM   6196 C  CE2   . PHE D 2 31  ? 3.638   31.100  -5.538  1.00 30.92 ? 70   PHE D CE2   1 
ATOM   6197 C  CZ    . PHE D 2 31  ? 3.987   32.351  -6.051  1.00 33.06 ? 70   PHE D CZ    1 
ATOM   6198 N  N     . ARG D 2 32  ? 6.007   26.790  -8.594  1.00 32.22 ? 71   ARG D N     1 
ATOM   6199 C  CA    . ARG D 2 32  ? 7.100   26.149  -7.860  1.00 32.41 ? 71   ARG D CA    1 
ATOM   6200 C  C     . ARG D 2 32  ? 8.452   26.363  -8.510  1.00 32.23 ? 71   ARG D C     1 
ATOM   6201 O  O     . ARG D 2 32  ? 9.447   26.679  -7.836  1.00 31.75 ? 71   ARG D O     1 
ATOM   6202 C  CB    . ARG D 2 32  ? 6.838   24.668  -7.738  1.00 32.87 ? 71   ARG D CB    1 
ATOM   6203 C  CG    . ARG D 2 32  ? 7.948   23.917  -7.069  1.00 33.98 ? 71   ARG D CG    1 
ATOM   6204 C  CD    . ARG D 2 32  ? 7.744   22.425  -7.167  1.00 38.81 ? 71   ARG D CD    1 
ATOM   6205 N  NE    . ARG D 2 32  ? 6.854   21.930  -6.126  1.00 39.88 ? 71   ARG D NE    1 
ATOM   6206 C  CZ    . ARG D 2 32  ? 5.695   21.313  -6.327  1.00 43.15 ? 71   ARG D CZ    1 
ATOM   6207 N  NH1   . ARG D 2 32  ? 4.990   20.906  -5.268  1.00 43.21 ? 71   ARG D NH1   1 
ATOM   6208 N  NH2   . ARG D 2 32  ? 5.251   21.043  -7.566  1.00 44.75 ? 71   ARG D NH2   1 
ATOM   6209 N  N     . ALA D 2 33  ? 8.486   26.139  -9.813  1.00 32.01 ? 72   ALA D N     1 
ATOM   6210 C  CA    . ALA D 2 33  ? 9.703   26.349  -10.606 1.00 31.84 ? 72   ALA D CA    1 
ATOM   6211 C  C     . ALA D 2 33  ? 10.207  27.779  -10.440 1.00 31.97 ? 72   ALA D C     1 
ATOM   6212 O  O     . ALA D 2 33  ? 11.412  28.009  -10.316 1.00 31.17 ? 72   ALA D O     1 
ATOM   6213 C  CB    . ALA D 2 33  ? 9.424   26.031  -12.072 1.00 31.81 ? 72   ALA D CB    1 
ATOM   6214 N  N     . PHE D 2 34  ? 9.271   28.733  -10.414 1.00 32.51 ? 73   PHE D N     1 
ATOM   6215 C  CA    . PHE D 2 34  ? 9.616   30.142  -10.292 1.00 32.44 ? 73   PHE D CA    1 
ATOM   6216 C  C     . PHE D 2 34  ? 10.197  30.431  -8.921  1.00 32.46 ? 73   PHE D C     1 
ATOM   6217 O  O     . PHE D 2 34  ? 11.239  31.094  -8.834  1.00 32.34 ? 73   PHE D O     1 
ATOM   6218 C  CB    . PHE D 2 34  ? 8.438   31.077  -10.589 1.00 32.58 ? 73   PHE D CB    1 
ATOM   6219 C  CG    . PHE D 2 34  ? 8.762   32.529  -10.321 1.00 32.89 ? 73   PHE D CG    1 
ATOM   6220 C  CD1   . PHE D 2 34  ? 9.575   33.253  -11.188 1.00 35.24 ? 73   PHE D CD1   1 
ATOM   6221 C  CD2   . PHE D 2 34  ? 8.287   33.160  -9.168  1.00 34.86 ? 73   PHE D CD2   1 
ATOM   6222 C  CE1   . PHE D 2 34  ? 9.913   34.601  -10.910 1.00 32.86 ? 73   PHE D CE1   1 
ATOM   6223 C  CE2   . PHE D 2 34  ? 8.597   34.500  -8.913  1.00 33.71 ? 73   PHE D CE2   1 
ATOM   6224 C  CZ    . PHE D 2 34  ? 9.421   35.208  -9.788  1.00 31.48 ? 73   PHE D CZ    1 
ATOM   6225 N  N     . LEU D 2 35  ? 9.521   29.943  -7.872  1.00 31.45 ? 74   LEU D N     1 
ATOM   6226 C  CA    . LEU D 2 35  ? 9.959   30.126  -6.489  1.00 31.72 ? 74   LEU D CA    1 
ATOM   6227 C  C     . LEU D 2 35  ? 11.349  29.528  -6.261  1.00 31.62 ? 74   LEU D C     1 
ATOM   6228 O  O     . LEU D 2 35  ? 12.165  30.124  -5.531  1.00 32.28 ? 74   LEU D O     1 
ATOM   6229 C  CB    . LEU D 2 35  ? 8.964   29.511  -5.485  1.00 31.01 ? 74   LEU D CB    1 
ATOM   6230 C  CG    . LEU D 2 35  ? 7.590   30.164  -5.406  1.00 31.23 ? 74   LEU D CG    1 
ATOM   6231 C  CD1   . LEU D 2 35  ? 6.796   29.634  -4.233  1.00 32.41 ? 74   LEU D CD1   1 
ATOM   6232 C  CD2   . LEU D 2 35  ? 7.764   31.694  -5.326  1.00 31.31 ? 74   LEU D CD2   1 
ATOM   6233 N  N     . LYS D 2 36  ? 11.622  28.379  -6.867  1.00 32.03 ? 75   LYS D N     1 
ATOM   6234 C  CA    . LYS D 2 36  ? 12.969  27.795  -6.784  1.00 32.38 ? 75   LYS D CA    1 
ATOM   6235 C  C     . LYS D 2 36  ? 14.061  28.757  -7.306  1.00 32.00 ? 75   LYS D C     1 
ATOM   6236 O  O     . LYS D 2 36  ? 15.190  28.824  -6.742  1.00 32.25 ? 75   LYS D O     1 
ATOM   6237 C  CB    . LYS D 2 36  ? 13.026  26.444  -7.489  1.00 33.63 ? 75   LYS D CB    1 
ATOM   6238 C  CG    . LYS D 2 36  ? 12.350  25.277  -6.750  1.00 32.67 ? 75   LYS D CG    1 
ATOM   6239 C  CD    . LYS D 2 36  ? 12.562  23.973  -7.576  1.00 34.04 ? 75   LYS D CD    1 
ATOM   6240 C  CE    . LYS D 2 36  ? 11.936  22.758  -6.905  1.00 36.07 ? 75   LYS D CE    1 
ATOM   6241 N  NZ    . LYS D 2 36  ? 11.894  21.574  -7.780  1.00 36.62 ? 75   LYS D NZ    1 
ATOM   6242 N  N     . THR D 2 37  ? 13.750  29.519  -8.351  1.00 30.76 ? 76   THR D N     1 
ATOM   6243 C  CA    . THR D 2 37  ? 14.729  30.499  -8.882  1.00 30.93 ? 76   THR D CA    1 
ATOM   6244 C  C     . THR D 2 37  ? 14.973  31.660  -7.897  1.00 30.95 ? 76   THR D C     1 
ATOM   6245 O  O     . THR D 2 37  ? 16.027  32.326  -7.942  1.00 29.86 ? 76   THR D O     1 
ATOM   6246 C  CB    . THR D 2 37  ? 14.334  31.071  -10.299 1.00 30.47 ? 76   THR D CB    1 
ATOM   6247 O  OG1   . THR D 2 37  ? 13.199  31.933  -10.191 1.00 30.86 ? 76   THR D OG1   1 
ATOM   6248 C  CG2   . THR D 2 37  ? 14.050  29.973  -11.300 1.00 31.84 ? 76   THR D CG2   1 
ATOM   6249 N  N     . GLU D 2 38  ? 13.993  31.888  -7.008  1.00 30.98 ? 77   GLU D N     1 
ATOM   6250 C  CA    . GLU D 2 38  ? 14.067  32.939  -6.006  1.00 31.74 ? 77   GLU D CA    1 
ATOM   6251 C  C     . GLU D 2 38  ? 14.399  32.413  -4.619  1.00 31.63 ? 77   GLU D C     1 
ATOM   6252 O  O     . GLU D 2 38  ? 14.456  33.186  -3.689  1.00 31.12 ? 77   GLU D O     1 
ATOM   6253 C  CB    . GLU D 2 38  ? 12.767  33.748  -5.929  1.00 31.20 ? 77   GLU D CB    1 
ATOM   6254 C  CG    . GLU D 2 38  ? 12.524  34.556  -7.156  1.00 30.65 ? 77   GLU D CG    1 
ATOM   6255 C  CD    . GLU D 2 38  ? 11.613  35.734  -6.934  1.00 32.86 ? 77   GLU D CD    1 
ATOM   6256 O  OE1   . GLU D 2 38  ? 10.855  35.724  -5.932  1.00 33.97 ? 77   GLU D OE1   1 
ATOM   6257 O  OE2   . GLU D 2 38  ? 11.628  36.651  -7.790  1.00 33.10 ? 77   GLU D OE2   1 
ATOM   6258 N  N     . PHE D 2 39  ? 14.680  31.117  -4.520  1.00 31.63 ? 78   PHE D N     1 
ATOM   6259 C  CA    . PHE D 2 39  ? 14.932  30.450  -3.245  1.00 32.15 ? 78   PHE D CA    1 
ATOM   6260 C  C     . PHE D 2 39  ? 13.858  30.743  -2.210  1.00 32.60 ? 78   PHE D C     1 
ATOM   6261 O  O     . PHE D 2 39  ? 14.165  31.033  -1.061  1.00 33.35 ? 78   PHE D O     1 
ATOM   6262 C  CB    . PHE D 2 39  ? 16.338  30.811  -2.726  1.00 31.95 ? 78   PHE D CB    1 
ATOM   6263 C  CG    . PHE D 2 39  ? 17.408  30.549  -3.714  1.00 32.86 ? 78   PHE D CG    1 
ATOM   6264 C  CD1   . PHE D 2 39  ? 18.029  29.298  -3.778  1.00 31.54 ? 78   PHE D CD1   1 
ATOM   6265 C  CD2   . PHE D 2 39  ? 17.808  31.543  -4.612  1.00 32.09 ? 78   PHE D CD2   1 
ATOM   6266 C  CE1   . PHE D 2 39  ? 19.023  29.053  -4.711  1.00 33.09 ? 78   PHE D CE1   1 
ATOM   6267 C  CE2   . PHE D 2 39  ? 18.795  31.289  -5.542  1.00 32.52 ? 78   PHE D CE2   1 
ATOM   6268 C  CZ    . PHE D 2 39  ? 19.399  30.030  -5.598  1.00 30.53 ? 78   PHE D CZ    1 
ATOM   6269 N  N     . SER D 2 40  ? 12.595  30.660  -2.608  1.00 32.64 ? 79   SER D N     1 
ATOM   6270 C  CA    . SER D 2 40  ? 11.474  30.819  -1.674  1.00 33.17 ? 79   SER D CA    1 
ATOM   6271 C  C     . SER D 2 40  ? 10.419  29.707  -1.793  1.00 33.62 ? 79   SER D C     1 
ATOM   6272 O  O     . SER D 2 40  ? 9.267   29.873  -1.365  1.00 33.69 ? 79   SER D O     1 
ATOM   6273 C  CB    . SER D 2 40  ? 10.826  32.224  -1.830  1.00 33.21 ? 79   SER D CB    1 
ATOM   6274 O  OG    . SER D 2 40  ? 10.278  32.388  -3.131  1.00 32.33 ? 79   SER D OG    1 
ATOM   6275 N  N     . GLU D 2 41  ? 10.819  28.561  -2.339  1.00 33.51 ? 80   GLU D N     1 
ATOM   6276 C  CA    . GLU D 2 41  ? 9.877   27.466  -2.589  1.00 34.39 ? 80   GLU D CA    1 
ATOM   6277 C  C     . GLU D 2 41  ? 9.352   26.824  -1.292  1.00 33.86 ? 80   GLU D C     1 
ATOM   6278 O  O     . GLU D 2 41  ? 8.315   26.166  -1.307  1.00 33.12 ? 80   GLU D O     1 
ATOM   6279 C  CB    . GLU D 2 41  ? 10.508  26.420  -3.534  1.00 35.39 ? 80   GLU D CB    1 
ATOM   6280 C  CG    . GLU D 2 41  ? 11.644  25.565  -2.905  1.00 39.56 ? 80   GLU D CG    1 
ATOM   6281 C  CD    . GLU D 2 41  ? 13.071  26.126  -3.042  1.00 40.98 ? 80   GLU D CD    1 
ATOM   6282 O  OE1   . GLU D 2 41  ? 13.285  27.357  -3.106  1.00 41.24 ? 80   GLU D OE1   1 
ATOM   6283 O  OE2   . GLU D 2 41  ? 13.996  25.285  -3.046  1.00 43.56 ? 80   GLU D OE2   1 
ATOM   6284 N  N     . GLU D 2 42  ? 10.024  27.047  -0.152  1.00 33.58 ? 81   GLU D N     1 
ATOM   6285 C  CA    . GLU D 2 42  ? 9.503   26.545  1.121   1.00 33.18 ? 81   GLU D CA    1 
ATOM   6286 C  C     . GLU D 2 42  ? 8.123   27.090  1.429   1.00 32.85 ? 81   GLU D C     1 
ATOM   6287 O  O     . GLU D 2 42  ? 7.371   26.428  2.111   1.00 33.76 ? 81   GLU D O     1 
ATOM   6288 C  CB    . GLU D 2 42  ? 10.431  26.807  2.317   1.00 33.39 ? 81   GLU D CB    1 
ATOM   6289 C  CG    . GLU D 2 42  ? 10.403  28.233  2.881   1.00 34.09 ? 81   GLU D CG    1 
ATOM   6290 C  CD    . GLU D 2 42  ? 11.260  29.222  2.101   1.00 35.89 ? 81   GLU D CD    1 
ATOM   6291 O  OE1   . GLU D 2 42  ? 11.876  28.851  1.077   1.00 37.05 ? 81   GLU D OE1   1 
ATOM   6292 O  OE2   . GLU D 2 42  ? 11.322  30.392  2.540   1.00 40.26 ? 81   GLU D OE2   1 
ATOM   6293 N  N     . ASN D 2 43  ? 7.801   28.289  0.958   1.00 32.75 ? 82   ASN D N     1 
ATOM   6294 C  CA    . ASN D 2 43  ? 6.499   28.861  1.201   1.00 33.10 ? 82   ASN D CA    1 
ATOM   6295 C  C     . ASN D 2 43  ? 5.397   28.041  0.559   1.00 33.55 ? 82   ASN D C     1 
ATOM   6296 O  O     . ASN D 2 43  ? 4.349   27.765  1.193   1.00 34.12 ? 82   ASN D O     1 
ATOM   6297 C  CB    . ASN D 2 43  ? 6.456   30.300  0.709   1.00 33.30 ? 82   ASN D CB    1 
ATOM   6298 C  CG    . ASN D 2 43  ? 7.286   31.213  1.562   1.00 34.87 ? 82   ASN D CG    1 
ATOM   6299 O  OD1   . ASN D 2 43  ? 7.334   31.062  2.791   1.00 38.52 ? 82   ASN D OD1   1 
ATOM   6300 N  ND2   . ASN D 2 43  ? 7.965   32.152  0.922   1.00 32.80 ? 82   ASN D ND2   1 
ATOM   6301 N  N     . LEU D 2 44  ? 5.615   27.637  -0.685  1.00 32.58 ? 83   LEU D N     1 
ATOM   6302 C  CA    . LEU D 2 44  ? 4.657   26.796  -1.367  1.00 32.94 ? 83   LEU D CA    1 
ATOM   6303 C  C     . LEU D 2 44  ? 4.586   25.379  -0.778  1.00 32.63 ? 83   LEU D C     1 
ATOM   6304 O  O     . LEU D 2 44  ? 3.485   24.806  -0.683  1.00 32.38 ? 83   LEU D O     1 
ATOM   6305 C  CB    . LEU D 2 44  ? 4.977   26.714  -2.852  1.00 32.92 ? 83   LEU D CB    1 
ATOM   6306 C  CG    . LEU D 2 44  ? 3.995   25.950  -3.740  1.00 31.93 ? 83   LEU D CG    1 
ATOM   6307 C  CD1   . LEU D 2 44  ? 2.628   26.605  -3.670  1.00 31.05 ? 83   LEU D CD1   1 
ATOM   6308 C  CD2   . LEU D 2 44  ? 4.559   25.936  -5.168  1.00 32.49 ? 83   LEU D CD2   1 
ATOM   6309 N  N     . GLU D 2 45  ? 5.750   24.796  -0.445  1.00 31.89 ? 84   GLU D N     1 
ATOM   6310 C  CA    A GLU D 2 45  ? 5.807   23.449  0.100   0.50 32.37 ? 84   GLU D CA    1 
ATOM   6311 C  CA    B GLU D 2 45  ? 5.747   23.438  0.059   0.50 32.78 ? 84   GLU D CA    1 
ATOM   6312 C  C     . GLU D 2 45  ? 4.983   23.409  1.387   1.00 32.44 ? 84   GLU D C     1 
ATOM   6313 O  O     . GLU D 2 45  ? 4.191   22.522  1.609   1.00 30.97 ? 84   GLU D O     1 
ATOM   6314 C  CB    A GLU D 2 45  ? 7.254   23.048  0.396   0.50 32.49 ? 84   GLU D CB    1 
ATOM   6315 C  CB    B GLU D 2 45  ? 7.164   22.844  0.159   0.50 33.15 ? 84   GLU D CB    1 
ATOM   6316 C  CG    A GLU D 2 45  ? 8.151   22.894  -0.827  0.50 32.19 ? 84   GLU D CG    1 
ATOM   6317 C  CG    B GLU D 2 45  ? 7.806   22.521  -1.198  0.50 34.91 ? 84   GLU D CG    1 
ATOM   6318 C  CD    A GLU D 2 45  ? 9.630   22.946  -0.480  0.50 34.00 ? 84   GLU D CD    1 
ATOM   6319 C  CD    B GLU D 2 45  ? 6.828   21.901  -2.225  0.50 37.41 ? 84   GLU D CD    1 
ATOM   6320 O  OE1   A GLU D 2 45  ? 9.957   23.029  0.710   0.50 35.50 ? 84   GLU D OE1   1 
ATOM   6321 O  OE1   B GLU D 2 45  ? 6.261   20.805  -1.977  0.50 39.18 ? 84   GLU D OE1   1 
ATOM   6322 O  OE2   A GLU D 2 45  ? 10.478  22.908  -1.380  0.50 34.94 ? 84   GLU D OE2   1 
ATOM   6323 O  OE2   B GLU D 2 45  ? 6.635   22.523  -3.294  0.50 40.19 ? 84   GLU D OE2   1 
ATOM   6324 N  N     . PHE D 2 46  ? 5.178   24.424  2.228   1.00 32.51 ? 85   PHE D N     1 
ATOM   6325 C  CA    . PHE D 2 46  ? 4.402   24.571  3.470   1.00 32.80 ? 85   PHE D CA    1 
ATOM   6326 C  C     . PHE D 2 46  ? 2.921   24.719  3.198   1.00 33.52 ? 85   PHE D C     1 
ATOM   6327 O  O     . PHE D 2 46  ? 2.110   24.027  3.818   1.00 32.38 ? 85   PHE D O     1 
ATOM   6328 C  CB    . PHE D 2 46  ? 4.885   25.769  4.261   1.00 33.11 ? 85   PHE D CB    1 
ATOM   6329 C  CG    . PHE D 2 46  ? 4.071   26.062  5.502   1.00 33.62 ? 85   PHE D CG    1 
ATOM   6330 C  CD1   . PHE D 2 46  ? 3.968   25.113  6.520   1.00 34.29 ? 85   PHE D CD1   1 
ATOM   6331 C  CD2   . PHE D 2 46  ? 3.401   27.265  5.646   1.00 33.79 ? 85   PHE D CD2   1 
ATOM   6332 C  CE1   . PHE D 2 46  ? 3.232   25.371  7.666   1.00 32.20 ? 85   PHE D CE1   1 
ATOM   6333 C  CE2   . PHE D 2 46  ? 2.650   27.545  6.802   1.00 33.99 ? 85   PHE D CE2   1 
ATOM   6334 C  CZ    . PHE D 2 46  ? 2.581   26.594  7.817   1.00 31.84 ? 85   PHE D CZ    1 
ATOM   6335 N  N     . TRP D 2 47  ? 2.573   25.637  2.300   1.00 33.98 ? 86   TRP D N     1 
ATOM   6336 C  CA    . TRP D 2 47  ? 1.159   25.873  1.949   1.00 34.21 ? 86   TRP D CA    1 
ATOM   6337 C  C     . TRP D 2 47  ? 0.461   24.578  1.430   1.00 34.13 ? 86   TRP D C     1 
ATOM   6338 O  O     . TRP D 2 47  ? -0.649  24.221  1.854   1.00 34.64 ? 86   TRP D O     1 
ATOM   6339 C  CB    . TRP D 2 47  ? 1.070   26.984  0.914   1.00 34.07 ? 86   TRP D CB    1 
ATOM   6340 C  CG    . TRP D 2 47  ? -0.359  27.426  0.673   1.00 35.39 ? 86   TRP D CG    1 
ATOM   6341 C  CD1   . TRP D 2 47  ? -1.036  28.387  1.350   1.00 35.36 ? 86   TRP D CD1   1 
ATOM   6342 C  CD2   . TRP D 2 47  ? -1.263  26.905  -0.304  1.00 35.21 ? 86   TRP D CD2   1 
ATOM   6343 N  NE1   . TRP D 2 47  ? -2.302  28.509  0.857   1.00 34.76 ? 86   TRP D NE1   1 
ATOM   6344 C  CE2   . TRP D 2 47  ? -2.485  27.593  -0.140  1.00 35.65 ? 86   TRP D CE2   1 
ATOM   6345 C  CE3   . TRP D 2 47  ? -1.169  25.909  -1.285  1.00 34.69 ? 86   TRP D CE3   1 
ATOM   6346 C  CZ2   . TRP D 2 47  ? -3.584  27.363  -0.944  1.00 34.71 ? 86   TRP D CZ2   1 
ATOM   6347 C  CZ3   . TRP D 2 47  ? -2.298  25.647  -2.082  1.00 35.55 ? 86   TRP D CZ3   1 
ATOM   6348 C  CH2   . TRP D 2 47  ? -3.488  26.376  -1.898  1.00 35.45 ? 86   TRP D CH2   1 
ATOM   6349 N  N     . LEU D 2 48  ? 1.138   23.853  0.542   1.00 33.80 ? 87   LEU D N     1 
ATOM   6350 C  CA    . LEU D 2 48  ? 0.647   22.557  0.060   1.00 33.36 ? 87   LEU D CA    1 
ATOM   6351 C  C     . LEU D 2 48  ? 0.563   21.470  1.139   1.00 33.16 ? 87   LEU D C     1 
ATOM   6352 O  O     . LEU D 2 48  ? -0.397  20.672  1.151   1.00 31.41 ? 87   LEU D O     1 
ATOM   6353 C  CB    . LEU D 2 48  ? 1.494   22.035  -1.108  1.00 33.54 ? 87   LEU D CB    1 
ATOM   6354 C  CG    . LEU D 2 48  ? 1.454   22.859  -2.399  1.00 33.00 ? 87   LEU D CG    1 
ATOM   6355 C  CD1   . LEU D 2 48  ? 2.615   22.445  -3.283  1.00 36.27 ? 87   LEU D CD1   1 
ATOM   6356 C  CD2   . LEU D 2 48  ? 0.099   22.750  -3.145  1.00 36.09 ? 87   LEU D CD2   1 
ATOM   6357 N  N     . ALA D 2 49  ? 1.551   21.416  2.028   1.00 32.67 ? 88   ALA D N     1 
ATOM   6358 C  CA    . ALA D 2 49  ? 1.490   20.498  3.147   1.00 32.89 ? 88   ALA D CA    1 
ATOM   6359 C  C     . ALA D 2 49  ? 0.271   20.795  4.031   1.00 33.56 ? 88   ALA D C     1 
ATOM   6360 O  O     . ALA D 2 49  ? -0.358  19.876  4.539   1.00 32.87 ? 88   ALA D O     1 
ATOM   6361 C  CB    . ALA D 2 49  ? 2.775   20.547  3.969   1.00 32.32 ? 88   ALA D CB    1 
ATOM   6362 N  N     . CYS D 2 50  ? -0.037  22.076  4.235   1.00 33.67 ? 89   CYS D N     1 
ATOM   6363 C  CA    . CYS D 2 50  ? -1.237  22.456  5.021   1.00 34.32 ? 89   CYS D CA    1 
ATOM   6364 C  C     . CYS D 2 50  ? -2.542  22.052  4.362   1.00 34.42 ? 89   CYS D C     1 
ATOM   6365 O  O     . CYS D 2 50  ? -3.486  21.621  5.049   1.00 33.29 ? 89   CYS D O     1 
ATOM   6366 C  CB    . CYS D 2 50  ? -1.237  23.964  5.355   1.00 34.95 ? 89   CYS D CB    1 
ATOM   6367 S  SG    . CYS D 2 50  ? 0.101   24.531  6.482   1.00 35.56 ? 89   CYS D SG    1 
ATOM   6368 N  N     . GLU D 2 51  ? -2.620  22.195  3.035   1.00 33.92 ? 90   GLU D N     1 
ATOM   6369 C  CA    . GLU D 2 51  ? -3.783  21.730  2.299   1.00 34.59 ? 90   GLU D CA    1 
ATOM   6370 C  C     . GLU D 2 51  ? -3.973  20.248  2.429   1.00 33.63 ? 90   GLU D C     1 
ATOM   6371 O  O     . GLU D 2 51  ? -5.082  19.809  2.595   1.00 33.64 ? 90   GLU D O     1 
ATOM   6372 C  CB    . GLU D 2 51  ? -3.706  22.096  0.801   1.00 34.24 ? 90   GLU D CB    1 
ATOM   6373 C  CG    . GLU D 2 51  ? -3.773  23.587  0.583   1.00 36.62 ? 90   GLU D CG    1 
ATOM   6374 C  CD    . GLU D 2 51  ? -5.114  24.131  0.971   1.00 37.57 ? 90   GLU D CD    1 
ATOM   6375 O  OE1   . GLU D 2 51  ? -6.051  23.901  0.227   1.00 38.69 ? 90   GLU D OE1   1 
ATOM   6376 O  OE2   . GLU D 2 51  ? -5.239  24.757  2.033   1.00 39.22 ? 90   GLU D OE2   1 
ATOM   6377 N  N     . GLU D 2 52  ? -2.892  19.476  2.334   1.00 33.83 ? 91   GLU D N     1 
ATOM   6378 C  CA    . GLU D 2 52  ? -2.979  18.022  2.494   1.00 35.04 ? 91   GLU D CA    1 
ATOM   6379 C  C     . GLU D 2 52  ? -3.355  17.637  3.952   1.00 34.62 ? 91   GLU D C     1 
ATOM   6380 O  O     . GLU D 2 52  ? -4.191  16.762  4.161   1.00 34.58 ? 91   GLU D O     1 
ATOM   6381 C  CB    . GLU D 2 52  ? -1.669  17.356  2.067   1.00 36.20 ? 91   GLU D CB    1 
ATOM   6382 C  CG    . GLU D 2 52  ? -1.761  15.867  1.794   1.00 38.82 ? 91   GLU D CG    1 
ATOM   6383 C  CD    . GLU D 2 52  ? -1.741  14.969  3.051   1.00 42.89 ? 91   GLU D CD    1 
ATOM   6384 O  OE1   . GLU D 2 52  ? -1.305  15.417  4.148   1.00 41.40 ? 91   GLU D OE1   1 
ATOM   6385 O  OE2   . GLU D 2 52  ? -2.184  13.793  2.924   1.00 43.54 ? 91   GLU D OE2   1 
ATOM   6386 N  N     . PHE D 2 53  ? -2.754  18.305  4.926   1.00 34.29 ? 92   PHE D N     1 
ATOM   6387 C  CA    . PHE D 2 53  ? -3.061  18.091  6.352   1.00 34.52 ? 92   PHE D CA    1 
ATOM   6388 C  C     . PHE D 2 53  ? -4.559  18.190  6.653   1.00 35.06 ? 92   PHE D C     1 
ATOM   6389 O  O     . PHE D 2 53  ? -5.133  17.352  7.366   1.00 34.01 ? 92   PHE D O     1 
ATOM   6390 C  CB    . PHE D 2 53  ? -2.305  19.123  7.196   1.00 33.87 ? 92   PHE D CB    1 
ATOM   6391 C  CG    . PHE D 2 53  ? -2.656  19.111  8.658   1.00 33.45 ? 92   PHE D CG    1 
ATOM   6392 C  CD1   . PHE D 2 53  ? -2.156  18.110  9.508   1.00 34.21 ? 92   PHE D CD1   1 
ATOM   6393 C  CD2   . PHE D 2 53  ? -3.445  20.114  9.193   1.00 29.85 ? 92   PHE D CD2   1 
ATOM   6394 C  CE1   . PHE D 2 53  ? -2.464  18.113  10.892  1.00 33.28 ? 92   PHE D CE1   1 
ATOM   6395 C  CE2   . PHE D 2 53  ? -3.763  20.124  10.555  1.00 31.76 ? 92   PHE D CE2   1 
ATOM   6396 C  CZ    . PHE D 2 53  ? -3.266  19.122  11.403  1.00 32.87 ? 92   PHE D CZ    1 
ATOM   6397 N  N     . LYS D 2 54  ? -5.180  19.218  6.089   1.00 35.59 ? 93   LYS D N     1 
ATOM   6398 C  CA    . LYS D 2 54  ? -6.614  19.457  6.260   1.00 37.53 ? 93   LYS D CA    1 
ATOM   6399 C  C     . LYS D 2 54  ? -7.511  18.347  5.708   1.00 36.60 ? 93   LYS D C     1 
ATOM   6400 O  O     . LYS D 2 54  ? -8.692  18.286  6.051   1.00 37.58 ? 93   LYS D O     1 
ATOM   6401 C  CB    . LYS D 2 54  ? -6.993  20.828  5.665   1.00 37.92 ? 93   LYS D CB    1 
ATOM   6402 C  CG    . LYS D 2 54  ? -6.580  21.975  6.572   1.00 40.09 ? 93   LYS D CG    1 
ATOM   6403 C  CD    . LYS D 2 54  ? -7.032  23.357  6.050   1.00 41.20 ? 93   LYS D CD    1 
ATOM   6404 C  CE    . LYS D 2 54  ? -6.022  24.028  5.125   1.00 40.83 ? 93   LYS D CE    1 
ATOM   6405 N  NZ    . LYS D 2 54  ? -6.549  25.356  4.600   1.00 40.60 ? 93   LYS D NZ    1 
ATOM   6406 N  N     . LYS D 2 55  ? -6.950  17.463  4.883   1.00 35.69 ? 94   LYS D N     1 
ATOM   6407 C  CA    . LYS D 2 55  ? -7.657  16.304  4.366   1.00 35.67 ? 94   LYS D CA    1 
ATOM   6408 C  C     . LYS D 2 55  ? -7.593  15.061  5.253   1.00 34.41 ? 94   LYS D C     1 
ATOM   6409 O  O     . LYS D 2 55  ? -8.244  14.070  4.969   1.00 33.10 ? 94   LYS D O     1 
ATOM   6410 C  CB    . LYS D 2 55  ? -7.088  15.940  2.990   1.00 36.32 ? 94   LYS D CB    1 
ATOM   6411 C  CG    . LYS D 2 55  ? -7.338  16.990  1.932   1.00 39.30 ? 94   LYS D CG    1 
ATOM   6412 C  CD    . LYS D 2 55  ? -6.491  16.720  0.684   1.00 43.04 ? 94   LYS D CD    1 
ATOM   6413 C  CE    . LYS D 2 55  ? -7.002  17.473  -0.552  1.00 44.55 ? 94   LYS D CE    1 
ATOM   6414 N  NZ    . LYS D 2 55  ? -6.638  18.910  -0.598  1.00 45.99 ? 94   LYS D NZ    1 
ATOM   6415 N  N     . THR D 2 56  ? -6.821  15.115  6.324   1.00 33.43 ? 95   THR D N     1 
ATOM   6416 C  CA    . THR D 2 56  ? -6.564  13.948  7.161   1.00 33.63 ? 95   THR D CA    1 
ATOM   6417 C  C     . THR D 2 56  ? -7.811  13.609  7.952   1.00 33.71 ? 95   THR D C     1 
ATOM   6418 O  O     . THR D 2 56  ? -8.512  14.502  8.424   1.00 33.21 ? 95   THR D O     1 
ATOM   6419 C  CB    . THR D 2 56  ? -5.398  14.212  8.139   1.00 33.35 ? 95   THR D CB    1 
ATOM   6420 O  OG1   . THR D 2 56  ? -4.317  14.844  7.436   1.00 34.22 ? 95   THR D OG1   1 
ATOM   6421 C  CG2   . THR D 2 56  ? -4.915  12.913  8.779   1.00 33.65 ? 95   THR D CG2   1 
ATOM   6422 N  N     . ARG D 2 57  ? -8.098  12.320  8.076   1.00 34.72 ? 96   ARG D N     1 
ATOM   6423 C  CA    . ARG D 2 57  ? -9.281  11.899  8.829   1.00 35.68 ? 96   ARG D CA    1 
ATOM   6424 C  C     . ARG D 2 57  ? -8.976  10.989  10.022  1.00 35.28 ? 96   ARG D C     1 
ATOM   6425 O  O     . ARG D 2 57  ? -9.899  10.545  10.696  1.00 37.85 ? 96   ARG D O     1 
ATOM   6426 C  CB    . ARG D 2 57  ? -10.287 11.239  7.905   1.00 36.44 ? 96   ARG D CB    1 
ATOM   6427 C  CG    . ARG D 2 57  ? -10.114 11.553  6.434   1.00 38.68 ? 96   ARG D CG    1 
ATOM   6428 C  CD    . ARG D 2 57  ? -9.245  10.480  5.757   1.00 42.53 ? 96   ARG D CD    1 
ATOM   6429 N  N     . SER D 2 58  ? -7.702  10.688  10.247  1.00 34.55 ? 97   SER D N     1 
ATOM   6430 C  CA    . SER D 2 58  ? -7.239  9.857   11.348  1.00 34.75 ? 97   SER D CA    1 
ATOM   6431 C  C     . SER D 2 58  ? -6.538  10.730  12.374  1.00 33.91 ? 97   SER D C     1 
ATOM   6432 O  O     . SER D 2 58  ? -5.637  11.487  12.016  1.00 34.10 ? 97   SER D O     1 
ATOM   6433 C  CB    . SER D 2 58  ? -6.280  8.771   10.827  1.00 35.02 ? 97   SER D CB    1 
ATOM   6434 O  OG    . SER D 2 58  ? -5.607  8.093   11.879  1.00 35.32 ? 97   SER D OG    1 
ATOM   6435 N  N     . THR D 2 59  ? -6.959  10.650  13.637  1.00 33.22 ? 98   THR D N     1 
ATOM   6436 C  CA    . THR D 2 59  ? -6.321  11.438  14.698  1.00 32.88 ? 98   THR D CA    1 
ATOM   6437 C  C     . THR D 2 59  ? -4.834  11.124  14.800  1.00 32.05 ? 98   THR D C     1 
ATOM   6438 O  O     . THR D 2 59  ? -4.050  12.027  14.919  1.00 31.38 ? 98   THR D O     1 
ATOM   6439 C  CB    . THR D 2 59  ? -6.936  11.181  16.080  1.00 33.33 ? 98   THR D CB    1 
ATOM   6440 O  OG1   . THR D 2 59  ? -8.338  11.441  16.037  1.00 33.99 ? 98   THR D OG1   1 
ATOM   6441 C  CG2   . THR D 2 59  ? -6.268  12.064  17.154  1.00 34.58 ? 98   THR D CG2   1 
ATOM   6442 N  N     . ALA D 2 60  ? -4.450  9.841   14.788  1.00 31.52 ? 99   ALA D N     1 
ATOM   6443 C  CA    . ALA D 2 60  ? -3.026  9.482   14.900  1.00 31.26 ? 99   ALA D CA    1 
ATOM   6444 C  C     . ALA D 2 60  ? -2.206  10.097  13.746  1.00 30.96 ? 99   ALA D C     1 
ATOM   6445 O  O     . ALA D 2 60  ? -1.117  10.620  13.968  1.00 29.86 ? 99   ALA D O     1 
ATOM   6446 C  CB    . ALA D 2 60  ? -2.839  7.969   14.962  1.00 31.44 ? 99   ALA D CB    1 
ATOM   6447 N  N     . LYS D 2 61  ? -2.740  10.040  12.523  1.00 31.00 ? 100  LYS D N     1 
ATOM   6448 C  CA    . LYS D 2 61  ? -2.070  10.615  11.358  1.00 31.49 ? 100  LYS D CA    1 
ATOM   6449 C  C     . LYS D 2 61  ? -2.076  12.132  11.434  1.00 31.03 ? 100  LYS D C     1 
ATOM   6450 O  O     . LYS D 2 61  ? -1.088  12.780  11.084  1.00 31.65 ? 100  LYS D O     1 
ATOM   6451 C  CB    . LYS D 2 61  ? -2.724  10.160  10.046  1.00 31.19 ? 100  LYS D CB    1 
ATOM   6452 C  CG    . LYS D 2 61  ? -2.496  8.690   9.738   1.00 31.72 ? 100  LYS D CG    1 
ATOM   6453 C  CD    . LYS D 2 61  ? -2.796  8.362   8.289   1.00 34.13 ? 100  LYS D CD    1 
ATOM   6454 C  CE    . LYS D 2 61  ? -2.541  6.857   8.002   1.00 34.82 ? 100  LYS D CE    1 
ATOM   6455 N  NZ    . LYS D 2 61  ? -3.663  5.950   8.422   1.00 38.60 ? 100  LYS D NZ    1 
ATOM   6456 N  N     . LEU D 2 62  ? -3.185  12.699  11.893  1.00 31.20 ? 101  LEU D N     1 
ATOM   6457 C  CA    . LEU D 2 62  ? -3.272  14.161  12.093  1.00 31.57 ? 101  LEU D CA    1 
ATOM   6458 C  C     . LEU D 2 62  ? -2.193  14.667  13.060  1.00 31.69 ? 101  LEU D C     1 
ATOM   6459 O  O     . LEU D 2 62  ? -1.455  15.589  12.740  1.00 31.28 ? 101  LEU D O     1 
ATOM   6460 C  CB    . LEU D 2 62  ? -4.676  14.542  12.585  1.00 32.15 ? 101  LEU D CB    1 
ATOM   6461 C  CG    . LEU D 2 62  ? -5.072  16.017  12.668  1.00 33.58 ? 101  LEU D CG    1 
ATOM   6462 C  CD1   . LEU D 2 62  ? -6.602  16.183  12.682  1.00 36.76 ? 101  LEU D CD1   1 
ATOM   6463 C  CD2   . LEU D 2 62  ? -4.450  16.650  13.910  1.00 37.55 ? 101  LEU D CD2   1 
ATOM   6464 N  N     . VAL D 2 63  ? -2.085  14.030  14.225  1.00 31.72 ? 102  VAL D N     1 
ATOM   6465 C  CA    . VAL D 2 63  ? -1.048  14.400  15.199  1.00 31.32 ? 102  VAL D CA    1 
ATOM   6466 C  C     . VAL D 2 63  ? 0.375   14.248  14.601  1.00 31.34 ? 102  VAL D C     1 
ATOM   6467 O  O     . VAL D 2 63  ? 1.224   15.160  14.711  1.00 29.78 ? 102  VAL D O     1 
ATOM   6468 C  CB    . VAL D 2 63  ? -1.250  13.659  16.545  1.00 31.84 ? 102  VAL D CB    1 
ATOM   6469 C  CG1   . VAL D 2 63  ? -0.086  13.970  17.530  1.00 32.10 ? 102  VAL D CG1   1 
ATOM   6470 C  CG2   . VAL D 2 63  ? -2.625  14.042  17.161  1.00 30.90 ? 102  VAL D CG2   1 
ATOM   6471 N  N     . SER D 2 64  ? 0.609   13.138  13.917  1.00 32.09 ? 103  SER D N     1 
ATOM   6472 C  CA    . SER D 2 64  ? 1.904   12.851  13.305  1.00 32.16 ? 103  SER D CA    1 
ATOM   6473 C  C     . SER D 2 64  ? 2.277   13.919  12.283  1.00 32.45 ? 103  SER D C     1 
ATOM   6474 O  O     . SER D 2 64  ? 3.353   14.534  12.361  1.00 31.24 ? 103  SER D O     1 
ATOM   6475 C  CB    . SER D 2 64  ? 1.876   11.459  12.652  1.00 32.36 ? 103  SER D CB    1 
ATOM   6476 O  OG    . SER D 2 64  ? 3.112   11.136  12.025  1.00 31.62 ? 103  SER D OG    1 
ATOM   6477 N  N     . LYS D 2 65  ? 1.370   14.123  11.327  1.00 32.24 ? 104  LYS D N     1 
ATOM   6478 C  CA    . LYS D 2 65  ? 1.522   15.148  10.300  1.00 32.78 ? 104  LYS D CA    1 
ATOM   6479 C  C     . LYS D 2 65  ? 1.747   16.555  10.862  1.00 31.77 ? 104  LYS D C     1 
ATOM   6480 O  O     . LYS D 2 65  ? 2.622   17.261  10.390  1.00 31.44 ? 104  LYS D O     1 
ATOM   6481 C  CB    . LYS D 2 65  ? 0.287   15.177  9.402   1.00 32.76 ? 104  LYS D CB    1 
ATOM   6482 C  CG    . LYS D 2 65  ? 0.133   13.999  8.495   1.00 35.27 ? 104  LYS D CG    1 
ATOM   6483 C  CD    . LYS D 2 65  ? -1.069  14.286  7.567   1.00 39.48 ? 104  LYS D CD    1 
ATOM   6484 C  CE    . LYS D 2 65  ? -1.400  13.169  6.632   1.00 40.41 ? 104  LYS D CE    1 
ATOM   6485 N  NZ    . LYS D 2 65  ? -2.568  13.541  5.773   1.00 41.10 ? 104  LYS D NZ    1 
ATOM   6486 N  N     . ALA D 2 66  ? 0.979   16.942  11.879  1.00 31.65 ? 105  ALA D N     1 
ATOM   6487 C  CA    . ALA D 2 66  ? 1.109   18.264  12.461  1.00 31.74 ? 105  ALA D CA    1 
ATOM   6488 C  C     . ALA D 2 66  ? 2.526   18.444  13.038  1.00 32.34 ? 105  ALA D C     1 
ATOM   6489 O  O     . ALA D 2 66  ? 3.186   19.471  12.832  1.00 30.90 ? 105  ALA D O     1 
ATOM   6490 C  CB    . ALA D 2 66  ? 0.030   18.508  13.528  1.00 31.74 ? 105  ALA D CB    1 
ATOM   6491 N  N     . HIS D 2 67  ? 3.024   17.426  13.711  1.00 33.26 ? 106  HIS D N     1 
ATOM   6492 C  CA    . HIS D 2 67  ? 4.372   17.465  14.228  1.00 34.15 ? 106  HIS D CA    1 
ATOM   6493 C  C     . HIS D 2 67  ? 5.444   17.508  13.172  1.00 33.53 ? 106  HIS D C     1 
ATOM   6494 O  O     . HIS D 2 67  ? 6.397   18.186  13.294  1.00 33.42 ? 106  HIS D O     1 
ATOM   6495 C  CB    . HIS D 2 67  ? 4.607   16.377  15.272  1.00 34.43 ? 106  HIS D CB    1 
ATOM   6496 C  CG    . HIS D 2 67  ? 4.003   16.713  16.584  1.00 36.95 ? 106  HIS D CG    1 
ATOM   6497 N  ND1   . HIS D 2 67  ? 2.777   16.250  16.981  1.00 40.19 ? 106  HIS D ND1   1 
ATOM   6498 C  CD2   . HIS D 2 67  ? 4.424   17.535  17.562  1.00 38.11 ? 106  HIS D CD2   1 
ATOM   6499 C  CE1   . HIS D 2 67  ? 2.469   16.761  18.150  1.00 40.21 ? 106  HIS D CE1   1 
ATOM   6500 N  NE2   . HIS D 2 67  ? 3.450   17.549  18.519  1.00 39.24 ? 106  HIS D NE2   1 
ATOM   6501 N  N     . ARG D 2 68  ? 5.237   16.787  12.106  1.00 34.12 ? 107  ARG D N     1 
ATOM   6502 C  CA    . ARG D 2 68  ? 6.193   16.769  10.994  1.00 34.60 ? 107  ARG D CA    1 
ATOM   6503 C  C     . ARG D 2 68  ? 6.255   18.123  10.305  1.00 33.46 ? 107  ARG D C     1 
ATOM   6504 O  O     . ARG D 2 68  ? 7.353   18.618  9.979   1.00 33.89 ? 107  ARG D O     1 
ATOM   6505 C  CB    . ARG D 2 68  ? 5.811   15.665  9.991   1.00 34.60 ? 107  ARG D CB    1 
ATOM   6506 C  CG    . ARG D 2 68  ? 6.034   14.280  10.569  1.00 37.72 ? 107  ARG D CG    1 
ATOM   6507 C  CD    . ARG D 2 68  ? 5.687   13.126  9.623   1.00 37.58 ? 107  ARG D CD    1 
ATOM   6508 N  NE    . ARG D 2 68  ? 6.876   12.384  9.173   1.00 42.76 ? 107  ARG D NE    1 
ATOM   6509 N  N     . ILE D 2 69  ? 5.073   18.714  10.083  1.00 32.11 ? 108  ILE D N     1 
ATOM   6510 C  CA    . ILE D 2 69  ? 4.962   20.033  9.453   1.00 32.03 ? 108  ILE D CA    1 
ATOM   6511 C  C     . ILE D 2 69  ? 5.617   21.088  10.335  1.00 31.34 ? 108  ILE D C     1 
ATOM   6512 O  O     . ILE D 2 69  ? 6.298   21.964  9.845   1.00 31.81 ? 108  ILE D O     1 
ATOM   6513 C  CB    . ILE D 2 69  ? 3.466   20.421  9.168   1.00 31.49 ? 108  ILE D CB    1 
ATOM   6514 C  CG1   . ILE D 2 69  ? 2.886   19.514  8.063   1.00 33.26 ? 108  ILE D CG1   1 
ATOM   6515 C  CG2   . ILE D 2 69  ? 3.323   21.953  8.828   1.00 33.32 ? 108  ILE D CG2   1 
ATOM   6516 C  CD1   . ILE D 2 69  ? 1.354   19.571  7.909   1.00 31.47 ? 108  ILE D CD1   1 
ATOM   6517 N  N     . PHE D 2 70  ? 5.416   21.005  11.642  1.00 31.77 ? 109  PHE D N     1 
ATOM   6518 C  CA    . PHE D 2 70  ? 5.979   22.004  12.546  1.00 30.98 ? 109  PHE D CA    1 
ATOM   6519 C  C     . PHE D 2 70  ? 7.494   21.898  12.578  1.00 31.58 ? 109  PHE D C     1 
ATOM   6520 O  O     . PHE D 2 70  ? 8.204   22.911  12.431  1.00 32.72 ? 109  PHE D O     1 
ATOM   6521 C  CB    . PHE D 2 70  ? 5.412   21.835  13.952  1.00 31.88 ? 109  PHE D CB    1 
ATOM   6522 C  CG    . PHE D 2 70  ? 5.703   23.006  14.846  1.00 31.96 ? 109  PHE D CG    1 
ATOM   6523 C  CD1   . PHE D 2 70  ? 4.778   24.056  14.967  1.00 32.58 ? 109  PHE D CD1   1 
ATOM   6524 C  CD2   . PHE D 2 70  ? 6.909   23.079  15.543  1.00 31.15 ? 109  PHE D CD2   1 
ATOM   6525 C  CE1   . PHE D 2 70  ? 5.070   25.145  15.779  1.00 33.27 ? 109  PHE D CE1   1 
ATOM   6526 C  CE2   . PHE D 2 70  ? 7.184   24.165  16.337  1.00 33.14 ? 109  PHE D CE2   1 
ATOM   6527 C  CZ    . PHE D 2 70  ? 6.257   25.202  16.443  1.00 31.57 ? 109  PHE D CZ    1 
ATOM   6528 N  N     . GLU D 2 71  ? 7.984   20.688  12.767  1.00 31.21 ? 110  GLU D N     1 
ATOM   6529 C  CA    . GLU D 2 71  ? 9.419   20.410  12.747  1.00 32.35 ? 110  GLU D CA    1 
ATOM   6530 C  C     . GLU D 2 71  ? 10.062  20.867  11.403  1.00 31.91 ? 110  GLU D C     1 
ATOM   6531 O  O     . GLU D 2 71  ? 11.161  21.387  11.395  1.00 31.85 ? 110  GLU D O     1 
ATOM   6532 C  CB    . GLU D 2 71  ? 9.745   18.931  13.018  1.00 31.92 ? 110  GLU D CB    1 
ATOM   6533 C  CG    . GLU D 2 71  ? 9.354   18.331  14.437  1.00 32.34 ? 110  GLU D CG    1 
ATOM   6534 C  CD    . GLU D 2 71  ? 9.856   16.917  14.674  1.00 33.52 ? 110  GLU D CD    1 
ATOM   6535 O  OE1   . GLU D 2 71  ? 10.650  16.427  13.805  1.00 32.07 ? 110  GLU D OE1   1 
ATOM   6536 O  OE2   . GLU D 2 71  ? 9.517   16.295  15.762  1.00 29.64 ? 110  GLU D OE2   1 
ATOM   6537 N  N     . GLU D 2 72  ? 9.391   20.657  10.276  1.00 32.80 ? 111  GLU D N     1 
ATOM   6538 C  CA    . GLU D 2 72  ? 10.000  20.917  8.949   1.00 32.78 ? 111  GLU D CA    1 
ATOM   6539 C  C     . GLU D 2 72  ? 9.967   22.373  8.504   1.00 33.14 ? 111  GLU D C     1 
ATOM   6540 O  O     . GLU D 2 72  ? 10.894  22.846  7.820   1.00 33.25 ? 111  GLU D O     1 
ATOM   6541 C  CB    . GLU D 2 72  ? 9.319   20.056  7.869   1.00 34.19 ? 111  GLU D CB    1 
ATOM   6542 C  CG    . GLU D 2 72  ? 9.952   20.187  6.486   1.00 37.20 ? 111  GLU D CG    1 
ATOM   6543 C  CD    . GLU D 2 72  ? 11.383  19.617  6.402   1.00 43.45 ? 111  GLU D CD    1 
ATOM   6544 O  OE1   . GLU D 2 72  ? 11.848  18.905  7.335   1.00 45.55 ? 111  GLU D OE1   1 
ATOM   6545 O  OE2   . GLU D 2 72  ? 12.050  19.855  5.367   1.00 46.81 ? 111  GLU D OE2   1 
ATOM   6546 N  N     . PHE D 2 73  ? 8.908   23.076  8.881   1.00 32.31 ? 112  PHE D N     1 
ATOM   6547 C  CA    . PHE D 2 73  ? 8.621   24.425  8.364   1.00 32.79 ? 112  PHE D CA    1 
ATOM   6548 C  C     . PHE D 2 73  ? 8.464   25.553  9.377   1.00 32.31 ? 112  PHE D C     1 
ATOM   6549 O  O     . PHE D 2 73  ? 8.590   26.717  8.996   1.00 33.35 ? 112  PHE D O     1 
ATOM   6550 C  CB    . PHE D 2 73  ? 7.322   24.416  7.571   1.00 31.96 ? 112  PHE D CB    1 
ATOM   6551 C  CG    . PHE D 2 73  ? 7.351   23.524  6.344   1.00 32.15 ? 112  PHE D CG    1 
ATOM   6552 C  CD1   . PHE D 2 73  ? 8.111   23.864  5.243   1.00 33.37 ? 112  PHE D CD1   1 
ATOM   6553 C  CD2   . PHE D 2 73  ? 6.609   22.348  6.302   1.00 32.36 ? 112  PHE D CD2   1 
ATOM   6554 C  CE1   . PHE D 2 73  ? 8.171   23.041  4.120   1.00 33.64 ? 112  PHE D CE1   1 
ATOM   6555 C  CE2   . PHE D 2 73  ? 6.608   21.544  5.180   1.00 34.59 ? 112  PHE D CE2   1 
ATOM   6556 C  CZ    . PHE D 2 73  ? 7.375   21.893  4.073   1.00 33.47 ? 112  PHE D CZ    1 
ATOM   6557 N  N     . VAL D 2 74  ? 8.055   25.246  10.605  1.00 32.83 ? 113  VAL D N     1 
ATOM   6558 C  CA    . VAL D 2 74  ? 7.566   26.292  11.520  1.00 33.48 ? 113  VAL D CA    1 
ATOM   6559 C  C     . VAL D 2 74  ? 8.538   26.590  12.673  1.00 33.50 ? 113  VAL D C     1 
ATOM   6560 O  O     . VAL D 2 74  ? 8.719   27.763  13.036  1.00 33.48 ? 113  VAL D O     1 
ATOM   6561 C  CB    . VAL D 2 74  ? 6.164   25.976  12.067  1.00 34.24 ? 113  VAL D CB    1 
ATOM   6562 C  CG1   . VAL D 2 74  ? 5.617   27.161  12.973  1.00 32.44 ? 113  VAL D CG1   1 
ATOM   6563 C  CG2   . VAL D 2 74  ? 5.213   25.687  10.913  1.00 33.79 ? 113  VAL D CG2   1 
ATOM   6564 N  N     . ASP D 2 75  ? 9.138   25.556  13.247  1.00 34.14 ? 114  ASP D N     1 
ATOM   6565 C  CA    . ASP D 2 75  ? 10.074  25.701  14.376  1.00 35.13 ? 114  ASP D CA    1 
ATOM   6566 C  C     . ASP D 2 75  ? 11.246  26.583  13.901  1.00 35.52 ? 114  ASP D C     1 
ATOM   6567 O  O     . ASP D 2 75  ? 11.600  26.580  12.720  1.00 34.22 ? 114  ASP D O     1 
ATOM   6568 C  CB    . ASP D 2 75  ? 10.544  24.300  14.850  1.00 34.91 ? 114  ASP D CB    1 
ATOM   6569 C  CG    . ASP D 2 75  ? 11.295  24.315  16.193  1.00 37.60 ? 114  ASP D CG    1 
ATOM   6570 O  OD1   . ASP D 2 75  ? 12.333  24.995  16.262  1.00 43.23 ? 114  ASP D OD1   1 
ATOM   6571 O  OD2   . ASP D 2 75  ? 10.921  23.558  17.155  1.00 35.27 ? 114  ASP D OD2   1 
ATOM   6572 N  N     . VAL D 2 76  ? 11.815  27.364  14.810  1.00 36.55 ? 115  VAL D N     1 
ATOM   6573 C  CA    . VAL D 2 76  ? 12.936  28.264  14.466  1.00 37.83 ? 115  VAL D CA    1 
ATOM   6574 C  C     . VAL D 2 76  ? 14.153  27.506  13.934  1.00 38.65 ? 115  VAL D C     1 
ATOM   6575 O  O     . VAL D 2 76  ? 14.947  28.016  13.130  1.00 38.73 ? 115  VAL D O     1 
ATOM   6576 C  CB    . VAL D 2 76  ? 13.296  29.129  15.699  1.00 37.98 ? 115  VAL D CB    1 
ATOM   6577 C  CG1   . VAL D 2 76  ? 14.763  29.536  15.712  1.00 39.09 ? 115  VAL D CG1   1 
ATOM   6578 C  CG2   . VAL D 2 76  ? 12.358  30.316  15.755  1.00 38.46 ? 115  VAL D CG2   1 
ATOM   6579 N  N     . GLN D 2 77  ? 14.329  26.287  14.368  1.00 38.72 ? 116  GLN D N     1 
ATOM   6580 C  CA    . GLN D 2 77  ? 15.392  25.501  13.809  1.00 39.82 ? 116  GLN D CA    1 
ATOM   6581 C  C     . GLN D 2 77  ? 14.987  24.693  12.580  1.00 39.14 ? 116  GLN D C     1 
ATOM   6582 O  O     . GLN D 2 77  ? 15.727  23.849  12.144  1.00 39.16 ? 116  GLN D O     1 
ATOM   6583 C  CB    . GLN D 2 77  ? 15.965  24.571  14.864  1.00 40.51 ? 116  GLN D CB    1 
ATOM   6584 C  CG    . GLN D 2 77  ? 16.284  25.189  16.196  1.00 43.66 ? 116  GLN D CG    1 
ATOM   6585 C  CD    . GLN D 2 77  ? 17.345  26.274  16.145  1.00 48.62 ? 116  GLN D CD    1 
ATOM   6586 O  OE1   . GLN D 2 77  ? 17.617  26.847  15.103  1.00 50.84 ? 116  GLN D OE1   1 
ATOM   6587 N  NE2   . GLN D 2 77  ? 17.926  26.573  17.284  1.00 51.98 ? 116  GLN D NE2   1 
ATOM   6588 N  N     . ALA D 2 78  ? 13.804  24.927  12.043  1.00 37.01 ? 117  ALA D N     1 
ATOM   6589 C  CA    . ALA D 2 78  ? 13.303  24.087  10.950  1.00 36.74 ? 117  ALA D CA    1 
ATOM   6590 C  C     . ALA D 2 78  ? 14.174  24.252  9.694   1.00 36.34 ? 117  ALA D C     1 
ATOM   6591 O  O     . ALA D 2 78  ? 14.547  25.379  9.332   1.00 36.02 ? 117  ALA D O     1 
ATOM   6592 C  CB    . ALA D 2 78  ? 11.839  24.372  10.629  1.00 35.68 ? 117  ALA D CB    1 
ATOM   6593 N  N     . PRO D 2 79  ? 14.509  23.127  9.040   1.00 36.53 ? 118  PRO D N     1 
ATOM   6594 C  CA    . PRO D 2 79  ? 15.335  23.157  7.817   1.00 36.81 ? 118  PRO D CA    1 
ATOM   6595 C  C     . PRO D 2 79  ? 14.697  23.950  6.691   1.00 36.94 ? 118  PRO D C     1 
ATOM   6596 O  O     . PRO D 2 79  ? 15.402  24.597  5.914   1.00 37.24 ? 118  PRO D O     1 
ATOM   6597 C  CB    . PRO D 2 79  ? 15.439  21.678  7.430   1.00 36.99 ? 118  PRO D CB    1 
ATOM   6598 C  CG    . PRO D 2 79  ? 14.306  21.033  8.057   1.00 37.21 ? 118  PRO D CG    1 
ATOM   6599 C  CD    . PRO D 2 79  ? 14.104  21.749  9.366   1.00 36.40 ? 118  PRO D CD    1 
ATOM   6600 N  N     . ARG D 2 80  ? 13.371  23.926  6.607   1.00 36.96 ? 119  ARG D N     1 
ATOM   6601 C  CA    . ARG D 2 80  ? 12.667  24.762  5.634   1.00 37.83 ? 119  ARG D CA    1 
ATOM   6602 C  C     . ARG D 2 80  ? 11.751  25.812  6.294   1.00 37.12 ? 119  ARG D C     1 
ATOM   6603 O  O     . ARG D 2 80  ? 10.601  26.036  5.905   1.00 37.85 ? 119  ARG D O     1 
ATOM   6604 C  CB    . ARG D 2 80  ? 11.953  23.891  4.618   1.00 38.40 ? 119  ARG D CB    1 
ATOM   6605 C  CG    . ARG D 2 80  ? 12.946  23.120  3.748   1.00 40.15 ? 119  ARG D CG    1 
ATOM   6606 C  CD    . ARG D 2 80  ? 12.273  22.357  2.651   1.00 44.14 ? 119  ARG D CD    1 
ATOM   6607 N  NE    . ARG D 2 80  ? 11.454  21.246  3.168   1.00 45.90 ? 119  ARG D NE    1 
ATOM   6608 C  CZ    . ARG D 2 80  ? 10.627  20.509  2.412   1.00 47.13 ? 119  ARG D CZ    1 
ATOM   6609 N  NH1   . ARG D 2 80  ? 10.469  20.789  1.130   1.00 46.92 ? 119  ARG D NH1   1 
ATOM   6610 N  NH2   . ARG D 2 80  ? 9.923   19.511  2.942   1.00 45.87 ? 119  ARG D NH2   1 
ATOM   6611 N  N     . GLU D 2 81  ? 12.325  26.499  7.276   1.00 37.14 ? 120  GLU D N     1 
ATOM   6612 C  CA    . GLU D 2 81  ? 11.568  27.432  8.105   1.00 36.26 ? 120  GLU D CA    1 
ATOM   6613 C  C     . GLU D 2 81  ? 10.965  28.557  7.266   1.00 36.04 ? 120  GLU D C     1 
ATOM   6614 O  O     . GLU D 2 81  ? 11.678  29.204  6.479   1.00 35.29 ? 120  GLU D O     1 
ATOM   6615 C  CB    . GLU D 2 81  ? 12.468  28.035  9.155   1.00 36.46 ? 120  GLU D CB    1 
ATOM   6616 C  CG    . GLU D 2 81  ? 11.724  28.954  10.094  1.00 35.55 ? 120  GLU D CG    1 
ATOM   6617 C  CD    . GLU D 2 81  ? 12.634  29.823  10.932  1.00 37.90 ? 120  GLU D CD    1 
ATOM   6618 O  OE1   . GLU D 2 81  ? 13.874  29.850  10.697  1.00 37.15 ? 120  GLU D OE1   1 
ATOM   6619 O  OE2   . GLU D 2 81  ? 12.066  30.462  11.830  1.00 39.29 ? 120  GLU D OE2   1 
ATOM   6620 N  N     . VAL D 2 82  ? 9.655   28.746  7.418   1.00 34.08 ? 121  VAL D N     1 
ATOM   6621 C  CA    . VAL D 2 82  ? 8.931   29.800  6.722   1.00 34.31 ? 121  VAL D CA    1 
ATOM   6622 C  C     . VAL D 2 82  ? 9.056   31.134  7.484   1.00 34.03 ? 121  VAL D C     1 
ATOM   6623 O  O     . VAL D 2 82  ? 9.190   31.173  8.723   1.00 34.18 ? 121  VAL D O     1 
ATOM   6624 C  CB    . VAL D 2 82  ? 7.439   29.459  6.436   1.00 33.36 ? 121  VAL D CB    1 
ATOM   6625 C  CG1   . VAL D 2 82  ? 7.345   28.236  5.502   1.00 33.50 ? 121  VAL D CG1   1 
ATOM   6626 C  CG2   . VAL D 2 82  ? 6.639   29.231  7.743   1.00 33.17 ? 121  VAL D CG2   1 
ATOM   6627 N  N     . ASN D 2 83  ? 9.011   32.209  6.693   1.00 34.04 ? 122  ASN D N     1 
ATOM   6628 C  CA    . ASN D 2 83  ? 9.139   33.591  7.184   1.00 33.59 ? 122  ASN D CA    1 
ATOM   6629 C  C     . ASN D 2 83  ? 7.801   34.034  7.769   1.00 33.43 ? 122  ASN D C     1 
ATOM   6630 O  O     . ASN D 2 83  ? 6.954   34.574  7.073   1.00 33.33 ? 122  ASN D O     1 
ATOM   6631 C  CB    . ASN D 2 83  ? 9.527   34.503  6.027   1.00 33.05 ? 122  ASN D CB    1 
ATOM   6632 C  CG    . ASN D 2 83  ? 9.969   35.871  6.473   1.00 31.89 ? 122  ASN D CG    1 
ATOM   6633 O  OD1   . ASN D 2 83  ? 9.593   36.364  7.577   1.00 31.49 ? 122  ASN D OD1   1 
ATOM   6634 N  ND2   . ASN D 2 83  ? 10.757  36.525  5.608   1.00 30.88 ? 122  ASN D ND2   1 
ATOM   6635 N  N     . ILE D 2 84  ? 7.627   33.787  9.060   1.00 33.64 ? 123  ILE D N     1 
ATOM   6636 C  CA    . ILE D 2 84  ? 6.455   34.256  9.784   1.00 33.50 ? 123  ILE D CA    1 
ATOM   6637 C  C     . ILE D 2 84  ? 6.942   34.868  11.080  1.00 34.23 ? 123  ILE D C     1 
ATOM   6638 O  O     . ILE D 2 84  ? 8.035   34.530  11.568  1.00 33.81 ? 123  ILE D O     1 
ATOM   6639 C  CB    . ILE D 2 84  ? 5.434   33.099  10.117  1.00 34.92 ? 123  ILE D CB    1 
ATOM   6640 C  CG1   . ILE D 2 84  ? 6.105   31.957  10.906  1.00 34.01 ? 123  ILE D CG1   1 
ATOM   6641 C  CG2   . ILE D 2 84  ? 4.749   32.616  8.854   1.00 34.09 ? 123  ILE D CG2   1 
ATOM   6642 C  CD1   . ILE D 2 84  ? 5.102   30.841  11.313  1.00 35.26 ? 123  ILE D CD1   1 
ATOM   6643 N  N     . ASP D 2 85  ? 6.139   35.756  11.662  1.00 31.57 ? 124  ASP D N     1 
ATOM   6644 C  CA    . ASP D 2 85  ? 6.554   36.413  12.859  1.00 31.50 ? 124  ASP D CA    1 
ATOM   6645 C  C     . ASP D 2 85  ? 6.427   35.524  14.096  1.00 30.43 ? 124  ASP D C     1 
ATOM   6646 O  O     . ASP D 2 85  ? 5.922   34.400  14.019  1.00 30.09 ? 124  ASP D O     1 
ATOM   6647 C  CB    . ASP D 2 85  ? 5.866   37.764  13.037  1.00 30.92 ? 124  ASP D CB    1 
ATOM   6648 C  CG    . ASP D 2 85  ? 4.377   37.676  13.123  1.00 32.96 ? 124  ASP D CG    1 
ATOM   6649 O  OD1   . ASP D 2 85  ? 3.747   38.748  13.011  1.00 37.27 ? 124  ASP D OD1   1 
ATOM   6650 O  OD2   . ASP D 2 85  ? 3.822   36.612  13.387  1.00 35.56 ? 124  ASP D OD2   1 
ATOM   6651 N  N     . PHE D 2 86  ? 6.933   36.014  15.195  1.00 30.08 ? 125  PHE D N     1 
ATOM   6652 C  CA    . PHE D 2 86  ? 6.858   35.284  16.462  1.00 29.71 ? 125  PHE D CA    1 
ATOM   6653 C  C     . PHE D 2 86  ? 5.405   35.028  16.874  1.00 29.91 ? 125  PHE D C     1 
ATOM   6654 O  O     . PHE D 2 86  ? 5.041   33.897  17.256  1.00 29.26 ? 125  PHE D O     1 
ATOM   6655 C  CB    . PHE D 2 86  ? 7.575   35.998  17.584  1.00 29.46 ? 125  PHE D CB    1 
ATOM   6656 C  CG    . PHE D 2 86  ? 7.293   35.411  18.918  1.00 28.57 ? 125  PHE D CG    1 
ATOM   6657 C  CD1   . PHE D 2 86  ? 6.392   36.005  19.795  1.00 28.99 ? 125  PHE D CD1   1 
ATOM   6658 C  CD2   . PHE D 2 86  ? 7.860   34.179  19.263  1.00 31.38 ? 125  PHE D CD2   1 
ATOM   6659 C  CE1   . PHE D 2 86  ? 6.125   35.439  21.037  1.00 30.08 ? 125  PHE D CE1   1 
ATOM   6660 C  CE2   . PHE D 2 86  ? 7.577   33.577  20.474  1.00 29.59 ? 125  PHE D CE2   1 
ATOM   6661 C  CZ    . PHE D 2 86  ? 6.699   34.217  21.380  1.00 29.45 ? 125  PHE D CZ    1 
ATOM   6662 N  N     . GLN D 2 87  ? 4.574   36.053  16.769  1.00 28.88 ? 126  GLN D N     1 
ATOM   6663 C  CA    . GLN D 2 87  ? 3.173   35.891  17.156  1.00 30.08 ? 126  GLN D CA    1 
ATOM   6664 C  C     . GLN D 2 87  ? 2.482   34.741  16.422  1.00 29.89 ? 126  GLN D C     1 
ATOM   6665 O  O     . GLN D 2 87  ? 1.759   33.945  17.036  1.00 29.75 ? 126  GLN D O     1 
ATOM   6666 C  CB    . GLN D 2 87  ? 2.389   37.214  16.999  1.00 30.63 ? 126  GLN D CB    1 
ATOM   6667 C  CG    . GLN D 2 87  ? 2.640   38.298  18.042  1.00 34.31 ? 126  GLN D CG    1 
ATOM   6668 C  CD    . GLN D 2 87  ? 2.392   37.866  19.475  1.00 37.67 ? 126  GLN D CD    1 
ATOM   6669 O  OE1   . GLN D 2 87  ? 1.397   37.206  19.774  1.00 41.49 ? 126  GLN D OE1   1 
ATOM   6670 N  NE2   . GLN D 2 87  ? 3.303   38.217  20.364  1.00 33.44 ? 126  GLN D NE2   1 
ATOM   6671 N  N     . THR D 2 88  ? 2.742   34.612  15.125  1.00 28.33 ? 127  THR D N     1 
ATOM   6672 C  CA    . THR D 2 88  ? 2.204   33.555  14.336  1.00 31.11 ? 127  THR D CA    1 
ATOM   6673 C  C     . THR D 2 88  ? 2.797   32.186  14.651  1.00 31.55 ? 127  THR D C     1 
ATOM   6674 O  O     . THR D 2 88  ? 2.075   31.187  14.699  1.00 30.18 ? 127  THR D O     1 
ATOM   6675 C  CB    . THR D 2 88  ? 2.321   33.883  12.820  1.00 31.28 ? 127  THR D CB    1 
ATOM   6676 O  OG1   . THR D 2 88  ? 1.696   35.138  12.601  1.00 31.51 ? 127  THR D OG1   1 
ATOM   6677 C  CG2   . THR D 2 88  ? 1.680   32.815  11.980  1.00 30.15 ? 127  THR D CG2   1 
ATOM   6678 N  N     . ARG D 2 89  ? 4.104   32.143  14.833  1.00 30.87 ? 128  ARG D N     1 
ATOM   6679 C  CA    . ARG D 2 89  ? 4.763   30.896  15.196  1.00 31.93 ? 128  ARG D CA    1 
ATOM   6680 C  C     . ARG D 2 89  ? 4.272   30.392  16.550  1.00 30.42 ? 128  ARG D C     1 
ATOM   6681 O  O     . ARG D 2 89  ? 3.963   29.200  16.717  1.00 29.53 ? 128  ARG D O     1 
ATOM   6682 C  CB    . ARG D 2 89  ? 6.266   31.161  15.199  1.00 32.14 ? 128  ARG D CB    1 
ATOM   6683 C  CG    . ARG D 2 89  ? 7.168   29.990  15.490  1.00 37.43 ? 128  ARG D CG    1 
ATOM   6684 C  CD    . ARG D 2 89  ? 8.628   30.386  15.293  1.00 40.63 ? 128  ARG D CD    1 
ATOM   6685 N  NE    . ARG D 2 89  ? 9.262   30.753  16.559  1.00 47.27 ? 128  ARG D NE    1 
ATOM   6686 C  CZ    . ARG D 2 89  ? 9.788   31.932  16.911  1.00 48.76 ? 128  ARG D CZ    1 
ATOM   6687 N  NH1   . ARG D 2 89  ? 10.323  32.028  18.107  1.00 49.85 ? 128  ARG D NH1   1 
ATOM   6688 N  NH2   . ARG D 2 89  ? 9.836   32.991  16.113  1.00 49.48 ? 128  ARG D NH2   1 
ATOM   6689 N  N     . GLU D 2 90  ? 4.211   31.300  17.525  1.00 30.74 ? 129  GLU D N     1 
ATOM   6690 C  CA    . GLU D 2 90  ? 3.750   30.982  18.877  1.00 30.60 ? 129  GLU D CA    1 
ATOM   6691 C  C     . GLU D 2 90  ? 2.270   30.509  18.940  1.00 30.89 ? 129  GLU D C     1 
ATOM   6692 O  O     . GLU D 2 90  ? 2.012   29.535  19.628  1.00 28.36 ? 129  GLU D O     1 
ATOM   6693 C  CB    . GLU D 2 90  ? 4.041   32.156  19.826  1.00 30.84 ? 129  GLU D CB    1 
ATOM   6694 C  CG    . GLU D 2 90  ? 3.547   32.002  21.256  1.00 32.13 ? 129  GLU D CG    1 
ATOM   6695 C  CD    . GLU D 2 90  ? 4.185   30.814  21.983  1.00 35.68 ? 129  GLU D CD    1 
ATOM   6696 O  OE1   . GLU D 2 90  ? 3.630   30.418  23.016  1.00 40.20 ? 129  GLU D OE1   1 
ATOM   6697 O  OE2   . GLU D 2 90  ? 5.237   30.298  21.536  1.00 34.14 ? 129  GLU D OE2   1 
ATOM   6698 N  N     . ALA D 2 91  ? 1.332   31.157  18.210  1.00 30.02 ? 130  ALA D N     1 
ATOM   6699 C  CA    . ALA D 2 91  ? -0.053  30.635  18.087  1.00 30.66 ? 130  ALA D CA    1 
ATOM   6700 C  C     . ALA D 2 91  ? -0.036  29.194  17.541  1.00 30.78 ? 130  ALA D C     1 
ATOM   6701 O  O     . ALA D 2 91  ? -0.723  28.307  18.052  1.00 29.66 ? 130  ALA D O     1 
ATOM   6702 C  CB    . ALA D 2 91  ? -0.881  31.515  17.145  1.00 31.36 ? 130  ALA D CB    1 
ATOM   6703 N  N     . THR D 2 92  ? 0.813   28.949  16.535  1.00 30.52 ? 131  THR D N     1 
ATOM   6704 C  CA    . THR D 2 92  ? 0.879   27.635  15.917  1.00 30.70 ? 131  THR D CA    1 
ATOM   6705 C  C     . THR D 2 92  ? 1.397   26.617  16.947  1.00 31.54 ? 131  THR D C     1 
ATOM   6706 O  O     . THR D 2 92  ? 0.870   25.495  17.072  1.00 30.74 ? 131  THR D O     1 
ATOM   6707 C  CB    . THR D 2 92  ? 1.734   27.660  14.628  1.00 31.75 ? 131  THR D CB    1 
ATOM   6708 O  OG1   . THR D 2 92  ? 1.238   28.692  13.769  1.00 33.28 ? 131  THR D OG1   1 
ATOM   6709 C  CG2   . THR D 2 92  ? 1.666   26.301  13.887  1.00 30.72 ? 131  THR D CG2   1 
ATOM   6710 N  N     . ARG D 2 93  ? 2.400   27.028  17.711  1.00 30.72 ? 132  ARG D N     1 
ATOM   6711 C  CA    . ARG D 2 93  ? 3.001   26.166  18.704  1.00 31.62 ? 132  ARG D CA    1 
ATOM   6712 C  C     . ARG D 2 93  ? 1.983   25.728  19.770  1.00 31.82 ? 132  ARG D C     1 
ATOM   6713 O  O     . ARG D 2 93  ? 1.933   24.563  20.157  1.00 31.27 ? 132  ARG D O     1 
ATOM   6714 C  CB    . ARG D 2 93  ? 4.185   26.873  19.376  1.00 31.00 ? 132  ARG D CB    1 
ATOM   6715 C  CG    . ARG D 2 93  ? 4.965   25.943  20.272  1.00 31.99 ? 132  ARG D CG    1 
ATOM   6716 C  CD    . ARG D 2 93  ? 5.905   26.683  21.208  1.00 30.94 ? 132  ARG D CD    1 
ATOM   6717 N  NE    . ARG D 2 93  ? 5.208   27.441  22.227  1.00 29.26 ? 132  ARG D NE    1 
ATOM   6718 C  CZ    . ARG D 2 93  ? 4.646   26.902  23.308  1.00 32.78 ? 132  ARG D CZ    1 
ATOM   6719 N  NH1   . ARG D 2 93  ? 4.051   27.685  24.199  1.00 32.84 ? 132  ARG D NH1   1 
ATOM   6720 N  NH2   . ARG D 2 93  ? 4.667   25.584  23.511  1.00 33.96 ? 132  ARG D NH2   1 
ATOM   6721 N  N     . LYS D 2 94  ? 1.158   26.673  20.215  1.00 31.78 ? 133  LYS D N     1 
ATOM   6722 C  CA    . LYS D 2 94  ? 0.123   26.390  21.156  1.00 33.09 ? 133  LYS D CA    1 
ATOM   6723 C  C     . LYS D 2 94  ? -0.961  25.481  20.560  1.00 33.29 ? 133  LYS D C     1 
ATOM   6724 O  O     . LYS D 2 94  ? -1.487  24.609  21.251  1.00 31.24 ? 133  LYS D O     1 
ATOM   6725 C  CB    . LYS D 2 94  ? -0.458  27.690  21.706  1.00 33.14 ? 133  LYS D CB    1 
ATOM   6726 C  CG    . LYS D 2 94  ? 0.555   28.425  22.560  1.00 37.27 ? 133  LYS D CG    1 
ATOM   6727 C  CD    . LYS D 2 94  ? -0.044  29.527  23.423  1.00 41.02 ? 133  LYS D CD    1 
ATOM   6728 C  CE    . LYS D 2 94  ? -0.270  30.780  22.609  1.00 43.73 ? 133  LYS D CE    1 
ATOM   6729 N  N     . ASN D 2 95  ? -1.257  25.657  19.280  1.00 33.99 ? 134  ASN D N     1 
ATOM   6730 C  CA    . ASN D 2 95  ? -2.203  24.783  18.561  1.00 34.61 ? 134  ASN D CA    1 
ATOM   6731 C  C     . ASN D 2 95  ? -1.735  23.339  18.521  1.00 35.58 ? 134  ASN D C     1 
ATOM   6732 O  O     . ASN D 2 95  ? -2.552  22.430  18.452  1.00 36.97 ? 134  ASN D O     1 
ATOM   6733 C  CB    . ASN D 2 95  ? -2.439  25.275  17.118  1.00 34.62 ? 134  ASN D CB    1 
ATOM   6734 C  CG    . ASN D 2 95  ? -3.191  26.587  17.068  1.00 34.86 ? 134  ASN D CG    1 
ATOM   6735 O  OD1   . ASN D 2 95  ? -3.661  27.064  18.090  1.00 37.47 ? 134  ASN D OD1   1 
ATOM   6736 N  ND2   . ASN D 2 95  ? -3.254  27.208  15.898  1.00 36.49 ? 134  ASN D ND2   1 
ATOM   6737 N  N     . LEU D 2 96  ? -0.427  23.118  18.563  1.00 36.37 ? 135  LEU D N     1 
ATOM   6738 C  CA    . LEU D 2 96  ? 0.136   21.789  18.402  1.00 38.08 ? 135  LEU D CA    1 
ATOM   6739 C  C     . LEU D 2 96  ? -0.080  20.949  19.665  1.00 38.74 ? 135  LEU D C     1 
ATOM   6740 O  O     . LEU D 2 96  ? 0.046   19.731  19.635  1.00 38.69 ? 135  LEU D O     1 
ATOM   6741 C  CB    . LEU D 2 96  ? 1.615   21.905  17.995  1.00 39.06 ? 135  LEU D CB    1 
ATOM   6742 C  CG    . LEU D 2 96  ? 2.330   20.711  17.366  1.00 39.43 ? 135  LEU D CG    1 
ATOM   6743 C  CD1   . LEU D 2 96  ? 1.582   20.184  16.141  1.00 39.81 ? 135  LEU D CD1   1 
ATOM   6744 C  CD2   . LEU D 2 96  ? 3.769   21.094  17.005  1.00 39.24 ? 135  LEU D CD2   1 
ATOM   6745 N  N     . GLN D 2 97  ? -0.474  21.606  20.753  1.00 39.45 ? 136  GLN D N     1 
ATOM   6746 C  CA    . GLN D 2 97  ? -0.713  20.950  22.025  1.00 41.24 ? 136  GLN D CA    1 
ATOM   6747 C  C     . GLN D 2 97  ? -1.917  20.006  21.929  1.00 41.19 ? 136  GLN D C     1 
ATOM   6748 O  O     . GLN D 2 97  ? -1.866  18.902  22.467  1.00 42.20 ? 136  GLN D O     1 
ATOM   6749 C  CB    . GLN D 2 97  ? -0.876  22.003  23.148  1.00 41.15 ? 136  GLN D CB    1 
ATOM   6750 C  CG    . GLN D 2 97  ? 0.371   22.945  23.279  1.00 42.81 ? 136  GLN D CG    1 
ATOM   6751 C  CD    . GLN D 2 97  ? 0.209   24.100  24.290  1.00 44.00 ? 136  GLN D CD    1 
ATOM   6752 O  OE1   . GLN D 2 97  ? 1.131   24.387  25.068  1.00 46.99 ? 136  GLN D OE1   1 
ATOM   6753 N  NE2   . GLN D 2 97  ? -0.957  24.780  24.260  1.00 46.67 ? 136  GLN D NE2   1 
ATOM   6754 N  N     . GLU D 2 98  ? -2.967  20.422  21.211  1.00 40.95 ? 137  GLU D N     1 
ATOM   6755 C  CA    . GLU D 2 98  ? -4.115  19.554  20.902  1.00 40.44 ? 137  GLU D CA    1 
ATOM   6756 C  C     . GLU D 2 98  ? -4.439  19.771  19.440  1.00 39.29 ? 137  GLU D C     1 
ATOM   6757 O  O     . GLU D 2 98  ? -5.313  20.567  19.103  1.00 39.48 ? 137  GLU D O     1 
ATOM   6758 C  CB    . GLU D 2 98  ? -5.321  19.901  21.776  1.00 40.92 ? 137  GLU D CB    1 
ATOM   6759 N  N     . PRO D 2 99  ? -3.693  19.097  18.555  1.00 38.55 ? 138  PRO D N     1 
ATOM   6760 C  CA    . PRO D 2 99  ? -3.805  19.396  17.134  1.00 37.69 ? 138  PRO D CA    1 
ATOM   6761 C  C     . PRO D 2 99  ? -5.223  19.139  16.608  1.00 37.18 ? 138  PRO D C     1 
ATOM   6762 O  O     . PRO D 2 99  ? -5.839  18.127  16.956  1.00 36.77 ? 138  PRO D O     1 
ATOM   6763 C  CB    . PRO D 2 99  ? -2.789  18.442  16.483  1.00 38.23 ? 138  PRO D CB    1 
ATOM   6764 C  CG    . PRO D 2 99  ? -1.920  17.954  17.597  1.00 38.36 ? 138  PRO D CG    1 
ATOM   6765 C  CD    . PRO D 2 99  ? -2.729  18.014  18.830  1.00 38.69 ? 138  PRO D CD    1 
ATOM   6766 N  N     . SER D 2 100 ? -5.736  20.082  15.821  1.00 35.86 ? 139  SER D N     1 
ATOM   6767 C  CA    . SER D 2 100 ? -6.985  19.955  15.126  1.00 35.70 ? 139  SER D CA    1 
ATOM   6768 C  C     . SER D 2 100 ? -6.714  20.302  13.657  1.00 34.90 ? 139  SER D C     1 
ATOM   6769 O  O     . SER D 2 100 ? -5.600  20.751  13.308  1.00 34.67 ? 139  SER D O     1 
ATOM   6770 C  CB    . SER D 2 100 ? -8.012  20.936  15.708  1.00 36.09 ? 139  SER D CB    1 
ATOM   6771 O  OG    . SER D 2 100 ? -7.742  22.275  15.269  1.00 35.38 ? 139  SER D OG    1 
ATOM   6772 N  N     . LEU D 2 101 ? -7.727  20.152  12.812  1.00 33.86 ? 140  LEU D N     1 
ATOM   6773 C  CA    . LEU D 2 101 ? -7.577  20.468  11.379  1.00 34.20 ? 140  LEU D CA    1 
ATOM   6774 C  C     . LEU D 2 101 ? -7.270  21.959  11.102  1.00 34.49 ? 140  LEU D C     1 
ATOM   6775 O  O     . LEU D 2 101 ? -6.828  22.290  10.022  1.00 34.48 ? 140  LEU D O     1 
ATOM   6776 C  CB    . LEU D 2 101 ? -8.808  20.017  10.575  1.00 34.49 ? 140  LEU D CB    1 
ATOM   6777 C  CG    . LEU D 2 101 ? -9.003  18.503  10.408  1.00 32.81 ? 140  LEU D CG    1 
ATOM   6778 C  CD1   . LEU D 2 101 ? -10.326 18.222  9.757   1.00 33.73 ? 140  LEU D CD1   1 
ATOM   6779 C  CD2   . LEU D 2 101 ? -7.844  17.900  9.621   1.00 31.77 ? 140  LEU D CD2   1 
ATOM   6780 N  N     . THR D 2 102 ? -7.469  22.833  12.088  1.00 34.67 ? 141  THR D N     1 
ATOM   6781 C  CA    . THR D 2 102 ? -7.194  24.267  11.928  1.00 34.97 ? 141  THR D CA    1 
ATOM   6782 C  C     . THR D 2 102 ? -5.855  24.695  12.511  1.00 34.65 ? 141  THR D C     1 
ATOM   6783 O  O     . THR D 2 102 ? -5.548  25.883  12.554  1.00 34.68 ? 141  THR D O     1 
ATOM   6784 C  CB    . THR D 2 102 ? -8.299  25.121  12.589  1.00 35.34 ? 141  THR D CB    1 
ATOM   6785 O  OG1   . THR D 2 102 ? -8.466  24.726  13.960  1.00 37.25 ? 141  THR D OG1   1 
ATOM   6786 C  CG2   . THR D 2 102 ? -9.638  24.976  11.806  1.00 35.00 ? 141  THR D CG2   1 
ATOM   6787 N  N     . CYS D 2 103 ? -5.048  23.732  12.938  1.00 35.15 ? 142  CYS D N     1 
ATOM   6788 C  CA    . CYS D 2 103 ? -3.744  24.010  13.555  1.00 34.80 ? 142  CYS D CA    1 
ATOM   6789 C  C     . CYS D 2 103 ? -2.911  25.111  12.867  1.00 33.81 ? 142  CYS D C     1 
ATOM   6790 O  O     . CYS D 2 103 ? -2.395  26.029  13.534  1.00 33.04 ? 142  CYS D O     1 
ATOM   6791 C  CB    . CYS D 2 103 ? -2.935  22.713  13.629  1.00 35.22 ? 142  CYS D CB    1 
ATOM   6792 S  SG    . CYS D 2 103 ? -1.495  22.833  14.640  1.00 37.28 ? 142  CYS D SG    1 
ATOM   6793 N  N     . PHE D 2 104 ? -2.791  25.012  11.546  1.00 33.85 ? 143  PHE D N     1 
ATOM   6794 C  CA    . PHE D 2 104 ? -1.904  25.846  10.777  1.00 34.16 ? 143  PHE D CA    1 
ATOM   6795 C  C     . PHE D 2 104 ? -2.576  26.992  10.018  1.00 34.33 ? 143  PHE D C     1 
ATOM   6796 O  O     . PHE D 2 104 ? -1.932  27.638  9.167   1.00 32.78 ? 143  PHE D O     1 
ATOM   6797 C  CB    . PHE D 2 104 ? -1.146  24.958  9.795   1.00 33.91 ? 143  PHE D CB    1 
ATOM   6798 C  CG    . PHE D 2 104 ? -0.343  23.900  10.466  1.00 33.03 ? 143  PHE D CG    1 
ATOM   6799 C  CD1   . PHE D 2 104 ? 0.866   24.215  11.080  1.00 33.10 ? 143  PHE D CD1   1 
ATOM   6800 C  CD2   . PHE D 2 104 ? -0.793  22.608  10.511  1.00 30.96 ? 143  PHE D CD2   1 
ATOM   6801 C  CE1   . PHE D 2 104 ? 1.620   23.229  11.716  1.00 33.29 ? 143  PHE D CE1   1 
ATOM   6802 C  CE2   . PHE D 2 104 ? -0.055  21.605  11.133  1.00 32.79 ? 143  PHE D CE2   1 
ATOM   6803 C  CZ    . PHE D 2 104 ? 1.153   21.910  11.743  1.00 33.53 ? 143  PHE D CZ    1 
ATOM   6804 N  N     . ASP D 2 105 ? -3.858  27.229  10.290  1.00 34.52 ? 144  ASP D N     1 
ATOM   6805 C  CA    . ASP D 2 105 ? -4.628  28.244  9.546   1.00 34.61 ? 144  ASP D CA    1 
ATOM   6806 C  C     . ASP D 2 105 ? -3.979  29.638  9.588   1.00 34.63 ? 144  ASP D C     1 
ATOM   6807 O  O     . ASP D 2 105 ? -3.841  30.315  8.569   1.00 32.91 ? 144  ASP D O     1 
ATOM   6808 C  CB    . ASP D 2 105 ? -6.053  28.344  10.081  1.00 34.95 ? 144  ASP D CB    1 
ATOM   6809 C  CG    . ASP D 2 105 ? -6.972  27.239  9.550   1.00 35.49 ? 144  ASP D CG    1 
ATOM   6810 O  OD1   . ASP D 2 105 ? -6.507  26.302  8.860   1.00 37.12 ? 144  ASP D OD1   1 
ATOM   6811 O  OD2   . ASP D 2 105 ? -8.187  27.314  9.845   1.00 39.18 ? 144  ASP D OD2   1 
ATOM   6812 N  N     . GLN D 2 106 ? -3.594  30.059  10.782  1.00 34.54 ? 145  GLN D N     1 
ATOM   6813 C  CA    . GLN D 2 106 ? -2.934  31.346  10.944  1.00 36.26 ? 145  GLN D CA    1 
ATOM   6814 C  C     . GLN D 2 106 ? -1.605  31.461  10.162  1.00 34.18 ? 145  GLN D C     1 
ATOM   6815 O  O     . GLN D 2 106 ? -1.395  32.422  9.419   1.00 35.04 ? 145  GLN D O     1 
ATOM   6816 C  CB    . GLN D 2 106 ? -2.725  31.616  12.438  1.00 36.14 ? 145  GLN D CB    1 
ATOM   6817 C  CG    . GLN D 2 106 ? -2.399  33.033  12.774  1.00 39.82 ? 145  GLN D CG    1 
ATOM   6818 C  CD    . GLN D 2 106 ? -2.447  33.326  14.278  1.00 40.20 ? 145  GLN D CD    1 
ATOM   6819 O  OE1   . GLN D 2 106 ? -3.114  32.625  15.066  1.00 46.43 ? 145  GLN D OE1   1 
ATOM   6820 N  NE2   . GLN D 2 106 ? -1.756  34.367  14.670  1.00 44.08 ? 145  GLN D NE2   1 
ATOM   6821 N  N     . ALA D 2 107 ? -0.720  30.483  10.333  1.00 34.38 ? 146  ALA D N     1 
ATOM   6822 C  CA    . ALA D 2 107 ? 0.544   30.429  9.629   1.00 34.35 ? 146  ALA D CA    1 
ATOM   6823 C  C     . ALA D 2 107 ? 0.352   30.259  8.135   1.00 33.75 ? 146  ALA D C     1 
ATOM   6824 O  O     . ALA D 2 107 ? 1.075   30.854  7.359   1.00 33.51 ? 146  ALA D O     1 
ATOM   6825 C  CB    . ALA D 2 107 ? 1.455   29.326  10.181  1.00 34.23 ? 146  ALA D CB    1 
ATOM   6826 N  N     . GLN D 2 108 ? -0.559  29.386  7.735   1.00 34.28 ? 147  GLN D N     1 
ATOM   6827 C  CA    . GLN D 2 108 ? -0.854  29.215  6.299   1.00 34.49 ? 147  GLN D CA    1 
ATOM   6828 C  C     . GLN D 2 108 ? -1.343  30.507  5.612   1.00 33.67 ? 147  GLN D C     1 
ATOM   6829 O  O     . GLN D 2 108 ? -0.930  30.810  4.472   1.00 34.13 ? 147  GLN D O     1 
ATOM   6830 C  CB    . GLN D 2 108 ? -1.884  28.108  6.081   1.00 35.48 ? 147  GLN D CB    1 
ATOM   6831 C  CG    . GLN D 2 108 ? -2.010  27.730  4.595   1.00 35.03 ? 147  GLN D CG    1 
ATOM   6832 C  CD    . GLN D 2 108 ? -3.129  26.738  4.267   1.00 34.82 ? 147  GLN D CD    1 
ATOM   6833 O  OE1   . GLN D 2 108 ? -4.051  26.528  5.046   1.00 35.42 ? 147  GLN D OE1   1 
ATOM   6834 N  NE2   . GLN D 2 108 ? -3.064  26.163  3.058   1.00 33.34 ? 147  GLN D NE2   1 
ATOM   6835 N  N     . GLY D 2 109 ? -2.259  31.211  6.273   1.00 32.25 ? 148  GLY D N     1 
ATOM   6836 C  CA    . GLY D 2 109 ? -2.761  32.513  5.830   1.00 32.91 ? 148  GLY D CA    1 
ATOM   6837 C  C     . GLY D 2 109 ? -1.638  33.530  5.639   1.00 33.03 ? 148  GLY D C     1 
ATOM   6838 O  O     . GLY D 2 109 ? -1.568  34.238  4.605   1.00 33.09 ? 148  GLY D O     1 
ATOM   6839 N  N     . LYS D 2 110 ? -0.724  33.601  6.603   1.00 32.42 ? 149  LYS D N     1 
ATOM   6840 C  CA    . LYS D 2 110 ? 0.426   34.496  6.498   1.00 33.07 ? 149  LYS D CA    1 
ATOM   6841 C  C     . LYS D 2 110 ? 1.328   34.143  5.303   1.00 32.75 ? 149  LYS D C     1 
ATOM   6842 O  O     . LYS D 2 110 ? 1.778   35.012  4.572   1.00 32.99 ? 149  LYS D O     1 
ATOM   6843 C  CB    . LYS D 2 110 ? 1.230   34.513  7.806   1.00 34.34 ? 149  LYS D CB    1 
ATOM   6844 C  CG    . LYS D 2 110 ? 0.555   35.215  8.982   1.00 35.47 ? 149  LYS D CG    1 
ATOM   6845 C  CD    . LYS D 2 110 ? 0.462   36.695  8.727   1.00 39.99 ? 149  LYS D CD    1 
ATOM   6846 C  CE    . LYS D 2 110 ? 0.213   37.472  9.986   1.00 43.32 ? 149  LYS D CE    1 
ATOM   6847 N  NZ    . LYS D 2 110 ? 0.166   38.914  9.623   1.00 44.87 ? 149  LYS D NZ    1 
ATOM   6848 N  N     . VAL D 2 111 ? 1.593   32.865  5.110   1.00 33.25 ? 150  VAL D N     1 
ATOM   6849 C  CA    . VAL D 2 111 ? 2.500   32.427  4.058   1.00 32.66 ? 150  VAL D CA    1 
ATOM   6850 C  C     . VAL D 2 111 ? 1.812   32.580  2.677   1.00 32.87 ? 150  VAL D C     1 
ATOM   6851 O  O     . VAL D 2 111 ? 2.459   32.955  1.700   1.00 32.00 ? 150  VAL D O     1 
ATOM   6852 C  CB    . VAL D 2 111 ? 3.005   31.001  4.323   1.00 32.71 ? 150  VAL D CB    1 
ATOM   6853 C  CG1   . VAL D 2 111 ? 3.713   30.437  3.108   1.00 33.10 ? 150  VAL D CG1   1 
ATOM   6854 C  CG2   . VAL D 2 111 ? 4.011   31.020  5.540   1.00 31.03 ? 150  VAL D CG2   1 
ATOM   6855 N  N     . HIS D 2 112 ? 0.515   32.288  2.621   1.00 32.82 ? 151  HIS D N     1 
ATOM   6856 C  CA    . HIS D 2 112 ? -0.309  32.607  1.436   1.00 33.52 ? 151  HIS D CA    1 
ATOM   6857 C  C     . HIS D 2 112 ? -0.190  34.088  1.031   1.00 34.25 ? 151  HIS D C     1 
ATOM   6858 O  O     . HIS D 2 112 ? 0.093   34.414  -0.124  1.00 33.53 ? 151  HIS D O     1 
ATOM   6859 C  CB    . HIS D 2 112 ? -1.778  32.238  1.689   1.00 33.25 ? 151  HIS D CB    1 
ATOM   6860 C  CG    . HIS D 2 112 ? -2.651  32.407  0.481   1.00 35.38 ? 151  HIS D CG    1 
ATOM   6861 N  ND1   . HIS D 2 112 ? -3.326  33.574  0.216   1.00 35.95 ? 151  HIS D ND1   1 
ATOM   6862 C  CD2   . HIS D 2 112 ? -2.930  31.568  -0.541  1.00 35.90 ? 151  HIS D CD2   1 
ATOM   6863 C  CE1   . HIS D 2 112 ? -4.021  33.436  -0.899  1.00 36.12 ? 151  HIS D CE1   1 
ATOM   6864 N  NE2   . HIS D 2 112 ? -3.789  32.230  -1.381  1.00 37.94 ? 151  HIS D NE2   1 
ATOM   6865 N  N     . SER D 2 113 ? -0.381  34.980  2.007   1.00 34.30 ? 152  SER D N     1 
ATOM   6866 C  CA    . SER D 2 113 ? -0.218  36.423  1.828   1.00 34.65 ? 152  SER D CA    1 
ATOM   6867 C  C     . SER D 2 113 ? 1.174   36.847  1.339   1.00 33.09 ? 152  SER D C     1 
ATOM   6868 O  O     . SER D 2 113 ? 1.294   37.700  0.455   1.00 32.61 ? 152  SER D O     1 
ATOM   6869 C  CB    . SER D 2 113 ? -0.582  37.135  3.128   1.00 34.57 ? 152  SER D CB    1 
ATOM   6870 O  OG    . SER D 2 113 ? -0.581  38.522  2.947   1.00 39.25 ? 152  SER D OG    1 
ATOM   6871 N  N     . LEU D 2 114 ? 2.210   36.237  1.904   1.00 33.42 ? 153  LEU D N     1 
ATOM   6872 C  CA    . LEU D 2 114 ? 3.598   36.478  1.519   1.00 33.60 ? 153  LEU D CA    1 
ATOM   6873 C  C     . LEU D 2 114 ? 3.835   36.132  0.050   1.00 32.93 ? 153  LEU D C     1 
ATOM   6874 O  O     . LEU D 2 114 ? 4.370   36.932  -0.713  1.00 32.52 ? 153  LEU D O     1 
ATOM   6875 C  CB    . LEU D 2 114 ? 4.554   35.683  2.427   1.00 33.52 ? 153  LEU D CB    1 
ATOM   6876 C  CG    . LEU D 2 114 ? 6.056   35.780  2.177   1.00 35.47 ? 153  LEU D CG    1 
ATOM   6877 C  CD1   . LEU D 2 114 ? 6.470   37.240  2.312   1.00 34.14 ? 153  LEU D CD1   1 
ATOM   6878 C  CD2   . LEU D 2 114 ? 6.850   34.864  3.114   1.00 35.23 ? 153  LEU D CD2   1 
ATOM   6879 N  N     . MET D 2 115 ? 3.418   34.931  -0.335  1.00 33.81 ? 154  MET D N     1 
ATOM   6880 C  CA    . MET D 2 115 ? 3.488   34.487  -1.729  1.00 33.66 ? 154  MET D CA    1 
ATOM   6881 C  C     . MET D 2 115 ? 2.659   35.374  -2.681  1.00 33.06 ? 154  MET D C     1 
ATOM   6882 O  O     . MET D 2 115 ? 3.128   35.740  -3.749  1.00 32.06 ? 154  MET D O     1 
ATOM   6883 C  CB    . MET D 2 115 ? 3.026   33.040  -1.844  1.00 33.50 ? 154  MET D CB    1 
ATOM   6884 C  CG    . MET D 2 115 ? 3.916   31.977  -1.158  1.00 32.70 ? 154  MET D CG    1 
ATOM   6885 S  SD    . MET D 2 115 ? 3.434   30.294  -1.658  1.00 34.61 ? 154  MET D SD    1 
ATOM   6886 C  CE    . MET D 2 115 ? 1.792   30.116  -0.928  1.00 32.27 ? 154  MET D CE    1 
ATOM   6887 N  N     . GLU D 2 116 ? 1.438   35.718  -2.277  1.00 33.36 ? 155  GLU D N     1 
ATOM   6888 C  CA    . GLU D 2 116 ? 0.547   36.519  -3.106  1.00 32.82 ? 155  GLU D CA    1 
ATOM   6889 C  C     . GLU D 2 116 ? 1.060   37.931  -3.368  1.00 32.92 ? 155  GLU D C     1 
ATOM   6890 O  O     . GLU D 2 116 ? 1.011   38.425  -4.479  1.00 32.19 ? 155  GLU D O     1 
ATOM   6891 C  CB    . GLU D 2 116 ? -0.854  36.617  -2.501  1.00 33.10 ? 155  GLU D CB    1 
ATOM   6892 C  CG    . GLU D 2 116 ? -1.823  37.198  -3.537  1.00 34.56 ? 155  GLU D CG    1 
ATOM   6893 C  CD    . GLU D 2 116 ? -3.303  37.095  -3.187  1.00 37.76 ? 155  GLU D CD    1 
ATOM   6894 O  OE1   . GLU D 2 116 ? -3.660  36.478  -2.178  1.00 38.30 ? 155  GLU D OE1   1 
ATOM   6895 O  OE2   . GLU D 2 116 ? -4.110  37.633  -3.963  1.00 39.90 ? 155  GLU D OE2   1 
ATOM   6896 N  N     . LYS D 2 117 ? 1.561   38.584  -2.328  1.00 31.87 ? 156  LYS D N     1 
ATOM   6897 C  CA    . LYS D 2 117 ? 1.941   39.969  -2.439  1.00 31.74 ? 156  LYS D CA    1 
ATOM   6898 C  C     . LYS D 2 117 ? 3.386   40.195  -2.894  1.00 31.04 ? 156  LYS D C     1 
ATOM   6899 O  O     . LYS D 2 117 ? 3.685   41.228  -3.479  1.00 30.05 ? 156  LYS D O     1 
ATOM   6900 C  CB    . LYS D 2 117 ? 1.730   40.651  -1.087  1.00 32.55 ? 156  LYS D CB    1 
ATOM   6901 C  CG    . LYS D 2 117 ? 0.296   40.749  -0.621  1.00 35.64 ? 156  LYS D CG    1 
ATOM   6902 C  CD    . LYS D 2 117 ? 0.312   41.260  0.837   1.00 39.15 ? 156  LYS D CD    1 
ATOM   6903 C  CE    . LYS D 2 117 ? -1.076  41.677  1.379   1.00 42.29 ? 156  LYS D CE    1 
ATOM   6904 N  NZ    . LYS D 2 117 ? -2.031  40.544  1.514   1.00 44.69 ? 156  LYS D NZ    1 
ATOM   6905 N  N     . ASP D 2 118 ? 4.288   39.260  -2.592  1.00 30.36 ? 157  ASP D N     1 
ATOM   6906 C  CA    . ASP D 2 118 ? 5.687   39.443  -2.951  1.00 30.41 ? 157  ASP D CA    1 
ATOM   6907 C  C     . ASP D 2 118 ? 6.094   38.671  -4.206  1.00 30.62 ? 157  ASP D C     1 
ATOM   6908 O  O     . ASP D 2 118 ? 6.446   39.272  -5.197  1.00 31.00 ? 157  ASP D O     1 
ATOM   6909 C  CB    . ASP D 2 118 ? 6.619   39.082  -1.785  1.00 30.40 ? 157  ASP D CB    1 
ATOM   6910 C  CG    . ASP D 2 118 ? 8.056   39.454  -2.071  1.00 29.77 ? 157  ASP D CG    1 
ATOM   6911 O  OD1   . ASP D 2 118 ? 8.310   40.617  -2.477  1.00 29.86 ? 157  ASP D OD1   1 
ATOM   6912 O  OD2   . ASP D 2 118 ? 8.957   38.601  -1.884  1.00 32.90 ? 157  ASP D OD2   1 
ATOM   6913 N  N     . SER D 2 119 ? 6.075   37.351  -4.130  1.00 31.46 ? 158  SER D N     1 
ATOM   6914 C  CA    . SER D 2 119 ? 6.583   36.478  -5.203  1.00 32.14 ? 158  SER D CA    1 
ATOM   6915 C  C     . SER D 2 119 ? 5.665   36.502  -6.460  1.00 32.08 ? 158  SER D C     1 
ATOM   6916 O  O     . SER D 2 119 ? 6.149   36.541  -7.623  1.00 31.39 ? 158  SER D O     1 
ATOM   6917 C  CB    . SER D 2 119 ? 6.728   35.042  -4.666  1.00 32.03 ? 158  SER D CB    1 
ATOM   6918 O  OG    . SER D 2 119 ? 7.429   35.014  -3.426  1.00 34.16 ? 158  SER D OG    1 
ATOM   6919 N  N     . TYR D 2 120 ? 4.354   36.507  -6.226  1.00 31.58 ? 159  TYR D N     1 
ATOM   6920 C  CA    . TYR D 2 120 ? 3.380   36.341  -7.308  1.00 32.41 ? 159  TYR D CA    1 
ATOM   6921 C  C     . TYR D 2 120 ? 3.421   37.451  -8.365  1.00 32.31 ? 159  TYR D C     1 
ATOM   6922 O  O     . TYR D 2 120 ? 3.447   37.137  -9.552  1.00 32.09 ? 159  TYR D O     1 
ATOM   6923 C  CB    . TYR D 2 120 ? 1.958   36.086  -6.751  1.00 32.51 ? 159  TYR D CB    1 
ATOM   6924 C  CG    . TYR D 2 120 ? 0.860   35.950  -7.782  1.00 32.73 ? 159  TYR D CG    1 
ATOM   6925 C  CD1   . TYR D 2 120 ? 0.885   34.930  -8.770  1.00 33.34 ? 159  TYR D CD1   1 
ATOM   6926 C  CD2   . TYR D 2 120 ? -0.239  36.802  -7.758  1.00 34.35 ? 159  TYR D CD2   1 
ATOM   6927 C  CE1   . TYR D 2 120 ? -0.158  34.795  -9.701  1.00 32.47 ? 159  TYR D CE1   1 
ATOM   6928 C  CE2   . TYR D 2 120 ? -1.286  36.667  -8.661  1.00 33.51 ? 159  TYR D CE2   1 
ATOM   6929 C  CZ    . TYR D 2 120 ? -1.242  35.680  -9.642  1.00 34.80 ? 159  TYR D CZ    1 
ATOM   6930 O  OH    . TYR D 2 120 ? -2.293  35.624  -10.549 1.00 34.11 ? 159  TYR D OH    1 
ATOM   6931 N  N     . PRO D 2 121 ? 3.428   38.750  -7.957  1.00 31.88 ? 160  PRO D N     1 
ATOM   6932 C  CA    . PRO D 2 121 ? 3.557   39.783  -8.983  1.00 30.92 ? 160  PRO D CA    1 
ATOM   6933 C  C     . PRO D 2 121 ? 4.801   39.660  -9.879  1.00 30.54 ? 160  PRO D C     1 
ATOM   6934 O  O     . PRO D 2 121 ? 4.723   39.967  -11.063 1.00 28.49 ? 160  PRO D O     1 
ATOM   6935 C  CB    . PRO D 2 121 ? 3.595   41.083  -8.164  1.00 31.66 ? 160  PRO D CB    1 
ATOM   6936 C  CG    . PRO D 2 121 ? 2.780   40.768  -6.939  1.00 30.50 ? 160  PRO D CG    1 
ATOM   6937 C  CD    . PRO D 2 121 ? 3.235   39.356  -6.617  1.00 32.12 ? 160  PRO D CD    1 
ATOM   6938 N  N     . ARG D 2 122 ? 5.927   39.225  -9.306  1.00 30.42 ? 161  ARG D N     1 
ATOM   6939 C  CA    . ARG D 2 122 ? 7.141   38.939  -10.087 1.00 30.20 ? 161  ARG D CA    1 
ATOM   6940 C  C     . ARG D 2 122 ? 7.006   37.698  -10.984 1.00 30.66 ? 161  ARG D C     1 
ATOM   6941 O  O     . ARG D 2 122 ? 7.478   37.702  -12.134 1.00 29.07 ? 161  ARG D O     1 
ATOM   6942 C  CB    . ARG D 2 122 ? 8.360   38.803  -9.169  1.00 30.11 ? 161  ARG D CB    1 
ATOM   6943 C  CG    . ARG D 2 122 ? 8.818   40.151  -8.605  1.00 30.17 ? 161  ARG D CG    1 
ATOM   6944 C  CD    . ARG D 2 122 ? 10.147  40.053  -7.847  1.00 30.82 ? 161  ARG D CD    1 
ATOM   6945 N  NE    . ARG D 2 122 ? 10.130  39.019  -6.822  1.00 28.89 ? 161  ARG D NE    1 
ATOM   6946 C  CZ    . ARG D 2 122 ? 9.856   39.208  -5.528  1.00 31.53 ? 161  ARG D CZ    1 
ATOM   6947 N  NH1   . ARG D 2 122 ? 9.581   40.406  -5.036  1.00 29.89 ? 161  ARG D NH1   1 
ATOM   6948 N  NH2   . ARG D 2 122 ? 9.867   38.167  -4.719  1.00 29.82 ? 161  ARG D NH2   1 
ATOM   6949 N  N     . PHE D 2 123 ? 6.365   36.650  -10.464 1.00 30.53 ? 162  PHE D N     1 
ATOM   6950 C  CA    . PHE D 2 123 ? 6.034   35.482  -11.271 1.00 31.41 ? 162  PHE D CA    1 
ATOM   6951 C  C     . PHE D 2 123 ? 5.314   35.868  -12.553 1.00 31.37 ? 162  PHE D C     1 
ATOM   6952 O  O     . PHE D 2 123 ? 5.655   35.377  -13.631 1.00 31.49 ? 162  PHE D O     1 
ATOM   6953 C  CB    . PHE D 2 123 ? 5.155   34.515  -10.483 1.00 31.69 ? 162  PHE D CB    1 
ATOM   6954 C  CG    . PHE D 2 123 ? 4.579   33.374  -11.314 1.00 31.51 ? 162  PHE D CG    1 
ATOM   6955 C  CD1   . PHE D 2 123 ? 5.390   32.324  -11.736 1.00 31.81 ? 162  PHE D CD1   1 
ATOM   6956 C  CD2   . PHE D 2 123 ? 3.212   33.309  -11.575 1.00 32.05 ? 162  PHE D CD2   1 
ATOM   6957 C  CE1   . PHE D 2 123 ? 4.843   31.234  -12.465 1.00 32.90 ? 162  PHE D CE1   1 
ATOM   6958 C  CE2   . PHE D 2 123 ? 2.656   32.242  -12.300 1.00 32.96 ? 162  PHE D CE2   1 
ATOM   6959 C  CZ    . PHE D 2 123 ? 3.477   31.197  -12.743 1.00 32.76 ? 162  PHE D CZ    1 
ATOM   6960 N  N     . LEU D 2 124 ? 4.306   36.728  -12.417 1.00 31.96 ? 163  LEU D N     1 
ATOM   6961 C  CA    . LEU D 2 124 ? 3.484   37.190  -13.544 1.00 32.22 ? 163  LEU D CA    1 
ATOM   6962 C  C     . LEU D 2 124 ? 4.264   37.989  -14.586 1.00 33.20 ? 163  LEU D C     1 
ATOM   6963 O  O     . LEU D 2 124 ? 3.862   38.039  -15.738 1.00 32.42 ? 163  LEU D O     1 
ATOM   6964 C  CB    . LEU D 2 124 ? 2.302   38.045  -13.044 1.00 32.51 ? 163  LEU D CB    1 
ATOM   6965 C  CG    . LEU D 2 124 ? 1.231   37.320  -12.229 1.00 31.25 ? 163  LEU D CG    1 
ATOM   6966 C  CD1   . LEU D 2 124 ? 0.226   38.307  -11.667 1.00 33.73 ? 163  LEU D CD1   1 
ATOM   6967 C  CD2   . LEU D 2 124 ? 0.539   36.293  -13.034 1.00 31.88 ? 163  LEU D CD2   1 
ATOM   6968 N  N     . ARG D 2 125 ? 5.363   38.617  -14.180 1.00 34.27 ? 164  ARG D N     1 
ATOM   6969 C  CA    . ARG D 2 125 ? 6.183   39.375  -15.102 1.00 35.39 ? 164  ARG D CA    1 
ATOM   6970 C  C     . ARG D 2 125 ? 7.396   38.561  -15.546 1.00 35.66 ? 164  ARG D C     1 
ATOM   6971 O  O     . ARG D 2 125 ? 8.221   39.065  -16.300 1.00 35.61 ? 164  ARG D O     1 
ATOM   6972 C  CB    . ARG D 2 125 ? 6.658   40.669  -14.447 1.00 35.94 ? 164  ARG D CB    1 
ATOM   6973 C  CG    . ARG D 2 125 ? 5.561   41.630  -14.058 1.00 37.69 ? 164  ARG D CG    1 
ATOM   6974 C  CD    . ARG D 2 125 ? 6.133   42.763  -13.226 1.00 39.82 ? 164  ARG D CD    1 
ATOM   6975 N  N     . SER D 2 126 ? 7.502   37.310  -15.089 1.00 36.10 ? 165  SER D N     1 
ATOM   6976 C  CA    . SER D 2 126 ? 8.730   36.529  -15.271 1.00 36.09 ? 165  SER D CA    1 
ATOM   6977 C  C     . SER D 2 126 ? 8.952   36.025  -16.685 1.00 36.98 ? 165  SER D C     1 
ATOM   6978 O  O     . SER D 2 126 ? 8.007   35.592  -17.381 1.00 36.51 ? 165  SER D O     1 
ATOM   6979 C  CB    . SER D 2 126 ? 8.790   35.332  -14.314 1.00 36.08 ? 165  SER D CB    1 
ATOM   6980 O  OG    . SER D 2 126 ? 7.866   34.319  -14.658 1.00 34.13 ? 165  SER D OG    1 
ATOM   6981 N  N     . LYS D 2 127 ? 10.224  36.048  -17.086 1.00 37.60 ? 166  LYS D N     1 
ATOM   6982 C  CA    . LYS D 2 127 ? 10.638  35.434  -18.335 1.00 38.23 ? 166  LYS D CA    1 
ATOM   6983 C  C     . LYS D 2 127 ? 10.098  33.982  -18.403 1.00 39.11 ? 166  LYS D C     1 
ATOM   6984 O  O     . LYS D 2 127 ? 9.632   33.538  -19.450 1.00 38.05 ? 166  LYS D O     1 
ATOM   6985 C  CB    . LYS D 2 127 ? 12.167  35.476  -18.457 1.00 38.47 ? 166  LYS D CB    1 
ATOM   6986 N  N     . MET D 2 128 ? 10.114  33.265  -17.281 1.00 40.08 ? 167  MET D N     1 
ATOM   6987 C  CA    . MET D 2 128 ? 9.636   31.865  -17.287 1.00 41.94 ? 167  MET D CA    1 
ATOM   6988 C  C     . MET D 2 128 ? 8.120   31.705  -17.511 1.00 40.91 ? 167  MET D C     1 
ATOM   6989 O  O     . MET D 2 128 ? 7.706   30.884  -18.329 1.00 41.25 ? 167  MET D O     1 
ATOM   6990 C  CB    . MET D 2 128 ? 10.115  31.103  -16.042 1.00 42.00 ? 167  MET D CB    1 
ATOM   6991 C  CG    . MET D 2 128 ? 9.165   30.983  -14.855 1.00 44.14 ? 167  MET D CG    1 
ATOM   6992 S  SD    . MET D 2 128 ? 9.772   29.594  -13.870 1.00 46.49 ? 167  MET D SD    1 
ATOM   6993 C  CE    . MET D 2 128 ? 11.507  30.086  -13.710 1.00 46.04 ? 167  MET D CE    1 
ATOM   6994 N  N     . TYR D 2 129 ? 7.322   32.506  -16.817 1.00 41.08 ? 168  TYR D N     1 
ATOM   6995 C  CA    . TYR D 2 129 ? 5.854   32.520  -16.964 1.00 41.34 ? 168  TYR D CA    1 
ATOM   6996 C  C     . TYR D 2 129 ? 5.472   32.994  -18.364 1.00 40.98 ? 168  TYR D C     1 
ATOM   6997 O  O     . TYR D 2 129 ? 4.461   32.549  -18.924 1.00 41.41 ? 168  TYR D O     1 
ATOM   6998 C  CB    . TYR D 2 129 ? 5.209   33.427  -15.901 1.00 42.00 ? 168  TYR D CB    1 
ATOM   6999 C  CG    . TYR D 2 129 ? 3.745   33.813  -16.121 1.00 43.08 ? 168  TYR D CG    1 
ATOM   7000 C  CD1   . TYR D 2 129 ? 2.703   32.923  -15.859 1.00 44.88 ? 168  TYR D CD1   1 
ATOM   7001 C  CD2   . TYR D 2 129 ? 3.409   35.089  -16.551 1.00 44.60 ? 168  TYR D CD2   1 
ATOM   7002 C  CE1   . TYR D 2 129 ? 1.352   33.298  -16.044 1.00 44.87 ? 168  TYR D CE1   1 
ATOM   7003 C  CE2   . TYR D 2 129 ? 2.075   35.473  -16.748 1.00 44.94 ? 168  TYR D CE2   1 
ATOM   7004 C  CZ    . TYR D 2 129 ? 1.053   34.577  -16.500 1.00 45.61 ? 168  TYR D CZ    1 
ATOM   7005 O  OH    . TYR D 2 129 ? -0.256  34.985  -16.727 1.00 45.35 ? 168  TYR D OH    1 
ATOM   7006 N  N     . LEU D 2 130 ? 6.291   33.880  -18.931 1.00 40.28 ? 169  LEU D N     1 
ATOM   7007 C  CA    . LEU D 2 130 ? 6.074   34.374  -20.289 1.00 39.47 ? 169  LEU D CA    1 
ATOM   7008 C  C     . LEU D 2 130 ? 6.403   33.302  -21.350 1.00 39.31 ? 169  LEU D C     1 
ATOM   7009 O  O     . LEU D 2 130 ? 5.693   33.175  -22.346 1.00 39.07 ? 169  LEU D O     1 
ATOM   7010 C  CB    . LEU D 2 130 ? 6.894   35.651  -20.509 1.00 39.69 ? 169  LEU D CB    1 
ATOM   7011 N  N     . ASP D 2 131 ? 7.457   32.512  -21.135 1.00 39.05 ? 170  ASP D N     1 
ATOM   7012 C  CA    . ASP D 2 131 ? 7.825   31.446  -22.083 1.00 38.36 ? 170  ASP D CA    1 
ATOM   7013 C  C     . ASP D 2 131 ? 6.778   30.310  -22.152 1.00 38.01 ? 170  ASP D C     1 
ATOM   7014 O  O     . ASP D 2 131 ? 6.825   29.491  -23.068 1.00 36.40 ? 170  ASP D O     1 
ATOM   7015 C  CB    . ASP D 2 131 ? 9.232   30.909  -21.786 1.00 38.78 ? 170  ASP D CB    1 
ATOM   7016 C  CG    . ASP D 2 131 ? 10.336  31.853  -22.274 1.00 40.48 ? 170  ASP D CG    1 
ATOM   7017 O  OD1   . ASP D 2 131 ? 10.245  32.368  -23.413 1.00 41.82 ? 170  ASP D OD1   1 
ATOM   7018 O  OD2   . ASP D 2 131 ? 11.298  32.088  -21.515 1.00 43.91 ? 170  ASP D OD2   1 
ATOM   7019 N  N     . LEU D 2 132 ? 5.878   30.233  -21.160 1.00 37.84 ? 171  LEU D N     1 
ATOM   7020 C  CA    . LEU D 2 132 ? 4.487   29.776  -21.394 1.00 38.24 ? 171  LEU D CA    1 
ATOM   7021 C  C     . LEU D 2 132 ? 4.250   29.008  -22.709 1.00 38.76 ? 171  LEU D C     1 
ATOM   7022 O  O     . LEU D 2 132 ? 4.056   29.603  -23.811 1.00 39.56 ? 171  LEU D O     1 
ATOM   7023 C  CB    . LEU D 2 132 ? 3.586   31.020  -21.402 1.00 38.53 ? 171  LEU D CB    1 
ATOM   7024 C  CG    . LEU D 2 132 ? 2.071   30.870  -21.486 1.00 39.08 ? 171  LEU D CG    1 
ATOM   7025 C  CD1   . LEU D 2 132 ? 1.512   30.406  -20.126 1.00 36.32 ? 171  LEU D CD1   1 
ATOM   7026 C  CD2   . LEU D 2 132 ? 1.462   32.197  -21.924 1.00 38.83 ? 171  LEU D CD2   1 
HETATM 7027 AL AL    . ALF E 3 .   ? 22.993  15.717  30.260  1.00 20.39 ? 2001 ALF A AL    1 
HETATM 7028 F  F1    . ALF E 3 .   ? 23.316  15.715  28.493  1.00 22.46 ? 2001 ALF A F1    1 
HETATM 7029 F  F2    . ALF E 3 .   ? 22.757  15.871  32.020  1.00 23.91 ? 2001 ALF A F2    1 
HETATM 7030 F  F3    . ALF E 3 .   ? 24.651  15.404  30.732  1.00 22.20 ? 2001 ALF A F3    1 
HETATM 7031 F  F4    . ALF E 3 .   ? 21.293  16.053  29.965  1.00 21.38 ? 2001 ALF A F4    1 
HETATM 7032 MG MG    . MG  F 4 .   ? 25.624  14.102  31.838  1.00 20.22 ? 3001 MG  A MG    1 
HETATM 7033 P  PB    . GDP G 5 .   ? 23.403  12.458  30.194  1.00 19.40 ? 1001 GDP A PB    1 
HETATM 7034 O  O1B   . GDP G 5 .   ? 24.658  12.545  30.998  1.00 22.28 ? 1001 GDP A O1B   1 
HETATM 7035 O  O2B   . GDP G 5 .   ? 22.665  13.794  30.181  1.00 18.77 ? 1001 GDP A O2B   1 
HETATM 7036 O  O3B   . GDP G 5 .   ? 23.506  12.018  28.738  1.00 21.18 ? 1001 GDP A O3B   1 
HETATM 7037 O  O3A   . GDP G 5 .   ? 22.360  11.389  30.842  1.00 20.08 ? 1001 GDP A O3A   1 
HETATM 7038 P  PA    . GDP G 5 .   ? 22.541  10.667  32.272  1.00 20.52 ? 1001 GDP A PA    1 
HETATM 7039 O  O1A   . GDP G 5 .   ? 22.546  11.671  33.423  1.00 19.45 ? 1001 GDP A O1A   1 
HETATM 7040 O  O2A   . GDP G 5 .   ? 23.751  9.771   32.270  1.00 20.45 ? 1001 GDP A O2A   1 
HETATM 7041 O  "O5'" . GDP G 5 .   ? 21.197  9.809   32.327  1.00 21.71 ? 1001 GDP A "O5'" 1 
HETATM 7042 C  "C5'" . GDP G 5 .   ? 19.876  10.334  32.500  1.00 19.08 ? 1001 GDP A "C5'" 1 
HETATM 7043 C  "C4'" . GDP G 5 .   ? 19.109  9.455   33.463  1.00 20.73 ? 1001 GDP A "C4'" 1 
HETATM 7044 O  "O4'" . GDP G 5 .   ? 18.864  8.199   32.805  1.00 22.80 ? 1001 GDP A "O4'" 1 
HETATM 7045 C  "C3'" . GDP G 5 .   ? 19.813  9.122   34.755  1.00 19.85 ? 1001 GDP A "C3'" 1 
HETATM 7046 O  "O3'" . GDP G 5 .   ? 18.910  9.157   35.858  1.00 17.50 ? 1001 GDP A "O3'" 1 
HETATM 7047 C  "C2'" . GDP G 5 .   ? 20.328  7.699   34.590  1.00 20.88 ? 1001 GDP A "C2'" 1 
HETATM 7048 O  "O2'" . GDP G 5 .   ? 20.350  6.945   35.796  1.00 21.41 ? 1001 GDP A "O2'" 1 
HETATM 7049 C  "C1'" . GDP G 5 .   ? 19.355  7.104   33.616  1.00 23.07 ? 1001 GDP A "C1'" 1 
HETATM 7050 N  N9    . GDP G 5 .   ? 19.890  6.125   32.661  1.00 23.35 ? 1001 GDP A N9    1 
HETATM 7051 C  C8    . GDP G 5 .   ? 20.916  6.286   31.787  1.00 24.56 ? 1001 GDP A C8    1 
HETATM 7052 N  N7    . GDP G 5 .   ? 21.073  5.164   31.051  1.00 24.56 ? 1001 GDP A N7    1 
HETATM 7053 C  C5    . GDP G 5 .   ? 20.120  4.306   31.439  1.00 24.28 ? 1001 GDP A C5    1 
HETATM 7054 C  C6    . GDP G 5 .   ? 19.723  2.951   31.046  1.00 24.71 ? 1001 GDP A C6    1 
HETATM 7055 O  O6    . GDP G 5 .   ? 20.320  2.401   30.095  1.00 23.93 ? 1001 GDP A O6    1 
HETATM 7056 N  N1    . GDP G 5 .   ? 18.685  2.402   31.710  1.00 24.55 ? 1001 GDP A N1    1 
HETATM 7057 C  C2    . GDP G 5 .   ? 18.004  3.022   32.698  1.00 25.66 ? 1001 GDP A C2    1 
HETATM 7058 N  N2    . GDP G 5 .   ? 16.993  2.374   33.313  1.00 24.58 ? 1001 GDP A N2    1 
HETATM 7059 N  N3    . GDP G 5 .   ? 18.295  4.285   33.134  1.00 23.32 ? 1001 GDP A N3    1 
HETATM 7060 C  C4    . GDP G 5 .   ? 19.342  4.927   32.514  1.00 25.27 ? 1001 GDP A C4    1 
HETATM 7061 AL AL    . ALF H 3 .   ? 12.399  42.493  4.324   1.00 23.86 ? 2002 ALF C AL    1 
HETATM 7062 F  F1    . ALF H 3 .   ? 12.908  42.412  2.629   1.00 24.56 ? 2002 ALF C F1    1 
HETATM 7063 F  F2    . ALF H 3 .   ? 11.691  42.554  5.947   1.00 22.89 ? 2002 ALF C F2    1 
HETATM 7064 F  F3    . ALF H 3 .   ? 14.060  42.175  4.892   1.00 22.03 ? 2002 ALF C F3    1 
HETATM 7065 F  F4    . ALF H 3 .   ? 10.781  42.745  3.655   1.00 27.35 ? 2002 ALF C F4    1 
HETATM 7066 MG MG    . MG  I 4 .   ? 12.651  43.691  1.157   1.00 24.70 ? 3002 MG  C MG    1 
HETATM 7067 P  PB    . GDP J 5 .   ? 13.381  45.514  3.642   1.00 21.17 ? 1002 GDP C PB    1 
HETATM 7068 O  O1B   . GDP J 5 .   ? 13.228  45.298  2.185   1.00 19.80 ? 1002 GDP C O1B   1 
HETATM 7069 O  O2B   . GDP J 5 .   ? 12.691  44.422  4.400   1.00 21.99 ? 1002 GDP C O2B   1 
HETATM 7070 O  O3B   . GDP J 5 .   ? 14.763  45.779  4.120   1.00 20.27 ? 1002 GDP C O3B   1 
HETATM 7071 O  O3A   . GDP J 5 .   ? 12.599  46.909  3.969   1.00 18.91 ? 1002 GDP C O3A   1 
HETATM 7072 P  PA    . GDP J 5 .   ? 11.604  47.750  3.029   1.00 21.30 ? 1002 GDP C PA    1 
HETATM 7073 O  O1A   . GDP J 5 .   ? 10.436  46.978  2.583   1.00 22.34 ? 1002 GDP C O1A   1 
HETATM 7074 O  O2A   . GDP J 5 .   ? 12.410  48.407  1.924   1.00 22.35 ? 1002 GDP C O2A   1 
HETATM 7075 O  "O5'" . GDP J 5 .   ? 11.215  48.965  4.032   1.00 21.69 ? 1002 GDP C "O5'" 1 
HETATM 7076 C  "C5'" . GDP J 5 .   ? 10.321  48.726  5.136   1.00 21.03 ? 1002 GDP C "C5'" 1 
HETATM 7077 C  "C4'" . GDP J 5 .   ? 9.335   49.891  5.273   1.00 21.46 ? 1002 GDP C "C4'" 1 
HETATM 7078 O  "O4'" . GDP J 5 .   ? 10.052  51.043  5.681   1.00 21.03 ? 1002 GDP C "O4'" 1 
HETATM 7079 C  "C3'" . GDP J 5 .   ? 8.613   50.269  3.975   1.00 23.48 ? 1002 GDP C "C3'" 1 
HETATM 7080 O  "O3'" . GDP J 5 .   ? 7.247   50.623  4.213   1.00 22.27 ? 1002 GDP C "O3'" 1 
HETATM 7081 C  "C2'" . GDP J 5 .   ? 9.351   51.482  3.491   1.00 22.08 ? 1002 GDP C "C2'" 1 
HETATM 7082 O  "O2'" . GDP J 5 .   ? 8.555   52.422  2.738   1.00 22.77 ? 1002 GDP C "O2'" 1 
HETATM 7083 C  "C1'" . GDP J 5 .   ? 9.848   52.107  4.773   1.00 23.95 ? 1002 GDP C "C1'" 1 
HETATM 7084 N  N9    . GDP J 5 .   ? 11.145  52.788  4.696   1.00 24.51 ? 1002 GDP C N9    1 
HETATM 7085 C  C8    . GDP J 5 .   ? 12.315  52.263  4.251   1.00 24.19 ? 1002 GDP C C8    1 
HETATM 7086 N  N7    . GDP J 5 .   ? 13.306  53.167  4.387   1.00 25.57 ? 1002 GDP C N7    1 
HETATM 7087 C  C5    . GDP J 5 .   ? 12.757  54.272  4.912   1.00 23.88 ? 1002 GDP C C5    1 
HETATM 7088 C  C6    . GDP J 5 .   ? 13.224  55.579  5.336   1.00 24.64 ? 1002 GDP C C6    1 
HETATM 7089 O  O6    . GDP J 5 .   ? 14.390  55.884  5.214   1.00 23.95 ? 1002 GDP C O6    1 
HETATM 7090 N  N1    . GDP J 5 .   ? 12.339  56.436  5.842   1.00 23.68 ? 1002 GDP C N1    1 
HETATM 7091 C  C2    . GDP J 5 .   ? 11.055  56.166  5.993   1.00 24.01 ? 1002 GDP C C2    1 
HETATM 7092 N  N2    . GDP J 5 .   ? 10.274  57.122  6.522   1.00 24.82 ? 1002 GDP C N2    1 
HETATM 7093 N  N3    . GDP J 5 .   ? 10.508  54.976  5.665   1.00 22.59 ? 1002 GDP C N3    1 
HETATM 7094 C  C4    . GDP J 5 .   ? 11.331  54.018  5.135   1.00 24.46 ? 1002 GDP C C4    1 
HETATM 7095 O  O     . HOH K 6 .   ? 16.214  9.926   35.825  1.00 22.84 ? 3002 HOH A O     1 
HETATM 7096 O  O     . HOH K 6 .   ? 19.136  23.880  25.482  1.00 18.72 ? 3003 HOH A O     1 
HETATM 7097 O  O     . HOH K 6 .   ? 15.818  17.112  26.171  1.00 20.87 ? 3004 HOH A O     1 
HETATM 7098 O  O     . HOH K 6 .   ? 8.149   13.858  26.481  1.00 23.06 ? 3005 HOH A O     1 
HETATM 7099 O  O     . HOH K 6 .   ? 10.176  22.067  29.173  1.00 22.73 ? 3006 HOH A O     1 
HETATM 7100 O  O     . HOH K 6 .   ? 22.812  11.748  36.037  1.00 20.29 ? 3007 HOH A O     1 
HETATM 7101 O  O     . HOH K 6 .   ? 18.919  17.491  24.202  1.00 19.65 ? 3008 HOH A O     1 
HETATM 7102 O  O     . HOH K 6 .   ? 16.559  16.633  41.244  1.00 22.77 ? 3009 HOH A O     1 
HETATM 7103 O  O     . HOH K 6 .   ? 17.331  15.107  24.866  1.00 20.25 ? 3010 HOH A O     1 
HETATM 7104 O  O     . HOH K 6 .   ? 11.211  13.989  37.137  1.00 22.85 ? 3011 HOH A O     1 
HETATM 7105 O  O     . HOH K 6 .   ? 16.440  4.956   35.159  1.00 22.15 ? 3012 HOH A O     1 
HETATM 7106 O  O     . HOH K 6 .   ? 24.666  25.730  21.816  1.00 25.20 ? 3013 HOH A O     1 
HETATM 7107 O  O     . HOH K 6 .   ? 8.685   12.373  29.976  1.00 26.28 ? 3014 HOH A O     1 
HETATM 7108 O  O     . HOH K 6 .   ? 30.689  22.916  19.120  1.00 31.26 ? 3015 HOH A O     1 
HETATM 7109 O  O     . HOH K 6 .   ? 15.956  10.458  32.264  1.00 26.01 ? 3016 HOH A O     1 
HETATM 7110 O  O     . HOH K 6 .   ? 37.730  18.743  33.507  1.00 32.93 ? 3017 HOH A O     1 
HETATM 7111 O  O     . HOH K 6 .   ? 8.606   24.226  23.324  1.00 27.62 ? 3018 HOH A O     1 
HETATM 7112 O  O     . HOH K 6 .   ? 9.045   6.675   8.889   1.00 30.36 ? 3019 HOH A O     1 
HETATM 7113 O  O     . HOH K 6 .   ? 24.100  11.659  38.971  1.00 23.01 ? 3020 HOH A O     1 
HETATM 7114 O  O     . HOH K 6 .   ? 16.506  21.197  28.850  1.00 28.70 ? 3021 HOH A O     1 
HETATM 7115 O  O     . HOH K 6 .   ? 23.924  8.404   36.225  1.00 26.69 ? 3022 HOH A O     1 
HETATM 7116 O  O     . HOH K 6 .   ? 24.483  25.958  28.149  1.00 25.57 ? 3023 HOH A O     1 
HETATM 7117 O  O     . HOH K 6 .   ? 20.245  18.358  37.732  0.50 12.36 ? 3024 HOH A O     1 
HETATM 7118 O  O     . HOH K 6 .   ? 19.103  10.334  22.968  1.00 23.42 ? 3025 HOH A O     1 
HETATM 7119 O  O     . HOH K 6 .   ? 7.042   18.137  27.465  1.00 25.87 ? 3026 HOH A O     1 
HETATM 7120 O  O     . HOH K 6 .   ? 18.224  23.609  34.280  1.00 29.75 ? 3027 HOH A O     1 
HETATM 7121 O  O     . HOH K 6 .   ? 17.322  17.378  33.619  1.00 32.91 ? 3028 HOH A O     1 
HETATM 7122 O  O     . HOH K 6 .   ? 23.635  13.486  50.659  1.00 29.16 ? 3029 HOH A O     1 
HETATM 7123 O  O     . HOH K 6 .   ? 9.423   -0.568  7.897   1.00 37.22 ? 3030 HOH A O     1 
HETATM 7124 O  O     . HOH K 6 .   ? 17.127  17.086  28.552  1.00 26.73 ? 3031 HOH A O     1 
HETATM 7125 O  O     . HOH K 6 .   ? 21.641  11.405  21.452  1.00 25.73 ? 3032 HOH A O     1 
HETATM 7126 O  O     . HOH K 6 .   ? -5.563  7.886   46.754  1.00 39.01 ? 3033 HOH A O     1 
HETATM 7127 O  O     . HOH K 6 .   ? 15.794  10.714  38.641  1.00 25.57 ? 3034 HOH A O     1 
HETATM 7128 O  O     . HOH K 6 .   ? 9.936   6.347   35.592  1.00 29.53 ? 3035 HOH A O     1 
HETATM 7129 O  O     . HOH K 6 .   ? 25.224  -5.776  36.585  1.00 29.70 ? 3036 HOH A O     1 
HETATM 7130 O  O     . HOH K 6 .   ? 24.509  -1.892  40.305  1.00 28.19 ? 3037 HOH A O     1 
HETATM 7131 O  O     . HOH K 6 .   ? 23.751  -1.837  43.877  1.00 28.87 ? 3038 HOH A O     1 
HETATM 7132 O  O     . HOH K 6 .   ? 17.973  7.565   8.518   1.00 30.66 ? 3039 HOH A O     1 
HETATM 7133 O  O     . HOH K 6 .   ? 17.906  -2.230  34.504  1.00 33.26 ? 3040 HOH A O     1 
HETATM 7134 O  O     . HOH K 6 .   ? 10.555  13.441  28.456  1.00 29.38 ? 3041 HOH A O     1 
HETATM 7135 O  O     . HOH K 6 .   ? 12.090  0.224   42.220  1.00 32.74 ? 3042 HOH A O     1 
HETATM 7136 O  O     . HOH K 6 .   ? 9.114   25.149  19.169  1.00 31.79 ? 3043 HOH A O     1 
HETATM 7137 O  O     . HOH K 6 .   ? 17.106  13.378  22.677  1.00 23.00 ? 3044 HOH A O     1 
HETATM 7138 O  O     . HOH K 6 .   ? 16.439  20.332  31.016  1.00 29.97 ? 3045 HOH A O     1 
HETATM 7139 O  O     . HOH K 6 .   ? 8.847   7.213   33.588  1.00 36.67 ? 3046 HOH A O     1 
HETATM 7140 O  O     . HOH K 6 .   ? -6.955  5.645   43.657  1.00 39.15 ? 3047 HOH A O     1 
HETATM 7141 O  O     . HOH K 6 .   ? 5.026   18.548  35.015  1.00 28.16 ? 3048 HOH A O     1 
HETATM 7142 O  O     . HOH K 6 .   ? 5.498   6.470   26.702  1.00 36.11 ? 3049 HOH A O     1 
HETATM 7143 O  O     . HOH K 6 .   ? 11.160  -0.142  49.492  1.00 37.44 ? 3050 HOH A O     1 
HETATM 7144 O  O     . HOH K 6 .   ? 9.369   18.897  39.341  1.00 30.47 ? 3051 HOH A O     1 
HETATM 7145 O  O     . HOH K 6 .   ? 34.714  12.375  32.107  1.00 34.10 ? 3052 HOH A O     1 
HETATM 7146 O  O     . HOH K 6 .   ? 19.680  1.133   50.699  1.00 34.07 ? 3053 HOH A O     1 
HETATM 7147 O  O     . HOH K 6 .   ? 28.368  11.129  36.831  1.00 34.25 ? 3054 HOH A O     1 
HETATM 7148 O  O     . HOH K 6 .   ? 12.114  4.257   36.654  1.00 30.55 ? 3055 HOH A O     1 
HETATM 7149 O  O     . HOH K 6 .   ? 13.176  1.510   36.011  1.00 30.28 ? 3056 HOH A O     1 
HETATM 7150 O  O     . HOH K 6 .   ? 11.233  6.674   28.727  1.00 32.83 ? 3057 HOH A O     1 
HETATM 7151 O  O     . HOH K 6 .   ? 42.383  3.578   17.376  1.00 45.41 ? 3058 HOH A O     1 
HETATM 7152 O  O     . HOH K 6 .   ? 8.476   9.830   30.300  1.00 27.36 ? 3059 HOH A O     1 
HETATM 7153 O  O     . HOH K 6 .   ? 37.089  20.525  31.600  1.00 34.69 ? 3060 HOH A O     1 
HETATM 7154 O  O     . HOH K 6 .   ? 43.521  -3.747  32.175  1.00 50.15 ? 3061 HOH A O     1 
HETATM 7155 O  O     . HOH K 6 .   ? 32.378  1.045   42.428  1.00 40.41 ? 3062 HOH A O     1 
HETATM 7156 O  O     . HOH K 6 .   ? 10.305  21.111  16.059  1.00 34.30 ? 3063 HOH A O     1 
HETATM 7157 O  O     . HOH K 6 .   ? 40.111  11.233  36.839  1.00 40.84 ? 3064 HOH A O     1 
HETATM 7158 O  O     . HOH K 6 .   ? 19.881  -6.242  22.330  1.00 39.12 ? 3065 HOH A O     1 
HETATM 7159 O  O     . HOH K 6 .   ? 34.071  -0.972  41.862  1.00 34.63 ? 3066 HOH A O     1 
HETATM 7160 O  O     . HOH K 6 .   ? 5.042   17.637  25.987  1.00 37.99 ? 3067 HOH A O     1 
HETATM 7161 O  O     . HOH K 6 .   ? 6.424   19.736  29.830  1.00 31.31 ? 3068 HOH A O     1 
HETATM 7162 O  O     . HOH K 6 .   ? 19.723  -1.112  45.063  1.00 33.46 ? 3069 HOH A O     1 
HETATM 7163 O  O     . HOH K 6 .   ? 10.269  8.965   32.289  1.00 34.89 ? 3070 HOH A O     1 
HETATM 7164 O  O     . HOH K 6 .   ? 7.658   14.032  60.191  1.00 46.12 ? 3071 HOH A O     1 
HETATM 7165 O  O     . HOH K 6 .   ? 3.865   7.793   28.335  1.00 35.33 ? 3072 HOH A O     1 
HETATM 7166 O  O     . HOH K 6 .   ? 7.900   7.475   28.706  1.00 37.14 ? 3073 HOH A O     1 
HETATM 7167 O  O     . HOH K 6 .   ? 42.395  13.346  31.563  1.00 53.05 ? 3074 HOH A O     1 
HETATM 7168 O  O     . HOH K 6 .   ? 20.208  -1.254  35.863  1.00 31.55 ? 3075 HOH A O     1 
HETATM 7169 O  O     . HOH K 6 .   ? 11.914  -9.075  20.699  1.00 39.68 ? 3076 HOH A O     1 
HETATM 7170 O  O     . HOH K 6 .   ? 14.469  10.920  29.792  1.00 29.38 ? 3077 HOH A O     1 
HETATM 7171 O  O     . HOH K 6 .   ? 24.811  -4.954  21.037  1.00 32.36 ? 3078 HOH A O     1 
HETATM 7172 O  O     . HOH K 6 .   ? 3.792   1.545   41.363  1.00 40.65 ? 3079 HOH A O     1 
HETATM 7173 O  O     . HOH K 6 .   ? 10.013  23.819  49.136  1.00 54.50 ? 3080 HOH A O     1 
HETATM 7174 O  O     . HOH K 6 .   ? 33.483  4.767   52.799  1.00 40.39 ? 3081 HOH A O     1 
HETATM 7175 O  O     . HOH K 6 .   ? -8.621  10.220  37.716  1.00 39.79 ? 3082 HOH A O     1 
HETATM 7176 O  O     . HOH K 6 .   ? 30.633  14.163  34.514  1.00 43.80 ? 3083 HOH A O     1 
HETATM 7177 O  O     . HOH K 6 .   ? 1.963   2.830   42.867  1.00 40.22 ? 3084 HOH A O     1 
HETATM 7178 O  O     . HOH K 6 .   ? 4.843   0.848   15.470  1.00 37.74 ? 3085 HOH A O     1 
HETATM 7179 O  O     . HOH K 6 .   ? 33.279  13.005  34.488  1.00 34.14 ? 3086 HOH A O     1 
HETATM 7180 O  O     . HOH K 6 .   ? 26.961  -1.732  39.922  1.00 36.10 ? 3087 HOH A O     1 
HETATM 7181 O  O     . HOH K 6 .   ? 21.803  -3.398  36.536  1.00 36.21 ? 3088 HOH A O     1 
HETATM 7182 O  O     . HOH K 6 .   ? 25.591  12.933  36.466  1.00 30.97 ? 3089 HOH A O     1 
HETATM 7183 O  O     . HOH K 6 .   ? 13.326  16.279  31.163  1.00 29.27 ? 3090 HOH A O     1 
HETATM 7184 O  O     . HOH K 6 .   ? 17.236  9.190   21.242  1.00 35.04 ? 3091 HOH A O     1 
HETATM 7185 O  O     . HOH K 6 .   ? 17.863  -1.538  43.351  1.00 40.00 ? 3092 HOH A O     1 
HETATM 7186 O  O     . HOH K 6 .   ? 26.237  15.607  35.615  1.00 30.10 ? 3093 HOH A O     1 
HETATM 7187 O  O     . HOH K 6 .   ? 13.278  -4.347  11.882  1.00 33.95 ? 3094 HOH A O     1 
HETATM 7188 O  O     . HOH K 6 .   ? 33.363  11.757  9.656   1.00 40.77 ? 3095 HOH A O     1 
HETATM 7189 O  O     . HOH K 6 .   ? 2.975   19.727  33.107  1.00 42.34 ? 3096 HOH A O     1 
HETATM 7190 O  O     . HOH K 6 .   ? -3.463  6.646   47.763  1.00 37.92 ? 3097 HOH A O     1 
HETATM 7191 O  O     . HOH K 6 .   ? 24.405  -3.373  37.665  1.00 31.96 ? 3098 HOH A O     1 
HETATM 7192 O  O     . HOH K 6 .   ? 7.797   20.234  32.414  1.00 30.53 ? 3099 HOH A O     1 
HETATM 7193 O  O     . HOH K 6 .   ? 10.306  -0.007  39.802  1.00 36.98 ? 3100 HOH A O     1 
HETATM 7194 O  O     . HOH K 6 .   ? 14.562  8.260   27.060  1.00 36.83 ? 3101 HOH A O     1 
HETATM 7195 O  O     . HOH K 6 .   ? 36.808  -4.924  32.280  1.00 44.08 ? 3102 HOH A O     1 
HETATM 7196 O  O     . HOH K 6 .   ? 35.338  -2.680  30.444  1.00 33.08 ? 3103 HOH A O     1 
HETATM 7197 O  O     . HOH K 6 .   ? 40.233  19.685  21.577  1.00 40.52 ? 3104 HOH A O     1 
HETATM 7198 O  O     . HOH K 6 .   ? 7.179   11.669  13.257  1.00 41.84 ? 3105 HOH A O     1 
HETATM 7199 O  O     . HOH K 6 .   ? 28.906  0.279   9.990   1.00 39.71 ? 3106 HOH A O     1 
HETATM 7200 O  O     . HOH K 6 .   ? 12.539  12.187  30.336  1.00 42.63 ? 3107 HOH A O     1 
HETATM 7201 O  O     . HOH K 6 .   ? 4.576   -5.876  11.335  1.00 37.78 ? 3108 HOH A O     1 
HETATM 7202 O  O     . HOH K 6 .   ? 15.360  1.190   7.160   1.00 45.20 ? 3109 HOH A O     1 
HETATM 7203 O  O     . HOH K 6 .   ? 13.805  18.646  45.701  1.00 37.08 ? 3110 HOH A O     1 
HETATM 7204 O  O     . HOH K 6 .   ? 6.376   2.951   47.107  1.00 47.96 ? 3111 HOH A O     1 
HETATM 7205 O  O     . HOH K 6 .   ? 17.795  -5.991  17.299  1.00 47.32 ? 3112 HOH A O     1 
HETATM 7206 O  O     . HOH K 6 .   ? 8.555   1.061   48.973  1.00 43.55 ? 3113 HOH A O     1 
HETATM 7207 O  O     . HOH K 6 .   ? 6.945   17.894  33.474  1.00 23.94 ? 3114 HOH A O     1 
HETATM 7208 O  O     . HOH K 6 .   ? 13.333  -1.147  48.021  1.00 53.27 ? 3115 HOH A O     1 
HETATM 7209 O  O     . HOH K 6 .   ? 35.315  7.328   50.392  1.00 32.98 ? 3116 HOH A O     1 
HETATM 7210 O  O     . HOH K 6 .   ? 3.487   -5.227  17.142  1.00 35.75 ? 3117 HOH A O     1 
HETATM 7211 O  O     . HOH K 6 .   ? 6.611   13.457  18.892  1.00 49.73 ? 3118 HOH A O     1 
HETATM 7212 O  O     . HOH K 6 .   ? 34.367  4.758   12.947  1.00 43.64 ? 3119 HOH A O     1 
HETATM 7213 O  O     . HOH K 6 .   ? 16.774  11.494  26.450  1.00 37.80 ? 3120 HOH A O     1 
HETATM 7214 O  O     . HOH K 6 .   ? 4.705   23.358  25.719  1.00 43.00 ? 3121 HOH A O     1 
HETATM 7215 O  O     . HOH K 6 .   ? 6.931   20.341  36.546  1.00 43.18 ? 3122 HOH A O     1 
HETATM 7216 O  O     . HOH K 6 .   ? 37.205  4.210   12.218  1.00 43.59 ? 3123 HOH A O     1 
HETATM 7217 O  O     . HOH K 6 .   ? 3.798   21.131  28.490  1.00 41.98 ? 3124 HOH A O     1 
HETATM 7218 O  O     . HOH K 6 .   ? 10.647  -2.622  8.380   1.00 40.60 ? 3125 HOH A O     1 
HETATM 7219 O  O     . HOH K 6 .   ? 1.992   5.705   10.672  1.00 42.86 ? 3126 HOH A O     1 
HETATM 7220 O  O     . HOH K 6 .   ? 6.347   6.688   32.738  1.00 39.52 ? 3127 HOH A O     1 
HETATM 7221 O  O     . HOH K 6 .   ? 27.273  -5.712  22.664  1.00 41.36 ? 3128 HOH A O     1 
HETATM 7222 O  O     . HOH K 6 .   ? 2.488   11.893  55.919  1.00 40.21 ? 3129 HOH A O     1 
HETATM 7223 O  O     . HOH K 6 .   ? 12.498  0.111   38.269  1.00 46.20 ? 3130 HOH A O     1 
HETATM 7224 O  O     . HOH K 6 .   ? 42.041  16.674  14.976  1.00 41.76 ? 3131 HOH A O     1 
HETATM 7225 O  O     . HOH K 6 .   ? 44.070  9.377   18.501  1.00 48.81 ? 3132 HOH A O     1 
HETATM 7226 O  O     . HOH K 6 .   ? 42.932  19.998  21.969  1.00 44.59 ? 3133 HOH A O     1 
HETATM 7227 O  O     . HOH K 6 .   ? 15.208  -3.046  10.660  1.00 38.60 ? 3134 HOH A O     1 
HETATM 7228 O  O     . HOH K 6 .   ? 3.068   22.711  21.817  1.00 44.04 ? 3135 HOH A O     1 
HETATM 7229 O  O     . HOH K 6 .   ? 22.233  17.392  11.093  1.00 35.90 ? 3136 HOH A O     1 
HETATM 7230 O  O     . HOH K 6 .   ? 22.766  13.851  53.213  1.00 57.33 ? 3137 HOH A O     1 
HETATM 7231 O  O     . HOH K 6 .   ? 25.692  -8.191  29.487  1.00 50.14 ? 3138 HOH A O     1 
HETATM 7232 O  O     . HOH K 6 .   ? -1.094  16.106  26.637  1.00 43.94 ? 3139 HOH A O     1 
HETATM 7233 O  O     . HOH K 6 .   ? 19.678  16.664  40.279  1.00 32.01 ? 3140 HOH A O     1 
HETATM 7234 O  O     . HOH K 6 .   ? 27.584  -1.508  13.766  1.00 37.42 ? 3141 HOH A O     1 
HETATM 7235 O  O     . HOH K 6 .   ? 14.772  -0.821  34.341  1.00 46.45 ? 3142 HOH A O     1 
HETATM 7236 O  O     . HOH K 6 .   ? 39.480  14.752  16.183  1.00 39.59 ? 3143 HOH A O     1 
HETATM 7237 O  O     . HOH K 6 .   ? 30.159  1.179   6.904   1.00 45.51 ? 3144 HOH A O     1 
HETATM 7238 O  O     . HOH K 6 .   ? 29.377  18.089  14.328  1.00 39.52 ? 3145 HOH A O     1 
HETATM 7239 O  O     . HOH K 6 .   ? 2.226   6.390   23.245  1.00 38.55 ? 3146 HOH A O     1 
HETATM 7240 O  O     . HOH K 6 .   ? 13.526  14.365  32.764  1.00 36.44 ? 3147 HOH A O     1 
HETATM 7241 O  O     . HOH K 6 .   ? 10.337  -9.769  17.468  1.00 45.41 ? 3148 HOH A O     1 
HETATM 7242 O  O     . HOH K 6 .   ? 17.502  -2.074  38.777  1.00 35.77 ? 3149 HOH A O     1 
HETATM 7243 O  O     . HOH K 6 .   ? 0.295   14.898  55.936  1.00 37.91 ? 3150 HOH A O     1 
HETATM 7244 O  O     . HOH K 6 .   ? 16.936  1.649   54.086  1.00 38.93 ? 3151 HOH A O     1 
HETATM 7245 O  O     . HOH K 6 .   ? 5.552   12.950  23.208  1.00 46.45 ? 3152 HOH A O     1 
HETATM 7246 O  O     . HOH K 6 .   ? 19.781  14.479  9.774   1.00 39.60 ? 3153 HOH A O     1 
HETATM 7247 O  O     . HOH K 6 .   ? 14.202  -7.002  11.958  1.00 41.38 ? 3154 HOH A O     1 
HETATM 7248 O  O     . HOH K 6 .   ? 33.943  13.340  36.929  1.00 41.31 ? 3155 HOH A O     1 
HETATM 7249 O  O     . HOH K 6 .   ? 13.259  -4.396  30.352  1.00 40.76 ? 3156 HOH A O     1 
HETATM 7250 O  O     . HOH K 6 .   ? 32.490  21.265  14.295  1.00 47.34 ? 3157 HOH A O     1 
HETATM 7251 O  O     . HOH K 6 .   ? 31.082  -2.595  12.658  1.00 54.95 ? 3158 HOH A O     1 
HETATM 7252 O  O     . HOH K 6 .   ? 39.967  11.992  12.904  1.00 43.37 ? 3159 HOH A O     1 
HETATM 7253 O  O     . HOH K 6 .   ? 25.896  -0.738  46.924  1.00 36.84 ? 3160 HOH A O     1 
HETATM 7254 O  O     . HOH K 6 .   ? 15.019  -1.779  43.427  1.00 46.88 ? 3161 HOH A O     1 
HETATM 7255 O  O     . HOH K 6 .   ? -3.511  7.129   31.652  1.00 50.31 ? 3162 HOH A O     1 
HETATM 7256 O  O     . HOH K 6 .   ? 15.371  15.824  38.758  1.00 36.10 ? 3163 HOH A O     1 
HETATM 7257 O  O     . HOH K 6 .   ? 13.603  21.884  16.208  1.00 34.55 ? 3164 HOH A O     1 
HETATM 7258 O  O     . HOH K 6 .   ? 24.951  -5.265  24.669  1.00 47.24 ? 3165 HOH A O     1 
HETATM 7259 O  O     . HOH K 6 .   ? 42.210  -5.690  19.838  1.00 51.47 ? 3166 HOH A O     1 
HETATM 7260 O  O     . HOH K 6 .   ? 28.927  20.753  26.952  1.00 36.00 ? 3167 HOH A O     1 
HETATM 7261 O  O     . HOH K 6 .   ? 16.784  16.786  48.712  1.00 48.66 ? 3168 HOH A O     1 
HETATM 7262 O  O     . HOH K 6 .   ? 26.355  13.299  39.657  1.00 37.70 ? 3169 HOH A O     1 
HETATM 7263 O  O     . HOH K 6 .   ? 30.537  10.246  40.165  1.00 40.94 ? 3170 HOH A O     1 
HETATM 7264 O  O     . HOH K 6 .   ? 35.797  -0.251  0.375   1.00 50.37 ? 3171 HOH A O     1 
HETATM 7265 O  O     . HOH K 6 .   ? 21.696  0.260   8.193   1.00 58.77 ? 3172 HOH A O     1 
HETATM 7266 O  O     . HOH K 6 .   ? 19.769  1.763   53.434  1.00 44.92 ? 3173 HOH A O     1 
HETATM 7267 O  O     . HOH K 6 .   ? 16.994  5.139   6.758   1.00 42.39 ? 3174 HOH A O     1 
HETATM 7268 O  O     . HOH K 6 .   ? 18.097  12.733  10.576  1.00 40.66 ? 3175 HOH A O     1 
HETATM 7269 O  O     . HOH K 6 .   ? -2.679  5.908   29.315  1.00 42.58 ? 3176 HOH A O     1 
HETATM 7270 O  O     . HOH K 6 .   ? 39.375  25.062  23.438  1.00 49.78 ? 3177 HOH A O     1 
HETATM 7271 O  O     . HOH K 6 .   ? 26.957  3.061   8.747   1.00 45.92 ? 3178 HOH A O     1 
HETATM 7272 O  O     . HOH K 6 .   ? 12.985  5.191   59.314  1.00 49.15 ? 3179 HOH A O     1 
HETATM 7273 O  O     . HOH K 6 .   ? 20.118  8.338   55.837  1.00 46.86 ? 3180 HOH A O     1 
HETATM 7274 O  O     . HOH K 6 .   ? 32.311  27.877  24.633  1.00 43.64 ? 3181 HOH A O     1 
HETATM 7275 O  O     . HOH K 6 .   ? 6.018   1.589   38.228  1.00 35.73 ? 3182 HOH A O     1 
HETATM 7276 O  O     . HOH K 6 .   ? 3.441   2.098   38.481  1.00 41.59 ? 3183 HOH A O     1 
HETATM 7277 O  O     . HOH K 6 .   ? 35.925  2.852   9.583   1.00 46.32 ? 3184 HOH A O     1 
HETATM 7278 O  O     . HOH K 6 .   ? 40.371  17.490  34.593  1.00 52.78 ? 3185 HOH A O     1 
HETATM 7279 O  O     . HOH K 6 .   ? 0.491   27.931  41.957  1.00 48.86 ? 3186 HOH A O     1 
HETATM 7280 O  O     . HOH K 6 .   ? 18.826  -6.471  19.499  1.00 48.27 ? 3187 HOH A O     1 
HETATM 7281 O  O     . HOH K 6 .   ? 12.682  18.340  32.899  1.00 49.00 ? 3188 HOH A O     1 
HETATM 7282 O  O     . HOH K 6 .   ? 44.681  17.178  30.364  1.00 57.86 ? 3189 HOH A O     1 
HETATM 7283 O  O     . HOH K 6 .   ? 1.365   7.975   11.464  1.00 47.04 ? 3190 HOH A O     1 
HETATM 7284 O  O     . HOH K 6 .   ? 38.241  20.862  26.218  1.00 46.68 ? 3191 HOH A O     1 
HETATM 7285 O  O     . HOH K 6 .   ? -5.782  9.253   31.423  1.00 42.63 ? 3192 HOH A O     1 
HETATM 7286 O  O     . HOH K 6 .   ? 2.445   23.914  40.495  1.00 50.66 ? 3193 HOH A O     1 
HETATM 7287 O  O     . HOH K 6 .   ? 25.382  15.868  50.108  1.00 52.79 ? 3194 HOH A O     1 
HETATM 7288 O  O     . HOH K 6 .   ? 22.254  23.532  19.305  1.00 44.12 ? 3195 HOH A O     1 
HETATM 7289 O  O     . HOH K 6 .   ? 31.482  -1.702  0.990   1.00 54.74 ? 3196 HOH A O     1 
HETATM 7290 O  O     . HOH K 6 .   ? 17.579  19.766  15.713  1.00 55.89 ? 3197 HOH A O     1 
HETATM 7291 O  O     . HOH K 6 .   ? 22.925  20.358  17.491  1.00 34.09 ? 3198 HOH A O     1 
HETATM 7292 O  O     . HOH K 6 .   ? 6.108   1.997   4.992   1.00 45.13 ? 3199 HOH A O     1 
HETATM 7293 O  O     . HOH K 6 .   ? 22.224  18.690  15.612  1.00 38.70 ? 3200 HOH A O     1 
HETATM 7294 O  O     . HOH K 6 .   ? 1.833   25.407  38.200  1.00 45.66 ? 3201 HOH A O     1 
HETATM 7295 O  O     . HOH K 6 .   ? 29.094  -3.646  16.904  1.00 45.26 ? 3202 HOH A O     1 
HETATM 7296 O  O     . HOH K 6 .   ? 4.588   -0.886  12.645  1.00 42.32 ? 3203 HOH A O     1 
HETATM 7297 O  O     . HOH K 6 .   ? 0.539   25.892  42.510  1.00 44.18 ? 3204 HOH A O     1 
HETATM 7298 O  O     . HOH K 6 .   ? -6.171  14.725  53.117  1.00 48.37 ? 3205 HOH A O     1 
HETATM 7299 O  O     . HOH K 6 .   ? 24.811  -5.292  14.894  1.00 50.69 ? 3206 HOH A O     1 
HETATM 7300 O  O     . HOH K 6 .   ? 7.685   23.067  46.214  1.00 48.71 ? 3207 HOH A O     1 
HETATM 7301 O  O     . HOH K 6 .   ? 30.359  -0.124  2.522   1.00 46.36 ? 3208 HOH A O     1 
HETATM 7302 O  O     . HOH K 6 .   ? 39.451  22.784  18.980  1.00 50.89 ? 3209 HOH A O     1 
HETATM 7303 O  O     . HOH K 6 .   ? 28.676  16.600  9.669   1.00 52.43 ? 3210 HOH A O     1 
HETATM 7304 O  O     . HOH K 6 .   ? 7.873   2.929   33.938  1.00 45.31 ? 3211 HOH A O     1 
HETATM 7305 O  O     . HOH K 6 .   ? 19.160  21.920  16.795  1.00 49.91 ? 3212 HOH A O     1 
HETATM 7306 O  O     . HOH K 6 .   ? 29.847  18.950  9.867   1.00 57.78 ? 3213 HOH A O     1 
HETATM 7307 O  O     . HOH K 6 .   ? 16.256  10.188  55.581  1.00 55.70 ? 3214 HOH A O     1 
HETATM 7308 O  O     . HOH K 6 .   ? -2.194  18.178  54.421  1.00 52.69 ? 3215 HOH A O     1 
HETATM 7309 O  O     . HOH K 6 .   ? 32.409  10.731  7.062   1.00 45.79 ? 3216 HOH A O     1 
HETATM 7310 O  O     . HOH K 6 .   ? 16.034  9.732   27.975  1.00 41.82 ? 3217 HOH A O     1 
HETATM 7311 O  O     . HOH K 6 .   ? 34.172  -8.083  30.235  1.00 58.14 ? 3218 HOH A O     1 
HETATM 7312 O  O     . HOH K 6 .   ? 2.607   -7.572  26.196  1.00 50.82 ? 3219 HOH A O     1 
HETATM 7313 O  O     . HOH K 6 .   ? 29.277  6.639   0.151   1.00 55.20 ? 3220 HOH A O     1 
HETATM 7314 O  O     . HOH K 6 .   ? -4.445  8.724   26.920  1.00 43.26 ? 3221 HOH A O     1 
HETATM 7315 O  O     . HOH K 6 .   ? -5.869  15.383  27.933  1.00 52.02 ? 3222 HOH A O     1 
HETATM 7316 O  O     . HOH K 6 .   ? 18.977  -4.405  30.136  1.00 34.44 ? 3223 HOH A O     1 
HETATM 7317 O  O     . HOH K 6 .   ? 13.012  10.703  10.402  1.00 60.35 ? 3224 HOH A O     1 
HETATM 7318 O  O     . HOH K 6 .   ? 1.845   -3.517  20.546  1.00 51.27 ? 3225 HOH A O     1 
HETATM 7319 O  O     . HOH K 6 .   ? 0.986   7.617   27.011  1.00 44.53 ? 3226 HOH A O     1 
HETATM 7320 O  O     . HOH K 6 .   ? 5.486   -2.818  29.954  1.00 51.88 ? 3227 HOH A O     1 
HETATM 7321 O  O     . HOH K 6 .   ? 26.142  -1.397  53.320  1.00 50.25 ? 3228 HOH A O     1 
HETATM 7322 O  O     . HOH K 6 .   ? 27.116  14.279  30.420  1.00 23.11 ? 3229 HOH A O     1 
HETATM 7323 O  O     . HOH K 6 .   ? 9.460   -6.528  11.071  1.00 51.60 ? 3230 HOH A O     1 
HETATM 7324 O  O     . HOH K 6 .   ? 24.268  13.789  33.441  1.00 19.86 ? 3231 HOH A O     1 
HETATM 7325 O  O     . HOH K 6 .   ? 37.414  7.053   35.594  1.00 43.50 ? 3232 HOH A O     1 
HETATM 7326 O  O     . HOH K 6 .   ? 26.369  20.084  17.433  1.00 42.45 ? 3233 HOH A O     1 
HETATM 7327 O  O     . HOH K 6 .   ? 34.834  28.176  20.884  1.00 61.35 ? 3234 HOH A O     1 
HETATM 7328 O  O     . HOH K 6 .   ? 28.472  15.818  46.910  1.00 43.09 ? 3235 HOH A O     1 
HETATM 7329 O  O     . HOH K 6 .   ? 23.411  17.740  30.086  1.00 18.47 ? 3236 HOH A O     1 
HETATM 7330 O  O     . HOH K 6 .   ? 1.504   6.075   15.588  1.00 49.20 ? 3237 HOH A O     1 
HETATM 7331 O  O     . HOH K 6 .   ? 3.706   2.413   9.179   1.00 42.35 ? 3238 HOH A O     1 
HETATM 7332 O  O     . HOH K 6 .   ? 10.459  5.503   8.665   1.00 43.34 ? 3239 HOH A O     1 
HETATM 7333 O  O     . HOH K 6 .   ? 30.766  9.103   7.998   1.00 45.74 ? 3240 HOH A O     1 
HETATM 7334 O  O     . HOH K 6 .   ? 38.391  19.386  10.419  1.00 56.75 ? 3241 HOH A O     1 
HETATM 7335 O  O     . HOH K 6 .   ? 28.680  19.795  17.587  1.00 64.50 ? 3242 HOH A O     1 
HETATM 7336 O  O     . HOH K 6 .   ? 20.326  23.308  18.110  1.00 50.83 ? 3243 HOH A O     1 
HETATM 7337 O  O     . HOH K 6 .   ? 16.242  11.468  33.649  1.00 30.20 ? 3244 HOH A O     1 
HETATM 7338 O  O     . HOH K 6 .   ? 13.456  7.217   28.225  1.00 38.85 ? 3245 HOH A O     1 
HETATM 7339 O  O     . HOH K 6 .   ? 7.832   5.417   30.422  1.00 40.42 ? 3246 HOH A O     1 
HETATM 7340 O  O     . HOH K 6 .   ? 10.140  1.951   30.000  1.00 38.58 ? 3247 HOH A O     1 
HETATM 7341 O  O     . HOH K 6 .   ? -2.321  19.547  38.119  1.00 55.42 ? 3248 HOH A O     1 
HETATM 7342 O  O     . HOH K 6 .   ? -4.404  17.698  40.549  1.00 58.03 ? 3249 HOH A O     1 
HETATM 7343 O  O     . HOH K 6 .   ? 25.846  1.611   49.309  1.00 41.41 ? 3250 HOH A O     1 
HETATM 7344 O  O     . HOH K 6 .   ? 13.624  -1.281  53.669  1.00 48.80 ? 3251 HOH A O     1 
HETATM 7345 O  O     . HOH K 6 .   ? 12.187  -5.565  54.819  1.00 52.96 ? 3252 HOH A O     1 
HETATM 7346 O  O     . HOH K 6 .   ? 29.877  11.247  45.633  1.00 50.18 ? 3253 HOH A O     1 
HETATM 7347 O  O     . HOH K 6 .   ? 31.251  10.786  43.810  1.00 51.15 ? 3254 HOH A O     1 
HETATM 7348 O  O     . HOH K 6 .   ? 36.047  8.829   34.882  1.00 53.44 ? 3255 HOH A O     1 
HETATM 7349 O  O     . HOH K 6 .   ? 25.919  15.769  47.612  1.00 41.56 ? 3256 HOH A O     1 
HETATM 7350 O  O     . HOH K 6 .   ? 38.790  19.974  28.557  1.00 47.40 ? 3257 HOH A O     1 
HETATM 7351 O  O     . HOH K 6 .   ? 20.192  17.036  9.961   1.00 47.23 ? 3258 HOH A O     1 
HETATM 7352 O  O     . HOH K 6 .   ? 28.652  -6.722  18.110  1.00 52.07 ? 3259 HOH A O     1 
HETATM 7353 O  O     . HOH K 6 .   ? 28.972  13.940  36.050  1.00 37.20 ? 3260 HOH A O     1 
HETATM 7354 O  O     . HOH K 6 .   ? 0.469   3.652   35.987  1.00 40.43 ? 3261 HOH A O     1 
HETATM 7355 O  O     . HOH K 6 .   ? 10.457  25.837  21.922  1.00 42.09 ? 3262 HOH A O     1 
HETATM 7356 O  O     . HOH L 6 .   ? 18.356  23.344  28.228  1.00 18.74 ? 177  HOH B O     1 
HETATM 7357 O  O     . HOH L 6 .   ? 12.599  33.137  35.664  1.00 24.69 ? 178  HOH B O     1 
HETATM 7358 O  O     . HOH L 6 .   ? 30.456  22.683  35.066  1.00 23.03 ? 179  HOH B O     1 
HETATM 7359 O  O     . HOH L 6 .   ? 24.272  26.619  31.221  1.00 21.93 ? 180  HOH B O     1 
HETATM 7360 O  O     . HOH L 6 .   ? 15.477  24.051  33.856  1.00 23.44 ? 181  HOH B O     1 
HETATM 7361 O  O     . HOH L 6 .   ? 28.195  25.798  36.072  1.00 22.49 ? 182  HOH B O     1 
HETATM 7362 O  O     . HOH L 6 .   ? 18.000  29.269  27.788  1.00 25.73 ? 183  HOH B O     1 
HETATM 7363 O  O     . HOH L 6 .   ? 18.725  22.991  36.946  1.00 24.84 ? 184  HOH B O     1 
HETATM 7364 O  O     . HOH L 6 .   ? 40.311  29.452  35.158  1.00 33.43 ? 185  HOH B O     1 
HETATM 7365 O  O     . HOH L 6 .   ? 22.707  30.226  21.941  1.00 31.58 ? 186  HOH B O     1 
HETATM 7366 O  O     . HOH L 6 .   ? 8.827   40.078  35.885  1.00 31.99 ? 187  HOH B O     1 
HETATM 7367 O  O     . HOH L 6 .   ? 10.549  33.870  37.950  1.00 26.89 ? 188  HOH B O     1 
HETATM 7368 O  O     . HOH L 6 .   ? 25.251  16.366  43.316  1.00 30.46 ? 189  HOH B O     1 
HETATM 7369 O  O     . HOH L 6 .   ? 15.415  31.899  42.714  1.00 35.59 ? 190  HOH B O     1 
HETATM 7370 O  O     . HOH L 6 .   ? 3.663   24.928  27.815  1.00 37.78 ? 191  HOH B O     1 
HETATM 7371 O  O     . HOH L 6 .   ? 19.272  31.329  43.573  1.00 32.01 ? 192  HOH B O     1 
HETATM 7372 O  O     . HOH L 6 .   ? 41.219  22.072  38.893  1.00 29.71 ? 193  HOH B O     1 
HETATM 7373 O  O     . HOH L 6 .   ? 10.383  20.700  31.499  1.00 26.86 ? 194  HOH B O     1 
HETATM 7374 O  O     . HOH L 6 .   ? 14.817  38.346  39.238  1.00 26.19 ? 195  HOH B O     1 
HETATM 7375 O  O     . HOH L 6 .   ? 16.070  36.338  40.354  1.00 30.25 ? 196  HOH B O     1 
HETATM 7376 O  O     . HOH L 6 .   ? 8.599   38.969  26.646  1.00 32.50 ? 197  HOH B O     1 
HETATM 7377 O  O     . HOH L 6 .   ? 14.377  32.473  23.189  1.00 32.97 ? 198  HOH B O     1 
HETATM 7378 O  O     . HOH L 6 .   ? 25.580  28.334  26.012  1.00 30.11 ? 199  HOH B O     1 
HETATM 7379 O  O     . HOH L 6 .   ? 23.656  25.707  49.583  1.00 33.94 ? 200  HOH B O     1 
HETATM 7380 O  O     . HOH L 6 .   ? 10.718  23.096  34.729  1.00 34.81 ? 201  HOH B O     1 
HETATM 7381 O  O     . HOH L 6 .   ? 35.684  36.100  50.603  1.00 40.07 ? 202  HOH B O     1 
HETATM 7382 O  O     . HOH L 6 .   ? 22.330  41.142  22.236  1.00 37.49 ? 203  HOH B O     1 
HETATM 7383 O  O     . HOH L 6 .   ? 2.536   24.992  31.263  1.00 47.50 ? 204  HOH B O     1 
HETATM 7384 O  O     . HOH L 6 .   ? 35.965  29.127  29.597  1.00 42.27 ? 205  HOH B O     1 
HETATM 7385 O  O     . HOH L 6 .   ? 36.959  17.508  40.719  1.00 34.69 ? 206  HOH B O     1 
HETATM 7386 O  O     . HOH L 6 .   ? 13.303  27.638  39.717  1.00 33.83 ? 207  HOH B O     1 
HETATM 7387 O  O     . HOH L 6 .   ? 10.724  30.911  25.088  1.00 36.72 ? 208  HOH B O     1 
HETATM 7388 O  O     . HOH L 6 .   ? 25.571  22.847  48.766  1.00 34.33 ? 209  HOH B O     1 
HETATM 7389 O  O     . HOH L 6 .   ? 17.698  25.924  23.954  1.00 31.69 ? 210  HOH B O     1 
HETATM 7390 O  O     . HOH L 6 .   ? 30.268  29.414  28.478  1.00 39.92 ? 211  HOH B O     1 
HETATM 7391 O  O     . HOH L 6 .   ? 27.473  38.646  35.500  1.00 36.19 ? 212  HOH B O     1 
HETATM 7392 O  O     . HOH L 6 .   ? 24.657  17.220  45.632  1.00 30.85 ? 213  HOH B O     1 
HETATM 7393 O  O     . HOH L 6 .   ? 26.188  20.023  46.220  1.00 38.04 ? 214  HOH B O     1 
HETATM 7394 O  O     . HOH L 6 .   ? 8.090   33.050  37.243  1.00 37.01 ? 215  HOH B O     1 
HETATM 7395 O  O     . HOH L 6 .   ? 24.073  27.012  53.708  1.00 49.49 ? 216  HOH B O     1 
HETATM 7396 O  O     . HOH L 6 .   ? 24.556  32.930  49.189  1.00 52.58 ? 217  HOH B O     1 
HETATM 7397 O  O     . HOH L 6 .   ? 36.895  19.534  36.110  1.00 32.59 ? 218  HOH B O     1 
HETATM 7398 O  O     . HOH L 6 .   ? 2.865   22.766  31.871  1.00 46.36 ? 219  HOH B O     1 
HETATM 7399 O  O     . HOH L 6 .   ? 16.679  27.354  27.149  1.00 53.44 ? 220  HOH B O     1 
HETATM 7400 O  O     . HOH L 6 .   ? 7.787   30.566  22.979  1.00 40.46 ? 221  HOH B O     1 
HETATM 7401 O  O     . HOH L 6 .   ? 17.209  31.596  13.958  1.00 39.33 ? 222  HOH B O     1 
HETATM 7402 O  O     . HOH L 6 .   ? 28.901  16.602  40.349  1.00 33.04 ? 223  HOH B O     1 
HETATM 7403 O  O     . HOH L 6 .   ? 9.134   41.886  26.363  1.00 43.10 ? 224  HOH B O     1 
HETATM 7404 O  O     . HOH L 6 .   ? 18.177  26.249  43.617  1.00 44.17 ? 225  HOH B O     1 
HETATM 7405 O  O     . HOH L 6 .   ? 28.946  38.921  32.971  1.00 49.10 ? 226  HOH B O     1 
HETATM 7406 O  O     . HOH L 6 .   ? 41.026  18.808  38.904  1.00 37.97 ? 227  HOH B O     1 
HETATM 7407 O  O     . HOH L 6 .   ? 9.498   44.753  41.340  1.00 37.71 ? 228  HOH B O     1 
HETATM 7408 O  O     . HOH L 6 .   ? 6.340   27.909  31.424  1.00 32.57 ? 229  HOH B O     1 
HETATM 7409 O  O     . HOH L 6 .   ? 27.651  15.364  38.535  1.00 34.42 ? 230  HOH B O     1 
HETATM 7410 O  O     . HOH L 6 .   ? 32.571  16.965  46.574  1.00 46.64 ? 231  HOH B O     1 
HETATM 7411 O  O     . HOH L 6 .   ? 30.862  32.873  29.768  1.00 53.53 ? 232  HOH B O     1 
HETATM 7412 O  O     . HOH L 6 .   ? 44.458  26.965  42.613  1.00 42.12 ? 233  HOH B O     1 
HETATM 7413 O  O     . HOH L 6 .   ? 15.670  33.423  19.785  1.00 45.01 ? 234  HOH B O     1 
HETATM 7414 O  O     . HOH L 6 .   ? 19.407  33.689  13.464  1.00 43.40 ? 235  HOH B O     1 
HETATM 7415 O  O     . HOH L 6 .   ? 27.757  29.729  26.776  1.00 43.70 ? 236  HOH B O     1 
HETATM 7416 O  O     . HOH L 6 .   ? 32.989  14.873  42.519  1.00 43.66 ? 237  HOH B O     1 
HETATM 7417 O  O     . HOH L 6 .   ? 39.018  21.786  36.120  1.00 42.88 ? 238  HOH B O     1 
HETATM 7418 O  O     . HOH L 6 .   ? 38.477  34.162  39.051  1.00 33.65 ? 239  HOH B O     1 
HETATM 7419 O  O     . HOH L 6 .   ? 4.117   27.071  29.193  1.00 60.59 ? 240  HOH B O     1 
HETATM 7420 O  O     . HOH L 6 .   ? 5.924   40.220  35.411  1.00 49.63 ? 241  HOH B O     1 
HETATM 7421 O  O     . HOH L 6 .   ? 10.953  26.477  36.268  1.00 38.54 ? 242  HOH B O     1 
HETATM 7422 O  O     . HOH L 6 .   ? 45.126  34.946  51.764  1.00 71.57 ? 243  HOH B O     1 
HETATM 7423 O  O     . HOH L 6 .   ? 18.397  44.942  25.368  1.00 42.02 ? 244  HOH B O     1 
HETATM 7424 O  O     . HOH L 6 .   ? 38.410  33.514  36.605  1.00 40.71 ? 245  HOH B O     1 
HETATM 7425 O  O     . HOH L 6 .   ? 9.522   34.466  42.845  1.00 43.72 ? 246  HOH B O     1 
HETATM 7426 O  O     . HOH L 6 .   ? 18.422  29.152  46.857  1.00 45.03 ? 247  HOH B O     1 
HETATM 7427 O  O     . HOH L 6 .   ? 11.240  30.505  42.299  1.00 54.34 ? 248  HOH B O     1 
HETATM 7428 O  O     . HOH L 6 .   ? 22.258  42.590  25.477  1.00 66.56 ? 249  HOH B O     1 
HETATM 7429 O  O     . HOH L 6 .   ? 2.507   26.046  33.535  1.00 46.65 ? 250  HOH B O     1 
HETATM 7430 O  O     . HOH L 6 .   ? 26.203  39.926  42.085  1.00 45.23 ? 251  HOH B O     1 
HETATM 7431 O  O     . HOH L 6 .   ? 6.068   40.656  39.816  1.00 50.99 ? 252  HOH B O     1 
HETATM 7432 O  O     . HOH L 6 .   ? 7.832   37.536  38.028  1.00 54.88 ? 253  HOH B O     1 
HETATM 7433 O  O     . HOH L 6 .   ? 19.808  36.912  22.410  1.00 45.94 ? 254  HOH B O     1 
HETATM 7434 O  O     . HOH L 6 .   ? 39.353  26.861  29.998  1.00 53.64 ? 255  HOH B O     1 
HETATM 7435 O  O     . HOH L 6 .   ? 32.932  38.177  51.355  1.00 57.10 ? 256  HOH B O     1 
HETATM 7436 O  O     . HOH L 6 .   ? 42.834  32.143  50.885  1.00 57.95 ? 257  HOH B O     1 
HETATM 7437 O  O     . HOH L 6 .   ? 29.441  37.869  45.339  1.00 48.53 ? 258  HOH B O     1 
HETATM 7438 O  O     . HOH L 6 .   ? 19.788  24.562  44.563  1.00 48.09 ? 259  HOH B O     1 
HETATM 7439 O  O     . HOH L 6 .   ? 3.047   37.663  30.452  1.00 58.41 ? 260  HOH B O     1 
HETATM 7440 O  O     . HOH L 6 .   ? 35.625  15.060  40.871  1.00 37.54 ? 261  HOH B O     1 
HETATM 7441 O  O     . HOH L 6 .   ? 32.015  28.498  27.367  1.00 48.12 ? 262  HOH B O     1 
HETATM 7442 O  O     . HOH L 6 .   ? 20.374  35.175  14.665  1.00 52.22 ? 263  HOH B O     1 
HETATM 7443 O  O     . HOH L 6 .   ? 19.159  51.114  40.460  1.00 52.18 ? 264  HOH B O     1 
HETATM 7444 O  O     . HOH L 6 .   ? 26.749  14.382  43.561  1.00 49.93 ? 265  HOH B O     1 
HETATM 7445 O  O     . HOH L 6 .   ? 21.199  47.692  31.052  1.00 44.87 ? 266  HOH B O     1 
HETATM 7446 O  O     . HOH L 6 .   ? 20.155  20.478  38.071  0.50 27.58 ? 267  HOH B O     1 
HETATM 7447 O  O     . HOH L 6 .   ? 9.747   44.649  28.842  1.00 46.69 ? 268  HOH B O     1 
HETATM 7448 O  O     . HOH L 6 .   ? 30.986  14.514  38.235  1.00 35.71 ? 269  HOH B O     1 
HETATM 7449 O  O     . HOH L 6 .   ? 12.638  32.742  24.777  1.00 46.81 ? 270  HOH B O     1 
HETATM 7450 O  O     . HOH L 6 .   ? 23.248  39.104  22.298  1.00 52.42 ? 271  HOH B O     1 
HETATM 7451 O  O     . HOH L 6 .   ? 23.874  40.541  24.873  1.00 54.32 ? 272  HOH B O     1 
HETATM 7452 O  O     . HOH L 6 .   ? 47.232  25.366  54.355  1.00 44.65 ? 273  HOH B O     1 
HETATM 7453 O  O     . HOH L 6 .   ? 15.374  43.261  24.344  1.00 46.29 ? 274  HOH B O     1 
HETATM 7454 O  O     . HOH L 6 .   ? 9.062   42.581  43.105  1.00 51.56 ? 275  HOH B O     1 
HETATM 7455 O  O     . HOH M 6 .   ? 20.267  45.517  9.426   1.00 23.95 ? 3003 HOH C O     1 
HETATM 7456 O  O     . HOH M 6 .   ? 12.718  34.732  10.888  1.00 22.21 ? 3004 HOH C O     1 
HETATM 7457 O  O     . HOH M 6 .   ? 12.111  42.102  12.675  1.00 20.85 ? 3005 HOH C O     1 
HETATM 7458 O  O     . HOH M 6 .   ? 23.078  66.739  17.493  1.00 26.27 ? 3006 HOH C O     1 
HETATM 7459 O  O     . HOH M 6 .   ? 7.630   55.061  6.348   1.00 21.13 ? 3007 HOH C O     1 
HETATM 7460 O  O     . HOH M 6 .   ? 5.814   50.536  6.558   1.00 24.41 ? 3008 HOH C O     1 
HETATM 7461 O  O     . HOH M 6 .   ? 5.746   38.944  16.587  1.00 21.35 ? 3009 HOH C O     1 
HETATM 7462 O  O     . HOH M 6 .   ? 6.785   43.192  19.491  1.00 25.53 ? 3010 HOH C O     1 
HETATM 7463 O  O     . HOH M 6 .   ? 9.608   36.446  21.023  1.00 23.41 ? 3011 HOH C O     1 
HETATM 7464 O  O     . HOH M 6 .   ? 15.182  40.783  11.040  1.00 19.82 ? 3012 HOH C O     1 
HETATM 7465 O  O     . HOH M 6 .   ? 18.182  47.362  10.764  1.00 25.89 ? 3013 HOH C O     1 
HETATM 7466 O  O     . HOH M 6 .   ? 18.017  31.193  8.442   1.00 25.28 ? 3014 HOH C O     1 
HETATM 7467 O  O     . HOH M 6 .   ? -0.787  44.745  17.565  1.00 24.03 ? 3015 HOH C O     1 
HETATM 7468 O  O     . HOH M 6 .   ? 14.446  43.477  11.764  1.00 20.87 ? 3016 HOH C O     1 
HETATM 7469 O  O     . HOH M 6 .   ? 9.215   46.935  18.722  1.00 22.55 ? 3017 HOH C O     1 
HETATM 7470 O  O     . HOH M 6 .   ? 8.229   47.215  0.961   1.00 24.07 ? 3018 HOH C O     1 
HETATM 7471 O  O     . HOH M 6 .   ? 9.370   42.739  -1.263  1.00 25.69 ? 3019 HOH C O     1 
HETATM 7472 O  O     . HOH M 6 .   ? 6.809   48.899  16.186  1.00 26.55 ? 3020 HOH C O     1 
HETATM 7473 O  O     . HOH M 6 .   ? 7.603   48.718  8.052   1.00 36.30 ? 3021 HOH C O     1 
HETATM 7474 O  O     . HOH M 6 .   ? 3.921   41.879  3.257   1.00 29.58 ? 3022 HOH C O     1 
HETATM 7475 O  O     . HOH M 6 .   ? 21.501  67.471  15.409  1.00 30.73 ? 3023 HOH C O     1 
HETATM 7476 O  O     . HOH M 6 .   ? 1.468   47.826  10.596  1.00 26.21 ? 3024 HOH C O     1 
HETATM 7477 O  O     . HOH M 6 .   ? 12.871  35.008  23.009  1.00 29.50 ? 3025 HOH C O     1 
HETATM 7478 O  O     . HOH M 6 .   ? 7.062   51.432  16.113  1.00 27.19 ? 3026 HOH C O     1 
HETATM 7479 O  O     . HOH M 6 .   ? 17.042  38.231  23.056  1.00 35.01 ? 3027 HOH C O     1 
HETATM 7480 O  O     . HOH M 6 .   ? 30.633  48.108  18.593  1.00 33.77 ? 3028 HOH C O     1 
HETATM 7481 O  O     . HOH M 6 .   ? 6.983   53.940  20.804  1.00 30.03 ? 3029 HOH C O     1 
HETATM 7482 O  O     . HOH M 6 .   ? 6.378   47.549  -1.559  1.00 27.00 ? 3030 HOH C O     1 
HETATM 7483 O  O     . HOH M 6 .   ? 1.675   44.404  16.557  1.00 23.45 ? 3031 HOH C O     1 
HETATM 7484 O  O     . HOH M 6 .   ? 0.961   61.737  5.830   1.00 32.02 ? 3032 HOH C O     1 
HETATM 7485 O  O     . HOH M 6 .   ? 16.822  43.384  -7.162  1.00 34.70 ? 3033 HOH C O     1 
HETATM 7486 O  O     . HOH M 6 .   ? 3.015   50.217  5.593   1.00 27.10 ? 3034 HOH C O     1 
HETATM 7487 O  O     . HOH M 6 .   ? 12.485  49.372  10.481  1.00 33.90 ? 3035 HOH C O     1 
HETATM 7488 O  O     . HOH M 6 .   ? 11.393  61.711  -2.659  1.00 36.32 ? 3036 HOH C O     1 
HETATM 7489 O  O     . HOH M 6 .   ? 9.284   38.510  11.314  1.00 31.89 ? 3037 HOH C O     1 
HETATM 7490 O  O     . HOH M 6 .   ? 6.490   52.139  13.411  1.00 29.29 ? 3038 HOH C O     1 
HETATM 7491 O  O     . HOH M 6 .   ? 12.453  63.853  10.320  1.00 35.00 ? 3039 HOH C O     1 
HETATM 7492 O  O     . HOH M 6 .   ? 4.723   56.942  9.043   1.00 31.91 ? 3040 HOH C O     1 
HETATM 7493 O  O     . HOH M 6 .   ? 6.970   44.201  12.183  1.00 27.58 ? 3041 HOH C O     1 
HETATM 7494 O  O     . HOH M 6 .   ? 16.583  44.769  12.888  1.00 22.26 ? 3042 HOH C O     1 
HETATM 7495 O  O     . HOH M 6 .   ? 1.338   61.137  13.368  1.00 32.65 ? 3043 HOH C O     1 
HETATM 7496 O  O     . HOH M 6 .   ? 22.664  57.886  -8.268  1.00 36.41 ? 3044 HOH C O     1 
HETATM 7497 O  O     . HOH M 6 .   ? 9.060   45.559  -1.367  1.00 33.53 ? 3045 HOH C O     1 
HETATM 7498 O  O     . HOH M 6 .   ? 29.019  57.877  25.380  1.00 40.13 ? 3046 HOH C O     1 
HETATM 7499 O  O     . HOH M 6 .   ? 7.462   39.603  9.882   1.00 29.72 ? 3047 HOH C O     1 
HETATM 7500 O  O     . HOH M 6 .   ? 3.983   55.214  11.595  1.00 28.53 ? 3048 HOH C O     1 
HETATM 7501 O  O     . HOH M 6 .   ? 9.398   50.289  -0.336  1.00 28.59 ? 3049 HOH C O     1 
HETATM 7502 O  O     . HOH M 6 .   ? 32.229  37.510  -2.788  1.00 34.47 ? 3050 HOH C O     1 
HETATM 7503 O  O     . HOH M 6 .   ? 19.401  33.579  11.107  1.00 38.07 ? 3051 HOH C O     1 
HETATM 7504 O  O     . HOH M 6 .   ? 3.887   42.133  19.019  1.00 37.36 ? 3052 HOH C O     1 
HETATM 7505 O  O     . HOH M 6 .   ? 8.768   60.855  -3.801  1.00 41.48 ? 3053 HOH C O     1 
HETATM 7506 O  O     . HOH M 6 .   ? 10.355  60.306  2.073   1.00 30.20 ? 3054 HOH C O     1 
HETATM 7507 O  O     . HOH M 6 .   ? 15.777  36.737  -9.468  1.00 32.87 ? 3055 HOH C O     1 
HETATM 7508 O  O     . HOH M 6 .   ? 23.616  32.178  4.296   1.00 32.01 ? 3056 HOH C O     1 
HETATM 7509 O  O     . HOH M 6 .   ? -5.160  63.943  2.870   1.00 34.76 ? 3057 HOH C O     1 
HETATM 7510 O  O     . HOH M 6 .   ? 26.830  33.320  -5.441  1.00 38.76 ? 3058 HOH C O     1 
HETATM 7511 O  O     . HOH M 6 .   ? 4.682   36.555  7.265   1.00 31.04 ? 3059 HOH C O     1 
HETATM 7512 O  O     . HOH M 6 .   ? 12.350  32.143  5.111   1.00 27.12 ? 3060 HOH C O     1 
HETATM 7513 O  O     . HOH M 6 .   ? 8.531   47.077  15.383  1.00 30.09 ? 3061 HOH C O     1 
HETATM 7514 O  O     . HOH M 6 .   ? 0.186   60.253  19.345  1.00 37.41 ? 3062 HOH C O     1 
HETATM 7515 O  O     . HOH M 6 .   ? 35.679  50.280  10.781  1.00 43.29 ? 3063 HOH C O     1 
HETATM 7516 O  O     . HOH M 6 .   ? 35.985  52.460  8.221   1.00 45.74 ? 3064 HOH C O     1 
HETATM 7517 O  O     . HOH M 6 .   ? -0.154  44.825  3.977   1.00 33.74 ? 3065 HOH C O     1 
HETATM 7518 O  O     . HOH M 6 .   ? 26.006  60.613  4.785   1.00 32.24 ? 3066 HOH C O     1 
HETATM 7519 O  O     . HOH M 6 .   ? 10.055  48.964  11.344  1.00 34.32 ? 3067 HOH C O     1 
HETATM 7520 O  O     . HOH M 6 .   ? 21.020  47.810  -17.884 1.00 41.79 ? 3068 HOH C O     1 
HETATM 7521 O  O     . HOH M 6 .   ? 13.082  67.667  13.646  1.00 39.79 ? 3069 HOH C O     1 
HETATM 7522 O  O     . HOH M 6 .   ? -6.543  62.982  6.161   1.00 38.75 ? 3070 HOH C O     1 
HETATM 7523 O  O     . HOH M 6 .   ? -0.583  55.243  27.355  1.00 42.76 ? 3071 HOH C O     1 
HETATM 7524 O  O     . HOH M 6 .   ? 9.243   61.035  7.426   1.00 47.93 ? 3072 HOH C O     1 
HETATM 7525 O  O     . HOH M 6 .   ? 1.120   45.471  6.348   1.00 38.87 ? 3073 HOH C O     1 
HETATM 7526 O  O     . HOH M 6 .   ? 26.047  62.490  12.413  0.50 22.17 ? 3074 HOH C O     1 
HETATM 7527 O  O     . HOH M 6 .   ? 25.765  64.973  22.961  1.00 46.40 ? 3075 HOH C O     1 
HETATM 7528 O  O     . HOH M 6 .   ? 10.706  42.095  10.410  1.00 31.06 ? 3076 HOH C O     1 
HETATM 7529 O  O     . HOH M 6 .   ? 20.191  58.510  25.647  1.00 34.17 ? 3077 HOH C O     1 
HETATM 7530 O  O     . HOH M 6 .   ? 6.330   45.836  -3.716  1.00 38.57 ? 3078 HOH C O     1 
HETATM 7531 O  O     . HOH M 6 .   ? 5.007   51.663  28.738  1.00 47.08 ? 3079 HOH C O     1 
HETATM 7532 O  O     . HOH M 6 .   ? 34.190  34.096  7.097   1.00 47.03 ? 3080 HOH C O     1 
HETATM 7533 O  O     . HOH M 6 .   ? 9.982   58.377  14.127  1.00 31.33 ? 3081 HOH C O     1 
HETATM 7534 O  O     . HOH M 6 .   ? 12.824  43.187  -4.712  1.00 45.67 ? 3082 HOH C O     1 
HETATM 7535 O  O     . HOH M 6 .   ? 19.651  51.260  -16.530 1.00 41.28 ? 3083 HOH C O     1 
HETATM 7536 O  O     . HOH M 6 .   ? 10.377  46.694  -4.234  1.00 38.50 ? 3084 HOH C O     1 
HETATM 7537 O  O     . HOH M 6 .   ? 19.058  48.522  13.199  1.00 40.28 ? 3085 HOH C O     1 
HETATM 7538 O  O     . HOH M 6 .   ? 1.889   44.083  1.926   1.00 36.59 ? 3086 HOH C O     1 
HETATM 7539 O  O     . HOH M 6 .   ? 32.240  36.798  9.955   1.00 41.67 ? 3087 HOH C O     1 
HETATM 7540 O  O     . HOH M 6 .   ? 22.054  36.062  11.319  1.00 38.25 ? 3088 HOH C O     1 
HETATM 7541 O  O     . HOH M 6 .   ? -2.537  44.025  11.685  1.00 35.04 ? 3089 HOH C O     1 
HETATM 7542 O  O     . HOH M 6 .   ? -2.193  62.267  13.563  1.00 37.01 ? 3090 HOH C O     1 
HETATM 7543 O  O     . HOH M 6 .   ? 3.345   62.545  0.257   1.00 37.13 ? 3091 HOH C O     1 
HETATM 7544 O  O     . HOH M 6 .   ? 22.667  61.729  3.229   1.00 41.52 ? 3092 HOH C O     1 
HETATM 7545 O  O     . HOH M 6 .   ? 4.904   55.294  16.367  1.00 36.42 ? 3093 HOH C O     1 
HETATM 7546 O  O     . HOH M 6 .   ? 10.405  53.704  13.961  1.00 30.76 ? 3094 HOH C O     1 
HETATM 7547 O  O     . HOH M 6 .   ? 28.682  41.272  17.064  1.00 50.64 ? 3095 HOH C O     1 
HETATM 7548 O  O     . HOH M 6 .   ? 27.705  43.240  18.264  1.00 41.61 ? 3096 HOH C O     1 
HETATM 7549 O  O     . HOH M 6 .   ? 12.893  51.290  12.371  1.00 36.00 ? 3097 HOH C O     1 
HETATM 7550 O  O     . HOH M 6 .   ? 23.680  37.446  13.015  1.00 42.20 ? 3098 HOH C O     1 
HETATM 7551 O  O     . HOH M 6 .   ? 1.594   43.784  24.131  1.00 52.00 ? 3099 HOH C O     1 
HETATM 7552 O  O     . HOH M 6 .   ? -0.041  61.118  15.330  1.00 45.47 ? 3100 HOH C O     1 
HETATM 7553 O  O     . HOH M 6 .   ? 35.963  39.494  -1.274  1.00 43.25 ? 3101 HOH C O     1 
HETATM 7554 O  O     . HOH M 6 .   ? 22.790  62.859  8.458   1.00 39.39 ? 3102 HOH C O     1 
HETATM 7555 O  O     . HOH M 6 .   ? -12.132 60.218  17.223  1.00 38.16 ? 3103 HOH C O     1 
HETATM 7556 O  O     . HOH M 6 .   ? 22.397  59.921  26.819  1.00 42.96 ? 3104 HOH C O     1 
HETATM 7557 O  O     . HOH M 6 .   ? 4.513   46.653  26.713  1.00 39.28 ? 3105 HOH C O     1 
HETATM 7558 O  O     . HOH M 6 .   ? 8.106   47.966  12.964  1.00 45.22 ? 3106 HOH C O     1 
HETATM 7559 O  O     . HOH M 6 .   ? 16.795  34.820  -7.619  1.00 37.08 ? 3107 HOH C O     1 
HETATM 7560 O  O     . HOH M 6 .   ? 10.249  60.019  -5.921  1.00 40.08 ? 3108 HOH C O     1 
HETATM 7561 O  O     . HOH M 6 .   ? 0.774   44.194  -0.928  1.00 40.46 ? 3109 HOH C O     1 
HETATM 7562 O  O     . HOH M 6 .   ? 23.371  28.698  5.066   1.00 43.04 ? 3110 HOH C O     1 
HETATM 7563 O  O     . HOH M 6 .   ? 14.399  43.545  -6.867  1.00 43.53 ? 3111 HOH C O     1 
HETATM 7564 O  O     . HOH M 6 .   ? 11.051  34.279  20.918  1.00 39.93 ? 3112 HOH C O     1 
HETATM 7565 O  O     . HOH M 6 .   ? 8.836   53.594  17.038  1.00 35.37 ? 3113 HOH C O     1 
HETATM 7566 O  O     . HOH M 6 .   ? 4.578   40.631  6.725   1.00 34.54 ? 3114 HOH C O     1 
HETATM 7567 O  O     . HOH M 6 .   ? -12.585 60.088  5.539   1.00 52.66 ? 3115 HOH C O     1 
HETATM 7568 O  O     . HOH M 6 .   ? 2.089   62.083  8.328   1.00 36.73 ? 3116 HOH C O     1 
HETATM 7569 O  O     . HOH M 6 .   ? 2.840   62.463  -2.277  1.00 38.05 ? 3117 HOH C O     1 
HETATM 7570 O  O     . HOH M 6 .   ? 27.788  63.485  22.290  1.00 36.40 ? 3118 HOH C O     1 
HETATM 7571 O  O     . HOH M 6 .   ? -6.527  61.211  9.224   1.00 47.07 ? 3119 HOH C O     1 
HETATM 7572 O  O     . HOH M 6 .   ? 20.065  47.693  25.924  1.00 41.64 ? 3120 HOH C O     1 
HETATM 7573 O  O     . HOH M 6 .   ? 16.091  44.393  -14.062 1.00 45.83 ? 3121 HOH C O     1 
HETATM 7574 O  O     . HOH M 6 .   ? 5.221   54.381  13.690  1.00 32.46 ? 3122 HOH C O     1 
HETATM 7575 O  O     . HOH M 6 .   ? 4.135   61.232  -7.923  1.00 44.91 ? 3123 HOH C O     1 
HETATM 7576 O  O     . HOH M 6 .   ? 18.815  64.481  3.083   1.00 42.86 ? 3124 HOH C O     1 
HETATM 7577 O  O     . HOH M 6 .   ? 7.139   52.607  25.343  1.00 40.63 ? 3125 HOH C O     1 
HETATM 7578 O  O     . HOH M 6 .   ? 6.449   59.329  8.383   1.00 33.13 ? 3126 HOH C O     1 
HETATM 7579 O  O     . HOH M 6 .   ? 7.159   54.641  23.652  1.00 44.60 ? 3127 HOH C O     1 
HETATM 7580 O  O     . HOH M 6 .   ? 24.840  43.125  19.543  1.00 40.57 ? 3128 HOH C O     1 
HETATM 7581 O  O     . HOH M 6 .   ? 32.067  56.537  0.795   1.00 50.74 ? 3129 HOH C O     1 
HETATM 7582 O  O     . HOH M 6 .   ? 10.693  43.769  -3.916  1.00 37.15 ? 3130 HOH C O     1 
HETATM 7583 O  O     . HOH M 6 .   ? -5.908  53.988  29.499  1.00 47.18 ? 3131 HOH C O     1 
HETATM 7584 O  O     . HOH M 6 .   ? -12.029 51.487  26.030  1.00 46.37 ? 3132 HOH C O     1 
HETATM 7585 O  O     . HOH M 6 .   ? 10.835  55.154  24.819  1.00 42.81 ? 3133 HOH C O     1 
HETATM 7586 O  O     . HOH M 6 .   ? 3.234   60.004  18.551  1.00 57.52 ? 3134 HOH C O     1 
HETATM 7587 O  O     . HOH M 6 .   ? 3.201   39.521  3.382   1.00 45.51 ? 3135 HOH C O     1 
HETATM 7588 O  O     . HOH M 6 .   ? 3.506   39.998  8.882   1.00 48.38 ? 3136 HOH C O     1 
HETATM 7589 O  O     . HOH M 6 .   ? -6.019  42.413  21.459  1.00 43.50 ? 3137 HOH C O     1 
HETATM 7590 O  O     . HOH M 6 .   ? 5.407   61.642  -4.922  1.00 40.14 ? 3138 HOH C O     1 
HETATM 7591 O  O     . HOH M 6 .   ? -12.797 59.451  19.736  1.00 44.62 ? 3139 HOH C O     1 
HETATM 7592 O  O     . HOH M 6 .   ? 16.063  47.638  -9.541  1.00 51.95 ? 3140 HOH C O     1 
HETATM 7593 O  O     . HOH M 6 .   ? -2.838  61.166  -4.669  1.00 46.48 ? 3141 HOH C O     1 
HETATM 7594 O  O     . HOH M 6 .   ? -12.035 46.813  -2.857  1.00 58.65 ? 3142 HOH C O     1 
HETATM 7595 O  O     . HOH M 6 .   ? 16.445  67.871  14.393  1.00 40.42 ? 3143 HOH C O     1 
HETATM 7596 O  O     . HOH M 6 .   ? 32.757  42.822  -16.911 1.00 49.26 ? 3144 HOH C O     1 
HETATM 7597 O  O     . HOH M 6 .   ? 1.349   64.885  9.092   1.00 48.54 ? 3145 HOH C O     1 
HETATM 7598 O  O     . HOH M 6 .   ? 16.707  48.427  26.703  1.00 44.35 ? 3146 HOH C O     1 
HETATM 7599 O  O     . HOH M 6 .   ? 21.375  37.317  16.074  1.00 43.76 ? 3147 HOH C O     1 
HETATM 7600 O  O     . HOH M 6 .   ? 40.804  46.037  13.390  1.00 46.24 ? 3148 HOH C O     1 
HETATM 7601 O  O     . HOH M 6 .   ? 14.633  46.974  23.219  1.00 51.80 ? 3149 HOH C O     1 
HETATM 7602 O  O     . HOH M 6 .   ? 35.632  40.293  5.270   1.00 46.49 ? 3150 HOH C O     1 
HETATM 7603 O  O     . HOH M 6 .   ? 26.304  60.762  2.195   1.00 41.62 ? 3151 HOH C O     1 
HETATM 7604 O  O     . HOH M 6 .   ? 32.813  55.351  6.937   1.00 42.78 ? 3152 HOH C O     1 
HETATM 7605 O  O     . HOH M 6 .   ? 1.624   45.663  11.216  1.00 49.34 ? 3153 HOH C O     1 
HETATM 7606 O  O     . HOH M 6 .   ? 16.073  65.492  -0.530  1.00 50.42 ? 3154 HOH C O     1 
HETATM 7607 O  O     . HOH M 6 .   ? 10.869  62.277  0.261   1.00 39.96 ? 3155 HOH C O     1 
HETATM 7608 O  O     . HOH M 6 .   ? 10.840  61.498  4.697   1.00 37.14 ? 3156 HOH C O     1 
HETATM 7609 O  O     . HOH M 6 .   ? 6.169   46.211  10.991  1.00 41.41 ? 3157 HOH C O     1 
HETATM 7610 O  O     . HOH M 6 .   ? 29.872  58.660  -9.515  1.00 58.86 ? 3158 HOH C O     1 
HETATM 7611 O  O     . HOH M 6 .   ? 8.888   57.427  19.859  1.00 44.21 ? 3159 HOH C O     1 
HETATM 7612 O  O     . HOH M 6 .   ? 9.661   54.870  20.018  1.00 38.50 ? 3160 HOH C O     1 
HETATM 7613 O  O     . HOH M 6 .   ? 33.816  42.660  -8.987  1.00 50.07 ? 3161 HOH C O     1 
HETATM 7614 O  O     . HOH M 6 .   ? 16.831  63.837  8.944   1.00 41.81 ? 3162 HOH C O     1 
HETATM 7615 O  O     . HOH M 6 .   ? -13.401 49.453  1.496   1.00 50.55 ? 3163 HOH C O     1 
HETATM 7616 O  O     . HOH M 6 .   ? 15.564  62.744  5.785   1.00 39.12 ? 3164 HOH C O     1 
HETATM 7617 O  O     . HOH M 6 .   ? -16.554 60.973  10.600  1.00 54.17 ? 3165 HOH C O     1 
HETATM 7618 O  O     . HOH M 6 .   ? -4.723  61.560  14.566  1.00 52.01 ? 3166 HOH C O     1 
HETATM 7619 O  O     . HOH M 6 .   ? 13.481  63.675  -3.410  1.00 48.01 ? 3167 HOH C O     1 
HETATM 7620 O  O     . HOH M 6 .   ? 7.206   43.472  22.276  1.00 39.74 ? 3168 HOH C O     1 
HETATM 7621 O  O     . HOH M 6 .   ? 27.990  30.377  -3.045  1.00 50.44 ? 3169 HOH C O     1 
HETATM 7622 O  O     . HOH M 6 .   ? 26.544  63.783  -6.707  1.00 44.28 ? 3170 HOH C O     1 
HETATM 7623 O  O     . HOH M 6 .   ? 30.548  59.117  18.356  1.00 44.59 ? 3171 HOH C O     1 
HETATM 7624 O  O     . HOH M 6 .   ? 2.753   52.060  30.704  1.00 48.12 ? 3172 HOH C O     1 
HETATM 7625 O  O     . HOH M 6 .   ? -5.385  63.529  16.236  1.00 51.61 ? 3173 HOH C O     1 
HETATM 7626 O  O     . HOH M 6 .   ? 31.246  58.495  13.852  1.00 55.48 ? 3174 HOH C O     1 
HETATM 7627 O  O     . HOH M 6 .   ? 37.690  41.398  6.331   1.00 53.26 ? 3175 HOH C O     1 
HETATM 7628 O  O     . HOH M 6 .   ? 34.485  56.895  10.043  1.00 47.10 ? 3176 HOH C O     1 
HETATM 7629 O  O     . HOH M 6 .   ? 35.236  40.057  -3.672  1.00 44.96 ? 3177 HOH C O     1 
HETATM 7630 O  O     . HOH M 6 .   ? 34.880  53.495  14.817  1.00 53.54 ? 3178 HOH C O     1 
HETATM 7631 O  O     . HOH M 6 .   ? -5.401  62.933  11.400  1.00 48.50 ? 3179 HOH C O     1 
HETATM 7632 O  O     . HOH M 6 .   ? 12.310  43.244  -8.365  1.00 42.60 ? 3180 HOH C O     1 
HETATM 7633 O  O     . HOH M 6 .   ? 29.824  61.706  -8.256  1.00 54.06 ? 3181 HOH C O     1 
HETATM 7634 O  O     . HOH M 6 .   ? 35.254  47.507  -6.936  1.00 56.73 ? 3182 HOH C O     1 
HETATM 7635 O  O     . HOH M 6 .   ? 19.777  34.820  -7.730  1.00 44.85 ? 3183 HOH C O     1 
HETATM 7636 O  O     . HOH M 6 .   ? 18.960  27.133  1.981   1.00 54.82 ? 3184 HOH C O     1 
HETATM 7637 O  O     . HOH M 6 .   ? 32.241  50.370  19.914  1.00 48.82 ? 3185 HOH C O     1 
HETATM 7638 O  O     . HOH M 6 .   ? 24.208  35.710  7.802   1.00 59.87 ? 3186 HOH C O     1 
HETATM 7639 O  O     . HOH M 6 .   ? 10.659  44.579  1.346   1.00 22.67 ? 3187 HOH C O     1 
HETATM 7640 O  O     . HOH M 6 .   ? 26.384  54.282  -18.283 1.00 43.92 ? 3188 HOH C O     1 
HETATM 7641 O  O     . HOH M 6 .   ? 6.214   42.971  7.629   1.00 41.19 ? 3189 HOH C O     1 
HETATM 7642 O  O     . HOH M 6 .   ? 14.504  42.988  0.533   1.00 21.39 ? 3190 HOH C O     1 
HETATM 7643 O  O     . HOH M 6 .   ? 24.903  62.549  10.901  0.50 35.89 ? 3191 HOH C O     1 
HETATM 7644 O  O     . HOH M 6 .   ? 22.139  53.961  30.958  1.00 47.85 ? 3192 HOH C O     1 
HETATM 7645 O  O     . HOH M 6 .   ? 28.697  61.112  18.673  1.00 50.40 ? 3193 HOH C O     1 
HETATM 7646 O  O     . HOH M 6 .   ? 12.197  40.454  4.243   1.00 18.68 ? 3194 HOH C O     1 
HETATM 7647 O  O     . HOH M 6 .   ? -4.078  48.521  -7.032  1.00 44.28 ? 3195 HOH C O     1 
HETATM 7648 O  O     . HOH M 6 .   ? 11.993  58.087  -12.784 1.00 47.46 ? 3196 HOH C O     1 
HETATM 7649 O  O     . HOH M 6 .   ? -0.378  60.346  23.008  1.00 52.67 ? 3197 HOH C O     1 
HETATM 7650 O  O     . HOH M 6 .   ? 1.055   57.043  25.157  1.00 51.88 ? 3198 HOH C O     1 
HETATM 7651 O  O     . HOH M 6 .   ? 8.775   49.585  8.716   1.00 28.36 ? 3199 HOH C O     1 
HETATM 7652 O  O     . HOH M 6 .   ? 7.889   42.159  8.593   1.00 39.35 ? 3200 HOH C O     1 
HETATM 7653 O  O     . HOH M 6 .   ? 18.445  36.486  20.075  1.00 34.19 ? 3201 HOH C O     1 
HETATM 7654 O  O     . HOH M 6 .   ? 21.942  37.575  20.742  1.00 50.62 ? 3202 HOH C O     1 
HETATM 7655 O  O     . HOH M 6 .   ? 29.119  45.359  20.480  1.00 51.71 ? 3203 HOH C O     1 
HETATM 7656 O  O     . HOH M 6 .   ? 15.235  41.053  26.264  1.00 42.98 ? 3204 HOH C O     1 
HETATM 7657 O  O     . HOH M 6 .   ? 15.578  46.882  10.282  1.00 42.73 ? 3205 HOH C O     1 
HETATM 7658 O  O     . HOH M 6 .   ? 13.735  47.484  11.017  1.00 44.82 ? 3206 HOH C O     1 
HETATM 7659 O  O     . HOH M 6 .   ? -1.398  42.711  15.244  1.00 40.22 ? 3207 HOH C O     1 
HETATM 7660 O  O     . HOH M 6 .   ? 7.409   62.438  2.986   1.00 44.15 ? 3208 HOH C O     1 
HETATM 7661 O  O     . HOH M 6 .   ? 21.745  34.092  -6.313  1.00 46.59 ? 3209 HOH C O     1 
HETATM 7662 O  O     . HOH M 6 .   ? 13.600  33.736  15.637  1.00 47.67 ? 3210 HOH C O     1 
HETATM 7663 O  O     . HOH M 6 .   ? 22.465  32.206  8.502   1.00 44.49 ? 3211 HOH C O     1 
HETATM 7664 O  O     . HOH M 6 .   ? 30.192  40.306  -11.291 1.00 57.80 ? 3212 HOH C O     1 
HETATM 7665 O  O     . HOH M 6 .   ? 10.651  42.513  24.762  1.00 42.31 ? 3213 HOH C O     1 
HETATM 7666 O  O     . HOH M 6 .   ? 35.000  47.865  2.161   1.00 42.30 ? 3214 HOH C O     1 
HETATM 7667 O  O     . HOH M 6 .   ? 27.337  62.412  -4.137  1.00 53.95 ? 3215 HOH C O     1 
HETATM 7668 O  O     . HOH N 6 .   ? 3.767   36.572  9.912   1.00 22.72 ? 172  HOH D O     1 
HETATM 7669 O  O     . HOH N 6 .   ? -1.102  28.580  12.501  1.00 25.09 ? 173  HOH D O     1 
HETATM 7670 O  O     . HOH N 6 .   ? 10.030  35.867  10.308  1.00 22.03 ? 174  HOH D O     1 
HETATM 7671 O  O     . HOH N 6 .   ? 15.882  27.439  10.420  1.00 31.05 ? 175  HOH D O     1 
HETATM 7672 O  O     . HOH N 6 .   ? -4.370  23.589  9.550   1.00 26.08 ? 176  HOH D O     1 
HETATM 7673 O  O     . HOH N 6 .   ? -4.346  29.731  2.423   1.00 31.10 ? 177  HOH D O     1 
HETATM 7674 O  O     . HOH N 6 .   ? 7.477   32.437  -1.849  1.00 25.93 ? 178  HOH D O     1 
HETATM 7675 O  O     . HOH N 6 .   ? 9.490   31.852  4.048   1.00 24.36 ? 179  HOH D O     1 
HETATM 7676 O  O     . HOH N 6 .   ? 13.041  32.984  13.395  1.00 35.92 ? 180  HOH D O     1 
HETATM 7677 O  O     . HOH N 6 .   ? 10.146  34.859  -3.624  1.00 26.03 ? 181  HOH D O     1 
HETATM 7678 O  O     . HOH N 6 .   ? 10.438  27.540  17.299  1.00 36.45 ? 182  HOH D O     1 
HETATM 7679 O  O     . HOH N 6 .   ? -4.278  25.418  7.836   1.00 29.39 ? 183  HOH D O     1 
HETATM 7680 O  O     . HOH N 6 .   ? -0.570  40.102  -5.785  1.00 37.17 ? 184  HOH D O     1 
HETATM 7681 O  O     . HOH N 6 .   ? -4.733  22.872  16.517  1.00 33.40 ? 185  HOH D O     1 
HETATM 7682 O  O     . HOH N 6 .   ? 2.836   37.277  5.460   1.00 24.94 ? 186  HOH D O     1 
HETATM 7683 O  O     . HOH N 6 .   ? -1.655  20.014  -1.193  1.00 32.17 ? 187  HOH D O     1 
HETATM 7684 O  O     . HOH N 6 .   ? 14.268  29.071  5.647   1.00 37.11 ? 188  HOH D O     1 
HETATM 7685 O  O     . HOH N 6 .   ? 2.056   43.435  -3.687  1.00 28.22 ? 189  HOH D O     1 
HETATM 7686 O  O     . HOH N 6 .   ? 4.220   40.628  15.007  1.00 33.35 ? 190  HOH D O     1 
HETATM 7687 O  O     . HOH N 6 .   ? 8.954   30.129  11.582  1.00 30.96 ? 191  HOH D O     1 
HETATM 7688 O  O     . HOH N 6 .   ? -3.112  34.329  9.075   1.00 34.11 ? 192  HOH D O     1 
HETATM 7689 O  O     . HOH N 6 .   ? 2.478   41.712  16.589  1.00 37.48 ? 193  HOH D O     1 
HETATM 7690 O  O     . HOH N 6 .   ? 0.661   34.464  19.503  1.00 32.52 ? 194  HOH D O     1 
HETATM 7691 O  O     . HOH N 6 .   ? -6.130  9.971   6.953   1.00 33.63 ? 195  HOH D O     1 
HETATM 7692 O  O     . HOH N 6 .   ? 9.766   38.909  -12.781 1.00 37.90 ? 196  HOH D O     1 
HETATM 7693 O  O     . HOH N 6 .   ? 4.711   20.105  0.731   1.00 30.07 ? 197  HOH D O     1 
HETATM 7694 O  O     . HOH N 6 .   ? 0.924   38.695  13.527  1.00 41.62 ? 198  HOH D O     1 
HETATM 7695 O  O     . HOH N 6 .   ? -6.234  27.922  2.083   1.00 39.21 ? 199  HOH D O     1 
HETATM 7696 O  O     . HOH N 6 .   ? -4.375  28.556  13.278  1.00 31.18 ? 200  HOH D O     1 
HETATM 7697 O  O     . HOH N 6 .   ? 13.093  36.861  -9.846  1.00 36.39 ? 201  HOH D O     1 
HETATM 7698 O  O     . HOH N 6 .   ? 7.985   27.854  18.039  1.00 39.43 ? 202  HOH D O     1 
HETATM 7699 O  O     . HOH N 6 .   ? 9.872   22.648  -3.888  1.00 41.68 ? 203  HOH D O     1 
HETATM 7700 O  O     . HOH N 6 .   ? 7.538   43.552  -3.730  1.00 39.38 ? 204  HOH D O     1 
HETATM 7701 O  O     . HOH N 6 .   ? -3.677  17.850  -0.876  1.00 41.00 ? 205  HOH D O     1 
HETATM 7702 O  O     . HOH N 6 .   ? 12.682  21.698  13.564  1.00 42.15 ? 206  HOH D O     1 
HETATM 7703 O  O     . HOH N 6 .   ? 14.398  27.387  3.524   1.00 39.02 ? 207  HOH D O     1 
HETATM 7704 O  O     . HOH N 6 .   ? 7.678   22.584  -11.368 1.00 38.61 ? 208  HOH D O     1 
HETATM 7705 O  O     . HOH N 6 .   ? 13.032  26.313  -11.304 1.00 36.26 ? 209  HOH D O     1 
HETATM 7706 O  O     . HOH N 6 .   ? -10.079 18.707  13.970  1.00 46.70 ? 210  HOH D O     1 
HETATM 7707 O  O     . HOH N 6 .   ? -5.389  32.888  2.527   1.00 47.39 ? 211  HOH D O     1 
HETATM 7708 O  O     . HOH N 6 .   ? 12.158  23.689  -11.373 1.00 38.45 ? 212  HOH D O     1 
HETATM 7709 O  O     . HOH N 6 .   ? -4.524  30.306  15.564  1.00 38.68 ? 213  HOH D O     1 
HETATM 7710 O  O     . HOH N 6 .   ? 13.134  24.382  0.270   1.00 45.71 ? 214  HOH D O     1 
HETATM 7711 O  O     . HOH N 6 .   ? 9.542   16.837  9.641   1.00 43.09 ? 215  HOH D O     1 
HETATM 7712 O  O     . HOH N 6 .   ? 10.192  22.813  -9.815  1.00 34.79 ? 216  HOH D O     1 
HETATM 7713 O  O     . HOH N 6 .   ? 13.897  27.591  0.853   1.00 43.22 ? 217  HOH D O     1 
HETATM 7714 O  O     . HOH N 6 .   ? -0.242  42.931  -4.774  1.00 39.60 ? 218  HOH D O     1 
HETATM 7715 O  O     . HOH N 6 .   ? -10.264 15.835  6.965   1.00 45.16 ? 219  HOH D O     1 
HETATM 7716 O  O     . HOH N 6 .   ? 13.338  34.541  -11.624 1.00 40.34 ? 220  HOH D O     1 
HETATM 7717 O  O     . HOH N 6 .   ? 15.512  31.480  12.236  1.00 46.33 ? 221  HOH D O     1 
HETATM 7718 O  O     . HOH N 6 .   ? -3.866  9.270   18.283  1.00 51.47 ? 222  HOH D O     1 
HETATM 7719 O  O     . HOH N 6 .   ? -5.269  20.198  -11.332 1.00 46.85 ? 223  HOH D O     1 
HETATM 7720 O  O     . HOH N 6 .   ? 7.051   29.733  19.331  1.00 40.30 ? 224  HOH D O     1 
HETATM 7721 O  O     . HOH N 6 .   ? -6.531  27.534  -4.652  1.00 50.94 ? 225  HOH D O     1 
HETATM 7722 O  O     . HOH N 6 .   ? 0.688   16.955  19.841  1.00 44.08 ? 226  HOH D O     1 
HETATM 7723 O  O     . HOH N 6 .   ? -4.079  35.046  3.386   1.00 48.00 ? 227  HOH D O     1 
HETATM 7724 O  O     . HOH N 6 .   ? -6.757  26.296  15.867  1.00 59.66 ? 228  HOH D O     1 
HETATM 7725 O  O     . HOH N 6 .   ? 0.391   17.258  4.970   1.00 39.58 ? 229  HOH D O     1 
HETATM 7726 O  O     . HOH N 6 .   ? 6.505   20.443  -9.936  1.00 40.34 ? 230  HOH D O     1 
HETATM 7727 O  O     . HOH N 6 .   ? 5.848   43.190  -10.219 1.00 59.51 ? 231  HOH D O     1 
HETATM 7728 O  O     . HOH N 6 .   ? -2.865  29.494  19.579  1.00 46.76 ? 232  HOH D O     1 
HETATM 7729 O  O     . HOH N 6 .   ? -6.053  6.214   7.472   1.00 57.40 ? 233  HOH D O     1 
HETATM 7730 O  O     . HOH N 6 .   ? -0.079  40.570  12.001  1.00 48.95 ? 234  HOH D O     1 
HETATM 7731 O  O     . HOH N 6 .   ? -3.617  23.220  21.335  1.00 48.36 ? 235  HOH D O     1 
HETATM 7732 O  O     . HOH N 6 .   ? -12.288 8.589   10.605  1.00 40.75 ? 236  HOH D O     1 
HETATM 7733 O  O     . HOH N 6 .   ? 5.393   17.688  5.476   1.00 49.56 ? 237  HOH D O     1 
HETATM 7734 O  O     . HOH N 6 .   ? -9.848  28.602  -6.861  1.00 54.50 ? 238  HOH D O     1 
HETATM 7735 O  O     . HOH N 6 .   ? 15.839  26.896  -4.996  1.00 43.75 ? 239  HOH D O     1 
HETATM 7736 O  O     . HOH N 6 .   ? 14.221  19.286  4.887   1.00 55.79 ? 240  HOH D O     1 
HETATM 7737 O  O     . HOH N 6 .   ? 12.264  18.096  9.596   1.00 44.93 ? 241  HOH D O     1 
HETATM 7738 O  O     . HOH N 6 .   ? 12.785  16.634  12.507  1.00 41.40 ? 242  HOH D O     1 
HETATM 7739 O  O     . HOH N 6 .   ? 9.538   14.761  11.368  1.00 46.29 ? 243  HOH D O     1 
HETATM 7740 O  O     . HOH N 6 .   ? 6.792   16.091  6.817   1.00 54.21 ? 244  HOH D O     1 
HETATM 7741 O  O     . HOH N 6 .   ? 3.275   11.782  8.774   1.00 58.30 ? 245  HOH D O     1 
HETATM 7742 O  O     . HOH N 6 .   ? 6.174   42.077  -5.365  1.00 39.13 ? 246  HOH D O     1 
HETATM 7743 O  O     . HOH N 6 .   ? 9.713   43.152  -6.491  1.00 43.98 ? 247  HOH D O     1 
HETATM 7744 O  O     . HOH N 6 .   ? 3.476   44.824  -4.766  1.00 43.24 ? 248  HOH D O     1 
HETATM 7745 O  O     . HOH N 6 .   ? 18.139  31.700  -9.521  1.00 43.74 ? 249  HOH D O     1 
HETATM 7746 O  O     . HOH N 6 .   ? 20.675  30.976  -8.643  1.00 53.65 ? 250  HOH D O     1 
HETATM 7747 O  O     . HOH N 6 .   ? 9.454   33.440  13.490  1.00 42.81 ? 251  HOH D O     1 
HETATM 7748 O  O     . HOH N 6 .   ? -0.437  32.977  21.142  1.00 40.68 ? 252  HOH D O     1 
HETATM 7749 O  O     . HOH N 6 .   ? -6.421  35.598  -1.970  1.00 53.00 ? 253  HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   2   ?   ?   ?   A . n 
A 1 2   MET 2   3   ?   ?   ?   A . n 
A 1 3   THR 3   4   ?   ?   ?   A . n 
A 1 4   LEU 4   5   ?   ?   ?   A . n 
A 1 5   SER 5   6   ?   ?   ?   A . n 
A 1 6   ALA 6   7   ?   ?   ?   A . n 
A 1 7   GLU 7   8   ?   ?   ?   A . n 
A 1 8   ASP 8   9   ?   ?   ?   A . n 
A 1 9   LYS 9   10  ?   ?   ?   A . n 
A 1 10  ALA 10  11  ?   ?   ?   A . n 
A 1 11  ALA 11  12  ?   ?   ?   A . n 
A 1 12  VAL 12  13  ?   ?   ?   A . n 
A 1 13  GLU 13  14  ?   ?   ?   A . n 
A 1 14  ARG 14  15  ?   ?   ?   A . n 
A 1 15  SER 15  16  ?   ?   ?   A . n 
A 1 16  LYS 16  17  ?   ?   ?   A . n 
A 1 17  MET 17  18  ?   ?   ?   A . n 
A 1 18  ILE 18  19  ?   ?   ?   A . n 
A 1 19  ASP 19  20  ?   ?   ?   A . n 
A 1 20  ARG 20  21  ?   ?   ?   A . n 
A 1 21  ASN 21  22  ?   ?   ?   A . n 
A 1 22  LEU 22  23  ?   ?   ?   A . n 
A 1 23  ARG 23  24  ?   ?   ?   A . n 
A 1 24  GLU 24  25  ?   ?   ?   A . n 
A 1 25  ASP 25  26  ?   ?   ?   A . n 
A 1 26  GLY 26  27  ?   ?   ?   A . n 
A 1 27  GLU 27  28  ?   ?   ?   A . n 
A 1 28  LYS 28  29  ?   ?   ?   A . n 
A 1 29  ALA 29  30  ?   ?   ?   A . n 
A 1 30  ALA 30  31  ?   ?   ?   A . n 
A 1 31  LYS 31  32  ?   ?   ?   A . n 
A 1 32  GLU 32  33  33  GLU GLU A . n 
A 1 33  VAL 33  34  34  VAL VAL A . n 
A 1 34  LYS 34  35  35  LYS LYS A . n 
A 1 35  LEU 35  36  36  LEU LEU A . n 
A 1 36  LEU 36  37  37  LEU LEU A . n 
A 1 37  LEU 37  38  38  LEU LEU A . n 
A 1 38  LEU 38  39  39  LEU LEU A . n 
A 1 39  GLY 39  40  40  GLY GLY A . n 
A 1 40  ALA 40  41  41  ALA ALA A . n 
A 1 41  GLY 41  42  42  GLY GLY A . n 
A 1 42  GLU 42  43  43  GLU GLU A . n 
A 1 43  SER 43  44  44  SER SER A . n 
A 1 44  GLY 44  45  45  GLY GLY A . n 
A 1 45  LYS 45  46  46  LYS LYS A . n 
A 1 46  SER 46  47  47  SER SER A . n 
A 1 47  THR 47  48  48  THR THR A . n 
A 1 48  ILE 48  49  49  ILE ILE A . n 
A 1 49  VAL 49  50  50  VAL VAL A . n 
A 1 50  LYS 50  51  51  LYS LYS A . n 
A 1 51  GLN 51  52  52  GLN GLN A . n 
A 1 52  MET 52  53  53  MET MET A . n 
A 1 53  LYS 53  54  54  LYS LYS A . n 
A 1 54  ILE 54  55  55  ILE ILE A . n 
A 1 55  ILE 55  56  56  ILE ILE A . n 
A 1 56  HIS 56  57  57  HIS HIS A . n 
A 1 57  GLU 57  58  58  GLU GLU A . n 
A 1 58  ASP 58  59  59  ASP ASP A . n 
A 1 59  GLY 59  60  60  GLY GLY A . n 
A 1 60  TYR 60  61  61  TYR TYR A . n 
A 1 61  SER 61  62  62  SER SER A . n 
A 1 62  GLU 62  63  63  GLU GLU A . n 
A 1 63  ASP 63  64  64  ASP ASP A . n 
A 1 64  GLU 64  65  65  GLU GLU A . n 
A 1 65  CYS 65  66  66  CYS CYS A . n 
A 1 66  LYS 66  67  67  LYS LYS A . n 
A 1 67  GLN 67  68  68  GLN GLN A . n 
A 1 68  TYR 68  69  69  TYR TYR A . n 
A 1 69  LYS 69  70  70  LYS LYS A . n 
A 1 70  VAL 70  71  71  VAL VAL A . n 
A 1 71  VAL 71  72  72  VAL VAL A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  TYR 73  74  74  TYR TYR A . n 
A 1 74  SER 74  75  75  SER SER A . n 
A 1 75  ASN 75  76  76  ASN ASN A . n 
A 1 76  THR 76  77  77  THR THR A . n 
A 1 77  ILE 77  78  78  ILE ILE A . n 
A 1 78  GLN 78  79  79  GLN GLN A . n 
A 1 79  SER 79  80  80  SER SER A . n 
A 1 80  ILE 80  81  81  ILE ILE A . n 
A 1 81  ILE 81  82  82  ILE ILE A . n 
A 1 82  ALA 82  83  83  ALA ALA A . n 
A 1 83  ILE 83  84  84  ILE ILE A . n 
A 1 84  ILE 84  85  85  ILE ILE A . n 
A 1 85  ARG 85  86  86  ARG ARG A . n 
A 1 86  ALA 86  87  87  ALA ALA A . n 
A 1 87  MET 87  88  88  MET MET A . n 
A 1 88  GLY 88  89  89  GLY GLY A . n 
A 1 89  ARG 89  90  90  ARG ARG A . n 
A 1 90  LEU 90  91  91  LEU LEU A . n 
A 1 91  LYS 91  92  92  LYS LYS A . n 
A 1 92  ILE 92  93  93  ILE ILE A . n 
A 1 93  ASP 93  94  94  ASP ASP A . n 
A 1 94  PHE 94  95  95  PHE PHE A . n 
A 1 95  GLY 95  96  96  GLY GLY A . n 
A 1 96  GLU 96  97  97  GLU GLU A . n 
A 1 97  ALA 97  98  98  ALA ALA A . n 
A 1 98  ALA 98  99  99  ALA ALA A . n 
A 1 99  ARG 99  100 100 ARG ARG A . n 
A 1 100 ALA 100 101 101 ALA ALA A . n 
A 1 101 ASP 101 102 102 ASP ASP A . n 
A 1 102 ASP 102 103 103 ASP ASP A . n 
A 1 103 ALA 103 104 104 ALA ALA A . n 
A 1 104 ARG 104 105 105 ARG ARG A . n 
A 1 105 GLN 105 106 106 GLN GLN A . n 
A 1 106 LEU 106 107 107 LEU LEU A . n 
A 1 107 PHE 107 108 108 PHE PHE A . n 
A 1 108 VAL 108 109 109 VAL VAL A . n 
A 1 109 LEU 109 110 110 LEU LEU A . n 
A 1 110 ALA 110 111 111 ALA ALA A . n 
A 1 111 GLY 111 112 112 GLY GLY A . n 
A 1 112 SER 112 113 113 SER SER A . n 
A 1 113 ALA 113 114 114 ALA ALA A . n 
A 1 114 GLU 114 115 115 GLU GLU A . n 
A 1 115 GLU 115 116 116 GLU GLU A . n 
A 1 116 GLY 116 117 117 GLY GLY A . n 
A 1 117 VAL 117 118 118 VAL VAL A . n 
A 1 118 MET 118 119 119 MET MET A . n 
A 1 119 THR 119 120 120 THR THR A . n 
A 1 120 PRO 120 121 121 PRO PRO A . n 
A 1 121 GLU 121 122 122 GLU GLU A . n 
A 1 122 LEU 122 123 123 LEU LEU A . n 
A 1 123 ALA 123 124 124 ALA ALA A . n 
A 1 124 GLY 124 125 125 GLY GLY A . n 
A 1 125 VAL 125 126 126 VAL VAL A . n 
A 1 126 ILE 126 127 127 ILE ILE A . n 
A 1 127 LYS 127 128 128 LYS LYS A . n 
A 1 128 ARG 128 129 129 ARG ARG A . n 
A 1 129 LEU 129 130 130 LEU LEU A . n 
A 1 130 TRP 130 131 131 TRP TRP A . n 
A 1 131 ARG 131 132 132 ARG ARG A . n 
A 1 132 ASP 132 133 133 ASP ASP A . n 
A 1 133 GLY 133 134 134 GLY GLY A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 VAL 135 136 136 VAL VAL A . n 
A 1 136 GLN 136 137 137 GLN GLN A . n 
A 1 137 ALA 137 138 138 ALA ALA A . n 
A 1 138 CYS 138 139 139 CYS CYS A . n 
A 1 139 PHE 139 140 140 PHE PHE A . n 
A 1 140 SER 140 141 141 SER SER A . n 
A 1 141 ARG 141 142 142 ARG ARG A . n 
A 1 142 SER 142 143 143 SER SER A . n 
A 1 143 ARG 143 144 144 ARG ARG A . n 
A 1 144 GLU 144 145 145 GLU GLU A . n 
A 1 145 TYR 145 146 146 TYR TYR A . n 
A 1 146 GLN 146 147 147 GLN GLN A . n 
A 1 147 LEU 147 148 148 LEU LEU A . n 
A 1 148 ASN 148 149 149 ASN ASN A . n 
A 1 149 ASP 149 150 150 ASP ASP A . n 
A 1 150 SER 150 151 151 SER SER A . n 
A 1 151 ALA 151 152 152 ALA ALA A . n 
A 1 152 SER 152 153 153 SER SER A . n 
A 1 153 TYR 153 154 154 TYR TYR A . n 
A 1 154 TYR 154 155 155 TYR TYR A . n 
A 1 155 LEU 155 156 156 LEU LEU A . n 
A 1 156 ASN 156 157 157 ASN ASN A . n 
A 1 157 ASP 157 158 158 ASP ASP A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ASP 159 160 160 ASP ASP A . n 
A 1 160 ARG 160 161 161 ARG ARG A . n 
A 1 161 ILE 161 162 162 ILE ILE A . n 
A 1 162 SER 162 163 163 SER SER A . n 
A 1 163 GLN 163 164 164 GLN GLN A . n 
A 1 164 SER 164 165 165 SER SER A . n 
A 1 165 ASN 165 166 166 ASN ASN A . n 
A 1 166 TYR 166 167 167 TYR TYR A . n 
A 1 167 ILE 167 168 168 ILE ILE A . n 
A 1 168 PRO 168 169 169 PRO PRO A . n 
A 1 169 THR 169 170 170 THR THR A . n 
A 1 170 GLN 170 171 171 GLN GLN A . n 
A 1 171 GLN 171 172 172 GLN GLN A . n 
A 1 172 ASP 172 173 173 ASP ASP A . n 
A 1 173 VAL 173 174 174 VAL VAL A . n 
A 1 174 LEU 174 175 175 LEU LEU A . n 
A 1 175 ARG 175 176 176 ARG ARG A . n 
A 1 176 THR 176 177 177 THR THR A . n 
A 1 177 ARG 177 178 178 ARG ARG A . n 
A 1 178 VAL 178 179 179 VAL VAL A . n 
A 1 179 LYS 179 180 180 LYS LYS A . n 
A 1 180 THR 180 181 181 THR THR A . n 
A 1 181 THR 181 182 182 THR THR A . n 
A 1 182 GLY 182 183 183 GLY GLY A . n 
A 1 183 ILE 183 184 184 ILE ILE A . n 
A 1 184 VAL 184 185 185 VAL VAL A . n 
A 1 185 GLU 185 186 186 GLU GLU A . n 
A 1 186 THR 186 187 187 THR THR A . n 
A 1 187 HIS 187 188 188 HIS HIS A . n 
A 1 188 PHE 188 189 189 PHE PHE A . n 
A 1 189 THR 189 190 190 THR THR A . n 
A 1 190 PHE 190 191 191 PHE PHE A . n 
A 1 191 LYS 191 192 192 LYS LYS A . n 
A 1 192 ASP 192 193 193 ASP ASP A . n 
A 1 193 LEU 193 194 194 LEU LEU A . n 
A 1 194 TYR 194 195 195 TYR TYR A . n 
A 1 195 PHE 195 196 196 PHE PHE A . n 
A 1 196 LYS 196 197 197 LYS LYS A . n 
A 1 197 MET 197 198 198 MET MET A . n 
A 1 198 PHE 198 199 199 PHE PHE A . n 
A 1 199 ASP 199 200 200 ASP ASP A . n 
A 1 200 VAL 200 201 201 VAL VAL A . n 
A 1 201 GLY 201 202 202 GLY GLY A . n 
A 1 202 GLY 202 203 203 GLY GLY A . n 
A 1 203 GLN 203 204 204 GLN GLN A . n 
A 1 204 ARG 204 205 205 ARG ARG A . n 
A 1 205 SER 205 206 206 SER SER A . n 
A 1 206 GLU 206 207 207 GLU GLU A . n 
A 1 207 ARG 207 208 208 ARG ARG A . n 
A 1 208 LYS 208 209 209 LYS LYS A . n 
A 1 209 LYS 209 210 210 LYS LYS A . n 
A 1 210 TRP 210 211 211 TRP TRP A . n 
A 1 211 ILE 211 212 212 ILE ILE A . n 
A 1 212 HIS 212 213 213 HIS HIS A . n 
A 1 213 CYS 213 214 214 CYS CYS A . n 
A 1 214 PHE 214 215 215 PHE PHE A . n 
A 1 215 GLU 215 216 216 GLU GLU A . n 
A 1 216 GLY 216 217 217 GLY GLY A . n 
A 1 217 VAL 217 218 218 VAL VAL A . n 
A 1 218 THR 218 219 219 THR THR A . n 
A 1 219 ALA 219 220 220 ALA ALA A . n 
A 1 220 ILE 220 221 221 ILE ILE A . n 
A 1 221 ILE 221 222 222 ILE ILE A . n 
A 1 222 PHE 222 223 223 PHE PHE A . n 
A 1 223 CYS 223 224 224 CYS CYS A . n 
A 1 224 VAL 224 225 225 VAL VAL A . n 
A 1 225 ALA 225 226 226 ALA ALA A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 SER 227 228 228 SER SER A . n 
A 1 228 ASP 228 229 229 ASP ASP A . n 
A 1 229 TYR 229 230 230 TYR TYR A . n 
A 1 230 ASP 230 231 231 ASP ASP A . n 
A 1 231 LEU 231 232 232 LEU LEU A . n 
A 1 232 VAL 232 233 233 VAL VAL A . n 
A 1 233 LEU 233 234 234 LEU LEU A . n 
A 1 234 ALA 234 235 235 ALA ALA A . n 
A 1 235 GLU 235 236 236 GLU GLU A . n 
A 1 236 ASP 236 237 237 ASP ASP A . n 
A 1 237 GLU 237 238 238 GLU GLU A . n 
A 1 238 GLU 238 239 239 GLU GLU A . n 
A 1 239 MET 239 240 240 MET MET A . n 
A 1 240 ASN 240 241 241 ASN ASN A . n 
A 1 241 ARG 241 242 242 ARG ARG A . n 
A 1 242 MET 242 243 243 MET MET A . n 
A 1 243 HIS 243 244 244 HIS HIS A . n 
A 1 244 GLU 244 245 245 GLU GLU A . n 
A 1 245 SER 245 246 246 SER SER A . n 
A 1 246 MET 246 247 247 MET MET A . n 
A 1 247 LYS 247 248 248 LYS LYS A . n 
A 1 248 LEU 248 249 249 LEU LEU A . n 
A 1 249 PHE 249 250 250 PHE PHE A . n 
A 1 250 ASP 250 251 251 ASP ASP A . n 
A 1 251 SER 251 252 252 SER SER A . n 
A 1 252 ILE 252 253 253 ILE ILE A . n 
A 1 253 CYS 253 254 254 CYS CYS A . n 
A 1 254 ASN 254 255 255 ASN ASN A . n 
A 1 255 ASN 255 256 256 ASN ASN A . n 
A 1 256 LYS 256 257 257 LYS LYS A . n 
A 1 257 TRP 257 258 258 TRP TRP A . n 
A 1 258 PHE 258 259 259 PHE PHE A . n 
A 1 259 THR 259 260 260 THR THR A . n 
A 1 260 GLU 260 261 261 GLU GLU A . n 
A 1 261 THR 261 262 262 THR THR A . n 
A 1 262 SER 262 263 263 SER SER A . n 
A 1 263 ILE 263 264 264 ILE ILE A . n 
A 1 264 ILE 264 265 265 ILE ILE A . n 
A 1 265 LEU 265 266 266 LEU LEU A . n 
A 1 266 PHE 266 267 267 PHE PHE A . n 
A 1 267 LEU 267 268 268 LEU LEU A . n 
A 1 268 ASN 268 269 269 ASN ASN A . n 
A 1 269 LYS 269 270 270 LYS LYS A . n 
A 1 270 LYS 270 271 271 LYS LYS A . n 
A 1 271 ASP 271 272 272 ASP ASP A . n 
A 1 272 LEU 272 273 273 LEU LEU A . n 
A 1 273 PHE 273 274 274 PHE PHE A . n 
A 1 274 GLU 274 275 275 GLU GLU A . n 
A 1 275 GLU 275 276 276 GLU GLU A . n 
A 1 276 LYS 276 277 277 LYS LYS A . n 
A 1 277 ILE 277 278 278 ILE ILE A . n 
A 1 278 LYS 278 279 279 LYS LYS A . n 
A 1 279 ARG 279 280 280 ARG ARG A . n 
A 1 280 SER 280 281 281 SER SER A . n 
A 1 281 PRO 281 282 282 PRO PRO A . n 
A 1 282 LEU 282 283 283 LEU LEU A . n 
A 1 283 THR 283 284 284 THR THR A . n 
A 1 284 ILE 284 285 285 ILE ILE A . n 
A 1 285 CYS 285 286 286 CYS CYS A . n 
A 1 286 TYR 286 287 287 TYR TYR A . n 
A 1 287 PRO 287 288 288 PRO PRO A . n 
A 1 288 GLU 288 289 289 GLU GLU A . n 
A 1 289 TYR 289 290 290 TYR TYR A . n 
A 1 290 THR 290 291 291 THR THR A . n 
A 1 291 GLY 291 292 292 GLY GLY A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 ASN 293 294 294 ASN ASN A . n 
A 1 294 THR 294 295 295 THR THR A . n 
A 1 295 TYR 295 296 296 TYR TYR A . n 
A 1 296 GLU 296 297 297 GLU GLU A . n 
A 1 297 GLU 297 298 298 GLU GLU A . n 
A 1 298 ALA 298 299 299 ALA ALA A . n 
A 1 299 ALA 299 300 300 ALA ALA A . n 
A 1 300 ALA 300 301 301 ALA ALA A . n 
A 1 301 TYR 301 302 302 TYR TYR A . n 
A 1 302 ILE 302 303 303 ILE ILE A . n 
A 1 303 GLN 303 304 304 GLN GLN A . n 
A 1 304 CYS 304 305 305 CYS CYS A . n 
A 1 305 GLN 305 306 306 GLN GLN A . n 
A 1 306 PHE 306 307 307 PHE PHE A . n 
A 1 307 GLU 307 308 308 GLU GLU A . n 
A 1 308 ASP 308 309 309 ASP ASP A . n 
A 1 309 LEU 309 310 310 LEU LEU A . n 
A 1 310 ASN 310 311 311 ASN ASN A . n 
A 1 311 ARG 311 312 312 ARG ARG A . n 
A 1 312 ARG 312 313 313 ARG ARG A . n 
A 1 313 LYS 313 314 314 LYS LYS A . n 
A 1 314 ASP 314 315 315 ASP ASP A . n 
A 1 315 THR 315 316 316 THR THR A . n 
A 1 316 LYS 316 317 317 LYS LYS A . n 
A 1 317 GLU 317 318 318 GLU GLU A . n 
A 1 318 ILE 318 319 319 ILE ILE A . n 
A 1 319 TYR 319 320 320 TYR TYR A . n 
A 1 320 THR 320 321 321 THR THR A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 PHE 322 323 323 PHE PHE A . n 
A 1 323 THR 323 324 324 THR THR A . n 
A 1 324 CYS 324 325 325 CYS CYS A . n 
A 1 325 ALA 325 326 326 ALA ALA A . n 
A 1 326 THR 326 327 327 THR THR A . n 
A 1 327 ASP 327 328 328 ASP ASP A . n 
A 1 328 THR 328 329 329 THR THR A . n 
A 1 329 LYS 329 330 330 LYS LYS A . n 
A 1 330 ASN 330 331 331 ASN ASN A . n 
A 1 331 VAL 331 332 332 VAL VAL A . n 
A 1 332 GLN 332 333 333 GLN GLN A . n 
A 1 333 PHE 333 334 334 PHE PHE A . n 
A 1 334 VAL 334 335 335 VAL VAL A . n 
A 1 335 PHE 335 336 336 PHE PHE A . n 
A 1 336 ASP 336 337 337 ASP ASP A . n 
A 1 337 ALA 337 338 338 ALA ALA A . n 
A 1 338 VAL 338 339 339 VAL VAL A . n 
A 1 339 THR 339 340 340 THR THR A . n 
A 1 340 ASP 340 341 341 ASP ASP A . n 
A 1 341 VAL 341 342 342 VAL VAL A . n 
A 1 342 ILE 342 343 343 ILE ILE A . n 
A 1 343 ILE 343 344 344 ILE ILE A . n 
A 1 344 LYS 344 345 345 LYS LYS A . n 
A 1 345 ASN 345 346 346 ASN ASN A . n 
A 1 346 ASN 346 347 347 ASN ASN A . n 
A 1 347 LEU 347 348 348 LEU LEU A . n 
A 1 348 LYS 348 349 ?   ?   ?   A . n 
A 1 349 GLU 349 350 ?   ?   ?   A . n 
A 1 350 SER 350 351 ?   ?   ?   A . n 
B 2 1   SER 1   40  ?   ?   ?   B . n 
B 2 2   MET 2   41  ?   ?   ?   B . n 
B 2 3   LEU 3   42  ?   ?   ?   B . n 
B 2 4   LYS 4   43  ?   ?   ?   B . n 
B 2 5   ARG 5   44  ?   ?   ?   B . n 
B 2 6   LEU 6   45  ?   ?   ?   B . n 
B 2 7   SER 7   46  46  SER SER B . n 
B 2 8   THR 8   47  47  THR THR B . n 
B 2 9   GLU 9   48  48  GLU GLU B . n 
B 2 10  GLU 10  49  49  GLU GLU B . n 
B 2 11  ALA 11  50  50  ALA ALA B . n 
B 2 12  THR 12  51  51  THR THR B . n 
B 2 13  ARG 13  52  52  ARG ARG B . n 
B 2 14  TRP 14  53  53  TRP TRP B . n 
B 2 15  ALA 15  54  54  ALA ALA B . n 
B 2 16  ASP 16  55  55  ASP ASP B . n 
B 2 17  SER 17  56  56  SER SER B . n 
B 2 18  PHE 18  57  57  PHE PHE B . n 
B 2 19  ASP 19  58  58  ASP ASP B . n 
B 2 20  VAL 20  59  59  VAL VAL B . n 
B 2 21  LEU 21  60  60  LEU LEU B . n 
B 2 22  LEU 22  61  61  LEU LEU B . n 
B 2 23  SER 23  62  62  SER SER B . n 
B 2 24  HIS 24  63  63  HIS HIS B . n 
B 2 25  LYS 25  64  64  LYS LYS B . n 
B 2 26  TYR 26  65  65  TYR TYR B . n 
B 2 27  GLY 27  66  66  GLY GLY B . n 
B 2 28  VAL 28  67  67  VAL VAL B . n 
B 2 29  ALA 29  68  68  ALA ALA B . n 
B 2 30  ALA 30  69  69  ALA ALA B . n 
B 2 31  PHE 31  70  70  PHE PHE B . n 
B 2 32  ARG 32  71  71  ARG ARG B . n 
B 2 33  ALA 33  72  72  ALA ALA B . n 
B 2 34  PHE 34  73  73  PHE PHE B . n 
B 2 35  LEU 35  74  74  LEU LEU B . n 
B 2 36  LYS 36  75  75  LYS LYS B . n 
B 2 37  THR 37  76  76  THR THR B . n 
B 2 38  GLU 38  77  77  GLU GLU B . n 
B 2 39  PHE 39  78  78  PHE PHE B . n 
B 2 40  SER 40  79  79  SER SER B . n 
B 2 41  GLU 41  80  80  GLU GLU B . n 
B 2 42  GLU 42  81  81  GLU GLU B . n 
B 2 43  ASN 43  82  82  ASN ASN B . n 
B 2 44  LEU 44  83  83  LEU LEU B . n 
B 2 45  GLU 45  84  84  GLU GLU B . n 
B 2 46  PHE 46  85  85  PHE PHE B . n 
B 2 47  TRP 47  86  86  TRP TRP B . n 
B 2 48  LEU 48  87  87  LEU LEU B . n 
B 2 49  ALA 49  88  88  ALA ALA B . n 
B 2 50  CYS 50  89  89  CYS CYS B . n 
B 2 51  GLU 51  90  90  GLU GLU B . n 
B 2 52  GLU 52  91  91  GLU GLU B . n 
B 2 53  PHE 53  92  92  PHE PHE B . n 
B 2 54  LYS 54  93  93  LYS LYS B . n 
B 2 55  LYS 55  94  94  LYS LYS B . n 
B 2 56  THR 56  95  95  THR THR B . n 
B 2 57  ARG 57  96  96  ARG ARG B . n 
B 2 58  SER 58  97  97  SER SER B . n 
B 2 59  THR 59  98  98  THR THR B . n 
B 2 60  ALA 60  99  99  ALA ALA B . n 
B 2 61  LYS 61  100 100 LYS LYS B . n 
B 2 62  LEU 62  101 101 LEU LEU B . n 
B 2 63  VAL 63  102 102 VAL VAL B . n 
B 2 64  SER 64  103 103 SER SER B . n 
B 2 65  LYS 65  104 104 LYS LYS B . n 
B 2 66  ALA 66  105 105 ALA ALA B . n 
B 2 67  HIS 67  106 106 HIS HIS B . n 
B 2 68  ARG 68  107 107 ARG ARG B . n 
B 2 69  ILE 69  108 108 ILE ILE B . n 
B 2 70  PHE 70  109 109 PHE PHE B . n 
B 2 71  GLU 71  110 110 GLU GLU B . n 
B 2 72  GLU 72  111 111 GLU GLU B . n 
B 2 73  PHE 73  112 112 PHE PHE B . n 
B 2 74  VAL 74  113 113 VAL VAL B . n 
B 2 75  ASP 75  114 114 ASP ASP B . n 
B 2 76  VAL 76  115 115 VAL VAL B . n 
B 2 77  GLN 77  116 116 GLN GLN B . n 
B 2 78  ALA 78  117 117 ALA ALA B . n 
B 2 79  PRO 79  118 118 PRO PRO B . n 
B 2 80  ARG 80  119 119 ARG ARG B . n 
B 2 81  GLU 81  120 120 GLU GLU B . n 
B 2 82  VAL 82  121 121 VAL VAL B . n 
B 2 83  ASN 83  122 122 ASN ASN B . n 
B 2 84  ILE 84  123 123 ILE ILE B . n 
B 2 85  ASP 85  124 124 ASP ASP B . n 
B 2 86  PHE 86  125 125 PHE PHE B . n 
B 2 87  GLN 87  126 126 GLN GLN B . n 
B 2 88  THR 88  127 127 THR THR B . n 
B 2 89  ARG 89  128 128 ARG ARG B . n 
B 2 90  GLU 90  129 129 GLU GLU B . n 
B 2 91  ALA 91  130 130 ALA ALA B . n 
B 2 92  THR 92  131 131 THR THR B . n 
B 2 93  ARG 93  132 132 ARG ARG B . n 
B 2 94  LYS 94  133 133 LYS LYS B . n 
B 2 95  ASN 95  134 134 ASN ASN B . n 
B 2 96  LEU 96  135 135 LEU LEU B . n 
B 2 97  GLN 97  136 136 GLN GLN B . n 
B 2 98  GLU 98  137 137 GLU GLU B . n 
B 2 99  PRO 99  138 138 PRO PRO B . n 
B 2 100 SER 100 139 139 SER SER B . n 
B 2 101 LEU 101 140 140 LEU LEU B . n 
B 2 102 THR 102 141 141 THR THR B . n 
B 2 103 CYS 103 142 142 CYS CYS B . n 
B 2 104 PHE 104 143 143 PHE PHE B . n 
B 2 105 ASP 105 144 144 ASP ASP B . n 
B 2 106 GLN 106 145 145 GLN GLN B . n 
B 2 107 ALA 107 146 146 ALA ALA B . n 
B 2 108 GLN 108 147 147 GLN GLN B . n 
B 2 109 GLY 109 148 148 GLY GLY B . n 
B 2 110 LYS 110 149 149 LYS LYS B . n 
B 2 111 VAL 111 150 150 VAL VAL B . n 
B 2 112 HIS 112 151 151 HIS HIS B . n 
B 2 113 SER 113 152 152 SER SER B . n 
B 2 114 LEU 114 153 153 LEU LEU B . n 
B 2 115 MET 115 154 154 MET MET B . n 
B 2 116 GLU 116 155 155 GLU GLU B . n 
B 2 117 LYS 117 156 156 LYS LYS B . n 
B 2 118 ASP 118 157 157 ASP ASP B . n 
B 2 119 SER 119 158 158 SER SER B . n 
B 2 120 TYR 120 159 159 TYR TYR B . n 
B 2 121 PRO 121 160 160 PRO PRO B . n 
B 2 122 ARG 122 161 161 ARG ARG B . n 
B 2 123 PHE 123 162 162 PHE PHE B . n 
B 2 124 LEU 124 163 163 LEU LEU B . n 
B 2 125 ARG 125 164 164 ARG ARG B . n 
B 2 126 SER 126 165 165 SER SER B . n 
B 2 127 LYS 127 166 166 LYS LYS B . n 
B 2 128 MET 128 167 167 MET MET B . n 
B 2 129 TYR 129 168 168 TYR TYR B . n 
B 2 130 LEU 130 169 169 LEU LEU B . n 
B 2 131 ASP 131 170 170 ASP ASP B . n 
B 2 132 LEU 132 171 171 LEU LEU B . n 
B 2 133 LEU 133 172 172 LEU LEU B . n 
B 2 134 SER 134 173 173 SER SER B . n 
B 2 135 GLN 135 174 174 GLN GLN B . n 
B 2 136 SER 136 175 175 SER SER B . n 
B 2 137 GLN 137 176 176 GLN GLN B . n 
B 2 138 ARG 138 177 ?   ?   ?   B . n 
B 2 139 ARG 139 178 ?   ?   ?   B . n 
B 2 140 LEU 140 179 ?   ?   ?   B . n 
B 2 141 SER 141 180 ?   ?   ?   B . n 
C 1 1   SER 1   2   ?   ?   ?   C . n 
C 1 2   MET 2   3   ?   ?   ?   C . n 
C 1 3   THR 3   4   ?   ?   ?   C . n 
C 1 4   LEU 4   5   ?   ?   ?   C . n 
C 1 5   SER 5   6   ?   ?   ?   C . n 
C 1 6   ALA 6   7   ?   ?   ?   C . n 
C 1 7   GLU 7   8   ?   ?   ?   C . n 
C 1 8   ASP 8   9   ?   ?   ?   C . n 
C 1 9   LYS 9   10  ?   ?   ?   C . n 
C 1 10  ALA 10  11  ?   ?   ?   C . n 
C 1 11  ALA 11  12  ?   ?   ?   C . n 
C 1 12  VAL 12  13  ?   ?   ?   C . n 
C 1 13  GLU 13  14  ?   ?   ?   C . n 
C 1 14  ARG 14  15  ?   ?   ?   C . n 
C 1 15  SER 15  16  ?   ?   ?   C . n 
C 1 16  LYS 16  17  ?   ?   ?   C . n 
C 1 17  MET 17  18  ?   ?   ?   C . n 
C 1 18  ILE 18  19  ?   ?   ?   C . n 
C 1 19  ASP 19  20  ?   ?   ?   C . n 
C 1 20  ARG 20  21  ?   ?   ?   C . n 
C 1 21  ASN 21  22  ?   ?   ?   C . n 
C 1 22  LEU 22  23  ?   ?   ?   C . n 
C 1 23  ARG 23  24  ?   ?   ?   C . n 
C 1 24  GLU 24  25  ?   ?   ?   C . n 
C 1 25  ASP 25  26  ?   ?   ?   C . n 
C 1 26  GLY 26  27  ?   ?   ?   C . n 
C 1 27  GLU 27  28  ?   ?   ?   C . n 
C 1 28  LYS 28  29  ?   ?   ?   C . n 
C 1 29  ALA 29  30  ?   ?   ?   C . n 
C 1 30  ALA 30  31  31  ALA ALA C . n 
C 1 31  LYS 31  32  32  LYS LYS C . n 
C 1 32  GLU 32  33  33  GLU GLU C . n 
C 1 33  VAL 33  34  34  VAL VAL C . n 
C 1 34  LYS 34  35  35  LYS LYS C . n 
C 1 35  LEU 35  36  36  LEU LEU C . n 
C 1 36  LEU 36  37  37  LEU LEU C . n 
C 1 37  LEU 37  38  38  LEU LEU C . n 
C 1 38  LEU 38  39  39  LEU LEU C . n 
C 1 39  GLY 39  40  40  GLY GLY C . n 
C 1 40  ALA 40  41  41  ALA ALA C . n 
C 1 41  GLY 41  42  42  GLY GLY C . n 
C 1 42  GLU 42  43  43  GLU GLU C . n 
C 1 43  SER 43  44  44  SER SER C . n 
C 1 44  GLY 44  45  45  GLY GLY C . n 
C 1 45  LYS 45  46  46  LYS LYS C . n 
C 1 46  SER 46  47  47  SER SER C . n 
C 1 47  THR 47  48  48  THR THR C . n 
C 1 48  ILE 48  49  49  ILE ILE C . n 
C 1 49  VAL 49  50  50  VAL VAL C . n 
C 1 50  LYS 50  51  51  LYS LYS C . n 
C 1 51  GLN 51  52  52  GLN GLN C . n 
C 1 52  MET 52  53  53  MET MET C . n 
C 1 53  LYS 53  54  54  LYS LYS C . n 
C 1 54  ILE 54  55  55  ILE ILE C . n 
C 1 55  ILE 55  56  56  ILE ILE C . n 
C 1 56  HIS 56  57  57  HIS HIS C . n 
C 1 57  GLU 57  58  58  GLU GLU C . n 
C 1 58  ASP 58  59  59  ASP ASP C . n 
C 1 59  GLY 59  60  60  GLY GLY C . n 
C 1 60  TYR 60  61  61  TYR TYR C . n 
C 1 61  SER 61  62  62  SER SER C . n 
C 1 62  GLU 62  63  63  GLU GLU C . n 
C 1 63  ASP 63  64  64  ASP ASP C . n 
C 1 64  GLU 64  65  65  GLU GLU C . n 
C 1 65  CYS 65  66  66  CYS CYS C . n 
C 1 66  LYS 66  67  67  LYS LYS C . n 
C 1 67  GLN 67  68  68  GLN GLN C . n 
C 1 68  TYR 68  69  69  TYR TYR C . n 
C 1 69  LYS 69  70  70  LYS LYS C . n 
C 1 70  VAL 70  71  71  VAL VAL C . n 
C 1 71  VAL 71  72  72  VAL VAL C . n 
C 1 72  VAL 72  73  73  VAL VAL C . n 
C 1 73  TYR 73  74  74  TYR TYR C . n 
C 1 74  SER 74  75  75  SER SER C . n 
C 1 75  ASN 75  76  76  ASN ASN C . n 
C 1 76  THR 76  77  77  THR THR C . n 
C 1 77  ILE 77  78  78  ILE ILE C . n 
C 1 78  GLN 78  79  79  GLN GLN C . n 
C 1 79  SER 79  80  80  SER SER C . n 
C 1 80  ILE 80  81  81  ILE ILE C . n 
C 1 81  ILE 81  82  82  ILE ILE C . n 
C 1 82  ALA 82  83  83  ALA ALA C . n 
C 1 83  ILE 83  84  84  ILE ILE C . n 
C 1 84  ILE 84  85  85  ILE ILE C . n 
C 1 85  ARG 85  86  86  ARG ARG C . n 
C 1 86  ALA 86  87  87  ALA ALA C . n 
C 1 87  MET 87  88  88  MET MET C . n 
C 1 88  GLY 88  89  89  GLY GLY C . n 
C 1 89  ARG 89  90  90  ARG ARG C . n 
C 1 90  LEU 90  91  91  LEU LEU C . n 
C 1 91  LYS 91  92  92  LYS LYS C . n 
C 1 92  ILE 92  93  93  ILE ILE C . n 
C 1 93  ASP 93  94  94  ASP ASP C . n 
C 1 94  PHE 94  95  95  PHE PHE C . n 
C 1 95  GLY 95  96  96  GLY GLY C . n 
C 1 96  GLU 96  97  97  GLU GLU C . n 
C 1 97  ALA 97  98  98  ALA ALA C . n 
C 1 98  ALA 98  99  99  ALA ALA C . n 
C 1 99  ARG 99  100 100 ARG ARG C . n 
C 1 100 ALA 100 101 101 ALA ALA C . n 
C 1 101 ASP 101 102 102 ASP ASP C . n 
C 1 102 ASP 102 103 103 ASP ASP C . n 
C 1 103 ALA 103 104 104 ALA ALA C . n 
C 1 104 ARG 104 105 105 ARG ARG C . n 
C 1 105 GLN 105 106 106 GLN GLN C . n 
C 1 106 LEU 106 107 107 LEU LEU C . n 
C 1 107 PHE 107 108 108 PHE PHE C . n 
C 1 108 VAL 108 109 109 VAL VAL C . n 
C 1 109 LEU 109 110 110 LEU LEU C . n 
C 1 110 ALA 110 111 111 ALA ALA C . n 
C 1 111 GLY 111 112 112 GLY GLY C . n 
C 1 112 SER 112 113 113 SER SER C . n 
C 1 113 ALA 113 114 114 ALA ALA C . n 
C 1 114 GLU 114 115 115 GLU GLU C . n 
C 1 115 GLU 115 116 116 GLU GLU C . n 
C 1 116 GLY 116 117 117 GLY GLY C . n 
C 1 117 VAL 117 118 118 VAL VAL C . n 
C 1 118 MET 118 119 119 MET MET C . n 
C 1 119 THR 119 120 120 THR THR C . n 
C 1 120 PRO 120 121 121 PRO PRO C . n 
C 1 121 GLU 121 122 122 GLU GLU C . n 
C 1 122 LEU 122 123 123 LEU LEU C . n 
C 1 123 ALA 123 124 124 ALA ALA C . n 
C 1 124 GLY 124 125 125 GLY GLY C . n 
C 1 125 VAL 125 126 126 VAL VAL C . n 
C 1 126 ILE 126 127 127 ILE ILE C . n 
C 1 127 LYS 127 128 128 LYS LYS C . n 
C 1 128 ARG 128 129 129 ARG ARG C . n 
C 1 129 LEU 129 130 130 LEU LEU C . n 
C 1 130 TRP 130 131 131 TRP TRP C . n 
C 1 131 ARG 131 132 132 ARG ARG C . n 
C 1 132 ASP 132 133 133 ASP ASP C . n 
C 1 133 GLY 133 134 134 GLY GLY C . n 
C 1 134 GLY 134 135 135 GLY GLY C . n 
C 1 135 VAL 135 136 136 VAL VAL C . n 
C 1 136 GLN 136 137 137 GLN GLN C . n 
C 1 137 ALA 137 138 138 ALA ALA C . n 
C 1 138 CYS 138 139 139 CYS CYS C . n 
C 1 139 PHE 139 140 140 PHE PHE C . n 
C 1 140 SER 140 141 141 SER SER C . n 
C 1 141 ARG 141 142 142 ARG ARG C . n 
C 1 142 SER 142 143 143 SER SER C . n 
C 1 143 ARG 143 144 144 ARG ARG C . n 
C 1 144 GLU 144 145 145 GLU GLU C . n 
C 1 145 TYR 145 146 146 TYR TYR C . n 
C 1 146 GLN 146 147 147 GLN GLN C . n 
C 1 147 LEU 147 148 148 LEU LEU C . n 
C 1 148 ASN 148 149 149 ASN ASN C . n 
C 1 149 ASP 149 150 150 ASP ASP C . n 
C 1 150 SER 150 151 151 SER SER C . n 
C 1 151 ALA 151 152 152 ALA ALA C . n 
C 1 152 SER 152 153 153 SER SER C . n 
C 1 153 TYR 153 154 154 TYR TYR C . n 
C 1 154 TYR 154 155 155 TYR TYR C . n 
C 1 155 LEU 155 156 156 LEU LEU C . n 
C 1 156 ASN 156 157 157 ASN ASN C . n 
C 1 157 ASP 157 158 158 ASP ASP C . n 
C 1 158 LEU 158 159 159 LEU LEU C . n 
C 1 159 ASP 159 160 160 ASP ASP C . n 
C 1 160 ARG 160 161 161 ARG ARG C . n 
C 1 161 ILE 161 162 162 ILE ILE C . n 
C 1 162 SER 162 163 163 SER SER C . n 
C 1 163 GLN 163 164 164 GLN GLN C . n 
C 1 164 SER 164 165 165 SER SER C . n 
C 1 165 ASN 165 166 166 ASN ASN C . n 
C 1 166 TYR 166 167 167 TYR TYR C . n 
C 1 167 ILE 167 168 168 ILE ILE C . n 
C 1 168 PRO 168 169 169 PRO PRO C . n 
C 1 169 THR 169 170 170 THR THR C . n 
C 1 170 GLN 170 171 171 GLN GLN C . n 
C 1 171 GLN 171 172 172 GLN GLN C . n 
C 1 172 ASP 172 173 173 ASP ASP C . n 
C 1 173 VAL 173 174 174 VAL VAL C . n 
C 1 174 LEU 174 175 175 LEU LEU C . n 
C 1 175 ARG 175 176 176 ARG ARG C . n 
C 1 176 THR 176 177 177 THR THR C . n 
C 1 177 ARG 177 178 178 ARG ARG C . n 
C 1 178 VAL 178 179 179 VAL VAL C . n 
C 1 179 LYS 179 180 180 LYS LYS C . n 
C 1 180 THR 180 181 181 THR THR C . n 
C 1 181 THR 181 182 182 THR THR C . n 
C 1 182 GLY 182 183 183 GLY GLY C . n 
C 1 183 ILE 183 184 184 ILE ILE C . n 
C 1 184 VAL 184 185 185 VAL VAL C . n 
C 1 185 GLU 185 186 186 GLU GLU C . n 
C 1 186 THR 186 187 187 THR THR C . n 
C 1 187 HIS 187 188 188 HIS HIS C . n 
C 1 188 PHE 188 189 189 PHE PHE C . n 
C 1 189 THR 189 190 190 THR THR C . n 
C 1 190 PHE 190 191 191 PHE PHE C . n 
C 1 191 LYS 191 192 192 LYS LYS C . n 
C 1 192 ASP 192 193 193 ASP ASP C . n 
C 1 193 LEU 193 194 194 LEU LEU C . n 
C 1 194 TYR 194 195 195 TYR TYR C . n 
C 1 195 PHE 195 196 196 PHE PHE C . n 
C 1 196 LYS 196 197 197 LYS LYS C . n 
C 1 197 MET 197 198 198 MET MET C . n 
C 1 198 PHE 198 199 199 PHE PHE C . n 
C 1 199 ASP 199 200 200 ASP ASP C . n 
C 1 200 VAL 200 201 201 VAL VAL C . n 
C 1 201 GLY 201 202 202 GLY GLY C . n 
C 1 202 GLY 202 203 203 GLY GLY C . n 
C 1 203 GLN 203 204 204 GLN GLN C . n 
C 1 204 ARG 204 205 205 ARG ARG C . n 
C 1 205 SER 205 206 206 SER SER C . n 
C 1 206 GLU 206 207 207 GLU GLU C . n 
C 1 207 ARG 207 208 208 ARG ARG C . n 
C 1 208 LYS 208 209 209 LYS LYS C . n 
C 1 209 LYS 209 210 210 LYS LYS C . n 
C 1 210 TRP 210 211 211 TRP TRP C . n 
C 1 211 ILE 211 212 212 ILE ILE C . n 
C 1 212 HIS 212 213 213 HIS HIS C . n 
C 1 213 CYS 213 214 214 CYS CYS C . n 
C 1 214 PHE 214 215 215 PHE PHE C . n 
C 1 215 GLU 215 216 216 GLU GLU C . n 
C 1 216 GLY 216 217 217 GLY GLY C . n 
C 1 217 VAL 217 218 218 VAL VAL C . n 
C 1 218 THR 218 219 219 THR THR C . n 
C 1 219 ALA 219 220 220 ALA ALA C . n 
C 1 220 ILE 220 221 221 ILE ILE C . n 
C 1 221 ILE 221 222 222 ILE ILE C . n 
C 1 222 PHE 222 223 223 PHE PHE C . n 
C 1 223 CYS 223 224 224 CYS CYS C . n 
C 1 224 VAL 224 225 225 VAL VAL C . n 
C 1 225 ALA 225 226 226 ALA ALA C . n 
C 1 226 LEU 226 227 227 LEU LEU C . n 
C 1 227 SER 227 228 228 SER SER C . n 
C 1 228 ASP 228 229 229 ASP ASP C . n 
C 1 229 TYR 229 230 230 TYR TYR C . n 
C 1 230 ASP 230 231 231 ASP ASP C . n 
C 1 231 LEU 231 232 232 LEU LEU C . n 
C 1 232 VAL 232 233 233 VAL VAL C . n 
C 1 233 LEU 233 234 234 LEU LEU C . n 
C 1 234 ALA 234 235 235 ALA ALA C . n 
C 1 235 GLU 235 236 236 GLU GLU C . n 
C 1 236 ASP 236 237 237 ASP ASP C . n 
C 1 237 GLU 237 238 238 GLU GLU C . n 
C 1 238 GLU 238 239 239 GLU GLU C . n 
C 1 239 MET 239 240 240 MET MET C . n 
C 1 240 ASN 240 241 241 ASN ASN C . n 
C 1 241 ARG 241 242 242 ARG ARG C . n 
C 1 242 MET 242 243 243 MET MET C . n 
C 1 243 HIS 243 244 244 HIS HIS C . n 
C 1 244 GLU 244 245 245 GLU GLU C . n 
C 1 245 SER 245 246 246 SER SER C . n 
C 1 246 MET 246 247 247 MET MET C . n 
C 1 247 LYS 247 248 248 LYS LYS C . n 
C 1 248 LEU 248 249 249 LEU LEU C . n 
C 1 249 PHE 249 250 250 PHE PHE C . n 
C 1 250 ASP 250 251 251 ASP ASP C . n 
C 1 251 SER 251 252 252 SER SER C . n 
C 1 252 ILE 252 253 253 ILE ILE C . n 
C 1 253 CYS 253 254 254 CYS CYS C . n 
C 1 254 ASN 254 255 255 ASN ASN C . n 
C 1 255 ASN 255 256 256 ASN ASN C . n 
C 1 256 LYS 256 257 257 LYS LYS C . n 
C 1 257 TRP 257 258 258 TRP TRP C . n 
C 1 258 PHE 258 259 259 PHE PHE C . n 
C 1 259 THR 259 260 260 THR THR C . n 
C 1 260 GLU 260 261 261 GLU GLU C . n 
C 1 261 THR 261 262 262 THR THR C . n 
C 1 262 SER 262 263 263 SER SER C . n 
C 1 263 ILE 263 264 264 ILE ILE C . n 
C 1 264 ILE 264 265 265 ILE ILE C . n 
C 1 265 LEU 265 266 266 LEU LEU C . n 
C 1 266 PHE 266 267 267 PHE PHE C . n 
C 1 267 LEU 267 268 268 LEU LEU C . n 
C 1 268 ASN 268 269 269 ASN ASN C . n 
C 1 269 LYS 269 270 270 LYS LYS C . n 
C 1 270 LYS 270 271 271 LYS LYS C . n 
C 1 271 ASP 271 272 272 ASP ASP C . n 
C 1 272 LEU 272 273 273 LEU LEU C . n 
C 1 273 PHE 273 274 274 PHE PHE C . n 
C 1 274 GLU 274 275 275 GLU GLU C . n 
C 1 275 GLU 275 276 276 GLU GLU C . n 
C 1 276 LYS 276 277 277 LYS LYS C . n 
C 1 277 ILE 277 278 278 ILE ILE C . n 
C 1 278 LYS 278 279 279 LYS LYS C . n 
C 1 279 ARG 279 280 280 ARG ARG C . n 
C 1 280 SER 280 281 281 SER SER C . n 
C 1 281 PRO 281 282 282 PRO PRO C . n 
C 1 282 LEU 282 283 283 LEU LEU C . n 
C 1 283 THR 283 284 284 THR THR C . n 
C 1 284 ILE 284 285 285 ILE ILE C . n 
C 1 285 CYS 285 286 286 CYS CYS C . n 
C 1 286 TYR 286 287 287 TYR TYR C . n 
C 1 287 PRO 287 288 288 PRO PRO C . n 
C 1 288 GLU 288 289 289 GLU GLU C . n 
C 1 289 TYR 289 290 290 TYR TYR C . n 
C 1 290 THR 290 291 291 THR THR C . n 
C 1 291 GLY 291 292 292 GLY GLY C . n 
C 1 292 SER 292 293 293 SER SER C . n 
C 1 293 ASN 293 294 294 ASN ASN C . n 
C 1 294 THR 294 295 295 THR THR C . n 
C 1 295 TYR 295 296 296 TYR TYR C . n 
C 1 296 GLU 296 297 297 GLU GLU C . n 
C 1 297 GLU 297 298 298 GLU GLU C . n 
C 1 298 ALA 298 299 299 ALA ALA C . n 
C 1 299 ALA 299 300 300 ALA ALA C . n 
C 1 300 ALA 300 301 301 ALA ALA C . n 
C 1 301 TYR 301 302 302 TYR TYR C . n 
C 1 302 ILE 302 303 303 ILE ILE C . n 
C 1 303 GLN 303 304 304 GLN GLN C . n 
C 1 304 CYS 304 305 305 CYS CYS C . n 
C 1 305 GLN 305 306 306 GLN GLN C . n 
C 1 306 PHE 306 307 307 PHE PHE C . n 
C 1 307 GLU 307 308 308 GLU GLU C . n 
C 1 308 ASP 308 309 309 ASP ASP C . n 
C 1 309 LEU 309 310 310 LEU LEU C . n 
C 1 310 ASN 310 311 311 ASN ASN C . n 
C 1 311 ARG 311 312 312 ARG ARG C . n 
C 1 312 ARG 312 313 313 ARG ARG C . n 
C 1 313 LYS 313 314 314 LYS LYS C . n 
C 1 314 ASP 314 315 315 ASP ASP C . n 
C 1 315 THR 315 316 316 THR THR C . n 
C 1 316 LYS 316 317 317 LYS LYS C . n 
C 1 317 GLU 317 318 318 GLU GLU C . n 
C 1 318 ILE 318 319 319 ILE ILE C . n 
C 1 319 TYR 319 320 320 TYR TYR C . n 
C 1 320 THR 320 321 321 THR THR C . n 
C 1 321 HIS 321 322 322 HIS HIS C . n 
C 1 322 PHE 322 323 323 PHE PHE C . n 
C 1 323 THR 323 324 324 THR THR C . n 
C 1 324 CYS 324 325 325 CYS CYS C . n 
C 1 325 ALA 325 326 326 ALA ALA C . n 
C 1 326 THR 326 327 327 THR THR C . n 
C 1 327 ASP 327 328 328 ASP ASP C . n 
C 1 328 THR 328 329 329 THR THR C . n 
C 1 329 LYS 329 330 330 LYS LYS C . n 
C 1 330 ASN 330 331 331 ASN ASN C . n 
C 1 331 VAL 331 332 332 VAL VAL C . n 
C 1 332 GLN 332 333 333 GLN GLN C . n 
C 1 333 PHE 333 334 334 PHE PHE C . n 
C 1 334 VAL 334 335 335 VAL VAL C . n 
C 1 335 PHE 335 336 336 PHE PHE C . n 
C 1 336 ASP 336 337 337 ASP ASP C . n 
C 1 337 ALA 337 338 338 ALA ALA C . n 
C 1 338 VAL 338 339 339 VAL VAL C . n 
C 1 339 THR 339 340 340 THR THR C . n 
C 1 340 ASP 340 341 341 ASP ASP C . n 
C 1 341 VAL 341 342 342 VAL VAL C . n 
C 1 342 ILE 342 343 343 ILE ILE C . n 
C 1 343 ILE 343 344 344 ILE ILE C . n 
C 1 344 LYS 344 345 345 LYS LYS C . n 
C 1 345 ASN 345 346 346 ASN ASN C . n 
C 1 346 ASN 346 347 347 ASN ASN C . n 
C 1 347 LEU 347 348 ?   ?   ?   C . n 
C 1 348 LYS 348 349 ?   ?   ?   C . n 
C 1 349 GLU 349 350 ?   ?   ?   C . n 
C 1 350 SER 350 351 ?   ?   ?   C . n 
D 2 1   SER 1   40  ?   ?   ?   D . n 
D 2 2   MET 2   41  ?   ?   ?   D . n 
D 2 3   LEU 3   42  ?   ?   ?   D . n 
D 2 4   LYS 4   43  ?   ?   ?   D . n 
D 2 5   ARG 5   44  ?   ?   ?   D . n 
D 2 6   LEU 6   45  ?   ?   ?   D . n 
D 2 7   SER 7   46  ?   ?   ?   D . n 
D 2 8   THR 8   47  ?   ?   ?   D . n 
D 2 9   GLU 9   48  ?   ?   ?   D . n 
D 2 10  GLU 10  49  ?   ?   ?   D . n 
D 2 11  ALA 11  50  ?   ?   ?   D . n 
D 2 12  THR 12  51  ?   ?   ?   D . n 
D 2 13  ARG 13  52  ?   ?   ?   D . n 
D 2 14  TRP 14  53  ?   ?   ?   D . n 
D 2 15  ALA 15  54  ?   ?   ?   D . n 
D 2 16  ASP 16  55  ?   ?   ?   D . n 
D 2 17  SER 17  56  56  SER SER D . n 
D 2 18  PHE 18  57  57  PHE PHE D . n 
D 2 19  ASP 19  58  58  ASP ASP D . n 
D 2 20  VAL 20  59  59  VAL VAL D . n 
D 2 21  LEU 21  60  60  LEU LEU D . n 
D 2 22  LEU 22  61  61  LEU LEU D . n 
D 2 23  SER 23  62  62  SER SER D . n 
D 2 24  HIS 24  63  63  HIS HIS D . n 
D 2 25  LYS 25  64  64  LYS LYS D . n 
D 2 26  TYR 26  65  65  TYR TYR D . n 
D 2 27  GLY 27  66  66  GLY GLY D . n 
D 2 28  VAL 28  67  67  VAL VAL D . n 
D 2 29  ALA 29  68  68  ALA ALA D . n 
D 2 30  ALA 30  69  69  ALA ALA D . n 
D 2 31  PHE 31  70  70  PHE PHE D . n 
D 2 32  ARG 32  71  71  ARG ARG D . n 
D 2 33  ALA 33  72  72  ALA ALA D . n 
D 2 34  PHE 34  73  73  PHE PHE D . n 
D 2 35  LEU 35  74  74  LEU LEU D . n 
D 2 36  LYS 36  75  75  LYS LYS D . n 
D 2 37  THR 37  76  76  THR THR D . n 
D 2 38  GLU 38  77  77  GLU GLU D . n 
D 2 39  PHE 39  78  78  PHE PHE D . n 
D 2 40  SER 40  79  79  SER SER D . n 
D 2 41  GLU 41  80  80  GLU GLU D . n 
D 2 42  GLU 42  81  81  GLU GLU D . n 
D 2 43  ASN 43  82  82  ASN ASN D . n 
D 2 44  LEU 44  83  83  LEU LEU D . n 
D 2 45  GLU 45  84  84  GLU GLU D . n 
D 2 46  PHE 46  85  85  PHE PHE D . n 
D 2 47  TRP 47  86  86  TRP TRP D . n 
D 2 48  LEU 48  87  87  LEU LEU D . n 
D 2 49  ALA 49  88  88  ALA ALA D . n 
D 2 50  CYS 50  89  89  CYS CYS D . n 
D 2 51  GLU 51  90  90  GLU GLU D . n 
D 2 52  GLU 52  91  91  GLU GLU D . n 
D 2 53  PHE 53  92  92  PHE PHE D . n 
D 2 54  LYS 54  93  93  LYS LYS D . n 
D 2 55  LYS 55  94  94  LYS LYS D . n 
D 2 56  THR 56  95  95  THR THR D . n 
D 2 57  ARG 57  96  96  ARG ARG D . n 
D 2 58  SER 58  97  97  SER SER D . n 
D 2 59  THR 59  98  98  THR THR D . n 
D 2 60  ALA 60  99  99  ALA ALA D . n 
D 2 61  LYS 61  100 100 LYS LYS D . n 
D 2 62  LEU 62  101 101 LEU LEU D . n 
D 2 63  VAL 63  102 102 VAL VAL D . n 
D 2 64  SER 64  103 103 SER SER D . n 
D 2 65  LYS 65  104 104 LYS LYS D . n 
D 2 66  ALA 66  105 105 ALA ALA D . n 
D 2 67  HIS 67  106 106 HIS HIS D . n 
D 2 68  ARG 68  107 107 ARG ARG D . n 
D 2 69  ILE 69  108 108 ILE ILE D . n 
D 2 70  PHE 70  109 109 PHE PHE D . n 
D 2 71  GLU 71  110 110 GLU GLU D . n 
D 2 72  GLU 72  111 111 GLU GLU D . n 
D 2 73  PHE 73  112 112 PHE PHE D . n 
D 2 74  VAL 74  113 113 VAL VAL D . n 
D 2 75  ASP 75  114 114 ASP ASP D . n 
D 2 76  VAL 76  115 115 VAL VAL D . n 
D 2 77  GLN 77  116 116 GLN GLN D . n 
D 2 78  ALA 78  117 117 ALA ALA D . n 
D 2 79  PRO 79  118 118 PRO PRO D . n 
D 2 80  ARG 80  119 119 ARG ARG D . n 
D 2 81  GLU 81  120 120 GLU GLU D . n 
D 2 82  VAL 82  121 121 VAL VAL D . n 
D 2 83  ASN 83  122 122 ASN ASN D . n 
D 2 84  ILE 84  123 123 ILE ILE D . n 
D 2 85  ASP 85  124 124 ASP ASP D . n 
D 2 86  PHE 86  125 125 PHE PHE D . n 
D 2 87  GLN 87  126 126 GLN GLN D . n 
D 2 88  THR 88  127 127 THR THR D . n 
D 2 89  ARG 89  128 128 ARG ARG D . n 
D 2 90  GLU 90  129 129 GLU GLU D . n 
D 2 91  ALA 91  130 130 ALA ALA D . n 
D 2 92  THR 92  131 131 THR THR D . n 
D 2 93  ARG 93  132 132 ARG ARG D . n 
D 2 94  LYS 94  133 133 LYS LYS D . n 
D 2 95  ASN 95  134 134 ASN ASN D . n 
D 2 96  LEU 96  135 135 LEU LEU D . n 
D 2 97  GLN 97  136 136 GLN GLN D . n 
D 2 98  GLU 98  137 137 GLU GLU D . n 
D 2 99  PRO 99  138 138 PRO PRO D . n 
D 2 100 SER 100 139 139 SER SER D . n 
D 2 101 LEU 101 140 140 LEU LEU D . n 
D 2 102 THR 102 141 141 THR THR D . n 
D 2 103 CYS 103 142 142 CYS CYS D . n 
D 2 104 PHE 104 143 143 PHE PHE D . n 
D 2 105 ASP 105 144 144 ASP ASP D . n 
D 2 106 GLN 106 145 145 GLN GLN D . n 
D 2 107 ALA 107 146 146 ALA ALA D . n 
D 2 108 GLN 108 147 147 GLN GLN D . n 
D 2 109 GLY 109 148 148 GLY GLY D . n 
D 2 110 LYS 110 149 149 LYS LYS D . n 
D 2 111 VAL 111 150 150 VAL VAL D . n 
D 2 112 HIS 112 151 151 HIS HIS D . n 
D 2 113 SER 113 152 152 SER SER D . n 
D 2 114 LEU 114 153 153 LEU LEU D . n 
D 2 115 MET 115 154 154 MET MET D . n 
D 2 116 GLU 116 155 155 GLU GLU D . n 
D 2 117 LYS 117 156 156 LYS LYS D . n 
D 2 118 ASP 118 157 157 ASP ASP D . n 
D 2 119 SER 119 158 158 SER SER D . n 
D 2 120 TYR 120 159 159 TYR TYR D . n 
D 2 121 PRO 121 160 160 PRO PRO D . n 
D 2 122 ARG 122 161 161 ARG ARG D . n 
D 2 123 PHE 123 162 162 PHE PHE D . n 
D 2 124 LEU 124 163 163 LEU LEU D . n 
D 2 125 ARG 125 164 164 ARG ARG D . n 
D 2 126 SER 126 165 165 SER SER D . n 
D 2 127 LYS 127 166 166 LYS LYS D . n 
D 2 128 MET 128 167 167 MET MET D . n 
D 2 129 TYR 129 168 168 TYR TYR D . n 
D 2 130 LEU 130 169 169 LEU LEU D . n 
D 2 131 ASP 131 170 170 ASP ASP D . n 
D 2 132 LEU 132 171 171 LEU LEU D . n 
D 2 133 LEU 133 172 ?   ?   ?   D . n 
D 2 134 SER 134 173 ?   ?   ?   D . n 
D 2 135 GLN 135 174 ?   ?   ?   D . n 
D 2 136 SER 136 175 ?   ?   ?   D . n 
D 2 137 GLN 137 176 ?   ?   ?   D . n 
D 2 138 ARG 138 177 ?   ?   ?   D . n 
D 2 139 ARG 139 178 ?   ?   ?   D . n 
D 2 140 LEU 140 179 ?   ?   ?   D . n 
D 2 141 SER 141 180 ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 ALF 1   2001 2001 ALF ALF A . 
F 4 MG  1   3001 3001 MG  MG  A . 
G 5 GDP 1   1001 1001 GDP GDP A . 
H 3 ALF 1   2002 2002 ALF ALF C . 
I 4 MG  1   3002 3002 MG  MG  C . 
J 5 GDP 1   1002 1002 GDP GDP C . 
K 6 HOH 1   3002 2    HOH HOH A . 
K 6 HOH 2   3003 4    HOH HOH A . 
K 6 HOH 3   3004 5    HOH HOH A . 
K 6 HOH 4   3005 6    HOH HOH A . 
K 6 HOH 5   3006 8    HOH HOH A . 
K 6 HOH 6   3007 11   HOH HOH A . 
K 6 HOH 7   3008 14   HOH HOH A . 
K 6 HOH 8   3009 16   HOH HOH A . 
K 6 HOH 9   3010 17   HOH HOH A . 
K 6 HOH 10  3011 18   HOH HOH A . 
K 6 HOH 11  3012 24   HOH HOH A . 
K 6 HOH 12  3013 28   HOH HOH A . 
K 6 HOH 13  3014 31   HOH HOH A . 
K 6 HOH 14  3015 32   HOH HOH A . 
K 6 HOH 15  3016 35   HOH HOH A . 
K 6 HOH 16  3017 39   HOH HOH A . 
K 6 HOH 17  3018 41   HOH HOH A . 
K 6 HOH 18  3019 43   HOH HOH A . 
K 6 HOH 19  3020 45   HOH HOH A . 
K 6 HOH 20  3021 49   HOH HOH A . 
K 6 HOH 21  3022 52   HOH HOH A . 
K 6 HOH 22  3023 54   HOH HOH A . 
K 6 HOH 23  3024 57   HOH HOH A . 
K 6 HOH 24  3025 58   HOH HOH A . 
K 6 HOH 25  3026 60   HOH HOH A . 
K 6 HOH 26  3027 69   HOH HOH A . 
K 6 HOH 27  3028 78   HOH HOH A . 
K 6 HOH 28  3029 84   HOH HOH A . 
K 6 HOH 29  3030 85   HOH HOH A . 
K 6 HOH 30  3031 86   HOH HOH A . 
K 6 HOH 31  3032 87   HOH HOH A . 
K 6 HOH 32  3033 88   HOH HOH A . 
K 6 HOH 33  3034 89   HOH HOH A . 
K 6 HOH 34  3035 92   HOH HOH A . 
K 6 HOH 35  3036 93   HOH HOH A . 
K 6 HOH 36  3037 94   HOH HOH A . 
K 6 HOH 37  3038 96   HOH HOH A . 
K 6 HOH 38  3039 99   HOH HOH A . 
K 6 HOH 39  3040 105  HOH HOH A . 
K 6 HOH 40  3041 108  HOH HOH A . 
K 6 HOH 41  3042 110  HOH HOH A . 
K 6 HOH 42  3043 114  HOH HOH A . 
K 6 HOH 43  3044 115  HOH HOH A . 
K 6 HOH 44  3045 116  HOH HOH A . 
K 6 HOH 45  3046 121  HOH HOH A . 
K 6 HOH 46  3047 124  HOH HOH A . 
K 6 HOH 47  3048 126  HOH HOH A . 
K 6 HOH 48  3049 131  HOH HOH A . 
K 6 HOH 49  3050 137  HOH HOH A . 
K 6 HOH 50  3051 138  HOH HOH A . 
K 6 HOH 51  3052 143  HOH HOH A . 
K 6 HOH 52  3053 145  HOH HOH A . 
K 6 HOH 53  3054 146  HOH HOH A . 
K 6 HOH 54  3055 147  HOH HOH A . 
K 6 HOH 55  3056 149  HOH HOH A . 
K 6 HOH 56  3057 150  HOH HOH A . 
K 6 HOH 57  3058 152  HOH HOH A . 
K 6 HOH 58  3059 153  HOH HOH A . 
K 6 HOH 59  3060 155  HOH HOH A . 
K 6 HOH 60  3061 157  HOH HOH A . 
K 6 HOH 61  3062 159  HOH HOH A . 
K 6 HOH 62  3063 161  HOH HOH A . 
K 6 HOH 63  3064 162  HOH HOH A . 
K 6 HOH 64  3065 163  HOH HOH A . 
K 6 HOH 65  3066 167  HOH HOH A . 
K 6 HOH 66  3067 172  HOH HOH A . 
K 6 HOH 67  3068 175  HOH HOH A . 
K 6 HOH 68  3069 176  HOH HOH A . 
K 6 HOH 69  3070 179  HOH HOH A . 
K 6 HOH 70  3071 183  HOH HOH A . 
K 6 HOH 71  3072 184  HOH HOH A . 
K 6 HOH 72  3073 187  HOH HOH A . 
K 6 HOH 73  3074 189  HOH HOH A . 
K 6 HOH 74  3075 194  HOH HOH A . 
K 6 HOH 75  3076 196  HOH HOH A . 
K 6 HOH 76  3077 197  HOH HOH A . 
K 6 HOH 77  3078 198  HOH HOH A . 
K 6 HOH 78  3079 199  HOH HOH A . 
K 6 HOH 79  3080 200  HOH HOH A . 
K 6 HOH 80  3081 201  HOH HOH A . 
K 6 HOH 81  3082 202  HOH HOH A . 
K 6 HOH 82  3083 203  HOH HOH A . 
K 6 HOH 83  3084 207  HOH HOH A . 
K 6 HOH 84  3085 208  HOH HOH A . 
K 6 HOH 85  3086 209  HOH HOH A . 
K 6 HOH 86  3087 211  HOH HOH A . 
K 6 HOH 87  3088 212  HOH HOH A . 
K 6 HOH 88  3089 214  HOH HOH A . 
K 6 HOH 89  3090 215  HOH HOH A . 
K 6 HOH 90  3091 217  HOH HOH A . 
K 6 HOH 91  3092 219  HOH HOH A . 
K 6 HOH 92  3093 223  HOH HOH A . 
K 6 HOH 93  3094 225  HOH HOH A . 
K 6 HOH 94  3095 230  HOH HOH A . 
K 6 HOH 95  3096 231  HOH HOH A . 
K 6 HOH 96  3097 232  HOH HOH A . 
K 6 HOH 97  3098 234  HOH HOH A . 
K 6 HOH 98  3099 235  HOH HOH A . 
K 6 HOH 99  3100 238  HOH HOH A . 
K 6 HOH 100 3101 239  HOH HOH A . 
K 6 HOH 101 3102 241  HOH HOH A . 
K 6 HOH 102 3103 244  HOH HOH A . 
K 6 HOH 103 3104 247  HOH HOH A . 
K 6 HOH 104 3105 249  HOH HOH A . 
K 6 HOH 105 3106 250  HOH HOH A . 
K 6 HOH 106 3107 252  HOH HOH A . 
K 6 HOH 107 3108 253  HOH HOH A . 
K 6 HOH 108 3109 257  HOH HOH A . 
K 6 HOH 109 3110 260  HOH HOH A . 
K 6 HOH 110 3111 261  HOH HOH A . 
K 6 HOH 111 3112 262  HOH HOH A . 
K 6 HOH 112 3113 264  HOH HOH A . 
K 6 HOH 113 3114 266  HOH HOH A . 
K 6 HOH 114 3115 270  HOH HOH A . 
K 6 HOH 115 3116 273  HOH HOH A . 
K 6 HOH 116 3117 278  HOH HOH A . 
K 6 HOH 117 3118 282  HOH HOH A . 
K 6 HOH 118 3119 284  HOH HOH A . 
K 6 HOH 119 3120 286  HOH HOH A . 
K 6 HOH 120 3121 294  HOH HOH A . 
K 6 HOH 121 3122 297  HOH HOH A . 
K 6 HOH 122 3123 305  HOH HOH A . 
K 6 HOH 123 3124 306  HOH HOH A . 
K 6 HOH 124 3125 311  HOH HOH A . 
K 6 HOH 125 3126 316  HOH HOH A . 
K 6 HOH 126 3127 317  HOH HOH A . 
K 6 HOH 127 3128 320  HOH HOH A . 
K 6 HOH 128 3129 323  HOH HOH A . 
K 6 HOH 129 3130 326  HOH HOH A . 
K 6 HOH 130 3131 327  HOH HOH A . 
K 6 HOH 131 3132 328  HOH HOH A . 
K 6 HOH 132 3133 334  HOH HOH A . 
K 6 HOH 133 3134 338  HOH HOH A . 
K 6 HOH 134 3135 339  HOH HOH A . 
K 6 HOH 135 3136 340  HOH HOH A . 
K 6 HOH 136 3137 342  HOH HOH A . 
K 6 HOH 137 3138 344  HOH HOH A . 
K 6 HOH 138 3139 345  HOH HOH A . 
K 6 HOH 139 3140 352  HOH HOH A . 
K 6 HOH 140 3141 358  HOH HOH A . 
K 6 HOH 141 3142 359  HOH HOH A . 
K 6 HOH 142 3143 360  HOH HOH A . 
K 6 HOH 143 3144 364  HOH HOH A . 
K 6 HOH 144 3145 366  HOH HOH A . 
K 6 HOH 145 3146 371  HOH HOH A . 
K 6 HOH 146 3147 372  HOH HOH A . 
K 6 HOH 147 3148 373  HOH HOH A . 
K 6 HOH 148 3149 388  HOH HOH A . 
K 6 HOH 149 3150 389  HOH HOH A . 
K 6 HOH 150 3151 390  HOH HOH A . 
K 6 HOH 151 3152 391  HOH HOH A . 
K 6 HOH 152 3153 392  HOH HOH A . 
K 6 HOH 153 3154 394  HOH HOH A . 
K 6 HOH 154 3155 399  HOH HOH A . 
K 6 HOH 155 3156 401  HOH HOH A . 
K 6 HOH 156 3157 407  HOH HOH A . 
K 6 HOH 157 3158 408  HOH HOH A . 
K 6 HOH 158 3159 410  HOH HOH A . 
K 6 HOH 159 3160 412  HOH HOH A . 
K 6 HOH 160 3161 416  HOH HOH A . 
K 6 HOH 161 3162 417  HOH HOH A . 
K 6 HOH 162 3163 426  HOH HOH A . 
K 6 HOH 163 3164 427  HOH HOH A . 
K 6 HOH 164 3165 429  HOH HOH A . 
K 6 HOH 165 3166 433  HOH HOH A . 
K 6 HOH 166 3167 435  HOH HOH A . 
K 6 HOH 167 3168 437  HOH HOH A . 
K 6 HOH 168 3169 438  HOH HOH A . 
K 6 HOH 169 3170 444  HOH HOH A . 
K 6 HOH 170 3171 448  HOH HOH A . 
K 6 HOH 171 3172 450  HOH HOH A . 
K 6 HOH 172 3173 454  HOH HOH A . 
K 6 HOH 173 3174 456  HOH HOH A . 
K 6 HOH 174 3175 457  HOH HOH A . 
K 6 HOH 175 3176 460  HOH HOH A . 
K 6 HOH 176 3177 463  HOH HOH A . 
K 6 HOH 177 3178 473  HOH HOH A . 
K 6 HOH 178 3179 501  HOH HOH A . 
K 6 HOH 179 3180 502  HOH HOH A . 
K 6 HOH 180 3181 506  HOH HOH A . 
K 6 HOH 181 3182 509  HOH HOH A . 
K 6 HOH 182 3183 518  HOH HOH A . 
K 6 HOH 183 3184 519  HOH HOH A . 
K 6 HOH 184 3185 525  HOH HOH A . 
K 6 HOH 185 3186 534  HOH HOH A . 
K 6 HOH 186 3187 537  HOH HOH A . 
K 6 HOH 187 3188 555  HOH HOH A . 
K 6 HOH 188 3189 557  HOH HOH A . 
K 6 HOH 189 3190 567  HOH HOH A . 
K 6 HOH 190 3191 572  HOH HOH A . 
K 6 HOH 191 3192 573  HOH HOH A . 
K 6 HOH 192 3193 575  HOH HOH A . 
K 6 HOH 193 3194 576  HOH HOH A . 
K 6 HOH 194 3195 582  HOH HOH A . 
K 6 HOH 195 3196 583  HOH HOH A . 
K 6 HOH 196 3197 584  HOH HOH A . 
K 6 HOH 197 3198 585  HOH HOH A . 
K 6 HOH 198 3199 592  HOH HOH A . 
K 6 HOH 199 3200 600  HOH HOH A . 
K 6 HOH 200 3201 601  HOH HOH A . 
K 6 HOH 201 3202 613  HOH HOH A . 
K 6 HOH 202 3203 614  HOH HOH A . 
K 6 HOH 203 3204 616  HOH HOH A . 
K 6 HOH 204 3205 629  HOH HOH A . 
K 6 HOH 205 3206 642  HOH HOH A . 
K 6 HOH 206 3207 647  HOH HOH A . 
K 6 HOH 207 3208 650  HOH HOH A . 
K 6 HOH 208 3209 663  HOH HOH A . 
K 6 HOH 209 3210 670  HOH HOH A . 
K 6 HOH 210 3211 691  HOH HOH A . 
K 6 HOH 211 3212 692  HOH HOH A . 
K 6 HOH 212 3213 715  HOH HOH A . 
K 6 HOH 213 3214 717  HOH HOH A . 
K 6 HOH 214 3215 721  HOH HOH A . 
K 6 HOH 215 3216 728  HOH HOH A . 
K 6 HOH 216 3217 731  HOH HOH A . 
K 6 HOH 217 3218 737  HOH HOH A . 
K 6 HOH 218 3219 744  HOH HOH A . 
K 6 HOH 219 3220 746  HOH HOH A . 
K 6 HOH 220 3221 759  HOH HOH A . 
K 6 HOH 221 3222 762  HOH HOH A . 
K 6 HOH 222 3223 769  HOH HOH A . 
K 6 HOH 223 3224 779  HOH HOH A . 
K 6 HOH 224 3225 788  HOH HOH A . 
K 6 HOH 225 3226 809  HOH HOH A . 
K 6 HOH 226 3227 818  HOH HOH A . 
K 6 HOH 227 3228 819  HOH HOH A . 
K 6 HOH 228 3229 825  HOH HOH A . 
K 6 HOH 229 3230 829  HOH HOH A . 
K 6 HOH 230 3231 844  HOH HOH A . 
K 6 HOH 231 3232 845  HOH HOH A . 
K 6 HOH 232 3233 846  HOH HOH A . 
K 6 HOH 233 3234 862  HOH HOH A . 
K 6 HOH 234 3235 867  HOH HOH A . 
K 6 HOH 235 3236 872  HOH HOH A . 
K 6 HOH 236 3237 884  HOH HOH A . 
K 6 HOH 237 3238 885  HOH HOH A . 
K 6 HOH 238 3239 886  HOH HOH A . 
K 6 HOH 239 3240 887  HOH HOH A . 
K 6 HOH 240 3241 888  HOH HOH A . 
K 6 HOH 241 3242 889  HOH HOH A . 
K 6 HOH 242 3243 890  HOH HOH A . 
K 6 HOH 243 3244 891  HOH HOH A . 
K 6 HOH 244 3245 892  HOH HOH A . 
K 6 HOH 245 3246 893  HOH HOH A . 
K 6 HOH 246 3247 894  HOH HOH A . 
K 6 HOH 247 3248 895  HOH HOH A . 
K 6 HOH 248 3249 896  HOH HOH A . 
K 6 HOH 249 3250 897  HOH HOH A . 
K 6 HOH 250 3251 898  HOH HOH A . 
K 6 HOH 251 3252 899  HOH HOH A . 
K 6 HOH 252 3253 900  HOH HOH A . 
K 6 HOH 253 3254 901  HOH HOH A . 
K 6 HOH 254 3255 902  HOH HOH A . 
K 6 HOH 255 3256 916  HOH HOH A . 
K 6 HOH 256 3257 917  HOH HOH A . 
K 6 HOH 257 3258 924  HOH HOH A . 
K 6 HOH 258 3259 925  HOH HOH A . 
K 6 HOH 259 3260 926  HOH HOH A . 
K 6 HOH 260 3261 929  HOH HOH A . 
K 6 HOH 261 3262 949  HOH HOH A . 
L 6 HOH 1   177  1    HOH HOH B . 
L 6 HOH 2   178  13   HOH HOH B . 
L 6 HOH 3   179  15   HOH HOH B . 
L 6 HOH 4   180  21   HOH HOH B . 
L 6 HOH 5   181  25   HOH HOH B . 
L 6 HOH 6   182  30   HOH HOH B . 
L 6 HOH 7   183  36   HOH HOH B . 
L 6 HOH 8   184  47   HOH HOH B . 
L 6 HOH 9   185  50   HOH HOH B . 
L 6 HOH 10  186  62   HOH HOH B . 
L 6 HOH 11  187  63   HOH HOH B . 
L 6 HOH 12  188  72   HOH HOH B . 
L 6 HOH 13  189  73   HOH HOH B . 
L 6 HOH 14  190  97   HOH HOH B . 
L 6 HOH 15  191  98   HOH HOH B . 
L 6 HOH 16  192  103  HOH HOH B . 
L 6 HOH 17  193  109  HOH HOH B . 
L 6 HOH 18  194  112  HOH HOH B . 
L 6 HOH 19  195  123  HOH HOH B . 
L 6 HOH 20  196  134  HOH HOH B . 
L 6 HOH 21  197  141  HOH HOH B . 
L 6 HOH 22  198  151  HOH HOH B . 
L 6 HOH 23  199  158  HOH HOH B . 
L 6 HOH 24  200  168  HOH HOH B . 
L 6 HOH 25  201  170  HOH HOH B . 
L 6 HOH 26  202  177  HOH HOH B . 
L 6 HOH 27  203  178  HOH HOH B . 
L 6 HOH 28  204  185  HOH HOH B . 
L 6 HOH 29  205  188  HOH HOH B . 
L 6 HOH 30  206  192  HOH HOH B . 
L 6 HOH 31  207  205  HOH HOH B . 
L 6 HOH 32  208  213  HOH HOH B . 
L 6 HOH 33  209  221  HOH HOH B . 
L 6 HOH 34  210  222  HOH HOH B . 
L 6 HOH 35  211  229  HOH HOH B . 
L 6 HOH 36  212  265  HOH HOH B . 
L 6 HOH 37  213  281  HOH HOH B . 
L 6 HOH 38  214  288  HOH HOH B . 
L 6 HOH 39  215  296  HOH HOH B . 
L 6 HOH 40  216  298  HOH HOH B . 
L 6 HOH 41  217  299  HOH HOH B . 
L 6 HOH 42  218  301  HOH HOH B . 
L 6 HOH 43  219  308  HOH HOH B . 
L 6 HOH 44  220  309  HOH HOH B . 
L 6 HOH 45  221  322  HOH HOH B . 
L 6 HOH 46  222  343  HOH HOH B . 
L 6 HOH 47  223  347  HOH HOH B . 
L 6 HOH 48  224  357  HOH HOH B . 
L 6 HOH 49  225  361  HOH HOH B . 
L 6 HOH 50  226  377  HOH HOH B . 
L 6 HOH 51  227  379  HOH HOH B . 
L 6 HOH 52  228  381  HOH HOH B . 
L 6 HOH 53  229  393  HOH HOH B . 
L 6 HOH 54  230  398  HOH HOH B . 
L 6 HOH 55  231  402  HOH HOH B . 
L 6 HOH 56  232  404  HOH HOH B . 
L 6 HOH 57  233  413  HOH HOH B . 
L 6 HOH 58  234  431  HOH HOH B . 
L 6 HOH 59  235  432  HOH HOH B . 
L 6 HOH 60  236  445  HOH HOH B . 
L 6 HOH 61  237  461  HOH HOH B . 
L 6 HOH 62  238  466  HOH HOH B . 
L 6 HOH 63  239  467  HOH HOH B . 
L 6 HOH 64  240  480  HOH HOH B . 
L 6 HOH 65  241  495  HOH HOH B . 
L 6 HOH 66  242  500  HOH HOH B . 
L 6 HOH 67  243  513  HOH HOH B . 
L 6 HOH 68  244  520  HOH HOH B . 
L 6 HOH 69  245  522  HOH HOH B . 
L 6 HOH 70  246  529  HOH HOH B . 
L 6 HOH 71  247  545  HOH HOH B . 
L 6 HOH 72  248  559  HOH HOH B . 
L 6 HOH 73  249  564  HOH HOH B . 
L 6 HOH 74  250  565  HOH HOH B . 
L 6 HOH 75  251  591  HOH HOH B . 
L 6 HOH 76  252  607  HOH HOH B . 
L 6 HOH 77  253  612  HOH HOH B . 
L 6 HOH 78  254  619  HOH HOH B . 
L 6 HOH 79  255  621  HOH HOH B . 
L 6 HOH 80  256  649  HOH HOH B . 
L 6 HOH 81  257  655  HOH HOH B . 
L 6 HOH 82  258  665  HOH HOH B . 
L 6 HOH 83  259  678  HOH HOH B . 
L 6 HOH 84  260  701  HOH HOH B . 
L 6 HOH 85  261  719  HOH HOH B . 
L 6 HOH 86  262  745  HOH HOH B . 
L 6 HOH 87  263  756  HOH HOH B . 
L 6 HOH 88  264  770  HOH HOH B . 
L 6 HOH 89  265  815  HOH HOH B . 
L 6 HOH 90  266  833  HOH HOH B . 
L 6 HOH 91  267  868  HOH HOH B . 
L 6 HOH 92  268  874  HOH HOH B . 
L 6 HOH 93  269  915  HOH HOH B . 
L 6 HOH 94  270  918  HOH HOH B . 
L 6 HOH 95  271  921  HOH HOH B . 
L 6 HOH 96  272  922  HOH HOH B . 
L 6 HOH 97  273  928  HOH HOH B . 
L 6 HOH 98  274  930  HOH HOH B . 
L 6 HOH 99  275  932  HOH HOH B . 
M 6 HOH 1   3003 7    HOH HOH C . 
M 6 HOH 2   3004 9    HOH HOH C . 
M 6 HOH 3   3005 10   HOH HOH C . 
M 6 HOH 4   3006 12   HOH HOH C . 
M 6 HOH 5   3007 19   HOH HOH C . 
M 6 HOH 6   3008 20   HOH HOH C . 
M 6 HOH 7   3009 22   HOH HOH C . 
M 6 HOH 8   3010 26   HOH HOH C . 
M 6 HOH 9   3011 27   HOH HOH C . 
M 6 HOH 10  3012 29   HOH HOH C . 
M 6 HOH 11  3013 34   HOH HOH C . 
M 6 HOH 12  3014 37   HOH HOH C . 
M 6 HOH 13  3015 38   HOH HOH C . 
M 6 HOH 14  3016 40   HOH HOH C . 
M 6 HOH 15  3017 42   HOH HOH C . 
M 6 HOH 16  3018 44   HOH HOH C . 
M 6 HOH 17  3019 46   HOH HOH C . 
M 6 HOH 18  3020 51   HOH HOH C . 
M 6 HOH 19  3021 53   HOH HOH C . 
M 6 HOH 20  3022 55   HOH HOH C . 
M 6 HOH 21  3023 61   HOH HOH C . 
M 6 HOH 22  3024 65   HOH HOH C . 
M 6 HOH 23  3025 66   HOH HOH C . 
M 6 HOH 24  3026 67   HOH HOH C . 
M 6 HOH 25  3027 68   HOH HOH C . 
M 6 HOH 26  3028 70   HOH HOH C . 
M 6 HOH 27  3029 75   HOH HOH C . 
M 6 HOH 28  3030 76   HOH HOH C . 
M 6 HOH 29  3031 77   HOH HOH C . 
M 6 HOH 30  3032 82   HOH HOH C . 
M 6 HOH 31  3033 83   HOH HOH C . 
M 6 HOH 32  3034 90   HOH HOH C . 
M 6 HOH 33  3035 91   HOH HOH C . 
M 6 HOH 34  3036 95   HOH HOH C . 
M 6 HOH 35  3037 107  HOH HOH C . 
M 6 HOH 36  3038 117  HOH HOH C . 
M 6 HOH 37  3039 119  HOH HOH C . 
M 6 HOH 38  3040 122  HOH HOH C . 
M 6 HOH 39  3041 128  HOH HOH C . 
M 6 HOH 40  3042 129  HOH HOH C . 
M 6 HOH 41  3043 130  HOH HOH C . 
M 6 HOH 42  3044 132  HOH HOH C . 
M 6 HOH 43  3045 135  HOH HOH C . 
M 6 HOH 44  3046 139  HOH HOH C . 
M 6 HOH 45  3047 140  HOH HOH C . 
M 6 HOH 46  3048 144  HOH HOH C . 
M 6 HOH 47  3049 148  HOH HOH C . 
M 6 HOH 48  3050 156  HOH HOH C . 
M 6 HOH 49  3051 165  HOH HOH C . 
M 6 HOH 50  3052 169  HOH HOH C . 
M 6 HOH 51  3053 173  HOH HOH C . 
M 6 HOH 52  3054 174  HOH HOH C . 
M 6 HOH 53  3055 180  HOH HOH C . 
M 6 HOH 54  3056 182  HOH HOH C . 
M 6 HOH 55  3057 186  HOH HOH C . 
M 6 HOH 56  3058 190  HOH HOH C . 
M 6 HOH 57  3059 191  HOH HOH C . 
M 6 HOH 58  3060 193  HOH HOH C . 
M 6 HOH 59  3061 195  HOH HOH C . 
M 6 HOH 60  3062 206  HOH HOH C . 
M 6 HOH 61  3063 216  HOH HOH C . 
M 6 HOH 62  3064 220  HOH HOH C . 
M 6 HOH 63  3065 224  HOH HOH C . 
M 6 HOH 64  3066 226  HOH HOH C . 
M 6 HOH 65  3067 228  HOH HOH C . 
M 6 HOH 66  3068 236  HOH HOH C . 
M 6 HOH 67  3069 237  HOH HOH C . 
M 6 HOH 68  3070 242  HOH HOH C . 
M 6 HOH 69  3071 243  HOH HOH C . 
M 6 HOH 70  3072 245  HOH HOH C . 
M 6 HOH 71  3073 246  HOH HOH C . 
M 6 HOH 72  3074 251  HOH HOH C . 
M 6 HOH 73  3075 254  HOH HOH C . 
M 6 HOH 74  3076 255  HOH HOH C . 
M 6 HOH 75  3077 256  HOH HOH C . 
M 6 HOH 76  3078 258  HOH HOH C . 
M 6 HOH 77  3079 259  HOH HOH C . 
M 6 HOH 78  3080 267  HOH HOH C . 
M 6 HOH 79  3081 268  HOH HOH C . 
M 6 HOH 80  3082 269  HOH HOH C . 
M 6 HOH 81  3083 271  HOH HOH C . 
M 6 HOH 82  3084 272  HOH HOH C . 
M 6 HOH 83  3085 274  HOH HOH C . 
M 6 HOH 84  3086 276  HOH HOH C . 
M 6 HOH 85  3087 279  HOH HOH C . 
M 6 HOH 86  3088 280  HOH HOH C . 
M 6 HOH 87  3089 283  HOH HOH C . 
M 6 HOH 88  3090 285  HOH HOH C . 
M 6 HOH 89  3091 287  HOH HOH C . 
M 6 HOH 90  3092 289  HOH HOH C . 
M 6 HOH 91  3093 291  HOH HOH C . 
M 6 HOH 92  3094 293  HOH HOH C . 
M 6 HOH 93  3095 295  HOH HOH C . 
M 6 HOH 94  3096 300  HOH HOH C . 
M 6 HOH 95  3097 302  HOH HOH C . 
M 6 HOH 96  3098 303  HOH HOH C . 
M 6 HOH 97  3099 304  HOH HOH C . 
M 6 HOH 98  3100 310  HOH HOH C . 
M 6 HOH 99  3101 312  HOH HOH C . 
M 6 HOH 100 3102 313  HOH HOH C . 
M 6 HOH 101 3103 314  HOH HOH C . 
M 6 HOH 102 3104 318  HOH HOH C . 
M 6 HOH 103 3105 321  HOH HOH C . 
M 6 HOH 104 3106 324  HOH HOH C . 
M 6 HOH 105 3107 325  HOH HOH C . 
M 6 HOH 106 3108 331  HOH HOH C . 
M 6 HOH 107 3109 332  HOH HOH C . 
M 6 HOH 108 3110 333  HOH HOH C . 
M 6 HOH 109 3111 335  HOH HOH C . 
M 6 HOH 110 3112 336  HOH HOH C . 
M 6 HOH 111 3113 341  HOH HOH C . 
M 6 HOH 112 3114 346  HOH HOH C . 
M 6 HOH 113 3115 348  HOH HOH C . 
M 6 HOH 114 3116 349  HOH HOH C . 
M 6 HOH 115 3117 350  HOH HOH C . 
M 6 HOH 116 3118 351  HOH HOH C . 
M 6 HOH 117 3119 355  HOH HOH C . 
M 6 HOH 118 3120 356  HOH HOH C . 
M 6 HOH 119 3121 363  HOH HOH C . 
M 6 HOH 120 3122 365  HOH HOH C . 
M 6 HOH 121 3123 367  HOH HOH C . 
M 6 HOH 122 3124 368  HOH HOH C . 
M 6 HOH 123 3125 369  HOH HOH C . 
M 6 HOH 124 3126 370  HOH HOH C . 
M 6 HOH 125 3127 383  HOH HOH C . 
M 6 HOH 126 3128 385  HOH HOH C . 
M 6 HOH 127 3129 387  HOH HOH C . 
M 6 HOH 128 3130 396  HOH HOH C . 
M 6 HOH 129 3131 397  HOH HOH C . 
M 6 HOH 130 3132 403  HOH HOH C . 
M 6 HOH 131 3133 405  HOH HOH C . 
M 6 HOH 132 3134 409  HOH HOH C . 
M 6 HOH 133 3135 420  HOH HOH C . 
M 6 HOH 134 3136 421  HOH HOH C . 
M 6 HOH 135 3137 422  HOH HOH C . 
M 6 HOH 136 3138 424  HOH HOH C . 
M 6 HOH 137 3139 425  HOH HOH C . 
M 6 HOH 138 3140 430  HOH HOH C . 
M 6 HOH 139 3141 434  HOH HOH C . 
M 6 HOH 140 3142 439  HOH HOH C . 
M 6 HOH 141 3143 441  HOH HOH C . 
M 6 HOH 142 3144 452  HOH HOH C . 
M 6 HOH 143 3145 453  HOH HOH C . 
M 6 HOH 144 3146 464  HOH HOH C . 
M 6 HOH 145 3147 468  HOH HOH C . 
M 6 HOH 146 3148 481  HOH HOH C . 
M 6 HOH 147 3149 484  HOH HOH C . 
M 6 HOH 148 3150 485  HOH HOH C . 
M 6 HOH 149 3151 488  HOH HOH C . 
M 6 HOH 150 3152 490  HOH HOH C . 
M 6 HOH 151 3153 496  HOH HOH C . 
M 6 HOH 152 3154 497  HOH HOH C . 
M 6 HOH 153 3155 507  HOH HOH C . 
M 6 HOH 154 3156 508  HOH HOH C . 
M 6 HOH 155 3157 514  HOH HOH C . 
M 6 HOH 156 3158 542  HOH HOH C . 
M 6 HOH 157 3159 549  HOH HOH C . 
M 6 HOH 158 3160 570  HOH HOH C . 
M 6 HOH 159 3161 571  HOH HOH C . 
M 6 HOH 160 3162 598  HOH HOH C . 
M 6 HOH 161 3163 599  HOH HOH C . 
M 6 HOH 162 3164 602  HOH HOH C . 
M 6 HOH 163 3165 609  HOH HOH C . 
M 6 HOH 164 3166 622  HOH HOH C . 
M 6 HOH 165 3167 624  HOH HOH C . 
M 6 HOH 166 3168 631  HOH HOH C . 
M 6 HOH 167 3169 645  HOH HOH C . 
M 6 HOH 168 3170 657  HOH HOH C . 
M 6 HOH 169 3171 673  HOH HOH C . 
M 6 HOH 170 3172 681  HOH HOH C . 
M 6 HOH 171 3173 683  HOH HOH C . 
M 6 HOH 172 3174 690  HOH HOH C . 
M 6 HOH 173 3175 699  HOH HOH C . 
M 6 HOH 174 3176 704  HOH HOH C . 
M 6 HOH 175 3177 712  HOH HOH C . 
M 6 HOH 176 3178 714  HOH HOH C . 
M 6 HOH 177 3179 748  HOH HOH C . 
M 6 HOH 178 3180 749  HOH HOH C . 
M 6 HOH 179 3181 766  HOH HOH C . 
M 6 HOH 180 3182 768  HOH HOH C . 
M 6 HOH 181 3183 772  HOH HOH C . 
M 6 HOH 182 3184 799  HOH HOH C . 
M 6 HOH 183 3185 816  HOH HOH C . 
M 6 HOH 184 3186 817  HOH HOH C . 
M 6 HOH 185 3187 826  HOH HOH C . 
M 6 HOH 186 3188 827  HOH HOH C . 
M 6 HOH 187 3189 841  HOH HOH C . 
M 6 HOH 188 3190 843  HOH HOH C . 
M 6 HOH 189 3191 847  HOH HOH C . 
M 6 HOH 190 3192 850  HOH HOH C . 
M 6 HOH 191 3193 856  HOH HOH C . 
M 6 HOH 192 3194 875  HOH HOH C . 
M 6 HOH 193 3195 876  HOH HOH C . 
M 6 HOH 194 3196 906  HOH HOH C . 
M 6 HOH 195 3197 909  HOH HOH C . 
M 6 HOH 196 3198 910  HOH HOH C . 
M 6 HOH 197 3199 912  HOH HOH C . 
M 6 HOH 198 3200 913  HOH HOH C . 
M 6 HOH 199 3201 919  HOH HOH C . 
M 6 HOH 200 3202 920  HOH HOH C . 
M 6 HOH 201 3203 923  HOH HOH C . 
M 6 HOH 202 3204 931  HOH HOH C . 
M 6 HOH 203 3205 933  HOH HOH C . 
M 6 HOH 204 3206 934  HOH HOH C . 
M 6 HOH 205 3207 935  HOH HOH C . 
M 6 HOH 206 3208 936  HOH HOH C . 
M 6 HOH 207 3209 937  HOH HOH C . 
M 6 HOH 208 3210 940  HOH HOH C . 
M 6 HOH 209 3211 941  HOH HOH C . 
M 6 HOH 210 3212 942  HOH HOH C . 
M 6 HOH 211 3213 944  HOH HOH C . 
M 6 HOH 212 3214 945  HOH HOH C . 
M 6 HOH 213 3215 947  HOH HOH C . 
N 6 HOH 1   172  3    HOH HOH D . 
N 6 HOH 2   173  23   HOH HOH D . 
N 6 HOH 3   174  33   HOH HOH D . 
N 6 HOH 4   175  48   HOH HOH D . 
N 6 HOH 5   176  59   HOH HOH D . 
N 6 HOH 6   177  74   HOH HOH D . 
N 6 HOH 7   178  80   HOH HOH D . 
N 6 HOH 8   179  81   HOH HOH D . 
N 6 HOH 9   180  100  HOH HOH D . 
N 6 HOH 10  181  101  HOH HOH D . 
N 6 HOH 11  182  102  HOH HOH D . 
N 6 HOH 12  183  104  HOH HOH D . 
N 6 HOH 13  184  111  HOH HOH D . 
N 6 HOH 14  185  113  HOH HOH D . 
N 6 HOH 15  186  118  HOH HOH D . 
N 6 HOH 16  187  120  HOH HOH D . 
N 6 HOH 17  188  125  HOH HOH D . 
N 6 HOH 18  189  127  HOH HOH D . 
N 6 HOH 19  190  133  HOH HOH D . 
N 6 HOH 20  191  136  HOH HOH D . 
N 6 HOH 21  192  142  HOH HOH D . 
N 6 HOH 22  193  154  HOH HOH D . 
N 6 HOH 23  194  160  HOH HOH D . 
N 6 HOH 24  195  164  HOH HOH D . 
N 6 HOH 25  196  171  HOH HOH D . 
N 6 HOH 26  197  181  HOH HOH D . 
N 6 HOH 27  198  204  HOH HOH D . 
N 6 HOH 28  199  218  HOH HOH D . 
N 6 HOH 29  200  227  HOH HOH D . 
N 6 HOH 30  201  233  HOH HOH D . 
N 6 HOH 31  202  240  HOH HOH D . 
N 6 HOH 32  203  263  HOH HOH D . 
N 6 HOH 33  204  275  HOH HOH D . 
N 6 HOH 34  205  290  HOH HOH D . 
N 6 HOH 35  206  292  HOH HOH D . 
N 6 HOH 36  207  307  HOH HOH D . 
N 6 HOH 37  208  315  HOH HOH D . 
N 6 HOH 38  209  319  HOH HOH D . 
N 6 HOH 39  210  330  HOH HOH D . 
N 6 HOH 40  211  354  HOH HOH D . 
N 6 HOH 41  212  374  HOH HOH D . 
N 6 HOH 42  213  375  HOH HOH D . 
N 6 HOH 43  214  380  HOH HOH D . 
N 6 HOH 44  215  382  HOH HOH D . 
N 6 HOH 45  216  386  HOH HOH D . 
N 6 HOH 46  217  415  HOH HOH D . 
N 6 HOH 47  218  440  HOH HOH D . 
N 6 HOH 48  219  446  HOH HOH D . 
N 6 HOH 49  220  447  HOH HOH D . 
N 6 HOH 50  221  449  HOH HOH D . 
N 6 HOH 51  222  470  HOH HOH D . 
N 6 HOH 52  223  472  HOH HOH D . 
N 6 HOH 53  224  477  HOH HOH D . 
N 6 HOH 54  225  478  HOH HOH D . 
N 6 HOH 55  226  482  HOH HOH D . 
N 6 HOH 56  227  483  HOH HOH D . 
N 6 HOH 57  228  487  HOH HOH D . 
N 6 HOH 58  229  505  HOH HOH D . 
N 6 HOH 59  230  517  HOH HOH D . 
N 6 HOH 60  231  532  HOH HOH D . 
N 6 HOH 61  232  581  HOH HOH D . 
N 6 HOH 62  233  595  HOH HOH D . 
N 6 HOH 63  234  597  HOH HOH D . 
N 6 HOH 64  235  620  HOH HOH D . 
N 6 HOH 65  236  651  HOH HOH D . 
N 6 HOH 66  237  783  HOH HOH D . 
N 6 HOH 67  238  806  HOH HOH D . 
N 6 HOH 68  239  808  HOH HOH D . 
N 6 HOH 69  240  878  HOH HOH D . 
N 6 HOH 70  241  879  HOH HOH D . 
N 6 HOH 71  242  880  HOH HOH D . 
N 6 HOH 72  243  881  HOH HOH D . 
N 6 HOH 73  244  882  HOH HOH D . 
N 6 HOH 74  245  883  HOH HOH D . 
N 6 HOH 75  246  903  HOH HOH D . 
N 6 HOH 76  247  904  HOH HOH D . 
N 6 HOH 77  248  905  HOH HOH D . 
N 6 HOH 78  249  938  HOH HOH D . 
N 6 HOH 79  250  939  HOH HOH D . 
N 6 HOH 80  251  943  HOH HOH D . 
N 6 HOH 81  252  948  HOH HOH D . 
N 6 HOH 82  253  950  HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,G,K,L 
2 1 C,D,H,I,J,M,N 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG  ? A SER 46  ? A SER 47   ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 OG1 ? A THR 180 ? A THR 181  ? 1_555 87.1  ? 
2  OG  ? A SER 46  ? A SER 47   ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 O1B ? G GDP .   ? A GDP 1001 ? 1_555 92.7  ? 
3  OG1 ? A THR 180 ? A THR 181  ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 O1B ? G GDP .   ? A GDP 1001 ? 1_555 169.8 ? 
4  OG  ? A SER 46  ? A SER 47   ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 O   ? K HOH .   ? A HOH 3229 ? 1_555 82.1  ? 
5  OG1 ? A THR 180 ? A THR 181  ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 O   ? K HOH .   ? A HOH 3229 ? 1_555 92.9  ? 
6  O1B ? G GDP .   ? A GDP 1001 ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 O   ? K HOH .   ? A HOH 3229 ? 1_555 97.3  ? 
7  OG  ? A SER 46  ? A SER 47   ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 O   ? K HOH .   ? A HOH 3231 ? 1_555 90.8  ? 
8  OG1 ? A THR 180 ? A THR 181  ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 O   ? K HOH .   ? A HOH 3231 ? 1_555 85.8  ? 
9  O1B ? G GDP .   ? A GDP 1001 ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 O   ? K HOH .   ? A HOH 3231 ? 1_555 84.0  ? 
10 O   ? K HOH .   ? A HOH 3229 ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 O   ? K HOH .   ? A HOH 3231 ? 1_555 172.9 ? 
11 OG  ? A SER 46  ? A SER 47   ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 F3  ? E ALF .   ? A ALF 2001 ? 1_555 166.7 ? 
12 OG1 ? A THR 180 ? A THR 181  ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 F3  ? E ALF .   ? A ALF 2001 ? 1_555 90.1  ? 
13 O1B ? G GDP .   ? A GDP 1001 ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 F3  ? E ALF .   ? A ALF 2001 ? 1_555 92.3  ? 
14 O   ? K HOH .   ? A HOH 3229 ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 F3  ? E ALF .   ? A ALF 2001 ? 1_555 85.1  ? 
15 O   ? K HOH .   ? A HOH 3231 ? 1_555 MG ? F MG  . ? A MG  3001 ? 1_555 F3  ? E ALF .   ? A ALF 2001 ? 1_555 101.9 ? 
16 OG  ? C SER 46  ? C SER 47   ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 OG1 ? C THR 180 ? C THR 181  ? 1_555 79.9  ? 
17 OG  ? C SER 46  ? C SER 47   ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 O   ? M HOH .   ? C HOH 3187 ? 1_555 83.2  ? 
18 OG1 ? C THR 180 ? C THR 181  ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 O   ? M HOH .   ? C HOH 3187 ? 1_555 83.3  ? 
19 OG  ? C SER 46  ? C SER 47   ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 O   ? M HOH .   ? C HOH 3190 ? 1_555 84.2  ? 
20 OG1 ? C THR 180 ? C THR 181  ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 O   ? M HOH .   ? C HOH 3190 ? 1_555 91.7  ? 
21 O   ? M HOH .   ? C HOH 3187 ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 O   ? M HOH .   ? C HOH 3190 ? 1_555 167.1 ? 
22 OG  ? C SER 46  ? C SER 47   ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 O1B ? J GDP .   ? C GDP 1002 ? 1_555 92.8  ? 
23 OG1 ? C THR 180 ? C THR 181  ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 O1B ? J GDP .   ? C GDP 1002 ? 1_555 165.8 ? 
24 O   ? M HOH .   ? C HOH 3187 ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 O1B ? J GDP .   ? C GDP 1002 ? 1_555 83.8  ? 
25 O   ? M HOH .   ? C HOH 3190 ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 O1B ? J GDP .   ? C GDP 1002 ? 1_555 99.8  ? 
26 OG  ? C SER 46  ? C SER 47   ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 F1  ? H ALF .   ? C ALF 2002 ? 1_555 166.1 ? 
27 OG1 ? C THR 180 ? C THR 181  ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 F1  ? H ALF .   ? C ALF 2002 ? 1_555 93.8  ? 
28 O   ? M HOH .   ? C HOH 3187 ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 F1  ? H ALF .   ? C ALF 2002 ? 1_555 108.5 ? 
29 O   ? M HOH .   ? C HOH 3190 ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 F1  ? H ALF .   ? C ALF 2002 ? 1_555 83.6  ? 
30 O1B ? J GDP .   ? C GDP 1002 ? 1_555 MG ? I MG  . ? C MG  3002 ? 1_555 F1  ? H ALF .   ? C ALF 2002 ? 1_555 95.8  ? 
31 O2B ? G GDP .   ? A GDP 1001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 F1  ? E ALF .   ? A ALF 2001 ? 1_555 89.4  ? 
32 O2B ? G GDP .   ? A GDP 1001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 F2  ? E ALF .   ? A ALF 2001 ? 1_555 95.9  ? 
33 F1  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 F2  ? E ALF .   ? A ALF 2001 ? 1_555 174.4 ? 
34 O2B ? G GDP .   ? A GDP 1001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 F3  ? E ALF .   ? A ALF 2001 ? 1_555 89.7  ? 
35 F1  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 F3  ? E ALF .   ? A ALF 2001 ? 1_555 95.4  ? 
36 F2  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 F3  ? E ALF .   ? A ALF 2001 ? 1_555 82.8  ? 
37 O2B ? G GDP .   ? A GDP 1001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 F4  ? E ALF .   ? A ALF 2001 ? 1_555 91.1  ? 
38 F1  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 F4  ? E ALF .   ? A ALF 2001 ? 1_555 90.5  ? 
39 F2  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 F4  ? E ALF .   ? A ALF 2001 ? 1_555 91.2  ? 
40 F3  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 F4  ? E ALF .   ? A ALF 2001 ? 1_555 174.0 ? 
41 O2B ? G GDP .   ? A GDP 1001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 O1B ? G GDP .   ? A GDP 1001 ? 1_555 39.7  ? 
42 F1  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 O1B ? G GDP .   ? A GDP 1001 ? 1_555 96.6  ? 
43 F2  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 O1B ? G GDP .   ? A GDP 1001 ? 1_555 86.3  ? 
44 F3  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 O1B ? G GDP .   ? A GDP 1001 ? 1_555 50.2  ? 
45 F4  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 O1B ? G GDP .   ? A GDP 1001 ? 1_555 129.8 ? 
46 O2B ? G GDP .   ? A GDP 1001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 O   ? K HOH .   ? A HOH 3236 ? 1_555 172.6 ? 
47 F1  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 O   ? K HOH .   ? A HOH 3236 ? 1_555 83.2  ? 
48 F2  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 O   ? K HOH .   ? A HOH 3236 ? 1_555 91.4  ? 
49 F3  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 O   ? K HOH .   ? A HOH 3236 ? 1_555 90.4  ? 
50 F4  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 O   ? K HOH .   ? A HOH 3236 ? 1_555 89.7  ? 
51 O1B ? G GDP .   ? A GDP 1001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 O   ? K HOH .   ? A HOH 3236 ? 1_555 140.5 ? 
52 O2B ? G GDP .   ? A GDP 1001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 MG  ? F MG  .   ? A MG  3001 ? 1_555 71.8  ? 
53 F1  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 MG  ? F MG  .   ? A MG  3001 ? 1_555 108.1 ? 
54 F2  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 MG  ? F MG  .   ? A MG  3001 ? 1_555 72.0  ? 
55 F3  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 MG  ? F MG  .   ? A MG  3001 ? 1_555 22.5  ? 
56 F4  ? E ALF .   ? A ALF 2001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 MG  ? F MG  .   ? A MG  3001 ? 1_555 154.1 ? 
57 O1B ? G GDP .   ? A GDP 1001 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 MG  ? F MG  .   ? A MG  3001 ? 1_555 32.7  ? 
58 O   ? K HOH .   ? A HOH 3236 ? 1_555 AL ? E ALF . ? A ALF 2001 ? 1_555 MG  ? F MG  .   ? A MG  3001 ? 1_555 109.9 ? 
59 O2B ? J GDP .   ? C GDP 1002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 F1  ? H ALF .   ? C ALF 2002 ? 1_555 92.3  ? 
60 O2B ? J GDP .   ? C GDP 1002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 F2  ? H ALF .   ? C ALF 2002 ? 1_555 89.4  ? 
61 F1  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 F2  ? H ALF .   ? C ALF 2002 ? 1_555 173.1 ? 
62 O2B ? J GDP .   ? C GDP 1002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 F3  ? H ALF .   ? C ALF 2002 ? 1_555 91.4  ? 
63 F1  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 F3  ? H ALF .   ? C ALF 2002 ? 1_555 91.7  ? 
64 F2  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 F3  ? H ALF .   ? C ALF 2002 ? 1_555 95.0  ? 
65 O2B ? J GDP .   ? C GDP 1002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 F4  ? H ALF .   ? C ALF 2002 ? 1_555 90.6  ? 
66 F1  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 F4  ? H ALF .   ? C ALF 2002 ? 1_555 84.7  ? 
67 F2  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 F4  ? H ALF .   ? C ALF 2002 ? 1_555 88.6  ? 
68 F3  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 F4  ? H ALF .   ? C ALF 2002 ? 1_555 175.9 ? 
69 O2B ? J GDP .   ? C GDP 1002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O1B ? J GDP .   ? C GDP 1002 ? 1_555 39.1  ? 
70 F1  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O1B ? J GDP .   ? C GDP 1002 ? 1_555 53.5  ? 
71 F2  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O1B ? J GDP .   ? C GDP 1002 ? 1_555 127.3 ? 
72 F3  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O1B ? J GDP .   ? C GDP 1002 ? 1_555 96.5  ? 
73 F4  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O1B ? J GDP .   ? C GDP 1002 ? 1_555 82.9  ? 
74 O2B ? J GDP .   ? C GDP 1002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 MG  ? I MG  .   ? C MG  3002 ? 1_555 71.1  ? 
75 F1  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 MG  ? I MG  .   ? C MG  3002 ? 1_555 26.2  ? 
76 F2  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 MG  ? I MG  .   ? C MG  3002 ? 1_555 150.7 ? 
77 F3  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 MG  ? I MG  .   ? C MG  3002 ? 1_555 106.9 ? 
78 F4  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 MG  ? I MG  .   ? C MG  3002 ? 1_555 70.4  ? 
79 O1B ? J GDP .   ? C GDP 1002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 MG  ? I MG  .   ? C MG  3002 ? 1_555 32.8  ? 
80 O2B ? J GDP .   ? C GDP 1002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O   ? M HOH .   ? C HOH 3194 ? 1_555 177.1 ? 
81 F1  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O   ? M HOH .   ? C HOH 3194 ? 1_555 86.8  ? 
82 F2  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O   ? M HOH .   ? C HOH 3194 ? 1_555 91.8  ? 
83 F3  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O   ? M HOH .   ? C HOH 3194 ? 1_555 85.8  ? 
84 F4  ? H ALF .   ? C ALF 2002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O   ? M HOH .   ? C HOH 3194 ? 1_555 92.1  ? 
85 O1B ? J GDP .   ? C GDP 1002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O   ? M HOH .   ? C HOH 3194 ? 1_555 140.3 ? 
86 MG  ? I MG  .   ? C MG  3002 ? 1_555 AL ? H ALF . ? C ALF 2002 ? 1_555 O   ? M HOH .   ? C HOH 3194 ? 1_555 108.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-06 
2 'Structure model' 1 1 2007-10-10 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 19.6159 8.5925  30.4741 -0.1468 -0.2156 -0.1189 -0.0063 -0.0031 -0.0313 1.4930 1.9959 1.8415 0.0991  0.2341  0.2905  
-0.0433 0.0362  -0.1982 0.0159  0.0344  -0.1376 0.1676  0.0132  0.0089  'X-RAY DIFFRACTION' 
2 ? refined 24.9894 31.7483 38.6334 -0.0764 -0.1884 -0.1132 -0.0367 -0.0549 -0.0502 4.6891 2.1562 2.3851 -1.1627 1.1201  -0.3248 
-0.2213 -0.3113 0.4649  0.2205  0.1004  -0.3472 -0.3004 0.0619  0.1208  'X-RAY DIFFRACTION' 
3 ? refined 12.3490 50.1431 6.4319  -0.1218 -0.1647 -0.1653 0.0017  0.0124  -0.0035 1.7320 2.4960 1.9877 0.0428  -0.4247 0.2831  
0.0036  0.2157  -0.0295 -0.1359 -0.0331 -0.1620 -0.2488 -0.1901 0.0294  'X-RAY DIFFRACTION' 
4 ? refined 3.0027  26.9746 2.8948  -0.1495 -0.1175 -0.1406 -0.0574 -0.0078 -0.0453 2.4244 3.0537 4.2115 0.9522  -0.3961 -0.4097 
-0.0245 0.1762  -0.2131 -0.2446 0.1510  -0.1251 0.3109  -0.2462 -0.1265 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 33 A 32 A 348 A 347 ? 'X-RAY DIFFRACTION' ? 
2 2 B 46 B 7  B 176 B 137 ? 'X-RAY DIFFRACTION' ? 
3 3 C 31 C 30 C 347 C 346 ? 'X-RAY DIFFRACTION' ? 
4 4 D 56 D 17 D 171 D 132 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.2.0019 ? 1 
HKL-2000 'data reduction' .        ? 2 
HKL-2000 'data scaling'   .        ? 3 
PHASER   phasing          .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O C HOH 3021 ? ? O C HOH 3199 ? ? 1.60 
2 1 O A HOH 3016 ? ? O A HOH 3244 ? ? 1.74 
3 1 O A HOH 3019 ? ? O A HOH 3239 ? ? 1.85 
4 1 O A HOH 3101 ? ? O A HOH 3245 ? ? 1.92 
5 1 O C HOH 3205 ? ? O C HOH 3206 ? ? 2.07 
6 1 O C HOH 3189 ? ? O C HOH 3200 ? ? 2.10 
7 1 O A HOH 3186 ? ? O A HOH 3204 ? ? 2.11 
8 1 O B HOH 235  ? ? O B HOH 263  ? ? 2.14 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB B SER 46  ? ? OG B SER 46  ? ? 1.498 1.418 0.080  0.013 N 
2 1 CB C CYS 254 ? ? SG C CYS 254 ? ? 1.675 1.812 -0.137 0.016 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE B ARG 128 ? ? CZ B ARG 128 ? ? NH1 B ARG 128 ? ? 123.98 120.30 3.68  0.50 N 
2 1 NE B ARG 128 ? ? CZ B ARG 128 ? ? NH2 B ARG 128 ? ? 116.71 120.30 -3.59 0.50 N 
3 1 NE D ARG 128 ? ? CZ D ARG 128 ? ? NH2 D ARG 128 ? ? 124.00 120.30 3.70  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 58  ? ? -117.04 -139.53 
2 1 ASP A 237 ? ? -163.28 98.56   
3 1 ASP B 157 ? ? -102.89 -68.89  
4 1 GLU C 58  ? ? -128.12 -143.12 
5 1 TYR C 146 ? ? -145.16 -158.19 
6 1 ASP D 157 ? ? -100.80 -66.06  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_1   D 
_pdbx_validate_peptide_omega.auth_seq_id_1    170 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LEU 
_pdbx_validate_peptide_omega.auth_asym_id_2   D 
_pdbx_validate_peptide_omega.auth_seq_id_2    171 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            146.00 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 58  ? CG  ? A GLU 57  CG  
2   1 Y 1 A GLU 58  ? CD  ? A GLU 57  CD  
3   1 Y 1 A GLU 58  ? OE1 ? A GLU 57  OE1 
4   1 Y 1 A GLU 58  ? OE2 ? A GLU 57  OE2 
5   1 Y 1 A ASP 59  ? CG  ? A ASP 58  CG  
6   1 Y 1 A ASP 59  ? OD1 ? A ASP 58  OD1 
7   1 Y 1 A ASP 59  ? OD2 ? A ASP 58  OD2 
8   1 Y 1 A ARG 90  ? NE  ? A ARG 89  NE  
9   1 Y 1 A ARG 90  ? CZ  ? A ARG 89  CZ  
10  1 Y 1 A ARG 90  ? NH1 ? A ARG 89  NH1 
11  1 Y 1 A ARG 90  ? NH2 ? A ARG 89  NH2 
12  1 Y 1 A LYS 92  ? CG  ? A LYS 91  CG  
13  1 Y 1 A LYS 92  ? CD  ? A LYS 91  CD  
14  1 Y 1 A LYS 92  ? CE  ? A LYS 91  CE  
15  1 Y 1 A LYS 92  ? NZ  ? A LYS 91  NZ  
16  1 Y 1 A GLU 116 ? CG  ? A GLU 115 CG  
17  1 Y 1 A GLU 116 ? CD  ? A GLU 115 CD  
18  1 Y 1 A GLU 116 ? OE1 ? A GLU 115 OE1 
19  1 Y 1 A GLU 116 ? OE2 ? A GLU 115 OE2 
20  1 Y 1 A ASP 193 ? CG  ? A ASP 192 CG  
21  1 Y 1 A ASP 193 ? OD1 ? A ASP 192 OD1 
22  1 Y 1 A ASP 193 ? OD2 ? A ASP 192 OD2 
23  1 Y 1 A LYS 197 ? CG  ? A LYS 196 CG  
24  1 Y 1 A LYS 197 ? CD  ? A LYS 196 CD  
25  1 Y 1 A LYS 197 ? CE  ? A LYS 196 CE  
26  1 Y 1 A LYS 197 ? NZ  ? A LYS 196 NZ  
27  1 Y 1 A LYS 248 ? CE  ? A LYS 247 CE  
28  1 Y 1 A LYS 248 ? NZ  ? A LYS 247 NZ  
29  1 Y 1 A LYS 257 ? CG  ? A LYS 256 CG  
30  1 Y 1 A LYS 257 ? CD  ? A LYS 256 CD  
31  1 Y 1 A LYS 257 ? CE  ? A LYS 256 CE  
32  1 Y 1 A LYS 257 ? NZ  ? A LYS 256 NZ  
33  1 Y 1 A GLU 289 ? CG  ? A GLU 288 CG  
34  1 Y 1 A GLU 289 ? CD  ? A GLU 288 CD  
35  1 Y 1 A GLU 289 ? OE1 ? A GLU 288 OE1 
36  1 Y 1 A GLU 289 ? OE2 ? A GLU 288 OE2 
37  1 Y 1 A ARG 312 ? CZ  ? A ARG 311 CZ  
38  1 Y 1 A ARG 312 ? NH1 ? A ARG 311 NH1 
39  1 Y 1 A ARG 312 ? NH2 ? A ARG 311 NH2 
40  1 Y 1 A ARG 313 ? CD  ? A ARG 312 CD  
41  1 Y 1 A ARG 313 ? NE  ? A ARG 312 NE  
42  1 Y 1 A ARG 313 ? CZ  ? A ARG 312 CZ  
43  1 Y 1 A ARG 313 ? NH1 ? A ARG 312 NH1 
44  1 Y 1 A ARG 313 ? NH2 ? A ARG 312 NH2 
45  1 Y 1 A ASP 315 ? CG  ? A ASP 314 CG  
46  1 Y 1 A ASP 315 ? OD1 ? A ASP 314 OD1 
47  1 Y 1 A ASP 315 ? OD2 ? A ASP 314 OD2 
48  1 Y 1 A LYS 330 ? CD  ? A LYS 329 CD  
49  1 Y 1 A LYS 330 ? CE  ? A LYS 329 CE  
50  1 Y 1 A LYS 330 ? NZ  ? A LYS 329 NZ  
51  1 Y 1 B LYS 64  ? CD  ? B LYS 25  CD  
52  1 Y 1 B LYS 64  ? CE  ? B LYS 25  CE  
53  1 Y 1 B LYS 64  ? NZ  ? B LYS 25  NZ  
54  1 Y 1 B GLU 91  ? CD  ? B GLU 52  CD  
55  1 Y 1 B GLU 91  ? OE1 ? B GLU 52  OE1 
56  1 Y 1 B GLU 91  ? OE2 ? B GLU 52  OE2 
57  1 Y 1 B ARG 96  ? NE  ? B ARG 57  NE  
58  1 Y 1 B ARG 96  ? CZ  ? B ARG 57  CZ  
59  1 Y 1 B ARG 96  ? NH1 ? B ARG 57  NH1 
60  1 Y 1 B ARG 96  ? NH2 ? B ARG 57  NH2 
61  1 Y 1 B LYS 100 ? CG  ? B LYS 61  CG  
62  1 Y 1 B LYS 100 ? CD  ? B LYS 61  CD  
63  1 Y 1 B LYS 100 ? CE  ? B LYS 61  CE  
64  1 Y 1 B LYS 100 ? NZ  ? B LYS 61  NZ  
65  1 Y 1 B LYS 104 ? CD  ? B LYS 65  CD  
66  1 Y 1 B LYS 104 ? CE  ? B LYS 65  CE  
67  1 Y 1 B LYS 104 ? NZ  ? B LYS 65  NZ  
68  1 Y 1 B ARG 107 ? CG  ? B ARG 68  CG  
69  1 Y 1 B ARG 107 ? CD  ? B ARG 68  CD  
70  1 Y 1 B ARG 107 ? NE  ? B ARG 68  NE  
71  1 Y 1 B ARG 107 ? CZ  ? B ARG 68  CZ  
72  1 Y 1 B ARG 107 ? NH1 ? B ARG 68  NH1 
73  1 Y 1 B ARG 107 ? NH2 ? B ARG 68  NH2 
74  1 Y 1 B LYS 166 ? CG  ? B LYS 127 CG  
75  1 Y 1 B LYS 166 ? CD  ? B LYS 127 CD  
76  1 Y 1 B LYS 166 ? CE  ? B LYS 127 CE  
77  1 Y 1 B LYS 166 ? NZ  ? B LYS 127 NZ  
78  1 Y 1 B LEU 169 ? CG  ? B LEU 130 CG  
79  1 Y 1 B LEU 169 ? CD1 ? B LEU 130 CD1 
80  1 Y 1 B LEU 169 ? CD2 ? B LEU 130 CD2 
81  1 Y 1 B GLN 174 ? CD  ? B GLN 135 CD  
82  1 Y 1 B GLN 174 ? OE1 ? B GLN 135 OE1 
83  1 Y 1 B GLN 174 ? NE2 ? B GLN 135 NE2 
84  1 Y 1 C LYS 32  ? CD  ? C LYS 31  CD  
85  1 Y 1 C LYS 32  ? CE  ? C LYS 31  CE  
86  1 Y 1 C LYS 32  ? NZ  ? C LYS 31  NZ  
87  1 Y 1 C ASP 64  ? CG  ? C ASP 63  CG  
88  1 Y 1 C ASP 64  ? OD1 ? C ASP 63  OD1 
89  1 Y 1 C ASP 64  ? OD2 ? C ASP 63  OD2 
90  1 Y 1 C LYS 67  ? CD  ? C LYS 66  CD  
91  1 Y 1 C LYS 67  ? CE  ? C LYS 66  CE  
92  1 Y 1 C LYS 67  ? NZ  ? C LYS 66  NZ  
93  1 Y 1 C GLN 68  ? CG  ? C GLN 67  CG  
94  1 Y 1 C GLN 68  ? CD  ? C GLN 67  CD  
95  1 Y 1 C GLN 68  ? OE1 ? C GLN 67  OE1 
96  1 Y 1 C GLN 68  ? NE2 ? C GLN 67  NE2 
97  1 Y 1 C LYS 70  ? CE  ? C LYS 69  CE  
98  1 Y 1 C LYS 70  ? NZ  ? C LYS 69  NZ  
99  1 Y 1 C LYS 92  ? CG  ? C LYS 91  CG  
100 1 Y 1 C LYS 92  ? CD  ? C LYS 91  CD  
101 1 Y 1 C LYS 92  ? CE  ? C LYS 91  CE  
102 1 Y 1 C LYS 92  ? NZ  ? C LYS 91  NZ  
103 1 Y 1 C GLU 116 ? CG  ? C GLU 115 CG  
104 1 Y 1 C GLU 116 ? CD  ? C GLU 115 CD  
105 1 Y 1 C GLU 116 ? OE1 ? C GLU 115 OE1 
106 1 Y 1 C GLU 116 ? OE2 ? C GLU 115 OE2 
107 1 Y 1 C VAL 118 ? CG1 ? C VAL 117 CG1 
108 1 Y 1 C VAL 118 ? CG2 ? C VAL 117 CG2 
109 1 Y 1 C LYS 192 ? CG  ? C LYS 191 CG  
110 1 Y 1 C LYS 192 ? CD  ? C LYS 191 CD  
111 1 Y 1 C LYS 192 ? CE  ? C LYS 191 CE  
112 1 Y 1 C LYS 192 ? NZ  ? C LYS 191 NZ  
113 1 Y 1 C LYS 197 ? CE  ? C LYS 196 CE  
114 1 Y 1 C LYS 197 ? NZ  ? C LYS 196 NZ  
115 1 Y 1 C GLU 216 ? CG  ? C GLU 215 CG  
116 1 Y 1 C GLU 216 ? CD  ? C GLU 215 CD  
117 1 Y 1 C GLU 216 ? OE1 ? C GLU 215 OE1 
118 1 Y 1 C GLU 216 ? OE2 ? C GLU 215 OE2 
119 1 Y 1 C LYS 257 ? CG  ? C LYS 256 CG  
120 1 Y 1 C LYS 257 ? CD  ? C LYS 256 CD  
121 1 Y 1 C LYS 257 ? CE  ? C LYS 256 CE  
122 1 Y 1 C LYS 257 ? NZ  ? C LYS 256 NZ  
123 1 Y 1 C GLU 261 ? CG  ? C GLU 260 CG  
124 1 Y 1 C GLU 261 ? CD  ? C GLU 260 CD  
125 1 Y 1 C GLU 261 ? OE1 ? C GLU 260 OE1 
126 1 Y 1 C GLU 261 ? OE2 ? C GLU 260 OE2 
127 1 Y 1 C GLU 276 ? CD  ? C GLU 275 CD  
128 1 Y 1 C GLU 276 ? OE1 ? C GLU 275 OE1 
129 1 Y 1 C GLU 276 ? OE2 ? C GLU 275 OE2 
130 1 Y 1 C LYS 279 ? CD  ? C LYS 278 CD  
131 1 Y 1 C LYS 279 ? CE  ? C LYS 278 CE  
132 1 Y 1 C LYS 279 ? NZ  ? C LYS 278 NZ  
133 1 Y 1 C GLU 297 ? OE1 ? C GLU 296 OE1 
134 1 Y 1 C GLU 297 ? OE2 ? C GLU 296 OE2 
135 1 Y 1 C ARG 313 ? CD  ? C ARG 312 CD  
136 1 Y 1 C ARG 313 ? NE  ? C ARG 312 NE  
137 1 Y 1 C ARG 313 ? CZ  ? C ARG 312 CZ  
138 1 Y 1 C ARG 313 ? NH1 ? C ARG 312 NH1 
139 1 Y 1 C ARG 313 ? NH2 ? C ARG 312 NH2 
140 1 Y 1 C ASP 315 ? CG  ? C ASP 314 CG  
141 1 Y 1 C ASP 315 ? OD1 ? C ASP 314 OD1 
142 1 Y 1 C ASP 315 ? OD2 ? C ASP 314 OD2 
143 1 Y 1 C LYS 330 ? CG  ? C LYS 329 CG  
144 1 Y 1 C LYS 330 ? CD  ? C LYS 329 CD  
145 1 Y 1 C LYS 330 ? CE  ? C LYS 329 CE  
146 1 Y 1 C LYS 330 ? NZ  ? C LYS 329 NZ  
147 1 Y 1 C LYS 345 ? CD  ? C LYS 344 CD  
148 1 Y 1 C LYS 345 ? CE  ? C LYS 344 CE  
149 1 Y 1 C LYS 345 ? NZ  ? C LYS 344 NZ  
150 1 Y 1 D LYS 64  ? CD  ? D LYS 25  CD  
151 1 Y 1 D LYS 64  ? CE  ? D LYS 25  CE  
152 1 Y 1 D LYS 64  ? NZ  ? D LYS 25  NZ  
153 1 Y 1 D ARG 96  ? NE  ? D ARG 57  NE  
154 1 Y 1 D ARG 96  ? CZ  ? D ARG 57  CZ  
155 1 Y 1 D ARG 96  ? NH1 ? D ARG 57  NH1 
156 1 Y 1 D ARG 96  ? NH2 ? D ARG 57  NH2 
157 1 Y 1 D ARG 107 ? CZ  ? D ARG 68  CZ  
158 1 Y 1 D ARG 107 ? NH1 ? D ARG 68  NH1 
159 1 Y 1 D ARG 107 ? NH2 ? D ARG 68  NH2 
160 1 Y 1 D LYS 133 ? NZ  ? D LYS 94  NZ  
161 1 Y 1 D GLU 137 ? CG  ? D GLU 98  CG  
162 1 Y 1 D GLU 137 ? CD  ? D GLU 98  CD  
163 1 Y 1 D GLU 137 ? OE1 ? D GLU 98  OE1 
164 1 Y 1 D GLU 137 ? OE2 ? D GLU 98  OE2 
165 1 Y 1 D ARG 164 ? NE  ? D ARG 125 NE  
166 1 Y 1 D ARG 164 ? CZ  ? D ARG 125 CZ  
167 1 Y 1 D ARG 164 ? NH1 ? D ARG 125 NH1 
168 1 Y 1 D ARG 164 ? NH2 ? D ARG 125 NH2 
169 1 Y 1 D LYS 166 ? CG  ? D LYS 127 CG  
170 1 Y 1 D LYS 166 ? CD  ? D LYS 127 CD  
171 1 Y 1 D LYS 166 ? CE  ? D LYS 127 CE  
172 1 Y 1 D LYS 166 ? NZ  ? D LYS 127 NZ  
173 1 Y 1 D LEU 169 ? CG  ? D LEU 130 CG  
174 1 Y 1 D LEU 169 ? CD1 ? D LEU 130 CD1 
175 1 Y 1 D LEU 169 ? CD2 ? D LEU 130 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A SER 2   ? A SER 1   
2   1 Y 1 A MET 3   ? A MET 2   
3   1 Y 1 A THR 4   ? A THR 3   
4   1 Y 1 A LEU 5   ? A LEU 4   
5   1 Y 1 A SER 6   ? A SER 5   
6   1 Y 1 A ALA 7   ? A ALA 6   
7   1 Y 1 A GLU 8   ? A GLU 7   
8   1 Y 1 A ASP 9   ? A ASP 8   
9   1 Y 1 A LYS 10  ? A LYS 9   
10  1 Y 1 A ALA 11  ? A ALA 10  
11  1 Y 1 A ALA 12  ? A ALA 11  
12  1 Y 1 A VAL 13  ? A VAL 12  
13  1 Y 1 A GLU 14  ? A GLU 13  
14  1 Y 1 A ARG 15  ? A ARG 14  
15  1 Y 1 A SER 16  ? A SER 15  
16  1 Y 1 A LYS 17  ? A LYS 16  
17  1 Y 1 A MET 18  ? A MET 17  
18  1 Y 1 A ILE 19  ? A ILE 18  
19  1 Y 1 A ASP 20  ? A ASP 19  
20  1 Y 1 A ARG 21  ? A ARG 20  
21  1 Y 1 A ASN 22  ? A ASN 21  
22  1 Y 1 A LEU 23  ? A LEU 22  
23  1 Y 1 A ARG 24  ? A ARG 23  
24  1 Y 1 A GLU 25  ? A GLU 24  
25  1 Y 1 A ASP 26  ? A ASP 25  
26  1 Y 1 A GLY 27  ? A GLY 26  
27  1 Y 1 A GLU 28  ? A GLU 27  
28  1 Y 1 A LYS 29  ? A LYS 28  
29  1 Y 1 A ALA 30  ? A ALA 29  
30  1 Y 1 A ALA 31  ? A ALA 30  
31  1 Y 1 A LYS 32  ? A LYS 31  
32  1 Y 1 A LYS 349 ? A LYS 348 
33  1 Y 1 A GLU 350 ? A GLU 349 
34  1 Y 1 A SER 351 ? A SER 350 
35  1 Y 1 B SER 40  ? B SER 1   
36  1 Y 1 B MET 41  ? B MET 2   
37  1 Y 1 B LEU 42  ? B LEU 3   
38  1 Y 1 B LYS 43  ? B LYS 4   
39  1 Y 1 B ARG 44  ? B ARG 5   
40  1 Y 1 B LEU 45  ? B LEU 6   
41  1 Y 1 B ARG 177 ? B ARG 138 
42  1 Y 1 B ARG 178 ? B ARG 139 
43  1 Y 1 B LEU 179 ? B LEU 140 
44  1 Y 1 B SER 180 ? B SER 141 
45  1 Y 1 C SER 2   ? C SER 1   
46  1 Y 1 C MET 3   ? C MET 2   
47  1 Y 1 C THR 4   ? C THR 3   
48  1 Y 1 C LEU 5   ? C LEU 4   
49  1 Y 1 C SER 6   ? C SER 5   
50  1 Y 1 C ALA 7   ? C ALA 6   
51  1 Y 1 C GLU 8   ? C GLU 7   
52  1 Y 1 C ASP 9   ? C ASP 8   
53  1 Y 1 C LYS 10  ? C LYS 9   
54  1 Y 1 C ALA 11  ? C ALA 10  
55  1 Y 1 C ALA 12  ? C ALA 11  
56  1 Y 1 C VAL 13  ? C VAL 12  
57  1 Y 1 C GLU 14  ? C GLU 13  
58  1 Y 1 C ARG 15  ? C ARG 14  
59  1 Y 1 C SER 16  ? C SER 15  
60  1 Y 1 C LYS 17  ? C LYS 16  
61  1 Y 1 C MET 18  ? C MET 17  
62  1 Y 1 C ILE 19  ? C ILE 18  
63  1 Y 1 C ASP 20  ? C ASP 19  
64  1 Y 1 C ARG 21  ? C ARG 20  
65  1 Y 1 C ASN 22  ? C ASN 21  
66  1 Y 1 C LEU 23  ? C LEU 22  
67  1 Y 1 C ARG 24  ? C ARG 23  
68  1 Y 1 C GLU 25  ? C GLU 24  
69  1 Y 1 C ASP 26  ? C ASP 25  
70  1 Y 1 C GLY 27  ? C GLY 26  
71  1 Y 1 C GLU 28  ? C GLU 27  
72  1 Y 1 C LYS 29  ? C LYS 28  
73  1 Y 1 C ALA 30  ? C ALA 29  
74  1 Y 1 C LEU 348 ? C LEU 347 
75  1 Y 1 C LYS 349 ? C LYS 348 
76  1 Y 1 C GLU 350 ? C GLU 349 
77  1 Y 1 C SER 351 ? C SER 350 
78  1 Y 1 D SER 40  ? D SER 1   
79  1 Y 1 D MET 41  ? D MET 2   
80  1 Y 1 D LEU 42  ? D LEU 3   
81  1 Y 1 D LYS 43  ? D LYS 4   
82  1 Y 1 D ARG 44  ? D ARG 5   
83  1 Y 1 D LEU 45  ? D LEU 6   
84  1 Y 1 D SER 46  ? D SER 7   
85  1 Y 1 D THR 47  ? D THR 8   
86  1 Y 1 D GLU 48  ? D GLU 9   
87  1 Y 1 D GLU 49  ? D GLU 10  
88  1 Y 1 D ALA 50  ? D ALA 11  
89  1 Y 1 D THR 51  ? D THR 12  
90  1 Y 1 D ARG 52  ? D ARG 13  
91  1 Y 1 D TRP 53  ? D TRP 14  
92  1 Y 1 D ALA 54  ? D ALA 15  
93  1 Y 1 D ASP 55  ? D ASP 16  
94  1 Y 1 D LEU 172 ? D LEU 133 
95  1 Y 1 D SER 173 ? D SER 134 
96  1 Y 1 D GLN 174 ? D GLN 135 
97  1 Y 1 D SER 175 ? D SER 136 
98  1 Y 1 D GLN 176 ? D GLN 137 
99  1 Y 1 D ARG 177 ? D ARG 138 
100 1 Y 1 D ARG 178 ? D ARG 139 
101 1 Y 1 D LEU 179 ? D LEU 140 
102 1 Y 1 D SER 180 ? D SER 141 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'TETRAFLUOROALUMINATE ION' ALF 
4 'MAGNESIUM ION'            MG  
5 "GUANOSINE-5'-DIPHOSPHATE" GDP 
6 water                      HOH 
#