data_2OQ4
# 
_entry.id   2OQ4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OQ4         
NDB   PD0970       
RCSB  RCSB041448   
WWPDB D_1000041448 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2EA0 . unspecified 
PDB 2OPF . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2OQ4 
_pdbx_database_status.recvd_initial_deposition_date   2007-01-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Golan, G.'      1 
'Zharkov, D.O.'  2 
'Grollman, A.P.' 3 
'Shoahm, G.'     4 
# 
_citation.id                        primary 
_citation.title                     
;Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrates and mutations of critical residues
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Golan, G.'      1 
primary 'Zharkov, D.O.'  2 
primary 'Grollman, A.P.' 3 
primary 'Shoham, G.'     4 
# 
_cell.entry_id           2OQ4 
_cell.length_a           107.130 
_cell.length_b           107.130 
_cell.length_c           164.860 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2OQ4 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*G*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*GP*G)-3'"     3958.571  2  ?                    ?   ? ? 
2 polymer     syn "5'-D(*C*CP*AP*GP*GP*AP*(PED)P*GP*AP*AP*GP*CP*C)-3'" 3863.531  2  ?                    ?   ? ? 
3 polymer     man 'Endonuclease VIII'                                  29814.010 2  '3.2.2.-, 4.2.99.18' E2Q ? ? 
4 non-polymer syn 'SODIUM ION'                                         22.990    2  ?                    ?   ? ? 
5 non-polymer syn 'ZINC ION'                                           65.409    2  ?                    ?   ? ? 
6 non-polymer syn 'SULFATE ION'                                        96.063    3  ?                    ?   ? ? 
7 water       nat water                                                18.015    93 ?                    ?   ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'DNA glycosylase/AP lyase Nei, DNA-apurinic or apyrimidinic site, lyase Nei' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no  '(DG)(DG)(DC)(DT)(DT)(DC)(DA)(DT)(DC)(DC)(DT)(DG)(DG)' GGCTTCATCCTGG C,E ? 
2 polydeoxyribonucleotide no yes '(DC)(DC)(DA)(DG)(DG)(DA)(PED)(DG)(DA)(DA)(DG)(DC)(DC)' CCAGGAXGAAGCC D,F ? 
3 'polypeptide(L)'        no no  
;PQGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTG
EEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQ
AFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERC
GSIIEKTTLSSRPFYWCPGCQH
;
;PQGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTG
EEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQ
AFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERC
GSIIEKTTLSSRPFYWCPGCQH
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DG  n 
1 3   DC  n 
1 4   DT  n 
1 5   DT  n 
1 6   DC  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DT  n 
1 12  DG  n 
1 13  DG  n 
2 1   DC  n 
2 2   DC  n 
2 3   DA  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   PED n 
2 8   DG  n 
2 9   DA  n 
2 10  DA  n 
2 11  DG  n 
2 12  DC  n 
2 13  DC  n 
3 1   PRO n 
3 2   GLN n 
3 3   GLY n 
3 4   PRO n 
3 5   GLU n 
3 6   ILE n 
3 7   ARG n 
3 8   ARG n 
3 9   ALA n 
3 10  ALA n 
3 11  ASP n 
3 12  ASN n 
3 13  LEU n 
3 14  GLU n 
3 15  ALA n 
3 16  ALA n 
3 17  ILE n 
3 18  LYS n 
3 19  GLY n 
3 20  LYS n 
3 21  PRO n 
3 22  LEU n 
3 23  THR n 
3 24  ASP n 
3 25  VAL n 
3 26  TRP n 
3 27  PHE n 
3 28  ALA n 
3 29  PHE n 
3 30  PRO n 
3 31  GLN n 
3 32  LEU n 
3 33  LYS n 
3 34  THR n 
3 35  TYR n 
3 36  GLN n 
3 37  SER n 
3 38  GLN n 
3 39  LEU n 
3 40  ILE n 
3 41  GLY n 
3 42  GLN n 
3 43  HIS n 
3 44  VAL n 
3 45  THR n 
3 46  HIS n 
3 47  VAL n 
3 48  GLU n 
3 49  THR n 
3 50  ARG n 
3 51  GLY n 
3 52  LYS n 
3 53  ALA n 
3 54  LEU n 
3 55  LEU n 
3 56  THR n 
3 57  HIS n 
3 58  PHE n 
3 59  SER n 
3 60  ASN n 
3 61  ASP n 
3 62  LEU n 
3 63  THR n 
3 64  LEU n 
3 65  TYR n 
3 66  SER n 
3 67  HIS n 
3 68  ASN n 
3 69  GLN n 
3 70  LEU n 
3 71  TYR n 
3 72  GLY n 
3 73  VAL n 
3 74  TRP n 
3 75  ARG n 
3 76  VAL n 
3 77  VAL n 
3 78  ASP n 
3 79  THR n 
3 80  GLY n 
3 81  GLU n 
3 82  GLU n 
3 83  PRO n 
3 84  GLN n 
3 85  THR n 
3 86  THR n 
3 87  ARG n 
3 88  VAL n 
3 89  LEU n 
3 90  ARG n 
3 91  VAL n 
3 92  LYS n 
3 93  LEU n 
3 94  GLN n 
3 95  THR n 
3 96  ALA n 
3 97  ASP n 
3 98  LYS n 
3 99  THR n 
3 100 ILE n 
3 101 LEU n 
3 102 LEU n 
3 103 TYR n 
3 104 SER n 
3 105 ALA n 
3 106 SER n 
3 107 ASP n 
3 108 ILE n 
3 109 GLU n 
3 110 MET n 
3 111 LEU n 
3 112 ARG n 
3 113 PRO n 
3 114 GLU n 
3 115 GLN n 
3 116 LEU n 
3 117 THR n 
3 118 THR n 
3 119 HIS n 
3 120 PRO n 
3 121 PHE n 
3 122 LEU n 
3 123 GLN n 
3 124 ARG n 
3 125 VAL n 
3 126 GLY n 
3 127 PRO n 
3 128 ASP n 
3 129 VAL n 
3 130 LEU n 
3 131 ASP n 
3 132 PRO n 
3 133 ASN n 
3 134 LEU n 
3 135 THR n 
3 136 PRO n 
3 137 GLU n 
3 138 VAL n 
3 139 VAL n 
3 140 LYS n 
3 141 GLU n 
3 142 ARG n 
3 143 LEU n 
3 144 LEU n 
3 145 SER n 
3 146 PRO n 
3 147 ARG n 
3 148 PHE n 
3 149 ARG n 
3 150 ASN n 
3 151 ARG n 
3 152 GLN n 
3 153 PHE n 
3 154 ALA n 
3 155 GLY n 
3 156 LEU n 
3 157 LEU n 
3 158 LEU n 
3 159 ASP n 
3 160 GLN n 
3 161 ALA n 
3 162 PHE n 
3 163 LEU n 
3 164 ALA n 
3 165 GLY n 
3 166 LEU n 
3 167 GLY n 
3 168 ASN n 
3 169 TYR n 
3 170 LEU n 
3 171 ARG n 
3 172 VAL n 
3 173 GLU n 
3 174 ILE n 
3 175 LEU n 
3 176 TRP n 
3 177 GLN n 
3 178 VAL n 
3 179 GLY n 
3 180 LEU n 
3 181 THR n 
3 182 GLY n 
3 183 ASN n 
3 184 HIS n 
3 185 LYS n 
3 186 ALA n 
3 187 LYS n 
3 188 ASP n 
3 189 LEU n 
3 190 ASN n 
3 191 ALA n 
3 192 ALA n 
3 193 GLN n 
3 194 LEU n 
3 195 ASP n 
3 196 ALA n 
3 197 LEU n 
3 198 ALA n 
3 199 HIS n 
3 200 ALA n 
3 201 LEU n 
3 202 LEU n 
3 203 GLU n 
3 204 ILE n 
3 205 PRO n 
3 206 ARG n 
3 207 PHE n 
3 208 SER n 
3 209 TYR n 
3 210 ALA n 
3 211 THR n 
3 212 ARG n 
3 213 GLY n 
3 214 GLN n 
3 215 VAL n 
3 216 ASP n 
3 217 GLU n 
3 218 ASN n 
3 219 LYS n 
3 220 HIS n 
3 221 HIS n 
3 222 GLY n 
3 223 ALA n 
3 224 LEU n 
3 225 PHE n 
3 226 ARG n 
3 227 PHE n 
3 228 LYS n 
3 229 VAL n 
3 230 PHE n 
3 231 HIS n 
3 232 ARG n 
3 233 ASP n 
3 234 GLY n 
3 235 GLU n 
3 236 PRO n 
3 237 CYS n 
3 238 GLU n 
3 239 ARG n 
3 240 CYS n 
3 241 GLY n 
3 242 SER n 
3 243 ILE n 
3 244 ILE n 
3 245 GLU n 
3 246 LYS n 
3 247 THR n 
3 248 THR n 
3 249 LEU n 
3 250 SER n 
3 251 SER n 
3 252 ARG n 
3 253 PRO n 
3 254 PHE n 
3 255 TYR n 
3 256 TRP n 
3 257 CYS n 
3 258 PRO n 
3 259 GLY n 
3 260 CYS n 
3 261 GLN n 
3 262 HIS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 Nei 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'B834(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET13A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP END8_ECOLI P50465 3 
;PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKPYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTG
EEPQTTRVLRVKLQTADKTILLYSASDIEMLTPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQ
AFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERC
GSIIEKTTLSSRPFYWCPGCQH
;
2 ? 
2 PDB 2OQ4       2OQ4   1 ? ? ? 
3 PDB 2OQ4       2OQ4   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2OQ4 A 1 ? 262 ? P50465 2   ? 263 ? 1   262 
2 1 2OQ4 B 1 ? 262 ? P50465 2   ? 263 ? 1   262 
3 2 2OQ4 C 1 ? 13  ? 2OQ4   401 ? 413 ? 401 413 
4 3 2OQ4 D 1 ? 13  ? 2OQ4   421 ? 433 ? 421 433 
5 2 2OQ4 E 1 ? 13  ? 2OQ4   401 ? 413 ? 401 413 
6 3 2OQ4 F 1 ? 13  ? 2OQ4   421 ? 433 ? 421 433 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2OQ4 GLN A 2   ? UNP P50465 GLU 3   ENGINEERED       2   1 
1 2OQ4 THR A 34  ? UNP P50465 PRO 35  'SEE REMARK 999' 34  2 
1 2OQ4 ARG A 112 ? UNP P50465 THR 113 'SEE REMARK 999' 112 3 
2 2OQ4 GLN B 2   ? UNP P50465 GLU 3   ENGINEERED       2   4 
2 2OQ4 THR B 34  ? UNP P50465 PRO 35  'SEE REMARK 999' 34  5 
2 2OQ4 ARG B 112 ? UNP P50465 THR 113 'SEE REMARK 999' 112 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                                                     'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                             ?                                                     
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                                                     'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                                                     'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                                                     
'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                                                     
'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                                                     
'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                                                     
'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                                                     
'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                                                     
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                                                     'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                              ?                                                     'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                                                     
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                                                     'H2 O' 18.015 
ILE 'L-peptide linking' y ISOLEUCINE                           ?                                                     'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                                                     'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                               ?                                                     
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                                                     
'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                         ?                                                     'Na 1' 22.990 
PED non-polymer         . PENTANE-3,4-DIOL-5-PHOSPHATE         
;OPEN FORM OF 1'-2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE
;
'C5 H13 O6 P'     200.127 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                                                     'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                              ?                                                     'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                               ?                                                     'C3 H7 N O3' 
105.093 
SO4 non-polymer         . 'SULFATE ION'                        ?                                                     'O4 S -2' 
96.063  
THR 'L-peptide linking' y THREONINE                            ?                                                     'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                                                     
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                                                     'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                               ?                                                     'C5 H11 N O2' 
117.146 
ZN  non-polymer         . 'ZINC ION'                           ?                                                     'Zn 2' 65.409 
# 
_exptl.entry_id          2OQ4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.11 
_exptl_crystal.density_percent_sol   60.49 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'1.8M ammonium sulfate, 0.1M sodium acetate pH 4.6-5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'ammonium sulfate' ? ? ? 
1 2 1 'sodium acetate'   ? ? ? 
1 3 1 h2o                ? ? ? 
1 4 2 'ammonium sulfate' ? ? ? 
1 5 2 'sodium acetate'   ? ? ? 
1 6 2 h2o                ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.102 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 5ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   5ID-B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.102 
# 
_reflns.entry_id                     2OQ4 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             16.73 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   30010 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.083 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.1 
_reflns.B_iso_Wilson_estimate        48.1 
_reflns.pdbx_redundancy              6.4 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.6 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   98.4 
_reflns_shell.Rmerge_I_obs           0.338 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2OQ4 
_refine.ls_number_reflns_obs                     29947 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1272101.92 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             16.00 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    99.5 
_refine.ls_R_factor_obs                          0.374 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.374 
_refine.ls_R_factor_R_free                       0.432 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  2998 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               47.0 
_refine.aniso_B[1][1]                            7.17 
_refine.aniso_B[2][2]                            7.17 
_refine.aniso_B[3][3]                            -14.34 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.34846 
_refine.solvent_model_param_bsol                 57.8921 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;Data processing indicated that the crystal was twinned but the exact nature of the twining was not clear. Treatment of the data with the twinning utility of CNS indicated unequal (major and minor) twinning fractions, but a refinement of the initial model, ignoring the twinning and considering only the major twinning fraction, gave better structural results, with relatively reasonable final R and Rfree.
;
_refine.pdbx_starting_model                      2EA0 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2OQ4 
_refine_analyze.Luzzati_coordinate_error_obs    0.56 
_refine_analyze.Luzzati_sigma_a_obs             -0.26 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.75 
_refine_analyze.Luzzati_sigma_a_free            0.27 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4014 
_refine_hist.pdbx_number_atoms_nucleic_acid   850 
_refine_hist.pdbx_number_atoms_ligand         19 
_refine_hist.number_atoms_solvent             93 
_refine_hist.number_atoms_total               4976 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        16.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.195 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        2.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.1  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.02  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             4359 
_refine_ls_shell.R_factor_R_work                  0.369 
_refine_ls_shell.percent_reflns_obs               98.7 
_refine_ls_shell.R_factor_R_free                  0.457 
_refine_ls_shell.R_factor_R_free_error            0.020 
_refine_ls_shell.percent_reflns_R_free            10.5 
_refine_ls_shell.number_reflns_R_free             511 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top     'X-RAY DIFFRACTION' 
2 dna-rna-ped.param dna-rna-ped.top 'X-RAY DIFFRACTION' 
3 ion.param         ion.top         'X-RAY DIFFRACTION' 
4 water_rep.param   water.top       'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2OQ4 
_struct.title                     
;Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli (E2Q) in complex with AP-site containing DNA substrate
;
_struct.pdbx_descriptor           'Endonuclease VIII (E.C.3.2.2.-, E.C.4.2.99.18)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OQ4 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            
'Endonuclease VIII, oxidative damage, DNA repair, base excision, covalent intermediate, reaction mechanism, HYDROLASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 4 ? 
N N N 7 ? 
O N N 7 ? 
P N N 7 ? 
Q N N 7 ? 
R N N 7 ? 
S N N 7 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN E 2   ? LYS E 18  ? GLN A 2   LYS A 18  1 ? 17 
HELX_P HELX_P2  2  PHE E 29  ? THR E 34  ? PHE A 29  THR A 34  1 ? 6  
HELX_P HELX_P3  3  TYR E 35  ? ILE E 40  ? TYR A 35  ILE A 40  1 ? 6  
HELX_P HELX_P4  4  GLU E 114 ? THR E 118 ? GLU A 114 THR A 118 5 ? 5  
HELX_P HELX_P5  5  HIS E 119 ? VAL E 125 ? HIS A 119 VAL A 125 1 ? 7  
HELX_P HELX_P6  6  THR E 135 ? SER E 145 ? THR A 135 SER A 145 1 ? 11 
HELX_P HELX_P7  7  GLN E 152 ? LEU E 157 ? GLN A 152 LEU A 157 1 ? 6  
HELX_P HELX_P8  8  GLY E 167 ? VAL E 178 ? GLY A 167 VAL A 178 1 ? 12 
HELX_P HELX_P9  9  ASN E 190 ? ARG E 212 ? ASN A 190 ARG A 212 1 ? 23 
HELX_P HELX_P10 10 GLY F 3   ? LYS F 18  ? GLY B 3   LYS B 18  1 ? 16 
HELX_P HELX_P11 11 THR F 34  ? ILE F 40  ? THR B 34  ILE B 40  1 ? 7  
HELX_P HELX_P12 12 ARG F 112 ? THR F 117 ? ARG B 112 THR B 117 1 ? 6  
HELX_P HELX_P13 13 HIS F 119 ? VAL F 125 ? HIS B 119 VAL B 125 1 ? 7  
HELX_P HELX_P14 14 THR F 135 ? SER F 145 ? THR B 135 SER B 145 1 ? 11 
HELX_P HELX_P15 15 GLN F 152 ? LEU F 157 ? GLN B 152 LEU B 157 1 ? 6  
HELX_P HELX_P16 16 GLY F 167 ? VAL F 178 ? GLY B 167 VAL B 178 1 ? 12 
HELX_P HELX_P17 17 ASN F 190 ? ARG F 212 ? ASN B 190 ARG B 212 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B PED 7  "C1'" ? ? ? 1_555 E PRO 1   N  ? ? D PED 427 A PRO 1   1_555 ? ? ? ? ? ? ?            1.452 ? 
covale2  covale ? ? D PED 7  "C1'" ? ? ? 1_555 F PRO 1   N  ? ? F PED 427 B PRO 1   1_555 ? ? ? ? ? ? ?            1.443 ? 
metalc1  metalc ? ? H ZN  .  ZN    ? ? ? 1_555 E CYS 237 SG ? ? A ZN  501 A CYS 237 1_555 ? ? ? ? ? ? ?            2.103 ? 
metalc2  metalc ? ? H ZN  .  ZN    ? ? ? 1_555 E CYS 240 SG ? ? A ZN  501 A CYS 240 1_555 ? ? ? ? ? ? ?            2.547 ? 
metalc3  metalc ? ? H ZN  .  ZN    ? ? ? 1_555 E CYS 257 SG ? ? A ZN  501 A CYS 257 1_555 ? ? ? ? ? ? ?            2.092 ? 
metalc4  metalc ? ? H ZN  .  ZN    ? ? ? 1_555 E CYS 260 SG ? ? A ZN  501 A CYS 260 1_555 ? ? ? ? ? ? ?            2.773 ? 
metalc5  metalc ? ? J ZN  .  ZN    ? ? ? 1_555 F CYS 237 SG ? ? B ZN  501 B CYS 237 1_555 ? ? ? ? ? ? ?            2.316 ? 
metalc6  metalc ? ? J ZN  .  ZN    ? ? ? 1_555 F CYS 240 SG ? ? B ZN  501 B CYS 240 1_555 ? ? ? ? ? ? ?            2.763 ? 
metalc7  metalc ? ? J ZN  .  ZN    ? ? ? 1_555 F CYS 257 SG ? ? B ZN  501 B CYS 257 1_555 ? ? ? ? ? ? ?            2.383 ? 
metalc8  metalc ? ? J ZN  .  ZN    ? ? ? 1_555 F CYS 260 SG ? ? B ZN  501 B CYS 260 1_555 ? ? ? ? ? ? ?            2.014 ? 
covale3  covale ? ? B DA  6  "O3'" ? ? ? 1_555 B PED 7   P  ? ? D DA  426 D PED 427 1_555 ? ? ? ? ? ? ?            1.609 ? 
covale4  covale ? ? B PED 7  "O3'" ? ? ? 1_555 B DG  8   P  ? ? D PED 427 D DG  428 1_555 ? ? ? ? ? ? ?            1.601 ? 
covale5  covale ? ? D DA  6  "O3'" ? ? ? 1_555 D PED 7   P  ? ? F DA  426 F PED 427 1_555 ? ? ? ? ? ? ?            1.599 ? 
covale6  covale ? ? D PED 7  "O3'" ? ? ? 1_555 D DG  8   P  ? ? F PED 427 F DG  428 1_555 ? ? ? ? ? ? ?            1.612 ? 
hydrog1  hydrog ? ? A DG  2  O6    ? ? ? 1_555 B DC  12  N4 ? ? C DG  402 D DC  432 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog2  hydrog ? ? A DC  3  N3    ? ? ? 1_555 B DG  11  N1 ? ? C DC  403 D DG  431 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  3  N4    ? ? ? 1_555 B DG  11  O6 ? ? C DC  403 D DG  431 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC  3  O2    ? ? ? 1_555 B DG  11  N2 ? ? C DC  403 D DG  431 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DT  5  N3    ? ? ? 1_555 B DA  9   N1 ? ? C DT  405 D DA  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DT  5  O4    ? ? ? 1_555 B DA  9   N6 ? ? C DT  405 D DA  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DT  5  N3    ? ? ? 1_555 B DA  10  N1 ? ? C DT  405 D DA  430 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog8  hydrog ? ? A DT  8  N3    ? ? ? 1_555 B DA  6   N1 ? ? C DT  408 D DA  426 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  8  O4    ? ? ? 1_555 B DA  6   N6 ? ? C DT  408 D DA  426 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DC  9  N3    ? ? ? 1_555 B DG  5   N1 ? ? C DC  409 D DG  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DC  9  N4    ? ? ? 1_555 B DG  5   O6 ? ? C DC  409 D DG  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DC  9  O2    ? ? ? 1_555 B DG  5   N2 ? ? C DC  409 D DG  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DC  10 N4    ? ? ? 1_555 B DG  4   O6 ? ? C DC  410 D DG  424 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog14 hydrog ? ? A DG  12 N1    ? ? ? 1_555 B DC  2   N3 ? ? C DG  412 D DC  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  12 N2    ? ? ? 1_555 B DC  2   O2 ? ? C DG  412 D DC  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  12 O6    ? ? ? 1_555 B DC  2   N4 ? ? C DG  412 D DC  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DT  4  N3    ? ? ? 1_555 D DA  10  N1 ? ? E DT  404 F DA  430 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DT  4  O4    ? ? ? 1_555 D DA  10  N6 ? ? E DT  404 F DA  430 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DT  5  N3    ? ? ? 1_555 D DA  9   N1 ? ? E DT  405 F DA  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DT  5  O4    ? ? ? 1_555 D DA  9   N6 ? ? E DT  405 F DA  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DC  6  N3    ? ? ? 1_555 D DG  8   N1 ? ? E DC  406 F DG  428 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DC  6  N4    ? ? ? 1_555 D DG  8   O6 ? ? E DC  406 F DG  428 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DC  6  O2    ? ? ? 1_555 D DG  8   N2 ? ? E DC  406 F DG  428 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DT  8  O4    ? ? ? 1_555 D DA  6   N6 ? ? E DT  408 F DA  426 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog25 hydrog ? ? C DC  9  N3    ? ? ? 1_555 D DG  5   N1 ? ? E DC  409 F DG  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DC  9  N4    ? ? ? 1_555 D DG  5   O6 ? ? E DC  409 F DG  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DC  9  O2    ? ? ? 1_555 D DG  5   N2 ? ? E DC  409 F DG  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DT  11 N3    ? ? ? 1_555 D DA  3   N1 ? ? E DT  411 F DA  423 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DT  11 O4    ? ? ? 1_555 D DA  3   N6 ? ? E DT  411 F DA  423 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DG  12 N2    ? ? ? 1_555 D DC  2   N3 ? ? E DG  412 F DC  422 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
D ? 4 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP E 24  ? PHE E 27  ? ASP A 24  PHE A 27  
A 2 LEU E 89  ? GLN E 94  ? LEU A 89  GLN A 94  
A 3 LYS E 98  ? TYR E 103 ? LYS A 98  TYR A 103 
A 4 VAL E 73  ? ASP E 78  ? VAL A 73  ASP A 78  
B 1 VAL E 44  ? THR E 49  ? VAL A 44  THR A 49  
B 2 ALA E 53  ? PHE E 58  ? ALA A 53  PHE A 58  
B 3 THR E 63  ? HIS E 67  ? THR A 63  HIS A 67  
B 4 ASP E 107 ? LEU E 111 ? ASP A 107 LEU A 111 
C 1 GLU E 245 ? THR E 248 ? GLU A 245 THR A 248 
C 2 PRO E 253 ? TRP E 256 ? PRO A 253 TRP A 256 
D 1 LEU F 22  ? PHE F 27  ? LEU B 22  PHE B 27  
D 2 LEU F 89  ? THR F 95  ? LEU B 89  THR B 95  
D 3 THR F 99  ? TYR F 103 ? THR B 99  TYR B 103 
D 4 VAL F 73  ? ARG F 75  ? VAL B 73  ARG B 75  
E 1 HIS F 46  ? ARG F 50  ? HIS B 46  ARG B 50  
E 2 ALA F 53  ? HIS F 57  ? ALA B 53  HIS B 57  
E 3 THR F 63  ? HIS F 67  ? THR B 63  HIS B 67  
E 4 ASP F 107 ? LEU F 111 ? ASP B 107 LEU B 111 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TRP E 26  ? N TRP A 26  O LYS E 92  ? O LYS A 92  
A 2 3 N ARG E 90  ? N ARG A 90  O LEU E 102 ? O LEU A 102 
A 3 4 O LEU E 101 ? O LEU A 101 N ARG E 75  ? N ARG A 75  
B 1 2 N GLU E 48  ? N GLU A 48  O LEU E 55  ? O LEU A 55  
B 2 3 N THR E 56  ? N THR A 56  O LEU E 64  ? O LEU A 64  
B 3 4 N TYR E 65  ? N TYR A 65  O GLU E 109 ? O GLU A 109 
C 1 2 N THR E 247 ? N THR A 247 O PHE E 254 ? O PHE A 254 
D 1 2 N ASP F 24  ? N ASP B 24  O GLN F 94  ? O GLN B 94  
D 2 3 N VAL F 91  ? N VAL B 91  O LEU F 102 ? O LEU B 102 
D 3 4 O TYR F 103 ? O TYR B 103 N VAL F 73  ? N VAL B 73  
E 1 2 N GLU F 48  ? N GLU B 48  O LEU F 55  ? O LEU B 55  
E 2 3 N LEU F 54  ? N LEU B 54  O SER F 66  ? O SER B 66  
E 3 4 N THR F 63  ? N THR B 63  O LEU F 111 ? O LEU B 111 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE PED D 427' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PED F 427' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 501'  
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 501'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 601' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 602' 
AC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 B 603' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 PRO E 1   ? PRO A 1    . ? 1_555 ? 
2  AC1 9 GLN E 2   ? GLN A 2    . ? 1_555 ? 
3  AC1 9 LEU E 70  ? LEU A 70   . ? 1_555 ? 
4  AC1 9 ASN E 168 ? ASN A 168  . ? 1_555 ? 
5  AC1 9 PHE E 230 ? PHE A 230  . ? 1_555 ? 
6  AC1 9 PRO E 253 ? PRO A 253  . ? 1_555 ? 
7  AC1 9 DA  B 6   ? DA  D 426  . ? 1_555 ? 
8  AC1 9 DG  B 8   ? DG  D 428  . ? 1_555 ? 
9  AC1 9 HOH O .   ? HOH D 1053 . ? 1_555 ? 
10 AC2 6 PRO F 1   ? PRO B 1    . ? 1_555 ? 
11 AC2 6 GLN F 2   ? GLN B 2    . ? 1_555 ? 
12 AC2 6 ASN F 168 ? ASN B 168  . ? 1_555 ? 
13 AC2 6 ARG F 252 ? ARG B 252  . ? 1_555 ? 
14 AC2 6 DA  D 6   ? DA  F 426  . ? 1_555 ? 
15 AC2 6 DG  D 8   ? DG  F 428  . ? 1_555 ? 
16 AC3 4 CYS E 237 ? CYS A 237  . ? 1_555 ? 
17 AC3 4 CYS E 240 ? CYS A 240  . ? 1_555 ? 
18 AC3 4 CYS E 257 ? CYS A 257  . ? 1_555 ? 
19 AC3 4 CYS E 260 ? CYS A 260  . ? 1_555 ? 
20 AC4 4 CYS F 237 ? CYS B 237  . ? 1_555 ? 
21 AC4 4 CYS F 240 ? CYS B 240  . ? 1_555 ? 
22 AC4 4 CYS F 257 ? CYS B 257  . ? 1_555 ? 
23 AC4 4 CYS F 260 ? CYS B 260  . ? 1_555 ? 
24 AC5 4 PRO E 1   ? PRO A 1    . ? 1_555 ? 
25 AC5 4 GLU E 5   ? GLU A 5    . ? 1_555 ? 
26 AC5 4 ARG E 212 ? ARG A 212  . ? 1_555 ? 
27 AC5 4 HOH O .   ? HOH D 1053 . ? 1_555 ? 
28 AC6 4 GLU F 81  ? GLU B 81   . ? 1_555 ? 
29 AC6 4 GLU F 82  ? GLU B 82   . ? 1_555 ? 
30 AC6 4 PRO F 83  ? PRO B 83   . ? 1_555 ? 
31 AC6 4 HOH S .   ? HOH B 1085 . ? 1_555 ? 
32 AC7 2 ARG F 8   ? ARG B 8    . ? 1_555 ? 
33 AC7 2 ASN F 12  ? ASN B 12   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2OQ4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2OQ4 
_atom_sites.fract_transf_matrix[1][1]   0.009334 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009334 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006066 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 2   ? 31.137  30.108 -111.334 1.00 59.93  ? 402  DG  C "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 2   ? 30.240  30.096 -112.452 1.00 58.43  ? 402  DG  C "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 2   ? 30.087  28.733 -113.091 1.00 57.80  ? 402  DG  C "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 2   ? 29.308  28.863 -114.314 1.00 55.53  ? 402  DG  C "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 2   ? 31.407  28.071 -113.512 1.00 57.96  ? 402  DG  C "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 2   ? 31.310  26.642 -113.388 1.00 59.38  ? 402  DG  C "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 2   ? 31.477  28.402 -114.985 1.00 57.19  ? 402  DG  C "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 2   ? 30.029  28.231 -115.357 1.00 54.33  ? 402  DG  C "C1'" 1 
ATOM   9    N  N9    . DG  A 1 2   ? 29.684  28.841 -116.632 1.00 60.35  ? 402  DG  C N9    1 
ATOM   10   C  C8    . DG  A 1 2   ? 28.673  29.729 -116.917 1.00 59.31  ? 402  DG  C C8    1 
ATOM   11   N  N7    . DG  A 1 2   ? 28.630  30.065 -118.179 1.00 57.37  ? 402  DG  C N7    1 
ATOM   12   C  C5    . DG  A 1 2   ? 29.677  29.359 -118.756 1.00 57.22  ? 402  DG  C C5    1 
ATOM   13   C  C6    . DG  A 1 2   ? 30.126  29.316 -120.096 1.00 56.68  ? 402  DG  C C6    1 
ATOM   14   O  O6    . DG  A 1 2   ? 29.671  29.911 -121.080 1.00 54.34  ? 402  DG  C O6    1 
ATOM   15   N  N1    . DG  A 1 2   ? 31.224  28.470 -120.239 1.00 57.44  ? 402  DG  C N1    1 
ATOM   16   C  C2    . DG  A 1 2   ? 31.810  27.752 -119.219 1.00 57.40  ? 402  DG  C C2    1 
ATOM   17   N  N2    . DG  A 1 2   ? 32.860  26.983 -119.551 1.00 56.75  ? 402  DG  C N2    1 
ATOM   18   N  N3    . DG  A 1 2   ? 31.398  27.786 -117.968 1.00 56.23  ? 402  DG  C N3    1 
ATOM   19   C  C4    . DG  A 1 2   ? 30.336  28.603 -117.811 1.00 57.96  ? 402  DG  C C4    1 
ATOM   20   P  P     . DC  A 1 3   ? 32.511  25.694 -113.904 1.00 111.05 ? 403  DC  C P     1 
ATOM   21   O  OP1   . DC  A 1 3   ? 31.856  24.473 -114.446 1.00 59.45  ? 403  DC  C OP1   1 
ATOM   22   O  OP2   . DC  A 1 3   ? 33.523  25.570 -112.819 1.00 60.90  ? 403  DC  C OP2   1 
ATOM   23   O  "O5'" . DC  A 1 3   ? 33.169  26.454 -115.145 1.00 111.21 ? 403  DC  C "O5'" 1 
ATOM   24   C  "C5'" . DC  A 1 3   ? 34.472  27.042 -115.058 1.00 113.10 ? 403  DC  C "C5'" 1 
ATOM   25   C  "C4'" . DC  A 1 3   ? 34.974  27.411 -116.437 1.00 115.21 ? 403  DC  C "C4'" 1 
ATOM   26   O  "O4'" . DC  A 1 3   ? 33.977  28.200 -117.136 1.00 116.65 ? 403  DC  C "O4'" 1 
ATOM   27   C  "C3'" . DC  A 1 3   ? 36.253  28.252 -116.459 1.00 115.46 ? 403  DC  C "C3'" 1 
ATOM   28   O  "O3'" . DC  A 1 3   ? 37.053  27.905 -117.592 1.00 115.50 ? 403  DC  C "O3'" 1 
ATOM   29   C  "C2'" . DC  A 1 3   ? 35.735  29.659 -116.662 1.00 116.20 ? 403  DC  C "C2'" 1 
ATOM   30   C  "C1'" . DC  A 1 3   ? 34.573  29.406 -117.598 1.00 116.27 ? 403  DC  C "C1'" 1 
ATOM   31   N  N1    . DC  A 1 3   ? 33.551  30.459 -117.582 1.00 66.75  ? 403  DC  C N1    1 
ATOM   32   C  C2    . DC  A 1 3   ? 33.206  31.080 -118.781 1.00 66.76  ? 403  DC  C C2    1 
ATOM   33   O  O2    . DC  A 1 3   ? 33.794  30.746 -119.820 1.00 66.34  ? 403  DC  C O2    1 
ATOM   34   N  N3    . DC  A 1 3   ? 32.245  32.030 -118.779 1.00 66.85  ? 403  DC  C N3    1 
ATOM   35   C  C4    . DC  A 1 3   ? 31.652  32.374 -117.635 1.00 66.89  ? 403  DC  C C4    1 
ATOM   36   N  N4    . DC  A 1 3   ? 30.710  33.311 -117.677 1.00 66.87  ? 403  DC  C N4    1 
ATOM   37   C  C5    . DC  A 1 3   ? 31.998  31.769 -116.396 1.00 67.29  ? 403  DC  C C5    1 
ATOM   38   C  C6    . DC  A 1 3   ? 32.942  30.823 -116.416 1.00 67.49  ? 403  DC  C C6    1 
ATOM   39   P  P     . DT  A 1 4   ? 38.383  28.752 -117.916 1.00 89.46  ? 404  DT  C P     1 
ATOM   40   O  OP1   . DT  A 1 4   ? 39.306  27.830 -118.627 1.00 64.77  ? 404  DT  C OP1   1 
ATOM   41   O  OP2   . DT  A 1 4   ? 38.825  29.422 -116.665 1.00 64.38  ? 404  DT  C OP2   1 
ATOM   42   O  "O5'" . DT  A 1 4   ? 37.915  29.870 -118.954 1.00 88.88  ? 404  DT  C "O5'" 1 
ATOM   43   C  "C5'" . DT  A 1 4   ? 37.773  29.562 -120.342 1.00 87.11  ? 404  DT  C "C5'" 1 
ATOM   44   C  "C4'" . DT  A 1 4   ? 37.874  30.816 -121.181 1.00 86.16  ? 404  DT  C "C4'" 1 
ATOM   45   O  "O4'" . DT  A 1 4   ? 36.774  31.698 -120.859 1.00 85.31  ? 404  DT  C "O4'" 1 
ATOM   46   C  "C3'" . DT  A 1 4   ? 39.144  31.642 -120.982 1.00 85.88  ? 404  DT  C "C3'" 1 
ATOM   47   O  "O3'" . DT  A 1 4   ? 39.562  32.205 -122.233 1.00 85.64  ? 404  DT  C "O3'" 1 
ATOM   48   C  "C2'" . DT  A 1 4   ? 38.715  32.720 -120.003 1.00 85.37  ? 404  DT  C "C2'" 1 
ATOM   49   C  "C1'" . DT  A 1 4   ? 37.253  32.939 -120.355 1.00 84.38  ? 404  DT  C "C1'" 1 
ATOM   50   N  N1    . DT  A 1 4   ? 36.405  33.297 -119.203 1.00 59.42  ? 404  DT  C N1    1 
ATOM   51   C  C2    . DT  A 1 4   ? 35.302  34.081 -119.435 1.00 58.76  ? 404  DT  C C2    1 
ATOM   52   O  O2    . DT  A 1 4   ? 35.026  34.531 -120.535 1.00 58.98  ? 404  DT  C O2    1 
ATOM   53   N  N3    . DT  A 1 4   ? 34.531  34.325 -118.321 1.00 58.88  ? 404  DT  C N3    1 
ATOM   54   C  C4    . DT  A 1 4   ? 34.761  33.877 -117.029 1.00 58.56  ? 404  DT  C C4    1 
ATOM   55   O  O4    . DT  A 1 4   ? 33.971  34.153 -116.127 1.00 57.55  ? 404  DT  C O4    1 
ATOM   56   C  C5    . DT  A 1 4   ? 35.951  33.088 -116.857 1.00 58.82  ? 404  DT  C C5    1 
ATOM   57   C  C7    . DT  A 1 4   ? 36.286  32.584 -115.490 1.00 59.66  ? 404  DT  C C7    1 
ATOM   58   C  C6    . DT  A 1 4   ? 36.706  32.841 -117.934 1.00 58.84  ? 404  DT  C C6    1 
ATOM   59   P  P     . DT  A 1 5   ? 40.655  33.383 -122.257 1.00 102.48 ? 405  DT  C P     1 
ATOM   60   O  OP1   . DT  A 1 5   ? 41.378  33.297 -123.551 1.00 65.18  ? 405  DT  C OP1   1 
ATOM   61   O  OP2   . DT  A 1 5   ? 41.425  33.344 -120.983 1.00 67.12  ? 405  DT  C OP2   1 
ATOM   62   O  "O5'" . DT  A 1 5   ? 39.764  34.704 -122.296 1.00 100.08 ? 405  DT  C "O5'" 1 
ATOM   63   C  "C5'" . DT  A 1 5   ? 38.900  34.959 -123.406 1.00 97.43  ? 405  DT  C "C5'" 1 
ATOM   64   C  "C4'" . DT  A 1 5   ? 38.508  36.418 -123.452 1.00 95.02  ? 405  DT  C "C4'" 1 
ATOM   65   O  "O4'" . DT  A 1 5   ? 37.470  36.716 -122.489 1.00 94.26  ? 405  DT  C "O4'" 1 
ATOM   66   C  "C3'" . DT  A 1 5   ? 39.641  37.399 -123.156 1.00 95.06  ? 405  DT  C "C3'" 1 
ATOM   67   O  "O3'" . DT  A 1 5   ? 39.490  38.555 -123.973 1.00 94.44  ? 405  DT  C "O3'" 1 
ATOM   68   C  "C2'" . DT  A 1 5   ? 39.385  37.792 -121.714 1.00 92.52  ? 405  DT  C "C2'" 1 
ATOM   69   C  "C1'" . DT  A 1 5   ? 37.875  37.831 -121.713 1.00 91.07  ? 405  DT  C "C1'" 1 
ATOM   70   N  N1    . DT  A 1 5   ? 37.219  37.731 -120.406 1.00 53.11  ? 405  DT  C N1    1 
ATOM   71   C  C2    . DT  A 1 5   ? 35.925  38.156 -120.361 1.00 51.67  ? 405  DT  C C2    1 
ATOM   72   O  O2    . DT  A 1 5   ? 35.354  38.631 -121.331 1.00 50.51  ? 405  DT  C O2    1 
ATOM   73   N  N3    . DT  A 1 5   ? 35.320  38.011 -119.140 1.00 51.75  ? 405  DT  C N3    1 
ATOM   74   C  C4    . DT  A 1 5   ? 35.880  37.501 -117.985 1.00 50.16  ? 405  DT  C C4    1 
ATOM   75   O  O4    . DT  A 1 5   ? 35.197  37.402 -116.968 1.00 48.12  ? 405  DT  C O4    1 
ATOM   76   C  C5    . DT  A 1 5   ? 37.261  37.108 -118.096 1.00 49.61  ? 405  DT  C C5    1 
ATOM   77   C  C7    . DT  A 1 5   ? 37.967  36.588 -116.884 1.00 50.21  ? 405  DT  C C7    1 
ATOM   78   C  C6    . DT  A 1 5   ? 37.854  37.233 -119.288 1.00 51.53  ? 405  DT  C C6    1 
ATOM   79   P  P     . DC  A 1 6   ? 40.748  39.511 -124.220 1.00 78.92  ? 406  DC  C P     1 
ATOM   80   O  OP1   . DC  A 1 6   ? 41.446  38.992 -125.423 1.00 69.07  ? 406  DC  C OP1   1 
ATOM   81   O  OP2   . DC  A 1 6   ? 41.494  39.653 -122.942 1.00 66.46  ? 406  DC  C OP2   1 
ATOM   82   O  "O5'" . DC  A 1 6   ? 40.091  40.917 -124.577 1.00 77.30  ? 406  DC  C "O5'" 1 
ATOM   83   C  "C5'" . DC  A 1 6   ? 38.873  40.995 -125.315 1.00 71.55  ? 406  DC  C "C5'" 1 
ATOM   84   C  "C4'" . DC  A 1 6   ? 38.014  42.116 -124.777 1.00 69.55  ? 406  DC  C "C4'" 1 
ATOM   85   O  "O4'" . DC  A 1 6   ? 37.427  41.747 -123.504 1.00 68.82  ? 406  DC  C "O4'" 1 
ATOM   86   C  "C3'" . DC  A 1 6   ? 38.765  43.424 -124.523 1.00 68.39  ? 406  DC  C "C3'" 1 
ATOM   87   O  "O3'" . DC  A 1 6   ? 37.942  44.527 -124.906 1.00 67.23  ? 406  DC  C "O3'" 1 
ATOM   88   C  "C2'" . DC  A 1 6   ? 38.972  43.424 -123.017 1.00 67.37  ? 406  DC  C "C2'" 1 
ATOM   89   C  "C1'" . DC  A 1 6   ? 37.696  42.762 -122.547 1.00 67.39  ? 406  DC  C "C1'" 1 
ATOM   90   N  N1    . DC  A 1 6   ? 37.751  42.136 -121.217 1.00 56.42  ? 406  DC  C N1    1 
ATOM   91   C  C2    . DC  A 1 6   ? 36.650  42.280 -120.365 1.00 58.10  ? 406  DC  C C2    1 
ATOM   92   O  O2    . DC  A 1 6   ? 35.686  42.960 -120.741 1.00 60.81  ? 406  DC  C O2    1 
ATOM   93   N  N3    . DC  A 1 6   ? 36.664  41.682 -119.152 1.00 57.64  ? 406  DC  C N3    1 
ATOM   94   C  C4    . DC  A 1 6   ? 37.729  40.979 -118.769 1.00 57.60  ? 406  DC  C C4    1 
ATOM   95   N  N4    . DC  A 1 6   ? 37.693  40.409 -117.562 1.00 55.27  ? 406  DC  C N4    1 
ATOM   96   C  C5    . DC  A 1 6   ? 38.876  40.831 -119.608 1.00 56.61  ? 406  DC  C C5    1 
ATOM   97   C  C6    . DC  A 1 6   ? 38.843  41.421 -120.813 1.00 56.16  ? 406  DC  C C6    1 
ATOM   98   P  P     . DA  A 1 7   ? 38.546  46.013 -124.897 1.00 52.04  ? 407  DA  C P     1 
ATOM   99   O  OP1   . DA  A 1 7   ? 38.390  46.583 -126.263 1.00 61.47  ? 407  DA  C OP1   1 
ATOM   100  O  OP2   . DA  A 1 7   ? 39.893  45.954 -124.276 1.00 59.54  ? 407  DA  C OP2   1 
ATOM   101  O  "O5'" . DA  A 1 7   ? 37.563  46.786 -123.913 1.00 49.83  ? 407  DA  C "O5'" 1 
ATOM   102  C  "C5'" . DA  A 1 7   ? 37.240  46.219 -122.657 1.00 46.41  ? 407  DA  C "C5'" 1 
ATOM   103  C  "C4'" . DA  A 1 7   ? 37.369  47.255 -121.571 1.00 44.12  ? 407  DA  C "C4'" 1 
ATOM   104  O  "O4'" . DA  A 1 7   ? 37.444  46.566 -120.301 1.00 43.07  ? 407  DA  C "O4'" 1 
ATOM   105  C  "C3'" . DA  A 1 7   ? 38.637  48.096 -121.656 1.00 43.01  ? 407  DA  C "C3'" 1 
ATOM   106  O  "O3'" . DA  A 1 7   ? 38.365  49.353 -121.042 1.00 43.20  ? 407  DA  C "O3'" 1 
ATOM   107  C  "C2'" . DA  A 1 7   ? 39.600  47.331 -120.782 1.00 44.63  ? 407  DA  C "C2'" 1 
ATOM   108  C  "C1'" . DA  A 1 7   ? 38.682  46.843 -119.679 1.00 43.79  ? 407  DA  C "C1'" 1 
ATOM   109  N  N9    . DA  A 1 7   ? 39.160  45.618 -119.039 1.00 54.65  ? 407  DA  C N9    1 
ATOM   110  C  C8    . DA  A 1 7   ? 40.291  44.910 -119.368 1.00 54.78  ? 407  DA  C C8    1 
ATOM   111  N  N7    . DA  A 1 7   ? 40.523  43.889 -118.583 1.00 55.51  ? 407  DA  C N7    1 
ATOM   112  C  C5    . DA  A 1 7   ? 39.467  43.911 -117.687 1.00 54.96  ? 407  DA  C C5    1 
ATOM   113  C  C6    . DA  A 1 7   ? 39.149  43.099 -116.591 1.00 55.25  ? 407  DA  C C6    1 
ATOM   114  N  N6    . DA  A 1 7   ? 39.907  42.080 -116.183 1.00 55.53  ? 407  DA  C N6    1 
ATOM   115  N  N1    . DA  A 1 7   ? 38.018  43.380 -115.910 1.00 54.70  ? 407  DA  C N1    1 
ATOM   116  C  C2    . DA  A 1 7   ? 37.275  44.425 -116.302 1.00 54.11  ? 407  DA  C C2    1 
ATOM   117  N  N3    . DA  A 1 7   ? 37.479  45.275 -117.304 1.00 53.79  ? 407  DA  C N3    1 
ATOM   118  C  C4    . DA  A 1 7   ? 38.606  44.959 -117.968 1.00 55.36  ? 407  DA  C C4    1 
ATOM   119  P  P     . DT  A 1 8   ? 39.418  50.555 -121.151 1.00 38.51  ? 408  DT  C P     1 
ATOM   120  O  OP1   . DT  A 1 8   ? 38.985  51.424 -122.277 1.00 52.37  ? 408  DT  C OP1   1 
ATOM   121  O  OP2   . DT  A 1 8   ? 40.814  50.068 -121.097 1.00 51.19  ? 408  DT  C OP2   1 
ATOM   122  O  "O5'" . DT  A 1 8   ? 39.140  51.350 -119.811 1.00 37.89  ? 408  DT  C "O5'" 1 
ATOM   123  C  "C5'" . DT  A 1 8   ? 40.204  51.721 -118.967 1.00 35.73  ? 408  DT  C "C5'" 1 
ATOM   124  C  "C4'" . DT  A 1 8   ? 39.677  51.985 -117.582 1.00 32.69  ? 408  DT  C "C4'" 1 
ATOM   125  O  "O4'" . DT  A 1 8   ? 39.283  50.739 -116.964 1.00 33.08  ? 408  DT  C "O4'" 1 
ATOM   126  C  "C3'" . DT  A 1 8   ? 40.726  52.599 -116.669 1.00 32.13  ? 408  DT  C "C3'" 1 
ATOM   127  O  "O3'" . DT  A 1 8   ? 40.136  53.650 -115.923 1.00 34.13  ? 408  DT  C "O3'" 1 
ATOM   128  C  "C2'" . DT  A 1 8   ? 41.166  51.456 -115.781 1.00 31.26  ? 408  DT  C "C2'" 1 
ATOM   129  C  "C1'" . DT  A 1 8   ? 39.926  50.598 -115.704 1.00 32.68  ? 408  DT  C "C1'" 1 
ATOM   130  N  N1    . DT  A 1 8   ? 40.228  49.171 -115.512 1.00 43.62  ? 408  DT  C N1    1 
ATOM   131  C  C2    . DT  A 1 8   ? 39.721  48.517 -114.409 1.00 43.03  ? 408  DT  C C2    1 
ATOM   132  O  O2    . DT  A 1 8   ? 39.090  49.073 -113.526 1.00 43.29  ? 408  DT  C O2    1 
ATOM   133  N  N3    . DT  A 1 8   ? 39.995  47.178 -114.368 1.00 42.64  ? 408  DT  C N3    1 
ATOM   134  C  C4    . DT  A 1 8   ? 40.727  46.448 -115.273 1.00 42.89  ? 408  DT  C C4    1 
ATOM   135  O  O4    . DT  A 1 8   ? 40.841  45.242 -115.122 1.00 43.49  ? 408  DT  C O4    1 
ATOM   136  C  C5    . DT  A 1 8   ? 41.293  47.212 -116.370 1.00 44.99  ? 408  DT  C C5    1 
ATOM   137  C  C7    . DT  A 1 8   ? 42.180  46.525 -117.363 1.00 43.91  ? 408  DT  C C7    1 
ATOM   138  C  C6    . DT  A 1 8   ? 41.002  48.513 -116.440 1.00 44.03  ? 408  DT  C C6    1 
ATOM   139  P  P     . DC  A 1 9   ? 41.042  54.869 -115.434 1.00 45.07  ? 409  DC  C P     1 
ATOM   140  O  OP1   . DC  A 1 9   ? 40.235  56.110 -115.548 1.00 41.47  ? 409  DC  C OP1   1 
ATOM   141  O  OP2   . DC  A 1 9   ? 42.343  54.774 -116.133 1.00 45.13  ? 409  DC  C OP2   1 
ATOM   142  O  "O5'" . DC  A 1 9   ? 41.278  54.512 -113.897 1.00 46.87  ? 409  DC  C "O5'" 1 
ATOM   143  C  "C5'" . DC  A 1 9   ? 40.170  54.200 -113.060 1.00 48.83  ? 409  DC  C "C5'" 1 
ATOM   144  C  "C4'" . DC  A 1 9   ? 40.616  53.461 -111.817 1.00 51.86  ? 409  DC  C "C4'" 1 
ATOM   145  O  "O4'" . DC  A 1 9   ? 40.767  52.034 -112.038 1.00 50.12  ? 409  DC  C "O4'" 1 
ATOM   146  C  "C3'" . DC  A 1 9   ? 41.912  53.938 -111.153 1.00 52.96  ? 409  DC  C "C3'" 1 
ATOM   147  O  "O3'" . DC  A 1 9   ? 41.693  54.055 -109.750 1.00 57.30  ? 409  DC  C "O3'" 1 
ATOM   148  C  "C2'" . DC  A 1 9   ? 42.865  52.779 -111.391 1.00 51.10  ? 409  DC  C "C2'" 1 
ATOM   149  C  "C1'" . DC  A 1 9   ? 41.910  51.603 -111.323 1.00 48.59  ? 409  DC  C "C1'" 1 
ATOM   150  N  N1    . DC  A 1 9   ? 42.394  50.345 -111.919 1.00 45.22  ? 409  DC  C N1    1 
ATOM   151  C  C2    . DC  A 1 9   ? 42.046  49.130 -111.309 1.00 44.19  ? 409  DC  C C2    1 
ATOM   152  O  O2    . DC  A 1 9   ? 41.339  49.147 -110.279 1.00 44.79  ? 409  DC  C O2    1 
ATOM   153  N  N3    . DC  A 1 9   ? 42.495  47.971 -111.844 1.00 42.54  ? 409  DC  C N3    1 
ATOM   154  C  C4    . DC  A 1 9   ? 43.270  47.993 -112.926 1.00 43.67  ? 409  DC  C C4    1 
ATOM   155  N  N4    . DC  A 1 9   ? 43.697  46.824 -113.414 1.00 43.26  ? 409  DC  C N4    1 
ATOM   156  C  C5    . DC  A 1 9   ? 43.642  49.213 -113.562 1.00 44.65  ? 409  DC  C C5    1 
ATOM   157  C  C6    . DC  A 1 9   ? 43.179  50.353 -113.036 1.00 44.88  ? 409  DC  C C6    1 
ATOM   158  P  P     . DC  A 1 10  ? 42.530  55.117 -108.891 1.00 85.08  ? 410  DC  C P     1 
ATOM   159  O  OP1   . DC  A 1 10  ? 41.666  56.313 -108.719 1.00 52.42  ? 410  DC  C OP1   1 
ATOM   160  O  OP2   . DC  A 1 10  ? 43.878  55.259 -109.492 1.00 50.88  ? 410  DC  C OP2   1 
ATOM   161  O  "O5'" . DC  A 1 10  ? 42.676  54.402 -107.475 1.00 86.29  ? 410  DC  C "O5'" 1 
ATOM   162  C  "C5'" . DC  A 1 10  ? 41.519  53.917 -106.793 1.00 89.05  ? 410  DC  C "C5'" 1 
ATOM   163  C  "C4'" . DC  A 1 10  ? 41.834  52.650 -106.030 1.00 90.26  ? 410  DC  C "C4'" 1 
ATOM   164  O  "O4'" . DC  A 1 10  ? 42.121  51.551 -106.935 1.00 89.68  ? 410  DC  C "O4'" 1 
ATOM   165  C  "C3'" . DC  A 1 10  ? 43.024  52.729 -105.070 1.00 91.94  ? 410  DC  C "C3'" 1 
ATOM   166  O  "O3'" . DC  A 1 10  ? 42.695  52.032 -103.863 1.00 94.83  ? 410  DC  C "O3'" 1 
ATOM   167  C  "C2'" . DC  A 1 10  ? 44.118  51.981 -105.814 1.00 89.86  ? 410  DC  C "C2'" 1 
ATOM   168  C  "C1'" . DC  A 1 10  ? 43.315  50.904 -106.514 1.00 87.46  ? 410  DC  C "C1'" 1 
ATOM   169  N  N1    . DC  A 1 10  ? 43.954  50.273 -107.690 1.00 52.20  ? 410  DC  C N1    1 
ATOM   170  C  C2    . DC  A 1 10  ? 44.223  48.899 -107.648 1.00 51.44  ? 410  DC  C C2    1 
ATOM   171  O  O2    . DC  A 1 10  ? 43.964  48.268 -106.616 1.00 52.63  ? 410  DC  C O2    1 
ATOM   172  N  N3    . DC  A 1 10  ? 44.765  48.295 -108.727 1.00 49.53  ? 410  DC  C N3    1 
ATOM   173  C  C4    . DC  A 1 10  ? 45.055  49.011 -109.812 1.00 49.42  ? 410  DC  C C4    1 
ATOM   174  N  N4    . DC  A 1 10  ? 45.567  48.367 -110.862 1.00 49.32  ? 410  DC  C N4    1 
ATOM   175  C  C5    . DC  A 1 10  ? 44.823  50.415 -109.873 1.00 48.34  ? 410  DC  C C5    1 
ATOM   176  C  C6    . DC  A 1 10  ? 44.272  51.000 -108.802 1.00 50.06  ? 410  DC  C C6    1 
ATOM   177  P  P     . DT  A 1 11  ? 43.572  52.258 -102.533 1.00 136.78 ? 411  DT  C P     1 
ATOM   178  O  OP1   . DT  A 1 11  ? 43.106  53.504 -101.878 1.00 65.94  ? 411  DT  C OP1   1 
ATOM   179  O  OP2   . DT  A 1 11  ? 45.005  52.129 -102.914 1.00 65.85  ? 411  DT  C OP2   1 
ATOM   180  O  "O5'" . DT  A 1 11  ? 43.140  51.017 -101.623 1.00 137.87 ? 411  DT  C "O5'" 1 
ATOM   181  C  "C5'" . DT  A 1 11  ? 44.028  50.453 -100.655 1.00 137.84 ? 411  DT  C "C5'" 1 
ATOM   182  C  "C4'" . DT  A 1 11  ? 44.187  48.965 -100.884 1.00 136.97 ? 411  DT  C "C4'" 1 
ATOM   183  O  "O4'" . DT  A 1 11  ? 44.337  48.727 -102.305 1.00 136.44 ? 411  DT  C "O4'" 1 
ATOM   184  C  "C3'" . DT  A 1 11  ? 45.471  48.442 -100.237 1.00 136.71 ? 411  DT  C "C3'" 1 
ATOM   185  O  "O3'" . DT  A 1 11  ? 45.502  47.026 -99.944  1.00 136.66 ? 411  DT  C "O3'" 1 
ATOM   186  C  "C2'" . DT  A 1 11  ? 46.468  48.664 -101.353 1.00 136.94 ? 411  DT  C "C2'" 1 
ATOM   187  C  "C1'" . DT  A 1 11  ? 45.641  48.240 -102.555 1.00 135.91 ? 411  DT  C "C1'" 1 
ATOM   188  N  N1    . DT  A 1 11  ? 46.093  48.767 -103.856 1.00 63.74  ? 411  DT  C N1    1 
ATOM   189  C  C2    . DT  A 1 11  ? 46.150  47.887 -104.913 1.00 63.71  ? 411  DT  C C2    1 
ATOM   190  O  O2    . DT  A 1 11  ? 45.777  46.724 -104.831 1.00 63.67  ? 411  DT  C O2    1 
ATOM   191  N  N3    . DT  A 1 11  ? 46.653  48.420 -106.078 1.00 62.66  ? 411  DT  C N3    1 
ATOM   192  C  C4    . DT  A 1 11  ? 47.080  49.720 -106.284 1.00 62.18  ? 411  DT  C C4    1 
ATOM   193  O  O4    . DT  A 1 11  ? 47.545  50.051 -107.374 1.00 61.62  ? 411  DT  C O4    1 
ATOM   194  C  C5    . DT  A 1 11  ? 46.945  50.599 -105.145 1.00 62.37  ? 411  DT  C C5    1 
ATOM   195  C  C7    . DT  A 1 11  ? 47.344  52.033 -105.289 1.00 61.93  ? 411  DT  C C7    1 
ATOM   196  C  C6    . DT  A 1 11  ? 46.465  50.086 -104.003 1.00 62.70  ? 411  DT  C C6    1 
ATOM   197  P  P     . DG  A 1 12  ? 44.174  46.114 -100.024 1.00 95.29  ? 412  DG  C P     1 
ATOM   198  O  OP1   . DG  A 1 12  ? 43.312  46.557 -101.145 1.00 65.13  ? 412  DG  C OP1   1 
ATOM   199  O  OP2   . DG  A 1 12  ? 43.598  45.970 -98.661  1.00 63.31  ? 412  DG  C OP2   1 
ATOM   200  O  "O5'" . DG  A 1 12  ? 44.760  44.692 -100.436 1.00 92.23  ? 412  DG  C "O5'" 1 
ATOM   201  C  "C5'" . DG  A 1 12  ? 45.743  44.599 -101.464 1.00 88.43  ? 412  DG  C "C5'" 1 
ATOM   202  C  "C4'" . DG  A 1 12  ? 47.042  44.075 -100.899 1.00 86.27  ? 412  DG  C "C4'" 1 
ATOM   203  O  "O4'" . DG  A 1 12  ? 48.102  44.486 -101.801 1.00 83.69  ? 412  DG  C "O4'" 1 
ATOM   204  C  "C3'" . DG  A 1 12  ? 47.416  44.673 -99.541  1.00 85.20  ? 412  DG  C "C3'" 1 
ATOM   205  O  "O3'" . DG  A 1 12  ? 48.373  43.845 -98.870  1.00 86.32  ? 412  DG  C "O3'" 1 
ATOM   206  C  "C2'" . DG  A 1 12  ? 48.187  45.916 -99.927  1.00 81.95  ? 412  DG  C "C2'" 1 
ATOM   207  C  "C1'" . DG  A 1 12  ? 48.944  45.436 -101.153 1.00 80.21  ? 412  DG  C "C1'" 1 
ATOM   208  N  N9    . DG  A 1 12  ? 49.267  46.498 -102.103 1.00 46.26  ? 412  DG  C N9    1 
ATOM   209  C  C8    . DG  A 1 12  ? 49.154  47.855 -101.894 1.00 44.70  ? 412  DG  C C8    1 
ATOM   210  N  N7    . DG  A 1 12  ? 49.565  48.569 -102.908 1.00 43.99  ? 412  DG  C N7    1 
ATOM   211  C  C5    . DG  A 1 12  ? 49.963  47.628 -103.850 1.00 42.34  ? 412  DG  C C5    1 
ATOM   212  C  C6    . DG  A 1 12  ? 50.504  47.806 -105.137 1.00 40.16  ? 412  DG  C C6    1 
ATOM   213  O  O6    . DG  A 1 12  ? 50.736  48.866 -105.730 1.00 37.90  ? 412  DG  C O6    1 
ATOM   214  N  N1    . DG  A 1 12  ? 50.785  46.588 -105.746 1.00 37.79  ? 412  DG  C N1    1 
ATOM   215  C  C2    . DG  A 1 12  ? 50.563  45.356 -105.186 1.00 40.19  ? 412  DG  C C2    1 
ATOM   216  N  N2    . DG  A 1 12  ? 50.903  44.296 -105.933 1.00 39.77  ? 412  DG  C N2    1 
ATOM   217  N  N3    . DG  A 1 12  ? 50.048  45.175 -103.983 1.00 40.48  ? 412  DG  C N3    1 
ATOM   218  C  C4    . DG  A 1 12  ? 49.777  46.345 -103.373 1.00 43.08  ? 412  DG  C C4    1 
ATOM   219  O  "O5'" . DC  B 2 2   ? 56.923  45.785 -113.100 1.00 104.64 ? 422  DC  D "O5'" 1 
ATOM   220  C  "C5'" . DC  B 2 2   ? 56.224  46.137 -111.901 1.00 104.56 ? 422  DC  D "C5'" 1 
ATOM   221  C  "C4'" . DC  B 2 2   ? 55.401  45.000 -111.338 1.00 104.38 ? 422  DC  D "C4'" 1 
ATOM   222  O  "O4'" . DC  B 2 2   ? 54.707  45.449 -110.151 1.00 103.33 ? 422  DC  D "O4'" 1 
ATOM   223  C  "C3'" . DC  B 2 2   ? 54.313  44.467 -112.272 1.00 104.25 ? 422  DC  D "C3'" 1 
ATOM   224  O  "O3'" . DC  B 2 2   ? 54.086  43.085 -111.993 1.00 106.04 ? 422  DC  D "O3'" 1 
ATOM   225  C  "C2'" . DC  B 2 2   ? 53.090  45.251 -111.840 1.00 102.08 ? 422  DC  D "C2'" 1 
ATOM   226  C  "C1'" . DC  B 2 2   ? 53.301  45.334 -110.339 1.00 97.84  ? 422  DC  D "C1'" 1 
ATOM   227  N  N1    . DC  B 2 2   ? 52.678  46.497 -109.702 1.00 42.82  ? 422  DC  D N1    1 
ATOM   228  C  C2    . DC  B 2 2   ? 52.027  46.327 -108.482 1.00 39.86  ? 422  DC  D C2    1 
ATOM   229  O  O2    . DC  B 2 2   ? 51.944  45.184 -108.002 1.00 37.99  ? 422  DC  D O2    1 
ATOM   230  N  N3    . DC  B 2 2   ? 51.504  47.404 -107.861 1.00 38.34  ? 422  DC  D N3    1 
ATOM   231  C  C4    . DC  B 2 2   ? 51.608  48.611 -108.418 1.00 39.69  ? 422  DC  D C4    1 
ATOM   232  N  N4    . DC  B 2 2   ? 51.112  49.661 -107.749 1.00 38.22  ? 422  DC  D N4    1 
ATOM   233  C  C5    . DC  B 2 2   ? 52.235  48.805 -109.678 1.00 38.79  ? 422  DC  D C5    1 
ATOM   234  C  C6    . DC  B 2 2   ? 52.751  47.732 -110.279 1.00 40.82  ? 422  DC  D C6    1 
ATOM   235  P  P     . DA  B 2 3   ? 54.562  41.970 -113.040 1.00 112.15 ? 423  DA  D P     1 
ATOM   236  O  OP1   . DA  B 2 3   ? 56.024  41.796 -112.855 1.00 64.86  ? 423  DA  D OP1   1 
ATOM   237  O  OP2   . DA  B 2 3   ? 54.024  42.347 -114.373 1.00 63.70  ? 423  DA  D OP2   1 
ATOM   238  O  "O5'" . DA  B 2 3   ? 53.835  40.643 -112.538 1.00 111.91 ? 423  DA  D "O5'" 1 
ATOM   239  C  "C5'" . DA  B 2 3   ? 52.581  40.229 -113.086 1.00 109.55 ? 423  DA  D "C5'" 1 
ATOM   240  C  "C4'" . DA  B 2 3   ? 51.713  39.625 -112.005 1.00 108.54 ? 423  DA  D "C4'" 1 
ATOM   241  O  "O4'" . DA  B 2 3   ? 51.354  40.644 -111.039 1.00 106.21 ? 423  DA  D "O4'" 1 
ATOM   242  C  "C3'" . DA  B 2 3   ? 50.392  39.042 -112.498 1.00 109.03 ? 423  DA  D "C3'" 1 
ATOM   243  O  "O3'" . DA  B 2 3   ? 50.070  37.883 -111.721 1.00 111.91 ? 423  DA  D "O3'" 1 
ATOM   244  C  "C2'" . DA  B 2 3   ? 49.399  40.165 -112.261 1.00 105.27 ? 423  DA  D "C2'" 1 
ATOM   245  C  "C1'" . DA  B 2 3   ? 49.944  40.852 -111.019 1.00 102.58 ? 423  DA  D "C1'" 1 
ATOM   246  N  N9    . DA  B 2 3   ? 49.717  42.298 -111.000 1.00 49.93  ? 423  DA  D N9    1 
ATOM   247  C  C8    . DA  B 2 3   ? 50.010  43.187 -112.009 1.00 48.89  ? 423  DA  D C8    1 
ATOM   248  N  N7    . DA  B 2 3   ? 49.753  44.437 -111.706 1.00 45.78  ? 423  DA  D N7    1 
ATOM   249  C  C5    . DA  B 2 3   ? 49.243  44.370 -110.417 1.00 45.46  ? 423  DA  D C5    1 
ATOM   250  C  C6    . DA  B 2 3   ? 48.780  45.361 -109.533 1.00 43.12  ? 423  DA  D C6    1 
ATOM   251  N  N6    . DA  B 2 3   ? 48.777  46.668 -109.822 1.00 41.45  ? 423  DA  D N6    1 
ATOM   252  N  N1    . DA  B 2 3   ? 48.321  44.963 -108.325 1.00 42.00  ? 423  DA  D N1    1 
ATOM   253  C  C2    . DA  B 2 3   ? 48.336  43.656 -108.034 1.00 43.66  ? 423  DA  D C2    1 
ATOM   254  N  N3    . DA  B 2 3   ? 48.750  42.629 -108.780 1.00 47.39  ? 423  DA  D N3    1 
ATOM   255  C  C4    . DA  B 2 3   ? 49.200  43.057 -109.974 1.00 46.76  ? 423  DA  D C4    1 
ATOM   256  P  P     . DG  B 2 4   ? 48.697  37.097 -111.988 1.00 163.87 ? 424  DG  D P     1 
ATOM   257  O  OP1   . DG  B 2 4   ? 48.987  35.648 -111.841 1.00 67.58  ? 424  DG  D OP1   1 
ATOM   258  O  OP2   . DG  B 2 4   ? 48.115  37.602 -113.260 1.00 69.26  ? 424  DG  D OP2   1 
ATOM   259  O  "O5'" . DG  B 2 4   ? 47.776  37.549 -110.765 1.00 163.85 ? 424  DG  D "O5'" 1 
ATOM   260  C  "C5'" . DG  B 2 4   ? 48.277  37.498 -109.427 1.00 163.25 ? 424  DG  D "C5'" 1 
ATOM   261  C  "C4'" . DG  B 2 4   ? 47.411  38.315 -108.495 1.00 162.42 ? 424  DG  D "C4'" 1 
ATOM   262  O  "O4'" . DG  B 2 4   ? 47.414  39.706 -108.898 1.00 161.56 ? 424  DG  D "O4'" 1 
ATOM   263  C  "C3'" . DG  B 2 4   ? 45.937  37.913 -108.416 1.00 162.76 ? 424  DG  D "C3'" 1 
ATOM   264  O  "O3'" . DG  B 2 4   ? 45.484  38.108 -107.070 1.00 163.23 ? 424  DG  D "O3'" 1 
ATOM   265  C  "C2'" . DG  B 2 4   ? 45.261  38.909 -109.339 1.00 161.09 ? 424  DG  D "C2'" 1 
ATOM   266  C  "C1'" . DG  B 2 4   ? 46.074  40.154 -109.057 1.00 159.89 ? 424  DG  D "C1'" 1 
ATOM   267  N  N9    . DG  B 2 4   ? 46.064  41.178 -110.095 1.00 62.45  ? 424  DG  D N9    1 
ATOM   268  C  C8    . DG  B 2 4   ? 46.383  41.029 -111.423 1.00 61.27  ? 424  DG  D C8    1 
ATOM   269  N  N7    . DG  B 2 4   ? 46.365  42.155 -112.082 1.00 60.98  ? 424  DG  D N7    1 
ATOM   270  C  C5    . DG  B 2 4   ? 45.997  43.101 -111.135 1.00 60.53  ? 424  DG  D C5    1 
ATOM   271  C  C6    . DG  B 2 4   ? 45.840  44.504 -111.249 1.00 59.79  ? 424  DG  D C6    1 
ATOM   272  O  O6    . DG  B 2 4   ? 46.056  45.225 -112.230 1.00 59.68  ? 424  DG  D O6    1 
ATOM   273  N  N1    . DG  B 2 4   ? 45.409  45.068 -110.052 1.00 59.29  ? 424  DG  D N1    1 
ATOM   274  C  C2    . DG  B 2 4   ? 45.187  44.374 -108.884 1.00 58.32  ? 424  DG  D C2    1 
ATOM   275  N  N2    . DG  B 2 4   ? 44.742  45.082 -107.838 1.00 57.63  ? 424  DG  D N2    1 
ATOM   276  N  N3    . DG  B 2 4   ? 45.378  43.077 -108.755 1.00 59.98  ? 424  DG  D N3    1 
ATOM   277  C  C4    . DG  B 2 4   ? 45.774  42.507 -109.913 1.00 60.88  ? 424  DG  D C4    1 
ATOM   278  P  P     . DG  B 2 5   ? 43.925  37.950 -106.718 1.00 80.63  ? 425  DG  D P     1 
ATOM   279  O  OP1   . DG  B 2 5   ? 43.847  37.341 -105.363 1.00 63.14  ? 425  DG  D OP1   1 
ATOM   280  O  OP2   . DG  B 2 5   ? 43.268  37.280 -107.869 1.00 63.10  ? 425  DG  D OP2   1 
ATOM   281  O  "O5'" . DG  B 2 5   ? 43.383  39.452 -106.654 1.00 79.06  ? 425  DG  D "O5'" 1 
ATOM   282  C  "C5'" . DG  B 2 5   ? 42.597  39.923 -105.549 1.00 73.87  ? 425  DG  D "C5'" 1 
ATOM   283  C  "C4'" . DG  B 2 5   ? 41.236  40.380 -106.027 1.00 71.96  ? 425  DG  D "C4'" 1 
ATOM   284  O  "O4'" . DG  B 2 5   ? 41.390  41.446 -106.997 1.00 70.49  ? 425  DG  D "O4'" 1 
ATOM   285  C  "C3'" . DG  B 2 5   ? 40.424  39.286 -106.731 1.00 71.41  ? 425  DG  D "C3'" 1 
ATOM   286  O  "O3'" . DG  B 2 5   ? 39.007  39.439 -106.521 1.00 71.29  ? 425  DG  D "O3'" 1 
ATOM   287  C  "C2'" . DG  B 2 5   ? 40.697  39.569 -108.196 1.00 69.68  ? 425  DG  D "C2'" 1 
ATOM   288  C  "C1'" . DG  B 2 5   ? 40.705  41.084 -108.184 1.00 69.28  ? 425  DG  D "C1'" 1 
ATOM   289  N  N9    . DG  B 2 5   ? 41.355  41.734 -109.319 1.00 50.36  ? 425  DG  D N9    1 
ATOM   290  C  C8    . DG  B 2 5   ? 41.838  41.128 -110.452 1.00 51.14  ? 425  DG  D C8    1 
ATOM   291  N  N7    . DG  B 2 5   ? 42.306  41.976 -111.326 1.00 51.01  ? 425  DG  D N7    1 
ATOM   292  C  C5    . DG  B 2 5   ? 42.137  43.217 -110.726 1.00 49.84  ? 425  DG  D C5    1 
ATOM   293  C  C6    . DG  B 2 5   ? 42.439  44.520 -111.205 1.00 49.98  ? 425  DG  D C6    1 
ATOM   294  O  O6    . DG  B 2 5   ? 42.922  44.851 -112.303 1.00 48.98  ? 425  DG  D O6    1 
ATOM   295  N  N1    . DG  B 2 5   ? 42.102  45.495 -110.272 1.00 48.25  ? 425  DG  D N1    1 
ATOM   296  C  C2    . DG  B 2 5   ? 41.531  45.255 -109.050 1.00 47.30  ? 425  DG  D C2    1 
ATOM   297  N  N2    . DG  B 2 5   ? 41.254  46.339 -108.301 1.00 46.29  ? 425  DG  D N2    1 
ATOM   298  N  N3    . DG  B 2 5   ? 41.241  44.049 -108.599 1.00 47.73  ? 425  DG  D N3    1 
ATOM   299  C  C4    . DG  B 2 5   ? 41.567  43.085 -109.482 1.00 48.79  ? 425  DG  D C4    1 
ATOM   300  P  P     . DA  B 2 6   ? 38.451  40.193 -105.214 1.00 78.00  ? 426  DA  D P     1 
ATOM   301  O  OP1   . DA  B 2 6   ? 39.357  39.952 -104.072 1.00 54.83  ? 426  DA  D OP1   1 
ATOM   302  O  OP2   . DA  B 2 6   ? 37.015  39.858 -105.090 1.00 56.01  ? 426  DA  D OP2   1 
ATOM   303  O  "O5'" . DA  B 2 6   ? 38.545  41.727 -105.624 1.00 78.72  ? 426  DA  D "O5'" 1 
ATOM   304  C  "C5'" . DA  B 2 6   ? 37.965  42.748 -104.821 1.00 74.20  ? 426  DA  D "C5'" 1 
ATOM   305  C  "C4'" . DA  B 2 6   ? 36.906  43.484 -105.608 1.00 73.24  ? 426  DA  D "C4'" 1 
ATOM   306  O  "O4'" . DA  B 2 6   ? 37.461  43.934 -106.872 1.00 71.39  ? 426  DA  D "O4'" 1 
ATOM   307  C  "C3'" . DA  B 2 6   ? 35.676  42.647 -105.969 1.00 73.11  ? 426  DA  D "C3'" 1 
ATOM   308  O  "O3'" . DA  B 2 6   ? 34.507  43.465 -105.856 1.00 70.29  ? 426  DA  D "O3'" 1 
ATOM   309  C  "C2'" . DA  B 2 6   ? 35.923  42.265 -107.418 1.00 71.54  ? 426  DA  D "C2'" 1 
ATOM   310  C  "C1'" . DA  B 2 6   ? 36.630  43.499 -107.940 1.00 69.73  ? 426  DA  D "C1'" 1 
ATOM   311  N  N9    . DA  B 2 6   ? 37.467  43.287 -109.129 1.00 46.76  ? 426  DA  D N9    1 
ATOM   312  C  C8    . DA  B 2 6   ? 37.894  42.099 -109.683 1.00 44.52  ? 426  DA  D C8    1 
ATOM   313  N  N7    . DA  B 2 6   ? 38.634  42.251 -110.752 1.00 42.61  ? 426  DA  D N7    1 
ATOM   314  C  C5    . DA  B 2 6   ? 38.699  43.632 -110.918 1.00 42.62  ? 426  DA  D C5    1 
ATOM   315  C  C6    . DA  B 2 6   ? 39.351  44.451 -111.871 1.00 40.52  ? 426  DA  D C6    1 
ATOM   316  N  N6    . DA  B 2 6   ? 40.089  43.982 -112.875 1.00 37.84  ? 426  DA  D N6    1 
ATOM   317  N  N1    . DA  B 2 6   ? 39.218  45.786 -111.742 1.00 39.84  ? 426  DA  D N1    1 
ATOM   318  C  C2    . DA  B 2 6   ? 38.483  46.265 -110.728 1.00 39.75  ? 426  DA  D C2    1 
ATOM   319  N  N3    . DA  B 2 6   ? 37.828  45.606 -109.778 1.00 41.44  ? 426  DA  D N3    1 
ATOM   320  C  C4    . DA  B 2 6   ? 37.981  44.279 -109.929 1.00 43.12  ? 426  DA  D C4    1 
HETATM 321  P  P     . PED B 2 7   ? 33.043  42.814 -106.000 1.00 65.81  ? 427  PED D P     1 
HETATM 322  O  O1P   . PED B 2 7   ? 32.651  42.253 -104.683 1.00 65.06  ? 427  PED D O1P   1 
HETATM 323  O  O2P   . PED B 2 7   ? 33.037  41.938 -107.198 1.00 62.61  ? 427  PED D O2P   1 
HETATM 324  O  "O5'" . PED B 2 7   ? 32.134  44.090 -106.330 1.00 66.30  ? 427  PED D "O5'" 1 
HETATM 325  C  "C2'" . PED B 2 7   ? 31.101  47.022 -107.992 1.00 56.89  ? 427  PED D "C2'" 1 
HETATM 326  C  "C5'" . PED B 2 7   ? 30.846  44.285 -105.734 1.00 64.04  ? 427  PED D "C5'" 1 
HETATM 327  C  "C4'" . PED B 2 7   ? 30.204  45.552 -106.261 1.00 61.89  ? 427  PED D "C4'" 1 
HETATM 328  O  "O4'" . PED B 2 7   ? 30.856  46.694 -105.659 1.00 66.36  ? 427  PED D "O4'" 1 
HETATM 329  C  "C3'" . PED B 2 7   ? 30.306  45.737 -107.781 1.00 59.35  ? 427  PED D "C3'" 1 
HETATM 330  C  "C1'" . PED B 2 7   ? 30.130  48.155 -107.635 1.00 55.23  ? 427  PED D "C1'" 1 
HETATM 331  O  "O3'" . PED B 2 7   ? 29.010  45.923 -108.328 1.00 56.05  ? 427  PED D "O3'" 1 
ATOM   332  P  P     . DG  B 2 8   ? 28.498  44.940 -109.484 1.00 38.82  ? 428  DG  D P     1 
ATOM   333  O  OP1   . DG  B 2 8   ? 27.125  45.380 -109.863 1.00 44.53  ? 428  DG  D OP1   1 
ATOM   334  O  OP2   . DG  B 2 8   ? 28.728  43.550 -109.050 1.00 43.82  ? 428  DG  D OP2   1 
ATOM   335  O  "O5'" . DG  B 2 8   ? 29.477  45.221 -110.707 1.00 37.49  ? 428  DG  D "O5'" 1 
ATOM   336  C  "C5'" . DG  B 2 8   ? 29.262  46.341 -111.556 1.00 35.40  ? 428  DG  D "C5'" 1 
ATOM   337  C  "C4'" . DG  B 2 8   ? 28.976  45.901 -112.976 1.00 33.31  ? 428  DG  D "C4'" 1 
ATOM   338  O  "O4'" . DG  B 2 8   ? 30.175  45.371 -113.592 1.00 31.84  ? 428  DG  D "O4'" 1 
ATOM   339  C  "C3'" . DG  B 2 8   ? 27.879  44.849 -113.185 1.00 34.15  ? 428  DG  D "C3'" 1 
ATOM   340  O  "O3'" . DG  B 2 8   ? 27.071  45.236 -114.315 1.00 33.89  ? 428  DG  D "O3'" 1 
ATOM   341  C  "C2'" . DG  B 2 8   ? 28.669  43.579 -113.475 1.00 33.86  ? 428  DG  D "C2'" 1 
ATOM   342  C  "C1'" . DG  B 2 8   ? 29.891  44.116 -114.206 1.00 34.33  ? 428  DG  D "C1'" 1 
ATOM   343  N  N9    . DG  B 2 8   ? 31.106  43.310 -114.106 1.00 39.56  ? 428  DG  D N9    1 
ATOM   344  C  C8    . DG  B 2 8   ? 31.585  42.671 -112.988 1.00 39.41  ? 428  DG  D C8    1 
ATOM   345  N  N7    . DG  B 2 8   ? 32.782  42.179 -113.156 1.00 40.86  ? 428  DG  D N7    1 
ATOM   346  C  C5    . DG  B 2 8   ? 33.095  42.476 -114.476 1.00 40.98  ? 428  DG  D C5    1 
ATOM   347  C  C6    . DG  B 2 8   ? 34.286  42.234 -115.224 1.00 40.91  ? 428  DG  D C6    1 
ATOM   348  O  O6    . DG  B 2 8   ? 35.354  41.732 -114.843 1.00 41.54  ? 428  DG  D O6    1 
ATOM   349  N  N1    . DG  B 2 8   ? 34.159  42.671 -116.533 1.00 38.69  ? 428  DG  D N1    1 
ATOM   350  C  C2    . DG  B 2 8   ? 33.055  43.280 -117.053 1.00 37.28  ? 428  DG  D C2    1 
ATOM   351  N  N2    . DG  B 2 8   ? 33.132  43.611 -118.338 1.00 38.71  ? 428  DG  D N2    1 
ATOM   352  N  N3    . DG  B 2 8   ? 31.958  43.544 -116.366 1.00 39.80  ? 428  DG  D N3    1 
ATOM   353  C  C4    . DG  B 2 8   ? 32.048  43.121 -115.092 1.00 39.78  ? 428  DG  D C4    1 
ATOM   354  P  P     . DA  B 2 9   ? 25.623  44.563 -114.568 1.00 45.76  ? 429  DA  D P     1 
ATOM   355  O  OP1   . DA  B 2 9   ? 24.658  45.664 -114.798 1.00 39.12  ? 429  DA  D OP1   1 
ATOM   356  O  OP2   . DA  B 2 9   ? 25.326  43.559 -113.531 1.00 38.10  ? 429  DA  D OP2   1 
ATOM   357  O  "O5'" . DA  B 2 9   ? 25.851  43.815 -115.958 1.00 47.43  ? 429  DA  D "O5'" 1 
ATOM   358  C  "C5'" . DA  B 2 9   ? 27.120  43.242 -116.253 1.00 49.22  ? 429  DA  D "C5'" 1 
ATOM   359  C  "C4'" . DA  B 2 9   ? 27.365  43.191 -117.742 1.00 48.60  ? 429  DA  D "C4'" 1 
ATOM   360  O  "O4'" . DA  B 2 9   ? 28.732  42.767 -117.953 1.00 47.79  ? 429  DA  D "O4'" 1 
ATOM   361  C  "C3'" . DA  B 2 9   ? 26.516  42.168 -118.484 1.00 49.96  ? 429  DA  D "C3'" 1 
ATOM   362  O  "O3'" . DA  B 2 9   ? 26.381  42.574 -119.855 1.00 52.12  ? 429  DA  D "O3'" 1 
ATOM   363  C  "C2'" . DA  B 2 9   ? 27.344  40.901 -118.368 1.00 47.67  ? 429  DA  D "C2'" 1 
ATOM   364  C  "C1'" . DA  B 2 9   ? 28.777  41.418 -118.411 1.00 44.49  ? 429  DA  D "C1'" 1 
ATOM   365  N  N9    . DA  B 2 9   ? 29.682  40.695 -117.522 1.00 33.78  ? 429  DA  D N9    1 
ATOM   366  C  C8    . DA  B 2 9   ? 29.462  40.407 -116.201 1.00 32.74  ? 429  DA  D C8    1 
ATOM   367  N  N7    . DA  B 2 9   ? 30.468  39.805 -115.618 1.00 32.76  ? 429  DA  D N7    1 
ATOM   368  C  C5    . DA  B 2 9   ? 31.415  39.687 -116.621 1.00 31.54  ? 429  DA  D C5    1 
ATOM   369  C  C6    . DA  B 2 9   ? 32.731  39.171 -116.630 1.00 33.85  ? 429  DA  D C6    1 
ATOM   370  N  N6    . DA  B 2 9   ? 33.342  38.677 -115.547 1.00 33.65  ? 429  DA  D N6    1 
ATOM   371  N  N1    . DA  B 2 9   ? 33.405  39.190 -117.805 1.00 30.15  ? 429  DA  D N1    1 
ATOM   372  C  C2    . DA  B 2 9   ? 32.798  39.702 -118.875 1.00 30.88  ? 429  DA  D C2    1 
ATOM   373  N  N3    . DA  B 2 9   ? 31.576  40.235 -118.985 1.00 33.84  ? 429  DA  D N3    1 
ATOM   374  C  C4    . DA  B 2 9   ? 30.932  40.202 -117.809 1.00 33.06  ? 429  DA  D C4    1 
ATOM   375  P  P     . DA  B 2 10  ? 25.432  41.742 -120.844 1.00 59.02  ? 430  DA  D P     1 
ATOM   376  O  OP1   . DA  B 2 10  ? 24.555  42.707 -121.550 1.00 52.75  ? 430  DA  D OP1   1 
ATOM   377  O  OP2   . DA  B 2 10  ? 24.822  40.614 -120.107 1.00 51.07  ? 430  DA  D OP2   1 
ATOM   378  O  "O5'" . DA  B 2 10  ? 26.463  41.159 -121.899 1.00 62.10  ? 430  DA  D "O5'" 1 
ATOM   379  C  "C5'" . DA  B 2 10  ? 27.313  42.030 -122.642 1.00 64.99  ? 430  DA  D "C5'" 1 
ATOM   380  C  "C4'" . DA  B 2 10  ? 28.101  41.235 -123.656 1.00 65.74  ? 430  DA  D "C4'" 1 
ATOM   381  O  "O4'" . DA  B 2 10  ? 29.159  40.496 -122.993 1.00 65.21  ? 430  DA  D "O4'" 1 
ATOM   382  C  "C3'" . DA  B 2 10  ? 27.247  40.200 -124.383 1.00 66.23  ? 430  DA  D "C3'" 1 
ATOM   383  O  "O3'" . DA  B 2 10  ? 27.601  40.130 -125.765 1.00 67.41  ? 430  DA  D "O3'" 1 
ATOM   384  C  "C2'" . DA  B 2 10  ? 27.545  38.907 -123.645 1.00 66.05  ? 430  DA  D "C2'" 1 
ATOM   385  C  "C1'" . DA  B 2 10  ? 28.978  39.094 -123.168 1.00 65.50  ? 430  DA  D "C1'" 1 
ATOM   386  N  N9    . DA  B 2 10  ? 29.246  38.441 -121.884 1.00 55.18  ? 430  DA  D N9    1 
ATOM   387  C  C8    . DA  B 2 10  ? 28.356  38.217 -120.861 1.00 54.85  ? 430  DA  D C8    1 
ATOM   388  N  N7    . DA  B 2 10  ? 28.878  37.596 -119.832 1.00 53.60  ? 430  DA  D N7    1 
ATOM   389  C  C5    . DA  B 2 10  ? 30.201  37.398 -120.198 1.00 52.99  ? 430  DA  D C5    1 
ATOM   390  C  C6    . DA  B 2 10  ? 31.283  36.794 -119.537 1.00 52.36  ? 430  DA  D C6    1 
ATOM   391  N  N6    . DA  B 2 10  ? 31.198  36.251 -118.320 1.00 51.09  ? 430  DA  D N6    1 
ATOM   392  N  N1    . DA  B 2 10  ? 32.473  36.769 -120.176 1.00 53.18  ? 430  DA  D N1    1 
ATOM   393  C  C2    . DA  B 2 10  ? 32.557  37.315 -121.394 1.00 52.18  ? 430  DA  D C2    1 
ATOM   394  N  N3    . DA  B 2 10  ? 31.613  37.911 -122.119 1.00 52.91  ? 430  DA  D N3    1 
ATOM   395  C  C4    . DA  B 2 10  ? 30.444  37.919 -121.458 1.00 54.06  ? 430  DA  D C4    1 
ATOM   396  P  P     . DG  B 2 11  ? 27.277  38.802 -126.598 1.00 56.21  ? 431  DG  D P     1 
ATOM   397  O  OP1   . DG  B 2 11  ? 27.050  39.201 -128.007 1.00 59.65  ? 431  DG  D OP1   1 
ATOM   398  O  OP2   . DG  B 2 11  ? 26.248  38.008 -125.888 1.00 61.04  ? 431  DG  D OP2   1 
ATOM   399  O  "O5'" . DG  B 2 11  ? 28.653  38.025 -126.497 1.00 56.74  ? 431  DG  D "O5'" 1 
ATOM   400  C  "C5'" . DG  B 2 11  ? 29.871  38.753 -126.550 1.00 56.97  ? 431  DG  D "C5'" 1 
ATOM   401  C  "C4'" . DG  B 2 11  ? 31.033  37.797 -126.606 1.00 56.93  ? 431  DG  D "C4'" 1 
ATOM   402  O  "O4'" . DG  B 2 11  ? 31.206  37.188 -125.310 1.00 53.55  ? 431  DG  D "O4'" 1 
ATOM   403  C  "C3'" . DG  B 2 11  ? 30.806  36.645 -127.580 1.00 58.89  ? 431  DG  D "C3'" 1 
ATOM   404  O  "O3'" . DG  B 2 11  ? 32.051  36.284 -128.180 1.00 64.16  ? 431  DG  D "O3'" 1 
ATOM   405  C  "C2'" . DG  B 2 11  ? 30.290  35.537 -126.680 1.00 56.12  ? 431  DG  D "C2'" 1 
ATOM   406  C  "C1'" . DG  B 2 11  ? 31.108  35.786 -125.433 1.00 52.39  ? 431  DG  D "C1'" 1 
ATOM   407  N  N9    . DG  B 2 11  ? 30.586  35.270 -124.175 1.00 53.58  ? 431  DG  D N9    1 
ATOM   408  C  C8    . DG  B 2 11  ? 29.365  35.514 -123.591 1.00 52.48  ? 431  DG  D C8    1 
ATOM   409  N  N7    . DG  B 2 11  ? 29.241  34.952 -122.418 1.00 52.03  ? 431  DG  D N7    1 
ATOM   410  C  C5    . DG  B 2 11  ? 30.448  34.287 -122.230 1.00 50.71  ? 431  DG  D C5    1 
ATOM   411  C  C6    . DG  B 2 11  ? 30.918  33.507 -121.139 1.00 50.71  ? 431  DG  D C6    1 
ATOM   412  O  O6    . DG  B 2 11  ? 30.351  33.249 -120.074 1.00 49.08  ? 431  DG  D O6    1 
ATOM   413  N  N1    . DG  B 2 11  ? 32.196  33.011 -121.379 1.00 50.31  ? 431  DG  D N1    1 
ATOM   414  C  C2    . DG  B 2 11  ? 32.932  33.239 -122.516 1.00 50.70  ? 431  DG  D C2    1 
ATOM   415  N  N2    . DG  B 2 11  ? 34.143  32.667 -122.577 1.00 49.71  ? 431  DG  D N2    1 
ATOM   416  N  N3    . DG  B 2 11  ? 32.512  33.972 -123.525 1.00 52.34  ? 431  DG  D N3    1 
ATOM   417  C  C4    . DG  B 2 11  ? 31.274  34.460 -123.316 1.00 51.76  ? 431  DG  D C4    1 
ATOM   418  P  P     . DC  B 2 12  ? 32.063  35.269 -129.416 1.00 80.12  ? 432  DC  D P     1 
ATOM   419  O  OP1   . DC  B 2 12  ? 33.102  35.735 -130.375 1.00 66.48  ? 432  DC  D OP1   1 
ATOM   420  O  OP2   . DC  B 2 12  ? 30.654  35.127 -129.870 1.00 67.91  ? 432  DC  D OP2   1 
ATOM   421  O  "O5'" . DC  B 2 12  ? 32.541  33.895 -128.765 1.00 79.75  ? 432  DC  D "O5'" 1 
ATOM   422  C  "C5'" . DC  B 2 12  ? 32.076  32.647 -129.269 1.00 82.86  ? 432  DC  D "C5'" 1 
ATOM   423  C  "C4'" . DC  B 2 12  ? 32.600  31.512 -128.422 1.00 85.10  ? 432  DC  D "C4'" 1 
ATOM   424  O  "O4'" . DC  B 2 12  ? 32.221  31.730 -127.040 1.00 82.90  ? 432  DC  D "O4'" 1 
ATOM   425  C  "C3'" . DC  B 2 12  ? 32.056  30.130 -128.800 1.00 86.32  ? 432  DC  D "C3'" 1 
ATOM   426  O  "O3'" . DC  B 2 12  ? 33.084  29.142 -128.641 1.00 91.01  ? 432  DC  D "O3'" 1 
ATOM   427  C  "C2'" . DC  B 2 12  ? 30.957  29.907 -127.777 1.00 85.76  ? 432  DC  D "C2'" 1 
ATOM   428  C  "C1'" . DC  B 2 12  ? 31.546  30.581 -126.554 1.00 83.02  ? 432  DC  D "C1'" 1 
ATOM   429  N  N1    . DC  B 2 12  ? 30.562  31.012 -125.548 1.00 69.33  ? 432  DC  D N1    1 
ATOM   430  C  C2    . DC  B 2 12  ? 30.713  30.560 -124.233 1.00 68.32  ? 432  DC  D C2    1 
ATOM   431  O  O2    . DC  B 2 12  ? 31.672  29.824 -123.956 1.00 68.70  ? 432  DC  D O2    1 
ATOM   432  N  N3    . DC  B 2 12  ? 29.814  30.931 -123.301 1.00 66.74  ? 432  DC  D N3    1 
ATOM   433  C  C4    . DC  B 2 12  ? 28.794  31.719 -123.634 1.00 66.81  ? 432  DC  D C4    1 
ATOM   434  N  N4    . DC  B 2 12  ? 27.930  32.050 -122.673 1.00 65.35  ? 432  DC  D N4    1 
ATOM   435  C  C5    . DC  B 2 12  ? 28.616  32.201 -124.966 1.00 66.61  ? 432  DC  D C5    1 
ATOM   436  C  C6    . DC  B 2 12  ? 29.517  31.828 -125.882 1.00 67.52  ? 432  DC  D C6    1 
ATOM   437  P  P     . DC  B 2 13  ? 33.138  27.867 -129.622 1.00 82.28  ? 433  DC  D P     1 
ATOM   438  O  OP1   . DC  B 2 13  ? 34.534  27.362 -129.576 1.00 62.02  ? 433  DC  D OP1   1 
ATOM   439  O  OP2   . DC  B 2 13  ? 32.539  28.239 -130.926 1.00 61.60  ? 433  DC  D OP2   1 
ATOM   440  O  "O5'" . DC  B 2 13  ? 32.195  26.786 -128.924 1.00 83.53  ? 433  DC  D "O5'" 1 
ATOM   441  C  "C5'" . DC  B 2 13  ? 31.792  26.934 -127.562 1.00 85.14  ? 433  DC  D "C5'" 1 
ATOM   442  C  "C4'" . DC  B 2 13  ? 32.352  25.810 -126.723 1.00 86.43  ? 433  DC  D "C4'" 1 
ATOM   443  O  "O4'" . DC  B 2 13  ? 32.096  26.092 -125.327 1.00 87.55  ? 433  DC  D "O4'" 1 
ATOM   444  C  "C3'" . DC  B 2 13  ? 31.732  24.439 -126.986 1.00 86.77  ? 433  DC  D "C3'" 1 
ATOM   445  O  "O3'" . DC  B 2 13  ? 32.679  23.425 -126.633 1.00 85.88  ? 433  DC  D "O3'" 1 
ATOM   446  C  "C2'" . DC  B 2 13  ? 30.622  24.377 -125.953 1.00 87.72  ? 433  DC  D "C2'" 1 
ATOM   447  C  "C1'" . DC  B 2 13  ? 31.265  25.083 -124.772 1.00 88.06  ? 433  DC  D "C1'" 1 
ATOM   448  N  N1    . DC  B 2 13  ? 30.327  25.731 -123.839 1.00 68.79  ? 433  DC  D N1    1 
ATOM   449  C  C2    . DC  B 2 13  ? 30.329  25.326 -122.497 1.00 69.19  ? 433  DC  D C2    1 
ATOM   450  O  O2    . DC  B 2 13  ? 31.109  24.425 -122.141 1.00 69.28  ? 433  DC  D O2    1 
ATOM   451  N  N3    . DC  B 2 13  ? 29.483  25.921 -121.624 1.00 69.47  ? 433  DC  D N3    1 
ATOM   452  C  C4    . DC  B 2 13  ? 28.653  26.878 -122.046 1.00 69.78  ? 433  DC  D C4    1 
ATOM   453  N  N4    . DC  B 2 13  ? 27.834  27.434 -121.146 1.00 70.68  ? 433  DC  D N4    1 
ATOM   454  C  C5    . DC  B 2 13  ? 28.626  27.307 -123.408 1.00 69.79  ? 433  DC  D C5    1 
ATOM   455  C  C6    . DC  B 2 13  ? 29.473  26.712 -124.262 1.00 69.62  ? 433  DC  D C6    1 
ATOM   456  O  "O5'" . DT  C 1 4   ? 70.347  28.208 -88.005  1.00 114.64 ? 404  DT  E "O5'" 1 
ATOM   457  C  "C5'" . DT  C 1 4   ? 69.284  29.162 -88.079  1.00 114.21 ? 404  DT  E "C5'" 1 
ATOM   458  C  "C4'" . DT  C 1 4   ? 69.324  30.154 -86.939  1.00 113.98 ? 404  DT  E "C4'" 1 
ATOM   459  O  "O4'" . DT  C 1 4   ? 70.523  30.961 -87.046  1.00 112.94 ? 404  DT  E "O4'" 1 
ATOM   460  C  "C3'" . DT  C 1 4   ? 68.157  31.145 -86.907  1.00 115.32 ? 404  DT  E "C3'" 1 
ATOM   461  O  "O3'" . DT  C 1 4   ? 67.805  31.441 -85.550  1.00 116.57 ? 404  DT  E "O3'" 1 
ATOM   462  C  "C2'" . DT  C 1 4   ? 68.741  32.383 -87.558  1.00 114.80 ? 404  DT  E "C2'" 1 
ATOM   463  C  "C1'" . DT  C 1 4   ? 70.169  32.339 -87.057  1.00 112.66 ? 404  DT  E "C1'" 1 
ATOM   464  N  N1    . DT  C 1 4   ? 71.135  33.053 -87.908  1.00 58.53  ? 404  DT  E N1    1 
ATOM   465  C  C2    . DT  C 1 4   ? 72.012  33.925 -87.304  1.00 57.99  ? 404  DT  E C2    1 
ATOM   466  O  O2    . DT  C 1 4   ? 72.027  34.139 -86.103  1.00 57.22  ? 404  DT  E O2    1 
ATOM   467  N  N3    . DT  C 1 4   ? 72.882  34.542 -88.166  1.00 58.29  ? 404  DT  E N3    1 
ATOM   468  C  C4    . DT  C 1 4   ? 72.967  34.377 -89.537  1.00 57.87  ? 404  DT  E C4    1 
ATOM   469  O  O4    . DT  C 1 4   ? 73.811  35.002 -90.181  1.00 58.33  ? 404  DT  E O4    1 
ATOM   470  C  C5    . DT  C 1 4   ? 72.021  33.450 -90.102  1.00 58.01  ? 404  DT  E C5    1 
ATOM   471  C  C7    . DT  C 1 4   ? 72.045  33.200 -91.577  1.00 56.77  ? 404  DT  E C7    1 
ATOM   472  C  C6    . DT  C 1 4   ? 71.159  32.845 -89.271  1.00 58.21  ? 404  DT  E C6    1 
ATOM   473  P  P     . DT  C 1 5   ? 66.566  32.420 -85.239  1.00 97.71  ? 405  DT  E P     1 
ATOM   474  O  OP1   . DT  C 1 5   ? 65.465  31.592 -84.686  1.00 82.16  ? 405  DT  E OP1   1 
ATOM   475  O  OP2   . DT  C 1 5   ? 66.318  33.265 -86.437  1.00 80.77  ? 405  DT  E OP2   1 
ATOM   476  O  "O5'" . DT  C 1 5   ? 67.113  33.365 -84.079  1.00 97.08  ? 405  DT  E "O5'" 1 
ATOM   477  C  "C5'" . DT  C 1 5   ? 66.551  34.658 -83.855  1.00 95.96  ? 405  DT  E "C5'" 1 
ATOM   478  C  "C4'" . DT  C 1 5   ? 67.522  35.518 -83.079  1.00 95.37  ? 405  DT  E "C4'" 1 
ATOM   479  O  "O4'" . DT  C 1 5   ? 68.771  35.622 -83.806  1.00 96.48  ? 405  DT  E "O4'" 1 
ATOM   480  C  "C3'" . DT  C 1 5   ? 67.058  36.954 -82.839  1.00 95.24  ? 405  DT  E "C3'" 1 
ATOM   481  O  "O3'" . DT  C 1 5   ? 67.486  37.387 -81.546  1.00 94.35  ? 405  DT  E "O3'" 1 
ATOM   482  C  "C2'" . DT  C 1 5   ? 67.779  37.740 -83.918  1.00 95.20  ? 405  DT  E "C2'" 1 
ATOM   483  C  "C1'" . DT  C 1 5   ? 69.092  36.991 -84.020  1.00 95.70  ? 405  DT  E "C1'" 1 
ATOM   484  N  N1    . DT  C 1 5   ? 69.760  37.106 -85.330  1.00 78.93  ? 405  DT  E N1    1 
ATOM   485  C  C2    . DT  C 1 5   ? 70.842  37.958 -85.442  1.00 79.10  ? 405  DT  E C2    1 
ATOM   486  O  O2    . DT  C 1 5   ? 71.259  38.638 -84.520  1.00 77.75  ? 405  DT  E O2    1 
ATOM   487  N  N3    . DT  C 1 5   ? 71.415  37.991 -86.685  1.00 79.25  ? 405  DT  E N3    1 
ATOM   488  C  C4    . DT  C 1 5   ? 71.022  37.288 -87.803  1.00 79.18  ? 405  DT  E C4    1 
ATOM   489  O  O4    . DT  C 1 5   ? 71.640  37.418 -88.853  1.00 78.74  ? 405  DT  E O4    1 
ATOM   490  C  C5    . DT  C 1 5   ? 69.873  36.431 -87.622  1.00 79.30  ? 405  DT  E C5    1 
ATOM   491  C  C7    . DT  C 1 5   ? 69.365  35.647 -88.789  1.00 79.75  ? 405  DT  E C7    1 
ATOM   492  C  C6    . DT  C 1 5   ? 69.310  36.379 -86.409  1.00 78.90  ? 405  DT  E C6    1 
ATOM   493  P  P     . DC  C 1 6   ? 67.122  38.867 -81.042  1.00 96.72  ? 406  DC  E P     1 
ATOM   494  O  OP1   . DC  C 1 6   ? 67.579  38.971 -79.637  1.00 63.55  ? 406  DC  E OP1   1 
ATOM   495  O  OP2   . DC  C 1 6   ? 65.701  39.136 -81.369  1.00 63.47  ? 406  DC  E OP2   1 
ATOM   496  O  "O5'" . DC  C 1 6   ? 68.057  39.805 -81.931  1.00 96.15  ? 406  DC  E "O5'" 1 
ATOM   497  C  "C5'" . DC  C 1 6   ? 69.422  40.008 -81.569  1.00 94.11  ? 406  DC  E "C5'" 1 
ATOM   498  C  "C4'" . DC  C 1 6   ? 69.943  41.301 -82.153  1.00 92.52  ? 406  DC  E "C4'" 1 
ATOM   499  O  "O4'" . DC  C 1 6   ? 70.494  41.091 -83.475  1.00 91.75  ? 406  DC  E "O4'" 1 
ATOM   500  C  "C3'" . DC  C 1 6   ? 68.910  42.422 -82.285  1.00 91.85  ? 406  DC  E "C3'" 1 
ATOM   501  O  "O3'" . DC  C 1 6   ? 69.458  43.664 -81.836  1.00 90.68  ? 406  DC  E "O3'" 1 
ATOM   502  C  "C2'" . DC  C 1 6   ? 68.653  42.486 -83.781  1.00 91.42  ? 406  DC  E "C2'" 1 
ATOM   503  C  "C1'" . DC  C 1 6   ? 70.004  42.090 -84.349  1.00 90.09  ? 406  DC  E "C1'" 1 
ATOM   504  N  N1    . DC  C 1 6   ? 69.977  41.533 -85.715  1.00 56.99  ? 406  DC  E N1    1 
ATOM   505  C  C2    . DC  C 1 6   ? 71.003  41.883 -86.607  1.00 55.77  ? 406  DC  E C2    1 
ATOM   506  O  O2    . DC  C 1 6   ? 71.919  42.622 -86.207  1.00 55.95  ? 406  DC  E O2    1 
ATOM   507  N  N3    . DC  C 1 6   ? 70.972  41.404 -87.875  1.00 54.22  ? 406  DC  E N3    1 
ATOM   508  C  C4    . DC  C 1 6   ? 69.975  40.600 -88.259  1.00 54.60  ? 406  DC  E C4    1 
ATOM   509  N  N4    . DC  C 1 6   ? 69.970  40.159 -89.520  1.00 52.97  ? 406  DC  E N4    1 
ATOM   510  C  C5    . DC  C 1 6   ? 68.932  40.214 -87.366  1.00 54.78  ? 406  DC  E C5    1 
ATOM   511  C  C6    . DC  C 1 6   ? 68.970  40.700 -86.116  1.00 55.74  ? 406  DC  E C6    1 
ATOM   512  P  P     . DA  C 1 7   ? 68.474  44.855 -81.399  1.00 62.85  ? 407  DA  E P     1 
ATOM   513  O  OP1   . DA  C 1 7   ? 68.707  45.165 -79.967  1.00 92.98  ? 407  DA  E OP1   1 
ATOM   514  O  OP2   . DA  C 1 7   ? 67.110  44.496 -81.856  1.00 92.09  ? 407  DA  E OP2   1 
ATOM   515  O  "O5'" . DA  C 1 7   ? 68.981  46.090 -82.265  1.00 61.90  ? 407  DA  E "O5'" 1 
ATOM   516  C  "C5'" . DA  C 1 7   ? 68.102  46.777 -83.149  1.00 61.02  ? 407  DA  E "C5'" 1 
ATOM   517  C  "C4'" . DA  C 1 7   ? 68.894  47.521 -84.199  1.00 59.98  ? 407  DA  E "C4'" 1 
ATOM   518  O  "O4'" . DA  C 1 7   ? 69.521  46.564 -85.089  1.00 61.01  ? 407  DA  E "O4'" 1 
ATOM   519  C  "C3'" . DA  C 1 7   ? 68.031  48.422 -85.079  1.00 59.17  ? 407  DA  E "C3'" 1 
ATOM   520  O  "O3'" . DA  C 1 7   ? 68.613  49.709 -85.246  1.00 55.48  ? 407  DA  E "O3'" 1 
ATOM   521  C  "C2'" . DA  C 1 7   ? 67.914  47.688 -86.400  1.00 61.23  ? 407  DA  E "C2'" 1 
ATOM   522  C  "C1'" . DA  C 1 7   ? 69.128  46.782 -86.440  1.00 62.54  ? 407  DA  E "C1'" 1 
ATOM   523  N  N9    . DA  C 1 7   ? 68.783  45.484 -87.021  1.00 95.02  ? 407  DA  E N9    1 
ATOM   524  C  C8    . DA  C 1 7   ? 68.231  44.401 -86.384  1.00 95.10  ? 407  DA  E C8    1 
ATOM   525  N  N7    . DA  C 1 7   ? 67.985  43.388 -87.179  1.00 94.88  ? 407  DA  E N7    1 
ATOM   526  C  C5    . DA  C 1 7   ? 68.414  43.829 -88.423  1.00 95.85  ? 407  DA  E C5    1 
ATOM   527  C  C6    . DA  C 1 7   ? 68.420  43.223 -89.691  1.00 96.13  ? 407  DA  E C6    1 
ATOM   528  N  N6    . DA  C 1 7   ? 67.950  41.996 -89.928  1.00 96.31  ? 407  DA  E N6    1 
ATOM   529  N  N1    . DA  C 1 7   ? 68.928  43.931 -90.723  1.00 96.48  ? 407  DA  E N1    1 
ATOM   530  C  C2    . DA  C 1 7   ? 69.386  45.168 -90.487  1.00 97.74  ? 407  DA  E C2    1 
ATOM   531  N  N3    . DA  C 1 7   ? 69.424  45.849 -89.343  1.00 97.63  ? 407  DA  E N3    1 
ATOM   532  C  C4    . DA  C 1 7   ? 68.919  45.115 -88.338  1.00 96.04  ? 407  DA  E C4    1 
ATOM   533  P  P     . DT  C 1 8   ? 67.717  51.006 -84.955  1.00 60.40  ? 408  DT  E P     1 
ATOM   534  O  OP1   . DT  C 1 8   ? 68.557  51.989 -84.216  1.00 56.50  ? 408  DT  E OP1   1 
ATOM   535  O  OP2   . DT  C 1 8   ? 66.452  50.518 -84.339  1.00 58.69  ? 408  DT  E OP2   1 
ATOM   536  O  "O5'" . DT  C 1 8   ? 67.388  51.553 -86.415  1.00 57.46  ? 408  DT  E "O5'" 1 
ATOM   537  C  "C5'" . DT  C 1 8   ? 67.472  50.685 -87.544  1.00 52.59  ? 408  DT  E "C5'" 1 
ATOM   538  C  "C4'" . DT  C 1 8   ? 67.576  51.478 -88.825  1.00 49.41  ? 408  DT  E "C4'" 1 
ATOM   539  O  "O4'" . DT  C 1 8   ? 67.766  50.536 -89.901  1.00 47.82  ? 408  DT  E "O4'" 1 
ATOM   540  C  "C3'" . DT  C 1 8   ? 66.325  52.272 -89.188  1.00 50.16  ? 408  DT  E "C3'" 1 
ATOM   541  O  "O3'" . DT  C 1 8   ? 66.673  53.505 -89.838  1.00 53.25  ? 408  DT  E "O3'" 1 
ATOM   542  C  "C2'" . DT  C 1 8   ? 65.542  51.324 -90.086  1.00 47.95  ? 408  DT  E "C2'" 1 
ATOM   543  C  "C1'" . DT  C 1 8   ? 66.596  50.412 -90.707  1.00 45.94  ? 408  DT  E "C1'" 1 
ATOM   544  N  N1    . DT  C 1 8   ? 66.236  48.966 -90.724  1.00 40.58  ? 408  DT  E N1    1 
ATOM   545  C  C2    . DT  C 1 8   ? 66.529  48.208 -91.844  1.00 38.11  ? 408  DT  E C2    1 
ATOM   546  O  O2    . DT  C 1 8   ? 66.965  48.677 -92.885  1.00 36.72  ? 408  DT  E O2    1 
ATOM   547  N  N3    . DT  C 1 8   ? 66.274  46.866 -91.702  1.00 36.26  ? 408  DT  E N3    1 
ATOM   548  C  C4    . DT  C 1 8   ? 65.749  46.225 -90.599  1.00 35.46  ? 408  DT  E C4    1 
ATOM   549  O  O4    . DT  C 1 8   ? 65.626  45.012 -90.599  1.00 36.68  ? 408  DT  E O4    1 
ATOM   550  C  C5    . DT  C 1 8   ? 65.396  47.078 -89.498  1.00 35.60  ? 408  DT  E C5    1 
ATOM   551  C  C7    . DT  C 1 8   ? 64.761  46.465 -88.289  1.00 30.85  ? 408  DT  E C7    1 
ATOM   552  C  C6    . DT  C 1 8   ? 65.653  48.389 -89.610  1.00 37.30  ? 408  DT  E C6    1 
ATOM   553  P  P     . DC  C 1 9   ? 65.533  54.364 -90.579  1.00 59.29  ? 409  DC  E P     1 
ATOM   554  O  OP1   . DC  C 1 9   ? 65.976  55.778 -90.644  1.00 45.66  ? 409  DC  E OP1   1 
ATOM   555  O  OP2   . DC  C 1 9   ? 64.232  54.032 -89.944  1.00 46.57  ? 409  DC  E OP2   1 
ATOM   556  O  "O5'" . DC  C 1 9   ? 65.524  53.760 -92.053  1.00 59.79  ? 409  DC  E "O5'" 1 
ATOM   557  C  "C5'" . DC  C 1 9   ? 66.748  53.509 -92.741  1.00 63.10  ? 409  DC  E "C5'" 1 
ATOM   558  C  "C4'" . DC  C 1 9   ? 66.481  52.932 -94.112  1.00 64.86  ? 409  DC  E "C4'" 1 
ATOM   559  O  "O4'" . DC  C 1 9   ? 66.289  51.496 -94.067  1.00 63.34  ? 409  DC  E "O4'" 1 
ATOM   560  C  "C3'" . DC  C 1 9   ? 65.262  53.505 -94.843  1.00 67.00  ? 409  DC  E "C3'" 1 
ATOM   561  O  "O3'" . DC  C 1 9   ? 65.602  53.781 -96.205  1.00 70.15  ? 409  DC  E "O3'" 1 
ATOM   562  C  "C2'" . DC  C 1 9   ? 64.254  52.368 -94.791  1.00 65.38  ? 409  DC  E "C2'" 1 
ATOM   563  C  "C1'" . DC  C 1 9   ? 65.178  51.170 -94.895  1.00 64.96  ? 409  DC  E "C1'" 1 
ATOM   564  N  N1    . DC  C 1 9   ? 64.634  49.864 -94.465  1.00 51.75  ? 409  DC  E N1    1 
ATOM   565  C  C2    . DC  C 1 9   ? 64.791  48.765 -95.318  1.00 50.61  ? 409  DC  E C2    1 
ATOM   566  O  O2    . DC  C 1 9   ? 65.309  48.942 -96.430  1.00 50.18  ? 409  DC  E O2    1 
ATOM   567  N  N3    . DC  C 1 9   ? 64.364  47.546 -94.916  1.00 48.36  ? 409  DC  E N3    1 
ATOM   568  C  C4    . DC  C 1 9   ? 63.781  47.404 -93.728  1.00 48.89  ? 409  DC  E C4    1 
ATOM   569  N  N4    . DC  C 1 9   ? 63.404  46.181 -93.362  1.00 47.83  ? 409  DC  E N4    1 
ATOM   570  C  C5    . DC  C 1 9   ? 63.566  48.511 -92.855  1.00 49.78  ? 409  DC  E C5    1 
ATOM   571  C  C6    . DC  C 1 9   ? 64.007  49.714 -93.258  1.00 51.60  ? 409  DC  E C6    1 
ATOM   572  P  P     . DC  C 1 10  ? 64.572  54.590 -97.134  1.00 103.78 ? 410  DC  E P     1 
ATOM   573  O  OP1   . DC  C 1 10  ? 65.207  55.875 -97.516  1.00 69.41  ? 410  DC  E OP1   1 
ATOM   574  O  OP2   . DC  C 1 10  ? 63.273  54.602 -96.416  1.00 72.01  ? 410  DC  E OP2   1 
ATOM   575  O  "O5'" . DC  C 1 10  ? 64.422  53.669 -98.431  1.00 104.29 ? 410  DC  E "O5'" 1 
ATOM   576  C  "C5'" . DC  C 1 10  ? 65.567  53.069 -99.043  1.00 105.08 ? 410  DC  E "C5'" 1 
ATOM   577  C  "C4'" . DC  C 1 10  ? 65.185  51.793 -99.761  1.00 104.79 ? 410  DC  E "C4'" 1 
ATOM   578  O  "O4'" . DC  C 1 10  ? 64.651  50.842 -98.806  1.00 104.57 ? 410  DC  E "O4'" 1 
ATOM   579  C  "C3'" . DC  C 1 10  ? 64.117  51.932 -100.851 1.00 104.70 ? 410  DC  E "C3'" 1 
ATOM   580  O  "O3'" . DC  C 1 10  ? 64.421  51.054 -101.948 1.00 105.02 ? 410  DC  E "O3'" 1 
ATOM   581  C  "C2'" . DC  C 1 10  ? 62.849  51.486 -100.150 1.00 104.62 ? 410  DC  E "C2'" 1 
ATOM   582  C  "C1'" . DC  C 1 10  ? 63.370  50.396 -99.236  1.00 103.78 ? 410  DC  E "C1'" 1 
ATOM   583  N  N1    . DC  C 1 10  ? 62.534  50.172 -98.047  1.00 69.64  ? 410  DC  E N1    1 
ATOM   584  C  C2    . DC  C 1 10  ? 62.186  48.858 -97.701  1.00 68.44  ? 410  DC  E C2    1 
ATOM   585  O  O2    . DC  C 1 10  ? 62.592  47.923 -98.412  1.00 67.15  ? 410  DC  E O2    1 
ATOM   586  N  N3    . DC  C 1 10  ? 61.417  48.646 -96.605  1.00 67.72  ? 410  DC  E N3    1 
ATOM   587  C  C4    . DC  C 1 10  ? 61.002  49.685 -95.871  1.00 66.96  ? 410  DC  E C4    1 
ATOM   588  N  N4    . DC  C 1 10  ? 60.257  49.436 -94.792  1.00 67.47  ? 410  DC  E N4    1 
ATOM   589  C  C5    . DC  C 1 10  ? 61.336  51.028 -96.208  1.00 67.36  ? 410  DC  E C5    1 
ATOM   590  C  C6    . DC  C 1 10  ? 62.097  51.224 -97.291  1.00 68.63  ? 410  DC  E C6    1 
ATOM   591  P  P     . DT  C 1 11  ? 63.254  50.588 -102.960 1.00 130.73 ? 411  DT  E P     1 
ATOM   592  O  OP1   . DT  C 1 11  ? 63.857  50.381 -104.295 1.00 61.20  ? 411  DT  E OP1   1 
ATOM   593  O  OP2   . DT  C 1 11  ? 62.086  51.497 -102.823 1.00 61.68  ? 411  DT  E OP2   1 
ATOM   594  O  "O5'" . DT  C 1 11  ? 62.825  49.160 -102.404 1.00 128.42 ? 411  DT  E "O5'" 1 
ATOM   595  C  "C5'" . DT  C 1 11  ? 63.760  48.083 -102.370 1.00 125.88 ? 411  DT  E "C5'" 1 
ATOM   596  C  "C4'" . DT  C 1 11  ? 63.074  46.785 -102.728 1.00 123.13 ? 411  DT  E "C4'" 1 
ATOM   597  O  "O4'" . DT  C 1 11  ? 62.199  46.360 -101.659 1.00 121.17 ? 411  DT  E "O4'" 1 
ATOM   598  C  "C3'" . DT  C 1 11  ? 62.198  46.853 -103.974 1.00 122.35 ? 411  DT  E "C3'" 1 
ATOM   599  O  "O3'" . DT  C 1 11  ? 62.273  45.604 -104.662 1.00 123.28 ? 411  DT  E "O3'" 1 
ATOM   600  C  "C2'" . DT  C 1 11  ? 60.806  47.073 -103.407 1.00 117.92 ? 411  DT  E "C2'" 1 
ATOM   601  C  "C1'" . DT  C 1 11  ? 60.860  46.253 -102.132 1.00 115.32 ? 411  DT  E "C1'" 1 
ATOM   602  N  N1    . DT  C 1 11  ? 59.980  46.695 -101.037 1.00 40.87  ? 411  DT  E N1    1 
ATOM   603  C  C2    . DT  C 1 11  ? 59.398  45.721 -100.258 1.00 39.23  ? 411  DT  E C2    1 
ATOM   604  O  O2    . DT  C 1 11  ? 59.492  44.527 -100.503 1.00 40.35  ? 411  DT  E O2    1 
ATOM   605  N  N3    . DT  C 1 11  ? 58.703  46.194 -99.175  1.00 33.36  ? 411  DT  E N3    1 
ATOM   606  C  C4    . DT  C 1 11  ? 58.540  47.510 -98.810  1.00 33.42  ? 411  DT  E C4    1 
ATOM   607  O  O4    . DT  C 1 11  ? 57.969  47.787 -97.768  1.00 31.87  ? 411  DT  E O4    1 
ATOM   608  C  C5    . DT  C 1 11  ? 59.107  48.477 -99.706  1.00 35.26  ? 411  DT  E C5    1 
ATOM   609  C  C7    . DT  C 1 11  ? 58.917  49.930 -99.406  1.00 35.85  ? 411  DT  E C7    1 
ATOM   610  C  C6    . DT  C 1 11  ? 59.787  48.031 -100.770 1.00 37.49  ? 411  DT  E C6    1 
ATOM   611  P  P     . DG  C 1 12  ? 61.688  45.483 -106.147 1.00 92.50  ? 412  DG  E P     1 
ATOM   612  O  OP1   . DG  C 1 12  ? 62.704  44.831 -107.019 1.00 58.21  ? 412  DG  E OP1   1 
ATOM   613  O  OP2   . DG  C 1 12  ? 61.164  46.830 -106.503 1.00 59.08  ? 412  DG  E OP2   1 
ATOM   614  O  "O5'" . DG  C 1 12  ? 60.453  44.492 -105.981 1.00 88.64  ? 412  DG  E "O5'" 1 
ATOM   615  C  "C5'" . DG  C 1 12  ? 60.639  43.154 -105.526 1.00 83.77  ? 412  DG  E "C5'" 1 
ATOM   616  C  "C4'" . DG  C 1 12  ? 59.335  42.399 -105.612 1.00 80.86  ? 412  DG  E "C4'" 1 
ATOM   617  O  "O4'" . DG  C 1 12  ? 58.375  43.106 -104.793 1.00 79.65  ? 412  DG  E "O4'" 1 
ATOM   618  C  "C3'" . DG  C 1 12  ? 58.729  42.366 -107.015 1.00 78.74  ? 412  DG  E "C3'" 1 
ATOM   619  O  "O3'" . DG  C 1 12  ? 57.779  41.313 -107.191 1.00 78.71  ? 412  DG  E "O3'" 1 
ATOM   620  C  "C2'" . DG  C 1 12  ? 57.921  43.646 -107.053 1.00 78.73  ? 412  DG  E "C2'" 1 
ATOM   621  C  "C1'" . DG  C 1 12  ? 57.435  43.789 -105.612 1.00 77.06  ? 412  DG  E "C1'" 1 
ATOM   622  N  N9    . DG  C 1 12  ? 57.375  45.177 -105.160 1.00 41.13  ? 412  DG  E N9    1 
ATOM   623  C  C8    . DG  C 1 12  ? 57.726  46.292 -105.883 1.00 39.99  ? 412  DG  E C8    1 
ATOM   624  N  N7    . DG  C 1 12  ? 57.524  47.405 -105.238 1.00 39.02  ? 412  DG  E N7    1 
ATOM   625  C  C5    . DG  C 1 12  ? 57.025  47.002 -104.008 1.00 37.15  ? 412  DG  E C5    1 
ATOM   626  C  C6    . DG  C 1 12  ? 56.620  47.768 -102.896 1.00 36.91  ? 412  DG  E C6    1 
ATOM   627  O  O6    . DG  C 1 12  ? 56.626  49.005 -102.766 1.00 34.91  ? 412  DG  E O6    1 
ATOM   628  N  N1    . DG  C 1 12  ? 56.172  46.958 -101.855 1.00 36.02  ? 412  DG  E N1    1 
ATOM   629  C  C2    . DG  C 1 12  ? 56.133  45.587 -101.882 1.00 34.86  ? 412  DG  E C2    1 
ATOM   630  N  N2    . DG  C 1 12  ? 55.673  44.985 -100.772 1.00 32.26  ? 412  DG  E N2    1 
ATOM   631  N  N3    . DG  C 1 12  ? 56.515  44.861 -102.916 1.00 36.55  ? 412  DG  E N3    1 
ATOM   632  C  C4    . DG  C 1 12  ? 56.940  45.629 -103.939 1.00 38.10  ? 412  DG  E C4    1 
ATOM   633  O  "O5'" . DC  D 2 2   ? 53.071  46.603 -91.771  1.00 69.47  ? 422  DC  F "O5'" 1 
ATOM   634  C  "C5'" . DC  D 2 2   ? 53.875  45.467 -92.118  1.00 70.27  ? 422  DC  F "C5'" 1 
ATOM   635  C  "C4'" . DC  D 2 2   ? 53.125  44.467 -92.970  1.00 69.73  ? 422  DC  F "C4'" 1 
ATOM   636  O  "O4'" . DC  D 2 2   ? 52.817  45.069 -94.250  1.00 69.65  ? 422  DC  F "O4'" 1 
ATOM   637  C  "C3'" . DC  D 2 2   ? 53.896  43.181 -93.280  1.00 69.69  ? 422  DC  F "C3'" 1 
ATOM   638  O  "O3'" . DC  D 2 2   ? 53.008  42.059 -93.293  1.00 69.62  ? 422  DC  F "O3'" 1 
ATOM   639  C  "C2'" . DC  D 2 2   ? 54.434  43.425 -94.676  1.00 69.37  ? 422  DC  F "C2'" 1 
ATOM   640  C  "C1'" . DC  D 2 2   ? 53.335  44.264 -95.296  1.00 69.51  ? 422  DC  F "C1'" 1 
ATOM   641  N  N1    . DC  D 2 2   ? 53.793  45.153 -96.373  1.00 75.85  ? 422  DC  F N1    1 
ATOM   642  C  C2    . DC  D 2 2   ? 54.010  44.607 -97.638  1.00 76.36  ? 422  DC  F C2    1 
ATOM   643  O  O2    . DC  D 2 2   ? 53.808  43.392 -97.808  1.00 77.36  ? 422  DC  F O2    1 
ATOM   644  N  N3    . DC  D 2 2   ? 54.434  45.409 -98.643  1.00 75.84  ? 422  DC  F N3    1 
ATOM   645  C  C4    . DC  D 2 2   ? 54.642  46.708 -98.417  1.00 75.28  ? 422  DC  F C4    1 
ATOM   646  N  N4    . DC  D 2 2   ? 55.064  47.458 -99.437  1.00 74.34  ? 422  DC  F N4    1 
ATOM   647  C  C5    . DC  D 2 2   ? 54.426  47.293 -97.134  1.00 75.38  ? 422  DC  F C5    1 
ATOM   648  C  C6    . DC  D 2 2   ? 54.005  46.485 -96.150  1.00 75.89  ? 422  DC  F C6    1 
ATOM   649  P  P     . DA  D 2 3   ? 53.458  40.674 -92.608  1.00 85.93  ? 423  DA  F P     1 
ATOM   650  O  OP1   . DA  D 2 3   ? 52.228  39.861 -92.417  1.00 67.30  ? 423  DA  F OP1   1 
ATOM   651  O  OP2   . DA  D 2 3   ? 54.321  40.991 -91.436  1.00 67.62  ? 423  DA  F OP2   1 
ATOM   652  O  "O5'" . DA  D 2 3   ? 54.367  39.955 -93.703  1.00 84.28  ? 423  DA  F "O5'" 1 
ATOM   653  C  "C5'" . DA  D 2 3   ? 55.428  39.084 -93.302  1.00 83.39  ? 423  DA  F "C5'" 1 
ATOM   654  C  "C4'" . DA  D 2 3   ? 56.540  39.101 -94.326  1.00 82.74  ? 423  DA  F "C4'" 1 
ATOM   655  O  "O4'" . DA  D 2 3   ? 56.692  40.439 -94.845  1.00 81.93  ? 423  DA  F "O4'" 1 
ATOM   656  C  "C3'" . DA  D 2 3   ? 57.911  38.714 -93.768  1.00 81.87  ? 423  DA  F "C3'" 1 
ATOM   657  O  "O3'" . DA  D 2 3   ? 58.736  38.206 -94.821  1.00 82.69  ? 423  DA  F "O3'" 1 
ATOM   658  C  "C2'" . DA  D 2 3   ? 58.484  40.065 -93.385  1.00 80.00  ? 423  DA  F "C2'" 1 
ATOM   659  C  "C1'" . DA  D 2 3   ? 58.001  40.895 -94.562  1.00 80.49  ? 423  DA  F "C1'" 1 
ATOM   660  N  N9    . DA  D 2 3   ? 57.939  42.343 -94.377  1.00 60.77  ? 423  DA  F N9    1 
ATOM   661  C  C8    . DA  D 2 3   ? 58.116  43.094 -93.241  1.00 60.31  ? 423  DA  F C8    1 
ATOM   662  N  N7    . DA  D 2 3   ? 58.034  44.388 -93.449  1.00 60.55  ? 423  DA  F N7    1 
ATOM   663  C  C5    . DA  D 2 3   ? 57.776  44.493 -94.812  1.00 58.54  ? 423  DA  F C5    1 
ATOM   664  C  C6    . DA  D 2 3   ? 57.604  45.599 -95.667  1.00 57.12  ? 423  DA  F C6    1 
ATOM   665  N  N6    . DA  D 2 3   ? 57.672  46.870 -95.269  1.00 56.69  ? 423  DA  F N6    1 
ATOM   666  N  N1    . DA  D 2 3   ? 57.365  45.348 -96.972  1.00 57.20  ? 423  DA  F N1    1 
ATOM   667  C  C2    . DA  D 2 3   ? 57.309  44.075 -97.383  1.00 57.32  ? 423  DA  F C2    1 
ATOM   668  N  N3    . DA  D 2 3   ? 57.460  42.957 -96.681  1.00 56.59  ? 423  DA  F N3    1 
ATOM   669  C  C4    . DA  D 2 3   ? 57.698  43.239 -95.389  1.00 58.78  ? 423  DA  F C4    1 
ATOM   670  P  P     . DG  D 2 4   ? 58.411  36.788 -95.502  1.00 117.86 ? 424  DG  F P     1 
ATOM   671  O  OP1   . DG  D 2 4   ? 57.090  36.910 -96.167  1.00 68.95  ? 424  DG  F OP1   1 
ATOM   672  O  OP2   . DG  D 2 4   ? 58.652  35.682 -94.533  1.00 70.16  ? 424  DG  F OP2   1 
ATOM   673  O  "O5'" . DG  D 2 4   ? 59.509  36.696 -96.651  1.00 116.47 ? 424  DG  F "O5'" 1 
ATOM   674  C  "C5'" . DG  D 2 4   ? 59.180  36.997 -98.006  1.00 114.79 ? 424  DG  F "C5'" 1 
ATOM   675  C  "C4'" . DG  D 2 4   ? 60.366  37.610 -98.716  1.00 112.41 ? 424  DG  F "C4'" 1 
ATOM   676  O  "O4'" . DG  D 2 4   ? 60.423  39.045 -98.516  1.00 111.21 ? 424  DG  F "O4'" 1 
ATOM   677  C  "C3'" . DG  D 2 4   ? 61.728  37.063 -98.294  1.00 111.45 ? 424  DG  F "C3'" 1 
ATOM   678  O  "O3'" . DG  D 2 4   ? 62.528  36.825 -99.453  1.00 110.38 ? 424  DG  F "O3'" 1 
ATOM   679  C  "C2'" . DG  D 2 4   ? 62.311  38.181 -97.442  1.00 110.17 ? 424  DG  F "C2'" 1 
ATOM   680  C  "C1'" . DG  D 2 4   ? 61.726  39.426 -98.089  1.00 108.67 ? 424  DG  F "C1'" 1 
ATOM   681  N  N9    . DG  D 2 4   ? 61.586  40.580 -97.201  1.00 58.03  ? 424  DG  F N9    1 
ATOM   682  C  C8    . DG  D 2 4   ? 61.353  40.556 -95.846  1.00 56.65  ? 424  DG  F C8    1 
ATOM   683  N  N7    . DG  D 2 4   ? 61.225  41.746 -95.324  1.00 54.36  ? 424  DG  F N7    1 
ATOM   684  C  C5    . DG  D 2 4   ? 61.390  42.616 -96.395  1.00 53.40  ? 424  DG  F C5    1 
ATOM   685  C  C6    . DG  D 2 4   ? 61.349  44.044 -96.442  1.00 50.56  ? 424  DG  F C6    1 
ATOM   686  O  O6    . DG  D 2 4   ? 61.116  44.842 -95.521  1.00 49.68  ? 424  DG  F O6    1 
ATOM   687  N  N1    . DG  D 2 4   ? 61.605  44.521 -97.724  1.00 48.93  ? 424  DG  F N1    1 
ATOM   688  C  C2    . DG  D 2 4   ? 61.853  43.730 -98.826  1.00 51.61  ? 424  DG  F C2    1 
ATOM   689  N  N2    . DG  D 2 4   ? 62.101  44.376 -99.980  1.00 50.94  ? 424  DG  F N2    1 
ATOM   690  N  N3    . DG  D 2 4   ? 61.867  42.400 -98.800  1.00 52.95  ? 424  DG  F N3    1 
ATOM   691  C  C4    . DG  D 2 4   ? 61.633  41.915 -97.560  1.00 55.29  ? 424  DG  F C4    1 
ATOM   692  P  P     . DG  D 2 5   ? 64.121  36.711 -99.311  1.00 88.90  ? 425  DG  F P     1 
ATOM   693  O  OP1   . DG  D 2 5   ? 64.612  35.926 -100.471 1.00 62.58  ? 425  DG  F OP1   1 
ATOM   694  O  OP2   . DG  D 2 5   ? 64.449  36.274 -97.932  1.00 62.12  ? 425  DG  F OP2   1 
ATOM   695  O  "O5'" . DG  D 2 5   ? 64.597  38.216 -99.496  1.00 85.27  ? 425  DG  F "O5'" 1 
ATOM   696  C  "C5'" . DG  D 2 5   ? 64.210  38.944 -100.655 1.00 80.23  ? 425  DG  F "C5'" 1 
ATOM   697  C  "C4'" . DG  D 2 5   ? 65.172  40.080 -100.901 1.00 74.80  ? 425  DG  F "C4'" 1 
ATOM   698  O  "O4'" . DG  D 2 5   ? 64.830  41.199 -100.050 1.00 72.77  ? 425  DG  F "O4'" 1 
ATOM   699  C  "C3'" . DG  D 2 5   ? 66.633  39.736 -100.616 1.00 71.87  ? 425  DG  F "C3'" 1 
ATOM   700  O  "O3'" . DG  D 2 5   ? 67.470  40.254 -101.665 1.00 68.89  ? 425  DG  F "O3'" 1 
ATOM   701  C  "C2'" . DG  D 2 5   ? 66.884  40.382 -99.260  1.00 70.75  ? 425  DG  F "C2'" 1 
ATOM   702  C  "C1'" . DG  D 2 5   ? 65.925  41.572 -99.233  1.00 69.25  ? 425  DG  F "C1'" 1 
ATOM   703  N  N9    . DG  D 2 5   ? 65.390  41.907 -97.912  1.00 41.91  ? 425  DG  F N9    1 
ATOM   704  C  C8    . DG  D 2 5   ? 64.976  41.015 -96.954  1.00 40.68  ? 425  DG  F C8    1 
ATOM   705  N  N7    . DG  D 2 5   ? 64.524  41.594 -95.872  1.00 38.75  ? 425  DG  F N7    1 
ATOM   706  C  C5    . DG  D 2 5   ? 64.657  42.950 -96.123  1.00 36.42  ? 425  DG  F C5    1 
ATOM   707  C  C6    . DG  D 2 5   ? 64.333  44.068 -95.306  1.00 37.48  ? 425  DG  F C6    1 
ATOM   708  O  O6    . DG  D 2 5   ? 63.845  44.079 -94.164  1.00 36.05  ? 425  DG  F O6    1 
ATOM   709  N  N1    . DG  D 2 5   ? 64.623  45.269 -95.945  1.00 35.59  ? 425  DG  F N1    1 
ATOM   710  C  C2    . DG  D 2 5   ? 65.145  45.383 -97.205  1.00 36.15  ? 425  DG  F C2    1 
ATOM   711  N  N2    . DG  D 2 5   ? 65.330  46.636 -97.648  1.00 36.31  ? 425  DG  F N2    1 
ATOM   712  N  N3    . DG  D 2 5   ? 65.455  44.345 -97.978  1.00 38.72  ? 425  DG  F N3    1 
ATOM   713  C  C4    . DG  D 2 5   ? 65.186  43.168 -97.376  1.00 38.30  ? 425  DG  F C4    1 
ATOM   714  P  P     . DA  D 2 6   ? 68.965  39.677 -101.874 1.00 59.32  ? 426  DA  F P     1 
ATOM   715  O  OP1   . DA  D 2 6   ? 69.286  39.664 -103.318 1.00 45.50  ? 426  DA  F OP1   1 
ATOM   716  O  OP2   . DA  D 2 6   ? 69.131  38.431 -101.086 1.00 45.39  ? 426  DA  F OP2   1 
ATOM   717  O  "O5'" . DA  D 2 6   ? 69.858  40.848 -101.277 1.00 57.24  ? 426  DA  F "O5'" 1 
ATOM   718  C  "C5'" . DA  D 2 6   ? 69.762  42.162 -101.829 1.00 56.35  ? 426  DA  F "C5'" 1 
ATOM   719  C  "C4'" . DA  D 2 6   ? 70.421  43.168 -100.918 1.00 54.47  ? 426  DA  F "C4'" 1 
ATOM   720  O  "O4'" . DA  D 2 6   ? 69.556  43.508 -99.802  1.00 55.09  ? 426  DA  F "O4'" 1 
ATOM   721  C  "C3'" . DA  D 2 6   ? 71.721  42.645 -100.308 1.00 57.48  ? 426  DA  F "C3'" 1 
ATOM   722  O  "O3'" . DA  D 2 6   ? 72.764  43.612 -100.394 1.00 60.22  ? 426  DA  F "O3'" 1 
ATOM   723  C  "C2'" . DA  D 2 6   ? 71.365  42.393 -98.853  1.00 56.72  ? 426  DA  F "C2'" 1 
ATOM   724  C  "C1'" . DA  D 2 6   ? 70.325  43.468 -98.611  1.00 53.95  ? 426  DA  F "C1'" 1 
ATOM   725  N  N9    . DA  D 2 6   ? 69.443  43.227 -97.463  1.00 38.01  ? 426  DA  F N9    1 
ATOM   726  C  C8    . DA  D 2 6   ? 69.046  42.027 -96.926  1.00 35.87  ? 426  DA  F C8    1 
ATOM   727  N  N7    . DA  D 2 6   ? 68.321  42.150 -95.839  1.00 36.40  ? 426  DA  F N7    1 
ATOM   728  C  C5    . DA  D 2 6   ? 68.221  43.526 -95.656  1.00 34.59  ? 426  DA  F C5    1 
ATOM   729  C  C6    . DA  D 2 6   ? 67.595  44.316 -94.662  1.00 34.66  ? 426  DA  F C6    1 
ATOM   730  N  N6    . DA  D 2 6   ? 66.926  43.816 -93.619  1.00 32.71  ? 426  DA  F N6    1 
ATOM   731  N  N1    . DA  D 2 6   ? 67.692  45.658 -94.777  1.00 32.12  ? 426  DA  F N1    1 
ATOM   732  C  C2    . DA  D 2 6   ? 68.366  46.162 -95.810  1.00 32.45  ? 426  DA  F C2    1 
ATOM   733  N  N3    . DA  D 2 6   ? 68.998  45.530 -96.797  1.00 33.77  ? 426  DA  F N3    1 
ATOM   734  C  C4    . DA  D 2 6   ? 68.888  44.199 -96.659  1.00 35.07  ? 426  DA  F C4    1 
HETATM 735  P  P     . PED D 2 7   ? 74.276  43.140 -100.176 1.00 61.68  ? 427  PED F P     1 
HETATM 736  O  O1P   . PED D 2 7   ? 74.558  42.094 -101.191 1.00 59.89  ? 427  PED F O1P   1 
HETATM 737  O  O2P   . PED D 2 7   ? 74.423  42.826 -98.740  1.00 59.44  ? 427  PED F O2P   1 
HETATM 738  O  "O5'" . PED D 2 7   ? 75.158  44.425 -100.504 1.00 62.65  ? 427  PED F "O5'" 1 
HETATM 739  C  "C2'" . PED D 2 7   ? 76.394  47.151 -98.659  1.00 56.62  ? 427  PED F "C2'" 1 
HETATM 740  C  "C5'" . PED D 2 7   ? 76.557  44.289 -100.750 1.00 62.28  ? 427  PED F "C5'" 1 
HETATM 741  C  "C4'" . PED D 2 7   ? 77.318  45.445 -100.146 1.00 60.66  ? 427  PED F "C4'" 1 
HETATM 742  O  "O4'" . PED D 2 7   ? 76.985  46.624 -100.920 1.00 64.31  ? 427  PED F "O4'" 1 
HETATM 743  C  "C3'" . PED D 2 7   ? 76.999  45.748 -98.667  1.00 59.30  ? 427  PED F "C3'" 1 
HETATM 744  C  "C1'" . PED D 2 7   ? 77.542  48.084 -99.078  1.00 58.82  ? 427  PED F "C1'" 1 
HETATM 745  O  "O3'" . PED D 2 7   ? 78.212  45.782 -97.901  1.00 58.08  ? 427  PED F "O3'" 1 
ATOM   746  P  P     . DG  D 2 8   ? 78.632  44.515 -96.998  1.00 41.93  ? 428  DG  F P     1 
ATOM   747  O  OP1   . DG  D 2 8   ? 80.030  44.709 -96.557  1.00 46.20  ? 428  DG  F OP1   1 
ATOM   748  O  OP2   . DG  D 2 8   ? 78.267  43.299 -97.762  1.00 45.30  ? 428  DG  F OP2   1 
ATOM   749  O  "O5'" . DG  D 2 8   ? 77.711  44.617 -95.703  1.00 42.40  ? 428  DG  F "O5'" 1 
ATOM   750  C  "C5'" . DG  D 2 8   ? 77.669  45.823 -94.948  1.00 41.75  ? 428  DG  F "C5'" 1 
ATOM   751  C  "C4'" . DG  D 2 8   ? 77.897  45.545 -93.479  1.00 43.10  ? 428  DG  F "C4'" 1 
ATOM   752  O  "O4'" . DG  D 2 8   ? 76.705  45.034 -92.830  1.00 45.49  ? 428  DG  F "O4'" 1 
ATOM   753  C  "C3'" . DG  D 2 8   ? 79.023  44.567 -93.145  1.00 43.00  ? 428  DG  F "C3'" 1 
ATOM   754  O  "O3'" . DG  D 2 8   ? 79.726  45.064 -91.991  1.00 42.86  ? 428  DG  F "O3'" 1 
ATOM   755  C  "C2'" . DG  D 2 8   ? 78.273  43.282 -92.828  1.00 43.54  ? 428  DG  F "C2'" 1 
ATOM   756  C  "C1'" . DG  D 2 8   ? 77.022  43.825 -92.146  1.00 46.84  ? 428  DG  F "C1'" 1 
ATOM   757  N  N9    . DG  D 2 8   ? 75.844  42.962 -92.194  1.00 49.53  ? 428  DG  F N9    1 
ATOM   758  C  C8    . DG  D 2 8   ? 75.261  42.419 -93.313  1.00 50.17  ? 428  DG  F C8    1 
ATOM   759  N  N7    . DG  D 2 8   ? 74.192  41.720 -93.045  1.00 51.22  ? 428  DG  F N7    1 
ATOM   760  C  C5    . DG  D 2 8   ? 74.062  41.804 -91.664  1.00 51.87  ? 428  DG  F C5    1 
ATOM   761  C  C6    . DG  D 2 8   ? 73.071  41.259 -90.793  1.00 52.45  ? 428  DG  F C6    1 
ATOM   762  O  O6    . DG  D 2 8   ? 72.076  40.586 -91.084  1.00 54.65  ? 428  DG  F O6    1 
ATOM   763  N  N1    . DG  D 2 8   ? 73.327  41.580 -89.462  1.00 51.99  ? 428  DG  F N1    1 
ATOM   764  C  C2    . DG  D 2 8   ? 74.391  42.334 -89.024  1.00 52.80  ? 428  DG  F C2    1 
ATOM   765  N  N2    . DG  D 2 8   ? 74.474  42.534 -87.702  1.00 49.77  ? 428  DG  F N2    1 
ATOM   766  N  N3    . DG  D 2 8   ? 75.311  42.855 -89.826  1.00 52.84  ? 428  DG  F N3    1 
ATOM   767  C  C4    . DG  D 2 8   ? 75.084  42.553 -91.123  1.00 50.27  ? 428  DG  F C4    1 
ATOM   768  P  P     . DA  D 2 9   ? 81.092  44.365 -91.518  1.00 34.07  ? 429  DA  F P     1 
ATOM   769  O  OP1   . DA  D 2 9   ? 82.042  45.464 -91.226  1.00 55.27  ? 429  DA  F OP1   1 
ATOM   770  O  OP2   . DA  D 2 9   ? 81.460  43.306 -92.493  1.00 56.38  ? 429  DA  F OP2   1 
ATOM   771  O  "O5'" . DA  D 2 9   ? 80.699  43.634 -90.160  1.00 36.14  ? 429  DA  F "O5'" 1 
ATOM   772  C  "C5'" . DA  D 2 9   ? 80.232  44.386 -89.039  1.00 37.96  ? 429  DA  F "C5'" 1 
ATOM   773  C  "C4'" . DA  D 2 9   ? 79.796  43.474 -87.911  1.00 38.79  ? 429  DA  F "C4'" 1 
ATOM   774  O  "O4'" . DA  D 2 9   ? 78.559  42.793 -88.217  1.00 39.66  ? 429  DA  F "O4'" 1 
ATOM   775  C  "C3'" . DA  D 2 9   ? 80.765  42.389 -87.438  1.00 40.68  ? 429  DA  F "C3'" 1 
ATOM   776  O  "O3'" . DA  D 2 9   ? 80.704  42.355 -86.010  1.00 42.77  ? 429  DA  F "O3'" 1 
ATOM   777  C  "C2'" . DA  D 2 9   ? 80.155  41.113 -87.992  1.00 39.98  ? 429  DA  F "C2'" 1 
ATOM   778  C  "C1'" . DA  D 2 9   ? 78.681  41.429 -87.855  1.00 42.61  ? 429  DA  F "C1'" 1 
ATOM   779  N  N9    . DA  D 2 9   ? 77.756  40.657 -88.690  1.00 67.98  ? 429  DA  F N9    1 
ATOM   780  C  C8    . DA  D 2 9   ? 77.852  40.340 -90.022  1.00 68.68  ? 429  DA  F C8    1 
ATOM   781  N  N7    . DA  D 2 9   ? 76.826  39.660 -90.478  1.00 68.42  ? 429  DA  F N7    1 
ATOM   782  C  C5    . DA  D 2 9   ? 76.005  39.512 -89.370  1.00 70.13  ? 429  DA  F C5    1 
ATOM   783  C  C6    . DA  D 2 9   ? 74.759  38.889 -89.191  1.00 71.04  ? 429  DA  F C6    1 
ATOM   784  N  N6    . DA  D 2 9   ? 74.098  38.262 -90.160  1.00 73.00  ? 429  DA  F N6    1 
ATOM   785  N  N1    . DA  D 2 9   ? 74.206  38.932 -87.962  1.00 71.57  ? 429  DA  F N1    1 
ATOM   786  C  C2    . DA  D 2 9   ? 74.868  39.554 -86.985  1.00 71.18  ? 429  DA  F C2    1 
ATOM   787  N  N3    . DA  D 2 9   ? 76.042  40.168 -87.024  1.00 71.21  ? 429  DA  F N3    1 
ATOM   788  C  C4    . DA  D 2 9   ? 76.566  40.114 -88.262  1.00 70.10  ? 429  DA  F C4    1 
ATOM   789  P  P     . DA  D 2 10  ? 81.871  41.650 -85.165  1.00 43.04  ? 430  DA  F P     1 
ATOM   790  O  OP1   . DA  D 2 10  ? 82.667  42.741 -84.556  1.00 46.62  ? 430  DA  F OP1   1 
ATOM   791  O  OP2   . DA  D 2 10  ? 82.556  40.633 -85.999  1.00 49.27  ? 430  DA  F OP2   1 
ATOM   792  O  "O5'" . DA  D 2 10  ? 81.051  40.881 -84.038  1.00 44.10  ? 430  DA  F "O5'" 1 
ATOM   793  C  "C5'" . DA  D 2 10  ? 80.065  41.560 -83.262  1.00 45.85  ? 430  DA  F "C5'" 1 
ATOM   794  C  "C4'" . DA  D 2 10  ? 79.147  40.572 -82.579  1.00 47.64  ? 430  DA  F "C4'" 1 
ATOM   795  O  "O4'" . DA  D 2 10  ? 78.234  39.980 -83.527  1.00 48.80  ? 430  DA  F "O4'" 1 
ATOM   796  C  "C3'" . DA  D 2 10  ? 79.834  39.400 -81.878  1.00 49.13  ? 430  DA  F "C3'" 1 
ATOM   797  O  "O3'" . DA  D 2 10  ? 79.131  39.100 -80.674  1.00 49.86  ? 430  DA  F "O3'" 1 
ATOM   798  C  "C2'" . DA  D 2 10  ? 79.663  38.256 -82.859  1.00 47.85  ? 430  DA  F "C2'" 1 
ATOM   799  C  "C1'" . DA  D 2 10  ? 78.294  38.563 -83.419  1.00 48.72  ? 430  DA  F "C1'" 1 
ATOM   800  N  N9    . DA  D 2 10  ? 78.024  38.006 -84.743  1.00 54.20  ? 430  DA  F N9    1 
ATOM   801  C  C8    . DA  D 2 10  ? 78.844  37.968 -85.843  1.00 53.68  ? 430  DA  F C8    1 
ATOM   802  N  N7    . DA  D 2 10  ? 78.288  37.427 -86.898  1.00 54.62  ? 430  DA  F N7    1 
ATOM   803  C  C5    . DA  D 2 10  ? 77.016  37.080 -86.463  1.00 53.89  ? 430  DA  F C5    1 
ATOM   804  C  C6    . DA  D 2 10  ? 75.927  36.479 -87.111  1.00 53.85  ? 430  DA  F C6    1 
ATOM   805  N  N6    . DA  D 2 10  ? 75.944  36.102 -88.389  1.00 52.97  ? 430  DA  F N6    1 
ATOM   806  N  N1    . DA  D 2 10  ? 74.802  36.277 -86.391  1.00 53.83  ? 430  DA  F N1    1 
ATOM   807  C  C2    . DA  D 2 10  ? 74.785  36.655 -85.102  1.00 53.15  ? 430  DA  F C2    1 
ATOM   808  N  N3    . DA  D 2 10  ? 75.743  37.227 -84.383  1.00 52.19  ? 430  DA  F N3    1 
ATOM   809  C  C4    . DA  D 2 10  ? 76.845  37.419 -85.133  1.00 53.81  ? 430  DA  F C4    1 
ATOM   810  P  P     . DG  D 2 11  ? 79.755  38.057 -79.635  1.00 65.89  ? 431  DG  F P     1 
ATOM   811  O  OP1   . DG  D 2 11  ? 80.404  38.858 -78.568  1.00 64.63  ? 431  DG  F OP1   1 
ATOM   812  O  OP2   . DG  D 2 11  ? 80.551  37.058 -80.394  1.00 62.65  ? 431  DG  F OP2   1 
ATOM   813  O  "O5'" . DG  D 2 11  ? 78.488  37.299 -79.036  1.00 64.98  ? 431  DG  F "O5'" 1 
ATOM   814  C  "C5'" . DG  D 2 11  ? 77.228  37.956 -78.872  1.00 65.35  ? 431  DG  F "C5'" 1 
ATOM   815  C  "C4'" . DG  D 2 11  ? 76.108  36.938 -78.898  1.00 66.78  ? 431  DG  F "C4'" 1 
ATOM   816  O  "O4'" . DG  D 2 11  ? 75.804  36.547 -80.260  1.00 64.56  ? 431  DG  F "O4'" 1 
ATOM   817  C  "C3'" . DG  D 2 11  ? 76.437  35.641 -78.154  1.00 67.44  ? 431  DG  F "C3'" 1 
ATOM   818  O  "O3'" . DG  D 2 11  ? 75.275  35.105 -77.519  1.00 68.71  ? 431  DG  F "O3'" 1 
ATOM   819  C  "C2'" . DG  D 2 11  ? 76.872  34.717 -79.274  1.00 66.55  ? 431  DG  F "C2'" 1 
ATOM   820  C  "C1'" . DG  D 2 11  ? 75.939  35.138 -80.391  1.00 65.12  ? 431  DG  F "C1'" 1 
ATOM   821  N  N9    . DG  D 2 11  ? 76.421  34.858 -81.738  1.00 63.65  ? 431  DG  F N9    1 
ATOM   822  C  C8    . DG  D 2 11  ? 77.500  35.435 -82.365  1.00 63.80  ? 431  DG  F C8    1 
ATOM   823  N  N7    . DG  D 2 11  ? 77.660  35.025 -83.594  1.00 63.35  ? 431  DG  F N7    1 
ATOM   824  C  C5    . DG  D 2 11  ? 76.634  34.110 -83.788  1.00 62.38  ? 431  DG  F C5    1 
ATOM   825  C  C6    . DG  D 2 11  ? 76.301  33.341 -84.924  1.00 59.95  ? 431  DG  F C6    1 
ATOM   826  O  O6    . DG  D 2 11  ? 76.850  33.323 -86.025  1.00 61.04  ? 431  DG  F O6    1 
ATOM   827  N  N1    . DG  D 2 11  ? 75.201  32.531 -84.688  1.00 60.72  ? 431  DG  F N1    1 
ATOM   828  C  C2    . DG  D 2 11  ? 74.503  32.465 -83.509  1.00 61.26  ? 431  DG  F C2    1 
ATOM   829  N  N2    . DG  D 2 11  ? 73.466  31.607 -83.487  1.00 59.91  ? 431  DG  F N2    1 
ATOM   830  N  N3    . DG  D 2 11  ? 74.798  33.185 -82.436  1.00 61.34  ? 431  DG  F N3    1 
ATOM   831  C  C4    . DG  D 2 11  ? 75.868  33.982 -82.647  1.00 63.02  ? 431  DG  F C4    1 
ATOM   832  P  P     . DC  D 2 12  ? 75.400  34.440 -76.060  1.00 78.14  ? 432  DC  F P     1 
ATOM   833  O  OP1   . DC  D 2 12  ? 75.302  35.527 -75.047  1.00 62.23  ? 432  DC  F OP1   1 
ATOM   834  O  OP2   . DC  D 2 12  ? 76.585  33.544 -76.069  1.00 62.47  ? 432  DC  F OP2   1 
ATOM   835  O  "O5'" . DC  D 2 12  ? 74.100  33.534 -75.935  1.00 76.91  ? 432  DC  F "O5'" 1 
ATOM   836  C  "C5'" . DC  D 2 12  ? 74.203  32.121 -75.811  1.00 80.39  ? 432  DC  F "C5'" 1 
ATOM   837  C  "C4'" . DC  D 2 12  ? 73.284  31.448 -76.803  1.00 81.55  ? 432  DC  F "C4'" 1 
ATOM   838  O  "O4'" . DC  D 2 12  ? 73.726  31.771 -78.147  1.00 80.25  ? 432  DC  F "O4'" 1 
ATOM   839  C  "C3'" . DC  D 2 12  ? 73.282  29.923 -76.727  1.00 81.64  ? 432  DC  F "C3'" 1 
ATOM   840  O  "O3'" . DC  D 2 12  ? 72.020  29.443 -77.198  1.00 83.52  ? 432  DC  F "O3'" 1 
ATOM   841  C  "C2'" . DC  D 2 12  ? 74.312  29.536 -77.772  1.00 81.49  ? 432  DC  F "C2'" 1 
ATOM   842  C  "C1'" . DC  D 2 12  ? 74.050  30.577 -78.842  1.00 80.14  ? 432  DC  F "C1'" 1 
ATOM   843  N  N1    . DC  D 2 12  ? 75.190  30.851 -79.734  1.00 64.88  ? 432  DC  F N1    1 
ATOM   844  C  C2    . DC  D 2 12  ? 75.193  30.277 -81.015  1.00 63.55  ? 432  DC  F C2    1 
ATOM   845  O  O2    . DC  D 2 12  ? 74.240  29.555 -81.350  1.00 62.46  ? 432  DC  F O2    1 
ATOM   846  N  N3    . DC  D 2 12  ? 76.231  30.520 -81.850  1.00 62.36  ? 432  DC  F N3    1 
ATOM   847  C  C4    . DC  D 2 12  ? 77.243  31.292 -81.447  1.00 62.84  ? 432  DC  F C4    1 
ATOM   848  N  N4    . DC  D 2 12  ? 78.251  31.498 -82.301  1.00 61.77  ? 432  DC  F N4    1 
ATOM   849  C  C5    . DC  D 2 12  ? 77.269  31.888 -80.149  1.00 63.05  ? 432  DC  F C5    1 
ATOM   850  C  C6    . DC  D 2 12  ? 76.229  31.645 -79.333  1.00 64.08  ? 432  DC  F C6    1 
ATOM   851  N  N     . PRO E 3 1   ? 30.012  49.328 -108.483 1.00 32.84  ? 1    PRO A N     1 
ATOM   852  C  CA    . PRO E 3 1   ? 28.777  50.055 -108.100 1.00 29.16  ? 1    PRO A CA    1 
ATOM   853  C  C     . PRO E 3 1   ? 27.537  49.499 -108.797 1.00 28.42  ? 1    PRO A C     1 
ATOM   854  O  O     . PRO E 3 1   ? 27.627  48.936 -109.878 1.00 27.06  ? 1    PRO A O     1 
ATOM   855  C  CB    . PRO E 3 1   ? 29.013  51.519 -108.445 1.00 24.07  ? 1    PRO A CB    1 
ATOM   856  C  CG    . PRO E 3 1   ? 30.042  51.425 -109.523 1.00 22.70  ? 1    PRO A CG    1 
ATOM   857  C  CD    . PRO E 3 1   ? 30.967  50.290 -109.060 1.00 26.39  ? 1    PRO A CD    1 
ATOM   858  N  N     . GLN E 3 2   ? 26.374  49.668 -108.171 1.00 34.59  ? 2    GLN A N     1 
ATOM   859  C  CA    . GLN E 3 2   ? 25.124  49.150 -108.723 1.00 35.31  ? 2    GLN A CA    1 
ATOM   860  C  C     . GLN E 3 2   ? 24.006  50.179 -108.704 1.00 33.69  ? 2    GLN A C     1 
ATOM   861  O  O     . GLN E 3 2   ? 24.244  51.340 -108.397 1.00 35.12  ? 2    GLN A O     1 
ATOM   862  C  CB    . GLN E 3 2   ? 24.686  47.923 -107.928 1.00 54.33  ? 2    GLN A CB    1 
ATOM   863  C  CG    . GLN E 3 2   ? 25.832  47.014 -107.539 1.00 58.47  ? 2    GLN A CG    1 
ATOM   864  C  CD    . GLN E 3 2   ? 25.633  46.420 -106.164 1.00 59.98  ? 2    GLN A CD    1 
ATOM   865  O  OE1   . GLN E 3 2   ? 26.451  45.637 -105.683 1.00 62.89  ? 2    GLN A OE1   1 
ATOM   866  N  NE2   . GLN E 3 2   ? 24.538  46.796 -105.520 1.00 58.72  ? 2    GLN A NE2   1 
ATOM   867  N  N     . GLY E 3 3   ? 22.789  49.726 -109.023 1.00 24.48  ? 3    GLY A N     1 
ATOM   868  C  CA    . GLY E 3 3   ? 21.619  50.586 -109.069 1.00 26.55  ? 3    GLY A CA    1 
ATOM   869  C  C     . GLY E 3 3   ? 21.548  51.699 -108.037 1.00 27.55  ? 3    GLY A C     1 
ATOM   870  O  O     . GLY E 3 3   ? 21.377  52.863 -108.382 1.00 27.19  ? 3    GLY A O     1 
ATOM   871  N  N     . PRO E 3 4   ? 21.657  51.364 -106.748 1.00 32.35  ? 4    PRO A N     1 
ATOM   872  C  CA    . PRO E 3 4   ? 21.604  52.363 -105.681 1.00 32.29  ? 4    PRO A CA    1 
ATOM   873  C  C     . PRO E 3 4   ? 22.561  53.506 -105.974 1.00 32.51  ? 4    PRO A C     1 
ATOM   874  O  O     . PRO E 3 4   ? 22.167  54.674 -106.040 1.00 31.47  ? 4    PRO A O     1 
ATOM   875  C  CB    . PRO E 3 4   ? 22.022  51.572 -104.469 1.00 22.04  ? 4    PRO A CB    1 
ATOM   876  C  CG    . PRO E 3 4   ? 21.430  50.220 -104.759 1.00 21.78  ? 4    PRO A CG    1 
ATOM   877  C  CD    . PRO E 3 4   ? 21.773  50.006 -106.199 1.00 21.06  ? 4    PRO A CD    1 
ATOM   878  N  N     . GLU E 3 5   ? 23.827  53.153 -106.147 1.00 27.58  ? 5    GLU A N     1 
ATOM   879  C  CA    . GLU E 3 5   ? 24.846  54.136 -106.446 1.00 27.78  ? 5    GLU A CA    1 
ATOM   880  C  C     . GLU E 3 5   ? 24.625  54.771 -107.828 1.00 29.60  ? 5    GLU A C     1 
ATOM   881  O  O     . GLU E 3 5   ? 25.074  55.887 -108.075 1.00 29.49  ? 5    GLU A O     1 
ATOM   882  C  CB    . GLU E 3 5   ? 26.233  53.497 -106.394 1.00 35.06  ? 5    GLU A CB    1 
ATOM   883  C  CG    . GLU E 3 5   ? 26.732  53.109 -105.008 1.00 36.37  ? 5    GLU A CG    1 
ATOM   884  C  CD    . GLU E 3 5   ? 26.110  51.826 -104.471 1.00 38.34  ? 5    GLU A CD    1 
ATOM   885  O  OE1   . GLU E 3 5   ? 26.062  50.818 -105.216 1.00 38.79  ? 5    GLU A OE1   1 
ATOM   886  O  OE2   . GLU E 3 5   ? 25.682  51.828 -103.296 1.00 40.88  ? 5    GLU A OE2   1 
ATOM   887  N  N     . ILE E 3 6   ? 23.933  54.080 -108.729 1.00 38.35  ? 6    ILE A N     1 
ATOM   888  C  CA    . ILE E 3 6   ? 23.710  54.644 -110.059 1.00 38.21  ? 6    ILE A CA    1 
ATOM   889  C  C     . ILE E 3 6   ? 22.571  55.665 -110.089 1.00 38.32  ? 6    ILE A C     1 
ATOM   890  O  O     . ILE E 3 6   ? 22.607  56.608 -110.880 1.00 37.72  ? 6    ILE A O     1 
ATOM   891  C  CB    . ILE E 3 6   ? 23.443  53.536 -111.116 1.00 29.67  ? 6    ILE A CB    1 
ATOM   892  C  CG1   . ILE E 3 6   ? 24.655  52.615 -111.227 1.00 29.71  ? 6    ILE A CG1   1 
ATOM   893  C  CG2   . ILE E 3 6   ? 23.178  54.149 -112.468 1.00 29.82  ? 6    ILE A CG2   1 
ATOM   894  C  CD1   . ILE E 3 6   ? 25.993  53.335 -111.232 1.00 28.60  ? 6    ILE A CD1   1 
ATOM   895  N  N     . ARG E 3 7   ? 21.581  55.485 -109.215 1.00 34.02  ? 7    ARG A N     1 
ATOM   896  C  CA    . ARG E 3 7   ? 20.440  56.394 -109.152 1.00 34.63  ? 7    ARG A CA    1 
ATOM   897  C  C     . ARG E 3 7   ? 20.863  57.654 -108.395 1.00 35.15  ? 7    ARG A C     1 
ATOM   898  O  O     . ARG E 3 7   ? 20.506  58.768 -108.773 1.00 36.88  ? 7    ARG A O     1 
ATOM   899  C  CB    . ARG E 3 7   ? 19.247  55.706 -108.458 1.00 31.73  ? 7    ARG A CB    1 
ATOM   900  C  CG    . ARG E 3 7   ? 17.916  56.451 -108.482 1.00 28.31  ? 7    ARG A CG    1 
ATOM   901  C  CD    . ARG E 3 7   ? 17.404  56.711 -109.914 1.00 32.13  ? 7    ARG A CD    1 
ATOM   902  N  NE    . ARG E 3 7   ? 17.450  58.138 -110.255 1.00 34.32  ? 7    ARG A NE    1 
ATOM   903  C  CZ    . ARG E 3 7   ? 17.289  58.642 -111.476 1.00 34.18  ? 7    ARG A CZ    1 
ATOM   904  N  NH1   . ARG E 3 7   ? 17.064  57.853 -112.525 1.00 34.57  ? 7    ARG A NH1   1 
ATOM   905  N  NH2   . ARG E 3 7   ? 17.370  59.947 -111.653 1.00 36.14  ? 7    ARG A NH2   1 
ATOM   906  N  N     . ARG E 3 8   ? 21.648  57.473 -107.343 1.00 32.92  ? 8    ARG A N     1 
ATOM   907  C  CA    . ARG E 3 8   ? 22.125  58.601 -106.549 1.00 34.92  ? 8    ARG A CA    1 
ATOM   908  C  C     . ARG E 3 8   ? 22.951  59.548 -107.423 1.00 35.74  ? 8    ARG A C     1 
ATOM   909  O  O     . ARG E 3 8   ? 22.890  60.766 -107.273 1.00 36.84  ? 8    ARG A O     1 
ATOM   910  C  CB    . ARG E 3 8   ? 22.979  58.101 -105.367 1.00 37.31  ? 8    ARG A CB    1 
ATOM   911  C  CG    . ARG E 3 8   ? 22.197  57.637 -104.139 1.00 36.50  ? 8    ARG A CG    1 
ATOM   912  C  CD    . ARG E 3 8   ? 23.118  56.975 -103.114 1.00 37.00  ? 8    ARG A CD    1 
ATOM   913  N  NE    . ARG E 3 8   ? 24.359  57.723 -102.937 1.00 40.65  ? 8    ARG A NE    1 
ATOM   914  C  CZ    . ARG E 3 8   ? 25.448  57.260 -102.327 1.00 39.61  ? 8    ARG A CZ    1 
ATOM   915  N  NH1   . ARG E 3 8   ? 25.472  56.041 -101.810 1.00 41.58  ? 8    ARG A NH1   1 
ATOM   916  N  NH2   . ARG E 3 8   ? 26.534  58.003 -102.266 1.00 38.70  ? 8    ARG A NH2   1 
ATOM   917  N  N     . ALA E 3 9   ? 23.727  58.977 -108.331 1.00 56.78  ? 9    ALA A N     1 
ATOM   918  C  CA    . ALA E 3 9   ? 24.562  59.770 -109.222 1.00 59.77  ? 9    ALA A CA    1 
ATOM   919  C  C     . ALA E 3 9   ? 23.689  60.421 -110.287 1.00 60.11  ? 9    ALA A C     1 
ATOM   920  O  O     . ALA E 3 9   ? 23.840  61.606 -110.590 1.00 60.51  ? 9    ALA A O     1 
ATOM   921  C  CB    . ALA E 3 9   ? 25.624  58.880 -109.876 1.00 60.90  ? 9    ALA A CB    1 
ATOM   922  N  N     . ALA E 3 10  ? 22.777  59.635 -110.855 1.00 42.38  ? 10   ALA A N     1 
ATOM   923  C  CA    . ALA E 3 10  ? 21.870  60.142 -111.874 1.00 42.58  ? 10   ALA A CA    1 
ATOM   924  C  C     . ALA E 3 10  ? 21.225  61.427 -111.349 1.00 42.91  ? 10   ALA A C     1 
ATOM   925  O  O     . ALA E 3 10  ? 21.277  62.472 -111.986 1.00 43.10  ? 10   ALA A O     1 
ATOM   926  C  CB    . ALA E 3 10  ? 20.796  59.096 -112.179 1.00 30.31  ? 10   ALA A CB    1 
ATOM   927  N  N     . ASP E 3 11  ? 20.631  61.334 -110.167 1.00 40.11  ? 11   ASP A N     1 
ATOM   928  C  CA    . ASP E 3 11  ? 19.976  62.464 -109.546 1.00 39.82  ? 11   ASP A CA    1 
ATOM   929  C  C     . ASP E 3 11  ? 20.942  63.627 -109.385 1.00 37.79  ? 11   ASP A C     1 
ATOM   930  O  O     . ASP E 3 11  ? 20.590  64.767 -109.678 1.00 37.96  ? 11   ASP A O     1 
ATOM   931  C  CB    . ASP E 3 11  ? 19.421  62.053 -108.182 1.00 64.16  ? 11   ASP A CB    1 
ATOM   932  C  CG    . ASP E 3 11  ? 18.373  60.958 -108.282 1.00 65.93  ? 11   ASP A CG    1 
ATOM   933  O  OD1   . ASP E 3 11  ? 17.405  61.122 -109.052 1.00 68.25  ? 11   ASP A OD1   1 
ATOM   934  O  OD2   . ASP E 3 11  ? 18.511  59.938 -107.582 1.00 68.12  ? 11   ASP A OD2   1 
ATOM   935  N  N     . ASN E 3 12  ? 22.153  63.349 -108.909 1.00 32.88  ? 12   ASN A N     1 
ATOM   936  C  CA    . ASN E 3 12  ? 23.133  64.410 -108.749 1.00 30.91  ? 12   ASN A CA    1 
ATOM   937  C  C     . ASN E 3 12  ? 23.336  65.062 -110.092 1.00 29.72  ? 12   ASN A C     1 
ATOM   938  O  O     . ASN E 3 12  ? 23.533  66.265 -110.179 1.00 29.60  ? 12   ASN A O     1 
ATOM   939  C  CB    . ASN E 3 12  ? 24.460  63.874 -108.224 1.00 32.65  ? 12   ASN A CB    1 
ATOM   940  C  CG    . ASN E 3 12  ? 24.400  63.534 -106.748 1.00 33.89  ? 12   ASN A CG    1 
ATOM   941  O  OD1   . ASN E 3 12  ? 23.643  64.140 -105.992 1.00 31.74  ? 12   ASN A OD1   1 
ATOM   942  N  ND2   . ASN E 3 12  ? 25.216  62.580 -106.326 1.00 36.67  ? 12   ASN A ND2   1 
ATOM   943  N  N     . LEU E 3 13  ? 23.247  64.254 -111.142 1.00 31.07  ? 13   LEU A N     1 
ATOM   944  C  CA    . LEU E 3 13  ? 23.402  64.736 -112.499 1.00 30.46  ? 13   LEU A CA    1 
ATOM   945  C  C     . LEU E 3 13  ? 22.238  65.634 -112.882 1.00 31.12  ? 13   LEU A C     1 
ATOM   946  O  O     . LEU E 3 13  ? 22.430  66.709 -113.468 1.00 31.88  ? 13   LEU A O     1 
ATOM   947  C  CB    . LEU E 3 13  ? 23.461  63.560 -113.465 1.00 24.47  ? 13   LEU A CB    1 
ATOM   948  C  CG    . LEU E 3 13  ? 24.535  62.480 -113.355 1.00 20.03  ? 13   LEU A CG    1 
ATOM   949  C  CD1   . LEU E 3 13  ? 24.223  61.405 -114.372 1.00 16.13  ? 13   LEU A CD1   1 
ATOM   950  C  CD2   . LEU E 3 13  ? 25.898  63.064 -113.612 1.00 18.99  ? 13   LEU A CD2   1 
ATOM   951  N  N     . GLU E 3 14  ? 21.026  65.190 -112.562 1.00 40.03  ? 14   GLU A N     1 
ATOM   952  C  CA    . GLU E 3 14  ? 19.833  65.967 -112.885 1.00 40.72  ? 14   GLU A CA    1 
ATOM   953  C  C     . GLU E 3 14  ? 19.801  67.266 -112.080 1.00 40.51  ? 14   GLU A C     1 
ATOM   954  O  O     . GLU E 3 14  ? 19.365  68.316 -112.570 1.00 38.04  ? 14   GLU A O     1 
ATOM   955  C  CB    . GLU E 3 14  ? 18.563  65.147 -112.613 1.00 35.45  ? 14   GLU A CB    1 
ATOM   956  C  CG    . GLU E 3 14  ? 18.394  63.962 -113.564 1.00 39.64  ? 14   GLU A CG    1 
ATOM   957  C  CD    . GLU E 3 14  ? 17.040  63.269 -113.435 1.00 40.19  ? 14   GLU A CD    1 
ATOM   958  O  OE1   . GLU E 3 14  ? 16.754  62.717 -112.354 1.00 39.57  ? 14   GLU A OE1   1 
ATOM   959  O  OE2   . GLU E 3 14  ? 16.263  63.280 -114.421 1.00 41.31  ? 14   GLU A OE2   1 
ATOM   960  N  N     . ALA E 3 15  ? 20.290  67.186 -110.850 1.00 41.60  ? 15   ALA A N     1 
ATOM   961  C  CA    . ALA E 3 15  ? 20.310  68.339 -109.965 1.00 42.64  ? 15   ALA A CA    1 
ATOM   962  C  C     . ALA E 3 15  ? 21.270  69.401 -110.459 1.00 43.30  ? 15   ALA A C     1 
ATOM   963  O  O     . ALA E 3 15  ? 21.094  70.584 -110.168 1.00 45.54  ? 15   ALA A O     1 
ATOM   964  C  CB    . ALA E 3 15  ? 20.696  67.906 -108.545 1.00 19.19  ? 15   ALA A CB    1 
ATOM   965  N  N     . ALA E 3 16  ? 22.272  68.981 -111.225 1.00 48.30  ? 16   ALA A N     1 
ATOM   966  C  CA    . ALA E 3 16  ? 23.266  69.905 -111.726 1.00 46.92  ? 16   ALA A CA    1 
ATOM   967  C  C     . ALA E 3 16  ? 23.040  70.493 -113.114 1.00 49.43  ? 16   ALA A C     1 
ATOM   968  O  O     . ALA E 3 16  ? 23.336  71.663 -113.324 1.00 53.37  ? 16   ALA A O     1 
ATOM   969  C  CB    . ALA E 3 16  ? 24.631  69.255 -111.671 1.00 16.64  ? 16   ALA A CB    1 
ATOM   970  N  N     . ILE E 3 17  ? 22.530  69.725 -114.073 1.00 36.76  ? 17   ILE A N     1 
ATOM   971  C  CA    . ILE E 3 17  ? 22.364  70.301 -115.410 1.00 34.63  ? 17   ILE A CA    1 
ATOM   972  C  C     . ILE E 3 17  ? 21.032  70.074 -116.121 1.00 34.84  ? 17   ILE A C     1 
ATOM   973  O  O     . ILE E 3 17  ? 20.800  70.663 -117.162 1.00 33.79  ? 17   ILE A O     1 
ATOM   974  C  CB    . ILE E 3 17  ? 23.479  69.829 -116.362 1.00 21.21  ? 17   ILE A CB    1 
ATOM   975  C  CG1   . ILE E 3 17  ? 23.280  68.348 -116.699 1.00 21.97  ? 17   ILE A CG1   1 
ATOM   976  C  CG2   . ILE E 3 17  ? 24.830  70.007 -115.705 1.00 17.99  ? 17   ILE A CG2   1 
ATOM   977  C  CD1   . ILE E 3 17  ? 24.071  67.864 -117.893 1.00 23.80  ? 17   ILE A CD1   1 
ATOM   978  N  N     . LYS E 3 18  ? 20.163  69.223 -115.583 1.00 40.97  ? 18   LYS A N     1 
ATOM   979  C  CA    . LYS E 3 18  ? 18.866  68.996 -116.217 1.00 40.50  ? 18   LYS A CA    1 
ATOM   980  C  C     . LYS E 3 18  ? 18.184  70.323 -116.530 1.00 40.78  ? 18   LYS A C     1 
ATOM   981  O  O     . LYS E 3 18  ? 18.349  71.301 -115.797 1.00 43.46  ? 18   LYS A O     1 
ATOM   982  C  CB    . LYS E 3 18  ? 17.944  68.186 -115.315 1.00 34.74  ? 18   LYS A CB    1 
ATOM   983  C  CG    . LYS E 3 18  ? 16.508  68.201 -115.794 1.00 34.75  ? 18   LYS A CG    1 
ATOM   984  C  CD    . LYS E 3 18  ? 15.546  67.511 -114.844 1.00 35.56  ? 18   LYS A CD    1 
ATOM   985  C  CE    . LYS E 3 18  ? 14.108  67.607 -115.387 1.00 36.38  ? 18   LYS A CE    1 
ATOM   986  N  NZ    . LYS E 3 18  ? 13.106  66.801 -114.621 1.00 37.06  ? 18   LYS A NZ    1 
ATOM   987  N  N     . GLY E 3 19  ? 17.411  70.339 -117.614 1.00 26.79  ? 19   GLY A N     1 
ATOM   988  C  CA    . GLY E 3 19  ? 16.706  71.533 -118.030 1.00 26.62  ? 19   GLY A CA    1 
ATOM   989  C  C     . GLY E 3 19  ? 17.627  72.677 -118.406 1.00 29.10  ? 19   GLY A C     1 
ATOM   990  O  O     . GLY E 3 19  ? 17.183  73.687 -118.932 1.00 30.09  ? 19   GLY A O     1 
ATOM   991  N  N     . LYS E 3 20  ? 18.917  72.523 -118.156 1.00 31.03  ? 20   LYS A N     1 
ATOM   992  C  CA    . LYS E 3 20  ? 19.857  73.587 -118.456 1.00 32.52  ? 20   LYS A CA    1 
ATOM   993  C  C     . LYS E 3 20  ? 20.497  73.516 -119.834 1.00 33.37  ? 20   LYS A C     1 
ATOM   994  O  O     . LYS E 3 20  ? 21.070  72.504 -120.201 1.00 34.90  ? 20   LYS A O     1 
ATOM   995  C  CB    . LYS E 3 20  ? 20.957  73.625 -117.389 1.00 39.18  ? 20   LYS A CB    1 
ATOM   996  C  CG    . LYS E 3 20  ? 20.453  73.968 -115.998 1.00 37.97  ? 20   LYS A CG    1 
ATOM   997  C  CD    . LYS E 3 20  ? 19.800  75.331 -115.985 1.00 38.30  ? 20   LYS A CD    1 
ATOM   998  C  CE    . LYS E 3 20  ? 18.977  75.577 -114.719 1.00 39.18  ? 20   LYS A CE    1 
ATOM   999  N  NZ    . LYS E 3 20  ? 17.744  74.744 -114.650 1.00 38.81  ? 20   LYS A NZ    1 
ATOM   1000 N  N     . PRO E 3 21  ? 20.400  74.596 -120.619 1.00 38.36  ? 21   PRO A N     1 
ATOM   1001 C  CA    . PRO E 3 21  ? 21.009  74.573 -121.946 1.00 41.07  ? 21   PRO A CA    1 
ATOM   1002 C  C     . PRO E 3 21  ? 22.522  74.300 -121.889 1.00 41.71  ? 21   PRO A C     1 
ATOM   1003 O  O     . PRO E 3 21  ? 23.286  75.024 -121.249 1.00 41.71  ? 21   PRO A O     1 
ATOM   1004 C  CB    . PRO E 3 21  ? 20.669  75.955 -122.508 1.00 57.84  ? 21   PRO A CB    1 
ATOM   1005 C  CG    . PRO E 3 21  ? 20.495  76.792 -121.282 1.00 56.34  ? 21   PRO A CG    1 
ATOM   1006 C  CD    . PRO E 3 21  ? 19.738  75.883 -120.372 1.00 55.62  ? 21   PRO A CD    1 
ATOM   1007 N  N     . LEU E 3 22  ? 22.934  73.234 -122.560 1.00 51.61  ? 22   LEU A N     1 
ATOM   1008 C  CA    . LEU E 3 22  ? 24.327  72.842 -122.589 1.00 52.48  ? 22   LEU A CA    1 
ATOM   1009 C  C     . LEU E 3 22  ? 25.156  73.811 -123.433 1.00 52.87  ? 22   LEU A C     1 
ATOM   1010 O  O     . LEU E 3 22  ? 24.846  74.092 -124.598 1.00 51.59  ? 22   LEU A O     1 
ATOM   1011 C  CB    . LEU E 3 22  ? 24.443  71.411 -123.120 1.00 30.17  ? 22   LEU A CB    1 
ATOM   1012 C  CG    . LEU E 3 22  ? 24.026  70.251 -122.195 1.00 29.45  ? 22   LEU A CG    1 
ATOM   1013 C  CD1   . LEU E 3 22  ? 22.948  70.675 -121.221 1.00 29.57  ? 22   LEU A CD1   1 
ATOM   1014 C  CD2   . LEU E 3 22  ? 23.521  69.085 -123.045 1.00 30.37  ? 22   LEU A CD2   1 
ATOM   1015 N  N     . THR E 3 23  ? 26.207  74.338 -122.823 1.00 52.52  ? 23   THR A N     1 
ATOM   1016 C  CA    . THR E 3 23  ? 27.075  75.268 -123.509 1.00 50.66  ? 23   THR A CA    1 
ATOM   1017 C  C     . THR E 3 23  ? 28.251  74.550 -124.152 1.00 49.56  ? 23   THR A C     1 
ATOM   1018 O  O     . THR E 3 23  ? 29.062  75.176 -124.831 1.00 51.36  ? 23   THR A O     1 
ATOM   1019 C  CB    . THR E 3 23  ? 27.580  76.354 -122.547 1.00 30.70  ? 23   THR A CB    1 
ATOM   1020 O  OG1   . THR E 3 23  ? 27.940  75.758 -121.284 1.00 30.73  ? 23   THR A OG1   1 
ATOM   1021 C  CG2   . THR E 3 23  ? 26.499  77.416 -122.354 1.00 28.29  ? 23   THR A CG2   1 
ATOM   1022 N  N     . ASP E 3 24  ? 28.338  73.238 -123.928 1.00 31.75  ? 24   ASP A N     1 
ATOM   1023 C  CA    . ASP E 3 24  ? 29.394  72.414 -124.510 1.00 30.48  ? 24   ASP A CA    1 
ATOM   1024 C  C     . ASP E 3 24  ? 29.226  70.917 -124.263 1.00 30.62  ? 24   ASP A C     1 
ATOM   1025 O  O     . ASP E 3 24  ? 28.657  70.483 -123.262 1.00 30.98  ? 24   ASP A O     1 
ATOM   1026 C  CB    . ASP E 3 24  ? 30.787  72.839 -124.020 1.00 30.69  ? 24   ASP A CB    1 
ATOM   1027 C  CG    . ASP E 3 24  ? 31.913  72.254 -124.892 1.00 28.82  ? 24   ASP A CG    1 
ATOM   1028 O  OD1   . ASP E 3 24  ? 31.818  72.353 -126.133 1.00 22.93  ? 24   ASP A OD1   1 
ATOM   1029 O  OD2   . ASP E 3 24  ? 32.889  71.708 -124.341 1.00 29.03  ? 24   ASP A OD2   1 
ATOM   1030 N  N     . VAL E 3 25  ? 29.730  70.130 -125.204 1.00 36.06  ? 25   VAL A N     1 
ATOM   1031 C  CA    . VAL E 3 25  ? 29.657  68.687 -125.113 1.00 35.07  ? 25   VAL A CA    1 
ATOM   1032 C  C     . VAL E 3 25  ? 31.035  68.164 -125.527 1.00 35.69  ? 25   VAL A C     1 
ATOM   1033 O  O     . VAL E 3 25  ? 31.716  68.777 -126.344 1.00 34.72  ? 25   VAL A O     1 
ATOM   1034 C  CB    . VAL E 3 25  ? 28.549  68.144 -126.063 1.00 21.48  ? 25   VAL A CB    1 
ATOM   1035 C  CG1   . VAL E 3 25  ? 28.425  66.635 -125.955 1.00 21.55  ? 25   VAL A CG1   1 
ATOM   1036 C  CG2   . VAL E 3 25  ? 27.234  68.782 -125.726 1.00 22.15  ? 25   VAL A CG2   1 
ATOM   1037 N  N     . TRP E 3 26  ? 31.461  67.055 -124.935 1.00 34.40  ? 26   TRP A N     1 
ATOM   1038 C  CA    . TRP E 3 26  ? 32.749  66.470 -125.284 1.00 35.95  ? 26   TRP A CA    1 
ATOM   1039 C  C     . TRP E 3 26  ? 32.812  64.986 -125.002 1.00 36.20  ? 26   TRP A C     1 
ATOM   1040 O  O     . TRP E 3 26  ? 32.371  64.520 -123.953 1.00 37.42  ? 26   TRP A O     1 
ATOM   1041 C  CB    . TRP E 3 26  ? 33.901  67.123 -124.513 1.00 43.77  ? 26   TRP A CB    1 
ATOM   1042 C  CG    . TRP E 3 26  ? 35.244  66.588 -124.960 1.00 42.07  ? 26   TRP A CG    1 
ATOM   1043 C  CD1   . TRP E 3 26  ? 35.883  66.884 -126.119 1.00 41.04  ? 26   TRP A CD1   1 
ATOM   1044 C  CD2   . TRP E 3 26  ? 36.055  65.606 -124.296 1.00 40.67  ? 26   TRP A CD2   1 
ATOM   1045 N  NE1   . TRP E 3 26  ? 37.035  66.155 -126.230 1.00 43.40  ? 26   TRP A NE1   1 
ATOM   1046 C  CE2   . TRP E 3 26  ? 37.168  65.359 -125.125 1.00 41.78  ? 26   TRP A CE2   1 
ATOM   1047 C  CE3   . TRP E 3 26  ? 35.947  64.909 -123.086 1.00 39.99  ? 26   TRP A CE3   1 
ATOM   1048 C  CZ2   . TRP E 3 26  ? 38.171  64.443 -124.786 1.00 39.78  ? 26   TRP A CZ2   1 
ATOM   1049 C  CZ3   . TRP E 3 26  ? 36.935  64.002 -122.747 1.00 39.15  ? 26   TRP A CZ3   1 
ATOM   1050 C  CH2   . TRP E 3 26  ? 38.037  63.777 -123.598 1.00 40.90  ? 26   TRP A CH2   1 
ATOM   1051 N  N     . PHE E 3 27  ? 33.399  64.251 -125.934 1.00 37.03  ? 27   PHE A N     1 
ATOM   1052 C  CA    . PHE E 3 27  ? 33.556  62.818 -125.784 1.00 36.14  ? 27   PHE A CA    1 
ATOM   1053 C  C     . PHE E 3 27  ? 34.956  62.360 -126.190 1.00 36.10  ? 27   PHE A C     1 
ATOM   1054 O  O     . PHE E 3 27  ? 35.583  62.908 -127.103 1.00 33.80  ? 27   PHE A O     1 
ATOM   1055 C  CB    . PHE E 3 27  ? 32.501  62.093 -126.619 1.00 33.48  ? 27   PHE A CB    1 
ATOM   1056 C  CG    . PHE E 3 27  ? 31.108  62.442 -126.237 1.00 33.80  ? 27   PHE A CG    1 
ATOM   1057 C  CD1   . PHE E 3 27  ? 30.487  61.811 -125.162 1.00 34.62  ? 27   PHE A CD1   1 
ATOM   1058 C  CD2   . PHE E 3 27  ? 30.408  63.419 -126.935 1.00 34.15  ? 27   PHE A CD2   1 
ATOM   1059 C  CE1   . PHE E 3 27  ? 29.181  62.147 -124.789 1.00 35.61  ? 27   PHE A CE1   1 
ATOM   1060 C  CE2   . PHE E 3 27  ? 29.106  63.757 -126.566 1.00 33.02  ? 27   PHE A CE2   1 
ATOM   1061 C  CZ    . PHE E 3 27  ? 28.493  63.114 -125.486 1.00 33.23  ? 27   PHE A CZ    1 
ATOM   1062 N  N     . ALA E 3 28  ? 35.432  61.351 -125.478 1.00 44.19  ? 28   ALA A N     1 
ATOM   1063 C  CA    . ALA E 3 28  ? 36.727  60.753 -125.734 1.00 44.41  ? 28   ALA A CA    1 
ATOM   1064 C  C     . ALA E 3 28  ? 36.628  59.913 -127.009 1.00 45.37  ? 28   ALA A C     1 
ATOM   1065 O  O     . ALA E 3 28  ? 37.509  59.961 -127.870 1.00 44.73  ? 28   ALA A O     1 
ATOM   1066 C  CB    . ALA E 3 28  ? 37.137  59.874 -124.542 1.00 25.22  ? 28   ALA A CB    1 
ATOM   1067 N  N     . PHE E 3 29  ? 35.548  59.150 -127.134 1.00 45.06  ? 29   PHE A N     1 
ATOM   1068 C  CA    . PHE E 3 29  ? 35.383  58.309 -128.309 1.00 45.81  ? 29   PHE A CA    1 
ATOM   1069 C  C     . PHE E 3 29  ? 35.119  59.110 -129.574 1.00 48.55  ? 29   PHE A C     1 
ATOM   1070 O  O     . PHE E 3 29  ? 34.102  59.794 -129.693 1.00 49.38  ? 29   PHE A O     1 
ATOM   1071 C  CB    . PHE E 3 29  ? 34.255  57.293 -128.109 1.00 26.21  ? 29   PHE A CB    1 
ATOM   1072 C  CG    . PHE E 3 29  ? 34.476  56.358 -126.954 1.00 22.28  ? 29   PHE A CG    1 
ATOM   1073 C  CD1   . PHE E 3 29  ? 35.738  56.226 -126.372 1.00 19.12  ? 29   PHE A CD1   1 
ATOM   1074 C  CD2   . PHE E 3 29  ? 33.423  55.603 -126.445 1.00 19.35  ? 29   PHE A CD2   1 
ATOM   1075 C  CE1   . PHE E 3 29  ? 35.943  55.348 -125.293 1.00 18.82  ? 29   PHE A CE1   1 
ATOM   1076 C  CE2   . PHE E 3 29  ? 33.617  54.733 -125.370 1.00 19.49  ? 29   PHE A CE2   1 
ATOM   1077 C  CZ    . PHE E 3 29  ? 34.876  54.604 -124.796 1.00 18.84  ? 29   PHE A CZ    1 
ATOM   1078 N  N     . PRO E 3 30  ? 36.047  59.034 -130.539 1.00 51.42  ? 30   PRO A N     1 
ATOM   1079 C  CA    . PRO E 3 30  ? 35.929  59.742 -131.810 1.00 51.89  ? 30   PRO A CA    1 
ATOM   1080 C  C     . PRO E 3 30  ? 34.533  59.587 -132.394 1.00 52.30  ? 30   PRO A C     1 
ATOM   1081 O  O     . PRO E 3 30  ? 33.915  60.551 -132.833 1.00 55.41  ? 30   PRO A O     1 
ATOM   1082 C  CB    . PRO E 3 30  ? 36.988  59.066 -132.671 1.00 60.96  ? 30   PRO A CB    1 
ATOM   1083 C  CG    . PRO E 3 30  ? 38.063  58.764 -131.679 1.00 62.56  ? 30   PRO A CG    1 
ATOM   1084 C  CD    . PRO E 3 30  ? 37.284  58.233 -130.497 1.00 61.58  ? 30   PRO A CD    1 
ATOM   1085 N  N     . GLN E 3 31  ? 34.036  58.362 -132.386 1.00 35.99  ? 31   GLN A N     1 
ATOM   1086 C  CA    . GLN E 3 31  ? 32.721  58.065 -132.934 1.00 34.03  ? 31   GLN A CA    1 
ATOM   1087 C  C     . GLN E 3 31  ? 31.634  58.956 -132.362 1.00 33.42  ? 31   GLN A C     1 
ATOM   1088 O  O     . GLN E 3 31  ? 30.619  59.211 -133.017 1.00 32.70  ? 31   GLN A O     1 
ATOM   1089 C  CB    . GLN E 3 31  ? 32.352  56.608 -132.664 1.00 47.80  ? 31   GLN A CB    1 
ATOM   1090 C  CG    . GLN E 3 31  ? 33.354  55.576 -133.157 1.00 47.08  ? 31   GLN A CG    1 
ATOM   1091 C  CD    . GLN E 3 31  ? 34.644  55.537 -132.343 1.00 47.69  ? 31   GLN A CD    1 
ATOM   1092 O  OE1   . GLN E 3 31  ? 34.662  55.862 -131.147 1.00 47.70  ? 31   GLN A OE1   1 
ATOM   1093 N  NE2   . GLN E 3 31  ? 35.732  55.113 -132.990 1.00 48.56  ? 31   GLN A NE2   1 
ATOM   1094 N  N     . LEU E 3 32  ? 31.837  59.424 -131.136 1.00 39.46  ? 32   LEU A N     1 
ATOM   1095 C  CA    . LEU E 3 32  ? 30.837  60.274 -130.488 1.00 37.89  ? 32   LEU A CA    1 
ATOM   1096 C  C     . LEU E 3 32  ? 31.052  61.765 -130.738 1.00 36.27  ? 32   LEU A C     1 
ATOM   1097 O  O     . LEU E 3 32  ? 30.160  62.570 -130.486 1.00 37.37  ? 32   LEU A O     1 
ATOM   1098 C  CB    . LEU E 3 32  ? 30.781  59.963 -128.976 1.00 31.00  ? 32   LEU A CB    1 
ATOM   1099 C  CG    . LEU E 3 32  ? 29.980  58.713 -128.549 1.00 28.16  ? 32   LEU A CG    1 
ATOM   1100 C  CD1   . LEU E 3 32  ? 30.421  58.185 -127.189 1.00 24.82  ? 32   LEU A CD1   1 
ATOM   1101 C  CD2   . LEU E 3 32  ? 28.518  59.076 -128.503 1.00 28.37  ? 32   LEU A CD2   1 
ATOM   1102 N  N     . LYS E 3 33  ? 32.224  62.125 -131.260 1.00 37.39  ? 33   LYS A N     1 
ATOM   1103 C  CA    . LYS E 3 33  ? 32.542  63.526 -131.563 1.00 36.75  ? 33   LYS A CA    1 
ATOM   1104 C  C     . LYS E 3 33  ? 31.432  64.161 -132.397 1.00 35.08  ? 33   LYS A C     1 
ATOM   1105 O  O     . LYS E 3 33  ? 31.101  65.321 -132.202 1.00 37.69  ? 33   LYS A O     1 
ATOM   1106 C  CB    . LYS E 3 33  ? 33.854  63.642 -132.356 1.00 35.66  ? 33   LYS A CB    1 
ATOM   1107 C  CG    . LYS E 3 33  ? 35.089  63.032 -131.722 1.00 33.67  ? 33   LYS A CG    1 
ATOM   1108 C  CD    . LYS E 3 33  ? 35.756  63.936 -130.708 1.00 30.45  ? 33   LYS A CD    1 
ATOM   1109 C  CE    . LYS E 3 33  ? 37.011  63.277 -130.200 1.00 28.35  ? 33   LYS A CE    1 
ATOM   1110 N  NZ    . LYS E 3 33  ? 37.660  64.024 -129.104 1.00 36.75  ? 33   LYS A NZ    1 
ATOM   1111 N  N     . THR E 3 34  ? 30.870  63.390 -133.325 1.00 38.46  ? 34   THR A N     1 
ATOM   1112 C  CA    . THR E 3 34  ? 29.799  63.855 -134.218 1.00 37.42  ? 34   THR A CA    1 
ATOM   1113 C  C     . THR E 3 34  ? 28.537  64.375 -133.524 1.00 38.88  ? 34   THR A C     1 
ATOM   1114 O  O     . THR E 3 34  ? 27.768  65.134 -134.123 1.00 37.54  ? 34   THR A O     1 
ATOM   1115 C  CB    . THR E 3 34  ? 29.365  62.738 -135.221 1.00 22.41  ? 34   THR A CB    1 
ATOM   1116 O  OG1   . THR E 3 34  ? 28.567  63.321 -136.257 1.00 24.37  ? 34   THR A OG1   1 
ATOM   1117 C  CG2   . THR E 3 34  ? 28.541  61.648 -134.521 1.00 20.02  ? 34   THR A CG2   1 
ATOM   1118 N  N     . TYR E 3 35  ? 28.318  63.966 -132.273 1.00 44.73  ? 35   TYR A N     1 
ATOM   1119 C  CA    . TYR E 3 35  ? 27.139  64.410 -131.527 1.00 45.38  ? 35   TYR A CA    1 
ATOM   1120 C  C     . TYR E 3 35  ? 27.389  65.684 -130.708 1.00 45.69  ? 35   TYR A C     1 
ATOM   1121 O  O     . TYR E 3 35  ? 26.448  66.293 -130.199 1.00 43.94  ? 35   TYR A O     1 
ATOM   1122 C  CB    . TYR E 3 35  ? 26.639  63.292 -130.595 1.00 33.57  ? 35   TYR A CB    1 
ATOM   1123 C  CG    . TYR E 3 35  ? 26.198  62.037 -131.313 1.00 31.08  ? 35   TYR A CG    1 
ATOM   1124 C  CD1   . TYR E 3 35  ? 25.145  62.061 -132.229 1.00 33.23  ? 35   TYR A CD1   1 
ATOM   1125 C  CD2   . TYR E 3 35  ? 26.852  60.824 -131.093 1.00 32.08  ? 35   TYR A CD2   1 
ATOM   1126 C  CE1   . TYR E 3 35  ? 24.751  60.900 -132.914 1.00 31.51  ? 35   TYR A CE1   1 
ATOM   1127 C  CE2   . TYR E 3 35  ? 26.475  59.660 -131.770 1.00 30.47  ? 35   TYR A CE2   1 
ATOM   1128 C  CZ    . TYR E 3 35  ? 25.423  59.705 -132.680 1.00 31.22  ? 35   TYR A CZ    1 
ATOM   1129 O  OH    . TYR E 3 35  ? 25.065  58.552 -133.351 1.00 29.56  ? 35   TYR A OH    1 
ATOM   1130 N  N     . GLN E 3 36  ? 28.653  66.084 -130.587 1.00 52.71  ? 36   GLN A N     1 
ATOM   1131 C  CA    . GLN E 3 36  ? 29.004  67.280 -129.824 1.00 52.95  ? 36   GLN A CA    1 
ATOM   1132 C  C     . GLN E 3 36  ? 28.301  68.535 -130.357 1.00 54.04  ? 36   GLN A C     1 
ATOM   1133 O  O     . GLN E 3 36  ? 27.295  68.967 -129.786 1.00 54.27  ? 36   GLN A O     1 
ATOM   1134 C  CB    . GLN E 3 36  ? 30.526  67.488 -129.819 1.00 30.27  ? 36   GLN A CB    1 
ATOM   1135 C  CG    . GLN E 3 36  ? 31.294  66.341 -129.223 1.00 28.30  ? 36   GLN A CG    1 
ATOM   1136 C  CD    . GLN E 3 36  ? 32.796  66.592 -129.184 1.00 30.22  ? 36   GLN A CD    1 
ATOM   1137 O  OE1   . GLN E 3 36  ? 33.551  65.865 -128.518 1.00 24.65  ? 36   GLN A OE1   1 
ATOM   1138 N  NE2   . GLN E 3 36  ? 33.239  67.619 -129.906 1.00 29.74  ? 36   GLN A NE2   1 
ATOM   1139 N  N     . SER E 3 37  ? 28.809  69.116 -131.445 1.00 34.46  ? 37   SER A N     1 
ATOM   1140 C  CA    . SER E 3 37  ? 28.180  70.314 -131.982 1.00 35.44  ? 37   SER A CA    1 
ATOM   1141 C  C     . SER E 3 37  ? 26.668  70.092 -132.001 1.00 36.07  ? 37   SER A C     1 
ATOM   1142 O  O     . SER E 3 37  ? 25.884  70.988 -131.697 1.00 37.51  ? 37   SER A O     1 
ATOM   1143 C  CB    . SER E 3 37  ? 28.704  70.630 -133.397 1.00 37.08  ? 37   SER A CB    1 
ATOM   1144 O  OG    . SER E 3 37  ? 27.992  69.939 -134.411 1.00 33.80  ? 37   SER A OG    1 
ATOM   1145 N  N     . GLN E 3 38  ? 26.271  68.871 -132.327 1.00 43.82  ? 38   GLN A N     1 
ATOM   1146 C  CA    . GLN E 3 38  ? 24.868  68.517 -132.391 1.00 42.99  ? 38   GLN A CA    1 
ATOM   1147 C  C     . GLN E 3 38  ? 24.121  68.760 -131.088 1.00 44.43  ? 38   GLN A C     1 
ATOM   1148 O  O     . GLN E 3 38  ? 22.951  69.143 -131.102 1.00 46.40  ? 38   GLN A O     1 
ATOM   1149 C  CB    . GLN E 3 38  ? 24.724  67.049 -132.768 1.00 36.33  ? 38   GLN A CB    1 
ATOM   1150 C  CG    . GLN E 3 38  ? 23.470  66.765 -133.562 1.00 33.84  ? 38   GLN A CG    1 
ATOM   1151 C  CD    . GLN E 3 38  ? 23.269  65.303 -133.806 1.00 33.43  ? 38   GLN A CD    1 
ATOM   1152 O  OE1   . GLN E 3 38  ? 24.207  64.598 -134.185 1.00 35.42  ? 38   GLN A OE1   1 
ATOM   1153 N  NE2   . GLN E 3 38  ? 22.038  64.826 -133.604 1.00 31.40  ? 38   GLN A NE2   1 
ATOM   1154 N  N     . LEU E 3 39  ? 24.802  68.529 -129.966 1.00 46.13  ? 39   LEU A N     1 
ATOM   1155 C  CA    . LEU E 3 39  ? 24.210  68.675 -128.636 1.00 42.44  ? 39   LEU A CA    1 
ATOM   1156 C  C     . LEU E 3 39  ? 24.342  70.051 -128.000 1.00 42.04  ? 39   LEU A C     1 
ATOM   1157 O  O     . LEU E 3 39  ? 23.579  70.402 -127.091 1.00 40.02  ? 39   LEU A O     1 
ATOM   1158 C  CB    . LEU E 3 39  ? 24.787  67.609 -127.698 1.00 29.42  ? 39   LEU A CB    1 
ATOM   1159 C  CG    . LEU E 3 39  ? 24.142  66.233 -127.879 1.00 27.67  ? 39   LEU A CG    1 
ATOM   1160 C  CD1   . LEU E 3 39  ? 24.682  65.253 -126.860 1.00 29.02  ? 39   LEU A CD1   1 
ATOM   1161 C  CD2   . LEU E 3 39  ? 22.637  66.367 -127.733 1.00 29.10  ? 39   LEU A CD2   1 
ATOM   1162 N  N     . ILE E 3 40  ? 25.328  70.818 -128.454 1.00 28.20  ? 40   ILE A N     1 
ATOM   1163 C  CA    . ILE E 3 40  ? 25.517  72.154 -127.939 1.00 26.99  ? 40   ILE A CA    1 
ATOM   1164 C  C     . ILE E 3 40  ? 24.209  72.891 -128.249 1.00 28.22  ? 40   ILE A C     1 
ATOM   1165 O  O     . ILE E 3 40  ? 23.669  72.775 -129.364 1.00 27.82  ? 40   ILE A O     1 
ATOM   1166 C  CB    . ILE E 3 40  ? 26.687  72.853 -128.645 1.00 30.41  ? 40   ILE A CB    1 
ATOM   1167 C  CG1   . ILE E 3 40  ? 27.972  72.060 -128.404 1.00 33.60  ? 40   ILE A CG1   1 
ATOM   1168 C  CG2   . ILE E 3 40  ? 26.829  74.287 -128.131 1.00 29.39  ? 40   ILE A CG2   1 
ATOM   1169 C  CD1   . ILE E 3 40  ? 29.179  72.614 -129.100 1.00 34.06  ? 40   ILE A CD1   1 
ATOM   1170 N  N     . GLY E 3 41  ? 23.694  73.627 -127.265 1.00 34.89  ? 41   GLY A N     1 
ATOM   1171 C  CA    . GLY E 3 41  ? 22.457  74.354 -127.464 1.00 35.60  ? 41   GLY A CA    1 
ATOM   1172 C  C     . GLY E 3 41  ? 21.219  73.564 -127.062 1.00 37.15  ? 41   GLY A C     1 
ATOM   1173 O  O     . GLY E 3 41  ? 20.104  74.091 -127.118 1.00 39.54  ? 41   GLY A O     1 
ATOM   1174 N  N     . GLN E 3 42  ? 21.406  72.299 -126.685 1.00 45.56  ? 42   GLN A N     1 
ATOM   1175 C  CA    . GLN E 3 42  ? 20.310  71.439 -126.244 1.00 43.37  ? 42   GLN A CA    1 
ATOM   1176 C  C     . GLN E 3 42  ? 20.462  71.274 -124.728 1.00 44.43  ? 42   GLN A C     1 
ATOM   1177 O  O     . GLN E 3 42  ? 21.373  71.838 -124.122 1.00 44.20  ? 42   GLN A O     1 
ATOM   1178 C  CB    . GLN E 3 42  ? 20.397  70.056 -126.897 1.00 27.29  ? 42   GLN A CB    1 
ATOM   1179 C  CG    . GLN E 3 42  ? 20.277  70.023 -128.413 1.00 28.51  ? 42   GLN A CG    1 
ATOM   1180 C  CD    . GLN E 3 42  ? 18.869  70.333 -128.912 1.00 30.76  ? 42   GLN A CD    1 
ATOM   1181 O  OE1   . GLN E 3 42  ? 17.880  69.801 -128.402 1.00 27.33  ? 42   GLN A OE1   1 
ATOM   1182 N  NE2   . GLN E 3 42  ? 18.780  71.198 -129.924 1.00 27.67  ? 42   GLN A NE2   1 
ATOM   1183 N  N     . HIS E 3 43  ? 19.584  70.481 -124.122 1.00 43.43  ? 43   HIS A N     1 
ATOM   1184 C  CA    . HIS E 3 43  ? 19.652  70.244 -122.689 1.00 40.82  ? 43   HIS A CA    1 
ATOM   1185 C  C     . HIS E 3 43  ? 19.092  68.875 -122.282 1.00 40.72  ? 43   HIS A C     1 
ATOM   1186 O  O     . HIS E 3 43  ? 18.273  68.282 -122.984 1.00 39.45  ? 43   HIS A O     1 
ATOM   1187 C  CB    . HIS E 3 43  ? 18.904  71.356 -121.924 1.00 22.29  ? 43   HIS A CB    1 
ATOM   1188 C  CG    . HIS E 3 43  ? 17.429  71.402 -122.197 1.00 22.44  ? 43   HIS A CG    1 
ATOM   1189 N  ND1   . HIS E 3 43  ? 16.889  72.064 -123.282 1.00 22.90  ? 43   HIS A ND1   1 
ATOM   1190 C  CD2   . HIS E 3 43  ? 16.388  70.813 -121.561 1.00 20.91  ? 43   HIS A CD2   1 
ATOM   1191 C  CE1   . HIS E 3 43  ? 15.582  71.877 -123.302 1.00 21.12  ? 43   HIS A CE1   1 
ATOM   1192 N  NE2   . HIS E 3 43  ? 15.252  71.122 -122.268 1.00 17.24  ? 43   HIS A NE2   1 
ATOM   1193 N  N     . VAL E 3 44  ? 19.558  68.383 -121.138 1.00 33.45  ? 44   VAL A N     1 
ATOM   1194 C  CA    . VAL E 3 44  ? 19.093  67.114 -120.593 1.00 33.41  ? 44   VAL A CA    1 
ATOM   1195 C  C     . VAL E 3 44  ? 17.668  67.334 -120.097 1.00 34.37  ? 44   VAL A C     1 
ATOM   1196 O  O     . VAL E 3 44  ? 17.429  68.137 -119.197 1.00 34.24  ? 44   VAL A O     1 
ATOM   1197 C  CB    . VAL E 3 44  ? 19.960  66.659 -119.391 1.00 21.12  ? 44   VAL A CB    1 
ATOM   1198 C  CG1   . VAL E 3 44  ? 19.257  65.552 -118.633 1.00 18.70  ? 44   VAL A CG1   1 
ATOM   1199 C  CG2   . VAL E 3 44  ? 21.322  66.209 -119.870 1.00 16.68  ? 44   VAL A CG2   1 
ATOM   1200 N  N     . THR E 3 45  ? 16.720  66.629 -120.696 1.00 30.86  ? 45   THR A N     1 
ATOM   1201 C  CA    . THR E 3 45  ? 15.332  66.763 -120.293 1.00 28.67  ? 45   THR A CA    1 
ATOM   1202 C  C     . THR E 3 45  ? 15.105  65.915 -119.040 1.00 28.95  ? 45   THR A C     1 
ATOM   1203 O  O     . THR E 3 45  ? 14.271  66.234 -118.198 1.00 27.96  ? 45   THR A O     1 
ATOM   1204 C  CB    . THR E 3 45  ? 14.410  66.355 -121.447 1.00 22.98  ? 45   THR A CB    1 
ATOM   1205 O  OG1   . THR E 3 45  ? 14.747  65.033 -121.892 1.00 25.00  ? 45   THR A OG1   1 
ATOM   1206 C  CG2   . THR E 3 45  ? 14.566  67.351 -122.612 1.00 19.91  ? 45   THR A CG2   1 
ATOM   1207 N  N     . HIS E 3 46  ? 15.873  64.834 -118.931 1.00 29.52  ? 46   HIS A N     1 
ATOM   1208 C  CA    . HIS E 3 46  ? 15.835  63.955 -117.771 1.00 30.55  ? 46   HIS A CA    1 
ATOM   1209 C  C     . HIS E 3 46  ? 16.880  62.852 -117.863 1.00 29.94  ? 46   HIS A C     1 
ATOM   1210 O  O     . HIS E 3 46  ? 17.187  62.379 -118.943 1.00 28.51  ? 46   HIS A O     1 
ATOM   1211 C  CB    . HIS E 3 46  ? 14.424  63.366 -117.543 1.00 51.28  ? 46   HIS A CB    1 
ATOM   1212 C  CG    . HIS E 3 46  ? 14.021  62.277 -118.493 1.00 55.25  ? 46   HIS A CG    1 
ATOM   1213 N  ND1   . HIS E 3 46  ? 13.903  62.471 -119.854 1.00 57.65  ? 46   HIS A ND1   1 
ATOM   1214 C  CD2   . HIS E 3 46  ? 13.585  61.014 -118.258 1.00 57.34  ? 46   HIS A CD2   1 
ATOM   1215 C  CE1   . HIS E 3 46  ? 13.403  61.382 -120.412 1.00 58.38  ? 46   HIS A CE1   1 
ATOM   1216 N  NE2   . HIS E 3 46  ? 13.200  60.483 -119.466 1.00 58.68  ? 46   HIS A NE2   1 
ATOM   1217 N  N     . VAL E 3 47  ? 17.476  62.494 -116.727 1.00 38.69  ? 47   VAL A N     1 
ATOM   1218 C  CA    . VAL E 3 47  ? 18.448  61.405 -116.708 1.00 38.95  ? 47   VAL A CA    1 
ATOM   1219 C  C     . VAL E 3 47  ? 17.704  60.205 -116.140 1.00 39.47  ? 47   VAL A C     1 
ATOM   1220 O  O     . VAL E 3 47  ? 17.090  60.299 -115.092 1.00 40.10  ? 47   VAL A O     1 
ATOM   1221 C  CB    . VAL E 3 47  ? 19.704  61.715 -115.831 1.00 21.19  ? 47   VAL A CB    1 
ATOM   1222 C  CG1   . VAL E 3 47  ? 20.511  60.430 -115.620 1.00 19.25  ? 47   VAL A CG1   1 
ATOM   1223 C  CG2   . VAL E 3 47  ? 20.587  62.762 -116.514 1.00 16.63  ? 47   VAL A CG2   1 
ATOM   1224 N  N     . GLU E 3 48  ? 17.745  59.085 -116.849 1.00 35.86  ? 48   GLU A N     1 
ATOM   1225 C  CA    . GLU E 3 48  ? 17.045  57.894 -116.403 1.00 38.18  ? 48   GLU A CA    1 
ATOM   1226 C  C     . GLU E 3 48  ? 17.970  56.736 -116.074 1.00 37.38  ? 48   GLU A C     1 
ATOM   1227 O  O     . GLU E 3 48  ? 19.080  56.661 -116.588 1.00 36.92  ? 48   GLU A O     1 
ATOM   1228 C  CB    . GLU E 3 48  ? 16.074  57.440 -117.482 1.00 39.57  ? 48   GLU A CB    1 
ATOM   1229 C  CG    . GLU E 3 48  ? 15.163  56.303 -117.061 1.00 42.12  ? 48   GLU A CG    1 
ATOM   1230 C  CD    . GLU E 3 48  ? 14.625  55.531 -118.250 1.00 42.48  ? 48   GLU A CD    1 
ATOM   1231 O  OE1   . GLU E 3 48  ? 14.510  56.123 -119.345 1.00 42.23  ? 48   GLU A OE1   1 
ATOM   1232 O  OE2   . GLU E 3 48  ? 14.311  54.335 -118.081 1.00 42.58  ? 48   GLU A OE2   1 
ATOM   1233 N  N     . THR E 3 49  ? 17.514  55.850 -115.195 1.00 33.37  ? 49   THR A N     1 
ATOM   1234 C  CA    . THR E 3 49  ? 18.283  54.655 -114.845 1.00 34.62  ? 49   THR A CA    1 
ATOM   1235 C  C     . THR E 3 49  ? 17.406  53.429 -115.088 1.00 34.40  ? 49   THR A C     1 
ATOM   1236 O  O     . THR E 3 49  ? 16.194  53.544 -115.191 1.00 37.55  ? 49   THR A O     1 
ATOM   1237 C  CB    . THR E 3 49  ? 18.765  54.661 -113.362 1.00 34.62  ? 49   THR A CB    1 
ATOM   1238 O  OG1   . THR E 3 49  ? 17.650  54.822 -112.469 1.00 35.21  ? 49   THR A OG1   1 
ATOM   1239 C  CG2   . THR E 3 49  ? 19.766  55.778 -113.139 1.00 32.93  ? 49   THR A CG2   1 
ATOM   1240 N  N     . ARG E 3 50  ? 18.026  52.266 -115.220 1.00 30.41  ? 50   ARG A N     1 
ATOM   1241 C  CA    . ARG E 3 50  ? 17.307  51.007 -115.426 1.00 29.89  ? 50   ARG A CA    1 
ATOM   1242 C  C     . ARG E 3 50  ? 18.262  49.926 -115.001 1.00 30.40  ? 50   ARG A C     1 
ATOM   1243 O  O     . ARG E 3 50  ? 18.473  48.963 -115.729 1.00 31.22  ? 50   ARG A O     1 
ATOM   1244 C  CB    . ARG E 3 50  ? 16.944  50.776 -116.895 1.00 42.22  ? 50   ARG A CB    1 
ATOM   1245 C  CG    . ARG E 3 50  ? 15.867  51.691 -117.440 1.00 44.17  ? 50   ARG A CG    1 
ATOM   1246 C  CD    . ARG E 3 50  ? 15.422  51.236 -118.809 1.00 43.01  ? 50   ARG A CD    1 
ATOM   1247 N  NE    . ARG E 3 50  ? 14.864  52.335 -119.595 1.00 45.67  ? 50   ARG A NE    1 
ATOM   1248 C  CZ    . ARG E 3 50  ? 14.728  52.313 -120.915 1.00 43.54  ? 50   ARG A CZ    1 
ATOM   1249 N  NH1   . ARG E 3 50  ? 15.104  51.246 -121.603 1.00 41.01  ? 50   ARG A NH1   1 
ATOM   1250 N  NH2   . ARG E 3 50  ? 14.243  53.370 -121.546 1.00 42.18  ? 50   ARG A NH2   1 
ATOM   1251 N  N     . GLY E 3 51  ? 18.822  50.094 -113.805 1.00 29.26  ? 51   GLY A N     1 
ATOM   1252 C  CA    . GLY E 3 51  ? 19.802  49.164 -113.281 1.00 26.95  ? 51   GLY A CA    1 
ATOM   1253 C  C     . GLY E 3 51  ? 21.086  49.969 -113.164 1.00 25.83  ? 51   GLY A C     1 
ATOM   1254 O  O     . GLY E 3 51  ? 21.082  51.102 -112.671 1.00 22.90  ? 51   GLY A O     1 
ATOM   1255 N  N     . LYS E 3 52  ? 22.181  49.398 -113.635 1.00 32.95  ? 52   LYS A N     1 
ATOM   1256 C  CA    . LYS E 3 52  ? 23.454  50.081 -113.599 1.00 34.39  ? 52   LYS A CA    1 
ATOM   1257 C  C     . LYS E 3 52  ? 23.655  50.760 -114.951 1.00 32.56  ? 52   LYS A C     1 
ATOM   1258 O  O     . LYS E 3 52  ? 24.725  51.300 -115.256 1.00 31.80  ? 52   LYS A O     1 
ATOM   1259 C  CB    . LYS E 3 52  ? 24.566  49.082 -113.304 1.00 39.10  ? 52   LYS A CB    1 
ATOM   1260 C  CG    . LYS E 3 52  ? 24.374  48.394 -111.970 1.00 38.28  ? 52   LYS A CG    1 
ATOM   1261 C  CD    . LYS E 3 52  ? 24.816  46.954 -112.042 1.00 39.88  ? 52   LYS A CD    1 
ATOM   1262 C  CE    . LYS E 3 52  ? 23.987  46.072 -111.140 1.00 40.28  ? 52   LYS A CE    1 
ATOM   1263 N  NZ    . LYS E 3 52  ? 24.162  44.661 -111.555 1.00 42.30  ? 52   LYS A NZ    1 
ATOM   1264 N  N     . ALA E 3 53  ? 22.592  50.742 -115.744 1.00 23.61  ? 53   ALA A N     1 
ATOM   1265 C  CA    . ALA E 3 53  ? 22.592  51.359 -117.065 1.00 24.61  ? 53   ALA A CA    1 
ATOM   1266 C  C     . ALA E 3 53  ? 22.108  52.796 -116.896 1.00 24.27  ? 53   ALA A C     1 
ATOM   1267 O  O     . ALA E 3 53  ? 21.049  53.014 -116.323 1.00 22.84  ? 53   ALA A O     1 
ATOM   1268 C  CB    . ALA E 3 53  ? 21.662  50.579 -118.001 1.00 10.82  ? 53   ALA A CB    1 
ATOM   1269 N  N     . LEU E 3 54  ? 22.882  53.759 -117.397 1.00 30.75  ? 54   LEU A N     1 
ATOM   1270 C  CA    . LEU E 3 54  ? 22.548  55.181 -117.279 1.00 33.81  ? 54   LEU A CA    1 
ATOM   1271 C  C     . LEU E 3 54  ? 22.139  55.842 -118.600 1.00 33.92  ? 54   LEU A C     1 
ATOM   1272 O  O     . LEU E 3 54  ? 22.941  55.946 -119.541 1.00 34.73  ? 54   LEU A O     1 
ATOM   1273 C  CB    . LEU E 3 54  ? 23.736  55.942 -116.700 1.00 42.08  ? 54   LEU A CB    1 
ATOM   1274 C  CG    . LEU E 3 54  ? 23.464  57.389 -116.310 1.00 43.62  ? 54   LEU A CG    1 
ATOM   1275 C  CD1   . LEU E 3 54  ? 23.168  57.425 -114.812 1.00 46.75  ? 54   LEU A CD1   1 
ATOM   1276 C  CD2   . LEU E 3 54  ? 24.669  58.266 -116.631 1.00 46.24  ? 54   LEU A CD2   1 
ATOM   1277 N  N     . LEU E 3 55  ? 20.895  56.313 -118.647 1.00 35.48  ? 55   LEU A N     1 
ATOM   1278 C  CA    . LEU E 3 55  ? 20.333  56.953 -119.835 1.00 34.53  ? 55   LEU A CA    1 
ATOM   1279 C  C     . LEU E 3 55  ? 20.111  58.464 -119.667 1.00 35.42  ? 55   LEU A C     1 
ATOM   1280 O  O     . LEU E 3 55  ? 19.155  58.895 -119.018 1.00 34.76  ? 55   LEU A O     1 
ATOM   1281 C  CB    . LEU E 3 55  ? 19.001  56.288 -120.186 1.00 36.52  ? 55   LEU A CB    1 
ATOM   1282 C  CG    . LEU E 3 55  ? 18.938  54.771 -120.415 1.00 39.84  ? 55   LEU A CG    1 
ATOM   1283 C  CD1   . LEU E 3 55  ? 19.822  54.396 -121.605 1.00 40.55  ? 55   LEU A CD1   1 
ATOM   1284 C  CD2   . LEU E 3 55  ? 19.370  54.018 -119.157 1.00 39.73  ? 55   LEU A CD2   1 
ATOM   1285 N  N     . THR E 3 56  ? 20.995  59.277 -120.236 1.00 52.84  ? 56   THR A N     1 
ATOM   1286 C  CA    . THR E 3 56  ? 20.811  60.724 -120.133 1.00 53.84  ? 56   THR A CA    1 
ATOM   1287 C  C     . THR E 3 56  ? 20.205  61.262 -121.448 1.00 53.72  ? 56   THR A C     1 
ATOM   1288 O  O     . THR E 3 56  ? 20.872  61.398 -122.475 1.00 53.79  ? 56   THR A O     1 
ATOM   1289 C  CB    . THR E 3 56  ? 22.148  61.451 -119.718 1.00 38.03  ? 56   THR A CB    1 
ATOM   1290 O  OG1   . THR E 3 56  ? 22.145  62.803 -120.196 1.00 37.29  ? 56   THR A OG1   1 
ATOM   1291 C  CG2   . THR E 3 56  ? 23.355  60.708 -120.236 1.00 33.58  ? 56   THR A CG2   1 
ATOM   1292 N  N     . HIS E 3 57  ? 18.905  61.533 -121.379 1.00 35.01  ? 57   HIS A N     1 
ATOM   1293 C  CA    . HIS E 3 57  ? 18.103  62.012 -122.497 1.00 33.32  ? 57   HIS A CA    1 
ATOM   1294 C  C     . HIS E 3 57  ? 18.316  63.487 -122.805 1.00 33.50  ? 57   HIS A C     1 
ATOM   1295 O  O     . HIS E 3 57  ? 18.611  64.285 -121.929 1.00 35.42  ? 57   HIS A O     1 
ATOM   1296 C  CB    . HIS E 3 57  ? 16.617  61.782 -122.198 1.00 33.65  ? 57   HIS A CB    1 
ATOM   1297 C  CG    . HIS E 3 57  ? 16.275  60.366 -121.862 1.00 33.20  ? 57   HIS A CG    1 
ATOM   1298 N  ND1   . HIS E 3 57  ? 16.114  59.392 -122.820 1.00 34.47  ? 57   HIS A ND1   1 
ATOM   1299 C  CD2   . HIS E 3 57  ? 16.074  59.755 -120.670 1.00 35.88  ? 57   HIS A CD2   1 
ATOM   1300 C  CE1   . HIS E 3 57  ? 15.823  58.243 -122.235 1.00 35.16  ? 57   HIS A CE1   1 
ATOM   1301 N  NE2   . HIS E 3 57  ? 15.793  58.436 -120.930 1.00 35.23  ? 57   HIS A NE2   1 
ATOM   1302 N  N     . PHE E 3 58  ? 18.145  63.844 -124.066 1.00 30.92  ? 58   PHE A N     1 
ATOM   1303 C  CA    . PHE E 3 58  ? 18.312  65.217 -124.475 1.00 31.57  ? 58   PHE A CA    1 
ATOM   1304 C  C     . PHE E 3 58  ? 17.030  65.737 -125.092 1.00 32.68  ? 58   PHE A C     1 
ATOM   1305 O  O     . PHE E 3 58  ? 16.125  64.970 -125.424 1.00 34.95  ? 58   PHE A O     1 
ATOM   1306 C  CB    . PHE E 3 58  ? 19.467  65.328 -125.465 1.00 35.78  ? 58   PHE A CB    1 
ATOM   1307 C  CG    . PHE E 3 58  ? 20.779  64.920 -124.888 1.00 32.88  ? 58   PHE A CG    1 
ATOM   1308 C  CD1   . PHE E 3 58  ? 21.340  65.643 -123.841 1.00 33.75  ? 58   PHE A CD1   1 
ATOM   1309 C  CD2   . PHE E 3 58  ? 21.447  63.798 -125.368 1.00 29.73  ? 58   PHE A CD2   1 
ATOM   1310 C  CE1   . PHE E 3 58  ? 22.538  65.267 -123.280 1.00 34.99  ? 58   PHE A CE1   1 
ATOM   1311 C  CE2   . PHE E 3 58  ? 22.661  63.409 -124.805 1.00 29.45  ? 58   PHE A CE2   1 
ATOM   1312 C  CZ    . PHE E 3 58  ? 23.205  64.153 -123.757 1.00 32.94  ? 58   PHE A CZ    1 
ATOM   1313 N  N     . SER E 3 59  ? 16.964  67.052 -125.236 1.00 32.90  ? 59   SER A N     1 
ATOM   1314 C  CA    . SER E 3 59  ? 15.805  67.708 -125.788 1.00 32.69  ? 59   SER A CA    1 
ATOM   1315 C  C     . SER E 3 59  ? 15.547  67.330 -127.246 1.00 34.05  ? 59   SER A C     1 
ATOM   1316 O  O     . SER E 3 59  ? 14.428  67.457 -127.724 1.00 32.75  ? 59   SER A O     1 
ATOM   1317 C  CB    . SER E 3 59  ? 15.965  69.222 -125.632 1.00 24.54  ? 59   SER A CB    1 
ATOM   1318 O  OG    . SER E 3 59  ? 17.301  69.629 -125.873 1.00 25.47  ? 59   SER A OG    1 
ATOM   1319 N  N     . ASN E 3 60  ? 16.575  66.856 -127.945 1.00 41.75  ? 60   ASN A N     1 
ATOM   1320 C  CA    . ASN E 3 60  ? 16.421  66.472 -129.341 1.00 42.70  ? 60   ASN A CA    1 
ATOM   1321 C  C     . ASN E 3 60  ? 16.156  64.976 -129.504 1.00 43.93  ? 60   ASN A C     1 
ATOM   1322 O  O     . ASN E 3 60  ? 16.477  64.373 -130.524 1.00 46.19  ? 60   ASN A O     1 
ATOM   1323 C  CB    . ASN E 3 60  ? 17.652  66.901 -130.142 1.00 44.24  ? 60   ASN A CB    1 
ATOM   1324 C  CG    . ASN E 3 60  ? 18.882  66.088 -129.817 1.00 44.72  ? 60   ASN A CG    1 
ATOM   1325 O  OD1   . ASN E 3 60  ? 19.099  65.681 -128.669 1.00 40.83  ? 60   ASN A OD1   1 
ATOM   1326 N  ND2   . ASN E 3 60  ? 19.711  65.855 -130.830 1.00 45.15  ? 60   ASN A ND2   1 
ATOM   1327 N  N     . ASP E 3 61  ? 15.560  64.380 -128.481 1.00 41.92  ? 61   ASP A N     1 
ATOM   1328 C  CA    . ASP E 3 61  ? 15.208  62.970 -128.510 1.00 41.86  ? 61   ASP A CA    1 
ATOM   1329 C  C     . ASP E 3 61  ? 16.359  61.980 -128.532 1.00 40.46  ? 61   ASP A C     1 
ATOM   1330 O  O     . ASP E 3 61  ? 16.158  60.762 -128.630 1.00 39.84  ? 61   ASP A O     1 
ATOM   1331 C  CB    . ASP E 3 61  ? 14.255  62.717 -129.674 1.00 33.33  ? 61   ASP A CB    1 
ATOM   1332 C  CG    . ASP E 3 61  ? 12.847  63.168 -129.361 1.00 32.93  ? 61   ASP A CG    1 
ATOM   1333 O  OD1   . ASP E 3 61  ? 12.305  62.718 -128.330 1.00 33.46  ? 61   ASP A OD1   1 
ATOM   1334 O  OD2   . ASP E 3 61  ? 12.277  63.966 -130.127 1.00 36.75  ? 61   ASP A OD2   1 
ATOM   1335 N  N     . LEU E 3 62  ? 17.571  62.505 -128.433 1.00 41.88  ? 62   LEU A N     1 
ATOM   1336 C  CA    . LEU E 3 62  ? 18.745  61.650 -128.384 1.00 41.52  ? 62   LEU A CA    1 
ATOM   1337 C  C     . LEU E 3 62  ? 18.919  61.241 -126.928 1.00 41.82  ? 62   LEU A C     1 
ATOM   1338 O  O     . LEU E 3 62  ? 18.450  61.940 -126.025 1.00 42.15  ? 62   LEU A O     1 
ATOM   1339 C  CB    . LEU E 3 62  ? 19.984  62.406 -128.846 1.00 31.81  ? 62   LEU A CB    1 
ATOM   1340 C  CG    . LEU E 3 62  ? 20.121  62.590 -130.342 1.00 30.32  ? 62   LEU A CG    1 
ATOM   1341 C  CD1   . LEU E 3 62  ? 21.497  63.195 -130.616 1.00 29.58  ? 62   LEU A CD1   1 
ATOM   1342 C  CD2   . LEU E 3 62  ? 19.956  61.236 -131.044 1.00 25.34  ? 62   LEU A CD2   1 
ATOM   1343 N  N     . THR E 3 63  ? 19.583  60.110 -126.704 1.00 35.41  ? 63   THR A N     1 
ATOM   1344 C  CA    . THR E 3 63  ? 19.814  59.646 -125.352 1.00 33.51  ? 63   THR A CA    1 
ATOM   1345 C  C     . THR E 3 63  ? 21.228  59.114 -125.200 1.00 32.43  ? 63   THR A C     1 
ATOM   1346 O  O     . THR E 3 63  ? 21.687  58.311 -125.986 1.00 32.09  ? 63   THR A O     1 
ATOM   1347 C  CB    . THR E 3 63  ? 18.804  58.547 -124.946 1.00 33.49  ? 63   THR A CB    1 
ATOM   1348 O  OG1   . THR E 3 63  ? 17.467  59.008 -125.179 1.00 35.05  ? 63   THR A OG1   1 
ATOM   1349 C  CG2   . THR E 3 63  ? 18.936  58.236 -123.459 1.00 35.62  ? 63   THR A CG2   1 
ATOM   1350 N  N     . LEU E 3 64  ? 21.933  59.593 -124.189 1.00 35.28  ? 64   LEU A N     1 
ATOM   1351 C  CA    . LEU E 3 64  ? 23.281  59.128 -123.938 1.00 34.69  ? 64   LEU A CA    1 
ATOM   1352 C  C     . LEU E 3 64  ? 23.166  57.932 -122.996 1.00 34.73  ? 64   LEU A C     1 
ATOM   1353 O  O     . LEU E 3 64  ? 22.609  58.041 -121.892 1.00 35.32  ? 64   LEU A O     1 
ATOM   1354 C  CB    . LEU E 3 64  ? 24.128  60.245 -123.309 1.00 37.48  ? 64   LEU A CB    1 
ATOM   1355 C  CG    . LEU E 3 64  ? 25.599  59.947 -122.975 1.00 39.10  ? 64   LEU A CG    1 
ATOM   1356 C  CD1   . LEU E 3 64  ? 26.409  59.718 -124.248 1.00 36.98  ? 64   LEU A CD1   1 
ATOM   1357 C  CD2   . LEU E 3 64  ? 26.180  61.110 -122.176 1.00 40.97  ? 64   LEU A CD2   1 
ATOM   1358 N  N     . TYR E 3 65  ? 23.664  56.786 -123.451 1.00 30.90  ? 65   TYR A N     1 
ATOM   1359 C  CA    . TYR E 3 65  ? 23.633  55.560 -122.666 1.00 32.25  ? 65   TYR A CA    1 
ATOM   1360 C  C     . TYR E 3 65  ? 25.027  55.293 -122.118 1.00 31.59  ? 65   TYR A C     1 
ATOM   1361 O  O     . TYR E 3 65  ? 26.020  55.613 -122.765 1.00 31.67  ? 65   TYR A O     1 
ATOM   1362 C  CB    . TYR E 3 65  ? 23.174  54.377 -123.540 1.00 40.76  ? 65   TYR A CB    1 
ATOM   1363 C  CG    . TYR E 3 65  ? 23.473  52.997 -122.969 1.00 40.53  ? 65   TYR A CG    1 
ATOM   1364 C  CD1   . TYR E 3 65  ? 24.790  52.560 -122.785 1.00 42.07  ? 65   TYR A CD1   1 
ATOM   1365 C  CD2   . TYR E 3 65  ? 22.444  52.142 -122.581 1.00 42.45  ? 65   TYR A CD2   1 
ATOM   1366 C  CE1   . TYR E 3 65  ? 25.074  51.321 -122.221 1.00 41.91  ? 65   TYR A CE1   1 
ATOM   1367 C  CE2   . TYR E 3 65  ? 22.717  50.894 -122.019 1.00 42.58  ? 65   TYR A CE2   1 
ATOM   1368 C  CZ    . TYR E 3 65  ? 24.037  50.495 -121.840 1.00 42.62  ? 65   TYR A CZ    1 
ATOM   1369 O  OH    . TYR E 3 65  ? 24.323  49.272 -121.283 1.00 43.92  ? 65   TYR A OH    1 
ATOM   1370 N  N     . SER E 3 66  ? 25.097  54.727 -120.918 1.00 31.52  ? 66   SER A N     1 
ATOM   1371 C  CA    . SER E 3 66  ? 26.381  54.376 -120.325 1.00 30.87  ? 66   SER A CA    1 
ATOM   1372 C  C     . SER E 3 66  ? 26.274  53.419 -119.145 1.00 30.69  ? 66   SER A C     1 
ATOM   1373 O  O     . SER E 3 66  ? 25.360  53.520 -118.320 1.00 30.43  ? 66   SER A O     1 
ATOM   1374 C  CB    . SER E 3 66  ? 27.169  55.637 -119.911 1.00 33.10  ? 66   SER A CB    1 
ATOM   1375 O  OG    . SER E 3 66  ? 26.437  56.514 -119.080 1.00 34.60  ? 66   SER A OG    1 
ATOM   1376 N  N     . HIS E 3 67  ? 27.207  52.469 -119.099 1.00 38.93  ? 67   HIS A N     1 
ATOM   1377 C  CA    . HIS E 3 67  ? 27.296  51.485 -118.016 1.00 36.36  ? 67   HIS A CA    1 
ATOM   1378 C  C     . HIS E 3 67  ? 28.652  51.717 -117.326 1.00 35.83  ? 67   HIS A C     1 
ATOM   1379 O  O     . HIS E 3 67  ? 29.690  51.749 -117.974 1.00 37.87  ? 67   HIS A O     1 
ATOM   1380 C  CB    . HIS E 3 67  ? 27.224  50.052 -118.558 1.00 25.58  ? 67   HIS A CB    1 
ATOM   1381 C  CG    . HIS E 3 67  ? 27.080  49.022 -117.482 1.00 28.54  ? 67   HIS A CG    1 
ATOM   1382 N  ND1   . HIS E 3 67  ? 28.016  48.857 -116.483 1.00 29.73  ? 67   HIS A ND1   1 
ATOM   1383 C  CD2   . HIS E 3 67  ? 26.053  48.195 -117.170 1.00 27.69  ? 67   HIS A CD2   1 
ATOM   1384 C  CE1   . HIS E 3 67  ? 27.568  47.985 -115.598 1.00 27.74  ? 67   HIS A CE1   1 
ATOM   1385 N  NE2   . HIS E 3 67  ? 26.379  47.570 -115.990 1.00 27.34  ? 67   HIS A NE2   1 
ATOM   1386 N  N     . ASN E 3 68  ? 28.651  51.877 -116.015 1.00 26.56  ? 68   ASN A N     1 
ATOM   1387 C  CA    . ASN E 3 68  ? 29.895  52.137 -115.319 1.00 26.18  ? 68   ASN A CA    1 
ATOM   1388 C  C     . ASN E 3 68  ? 30.690  50.878 -115.034 1.00 28.13  ? 68   ASN A C     1 
ATOM   1389 O  O     . ASN E 3 68  ? 31.846  50.942 -114.571 1.00 29.24  ? 68   ASN A O     1 
ATOM   1390 C  CB    . ASN E 3 68  ? 29.623  52.900 -114.017 1.00 25.57  ? 68   ASN A CB    1 
ATOM   1391 C  CG    . ASN E 3 68  ? 29.474  54.411 -114.229 1.00 25.05  ? 68   ASN A CG    1 
ATOM   1392 O  OD1   . ASN E 3 68  ? 29.116  55.144 -113.312 1.00 21.67  ? 68   ASN A OD1   1 
ATOM   1393 N  ND2   . ASN E 3 68  ? 29.754  54.875 -115.442 1.00 26.37  ? 68   ASN A ND2   1 
ATOM   1394 N  N     . GLN E 3 69  ? 30.085  49.733 -115.338 1.00 25.65  ? 69   GLN A N     1 
ATOM   1395 C  CA    . GLN E 3 69  ? 30.716  48.448 -115.088 1.00 27.01  ? 69   GLN A CA    1 
ATOM   1396 C  C     . GLN E 3 69  ? 31.334  48.462 -113.683 1.00 28.29  ? 69   GLN A C     1 
ATOM   1397 O  O     . GLN E 3 69  ? 30.589  48.514 -112.718 1.00 28.03  ? 69   GLN A O     1 
ATOM   1398 C  CB    . GLN E 3 69  ? 31.721  48.166 -116.198 1.00 37.33  ? 69   GLN A CB    1 
ATOM   1399 C  CG    . GLN E 3 69  ? 31.024  48.244 -117.567 1.00 43.62  ? 69   GLN A CG    1 
ATOM   1400 C  CD    . GLN E 3 69  ? 31.977  48.349 -118.748 1.00 45.39  ? 69   GLN A CD    1 
ATOM   1401 O  OE1   . GLN E 3 69  ? 32.540  47.346 -119.201 1.00 46.19  ? 69   GLN A OE1   1 
ATOM   1402 N  NE2   . GLN E 3 69  ? 32.165  49.574 -119.250 1.00 44.29  ? 69   GLN A NE2   1 
ATOM   1403 N  N     . LEU E 3 70  ? 32.660  48.449 -113.549 1.00 36.56  ? 70   LEU A N     1 
ATOM   1404 C  CA    . LEU E 3 70  ? 33.280  48.455 -112.216 1.00 36.47  ? 70   LEU A CA    1 
ATOM   1405 C  C     . LEU E 3 70  ? 34.246  49.624 -111.963 1.00 37.87  ? 70   LEU A C     1 
ATOM   1406 O  O     . LEU E 3 70  ? 34.764  49.762 -110.864 1.00 37.46  ? 70   LEU A O     1 
ATOM   1407 C  CB    . LEU E 3 70  ? 34.048  47.147 -111.980 1.00 25.85  ? 70   LEU A CB    1 
ATOM   1408 C  CG    . LEU E 3 70  ? 33.317  45.797 -111.924 1.00 26.11  ? 70   LEU A CG    1 
ATOM   1409 C  CD1   . LEU E 3 70  ? 34.269  44.680 -112.323 1.00 23.93  ? 70   LEU A CD1   1 
ATOM   1410 C  CD2   . LEU E 3 70  ? 32.760  45.545 -110.541 1.00 19.39  ? 70   LEU A CD2   1 
ATOM   1411 N  N     . TYR E 3 71  ? 34.473  50.475 -112.961 1.00 37.58  ? 71   TYR A N     1 
ATOM   1412 C  CA    . TYR E 3 71  ? 35.433  51.574 -112.818 1.00 36.97  ? 71   TYR A CA    1 
ATOM   1413 C  C     . TYR E 3 71  ? 34.930  52.985 -113.155 1.00 38.57  ? 71   TYR A C     1 
ATOM   1414 O  O     . TYR E 3 71  ? 35.498  53.987 -112.706 1.00 37.08  ? 71   TYR A O     1 
ATOM   1415 C  CB    . TYR E 3 71  ? 36.669  51.238 -113.668 1.00 30.62  ? 71   TYR A CB    1 
ATOM   1416 C  CG    . TYR E 3 71  ? 36.333  50.565 -114.990 1.00 32.63  ? 71   TYR A CG    1 
ATOM   1417 C  CD1   . TYR E 3 71  ? 35.807  51.289 -116.056 1.00 33.56  ? 71   TYR A CD1   1 
ATOM   1418 C  CD2   . TYR E 3 71  ? 36.499  49.184 -115.162 1.00 35.21  ? 71   TYR A CD2   1 
ATOM   1419 C  CE1   . TYR E 3 71  ? 35.452  50.656 -117.270 1.00 33.94  ? 71   TYR A CE1   1 
ATOM   1420 C  CE2   . TYR E 3 71  ? 36.145  48.541 -116.374 1.00 33.73  ? 71   TYR A CE2   1 
ATOM   1421 C  CZ    . TYR E 3 71  ? 35.626  49.285 -117.418 1.00 33.58  ? 71   TYR A CZ    1 
ATOM   1422 O  OH    . TYR E 3 71  ? 35.297  48.675 -118.608 1.00 34.21  ? 71   TYR A OH    1 
ATOM   1423 N  N     . GLY E 3 72  ? 33.873  53.064 -113.956 1.00 70.45  ? 72   GLY A N     1 
ATOM   1424 C  CA    . GLY E 3 72  ? 33.331  54.358 -114.327 1.00 72.09  ? 72   GLY A CA    1 
ATOM   1425 C  C     . GLY E 3 72  ? 32.639  55.060 -113.172 1.00 72.29  ? 72   GLY A C     1 
ATOM   1426 O  O     . GLY E 3 72  ? 31.917  54.437 -112.395 1.00 74.97  ? 72   GLY A O     1 
ATOM   1427 N  N     . VAL E 3 73  ? 32.858  56.363 -113.057 1.00 39.26  ? 73   VAL A N     1 
ATOM   1428 C  CA    . VAL E 3 73  ? 32.249  57.144 -111.995 1.00 37.26  ? 73   VAL A CA    1 
ATOM   1429 C  C     . VAL E 3 73  ? 31.921  58.555 -112.491 1.00 38.59  ? 73   VAL A C     1 
ATOM   1430 O  O     . VAL E 3 73  ? 32.638  59.120 -113.322 1.00 40.67  ? 73   VAL A O     1 
ATOM   1431 C  CB    . VAL E 3 73  ? 33.193  57.227 -110.779 1.00 25.70  ? 73   VAL A CB    1 
ATOM   1432 C  CG1   . VAL E 3 73  ? 34.532  57.821 -111.196 1.00 22.23  ? 73   VAL A CG1   1 
ATOM   1433 C  CG2   . VAL E 3 73  ? 32.555  58.056 -109.675 1.00 22.65  ? 73   VAL A CG2   1 
ATOM   1434 N  N     . TRP E 3 74  ? 30.832  59.124 -111.995 1.00 37.52  ? 74   TRP A N     1 
ATOM   1435 C  CA    . TRP E 3 74  ? 30.454  60.466 -112.411 1.00 36.49  ? 74   TRP A CA    1 
ATOM   1436 C  C     . TRP E 3 74  ? 30.866  61.515 -111.415 1.00 37.36  ? 74   TRP A C     1 
ATOM   1437 O  O     . TRP E 3 74  ? 30.702  61.351 -110.200 1.00 39.23  ? 74   TRP A O     1 
ATOM   1438 C  CB    . TRP E 3 74  ? 28.936  60.594 -112.614 1.00 29.79  ? 74   TRP A CB    1 
ATOM   1439 C  CG    . TRP E 3 74  ? 28.425  59.986 -113.881 1.00 27.29  ? 74   TRP A CG    1 
ATOM   1440 C  CD1   . TRP E 3 74  ? 27.971  58.711 -114.056 1.00 26.21  ? 74   TRP A CD1   1 
ATOM   1441 C  CD2   . TRP E 3 74  ? 28.323  60.628 -115.152 1.00 24.80  ? 74   TRP A CD2   1 
ATOM   1442 N  NE1   . TRP E 3 74  ? 27.590  58.518 -115.355 1.00 24.63  ? 74   TRP A NE1   1 
ATOM   1443 C  CE2   . TRP E 3 74  ? 27.792  59.680 -116.054 1.00 25.27  ? 74   TRP A CE2   1 
ATOM   1444 C  CE3   . TRP E 3 74  ? 28.626  61.913 -115.620 1.00 21.61  ? 74   TRP A CE3   1 
ATOM   1445 C  CZ2   . TRP E 3 74  ? 27.553  59.982 -117.407 1.00 25.78  ? 74   TRP A CZ2   1 
ATOM   1446 C  CZ3   . TRP E 3 74  ? 28.389  62.212 -116.956 1.00 21.15  ? 74   TRP A CZ3   1 
ATOM   1447 C  CH2   . TRP E 3 74  ? 27.857  61.252 -117.834 1.00 22.84  ? 74   TRP A CH2   1 
ATOM   1448 N  N     . ARG E 3 75  ? 31.390  62.611 -111.931 1.00 49.15  ? 75   ARG A N     1 
ATOM   1449 C  CA    . ARG E 3 75  ? 31.779  63.717 -111.082 1.00 49.64  ? 75   ARG A CA    1 
ATOM   1450 C  C     . ARG E 3 75  ? 30.829  64.865 -111.418 1.00 49.40  ? 75   ARG A C     1 
ATOM   1451 O  O     . ARG E 3 75  ? 30.155  64.847 -112.448 1.00 50.49  ? 75   ARG A O     1 
ATOM   1452 C  CB    . ARG E 3 75  ? 33.232  64.112 -111.360 1.00 47.81  ? 75   ARG A CB    1 
ATOM   1453 C  CG    . ARG E 3 75  ? 34.236  63.716 -110.264 1.00 50.25  ? 75   ARG A CG    1 
ATOM   1454 C  CD    . ARG E 3 75  ? 34.080  62.258 -109.782 1.00 53.35  ? 75   ARG A CD    1 
ATOM   1455 N  NE    . ARG E 3 75  ? 35.284  61.774 -109.101 1.00 54.27  ? 75   ARG A NE    1 
ATOM   1456 C  CZ    . ARG E 3 75  ? 35.359  60.666 -108.360 1.00 55.45  ? 75   ARG A CZ    1 
ATOM   1457 N  NH1   . ARG E 3 75  ? 34.291  59.898 -108.179 1.00 55.89  ? 75   ARG A NH1   1 
ATOM   1458 N  NH2   . ARG E 3 75  ? 36.519  60.319 -107.804 1.00 54.09  ? 75   ARG A NH2   1 
ATOM   1459 N  N     . VAL E 3 76  ? 30.738  65.832 -110.520 1.00 32.60  ? 76   VAL A N     1 
ATOM   1460 C  CA    . VAL E 3 76  ? 29.916  67.001 -110.733 1.00 30.43  ? 76   VAL A CA    1 
ATOM   1461 C  C     . VAL E 3 76  ? 30.770  68.109 -110.161 1.00 31.74  ? 76   VAL A C     1 
ATOM   1462 O  O     . VAL E 3 76  ? 31.019  68.157 -108.947 1.00 30.76  ? 76   VAL A O     1 
ATOM   1463 C  CB    . VAL E 3 76  ? 28.563  66.949 -109.965 1.00 32.66  ? 76   VAL A CB    1 
ATOM   1464 C  CG1   . VAL E 3 76  ? 27.876  68.319 -110.043 1.00 31.19  ? 76   VAL A CG1   1 
ATOM   1465 C  CG2   . VAL E 3 76  ? 27.637  65.885 -110.570 1.00 30.53  ? 76   VAL A CG2   1 
ATOM   1466 N  N     . VAL E 3 77  ? 31.238  68.984 -111.044 1.00 31.24  ? 77   VAL A N     1 
ATOM   1467 C  CA    . VAL E 3 77  ? 32.076  70.096 -110.650 1.00 29.83  ? 77   VAL A CA    1 
ATOM   1468 C  C     . VAL E 3 77  ? 31.469  71.380 -111.150 1.00 31.72  ? 77   VAL A C     1 
ATOM   1469 O  O     . VAL E 3 77  ? 30.475  71.374 -111.886 1.00 31.47  ? 77   VAL A O     1 
ATOM   1470 C  CB    . VAL E 3 77  ? 33.466  69.983 -111.275 1.00 29.41  ? 77   VAL A CB    1 
ATOM   1471 C  CG1   . VAL E 3 77  ? 34.119  68.671 -110.848 1.00 28.22  ? 77   VAL A CG1   1 
ATOM   1472 C  CG2   . VAL E 3 77  ? 33.359  70.106 -112.815 1.00 25.83  ? 77   VAL A CG2   1 
ATOM   1473 N  N     . ASP E 3 78  ? 32.079  72.491 -110.759 1.00 37.11  ? 78   ASP A N     1 
ATOM   1474 C  CA    . ASP E 3 78  ? 31.612  73.787 -111.203 1.00 38.26  ? 78   ASP A CA    1 
ATOM   1475 C  C     . ASP E 3 78  ? 32.273  74.008 -112.543 1.00 38.96  ? 78   ASP A C     1 
ATOM   1476 O  O     . ASP E 3 78  ? 33.423  73.621 -112.737 1.00 40.11  ? 78   ASP A O     1 
ATOM   1477 C  CB    . ASP E 3 78  ? 32.002  74.849 -110.189 1.00 43.84  ? 78   ASP A CB    1 
ATOM   1478 C  CG    . ASP E 3 78  ? 31.301  74.642 -108.870 1.00 49.14  ? 78   ASP A CG    1 
ATOM   1479 O  OD1   . ASP E 3 78  ? 30.056  74.764 -108.845 1.00 50.07  ? 78   ASP A OD1   1 
ATOM   1480 O  OD2   . ASP E 3 78  ? 31.984  74.330 -107.866 1.00 51.86  ? 78   ASP A OD2   1 
ATOM   1481 N  N     . THR E 3 79  ? 31.544  74.614 -113.471 1.00 31.42  ? 79   THR A N     1 
ATOM   1482 C  CA    . THR E 3 79  ? 32.066  74.829 -114.814 1.00 32.35  ? 79   THR A CA    1 
ATOM   1483 C  C     . THR E 3 79  ? 33.452  75.473 -114.903 1.00 30.80  ? 79   THR A C     1 
ATOM   1484 O  O     . THR E 3 79  ? 33.690  76.530 -114.343 1.00 30.96  ? 79   THR A O     1 
ATOM   1485 C  CB    . THR E 3 79  ? 31.056  75.624 -115.644 1.00 46.21  ? 79   THR A CB    1 
ATOM   1486 O  OG1   . THR E 3 79  ? 29.847  74.869 -115.727 1.00 48.94  ? 79   THR A OG1   1 
ATOM   1487 C  CG2   . THR E 3 79  ? 31.580  75.875 -117.052 1.00 47.88  ? 79   THR A CG2   1 
ATOM   1488 N  N     . GLY E 3 80  ? 34.359  74.814 -115.614 1.00 32.36  ? 80   GLY A N     1 
ATOM   1489 C  CA    . GLY E 3 80  ? 35.708  75.333 -115.775 1.00 35.36  ? 80   GLY A CA    1 
ATOM   1490 C  C     . GLY E 3 80  ? 36.674  74.727 -114.776 1.00 36.78  ? 80   GLY A C     1 
ATOM   1491 O  O     . GLY E 3 80  ? 37.889  74.881 -114.876 1.00 37.68  ? 80   GLY A O     1 
ATOM   1492 N  N     . GLU E 3 81  ? 36.113  74.040 -113.790 1.00 32.95  ? 81   GLU A N     1 
ATOM   1493 C  CA    . GLU E 3 81  ? 36.893  73.389 -112.756 1.00 33.35  ? 81   GLU A CA    1 
ATOM   1494 C  C     . GLU E 3 81  ? 37.087  71.910 -113.118 1.00 34.21  ? 81   GLU A C     1 
ATOM   1495 O  O     . GLU E 3 81  ? 36.197  71.268 -113.656 1.00 33.23  ? 81   GLU A O     1 
ATOM   1496 C  CB    . GLU E 3 81  ? 36.159  73.509 -111.423 1.00 51.68  ? 81   GLU A CB    1 
ATOM   1497 C  CG    . GLU E 3 81  ? 37.068  73.713 -110.240 1.00 56.68  ? 81   GLU A CG    1 
ATOM   1498 C  CD    . GLU E 3 81  ? 37.527  75.149 -110.111 1.00 59.82  ? 81   GLU A CD    1 
ATOM   1499 O  OE1   . GLU E 3 81  ? 36.673  76.014 -109.803 1.00 61.73  ? 81   GLU A OE1   1 
ATOM   1500 O  OE2   . GLU E 3 81  ? 38.732  75.413 -110.322 1.00 60.43  ? 81   GLU A OE2   1 
ATOM   1501 N  N     . GLU E 3 82  ? 38.265  71.372 -112.848 1.00 47.09  ? 82   GLU A N     1 
ATOM   1502 C  CA    . GLU E 3 82  ? 38.500  69.967 -113.132 1.00 48.93  ? 82   GLU A CA    1 
ATOM   1503 C  C     . GLU E 3 82  ? 39.470  69.344 -112.145 1.00 49.40  ? 82   GLU A C     1 
ATOM   1504 O  O     . GLU E 3 82  ? 40.646  69.200 -112.432 1.00 50.47  ? 82   GLU A O     1 
ATOM   1505 C  CB    . GLU E 3 82  ? 39.002  69.771 -114.575 1.00 51.34  ? 82   GLU A CB    1 
ATOM   1506 C  CG    . GLU E 3 82  ? 39.334  68.318 -114.918 1.00 51.66  ? 82   GLU A CG    1 
ATOM   1507 C  CD    . GLU E 3 82  ? 39.412  68.038 -116.411 1.00 54.33  ? 82   GLU A CD    1 
ATOM   1508 O  OE1   . GLU E 3 82  ? 40.153  68.749 -117.131 1.00 53.82  ? 82   GLU A OE1   1 
ATOM   1509 O  OE2   . GLU E 3 82  ? 38.729  67.091 -116.863 1.00 54.44  ? 82   GLU A OE2   1 
ATOM   1510 N  N     . PRO E 3 83  ? 38.991  69.001 -110.944 1.00 49.32  ? 83   PRO A N     1 
ATOM   1511 C  CA    . PRO E 3 83  ? 39.883  68.385 -109.961 1.00 50.90  ? 83   PRO A CA    1 
ATOM   1512 C  C     . PRO E 3 83  ? 40.667  67.293 -110.684 1.00 52.65  ? 83   PRO A C     1 
ATOM   1513 O  O     . PRO E 3 83  ? 40.156  66.694 -111.640 1.00 53.83  ? 83   PRO A O     1 
ATOM   1514 C  CB    . PRO E 3 83  ? 38.911  67.814 -108.935 1.00 43.13  ? 83   PRO A CB    1 
ATOM   1515 C  CG    . PRO E 3 83  ? 37.837  68.835 -108.922 1.00 44.37  ? 83   PRO A CG    1 
ATOM   1516 C  CD    . PRO E 3 83  ? 37.632  69.156 -110.395 1.00 44.43  ? 83   PRO A CD    1 
ATOM   1517 N  N     . GLN E 3 84  ? 41.894  67.031 -110.243 1.00 61.99  ? 84   GLN A N     1 
ATOM   1518 C  CA    . GLN E 3 84  ? 42.708  66.017 -110.901 1.00 63.36  ? 84   GLN A CA    1 
ATOM   1519 C  C     . GLN E 3 84  ? 42.634  64.589 -110.390 1.00 62.02  ? 84   GLN A C     1 
ATOM   1520 O  O     . GLN E 3 84  ? 42.169  64.320 -109.279 1.00 60.54  ? 84   GLN A O     1 
ATOM   1521 C  CB    . GLN E 3 84  ? 44.172  66.458 -110.962 1.00 65.77  ? 84   GLN A CB    1 
ATOM   1522 C  CG    . GLN E 3 84  ? 44.487  67.205 -112.244 1.00 66.59  ? 84   GLN A CG    1 
ATOM   1523 C  CD    . GLN E 3 84  ? 43.981  66.459 -113.462 1.00 65.40  ? 84   GLN A CD    1 
ATOM   1524 O  OE1   . GLN E 3 84  ? 44.492  65.394 -113.803 1.00 65.94  ? 84   GLN A OE1   1 
ATOM   1525 N  NE2   . GLN E 3 84  ? 42.958  67.007 -114.113 1.00 63.14  ? 84   GLN A NE2   1 
ATOM   1526 N  N     . THR E 3 85  ? 43.106  63.692 -111.253 1.00 58.49  ? 85   THR A N     1 
ATOM   1527 C  CA    . THR E 3 85  ? 43.147  62.250 -111.031 1.00 59.22  ? 85   THR A CA    1 
ATOM   1528 C  C     . THR E 3 85  ? 43.721  61.624 -112.304 1.00 58.63  ? 85   THR A C     1 
ATOM   1529 O  O     . THR E 3 85  ? 43.819  62.284 -113.337 1.00 59.27  ? 85   THR A O     1 
ATOM   1530 C  CB    . THR E 3 85  ? 41.736  61.668 -110.799 1.00 71.87  ? 85   THR A CB    1 
ATOM   1531 O  OG1   . THR E 3 85  ? 41.823  60.243 -110.675 1.00 74.06  ? 85   THR A OG1   1 
ATOM   1532 C  CG2   . THR E 3 85  ? 40.818  62.012 -111.964 1.00 72.18  ? 85   THR A CG2   1 
ATOM   1533 N  N     . THR E 3 86  ? 44.095  60.354 -112.236 1.00 57.95  ? 86   THR A N     1 
ATOM   1534 C  CA    . THR E 3 86  ? 44.657  59.681 -113.398 1.00 56.55  ? 86   THR A CA    1 
ATOM   1535 C  C     . THR E 3 86  ? 43.557  59.074 -114.259 1.00 55.25  ? 86   THR A C     1 
ATOM   1536 O  O     . THR E 3 86  ? 43.824  58.550 -115.342 1.00 55.54  ? 86   THR A O     1 
ATOM   1537 C  CB    . THR E 3 86  ? 45.637  58.599 -112.953 1.00 67.32  ? 86   THR A CB    1 
ATOM   1538 N  N     . ARG E 3 87  ? 42.322  59.152 -113.774 1.00 64.42  ? 87   ARG A N     1 
ATOM   1539 C  CA    . ARG E 3 87  ? 41.171  58.612 -114.504 1.00 63.44  ? 87   ARG A CA    1 
ATOM   1540 C  C     . ARG E 3 87  ? 41.045  59.209 -115.909 1.00 62.22  ? 87   ARG A C     1 
ATOM   1541 O  O     . ARG E 3 87  ? 41.333  60.383 -116.121 1.00 63.02  ? 87   ARG A O     1 
ATOM   1542 C  CB    . ARG E 3 87  ? 39.872  58.859 -113.715 1.00 42.40  ? 87   ARG A CB    1 
ATOM   1543 C  CG    . ARG E 3 87  ? 39.713  57.987 -112.478 1.00 40.38  ? 87   ARG A CG    1 
ATOM   1544 C  CD    . ARG E 3 87  ? 38.389  58.275 -111.762 1.00 40.99  ? 87   ARG A CD    1 
ATOM   1545 N  NE    . ARG E 3 87  ? 38.143  57.340 -110.667 1.00 38.02  ? 87   ARG A NE    1 
ATOM   1546 C  CZ    . ARG E 3 87  ? 37.882  56.046 -110.830 1.00 39.18  ? 87   ARG A CZ    1 
ATOM   1547 N  NH1   . ARG E 3 87  ? 37.820  55.513 -112.038 1.00 39.49  ? 87   ARG A NH1   1 
ATOM   1548 N  NH2   . ARG E 3 87  ? 37.700  55.270 -109.780 1.00 43.21  ? 87   ARG A NH2   1 
ATOM   1549 N  N     . VAL E 3 88  ? 40.620  58.393 -116.864 1.00 53.88  ? 88   VAL A N     1 
ATOM   1550 C  CA    . VAL E 3 88  ? 40.452  58.847 -118.239 1.00 52.87  ? 88   VAL A CA    1 
ATOM   1551 C  C     . VAL E 3 88  ? 39.040  59.385 -118.483 1.00 53.99  ? 88   VAL A C     1 
ATOM   1552 O  O     . VAL E 3 88  ? 38.075  58.621 -118.529 1.00 53.49  ? 88   VAL A O     1 
ATOM   1553 C  CB    . VAL E 3 88  ? 40.731  57.699 -119.249 1.00 33.79  ? 88   VAL A CB    1 
ATOM   1554 C  CG1   . VAL E 3 88  ? 39.944  56.450 -118.862 1.00 31.47  ? 88   VAL A CG1   1 
ATOM   1555 C  CG2   . VAL E 3 88  ? 40.366  58.149 -120.651 1.00 31.82  ? 88   VAL A CG2   1 
ATOM   1556 N  N     . LEU E 3 89  ? 38.927  60.702 -118.641 1.00 43.53  ? 89   LEU A N     1 
ATOM   1557 C  CA    . LEU E 3 89  ? 37.639  61.339 -118.886 1.00 40.41  ? 89   LEU A CA    1 
ATOM   1558 C  C     . LEU E 3 89  ? 37.034  60.803 -120.166 1.00 39.39  ? 89   LEU A C     1 
ATOM   1559 O  O     . LEU E 3 89  ? 37.711  60.695 -121.183 1.00 37.78  ? 89   LEU A O     1 
ATOM   1560 C  CB    . LEU E 3 89  ? 37.802  62.854 -118.998 1.00 38.71  ? 89   LEU A CB    1 
ATOM   1561 C  CG    . LEU E 3 89  ? 36.517  63.632 -119.294 1.00 37.17  ? 89   LEU A CG    1 
ATOM   1562 C  CD1   . LEU E 3 89  ? 35.513  63.469 -118.158 1.00 34.85  ? 89   LEU A CD1   1 
ATOM   1563 C  CD2   . LEU E 3 89  ? 36.865  65.090 -119.475 1.00 37.54  ? 89   LEU A CD2   1 
ATOM   1564 N  N     . ARG E 3 90  ? 35.750  60.474 -120.110 1.00 64.33  ? 90   ARG A N     1 
ATOM   1565 C  CA    . ARG E 3 90  ? 35.059  59.929 -121.268 1.00 63.88  ? 90   ARG A CA    1 
ATOM   1566 C  C     . ARG E 3 90  ? 33.949  60.816 -121.792 1.00 63.27  ? 90   ARG A C     1 
ATOM   1567 O  O     . ARG E 3 90  ? 33.607  60.739 -122.973 1.00 64.72  ? 90   ARG A O     1 
ATOM   1568 C  CB    . ARG E 3 90  ? 34.504  58.535 -120.947 1.00 40.46  ? 90   ARG A CB    1 
ATOM   1569 C  CG    . ARG E 3 90  ? 35.400  57.400 -121.435 1.00 40.12  ? 90   ARG A CG    1 
ATOM   1570 C  CD    . ARG E 3 90  ? 36.793  57.476 -120.845 1.00 40.12  ? 90   ARG A CD    1 
ATOM   1571 N  NE    . ARG E 3 90  ? 37.783  56.797 -121.682 1.00 43.38  ? 90   ARG A NE    1 
ATOM   1572 C  CZ    . ARG E 3 90  ? 37.870  55.476 -121.854 1.00 43.68  ? 90   ARG A CZ    1 
ATOM   1573 N  NH1   . ARG E 3 90  ? 37.018  54.656 -121.245 1.00 42.05  ? 90   ARG A NH1   1 
ATOM   1574 N  NH2   . ARG E 3 90  ? 38.825  54.974 -122.633 1.00 42.14  ? 90   ARG A NH2   1 
ATOM   1575 N  N     . VAL E 3 91  ? 33.386  61.653 -120.922 1.00 43.54  ? 91   VAL A N     1 
ATOM   1576 C  CA    . VAL E 3 91  ? 32.314  62.556 -121.330 1.00 38.81  ? 91   VAL A CA    1 
ATOM   1577 C  C     . VAL E 3 91  ? 32.271  63.853 -120.543 1.00 40.33  ? 91   VAL A C     1 
ATOM   1578 O  O     . VAL E 3 91  ? 32.429  63.857 -119.316 1.00 39.09  ? 91   VAL A O     1 
ATOM   1579 C  CB    . VAL E 3 91  ? 30.892  61.933 -121.172 1.00 24.79  ? 91   VAL A CB    1 
ATOM   1580 C  CG1   . VAL E 3 91  ? 29.838  62.933 -121.704 1.00 16.83  ? 91   VAL A CG1   1 
ATOM   1581 C  CG2   . VAL E 3 91  ? 30.801  60.572 -121.864 1.00 18.18  ? 91   VAL A CG2   1 
ATOM   1582 N  N     . LYS E 3 92  ? 32.017  64.942 -121.268 1.00 36.36  ? 92   LYS A N     1 
ATOM   1583 C  CA    . LYS E 3 92  ? 31.886  66.275 -120.688 1.00 32.79  ? 92   LYS A CA    1 
ATOM   1584 C  C     . LYS E 3 92  ? 30.570  66.859 -121.213 1.00 31.96  ? 92   LYS A C     1 
ATOM   1585 O  O     . LYS E 3 92  ? 30.340  66.923 -122.430 1.00 30.58  ? 92   LYS A O     1 
ATOM   1586 C  CB    . LYS E 3 92  ? 33.056  67.157 -121.115 1.00 29.17  ? 92   LYS A CB    1 
ATOM   1587 C  CG    . LYS E 3 92  ? 33.429  68.261 -120.133 1.00 29.59  ? 92   LYS A CG    1 
ATOM   1588 C  CD    . LYS E 3 92  ? 32.537  69.466 -120.198 1.00 30.67  ? 92   LYS A CD    1 
ATOM   1589 C  CE    . LYS E 3 92  ? 33.266  70.650 -120.816 1.00 29.32  ? 92   LYS A CE    1 
ATOM   1590 N  NZ    . LYS E 3 92  ? 33.560  70.438 -122.260 1.00 26.85  ? 92   LYS A NZ    1 
ATOM   1591 N  N     . LEU E 3 93  ? 29.697  67.229 -120.280 1.00 21.14  ? 93   LEU A N     1 
ATOM   1592 C  CA    . LEU E 3 93  ? 28.402  67.841 -120.557 1.00 20.27  ? 93   LEU A CA    1 
ATOM   1593 C  C     . LEU E 3 93  ? 28.410  69.093 -119.665 1.00 21.59  ? 93   LEU A C     1 
ATOM   1594 O  O     . LEU E 3 93  ? 28.180  69.033 -118.451 1.00 20.71  ? 93   LEU A O     1 
ATOM   1595 C  CB    . LEU E 3 93  ? 27.248  66.907 -120.165 1.00 33.03  ? 93   LEU A CB    1 
ATOM   1596 C  CG    . LEU E 3 93  ? 26.735  65.838 -121.143 1.00 36.84  ? 93   LEU A CG    1 
ATOM   1597 C  CD1   . LEU E 3 93  ? 25.723  64.949 -120.428 1.00 38.12  ? 93   LEU A CD1   1 
ATOM   1598 C  CD2   . LEU E 3 93  ? 26.079  66.487 -122.377 1.00 35.15  ? 93   LEU A CD2   1 
ATOM   1599 N  N     . GLN E 3 94  ? 28.650  70.238 -120.283 1.00 31.34  ? 94   GLN A N     1 
ATOM   1600 C  CA    . GLN E 3 94  ? 28.770  71.485 -119.539 1.00 31.80  ? 94   GLN A CA    1 
ATOM   1601 C  C     . GLN E 3 94  ? 27.756  72.577 -119.831 1.00 30.35  ? 94   GLN A C     1 
ATOM   1602 O  O     . GLN E 3 94  ? 27.318  72.744 -120.973 1.00 26.74  ? 94   GLN A O     1 
ATOM   1603 C  CB    . GLN E 3 94  ? 30.200  72.006 -119.765 1.00 34.35  ? 94   GLN A CB    1 
ATOM   1604 C  CG    . GLN E 3 94  ? 30.556  73.340 -119.210 1.00 36.39  ? 94   GLN A CG    1 
ATOM   1605 C  CD    . GLN E 3 94  ? 31.905  73.797 -119.732 1.00 40.13  ? 94   GLN A CD    1 
ATOM   1606 O  OE1   . GLN E 3 94  ? 32.922  73.100 -119.566 1.00 41.50  ? 94   GLN A OE1   1 
ATOM   1607 N  NE2   . GLN E 3 94  ? 31.926  74.964 -120.381 1.00 37.92  ? 94   GLN A NE2   1 
ATOM   1608 N  N     . THR E 3 95  ? 27.388  73.303 -118.771 1.00 23.89  ? 95   THR A N     1 
ATOM   1609 C  CA    . THR E 3 95  ? 26.468  74.427 -118.876 1.00 25.69  ? 95   THR A CA    1 
ATOM   1610 C  C     . THR E 3 95  ? 27.114  75.647 -118.222 1.00 26.03  ? 95   THR A C     1 
ATOM   1611 O  O     . THR E 3 95  ? 28.262  75.577 -117.787 1.00 26.52  ? 95   THR A O     1 
ATOM   1612 C  CB    . THR E 3 95  ? 25.066  74.123 -118.232 1.00 28.41  ? 95   THR A CB    1 
ATOM   1613 O  OG1   . THR E 3 95  ? 25.094  74.382 -116.825 1.00 28.27  ? 95   THR A OG1   1 
ATOM   1614 C  CG2   . THR E 3 95  ? 24.654  72.658 -118.508 1.00 23.58  ? 95   THR A CG2   1 
ATOM   1615 N  N     . ALA E 3 96  ? 26.404  76.771 -118.166 1.00 34.51  ? 96   ALA A N     1 
ATOM   1616 C  CA    . ALA E 3 96  ? 26.968  77.992 -117.561 1.00 35.33  ? 96   ALA A CA    1 
ATOM   1617 C  C     . ALA E 3 96  ? 27.682  77.779 -116.219 1.00 35.57  ? 96   ALA A C     1 
ATOM   1618 O  O     . ALA E 3 96  ? 28.854  78.129 -116.060 1.00 31.95  ? 96   ALA A O     1 
ATOM   1619 C  CB    . ALA E 3 96  ? 25.868  79.057 -117.392 1.00 21.45  ? 96   ALA A CB    1 
ATOM   1620 N  N     . ASP E 3 97  ? 26.978  77.194 -115.256 1.00 36.04  ? 97   ASP A N     1 
ATOM   1621 C  CA    . ASP E 3 97  ? 27.559  76.986 -113.937 1.00 38.39  ? 97   ASP A CA    1 
ATOM   1622 C  C     . ASP E 3 97  ? 28.017  75.565 -113.609 1.00 38.57  ? 97   ASP A C     1 
ATOM   1623 O  O     . ASP E 3 97  ? 29.174  75.347 -113.246 1.00 37.94  ? 97   ASP A O     1 
ATOM   1624 C  CB    . ASP E 3 97  ? 26.576  77.482 -112.866 1.00 40.36  ? 97   ASP A CB    1 
ATOM   1625 C  CG    . ASP E 3 97  ? 25.347  76.601 -112.737 1.00 42.38  ? 97   ASP A CG    1 
ATOM   1626 O  OD1   . ASP E 3 97  ? 24.915  76.012 -113.747 1.00 40.08  ? 97   ASP A OD1   1 
ATOM   1627 O  OD2   . ASP E 3 97  ? 24.798  76.507 -111.620 1.00 46.17  ? 97   ASP A OD2   1 
ATOM   1628 N  N     . LYS E 3 98  ? 27.113  74.603 -113.745 1.00 38.21  ? 98   LYS A N     1 
ATOM   1629 C  CA    . LYS E 3 98  ? 27.418  73.211 -113.430 1.00 37.41  ? 98   LYS A CA    1 
ATOM   1630 C  C     . LYS E 3 98  ? 27.859  72.376 -114.635 1.00 37.24  ? 98   LYS A C     1 
ATOM   1631 O  O     . LYS E 3 98  ? 27.469  72.628 -115.778 1.00 37.55  ? 98   LYS A O     1 
ATOM   1632 C  CB    . LYS E 3 98  ? 26.196  72.552 -112.778 1.00 37.70  ? 98   LYS A CB    1 
ATOM   1633 C  CG    . LYS E 3 98  ? 25.570  73.343 -111.616 1.00 38.49  ? 98   LYS A CG    1 
ATOM   1634 C  CD    . LYS E 3 98  ? 26.531  73.534 -110.431 1.00 40.24  ? 98   LYS A CD    1 
ATOM   1635 C  CE    . LYS E 3 98  ? 27.184  72.223 -110.009 1.00 40.20  ? 98   LYS A CE    1 
ATOM   1636 N  NZ    . LYS E 3 98  ? 28.129  72.399 -108.879 1.00 39.71  ? 98   LYS A NZ    1 
ATOM   1637 N  N     . THR E 3 99  ? 28.699  71.389 -114.355 1.00 37.55  ? 99   THR A N     1 
ATOM   1638 C  CA    . THR E 3 99  ? 29.196  70.466 -115.363 1.00 36.33  ? 99   THR A CA    1 
ATOM   1639 C  C     . THR E 3 99  ? 29.310  69.099 -114.711 1.00 36.86  ? 99   THR A C     1 
ATOM   1640 O  O     . THR E 3 99  ? 29.492  68.962 -113.504 1.00 38.41  ? 99   THR A O     1 
ATOM   1641 C  CB    . THR E 3 99  ? 30.582  70.874 -115.928 1.00 30.35  ? 99   THR A CB    1 
ATOM   1642 O  OG1   . THR E 3 99  ? 30.468  72.124 -116.631 1.00 30.15  ? 99   THR A OG1   1 
ATOM   1643 C  CG2   . THR E 3 99  ? 31.110  69.801 -116.874 1.00 22.70  ? 99   THR A CG2   1 
ATOM   1644 N  N     . ILE E 3 100 ? 29.180  68.080 -115.532 1.00 28.96  ? 100  ILE A N     1 
ATOM   1645 C  CA    . ILE E 3 100 ? 29.248  66.722 -115.073 1.00 26.48  ? 100  ILE A CA    1 
ATOM   1646 C  C     . ILE E 3 100 ? 30.355  66.055 -115.877 1.00 26.31  ? 100  ILE A C     1 
ATOM   1647 O  O     . ILE E 3 100 ? 30.573  66.368 -117.057 1.00 21.71  ? 100  ILE A O     1 
ATOM   1648 C  CB    . ILE E 3 100 ? 27.899  66.037 -115.316 1.00 38.01  ? 100  ILE A CB    1 
ATOM   1649 C  CG1   . ILE E 3 100 ? 27.547  66.090 -116.798 1.00 37.59  ? 100  ILE A CG1   1 
ATOM   1650 C  CG2   . ILE E 3 100 ? 26.802  66.769 -114.540 1.00 36.75  ? 100  ILE A CG2   1 
ATOM   1651 C  CD1   . ILE E 3 100 ? 26.287  65.339 -117.136 1.00 39.02  ? 100  ILE A CD1   1 
ATOM   1652 N  N     . LEU E 3 101 ? 31.070  65.147 -115.225 1.00 38.14  ? 101  LEU A N     1 
ATOM   1653 C  CA    . LEU E 3 101 ? 32.165  64.446 -115.870 1.00 38.11  ? 101  LEU A CA    1 
ATOM   1654 C  C     . LEU E 3 101 ? 32.095  62.942 -115.640 1.00 38.56  ? 101  LEU A C     1 
ATOM   1655 O  O     . LEU E 3 101 ? 31.865  62.485 -114.538 1.00 39.48  ? 101  LEU A O     1 
ATOM   1656 C  CB    . LEU E 3 101 ? 33.512  65.003 -115.362 1.00 31.54  ? 101  LEU A CB    1 
ATOM   1657 C  CG    . LEU E 3 101 ? 33.761  66.507 -115.582 1.00 30.85  ? 101  LEU A CG    1 
ATOM   1658 C  CD1   . LEU E 3 101 ? 34.889  67.008 -114.666 1.00 31.25  ? 101  LEU A CD1   1 
ATOM   1659 C  CD2   . LEU E 3 101 ? 34.087  66.766 -117.042 1.00 24.87  ? 101  LEU A CD2   1 
ATOM   1660 N  N     . LEU E 3 102 ? 32.280  62.175 -116.704 1.00 38.81  ? 102  LEU A N     1 
ATOM   1661 C  CA    . LEU E 3 102 ? 32.277  60.725 -116.594 1.00 37.93  ? 102  LEU A CA    1 
ATOM   1662 C  C     . LEU E 3 102 ? 33.686  60.218 -116.876 1.00 38.48  ? 102  LEU A C     1 
ATOM   1663 O  O     . LEU E 3 102 ? 34.279  60.510 -117.913 1.00 39.17  ? 102  LEU A O     1 
ATOM   1664 C  CB    . LEU E 3 102 ? 31.299  60.095 -117.589 1.00 29.43  ? 102  LEU A CB    1 
ATOM   1665 C  CG    . LEU E 3 102 ? 31.209  58.578 -117.443 1.00 30.08  ? 102  LEU A CG    1 
ATOM   1666 C  CD1   . LEU E 3 102 ? 30.915  58.262 -115.998 1.00 30.16  ? 102  LEU A CD1   1 
ATOM   1667 C  CD2   . LEU E 3 102 ? 30.134  57.994 -118.347 1.00 32.76  ? 102  LEU A CD2   1 
ATOM   1668 N  N     . TYR E 3 103 ? 34.224  59.460 -115.933 1.00 42.91  ? 103  TYR A N     1 
ATOM   1669 C  CA    . TYR E 3 103 ? 35.553  58.905 -116.091 1.00 41.26  ? 103  TYR A CA    1 
ATOM   1670 C  C     . TYR E 3 103 ? 35.528  57.382 -116.130 1.00 40.88  ? 103  TYR A C     1 
ATOM   1671 O  O     . TYR E 3 103 ? 34.583  56.752 -115.656 1.00 41.36  ? 103  TYR A O     1 
ATOM   1672 C  CB    . TYR E 3 103 ? 36.459  59.341 -114.940 1.00 32.18  ? 103  TYR A CB    1 
ATOM   1673 C  CG    . TYR E 3 103 ? 36.853  60.796 -114.929 1.00 30.00  ? 103  TYR A CG    1 
ATOM   1674 C  CD1   . TYR E 3 103 ? 36.070  61.760 -114.276 1.00 28.80  ? 103  TYR A CD1   1 
ATOM   1675 C  CD2   . TYR E 3 103 ? 38.037  61.205 -115.523 1.00 29.55  ? 103  TYR A CD2   1 
ATOM   1676 C  CE1   . TYR E 3 103 ? 36.475  63.088 -114.217 1.00 27.62  ? 103  TYR A CE1   1 
ATOM   1677 C  CE2   . TYR E 3 103 ? 38.450  62.527 -115.470 1.00 29.08  ? 103  TYR A CE2   1 
ATOM   1678 C  CZ    . TYR E 3 103 ? 37.679  63.462 -114.818 1.00 29.50  ? 103  TYR A CZ    1 
ATOM   1679 O  OH    . TYR E 3 103 ? 38.141  64.758 -114.747 1.00 29.76  ? 103  TYR A OH    1 
ATOM   1680 N  N     . SER E 3 104 ? 36.602  56.823 -116.688 1.00 42.19  ? 104  SER A N     1 
ATOM   1681 C  CA    . SER E 3 104 ? 36.841  55.388 -116.814 1.00 40.73  ? 104  SER A CA    1 
ATOM   1682 C  C     . SER E 3 104 ? 35.898  54.632 -117.722 1.00 42.28  ? 104  SER A C     1 
ATOM   1683 O  O     . SER E 3 104 ? 36.337  54.064 -118.715 1.00 44.54  ? 104  SER A O     1 
ATOM   1684 C  CB    . SER E 3 104 ? 36.867  54.740 -115.433 1.00 36.31  ? 104  SER A CB    1 
ATOM   1685 O  OG    . SER E 3 104 ? 37.832  55.385 -114.614 1.00 34.66  ? 104  SER A OG    1 
ATOM   1686 N  N     . ALA E 3 105 ? 34.611  54.632 -117.390 1.00 26.68  ? 105  ALA A N     1 
ATOM   1687 C  CA    . ALA E 3 105 ? 33.596  53.934 -118.179 1.00 25.84  ? 105  ALA A CA    1 
ATOM   1688 C  C     . ALA E 3 105 ? 33.999  53.648 -119.627 1.00 23.64  ? 105  ALA A C     1 
ATOM   1689 O  O     . ALA E 3 105 ? 34.613  54.473 -120.281 1.00 19.71  ? 105  ALA A O     1 
ATOM   1690 C  CB    . ALA E 3 105 ? 32.284  54.719 -118.151 1.00 66.71  ? 105  ALA A CB    1 
ATOM   1691 N  N     . SER E 3 106 ? 33.642  52.465 -120.121 1.00 34.89  ? 106  SER A N     1 
ATOM   1692 C  CA    . SER E 3 106 ? 33.976  52.096 -121.484 1.00 34.75  ? 106  SER A CA    1 
ATOM   1693 C  C     . SER E 3 106 ? 32.732  51.845 -122.319 1.00 34.12  ? 106  SER A C     1 
ATOM   1694 O  O     . SER E 3 106 ? 32.773  51.967 -123.543 1.00 34.14  ? 106  SER A O     1 
ATOM   1695 C  CB    . SER E 3 106 ? 34.913  50.868 -121.510 1.00 44.26  ? 106  SER A CB    1 
ATOM   1696 O  OG    . SER E 3 106 ? 34.318  49.704 -120.957 1.00 49.20  ? 106  SER A OG    1 
ATOM   1697 N  N     . ASP E 3 107 ? 31.620  51.507 -121.676 1.00 38.05  ? 107  ASP A N     1 
ATOM   1698 C  CA    . ASP E 3 107 ? 30.389  51.266 -122.432 1.00 38.40  ? 107  ASP A CA    1 
ATOM   1699 C  C     . ASP E 3 107 ? 29.592  52.549 -122.521 1.00 37.19  ? 107  ASP A C     1 
ATOM   1700 O  O     . ASP E 3 107 ? 28.722  52.795 -121.689 1.00 38.05  ? 107  ASP A O     1 
ATOM   1701 C  CB    . ASP E 3 107 ? 29.520  50.175 -121.781 1.00 37.29  ? 107  ASP A CB    1 
ATOM   1702 C  CG    . ASP E 3 107 ? 28.646  49.416 -122.809 1.00 41.09  ? 107  ASP A CG    1 
ATOM   1703 O  OD1   . ASP E 3 107 ? 28.592  49.816 -123.999 1.00 42.97  ? 107  ASP A OD1   1 
ATOM   1704 O  OD2   . ASP E 3 107 ? 28.007  48.415 -122.429 1.00 41.12  ? 107  ASP A OD2   1 
ATOM   1705 N  N     . ILE E 3 108 ? 29.901  53.368 -123.523 1.00 31.88  ? 108  ILE A N     1 
ATOM   1706 C  CA    . ILE E 3 108 ? 29.203  54.642 -123.727 1.00 29.98  ? 108  ILE A CA    1 
ATOM   1707 C  C     . ILE E 3 108 ? 28.747  54.728 -125.164 1.00 30.45  ? 108  ILE A C     1 
ATOM   1708 O  O     . ILE E 3 108 ? 29.560  54.875 -126.079 1.00 30.80  ? 108  ILE A O     1 
ATOM   1709 C  CB    . ILE E 3 108 ? 30.092  55.873 -123.495 1.00 34.07  ? 108  ILE A CB    1 
ATOM   1710 C  CG1   . ILE E 3 108 ? 30.915  55.734 -122.225 1.00 31.85  ? 108  ILE A CG1   1 
ATOM   1711 C  CG2   . ILE E 3 108 ? 29.214  57.086 -123.369 1.00 31.95  ? 108  ILE A CG2   1 
ATOM   1712 C  CD1   . ILE E 3 108 ? 31.801  56.929 -121.959 1.00 29.43  ? 108  ILE A CD1   1 
ATOM   1713 N  N     . GLU E 3 109 ? 27.441  54.673 -125.353 1.00 32.01  ? 109  GLU A N     1 
ATOM   1714 C  CA    . GLU E 3 109 ? 26.855  54.706 -126.682 1.00 32.60  ? 109  GLU A CA    1 
ATOM   1715 C  C     . GLU E 3 109 ? 25.752  55.777 -126.736 1.00 33.40  ? 109  GLU A C     1 
ATOM   1716 O  O     . GLU E 3 109 ? 25.185  56.138 -125.709 1.00 34.11  ? 109  GLU A O     1 
ATOM   1717 C  CB    . GLU E 3 109 ? 26.298  53.307 -126.973 1.00 35.58  ? 109  GLU A CB    1 
ATOM   1718 C  CG    . GLU E 3 109 ? 26.277  52.868 -128.422 1.00 39.79  ? 109  GLU A CG    1 
ATOM   1719 C  CD    . GLU E 3 109 ? 26.207  51.349 -128.553 1.00 41.48  ? 109  GLU A CD    1 
ATOM   1720 O  OE1   . GLU E 3 109 ? 27.113  50.682 -128.004 1.00 45.96  ? 109  GLU A OE1   1 
ATOM   1721 O  OE2   . GLU E 3 109 ? 25.266  50.827 -129.193 1.00 37.45  ? 109  GLU A OE2   1 
ATOM   1722 N  N     . MET E 3 110 ? 25.477  56.294 -127.936 1.00 30.25  ? 110  MET A N     1 
ATOM   1723 C  CA    . MET E 3 110 ? 24.425  57.297 -128.145 1.00 28.31  ? 110  MET A CA    1 
ATOM   1724 C  C     . MET E 3 110 ? 23.308  56.587 -128.863 1.00 27.11  ? 110  MET A C     1 
ATOM   1725 O  O     . MET E 3 110 ? 23.535  55.946 -129.876 1.00 24.94  ? 110  MET A O     1 
ATOM   1726 C  CB    . MET E 3 110 ? 24.903  58.453 -129.032 1.00 34.18  ? 110  MET A CB    1 
ATOM   1727 C  CG    . MET E 3 110 ? 23.882  59.614 -129.198 1.00 31.40  ? 110  MET A CG    1 
ATOM   1728 S  SD    . MET E 3 110 ? 23.702  60.717 -127.730 1.00 30.27  ? 110  MET A SD    1 
ATOM   1729 C  CE    . MET E 3 110 ? 25.236  61.554 -127.735 1.00 25.68  ? 110  MET A CE    1 
ATOM   1730 N  N     . LEU E 3 111 ? 22.102  56.711 -128.329 1.00 33.31  ? 111  LEU A N     1 
ATOM   1731 C  CA    . LEU E 3 111 ? 20.925  56.082 -128.904 1.00 33.00  ? 111  LEU A CA    1 
ATOM   1732 C  C     . LEU E 3 111 ? 19.891  57.096 -129.353 1.00 34.82  ? 111  LEU A C     1 
ATOM   1733 O  O     . LEU E 3 111 ? 19.741  58.164 -128.754 1.00 35.01  ? 111  LEU A O     1 
ATOM   1734 C  CB    . LEU E 3 111 ? 20.260  55.162 -127.884 1.00 33.55  ? 111  LEU A CB    1 
ATOM   1735 C  CG    . LEU E 3 111 ? 21.047  53.964 -127.368 1.00 34.18  ? 111  LEU A CG    1 
ATOM   1736 C  CD1   . LEU E 3 111 ? 20.158  53.144 -126.437 1.00 36.24  ? 111  LEU A CD1   1 
ATOM   1737 C  CD2   . LEU E 3 111 ? 21.526  53.118 -128.541 1.00 32.36  ? 111  LEU A CD2   1 
ATOM   1738 N  N     . ARG E 3 112 ? 19.183  56.734 -130.416 1.00 35.46  ? 112  ARG A N     1 
ATOM   1739 C  CA    . ARG E 3 112 ? 18.101  57.526 -130.967 1.00 37.45  ? 112  ARG A CA    1 
ATOM   1740 C  C     . ARG E 3 112 ? 16.875  56.726 -130.534 1.00 38.69  ? 112  ARG A C     1 
ATOM   1741 O  O     . ARG E 3 112 ? 17.013  55.618 -130.010 1.00 39.83  ? 112  ARG A O     1 
ATOM   1742 C  CB    . ARG E 3 112 ? 18.175  57.521 -132.478 1.00 48.12  ? 112  ARG A CB    1 
ATOM   1743 C  CG    . ARG E 3 112 ? 19.524  57.881 -133.029 1.00 50.60  ? 112  ARG A CG    1 
ATOM   1744 C  CD    . ARG E 3 112 ? 19.521  57.685 -134.527 1.00 50.35  ? 112  ARG A CD    1 
ATOM   1745 N  NE    . ARG E 3 112 ? 18.331  58.270 -135.135 1.00 50.48  ? 112  ARG A NE    1 
ATOM   1746 C  CZ    . ARG E 3 112 ? 18.054  58.204 -136.432 1.00 52.99  ? 112  ARG A CZ    1 
ATOM   1747 N  NH1   . ARG E 3 112 ? 18.880  57.579 -137.262 1.00 51.20  ? 112  ARG A NH1   1 
ATOM   1748 N  NH2   . ARG E 3 112 ? 16.950  58.762 -136.897 1.00 53.72  ? 112  ARG A NH2   1 
ATOM   1749 N  N     . PRO E 3 113 ? 15.662  57.265 -130.736 1.00 56.66  ? 113  PRO A N     1 
ATOM   1750 C  CA    . PRO E 3 113 ? 14.513  56.456 -130.309 1.00 56.32  ? 113  PRO A CA    1 
ATOM   1751 C  C     . PRO E 3 113 ? 14.344  55.215 -131.214 1.00 57.17  ? 113  PRO A C     1 
ATOM   1752 O  O     . PRO E 3 113 ? 14.273  55.333 -132.440 1.00 55.84  ? 113  PRO A O     1 
ATOM   1753 C  CB    . PRO E 3 113 ? 13.341  57.427 -130.420 1.00 33.19  ? 113  PRO A CB    1 
ATOM   1754 C  CG    . PRO E 3 113 ? 13.979  58.787 -130.285 1.00 35.01  ? 113  PRO A CG    1 
ATOM   1755 C  CD    . PRO E 3 113 ? 15.244  58.633 -131.096 1.00 35.42  ? 113  PRO A CD    1 
ATOM   1756 N  N     . GLU E 3 114 ? 14.283  54.046 -130.577 1.00 41.85  ? 114  GLU A N     1 
ATOM   1757 C  CA    . GLU E 3 114 ? 14.145  52.733 -131.215 1.00 43.52  ? 114  GLU A CA    1 
ATOM   1758 C  C     . GLU E 3 114 ? 15.101  51.821 -130.459 1.00 43.55  ? 114  GLU A C     1 
ATOM   1759 O  O     . GLU E 3 114 ? 14.746  50.735 -130.008 1.00 42.10  ? 114  GLU A O     1 
ATOM   1760 C  CB    . GLU E 3 114 ? 14.541  52.770 -132.701 1.00 52.29  ? 114  GLU A CB    1 
ATOM   1761 C  CG    . GLU E 3 114 ? 13.360  52.811 -133.679 1.00 54.45  ? 114  GLU A CG    1 
ATOM   1762 C  CD    . GLU E 3 114 ? 12.822  51.422 -134.029 1.00 56.88  ? 114  GLU A CD    1 
ATOM   1763 O  OE1   . GLU E 3 114 ? 13.483  50.700 -134.809 1.00 58.42  ? 114  GLU A OE1   1 
ATOM   1764 O  OE2   . GLU E 3 114 ? 11.742  51.051 -133.517 1.00 56.12  ? 114  GLU A OE2   1 
ATOM   1765 N  N     . GLN E 3 115 ? 16.326  52.299 -130.310 1.00 58.67  ? 115  GLN A N     1 
ATOM   1766 C  CA    . GLN E 3 115 ? 17.348  51.556 -129.605 1.00 57.67  ? 115  GLN A CA    1 
ATOM   1767 C  C     . GLN E 3 115 ? 17.029  51.539 -128.120 1.00 57.46  ? 115  GLN A C     1 
ATOM   1768 O  O     . GLN E 3 115 ? 17.619  50.773 -127.364 1.00 57.39  ? 115  GLN A O     1 
ATOM   1769 C  CB    . GLN E 3 115 ? 18.720  52.192 -129.854 1.00 42.15  ? 115  GLN A CB    1 
ATOM   1770 C  CG    . GLN E 3 115 ? 19.211  52.042 -131.299 1.00 41.07  ? 115  GLN A CG    1 
ATOM   1771 C  CD    . GLN E 3 115 ? 20.555  52.697 -131.528 1.00 39.56  ? 115  GLN A CD    1 
ATOM   1772 O  OE1   . GLN E 3 115 ? 20.652  53.917 -131.621 1.00 39.27  ? 115  GLN A OE1   1 
ATOM   1773 N  NE2   . GLN E 3 115 ? 21.604  51.886 -131.605 1.00 40.77  ? 115  GLN A NE2   1 
ATOM   1774 N  N     . LEU E 3 116 ? 16.090  52.379 -127.700 1.00 36.15  ? 116  LEU A N     1 
ATOM   1775 C  CA    . LEU E 3 116 ? 15.721  52.420 -126.294 1.00 36.14  ? 116  LEU A CA    1 
ATOM   1776 C  C     . LEU E 3 116 ? 14.968  51.151 -125.901 1.00 37.10  ? 116  LEU A C     1 
ATOM   1777 O  O     . LEU E 3 116 ? 14.625  50.953 -124.740 1.00 37.55  ? 116  LEU A O     1 
ATOM   1778 C  CB    . LEU E 3 116 ? 14.898  53.680 -125.986 1.00 33.87  ? 116  LEU A CB    1 
ATOM   1779 C  CG    . LEU E 3 116 ? 15.672  55.016 -125.966 1.00 33.12  ? 116  LEU A CG    1 
ATOM   1780 C  CD1   . LEU E 3 116 ? 14.765  56.138 -125.468 1.00 32.13  ? 116  LEU A CD1   1 
ATOM   1781 C  CD2   . LEU E 3 116 ? 16.907  54.903 -125.065 1.00 31.72  ? 116  LEU A CD2   1 
ATOM   1782 N  N     . THR E 3 117 ? 14.723  50.289 -126.884 1.00 49.98  ? 117  THR A N     1 
ATOM   1783 C  CA    . THR E 3 117 ? 14.062  49.011 -126.658 1.00 51.20  ? 117  THR A CA    1 
ATOM   1784 C  C     . THR E 3 117 ? 14.808  48.001 -127.516 1.00 52.35  ? 117  THR A C     1 
ATOM   1785 O  O     . THR E 3 117 ? 14.403  46.846 -127.637 1.00 54.90  ? 117  THR A O     1 
ATOM   1786 C  CB    . THR E 3 117 ? 12.591  49.006 -127.130 1.00 37.61  ? 117  THR A CB    1 
ATOM   1787 O  OG1   . THR E 3 117 ? 12.553  48.963 -128.561 1.00 36.56  ? 117  THR A OG1   1 
ATOM   1788 C  CG2   . THR E 3 117 ? 11.862  50.232 -126.632 1.00 35.69  ? 117  THR A CG2   1 
ATOM   1789 N  N     . THR E 3 118 ? 15.910  48.451 -128.106 1.00 65.16  ? 118  THR A N     1 
ATOM   1790 C  CA    . THR E 3 118 ? 16.707  47.615 -128.994 1.00 63.87  ? 118  THR A CA    1 
ATOM   1791 C  C     . THR E 3 118 ? 18.149  47.343 -128.543 1.00 63.43  ? 118  THR A C     1 
ATOM   1792 O  O     . THR E 3 118 ? 18.722  46.306 -128.886 1.00 64.49  ? 118  THR A O     1 
ATOM   1793 C  CB    . THR E 3 118 ? 16.661  48.228 -130.417 1.00 35.03  ? 118  THR A CB    1 
ATOM   1794 O  OG1   . THR E 3 118 ? 15.630  47.571 -131.165 1.00 35.90  ? 118  THR A OG1   1 
ATOM   1795 C  CG2   . THR E 3 118 ? 17.997  48.116 -131.133 1.00 32.35  ? 118  THR A CG2   1 
ATOM   1796 N  N     . HIS E 3 119 ? 18.719  48.270 -127.775 1.00 30.98  ? 119  HIS A N     1 
ATOM   1797 C  CA    . HIS E 3 119 ? 20.081  48.147 -127.246 1.00 29.64  ? 119  HIS A CA    1 
ATOM   1798 C  C     . HIS E 3 119 ? 20.224  46.763 -126.604 1.00 29.77  ? 119  HIS A C     1 
ATOM   1799 O  O     . HIS E 3 119 ? 19.286  46.256 -125.978 1.00 28.81  ? 119  HIS A O     1 
ATOM   1800 C  CB    . HIS E 3 119 ? 20.308  49.257 -126.202 1.00 36.17  ? 119  HIS A CB    1 
ATOM   1801 C  CG    . HIS E 3 119 ? 21.748  49.542 -125.883 1.00 35.23  ? 119  HIS A CG    1 
ATOM   1802 N  ND1   . HIS E 3 119 ? 22.457  48.842 -124.930 1.00 36.13  ? 119  HIS A ND1   1 
ATOM   1803 C  CD2   . HIS E 3 119 ? 22.594  50.489 -126.357 1.00 34.97  ? 119  HIS A CD2   1 
ATOM   1804 C  CE1   . HIS E 3 119 ? 23.673  49.346 -124.830 1.00 33.78  ? 119  HIS A CE1   1 
ATOM   1805 N  NE2   . HIS E 3 119 ? 23.782  50.347 -125.684 1.00 34.38  ? 119  HIS A NE2   1 
ATOM   1806 N  N     . PRO E 3 120 ? 21.397  46.134 -126.760 1.00 42.66  ? 120  PRO A N     1 
ATOM   1807 C  CA    . PRO E 3 120 ? 21.720  44.808 -126.222 1.00 43.84  ? 120  PRO A CA    1 
ATOM   1808 C  C     . PRO E 3 120 ? 21.374  44.635 -124.748 1.00 46.16  ? 120  PRO A C     1 
ATOM   1809 O  O     . PRO E 3 120 ? 20.729  43.653 -124.358 1.00 47.87  ? 120  PRO A O     1 
ATOM   1810 C  CB    . PRO E 3 120 ? 23.221  44.698 -126.464 1.00 42.14  ? 120  PRO A CB    1 
ATOM   1811 C  CG    . PRO E 3 120 ? 23.388  45.436 -127.735 1.00 41.41  ? 120  PRO A CG    1 
ATOM   1812 C  CD    . PRO E 3 120 ? 22.536  46.670 -127.519 1.00 41.84  ? 120  PRO A CD    1 
ATOM   1813 N  N     . PHE E 3 121 ? 21.806  45.588 -123.928 1.00 49.13  ? 121  PHE A N     1 
ATOM   1814 C  CA    . PHE E 3 121 ? 21.542  45.521 -122.499 1.00 49.20  ? 121  PHE A CA    1 
ATOM   1815 C  C     . PHE E 3 121 ? 20.115  45.941 -122.172 1.00 49.22  ? 121  PHE A C     1 
ATOM   1816 O  O     . PHE E 3 121 ? 19.405  45.266 -121.434 1.00 50.61  ? 121  PHE A O     1 
ATOM   1817 C  CB    . PHE E 3 121 ? 22.521  46.414 -121.731 1.00 53.21  ? 121  PHE A CB    1 
ATOM   1818 C  CG    . PHE E 3 121 ? 22.582  46.118 -120.259 1.00 53.56  ? 121  PHE A CG    1 
ATOM   1819 C  CD1   . PHE E 3 121 ? 23.126  44.917 -119.800 1.00 53.43  ? 121  PHE A CD1   1 
ATOM   1820 C  CD2   . PHE E 3 121 ? 22.112  47.039 -119.329 1.00 52.86  ? 121  PHE A CD2   1 
ATOM   1821 C  CE1   . PHE E 3 121 ? 23.206  44.643 -118.430 1.00 53.15  ? 121  PHE A CE1   1 
ATOM   1822 C  CE2   . PHE E 3 121 ? 22.187  46.771 -117.952 1.00 54.33  ? 121  PHE A CE2   1 
ATOM   1823 C  CZ    . PHE E 3 121 ? 22.736  45.573 -117.506 1.00 51.97  ? 121  PHE A CZ    1 
ATOM   1824 N  N     . LEU E 3 122 ? 19.689  47.061 -122.724 1.00 39.99  ? 122  LEU A N     1 
ATOM   1825 C  CA    . LEU E 3 122 ? 18.354  47.535 -122.442 1.00 39.47  ? 122  LEU A CA    1 
ATOM   1826 C  C     . LEU E 3 122 ? 17.291  46.492 -122.741 1.00 39.64  ? 122  LEU A C     1 
ATOM   1827 O  O     . LEU E 3 122 ? 16.337  46.339 -121.982 1.00 39.62  ? 122  LEU A O     1 
ATOM   1828 C  CB    . LEU E 3 122 ? 18.091  48.819 -123.221 1.00 39.31  ? 122  LEU A CB    1 
ATOM   1829 C  CG    . LEU E 3 122 ? 19.021  49.955 -122.780 1.00 40.22  ? 122  LEU A CG    1 
ATOM   1830 C  CD1   . LEU E 3 122 ? 18.752  51.227 -123.611 1.00 38.63  ? 122  LEU A CD1   1 
ATOM   1831 C  CD2   . LEU E 3 122 ? 18.814  50.219 -121.296 1.00 37.45  ? 122  LEU A CD2   1 
ATOM   1832 N  N     . GLN E 3 123 ? 17.471  45.754 -123.831 1.00 34.78  ? 123  GLN A N     1 
ATOM   1833 C  CA    . GLN E 3 123 ? 16.504  44.737 -124.239 1.00 36.38  ? 123  GLN A CA    1 
ATOM   1834 C  C     . GLN E 3 123 ? 16.378  43.642 -123.175 1.00 37.30  ? 123  GLN A C     1 
ATOM   1835 O  O     . GLN E 3 123 ? 15.279  43.212 -122.817 1.00 37.15  ? 123  GLN A O     1 
ATOM   1836 C  CB    . GLN E 3 123 ? 16.951  44.147 -125.590 1.00 56.43  ? 123  GLN A CB    1 
ATOM   1837 C  CG    . GLN E 3 123 ? 15.873  43.470 -126.420 1.00 58.44  ? 123  GLN A CG    1 
ATOM   1838 C  CD    . GLN E 3 123 ? 16.078  43.674 -127.924 1.00 63.77  ? 123  GLN A CD    1 
ATOM   1839 O  OE1   . GLN E 3 123 ? 15.332  43.134 -128.748 1.00 64.43  ? 123  GLN A OE1   1 
ATOM   1840 N  NE2   . GLN E 3 123 ? 17.086  44.466 -128.285 1.00 62.90  ? 123  GLN A NE2   1 
ATOM   1841 N  N     . ARG E 3 124 ? 17.520  43.231 -122.646 1.00 46.13  ? 124  ARG A N     1 
ATOM   1842 C  CA    . ARG E 3 124 ? 17.596  42.172 -121.653 1.00 45.70  ? 124  ARG A CA    1 
ATOM   1843 C  C     . ARG E 3 124 ? 17.052  42.406 -120.228 1.00 43.28  ? 124  ARG A C     1 
ATOM   1844 O  O     . ARG E 3 124 ? 16.274  41.595 -119.727 1.00 42.78  ? 124  ARG A O     1 
ATOM   1845 C  CB    . ARG E 3 124 ? 19.055  41.708 -121.559 1.00 69.43  ? 124  ARG A CB    1 
ATOM   1846 C  CG    . ARG E 3 124 ? 19.253  40.410 -120.806 1.00 73.32  ? 124  ARG A CG    1 
ATOM   1847 C  CD    . ARG E 3 124 ? 18.822  39.207 -121.631 1.00 75.73  ? 124  ARG A CD    1 
ATOM   1848 N  NE    . ARG E 3 124 ? 18.399  38.106 -120.769 1.00 79.51  ? 124  ARG A NE    1 
ATOM   1849 C  CZ    . ARG E 3 124 ? 18.267  36.846 -121.164 1.00 80.18  ? 124  ARG A CZ    1 
ATOM   1850 N  NH1   . ARG E 3 124 ? 18.532  36.515 -122.420 1.00 81.04  ? 124  ARG A NH1   1 
ATOM   1851 N  NH2   . ARG E 3 124 ? 17.861  35.921 -120.303 1.00 80.70  ? 124  ARG A NH2   1 
ATOM   1852 N  N     . VAL E 3 125 ? 17.445  43.497 -119.579 1.00 43.03  ? 125  VAL A N     1 
ATOM   1853 C  CA    . VAL E 3 125 ? 17.038  43.745 -118.187 1.00 42.33  ? 125  VAL A CA    1 
ATOM   1854 C  C     . VAL E 3 125 ? 15.582  43.577 -117.750 1.00 41.29  ? 125  VAL A C     1 
ATOM   1855 O  O     . VAL E 3 125 ? 14.648  43.866 -118.489 1.00 40.65  ? 125  VAL A O     1 
ATOM   1856 C  CB    . VAL E 3 125 ? 17.502  45.144 -117.685 1.00 40.98  ? 125  VAL A CB    1 
ATOM   1857 C  CG1   . VAL E 3 125 ? 18.930  45.388 -118.115 1.00 39.10  ? 125  VAL A CG1   1 
ATOM   1858 C  CG2   . VAL E 3 125 ? 16.557  46.242 -118.176 1.00 40.36  ? 125  VAL A CG2   1 
ATOM   1859 N  N     . GLY E 3 126 ? 15.428  43.103 -116.514 1.00 29.45  ? 126  GLY A N     1 
ATOM   1860 C  CA    . GLY E 3 126 ? 14.125  42.901 -115.912 1.00 27.75  ? 126  GLY A CA    1 
ATOM   1861 C  C     . GLY E 3 126 ? 13.759  44.122 -115.074 1.00 27.80  ? 126  GLY A C     1 
ATOM   1862 O  O     . GLY E 3 126 ? 14.461  45.137 -115.101 1.00 27.11  ? 126  GLY A O     1 
ATOM   1863 N  N     . PRO E 3 127 ? 12.648  44.062 -114.331 1.00 31.22  ? 127  PRO A N     1 
ATOM   1864 C  CA    . PRO E 3 127 ? 12.223  45.184 -113.500 1.00 31.19  ? 127  PRO A CA    1 
ATOM   1865 C  C     . PRO E 3 127 ? 13.354  45.739 -112.642 1.00 31.73  ? 127  PRO A C     1 
ATOM   1866 O  O     . PRO E 3 127 ? 14.325  45.039 -112.355 1.00 28.80  ? 127  PRO A O     1 
ATOM   1867 C  CB    . PRO E 3 127 ? 11.097  44.580 -112.669 1.00 38.07  ? 127  PRO A CB    1 
ATOM   1868 C  CG    . PRO E 3 127 ? 10.462  43.655 -113.643 1.00 39.24  ? 127  PRO A CG    1 
ATOM   1869 C  CD    . PRO E 3 127 ? 11.654  42.973 -114.282 1.00 40.29  ? 127  PRO A CD    1 
ATOM   1870 N  N     . ASP E 3 128 ? 13.200  47.004 -112.251 1.00 48.34  ? 128  ASP A N     1 
ATOM   1871 C  CA    . ASP E 3 128 ? 14.166  47.722 -111.424 1.00 51.27  ? 128  ASP A CA    1 
ATOM   1872 C  C     . ASP E 3 128 ? 13.713  47.683 -109.950 1.00 52.11  ? 128  ASP A C     1 
ATOM   1873 O  O     . ASP E 3 128 ? 12.579  48.041 -109.621 1.00 51.74  ? 128  ASP A O     1 
ATOM   1874 C  CB    . ASP E 3 128 ? 14.254  49.181 -111.887 1.00 46.86  ? 128  ASP A CB    1 
ATOM   1875 C  CG    . ASP E 3 128 ? 15.581  49.855 -111.525 1.00 49.02  ? 128  ASP A CG    1 
ATOM   1876 O  OD1   . ASP E 3 128 ? 16.223  49.476 -110.519 1.00 49.00  ? 128  ASP A OD1   1 
ATOM   1877 O  OD2   . ASP E 3 128 ? 15.973  50.791 -112.257 1.00 49.37  ? 128  ASP A OD2   1 
ATOM   1878 N  N     . VAL E 3 129 ? 14.604  47.244 -109.071 1.00 44.89  ? 129  VAL A N     1 
ATOM   1879 C  CA    . VAL E 3 129 ? 14.301  47.182 -107.655 1.00 44.03  ? 129  VAL A CA    1 
ATOM   1880 C  C     . VAL E 3 129 ? 13.970  48.583 -107.160 1.00 45.41  ? 129  VAL A C     1 
ATOM   1881 O  O     . VAL E 3 129 ? 13.176  48.749 -106.235 1.00 45.12  ? 129  VAL A O     1 
ATOM   1882 C  CB    . VAL E 3 129 ? 15.497  46.620 -106.861 1.00 36.55  ? 129  VAL A CB    1 
ATOM   1883 C  CG1   . VAL E 3 129 ? 15.714  45.155 -107.230 1.00 35.01  ? 129  VAL A CG1   1 
ATOM   1884 C  CG2   . VAL E 3 129 ? 16.750  47.437 -107.149 1.00 31.94  ? 129  VAL A CG2   1 
ATOM   1885 N  N     . LEU E 3 130 ? 14.586  49.586 -107.781 1.00 50.54  ? 130  LEU A N     1 
ATOM   1886 C  CA    . LEU E 3 130 ? 14.349  50.983 -107.423 1.00 50.87  ? 130  LEU A CA    1 
ATOM   1887 C  C     . LEU E 3 130 ? 13.048  51.493 -108.040 1.00 52.53  ? 130  LEU A C     1 
ATOM   1888 O  O     . LEU E 3 130 ? 12.548  52.553 -107.664 1.00 53.53  ? 130  LEU A O     1 
ATOM   1889 C  CB    . LEU E 3 130 ? 15.517  51.861 -107.885 1.00 39.70  ? 130  LEU A CB    1 
ATOM   1890 C  CG    . LEU E 3 130 ? 16.829  51.707 -107.108 1.00 39.82  ? 130  LEU A CG    1 
ATOM   1891 C  CD1   . LEU E 3 130 ? 17.898  52.551 -107.747 1.00 39.09  ? 130  LEU A CD1   1 
ATOM   1892 C  CD2   . LEU E 3 130 ? 16.627  52.119 -105.646 1.00 39.55  ? 130  LEU A CD2   1 
ATOM   1893 N  N     . ASP E 3 131 ? 12.507  50.729 -108.986 1.00 42.86  ? 131  ASP A N     1 
ATOM   1894 C  CA    . ASP E 3 131 ? 11.260  51.071 -109.661 1.00 43.57  ? 131  ASP A CA    1 
ATOM   1895 C  C     . ASP E 3 131 ? 10.088  50.936 -108.680 1.00 43.88  ? 131  ASP A C     1 
ATOM   1896 O  O     . ASP E 3 131 ? 9.819   49.859 -108.152 1.00 41.97  ? 131  ASP A O     1 
ATOM   1897 C  CB    . ASP E 3 131 ? 11.052  50.130 -110.856 1.00 66.49  ? 131  ASP A CB    1 
ATOM   1898 C  CG    . ASP E 3 131 ? 9.843   50.500 -111.705 1.00 67.81  ? 131  ASP A CG    1 
ATOM   1899 O  OD1   . ASP E 3 131 ? 8.722   50.595 -111.161 1.00 67.89  ? 131  ASP A OD1   1 
ATOM   1900 O  OD2   . ASP E 3 131 ? 10.019  50.683 -112.929 1.00 67.25  ? 131  ASP A OD2   1 
ATOM   1901 N  N     . PRO E 3 132 ? 9.368   52.037 -108.435 1.00 73.61  ? 132  PRO A N     1 
ATOM   1902 C  CA    . PRO E 3 132 ? 8.224   52.042 -107.515 1.00 73.88  ? 132  PRO A CA    1 
ATOM   1903 C  C     . PRO E 3 132 ? 7.135   51.013 -107.831 1.00 73.75  ? 132  PRO A C     1 
ATOM   1904 O  O     . PRO E 3 132 ? 6.880   50.114 -107.033 1.00 75.38  ? 132  PRO A O     1 
ATOM   1905 C  CB    . PRO E 3 132 ? 7.709   53.476 -107.612 1.00 52.21  ? 132  PRO A CB    1 
ATOM   1906 C  CG    . PRO E 3 132 ? 8.960   54.253 -107.921 1.00 53.30  ? 132  PRO A CG    1 
ATOM   1907 C  CD    . PRO E 3 132 ? 9.637   53.390 -108.951 1.00 51.24  ? 132  PRO A CD    1 
ATOM   1908 N  N     . ASN E 3 133 ? 6.498   51.152 -108.993 1.00 41.33  ? 133  ASN A N     1 
ATOM   1909 C  CA    . ASN E 3 133 ? 5.422   50.247 -109.410 1.00 39.37  ? 133  ASN A CA    1 
ATOM   1910 C  C     . ASN E 3 133 ? 5.778   48.782 -109.260 1.00 37.36  ? 133  ASN A C     1 
ATOM   1911 O  O     . ASN E 3 133 ? 4.927   47.911 -109.378 1.00 37.57  ? 133  ASN A O     1 
ATOM   1912 C  CB    . ASN E 3 133 ? 5.011   50.533 -110.858 1.00 63.13  ? 133  ASN A CB    1 
ATOM   1913 C  CG    . ASN E 3 133 ? 4.057   51.705 -110.973 1.00 64.14  ? 133  ASN A CG    1 
ATOM   1914 O  OD1   . ASN E 3 133 ? 4.333   52.789 -110.468 1.00 66.50  ? 133  ASN A OD1   1 
ATOM   1915 N  ND2   . ASN E 3 133 ? 2.924   51.492 -111.643 1.00 65.61  ? 133  ASN A ND2   1 
ATOM   1916 N  N     . LEU E 3 134 ? 7.043   48.503 -109.009 1.00 38.96  ? 134  LEU A N     1 
ATOM   1917 C  CA    . LEU E 3 134 ? 7.477   47.127 -108.822 1.00 38.28  ? 134  LEU A CA    1 
ATOM   1918 C  C     . LEU E 3 134 ? 7.159   46.775 -107.368 1.00 37.50  ? 134  LEU A C     1 
ATOM   1919 O  O     . LEU E 3 134 ? 7.754   47.334 -106.455 1.00 36.57  ? 134  LEU A O     1 
ATOM   1920 C  CB    . LEU E 3 134 ? 8.987   47.017 -109.087 1.00 37.73  ? 134  LEU A CB    1 
ATOM   1921 C  CG    . LEU E 3 134 ? 9.577   45.616 -108.931 1.00 38.52  ? 134  LEU A CG    1 
ATOM   1922 C  CD1   . LEU E 3 134 ? 8.910   44.677 -109.931 1.00 38.09  ? 134  LEU A CD1   1 
ATOM   1923 C  CD2   . LEU E 3 134 ? 11.089  45.656 -109.138 1.00 38.44  ? 134  LEU A CD2   1 
ATOM   1924 N  N     . THR E 3 135 ? 6.217   45.865 -107.153 1.00 84.58  ? 135  THR A N     1 
ATOM   1925 C  CA    . THR E 3 135 ? 5.848   45.481 -105.792 1.00 85.71  ? 135  THR A CA    1 
ATOM   1926 C  C     . THR E 3 135 ? 6.366   44.097 -105.418 1.00 85.80  ? 135  THR A C     1 
ATOM   1927 O  O     . THR E 3 135 ? 6.678   43.279 -106.287 1.00 85.75  ? 135  THR A O     1 
ATOM   1928 C  CB    . THR E 3 135 ? 4.316   45.470 -105.596 1.00 32.49  ? 135  THR A CB    1 
ATOM   1929 O  OG1   . THR E 3 135 ? 3.741   44.416 -106.378 1.00 33.18  ? 135  THR A OG1   1 
ATOM   1930 C  CG2   . THR E 3 135 ? 3.715   46.786 -106.024 1.00 32.79  ? 135  THR A CG2   1 
ATOM   1931 N  N     . PRO E 3 136 ? 6.464   43.821 -104.108 1.00 36.93  ? 136  PRO A N     1 
ATOM   1932 C  CA    . PRO E 3 136 ? 6.943   42.522 -103.622 1.00 37.71  ? 136  PRO A CA    1 
ATOM   1933 C  C     . PRO E 3 136 ? 6.173   41.399 -104.284 1.00 39.08  ? 136  PRO A C     1 
ATOM   1934 O  O     . PRO E 3 136 ? 6.756   40.388 -104.686 1.00 40.85  ? 136  PRO A O     1 
ATOM   1935 C  CB    . PRO E 3 136 ? 6.674   42.588 -102.120 1.00 46.82  ? 136  PRO A CB    1 
ATOM   1936 C  CG    . PRO E 3 136 ? 6.849   44.040 -101.812 1.00 47.02  ? 136  PRO A CG    1 
ATOM   1937 C  CD    . PRO E 3 136 ? 6.199   44.746 -102.990 1.00 45.58  ? 136  PRO A CD    1 
ATOM   1938 N  N     . GLU E 3 137 ? 4.859   41.587 -104.391 1.00 37.64  ? 137  GLU A N     1 
ATOM   1939 C  CA    . GLU E 3 137 ? 3.966   40.605 -105.006 1.00 37.61  ? 137  GLU A CA    1 
ATOM   1940 C  C     . GLU E 3 137 ? 4.410   40.252 -106.413 1.00 36.83  ? 137  GLU A C     1 
ATOM   1941 O  O     . GLU E 3 137 ? 4.538   39.081 -106.756 1.00 36.47  ? 137  GLU A O     1 
ATOM   1942 C  CB    . GLU E 3 137 ? 2.530   41.140 -105.031 1.00 57.25  ? 137  GLU A CB    1 
ATOM   1943 C  CG    . GLU E 3 137 ? 1.838   41.085 -103.668 1.00 58.84  ? 137  GLU A CG    1 
ATOM   1944 C  CD    . GLU E 3 137 ? 2.709   41.635 -102.535 1.00 58.88  ? 137  GLU A CD    1 
ATOM   1945 O  OE1   . GLU E 3 137 ? 2.906   42.875 -102.461 1.00 54.52  ? 137  GLU A OE1   1 
ATOM   1946 O  OE2   . GLU E 3 137 ? 3.202   40.813 -101.726 1.00 57.87  ? 137  GLU A OE2   1 
ATOM   1947 N  N     . VAL E 3 138 ? 4.647   41.275 -107.226 1.00 60.44  ? 138  VAL A N     1 
ATOM   1948 C  CA    . VAL E 3 138 ? 5.098   41.061 -108.592 1.00 60.24  ? 138  VAL A CA    1 
ATOM   1949 C  C     . VAL E 3 138 ? 6.417   40.305 -108.529 1.00 59.57  ? 138  VAL A C     1 
ATOM   1950 O  O     . VAL E 3 138 ? 6.552   39.223 -109.094 1.00 61.83  ? 138  VAL A O     1 
ATOM   1951 C  CB    . VAL E 3 138 ? 5.319   42.400 -109.320 1.00 44.75  ? 138  VAL A CB    1 
ATOM   1952 C  CG1   . VAL E 3 138 ? 5.590   42.151 -110.785 1.00 43.21  ? 138  VAL A CG1   1 
ATOM   1953 C  CG2   . VAL E 3 138 ? 4.104   43.300 -109.134 1.00 43.70  ? 138  VAL A CG2   1 
ATOM   1954 N  N     . VAL E 3 139 ? 7.381   40.884 -107.824 1.00 65.24  ? 139  VAL A N     1 
ATOM   1955 C  CA    . VAL E 3 139 ? 8.701   40.287 -107.657 1.00 64.57  ? 139  VAL A CA    1 
ATOM   1956 C  C     . VAL E 3 139 ? 8.559   38.840 -107.145 1.00 64.35  ? 139  VAL A C     1 
ATOM   1957 O  O     . VAL E 3 139 ? 9.307   37.940 -107.537 1.00 65.14  ? 139  VAL A O     1 
ATOM   1958 C  CB    . VAL E 3 139 ? 9.544   41.139 -106.662 1.00 27.55  ? 139  VAL A CB    1 
ATOM   1959 C  CG1   . VAL E 3 139 ? 10.958  40.618 -106.596 1.00 26.60  ? 139  VAL A CG1   1 
ATOM   1960 C  CG2   . VAL E 3 139 ? 9.532   42.601 -107.091 1.00 22.36  ? 139  VAL A CG2   1 
ATOM   1961 N  N     . LYS E 3 140 ? 7.582   38.630 -106.273 1.00 35.58  ? 140  LYS A N     1 
ATOM   1962 C  CA    . LYS E 3 140 ? 7.298   37.324 -105.707 1.00 35.12  ? 140  LYS A CA    1 
ATOM   1963 C  C     . LYS E 3 140 ? 6.840   36.358 -106.807 1.00 35.82  ? 140  LYS A C     1 
ATOM   1964 O  O     . LYS E 3 140 ? 7.226   35.189 -106.820 1.00 38.30  ? 140  LYS A O     1 
ATOM   1965 C  CB    . LYS E 3 140 ? 6.208   37.486 -104.649 1.00 43.09  ? 140  LYS A CB    1 
ATOM   1966 C  CG    . LYS E 3 140 ? 5.870   36.250 -103.852 1.00 43.52  ? 140  LYS A CG    1 
ATOM   1967 C  CD    . LYS E 3 140 ? 4.741   36.556 -102.875 1.00 44.06  ? 140  LYS A CD    1 
ATOM   1968 C  CE    . LYS E 3 140 ? 3.469   36.990 -103.610 1.00 45.40  ? 140  LYS A CE    1 
ATOM   1969 N  NZ    . LYS E 3 140 ? 2.334   37.277 -102.673 1.00 48.01  ? 140  LYS A NZ    1 
ATOM   1970 N  N     . GLU E 3 141 ? 6.004   36.850 -107.721 1.00 31.21  ? 141  GLU A N     1 
ATOM   1971 C  CA    . GLU E 3 141 ? 5.494   36.046 -108.829 1.00 30.28  ? 141  GLU A CA    1 
ATOM   1972 C  C     . GLU E 3 141 ? 6.635   35.641 -109.747 1.00 29.53  ? 141  GLU A C     1 
ATOM   1973 O  O     . GLU E 3 141 ? 6.728   34.499 -110.201 1.00 28.21  ? 141  GLU A O     1 
ATOM   1974 C  CB    . GLU E 3 141 ? 4.521   36.841 -109.684 1.00 52.63  ? 141  GLU A CB    1 
ATOM   1975 C  CG    . GLU E 3 141 ? 3.370   37.512 -108.997 1.00 55.34  ? 141  GLU A CG    1 
ATOM   1976 C  CD    . GLU E 3 141 ? 2.505   38.221 -110.017 1.00 57.49  ? 141  GLU A CD    1 
ATOM   1977 O  OE1   . GLU E 3 141 ? 1.928   37.525 -110.873 1.00 60.00  ? 141  GLU A OE1   1 
ATOM   1978 O  OE2   . GLU E 3 141 ? 2.416   39.461 -109.986 1.00 59.12  ? 141  GLU A OE2   1 
ATOM   1979 N  N     . ARG E 3 142 ? 7.481   36.619 -110.044 1.00 41.41  ? 142  ARG A N     1 
ATOM   1980 C  CA    . ARG E 3 142 ? 8.620   36.428 -110.914 1.00 39.65  ? 142  ARG A CA    1 
ATOM   1981 C  C     . ARG E 3 142 ? 9.542   35.336 -110.356 1.00 40.65  ? 142  ARG A C     1 
ATOM   1982 O  O     . ARG E 3 142 ? 10.049  34.496 -111.112 1.00 41.94  ? 142  ARG A O     1 
ATOM   1983 C  CB    . ARG E 3 142 ? 9.342   37.768 -111.058 1.00 31.02  ? 142  ARG A CB    1 
ATOM   1984 C  CG    . ARG E 3 142 ? 10.320  37.878 -112.215 1.00 30.15  ? 142  ARG A CG    1 
ATOM   1985 C  CD    . ARG E 3 142 ? 10.992  39.262 -112.224 1.00 31.29  ? 142  ARG A CD    1 
ATOM   1986 N  NE    . ARG E 3 142 ? 11.825  39.499 -113.407 1.00 34.67  ? 142  ARG A NE    1 
ATOM   1987 C  CZ    . ARG E 3 142 ? 11.360  39.847 -114.607 1.00 35.69  ? 142  ARG A CZ    1 
ATOM   1988 N  NH1   . ARG E 3 142 ? 10.057  40.010 -114.803 1.00 36.05  ? 142  ARG A NH1   1 
ATOM   1989 N  NH2   . ARG E 3 142 ? 12.201  40.032 -115.613 1.00 38.45  ? 142  ARG A NH2   1 
ATOM   1990 N  N     . LEU E 3 143 ? 9.749   35.330 -109.037 1.00 35.72  ? 143  LEU A N     1 
ATOM   1991 C  CA    . LEU E 3 143 ? 10.610  34.320 -108.410 1.00 36.33  ? 143  LEU A CA    1 
ATOM   1992 C  C     . LEU E 3 143 ? 10.094  32.919 -108.673 1.00 36.10  ? 143  LEU A C     1 
ATOM   1993 O  O     . LEU E 3 143 ? 10.867  31.991 -108.899 1.00 36.39  ? 143  LEU A O     1 
ATOM   1994 C  CB    . LEU E 3 143 ? 10.692  34.526 -106.895 1.00 31.65  ? 143  LEU A CB    1 
ATOM   1995 C  CG    . LEU E 3 143 ? 11.830  35.380 -106.329 1.00 30.43  ? 143  LEU A CG    1 
ATOM   1996 C  CD1   . LEU E 3 143 ? 11.671  35.466 -104.831 1.00 27.15  ? 143  LEU A CD1   1 
ATOM   1997 C  CD2   . LEU E 3 143 ? 13.203  34.781 -106.700 1.00 30.44  ? 143  LEU A CD2   1 
ATOM   1998 N  N     . LEU E 3 144 ? 8.777   32.776 -108.629 1.00 49.58  ? 144  LEU A N     1 
ATOM   1999 C  CA    . LEU E 3 144 ? 8.136   31.487 -108.843 1.00 50.45  ? 144  LEU A CA    1 
ATOM   2000 C  C     . LEU E 3 144 ? 7.845   31.203 -110.308 1.00 50.61  ? 144  LEU A C     1 
ATOM   2001 O  O     . LEU E 3 144 ? 7.676   30.046 -110.687 1.00 50.76  ? 144  LEU A O     1 
ATOM   2002 C  CB    . LEU E 3 144 ? 6.832   31.413 -108.040 1.00 44.94  ? 144  LEU A CB    1 
ATOM   2003 C  CG    . LEU E 3 144 ? 6.944   31.456 -106.518 1.00 44.90  ? 144  LEU A CG    1 
ATOM   2004 C  CD1   . LEU E 3 144 ? 5.575   31.716 -105.928 1.00 45.18  ? 144  LEU A CD1   1 
ATOM   2005 C  CD2   . LEU E 3 144 ? 7.516   30.154 -105.995 1.00 40.71  ? 144  LEU A CD2   1 
ATOM   2006 N  N     . SER E 3 145 ? 7.781   32.247 -111.132 1.00 50.73  ? 145  SER A N     1 
ATOM   2007 C  CA    . SER E 3 145 ? 7.505   32.055 -112.555 1.00 50.04  ? 145  SER A CA    1 
ATOM   2008 C  C     . SER E 3 145 ? 8.423   30.957 -113.082 1.00 49.35  ? 145  SER A C     1 
ATOM   2009 O  O     . SER E 3 145 ? 9.481   30.677 -112.508 1.00 49.74  ? 145  SER A O     1 
ATOM   2010 C  CB    . SER E 3 145 ? 7.725   33.350 -113.346 1.00 26.60  ? 145  SER A CB    1 
ATOM   2011 O  OG    . SER E 3 145 ? 9.099   33.577 -113.577 1.00 25.83  ? 145  SER A OG    1 
ATOM   2012 N  N     . PRO E 3 146 ? 8.027   30.313 -114.185 1.00 32.87  ? 146  PRO A N     1 
ATOM   2013 C  CA    . PRO E 3 146 ? 8.861   29.240 -114.735 1.00 31.66  ? 146  PRO A CA    1 
ATOM   2014 C  C     . PRO E 3 146 ? 10.244  29.631 -115.243 1.00 33.07  ? 146  PRO A C     1 
ATOM   2015 O  O     . PRO E 3 146 ? 11.139  28.795 -115.329 1.00 34.64  ? 146  PRO A O     1 
ATOM   2016 C  CB    . PRO E 3 146 ? 7.963   28.615 -115.801 1.00 37.27  ? 146  PRO A CB    1 
ATOM   2017 C  CG    . PRO E 3 146 ? 6.950   29.700 -116.127 1.00 37.58  ? 146  PRO A CG    1 
ATOM   2018 C  CD    . PRO E 3 146 ? 6.698   30.359 -114.820 1.00 36.48  ? 146  PRO A CD    1 
ATOM   2019 N  N     . ARG E 3 147 ? 10.437  30.910 -115.527 1.00 44.13  ? 147  ARG A N     1 
ATOM   2020 C  CA    . ARG E 3 147 ? 11.718  31.406 -116.028 1.00 45.45  ? 147  ARG A CA    1 
ATOM   2021 C  C     . ARG E 3 147 ? 12.837  31.477 -114.976 1.00 47.10  ? 147  ARG A C     1 
ATOM   2022 O  O     . ARG E 3 147 ? 14.019  31.475 -115.323 1.00 49.02  ? 147  ARG A O     1 
ATOM   2023 C  CB    . ARG E 3 147 ? 11.506  32.785 -116.671 1.00 40.87  ? 147  ARG A CB    1 
ATOM   2024 C  CG    . ARG E 3 147 ? 12.731  33.389 -117.328 1.00 40.36  ? 147  ARG A CG    1 
ATOM   2025 C  CD    . ARG E 3 147 ? 12.412  34.734 -117.976 1.00 41.71  ? 147  ARG A CD    1 
ATOM   2026 N  NE    . ARG E 3 147 ? 13.633  35.412 -118.417 1.00 42.88  ? 147  ARG A NE    1 
ATOM   2027 C  CZ    . ARG E 3 147 ? 13.700  36.696 -118.749 1.00 41.40  ? 147  ARG A CZ    1 
ATOM   2028 N  NH1   . ARG E 3 147 ? 12.617  37.457 -118.699 1.00 40.84  ? 147  ARG A NH1   1 
ATOM   2029 N  NH2   . ARG E 3 147 ? 14.856  37.226 -119.103 1.00 41.77  ? 147  ARG A NH2   1 
ATOM   2030 N  N     . PHE E 3 148 ? 12.479  31.533 -113.696 1.00 45.36  ? 148  PHE A N     1 
ATOM   2031 C  CA    . PHE E 3 148 ? 13.488  31.607 -112.632 1.00 46.00  ? 148  PHE A CA    1 
ATOM   2032 C  C     . PHE E 3 148 ? 13.328  30.569 -111.518 1.00 47.15  ? 148  PHE A C     1 
ATOM   2033 O  O     . PHE E 3 148 ? 14.276  30.292 -110.788 1.00 47.11  ? 148  PHE A O     1 
ATOM   2034 C  CB    . PHE E 3 148 ? 13.487  33.004 -112.029 1.00 37.34  ? 148  PHE A CB    1 
ATOM   2035 C  CG    . PHE E 3 148 ? 13.493  34.093 -113.063 1.00 37.44  ? 148  PHE A CG    1 
ATOM   2036 C  CD1   . PHE E 3 148 ? 14.563  34.233 -113.936 1.00 34.42  ? 148  PHE A CD1   1 
ATOM   2037 C  CD2   . PHE E 3 148 ? 12.393  34.934 -113.214 1.00 35.46  ? 148  PHE A CD2   1 
ATOM   2038 C  CE1   . PHE E 3 148 ? 14.527  35.194 -114.950 1.00 33.13  ? 148  PHE A CE1   1 
ATOM   2039 C  CE2   . PHE E 3 148 ? 12.357  35.888 -114.223 1.00 35.31  ? 148  PHE A CE2   1 
ATOM   2040 C  CZ    . PHE E 3 148 ? 13.413  36.021 -115.088 1.00 32.47  ? 148  PHE A CZ    1 
ATOM   2041 N  N     . ARG E 3 149 ? 12.137  29.988 -111.409 1.00 60.72  ? 149  ARG A N     1 
ATOM   2042 C  CA    . ARG E 3 149 ? 11.835  28.990 -110.385 1.00 63.04  ? 149  ARG A CA    1 
ATOM   2043 C  C     . ARG E 3 149 ? 12.952  27.983 -110.090 1.00 63.85  ? 149  ARG A C     1 
ATOM   2044 O  O     . ARG E 3 149 ? 13.198  27.651 -108.926 1.00 64.58  ? 149  ARG A O     1 
ATOM   2045 C  CB    . ARG E 3 149 ? 10.561  28.236 -110.763 1.00 59.58  ? 149  ARG A CB    1 
ATOM   2046 N  N     . ASN E 3 150 ? 13.631  27.504 -111.129 1.00 38.88  ? 150  ASN A N     1 
ATOM   2047 C  CA    . ASN E 3 150 ? 14.678  26.508 -110.937 1.00 38.19  ? 150  ASN A CA    1 
ATOM   2048 C  C     . ASN E 3 150 ? 16.101  27.046 -111.005 1.00 37.78  ? 150  ASN A C     1 
ATOM   2049 O  O     . ASN E 3 150 ? 17.005  26.368 -111.486 1.00 37.16  ? 150  ASN A O     1 
ATOM   2050 C  CB    . ASN E 3 150 ? 14.484  25.369 -111.949 1.00 63.27  ? 150  ASN A CB    1 
ATOM   2051 C  CG    . ASN E 3 150 ? 15.465  24.226 -111.750 1.00 64.49  ? 150  ASN A CG    1 
ATOM   2052 O  OD1   . ASN E 3 150 ? 15.743  23.817 -110.620 1.00 64.25  ? 150  ASN A OD1   1 
ATOM   2053 N  ND2   . ASN E 3 150 ? 15.987  23.695 -112.853 1.00 64.30  ? 150  ASN A ND2   1 
ATOM   2054 N  N     . ARG E 3 151 ? 16.302  28.262 -110.509 1.00 43.49  ? 151  ARG A N     1 
ATOM   2055 C  CA    . ARG E 3 151 ? 17.623  28.878 -110.518 1.00 41.57  ? 151  ARG A CA    1 
ATOM   2056 C  C     . ARG E 3 151 ? 18.088  29.296 -109.115 1.00 42.24  ? 151  ARG A C     1 
ATOM   2057 O  O     . ARG E 3 151 ? 17.313  29.845 -108.319 1.00 42.01  ? 151  ARG A O     1 
ATOM   2058 C  CB    . ARG E 3 151 ? 17.628  30.092 -111.452 1.00 43.24  ? 151  ARG A CB    1 
ATOM   2059 C  CG    . ARG E 3 151 ? 17.532  29.737 -112.936 1.00 44.38  ? 151  ARG A CG    1 
ATOM   2060 C  CD    . ARG E 3 151 ? 17.955  30.905 -113.813 1.00 42.65  ? 151  ARG A CD    1 
ATOM   2061 N  NE    . ARG E 3 151 ? 19.329  31.329 -113.527 1.00 42.53  ? 151  ARG A NE    1 
ATOM   2062 C  CZ    . ARG E 3 151 ? 19.881  32.449 -113.987 1.00 40.28  ? 151  ARG A CZ    1 
ATOM   2063 N  NH1   . ARG E 3 151 ? 19.186  33.264 -114.761 1.00 40.12  ? 151  ARG A NH1   1 
ATOM   2064 N  NH2   . ARG E 3 151 ? 21.122  32.759 -113.656 1.00 36.34  ? 151  ARG A NH2   1 
ATOM   2065 N  N     . GLN E 3 152 ? 19.358  29.028 -108.824 1.00 37.38  ? 152  GLN A N     1 
ATOM   2066 C  CA    . GLN E 3 152 ? 19.951  29.362 -107.539 1.00 36.35  ? 152  GLN A CA    1 
ATOM   2067 C  C     . GLN E 3 152 ? 20.162  30.870 -107.421 1.00 35.39  ? 152  GLN A C     1 
ATOM   2068 O  O     . GLN E 3 152 ? 20.515  31.548 -108.403 1.00 33.04  ? 152  GLN A O     1 
ATOM   2069 C  CB    . GLN E 3 152 ? 21.279  28.637 -107.377 1.00 54.59  ? 152  GLN A CB    1 
ATOM   2070 C  CG    . GLN E 3 152 ? 21.175  27.158 -107.625 1.00 57.25  ? 152  GLN A CG    1 
ATOM   2071 C  CD    . GLN E 3 152 ? 22.509  26.460 -107.500 1.00 61.35  ? 152  GLN A CD    1 
ATOM   2072 O  OE1   . GLN E 3 152 ? 22.633  25.280 -107.829 1.00 62.55  ? 152  GLN A OE1   1 
ATOM   2073 N  NE2   . GLN E 3 152 ? 23.517  27.183 -107.017 1.00 62.13  ? 152  GLN A NE2   1 
ATOM   2074 N  N     . PHE E 3 153 ? 19.948  31.388 -106.211 1.00 35.27  ? 153  PHE A N     1 
ATOM   2075 C  CA    . PHE E 3 153 ? 20.071  32.813 -105.972 1.00 34.81  ? 153  PHE A CA    1 
ATOM   2076 C  C     . PHE E 3 153 ? 21.479  33.339 -106.173 1.00 35.44  ? 153  PHE A C     1 
ATOM   2077 O  O     . PHE E 3 153 ? 21.653  34.452 -106.662 1.00 36.48  ? 153  PHE A O     1 
ATOM   2078 C  CB    . PHE E 3 153 ? 19.556  33.162 -104.573 1.00 33.73  ? 153  PHE A CB    1 
ATOM   2079 C  CG    . PHE E 3 153 ? 18.176  32.636 -104.288 1.00 31.42  ? 153  PHE A CG    1 
ATOM   2080 C  CD1   . PHE E 3 153 ? 17.157  32.737 -105.251 1.00 27.22  ? 153  PHE A CD1   1 
ATOM   2081 C  CD2   . PHE E 3 153 ? 17.878  32.061 -103.051 1.00 30.08  ? 153  PHE A CD2   1 
ATOM   2082 C  CE1   . PHE E 3 153 ? 15.853  32.274 -104.986 1.00 28.32  ? 153  PHE A CE1   1 
ATOM   2083 C  CE2   . PHE E 3 153 ? 16.571  31.593 -102.775 1.00 28.66  ? 153  PHE A CE2   1 
ATOM   2084 C  CZ    . PHE E 3 153 ? 15.561  31.704 -103.751 1.00 29.74  ? 153  PHE A CZ    1 
ATOM   2085 N  N     . ALA E 3 154 ? 22.479  32.538 -105.815 1.00 47.93  ? 154  ALA A N     1 
ATOM   2086 C  CA    . ALA E 3 154 ? 23.877  32.942 -105.974 1.00 49.75  ? 154  ALA A CA    1 
ATOM   2087 C  C     . ALA E 3 154 ? 24.110  33.528 -107.368 1.00 49.36  ? 154  ALA A C     1 
ATOM   2088 O  O     . ALA E 3 154 ? 24.879  34.474 -107.541 1.00 50.40  ? 154  ALA A O     1 
ATOM   2089 C  CB    . ALA E 3 154 ? 24.808  31.737 -105.754 1.00 40.72  ? 154  ALA A CB    1 
ATOM   2090 N  N     . GLY E 3 155 ? 23.444  32.941 -108.357 1.00 51.95  ? 155  GLY A N     1 
ATOM   2091 C  CA    . GLY E 3 155 ? 23.575  33.403 -109.725 1.00 50.26  ? 155  GLY A CA    1 
ATOM   2092 C  C     . GLY E 3 155 ? 22.446  34.323 -110.151 1.00 49.95  ? 155  GLY A C     1 
ATOM   2093 O  O     . GLY E 3 155 ? 22.690  35.309 -110.847 1.00 50.63  ? 155  GLY A O     1 
ATOM   2094 N  N     . LEU E 3 156 ? 21.219  34.011 -109.730 1.00 32.81  ? 156  LEU A N     1 
ATOM   2095 C  CA    . LEU E 3 156 ? 20.054  34.818 -110.092 1.00 29.80  ? 156  LEU A CA    1 
ATOM   2096 C  C     . LEU E 3 156 ? 20.122  36.257 -109.565 1.00 29.48  ? 156  LEU A C     1 
ATOM   2097 O  O     . LEU E 3 156 ? 19.818  37.206 -110.276 1.00 31.21  ? 156  LEU A O     1 
ATOM   2098 C  CB    . LEU E 3 156 ? 18.774  34.135 -109.584 1.00 22.69  ? 156  LEU A CB    1 
ATOM   2099 C  CG    . LEU E 3 156 ? 17.385  34.742 -109.858 1.00 19.89  ? 156  LEU A CG    1 
ATOM   2100 C  CD1   . LEU E 3 156 ? 17.027  34.679 -111.339 1.00 20.77  ? 156  LEU A CD1   1 
ATOM   2101 C  CD2   . LEU E 3 156 ? 16.370  33.963 -109.079 1.00 15.64  ? 156  LEU A CD2   1 
ATOM   2102 N  N     . LEU E 3 157 ? 20.528  36.413 -108.314 1.00 32.62  ? 157  LEU A N     1 
ATOM   2103 C  CA    . LEU E 3 157 ? 20.607  37.723 -107.692 1.00 31.56  ? 157  LEU A CA    1 
ATOM   2104 C  C     . LEU E 3 157 ? 21.652  38.639 -108.314 1.00 32.87  ? 157  LEU A C     1 
ATOM   2105 O  O     . LEU E 3 157 ? 21.860  39.771 -107.869 1.00 32.78  ? 157  LEU A O     1 
ATOM   2106 C  CB    . LEU E 3 157 ? 20.829  37.554 -106.184 1.00 29.82  ? 157  LEU A CB    1 
ATOM   2107 C  CG    . LEU E 3 157 ? 19.497  37.666 -105.418 1.00 32.15  ? 157  LEU A CG    1 
ATOM   2108 C  CD1   . LEU E 3 157 ? 18.425  36.773 -106.056 1.00 31.57  ? 157  LEU A CD1   1 
ATOM   2109 C  CD2   . LEU E 3 157 ? 19.707  37.333 -103.971 1.00 27.87  ? 157  LEU A CD2   1 
ATOM   2110 N  N     . LEU E 3 158 ? 22.310  38.141 -109.352 1.00 35.24  ? 158  LEU A N     1 
ATOM   2111 C  CA    . LEU E 3 158 ? 23.300  38.928 -110.075 1.00 35.17  ? 158  LEU A CA    1 
ATOM   2112 C  C     . LEU E 3 158 ? 22.809  39.187 -111.506 1.00 34.38  ? 158  LEU A C     1 
ATOM   2113 O  O     . LEU E 3 158 ? 23.157  40.188 -112.114 1.00 33.77  ? 158  LEU A O     1 
ATOM   2114 C  CB    . LEU E 3 158 ? 24.649  38.205 -110.124 1.00 36.25  ? 158  LEU A CB    1 
ATOM   2115 C  CG    . LEU E 3 158 ? 25.492  38.100 -108.845 1.00 39.40  ? 158  LEU A CG    1 
ATOM   2116 C  CD1   . LEU E 3 158 ? 26.918  37.701 -109.244 1.00 38.01  ? 158  LEU A CD1   1 
ATOM   2117 C  CD2   . LEU E 3 158 ? 25.525  39.422 -108.097 1.00 38.16  ? 158  LEU A CD2   1 
ATOM   2118 N  N     . ASP E 3 159 ? 21.982  38.278 -112.012 1.00 40.30  ? 159  ASP A N     1 
ATOM   2119 C  CA    . ASP E 3 159 ? 21.429  38.344 -113.364 1.00 42.32  ? 159  ASP A CA    1 
ATOM   2120 C  C     . ASP E 3 159 ? 20.447  39.498 -113.596 1.00 41.68  ? 159  ASP A C     1 
ATOM   2121 O  O     . ASP E 3 159 ? 19.330  39.485 -113.091 1.00 42.87  ? 159  ASP A O     1 
ATOM   2122 C  CB    . ASP E 3 159 ? 20.737  37.011 -113.703 1.00 40.86  ? 159  ASP A CB    1 
ATOM   2123 C  CG    . ASP E 3 159 ? 20.370  36.900 -115.175 1.00 42.59  ? 159  ASP A CG    1 
ATOM   2124 O  OD1   . ASP E 3 159 ? 20.289  37.953 -115.858 1.00 43.58  ? 159  ASP A OD1   1 
ATOM   2125 O  OD2   . ASP E 3 159 ? 20.153  35.759 -115.643 1.00 41.13  ? 159  ASP A OD2   1 
ATOM   2126 N  N     . GLN E 3 160 ? 20.866  40.476 -114.386 1.00 33.68  ? 160  GLN A N     1 
ATOM   2127 C  CA    . GLN E 3 160 ? 20.038  41.636 -114.694 1.00 33.50  ? 160  GLN A CA    1 
ATOM   2128 C  C     . GLN E 3 160 ? 18.718  41.260 -115.387 1.00 34.14  ? 160  GLN A C     1 
ATOM   2129 O  O     . GLN E 3 160 ? 17.733  42.003 -115.324 1.00 32.09  ? 160  GLN A O     1 
ATOM   2130 C  CB    . GLN E 3 160 ? 20.832  42.611 -115.568 1.00 32.47  ? 160  GLN A CB    1 
ATOM   2131 C  CG    . GLN E 3 160 ? 22.110  43.081 -114.916 1.00 32.11  ? 160  GLN A CG    1 
ATOM   2132 C  CD    . GLN E 3 160 ? 21.886  43.549 -113.492 1.00 33.40  ? 160  GLN A CD    1 
ATOM   2133 O  OE1   . GLN E 3 160 ? 21.037  44.407 -113.232 1.00 33.85  ? 160  GLN A OE1   1 
ATOM   2134 N  NE2   . GLN E 3 160 ? 22.650  42.993 -112.561 1.00 32.46  ? 160  GLN A NE2   1 
ATOM   2135 N  N     . ALA E 3 161 ? 18.708  40.105 -116.050 1.00 43.38  ? 161  ALA A N     1 
ATOM   2136 C  CA    . ALA E 3 161 ? 17.518  39.624 -116.743 1.00 42.14  ? 161  ALA A CA    1 
ATOM   2137 C  C     . ALA E 3 161 ? 16.384  39.415 -115.740 1.00 42.94  ? 161  ALA A C     1 
ATOM   2138 O  O     . ALA E 3 161 ? 15.209  39.518 -116.088 1.00 40.51  ? 161  ALA A O     1 
ATOM   2139 C  CB    . ALA E 3 161 ? 17.830  38.321 -117.447 1.00 28.84  ? 161  ALA A CB    1 
ATOM   2140 N  N     . PHE E 3 162 ? 16.758  39.118 -114.493 1.00 35.66  ? 162  PHE A N     1 
ATOM   2141 C  CA    . PHE E 3 162 ? 15.801  38.892 -113.412 1.00 35.61  ? 162  PHE A CA    1 
ATOM   2142 C  C     . PHE E 3 162 ? 15.397  40.193 -112.715 1.00 34.48  ? 162  PHE A C     1 
ATOM   2143 O  O     . PHE E 3 162 ? 14.217  40.482 -112.571 1.00 34.11  ? 162  PHE A O     1 
ATOM   2144 C  CB    . PHE E 3 162 ? 16.401  37.905 -112.409 1.00 40.52  ? 162  PHE A CB    1 
ATOM   2145 C  CG    . PHE E 3 162 ? 15.719  37.891 -111.078 1.00 40.79  ? 162  PHE A CG    1 
ATOM   2146 C  CD1   . PHE E 3 162 ? 14.347  37.684 -110.979 1.00 41.23  ? 162  PHE A CD1   1 
ATOM   2147 C  CD2   . PHE E 3 162 ? 16.455  38.066 -109.914 1.00 40.07  ? 162  PHE A CD2   1 
ATOM   2148 C  CE1   . PHE E 3 162 ? 13.719  37.651 -109.730 1.00 41.83  ? 162  PHE A CE1   1 
ATOM   2149 C  CE2   . PHE E 3 162 ? 15.840  38.033 -108.673 1.00 40.42  ? 162  PHE A CE2   1 
ATOM   2150 C  CZ    . PHE E 3 162 ? 14.475  37.826 -108.576 1.00 40.02  ? 162  PHE A CZ    1 
ATOM   2151 N  N     . LEU E 3 163 ? 16.382  40.974 -112.291 1.00 34.77  ? 163  LEU A N     1 
ATOM   2152 C  CA    . LEU E 3 163 ? 16.137  42.246 -111.614 1.00 33.62  ? 163  LEU A CA    1 
ATOM   2153 C  C     . LEU E 3 163 ? 17.343  43.139 -111.823 1.00 34.09  ? 163  LEU A C     1 
ATOM   2154 O  O     . LEU E 3 163 ? 18.480  42.730 -111.593 1.00 33.54  ? 163  LEU A O     1 
ATOM   2155 C  CB    . LEU E 3 163 ? 15.942  42.054 -110.108 1.00 37.14  ? 163  LEU A CB    1 
ATOM   2156 C  CG    . LEU E 3 163 ? 14.773  41.267 -109.516 1.00 36.86  ? 163  LEU A CG    1 
ATOM   2157 C  CD1   . LEU E 3 163 ? 15.022  41.111 -108.016 1.00 38.29  ? 163  LEU A CD1   1 
ATOM   2158 C  CD2   . LEU E 3 163 ? 13.443  41.983 -109.770 1.00 32.50  ? 163  LEU A CD2   1 
ATOM   2159 N  N     . ALA E 3 164 ? 17.085  44.366 -112.253 1.00 34.13  ? 164  ALA A N     1 
ATOM   2160 C  CA    . ALA E 3 164 ? 18.141  45.326 -112.504 1.00 33.80  ? 164  ALA A CA    1 
ATOM   2161 C  C     . ALA E 3 164 ? 18.485  46.141 -111.270 1.00 33.84  ? 164  ALA A C     1 
ATOM   2162 O  O     . ALA E 3 164 ? 17.602  46.582 -110.529 1.00 32.21  ? 164  ALA A O     1 
ATOM   2163 C  CB    . ALA E 3 164 ? 17.735  46.261 -113.643 1.00 54.26  ? 164  ALA A CB    1 
ATOM   2164 N  N     . GLY E 3 165 ? 19.783  46.338 -111.066 1.00 37.06  ? 165  GLY A N     1 
ATOM   2165 C  CA    . GLY E 3 165 ? 20.247  47.127 -109.946 1.00 38.10  ? 165  GLY A CA    1 
ATOM   2166 C  C     . GLY E 3 165 ? 20.905  46.358 -108.826 1.00 38.65  ? 165  GLY A C     1 
ATOM   2167 O  O     . GLY E 3 165 ? 21.455  46.965 -107.904 1.00 39.48  ? 165  GLY A O     1 
ATOM   2168 N  N     . LEU E 3 166 ? 20.850  45.032 -108.894 1.00 41.84  ? 166  LEU A N     1 
ATOM   2169 C  CA    . LEU E 3 166 ? 21.451  44.195 -107.863 1.00 39.80  ? 166  LEU A CA    1 
ATOM   2170 C  C     . LEU E 3 166 ? 22.844  43.771 -108.264 1.00 39.34  ? 166  LEU A C     1 
ATOM   2171 O  O     . LEU E 3 166 ? 23.054  43.337 -109.376 1.00 41.80  ? 166  LEU A O     1 
ATOM   2172 C  CB    . LEU E 3 166 ? 20.616  42.951 -107.621 1.00 30.33  ? 166  LEU A CB    1 
ATOM   2173 C  CG    . LEU E 3 166 ? 19.169  43.032 -107.145 1.00 27.85  ? 166  LEU A CG    1 
ATOM   2174 C  CD1   . LEU E 3 166 ? 18.696  41.578 -106.955 1.00 26.98  ? 166  LEU A CD1   1 
ATOM   2175 C  CD2   . LEU E 3 166 ? 19.028  43.822 -105.853 1.00 24.17  ? 166  LEU A CD2   1 
ATOM   2176 N  N     . GLY E 3 167 ? 23.789  43.900 -107.341 1.00 39.05  ? 167  GLY A N     1 
ATOM   2177 C  CA    . GLY E 3 167 ? 25.165  43.526 -107.605 1.00 37.51  ? 167  GLY A CA    1 
ATOM   2178 C  C     . GLY E 3 167 ? 25.616  42.525 -106.560 1.00 38.53  ? 167  GLY A C     1 
ATOM   2179 O  O     . GLY E 3 167 ? 24.786  41.913 -105.883 1.00 38.30  ? 167  GLY A O     1 
ATOM   2180 N  N     . ASN E 3 168 ? 26.922  42.356 -106.399 1.00 29.12  ? 168  ASN A N     1 
ATOM   2181 C  CA    . ASN E 3 168 ? 27.397  41.384 -105.432 1.00 30.49  ? 168  ASN A CA    1 
ATOM   2182 C  C     . ASN E 3 168 ? 27.155  41.711 -103.965 1.00 30.66  ? 168  ASN A C     1 
ATOM   2183 O  O     . ASN E 3 168 ? 26.577  40.900 -103.239 1.00 32.67  ? 168  ASN A O     1 
ATOM   2184 C  CB    . ASN E 3 168 ? 28.873  41.090 -105.651 1.00 46.09  ? 168  ASN A CB    1 
ATOM   2185 C  CG    . ASN E 3 168 ? 29.310  39.846 -104.923 1.00 47.66  ? 168  ASN A CG    1 
ATOM   2186 O  OD1   . ASN E 3 168 ? 28.476  38.994 -104.585 1.00 45.81  ? 168  ASN A OD1   1 
ATOM   2187 N  ND2   . ASN E 3 168 ? 30.614  39.718 -104.684 1.00 45.47  ? 168  ASN A ND2   1 
ATOM   2188 N  N     . TYR E 3 169 ? 27.585  42.883 -103.521 1.00 36.93  ? 169  TYR A N     1 
ATOM   2189 C  CA    . TYR E 3 169 ? 27.389  43.265 -102.126 1.00 37.03  ? 169  TYR A CA    1 
ATOM   2190 C  C     . TYR E 3 169 ? 25.901  43.191 -101.775 1.00 36.50  ? 169  TYR A C     1 
ATOM   2191 O  O     . TYR E 3 169 ? 25.526  42.816 -100.662 1.00 36.56  ? 169  TYR A O     1 
ATOM   2192 C  CB    . TYR E 3 169 ? 27.953  44.670 -101.861 1.00 39.43  ? 169  TYR A CB    1 
ATOM   2193 C  CG    . TYR E 3 169 ? 27.010  45.813 -102.138 1.00 41.28  ? 169  TYR A CG    1 
ATOM   2194 C  CD1   . TYR E 3 169 ? 25.874  46.012 -101.349 1.00 41.09  ? 169  TYR A CD1   1 
ATOM   2195 C  CD2   . TYR E 3 169 ? 27.264  46.719 -103.170 1.00 42.35  ? 169  TYR A CD2   1 
ATOM   2196 C  CE1   . TYR E 3 169 ? 25.013  47.078 -101.578 1.00 42.59  ? 169  TYR A CE1   1 
ATOM   2197 C  CE2   . TYR E 3 169 ? 26.410  47.799 -103.408 1.00 41.52  ? 169  TYR A CE2   1 
ATOM   2198 C  CZ    . TYR E 3 169 ? 25.282  47.971 -102.606 1.00 43.29  ? 169  TYR A CZ    1 
ATOM   2199 O  OH    . TYR E 3 169 ? 24.416  49.022 -102.829 1.00 43.64  ? 169  TYR A OH    1 
ATOM   2200 N  N     . LEU E 3 170 ? 25.047  43.558 -102.719 1.00 52.96  ? 170  LEU A N     1 
ATOM   2201 C  CA    . LEU E 3 170 ? 23.627  43.469 -102.448 1.00 52.67  ? 170  LEU A CA    1 
ATOM   2202 C  C     . LEU E 3 170 ? 23.284  41.980 -102.441 1.00 53.24  ? 170  LEU A C     1 
ATOM   2203 O  O     . LEU E 3 170 ? 22.349  41.553 -101.775 1.00 53.85  ? 170  LEU A O     1 
ATOM   2204 C  CB    . LEU E 3 170 ? 22.803  44.204 -103.521 1.00 29.11  ? 170  LEU A CB    1 
ATOM   2205 C  CG    . LEU E 3 170 ? 22.519  45.707 -103.372 1.00 28.16  ? 170  LEU A CG    1 
ATOM   2206 C  CD1   . LEU E 3 170 ? 21.511  46.128 -104.452 1.00 28.86  ? 170  LEU A CD1   1 
ATOM   2207 C  CD2   . LEU E 3 170 ? 21.933  46.015 -102.023 1.00 27.33  ? 170  LEU A CD2   1 
ATOM   2208 N  N     . ARG E 3 171 ? 24.065  41.190 -103.170 1.00 29.57  ? 171  ARG A N     1 
ATOM   2209 C  CA    . ARG E 3 171 ? 23.827  39.757 -103.247 1.00 29.00  ? 171  ARG A CA    1 
ATOM   2210 C  C     . ARG E 3 171 ? 24.032  39.111 -101.892 1.00 28.00  ? 171  ARG A C     1 
ATOM   2211 O  O     . ARG E 3 171 ? 23.144  38.418 -101.391 1.00 27.99  ? 171  ARG A O     1 
ATOM   2212 C  CB    . ARG E 3 171 ? 24.759  39.091 -104.279 1.00 36.24  ? 171  ARG A CB    1 
ATOM   2213 C  CG    . ARG E 3 171 ? 24.639  37.550 -104.349 1.00 32.93  ? 171  ARG A CG    1 
ATOM   2214 C  CD    . ARG E 3 171 ? 25.613  36.906 -105.351 1.00 29.63  ? 171  ARG A CD    1 
ATOM   2215 N  NE    . ARG E 3 171 ? 27.024  37.041 -104.974 1.00 30.86  ? 171  ARG A NE    1 
ATOM   2216 C  CZ    . ARG E 3 171 ? 28.020  36.369 -105.555 1.00 33.56  ? 171  ARG A CZ    1 
ATOM   2217 N  NH1   . ARG E 3 171 ? 27.770  35.518 -106.531 1.00 36.87  ? 171  ARG A NH1   1 
ATOM   2218 N  NH2   . ARG E 3 171 ? 29.273  36.539 -105.171 1.00 34.42  ? 171  ARG A NH2   1 
ATOM   2219 N  N     . VAL E 3 172 ? 25.200  39.343 -101.302 1.00 39.09  ? 172  VAL A N     1 
ATOM   2220 C  CA    . VAL E 3 172 ? 25.516  38.763 -100.006 1.00 36.76  ? 172  VAL A CA    1 
ATOM   2221 C  C     . VAL E 3 172 ? 24.562  39.251 -98.922  1.00 38.92  ? 172  VAL A C     1 
ATOM   2222 O  O     . VAL E 3 172 ? 24.006  38.451 -98.148  1.00 41.55  ? 172  VAL A O     1 
ATOM   2223 C  CB    . VAL E 3 172 ? 26.989  39.076 -99.583  1.00 17.00  ? 172  VAL A CB    1 
ATOM   2224 C  CG1   . VAL E 3 172 ? 27.932  38.777 -100.730 1.00 17.29  ? 172  VAL A CG1   1 
ATOM   2225 C  CG2   . VAL E 3 172 ? 27.137  40.504 -99.148  1.00 15.80  ? 172  VAL A CG2   1 
ATOM   2226 N  N     . GLU E 3 173 ? 24.370  40.564 -98.889  1.00 33.06  ? 173  GLU A N     1 
ATOM   2227 C  CA    . GLU E 3 173 ? 23.515  41.239 -97.922  1.00 33.56  ? 173  GLU A CA    1 
ATOM   2228 C  C     . GLU E 3 173 ? 22.052  40.777 -97.891  1.00 32.54  ? 173  GLU A C     1 
ATOM   2229 O  O     . GLU E 3 173 ? 21.489  40.557 -96.815  1.00 36.19  ? 173  GLU A O     1 
ATOM   2230 C  CB    . GLU E 3 173 ? 23.563  42.745 -98.197  1.00 45.54  ? 173  GLU A CB    1 
ATOM   2231 C  CG    . GLU E 3 173 ? 23.559  43.626 -96.973  1.00 50.85  ? 173  GLU A CG    1 
ATOM   2232 C  CD    . GLU E 3 173 ? 24.762  43.384 -96.085  1.00 53.38  ? 173  GLU A CD    1 
ATOM   2233 O  OE1   . GLU E 3 173 ? 25.833  43.032 -96.627  1.00 53.65  ? 173  GLU A OE1   1 
ATOM   2234 O  OE2   . GLU E 3 173 ? 24.643  43.557 -94.852  1.00 53.72  ? 173  GLU A OE2   1 
ATOM   2235 N  N     . ILE E 3 174 ? 21.436  40.642 -99.060  1.00 34.49  ? 174  ILE A N     1 
ATOM   2236 C  CA    . ILE E 3 174 ? 20.041  40.242 -99.145  1.00 34.70  ? 174  ILE A CA    1 
ATOM   2237 C  C     . ILE E 3 174 ? 19.856  38.829 -98.598  1.00 36.71  ? 174  ILE A C     1 
ATOM   2238 O  O     . ILE E 3 174 ? 18.933  38.566 -97.817  1.00 37.59  ? 174  ILE A O     1 
ATOM   2239 C  CB    . ILE E 3 174 ? 19.524  40.307 -100.613 1.00 26.05  ? 174  ILE A CB    1 
ATOM   2240 C  CG1   . ILE E 3 174 ? 19.764  41.709 -101.206 1.00 22.36  ? 174  ILE A CG1   1 
ATOM   2241 C  CG2   . ILE E 3 174 ? 18.032  40.010 -100.651 1.00 25.82  ? 174  ILE A CG2   1 
ATOM   2242 C  CD1   . ILE E 3 174 ? 19.504  41.825 -102.705 1.00 16.04  ? 174  ILE A CD1   1 
ATOM   2243 N  N     . LEU E 3 175 ? 20.737  37.917 -98.996  1.00 38.43  ? 175  LEU A N     1 
ATOM   2244 C  CA    . LEU E 3 175 ? 20.655  36.541 -98.528  1.00 37.60  ? 175  LEU A CA    1 
ATOM   2245 C  C     . LEU E 3 175 ? 20.959  36.432 -97.049  1.00 39.66  ? 175  LEU A C     1 
ATOM   2246 O  O     . LEU E 3 175 ? 20.392  35.588 -96.353  1.00 42.13  ? 175  LEU A O     1 
ATOM   2247 C  CB    . LEU E 3 175 ? 21.606  35.670 -99.306  1.00 32.52  ? 175  LEU A CB    1 
ATOM   2248 C  CG    . LEU E 3 175 ? 20.969  34.870 -100.419 1.00 34.19  ? 175  LEU A CG    1 
ATOM   2249 C  CD1   . LEU E 3 175 ? 19.760  35.577 -100.993 1.00 33.86  ? 175  LEU A CD1   1 
ATOM   2250 C  CD2   . LEU E 3 175 ? 22.044  34.663 -101.471 1.00 32.18  ? 175  LEU A CD2   1 
ATOM   2251 N  N     . TRP E 3 176 ? 21.867  37.266 -96.561  1.00 29.84  ? 176  TRP A N     1 
ATOM   2252 C  CA    . TRP E 3 176 ? 22.145  37.236 -95.144  1.00 32.05  ? 176  TRP A CA    1 
ATOM   2253 C  C     . TRP E 3 176 ? 20.927  37.816 -94.426  1.00 32.62  ? 176  TRP A C     1 
ATOM   2254 O  O     . TRP E 3 176 ? 20.615  37.438 -93.306  1.00 34.09  ? 176  TRP A O     1 
ATOM   2255 C  CB    . TRP E 3 176 ? 23.378  38.072 -94.804  1.00 38.27  ? 176  TRP A CB    1 
ATOM   2256 C  CG    . TRP E 3 176 ? 23.614  38.149 -93.339  1.00 35.24  ? 176  TRP A CG    1 
ATOM   2257 C  CD1   . TRP E 3 176 ? 24.383  37.319 -92.591  1.00 36.57  ? 176  TRP A CD1   1 
ATOM   2258 C  CD2   . TRP E 3 176 ? 23.001  39.062 -92.426  1.00 34.99  ? 176  TRP A CD2   1 
ATOM   2259 N  NE1   . TRP E 3 176 ? 24.293  37.650 -91.262  1.00 37.26  ? 176  TRP A NE1   1 
ATOM   2260 C  CE2   . TRP E 3 176 ? 23.448  38.721 -91.131  1.00 35.97  ? 176  TRP A CE2   1 
ATOM   2261 C  CE3   . TRP E 3 176 ? 22.118  40.136 -92.574  1.00 33.15  ? 176  TRP A CE3   1 
ATOM   2262 C  CZ2   . TRP E 3 176 ? 23.038  39.419 -89.986  1.00 33.12  ? 176  TRP A CZ2   1 
ATOM   2263 C  CZ3   . TRP E 3 176 ? 21.712  40.831 -91.434  1.00 32.82  ? 176  TRP A CZ3   1 
ATOM   2264 C  CH2   . TRP E 3 176 ? 22.173  40.469 -90.159  1.00 29.94  ? 176  TRP A CH2   1 
ATOM   2265 N  N     . GLN E 3 177 ? 20.228  38.729 -95.084  1.00 36.91  ? 177  GLN A N     1 
ATOM   2266 C  CA    . GLN E 3 177 ? 19.065  39.365 -94.478  1.00 36.00  ? 177  GLN A CA    1 
ATOM   2267 C  C     . GLN E 3 177 ? 17.979  38.362 -94.135  1.00 34.75  ? 177  GLN A C     1 
ATOM   2268 O  O     . GLN E 3 177 ? 17.316  38.459 -93.104  1.00 33.03  ? 177  GLN A O     1 
ATOM   2269 C  CB    . GLN E 3 177 ? 18.497  40.425 -95.426  1.00 35.83  ? 177  GLN A CB    1 
ATOM   2270 C  CG    . GLN E 3 177 ? 17.423  41.293 -94.791  1.00 36.52  ? 177  GLN A CG    1 
ATOM   2271 C  CD    . GLN E 3 177 ? 17.952  42.057 -93.587  1.00 39.92  ? 177  GLN A CD    1 
ATOM   2272 O  OE1   . GLN E 3 177 ? 18.891  42.863 -93.704  1.00 39.74  ? 177  GLN A OE1   1 
ATOM   2273 N  NE2   . GLN E 3 177 ? 17.364  41.805 -92.423  1.00 35.84  ? 177  GLN A NE2   1 
ATOM   2274 N  N     . VAL E 3 178 ? 17.795  37.397 -95.020  1.00 30.97  ? 178  VAL A N     1 
ATOM   2275 C  CA    . VAL E 3 178 ? 16.778  36.393 -94.816  1.00 31.05  ? 178  VAL A CA    1 
ATOM   2276 C  C     . VAL E 3 178 ? 17.357  35.046 -94.418  1.00 30.76  ? 178  VAL A C     1 
ATOM   2277 O  O     . VAL E 3 178 ? 16.691  34.026 -94.541  1.00 31.83  ? 178  VAL A O     1 
ATOM   2278 C  CB    . VAL E 3 178 ? 15.906  36.240 -96.089  1.00 44.14  ? 178  VAL A CB    1 
ATOM   2279 C  CG1   . VAL E 3 178 ? 15.054  37.482 -96.283  1.00 41.77  ? 178  VAL A CG1   1 
ATOM   2280 C  CG2   . VAL E 3 178 ? 16.792  36.024 -97.308  1.00 43.17  ? 178  VAL A CG2   1 
ATOM   2281 N  N     . GLY E 3 179 ? 18.598  35.054 -93.939  1.00 33.57  ? 179  GLY A N     1 
ATOM   2282 C  CA    . GLY E 3 179 ? 19.258  33.831 -93.501  1.00 33.35  ? 179  GLY A CA    1 
ATOM   2283 C  C     . GLY E 3 179 ? 19.421  32.713 -94.516  1.00 34.56  ? 179  GLY A C     1 
ATOM   2284 O  O     . GLY E 3 179 ? 19.274  31.534 -94.185  1.00 33.33  ? 179  GLY A O     1 
ATOM   2285 N  N     . LEU E 3 180 ? 19.735  33.076 -95.755  1.00 43.26  ? 180  LEU A N     1 
ATOM   2286 C  CA    . LEU E 3 180 ? 19.922  32.086 -96.807  1.00 43.84  ? 180  LEU A CA    1 
ATOM   2287 C  C     . LEU E 3 180 ? 21.301  32.181 -97.414  1.00 44.26  ? 180  LEU A C     1 
ATOM   2288 O  O     . LEU E 3 180 ? 21.955  33.216 -97.350  1.00 45.66  ? 180  LEU A O     1 
ATOM   2289 C  CB    . LEU E 3 180 ? 18.895  32.276 -97.927  1.00 33.06  ? 180  LEU A CB    1 
ATOM   2290 C  CG    . LEU E 3 180 ? 17.411  32.114 -97.602  1.00 33.10  ? 180  LEU A CG    1 
ATOM   2291 C  CD1   . LEU E 3 180 ? 16.585  32.550 -98.808  1.00 31.28  ? 180  LEU A CD1   1 
ATOM   2292 C  CD2   . LEU E 3 180 ? 17.117  30.659 -97.218  1.00 31.23  ? 180  LEU A CD2   1 
ATOM   2293 N  N     . THR E 3 181 ? 21.737  31.078 -97.999  1.00 37.78  ? 181  THR A N     1 
ATOM   2294 C  CA    . THR E 3 181 ? 23.019  31.012 -98.677  1.00 38.47  ? 181  THR A CA    1 
ATOM   2295 C  C     . THR E 3 181 ? 22.646  31.074 -100.154 1.00 39.88  ? 181  THR A C     1 
ATOM   2296 O  O     . THR E 3 181 ? 21.460  31.130 -100.494 1.00 41.16  ? 181  THR A O     1 
ATOM   2297 C  CB    . THR E 3 181 ? 23.771  29.688 -98.358  1.00 36.52  ? 181  THR A CB    1 
ATOM   2298 O  OG1   . THR E 3 181 ? 22.872  28.580 -98.475  1.00 36.17  ? 181  THR A OG1   1 
ATOM   2299 C  CG2   . THR E 3 181 ? 24.323  29.717 -96.942  1.00 34.64  ? 181  THR A CG2   1 
ATOM   2300 N  N     . GLY E 3 182 ? 23.637  31.060 -101.032 1.00 37.20  ? 182  GLY A N     1 
ATOM   2301 C  CA    . GLY E 3 182 ? 23.336  31.146 -102.447 1.00 37.42  ? 182  GLY A CA    1 
ATOM   2302 C  C     . GLY E 3 182 ? 22.980  29.844 -103.133 1.00 38.98  ? 182  GLY A C     1 
ATOM   2303 O  O     . GLY E 3 182 ? 22.825  29.831 -104.347 1.00 40.49  ? 182  GLY A O     1 
ATOM   2304 N  N     . ASN E 3 183 ? 22.833  28.755 -102.381 1.00 47.36  ? 183  ASN A N     1 
ATOM   2305 C  CA    . ASN E 3 183 ? 22.508  27.471 -102.993 1.00 48.33  ? 183  ASN A CA    1 
ATOM   2306 C  C     . ASN E 3 183 ? 21.032  27.066 -103.010 1.00 49.74  ? 183  ASN A C     1 
ATOM   2307 O  O     . ASN E 3 183 ? 20.725  25.909 -103.286 1.00 51.29  ? 183  ASN A O     1 
ATOM   2308 C  CB    . ASN E 3 183 ? 23.339  26.351 -102.347 1.00 39.72  ? 183  ASN A CB    1 
ATOM   2309 C  CG    . ASN E 3 183 ? 23.046  26.177 -100.865 1.00 40.11  ? 183  ASN A CG    1 
ATOM   2310 O  OD1   . ASN E 3 183 ? 23.119  27.125 -100.097 1.00 38.10  ? 183  ASN A OD1   1 
ATOM   2311 N  ND2   . ASN E 3 183 ? 22.724  24.952 -100.461 1.00 37.70  ? 183  ASN A ND2   1 
ATOM   2312 N  N     . HIS E 3 184 ? 20.119  27.997 -102.730 1.00 31.96  ? 184  HIS A N     1 
ATOM   2313 C  CA    . HIS E 3 184 ? 18.687  27.677 -102.749 1.00 33.88  ? 184  HIS A CA    1 
ATOM   2314 C  C     . HIS E 3 184 ? 18.055  28.053 -104.087 1.00 34.48  ? 184  HIS A C     1 
ATOM   2315 O  O     . HIS E 3 184 ? 18.718  28.581 -104.964 1.00 36.07  ? 184  HIS A O     1 
ATOM   2316 C  CB    . HIS E 3 184 ? 17.947  28.402 -101.621 1.00 50.78  ? 184  HIS A CB    1 
ATOM   2317 C  CG    . HIS E 3 184 ? 17.865  27.623 -100.344 1.00 54.21  ? 184  HIS A CG    1 
ATOM   2318 N  ND1   . HIS E 3 184 ? 17.070  26.505 -100.202 1.00 55.71  ? 184  HIS A ND1   1 
ATOM   2319 C  CD2   . HIS E 3 184 ? 18.472  27.806 -99.148  1.00 53.80  ? 184  HIS A CD2   1 
ATOM   2320 C  CE1   . HIS E 3 184 ? 17.188  26.036 -98.973  1.00 55.06  ? 184  HIS A CE1   1 
ATOM   2321 N  NE2   . HIS E 3 184 ? 18.034  26.807 -98.313  1.00 54.36  ? 184  HIS A NE2   1 
ATOM   2322 N  N     . LYS E 3 185 ? 16.770  27.758 -104.237 1.00 73.70  ? 185  LYS A N     1 
ATOM   2323 C  CA    . LYS E 3 185 ? 16.025  28.070 -105.452 1.00 73.80  ? 185  LYS A CA    1 
ATOM   2324 C  C     . LYS E 3 185 ? 14.608  28.463 -105.052 1.00 74.70  ? 185  LYS A C     1 
ATOM   2325 O  O     . LYS E 3 185 ? 14.028  27.859 -104.146 1.00 76.41  ? 185  LYS A O     1 
ATOM   2326 C  CB    . LYS E 3 185 ? 15.974  26.860 -106.385 1.00 53.25  ? 185  LYS A CB    1 
ATOM   2327 C  CG    . LYS E 3 185 ? 17.269  26.571 -107.120 1.00 54.24  ? 185  LYS A CG    1 
ATOM   2328 C  CD    . LYS E 3 185 ? 17.076  25.499 -108.181 1.00 53.72  ? 185  LYS A CD    1 
ATOM   2329 C  CE    . LYS E 3 185 ? 18.333  25.318 -109.006 1.00 54.44  ? 185  LYS A CE    1 
ATOM   2330 N  NZ    . LYS E 3 185 ? 18.175  24.277 -110.061 1.00 54.79  ? 185  LYS A NZ    1 
ATOM   2331 N  N     . ALA E 3 186 ? 14.048  29.465 -105.726 1.00 47.77  ? 186  ALA A N     1 
ATOM   2332 C  CA    . ALA E 3 186 ? 12.705  29.937 -105.405 1.00 46.86  ? 186  ALA A CA    1 
ATOM   2333 C  C     . ALA E 3 186 ? 11.748  28.790 -105.082 1.00 45.73  ? 186  ALA A C     1 
ATOM   2334 O  O     . ALA E 3 186 ? 10.970  28.880 -104.134 1.00 44.51  ? 186  ALA A O     1 
ATOM   2335 C  CB    . ALA E 3 186 ? 12.157  30.779 -106.554 1.00 56.04  ? 186  ALA A CB    1 
ATOM   2336 N  N     . LYS E 3 187 ? 11.830  27.710 -105.860 1.00 44.93  ? 187  LYS A N     1 
ATOM   2337 C  CA    . LYS E 3 187 ? 10.968  26.545 -105.676 1.00 44.20  ? 187  LYS A CA    1 
ATOM   2338 C  C     . LYS E 3 187 ? 11.217  25.806 -104.367 1.00 42.87  ? 187  LYS A C     1 
ATOM   2339 O  O     . LYS E 3 187 ? 10.307  25.168 -103.839 1.00 40.33  ? 187  LYS A O     1 
ATOM   2340 C  CB    . LYS E 3 187 ? 11.117  25.569 -106.852 1.00 49.29  ? 187  LYS A CB    1 
ATOM   2341 C  CG    . LYS E 3 187 ? 12.465  24.871 -106.937 1.00 50.40  ? 187  LYS A CG    1 
ATOM   2342 C  CD    . LYS E 3 187 ? 12.515  23.885 -108.099 1.00 49.80  ? 187  LYS A CD    1 
ATOM   2343 C  CE    . LYS E 3 187 ? 13.950  23.438 -108.396 1.00 50.94  ? 187  LYS A CE    1 
ATOM   2344 N  NZ    . LYS E 3 187 ? 14.603  22.667 -107.286 1.00 51.66  ? 187  LYS A NZ    1 
ATOM   2345 N  N     . ASP E 3 188 ? 12.447  25.864 -103.856 1.00 73.94  ? 188  ASP A N     1 
ATOM   2346 C  CA    . ASP E 3 188 ? 12.764  25.208 -102.588 1.00 72.60  ? 188  ASP A CA    1 
ATOM   2347 C  C     . ASP E 3 188 ? 12.632  26.256 -101.497 1.00 72.46  ? 188  ASP A C     1 
ATOM   2348 O  O     . ASP E 3 188 ? 13.628  26.713 -100.942 1.00 75.62  ? 188  ASP A O     1 
ATOM   2349 C  CB    . ASP E 3 188 ? 14.198  24.670 -102.537 1.00 40.08  ? 188  ASP A CB    1 
ATOM   2350 C  CG    . ASP E 3 188 ? 14.790  24.394 -103.898 1.00 40.34  ? 188  ASP A CG    1 
ATOM   2351 O  OD1   . ASP E 3 188 ? 14.114  23.772 -104.748 1.00 40.75  ? 188  ASP A OD1   1 
ATOM   2352 O  OD2   . ASP E 3 188 ? 15.959  24.792 -104.096 1.00 38.46  ? 188  ASP A OD2   1 
ATOM   2353 N  N     . LEU E 3 189 ? 11.404  26.640 -101.190 1.00 40.09  ? 189  LEU A N     1 
ATOM   2354 C  CA    . LEU E 3 189 ? 11.169  27.653 -100.174 1.00 37.16  ? 189  LEU A CA    1 
ATOM   2355 C  C     . LEU E 3 189 ? 9.740   27.600 -99.699  1.00 34.90  ? 189  LEU A C     1 
ATOM   2356 O  O     . LEU E 3 189 ? 8.845   27.210 -100.447 1.00 32.48  ? 189  LEU A O     1 
ATOM   2357 C  CB    . LEU E 3 189 ? 11.415  29.054 -100.733 1.00 35.87  ? 189  LEU A CB    1 
ATOM   2358 C  CG    . LEU E 3 189 ? 12.816  29.587 -100.939 1.00 34.83  ? 189  LEU A CG    1 
ATOM   2359 C  CD1   . LEU E 3 189 ? 12.725  30.964 -101.604 1.00 34.63  ? 189  LEU A CD1   1 
ATOM   2360 C  CD2   . LEU E 3 189 ? 13.518  29.676 -99.605  1.00 32.19  ? 189  LEU A CD2   1 
ATOM   2361 N  N     . ASN E 3 190 ? 9.535   28.014 -98.454  1.00 31.96  ? 190  ASN A N     1 
ATOM   2362 C  CA    . ASN E 3 190 ? 8.203   28.042 -97.886  1.00 32.16  ? 190  ASN A CA    1 
ATOM   2363 C  C     . ASN E 3 190 ? 7.684   29.439 -98.150  1.00 30.84  ? 190  ASN A C     1 
ATOM   2364 O  O     . ASN E 3 190 ? 8.449   30.347 -98.471  1.00 29.61  ? 190  ASN A O     1 
ATOM   2365 C  CB    . ASN E 3 190 ? 8.236   27.751 -96.377  1.00 40.97  ? 190  ASN A CB    1 
ATOM   2366 C  CG    . ASN E 3 190 ? 9.109   28.728 -95.602  1.00 45.13  ? 190  ASN A CG    1 
ATOM   2367 O  OD1   . ASN E 3 190 ? 8.837   29.933 -95.547  1.00 45.61  ? 190  ASN A OD1   1 
ATOM   2368 N  ND2   . ASN E 3 190 ? 10.172  28.208 -94.998  1.00 46.50  ? 190  ASN A ND2   1 
ATOM   2369 N  N     . ALA E 3 191 ? 6.381   29.604 -98.021  1.00 37.08  ? 191  ALA A N     1 
ATOM   2370 C  CA    . ALA E 3 191 ? 5.757   30.894 -98.232  1.00 37.00  ? 191  ALA A CA    1 
ATOM   2371 C  C     . ALA E 3 191 ? 6.340   32.037 -97.349  1.00 37.69  ? 191  ALA A C     1 
ATOM   2372 O  O     . ALA E 3 191 ? 6.286   33.196 -97.751  1.00 38.79  ? 191  ALA A O     1 
ATOM   2373 C  CB    . ALA E 3 191 ? 4.225   30.747 -98.023  1.00 11.65  ? 191  ALA A CB    1 
ATOM   2374 N  N     . ALA E 3 192 ? 6.897   31.727 -96.169  1.00 52.46  ? 192  ALA A N     1 
ATOM   2375 C  CA    . ALA E 3 192 ? 7.463   32.777 -95.296  1.00 53.40  ? 192  ALA A CA    1 
ATOM   2376 C  C     . ALA E 3 192 ? 8.841   33.259 -95.753  1.00 54.26  ? 192  ALA A C     1 
ATOM   2377 O  O     . ALA E 3 192 ? 9.188   34.427 -95.553  1.00 54.65  ? 192  ALA A O     1 
ATOM   2378 C  CB    . ALA E 3 192 ? 7.543   32.305 -93.791  1.00 11.59  ? 192  ALA A CB    1 
ATOM   2379 N  N     . GLN E 3 193 ? 9.630   32.367 -96.352  1.00 37.11  ? 193  GLN A N     1 
ATOM   2380 C  CA    . GLN E 3 193 ? 10.958  32.755 -96.823  1.00 37.91  ? 193  GLN A CA    1 
ATOM   2381 C  C     . GLN E 3 193 ? 10.945  33.429 -98.194  1.00 36.91  ? 193  GLN A C     1 
ATOM   2382 O  O     . GLN E 3 193 ? 11.848  34.193 -98.515  1.00 38.64  ? 193  GLN A O     1 
ATOM   2383 C  CB    . GLN E 3 193 ? 11.879  31.543 -96.889  1.00 40.75  ? 193  GLN A CB    1 
ATOM   2384 C  CG    . GLN E 3 193 ? 12.113  30.855 -95.581  1.00 40.88  ? 193  GLN A CG    1 
ATOM   2385 C  CD    . GLN E 3 193 ? 12.813  29.526 -95.770  1.00 42.45  ? 193  GLN A CD    1 
ATOM   2386 O  OE1   . GLN E 3 193 ? 12.392  28.708 -96.593  1.00 43.52  ? 193  GLN A OE1   1 
ATOM   2387 N  NE2   . GLN E 3 193 ? 13.878  29.297 -95.008  1.00 43.74  ? 193  GLN A NE2   1 
ATOM   2388 N  N     . LEU E 3 194 ? 9.929   33.135 -98.999  1.00 30.39  ? 194  LEU A N     1 
ATOM   2389 C  CA    . LEU E 3 194 ? 9.813   33.704 -100.333 1.00 30.16  ? 194  LEU A CA    1 
ATOM   2390 C  C     . LEU E 3 194 ? 9.349   35.142 -100.184 1.00 32.29  ? 194  LEU A C     1 
ATOM   2391 O  O     . LEU E 3 194 ? 9.867   36.039 -100.850 1.00 32.93  ? 194  LEU A O     1 
ATOM   2392 C  CB    . LEU E 3 194 ? 8.797   32.912 -101.151 1.00 47.64  ? 194  LEU A CB    1 
ATOM   2393 C  CG    . LEU E 3 194 ? 8.471   33.392 -102.565 1.00 49.23  ? 194  LEU A CG    1 
ATOM   2394 C  CD1   . LEU E 3 194 ? 9.616   33.042 -103.499 1.00 48.57  ? 194  LEU A CD1   1 
ATOM   2395 C  CD2   . LEU E 3 194 ? 7.183   32.727 -103.048 1.00 48.56  ? 194  LEU A CD2   1 
ATOM   2396 N  N     . ASP E 3 195 ? 8.372   35.353 -99.299  1.00 32.59  ? 195  ASP A N     1 
ATOM   2397 C  CA    . ASP E 3 195 ? 7.842   36.684 -99.042  1.00 32.81  ? 195  ASP A CA    1 
ATOM   2398 C  C     . ASP E 3 195 ? 8.960   37.511 -98.403  1.00 32.18  ? 195  ASP A C     1 
ATOM   2399 O  O     . ASP E 3 195 ? 9.122   38.689 -98.690  1.00 33.54  ? 195  ASP A O     1 
ATOM   2400 C  CB    . ASP E 3 195 ? 6.641   36.600 -98.101  1.00 48.06  ? 195  ASP A CB    1 
ATOM   2401 C  CG    . ASP E 3 195 ? 5.882   37.914 -97.991  1.00 51.27  ? 195  ASP A CG    1 
ATOM   2402 O  OD1   . ASP E 3 195 ? 5.130   38.262 -98.925  1.00 52.75  ? 195  ASP A OD1   1 
ATOM   2403 O  OD2   . ASP E 3 195 ? 6.038   38.604 -96.967  1.00 50.56  ? 195  ASP A OD2   1 
ATOM   2404 N  N     . ALA E 3 196 ? 9.740   36.889 -97.536  1.00 39.36  ? 196  ALA A N     1 
ATOM   2405 C  CA    . ALA E 3 196 ? 10.843  37.595 -96.909  1.00 39.93  ? 196  ALA A CA    1 
ATOM   2406 C  C     . ALA E 3 196 ? 11.799  37.982 -98.024  1.00 39.83  ? 196  ALA A C     1 
ATOM   2407 O  O     . ALA E 3 196 ? 12.012  39.165 -98.276  1.00 41.15  ? 196  ALA A O     1 
ATOM   2408 C  CB    . ALA E 3 196 ? 11.540  36.708 -95.901  1.00 16.90  ? 196  ALA A CB    1 
ATOM   2409 N  N     . LEU E 3 197 ? 12.366  36.975 -98.684  1.00 31.98  ? 197  LEU A N     1 
ATOM   2410 C  CA    . LEU E 3 197 ? 13.286  37.191 -99.791  1.00 32.41  ? 197  LEU A CA    1 
ATOM   2411 C  C     . LEU E 3 197 ? 12.729  38.317 -100.676 1.00 32.56  ? 197  LEU A C     1 
ATOM   2412 O  O     . LEU E 3 197 ? 13.438  39.251 -101.041 1.00 31.15  ? 197  LEU A O     1 
ATOM   2413 C  CB    . LEU E 3 197 ? 13.404  35.913 -100.623 1.00 39.02  ? 197  LEU A CB    1 
ATOM   2414 C  CG    . LEU E 3 197 ? 14.596  35.702 -101.565 1.00 39.55  ? 197  LEU A CG    1 
ATOM   2415 C  CD1   . LEU E 3 197 ? 14.099  34.982 -102.785 1.00 38.87  ? 197  LEU A CD1   1 
ATOM   2416 C  CD2   . LEU E 3 197 ? 15.251  37.002 -101.957 1.00 37.00  ? 197  LEU A CD2   1 
ATOM   2417 N  N     . ALA E 3 198 ? 11.445  38.206 -101.001 1.00 34.00  ? 198  ALA A N     1 
ATOM   2418 C  CA    . ALA E 3 198 ? 10.740  39.175 -101.832 1.00 35.53  ? 198  ALA A CA    1 
ATOM   2419 C  C     . ALA E 3 198 ? 11.023  40.615 -101.447 1.00 35.75  ? 198  ALA A C     1 
ATOM   2420 O  O     . ALA E 3 198 ? 11.560  41.388 -102.245 1.00 36.44  ? 198  ALA A O     1 
ATOM   2421 C  CB    . ALA E 3 198 ? 9.233   38.910 -101.768 1.00 47.26  ? 198  ALA A CB    1 
ATOM   2422 N  N     . HIS E 3 199 ? 10.642  40.968 -100.223 1.00 54.29  ? 199  HIS A N     1 
ATOM   2423 C  CA    . HIS E 3 199 ? 10.833  42.315 -99.684  1.00 53.87  ? 199  HIS A CA    1 
ATOM   2424 C  C     . HIS E 3 199 ? 12.303  42.726 -99.624  1.00 52.70  ? 199  HIS A C     1 
ATOM   2425 O  O     . HIS E 3 199 ? 12.685  43.784 -100.116 1.00 54.16  ? 199  HIS A O     1 
ATOM   2426 C  CB    . HIS E 3 199 ? 10.205  42.398 -98.285  1.00 45.77  ? 199  HIS A CB    1 
ATOM   2427 C  CG    . HIS E 3 199 ? 8.710   42.274 -98.287  1.00 44.57  ? 199  HIS A CG    1 
ATOM   2428 N  ND1   . HIS E 3 199 ? 7.872   43.357 -98.457  1.00 43.54  ? 199  HIS A ND1   1 
ATOM   2429 C  CD2   . HIS E 3 199 ? 7.904   41.187 -98.209  1.00 42.60  ? 199  HIS A CD2   1 
ATOM   2430 C  CE1   . HIS E 3 199 ? 6.618   42.942 -98.486  1.00 41.99  ? 199  HIS A CE1   1 
ATOM   2431 N  NE2   . HIS E 3 199 ? 6.611   41.630 -98.340  1.00 42.83  ? 199  HIS A NE2   1 
ATOM   2432 N  N     . ALA E 3 200 ? 13.125  41.876 -99.026  1.00 35.56  ? 200  ALA A N     1 
ATOM   2433 C  CA    . ALA E 3 200 ? 14.550  42.160 -98.890  1.00 34.70  ? 200  ALA A CA    1 
ATOM   2434 C  C     . ALA E 3 200 ? 15.135  42.574 -100.236 1.00 34.54  ? 200  ALA A C     1 
ATOM   2435 O  O     . ALA E 3 200 ? 16.003  43.445 -100.321 1.00 33.57  ? 200  ALA A O     1 
ATOM   2436 C  CB    . ALA E 3 200 ? 15.276  40.919 -98.352  1.00 22.48  ? 200  ALA A CB    1 
ATOM   2437 N  N     . LEU E 3 201 ? 14.633  41.924 -101.281 1.00 51.91  ? 201  LEU A N     1 
ATOM   2438 C  CA    . LEU E 3 201 ? 15.065  42.160 -102.645 1.00 50.87  ? 201  LEU A CA    1 
ATOM   2439 C  C     . LEU E 3 201 ? 14.781  43.575 -103.120 1.00 52.62  ? 201  LEU A C     1 
ATOM   2440 O  O     . LEU E 3 201 ? 15.465  44.087 -104.009 1.00 53.26  ? 201  LEU A O     1 
ATOM   2441 C  CB    . LEU E 3 201 ? 14.396  41.156 -103.571 1.00 28.62  ? 201  LEU A CB    1 
ATOM   2442 C  CG    . LEU E 3 201 ? 15.077  39.790 -103.657 1.00 28.54  ? 201  LEU A CG    1 
ATOM   2443 C  CD1   . LEU E 3 201 ? 14.195  38.811 -104.433 1.00 26.43  ? 201  LEU A CD1   1 
ATOM   2444 C  CD2   . LEU E 3 201 ? 16.450  39.941 -104.326 1.00 27.16  ? 201  LEU A CD2   1 
ATOM   2445 N  N     . LEU E 3 202 ? 13.780  44.210 -102.522 1.00 48.53  ? 202  LEU A N     1 
ATOM   2446 C  CA    . LEU E 3 202 ? 13.435  45.571 -102.895 1.00 47.67  ? 202  LEU A CA    1 
ATOM   2447 C  C     . LEU E 3 202 ? 13.815  46.571 -101.796 1.00 50.71  ? 202  LEU A C     1 
ATOM   2448 O  O     . LEU E 3 202 ? 14.481  47.577 -102.055 1.00 49.93  ? 202  LEU A O     1 
ATOM   2449 C  CB    . LEU E 3 202 ? 11.940  45.656 -103.187 1.00 27.49  ? 202  LEU A CB    1 
ATOM   2450 C  CG    . LEU E 3 202 ? 11.396  44.728 -104.279 1.00 25.90  ? 202  LEU A CG    1 
ATOM   2451 C  CD1   . LEU E 3 202 ? 9.863   44.908 -104.418 1.00 24.10  ? 202  LEU A CD1   1 
ATOM   2452 C  CD2   . LEU E 3 202 ? 12.099  45.038 -105.601 1.00 26.13  ? 202  LEU A CD2   1 
ATOM   2453 N  N     . GLU E 3 203 ? 13.393  46.271 -100.569 1.00 39.64  ? 203  GLU A N     1 
ATOM   2454 C  CA    . GLU E 3 203 ? 13.646  47.122 -99.409  1.00 40.27  ? 203  GLU A CA    1 
ATOM   2455 C  C     . GLU E 3 203 ? 15.119  47.433 -99.173  1.00 40.35  ? 203  GLU A C     1 
ATOM   2456 O  O     . GLU E 3 203 ? 15.502  48.594 -99.080  1.00 41.02  ? 203  GLU A O     1 
ATOM   2457 C  CB    . GLU E 3 203 ? 13.040  46.477 -98.153  1.00 42.71  ? 203  GLU A CB    1 
ATOM   2458 C  CG    . GLU E 3 203 ? 11.549  46.740 -97.954  1.00 45.36  ? 203  GLU A CG    1 
ATOM   2459 C  CD    . GLU E 3 203 ? 10.881  45.696 -97.064  1.00 47.22  ? 203  GLU A CD    1 
ATOM   2460 O  OE1   . GLU E 3 203 ? 11.517  45.261 -96.082  1.00 47.48  ? 203  GLU A OE1   1 
ATOM   2461 O  OE2   . GLU E 3 203 ? 9.719   45.312 -97.342  1.00 47.78  ? 203  GLU A OE2   1 
ATOM   2462 N  N     . ILE E 3 204 ? 15.944  46.396 -99.059  1.00 43.29  ? 204  ILE A N     1 
ATOM   2463 C  CA    . ILE E 3 204 ? 17.371  46.590 -98.836  1.00 42.14  ? 204  ILE A CA    1 
ATOM   2464 C  C     . ILE E 3 204 ? 17.981  47.497 -99.894  1.00 40.58  ? 204  ILE A C     1 
ATOM   2465 O  O     . ILE E 3 204 ? 18.505  48.547 -99.559  1.00 40.75  ? 204  ILE A O     1 
ATOM   2466 C  CB    . ILE E 3 204 ? 18.132  45.242 -98.798  1.00 52.54  ? 204  ILE A CB    1 
ATOM   2467 C  CG1   . ILE E 3 204 ? 17.844  44.539 -97.472  1.00 53.12  ? 204  ILE A CG1   1 
ATOM   2468 C  CG2   . ILE E 3 204 ? 19.634  45.465 -98.970  1.00 52.74  ? 204  ILE A CG2   1 
ATOM   2469 C  CD1   . ILE E 3 204 ? 18.726  43.340 -97.209  1.00 50.30  ? 204  ILE A CD1   1 
ATOM   2470 N  N     . PRO E 3 205 ? 17.927  47.104 -101.182 1.00 36.01  ? 205  PRO A N     1 
ATOM   2471 C  CA    . PRO E 3 205 ? 18.503  47.963 -102.224 1.00 36.20  ? 205  PRO A CA    1 
ATOM   2472 C  C     . PRO E 3 205 ? 18.057  49.434 -102.072 1.00 37.75  ? 205  PRO A C     1 
ATOM   2473 O  O     . PRO E 3 205 ? 18.852  50.371 -102.221 1.00 37.06  ? 205  PRO A O     1 
ATOM   2474 C  CB    . PRO E 3 205 ? 17.991  47.320 -103.509 1.00 26.58  ? 205  PRO A CB    1 
ATOM   2475 C  CG    . PRO E 3 205 ? 17.941  45.851 -103.138 1.00 25.04  ? 205  PRO A CG    1 
ATOM   2476 C  CD    . PRO E 3 205 ? 17.351  45.874 -101.768 1.00 24.45  ? 205  PRO A CD    1 
ATOM   2477 N  N     . ARG E 3 206 ? 16.782  49.629 -101.754 1.00 48.83  ? 206  ARG A N     1 
ATOM   2478 C  CA    . ARG E 3 206 ? 16.263  50.972 -101.562 1.00 48.86  ? 206  ARG A CA    1 
ATOM   2479 C  C     . ARG E 3 206 ? 16.912  51.619 -100.349 1.00 49.78  ? 206  ARG A C     1 
ATOM   2480 O  O     . ARG E 3 206 ? 17.388  52.746 -100.431 1.00 52.67  ? 206  ARG A O     1 
ATOM   2481 C  CB    . ARG E 3 206 ? 14.743  50.933 -101.393 1.00 35.97  ? 206  ARG A CB    1 
ATOM   2482 C  CG    . ARG E 3 206 ? 14.049  50.502 -102.660 1.00 39.18  ? 206  ARG A CG    1 
ATOM   2483 C  CD    . ARG E 3 206 ? 12.586  50.156 -102.505 1.00 36.74  ? 206  ARG A CD    1 
ATOM   2484 N  NE    . ARG E 3 206 ? 12.055  49.813 -103.820 1.00 37.62  ? 206  ARG A NE    1 
ATOM   2485 C  CZ    . ARG E 3 206 ? 10.796  49.483 -104.076 1.00 36.68  ? 206  ARG A CZ    1 
ATOM   2486 N  NH1   . ARG E 3 206 ? 9.900   49.441 -103.102 1.00 37.97  ? 206  ARG A NH1   1 
ATOM   2487 N  NH2   . ARG E 3 206 ? 10.435  49.193 -105.314 1.00 36.73  ? 206  ARG A NH2   1 
ATOM   2488 N  N     . PHE E 3 207 ? 16.937  50.894 -99.233  1.00 33.51  ? 207  PHE A N     1 
ATOM   2489 C  CA    . PHE E 3 207 ? 17.519  51.386 -97.985  1.00 32.06  ? 207  PHE A CA    1 
ATOM   2490 C  C     . PHE E 3 207 ? 18.938  51.834 -98.281  1.00 32.31  ? 207  PHE A C     1 
ATOM   2491 O  O     . PHE E 3 207 ? 19.398  52.867 -97.802  1.00 32.26  ? 207  PHE A O     1 
ATOM   2492 C  CB    . PHE E 3 207 ? 17.503  50.269 -96.915  1.00 37.70  ? 207  PHE A CB    1 
ATOM   2493 C  CG    . PHE E 3 207 ? 18.043  50.689 -95.566  1.00 37.70  ? 207  PHE A CG    1 
ATOM   2494 C  CD1   . PHE E 3 207 ? 17.594  51.857 -94.943  1.00 37.71  ? 207  PHE A CD1   1 
ATOM   2495 C  CD2   . PHE E 3 207 ? 18.991  49.912 -94.913  1.00 35.98  ? 207  PHE A CD2   1 
ATOM   2496 C  CE1   . PHE E 3 207 ? 18.089  52.242 -93.681  1.00 35.73  ? 207  PHE A CE1   1 
ATOM   2497 C  CE2   . PHE E 3 207 ? 19.490  50.285 -93.656  1.00 36.35  ? 207  PHE A CE2   1 
ATOM   2498 C  CZ    . PHE E 3 207 ? 19.040  51.451 -93.037  1.00 33.27  ? 207  PHE A CZ    1 
ATOM   2499 N  N     . SER E 3 208 ? 19.625  51.053 -99.099  1.00 40.57  ? 208  SER A N     1 
ATOM   2500 C  CA    . SER E 3 208 ? 20.986  51.381 -99.463  1.00 41.58  ? 208  SER A CA    1 
ATOM   2501 C  C     . SER E 3 208 ? 20.952  52.698 -100.223 1.00 41.43  ? 208  SER A C     1 
ATOM   2502 O  O     . SER E 3 208 ? 21.659  53.641 -99.888  1.00 42.48  ? 208  SER A O     1 
ATOM   2503 C  CB    . SER E 3 208 ? 21.575  50.277 -100.342 1.00 39.72  ? 208  SER A CB    1 
ATOM   2504 O  OG    . SER E 3 208 ? 22.981  50.397 -100.402 1.00 40.86  ? 208  SER A OG    1 
ATOM   2505 N  N     . TYR E 3 209 ? 20.111  52.757 -101.245 1.00 41.94  ? 209  TYR A N     1 
ATOM   2506 C  CA    . TYR E 3 209 ? 19.983  53.957 -102.055 1.00 42.18  ? 209  TYR A CA    1 
ATOM   2507 C  C     . TYR E 3 209 ? 19.656  55.205 -101.232 1.00 42.78  ? 209  TYR A C     1 
ATOM   2508 O  O     . TYR E 3 209 ? 20.309  56.236 -101.358 1.00 43.12  ? 209  TYR A O     1 
ATOM   2509 C  CB    . TYR E 3 209 ? 18.898  53.740 -103.098 1.00 37.24  ? 209  TYR A CB    1 
ATOM   2510 C  CG    . TYR E 3 209 ? 18.358  55.018 -103.685 1.00 35.00  ? 209  TYR A CG    1 
ATOM   2511 C  CD1   . TYR E 3 209 ? 19.153  55.836 -104.493 1.00 31.83  ? 209  TYR A CD1   1 
ATOM   2512 C  CD2   . TYR E 3 209 ? 17.037  55.401 -103.450 1.00 32.38  ? 209  TYR A CD2   1 
ATOM   2513 C  CE1   . TYR E 3 209 ? 18.636  56.998 -105.056 1.00 31.28  ? 209  TYR A CE1   1 
ATOM   2514 C  CE2   . TYR E 3 209 ? 16.518  56.558 -104.008 1.00 29.83  ? 209  TYR A CE2   1 
ATOM   2515 C  CZ    . TYR E 3 209 ? 17.314  57.349 -104.811 1.00 28.88  ? 209  TYR A CZ    1 
ATOM   2516 O  OH    . TYR E 3 209 ? 16.771  58.479 -105.383 1.00 29.28  ? 209  TYR A OH    1 
ATOM   2517 N  N     . ALA E 3 210 ? 18.636  55.098 -100.393 1.00 42.51  ? 210  ALA A N     1 
ATOM   2518 C  CA    . ALA E 3 210 ? 18.203  56.202 -99.562  1.00 44.64  ? 210  ALA A CA    1 
ATOM   2519 C  C     . ALA E 3 210 ? 19.169  56.560 -98.424  1.00 46.26  ? 210  ALA A C     1 
ATOM   2520 O  O     . ALA E 3 210 ? 19.265  57.733 -98.036  1.00 45.55  ? 210  ALA A O     1 
ATOM   2521 C  CB    . ALA E 3 210 ? 16.822  55.893 -98.991  1.00 31.16  ? 210  ALA A CB    1 
ATOM   2522 N  N     . THR E 3 211 ? 19.890  55.575 -97.887  1.00 41.20  ? 211  THR A N     1 
ATOM   2523 C  CA    . THR E 3 211 ? 20.793  55.883 -96.786  1.00 41.85  ? 211  THR A CA    1 
ATOM   2524 C  C     . THR E 3 211 ? 22.297  55.696 -96.974  1.00 41.82  ? 211  THR A C     1 
ATOM   2525 O  O     . THR E 3 211 ? 23.078  56.401 -96.334  1.00 39.80  ? 211  THR A O     1 
ATOM   2526 C  CB    . THR E 3 211 ? 20.330  55.180 -95.456  1.00 44.80  ? 211  THR A CB    1 
ATOM   2527 O  OG1   . THR E 3 211 ? 20.188  53.764 -95.648  1.00 45.28  ? 211  THR A OG1   1 
ATOM   2528 C  CG2   . THR E 3 211 ? 18.998  55.768 -94.998  1.00 43.63  ? 211  THR A CG2   1 
ATOM   2529 N  N     . ARG E 3 212 ? 22.726  54.786 -97.841  1.00 43.88  ? 212  ARG A N     1 
ATOM   2530 C  CA    . ARG E 3 212 ? 24.168  54.627 -98.039  1.00 46.69  ? 212  ARG A CA    1 
ATOM   2531 C  C     . ARG E 3 212 ? 24.811  56.001 -98.246  1.00 50.19  ? 212  ARG A C     1 
ATOM   2532 O  O     . ARG E 3 212 ? 24.514  56.698 -99.211  1.00 50.22  ? 212  ARG A O     1 
ATOM   2533 C  CB    . ARG E 3 212 ? 24.480  53.741 -99.243  1.00 37.35  ? 212  ARG A CB    1 
ATOM   2534 C  CG    . ARG E 3 212 ? 25.954  53.436 -99.363  1.00 36.50  ? 212  ARG A CG    1 
ATOM   2535 C  CD    . ARG E 3 212 ? 26.251  52.257 -100.270 1.00 36.55  ? 212  ARG A CD    1 
ATOM   2536 N  NE    . ARG E 3 212 ? 27.673  51.914 -100.211 1.00 36.80  ? 212  ARG A NE    1 
ATOM   2537 C  CZ    . ARG E 3 212 ? 28.388  51.420 -101.226 1.00 38.01  ? 212  ARG A CZ    1 
ATOM   2538 N  NH1   . ARG E 3 212 ? 27.822  51.205 -102.410 1.00 34.19  ? 212  ARG A NH1   1 
ATOM   2539 N  NH2   . ARG E 3 212 ? 29.679  51.133 -101.051 1.00 37.57  ? 212  ARG A NH2   1 
ATOM   2540 N  N     . GLY E 3 213 ? 25.691  56.385 -97.330  1.00 62.35  ? 213  GLY A N     1 
ATOM   2541 C  CA    . GLY E 3 213 ? 26.340  57.680 -97.429  1.00 67.58  ? 213  GLY A CA    1 
ATOM   2542 C  C     . GLY E 3 213 ? 25.300  58.781 -97.484  1.00 70.72  ? 213  GLY A C     1 
ATOM   2543 O  O     . GLY E 3 213 ? 24.774  59.154 -96.413  1.00 72.18  ? 213  GLY A O     1 
ATOM   2544 N  N     . LEU E 3 224 ? 20.379  53.900 -90.391  1.00 61.62  ? 224  LEU A N     1 
ATOM   2545 C  CA    . LEU E 3 224 ? 21.176  54.096 -91.634  1.00 57.28  ? 224  LEU A CA    1 
ATOM   2546 C  C     . LEU E 3 224 ? 21.770  52.781 -92.135  1.00 53.94  ? 224  LEU A C     1 
ATOM   2547 O  O     . LEU E 3 224 ? 21.995  51.852 -91.367  1.00 53.46  ? 224  LEU A O     1 
ATOM   2548 C  CB    . LEU E 3 224 ? 22.295  55.117 -91.391  1.00 72.76  ? 224  LEU A CB    1 
ATOM   2549 C  CG    . LEU E 3 224 ? 21.859  56.512 -90.915  1.00 74.19  ? 224  LEU A CG    1 
ATOM   2550 C  CD1   . LEU E 3 224 ? 23.083  57.380 -90.676  1.00 75.08  ? 224  LEU A CD1   1 
ATOM   2551 C  CD2   . LEU E 3 224 ? 20.940  57.153 -91.945  1.00 75.09  ? 224  LEU A CD2   1 
ATOM   2552 N  N     . PHE E 3 225 ? 22.008  52.713 -93.436  1.00 47.49  ? 225  PHE A N     1 
ATOM   2553 C  CA    . PHE E 3 225 ? 22.565  51.526 -94.059  1.00 43.66  ? 225  PHE A CA    1 
ATOM   2554 C  C     . PHE E 3 225 ? 24.041  51.317 -93.711  1.00 43.72  ? 225  PHE A C     1 
ATOM   2555 O  O     . PHE E 3 225 ? 24.849  52.244 -93.735  1.00 43.40  ? 225  PHE A O     1 
ATOM   2556 C  CB    . PHE E 3 225 ? 22.363  51.625 -95.579  1.00 44.95  ? 225  PHE A CB    1 
ATOM   2557 C  CG    . PHE E 3 225 ? 23.125  50.609 -96.372  1.00 39.70  ? 225  PHE A CG    1 
ATOM   2558 C  CD1   . PHE E 3 225 ? 24.495  50.741 -96.567  1.00 39.40  ? 225  PHE A CD1   1 
ATOM   2559 C  CD2   . PHE E 3 225 ? 22.472  49.513 -96.924  1.00 38.02  ? 225  PHE A CD2   1 
ATOM   2560 C  CE1   . PHE E 3 225 ? 25.207  49.799 -97.297  1.00 36.10  ? 225  PHE A CE1   1 
ATOM   2561 C  CE2   . PHE E 3 225 ? 23.176  48.560 -97.660  1.00 35.57  ? 225  PHE A CE2   1 
ATOM   2562 C  CZ    . PHE E 3 225 ? 24.547  48.705 -97.845  1.00 34.98  ? 225  PHE A CZ    1 
ATOM   2563 N  N     . ARG E 3 226 ? 24.378  50.080 -93.386  1.00 52.29  ? 226  ARG A N     1 
ATOM   2564 C  CA    . ARG E 3 226 ? 25.740  49.709 -93.049  1.00 51.71  ? 226  ARG A CA    1 
ATOM   2565 C  C     . ARG E 3 226 ? 25.913  48.273 -93.527  1.00 51.58  ? 226  ARG A C     1 
ATOM   2566 O  O     . ARG E 3 226 ? 24.925  47.581 -93.781  1.00 50.23  ? 226  ARG A O     1 
ATOM   2567 C  CB    . ARG E 3 226 ? 25.967  49.796 -91.535  1.00 68.93  ? 226  ARG A CB    1 
ATOM   2568 C  CG    . ARG E 3 226 ? 25.137  48.818 -90.705  1.00 69.43  ? 226  ARG A CG    1 
ATOM   2569 C  CD    . ARG E 3 226 ? 25.555  48.807 -89.226  1.00 68.71  ? 226  ARG A CD    1 
ATOM   2570 N  NE    . ARG E 3 226 ? 24.926  47.711 -88.483  1.00 67.84  ? 226  ARG A NE    1 
ATOM   2571 C  CZ    . ARG E 3 226 ? 23.654  47.691 -88.087  1.00 66.06  ? 226  ARG A CZ    1 
ATOM   2572 N  NH1   . ARG E 3 226 ? 22.848  48.712 -88.344  1.00 65.52  ? 226  ARG A NH1   1 
ATOM   2573 N  NH2   . ARG E 3 226 ? 23.179  46.631 -87.452  1.00 63.63  ? 226  ARG A NH2   1 
ATOM   2574 N  N     . PHE E 3 227 ? 27.154  47.823 -93.667  1.00 93.58  ? 227  PHE A N     1 
ATOM   2575 C  CA    . PHE E 3 227 ? 27.392  46.456 -94.114  1.00 92.81  ? 227  PHE A CA    1 
ATOM   2576 C  C     . PHE E 3 227 ? 27.275  45.458 -92.973  1.00 91.94  ? 227  PHE A C     1 
ATOM   2577 O  O     . PHE E 3 227 ? 27.856  45.645 -91.905  1.00 92.95  ? 227  PHE A O     1 
ATOM   2578 C  CB    . PHE E 3 227 ? 28.769  46.327 -94.754  1.00 46.12  ? 227  PHE A CB    1 
ATOM   2579 C  CG    . PHE E 3 227 ? 28.829  46.815 -96.164  1.00 46.21  ? 227  PHE A CG    1 
ATOM   2580 C  CD1   . PHE E 3 227 ? 27.805  46.524 -97.058  1.00 46.61  ? 227  PHE A CD1   1 
ATOM   2581 C  CD2   . PHE E 3 227 ? 29.939  47.513 -96.623  1.00 46.75  ? 227  PHE A CD2   1 
ATOM   2582 C  CE1   . PHE E 3 227 ? 27.892  46.920 -98.394  1.00 47.11  ? 227  PHE A CE1   1 
ATOM   2583 C  CE2   . PHE E 3 227 ? 30.032  47.909 -97.942  1.00 46.92  ? 227  PHE A CE2   1 
ATOM   2584 C  CZ    . PHE E 3 227 ? 29.007  47.610 -98.833  1.00 48.63  ? 227  PHE A CZ    1 
ATOM   2585 N  N     . LYS E 3 228 ? 26.529  44.388 -93.210  1.00 50.73  ? 228  LYS A N     1 
ATOM   2586 C  CA    . LYS E 3 228 ? 26.337  43.369 -92.191  1.00 49.12  ? 228  LYS A CA    1 
ATOM   2587 C  C     . LYS E 3 228 ? 27.082  42.069 -92.475  1.00 46.42  ? 228  LYS A C     1 
ATOM   2588 O  O     . LYS E 3 228 ? 27.174  41.212 -91.612  1.00 46.15  ? 228  LYS A O     1 
ATOM   2589 C  CB    . LYS E 3 228 ? 24.831  43.134 -91.980  1.00 44.91  ? 228  LYS A CB    1 
ATOM   2590 C  CG    . LYS E 3 228 ? 24.153  44.352 -91.331  1.00 43.64  ? 228  LYS A CG    1 
ATOM   2591 C  CD    . LYS E 3 228 ? 22.627  44.282 -91.301  1.00 43.05  ? 228  LYS A CD    1 
ATOM   2592 C  CE    . LYS E 3 228 ? 22.053  45.454 -90.485  1.00 42.71  ? 228  LYS A CE    1 
ATOM   2593 N  NZ    . LYS E 3 228 ? 20.563  45.450 -90.313  1.00 40.83  ? 228  LYS A NZ    1 
ATOM   2594 N  N     . VAL E 3 229 ? 27.630  41.930 -93.677  1.00 36.01  ? 229  VAL A N     1 
ATOM   2595 C  CA    . VAL E 3 229 ? 28.387  40.730 -94.013  1.00 34.08  ? 229  VAL A CA    1 
ATOM   2596 C  C     . VAL E 3 229 ? 29.389  40.977 -95.145  1.00 34.20  ? 229  VAL A C     1 
ATOM   2597 O  O     . VAL E 3 229 ? 30.236  40.134 -95.421  1.00 32.10  ? 229  VAL A O     1 
ATOM   2598 C  CB    . VAL E 3 229 ? 27.452  39.543 -94.401  1.00 39.64  ? 229  VAL A CB    1 
ATOM   2599 C  CG1   . VAL E 3 229 ? 27.145  39.562 -95.905  1.00 38.26  ? 229  VAL A CG1   1 
ATOM   2600 C  CG2   . VAL E 3 229 ? 28.092  38.235 -94.002  1.00 36.26  ? 229  VAL A CG2   1 
ATOM   2601 N  N     . PHE E 3 230 ? 29.305  42.136 -95.790  1.00 41.14  ? 230  PHE A N     1 
ATOM   2602 C  CA    . PHE E 3 230 ? 30.220  42.458 -96.892  1.00 41.07  ? 230  PHE A CA    1 
ATOM   2603 C  C     . PHE E 3 230 ? 31.550  43.032 -96.376  1.00 41.07  ? 230  PHE A C     1 
ATOM   2604 O  O     . PHE E 3 230 ? 31.573  44.078 -95.721  1.00 40.42  ? 230  PHE A O     1 
ATOM   2605 C  CB    . PHE E 3 230 ? 29.552  43.463 -97.822  1.00 48.30  ? 230  PHE A CB    1 
ATOM   2606 C  CG    . PHE E 3 230 ? 30.156  43.520 -99.188  1.00 49.18  ? 230  PHE A CG    1 
ATOM   2607 C  CD1   . PHE E 3 230 ? 30.138  42.396 -100.016 1.00 49.14  ? 230  PHE A CD1   1 
ATOM   2608 C  CD2   . PHE E 3 230 ? 30.702  44.704 -99.671  1.00 49.20  ? 230  PHE A CD2   1 
ATOM   2609 C  CE1   . PHE E 3 230 ? 30.649  42.451 -101.308 1.00 48.86  ? 230  PHE A CE1   1 
ATOM   2610 C  CE2   . PHE E 3 230 ? 31.218  44.773 -100.964 1.00 50.04  ? 230  PHE A CE2   1 
ATOM   2611 C  CZ    . PHE E 3 230 ? 31.191  43.646 -101.786 1.00 51.97  ? 230  PHE A CZ    1 
ATOM   2612 N  N     . HIS E 3 231 ? 32.659  42.358 -96.678  1.00 51.09  ? 231  HIS A N     1 
ATOM   2613 C  CA    . HIS E 3 231 ? 33.971  42.813 -96.209  1.00 52.21  ? 231  HIS A CA    1 
ATOM   2614 C  C     . HIS E 3 231 ? 34.006  42.693 -94.684  1.00 53.85  ? 231  HIS A C     1 
ATOM   2615 O  O     . HIS E 3 231 ? 34.429  43.626 -93.986  1.00 52.77  ? 231  HIS A O     1 
ATOM   2616 C  CB    . HIS E 3 231 ? 34.209  44.275 -96.599  1.00 52.34  ? 231  HIS A CB    1 
ATOM   2617 C  CG    . HIS E 3 231 ? 34.536  44.477 -98.044  1.00 52.92  ? 231  HIS A CG    1 
ATOM   2618 N  ND1   . HIS E 3 231 ? 35.737  44.092 -98.597  1.00 55.08  ? 231  HIS A ND1   1 
ATOM   2619 C  CD2   . HIS E 3 231 ? 33.821  45.032 -99.049  1.00 53.18  ? 231  HIS A CD2   1 
ATOM   2620 C  CE1   . HIS E 3 231 ? 35.749  44.401 -99.880  1.00 55.11  ? 231  HIS A CE1   1 
ATOM   2621 N  NE2   . HIS E 3 231 ? 34.597  44.972 -100.180 1.00 55.88  ? 231  HIS A NE2   1 
ATOM   2622 N  N     . ARG E 3 232 ? 33.545  41.541 -94.188  1.00 52.74  ? 232  ARG A N     1 
ATOM   2623 C  CA    . ARG E 3 232 ? 33.480  41.248 -92.758  1.00 53.62  ? 232  ARG A CA    1 
ATOM   2624 C  C     . ARG E 3 232 ? 34.008  39.858 -92.364  1.00 54.33  ? 232  ARG A C     1 
ATOM   2625 O  O     . ARG E 3 232 ? 33.551  39.267 -91.383  1.00 54.90  ? 232  ARG A O     1 
ATOM   2626 C  CB    . ARG E 3 232 ? 32.035  41.409 -92.253  1.00 49.48  ? 232  ARG A CB    1 
ATOM   2627 C  CG    . ARG E 3 232 ? 31.623  42.842 -91.970  1.00 50.39  ? 232  ARG A CG    1 
ATOM   2628 C  CD    . ARG E 3 232 ? 30.412  42.927 -91.037  1.00 52.01  ? 232  ARG A CD    1 
ATOM   2629 N  NE    . ARG E 3 232 ? 30.536  44.037 -90.087  1.00 52.54  ? 232  ARG A NE    1 
ATOM   2630 C  CZ    . ARG E 3 232 ? 29.556  44.496 -89.309  1.00 52.85  ? 232  ARG A CZ    1 
ATOM   2631 N  NH1   . ARG E 3 232 ? 28.341  43.952 -89.350  1.00 50.42  ? 232  ARG A NH1   1 
ATOM   2632 N  NH2   . ARG E 3 232 ? 29.795  45.510 -88.476  1.00 53.36  ? 232  ARG A NH2   1 
ATOM   2633 N  N     . ASP E 3 233 ? 34.962  39.330 -93.124  1.00 51.85  ? 233  ASP A N     1 
ATOM   2634 C  CA    . ASP E 3 233 ? 35.547  38.033 -92.795  1.00 51.93  ? 233  ASP A CA    1 
ATOM   2635 C  C     . ASP E 3 233 ? 36.412  38.184 -91.543  1.00 51.99  ? 233  ASP A C     1 
ATOM   2636 O  O     . ASP E 3 233 ? 37.318  39.017 -91.507  1.00 53.37  ? 233  ASP A O     1 
ATOM   2637 C  CB    . ASP E 3 233 ? 36.398  37.520 -93.964  1.00 57.25  ? 233  ASP A CB    1 
ATOM   2638 C  CG    . ASP E 3 233 ? 37.407  38.543 -94.450  1.00 56.79  ? 233  ASP A CG    1 
ATOM   2639 O  OD1   . ASP E 3 233 ? 36.985  39.659 -94.817  1.00 54.66  ? 233  ASP A OD1   1 
ATOM   2640 O  OD2   . ASP E 3 233 ? 38.617  38.223 -94.471  1.00 56.63  ? 233  ASP A OD2   1 
ATOM   2641 N  N     . GLY E 3 234 ? 36.127  37.383 -90.519  1.00 44.57  ? 234  GLY A N     1 
ATOM   2642 C  CA    . GLY E 3 234 ? 36.874  37.459 -89.273  1.00 44.30  ? 234  GLY A CA    1 
ATOM   2643 C  C     . GLY E 3 234 ? 36.122  38.308 -88.257  1.00 45.41  ? 234  GLY A C     1 
ATOM   2644 O  O     . GLY E 3 234 ? 36.431  38.318 -87.060  1.00 43.79  ? 234  GLY A O     1 
ATOM   2645 N  N     . GLU E 3 235 ? 35.124  39.034 -88.750  1.00 79.07  ? 235  GLU A N     1 
ATOM   2646 C  CA    . GLU E 3 235 ? 34.300  39.880 -87.900  1.00 80.12  ? 235  GLU A CA    1 
ATOM   2647 C  C     . GLU E 3 235 ? 33.184  39.044 -87.293  1.00 79.76  ? 235  GLU A C     1 
ATOM   2648 O  O     . GLU E 3 235 ? 32.861  37.966 -87.793  1.00 80.91  ? 235  GLU A O     1 
ATOM   2649 C  CB    . GLU E 3 235 ? 33.699  41.033 -88.705  1.00 52.97  ? 235  GLU A CB    1 
ATOM   2650 C  CG    . GLU E 3 235 ? 34.703  42.081 -89.136  1.00 52.16  ? 235  GLU A CG    1 
ATOM   2651 C  CD    . GLU E 3 235 ? 34.043  43.246 -89.832  1.00 52.53  ? 235  GLU A CD    1 
ATOM   2652 O  OE1   . GLU E 3 235 ? 33.081  43.811 -89.273  1.00 51.50  ? 235  GLU A OE1   1 
ATOM   2653 O  OE2   . GLU E 3 235 ? 34.487  43.603 -90.941  1.00 53.77  ? 235  GLU A OE2   1 
ATOM   2654 N  N     . PRO E 3 236 ? 32.583  39.532 -86.201  1.00 63.99  ? 236  PRO A N     1 
ATOM   2655 C  CA    . PRO E 3 236 ? 31.495  38.817 -85.524  1.00 62.27  ? 236  PRO A CA    1 
ATOM   2656 C  C     . PRO E 3 236 ? 30.113  39.040 -86.126  1.00 59.91  ? 236  PRO A C     1 
ATOM   2657 O  O     . PRO E 3 236 ? 29.684  40.172 -86.333  1.00 61.81  ? 236  PRO A O     1 
ATOM   2658 C  CB    . PRO E 3 236 ? 31.584  39.348 -84.100  1.00 117.72 ? 236  PRO A CB    1 
ATOM   2659 C  CG    . PRO E 3 236 ? 31.954  40.783 -84.327  1.00 118.03 ? 236  PRO A CG    1 
ATOM   2660 C  CD    . PRO E 3 236 ? 33.031  40.685 -85.397  1.00 118.34 ? 236  PRO A CD    1 
ATOM   2661 N  N     . CYS E 3 237 ? 29.417  37.953 -86.410  1.00 47.03  ? 237  CYS A N     1 
ATOM   2662 C  CA    . CYS E 3 237 ? 28.077  38.060 -86.955  1.00 43.73  ? 237  CYS A CA    1 
ATOM   2663 C  C     . CYS E 3 237 ? 27.274  38.836 -85.922  1.00 44.00  ? 237  CYS A C     1 
ATOM   2664 O  O     . CYS E 3 237 ? 27.294  38.493 -84.742  1.00 43.64  ? 237  CYS A O     1 
ATOM   2665 C  CB    . CYS E 3 237 ? 27.486  36.674 -87.149  1.00 37.50  ? 237  CYS A CB    1 
ATOM   2666 S  SG    . CYS E 3 237 ? 25.892  36.667 -87.955  1.00 31.44  ? 237  CYS A SG    1 
ATOM   2667 N  N     . GLU E 3 238 ? 26.585  39.886 -86.351  1.00 35.51  ? 238  GLU A N     1 
ATOM   2668 C  CA    . GLU E 3 238 ? 25.817  40.690 -85.409  1.00 35.47  ? 238  GLU A CA    1 
ATOM   2669 C  C     . GLU E 3 238 ? 24.515  40.032 -84.977  1.00 34.40  ? 238  GLU A C     1 
ATOM   2670 O  O     . GLU E 3 238 ? 23.943  40.405 -83.959  1.00 33.87  ? 238  GLU A O     1 
ATOM   2671 C  CB    . GLU E 3 238 ? 25.504  42.075 -85.988  1.00 38.08  ? 238  GLU A CB    1 
ATOM   2672 C  CG    . GLU E 3 238 ? 24.447  42.094 -87.078  1.00 39.12  ? 238  GLU A CG    1 
ATOM   2673 C  CD    . GLU E 3 238 ? 23.971  43.496 -87.379  1.00 40.68  ? 238  GLU A CD    1 
ATOM   2674 O  OE1   . GLU E 3 238 ? 24.823  44.362 -87.658  1.00 41.57  ? 238  GLU A OE1   1 
ATOM   2675 O  OE2   . GLU E 3 238 ? 22.750  43.745 -87.332  1.00 40.30  ? 238  GLU A OE2   1 
ATOM   2676 N  N     . ARG E 3 239 ? 24.050  39.056 -85.746  1.00 42.64  ? 239  ARG A N     1 
ATOM   2677 C  CA    . ARG E 3 239 ? 22.806  38.375 -85.421  1.00 42.65  ? 239  ARG A CA    1 
ATOM   2678 C  C     . ARG E 3 239 ? 23.006  37.168 -84.492  1.00 42.38  ? 239  ARG A C     1 
ATOM   2679 O  O     . ARG E 3 239 ? 22.338  37.049 -83.461  1.00 41.17  ? 239  ARG A O     1 
ATOM   2680 C  CB    . ARG E 3 239 ? 22.101  37.913 -86.701  1.00 38.85  ? 239  ARG A CB    1 
ATOM   2681 C  CG    . ARG E 3 239 ? 20.851  37.085 -86.408  1.00 39.98  ? 239  ARG A CG    1 
ATOM   2682 C  CD    . ARG E 3 239 ? 20.418  36.260 -87.599  1.00 37.78  ? 239  ARG A CD    1 
ATOM   2683 N  NE    . ARG E 3 239 ? 19.657  37.046 -88.557  1.00 34.70  ? 239  ARG A NE    1 
ATOM   2684 C  CZ    . ARG E 3 239 ? 19.881  37.063 -89.863  1.00 30.38  ? 239  ARG A CZ    1 
ATOM   2685 N  NH1   . ARG E 3 239 ? 20.859  36.343 -90.396  1.00 28.39  ? 239  ARG A NH1   1 
ATOM   2686 N  NH2   . ARG E 3 239 ? 19.103  37.790 -90.637  1.00 28.36  ? 239  ARG A NH2   1 
ATOM   2687 N  N     . CYS E 3 240 ? 23.917  36.276 -84.863  1.00 43.97  ? 240  CYS A N     1 
ATOM   2688 C  CA    . CYS E 3 240 ? 24.166  35.088 -84.067  1.00 44.45  ? 240  CYS A CA    1 
ATOM   2689 C  C     . CYS E 3 240 ? 25.564  35.127 -83.465  1.00 45.40  ? 240  CYS A C     1 
ATOM   2690 O  O     . CYS E 3 240 ? 25.795  34.608 -82.366  1.00 47.14  ? 240  CYS A O     1 
ATOM   2691 C  CB    . CYS E 3 240 ? 24.001  33.821 -84.926  1.00 39.54  ? 240  CYS A CB    1 
ATOM   2692 S  SG    . CYS E 3 240 ? 25.413  33.433 -85.968  1.00 38.30  ? 240  CYS A SG    1 
ATOM   2693 N  N     . GLY E 3 241 ? 26.496  35.730 -84.199  1.00 44.68  ? 241  GLY A N     1 
ATOM   2694 C  CA    . GLY E 3 241 ? 27.859  35.840 -83.713  1.00 44.20  ? 241  GLY A CA    1 
ATOM   2695 C  C     . GLY E 3 241 ? 28.857  34.823 -84.235  1.00 43.51  ? 241  GLY A C     1 
ATOM   2696 O  O     . GLY E 3 241 ? 29.937  34.682 -83.672  1.00 43.53  ? 241  GLY A O     1 
ATOM   2697 N  N     . SER E 3 242 ? 28.520  34.108 -85.299  1.00 33.45  ? 242  SER A N     1 
ATOM   2698 C  CA    . SER E 3 242 ? 29.471  33.132 -85.830  1.00 34.59  ? 242  SER A CA    1 
ATOM   2699 C  C     . SER E 3 242 ? 30.594  33.787 -86.633  1.00 33.89  ? 242  SER A C     1 
ATOM   2700 O  O     . SER E 3 242 ? 30.570  34.987 -86.898  1.00 32.83  ? 242  SER A O     1 
ATOM   2701 C  CB    . SER E 3 242 ? 28.754  32.095 -86.692  1.00 54.94  ? 242  SER A CB    1 
ATOM   2702 O  OG    . SER E 3 242 ? 28.241  31.046 -85.887  1.00 59.86  ? 242  SER A OG    1 
ATOM   2703 N  N     . ILE E 3 243 ? 31.585  32.993 -87.011  1.00 33.39  ? 243  ILE A N     1 
ATOM   2704 C  CA    . ILE E 3 243 ? 32.712  33.509 -87.786  1.00 35.00  ? 243  ILE A CA    1 
ATOM   2705 C  C     . ILE E 3 243 ? 32.370  33.569 -89.272  1.00 34.47  ? 243  ILE A C     1 
ATOM   2706 O  O     . ILE E 3 243 ? 32.165  32.534 -89.903  1.00 30.95  ? 243  ILE A O     1 
ATOM   2707 C  CB    . ILE E 3 243 ? 33.941  32.632 -87.563  1.00 62.48  ? 243  ILE A CB    1 
ATOM   2708 N  N     . ILE E 3 244 ? 32.320  34.782 -89.821  1.00 58.27  ? 244  ILE A N     1 
ATOM   2709 C  CA    . ILE E 3 244 ? 31.989  34.992 -91.232  1.00 58.40  ? 244  ILE A CA    1 
ATOM   2710 C  C     . ILE E 3 244 ? 33.203  34.720 -92.123  1.00 60.31  ? 244  ILE A C     1 
ATOM   2711 O  O     . ILE E 3 244 ? 34.254  35.339 -91.976  1.00 61.30  ? 244  ILE A O     1 
ATOM   2712 C  CB    . ILE E 3 244 ? 31.438  36.431 -91.441  1.00 31.78  ? 244  ILE A CB    1 
ATOM   2713 C  CG1   . ILE E 3 244 ? 30.114  36.578 -90.672  1.00 29.03  ? 244  ILE A CG1   1 
ATOM   2714 C  CG2   . ILE E 3 244 ? 31.212  36.720 -92.919  1.00 29.89  ? 244  ILE A CG2   1 
ATOM   2715 C  CD1   . ILE E 3 244 ? 29.633  38.016 -90.508  1.00 29.17  ? 244  ILE A CD1   1 
ATOM   2716 N  N     . GLU E 3 245 ? 33.035  33.780 -93.047  1.00 54.40  ? 245  GLU A N     1 
ATOM   2717 C  CA    . GLU E 3 245 ? 34.100  33.350 -93.952  1.00 55.51  ? 245  GLU A CA    1 
ATOM   2718 C  C     . GLU E 3 245 ? 34.023  33.917 -95.373  1.00 56.15  ? 245  GLU A C     1 
ATOM   2719 O  O     . GLU E 3 245 ? 32.940  34.212 -95.886  1.00 55.39  ? 245  GLU A O     1 
ATOM   2720 C  CB    . GLU E 3 245 ? 34.084  31.820 -94.032  1.00 48.52  ? 245  GLU A CB    1 
ATOM   2721 C  CG    . GLU E 3 245 ? 33.879  31.147 -92.686  1.00 48.43  ? 245  GLU A CG    1 
ATOM   2722 C  CD    . GLU E 3 245 ? 33.097  29.850 -92.797  1.00 49.48  ? 245  GLU A CD    1 
ATOM   2723 O  OE1   . GLU E 3 245 ? 32.056  29.856 -93.481  1.00 47.67  ? 245  GLU A OE1   1 
ATOM   2724 O  OE2   . GLU E 3 245 ? 33.510  28.835 -92.194  1.00 49.58  ? 245  GLU A OE2   1 
ATOM   2725 N  N     . LYS E 3 246 ? 35.180  34.059 -96.014  1.00 54.93  ? 246  LYS A N     1 
ATOM   2726 C  CA    . LYS E 3 246 ? 35.205  34.558 -97.379  1.00 54.91  ? 246  LYS A CA    1 
ATOM   2727 C  C     . LYS E 3 246 ? 35.486  33.414 -98.340  1.00 56.10  ? 246  LYS A C     1 
ATOM   2728 O  O     . LYS E 3 246 ? 36.482  32.707 -98.205  1.00 57.72  ? 246  LYS A O     1 
ATOM   2729 C  CB    . LYS E 3 246 ? 36.265  35.644 -97.557  1.00 55.75  ? 246  LYS A CB    1 
ATOM   2730 C  CG    . LYS E 3 246 ? 36.317  36.180 -98.985  1.00 54.75  ? 246  LYS A CG    1 
ATOM   2731 C  CD    . LYS E 3 246 ? 37.286  37.330 -99.143  1.00 52.18  ? 246  LYS A CD    1 
ATOM   2732 C  CE    . LYS E 3 246 ? 37.341  37.805 -100.600 1.00 52.70  ? 246  LYS A CE    1 
ATOM   2733 N  NZ    . LYS E 3 246 ? 37.926  36.781 -101.523 1.00 51.63  ? 246  LYS A NZ    1 
ATOM   2734 N  N     . THR E 3 247 ? 34.590  33.228 -99.299  1.00 45.59  ? 247  THR A N     1 
ATOM   2735 C  CA    . THR E 3 247 ? 34.733  32.177 -100.292 1.00 47.65  ? 247  THR A CA    1 
ATOM   2736 C  C     . THR E 3 247 ? 34.408  32.776 -101.658 1.00 48.55  ? 247  THR A C     1 
ATOM   2737 O  O     . THR E 3 247 ? 34.270  33.994 -101.784 1.00 49.23  ? 247  THR A O     1 
ATOM   2738 C  CB    . THR E 3 247 ? 33.772  31.001 -100.008 1.00 42.67  ? 247  THR A CB    1 
ATOM   2739 O  OG1   . THR E 3 247 ? 34.006  29.951 -100.954 1.00 41.02  ? 247  THR A OG1   1 
ATOM   2740 C  CG2   . THR E 3 247 ? 32.323  31.456 -100.112 1.00 42.11  ? 247  THR A CG2   1 
ATOM   2741 N  N     . THR E 3 248 ? 34.285  31.928 -102.673 1.00 67.03  ? 248  THR A N     1 
ATOM   2742 C  CA    . THR E 3 248 ? 33.973  32.402 -104.016 1.00 67.19  ? 248  THR A CA    1 
ATOM   2743 C  C     . THR E 3 248 ? 32.660  31.821 -104.531 1.00 68.21  ? 248  THR A C     1 
ATOM   2744 O  O     . THR E 3 248 ? 32.493  30.602 -104.599 1.00 67.90  ? 248  THR A O     1 
ATOM   2745 C  CB    . THR E 3 248 ? 35.084  32.028 -105.024 1.00 57.22  ? 248  THR A CB    1 
ATOM   2746 O  OG1   . THR E 3 248 ? 34.959  30.646 -105.394 1.00 56.32  ? 248  THR A OG1   1 
ATOM   2747 C  CG2   . THR E 3 248 ? 36.460  32.265 -104.409 1.00 56.19  ? 248  THR A CG2   1 
ATOM   2748 N  N     . LEU E 3 249 ? 31.727  32.699 -104.882 1.00 81.38  ? 249  LEU A N     1 
ATOM   2749 C  CA    . LEU E 3 249 ? 30.444  32.272 -105.423 1.00 81.10  ? 249  LEU A CA    1 
ATOM   2750 C  C     . LEU E 3 249 ? 30.129  33.069 -106.676 1.00 80.98  ? 249  LEU A C     1 
ATOM   2751 O  O     . LEU E 3 249 ? 30.095  34.299 -106.650 1.00 83.13  ? 249  LEU A O     1 
ATOM   2752 C  CB    . LEU E 3 249 ? 29.312  32.446 -104.400 1.00 45.15  ? 249  LEU A CB    1 
ATOM   2753 C  CG    . LEU E 3 249 ? 28.957  31.161 -103.659 1.00 44.63  ? 249  LEU A CG    1 
ATOM   2754 C  CD1   . LEU E 3 249 ? 30.087  30.824 -102.717 1.00 46.43  ? 249  LEU A CD1   1 
ATOM   2755 C  CD2   . LEU E 3 249 ? 27.656  31.308 -102.890 1.00 45.69  ? 249  LEU A CD2   1 
ATOM   2756 N  N     . SER E 3 250 ? 29.912  32.352 -107.772 1.00 37.78  ? 250  SER A N     1 
ATOM   2757 C  CA    . SER E 3 250 ? 29.591  32.965 -109.050 1.00 36.38  ? 250  SER A CA    1 
ATOM   2758 C  C     . SER E 3 250 ? 30.827  33.623 -109.626 1.00 35.25  ? 250  SER A C     1 
ATOM   2759 O  O     . SER E 3 250 ? 30.744  34.660 -110.281 1.00 34.69  ? 250  SER A O     1 
ATOM   2760 C  CB    . SER E 3 250 ? 28.488  34.007 -108.866 1.00 52.10  ? 250  SER A CB    1 
ATOM   2761 O  OG    . SER E 3 250 ? 27.358  33.448 -108.223 1.00 52.66  ? 250  SER A OG    1 
ATOM   2762 N  N     . SER E 3 251 ? 31.974  33.010 -109.357 1.00 53.82  ? 251  SER A N     1 
ATOM   2763 C  CA    . SER E 3 251 ? 33.269  33.495 -109.809 1.00 52.60  ? 251  SER A CA    1 
ATOM   2764 C  C     . SER E 3 251 ? 33.608  34.867 -109.256 1.00 52.51  ? 251  SER A C     1 
ATOM   2765 O  O     . SER E 3 251 ? 34.282  35.661 -109.910 1.00 53.84  ? 251  SER A O     1 
ATOM   2766 C  CB    . SER E 3 251 ? 33.341  33.505 -111.340 1.00 58.73  ? 251  SER A CB    1 
ATOM   2767 O  OG    . SER E 3 251 ? 33.367  32.177 -111.853 1.00 59.73  ? 251  SER A OG    1 
ATOM   2768 N  N     . ARG E 3 252 ? 33.136  35.130 -108.041 1.00 43.39  ? 252  ARG A N     1 
ATOM   2769 C  CA    . ARG E 3 252 ? 33.383  36.384 -107.325 1.00 41.92  ? 252  ARG A CA    1 
ATOM   2770 C  C     . ARG E 3 252 ? 33.325  36.093 -105.821 1.00 42.41  ? 252  ARG A C     1 
ATOM   2771 O  O     . ARG E 3 252 ? 32.831  35.041 -105.400 1.00 43.13  ? 252  ARG A O     1 
ATOM   2772 C  CB    . ARG E 3 252 ? 32.340  37.433 -107.709 1.00 40.33  ? 252  ARG A CB    1 
ATOM   2773 C  CG    . ARG E 3 252 ? 32.240  37.625 -109.210 1.00 38.54  ? 252  ARG A CG    1 
ATOM   2774 C  CD    . ARG E 3 252 ? 31.434  38.826 -109.630 1.00 37.24  ? 252  ARG A CD    1 
ATOM   2775 N  NE    . ARG E 3 252 ? 31.474  38.921 -111.083 1.00 37.69  ? 252  ARG A NE    1 
ATOM   2776 C  CZ    . ARG E 3 252 ? 32.586  39.148 -111.786 1.00 37.97  ? 252  ARG A CZ    1 
ATOM   2777 N  NH1   . ARG E 3 252 ? 33.748  39.317 -111.166 1.00 38.22  ? 252  ARG A NH1   1 
ATOM   2778 N  NH2   . ARG E 3 252 ? 32.540  39.174 -113.116 1.00 36.68  ? 252  ARG A NH2   1 
ATOM   2779 N  N     . PRO E 3 253 ? 33.838  37.013 -104.992 1.00 50.62  ? 253  PRO A N     1 
ATOM   2780 C  CA    . PRO E 3 253 ? 33.839  36.828 -103.540 1.00 51.04  ? 253  PRO A CA    1 
ATOM   2781 C  C     . PRO E 3 253 ? 32.448  36.772 -102.902 1.00 52.42  ? 253  PRO A C     1 
ATOM   2782 O  O     . PRO E 3 253 ? 31.554  37.546 -103.260 1.00 53.80  ? 253  PRO A O     1 
ATOM   2783 C  CB    . PRO E 3 253 ? 34.667  38.015 -103.048 1.00 45.84  ? 253  PRO A CB    1 
ATOM   2784 C  CG    . PRO E 3 253 ? 34.370  39.072 -104.044 1.00 43.58  ? 253  PRO A CG    1 
ATOM   2785 C  CD    . PRO E 3 253 ? 34.387  38.333 -105.356 1.00 46.12  ? 253  PRO A CD    1 
ATOM   2786 N  N     . PHE E 3 254 ? 32.270  35.846 -101.962 1.00 62.51  ? 254  PHE A N     1 
ATOM   2787 C  CA    . PHE E 3 254 ? 30.991  35.692 -101.273 1.00 63.46  ? 254  PHE A CA    1 
ATOM   2788 C  C     . PHE E 3 254 ? 31.133  35.650 -99.752  1.00 62.68  ? 254  PHE A C     1 
ATOM   2789 O  O     . PHE E 3 254 ? 31.752  34.738 -99.203  1.00 62.66  ? 254  PHE A O     1 
ATOM   2790 C  CB    . PHE E 3 254 ? 30.283  34.421 -101.725 1.00 39.43  ? 254  PHE A CB    1 
ATOM   2791 C  CG    . PHE E 3 254 ? 28.915  34.243 -101.110 1.00 39.92  ? 254  PHE A CG    1 
ATOM   2792 C  CD1   . PHE E 3 254 ? 27.824  34.974 -101.579 1.00 40.62  ? 254  PHE A CD1   1 
ATOM   2793 C  CD2   . PHE E 3 254 ? 28.708  33.320 -100.092 1.00 38.44  ? 254  PHE A CD2   1 
ATOM   2794 C  CE1   . PHE E 3 254 ? 26.554  34.780 -101.049 1.00 37.99  ? 254  PHE A CE1   1 
ATOM   2795 C  CE2   . PHE E 3 254 ? 27.436  33.122 -99.555  1.00 37.01  ? 254  PHE A CE2   1 
ATOM   2796 C  CZ    . PHE E 3 254 ? 26.360  33.853 -100.037 1.00 36.36  ? 254  PHE A CZ    1 
ATOM   2797 N  N     . TYR E 3 255 ? 30.527  36.633 -99.088  1.00 33.38  ? 255  TYR A N     1 
ATOM   2798 C  CA    . TYR E 3 255 ? 30.560  36.755 -97.636  1.00 33.16  ? 255  TYR A CA    1 
ATOM   2799 C  C     . TYR E 3 255 ? 29.279  36.233 -97.003  1.00 32.95  ? 255  TYR A C     1 
ATOM   2800 O  O     . TYR E 3 255 ? 28.184  36.532 -97.487  1.00 33.04  ? 255  TYR A O     1 
ATOM   2801 C  CB    . TYR E 3 255 ? 30.765  38.221 -97.255  1.00 38.22  ? 255  TYR A CB    1 
ATOM   2802 C  CG    . TYR E 3 255 ? 31.975  38.855 -97.911  1.00 39.42  ? 255  TYR A CG    1 
ATOM   2803 C  CD1   . TYR E 3 255 ? 31.906  39.370 -99.210  1.00 40.64  ? 255  TYR A CD1   1 
ATOM   2804 C  CD2   . TYR E 3 255 ? 33.200  38.904 -97.253  1.00 38.82  ? 255  TYR A CD2   1 
ATOM   2805 C  CE1   . TYR E 3 255 ? 33.036  39.913 -99.834  1.00 40.24  ? 255  TYR A CE1   1 
ATOM   2806 C  CE2   . TYR E 3 255 ? 34.334  39.443 -97.864  1.00 39.86  ? 255  TYR A CE2   1 
ATOM   2807 C  CZ    . TYR E 3 255 ? 34.250  39.941 -99.154  1.00 40.54  ? 255  TYR A CZ    1 
ATOM   2808 O  OH    . TYR E 3 255 ? 35.389  40.411 -99.780  1.00 40.63  ? 255  TYR A OH    1 
ATOM   2809 N  N     . TRP E 3 256 ? 29.408  35.453 -95.928  1.00 63.27  ? 256  TRP A N     1 
ATOM   2810 C  CA    . TRP E 3 256 ? 28.234  34.906 -95.236  1.00 64.69  ? 256  TRP A CA    1 
ATOM   2811 C  C     . TRP E 3 256 ? 28.550  34.389 -93.832  1.00 64.16  ? 256  TRP A C     1 
ATOM   2812 O  O     . TRP E 3 256 ? 29.707  34.330 -93.431  1.00 66.46  ? 256  TRP A O     1 
ATOM   2813 C  CB    . TRP E 3 256 ? 27.611  33.771 -96.062  1.00 44.55  ? 256  TRP A CB    1 
ATOM   2814 C  CG    . TRP E 3 256 ? 28.168  32.416 -95.770  1.00 45.42  ? 256  TRP A CG    1 
ATOM   2815 C  CD1   . TRP E 3 256 ? 27.521  31.382 -95.155  1.00 45.81  ? 256  TRP A CD1   1 
ATOM   2816 C  CD2   . TRP E 3 256 ? 29.470  31.925 -96.121  1.00 45.86  ? 256  TRP A CD2   1 
ATOM   2817 N  NE1   . TRP E 3 256 ? 28.337  30.274 -95.105  1.00 46.37  ? 256  TRP A NE1   1 
ATOM   2818 C  CE2   . TRP E 3 256 ? 29.539  30.578 -95.693  1.00 45.79  ? 256  TRP A CE2   1 
ATOM   2819 C  CE3   . TRP E 3 256 ? 30.586  32.490 -96.760  1.00 46.90  ? 256  TRP A CE3   1 
ATOM   2820 C  CZ2   . TRP E 3 256 ? 30.681  29.784 -95.885  1.00 46.73  ? 256  TRP A CZ2   1 
ATOM   2821 C  CZ3   . TRP E 3 256 ? 31.726  31.701 -96.951  1.00 47.22  ? 256  TRP A CZ3   1 
ATOM   2822 C  CH2   . TRP E 3 256 ? 31.762  30.362 -96.514  1.00 48.11  ? 256  TRP A CH2   1 
ATOM   2823 N  N     . CYS E 3 257 ? 27.509  34.013 -93.096  1.00 38.24  ? 257  CYS A N     1 
ATOM   2824 C  CA    . CYS E 3 257 ? 27.654  33.481 -91.743  1.00 38.33  ? 257  CYS A CA    1 
ATOM   2825 C  C     . CYS E 3 257 ? 27.390  31.969 -91.726  1.00 39.47  ? 257  CYS A C     1 
ATOM   2826 O  O     . CYS E 3 257 ? 26.350  31.508 -92.196  1.00 40.51  ? 257  CYS A O     1 
ATOM   2827 C  CB    . CYS E 3 257 ? 26.673  34.187 -90.807  1.00 47.38  ? 257  CYS A CB    1 
ATOM   2828 S  SG    . CYS E 3 257 ? 26.850  33.789 -89.053  1.00 44.59  ? 257  CYS A SG    1 
ATOM   2829 N  N     . PRO E 3 258 ? 28.325  31.176 -91.184  1.00 61.91  ? 258  PRO A N     1 
ATOM   2830 C  CA    . PRO E 3 258 ? 28.145  29.718 -91.135  1.00 61.97  ? 258  PRO A CA    1 
ATOM   2831 C  C     . PRO E 3 258 ? 26.995  29.261 -90.249  1.00 61.00  ? 258  PRO A C     1 
ATOM   2832 O  O     . PRO E 3 258 ? 26.355  28.258 -90.538  1.00 62.90  ? 258  PRO A O     1 
ATOM   2833 C  CB    . PRO E 3 258 ? 29.490  29.212 -90.613  1.00 57.19  ? 258  PRO A CB    1 
ATOM   2834 C  CG    . PRO E 3 258 ? 30.444  30.279 -91.034  1.00 57.60  ? 258  PRO A CG    1 
ATOM   2835 C  CD    . PRO E 3 258 ? 29.676  31.543 -90.739  1.00 57.70  ? 258  PRO A CD    1 
ATOM   2836 N  N     . GLY E 3 259 ? 26.736  29.995 -89.172  1.00 39.70  ? 259  GLY A N     1 
ATOM   2837 C  CA    . GLY E 3 259 ? 25.664  29.619 -88.267  1.00 38.32  ? 259  GLY A CA    1 
ATOM   2838 C  C     . GLY E 3 259 ? 24.399  30.435 -88.448  1.00 36.99  ? 259  GLY A C     1 
ATOM   2839 O  O     . GLY E 3 259 ? 23.461  30.367 -87.657  1.00 37.71  ? 259  GLY A O     1 
ATOM   2840 N  N     . CYS E 3 260 ? 24.353  31.194 -89.526  1.00 33.97  ? 260  CYS A N     1 
ATOM   2841 C  CA    . CYS E 3 260 ? 23.211  32.043 -89.767  1.00 31.80  ? 260  CYS A CA    1 
ATOM   2842 C  C     . CYS E 3 260 ? 22.504  31.756 -91.093  1.00 30.02  ? 260  CYS A C     1 
ATOM   2843 O  O     . CYS E 3 260 ? 21.342  32.124 -91.268  1.00 27.82  ? 260  CYS A O     1 
ATOM   2844 C  CB    . CYS E 3 260 ? 23.692  33.488 -89.737  1.00 42.36  ? 260  CYS A CB    1 
ATOM   2845 S  SG    . CYS E 3 260 ? 22.551  34.616 -89.027  1.00 46.25  ? 260  CYS A SG    1 
ATOM   2846 N  N     . GLN E 3 261 ? 23.215  31.122 -92.021  1.00 32.88  ? 261  GLN A N     1 
ATOM   2847 C  CA    . GLN E 3 261 ? 22.660  30.829 -93.338  1.00 34.39  ? 261  GLN A CA    1 
ATOM   2848 C  C     . GLN E 3 261 ? 22.622  29.337 -93.699  1.00 35.70  ? 261  GLN A C     1 
ATOM   2849 O  O     . GLN E 3 261 ? 23.624  28.618 -93.608  1.00 35.19  ? 261  GLN A O     1 
ATOM   2850 C  CB    . GLN E 3 261 ? 23.415  31.641 -94.404  1.00 32.61  ? 261  GLN A CB    1 
ATOM   2851 C  CG    . GLN E 3 261 ? 22.866  33.058 -94.569  1.00 32.09  ? 261  GLN A CG    1 
ATOM   2852 C  CD    . GLN E 3 261 ? 23.879  34.154 -94.304  1.00 31.85  ? 261  GLN A CD    1 
ATOM   2853 O  OE1   . GLN E 3 261 ? 24.698  34.489 -95.156  1.00 29.62  ? 261  GLN A OE1   1 
ATOM   2854 N  NE2   . GLN E 3 261 ? 23.828  34.715 -93.104  1.00 34.04  ? 261  GLN A NE2   1 
ATOM   2855 N  N     . HIS E 3 262 ? 21.453  28.884 -94.138  1.00 39.09  ? 262  HIS A N     1 
ATOM   2856 C  CA    . HIS E 3 262 ? 21.277  27.483 -94.442  1.00 39.05  ? 262  HIS A CA    1 
ATOM   2857 C  C     . HIS E 3 262 ? 20.683  27.147 -95.813  1.00 41.51  ? 262  HIS A C     1 
ATOM   2858 O  O     . HIS E 3 262 ? 19.812  27.853 -96.329  1.00 44.43  ? 262  HIS A O     1 
ATOM   2859 C  CB    . HIS E 3 262 ? 20.441  26.890 -93.313  1.00 32.11  ? 262  HIS A CB    1 
ATOM   2860 C  CG    . HIS E 3 262 ? 20.895  27.332 -91.955  1.00 33.32  ? 262  HIS A CG    1 
ATOM   2861 N  ND1   . HIS E 3 262 ? 20.216  28.274 -91.209  1.00 31.38  ? 262  HIS A ND1   1 
ATOM   2862 C  CD2   . HIS E 3 262 ? 22.014  27.035 -91.253  1.00 30.99  ? 262  HIS A CD2   1 
ATOM   2863 C  CE1   . HIS E 3 262 ? 20.898  28.540 -90.111  1.00 30.26  ? 262  HIS A CE1   1 
ATOM   2864 N  NE2   . HIS E 3 262 ? 21.994  27.803 -90.114  1.00 29.92  ? 262  HIS A NE2   1 
ATOM   2865 N  N     . PRO F 3 1   ? 77.442  49.513 -98.902  1.00 38.07  ? 1    PRO B N     1 
ATOM   2866 C  CA    . PRO F 3 1   ? 78.650  50.217 -98.384  1.00 36.23  ? 1    PRO B CA    1 
ATOM   2867 C  C     . PRO F 3 1   ? 79.495  49.267 -97.543  1.00 36.03  ? 1    PRO B C     1 
ATOM   2868 O  O     . PRO F 3 1   ? 78.973  48.634 -96.635  1.00 34.18  ? 1    PRO B O     1 
ATOM   2869 C  CB    . PRO F 3 1   ? 78.134  51.398 -97.593  1.00 53.93  ? 1    PRO B CB    1 
ATOM   2870 C  CG    . PRO F 3 1   ? 76.930  51.785 -98.452  1.00 55.38  ? 1    PRO B CG    1 
ATOM   2871 C  CD    . PRO F 3 1   ? 76.296  50.443 -98.922  1.00 54.52  ? 1    PRO B CD    1 
ATOM   2872 N  N     . GLN F 3 2   ? 80.791  49.168 -97.852  1.00 86.85  ? 2    GLN B N     1 
ATOM   2873 C  CA    . GLN F 3 2   ? 81.668  48.226 -97.153  1.00 87.54  ? 2    GLN B CA    1 
ATOM   2874 C  C     . GLN F 3 2   ? 83.141  48.573 -96.943  1.00 87.41  ? 2    GLN B C     1 
ATOM   2875 O  O     . GLN F 3 2   ? 83.821  47.906 -96.173  1.00 86.46  ? 2    GLN B O     1 
ATOM   2876 C  CB    . GLN F 3 2   ? 81.609  46.885 -97.873  1.00 51.98  ? 2    GLN B CB    1 
ATOM   2877 C  CG    . GLN F 3 2   ? 82.135  46.926 -99.304  1.00 53.76  ? 2    GLN B CG    1 
ATOM   2878 C  CD    . GLN F 3 2   ? 81.385  45.973 -100.223 1.00 55.74  ? 2    GLN B CD    1 
ATOM   2879 O  OE1   . GLN F 3 2   ? 81.823  45.676 -101.339 1.00 57.55  ? 2    GLN B OE1   1 
ATOM   2880 N  NE2   . GLN F 3 2   ? 80.241  45.498 -99.759  1.00 54.39  ? 2    GLN B NE2   1 
ATOM   2881 N  N     . GLY F 3 3   ? 83.648  49.586 -97.628  1.00 41.06  ? 3    GLY B N     1 
ATOM   2882 C  CA    . GLY F 3 3   ? 85.043  49.942 -97.470  1.00 40.09  ? 3    GLY B CA    1 
ATOM   2883 C  C     . GLY F 3 3   ? 85.308  51.143 -98.349  1.00 40.71  ? 3    GLY B C     1 
ATOM   2884 O  O     . GLY F 3 3   ? 85.554  52.240 -97.843  1.00 42.51  ? 3    GLY B O     1 
ATOM   2885 N  N     . PRO F 3 4   ? 85.256  50.971 -99.680  1.00 40.31  ? 4    PRO B N     1 
ATOM   2886 C  CA    . PRO F 3 4   ? 85.493  52.077 -100.613 1.00 39.45  ? 4    PRO B CA    1 
ATOM   2887 C  C     . PRO F 3 4   ? 84.470  53.193 -100.380 1.00 38.35  ? 4    PRO B C     1 
ATOM   2888 O  O     . PRO F 3 4   ? 84.735  54.372 -100.656 1.00 36.85  ? 4    PRO B O     1 
ATOM   2889 C  CB    . PRO F 3 4   ? 85.314  51.420 -101.985 1.00 46.28  ? 4    PRO B CB    1 
ATOM   2890 C  CG    . PRO F 3 4   ? 85.678  49.995 -101.741 1.00 48.51  ? 4    PRO B CG    1 
ATOM   2891 C  CD    . PRO F 3 4   ? 85.044  49.707 -100.406 1.00 48.48  ? 4    PRO B CD    1 
ATOM   2892 N  N     . GLU F 3 5   ? 83.297  52.798 -99.882  1.00 45.25  ? 5    GLU B N     1 
ATOM   2893 C  CA    . GLU F 3 5   ? 82.204  53.732 -99.610  1.00 45.20  ? 5    GLU B CA    1 
ATOM   2894 C  C     . GLU F 3 5   ? 82.468  54.538 -98.323  1.00 45.17  ? 5    GLU B C     1 
ATOM   2895 O  O     . GLU F 3 5   ? 82.350  55.771 -98.307  1.00 45.29  ? 5    GLU B O     1 
ATOM   2896 C  CB    . GLU F 3 5   ? 80.884  52.963 -99.469  1.00 38.22  ? 5    GLU B CB    1 
ATOM   2897 C  CG    . GLU F 3 5   ? 80.431  52.112 -100.688 1.00 37.13  ? 5    GLU B CG    1 
ATOM   2898 C  CD    . GLU F 3 5   ? 81.449  51.059 -101.147 1.00 36.06  ? 5    GLU B CD    1 
ATOM   2899 O  OE1   . GLU F 3 5   ? 81.957  50.279 -100.303 1.00 33.96  ? 5    GLU B OE1   1 
ATOM   2900 O  OE2   . GLU F 3 5   ? 81.735  51.016 -102.370 1.00 33.03  ? 5    GLU B OE2   1 
ATOM   2901 N  N     . ILE F 3 6   ? 82.841  53.832 -97.254  1.00 41.19  ? 6    ILE B N     1 
ATOM   2902 C  CA    . ILE F 3 6   ? 83.108  54.463 -95.974  1.00 39.95  ? 6    ILE B CA    1 
ATOM   2903 C  C     . ILE F 3 6   ? 84.253  55.464 -96.060  1.00 42.00  ? 6    ILE B C     1 
ATOM   2904 O  O     . ILE F 3 6   ? 84.155  56.579 -95.529  1.00 41.86  ? 6    ILE B O     1 
ATOM   2905 C  CB    . ILE F 3 6   ? 83.415  53.397 -94.897  1.00 23.80  ? 6    ILE B CB    1 
ATOM   2906 C  CG1   . ILE F 3 6   ? 82.176  52.536 -94.675  1.00 22.50  ? 6    ILE B CG1   1 
ATOM   2907 C  CG2   . ILE F 3 6   ? 83.756  54.068 -93.548  1.00 23.76  ? 6    ILE B CG2   1 
ATOM   2908 C  CD1   . ILE F 3 6   ? 82.469  51.198 -94.175  1.00 17.29  ? 6    ILE B CD1   1 
ATOM   2909 N  N     . ARG F 3 7   ? 85.332  55.064 -96.731  1.00 52.12  ? 7    ARG B N     1 
ATOM   2910 C  CA    . ARG F 3 7   ? 86.501  55.919 -96.903  1.00 51.83  ? 7    ARG B CA    1 
ATOM   2911 C  C     . ARG F 3 7   ? 86.048  57.133 -97.696  1.00 52.13  ? 7    ARG B C     1 
ATOM   2912 O  O     . ARG F 3 7   ? 86.423  58.269 -97.405  1.00 54.62  ? 7    ARG B O     1 
ATOM   2913 C  CB    . ARG F 3 7   ? 87.598  55.167 -97.670  1.00 36.53  ? 7    ARG B CB    1 
ATOM   2914 C  CG    . ARG F 3 7   ? 88.916  55.911 -97.819  1.00 34.59  ? 7    ARG B CG    1 
ATOM   2915 C  CD    . ARG F 3 7   ? 89.488  56.286 -96.471  1.00 34.78  ? 7    ARG B CD    1 
ATOM   2916 N  NE    . ARG F 3 7   ? 89.373  57.707 -96.170  1.00 35.05  ? 7    ARG B NE    1 
ATOM   2917 C  CZ    . ARG F 3 7   ? 89.511  58.213 -94.948  1.00 35.38  ? 7    ARG B CZ    1 
ATOM   2918 N  NH1   . ARG F 3 7   ? 89.753  57.402 -93.937  1.00 36.01  ? 7    ARG B NH1   1 
ATOM   2919 N  NH2   . ARG F 3 7   ? 89.433  59.522 -94.733  1.00 35.11  ? 7    ARG B NH2   1 
ATOM   2920 N  N     . ARG F 3 8   ? 85.224  56.865 -98.698  1.00 38.06  ? 8    ARG B N     1 
ATOM   2921 C  CA    . ARG F 3 8   ? 84.672  57.889 -99.575  1.00 38.58  ? 8    ARG B CA    1 
ATOM   2922 C  C     . ARG F 3 8   ? 83.862  58.900 -98.769  1.00 38.01  ? 8    ARG B C     1 
ATOM   2923 O  O     . ARG F 3 8   ? 83.891  60.096 -99.045  1.00 38.66  ? 8    ARG B O     1 
ATOM   2924 C  CB    . ARG F 3 8   ? 83.786  57.226 -100.631 1.00 41.47  ? 8    ARG B CB    1 
ATOM   2925 C  CG    . ARG F 3 8   ? 84.094  57.638 -102.059 1.00 39.31  ? 8    ARG B CG    1 
ATOM   2926 C  CD    . ARG F 3 8   ? 83.793  56.482 -102.994 1.00 41.07  ? 8    ARG B CD    1 
ATOM   2927 N  NE    . ARG F 3 8   ? 82.370  56.156 -103.085 1.00 39.22  ? 8    ARG B NE    1 
ATOM   2928 C  CZ    . ARG F 3 8   ? 81.899  54.938 -103.345 1.00 39.95  ? 8    ARG B CZ    1 
ATOM   2929 N  NH1   . ARG F 3 8   ? 82.741  53.922 -103.535 1.00 35.11  ? 8    ARG B NH1   1 
ATOM   2930 N  NH2   . ARG F 3 8   ? 80.589  54.738 -103.429 1.00 38.07  ? 8    ARG B NH2   1 
ATOM   2931 N  N     . ALA F 3 9   ? 83.131  58.415 -97.778  1.00 46.67  ? 9    ALA B N     1 
ATOM   2932 C  CA    . ALA F 3 9   ? 82.354  59.305 -96.933  1.00 47.58  ? 9    ALA B CA    1 
ATOM   2933 C  C     . ALA F 3 9   ? 83.329  60.048 -96.015  1.00 47.68  ? 9    ALA B C     1 
ATOM   2934 O  O     . ALA F 3 9   ? 83.278  61.275 -95.895  1.00 47.26  ? 9    ALA B O     1 
ATOM   2935 C  CB    . ALA F 3 9   ? 81.365  58.503 -96.115  1.00 53.81  ? 9    ALA B CB    1 
ATOM   2936 N  N     . ALA F 3 10  ? 84.226  59.287 -95.386  1.00 39.50  ? 10   ALA B N     1 
ATOM   2937 C  CA    . ALA F 3 10  ? 85.227  59.834 -94.478  1.00 38.45  ? 10   ALA B CA    1 
ATOM   2938 C  C     . ALA F 3 10  ? 85.899  61.063 -95.063  1.00 39.68  ? 10   ALA B C     1 
ATOM   2939 O  O     . ALA F 3 10  ? 86.159  62.031 -94.348  1.00 41.55  ? 10   ALA B O     1 
ATOM   2940 C  CB    . ALA F 3 10  ? 86.280  58.774 -94.152  1.00 17.25  ? 10   ALA B CB    1 
ATOM   2941 N  N     . ASP F 3 11  ? 86.194  61.017 -96.359  1.00 34.46  ? 11   ASP B N     1 
ATOM   2942 C  CA    . ASP F 3 11  ? 86.829  62.141 -97.020  1.00 34.37  ? 11   ASP B CA    1 
ATOM   2943 C  C     . ASP F 3 11  ? 85.890  63.332 -97.004  1.00 33.94  ? 11   ASP B C     1 
ATOM   2944 O  O     . ASP F 3 11  ? 86.316  64.474 -96.841  1.00 33.60  ? 11   ASP B O     1 
ATOM   2945 C  CB    . ASP F 3 11  ? 87.175  61.792 -98.473  1.00 46.34  ? 11   ASP B CB    1 
ATOM   2946 C  CG    . ASP F 3 11  ? 88.321  60.798 -98.586  1.00 46.84  ? 11   ASP B CG    1 
ATOM   2947 O  OD1   . ASP F 3 11  ? 88.915  60.445 -97.547  1.00 47.21  ? 11   ASP B OD1   1 
ATOM   2948 O  OD2   . ASP F 3 11  ? 88.634  60.379 -99.720  1.00 47.23  ? 11   ASP B OD2   1 
ATOM   2949 N  N     . ASN F 3 12  ? 84.602  63.067 -97.178  1.00 42.05  ? 12   ASN B N     1 
ATOM   2950 C  CA    . ASN F 3 12  ? 83.617  64.134 -97.194  1.00 41.37  ? 12   ASN B CA    1 
ATOM   2951 C  C     . ASN F 3 12  ? 83.470  64.822 -95.855  1.00 41.36  ? 12   ASN B C     1 
ATOM   2952 O  O     . ASN F 3 12  ? 83.263  66.037 -95.785  1.00 40.67  ? 12   ASN B O     1 
ATOM   2953 C  CB    . ASN F 3 12  ? 82.272  63.590 -97.630  1.00 36.39  ? 12   ASN B CB    1 
ATOM   2954 C  CG    . ASN F 3 12  ? 82.208  63.392 -99.096  1.00 36.68  ? 12   ASN B CG    1 
ATOM   2955 O  OD1   . ASN F 3 12  ? 82.968  64.008 -99.822  1.00 37.83  ? 12   ASN B OD1   1 
ATOM   2956 N  ND2   . ASN F 3 12  ? 81.296  62.553 -99.555  1.00 37.43  ? 12   ASN B ND2   1 
ATOM   2957 N  N     . LEU F 3 13  ? 83.568  64.032 -94.796  1.00 34.72  ? 13   LEU B N     1 
ATOM   2958 C  CA    . LEU F 3 13  ? 83.447  64.558 -93.458  1.00 34.68  ? 13   LEU B CA    1 
ATOM   2959 C  C     . LEU F 3 13  ? 84.602  65.521 -93.166  1.00 35.98  ? 13   LEU B C     1 
ATOM   2960 O  O     . LEU F 3 13  ? 84.374  66.646 -92.721  1.00 36.12  ? 13   LEU B O     1 
ATOM   2961 C  CB    . LEU F 3 13  ? 83.388  63.388 -92.457  1.00 29.35  ? 13   LEU B CB    1 
ATOM   2962 C  CG    . LEU F 3 13  ? 82.184  62.438 -92.709  1.00 25.58  ? 13   LEU B CG    1 
ATOM   2963 C  CD1   . LEU F 3 13  ? 82.297  61.136 -91.927  1.00 21.12  ? 13   LEU B CD1   1 
ATOM   2964 C  CD2   . LEU F 3 13  ? 80.910  63.147 -92.333  1.00 21.25  ? 13   LEU B CD2   1 
ATOM   2965 N  N     . GLU F 3 14  ? 85.833  65.104 -93.448  1.00 40.40  ? 14   GLU B N     1 
ATOM   2966 C  CA    . GLU F 3 14  ? 86.998  65.955 -93.194  1.00 41.93  ? 14   GLU B CA    1 
ATOM   2967 C  C     . GLU F 3 14  ? 86.908  67.294 -93.918  1.00 42.70  ? 14   GLU B C     1 
ATOM   2968 O  O     . GLU F 3 14  ? 86.825  68.342 -93.286  1.00 43.05  ? 14   GLU B O     1 
ATOM   2969 C  CB    . GLU F 3 14  ? 88.297  65.238 -93.604  1.00 41.61  ? 14   GLU B CB    1 
ATOM   2970 C  CG    . GLU F 3 14  ? 88.870  64.352 -92.529  1.00 41.25  ? 14   GLU B CG    1 
ATOM   2971 C  CD    . GLU F 3 14  ? 89.697  63.189 -93.063  1.00 44.56  ? 14   GLU B CD    1 
ATOM   2972 O  OE1   . GLU F 3 14  ? 89.159  62.382 -93.847  1.00 47.68  ? 14   GLU B OE1   1 
ATOM   2973 O  OE2   . GLU F 3 14  ? 90.881  63.067 -92.678  1.00 44.59  ? 14   GLU B OE2   1 
ATOM   2974 N  N     . ALA F 3 15  ? 86.941  67.247 -95.245  1.00 46.03  ? 15   ALA B N     1 
ATOM   2975 C  CA    . ALA F 3 15  ? 86.861  68.445 -96.076  1.00 44.82  ? 15   ALA B CA    1 
ATOM   2976 C  C     . ALA F 3 15  ? 85.802  69.384 -95.537  1.00 46.53  ? 15   ALA B C     1 
ATOM   2977 O  O     . ALA F 3 15  ? 85.907  70.612 -95.647  1.00 47.68  ? 15   ALA B O     1 
ATOM   2978 C  CB    . ALA F 3 15  ? 86.515  68.056 -97.496  1.00 15.32  ? 15   ALA B CB    1 
ATOM   2979 N  N     . ALA F 3 16  ? 84.780  68.793 -94.940  1.00 64.35  ? 16   ALA B N     1 
ATOM   2980 C  CA    . ALA F 3 16  ? 83.693  69.569 -94.396  1.00 66.28  ? 16   ALA B CA    1 
ATOM   2981 C  C     . ALA F 3 16  ? 83.928  70.082 -92.975  1.00 68.32  ? 16   ALA B C     1 
ATOM   2982 O  O     . ALA F 3 16  ? 83.411  71.141 -92.620  1.00 70.18  ? 16   ALA B O     1 
ATOM   2983 C  CB    . ALA F 3 16  ? 82.416  68.754 -94.459  1.00 26.36  ? 16   ALA B CB    1 
ATOM   2984 N  N     . ILE F 3 17  ? 84.706  69.368 -92.161  1.00 42.26  ? 17   ILE B N     1 
ATOM   2985 C  CA    . ILE F 3 17  ? 84.907  69.830 -90.787  1.00 42.59  ? 17   ILE B CA    1 
ATOM   2986 C  C     . ILE F 3 17  ? 86.268  69.671 -90.097  1.00 42.31  ? 17   ILE B C     1 
ATOM   2987 O  O     . ILE F 3 17  ? 86.406  70.017 -88.924  1.00 42.08  ? 17   ILE B O     1 
ATOM   2988 C  CB    . ILE F 3 17  ? 83.868  69.209 -89.861  1.00 43.96  ? 17   ILE B CB    1 
ATOM   2989 C  CG1   . ILE F 3 17  ? 84.021  67.692 -89.877  1.00 42.49  ? 17   ILE B CG1   1 
ATOM   2990 C  CG2   . ILE F 3 17  ? 82.461  69.644 -90.290  1.00 46.07  ? 17   ILE B CG2   1 
ATOM   2991 C  CD1   . ILE F 3 17  ? 83.250  67.007 -88.787  1.00 42.16  ? 17   ILE B CD1   1 
ATOM   2992 N  N     . LYS F 3 18  ? 87.273  69.158 -90.796  1.00 44.45  ? 18   LYS B N     1 
ATOM   2993 C  CA    . LYS F 3 18  ? 88.571  69.013 -90.164  1.00 44.07  ? 18   LYS B CA    1 
ATOM   2994 C  C     . LYS F 3 18  ? 89.025  70.366 -89.628  1.00 44.17  ? 18   LYS B C     1 
ATOM   2995 O  O     . LYS F 3 18  ? 88.862  71.390 -90.287  1.00 46.02  ? 18   LYS B O     1 
ATOM   2996 C  CB    . LYS F 3 18  ? 89.605  68.489 -91.156  1.00 34.40  ? 18   LYS B CB    1 
ATOM   2997 C  CG    . LYS F 3 18  ? 90.957  68.165 -90.530  1.00 33.88  ? 18   LYS B CG    1 
ATOM   2998 C  CD    . LYS F 3 18  ? 91.981  67.778 -91.590  1.00 37.09  ? 18   LYS B CD    1 
ATOM   2999 C  CE    . LYS F 3 18  ? 93.298  67.281 -90.983  1.00 36.18  ? 18   LYS B CE    1 
ATOM   3000 N  NZ    . LYS F 3 18  ? 93.911  68.298 -90.092  1.00 36.49  ? 18   LYS B NZ    1 
ATOM   3001 N  N     . GLY F 3 19  ? 89.570  70.363 -88.416  1.00 50.94  ? 19   GLY B N     1 
ATOM   3002 C  CA    . GLY F 3 19  ? 90.075  71.582 -87.810  1.00 50.04  ? 19   GLY B CA    1 
ATOM   3003 C  C     . GLY F 3 19  ? 89.106  72.706 -87.484  1.00 50.90  ? 19   GLY B C     1 
ATOM   3004 O  O     . GLY F 3 19  ? 89.532  73.752 -86.984  1.00 52.02  ? 19   GLY B O     1 
ATOM   3005 N  N     . LYS F 3 20  ? 87.817  72.515 -87.752  1.00 40.12  ? 20   LYS B N     1 
ATOM   3006 C  CA    . LYS F 3 20  ? 86.839  73.555 -87.460  1.00 37.53  ? 20   LYS B CA    1 
ATOM   3007 C  C     . LYS F 3 20  ? 86.170  73.332 -86.115  1.00 36.40  ? 20   LYS B C     1 
ATOM   3008 O  O     . LYS F 3 20  ? 85.661  72.254 -85.836  1.00 37.05  ? 20   LYS B O     1 
ATOM   3009 C  CB    . LYS F 3 20  ? 85.773  73.610 -88.555  1.00 33.37  ? 20   LYS B CB    1 
ATOM   3010 C  CG    . LYS F 3 20  ? 86.324  73.872 -89.932  1.00 31.91  ? 20   LYS B CG    1 
ATOM   3011 C  CD    . LYS F 3 20  ? 85.219  73.791 -90.972  1.00 32.81  ? 20   LYS B CD    1 
ATOM   3012 C  CE    . LYS F 3 20  ? 85.677  74.321 -92.323  1.00 28.82  ? 20   LYS B CE    1 
ATOM   3013 N  NZ    . LYS F 3 20  ? 84.704  73.988 -93.380  1.00 27.38  ? 20   LYS B NZ    1 
ATOM   3014 N  N     . PRO F 3 21  ? 86.174  74.354 -85.256  1.00 29.77  ? 21   PRO B N     1 
ATOM   3015 C  CA    . PRO F 3 21  ? 85.548  74.238 -83.933  1.00 29.54  ? 21   PRO B CA    1 
ATOM   3016 C  C     . PRO F 3 21  ? 84.068  73.896 -84.087  1.00 29.73  ? 21   PRO B C     1 
ATOM   3017 O  O     . PRO F 3 21  ? 83.329  74.599 -84.787  1.00 28.27  ? 21   PRO B O     1 
ATOM   3018 C  CB    . PRO F 3 21  ? 85.725  75.635 -83.326  1.00 38.66  ? 21   PRO B CB    1 
ATOM   3019 C  CG    . PRO F 3 21  ? 86.906  76.213 -84.089  1.00 37.48  ? 21   PRO B CG    1 
ATOM   3020 C  CD    . PRO F 3 21  ? 86.696  75.713 -85.487  1.00 37.10  ? 21   PRO B CD    1 
ATOM   3021 N  N     . LEU F 3 22  ? 83.627  72.827 -83.432  1.00 44.75  ? 22   LEU B N     1 
ATOM   3022 C  CA    . LEU F 3 22  ? 82.229  72.442 -83.526  1.00 43.87  ? 22   LEU B CA    1 
ATOM   3023 C  C     . LEU F 3 22  ? 81.345  73.455 -82.804  1.00 44.53  ? 22   LEU B C     1 
ATOM   3024 O  O     . LEU F 3 22  ? 81.602  73.801 -81.658  1.00 44.40  ? 22   LEU B O     1 
ATOM   3025 C  CB    . LEU F 3 22  ? 82.049  71.037 -82.958  1.00 21.41  ? 22   LEU B CB    1 
ATOM   3026 C  CG    . LEU F 3 22  ? 82.491  69.936 -83.944  1.00 20.91  ? 22   LEU B CG    1 
ATOM   3027 C  CD1   . LEU F 3 22  ? 82.899  68.664 -83.183  1.00 19.04  ? 22   LEU B CD1   1 
ATOM   3028 C  CD2   . LEU F 3 22  ? 81.364  69.656 -84.940  1.00 16.47  ? 22   LEU B CD2   1 
ATOM   3029 N  N     . THR F 3 23  ? 80.318  73.953 -83.489  1.00 44.04  ? 23   THR B N     1 
ATOM   3030 C  CA    . THR F 3 23  ? 79.423  74.929 -82.871  1.00 45.11  ? 23   THR B CA    1 
ATOM   3031 C  C     . THR F 3 23  ? 78.290  74.217 -82.156  1.00 45.63  ? 23   THR B C     1 
ATOM   3032 O  O     . THR F 3 23  ? 77.629  74.787 -81.285  1.00 45.09  ? 23   THR B O     1 
ATOM   3033 C  CB    . THR F 3 23  ? 78.842  75.931 -83.901  1.00 39.90  ? 23   THR B CB    1 
ATOM   3034 O  OG1   . THR F 3 23  ? 78.011  75.239 -84.843  1.00 38.17  ? 23   THR B OG1   1 
ATOM   3035 C  CG2   . THR F 3 23  ? 79.973  76.639 -84.644  1.00 41.42  ? 23   THR B CG2   1 
ATOM   3036 N  N     . ASP F 3 24  ? 78.049  72.973 -82.544  1.00 29.89  ? 24   ASP B N     1 
ATOM   3037 C  CA    . ASP F 3 24  ? 77.032  72.184 -81.877  1.00 31.74  ? 24   ASP B CA    1 
ATOM   3038 C  C     . ASP F 3 24  ? 77.278  70.683 -81.994  1.00 29.93  ? 24   ASP B C     1 
ATOM   3039 O  O     . ASP F 3 24  ? 77.570  70.169 -83.067  1.00 30.44  ? 24   ASP B O     1 
ATOM   3040 C  CB    . ASP F 3 24  ? 75.628  72.533 -82.390  1.00 55.82  ? 24   ASP B CB    1 
ATOM   3041 C  CG    . ASP F 3 24  ? 74.530  71.989 -81.477  1.00 58.82  ? 24   ASP B CG    1 
ATOM   3042 O  OD1   . ASP F 3 24  ? 74.748  71.958 -80.245  1.00 56.35  ? 24   ASP B OD1   1 
ATOM   3043 O  OD2   . ASP F 3 24  ? 73.448  71.606 -81.978  1.00 59.72  ? 24   ASP B OD2   1 
ATOM   3044 N  N     . VAL F 3 25  ? 77.190  69.987 -80.872  1.00 29.60  ? 25   VAL B N     1 
ATOM   3045 C  CA    . VAL F 3 25  ? 77.373  68.551 -80.885  1.00 28.55  ? 25   VAL B CA    1 
ATOM   3046 C  C     . VAL F 3 25  ? 76.087  67.924 -80.415  1.00 27.94  ? 25   VAL B C     1 
ATOM   3047 O  O     . VAL F 3 25  ? 75.619  68.203 -79.315  1.00 27.37  ? 25   VAL B O     1 
ATOM   3048 C  CB    . VAL F 3 25  ? 78.487  68.084 -79.967  1.00 31.03  ? 25   VAL B CB    1 
ATOM   3049 C  CG1   . VAL F 3 25  ? 78.586  66.591 -80.043  1.00 28.37  ? 25   VAL B CG1   1 
ATOM   3050 C  CG2   . VAL F 3 25  ? 79.792  68.730 -80.362  1.00 29.18  ? 25   VAL B CG2   1 
ATOM   3051 N  N     . TRP F 3 26  ? 75.503  67.085 -81.261  1.00 27.37  ? 26   TRP B N     1 
ATOM   3052 C  CA    . TRP F 3 26  ? 74.259  66.453 -80.892  1.00 27.15  ? 26   TRP B CA    1 
ATOM   3053 C  C     . TRP F 3 26  ? 74.225  64.960 -81.105  1.00 27.85  ? 26   TRP B C     1 
ATOM   3054 O  O     . TRP F 3 26  ? 74.681  64.465 -82.124  1.00 28.73  ? 26   TRP B O     1 
ATOM   3055 C  CB    . TRP F 3 26  ? 73.090  67.086 -81.641  1.00 27.95  ? 26   TRP B CB    1 
ATOM   3056 C  CG    . TRP F 3 26  ? 71.807  66.540 -81.149  1.00 27.86  ? 26   TRP B CG    1 
ATOM   3057 C  CD1   . TRP F 3 26  ? 71.165  66.888 -79.998  1.00 26.75  ? 26   TRP B CD1   1 
ATOM   3058 C  CD2   . TRP F 3 26  ? 71.051  65.467 -81.724  1.00 28.45  ? 26   TRP B CD2   1 
ATOM   3059 N  NE1   . TRP F 3 26  ? 70.065  66.099 -79.817  1.00 28.14  ? 26   TRP B NE1   1 
ATOM   3060 C  CE2   . TRP F 3 26  ? 69.966  65.216 -80.859  1.00 28.15  ? 26   TRP B CE2   1 
ATOM   3061 C  CE3   . TRP F 3 26  ? 71.187  64.690 -82.887  1.00 28.08  ? 26   TRP B CE3   1 
ATOM   3062 C  CZ2   . TRP F 3 26  ? 69.010  64.219 -81.114  1.00 29.08  ? 26   TRP B CZ2   1 
ATOM   3063 C  CZ3   . TRP F 3 26  ? 70.233  63.693 -83.144  1.00 28.47  ? 26   TRP B CZ3   1 
ATOM   3064 C  CH2   . TRP F 3 26  ? 69.160  63.472 -82.258  1.00 30.29  ? 26   TRP B CH2   1 
ATOM   3065 N  N     . PHE F 3 27  ? 73.680  64.259 -80.117  1.00 39.42  ? 27   PHE B N     1 
ATOM   3066 C  CA    . PHE F 3 27  ? 73.517  62.814 -80.155  1.00 42.43  ? 27   PHE B CA    1 
ATOM   3067 C  C     . PHE F 3 27  ? 72.065  62.502 -79.829  1.00 44.21  ? 27   PHE B C     1 
ATOM   3068 O  O     . PHE F 3 27  ? 71.422  63.237 -79.088  1.00 44.65  ? 27   PHE B O     1 
ATOM   3069 C  CB    . PHE F 3 27  ? 74.408  62.127 -79.117  1.00 49.98  ? 27   PHE B CB    1 
ATOM   3070 C  CG    . PHE F 3 27  ? 75.841  62.031 -79.521  1.00 51.10  ? 27   PHE B CG    1 
ATOM   3071 C  CD1   . PHE F 3 27  ? 76.194  61.443 -80.730  1.00 52.03  ? 27   PHE B CD1   1 
ATOM   3072 C  CD2   . PHE F 3 27  ? 76.846  62.499 -78.684  1.00 50.45  ? 27   PHE B CD2   1 
ATOM   3073 C  CE1   . PHE F 3 27  ? 77.522  61.320 -81.093  1.00 51.32  ? 27   PHE B CE1   1 
ATOM   3074 C  CE2   . PHE F 3 27  ? 78.179  62.379 -79.041  1.00 51.35  ? 27   PHE B CE2   1 
ATOM   3075 C  CZ    . PHE F 3 27  ? 78.520  61.789 -80.246  1.00 51.90  ? 27   PHE B CZ    1 
ATOM   3076 N  N     . ALA F 3 28  ? 71.546  61.414 -80.381  1.00 52.10  ? 28   ALA B N     1 
ATOM   3077 C  CA    . ALA F 3 28  ? 70.175  61.029 -80.099  1.00 52.56  ? 28   ALA B CA    1 
ATOM   3078 C  C     . ALA F 3 28  ? 70.157  60.046 -78.927  1.00 52.97  ? 28   ALA B C     1 
ATOM   3079 O  O     . ALA F 3 28  ? 69.272  60.118 -78.076  1.00 54.04  ? 28   ALA B O     1 
ATOM   3080 C  CB    . ALA F 3 28  ? 69.536  60.406 -81.330  1.00 33.95  ? 28   ALA B CB    1 
ATOM   3081 N  N     . PHE F 3 29  ? 71.136  59.141 -78.877  1.00 55.82  ? 29   PHE B N     1 
ATOM   3082 C  CA    . PHE F 3 29  ? 71.213  58.155 -77.789  1.00 56.35  ? 29   PHE B CA    1 
ATOM   3083 C  C     . PHE F 3 29  ? 71.227  58.828 -76.433  1.00 56.09  ? 29   PHE B C     1 
ATOM   3084 O  O     . PHE F 3 29  ? 71.591  59.993 -76.311  1.00 59.27  ? 29   PHE B O     1 
ATOM   3085 C  CB    . PHE F 3 29  ? 72.473  57.282 -77.896  1.00 32.24  ? 29   PHE B CB    1 
ATOM   3086 C  CG    . PHE F 3 29  ? 72.426  56.270 -78.999  1.00 30.97  ? 29   PHE B CG    1 
ATOM   3087 C  CD1   . PHE F 3 29  ? 71.342  56.221 -79.880  1.00 29.05  ? 29   PHE B CD1   1 
ATOM   3088 C  CD2   . PHE F 3 29  ? 73.492  55.380 -79.180  1.00 29.26  ? 29   PHE B CD2   1 
ATOM   3089 C  CE1   . PHE F 3 29  ? 71.320  55.307 -80.925  1.00 27.20  ? 29   PHE B CE1   1 
ATOM   3090 C  CE2   . PHE F 3 29  ? 73.489  54.453 -80.223  1.00 30.78  ? 29   PHE B CE2   1 
ATOM   3091 C  CZ    . PHE F 3 29  ? 72.409  54.411 -81.098  1.00 28.75  ? 29   PHE B CZ    1 
ATOM   3092 N  N     . PRO F 3 30  ? 70.822  58.097 -75.389  1.00 46.71  ? 30   PRO B N     1 
ATOM   3093 C  CA    . PRO F 3 30  ? 70.810  58.676 -74.044  1.00 46.19  ? 30   PRO B CA    1 
ATOM   3094 C  C     . PRO F 3 30  ? 72.159  58.574 -73.319  1.00 45.68  ? 30   PRO B C     1 
ATOM   3095 O  O     . PRO F 3 30  ? 72.518  59.457 -72.546  1.00 45.13  ? 30   PRO B O     1 
ATOM   3096 C  CB    . PRO F 3 30  ? 69.709  57.883 -73.350  1.00 50.00  ? 30   PRO B CB    1 
ATOM   3097 C  CG    . PRO F 3 30  ? 69.869  56.528 -73.949  1.00 48.97  ? 30   PRO B CG    1 
ATOM   3098 C  CD    . PRO F 3 30  ? 70.064  56.833 -75.421  1.00 50.62  ? 30   PRO B CD    1 
ATOM   3099 N  N     . GLN F 3 31  ? 72.908  57.511 -73.601  1.00 38.31  ? 31   GLN B N     1 
ATOM   3100 C  CA    . GLN F 3 31  ? 74.200  57.266 -72.952  1.00 38.86  ? 31   GLN B CA    1 
ATOM   3101 C  C     . GLN F 3 31  ? 75.389  58.007 -73.556  1.00 38.99  ? 31   GLN B C     1 
ATOM   3102 O  O     . GLN F 3 31  ? 76.545  57.715 -73.218  1.00 38.43  ? 31   GLN B O     1 
ATOM   3103 C  CB    . GLN F 3 31  ? 74.507  55.768 -72.960  1.00 50.23  ? 31   GLN B CB    1 
ATOM   3104 C  CG    . GLN F 3 31  ? 74.871  55.227 -74.333  1.00 50.82  ? 31   GLN B CG    1 
ATOM   3105 C  CD    . GLN F 3 31  ? 73.690  55.163 -75.272  1.00 52.25  ? 31   GLN B CD    1 
ATOM   3106 O  OE1   . GLN F 3 31  ? 72.699  55.875 -75.100  1.00 52.97  ? 31   GLN B OE1   1 
ATOM   3107 N  NE2   . GLN F 3 31  ? 73.792  54.314 -76.284  1.00 52.04  ? 31   GLN B NE2   1 
ATOM   3108 N  N     . LEU F 3 32  ? 75.118  58.961 -74.445  1.00 43.26  ? 32   LEU B N     1 
ATOM   3109 C  CA    . LEU F 3 32  ? 76.192  59.708 -75.079  1.00 41.44  ? 32   LEU B CA    1 
ATOM   3110 C  C     . LEU F 3 32  ? 75.984  61.211 -75.048  1.00 42.21  ? 32   LEU B C     1 
ATOM   3111 O  O     . LEU F 3 32  ? 76.849  61.966 -75.485  1.00 44.36  ? 32   LEU B O     1 
ATOM   3112 C  CB    . LEU F 3 32  ? 76.346  59.257 -76.529  1.00 31.71  ? 32   LEU B CB    1 
ATOM   3113 C  CG    . LEU F 3 32  ? 76.621  57.789 -76.829  1.00 29.42  ? 32   LEU B CG    1 
ATOM   3114 C  CD1   . LEU F 3 32  ? 76.313  57.513 -78.289  1.00 31.72  ? 32   LEU B CD1   1 
ATOM   3115 C  CD2   . LEU F 3 32  ? 78.044  57.455 -76.511  1.00 28.06  ? 32   LEU B CD2   1 
ATOM   3116 N  N     . LYS F 3 33  ? 74.840  61.651 -74.538  1.00 44.59  ? 33   LYS B N     1 
ATOM   3117 C  CA    . LYS F 3 33  ? 74.545  63.079 -74.485  1.00 43.80  ? 33   LYS B CA    1 
ATOM   3118 C  C     . LYS F 3 33  ? 75.440  63.868 -73.531  1.00 43.46  ? 33   LYS B C     1 
ATOM   3119 O  O     . LYS F 3 33  ? 75.560  65.077 -73.659  1.00 45.90  ? 33   LYS B O     1 
ATOM   3120 C  CB    . LYS F 3 33  ? 73.073  63.290 -74.146  1.00 42.34  ? 33   LYS B CB    1 
ATOM   3121 C  CG    . LYS F 3 33  ? 72.157  62.775 -75.229  1.00 42.47  ? 33   LYS B CG    1 
ATOM   3122 C  CD    . LYS F 3 33  ? 70.707  63.054 -74.926  1.00 44.19  ? 33   LYS B CD    1 
ATOM   3123 C  CE    . LYS F 3 33  ? 69.877  63.037 -76.202  1.00 43.76  ? 33   LYS B CE    1 
ATOM   3124 N  NZ    . LYS F 3 33  ? 70.273  64.140 -77.129  1.00 41.63  ? 33   LYS B NZ    1 
ATOM   3125 N  N     . THR F 3 34  ? 76.075  63.185 -72.586  1.00 31.54  ? 34   THR B N     1 
ATOM   3126 C  CA    . THR F 3 34  ? 76.976  63.850 -71.655  1.00 32.36  ? 34   THR B CA    1 
ATOM   3127 C  C     . THR F 3 34  ? 78.186  64.379 -72.437  1.00 35.75  ? 34   THR B C     1 
ATOM   3128 O  O     . THR F 3 34  ? 78.913  65.251 -71.971  1.00 37.17  ? 34   THR B O     1 
ATOM   3129 C  CB    . THR F 3 34  ? 77.464  62.875 -70.538  1.00 40.71  ? 34   THR B CB    1 
ATOM   3130 O  OG1   . THR F 3 34  ? 78.461  63.516 -69.739  1.00 40.20  ? 34   THR B OG1   1 
ATOM   3131 C  CG2   . THR F 3 34  ? 78.063  61.618 -71.134  1.00 40.82  ? 34   THR B CG2   1 
ATOM   3132 N  N     . TYR F 3 35  ? 78.397  63.855 -73.639  1.00 50.10  ? 35   TYR B N     1 
ATOM   3133 C  CA    . TYR F 3 35  ? 79.512  64.300 -74.464  1.00 49.75  ? 35   TYR B CA    1 
ATOM   3134 C  C     . TYR F 3 35  ? 79.181  65.509 -75.349  1.00 49.91  ? 35   TYR B C     1 
ATOM   3135 O  O     . TYR F 3 35  ? 80.018  65.960 -76.133  1.00 48.69  ? 35   TYR B O     1 
ATOM   3136 C  CB    . TYR F 3 35  ? 79.995  63.146 -75.338  1.00 43.56  ? 35   TYR B CB    1 
ATOM   3137 C  CG    . TYR F 3 35  ? 80.509  61.982 -74.540  1.00 43.65  ? 35   TYR B CG    1 
ATOM   3138 C  CD1   . TYR F 3 35  ? 81.725  62.066 -73.852  1.00 41.53  ? 35   TYR B CD1   1 
ATOM   3139 C  CD2   . TYR F 3 35  ? 79.776  60.806 -74.448  1.00 43.50  ? 35   TYR B CD2   1 
ATOM   3140 C  CE1   . TYR F 3 35  ? 82.196  61.007 -73.097  1.00 41.49  ? 35   TYR B CE1   1 
ATOM   3141 C  CE2   . TYR F 3 35  ? 80.233  59.748 -73.700  1.00 40.28  ? 35   TYR B CE2   1 
ATOM   3142 C  CZ    . TYR F 3 35  ? 81.447  59.847 -73.025  1.00 41.99  ? 35   TYR B CZ    1 
ATOM   3143 O  OH    . TYR F 3 35  ? 81.912  58.776 -72.296  1.00 41.70  ? 35   TYR B OH    1 
ATOM   3144 N  N     . GLN F 3 36  ? 77.972  66.043 -75.221  1.00 40.91  ? 36   GLN B N     1 
ATOM   3145 C  CA    . GLN F 3 36  ? 77.588  67.182 -76.041  1.00 40.12  ? 36   GLN B CA    1 
ATOM   3146 C  C     . GLN F 3 36  ? 78.377  68.461 -75.707  1.00 38.74  ? 36   GLN B C     1 
ATOM   3147 O  O     . GLN F 3 36  ? 79.019  69.050 -76.580  1.00 38.10  ? 36   GLN B O     1 
ATOM   3148 C  CB    . GLN F 3 36  ? 76.075  67.418 -75.926  1.00 48.25  ? 36   GLN B CB    1 
ATOM   3149 C  CG    . GLN F 3 36  ? 75.245  66.191 -76.293  1.00 48.84  ? 36   GLN B CG    1 
ATOM   3150 C  CD    . GLN F 3 36  ? 73.915  66.538 -76.950  1.00 50.74  ? 36   GLN B CD    1 
ATOM   3151 O  OE1   . GLN F 3 36  ? 73.043  65.683 -77.103  1.00 49.69  ? 36   GLN B OE1   1 
ATOM   3152 N  NE2   . GLN F 3 36  ? 73.763  67.792 -77.355  1.00 51.04  ? 36   GLN B NE2   1 
ATOM   3153 N  N     . SER F 3 37  ? 78.331  68.891 -74.452  1.00 32.21  ? 37   SER B N     1 
ATOM   3154 C  CA    . SER F 3 37  ? 79.067  70.084 -74.048  1.00 31.13  ? 37   SER B CA    1 
ATOM   3155 C  C     . SER F 3 37  ? 80.598  69.896 -74.074  1.00 29.78  ? 37   SER B C     1 
ATOM   3156 O  O     . SER F 3 37  ? 81.328  70.810 -74.442  1.00 28.84  ? 37   SER B O     1 
ATOM   3157 C  CB    . SER F 3 37  ? 78.597  70.562 -72.659  1.00 55.01  ? 37   SER B CB    1 
ATOM   3158 O  OG    . SER F 3 37  ? 78.592  69.515 -71.702  1.00 57.82  ? 37   SER B OG    1 
ATOM   3159 N  N     . GLN F 3 38  ? 81.082  68.719 -73.702  1.00 29.10  ? 38   GLN B N     1 
ATOM   3160 C  CA    . GLN F 3 38  ? 82.520  68.442 -73.710  1.00 30.42  ? 38   GLN B CA    1 
ATOM   3161 C  C     . GLN F 3 38  ? 83.253  68.599 -75.068  1.00 31.48  ? 38   GLN B C     1 
ATOM   3162 O  O     . GLN F 3 38  ? 84.486  68.701 -75.100  1.00 33.60  ? 38   GLN B O     1 
ATOM   3163 C  CB    . GLN F 3 38  ? 82.764  67.034 -73.158  1.00 35.36  ? 38   GLN B CB    1 
ATOM   3164 C  CG    . GLN F 3 38  ? 84.233  66.616 -73.039  1.00 33.58  ? 38   GLN B CG    1 
ATOM   3165 C  CD    . GLN F 3 38  ? 84.371  65.235 -72.424  1.00 33.72  ? 38   GLN B CD    1 
ATOM   3166 O  OE1   . GLN F 3 38  ? 83.368  64.559 -72.191  1.00 30.99  ? 38   GLN B OE1   1 
ATOM   3167 N  NE2   . GLN F 3 38  ? 85.609  64.806 -72.162  1.00 29.61  ? 38   GLN B NE2   1 
ATOM   3168 N  N     . LEU F 3 39  ? 82.509  68.627 -76.175  1.00 37.73  ? 39   LEU B N     1 
ATOM   3169 C  CA    . LEU F 3 39  ? 83.102  68.766 -77.511  1.00 36.53  ? 39   LEU B CA    1 
ATOM   3170 C  C     . LEU F 3 39  ? 82.902  70.136 -78.185  1.00 36.01  ? 39   LEU B C     1 
ATOM   3171 O  O     . LEU F 3 39  ? 83.636  70.476 -79.114  1.00 34.58  ? 39   LEU B O     1 
ATOM   3172 C  CB    . LEU F 3 39  ? 82.583  67.660 -78.443  1.00 42.63  ? 39   LEU B CB    1 
ATOM   3173 C  CG    . LEU F 3 39  ? 83.086  66.228 -78.196  1.00 44.36  ? 39   LEU B CG    1 
ATOM   3174 C  CD1   . LEU F 3 39  ? 82.344  65.243 -79.090  1.00 43.04  ? 39   LEU B CD1   1 
ATOM   3175 C  CD2   . LEU F 3 39  ? 84.587  66.153 -78.448  1.00 44.37  ? 39   LEU B CD2   1 
ATOM   3176 N  N     . ILE F 3 40  ? 81.913  70.914 -77.739  1.00 32.69  ? 40   ILE B N     1 
ATOM   3177 C  CA    . ILE F 3 40  ? 81.687  72.241 -78.322  1.00 31.29  ? 40   ILE B CA    1 
ATOM   3178 C  C     . ILE F 3 40  ? 82.940  73.061 -78.061  1.00 30.75  ? 40   ILE B C     1 
ATOM   3179 O  O     . ILE F 3 40  ? 83.254  73.365 -76.918  1.00 30.50  ? 40   ILE B O     1 
ATOM   3180 C  CB    . ILE F 3 40  ? 80.457  72.965 -77.683  1.00 36.59  ? 40   ILE B CB    1 
ATOM   3181 C  CG1   . ILE F 3 40  ? 79.161  72.289 -78.144  1.00 37.22  ? 40   ILE B CG1   1 
ATOM   3182 C  CG2   . ILE F 3 40  ? 80.451  74.456 -78.060  1.00 35.99  ? 40   ILE B CG2   1 
ATOM   3183 C  CD1   . ILE F 3 40  ? 77.884  72.972 -77.663  1.00 37.25  ? 40   ILE B CD1   1 
ATOM   3184 N  N     . GLY F 3 41  ? 83.653  73.418 -79.120  1.00 36.57  ? 41   GLY B N     1 
ATOM   3185 C  CA    . GLY F 3 41  ? 84.879  74.178 -78.962  1.00 38.01  ? 41   GLY B CA    1 
ATOM   3186 C  C     . GLY F 3 41  ? 86.059  73.320 -79.375  1.00 38.51  ? 41   GLY B C     1 
ATOM   3187 O  O     . GLY F 3 41  ? 87.142  73.812 -79.683  1.00 39.24  ? 41   GLY B O     1 
ATOM   3188 N  N     . GLN F 3 42  ? 85.855  72.013 -79.361  1.00 42.06  ? 42   GLN B N     1 
ATOM   3189 C  CA    . GLN F 3 42  ? 86.895  71.101 -79.773  1.00 40.53  ? 42   GLN B CA    1 
ATOM   3190 C  C     . GLN F 3 42  ? 86.671  71.005 -81.280  1.00 41.68  ? 42   GLN B C     1 
ATOM   3191 O  O     . GLN F 3 42  ? 85.783  71.666 -81.820  1.00 40.63  ? 42   GLN B O     1 
ATOM   3192 C  CB    . GLN F 3 42  ? 86.715  69.730 -79.098  1.00 27.93  ? 42   GLN B CB    1 
ATOM   3193 C  CG    . GLN F 3 42  ? 86.812  69.735 -77.559  1.00 26.73  ? 42   GLN B CG    1 
ATOM   3194 C  CD    . GLN F 3 42  ? 88.196  70.119 -77.024  1.00 28.94  ? 42   GLN B CD    1 
ATOM   3195 O  OE1   . GLN F 3 42  ? 89.209  69.498 -77.361  1.00 25.57  ? 42   GLN B OE1   1 
ATOM   3196 N  NE2   . GLN F 3 42  ? 88.238  71.154 -76.172  1.00 30.92  ? 42   GLN B NE2   1 
ATOM   3197 N  N     . HIS F 3 43  ? 87.468  70.192 -81.957  1.00 35.24  ? 43   HIS B N     1 
ATOM   3198 C  CA    . HIS F 3 43  ? 87.337  70.034 -83.395  1.00 35.87  ? 43   HIS B CA    1 
ATOM   3199 C  C     . HIS F 3 43  ? 87.826  68.653 -83.820  1.00 34.73  ? 43   HIS B C     1 
ATOM   3200 O  O     . HIS F 3 43  ? 88.526  67.963 -83.069  1.00 30.99  ? 43   HIS B O     1 
ATOM   3201 C  CB    . HIS F 3 43  ? 88.144  71.126 -84.112  1.00 34.93  ? 43   HIS B CB    1 
ATOM   3202 C  CG    . HIS F 3 43  ? 89.585  71.176 -83.706  1.00 37.88  ? 43   HIS B CG    1 
ATOM   3203 N  ND1   . HIS F 3 43  ? 90.537  70.322 -84.221  1.00 38.09  ? 43   HIS B ND1   1 
ATOM   3204 C  CD2   . HIS F 3 43  ? 90.225  71.940 -82.788  1.00 38.21  ? 43   HIS B CD2   1 
ATOM   3205 C  CE1   . HIS F 3 43  ? 91.701  70.556 -83.639  1.00 37.17  ? 43   HIS B CE1   1 
ATOM   3206 N  NE2   . HIS F 3 43  ? 91.538  71.534 -82.764  1.00 37.97  ? 43   HIS B NE2   1 
ATOM   3207 N  N     . VAL F 3 44  ? 87.453  68.253 -85.028  1.00 41.25  ? 44   VAL B N     1 
ATOM   3208 C  CA    . VAL F 3 44  ? 87.881  66.962 -85.546  1.00 41.47  ? 44   VAL B CA    1 
ATOM   3209 C  C     . VAL F 3 44  ? 89.327  67.025 -85.997  1.00 42.00  ? 44   VAL B C     1 
ATOM   3210 O  O     . VAL F 3 44  ? 89.716  67.908 -86.769  1.00 40.77  ? 44   VAL B O     1 
ATOM   3211 C  CB    . VAL F 3 44  ? 87.037  66.519 -86.728  1.00 25.05  ? 44   VAL B CB    1 
ATOM   3212 C  CG1   . VAL F 3 44  ? 87.627  65.264 -87.326  1.00 23.77  ? 44   VAL B CG1   1 
ATOM   3213 C  CG2   . VAL F 3 44  ? 85.595  66.291 -86.269  1.00 23.11  ? 44   VAL B CG2   1 
ATOM   3214 N  N     . THR F 3 45  ? 90.121  66.079 -85.507  1.00 40.37  ? 45   THR B N     1 
ATOM   3215 C  CA    . THR F 3 45  ? 91.533  66.029 -85.844  1.00 40.63  ? 45   THR B CA    1 
ATOM   3216 C  C     . THR F 3 45  ? 91.672  65.481 -87.249  1.00 40.28  ? 45   THR B C     1 
ATOM   3217 O  O     . THR F 3 45  ? 92.379  66.030 -88.080  1.00 41.05  ? 45   THR B O     1 
ATOM   3218 C  CB    . THR F 3 45  ? 92.307  65.144 -84.837  1.00 38.45  ? 45   THR B CB    1 
ATOM   3219 O  OG1   . THR F 3 45  ? 91.921  63.776 -84.984  1.00 40.74  ? 45   THR B OG1   1 
ATOM   3220 C  CG2   . THR F 3 45  ? 91.997  65.580 -83.417  1.00 40.16  ? 45   THR B CG2   1 
ATOM   3221 N  N     . HIS F 3 46  ? 90.964  64.396 -87.511  1.00 40.75  ? 46   HIS B N     1 
ATOM   3222 C  CA    . HIS F 3 46  ? 90.974  63.752 -88.811  1.00 41.12  ? 46   HIS B CA    1 
ATOM   3223 C  C     . HIS F 3 46  ? 89.984  62.607 -88.650  1.00 40.49  ? 46   HIS B C     1 
ATOM   3224 O  O     . HIS F 3 46  ? 89.792  62.130 -87.529  1.00 40.55  ? 46   HIS B O     1 
ATOM   3225 C  CB    . HIS F 3 46  ? 92.368  63.183 -89.095  1.00 40.29  ? 46   HIS B CB    1 
ATOM   3226 C  CG    . HIS F 3 46  ? 92.779  62.107 -88.132  1.00 39.68  ? 46   HIS B CG    1 
ATOM   3227 N  ND1   . HIS F 3 46  ? 93.093  62.365 -86.812  1.00 38.70  ? 46   HIS B ND1   1 
ATOM   3228 C  CD2   . HIS F 3 46  ? 92.852  60.765 -88.280  1.00 39.01  ? 46   HIS B CD2   1 
ATOM   3229 C  CE1   . HIS F 3 46  ? 93.338  61.228 -86.189  1.00 38.56  ? 46   HIS B CE1   1 
ATOM   3230 N  NE2   . HIS F 3 46  ? 93.197  60.242 -87.056  1.00 40.40  ? 46   HIS B NE2   1 
ATOM   3231 N  N     . VAL F 3 47  ? 89.341  62.180 -89.737  1.00 29.64  ? 47   VAL B N     1 
ATOM   3232 C  CA    . VAL F 3 47  ? 88.422  61.046 -89.646  1.00 29.38  ? 47   VAL B CA    1 
ATOM   3233 C  C     . VAL F 3 47  ? 89.177  59.795 -90.071  1.00 30.27  ? 47   VAL B C     1 
ATOM   3234 O  O     . VAL F 3 47  ? 89.879  59.809 -91.067  1.00 32.24  ? 47   VAL B O     1 
ATOM   3235 C  CB    . VAL F 3 47  ? 87.198  61.199 -90.561  1.00 25.30  ? 47   VAL B CB    1 
ATOM   3236 C  CG1   . VAL F 3 47  ? 86.332  59.918 -90.476  1.00 25.63  ? 47   VAL B CG1   1 
ATOM   3237 C  CG2   . VAL F 3 47  ? 86.403  62.414 -90.166  1.00 22.13  ? 47   VAL B CG2   1 
ATOM   3238 N  N     . GLU F 3 48  ? 89.027  58.711 -89.326  1.00 40.56  ? 48   GLU B N     1 
ATOM   3239 C  CA    . GLU F 3 48  ? 89.743  57.481 -89.651  1.00 41.55  ? 48   GLU B CA    1 
ATOM   3240 C  C     . GLU F 3 48  ? 88.832  56.338 -90.067  1.00 40.56  ? 48   GLU B C     1 
ATOM   3241 O  O     . GLU F 3 48  ? 87.729  56.189 -89.551  1.00 41.63  ? 48   GLU B O     1 
ATOM   3242 C  CB    . GLU F 3 48  ? 90.580  57.023 -88.458  1.00 41.85  ? 48   GLU B CB    1 
ATOM   3243 C  CG    . GLU F 3 48  ? 91.742  56.125 -88.836  1.00 44.48  ? 48   GLU B CG    1 
ATOM   3244 C  CD    . GLU F 3 48  ? 92.175  55.215 -87.707  1.00 47.08  ? 48   GLU B CD    1 
ATOM   3245 O  OE1   . GLU F 3 48  ? 92.149  55.648 -86.525  1.00 46.26  ? 48   GLU B OE1   1 
ATOM   3246 O  OE2   . GLU F 3 48  ? 92.556  54.064 -88.011  1.00 46.13  ? 48   GLU B OE2   1 
ATOM   3247 N  N     . THR F 3 49  ? 89.313  55.529 -91.002  1.00 39.01  ? 49   THR B N     1 
ATOM   3248 C  CA    . THR F 3 49  ? 88.567  54.383 -91.496  1.00 40.53  ? 49   THR B CA    1 
ATOM   3249 C  C     . THR F 3 49  ? 89.346  53.087 -91.308  1.00 42.62  ? 49   THR B C     1 
ATOM   3250 O  O     . THR F 3 49  ? 90.507  52.978 -91.707  1.00 45.05  ? 49   THR B O     1 
ATOM   3251 C  CB    . THR F 3 49  ? 88.224  54.514 -93.006  1.00 32.96  ? 49   THR B CB    1 
ATOM   3252 O  OG1   . THR F 3 49  ? 89.409  54.842 -93.755  1.00 29.75  ? 49   THR B OG1   1 
ATOM   3253 C  CG2   . THR F 3 49  ? 87.148  55.561 -93.226  1.00 31.51  ? 49   THR B CG2   1 
ATOM   3254 N  N     . ARG F 3 50  ? 88.693  52.114 -90.683  1.00 41.76  ? 50   ARG B N     1 
ATOM   3255 C  CA    . ARG F 3 50  ? 89.271  50.796 -90.448  1.00 40.90  ? 50   ARG B CA    1 
ATOM   3256 C  C     . ARG F 3 50  ? 88.229  49.814 -90.958  1.00 40.71  ? 50   ARG B C     1 
ATOM   3257 O  O     . ARG F 3 50  ? 87.384  49.338 -90.197  1.00 38.86  ? 50   ARG B O     1 
ATOM   3258 C  CB    . ARG F 3 50  ? 89.518  50.566 -88.955  1.00 52.45  ? 50   ARG B CB    1 
ATOM   3259 C  CG    . ARG F 3 50  ? 90.902  50.964 -88.461  1.00 53.55  ? 50   ARG B CG    1 
ATOM   3260 C  CD    . ARG F 3 50  ? 90.905  51.021 -86.947  1.00 57.98  ? 50   ARG B CD    1 
ATOM   3261 N  NE    . ARG F 3 50  ? 92.233  51.198 -86.366  1.00 59.10  ? 50   ARG B NE    1 
ATOM   3262 C  CZ    . ARG F 3 50  ? 92.467  51.291 -85.059  1.00 59.32  ? 50   ARG B CZ    1 
ATOM   3263 N  NH1   . ARG F 3 50  ? 91.466  51.229 -84.191  1.00 59.96  ? 50   ARG B NH1   1 
ATOM   3264 N  NH2   . ARG F 3 50  ? 93.706  51.426 -84.615  1.00 61.92  ? 50   ARG B NH2   1 
ATOM   3265 N  N     . GLY F 3 51  ? 88.295  49.522 -92.255  1.00 38.82  ? 51   GLY B N     1 
ATOM   3266 C  CA    . GLY F 3 51  ? 87.333  48.624 -92.850  1.00 38.25  ? 51   GLY B CA    1 
ATOM   3267 C  C     . GLY F 3 51  ? 86.050  49.417 -92.877  1.00 38.87  ? 51   GLY B C     1 
ATOM   3268 O  O     . GLY F 3 51  ? 86.016  50.507 -93.450  1.00 37.95  ? 51   GLY B O     1 
ATOM   3269 N  N     . LYS F 3 52  ? 85.010  48.895 -92.232  1.00 68.76  ? 52   LYS B N     1 
ATOM   3270 C  CA    . LYS F 3 52  ? 83.723  49.575 -92.187  1.00 69.13  ? 52   LYS B CA    1 
ATOM   3271 C  C     . LYS F 3 52  ? 83.515  50.394 -90.918  1.00 70.17  ? 52   LYS B C     1 
ATOM   3272 O  O     . LYS F 3 52  ? 82.404  50.843 -90.635  1.00 72.45  ? 52   LYS B O     1 
ATOM   3273 C  CB    . LYS F 3 52  ? 82.571  48.572 -92.366  1.00 30.53  ? 52   LYS B CB    1 
ATOM   3274 C  CG    . LYS F 3 52  ? 82.368  48.129 -93.804  1.00 29.63  ? 52   LYS B CG    1 
ATOM   3275 C  CD    . LYS F 3 52  ? 81.714  46.771 -93.892  1.00 26.62  ? 52   LYS B CD    1 
ATOM   3276 C  CE    . LYS F 3 52  ? 82.410  45.900 -94.920  1.00 24.38  ? 52   LYS B CE    1 
ATOM   3277 N  NZ    . LYS F 3 52  ? 82.068  44.440 -94.805  1.00 21.98  ? 52   LYS B NZ    1 
ATOM   3278 N  N     . ALA F 3 53  ? 84.591  50.598 -90.167  1.00 47.80  ? 53   ALA B N     1 
ATOM   3279 C  CA    . ALA F 3 53  ? 84.526  51.375 -88.927  1.00 47.79  ? 53   ALA B CA    1 
ATOM   3280 C  C     . ALA F 3 53  ? 84.912  52.841 -89.161  1.00 47.40  ? 53   ALA B C     1 
ATOM   3281 O  O     . ALA F 3 53  ? 85.961  53.134 -89.741  1.00 46.71  ? 53   ALA B O     1 
ATOM   3282 C  CB    . ALA F 3 53  ? 85.451  50.747 -87.847  1.00 21.07  ? 53   ALA B CB    1 
ATOM   3283 N  N     . LEU F 3 54  ? 84.055  53.750 -88.706  1.00 57.64  ? 54   LEU B N     1 
ATOM   3284 C  CA    . LEU F 3 54  ? 84.300  55.183 -88.846  1.00 58.51  ? 54   LEU B CA    1 
ATOM   3285 C  C     . LEU F 3 54  ? 84.791  55.733 -87.503  1.00 58.72  ? 54   LEU B C     1 
ATOM   3286 O  O     . LEU F 3 54  ? 84.082  55.678 -86.498  1.00 59.28  ? 54   LEU B O     1 
ATOM   3287 C  CB    . LEU F 3 54  ? 83.014  55.896 -89.255  1.00 45.09  ? 54   LEU B CB    1 
ATOM   3288 C  CG    . LEU F 3 54  ? 83.122  57.390 -89.521  1.00 46.43  ? 54   LEU B CG    1 
ATOM   3289 C  CD1   . LEU F 3 54  ? 83.630  57.643 -90.939  1.00 46.70  ? 54   LEU B CD1   1 
ATOM   3290 C  CD2   . LEU F 3 54  ? 81.763  58.012 -89.331  1.00 47.43  ? 54   LEU B CD2   1 
ATOM   3291 N  N     . LEU F 3 55  ? 86.009  56.258 -87.490  1.00 41.15  ? 55   LEU B N     1 
ATOM   3292 C  CA    . LEU F 3 55  ? 86.595  56.796 -86.277  1.00 39.79  ? 55   LEU B CA    1 
ATOM   3293 C  C     . LEU F 3 55  ? 86.878  58.293 -86.360  1.00 40.41  ? 55   LEU B C     1 
ATOM   3294 O  O     . LEU F 3 55  ? 87.906  58.715 -86.897  1.00 40.19  ? 55   LEU B O     1 
ATOM   3295 C  CB    . LEU F 3 55  ? 87.897  56.054 -85.960  1.00 26.00  ? 55   LEU B CB    1 
ATOM   3296 C  CG    . LEU F 3 55  ? 87.821  54.705 -85.231  1.00 27.68  ? 55   LEU B CG    1 
ATOM   3297 C  CD1   . LEU F 3 55  ? 86.532  53.981 -85.560  1.00 28.73  ? 55   LEU B CD1   1 
ATOM   3298 C  CD2   . LEU F 3 55  ? 89.057  53.868 -85.591  1.00 24.89  ? 55   LEU B CD2   1 
ATOM   3299 N  N     . THR F 3 56  ? 85.973  59.106 -85.829  1.00 33.27  ? 56   THR B N     1 
ATOM   3300 C  CA    . THR F 3 56  ? 86.221  60.534 -85.840  1.00 34.13  ? 56   THR B CA    1 
ATOM   3301 C  C     . THR F 3 56  ? 86.999  60.843 -84.577  1.00 34.52  ? 56   THR B C     1 
ATOM   3302 O  O     . THR F 3 56  ? 86.529  60.567 -83.488  1.00 35.12  ? 56   THR B O     1 
ATOM   3303 C  CB    . THR F 3 56  ? 84.933  61.354 -85.806  1.00 41.48  ? 56   THR B CB    1 
ATOM   3304 O  OG1   . THR F 3 56  ? 83.894  60.652 -86.495  1.00 42.02  ? 56   THR B OG1   1 
ATOM   3305 C  CG2   . THR F 3 56  ? 85.162  62.689 -86.488  1.00 41.09  ? 56   THR B CG2   1 
ATOM   3306 N  N     . HIS F 3 57  ? 88.195  61.404 -84.734  1.00 49.12  ? 57   HIS B N     1 
ATOM   3307 C  CA    . HIS F 3 57  ? 89.055  61.774 -83.612  1.00 48.46  ? 57   HIS B CA    1 
ATOM   3308 C  C     . HIS F 3 57  ? 88.848  63.225 -83.210  1.00 50.42  ? 57   HIS B C     1 
ATOM   3309 O  O     . HIS F 3 57  ? 88.796  64.116 -84.065  1.00 51.17  ? 57   HIS B O     1 
ATOM   3310 C  CB    . HIS F 3 57  ? 90.515  61.586 -83.989  1.00 31.85  ? 57   HIS B CB    1 
ATOM   3311 C  CG    . HIS F 3 57  ? 90.952  60.164 -83.988  1.00 34.90  ? 57   HIS B CG    1 
ATOM   3312 N  ND1   . HIS F 3 57  ? 91.548  59.572 -82.895  1.00 34.09  ? 57   HIS B ND1   1 
ATOM   3313 C  CD2   . HIS F 3 57  ? 90.830  59.197 -84.924  1.00 36.14  ? 57   HIS B CD2   1 
ATOM   3314 C  CE1   . HIS F 3 57  ? 91.771  58.298 -83.156  1.00 36.00  ? 57   HIS B CE1   1 
ATOM   3315 N  NE2   . HIS F 3 57  ? 91.343  58.046 -84.381  1.00 35.58  ? 57   HIS B NE2   1 
ATOM   3316 N  N     . PHE F 3 58  ? 88.764  63.469 -81.906  1.00 45.63  ? 58   PHE B N     1 
ATOM   3317 C  CA    . PHE F 3 58  ? 88.558  64.825 -81.409  1.00 47.06  ? 58   PHE B CA    1 
ATOM   3318 C  C     . PHE F 3 58  ? 89.802  65.492 -80.810  1.00 47.38  ? 58   PHE B C     1 
ATOM   3319 O  O     . PHE F 3 58  ? 90.877  64.902 -80.761  1.00 49.10  ? 58   PHE B O     1 
ATOM   3320 C  CB    . PHE F 3 58  ? 87.406  64.818 -80.402  1.00 44.87  ? 58   PHE B CB    1 
ATOM   3321 C  CG    . PHE F 3 58  ? 86.107  64.337 -80.987  1.00 44.84  ? 58   PHE B CG    1 
ATOM   3322 C  CD1   . PHE F 3 58  ? 85.489  65.049 -82.009  1.00 44.63  ? 58   PHE B CD1   1 
ATOM   3323 C  CD2   . PHE F 3 58  ? 85.518  63.157 -80.538  1.00 44.98  ? 58   PHE B CD2   1 
ATOM   3324 C  CE1   . PHE F 3 58  ? 84.305  64.592 -82.577  1.00 45.40  ? 58   PHE B CE1   1 
ATOM   3325 C  CE2   . PHE F 3 58  ? 84.332  62.693 -81.100  1.00 45.48  ? 58   PHE B CE2   1 
ATOM   3326 C  CZ    . PHE F 3 58  ? 83.726  63.411 -82.120  1.00 45.69  ? 58   PHE B CZ    1 
ATOM   3327 N  N     . SER F 3 59  ? 89.642  66.734 -80.367  1.00 39.71  ? 59   SER B N     1 
ATOM   3328 C  CA    . SER F 3 59  ? 90.748  67.485 -79.789  1.00 38.97  ? 59   SER B CA    1 
ATOM   3329 C  C     . SER F 3 59  ? 91.068  67.027 -78.376  1.00 38.06  ? 59   SER B C     1 
ATOM   3330 O  O     . SER F 3 59  ? 92.222  67.041 -77.974  1.00 37.42  ? 59   SER B O     1 
ATOM   3331 C  CB    . SER F 3 59  ? 90.435  68.994 -79.765  1.00 43.00  ? 59   SER B CB    1 
ATOM   3332 O  OG    . SER F 3 59  ? 90.508  69.599 -81.042  1.00 42.67  ? 59   SER B OG    1 
ATOM   3333 N  N     . ASN F 3 60  ? 90.033  66.634 -77.636  1.00 39.52  ? 60   ASN B N     1 
ATOM   3334 C  CA    . ASN F 3 60  ? 90.153  66.184 -76.250  1.00 37.61  ? 60   ASN B CA    1 
ATOM   3335 C  C     . ASN F 3 60  ? 90.489  64.702 -76.126  1.00 37.06  ? 60   ASN B C     1 
ATOM   3336 O  O     . ASN F 3 60  ? 90.154  64.073 -75.126  1.00 35.55  ? 60   ASN B O     1 
ATOM   3337 C  CB    . ASN F 3 60  ? 88.837  66.448 -75.516  1.00 38.95  ? 60   ASN B CB    1 
ATOM   3338 C  CG    . ASN F 3 60  ? 87.716  65.526 -75.979  1.00 39.75  ? 60   ASN B CG    1 
ATOM   3339 O  OD1   . ASN F 3 60  ? 87.869  64.783 -76.948  1.00 40.22  ? 60   ASN B OD1   1 
ATOM   3340 N  ND2   . ASN F 3 60  ? 86.581  65.571 -75.286  1.00 39.70  ? 60   ASN B ND2   1 
ATOM   3341 N  N     . ASP F 3 61  ? 91.120  64.139 -77.149  1.00 47.26  ? 61   ASP B N     1 
ATOM   3342 C  CA    . ASP F 3 61  ? 91.498  62.720 -77.144  1.00 47.02  ? 61   ASP B CA    1 
ATOM   3343 C  C     . ASP F 3 61  ? 90.345  61.704 -77.228  1.00 45.20  ? 61   ASP B C     1 
ATOM   3344 O  O     . ASP F 3 61  ? 90.587  60.505 -77.173  1.00 44.52  ? 61   ASP B O     1 
ATOM   3345 C  CB    . ASP F 3 61  ? 92.372  62.395 -75.915  1.00 51.12  ? 61   ASP B CB    1 
ATOM   3346 C  CG    . ASP F 3 61  ? 93.786  62.966 -76.024  1.00 53.16  ? 61   ASP B CG    1 
ATOM   3347 O  OD1   . ASP F 3 61  ? 94.445  62.734 -77.058  1.00 53.36  ? 61   ASP B OD1   1 
ATOM   3348 O  OD2   . ASP F 3 61  ? 94.246  63.640 -75.076  1.00 55.38  ? 61   ASP B OD2   1 
ATOM   3349 N  N     . LEU F 3 62  ? 89.105  62.176 -77.371  1.00 24.16  ? 62   LEU B N     1 
ATOM   3350 C  CA    . LEU F 3 62  ? 87.948  61.283 -77.481  1.00 22.93  ? 62   LEU B CA    1 
ATOM   3351 C  C     . LEU F 3 62  ? 87.728  60.796 -78.915  1.00 22.95  ? 62   LEU B C     1 
ATOM   3352 O  O     . LEU F 3 62  ? 88.078  61.473 -79.879  1.00 19.27  ? 62   LEU B O     1 
ATOM   3353 C  CB    . LEU F 3 62  ? 86.674  61.988 -77.008  1.00 41.47  ? 62   LEU B CB    1 
ATOM   3354 C  CG    . LEU F 3 62  ? 86.542  62.444 -75.552  1.00 42.98  ? 62   LEU B CG    1 
ATOM   3355 C  CD1   . LEU F 3 62  ? 85.111  62.887 -75.310  1.00 43.36  ? 62   LEU B CD1   1 
ATOM   3356 C  CD2   . LEU F 3 62  ? 86.914  61.314 -74.595  1.00 43.81  ? 62   LEU B CD2   1 
ATOM   3357 N  N     . THR F 3 63  ? 87.113  59.622 -79.041  1.00 54.22  ? 63   THR B N     1 
ATOM   3358 C  CA    . THR F 3 63  ? 86.840  59.007 -80.343  1.00 54.52  ? 63   THR B CA    1 
ATOM   3359 C  C     . THR F 3 63  ? 85.415  58.474 -80.518  1.00 55.93  ? 63   THR B C     1 
ATOM   3360 O  O     . THR F 3 63  ? 84.982  57.569 -79.802  1.00 57.78  ? 63   THR B O     1 
ATOM   3361 C  CB    . THR F 3 63  ? 87.817  57.852 -80.601  1.00 36.61  ? 63   THR B CB    1 
ATOM   3362 O  OG1   . THR F 3 63  ? 89.108  58.394 -80.900  1.00 42.07  ? 63   THR B OG1   1 
ATOM   3363 C  CG2   . THR F 3 63  ? 87.347  56.983 -81.751  1.00 38.64  ? 63   THR B CG2   1 
ATOM   3364 N  N     . LEU F 3 64  ? 84.696  59.043 -81.479  1.00 34.95  ? 64   LEU B N     1 
ATOM   3365 C  CA    . LEU F 3 64  ? 83.338  58.617 -81.772  1.00 35.21  ? 64   LEU B CA    1 
ATOM   3366 C  C     . LEU F 3 64  ? 83.481  57.462 -82.730  1.00 35.10  ? 64   LEU B C     1 
ATOM   3367 O  O     . LEU F 3 64  ? 84.116  57.597 -83.766  1.00 35.91  ? 64   LEU B O     1 
ATOM   3368 C  CB    . LEU F 3 64  ? 82.547  59.730 -82.462  1.00 36.23  ? 64   LEU B CB    1 
ATOM   3369 C  CG    . LEU F 3 64  ? 81.028  59.852 -82.237  1.00 34.44  ? 64   LEU B CG    1 
ATOM   3370 C  CD1   . LEU F 3 64  ? 80.353  60.250 -83.550  1.00 34.49  ? 64   LEU B CD1   1 
ATOM   3371 C  CD2   . LEU F 3 64  ? 80.447  58.562 -81.731  1.00 30.63  ? 64   LEU B CD2   1 
ATOM   3372 N  N     . TYR F 3 65  ? 82.911  56.322 -82.366  1.00 35.88  ? 65   TYR B N     1 
ATOM   3373 C  CA    . TYR F 3 65  ? 82.948  55.127 -83.197  1.00 34.80  ? 65   TYR B CA    1 
ATOM   3374 C  C     . TYR F 3 65  ? 81.565  55.016 -83.822  1.00 34.59  ? 65   TYR B C     1 
ATOM   3375 O  O     . TYR F 3 65  ? 80.575  55.183 -83.119  1.00 33.10  ? 65   TYR B O     1 
ATOM   3376 C  CB    . TYR F 3 65  ? 83.212  53.900 -82.334  1.00 48.14  ? 65   TYR B CB    1 
ATOM   3377 C  CG    . TYR F 3 65  ? 82.980  52.601 -83.047  1.00 52.22  ? 65   TYR B CG    1 
ATOM   3378 C  CD1   . TYR F 3 65  ? 83.959  52.050 -83.856  1.00 55.85  ? 65   TYR B CD1   1 
ATOM   3379 C  CD2   . TYR F 3 65  ? 81.773  51.917 -82.916  1.00 54.14  ? 65   TYR B CD2   1 
ATOM   3380 C  CE1   . TYR F 3 65  ? 83.752  50.843 -84.513  1.00 56.78  ? 65   TYR B CE1   1 
ATOM   3381 C  CE2   . TYR F 3 65  ? 81.554  50.711 -83.573  1.00 55.16  ? 65   TYR B CE2   1 
ATOM   3382 C  CZ    . TYR F 3 65  ? 82.551  50.179 -84.366  1.00 56.36  ? 65   TYR B CZ    1 
ATOM   3383 O  OH    . TYR F 3 65  ? 82.373  48.969 -84.996  1.00 59.57  ? 65   TYR B OH    1 
ATOM   3384 N  N     . SER F 3 66  ? 81.496  54.758 -85.130  1.00 43.36  ? 66   SER B N     1 
ATOM   3385 C  CA    . SER F 3 66  ? 80.211  54.616 -85.825  1.00 43.65  ? 66   SER B CA    1 
ATOM   3386 C  C     . SER F 3 66  ? 80.294  53.646 -86.994  1.00 45.83  ? 66   SER B C     1 
ATOM   3387 O  O     . SER F 3 66  ? 81.184  53.727 -87.853  1.00 46.71  ? 66   SER B O     1 
ATOM   3388 C  CB    . SER F 3 66  ? 79.695  55.963 -86.330  1.00 31.91  ? 66   SER B CB    1 
ATOM   3389 O  OG    . SER F 3 66  ? 80.591  56.533 -87.257  1.00 29.98  ? 66   SER B OG    1 
ATOM   3390 N  N     . HIS F 3 67  ? 79.355  52.713 -87.023  1.00 58.53  ? 67   HIS B N     1 
ATOM   3391 C  CA    . HIS F 3 67  ? 79.347  51.722 -88.071  1.00 58.18  ? 67   HIS B CA    1 
ATOM   3392 C  C     . HIS F 3 67  ? 77.975  51.708 -88.722  1.00 56.58  ? 67   HIS B C     1 
ATOM   3393 O  O     . HIS F 3 67  ? 77.004  51.243 -88.131  1.00 57.52  ? 67   HIS B O     1 
ATOM   3394 C  CB    . HIS F 3 67  ? 79.697  50.358 -87.476  1.00 40.72  ? 67   HIS B CB    1 
ATOM   3395 C  CG    . HIS F 3 67  ? 80.219  49.388 -88.483  1.00 41.69  ? 67   HIS B CG    1 
ATOM   3396 N  ND1   . HIS F 3 67  ? 79.519  49.053 -89.621  1.00 41.25  ? 67   HIS B ND1   1 
ATOM   3397 C  CD2   . HIS F 3 67  ? 81.372  48.679 -88.524  1.00 41.56  ? 67   HIS B CD2   1 
ATOM   3398 C  CE1   . HIS F 3 67  ? 80.218  48.176 -90.317  1.00 40.08  ? 67   HIS B CE1   1 
ATOM   3399 N  NE2   . HIS F 3 67  ? 81.345  47.933 -89.673  1.00 40.40  ? 67   HIS B NE2   1 
ATOM   3400 N  N     . ASN F 3 68  ? 77.917  52.238 -89.942  1.00 32.10  ? 68   ASN B N     1 
ATOM   3401 C  CA    . ASN F 3 68  ? 76.693  52.353 -90.730  1.00 29.01  ? 68   ASN B CA    1 
ATOM   3402 C  C     . ASN F 3 68  ? 76.045  51.030 -91.054  1.00 29.42  ? 68   ASN B C     1 
ATOM   3403 O  O     . ASN F 3 68  ? 75.001  50.997 -91.694  1.00 29.99  ? 68   ASN B O     1 
ATOM   3404 C  CB    . ASN F 3 68  ? 76.994  53.076 -92.035  1.00 32.19  ? 68   ASN B CB    1 
ATOM   3405 C  CG    . ASN F 3 68  ? 77.193  54.569 -91.844  1.00 32.88  ? 68   ASN B CG    1 
ATOM   3406 O  OD1   . ASN F 3 68  ? 77.607  55.273 -92.764  1.00 29.42  ? 68   ASN B OD1   1 
ATOM   3407 N  ND2   . ASN F 3 68  ? 76.894  55.059 -90.645  1.00 31.65  ? 68   ASN B ND2   1 
ATOM   3408 N  N     . GLN F 3 69  ? 76.669  49.946 -90.610  1.00 36.75  ? 69   GLN B N     1 
ATOM   3409 C  CA    . GLN F 3 69  ? 76.177  48.602 -90.871  1.00 38.32  ? 69   GLN B CA    1 
ATOM   3410 C  C     . GLN F 3 69  ? 75.578  48.494 -92.289  1.00 40.05  ? 69   GLN B C     1 
ATOM   3411 O  O     . GLN F 3 69  ? 76.297  48.590 -93.277  1.00 39.29  ? 69   GLN B O     1 
ATOM   3412 C  CB    . GLN F 3 69  ? 75.137  48.202 -89.817  1.00 27.42  ? 69   GLN B CB    1 
ATOM   3413 C  CG    . GLN F 3 69  ? 75.014  46.678 -89.609  1.00 27.06  ? 69   GLN B CG    1 
ATOM   3414 C  CD    . GLN F 3 69  ? 73.619  46.150 -89.899  1.00 26.10  ? 69   GLN B CD    1 
ATOM   3415 O  OE1   . GLN F 3 69  ? 73.179  46.146 -91.039  1.00 23.69  ? 69   GLN B OE1   1 
ATOM   3416 N  NE2   . GLN F 3 69  ? 72.917  45.713 -88.860  1.00 26.86  ? 69   GLN B NE2   1 
ATOM   3417 N  N     . LEU F 3 70  ? 74.262  48.328 -92.377  1.00 69.87  ? 70   LEU B N     1 
ATOM   3418 C  CA    . LEU F 3 70  ? 73.592  48.189 -93.666  1.00 72.97  ? 70   LEU B CA    1 
ATOM   3419 C  C     . LEU F 3 70  ? 72.750  49.403 -94.082  1.00 74.53  ? 70   LEU B C     1 
ATOM   3420 O  O     . LEU F 3 70  ? 72.365  49.521 -95.245  1.00 75.06  ? 70   LEU B O     1 
ATOM   3421 C  CB    . LEU F 3 70  ? 72.694  46.945 -93.631  1.00 43.70  ? 70   LEU B CB    1 
ATOM   3422 C  CG    . LEU F 3 70  ? 72.478  46.111 -94.895  1.00 42.34  ? 70   LEU B CG    1 
ATOM   3423 C  CD1   . LEU F 3 70  ? 71.819  44.776 -94.538  1.00 41.76  ? 70   LEU B CD1   1 
ATOM   3424 C  CD2   . LEU F 3 70  ? 71.645  46.892 -95.872  1.00 41.36  ? 70   LEU B CD2   1 
ATOM   3425 N  N     . TYR F 3 71  ? 72.495  50.317 -93.151  1.00 49.42  ? 71   TYR B N     1 
ATOM   3426 C  CA    . TYR F 3 71  ? 71.638  51.466 -93.440  1.00 48.34  ? 71   TYR B CA    1 
ATOM   3427 C  C     . TYR F 3 71  ? 72.190  52.849 -93.067  1.00 49.69  ? 71   TYR B C     1 
ATOM   3428 O  O     . TYR F 3 71  ? 71.638  53.871 -93.489  1.00 50.70  ? 71   TYR B O     1 
ATOM   3429 C  CB    . TYR F 3 71  ? 70.291  51.233 -92.738  1.00 34.60  ? 71   TYR B CB    1 
ATOM   3430 C  CG    . TYR F 3 71  ? 70.474  50.592 -91.377  1.00 32.30  ? 71   TYR B CG    1 
ATOM   3431 C  CD1   . TYR F 3 71  ? 71.070  51.299 -90.329  1.00 30.46  ? 71   TYR B CD1   1 
ATOM   3432 C  CD2   . TYR F 3 71  ? 70.154  49.249 -91.165  1.00 31.78  ? 71   TYR B CD2   1 
ATOM   3433 C  CE1   . TYR F 3 71  ? 71.350  50.688 -89.112  1.00 28.37  ? 71   TYR B CE1   1 
ATOM   3434 C  CE2   . TYR F 3 71  ? 70.434  48.625 -89.942  1.00 27.83  ? 71   TYR B CE2   1 
ATOM   3435 C  CZ    . TYR F 3 71  ? 71.031  49.355 -88.927  1.00 27.73  ? 71   TYR B CZ    1 
ATOM   3436 O  OH    . TYR F 3 71  ? 71.317  48.765 -87.721  1.00 28.22  ? 71   TYR B OH    1 
ATOM   3437 N  N     . GLY F 3 72  ? 73.264  52.886 -92.277  1.00 38.71  ? 72   GLY B N     1 
ATOM   3438 C  CA    . GLY F 3 72  ? 73.848  54.161 -91.885  1.00 37.65  ? 72   GLY B CA    1 
ATOM   3439 C  C     . GLY F 3 72  ? 74.383  54.972 -93.058  1.00 37.54  ? 72   GLY B C     1 
ATOM   3440 O  O     . GLY F 3 72  ? 75.125  54.457 -93.896  1.00 35.80  ? 72   GLY B O     1 
ATOM   3441 N  N     . VAL F 3 73  ? 74.010  56.250 -93.107  1.00 40.22  ? 73   VAL B N     1 
ATOM   3442 C  CA    . VAL F 3 73  ? 74.434  57.152 -94.176  1.00 40.53  ? 73   VAL B CA    1 
ATOM   3443 C  C     . VAL F 3 73  ? 74.878  58.541 -93.665  1.00 40.83  ? 73   VAL B C     1 
ATOM   3444 O  O     . VAL F 3 73  ? 74.213  59.148 -92.837  1.00 42.12  ? 73   VAL B O     1 
ATOM   3445 C  CB    . VAL F 3 73  ? 73.281  57.329 -95.220  1.00 38.34  ? 73   VAL B CB    1 
ATOM   3446 C  CG1   . VAL F 3 73  ? 72.455  56.042 -95.291  1.00 39.90  ? 73   VAL B CG1   1 
ATOM   3447 C  CG2   . VAL F 3 73  ? 72.373  58.490 -94.853  1.00 35.79  ? 73   VAL B CG2   1 
ATOM   3448 N  N     . TRP F 3 74  ? 76.010  59.038 -94.150  1.00 43.94  ? 74   TRP B N     1 
ATOM   3449 C  CA    . TRP F 3 74  ? 76.469  60.361 -93.746  1.00 44.76  ? 74   TRP B CA    1 
ATOM   3450 C  C     . TRP F 3 74  ? 76.050  61.416 -94.756  1.00 45.12  ? 74   TRP B C     1 
ATOM   3451 O  O     . TRP F 3 74  ? 76.067  61.174 -95.962  1.00 46.14  ? 74   TRP B O     1 
ATOM   3452 C  CB    . TRP F 3 74  ? 77.989  60.407 -93.592  1.00 46.84  ? 74   TRP B CB    1 
ATOM   3453 C  CG    . TRP F 3 74  ? 78.477  59.969 -92.248  1.00 46.63  ? 74   TRP B CG    1 
ATOM   3454 C  CD1   . TRP F 3 74  ? 79.054  58.771 -91.937  1.00 46.32  ? 74   TRP B CD1   1 
ATOM   3455 C  CD2   . TRP F 3 74  ? 78.461  60.733 -91.038  1.00 44.02  ? 74   TRP B CD2   1 
ATOM   3456 N  NE1   . TRP F 3 74  ? 79.403  58.745 -90.610  1.00 45.54  ? 74   TRP B NE1   1 
ATOM   3457 C  CE2   . TRP F 3 74  ? 79.049  59.936 -90.033  1.00 44.40  ? 74   TRP B CE2   1 
ATOM   3458 C  CE3   . TRP F 3 74  ? 78.009  62.014 -90.704  1.00 42.90  ? 74   TRP B CE3   1 
ATOM   3459 C  CZ2   . TRP F 3 74  ? 79.198  60.380 -88.713  1.00 42.74  ? 74   TRP B CZ2   1 
ATOM   3460 C  CZ3   . TRP F 3 74  ? 78.160  62.454 -89.391  1.00 38.96  ? 74   TRP B CZ3   1 
ATOM   3461 C  CH2   . TRP F 3 74  ? 78.747  61.637 -88.416  1.00 39.68  ? 74   TRP B CH2   1 
ATOM   3462 N  N     . ARG F 3 75  ? 75.690  62.595 -94.262  1.00 39.04  ? 75   ARG B N     1 
ATOM   3463 C  CA    . ARG F 3 75  ? 75.268  63.664 -95.142  1.00 40.22  ? 75   ARG B CA    1 
ATOM   3464 C  C     . ARG F 3 75  ? 75.932  64.965 -94.761  1.00 39.73  ? 75   ARG B C     1 
ATOM   3465 O  O     . ARG F 3 75  ? 75.914  65.366 -93.601  1.00 41.75  ? 75   ARG B O     1 
ATOM   3466 C  CB    . ARG F 3 75  ? 73.750  63.828 -95.090  1.00 76.52  ? 75   ARG B CB    1 
ATOM   3467 C  CG    . ARG F 3 75  ? 73.173  64.585 -96.273  1.00 79.30  ? 75   ARG B CG    1 
ATOM   3468 C  CD    . ARG F 3 75  ? 73.304  63.772 -97.549  1.00 82.02  ? 75   ARG B CD    1 
ATOM   3469 N  NE    . ARG F 3 75  ? 72.614  62.486 -97.459  1.00 84.50  ? 75   ARG B NE    1 
ATOM   3470 C  CZ    . ARG F 3 75  ? 71.298  62.344 -97.333  1.00 85.98  ? 75   ARG B CZ    1 
ATOM   3471 N  NH1   . ARG F 3 75  ? 70.508  63.408 -97.280  1.00 84.37  ? 75   ARG B NH1   1 
ATOM   3472 N  NH2   . ARG F 3 75  ? 70.767  61.133 -97.264  1.00 86.49  ? 75   ARG B NH2   1 
ATOM   3473 N  N     . VAL F 3 76  ? 76.523  65.618 -95.753  1.00 47.12  ? 76   VAL B N     1 
ATOM   3474 C  CA    . VAL F 3 76  ? 77.195  66.892 -95.560  1.00 46.48  ? 76   VAL B CA    1 
ATOM   3475 C  C     . VAL F 3 76  ? 76.253  67.993 -96.028  1.00 47.46  ? 76   VAL B C     1 
ATOM   3476 O  O     . VAL F 3 76  ? 75.704  67.912 -97.124  1.00 49.10  ? 76   VAL B O     1 
ATOM   3477 C  CB    . VAL F 3 76  ? 78.463  66.983 -96.418  1.00 25.75  ? 76   VAL B CB    1 
ATOM   3478 C  CG1   . VAL F 3 76  ? 79.187  68.305 -96.130  1.00 23.74  ? 76   VAL B CG1   1 
ATOM   3479 C  CG2   . VAL F 3 76  ? 79.338  65.779 -96.178  1.00 22.39  ? 76   VAL B CG2   1 
ATOM   3480 N  N     . VAL F 3 77  ? 76.056  69.019 -95.212  1.00 46.54  ? 77   VAL B N     1 
ATOM   3481 C  CA    . VAL F 3 77  ? 75.179  70.117 -95.605  1.00 46.74  ? 77   VAL B CA    1 
ATOM   3482 C  C     . VAL F 3 77  ? 75.660  71.412 -94.972  1.00 47.83  ? 77   VAL B C     1 
ATOM   3483 O  O     . VAL F 3 77  ? 76.565  71.401 -94.133  1.00 49.32  ? 77   VAL B O     1 
ATOM   3484 C  CB    . VAL F 3 77  ? 73.722  69.857 -95.164  1.00 40.41  ? 77   VAL B CB    1 
ATOM   3485 C  CG1   . VAL F 3 77  ? 73.401  68.375 -95.297  1.00 38.81  ? 77   VAL B CG1   1 
ATOM   3486 C  CG2   . VAL F 3 77  ? 73.496  70.345 -93.733  1.00 39.73  ? 77   VAL B CG2   1 
ATOM   3487 N  N     . ASP F 3 78  ? 75.070  72.532 -95.368  1.00 46.61  ? 78   ASP B N     1 
ATOM   3488 C  CA    . ASP F 3 78  ? 75.475  73.799 -94.776  1.00 48.41  ? 78   ASP B CA    1 
ATOM   3489 C  C     . ASP F 3 78  ? 74.769  73.941 -93.430  1.00 49.06  ? 78   ASP B C     1 
ATOM   3490 O  O     . ASP F 3 78  ? 73.665  73.431 -93.245  1.00 49.01  ? 78   ASP B O     1 
ATOM   3491 C  CB    . ASP F 3 78  ? 75.147  74.972 -95.707  1.00 55.19  ? 78   ASP B CB    1 
ATOM   3492 C  CG    . ASP F 3 78  ? 76.014  74.980 -96.968  1.00 57.13  ? 78   ASP B CG    1 
ATOM   3493 O  OD1   . ASP F 3 78  ? 77.166  74.508 -96.889  1.00 57.81  ? 78   ASP B OD1   1 
ATOM   3494 O  OD2   . ASP F 3 78  ? 75.559  75.469 -98.030  1.00 57.56  ? 78   ASP B OD2   1 
ATOM   3495 N  N     . THR F 3 79  ? 75.419  74.619 -92.489  1.00 46.41  ? 79   THR B N     1 
ATOM   3496 C  CA    . THR F 3 79  ? 74.875  74.805 -91.147  1.00 47.74  ? 79   THR B CA    1 
ATOM   3497 C  C     . THR F 3 79  ? 73.439  75.327 -91.107  1.00 48.76  ? 79   THR B C     1 
ATOM   3498 O  O     . THR F 3 79  ? 73.067  76.227 -91.871  1.00 48.34  ? 79   THR B O     1 
ATOM   3499 C  CB    . THR F 3 79  ? 75.753  75.759 -90.325  1.00 66.88  ? 79   THR B CB    1 
ATOM   3500 O  OG1   . THR F 3 79  ? 77.115  75.331 -90.397  1.00 66.55  ? 79   THR B OG1   1 
ATOM   3501 C  CG2   . THR F 3 79  ? 75.317  75.762 -88.865  1.00 66.80  ? 79   THR B CG2   1 
ATOM   3502 N  N     . GLY F 3 80  ? 72.647  74.740 -90.203  1.00 39.12  ? 80   GLY B N     1 
ATOM   3503 C  CA    . GLY F 3 80  ? 71.263  75.138 -90.019  1.00 39.63  ? 80   GLY B CA    1 
ATOM   3504 C  C     . GLY F 3 80  ? 70.279  74.422 -90.918  1.00 40.60  ? 80   GLY B C     1 
ATOM   3505 O  O     . GLY F 3 80  ? 69.119  74.202 -90.548  1.00 40.93  ? 80   GLY B O     1 
ATOM   3506 N  N     . GLU F 3 81  ? 70.739  74.053 -92.108  1.00 48.50  ? 81   GLU B N     1 
ATOM   3507 C  CA    . GLU F 3 81  ? 69.882  73.368 -93.069  1.00 49.40  ? 81   GLU B CA    1 
ATOM   3508 C  C     . GLU F 3 81  ? 69.747  71.882 -92.784  1.00 48.23  ? 81   GLU B C     1 
ATOM   3509 O  O     . GLU F 3 81  ? 70.735  71.176 -92.619  1.00 47.09  ? 81   GLU B O     1 
ATOM   3510 C  CB    . GLU F 3 81  ? 70.411  73.589 -94.482  1.00 95.20  ? 81   GLU B CB    1 
ATOM   3511 C  CG    . GLU F 3 81  ? 70.475  75.052 -94.870  1.00 95.99  ? 81   GLU B CG    1 
ATOM   3512 C  CD    . GLU F 3 81  ? 71.874  75.481 -95.218  1.00 98.19  ? 81   GLU B CD    1 
ATOM   3513 O  OE1   . GLU F 3 81  ? 72.477  74.823 -96.088  1.00 98.72  ? 81   GLU B OE1   1 
ATOM   3514 O  OE2   . GLU F 3 81  ? 72.369  76.467 -94.630  1.00 98.73  ? 81   GLU B OE2   1 
ATOM   3515 N  N     . GLU F 3 82  ? 68.509  71.419 -92.746  1.00 53.51  ? 82   GLU B N     1 
ATOM   3516 C  CA    . GLU F 3 82  ? 68.202  70.027 -92.453  1.00 55.15  ? 82   GLU B CA    1 
ATOM   3517 C  C     . GLU F 3 82  ? 67.200  69.521 -93.501  1.00 55.19  ? 82   GLU B C     1 
ATOM   3518 O  O     . GLU F 3 82  ? 65.985  69.647 -93.317  1.00 56.40  ? 82   GLU B O     1 
ATOM   3519 C  CB    . GLU F 3 82  ? 67.625  69.964 -91.028  1.00 48.07  ? 82   GLU B CB    1 
ATOM   3520 C  CG    . GLU F 3 82  ? 67.286  68.603 -90.433  1.00 50.53  ? 82   GLU B CG    1 
ATOM   3521 C  CD    . GLU F 3 82  ? 66.905  68.724 -88.947  1.00 52.24  ? 82   GLU B CD    1 
ATOM   3522 O  OE1   . GLU F 3 82  ? 66.262  69.731 -88.579  1.00 54.86  ? 82   GLU B OE1   1 
ATOM   3523 O  OE2   . GLU F 3 82  ? 67.240  67.825 -88.146  1.00 51.47  ? 82   GLU B OE2   1 
ATOM   3524 N  N     . PRO F 3 83  ? 67.705  68.964 -94.628  1.00 70.88  ? 83   PRO B N     1 
ATOM   3525 C  CA    . PRO F 3 83  ? 66.908  68.424 -95.741  1.00 70.56  ? 83   PRO B CA    1 
ATOM   3526 C  C     . PRO F 3 83  ? 65.892  67.366 -95.326  1.00 70.79  ? 83   PRO B C     1 
ATOM   3527 O  O     . PRO F 3 83  ? 66.263  66.251 -94.957  1.00 71.19  ? 83   PRO B O     1 
ATOM   3528 C  CB    . PRO F 3 83  ? 67.964  67.845 -96.675  1.00 51.99  ? 83   PRO B CB    1 
ATOM   3529 C  CG    . PRO F 3 83  ? 69.115  68.753 -96.462  1.00 52.95  ? 83   PRO B CG    1 
ATOM   3530 C  CD    . PRO F 3 83  ? 69.141  68.899 -94.959  1.00 52.36  ? 83   PRO B CD    1 
ATOM   3531 N  N     . GLN F 3 84  ? 64.612  67.722 -95.398  1.00 115.95 ? 84   GLN B N     1 
ATOM   3532 C  CA    . GLN F 3 84  ? 63.543  66.803 -95.035  1.00 115.43 ? 84   GLN B CA    1 
ATOM   3533 C  C     . GLN F 3 84  ? 63.858  65.419 -95.589  1.00 115.11 ? 84   GLN B C     1 
ATOM   3534 O  O     . GLN F 3 84  ? 64.417  65.283 -96.678  1.00 115.83 ? 84   GLN B O     1 
ATOM   3535 C  CB    . GLN F 3 84  ? 62.205  67.308 -95.584  1.00 74.72  ? 84   GLN B CB    1 
ATOM   3536 C  CG    . GLN F 3 84  ? 62.153  67.399 -97.097  1.00 74.66  ? 84   GLN B CG    1 
ATOM   3537 C  CD    . GLN F 3 84  ? 61.077  68.344 -97.592  1.00 74.18  ? 84   GLN B CD    1 
ATOM   3538 O  OE1   . GLN F 3 84  ? 59.891  68.177 -97.295  1.00 73.68  ? 84   GLN B OE1   1 
ATOM   3539 N  NE2   . GLN F 3 84  ? 61.488  69.346 -98.356  1.00 73.35  ? 84   GLN B NE2   1 
ATOM   3540 N  N     . THR F 3 85  ? 63.503  64.396 -94.823  1.00 50.66  ? 85   THR B N     1 
ATOM   3541 C  CA    . THR F 3 85  ? 63.756  63.018 -95.202  1.00 47.83  ? 85   THR B CA    1 
ATOM   3542 C  C     . THR F 3 85  ? 63.065  62.114 -94.184  1.00 47.59  ? 85   THR B C     1 
ATOM   3543 O  O     . THR F 3 85  ? 62.619  62.582 -93.126  1.00 46.89  ? 85   THR B O     1 
ATOM   3544 C  CB    . THR F 3 85  ? 65.284  62.741 -95.216  1.00 45.48  ? 85   THR B CB    1 
ATOM   3545 O  OG1   . THR F 3 85  ? 65.536  61.324 -95.276  1.00 44.20  ? 85   THR B OG1   1 
ATOM   3546 C  CG2   . THR F 3 85  ? 65.932  63.344 -93.968  1.00 43.11  ? 85   THR B CG2   1 
ATOM   3547 N  N     . THR F 3 86  ? 62.992  60.824 -94.499  1.00 76.46  ? 86   THR B N     1 
ATOM   3548 C  CA    . THR F 3 86  ? 62.346  59.850 -93.627  1.00 75.38  ? 86   THR B CA    1 
ATOM   3549 C  C     . THR F 3 86  ? 63.299  59.062 -92.713  1.00 75.88  ? 86   THR B C     1 
ATOM   3550 O  O     . THR F 3 86  ? 62.866  58.172 -91.977  1.00 78.61  ? 86   THR B O     1 
ATOM   3551 C  CB    . THR F 3 86  ? 61.490  58.864 -94.471  1.00 51.88  ? 86   THR B CB    1 
ATOM   3552 O  OG1   . THR F 3 86  ? 61.519  57.556 -93.882  1.00 51.92  ? 86   THR B OG1   1 
ATOM   3553 C  CG2   . THR F 3 86  ? 62.008  58.802 -95.918  1.00 52.20  ? 86   THR B CG2   1 
ATOM   3554 N  N     . ARG F 3 87  ? 64.589  59.388 -92.743  1.00 35.76  ? 87   ARG B N     1 
ATOM   3555 C  CA    . ARG F 3 87  ? 65.550  58.691 -91.902  1.00 33.24  ? 87   ARG B CA    1 
ATOM   3556 C  C     . ARG F 3 87  ? 65.693  59.442 -90.586  1.00 32.89  ? 87   ARG B C     1 
ATOM   3557 O  O     . ARG F 3 87  ? 65.504  60.662 -90.532  1.00 33.99  ? 87   ARG B O     1 
ATOM   3558 C  CB    . ARG F 3 87  ? 66.916  58.617 -92.590  1.00 42.29  ? 87   ARG B CB    1 
ATOM   3559 C  CG    . ARG F 3 87  ? 66.986  57.773 -93.866  1.00 40.06  ? 87   ARG B CG    1 
ATOM   3560 C  CD    . ARG F 3 87  ? 68.256  58.144 -94.625  1.00 42.30  ? 87   ARG B CD    1 
ATOM   3561 N  NE    . ARG F 3 87  ? 68.528  57.302 -95.784  1.00 42.30  ? 87   ARG B NE    1 
ATOM   3562 C  CZ    . ARG F 3 87  ? 69.068  56.084 -95.723  1.00 42.60  ? 87   ARG B CZ    1 
ATOM   3563 N  NH1   . ARG F 3 87  ? 69.402  55.548 -94.550  1.00 41.44  ? 87   ARG B NH1   1 
ATOM   3564 N  NH2   . ARG F 3 87  ? 69.274  55.400 -96.841  1.00 41.55  ? 87   ARG B NH2   1 
ATOM   3565 N  N     . VAL F 3 88  ? 66.052  58.708 -89.537  1.00 38.80  ? 88   VAL B N     1 
ATOM   3566 C  CA    . VAL F 3 88  ? 66.218  59.260 -88.195  1.00 37.17  ? 88   VAL B CA    1 
ATOM   3567 C  C     . VAL F 3 88  ? 67.640  59.769 -87.923  1.00 37.76  ? 88   VAL B C     1 
ATOM   3568 O  O     . VAL F 3 88  ? 68.621  59.063 -88.156  1.00 36.60  ? 88   VAL B O     1 
ATOM   3569 C  CB    . VAL F 3 88  ? 65.870  58.190 -87.135  1.00 28.72  ? 88   VAL B CB    1 
ATOM   3570 C  CG1   . VAL F 3 88  ? 66.162  58.715 -85.736  1.00 28.08  ? 88   VAL B CG1   1 
ATOM   3571 C  CG2   . VAL F 3 88  ? 64.431  57.783 -87.279  1.00 26.69  ? 88   VAL B CG2   1 
ATOM   3572 N  N     . LEU F 3 89  ? 67.752  60.990 -87.413  1.00 45.23  ? 89   LEU B N     1 
ATOM   3573 C  CA    . LEU F 3 89  ? 69.071  61.542 -87.129  1.00 44.93  ? 89   LEU B CA    1 
ATOM   3574 C  C     . LEU F 3 89  ? 69.651  60.953 -85.856  1.00 45.16  ? 89   LEU B C     1 
ATOM   3575 O  O     . LEU F 3 89  ? 69.006  60.937 -84.810  1.00 44.58  ? 89   LEU B O     1 
ATOM   3576 C  CB    . LEU F 3 89  ? 69.019  63.069 -87.010  1.00 38.26  ? 89   LEU B CB    1 
ATOM   3577 C  CG    . LEU F 3 89  ? 70.364  63.812 -87.053  1.00 38.79  ? 89   LEU B CG    1 
ATOM   3578 C  CD1   . LEU F 3 89  ? 71.176  63.432 -88.304  1.00 37.30  ? 89   LEU B CD1   1 
ATOM   3579 C  CD2   . LEU F 3 89  ? 70.090  65.317 -87.055  1.00 40.29  ? 89   LEU B CD2   1 
ATOM   3580 N  N     . ARG F 3 90  ? 70.880  60.467 -85.962  1.00 59.85  ? 90   ARG B N     1 
ATOM   3581 C  CA    . ARG F 3 90  ? 71.562  59.881 -84.828  1.00 60.19  ? 90   ARG B CA    1 
ATOM   3582 C  C     . ARG F 3 90  ? 72.718  60.772 -84.375  1.00 61.13  ? 90   ARG B C     1 
ATOM   3583 O  O     . ARG F 3 90  ? 72.973  60.903 -83.180  1.00 64.38  ? 90   ARG B O     1 
ATOM   3584 C  CB    . ARG F 3 90  ? 72.066  58.479 -85.193  1.00 34.86  ? 90   ARG B CB    1 
ATOM   3585 C  CG    . ARG F 3 90  ? 70.948  57.425 -85.362  1.00 32.14  ? 90   ARG B CG    1 
ATOM   3586 C  CD    . ARG F 3 90  ? 70.282  57.046 -84.028  1.00 27.85  ? 90   ARG B CD    1 
ATOM   3587 N  NE    . ARG F 3 90  ? 69.043  56.294 -84.205  1.00 25.44  ? 90   ARG B NE    1 
ATOM   3588 C  CZ    . ARG F 3 90  ? 68.956  55.038 -84.647  1.00 28.50  ? 90   ARG B CZ    1 
ATOM   3589 N  NH1   . ARG F 3 90  ? 70.041  54.350 -84.967  1.00 28.46  ? 90   ARG B NH1   1 
ATOM   3590 N  NH2   . ARG F 3 90  ? 67.769  54.462 -84.786  1.00 27.45  ? 90   ARG B NH2   1 
ATOM   3591 N  N     . VAL F 3 91  ? 73.400  61.404 -85.323  1.00 35.93  ? 91   VAL B N     1 
ATOM   3592 C  CA    . VAL F 3 91  ? 74.531  62.266 -84.989  1.00 35.05  ? 91   VAL B CA    1 
ATOM   3593 C  C     . VAL F 3 91  ? 74.612  63.561 -85.805  1.00 35.20  ? 91   VAL B C     1 
ATOM   3594 O  O     . VAL F 3 91  ? 74.318  63.573 -87.003  1.00 30.63  ? 91   VAL B O     1 
ATOM   3595 C  CB    . VAL F 3 91  ? 75.886  61.534 -85.188  1.00 34.67  ? 91   VAL B CB    1 
ATOM   3596 C  CG1   . VAL F 3 91  ? 77.030  62.514 -84.940  1.00 33.63  ? 91   VAL B CG1   1 
ATOM   3597 C  CG2   . VAL F 3 91  ? 75.994  60.334 -84.272  1.00 32.69  ? 91   VAL B CG2   1 
ATOM   3598 N  N     . LYS F 3 92  ? 75.037  64.636 -85.135  1.00 45.16  ? 92   LYS B N     1 
ATOM   3599 C  CA    . LYS F 3 92  ? 75.219  65.948 -85.753  1.00 43.28  ? 92   LYS B CA    1 
ATOM   3600 C  C     . LYS F 3 92  ? 76.483  66.643 -85.236  1.00 44.18  ? 92   LYS B C     1 
ATOM   3601 O  O     . LYS F 3 92  ? 76.572  67.017 -84.067  1.00 43.46  ? 92   LYS B O     1 
ATOM   3602 C  CB    . LYS F 3 92  ? 74.022  66.869 -85.501  1.00 36.35  ? 92   LYS B CB    1 
ATOM   3603 C  CG    . LYS F 3 92  ? 74.252  68.286 -86.053  1.00 37.50  ? 92   LYS B CG    1 
ATOM   3604 C  CD    . LYS F 3 92  ? 73.036  69.220 -85.927  1.00 41.15  ? 92   LYS B CD    1 
ATOM   3605 C  CE    . LYS F 3 92  ? 72.798  69.702 -84.495  1.00 42.92  ? 92   LYS B CE    1 
ATOM   3606 N  NZ    . LYS F 3 92  ? 71.670  70.686 -84.375  1.00 45.49  ? 92   LYS B NZ    1 
ATOM   3607 N  N     . LEU F 3 93  ? 77.466  66.797 -86.113  1.00 45.43  ? 93   LEU B N     1 
ATOM   3608 C  CA    . LEU F 3 93  ? 78.700  67.478 -85.755  1.00 44.84  ? 93   LEU B CA    1 
ATOM   3609 C  C     . LEU F 3 93  ? 78.697  68.717 -86.627  1.00 44.24  ? 93   LEU B C     1 
ATOM   3610 O  O     . LEU F 3 93  ? 79.101  68.688 -87.788  1.00 45.16  ? 93   LEU B O     1 
ATOM   3611 C  CB    . LEU F 3 93  ? 79.920  66.603 -86.045  1.00 24.29  ? 93   LEU B CB    1 
ATOM   3612 C  CG    . LEU F 3 93  ? 79.949  65.287 -85.254  1.00 25.50  ? 93   LEU B CG    1 
ATOM   3613 C  CD1   . LEU F 3 93  ? 81.266  64.547 -85.497  1.00 24.69  ? 93   LEU B CD1   1 
ATOM   3614 C  CD2   . LEU F 3 93  ? 79.763  65.584 -83.780  1.00 23.29  ? 93   LEU B CD2   1 
ATOM   3615 N  N     . GLN F 3 94  ? 78.196  69.800 -86.045  1.00 35.82  ? 94   GLN B N     1 
ATOM   3616 C  CA    . GLN F 3 94  ? 78.063  71.075 -86.715  1.00 34.36  ? 94   GLN B CA    1 
ATOM   3617 C  C     . GLN F 3 94  ? 79.187  72.077 -86.460  1.00 36.12  ? 94   GLN B C     1 
ATOM   3618 O  O     . GLN F 3 94  ? 79.836  72.075 -85.409  1.00 38.45  ? 94   GLN B O     1 
ATOM   3619 C  CB    . GLN F 3 94  ? 76.725  71.683 -86.316  1.00 25.65  ? 94   GLN B CB    1 
ATOM   3620 C  CG    . GLN F 3 94  ? 76.711  73.180 -86.323  1.00 22.81  ? 94   GLN B CG    1 
ATOM   3621 C  CD    . GLN F 3 94  ? 75.391  73.778 -85.906  1.00 19.29  ? 94   GLN B CD    1 
ATOM   3622 O  OE1   . GLN F 3 94  ? 75.337  74.940 -85.519  1.00 22.79  ? 94   GLN B OE1   1 
ATOM   3623 N  NE2   . GLN F 3 94  ? 74.320  73.002 -85.998  1.00 22.50  ? 94   GLN B NE2   1 
ATOM   3624 N  N     . THR F 3 95  ? 79.411  72.938 -87.441  1.00 27.34  ? 95   THR B N     1 
ATOM   3625 C  CA    . THR F 3 95  ? 80.421  73.977 -87.338  1.00 30.21  ? 95   THR B CA    1 
ATOM   3626 C  C     . THR F 3 95  ? 79.827  75.252 -87.942  1.00 29.21  ? 95   THR B C     1 
ATOM   3627 O  O     . THR F 3 95  ? 78.686  75.244 -88.399  1.00 27.21  ? 95   THR B O     1 
ATOM   3628 C  CB    . THR F 3 95  ? 81.723  73.586 -88.082  1.00 87.83  ? 95   THR B CB    1 
ATOM   3629 O  OG1   . THR F 3 95  ? 81.434  73.292 -89.453  1.00 91.51  ? 95   THR B OG1   1 
ATOM   3630 C  CG2   . THR F 3 95  ? 82.354  72.367 -87.435  1.00 85.71  ? 95   THR B CG2   1 
ATOM   3631 N  N     . ALA F 3 96  ? 80.593  76.338 -87.938  1.00 43.37  ? 96   ALA B N     1 
ATOM   3632 C  CA    . ALA F 3 96  ? 80.111  77.608 -88.477  1.00 42.48  ? 96   ALA B CA    1 
ATOM   3633 C  C     . ALA F 3 96  ? 79.532  77.516 -89.885  1.00 42.64  ? 96   ALA B C     1 
ATOM   3634 O  O     . ALA F 3 96  ? 78.563  78.206 -90.196  1.00 43.63  ? 96   ALA B O     1 
ATOM   3635 C  CB    . ALA F 3 96  ? 81.228  78.649 -88.457  1.00 32.08  ? 96   ALA B CB    1 
ATOM   3636 N  N     . ASP F 3 97  ? 80.100  76.665 -90.735  1.00 30.04  ? 97   ASP B N     1 
ATOM   3637 C  CA    . ASP F 3 97  ? 79.601  76.574 -92.105  1.00 30.16  ? 97   ASP B CA    1 
ATOM   3638 C  C     . ASP F 3 97  ? 79.089  75.231 -92.597  1.00 28.94  ? 97   ASP B C     1 
ATOM   3639 O  O     . ASP F 3 97  ? 78.063  75.182 -93.268  1.00 28.39  ? 97   ASP B O     1 
ATOM   3640 C  CB    . ASP F 3 97  ? 80.657  77.118 -93.076  1.00 57.80  ? 97   ASP B CB    1 
ATOM   3641 C  CG    . ASP F 3 97  ? 82.014  76.477 -92.883  1.00 59.89  ? 97   ASP B CG    1 
ATOM   3642 O  OD1   . ASP F 3 97  ? 82.270  75.958 -91.774  1.00 60.92  ? 97   ASP B OD1   1 
ATOM   3643 O  OD2   . ASP F 3 97  ? 82.829  76.511 -93.834  1.00 57.93  ? 97   ASP B OD2   1 
ATOM   3644 N  N     . LYS F 3 98  ? 79.800  74.150 -92.296  1.00 35.14  ? 98   LYS B N     1 
ATOM   3645 C  CA    . LYS F 3 98  ? 79.361  72.818 -92.719  1.00 35.18  ? 98   LYS B CA    1 
ATOM   3646 C  C     . LYS F 3 98  ? 78.863  72.035 -91.511  1.00 34.95  ? 98   LYS B C     1 
ATOM   3647 O  O     . LYS F 3 98  ? 79.385  72.199 -90.402  1.00 33.95  ? 98   LYS B O     1 
ATOM   3648 C  CB    . LYS F 3 98  ? 80.511  72.044 -93.380  1.00 42.32  ? 98   LYS B CB    1 
ATOM   3649 C  CG    . LYS F 3 98  ? 81.057  72.672 -94.661  1.00 43.24  ? 98   LYS B CG    1 
ATOM   3650 C  CD    . LYS F 3 98  ? 79.963  72.846 -95.711  1.00 44.27  ? 98   LYS B CD    1 
ATOM   3651 C  CE    . LYS F 3 98  ? 80.471  73.588 -96.934  1.00 43.19  ? 98   LYS B CE    1 
ATOM   3652 N  NZ    . LYS F 3 98  ? 79.419  73.743 -97.985  1.00 43.76  ? 98   LYS B NZ    1 
ATOM   3653 N  N     . THR F 3 99  ? 77.857  71.188 -91.722  1.00 45.78  ? 99   THR B N     1 
ATOM   3654 C  CA    . THR F 3 99  ? 77.318  70.375 -90.633  1.00 46.66  ? 99   THR B CA    1 
ATOM   3655 C  C     . THR F 3 99  ? 77.029  68.953 -91.096  1.00 47.70  ? 99   THR B C     1 
ATOM   3656 O  O     . THR F 3 99  ? 75.973  68.682 -91.663  1.00 50.02  ? 99   THR B O     1 
ATOM   3657 C  CB    . THR F 3 99  ? 75.994  70.951 -90.074  1.00 41.17  ? 99   THR B CB    1 
ATOM   3658 O  OG1   . THR F 3 99  ? 76.160  72.331 -89.704  1.00 37.61  ? 99   THR B OG1   1 
ATOM   3659 C  CG2   . THR F 3 99  ? 75.556  70.135 -88.870  1.00 37.89  ? 99   THR B CG2   1 
ATOM   3660 N  N     . ILE F 3 100 ? 77.960  68.041 -90.848  1.00 36.77  ? 100  ILE B N     1 
ATOM   3661 C  CA    . ILE F 3 100 ? 77.775  66.650 -91.252  1.00 35.84  ? 100  ILE B CA    1 
ATOM   3662 C  C     . ILE F 3 100 ? 76.787  65.989 -90.303  1.00 36.96  ? 100  ILE B C     1 
ATOM   3663 O  O     . ILE F 3 100 ? 76.797  66.251 -89.096  1.00 37.86  ? 100  ILE B O     1 
ATOM   3664 C  CB    . ILE F 3 100 ? 79.113  65.883 -91.228  1.00 30.22  ? 100  ILE B CB    1 
ATOM   3665 C  CG1   . ILE F 3 100 ? 79.533  65.583 -89.785  1.00 28.43  ? 100  ILE B CG1   1 
ATOM   3666 C  CG2   . ILE F 3 100 ? 80.200  66.747 -91.875  1.00 28.74  ? 100  ILE B CG2   1 
ATOM   3667 C  CD1   . ILE F 3 100 ? 80.857  64.927 -89.659  1.00 23.88  ? 100  ILE B CD1   1 
ATOM   3668 N  N     . LEU F 3 101 ? 75.935  65.132 -90.857  1.00 35.16  ? 101  LEU B N     1 
ATOM   3669 C  CA    . LEU F 3 101 ? 74.914  64.434 -90.090  1.00 31.88  ? 101  LEU B CA    1 
ATOM   3670 C  C     . LEU F 3 101 ? 75.004  62.949 -90.315  1.00 32.01  ? 101  LEU B C     1 
ATOM   3671 O  O     . LEU F 3 101 ? 75.310  62.506 -91.407  1.00 31.03  ? 101  LEU B O     1 
ATOM   3672 C  CB    . LEU F 3 101 ? 73.532  64.903 -90.525  1.00 29.26  ? 101  LEU B CB    1 
ATOM   3673 C  CG    . LEU F 3 101 ? 73.246  66.394 -90.352  1.00 31.78  ? 101  LEU B CG    1 
ATOM   3674 C  CD1   . LEU F 3 101 ? 71.930  66.755 -91.039  1.00 32.35  ? 101  LEU B CD1   1 
ATOM   3675 C  CD2   . LEU F 3 101 ? 73.209  66.738 -88.866  1.00 31.92  ? 101  LEU B CD2   1 
ATOM   3676 N  N     . LEU F 3 102 ? 74.743  62.168 -89.278  1.00 54.16  ? 102  LEU B N     1 
ATOM   3677 C  CA    . LEU F 3 102 ? 74.774  60.725 -89.432  1.00 53.83  ? 102  LEU B CA    1 
ATOM   3678 C  C     . LEU F 3 102 ? 73.379  60.175 -89.271  1.00 55.28  ? 102  LEU B C     1 
ATOM   3679 O  O     . LEU F 3 102 ? 72.814  60.196 -88.179  1.00 57.75  ? 102  LEU B O     1 
ATOM   3680 C  CB    . LEU F 3 102 ? 75.690  60.057 -88.407  1.00 28.26  ? 102  LEU B CB    1 
ATOM   3681 C  CG    . LEU F 3 102 ? 75.486  58.536 -88.350  1.00 27.29  ? 102  LEU B CG    1 
ATOM   3682 C  CD1   . LEU F 3 102 ? 75.569  57.938 -89.749  1.00 25.64  ? 102  LEU B CD1   1 
ATOM   3683 C  CD2   . LEU F 3 102 ? 76.515  57.918 -87.427  1.00 26.13  ? 102  LEU B CD2   1 
ATOM   3684 N  N     . TYR F 3 103 ? 72.820  59.680 -90.364  1.00 46.34  ? 103  TYR B N     1 
ATOM   3685 C  CA    . TYR F 3 103 ? 71.491  59.116 -90.311  1.00 45.43  ? 103  TYR B CA    1 
ATOM   3686 C  C     . TYR F 3 103 ? 71.506  57.605 -90.080  1.00 45.66  ? 103  TYR B C     1 
ATOM   3687 O  O     . TYR F 3 103 ? 72.535  56.944 -90.223  1.00 45.88  ? 103  TYR B O     1 
ATOM   3688 C  CB    . TYR F 3 103 ? 70.746  59.398 -91.607  1.00 38.92  ? 103  TYR B CB    1 
ATOM   3689 C  CG    . TYR F 3 103 ? 70.463  60.852 -91.905  1.00 38.05  ? 103  TYR B CG    1 
ATOM   3690 C  CD1   . TYR F 3 103 ? 71.339  61.609 -92.673  1.00 36.07  ? 103  TYR B CD1   1 
ATOM   3691 C  CD2   . TYR F 3 103 ? 69.272  61.452 -91.480  1.00 39.01  ? 103  TYR B CD2   1 
ATOM   3692 C  CE1   . TYR F 3 103 ? 71.039  62.925 -93.024  1.00 38.20  ? 103  TYR B CE1   1 
ATOM   3693 C  CE2   . TYR F 3 103 ? 68.958  62.768 -91.823  1.00 37.27  ? 103  TYR B CE2   1 
ATOM   3694 C  CZ    . TYR F 3 103 ? 69.844  63.500 -92.600  1.00 37.96  ? 103  TYR B CZ    1 
ATOM   3695 O  OH    . TYR F 3 103 ? 69.524  64.790 -92.982  1.00 38.58  ? 103  TYR B OH    1 
ATOM   3696 N  N     . SER F 3 104 ? 70.339  57.102 -89.696  1.00 36.97  ? 104  SER B N     1 
ATOM   3697 C  CA    . SER F 3 104 ? 70.024  55.691 -89.479  1.00 37.30  ? 104  SER B CA    1 
ATOM   3698 C  C     . SER F 3 104 ? 70.838  54.733 -88.623  1.00 37.41  ? 104  SER B C     1 
ATOM   3699 O  O     . SER F 3 104 ? 70.265  53.866 -87.969  1.00 39.92  ? 104  SER B O     1 
ATOM   3700 C  CB    . SER F 3 104 ? 69.818  55.030 -90.834  1.00 55.26  ? 104  SER B CB    1 
ATOM   3701 O  OG    . SER F 3 104 ? 69.599  53.644 -90.668  1.00 60.70  ? 104  SER B OG    1 
ATOM   3702 N  N     . ALA F 3 105 ? 72.159  54.862 -88.640  1.00 36.72  ? 105  ALA B N     1 
ATOM   3703 C  CA    . ALA F 3 105 ? 73.036  53.965 -87.897  1.00 34.32  ? 105  ALA B CA    1 
ATOM   3704 C  C     . ALA F 3 105 ? 72.702  53.786 -86.414  1.00 34.48  ? 105  ALA B C     1 
ATOM   3705 O  O     . ALA F 3 105 ? 72.341  54.737 -85.727  1.00 34.28  ? 105  ALA B O     1 
ATOM   3706 C  CB    . ALA F 3 105 ? 74.471  54.425 -88.071  1.00 38.78  ? 105  ALA B CB    1 
ATOM   3707 N  N     . SER F 3 106 ? 72.847  52.559 -85.921  1.00 34.26  ? 106  SER B N     1 
ATOM   3708 C  CA    . SER F 3 106 ? 72.563  52.257 -84.517  1.00 34.15  ? 106  SER B CA    1 
ATOM   3709 C  C     . SER F 3 106 ? 73.807  51.884 -83.690  1.00 35.62  ? 106  SER B C     1 
ATOM   3710 O  O     . SER F 3 106 ? 73.752  51.837 -82.456  1.00 34.65  ? 106  SER B O     1 
ATOM   3711 C  CB    . SER F 3 106 ? 71.547  51.125 -84.428  1.00 46.91  ? 106  SER B CB    1 
ATOM   3712 O  OG    . SER F 3 106 ? 72.024  49.975 -85.096  1.00 50.17  ? 106  SER B OG    1 
ATOM   3713 N  N     . ASP F 3 107 ? 74.915  51.599 -84.371  1.00 43.51  ? 107  ASP B N     1 
ATOM   3714 C  CA    . ASP F 3 107 ? 76.170  51.252 -83.708  1.00 43.69  ? 107  ASP B CA    1 
ATOM   3715 C  C     . ASP F 3 107 ? 76.955  52.554 -83.568  1.00 45.29  ? 107  ASP B C     1 
ATOM   3716 O  O     . ASP F 3 107 ? 77.575  53.020 -84.526  1.00 46.99  ? 107  ASP B O     1 
ATOM   3717 C  CB    . ASP F 3 107 ? 76.979  50.269 -84.556  1.00 45.43  ? 107  ASP B CB    1 
ATOM   3718 C  CG    . ASP F 3 107 ? 76.320  48.915 -84.677  1.00 48.33  ? 107  ASP B CG    1 
ATOM   3719 O  OD1   . ASP F 3 107 ? 76.543  48.068 -83.795  1.00 49.66  ? 107  ASP B OD1   1 
ATOM   3720 O  OD2   . ASP F 3 107 ? 75.572  48.692 -85.653  1.00 49.73  ? 107  ASP B OD2   1 
ATOM   3721 N  N     . ILE F 3 108 ? 76.919  53.148 -82.379  1.00 40.54  ? 108  ILE B N     1 
ATOM   3722 C  CA    . ILE F 3 108 ? 77.616  54.403 -82.135  1.00 40.69  ? 108  ILE B CA    1 
ATOM   3723 C  C     . ILE F 3 108 ? 78.036  54.451 -80.666  1.00 41.07  ? 108  ILE B C     1 
ATOM   3724 O  O     . ILE F 3 108 ? 77.201  54.518 -79.768  1.00 40.84  ? 108  ILE B O     1 
ATOM   3725 C  CB    . ILE F 3 108 ? 76.696  55.618 -82.469  1.00 37.90  ? 108  ILE B CB    1 
ATOM   3726 C  CG1   . ILE F 3 108 ? 76.038  55.415 -83.836  1.00 37.02  ? 108  ILE B CG1   1 
ATOM   3727 C  CG2   . ILE F 3 108 ? 77.510  56.906 -82.505  1.00 38.14  ? 108  ILE B CG2   1 
ATOM   3728 C  CD1   . ILE F 3 108 ? 74.981  56.436 -84.167  1.00 34.05  ? 108  ILE B CD1   1 
ATOM   3729 N  N     . GLU F 3 109 ? 79.339  54.416 -80.432  1.00 50.60  ? 109  GLU B N     1 
ATOM   3730 C  CA    . GLU F 3 109 ? 79.878  54.436 -79.079  1.00 52.03  ? 109  GLU B CA    1 
ATOM   3731 C  C     . GLU F 3 109 ? 80.774  55.655 -78.894  1.00 53.50  ? 109  GLU B C     1 
ATOM   3732 O  O     . GLU F 3 109 ? 80.976  56.429 -79.824  1.00 54.74  ? 109  GLU B O     1 
ATOM   3733 C  CB    . GLU F 3 109 ? 80.701  53.163 -78.845  1.00 46.99  ? 109  GLU B CB    1 
ATOM   3734 C  CG    . GLU F 3 109 ? 79.922  51.858 -79.033  1.00 48.63  ? 109  GLU B CG    1 
ATOM   3735 C  CD    . GLU F 3 109 ? 80.811  50.613 -78.987  1.00 49.84  ? 109  GLU B CD    1 
ATOM   3736 O  OE1   . GLU F 3 109 ? 81.674  50.524 -78.084  1.00 48.13  ? 109  GLU B OE1   1 
ATOM   3737 O  OE2   . GLU F 3 109 ? 80.634  49.716 -79.847  1.00 49.44  ? 109  GLU B OE2   1 
ATOM   3738 N  N     . MET F 3 110 ? 81.290  55.844 -77.685  1.00 57.05  ? 110  MET B N     1 
ATOM   3739 C  CA    . MET F 3 110 ? 82.223  56.941 -77.437  1.00 57.06  ? 110  MET B CA    1 
ATOM   3740 C  C     . MET F 3 110 ? 83.448  56.272 -76.826  1.00 56.64  ? 110  MET B C     1 
ATOM   3741 O  O     . MET F 3 110 ? 83.388  55.705 -75.741  1.00 55.37  ? 110  MET B O     1 
ATOM   3742 C  CB    . MET F 3 110 ? 81.639  57.990 -76.497  1.00 43.26  ? 110  MET B CB    1 
ATOM   3743 C  CG    . MET F 3 110 ? 82.492  59.248 -76.418  1.00 42.43  ? 110  MET B CG    1 
ATOM   3744 S  SD    . MET F 3 110 ? 82.866  60.016 -78.055  1.00 44.65  ? 110  MET B SD    1 
ATOM   3745 C  CE    . MET F 3 110 ? 81.281  60.756 -78.432  1.00 39.65  ? 110  MET B CE    1 
ATOM   3746 N  N     . LEU F 3 111 ? 84.560  56.336 -77.546  1.00 46.96  ? 111  LEU B N     1 
ATOM   3747 C  CA    . LEU F 3 111 ? 85.776  55.670 -77.116  1.00 46.29  ? 111  LEU B CA    1 
ATOM   3748 C  C     . LEU F 3 111 ? 86.867  56.548 -76.554  1.00 46.93  ? 111  LEU B C     1 
ATOM   3749 O  O     . LEU F 3 111 ? 87.167  57.607 -77.091  1.00 48.05  ? 111  LEU B O     1 
ATOM   3750 C  CB    . LEU F 3 111 ? 86.346  54.866 -78.288  1.00 30.80  ? 111  LEU B CB    1 
ATOM   3751 C  CG    . LEU F 3 111 ? 85.347  53.996 -79.068  1.00 28.80  ? 111  LEU B CG    1 
ATOM   3752 C  CD1   . LEU F 3 111 ? 86.102  53.249 -80.189  1.00 28.35  ? 111  LEU B CD1   1 
ATOM   3753 C  CD2   . LEU F 3 111 ? 84.647  53.004 -78.102  1.00 24.32  ? 111  LEU B CD2   1 
ATOM   3754 N  N     . ARG F 3 112 ? 87.453  56.084 -75.457  1.00 43.84  ? 112  ARG B N     1 
ATOM   3755 C  CA    . ARG F 3 112 ? 88.561  56.764 -74.811  1.00 44.60  ? 112  ARG B CA    1 
ATOM   3756 C  C     . ARG F 3 112 ? 89.815  56.041 -75.300  1.00 45.81  ? 112  ARG B C     1 
ATOM   3757 O  O     . ARG F 3 112 ? 89.756  54.879 -75.696  1.00 45.45  ? 112  ARG B O     1 
ATOM   3758 C  CB    . ARG F 3 112 ? 88.432  56.664 -73.283  1.00 45.69  ? 112  ARG B CB    1 
ATOM   3759 C  CG    . ARG F 3 112 ? 87.507  57.721 -72.684  1.00 46.86  ? 112  ARG B CG    1 
ATOM   3760 C  CD    . ARG F 3 112 ? 87.172  57.480 -71.219  1.00 48.46  ? 112  ARG B CD    1 
ATOM   3761 N  NE    . ARG F 3 112 ? 88.345  57.325 -70.358  1.00 48.53  ? 112  ARG B NE    1 
ATOM   3762 C  CZ    . ARG F 3 112 ? 88.275  57.094 -69.049  1.00 47.86  ? 112  ARG B CZ    1 
ATOM   3763 N  NH1   . ARG F 3 112 ? 87.093  56.999 -68.462  1.00 48.08  ? 112  ARG B NH1   1 
ATOM   3764 N  NH2   . ARG F 3 112 ? 89.379  56.947 -68.329  1.00 46.68  ? 112  ARG B NH2   1 
ATOM   3765 N  N     . PRO F 3 113 ? 90.965  56.721 -75.297  1.00 50.12  ? 113  PRO B N     1 
ATOM   3766 C  CA    . PRO F 3 113 ? 92.196  56.069 -75.763  1.00 50.40  ? 113  PRO B CA    1 
ATOM   3767 C  C     . PRO F 3 113 ? 92.381  54.617 -75.286  1.00 50.65  ? 113  PRO B C     1 
ATOM   3768 O  O     . PRO F 3 113 ? 92.707  53.719 -76.077  1.00 48.08  ? 113  PRO B O     1 
ATOM   3769 C  CB    . PRO F 3 113 ? 93.282  57.009 -75.246  1.00 39.90  ? 113  PRO B CB    1 
ATOM   3770 C  CG    . PRO F 3 113 ? 92.623  58.353 -75.391  1.00 38.80  ? 113  PRO B CG    1 
ATOM   3771 C  CD    . PRO F 3 113 ? 91.231  58.102 -74.842  1.00 37.73  ? 113  PRO B CD    1 
ATOM   3772 N  N     . GLU F 3 114 ? 92.167  54.400 -73.991  1.00 64.74  ? 114  GLU B N     1 
ATOM   3773 C  CA    . GLU F 3 114 ? 92.302  53.076 -73.386  1.00 65.68  ? 114  GLU B CA    1 
ATOM   3774 C  C     . GLU F 3 114 ? 91.051  52.236 -73.631  1.00 67.18  ? 114  GLU B C     1 
ATOM   3775 O  O     . GLU F 3 114 ? 90.953  51.097 -73.168  1.00 66.91  ? 114  GLU B O     1 
ATOM   3776 C  CB    . GLU F 3 114 ? 92.551  53.210 -71.878  1.00 51.90  ? 114  GLU B CB    1 
ATOM   3777 C  CG    . GLU F 3 114 ? 93.898  53.828 -71.514  1.00 51.66  ? 114  GLU B CG    1 
ATOM   3778 C  CD    . GLU F 3 114 ? 94.102  53.991 -70.009  1.00 52.39  ? 114  GLU B CD    1 
ATOM   3779 O  OE1   . GLU F 3 114 ? 93.654  55.010 -69.440  1.00 51.71  ? 114  GLU B OE1   1 
ATOM   3780 O  OE2   . GLU F 3 114 ? 94.708  53.094 -69.386  1.00 52.92  ? 114  GLU B OE2   1 
ATOM   3781 N  N     . GLN F 3 115 ? 90.096  52.810 -74.360  1.00 42.44  ? 115  GLN B N     1 
ATOM   3782 C  CA    . GLN F 3 115 ? 88.847  52.130 -74.681  1.00 42.12  ? 115  GLN B CA    1 
ATOM   3783 C  C     . GLN F 3 115 ? 88.777  51.884 -76.179  1.00 42.07  ? 115  GLN B C     1 
ATOM   3784 O  O     . GLN F 3 115 ? 88.097  50.970 -76.637  1.00 41.63  ? 115  GLN B O     1 
ATOM   3785 C  CB    . GLN F 3 115 ? 87.663  52.989 -74.233  1.00 81.35  ? 115  GLN B CB    1 
ATOM   3786 C  CG    . GLN F 3 115 ? 86.309  52.332 -74.416  1.00 81.45  ? 115  GLN B CG    1 
ATOM   3787 C  CD    . GLN F 3 115 ? 85.184  53.129 -73.794  1.00 80.74  ? 115  GLN B CD    1 
ATOM   3788 O  OE1   . GLN F 3 115 ? 84.021  52.739 -73.872  1.00 81.15  ? 115  GLN B OE1   1 
ATOM   3789 N  NE2   . GLN F 3 115 ? 85.524  54.252 -73.170  1.00 79.78  ? 115  GLN B NE2   1 
ATOM   3790 N  N     . LEU F 3 116 ? 89.487  52.712 -76.940  1.00 52.08  ? 116  LEU B N     1 
ATOM   3791 C  CA    . LEU F 3 116 ? 89.529  52.586 -78.392  1.00 51.58  ? 116  LEU B CA    1 
ATOM   3792 C  C     . LEU F 3 116 ? 90.151  51.248 -78.728  1.00 51.17  ? 116  LEU B C     1 
ATOM   3793 O  O     . LEU F 3 116 ? 89.454  50.247 -78.868  1.00 52.04  ? 116  LEU B O     1 
ATOM   3794 C  CB    . LEU F 3 116 ? 90.376  53.712 -78.989  1.00 76.40  ? 116  LEU B CB    1 
ATOM   3795 C  CG    . LEU F 3 116 ? 90.543  53.853 -80.507  1.00 77.08  ? 116  LEU B CG    1 
ATOM   3796 C  CD1   . LEU F 3 116 ? 91.133  55.223 -80.793  1.00 77.40  ? 116  LEU B CD1   1 
ATOM   3797 C  CD2   . LEU F 3 116 ? 91.440  52.766 -81.081  1.00 77.14  ? 116  LEU B CD2   1 
ATOM   3798 N  N     . THR F 3 117 ? 91.477  51.258 -78.839  1.00 67.10  ? 117  THR B N     1 
ATOM   3799 C  CA    . THR F 3 117 ? 92.308  50.094 -79.155  1.00 65.64  ? 117  THR B CA    1 
ATOM   3800 C  C     . THR F 3 117 ? 91.735  48.711 -78.822  1.00 64.20  ? 117  THR B C     1 
ATOM   3801 O  O     . THR F 3 117 ? 91.723  47.819 -79.671  1.00 64.68  ? 117  THR B O     1 
ATOM   3802 C  CB    . THR F 3 117 ? 93.656  50.211 -78.436  1.00 50.90  ? 117  THR B CB    1 
ATOM   3803 O  OG1   . THR F 3 117 ? 93.420  50.646 -77.091  1.00 54.03  ? 117  THR B OG1   1 
ATOM   3804 C  CG2   . THR F 3 117 ? 94.579  51.202 -79.144  1.00 51.58  ? 117  THR B CG2   1 
ATOM   3805 N  N     . THR F 3 118 ? 91.272  48.538 -77.585  1.00 45.92  ? 118  THR B N     1 
ATOM   3806 C  CA    . THR F 3 118 ? 90.732  47.263 -77.125  1.00 43.16  ? 118  THR B CA    1 
ATOM   3807 C  C     . THR F 3 118 ? 89.302  46.934 -77.575  1.00 43.82  ? 118  THR B C     1 
ATOM   3808 O  O     . THR F 3 118 ? 88.803  45.836 -77.303  1.00 41.22  ? 118  THR B O     1 
ATOM   3809 C  CB    . THR F 3 118 ? 90.783  47.188 -75.581  1.00 32.81  ? 118  THR B CB    1 
ATOM   3810 O  OG1   . THR F 3 118 ? 90.038  48.284 -75.036  1.00 32.38  ? 118  THR B OG1   1 
ATOM   3811 C  CG2   . THR F 3 118 ? 92.219  47.256 -75.081  1.00 27.97  ? 118  THR B CG2   1 
ATOM   3812 N  N     . HIS F 3 119 ? 88.641  47.876 -78.250  1.00 48.32  ? 119  HIS B N     1 
ATOM   3813 C  CA    . HIS F 3 119 ? 87.268  47.651 -78.717  1.00 47.95  ? 119  HIS B CA    1 
ATOM   3814 C  C     . HIS F 3 119 ? 87.206  46.305 -79.430  1.00 47.68  ? 119  HIS B C     1 
ATOM   3815 O  O     . HIS F 3 119 ? 87.992  46.037 -80.337  1.00 48.70  ? 119  HIS B O     1 
ATOM   3816 C  CB    . HIS F 3 119 ? 86.831  48.783 -79.649  1.00 54.46  ? 119  HIS B CB    1 
ATOM   3817 C  CG    . HIS F 3 119 ? 85.425  48.653 -80.141  1.00 56.12  ? 119  HIS B CG    1 
ATOM   3818 N  ND1   . HIS F 3 119 ? 85.120  48.342 -81.449  1.00 57.55  ? 119  HIS B ND1   1 
ATOM   3819 C  CD2   . HIS F 3 119 ? 84.240  48.790 -79.502  1.00 57.71  ? 119  HIS B CD2   1 
ATOM   3820 C  CE1   . HIS F 3 119 ? 83.807  48.296 -81.595  1.00 58.34  ? 119  HIS B CE1   1 
ATOM   3821 N  NE2   . HIS F 3 119 ? 83.250  48.564 -80.428  1.00 58.94  ? 119  HIS B NE2   1 
ATOM   3822 N  N     . PRO F 3 120 ? 86.266  45.438 -79.028  1.00 62.58  ? 120  PRO B N     1 
ATOM   3823 C  CA    . PRO F 3 120 ? 86.144  44.111 -79.652  1.00 62.17  ? 120  PRO B CA    1 
ATOM   3824 C  C     . PRO F 3 120 ? 86.179  44.042 -81.183  1.00 62.49  ? 120  PRO B C     1 
ATOM   3825 O  O     . PRO F 3 120 ? 86.831  43.159 -81.740  1.00 65.21  ? 120  PRO B O     1 
ATOM   3826 C  CB    . PRO F 3 120 ? 84.858  43.542 -79.042  1.00 36.30  ? 120  PRO B CB    1 
ATOM   3827 C  CG    . PRO F 3 120 ? 84.099  44.782 -78.567  1.00 36.86  ? 120  PRO B CG    1 
ATOM   3828 C  CD    . PRO F 3 120 ? 85.163  45.707 -78.085  1.00 36.35  ? 120  PRO B CD    1 
ATOM   3829 N  N     . PHE F 3 121 ? 85.502  44.956 -81.872  1.00 44.20  ? 121  PHE B N     1 
ATOM   3830 C  CA    . PHE F 3 121 ? 85.529  44.934 -83.332  1.00 43.95  ? 121  PHE B CA    1 
ATOM   3831 C  C     . PHE F 3 121 ? 86.842  45.490 -83.866  1.00 43.21  ? 121  PHE B C     1 
ATOM   3832 O  O     . PHE F 3 121 ? 87.397  44.971 -84.827  1.00 43.60  ? 121  PHE B O     1 
ATOM   3833 C  CB    . PHE F 3 121 ? 84.366  45.747 -83.920  1.00 52.78  ? 121  PHE B CB    1 
ATOM   3834 C  CG    . PHE F 3 121 ? 84.360  45.792 -85.429  1.00 52.34  ? 121  PHE B CG    1 
ATOM   3835 C  CD1   . PHE F 3 121 ? 84.348  44.616 -86.176  1.00 53.12  ? 121  PHE B CD1   1 
ATOM   3836 C  CD2   . PHE F 3 121 ? 84.393  47.008 -86.106  1.00 52.31  ? 121  PHE B CD2   1 
ATOM   3837 C  CE1   . PHE F 3 121 ? 84.371  44.651 -87.585  1.00 53.34  ? 121  PHE B CE1   1 
ATOM   3838 C  CE2   . PHE F 3 121 ? 84.417  47.050 -87.514  1.00 52.45  ? 121  PHE B CE2   1 
ATOM   3839 C  CZ    . PHE F 3 121 ? 84.407  45.870 -88.250  1.00 50.69  ? 121  PHE B CZ    1 
ATOM   3840 N  N     . LEU F 3 122 ? 87.334  46.548 -83.233  1.00 47.27  ? 122  LEU B N     1 
ATOM   3841 C  CA    . LEU F 3 122 ? 88.579  47.191 -83.648  1.00 47.55  ? 122  LEU B CA    1 
ATOM   3842 C  C     . LEU F 3 122 ? 89.840  46.357 -83.389  1.00 46.72  ? 122  LEU B C     1 
ATOM   3843 O  O     . LEU F 3 122 ? 90.834  46.490 -84.105  1.00 45.58  ? 122  LEU B O     1 
ATOM   3844 C  CB    . LEU F 3 122 ? 88.703  48.563 -82.972  1.00 64.38  ? 122  LEU B CB    1 
ATOM   3845 C  CG    . LEU F 3 122 ? 87.546  49.535 -83.246  1.00 64.27  ? 122  LEU B CG    1 
ATOM   3846 C  CD1   . LEU F 3 122 ? 87.797  50.863 -82.548  1.00 65.42  ? 122  LEU B CD1   1 
ATOM   3847 C  CD2   . LEU F 3 122 ? 87.404  49.742 -84.740  1.00 64.19  ? 122  LEU B CD2   1 
ATOM   3848 N  N     . GLN F 3 123 ? 89.800  45.498 -82.375  1.00 32.53  ? 123  GLN B N     1 
ATOM   3849 C  CA    . GLN F 3 123 ? 90.944  44.644 -82.056  1.00 32.54  ? 123  GLN B CA    1 
ATOM   3850 C  C     . GLN F 3 123 ? 90.943  43.367 -82.891  1.00 31.58  ? 123  GLN B C     1 
ATOM   3851 O  O     . GLN F 3 123 ? 91.984  42.737 -83.074  1.00 30.77  ? 123  GLN B O     1 
ATOM   3852 C  CB    . GLN F 3 123 ? 90.931  44.298 -80.554  1.00 50.76  ? 123  GLN B CB    1 
ATOM   3853 C  CG    . GLN F 3 123 ? 91.577  42.968 -80.143  1.00 50.20  ? 123  GLN B CG    1 
ATOM   3854 C  CD    . GLN F 3 123 ? 90.757  41.762 -80.574  1.00 53.18  ? 123  GLN B CD    1 
ATOM   3855 O  OE1   . GLN F 3 123 ? 89.523  41.796 -80.555  1.00 53.72  ? 123  GLN B OE1   1 
ATOM   3856 N  NE2   . GLN F 3 123 ? 91.436  40.688 -80.956  1.00 53.36  ? 123  GLN B NE2   1 
ATOM   3857 N  N     . ARG F 3 124 ? 89.779  43.013 -83.426  1.00 40.29  ? 124  ARG B N     1 
ATOM   3858 C  CA    . ARG F 3 124 ? 89.628  41.790 -84.204  1.00 40.42  ? 124  ARG B CA    1 
ATOM   3859 C  C     . ARG F 3 124 ? 89.817  41.849 -85.727  1.00 39.35  ? 124  ARG B C     1 
ATOM   3860 O  O     . ARG F 3 124 ? 90.013  40.808 -86.354  1.00 39.62  ? 124  ARG B O     1 
ATOM   3861 C  CB    . ARG F 3 124 ? 88.256  41.194 -83.904  1.00 53.67  ? 124  ARG B CB    1 
ATOM   3862 C  CG    . ARG F 3 124 ? 88.038  39.796 -84.413  1.00 55.63  ? 124  ARG B CG    1 
ATOM   3863 C  CD    . ARG F 3 124 ? 86.588  39.438 -84.260  1.00 57.88  ? 124  ARG B CD    1 
ATOM   3864 N  NE    . ARG F 3 124 ? 85.769  40.328 -85.075  1.00 63.78  ? 124  ARG B NE    1 
ATOM   3865 C  CZ    . ARG F 3 124 ? 85.745  40.311 -86.406  1.00 65.25  ? 124  ARG B CZ    1 
ATOM   3866 N  NH1   . ARG F 3 124 ? 86.492  39.438 -87.072  1.00 65.70  ? 124  ARG B NH1   1 
ATOM   3867 N  NH2   . ARG F 3 124 ? 84.988  41.175 -87.072  1.00 64.84  ? 124  ARG B NH2   1 
ATOM   3868 N  N     . VAL F 3 125 ? 89.769  43.037 -86.320  1.00 30.57  ? 125  VAL B N     1 
ATOM   3869 C  CA    . VAL F 3 125 ? 89.899  43.160 -87.773  1.00 30.89  ? 125  VAL B CA    1 
ATOM   3870 C  C     . VAL F 3 125 ? 91.316  43.348 -88.333  1.00 31.41  ? 125  VAL B C     1 
ATOM   3871 O  O     . VAL F 3 125 ? 92.071  44.206 -87.878  1.00 30.86  ? 125  VAL B O     1 
ATOM   3872 C  CB    . VAL F 3 125 ? 89.030  44.325 -88.326  1.00 37.76  ? 125  VAL B CB    1 
ATOM   3873 C  CG1   . VAL F 3 125 ? 87.582  44.069 -88.048  1.00 39.52  ? 125  VAL B CG1   1 
ATOM   3874 C  CG2   . VAL F 3 125 ? 89.457  45.637 -87.704  1.00 40.99  ? 125  VAL B CG2   1 
ATOM   3875 N  N     . GLY F 3 126 ? 91.640  42.554 -89.353  1.00 43.11  ? 126  GLY B N     1 
ATOM   3876 C  CA    . GLY F 3 126 ? 92.940  42.622 -89.988  1.00 44.36  ? 126  GLY B CA    1 
ATOM   3877 C  C     . GLY F 3 126 ? 93.158  43.878 -90.809  1.00 45.96  ? 126  GLY B C     1 
ATOM   3878 O  O     . GLY F 3 126 ? 92.356  44.802 -90.725  1.00 45.83  ? 126  GLY B O     1 
ATOM   3879 N  N     . PRO F 3 127 ? 94.241  43.932 -91.616  1.00 44.94  ? 127  PRO B N     1 
ATOM   3880 C  CA    . PRO F 3 127 ? 94.658  45.035 -92.494  1.00 44.21  ? 127  PRO B CA    1 
ATOM   3881 C  C     . PRO F 3 127 ? 93.554  45.651 -93.357  1.00 44.27  ? 127  PRO B C     1 
ATOM   3882 O  O     . PRO F 3 127 ? 92.679  44.946 -93.864  1.00 44.34  ? 127  PRO B O     1 
ATOM   3883 C  CB    . PRO F 3 127 ? 95.752  44.395 -93.345  1.00 39.29  ? 127  PRO B CB    1 
ATOM   3884 C  CG    . PRO F 3 127 ? 96.360  43.421 -92.418  1.00 39.51  ? 127  PRO B CG    1 
ATOM   3885 C  CD    . PRO F 3 127 ? 95.171  42.795 -91.748  1.00 41.17  ? 127  PRO B CD    1 
ATOM   3886 N  N     . ASP F 3 128 ? 93.628  46.971 -93.526  1.00 44.00  ? 128  ASP B N     1 
ATOM   3887 C  CA    . ASP F 3 128 ? 92.676  47.753 -94.318  1.00 44.02  ? 128  ASP B CA    1 
ATOM   3888 C  C     . ASP F 3 128 ? 93.117  47.759 -95.788  1.00 44.84  ? 128  ASP B C     1 
ATOM   3889 O  O     . ASP F 3 128 ? 94.189  48.286 -96.114  1.00 43.82  ? 128  ASP B O     1 
ATOM   3890 C  CB    . ASP F 3 128 ? 92.627  49.187 -93.764  1.00 55.81  ? 128  ASP B CB    1 
ATOM   3891 C  CG    . ASP F 3 128 ? 91.802  50.134 -94.624  1.00 58.04  ? 128  ASP B CG    1 
ATOM   3892 O  OD1   . ASP F 3 128 ? 92.193  50.374 -95.787  1.00 56.16  ? 128  ASP B OD1   1 
ATOM   3893 O  OD2   . ASP F 3 128 ? 90.768  50.646 -94.136  1.00 59.63  ? 128  ASP B OD2   1 
ATOM   3894 N  N     . VAL F 3 129 ? 92.303  47.183 -96.675  1.00 40.61  ? 129  VAL B N     1 
ATOM   3895 C  CA    . VAL F 3 129 ? 92.679  47.125 -98.087  1.00 40.33  ? 129  VAL B CA    1 
ATOM   3896 C  C     . VAL F 3 129 ? 93.043  48.476 -98.715  1.00 42.37  ? 129  VAL B C     1 
ATOM   3897 O  O     . VAL F 3 129 ? 93.787  48.524 -99.697  1.00 42.06  ? 129  VAL B O     1 
ATOM   3898 C  CB    . VAL F 3 129 ? 91.577  46.476 -98.954  1.00 26.61  ? 129  VAL B CB    1 
ATOM   3899 C  CG1   . VAL F 3 129 ? 91.311  45.084 -98.488  1.00 26.10  ? 129  VAL B CG1   1 
ATOM   3900 C  CG2   . VAL F 3 129 ? 90.310  47.293 -98.891  1.00 27.25  ? 129  VAL B CG2   1 
ATOM   3901 N  N     . LEU F 3 130 ? 92.529  49.569 -98.156  1.00 52.18  ? 130  LEU B N     1 
ATOM   3902 C  CA    . LEU F 3 130 ? 92.821  50.886 -98.708  1.00 53.70  ? 130  LEU B CA    1 
ATOM   3903 C  C     . LEU F 3 130 ? 94.050  51.568 -98.126  1.00 54.72  ? 130  LEU B C     1 
ATOM   3904 O  O     . LEU F 3 130 ? 94.294  52.745 -98.390  1.00 54.86  ? 130  LEU B O     1 
ATOM   3905 C  CB    . LEU F 3 130 ? 91.606  51.804 -98.574  1.00 38.87  ? 130  LEU B CB    1 
ATOM   3906 C  CG    . LEU F 3 130 ? 90.422  51.462 -99.490  1.00 38.71  ? 130  LEU B CG    1 
ATOM   3907 C  CD1   . LEU F 3 130 ? 89.294  52.488 -99.279  1.00 35.83  ? 130  LEU B CD1   1 
ATOM   3908 C  CD2   . LEU F 3 130 ? 90.880  51.451 -100.968 1.00 38.43  ? 130  LEU B CD2   1 
ATOM   3909 N  N     . ASP F 3 131 ? 94.834  50.826 -97.352  1.00 49.95  ? 131  ASP B N     1 
ATOM   3910 C  CA    . ASP F 3 131 ? 96.052  51.375 -96.751  1.00 50.74  ? 131  ASP B CA    1 
ATOM   3911 C  C     . ASP F 3 131 ? 97.224  51.206 -97.712  1.00 50.09  ? 131  ASP B C     1 
ATOM   3912 O  O     . ASP F 3 131 ? 97.633  50.087 -98.026  1.00 49.95  ? 131  ASP B O     1 
ATOM   3913 C  CB    . ASP F 3 131 ? 96.365  50.662 -95.428  1.00 85.63  ? 131  ASP B CB    1 
ATOM   3914 C  CG    . ASP F 3 131 ? 97.415  51.391 -94.597  1.00 85.77  ? 131  ASP B CG    1 
ATOM   3915 O  OD1   . ASP F 3 131 ? 98.526  51.642 -95.110  1.00 86.51  ? 131  ASP B OD1   1 
ATOM   3916 O  OD2   . ASP F 3 131 ? 97.126  51.707 -93.422  1.00 85.27  ? 131  ASP B OD2   1 
ATOM   3917 N  N     . PRO F 3 132 ? 97.792  52.324 -98.179  1.00 54.94  ? 132  PRO B N     1 
ATOM   3918 C  CA    . PRO F 3 132 ? 98.924  52.280 -99.110  1.00 55.06  ? 132  PRO B CA    1 
ATOM   3919 C  C     . PRO F 3 132 ? 100.016 51.328 -98.628  1.00 54.37  ? 132  PRO B C     1 
ATOM   3920 O  O     . PRO F 3 132 ? 100.722 50.719 -99.431  1.00 54.74  ? 132  PRO B O     1 
ATOM   3921 C  CB    . PRO F 3 132 ? 99.392  53.734 -99.150  1.00 59.45  ? 132  PRO B CB    1 
ATOM   3922 C  CG    . PRO F 3 132 ? 98.124  54.501 -98.904  1.00 59.35  ? 132  PRO B CG    1 
ATOM   3923 C  CD    . PRO F 3 132 ? 97.494  53.710 -97.778  1.00 58.88  ? 132  PRO B CD    1 
ATOM   3924 N  N     . ASN F 3 133 ? 100.149 51.210 -97.311  1.00 49.37  ? 133  ASN B N     1 
ATOM   3925 C  CA    . ASN F 3 133 ? 101.143 50.318 -96.734  1.00 47.46  ? 133  ASN B CA    1 
ATOM   3926 C  C     . ASN F 3 133 ? 100.822 48.864 -97.014  1.00 44.93  ? 133  ASN B C     1 
ATOM   3927 O  O     . ASN F 3 133 ? 101.730 48.051 -97.130  1.00 44.72  ? 133  ASN B O     1 
ATOM   3928 C  CB    . ASN F 3 133 ? 101.257 50.519 -95.223  1.00 48.41  ? 133  ASN B CB    1 
ATOM   3929 C  CG    . ASN F 3 133 ? 102.168 51.665 -94.853  1.00 49.01  ? 133  ASN B CG    1 
ATOM   3930 O  OD1   . ASN F 3 133 ? 102.508 51.843 -93.686  1.00 49.60  ? 133  ASN B OD1   1 
ATOM   3931 N  ND2   . ASN F 3 133 ? 102.566 52.452 -95.843  1.00 49.96  ? 133  ASN B ND2   1 
ATOM   3932 N  N     . LEU F 3 134 ? 99.545  48.515 -97.107  1.00 32.50  ? 134  LEU B N     1 
ATOM   3933 C  CA    . LEU F 3 134 ? 99.221  47.118 -97.393  1.00 32.66  ? 134  LEU B CA    1 
ATOM   3934 C  C     . LEU F 3 134 ? 99.625  46.825 -98.846  1.00 32.30  ? 134  LEU B C     1 
ATOM   3935 O  O     . LEU F 3 134 ? 99.087  47.402 -99.781  1.00 31.10  ? 134  LEU B O     1 
ATOM   3936 C  CB    . LEU F 3 134 ? 97.727  46.835 -97.177  1.00 38.57  ? 134  LEU B CB    1 
ATOM   3937 C  CG    . LEU F 3 134 ? 97.303  45.380 -97.421  1.00 37.35  ? 134  LEU B CG    1 
ATOM   3938 C  CD1   . LEU F 3 134 ? 98.219  44.438 -96.638  1.00 36.32  ? 134  LEU B CD1   1 
ATOM   3939 C  CD2   . LEU F 3 134 ? 95.853  45.178 -97.025  1.00 36.31  ? 134  LEU B CD2   1 
ATOM   3940 N  N     . THR F 3 135 ? 100.578 45.919 -99.013  1.00 51.99  ? 135  THR B N     1 
ATOM   3941 C  CA    . THR F 3 135 ? 101.103 45.569 -100.328 1.00 51.92  ? 135  THR B CA    1 
ATOM   3942 C  C     . THR F 3 135 ? 100.707 44.165 -100.779 1.00 52.78  ? 135  THR B C     1 
ATOM   3943 O  O     . THR F 3 135 ? 100.306 43.331 -99.960  1.00 54.53  ? 135  THR B O     1 
ATOM   3944 C  CB    . THR F 3 135 ? 102.650 45.664 -100.324 1.00 40.39  ? 135  THR B CB    1 
ATOM   3945 O  OG1   . THR F 3 135 ? 103.182 44.702 -99.404  1.00 40.86  ? 135  THR B OG1   1 
ATOM   3946 C  CG2   . THR F 3 135 ? 103.109 47.057 -99.887  1.00 37.27  ? 135  THR B CG2   1 
ATOM   3947 N  N     . PRO F 3 136 ? 100.804 43.890 -102.095 1.00 39.97  ? 136  PRO B N     1 
ATOM   3948 C  CA    . PRO F 3 136 ? 100.463 42.581 -102.676 1.00 38.92  ? 136  PRO B CA    1 
ATOM   3949 C  C     . PRO F 3 136 ? 101.233 41.432 -102.024 1.00 39.48  ? 136  PRO B C     1 
ATOM   3950 O  O     . PRO F 3 136 ? 100.659 40.414 -101.632 1.00 40.29  ? 136  PRO B O     1 
ATOM   3951 C  CB    . PRO F 3 136 ? 100.828 42.749 -104.149 1.00 29.71  ? 136  PRO B CB    1 
ATOM   3952 C  CG    . PRO F 3 136 ? 100.517 44.188 -104.413 1.00 30.07  ? 136  PRO B CG    1 
ATOM   3953 C  CD    . PRO F 3 136 ? 101.037 44.894 -103.156 1.00 30.94  ? 136  PRO B CD    1 
ATOM   3954 N  N     . GLU F 3 137 ? 102.540 41.608 -101.912 1.00 45.58  ? 137  GLU B N     1 
ATOM   3955 C  CA    . GLU F 3 137 ? 103.400 40.610 -101.308 1.00 47.02  ? 137  GLU B CA    1 
ATOM   3956 C  C     . GLU F 3 137 ? 102.925 40.275 -99.885  1.00 47.36  ? 137  GLU B C     1 
ATOM   3957 O  O     . GLU F 3 137 ? 103.010 39.128 -99.448  1.00 47.93  ? 137  GLU B O     1 
ATOM   3958 C  CB    . GLU F 3 137 ? 104.856 41.118 -101.301 1.00 45.30  ? 137  GLU B CB    1 
ATOM   3959 C  CG    . GLU F 3 137 ? 105.449 41.384 -102.705 1.00 46.41  ? 137  GLU B CG    1 
ATOM   3960 C  CD    . GLU F 3 137 ? 105.451 42.867 -103.118 1.00 45.96  ? 137  GLU B CD    1 
ATOM   3961 O  OE1   . GLU F 3 137 ? 104.497 43.599 -102.771 1.00 43.28  ? 137  GLU B OE1   1 
ATOM   3962 O  OE2   . GLU F 3 137 ? 106.407 43.294 -103.807 1.00 45.83  ? 137  GLU B OE2   1 
ATOM   3963 N  N     . VAL F 3 138 ? 102.413 41.276 -99.174  1.00 40.32  ? 138  VAL B N     1 
ATOM   3964 C  CA    . VAL F 3 138 ? 101.916 41.095 -97.811  1.00 39.43  ? 138  VAL B CA    1 
ATOM   3965 C  C     . VAL F 3 138 ? 100.648 40.238 -97.755  1.00 38.85  ? 138  VAL B C     1 
ATOM   3966 O  O     . VAL F 3 138 ? 100.551 39.306 -96.956  1.00 40.27  ? 138  VAL B O     1 
ATOM   3967 C  CB    . VAL F 3 138 ? 101.599 42.467 -97.142  1.00 58.52  ? 138  VAL B CB    1 
ATOM   3968 C  CG1   . VAL F 3 138 ? 100.831 42.254 -95.837  1.00 56.83  ? 138  VAL B CG1   1 
ATOM   3969 C  CG2   . VAL F 3 138 ? 102.884 43.232 -96.871  1.00 56.17  ? 138  VAL B CG2   1 
ATOM   3970 N  N     . VAL F 3 139 ? 99.679  40.578 -98.599  1.00 33.51  ? 139  VAL B N     1 
ATOM   3971 C  CA    . VAL F 3 139 ? 98.405  39.872 -98.658  1.00 32.70  ? 139  VAL B CA    1 
ATOM   3972 C  C     . VAL F 3 139 ? 98.620  38.435 -99.080  1.00 32.98  ? 139  VAL B C     1 
ATOM   3973 O  O     . VAL F 3 139 ? 97.848  37.548 -98.710  1.00 34.07  ? 139  VAL B O     1 
ATOM   3974 C  CB    . VAL F 3 139 ? 97.452  40.532 -99.678  1.00 50.02  ? 139  VAL B CB    1 
ATOM   3975 C  CG1   . VAL F 3 139 ? 96.158  39.736 -99.782  1.00 48.69  ? 139  VAL B CG1   1 
ATOM   3976 C  CG2   . VAL F 3 139 ? 97.184  41.979 -99.281  1.00 47.80  ? 139  VAL B CG2   1 
ATOM   3977 N  N     . LYS F 3 140 ? 99.680  38.214 -99.856  1.00 39.62  ? 140  LYS B N     1 
ATOM   3978 C  CA    . LYS F 3 140 ? 99.999  36.880 -100.342 1.00 38.04  ? 140  LYS B CA    1 
ATOM   3979 C  C     . LYS F 3 140 ? 100.539 36.004 -99.213  1.00 37.15  ? 140  LYS B C     1 
ATOM   3980 O  O     . LYS F 3 140 ? 100.478 34.775 -99.268  1.00 36.07  ? 140  LYS B O     1 
ATOM   3981 C  CB    . LYS F 3 140 ? 100.995 36.962 -101.503 1.00 35.58  ? 140  LYS B CB    1 
ATOM   3982 C  CG    . LYS F 3 140 ? 100.771 35.880 -102.557 1.00 35.63  ? 140  LYS B CG    1 
ATOM   3983 C  CD    . LYS F 3 140 ? 101.847 35.884 -103.646 1.00 36.42  ? 140  LYS B CD    1 
ATOM   3984 C  CE    . LYS F 3 140 ? 101.886 37.197 -104.437 1.00 35.93  ? 140  LYS B CE    1 
ATOM   3985 N  NZ    . LYS F 3 140 ? 103.076 37.267 -105.354 1.00 35.86  ? 140  LYS B NZ    1 
ATOM   3986 N  N     . GLU F 3 141 ? 101.069 36.625 -98.175  1.00 30.12  ? 141  GLU B N     1 
ATOM   3987 C  CA    . GLU F 3 141 ? 101.553 35.811 -97.072  1.00 32.29  ? 141  GLU B CA    1 
ATOM   3988 C  C     . GLU F 3 141 ? 100.428 35.590 -96.061  1.00 32.24  ? 141  GLU B C     1 
ATOM   3989 O  O     . GLU F 3 141 ? 100.405 34.587 -95.350  1.00 31.62  ? 141  GLU B O     1 
ATOM   3990 C  CB    . GLU F 3 141 ? 102.764 36.445 -96.397  1.00 46.10  ? 141  GLU B CB    1 
ATOM   3991 C  CG    . GLU F 3 141 ? 103.453 35.466 -95.468  1.00 48.20  ? 141  GLU B CG    1 
ATOM   3992 C  CD    . GLU F 3 141 ? 103.500 34.037 -96.032  1.00 50.18  ? 141  GLU B CD    1 
ATOM   3993 O  OE1   . GLU F 3 141 ? 104.122 33.812 -97.099  1.00 48.84  ? 141  GLU B OE1   1 
ATOM   3994 O  OE2   . GLU F 3 141 ? 102.906 33.138 -95.392  1.00 45.84  ? 141  GLU B OE2   1 
ATOM   3995 N  N     . ARG F 3 142 ? 99.489  36.531 -96.023  1.00 43.43  ? 142  ARG B N     1 
ATOM   3996 C  CA    . ARG F 3 142 ? 98.350  36.430 -95.134  1.00 44.35  ? 142  ARG B CA    1 
ATOM   3997 C  C     . ARG F 3 142 ? 97.409  35.349 -95.686  1.00 46.50  ? 142  ARG B C     1 
ATOM   3998 O  O     . ARG F 3 142 ? 96.872  34.527 -94.934  1.00 46.20  ? 142  ARG B O     1 
ATOM   3999 C  CB    . ARG F 3 142 ? 97.636  37.781 -95.042  1.00 34.70  ? 142  ARG B CB    1 
ATOM   4000 C  CG    . ARG F 3 142 ? 96.602  37.837 -93.942  1.00 33.69  ? 142  ARG B CG    1 
ATOM   4001 C  CD    . ARG F 3 142 ? 96.026  39.225 -93.767  1.00 36.47  ? 142  ARG B CD    1 
ATOM   4002 N  NE    . ARG F 3 142 ? 95.228  39.316 -92.541  1.00 36.52  ? 142  ARG B NE    1 
ATOM   4003 C  CZ    . ARG F 3 142 ? 95.738  39.364 -91.310  1.00 33.34  ? 142  ARG B CZ    1 
ATOM   4004 N  NH1   . ARG F 3 142 ? 97.051  39.338 -91.112  1.00 28.64  ? 142  ARG B NH1   1 
ATOM   4005 N  NH2   . ARG F 3 142 ? 94.923  39.423 -90.269  1.00 37.16  ? 142  ARG B NH2   1 
ATOM   4006 N  N     . LEU F 3 143 ? 97.215  35.360 -97.006  1.00 47.32  ? 143  LEU B N     1 
ATOM   4007 C  CA    . LEU F 3 143 ? 96.376  34.370 -97.679  1.00 46.67  ? 143  LEU B CA    1 
ATOM   4008 C  C     . LEU F 3 143 ? 96.976  32.982 -97.434  1.00 45.97  ? 143  LEU B C     1 
ATOM   4009 O  O     . LEU F 3 143 ? 96.264  32.023 -97.128  1.00 46.79  ? 143  LEU B O     1 
ATOM   4010 C  CB    . LEU F 3 143 ? 96.341  34.638 -99.190  1.00 51.96  ? 143  LEU B CB    1 
ATOM   4011 C  CG    . LEU F 3 143 ? 95.671  35.903 -99.737  1.00 53.61  ? 143  LEU B CG    1 
ATOM   4012 C  CD1   . LEU F 3 143 ? 96.338  36.298 -101.051 1.00 52.73  ? 143  LEU B CD1   1 
ATOM   4013 C  CD2   . LEU F 3 143 ? 94.180  35.669 -99.926  1.00 52.98  ? 143  LEU B CD2   1 
ATOM   4014 N  N     . LEU F 3 144 ? 98.296  32.891 -97.582  1.00 38.72  ? 144  LEU B N     1 
ATOM   4015 C  CA    . LEU F 3 144 ? 99.013  31.641 -97.384  1.00 38.11  ? 144  LEU B CA    1 
ATOM   4016 C  C     . LEU F 3 144 ? 99.218  31.380 -95.897  1.00 38.08  ? 144  LEU B C     1 
ATOM   4017 O  O     . LEU F 3 144 ? 99.414  30.247 -95.485  1.00 39.11  ? 144  LEU B O     1 
ATOM   4018 C  CB    . LEU F 3 144 ? 100.366 31.690 -98.097  1.00 44.41  ? 144  LEU B CB    1 
ATOM   4019 C  CG    . LEU F 3 144 ? 100.387 31.816 -99.627  1.00 46.70  ? 144  LEU B CG    1 
ATOM   4020 C  CD1   . LEU F 3 144 ? 101.833 31.940 -100.080 1.00 45.36  ? 144  LEU B CD1   1 
ATOM   4021 C  CD2   . LEU F 3 144 ? 99.725  30.593 -100.294 1.00 45.54  ? 144  LEU B CD2   1 
ATOM   4022 N  N     . SER F 3 145 ? 99.156  32.435 -95.093  1.00 35.75  ? 145  SER B N     1 
ATOM   4023 C  CA    . SER F 3 145 ? 99.324  32.317 -93.646  1.00 35.16  ? 145  SER B CA    1 
ATOM   4024 C  C     . SER F 3 145 ? 98.554  31.132 -93.078  1.00 34.94  ? 145  SER B C     1 
ATOM   4025 O  O     . SER F 3 145 ? 97.439  30.836 -93.498  1.00 35.18  ? 145  SER B O     1 
ATOM   4026 C  CB    . SER F 3 145 ? 98.848  33.586 -92.944  1.00 33.15  ? 145  SER B CB    1 
ATOM   4027 O  OG    . SER F 3 145 ? 97.527  33.421 -92.458  1.00 29.82  ? 145  SER B OG    1 
ATOM   4028 N  N     . PRO F 3 146 ? 99.136  30.448 -92.091  1.00 43.51  ? 146  PRO B N     1 
ATOM   4029 C  CA    . PRO F 3 146 ? 98.456  29.289 -91.495  1.00 44.93  ? 146  PRO B CA    1 
ATOM   4030 C  C     . PRO F 3 146 ? 97.047  29.599 -90.947  1.00 45.94  ? 146  PRO B C     1 
ATOM   4031 O  O     . PRO F 3 146 ? 96.239  28.693 -90.725  1.00 45.37  ? 146  PRO B O     1 
ATOM   4032 C  CB    . PRO F 3 146 ? 99.429  28.849 -90.399  1.00 28.95  ? 146  PRO B CB    1 
ATOM   4033 C  CG    . PRO F 3 146 ? 100.780 29.373 -90.905  1.00 29.14  ? 146  PRO B CG    1 
ATOM   4034 C  CD    . PRO F 3 146 ? 100.441 30.703 -91.456  1.00 25.28  ? 146  PRO B CD    1 
ATOM   4035 N  N     . ARG F 3 147 ? 96.757  30.887 -90.758  1.00 50.87  ? 147  ARG B N     1 
ATOM   4036 C  CA    . ARG F 3 147 ? 95.471  31.339 -90.220  1.00 51.60  ? 147  ARG B CA    1 
ATOM   4037 C  C     . ARG F 3 147 ? 94.369  31.541 -91.269  1.00 51.90  ? 147  ARG B C     1 
ATOM   4038 O  O     . ARG F 3 147 ? 93.182  31.531 -90.934  1.00 52.68  ? 147  ARG B O     1 
ATOM   4039 C  CB    . ARG F 3 147 ? 95.681  32.643 -89.434  1.00 42.23  ? 147  ARG B CB    1 
ATOM   4040 C  CG    . ARG F 3 147 ? 94.485  33.123 -88.618  1.00 38.93  ? 147  ARG B CG    1 
ATOM   4041 C  CD    . ARG F 3 147 ? 94.713  34.542 -88.137  1.00 35.97  ? 147  ARG B CD    1 
ATOM   4042 N  NE    . ARG F 3 147 ? 93.520  35.156 -87.545  1.00 33.85  ? 147  ARG B NE    1 
ATOM   4043 C  CZ    . ARG F 3 147 ? 93.371  36.468 -87.400  1.00 30.86  ? 147  ARG B CZ    1 
ATOM   4044 N  NH1   . ARG F 3 147 ? 94.326  37.293 -87.800  1.00 29.92  ? 147  ARG B NH1   1 
ATOM   4045 N  NH2   . ARG F 3 147 ? 92.284  36.960 -86.854  1.00 29.10  ? 147  ARG B NH2   1 
ATOM   4046 N  N     . PHE F 3 148 ? 94.751  31.717 -92.533  1.00 53.56  ? 148  PHE B N     1 
ATOM   4047 C  CA    . PHE F 3 148 ? 93.764  31.928 -93.594  1.00 55.11  ? 148  PHE B CA    1 
ATOM   4048 C  C     . PHE F 3 148 ? 93.936  31.042 -94.834  1.00 56.83  ? 148  PHE B C     1 
ATOM   4049 O  O     . PHE F 3 148 ? 93.143  31.133 -95.782  1.00 58.70  ? 148  PHE B O     1 
ATOM   4050 C  CB    . PHE F 3 148 ? 93.758  33.404 -94.010  1.00 35.70  ? 148  PHE B CB    1 
ATOM   4051 C  CG    . PHE F 3 148 ? 93.444  34.344 -92.887  1.00 35.00  ? 148  PHE B CG    1 
ATOM   4052 C  CD1   . PHE F 3 148 ? 92.198  34.327 -92.282  1.00 35.80  ? 148  PHE B CD1   1 
ATOM   4053 C  CD2   . PHE F 3 148 ? 94.400  35.241 -92.424  1.00 34.57  ? 148  PHE B CD2   1 
ATOM   4054 C  CE1   . PHE F 3 148 ? 91.903  35.183 -91.236  1.00 37.17  ? 148  PHE B CE1   1 
ATOM   4055 C  CE2   . PHE F 3 148 ? 94.112  36.109 -91.373  1.00 35.09  ? 148  PHE B CE2   1 
ATOM   4056 C  CZ    . PHE F 3 148 ? 92.857  36.076 -90.780  1.00 36.92  ? 148  PHE B CZ    1 
ATOM   4057 N  N     . ARG F 3 149 ? 94.960  30.187 -94.821  1.00 52.29  ? 149  ARG B N     1 
ATOM   4058 C  CA    . ARG F 3 149 ? 95.238  29.268 -95.933  1.00 53.13  ? 149  ARG B CA    1 
ATOM   4059 C  C     . ARG F 3 149 ? 94.088  28.282 -96.199  1.00 53.24  ? 149  ARG B C     1 
ATOM   4060 O  O     . ARG F 3 149 ? 93.732  28.050 -97.350  1.00 52.11  ? 149  ARG B O     1 
ATOM   4061 C  CB    . ARG F 3 149 ? 96.531  28.474 -95.663  1.00 54.86  ? 149  ARG B CB    1 
ATOM   4062 C  CG    . ARG F 3 149 ? 96.517  27.671 -94.354  1.00 56.32  ? 149  ARG B CG    1 
ATOM   4063 C  CD    . ARG F 3 149 ? 97.779  26.820 -94.135  1.00 57.10  ? 149  ARG B CD    1 
ATOM   4064 N  NE    . ARG F 3 149 ? 97.848  25.657 -95.017  1.00 59.71  ? 149  ARG B NE    1 
ATOM   4065 C  CZ    . ARG F 3 149 ? 98.553  24.557 -94.758  1.00 60.86  ? 149  ARG B CZ    1 
ATOM   4066 N  NH1   . ARG F 3 149 ? 99.253  24.465 -93.632  1.00 59.16  ? 149  ARG B NH1   1 
ATOM   4067 N  NH2   . ARG F 3 149 ? 98.563  23.549 -95.626  1.00 60.86  ? 149  ARG B NH2   1 
ATOM   4068 N  N     . ASN F 3 150 ? 93.508  27.712 -95.140  1.00 48.21  ? 150  ASN B N     1 
ATOM   4069 C  CA    . ASN F 3 150 ? 92.418  26.747 -95.293  1.00 47.53  ? 150  ASN B CA    1 
ATOM   4070 C  C     . ASN F 3 150 ? 91.012  27.341 -95.314  1.00 46.58  ? 150  ASN B C     1 
ATOM   4071 O  O     . ASN F 3 150 ? 90.031  26.608 -95.306  1.00 47.51  ? 150  ASN B O     1 
ATOM   4072 C  CB    . ASN F 3 150 ? 92.484  25.691 -94.197  1.00 56.94  ? 150  ASN B CB    1 
ATOM   4073 C  CG    . ASN F 3 150 ? 92.414  24.289 -94.750  1.00 58.73  ? 150  ASN B CG    1 
ATOM   4074 O  OD1   . ASN F 3 150 ? 93.436  23.606 -94.880  1.00 57.63  ? 150  ASN B OD1   1 
ATOM   4075 N  ND2   . ASN F 3 150 ? 91.209  23.853 -95.103  1.00 57.57  ? 150  ASN B ND2   1 
ATOM   4076 N  N     . ARG F 3 151 ? 90.914  28.663 -95.336  1.00 58.90  ? 151  ARG B N     1 
ATOM   4077 C  CA    . ARG F 3 151 ? 89.614  29.316 -95.370  1.00 59.06  ? 151  ARG B CA    1 
ATOM   4078 C  C     . ARG F 3 151 ? 89.063  29.333 -96.803  1.00 59.78  ? 151  ARG B C     1 
ATOM   4079 O  O     . ARG F 3 151 ? 89.749  29.737 -97.745  1.00 59.82  ? 151  ARG B O     1 
ATOM   4080 C  CB    . ARG F 3 151 ? 89.716  30.762 -94.849  1.00 40.77  ? 151  ARG B CB    1 
ATOM   4081 C  CG    . ARG F 3 151 ? 90.239  30.905 -93.428  1.00 39.63  ? 151  ARG B CG    1 
ATOM   4082 C  CD    . ARG F 3 151 ? 89.332  30.232 -92.391  1.00 38.36  ? 151  ARG B CD    1 
ATOM   4083 N  NE    . ARG F 3 151 ? 88.007  30.845 -92.326  1.00 38.48  ? 151  ARG B NE    1 
ATOM   4084 C  CZ    . ARG F 3 151 ? 87.782  32.129 -92.039  1.00 38.44  ? 151  ARG B CZ    1 
ATOM   4085 N  NH1   . ARG F 3 151 ? 88.796  32.951 -91.777  1.00 38.58  ? 151  ARG B NH1   1 
ATOM   4086 N  NH2   . ARG F 3 151 ? 86.541  32.599 -92.052  1.00 34.71  ? 151  ARG B NH2   1 
ATOM   4087 N  N     . GLN F 3 152 ? 87.830  28.869 -96.967  1.00 49.37  ? 152  GLN B N     1 
ATOM   4088 C  CA    . GLN F 3 152 ? 87.198  28.888 -98.272  1.00 48.76  ? 152  GLN B CA    1 
ATOM   4089 C  C     . GLN F 3 152 ? 87.028  30.375 -98.607  1.00 49.16  ? 152  GLN B C     1 
ATOM   4090 O  O     . GLN F 3 152 ? 86.556  31.139 -97.773  1.00 48.69  ? 152  GLN B O     1 
ATOM   4091 C  CB    . GLN F 3 152 ? 85.827  28.207 -98.204  1.00 47.60  ? 152  GLN B CB    1 
ATOM   4092 C  CG    . GLN F 3 152 ? 85.780  26.758 -98.703  1.00 46.59  ? 152  GLN B CG    1 
ATOM   4093 C  CD    . GLN F 3 152 ? 84.363  26.197 -98.679  1.00 46.87  ? 152  GLN B CD    1 
ATOM   4094 O  OE1   . GLN F 3 152 ? 83.978  25.403 -99.537  1.00 44.62  ? 152  GLN B OE1   1 
ATOM   4095 N  NE2   . GLN F 3 152 ? 83.577  26.613 -97.678  1.00 45.49  ? 152  GLN B NE2   1 
ATOM   4096 N  N     . PHE F 3 153 ? 87.409  30.790 -99.814  1.00 46.91  ? 153  PHE B N     1 
ATOM   4097 C  CA    . PHE F 3 153 ? 87.286  32.200 -100.177 1.00 46.42  ? 153  PHE B CA    1 
ATOM   4098 C  C     . PHE F 3 153 ? 85.852  32.668 -99.997  1.00 46.31  ? 153  PHE B C     1 
ATOM   4099 O  O     . PHE F 3 153 ? 85.545  33.855 -100.140 1.00 44.54  ? 153  PHE B O     1 
ATOM   4100 C  CB    . PHE F 3 153 ? 87.717  32.428 -101.624 1.00 53.80  ? 153  PHE B CB    1 
ATOM   4101 C  CG    . PHE F 3 153 ? 89.101  31.941 -101.929 1.00 55.72  ? 153  PHE B CG    1 
ATOM   4102 C  CD1   . PHE F 3 153 ? 90.084  31.925 -100.941 1.00 54.20  ? 153  PHE B CD1   1 
ATOM   4103 C  CD2   . PHE F 3 153 ? 89.435  31.520 -103.217 1.00 54.20  ? 153  PHE B CD2   1 
ATOM   4104 C  CE1   . PHE F 3 153 ? 91.367  31.500 -101.230 1.00 53.05  ? 153  PHE B CE1   1 
ATOM   4105 C  CE2   . PHE F 3 153 ? 90.725  31.092 -103.511 1.00 54.43  ? 153  PHE B CE2   1 
ATOM   4106 C  CZ    . PHE F 3 153 ? 91.691  31.083 -102.514 1.00 53.07  ? 153  PHE B CZ    1 
ATOM   4107 N  N     . ALA F 3 154 ? 84.984  31.712 -99.684  1.00 43.60  ? 154  ALA B N     1 
ATOM   4108 C  CA    . ALA F 3 154 ? 83.576  31.966 -99.466  1.00 41.92  ? 154  ALA B CA    1 
ATOM   4109 C  C     . ALA F 3 154 ? 83.368  33.001 -98.361  1.00 40.13  ? 154  ALA B C     1 
ATOM   4110 O  O     . ALA F 3 154 ? 82.823  34.079 -98.591  1.00 40.23  ? 154  ALA B O     1 
ATOM   4111 C  CB    . ALA F 3 154 ? 82.885  30.665 -99.103  1.00 39.52  ? 154  ALA B CB    1 
ATOM   4112 N  N     . GLY F 3 155 ? 83.808  32.665 -97.158  1.00 45.62  ? 155  GLY B N     1 
ATOM   4113 C  CA    . GLY F 3 155 ? 83.644  33.574 -96.042  1.00 45.48  ? 155  GLY B CA    1 
ATOM   4114 C  C     . GLY F 3 155 ? 84.771  34.563 -95.849  1.00 45.06  ? 155  GLY B C     1 
ATOM   4115 O  O     . GLY F 3 155 ? 84.547  35.690 -95.417  1.00 44.06  ? 155  GLY B O     1 
ATOM   4116 N  N     . LEU F 3 156 ? 85.981  34.139 -96.178  1.00 33.77  ? 156  LEU B N     1 
ATOM   4117 C  CA    . LEU F 3 156 ? 87.169  34.975 -96.030  1.00 33.99  ? 156  LEU B CA    1 
ATOM   4118 C  C     . LEU F 3 156 ? 86.989  36.402 -96.552  1.00 33.87  ? 156  LEU B C     1 
ATOM   4119 O  O     . LEU F 3 156 ? 87.297  37.374 -95.857  1.00 33.45  ? 156  LEU B O     1 
ATOM   4120 C  CB    . LEU F 3 156 ? 88.358  34.323 -96.741  1.00 47.61  ? 156  LEU B CB    1 
ATOM   4121 C  CG    . LEU F 3 156 ? 89.733  34.822 -96.292  1.00 48.85  ? 156  LEU B CG    1 
ATOM   4122 C  CD1   . LEU F 3 156 ? 89.960  34.400 -94.841  1.00 47.81  ? 156  LEU B CD1   1 
ATOM   4123 C  CD2   . LEU F 3 156 ? 90.825  34.257 -97.198  1.00 47.05  ? 156  LEU B CD2   1 
ATOM   4124 N  N     . LEU F 3 157 ? 86.496  36.522 -97.777  1.00 43.48  ? 157  LEU B N     1 
ATOM   4125 C  CA    . LEU F 3 157 ? 86.288  37.825 -98.408  1.00 45.18  ? 157  LEU B CA    1 
ATOM   4126 C  C     . LEU F 3 157 ? 85.317  38.710 -97.627  1.00 46.61  ? 157  LEU B C     1 
ATOM   4127 O  O     . LEU F 3 157 ? 85.294  39.932 -97.793  1.00 46.59  ? 157  LEU B O     1 
ATOM   4128 C  CB    . LEU F 3 157 ? 85.773  37.620 -99.827  1.00 41.43  ? 157  LEU B CB    1 
ATOM   4129 C  CG    . LEU F 3 157 ? 86.667  36.759 -100.722 1.00 43.50  ? 157  LEU B CG    1 
ATOM   4130 C  CD1   . LEU F 3 157 ? 85.851  36.249 -101.890 1.00 44.96  ? 157  LEU B CD1   1 
ATOM   4131 C  CD2   . LEU F 3 157 ? 87.877  37.551 -101.197 1.00 42.07  ? 157  LEU B CD2   1 
ATOM   4132 N  N     . LEU F 3 158 ? 84.514  38.084 -96.770  1.00 51.85  ? 158  LEU B N     1 
ATOM   4133 C  CA    . LEU F 3 158 ? 83.550  38.813 -95.962  1.00 50.72  ? 158  LEU B CA    1 
ATOM   4134 C  C     . LEU F 3 158 ? 84.056  38.979 -94.527  1.00 51.94  ? 158  LEU B C     1 
ATOM   4135 O  O     . LEU F 3 158 ? 83.482  39.745 -93.752  1.00 52.15  ? 158  LEU B O     1 
ATOM   4136 C  CB    . LEU F 3 158 ? 82.218  38.066 -95.945  1.00 39.76  ? 158  LEU B CB    1 
ATOM   4137 C  CG    . LEU F 3 158 ? 81.589  37.625 -97.273  1.00 40.84  ? 158  LEU B CG    1 
ATOM   4138 C  CD1   . LEU F 3 158 ? 80.213  37.078 -96.950  1.00 38.45  ? 158  LEU B CD1   1 
ATOM   4139 C  CD2   . LEU F 3 158 ? 81.479  38.782 -98.286  1.00 38.81  ? 158  LEU B CD2   1 
ATOM   4140 N  N     . ASP F 3 159 ? 85.127  38.257 -94.189  1.00 31.77  ? 159  ASP B N     1 
ATOM   4141 C  CA    . ASP F 3 159 ? 85.726  38.286 -92.855  1.00 31.67  ? 159  ASP B CA    1 
ATOM   4142 C  C     . ASP F 3 159 ? 86.627  39.506 -92.677  1.00 31.50  ? 159  ASP B C     1 
ATOM   4143 O  O     . ASP F 3 159 ? 87.528  39.747 -93.471  1.00 34.47  ? 159  ASP B O     1 
ATOM   4144 C  CB    . ASP F 3 159 ? 86.543  37.012 -92.622  1.00 52.09  ? 159  ASP B CB    1 
ATOM   4145 C  CG    . ASP F 3 159 ? 86.991  36.861 -91.184  1.00 53.01  ? 159  ASP B CG    1 
ATOM   4146 O  OD1   . ASP F 3 159 ? 87.257  37.896 -90.541  1.00 55.37  ? 159  ASP B OD1   1 
ATOM   4147 O  OD2   . ASP F 3 159 ? 87.088  35.712 -90.703  1.00 52.13  ? 159  ASP B OD2   1 
ATOM   4148 N  N     . GLN F 3 160 ? 86.394  40.268 -91.620  1.00 40.57  ? 160  GLN B N     1 
ATOM   4149 C  CA    . GLN F 3 160 ? 87.175  41.473 -91.385  1.00 39.80  ? 160  GLN B CA    1 
ATOM   4150 C  C     . GLN F 3 160 ? 88.457  41.162 -90.628  1.00 40.45  ? 160  GLN B C     1 
ATOM   4151 O  O     . GLN F 3 160 ? 89.323  42.013 -90.477  1.00 38.47  ? 160  GLN B O     1 
ATOM   4152 C  CB    . GLN F 3 160 ? 86.322  42.490 -90.620  1.00 36.10  ? 160  GLN B CB    1 
ATOM   4153 C  CG    . GLN F 3 160 ? 85.060  42.893 -91.363  1.00 31.88  ? 160  GLN B CG    1 
ATOM   4154 C  CD    . GLN F 3 160 ? 85.372  43.640 -92.630  1.00 30.81  ? 160  GLN B CD    1 
ATOM   4155 O  OE1   . GLN F 3 160 ? 85.927  44.735 -92.587  1.00 31.47  ? 160  GLN B OE1   1 
ATOM   4156 N  NE2   . GLN F 3 160 ? 85.024  43.059 -93.768  1.00 31.73  ? 160  GLN B NE2   1 
ATOM   4157 N  N     . ALA F 3 161 ? 88.570  39.926 -90.155  1.00 42.61  ? 161  ALA B N     1 
ATOM   4158 C  CA    . ALA F 3 161 ? 89.756  39.487 -89.435  1.00 41.85  ? 161  ALA B CA    1 
ATOM   4159 C  C     . ALA F 3 161 ? 90.877  39.299 -90.447  1.00 42.05  ? 161  ALA B C     1 
ATOM   4160 O  O     . ALA F 3 161 ? 92.059  39.399 -90.121  1.00 39.78  ? 161  ALA B O     1 
ATOM   4161 C  CB    . ALA F 3 161 ? 89.471  38.185 -88.732  1.00 23.02  ? 161  ALA B CB    1 
ATOM   4162 N  N     . PHE F 3 162 ? 90.483  39.029 -91.689  1.00 58.68  ? 162  PHE B N     1 
ATOM   4163 C  CA    . PHE F 3 162 ? 91.433  38.822 -92.764  1.00 58.46  ? 162  PHE B CA    1 
ATOM   4164 C  C     . PHE F 3 162 ? 91.806  40.131 -93.456  1.00 57.53  ? 162  PHE B C     1 
ATOM   4165 O  O     . PHE F 3 162 ? 92.961  40.552 -93.418  1.00 56.89  ? 162  PHE B O     1 
ATOM   4166 C  CB    . PHE F 3 162 ? 90.861  37.840 -93.780  1.00 80.12  ? 162  PHE B CB    1 
ATOM   4167 C  CG    . PHE F 3 162 ? 91.791  37.547 -94.920  1.00 85.46  ? 162  PHE B CG    1 
ATOM   4168 C  CD1   . PHE F 3 162 ? 93.079  37.089 -94.678  1.00 85.08  ? 162  PHE B CD1   1 
ATOM   4169 C  CD2   . PHE F 3 162 ? 91.381  37.727 -96.235  1.00 86.43  ? 162  PHE B CD2   1 
ATOM   4170 C  CE1   . PHE F 3 162 ? 93.944  36.817 -95.723  1.00 85.15  ? 162  PHE B CE1   1 
ATOM   4171 C  CE2   . PHE F 3 162 ? 92.243  37.456 -97.289  1.00 87.82  ? 162  PHE B CE2   1 
ATOM   4172 C  CZ    . PHE F 3 162 ? 93.526  37.001 -97.032  1.00 86.58  ? 162  PHE B CZ    1 
ATOM   4173 N  N     . LEU F 3 163 ? 90.829  40.771 -94.088  1.00 64.61  ? 163  LEU B N     1 
ATOM   4174 C  CA    . LEU F 3 163 ? 91.071  42.030 -94.785  1.00 63.36  ? 163  LEU B CA    1 
ATOM   4175 C  C     . LEU F 3 163 ? 89.924  43.013 -94.588  1.00 61.64  ? 163  LEU B C     1 
ATOM   4176 O  O     . LEU F 3 163 ? 88.829  42.809 -95.095  1.00 63.20  ? 163  LEU B O     1 
ATOM   4177 C  CB    . LEU F 3 163 ? 91.291  41.773 -96.282  1.00 37.99  ? 163  LEU B CB    1 
ATOM   4178 C  CG    . LEU F 3 163 ? 92.583  41.039 -96.639  1.00 38.20  ? 163  LEU B CG    1 
ATOM   4179 C  CD1   . LEU F 3 163 ? 92.718  40.905 -98.157  1.00 35.84  ? 163  LEU B CD1   1 
ATOM   4180 C  CD2   . LEU F 3 163 ? 93.766  41.818 -96.083  1.00 37.07  ? 163  LEU B CD2   1 
ATOM   4181 N  N     . ALA F 3 164 ? 90.189  44.096 -93.869  1.00 28.69  ? 164  ALA B N     1 
ATOM   4182 C  CA    . ALA F 3 164 ? 89.161  45.086 -93.593  1.00 25.30  ? 164  ALA B CA    1 
ATOM   4183 C  C     . ALA F 3 164 ? 88.776  45.986 -94.760  1.00 24.28  ? 164  ALA B C     1 
ATOM   4184 O  O     . ALA F 3 164 ? 89.638  46.617 -95.393  1.00 22.30  ? 164  ALA B O     1 
ATOM   4185 C  CB    . ALA F 3 164 ? 89.570  45.948 -92.389  1.00 32.06  ? 164  ALA B CB    1 
ATOM   4186 N  N     . GLY F 3 165 ? 87.467  46.039 -95.022  1.00 20.15  ? 165  GLY B N     1 
ATOM   4187 C  CA    . GLY F 3 165 ? 86.929  46.879 -96.076  1.00 19.83  ? 165  GLY B CA    1 
ATOM   4188 C  C     . GLY F 3 165 ? 86.002  46.171 -97.052  1.00 22.42  ? 165  GLY B C     1 
ATOM   4189 O  O     . GLY F 3 165 ? 85.021  46.750 -97.559  1.00 20.46  ? 165  GLY B O     1 
ATOM   4190 N  N     . LEU F 3 166 ? 86.331  44.905 -97.307  1.00 44.92  ? 166  LEU B N     1 
ATOM   4191 C  CA    . LEU F 3 166 ? 85.616  44.059 -98.251  1.00 44.51  ? 166  LEU B CA    1 
ATOM   4192 C  C     . LEU F 3 166 ? 84.203  43.703 -97.877  1.00 45.17  ? 166  LEU B C     1 
ATOM   4193 O  O     . LEU F 3 166 ? 83.947  43.121 -96.837  1.00 45.52  ? 166  LEU B O     1 
ATOM   4194 C  CB    . LEU F 3 166 ? 86.385  42.752 -98.495  1.00 28.56  ? 166  LEU B CB    1 
ATOM   4195 C  CG    . LEU F 3 166 ? 87.832  42.763 -98.998  1.00 27.19  ? 166  LEU B CG    1 
ATOM   4196 C  CD1   . LEU F 3 166 ? 88.287  41.322 -99.223  1.00 23.76  ? 166  LEU B CD1   1 
ATOM   4197 C  CD2   . LEU F 3 166 ? 87.943  43.588 -100.290 1.00 27.72  ? 166  LEU B CD2   1 
ATOM   4198 N  N     . GLY F 3 167 ? 83.283  44.036 -98.764  1.00 53.40  ? 167  GLY B N     1 
ATOM   4199 C  CA    . GLY F 3 167 ? 81.897  43.704 -98.532  1.00 54.67  ? 167  GLY B CA    1 
ATOM   4200 C  C     . GLY F 3 167 ? 81.503  42.661 -99.552  1.00 54.25  ? 167  GLY B C     1 
ATOM   4201 O  O     . GLY F 3 167 ? 82.356  42.106 -100.241 1.00 53.82  ? 167  GLY B O     1 
ATOM   4202 N  N     . ASN F 3 168 ? 80.212  42.404 -99.674  1.00 45.93  ? 168  ASN B N     1 
ATOM   4203 C  CA    . ASN F 3 168 ? 79.770  41.398 -100.613 1.00 48.02  ? 168  ASN B CA    1 
ATOM   4204 C  C     . ASN F 3 168 ? 79.812  41.770 -102.103 1.00 48.88  ? 168  ASN B C     1 
ATOM   4205 O  O     . ASN F 3 168 ? 79.789  40.876 -102.955 1.00 50.70  ? 168  ASN B O     1 
ATOM   4206 C  CB    . ASN F 3 168 ? 78.373  40.912 -100.237 1.00 40.32  ? 168  ASN B CB    1 
ATOM   4207 C  CG    . ASN F 3 168 ? 77.987  39.680 -100.998 1.00 39.38  ? 168  ASN B CG    1 
ATOM   4208 O  OD1   . ASN F 3 168 ? 78.833  38.835 -101.278 1.00 36.53  ? 168  ASN B OD1   1 
ATOM   4209 N  ND2   . ASN F 3 168 ? 76.710  39.558 -101.331 1.00 40.71  ? 168  ASN B ND2   1 
ATOM   4210 N  N     . TYR F 3 169 ? 79.875  43.059 -102.439 1.00 48.25  ? 169  TYR B N     1 
ATOM   4211 C  CA    . TYR F 3 169 ? 79.919  43.407 -103.850 1.00 48.10  ? 169  TYR B CA    1 
ATOM   4212 C  C     . TYR F 3 169 ? 81.345  43.298 -104.351 1.00 49.15  ? 169  TYR B C     1 
ATOM   4213 O  O     . TYR F 3 169 ? 81.568  42.957 -105.515 1.00 51.14  ? 169  TYR B O     1 
ATOM   4214 C  CB    . TYR F 3 169 ? 79.327  44.801 -104.118 1.00 45.56  ? 169  TYR B CB    1 
ATOM   4215 C  CG    . TYR F 3 169 ? 80.256  45.994 -103.998 1.00 47.17  ? 169  TYR B CG    1 
ATOM   4216 C  CD1   . TYR F 3 169 ? 81.383  46.125 -104.817 1.00 45.61  ? 169  TYR B CD1   1 
ATOM   4217 C  CD2   . TYR F 3 169 ? 79.974  47.027 -103.104 1.00 46.29  ? 169  TYR B CD2   1 
ATOM   4218 C  CE1   . TYR F 3 169 ? 82.198  47.251 -104.745 1.00 45.63  ? 169  TYR B CE1   1 
ATOM   4219 C  CE2   . TYR F 3 169 ? 80.783  48.153 -103.031 1.00 46.42  ? 169  TYR B CE2   1 
ATOM   4220 C  CZ    . TYR F 3 169 ? 81.890  48.258 -103.849 1.00 43.44  ? 169  TYR B CZ    1 
ATOM   4221 O  OH    . TYR F 3 169 ? 82.695  49.364 -103.766 1.00 45.40  ? 169  TYR B OH    1 
ATOM   4222 N  N     . LEU F 3 170 ? 82.307  43.576 -103.471 1.00 38.52  ? 170  LEU B N     1 
ATOM   4223 C  CA    . LEU F 3 170 ? 83.725  43.467 -103.814 1.00 36.02  ? 170  LEU B CA    1 
ATOM   4224 C  C     . LEU F 3 170 ? 84.065  41.993 -103.828 1.00 36.85  ? 170  LEU B C     1 
ATOM   4225 O  O     . LEU F 3 170 ? 84.733  41.504 -104.735 1.00 38.76  ? 170  LEU B O     1 
ATOM   4226 C  CB    . LEU F 3 170 ? 84.593  44.185 -102.776 1.00 50.54  ? 170  LEU B CB    1 
ATOM   4227 C  CG    . LEU F 3 170 ? 84.720  45.700 -102.968 1.00 50.45  ? 170  LEU B CG    1 
ATOM   4228 C  CD1   . LEU F 3 170 ? 85.132  46.377 -101.675 1.00 44.58  ? 170  LEU B CD1   1 
ATOM   4229 C  CD2   . LEU F 3 170 ? 85.732  45.970 -104.083 1.00 51.50  ? 170  LEU B CD2   1 
ATOM   4230 N  N     . ARG F 3 171 ? 83.591  41.284 -102.814 1.00 42.61  ? 171  ARG B N     1 
ATOM   4231 C  CA    . ARG F 3 171 ? 83.825  39.851 -102.700 1.00 42.05  ? 171  ARG B CA    1 
ATOM   4232 C  C     . ARG F 3 171 ? 83.843  39.161 -104.055 1.00 42.89  ? 171  ARG B C     1 
ATOM   4233 O  O     . ARG F 3 171 ? 84.907  38.853 -104.602 1.00 41.98  ? 171  ARG B O     1 
ATOM   4234 C  CB    . ARG F 3 171 ? 82.725  39.210 -101.870 1.00 35.16  ? 171  ARG B CB    1 
ATOM   4235 C  CG    . ARG F 3 171 ? 82.684  37.694 -101.966 1.00 35.12  ? 171  ARG B CG    1 
ATOM   4236 C  CD    . ARG F 3 171 ? 81.305  37.201 -101.599 1.00 33.07  ? 171  ARG B CD    1 
ATOM   4237 N  NE    . ARG F 3 171 ? 81.357  35.921 -100.911 1.00 33.59  ? 171  ARG B NE    1 
ATOM   4238 C  CZ    . ARG F 3 171 ? 80.282  35.295 -100.455 1.00 32.29  ? 171  ARG B CZ    1 
ATOM   4239 N  NH1   . ARG F 3 171 ? 79.087  35.844 -100.627 1.00 29.30  ? 171  ARG B NH1   1 
ATOM   4240 N  NH2   . ARG F 3 171 ? 80.401  34.137 -99.818  1.00 30.33  ? 171  ARG B NH2   1 
ATOM   4241 N  N     . VAL F 3 172 ? 82.634  38.935 -104.571 1.00 48.35  ? 172  VAL B N     1 
ATOM   4242 C  CA    . VAL F 3 172 ? 82.392  38.254 -105.839 1.00 47.31  ? 172  VAL B CA    1 
ATOM   4243 C  C     . VAL F 3 172 ? 82.843  38.967 -107.115 1.00 46.07  ? 172  VAL B C     1 
ATOM   4244 O  O     . VAL F 3 172 ? 82.986  38.325 -108.148 1.00 47.19  ? 172  VAL B O     1 
ATOM   4245 C  CB    . VAL F 3 172 ? 80.890  37.870 -105.970 1.00 37.10  ? 172  VAL B CB    1 
ATOM   4246 C  CG1   . VAL F 3 172 ? 80.504  36.858 -104.874 1.00 35.52  ? 172  VAL B CG1   1 
ATOM   4247 C  CG2   . VAL F 3 172 ? 80.027  39.115 -105.878 1.00 36.65  ? 172  VAL B CG2   1 
ATOM   4248 N  N     . GLU F 3 173 ? 83.047  40.281 -107.071 1.00 34.73  ? 173  GLU B N     1 
ATOM   4249 C  CA    . GLU F 3 173 ? 83.540  40.976 -108.263 1.00 33.69  ? 173  GLU B CA    1 
ATOM   4250 C  C     . GLU F 3 173 ? 85.029  40.610 -108.380 1.00 31.72  ? 173  GLU B C     1 
ATOM   4251 O  O     . GLU F 3 173 ? 85.577  40.505 -109.477 1.00 30.00  ? 173  GLU B O     1 
ATOM   4252 C  CB    . GLU F 3 173 ? 83.383  42.505 -108.146 1.00 37.09  ? 173  GLU B CB    1 
ATOM   4253 C  CG    . GLU F 3 173 ? 82.017  43.063 -108.570 1.00 38.56  ? 173  GLU B CG    1 
ATOM   4254 C  CD    . GLU F 3 173 ? 81.661  42.812 -110.044 1.00 37.84  ? 173  GLU B CD    1 
ATOM   4255 O  OE1   . GLU F 3 173 ? 82.178  43.513 -110.942 1.00 36.37  ? 173  GLU B OE1   1 
ATOM   4256 O  OE2   . GLU F 3 173 ? 80.851  41.905 -110.302 1.00 39.81  ? 173  GLU B OE2   1 
ATOM   4257 N  N     . ILE F 3 174 ? 85.661  40.402 -107.230 1.00 41.74  ? 174  ILE B N     1 
ATOM   4258 C  CA    . ILE F 3 174 ? 87.068  40.019 -107.170 1.00 42.72  ? 174  ILE B CA    1 
ATOM   4259 C  C     . ILE F 3 174 ? 87.262  38.616 -107.734 1.00 41.33  ? 174  ILE B C     1 
ATOM   4260 O  O     . ILE F 3 174 ? 88.200  38.377 -108.488 1.00 41.23  ? 174  ILE B O     1 
ATOM   4261 C  CB    . ILE F 3 174 ? 87.621  40.089 -105.692 1.00 32.61  ? 174  ILE B CB    1 
ATOM   4262 C  CG1   . ILE F 3 174 ? 88.294  41.447 -105.465 1.00 33.15  ? 174  ILE B CG1   1 
ATOM   4263 C  CG2   . ILE F 3 174 ? 88.628  38.966 -105.417 1.00 28.70  ? 174  ILE B CG2   1 
ATOM   4264 C  CD1   . ILE F 3 174 ? 87.389  42.629 -105.654 1.00 34.41  ? 174  ILE B CD1   1 
ATOM   4265 N  N     . LEU F 3 175 ? 86.366  37.701 -107.377 1.00 40.73  ? 175  LEU B N     1 
ATOM   4266 C  CA    . LEU F 3 175 ? 86.446  36.317 -107.853 1.00 41.20  ? 175  LEU B CA    1 
ATOM   4267 C  C     . LEU F 3 175 ? 86.297  36.179 -109.375 1.00 41.50  ? 175  LEU B C     1 
ATOM   4268 O  O     . LEU F 3 175 ? 87.005  35.403 -110.007 1.00 42.51  ? 175  LEU B O     1 
ATOM   4269 C  CB    . LEU F 3 175 ? 85.389  35.460 -107.147 1.00 38.46  ? 175  LEU B CB    1 
ATOM   4270 C  CG    . LEU F 3 175 ? 85.656  35.177 -105.666 1.00 39.82  ? 175  LEU B CG    1 
ATOM   4271 C  CD1   . LEU F 3 175 ? 84.522  34.335 -105.076 1.00 41.99  ? 175  LEU B CD1   1 
ATOM   4272 C  CD2   . LEU F 3 175 ? 86.983  34.449 -105.527 1.00 38.57  ? 175  LEU B CD2   1 
ATOM   4273 N  N     . TRP F 3 176 ? 85.375  36.931 -109.958 1.00 31.50  ? 176  TRP B N     1 
ATOM   4274 C  CA    . TRP F 3 176 ? 85.153  36.875 -111.390 1.00 33.00  ? 176  TRP B CA    1 
ATOM   4275 C  C     . TRP F 3 176 ? 86.353  37.428 -112.141 1.00 33.55  ? 176  TRP B C     1 
ATOM   4276 O  O     . TRP F 3 176 ? 86.590  37.035 -113.273 1.00 33.09  ? 176  TRP B O     1 
ATOM   4277 C  CB    . TRP F 3 176 ? 83.915  37.688 -111.779 1.00 49.05  ? 176  TRP B CB    1 
ATOM   4278 C  CG    . TRP F 3 176 ? 83.839  37.988 -113.266 1.00 48.90  ? 176  TRP B CG    1 
ATOM   4279 C  CD1   . TRP F 3 176 ? 83.191  37.258 -114.219 1.00 47.77  ? 176  TRP B CD1   1 
ATOM   4280 C  CD2   . TRP F 3 176 ? 84.466  39.081 -113.959 1.00 50.03  ? 176  TRP B CD2   1 
ATOM   4281 N  NE1   . TRP F 3 176 ? 83.370  37.825 -115.458 1.00 48.27  ? 176  TRP B NE1   1 
ATOM   4282 C  CE2   . TRP F 3 176 ? 84.148  38.945 -115.329 1.00 48.88  ? 176  TRP B CE2   1 
ATOM   4283 C  CE3   . TRP F 3 176 ? 85.268  40.161 -113.554 1.00 52.08  ? 176  TRP B CE3   1 
ATOM   4284 C  CZ2   . TRP F 3 176 ? 84.599  39.847 -116.296 1.00 47.75  ? 176  TRP B CZ2   1 
ATOM   4285 C  CZ3   . TRP F 3 176 ? 85.717  41.059 -114.519 1.00 49.29  ? 176  TRP B CZ3   1 
ATOM   4286 C  CH2   . TRP F 3 176 ? 85.378  40.894 -115.874 1.00 49.91  ? 176  TRP B CH2   1 
ATOM   4287 N  N     . GLN F 3 177 ? 87.078  38.353 -111.504 1.00 69.26  ? 177  GLN B N     1 
ATOM   4288 C  CA    . GLN F 3 177 ? 88.257  38.998 -112.086 1.00 68.78  ? 177  GLN B CA    1 
ATOM   4289 C  C     . GLN F 3 177 ? 89.496  38.103 -112.052 1.00 70.03  ? 177  GLN B C     1 
ATOM   4290 O  O     . GLN F 3 177 ? 90.480  38.367 -112.742 1.00 72.52  ? 177  GLN B O     1 
ATOM   4291 C  CB    . GLN F 3 177 ? 88.542  40.324 -111.361 1.00 29.62  ? 177  GLN B CB    1 
ATOM   4292 C  CG    . GLN F 3 177 ? 89.887  40.991 -111.692 1.00 28.09  ? 177  GLN B CG    1 
ATOM   4293 C  CD    . GLN F 3 177 ? 90.053  41.352 -113.165 1.00 27.69  ? 177  GLN B CD    1 
ATOM   4294 O  OE1   . GLN F 3 177 ? 91.164  41.330 -113.690 1.00 26.70  ? 177  GLN B OE1   1 
ATOM   4295 N  NE2   . GLN F 3 177 ? 88.954  41.695 -113.833 1.00 26.96  ? 177  GLN B NE2   1 
ATOM   4296 N  N     . VAL F 3 178 ? 89.449  37.047 -111.247 1.00 37.84  ? 178  VAL B N     1 
ATOM   4297 C  CA    . VAL F 3 178 ? 90.563  36.111 -111.157 1.00 35.66  ? 178  VAL B CA    1 
ATOM   4298 C  C     . VAL F 3 178 ? 90.064  34.707 -111.467 1.00 35.30  ? 178  VAL B C     1 
ATOM   4299 O  O     . VAL F 3 178 ? 90.722  33.715 -111.162 1.00 34.91  ? 178  VAL B O     1 
ATOM   4300 C  CB    . VAL F 3 178 ? 91.255  36.137 -109.744 1.00 36.63  ? 178  VAL B CB    1 
ATOM   4301 C  CG1   . VAL F 3 178 ? 91.989  37.461 -109.549 1.00 32.52  ? 178  VAL B CG1   1 
ATOM   4302 C  CG2   . VAL F 3 178 ? 90.226  35.900 -108.630 1.00 34.87  ? 178  VAL B CG2   1 
ATOM   4303 N  N     . GLY F 3 179 ? 88.879  34.647 -112.067 1.00 37.44  ? 179  GLY B N     1 
ATOM   4304 C  CA    . GLY F 3 179 ? 88.276  33.383 -112.460 1.00 37.18  ? 179  GLY B CA    1 
ATOM   4305 C  C     . GLY F 3 179 ? 87.967  32.353 -111.388 1.00 37.94  ? 179  GLY B C     1 
ATOM   4306 O  O     . GLY F 3 179 ? 87.787  31.174 -111.694 1.00 37.00  ? 179  GLY B O     1 
ATOM   4307 N  N     . LEU F 3 180 ? 87.878  32.773 -110.135 1.00 39.77  ? 180  LEU B N     1 
ATOM   4308 C  CA    . LEU F 3 180 ? 87.597  31.810 -109.076 1.00 41.84  ? 180  LEU B CA    1 
ATOM   4309 C  C     . LEU F 3 180 ? 86.178  31.840 -108.537 1.00 42.04  ? 180  LEU B C     1 
ATOM   4310 O  O     . LEU F 3 180 ? 85.514  32.877 -108.557 1.00 42.38  ? 180  LEU B O     1 
ATOM   4311 C  CB    . LEU F 3 180 ? 88.597  31.980 -107.927 1.00 43.11  ? 180  LEU B CB    1 
ATOM   4312 C  CG    . LEU F 3 180 ? 90.010  31.514 -108.278 1.00 44.27  ? 180  LEU B CG    1 
ATOM   4313 C  CD1   . LEU F 3 180 ? 90.993  31.954 -107.201 1.00 43.32  ? 180  LEU B CD1   1 
ATOM   4314 C  CD2   . LEU F 3 180 ? 90.011  30.006 -108.454 1.00 42.14  ? 180  LEU B CD2   1 
ATOM   4315 N  N     . THR F 3 181 ? 85.722  30.681 -108.066 1.00 74.12  ? 181  THR B N     1 
ATOM   4316 C  CA    . THR F 3 181 ? 84.385  30.548 -107.500 1.00 75.52  ? 181  THR B CA    1 
ATOM   4317 C  C     . THR F 3 181 ? 84.428  30.691 -105.974 1.00 76.52  ? 181  THR B C     1 
ATOM   4318 O  O     . THR F 3 181 ? 85.265  31.419 -105.441 1.00 77.03  ? 181  THR B O     1 
ATOM   4319 C  CB    . THR F 3 181 ? 83.736  29.191 -107.870 1.00 43.90  ? 181  THR B CB    1 
ATOM   4320 O  OG1   . THR F 3 181 ? 84.382  28.131 -107.156 1.00 44.47  ? 181  THR B OG1   1 
ATOM   4321 C  CG2   . THR F 3 181 ? 83.849  28.938 -109.349 1.00 43.54  ? 181  THR B CG2   1 
ATOM   4322 N  N     . GLY F 3 182 ? 83.544  29.977 -105.279 1.00 40.75  ? 182  GLY B N     1 
ATOM   4323 C  CA    . GLY F 3 182 ? 83.465  30.083 -103.828 1.00 40.01  ? 182  GLY B CA    1 
ATOM   4324 C  C     . GLY F 3 182 ? 84.279  29.142 -102.970 1.00 40.35  ? 182  GLY B C     1 
ATOM   4325 O  O     . GLY F 3 182 ? 84.984  29.596 -102.071 1.00 39.64  ? 182  GLY B O     1 
ATOM   4326 N  N     . ASN F 3 183 ? 84.175  27.840 -103.225 1.00 58.64  ? 183  ASN B N     1 
ATOM   4327 C  CA    . ASN F 3 183 ? 84.909  26.846 -102.448 1.00 58.51  ? 183  ASN B CA    1 
ATOM   4328 C  C     . ASN F 3 183 ? 86.331  26.606 -102.921 1.00 59.65  ? 183  ASN B C     1 
ATOM   4329 O  O     . ASN F 3 183 ? 86.656  25.548 -103.457 1.00 60.76  ? 183  ASN B O     1 
ATOM   4330 C  CB    . ASN F 3 183 ? 84.159  25.518 -102.432 1.00 59.20  ? 183  ASN B CB    1 
ATOM   4331 C  CG    . ASN F 3 183 ? 83.303  25.324 -103.648 1.00 58.33  ? 183  ASN B CG    1 
ATOM   4332 O  OD1   . ASN F 3 183 ? 83.801  24.556 -104.606 1.00 61.33  ? 183  ASN B OD1   1 
ATOM   4333 N  ND2   . ASN F 3 183 ? 82.200  25.866 -103.735 1.00 59.63  ? 183  ASN B ND2   1 
ATOM   4334 N  N     . HIS F 3 184 ? 87.181  27.600 -102.718 1.00 68.15  ? 184  HIS B N     1 
ATOM   4335 C  CA    . HIS F 3 184 ? 88.579  27.495 -103.096 1.00 67.85  ? 184  HIS B CA    1 
ATOM   4336 C  C     . HIS F 3 184 ? 89.406  28.052 -101.948 1.00 68.12  ? 184  HIS B C     1 
ATOM   4337 O  O     . HIS F 3 184 ? 89.171  29.162 -101.466 1.00 68.20  ? 184  HIS B O     1 
ATOM   4338 C  CB    . HIS F 3 184 ? 88.829  28.265 -104.386 1.00 56.19  ? 184  HIS B CB    1 
ATOM   4339 C  CG    . HIS F 3 184 ? 88.012  27.770 -105.542 1.00 57.37  ? 184  HIS B CG    1 
ATOM   4340 N  ND1   . HIS F 3 184 ? 88.089  26.474 -106.007 1.00 57.63  ? 184  HIS B ND1   1 
ATOM   4341 C  CD2   . HIS F 3 184 ? 87.084  28.389 -106.308 1.00 57.20  ? 184  HIS B CD2   1 
ATOM   4342 C  CE1   . HIS F 3 184 ? 87.243  26.317 -107.008 1.00 57.01  ? 184  HIS B CE1   1 
ATOM   4343 N  NE2   . HIS F 3 184 ? 86.620  27.463 -107.210 1.00 57.25  ? 184  HIS B NE2   1 
ATOM   4344 N  N     . LYS F 3 185 ? 90.359  27.254 -101.491 1.00 55.23  ? 185  LYS B N     1 
ATOM   4345 C  CA    . LYS F 3 185 ? 91.206  27.640 -100.378 1.00 52.65  ? 185  LYS B CA    1 
ATOM   4346 C  C     . LYS F 3 185 ? 92.495  28.243 -100.894 1.00 51.75  ? 185  LYS B C     1 
ATOM   4347 O  O     . LYS F 3 185 ? 93.040  27.794 -101.903 1.00 52.25  ? 185  LYS B O     1 
ATOM   4348 C  CB    . LYS F 3 185 ? 91.466  26.408 -99.521  1.00 41.42  ? 185  LYS B CB    1 
ATOM   4349 C  CG    . LYS F 3 185 ? 90.166  25.761 -99.103  1.00 41.94  ? 185  LYS B CG    1 
ATOM   4350 C  CD    . LYS F 3 185 ? 90.341  24.366 -98.557  1.00 43.34  ? 185  LYS B CD    1 
ATOM   4351 C  CE    . LYS F 3 185 ? 88.982  23.752 -98.206  1.00 44.77  ? 185  LYS B CE    1 
ATOM   4352 N  NZ    . LYS F 3 185 ? 89.086  22.412 -97.564  1.00 43.38  ? 185  LYS B NZ    1 
ATOM   4353 N  N     . ALA F 3 186 ? 92.974  29.268 -100.201 1.00 53.61  ? 186  ALA B N     1 
ATOM   4354 C  CA    . ALA F 3 186 ? 94.194  29.957 -100.596 1.00 53.55  ? 186  ALA B CA    1 
ATOM   4355 C  C     . ALA F 3 186 ? 95.431  29.073 -100.526 1.00 52.94  ? 186  ALA B C     1 
ATOM   4356 O  O     . ALA F 3 186 ? 96.547  29.571 -100.608 1.00 54.41  ? 186  ALA B O     1 
ATOM   4357 C  CB    . ALA F 3 186 ? 94.393  31.204 -99.740  1.00 82.82  ? 186  ALA B CB    1 
ATOM   4358 N  N     . LYS F 3 187 ? 95.237  27.768 -100.377 1.00 44.33  ? 187  LYS B N     1 
ATOM   4359 C  CA    . LYS F 3 187 ? 96.364  26.856 -100.327 1.00 42.92  ? 187  LYS B CA    1 
ATOM   4360 C  C     . LYS F 3 187 ? 96.445  25.952 -101.568 1.00 42.73  ? 187  LYS B C     1 
ATOM   4361 O  O     . LYS F 3 187 ? 97.532  25.580 -101.996 1.00 41.84  ? 187  LYS B O     1 
ATOM   4362 C  CB    . LYS F 3 187 ? 96.310  25.993 -99.057  1.00 42.40  ? 187  LYS B CB    1 
ATOM   4363 C  CG    . LYS F 3 187 ? 95.237  24.904 -99.040  1.00 42.27  ? 187  LYS B CG    1 
ATOM   4364 C  CD    . LYS F 3 187 ? 95.566  23.836 -98.004  1.00 41.12  ? 187  LYS B CD    1 
ATOM   4365 C  CE    . LYS F 3 187 ? 94.681  22.610 -98.164  1.00 42.06  ? 187  LYS B CE    1 
ATOM   4366 N  NZ    . LYS F 3 187 ? 94.981  21.497 -97.200  1.00 43.10  ? 187  LYS B NZ    1 
ATOM   4367 N  N     . ASP F 3 188 ? 95.301  25.609 -102.150 1.00 50.95  ? 188  ASP B N     1 
ATOM   4368 C  CA    . ASP F 3 188 ? 95.281  24.732 -103.324 1.00 49.89  ? 188  ASP B CA    1 
ATOM   4369 C  C     . ASP F 3 188 ? 95.338  25.460 -104.682 1.00 49.52  ? 188  ASP B C     1 
ATOM   4370 O  O     . ASP F 3 188 ? 94.805  24.966 -105.673 1.00 49.58  ? 188  ASP B O     1 
ATOM   4371 C  CB    . ASP F 3 188 ? 94.029  23.839 -103.281 1.00 37.40  ? 188  ASP B CB    1 
ATOM   4372 C  CG    . ASP F 3 188 ? 94.033  22.870 -102.108 1.00 37.92  ? 188  ASP B CG    1 
ATOM   4373 O  OD1   . ASP F 3 188 ? 94.903  21.977 -102.059 1.00 39.59  ? 188  ASP B OD1   1 
ATOM   4374 O  OD2   . ASP F 3 188 ? 93.163  22.988 -101.229 1.00 37.45  ? 188  ASP B OD2   1 
ATOM   4375 N  N     . LEU F 3 189 ? 95.979  26.624 -104.737 1.00 41.86  ? 189  LEU B N     1 
ATOM   4376 C  CA    . LEU F 3 189 ? 96.052  27.361 -105.991 1.00 40.85  ? 189  LEU B CA    1 
ATOM   4377 C  C     . LEU F 3 189 ? 97.472  27.553 -106.489 1.00 42.21  ? 189  LEU B C     1 
ATOM   4378 O  O     . LEU F 3 189 ? 98.422  27.454 -105.717 1.00 43.03  ? 189  LEU B O     1 
ATOM   4379 C  CB    . LEU F 3 189 ? 95.369  28.722 -105.854 1.00 47.64  ? 189  LEU B CB    1 
ATOM   4380 C  CG    . LEU F 3 189 ? 95.739  29.686 -104.727 1.00 46.42  ? 189  LEU B CG    1 
ATOM   4381 C  CD1   . LEU F 3 189 ? 97.230  29.977 -104.708 1.00 48.23  ? 189  LEU B CD1   1 
ATOM   4382 C  CD2   . LEU F 3 189 ? 94.952  30.975 -104.936 1.00 48.74  ? 189  LEU B CD2   1 
ATOM   4383 N  N     . ASN F 3 190 ? 97.618  27.824 -107.783 1.00 32.22  ? 190  ASN B N     1 
ATOM   4384 C  CA    . ASN F 3 190 ? 98.945  28.031 -108.341 1.00 32.22  ? 190  ASN B CA    1 
ATOM   4385 C  C     . ASN F 3 190 ? 99.453  29.429 -107.997 1.00 31.56  ? 190  ASN B C     1 
ATOM   4386 O  O     . ASN F 3 190 ? 98.688  30.299 -107.596 1.00 30.56  ? 190  ASN B O     1 
ATOM   4387 C  CB    . ASN F 3 190 ? 98.941  27.831 -109.866 1.00 36.65  ? 190  ASN B CB    1 
ATOM   4388 C  CG    . ASN F 3 190 ? 98.104  28.862 -110.592 1.00 36.71  ? 190  ASN B CG    1 
ATOM   4389 O  OD1   . ASN F 3 190 ? 98.371  30.058 -110.525 1.00 36.09  ? 190  ASN B OD1   1 
ATOM   4390 N  ND2   . ASN F 3 190 ? 97.085  28.399 -111.296 1.00 38.65  ? 190  ASN B ND2   1 
ATOM   4391 N  N     . ALA F 3 191 ? 100.754 29.627 -108.170 1.00 40.04  ? 191  ALA B N     1 
ATOM   4392 C  CA    . ALA F 3 191 ? 101.401 30.887 -107.863 1.00 37.84  ? 191  ALA B CA    1 
ATOM   4393 C  C     . ALA F 3 191 ? 100.867 32.066 -108.690 1.00 38.40  ? 191  ALA B C     1 
ATOM   4394 O  O     . ALA F 3 191 ? 100.796 33.202 -108.205 1.00 38.99  ? 191  ALA B O     1 
ATOM   4395 C  CB    . ALA F 3 191 ? 102.894 30.726 -108.053 1.00 6.02   ? 191  ALA B CB    1 
ATOM   4396 N  N     . ALA F 3 192 ? 100.481 31.788 -109.933 1.00 37.83  ? 192  ALA B N     1 
ATOM   4397 C  CA    . ALA F 3 192 ? 99.951  32.811 -110.829 1.00 37.49  ? 192  ALA B CA    1 
ATOM   4398 C  C     . ALA F 3 192 ? 98.611  33.336 -110.316 1.00 39.40  ? 192  ALA B C     1 
ATOM   4399 O  O     . ALA F 3 192 ? 98.389  34.551 -110.252 1.00 38.55  ? 192  ALA B O     1 
ATOM   4400 C  CB    . ALA F 3 192 ? 99.792  32.241 -112.228 1.00 27.42  ? 192  ALA B CB    1 
ATOM   4401 N  N     . GLN F 3 193 ? 97.716  32.415 -109.963 1.00 40.51  ? 193  GLN B N     1 
ATOM   4402 C  CA    . GLN F 3 193 ? 96.408  32.779 -109.429 1.00 40.50  ? 193  GLN B CA    1 
ATOM   4403 C  C     . GLN F 3 193 ? 96.613  33.580 -108.143 1.00 41.92  ? 193  GLN B C     1 
ATOM   4404 O  O     . GLN F 3 193 ? 96.052  34.664 -107.974 1.00 41.38  ? 193  GLN B O     1 
ATOM   4405 C  CB    . GLN F 3 193 ? 95.589  31.528 -109.100 1.00 38.86  ? 193  GLN B CB    1 
ATOM   4406 C  CG    . GLN F 3 193 ? 95.053  30.765 -110.285 1.00 35.37  ? 193  GLN B CG    1 
ATOM   4407 C  CD    . GLN F 3 193 ? 94.482  29.410 -109.889 1.00 34.28  ? 193  GLN B CD    1 
ATOM   4408 O  OE1   . GLN F 3 193 ? 95.178  28.573 -109.311 1.00 30.62  ? 193  GLN B OE1   1 
ATOM   4409 N  NE2   . GLN F 3 193 ? 93.215  29.189 -110.206 1.00 33.33  ? 193  GLN B NE2   1 
ATOM   4410 N  N     . LEU F 3 194 ? 97.421  33.032 -107.240 1.00 54.75  ? 194  LEU B N     1 
ATOM   4411 C  CA    . LEU F 3 194 ? 97.702  33.682 -105.964 1.00 55.95  ? 194  LEU B CA    1 
ATOM   4412 C  C     . LEU F 3 194 ? 98.140  35.122 -106.204 1.00 54.88  ? 194  LEU B C     1 
ATOM   4413 O  O     . LEU F 3 194 ? 97.745  36.045 -105.482 1.00 53.75  ? 194  LEU B O     1 
ATOM   4414 C  CB    . LEU F 3 194 ? 98.801  32.929 -105.210 1.00 71.22  ? 194  LEU B CB    1 
ATOM   4415 C  CG    . LEU F 3 194 ? 98.938  33.304 -103.732 1.00 72.15  ? 194  LEU B CG    1 
ATOM   4416 C  CD1   . LEU F 3 194 ? 97.680  32.877 -102.987 1.00 69.19  ? 194  LEU B CD1   1 
ATOM   4417 C  CD2   . LEU F 3 194 ? 100.167 32.638 -103.139 1.00 72.54  ? 194  LEU B CD2   1 
ATOM   4418 N  N     . ASP F 3 195 ? 98.962  35.307 -107.226 1.00 32.65  ? 195  ASP B N     1 
ATOM   4419 C  CA    . ASP F 3 195 ? 99.414  36.640 -107.535 1.00 32.48  ? 195  ASP B CA    1 
ATOM   4420 C  C     . ASP F 3 195 ? 98.241  37.514 -107.935 1.00 30.67  ? 195  ASP B C     1 
ATOM   4421 O  O     . ASP F 3 195 ? 98.088  38.633 -107.443 1.00 30.85  ? 195  ASP B O     1 
ATOM   4422 N  N     . ALA F 3 196 ? 97.402  37.007 -108.830 1.00 41.25  ? 196  ALA B N     1 
ATOM   4423 C  CA    . ALA F 3 196 ? 96.256  37.784 -109.278 1.00 41.29  ? 196  ALA B CA    1 
ATOM   4424 C  C     . ALA F 3 196 ? 95.312  38.044 -108.117 1.00 41.39  ? 196  ALA B C     1 
ATOM   4425 O  O     . ALA F 3 196 ? 94.836  39.163 -107.938 1.00 41.68  ? 196  ALA B O     1 
ATOM   4426 C  CB    . ALA F 3 196 ? 95.516  37.060 -110.414 1.00 20.22  ? 196  ALA B CB    1 
ATOM   4427 N  N     . LEU F 3 197 ? 95.050  37.012 -107.325 1.00 43.85  ? 197  LEU B N     1 
ATOM   4428 C  CA    . LEU F 3 197 ? 94.151  37.162 -106.197 1.00 46.22  ? 197  LEU B CA    1 
ATOM   4429 C  C     . LEU F 3 197 ? 94.649  38.270 -105.265 1.00 47.64  ? 197  LEU B C     1 
ATOM   4430 O  O     . LEU F 3 197 ? 93.934  39.243 -105.011 1.00 48.96  ? 197  LEU B O     1 
ATOM   4431 C  CB    . LEU F 3 197 ? 94.027  35.847 -105.433 1.00 27.71  ? 197  LEU B CB    1 
ATOM   4432 C  CG    . LEU F 3 197 ? 92.629  35.583 -104.868 1.00 27.26  ? 197  LEU B CG    1 
ATOM   4433 C  CD1   . LEU F 3 197 ? 92.720  34.495 -103.799 1.00 23.68  ? 197  LEU B CD1   1 
ATOM   4434 C  CD2   . LEU F 3 197 ? 92.036  36.877 -104.296 1.00 23.95  ? 197  LEU B CD2   1 
ATOM   4435 N  N     . ALA F 3 198 ? 95.873  38.123 -104.767 1.00 36.03  ? 198  ALA B N     1 
ATOM   4436 C  CA    . ALA F 3 198 ? 96.452  39.132 -103.887 1.00 35.51  ? 198  ALA B CA    1 
ATOM   4437 C  C     . ALA F 3 198 ? 96.319  40.536 -104.498 1.00 34.37  ? 198  ALA B C     1 
ATOM   4438 O  O     . ALA F 3 198 ? 95.903  41.474 -103.817 1.00 34.38  ? 198  ALA B O     1 
ATOM   4439 C  CB    . ALA F 3 198 ? 97.939  38.814 -103.607 1.00 29.08  ? 198  ALA B CB    1 
ATOM   4440 N  N     . HIS F 3 199 ? 96.667  40.676 -105.775 1.00 29.37  ? 199  HIS B N     1 
ATOM   4441 C  CA    . HIS F 3 199 ? 96.583  41.975 -106.451 1.00 29.42  ? 199  HIS B CA    1 
ATOM   4442 C  C     . HIS F 3 199 ? 95.138  42.435 -106.582 1.00 29.12  ? 199  HIS B C     1 
ATOM   4443 O  O     . HIS F 3 199 ? 94.851  43.636 -106.584 1.00 27.19  ? 199  HIS B O     1 
ATOM   4444 C  CB    . HIS F 3 199 ? 97.206  41.913 -107.853 1.00 28.28  ? 199  HIS B CB    1 
ATOM   4445 C  CG    . HIS F 3 199 ? 98.689  41.724 -107.855 1.00 27.66  ? 199  HIS B CG    1 
ATOM   4446 N  ND1   . HIS F 3 199 ? 99.286  40.545 -107.469 1.00 26.22  ? 199  HIS B ND1   1 
ATOM   4447 C  CD2   . HIS F 3 199 ? 99.698  42.577 -108.158 1.00 28.82  ? 199  HIS B CD2   1 
ATOM   4448 C  CE1   . HIS F 3 199 ? 100.600 40.678 -107.528 1.00 30.27  ? 199  HIS B CE1   1 
ATOM   4449 N  NE2   . HIS F 3 199 ? 100.877 41.902 -107.942 1.00 30.37  ? 199  HIS B NE2   1 
ATOM   4450 N  N     . ALA F 3 200 ? 94.236  41.462 -106.689 1.00 36.07  ? 200  ALA B N     1 
ATOM   4451 C  CA    . ALA F 3 200 ? 92.811  41.743 -106.831 1.00 37.78  ? 200  ALA B CA    1 
ATOM   4452 C  C     . ALA F 3 200 ? 92.203  42.208 -105.500 1.00 37.20  ? 200  ALA B C     1 
ATOM   4453 O  O     . ALA F 3 200 ? 91.437  43.178 -105.448 1.00 35.71  ? 200  ALA B O     1 
ATOM   4454 C  CB    . ALA F 3 200 ? 92.081  40.495 -107.353 1.00 38.18  ? 200  ALA B CB    1 
ATOM   4455 N  N     . LEU F 3 201 ? 92.553  41.507 -104.429 1.00 36.93  ? 201  LEU B N     1 
ATOM   4456 C  CA    . LEU F 3 201 ? 92.063  41.855 -103.101 1.00 37.15  ? 201  LEU B CA    1 
ATOM   4457 C  C     . LEU F 3 201 ? 92.444  43.284 -102.693 1.00 37.47  ? 201  LEU B C     1 
ATOM   4458 O  O     . LEU F 3 201 ? 91.965  43.781 -101.682 1.00 38.35  ? 201  LEU B O     1 
ATOM   4459 C  CB    . LEU F 3 201 ? 92.597  40.862 -102.068 1.00 30.02  ? 201  LEU B CB    1 
ATOM   4460 C  CG    . LEU F 3 201 ? 92.192  39.410 -102.342 1.00 28.80  ? 201  LEU B CG    1 
ATOM   4461 C  CD1   . LEU F 3 201 ? 92.914  38.483 -101.407 1.00 28.14  ? 201  LEU B CD1   1 
ATOM   4462 C  CD2   . LEU F 3 201 ? 90.679  39.265 -102.217 1.00 28.05  ? 201  LEU B CD2   1 
ATOM   4463 N  N     . LEU F 3 202 ? 93.289  43.942 -103.480 1.00 26.91  ? 202  LEU B N     1 
ATOM   4464 C  CA    . LEU F 3 202 ? 93.690  45.305 -103.176 1.00 27.54  ? 202  LEU B CA    1 
ATOM   4465 C  C     . LEU F 3 202 ? 93.376  46.282 -104.290 1.00 28.32  ? 202  LEU B C     1 
ATOM   4466 O  O     . LEU F 3 202 ? 93.049  47.438 -104.034 1.00 26.79  ? 202  LEU B O     1 
ATOM   4467 C  CB    . LEU F 3 202 ? 95.192  45.396 -102.908 1.00 48.10  ? 202  LEU B CB    1 
ATOM   4468 C  CG    . LEU F 3 202 ? 95.886  44.568 -101.828 1.00 46.90  ? 202  LEU B CG    1 
ATOM   4469 C  CD1   . LEU F 3 202 ? 97.340  45.023 -101.773 1.00 46.55  ? 202  LEU B CD1   1 
ATOM   4470 C  CD2   . LEU F 3 202 ? 95.202  44.740 -100.471 1.00 45.07  ? 202  LEU B CD2   1 
ATOM   4471 N  N     . GLU F 3 203 ? 93.509  45.822 -105.529 1.00 52.59  ? 203  GLU B N     1 
ATOM   4472 C  CA    . GLU F 3 203 ? 93.275  46.673 -106.689 1.00 52.48  ? 203  GLU B CA    1 
ATOM   4473 C  C     . GLU F 3 203 ? 91.829  47.107 -106.917 1.00 51.49  ? 203  GLU B C     1 
ATOM   4474 O  O     . GLU F 3 203 ? 91.565  48.294 -107.108 1.00 52.44  ? 203  GLU B O     1 
ATOM   4475 C  CB    . GLU F 3 203 ? 93.808  45.997 -107.957 1.00 63.44  ? 203  GLU B CB    1 
ATOM   4476 C  CG    . GLU F 3 203 ? 95.324  45.977 -108.078 1.00 66.33  ? 203  GLU B CG    1 
ATOM   4477 C  CD    . GLU F 3 203 ? 95.815  45.157 -109.271 1.00 70.18  ? 203  GLU B CD    1 
ATOM   4478 O  OE1   . GLU F 3 203 ? 95.504  43.948 -109.346 1.00 71.37  ? 203  GLU B OE1   1 
ATOM   4479 O  OE2   . GLU F 3 203 ? 96.518  45.720 -110.135 1.00 70.69  ? 203  GLU B OE2   1 
ATOM   4480 N  N     . ILE F 3 204 ? 90.889  46.170 -106.910 1.00 36.84  ? 204  ILE B N     1 
ATOM   4481 C  CA    . ILE F 3 204 ? 89.506  46.560 -107.155 1.00 38.39  ? 204  ILE B CA    1 
ATOM   4482 C  C     . ILE F 3 204 ? 89.013  47.588 -106.139 1.00 39.25  ? 204  ILE B C     1 
ATOM   4483 O  O     . ILE F 3 204 ? 88.475  48.639 -106.516 1.00 41.00  ? 204  ILE B O     1 
ATOM   4484 C  CB    . ILE F 3 204 ? 88.559  45.335 -107.197 1.00 39.63  ? 204  ILE B CB    1 
ATOM   4485 C  CG1   . ILE F 3 204 ? 88.910  44.455 -108.402 1.00 39.51  ? 204  ILE B CG1   1 
ATOM   4486 C  CG2   . ILE F 3 204 ? 87.114  45.791 -107.303 1.00 41.01  ? 204  ILE B CG2   1 
ATOM   4487 C  CD1   . ILE F 3 204 ? 87.894  43.381 -108.711 1.00 39.65  ? 204  ILE B CD1   1 
ATOM   4488 N  N     . PRO F 3 205 ? 89.188  47.306 -104.837 1.00 37.36  ? 205  PRO B N     1 
ATOM   4489 C  CA    . PRO F 3 205 ? 88.751  48.241 -103.808 1.00 36.26  ? 205  PRO B CA    1 
ATOM   4490 C  C     . PRO F 3 205 ? 89.279  49.651 -104.053 1.00 36.89  ? 205  PRO B C     1 
ATOM   4491 O  O     . PRO F 3 205 ? 88.528  50.626 -104.029 1.00 36.49  ? 205  PRO B O     1 
ATOM   4492 C  CB    . PRO F 3 205 ? 89.328  47.628 -102.544 1.00 31.26  ? 205  PRO B CB    1 
ATOM   4493 C  CG    . PRO F 3 205 ? 89.183  46.201 -102.792 1.00 30.54  ? 205  PRO B CG    1 
ATOM   4494 C  CD    . PRO F 3 205 ? 89.654  46.052 -104.217 1.00 33.99  ? 205  PRO B CD    1 
ATOM   4495 N  N     . ARG F 3 206 ? 90.581  49.753 -104.281 1.00 53.88  ? 206  ARG B N     1 
ATOM   4496 C  CA    . ARG F 3 206 ? 91.212  51.047 -104.508 1.00 54.15  ? 206  ARG B CA    1 
ATOM   4497 C  C     . ARG F 3 206 ? 90.655  51.670 -105.765 1.00 55.98  ? 206  ARG B C     1 
ATOM   4498 O  O     . ARG F 3 206 ? 90.540  52.894 -105.872 1.00 57.57  ? 206  ARG B O     1 
ATOM   4499 C  CB    . ARG F 3 206 ? 92.728  50.881 -104.616 1.00 40.70  ? 206  ARG B CB    1 
ATOM   4500 C  CG    . ARG F 3 206 ? 93.316  50.176 -103.405 1.00 39.81  ? 206  ARG B CG    1 
ATOM   4501 C  CD    . ARG F 3 206 ? 94.795  49.921 -103.550 1.00 40.04  ? 206  ARG B CD    1 
ATOM   4502 N  NE    . ARG F 3 206 ? 95.355  49.131 -102.454 1.00 39.64  ? 206  ARG B NE    1 
ATOM   4503 C  CZ    . ARG F 3 206 ? 96.614  49.243 -102.038 1.00 35.85  ? 206  ARG B CZ    1 
ATOM   4504 N  NH1   . ARG F 3 206 ? 97.413  50.114 -102.621 1.00 35.39  ? 206  ARG B NH1   1 
ATOM   4505 N  NH2   . ARG F 3 206 ? 97.083  48.472 -101.067 1.00 36.25  ? 206  ARG B NH2   1 
ATOM   4506 N  N     . PHE F 3 207 ? 90.298  50.820 -106.718 1.00 43.35  ? 207  PHE B N     1 
ATOM   4507 C  CA    . PHE F 3 207 ? 89.737  51.307 -107.959 1.00 42.95  ? 207  PHE B CA    1 
ATOM   4508 C  C     . PHE F 3 207 ? 88.346  51.848 -107.645 1.00 44.22  ? 207  PHE B C     1 
ATOM   4509 O  O     . PHE F 3 207 ? 88.034  52.996 -107.980 1.00 44.41  ? 207  PHE B O     1 
ATOM   4510 C  CB    . PHE F 3 207 ? 89.675  50.189 -109.000 1.00 36.60  ? 207  PHE B CB    1 
ATOM   4511 C  CG    . PHE F 3 207 ? 89.413  50.689 -110.390 1.00 38.31  ? 207  PHE B CG    1 
ATOM   4512 C  CD1   . PHE F 3 207 ? 90.226  51.674 -110.948 1.00 38.45  ? 207  PHE B CD1   1 
ATOM   4513 C  CD2   . PHE F 3 207 ? 88.336  50.215 -111.125 1.00 38.15  ? 207  PHE B CD2   1 
ATOM   4514 C  CE1   . PHE F 3 207 ? 89.971  52.183 -112.207 1.00 39.26  ? 207  PHE B CE1   1 
ATOM   4515 C  CE2   . PHE F 3 207 ? 88.069  50.722 -112.401 1.00 38.18  ? 207  PHE B CE2   1 
ATOM   4516 C  CZ    . PHE F 3 207 ? 88.885  51.707 -112.942 1.00 38.49  ? 207  PHE B CZ    1 
ATOM   4517 N  N     . SER F 3 208 ? 87.514  51.039 -106.987 1.00 39.91  ? 208  SER B N     1 
ATOM   4518 C  CA    . SER F 3 208 ? 86.178  51.510 -106.616 1.00 41.22  ? 208  SER B CA    1 
ATOM   4519 C  C     . SER F 3 208 ? 86.293  52.767 -105.734 1.00 39.34  ? 208  SER B C     1 
ATOM   4520 O  O     . SER F 3 208 ? 85.508  53.711 -105.863 1.00 38.18  ? 208  SER B O     1 
ATOM   4521 C  CB    . SER F 3 208 ? 85.390  50.411 -105.889 1.00 54.65  ? 208  SER B CB    1 
ATOM   4522 O  OG    . SER F 3 208 ? 86.190  49.736 -104.935 1.00 58.01  ? 208  SER B OG    1 
ATOM   4523 N  N     . TYR F 3 209 ? 87.288  52.784 -104.857 1.00 34.66  ? 209  TYR B N     1 
ATOM   4524 C  CA    . TYR F 3 209 ? 87.500  53.929 -103.981 1.00 36.05  ? 209  TYR B CA    1 
ATOM   4525 C  C     . TYR F 3 209 ? 87.863  55.188 -104.763 1.00 36.88  ? 209  TYR B C     1 
ATOM   4526 O  O     . TYR F 3 209 ? 87.612  56.307 -104.303 1.00 35.82  ? 209  TYR B O     1 
ATOM   4527 C  CB    . TYR F 3 209 ? 88.620  53.631 -102.974 1.00 44.93  ? 209  TYR B CB    1 
ATOM   4528 C  CG    . TYR F 3 209 ? 89.165  54.870 -102.300 1.00 44.77  ? 209  TYR B CG    1 
ATOM   4529 C  CD1   . TYR F 3 209 ? 88.374  55.631 -101.430 1.00 44.50  ? 209  TYR B CD1   1 
ATOM   4530 C  CD2   . TYR F 3 209 ? 90.437  55.340 -102.606 1.00 45.07  ? 209  TYR B CD2   1 
ATOM   4531 C  CE1   . TYR F 3 209 ? 88.841  56.842 -100.896 1.00 42.49  ? 209  TYR B CE1   1 
ATOM   4532 C  CE2   . TYR F 3 209 ? 90.910  56.543 -102.079 1.00 44.23  ? 209  TYR B CE2   1 
ATOM   4533 C  CZ    . TYR F 3 209 ? 90.111  57.294 -101.233 1.00 43.67  ? 209  TYR B CZ    1 
ATOM   4534 O  OH    . TYR F 3 209 ? 90.571  58.522 -100.786 1.00 43.02  ? 209  TYR B OH    1 
ATOM   4535 N  N     . ALA F 3 210 ? 88.437  55.004 -105.951 1.00 72.31  ? 210  ALA B N     1 
ATOM   4536 C  CA    . ALA F 3 210 ? 88.875  56.135 -106.763 1.00 71.97  ? 210  ALA B CA    1 
ATOM   4537 C  C     . ALA F 3 210 ? 88.033  56.538 -107.958 1.00 72.44  ? 210  ALA B C     1 
ATOM   4538 O  O     . ALA F 3 210 ? 88.306  57.578 -108.552 1.00 73.04  ? 210  ALA B O     1 
ATOM   4539 C  CB    . ALA F 3 210 ? 90.301  55.908 -107.230 1.00 45.99  ? 210  ALA B CB    1 
ATOM   4540 N  N     . THR F 3 211 ? 87.025  55.754 -108.332 1.00 51.33  ? 211  THR B N     1 
ATOM   4541 C  CA    . THR F 3 211 ? 86.233  56.142 -109.501 1.00 51.15  ? 211  THR B CA    1 
ATOM   4542 C  C     . THR F 3 211 ? 84.708  55.971 -109.432 1.00 53.17  ? 211  THR B C     1 
ATOM   4543 O  O     . THR F 3 211 ? 83.979  56.714 -110.079 1.00 55.09  ? 211  THR B O     1 
ATOM   4544 C  CB    . THR F 3 211 ? 86.749  55.419 -110.792 1.00 30.79  ? 211  THR B CB    1 
ATOM   4545 O  OG1   . THR F 3 211 ? 86.450  54.018 -110.732 1.00 29.61  ? 211  THR B OG1   1 
ATOM   4546 C  CG2   . THR F 3 211 ? 88.246  55.595 -110.946 1.00 28.40  ? 211  THR B CG2   1 
ATOM   4547 N  N     . ARG F 3 212 ? 84.225  55.012 -108.650 1.00 40.13  ? 212  ARG B N     1 
ATOM   4548 C  CA    . ARG F 3 212 ? 82.790  54.757 -108.552 1.00 39.71  ? 212  ARG B CA    1 
ATOM   4549 C  C     . ARG F 3 212 ? 81.993  55.974 -108.095 1.00 40.64  ? 212  ARG B C     1 
ATOM   4550 O  O     . ARG F 3 212 ? 82.605  56.915 -107.567 1.00 40.25  ? 212  ARG B O     1 
ATOM   4551 C  CB    . ARG F 3 212 ? 82.544  53.580 -107.602 1.00 41.27  ? 212  ARG B CB    1 
ATOM   4552 C  CG    . ARG F 3 212 ? 81.086  53.216 -107.442 1.00 37.53  ? 212  ARG B CG    1 
ATOM   4553 C  CD    . ARG F 3 212 ? 80.845  52.103 -106.424 1.00 36.82  ? 212  ARG B CD    1 
ATOM   4554 N  NE    . ARG F 3 212 ? 79.413  51.825 -106.369 1.00 35.42  ? 212  ARG B NE    1 
ATOM   4555 C  CZ    . ARG F 3 212 ? 78.787  51.163 -105.405 1.00 33.13  ? 212  ARG B CZ    1 
ATOM   4556 N  NH1   . ARG F 3 212 ? 79.454  50.680 -104.368 1.00 32.34  ? 212  ARG B NH1   1 
ATOM   4557 N  NH2   . ARG F 3 212 ? 77.472  51.003 -105.480 1.00 32.57  ? 212  ARG B NH2   1 
ATOM   4558 N  N     . ALA F 3 223 ? 88.187  52.652 -117.233 1.00 81.69  ? 223  ALA B N     1 
ATOM   4559 C  CA    . ALA F 3 223 ? 88.802  53.658 -116.320 1.00 80.64  ? 223  ALA B CA    1 
ATOM   4560 C  C     . ALA F 3 223 ? 87.915  53.935 -115.104 1.00 76.50  ? 223  ALA B C     1 
ATOM   4561 O  O     . ALA F 3 223 ? 88.343  54.593 -114.157 1.00 78.35  ? 223  ALA B O     1 
ATOM   4562 C  CB    . ALA F 3 223 ? 89.075  54.959 -117.083 1.00 50.52  ? 223  ALA B CB    1 
ATOM   4563 N  N     . LEU F 3 224 ? 86.684  53.431 -115.137 1.00 51.40  ? 224  LEU B N     1 
ATOM   4564 C  CA    . LEU F 3 224 ? 85.742  53.621 -114.035 1.00 47.21  ? 224  LEU B CA    1 
ATOM   4565 C  C     . LEU F 3 224 ? 85.153  52.288 -113.592 1.00 43.97  ? 224  LEU B C     1 
ATOM   4566 O  O     . LEU F 3 224 ? 84.595  51.547 -114.396 1.00 45.27  ? 224  LEU B O     1 
ATOM   4567 C  CB    . LEU F 3 224 ? 84.626  54.554 -114.453 1.00 30.57  ? 224  LEU B CB    1 
ATOM   4568 N  N     . PHE F 3 225 ? 85.268  51.995 -112.302 1.00 33.98  ? 225  PHE B N     1 
ATOM   4569 C  CA    . PHE F 3 225 ? 84.754  50.745 -111.767 1.00 33.74  ? 225  PHE B CA    1 
ATOM   4570 C  C     . PHE F 3 225 ? 83.291  50.472 -112.121 1.00 34.08  ? 225  PHE B C     1 
ATOM   4571 O  O     . PHE F 3 225 ? 82.426  51.349 -112.038 1.00 36.45  ? 225  PHE B O     1 
ATOM   4572 C  CB    . PHE F 3 225 ? 84.923  50.700 -110.241 1.00 34.52  ? 225  PHE B CB    1 
ATOM   4573 C  CG    . PHE F 3 225 ? 84.358  49.459 -109.613 1.00 34.70  ? 225  PHE B CG    1 
ATOM   4574 C  CD1   . PHE F 3 225 ? 85.048  48.259 -109.670 1.00 34.64  ? 225  PHE B CD1   1 
ATOM   4575 C  CD2   . PHE F 3 225 ? 83.115  49.484 -108.989 1.00 35.68  ? 225  PHE B CD2   1 
ATOM   4576 C  CE1   . PHE F 3 225 ? 84.506  47.102 -109.113 1.00 35.19  ? 225  PHE B CE1   1 
ATOM   4577 C  CE2   . PHE F 3 225 ? 82.573  48.342 -108.435 1.00 35.31  ? 225  PHE B CE2   1 
ATOM   4578 C  CZ    . PHE F 3 225 ? 83.268  47.148 -108.497 1.00 34.90  ? 225  PHE B CZ    1 
ATOM   4579 N  N     . ARG F 3 226 ? 83.046  49.223 -112.508 1.00 50.57  ? 226  ARG B N     1 
ATOM   4580 C  CA    . ARG F 3 226 ? 81.721  48.745 -112.878 1.00 49.34  ? 226  ARG B CA    1 
ATOM   4581 C  C     . ARG F 3 226 ? 81.597  47.297 -112.439 1.00 47.32  ? 226  ARG B C     1 
ATOM   4582 O  O     . ARG F 3 226 ? 82.555  46.547 -112.510 1.00 47.04  ? 226  ARG B O     1 
ATOM   4583 C  CB    . ARG F 3 226 ? 81.517  48.825 -114.397 1.00 60.13  ? 226  ARG B CB    1 
ATOM   4584 C  CG    . ARG F 3 226 ? 82.598  48.119 -115.213 1.00 60.73  ? 226  ARG B CG    1 
ATOM   4585 C  CD    . ARG F 3 226 ? 82.165  47.932 -116.663 1.00 61.60  ? 226  ARG B CD    1 
ATOM   4586 N  NE    . ARG F 3 226 ? 83.236  47.434 -117.527 1.00 61.18  ? 226  ARG B NE    1 
ATOM   4587 C  CZ    . ARG F 3 226 ? 84.289  48.155 -117.901 1.00 62.71  ? 226  ARG B CZ    1 
ATOM   4588 N  NH1   . ARG F 3 226 ? 84.414  49.410 -117.483 1.00 63.42  ? 226  ARG B NH1   1 
ATOM   4589 N  NH2   . ARG F 3 226 ? 85.213  47.628 -118.698 1.00 62.85  ? 226  ARG B NH2   1 
ATOM   4590 N  N     . PHE F 3 227 ? 80.417  46.916 -111.966 1.00 58.48  ? 227  PHE B N     1 
ATOM   4591 C  CA    . PHE F 3 227 ? 80.181  45.540 -111.556 1.00 56.97  ? 227  PHE B CA    1 
ATOM   4592 C  C     . PHE F 3 227 ? 80.030  44.703 -112.831 1.00 54.69  ? 227  PHE B C     1 
ATOM   4593 O  O     . PHE F 3 227 ? 79.349  45.111 -113.775 1.00 53.62  ? 227  PHE B O     1 
ATOM   4594 C  CB    . PHE F 3 227 ? 78.905  45.442 -110.719 1.00 86.99  ? 227  PHE B CB    1 
ATOM   4595 C  CG    . PHE F 3 227 ? 78.863  46.398 -109.559 1.00 88.08  ? 227  PHE B CG    1 
ATOM   4596 C  CD1   . PHE F 3 227 ? 79.829  46.348 -108.563 1.00 89.12  ? 227  PHE B CD1   1 
ATOM   4597 C  CD2   . PHE F 3 227 ? 77.854  47.350 -109.463 1.00 88.18  ? 227  PHE B CD2   1 
ATOM   4598 C  CE1   . PHE F 3 227 ? 79.790  47.231 -107.489 1.00 89.30  ? 227  PHE B CE1   1 
ATOM   4599 C  CE2   . PHE F 3 227 ? 77.809  48.237 -108.391 1.00 87.51  ? 227  PHE B CE2   1 
ATOM   4600 C  CZ    . PHE F 3 227 ? 78.781  48.176 -107.403 1.00 87.89  ? 227  PHE B CZ    1 
ATOM   4601 N  N     . LYS F 3 228 ? 80.675  43.541 -112.852 1.00 46.94  ? 228  LYS B N     1 
ATOM   4602 C  CA    . LYS F 3 228 ? 80.628  42.641 -114.000 1.00 43.95  ? 228  LYS B CA    1 
ATOM   4603 C  C     . LYS F 3 228 ? 79.553  41.587 -113.815 1.00 44.53  ? 228  LYS B C     1 
ATOM   4604 O  O     . LYS F 3 228 ? 78.946  41.133 -114.783 1.00 43.81  ? 228  LYS B O     1 
ATOM   4605 C  CB    . LYS F 3 228 ? 81.978  41.938 -114.180 1.00 34.75  ? 228  LYS B CB    1 
ATOM   4606 C  CG    . LYS F 3 228 ? 83.159  42.884 -114.257 1.00 32.85  ? 228  LYS B CG    1 
ATOM   4607 C  CD    . LYS F 3 228 ? 83.028  43.869 -115.396 1.00 27.78  ? 228  LYS B CD    1 
ATOM   4608 C  CE    . LYS F 3 228 ? 84.197  44.848 -115.366 1.00 29.27  ? 228  LYS B CE    1 
ATOM   4609 N  NZ    . LYS F 3 228 ? 85.559  44.195 -115.461 1.00 28.56  ? 228  LYS B NZ    1 
ATOM   4610 N  N     . VAL F 3 229 ? 79.325  41.195 -112.564 1.00 43.46  ? 229  VAL B N     1 
ATOM   4611 C  CA    . VAL F 3 229 ? 78.329  40.182 -112.268 1.00 43.45  ? 229  VAL B CA    1 
ATOM   4612 C  C     . VAL F 3 229 ? 77.382  40.588 -111.141 1.00 43.41  ? 229  VAL B C     1 
ATOM   4613 O  O     . VAL F 3 229 ? 76.247  40.115 -111.092 1.00 43.69  ? 229  VAL B O     1 
ATOM   4614 C  CB    . VAL F 3 229 ? 79.007  38.822 -111.904 1.00 59.15  ? 229  VAL B CB    1 
ATOM   4615 C  CG1   . VAL F 3 229 ? 80.022  38.445 -112.965 1.00 57.97  ? 229  VAL B CG1   1 
ATOM   4616 C  CG2   . VAL F 3 229 ? 79.675  38.901 -110.533 1.00 59.71  ? 229  VAL B CG2   1 
ATOM   4617 N  N     . PHE F 3 230 ? 77.850  41.463 -110.246 1.00 35.50  ? 230  PHE B N     1 
ATOM   4618 C  CA    . PHE F 3 230 ? 77.060  41.932 -109.091 1.00 34.77  ? 230  PHE B CA    1 
ATOM   4619 C  C     . PHE F 3 230 ? 75.674  42.369 -109.511 1.00 35.65  ? 230  PHE B C     1 
ATOM   4620 O  O     . PHE F 3 230 ? 75.502  43.463 -110.053 1.00 35.23  ? 230  PHE B O     1 
ATOM   4621 C  CB    . PHE F 3 230 ? 77.762  43.113 -108.398 1.00 43.49  ? 230  PHE B CB    1 
ATOM   4622 C  CG    . PHE F 3 230 ? 77.044  43.617 -107.167 1.00 41.75  ? 230  PHE B CG    1 
ATOM   4623 C  CD1   . PHE F 3 230 ? 76.762  42.762 -106.107 1.00 41.63  ? 230  PHE B CD1   1 
ATOM   4624 C  CD2   . PHE F 3 230 ? 76.654  44.951 -107.068 1.00 41.34  ? 230  PHE B CD2   1 
ATOM   4625 C  CE1   . PHE F 3 230 ? 76.105  43.232 -104.967 1.00 41.08  ? 230  PHE B CE1   1 
ATOM   4626 C  CE2   . PHE F 3 230 ? 75.996  45.428 -105.931 1.00 39.14  ? 230  PHE B CE2   1 
ATOM   4627 C  CZ    . PHE F 3 230 ? 75.723  44.571 -104.881 1.00 39.15  ? 230  PHE B CZ    1 
ATOM   4628 N  N     . HIS F 3 231 ? 74.690  41.519 -109.245 1.00 50.05  ? 231  HIS B N     1 
ATOM   4629 C  CA    . HIS F 3 231 ? 73.309  41.798 -109.607 1.00 52.64  ? 231  HIS B CA    1 
ATOM   4630 C  C     . HIS F 3 231 ? 73.124  41.989 -111.108 1.00 53.16  ? 231  HIS B C     1 
ATOM   4631 O  O     . HIS F 3 231 ? 72.229  42.712 -111.550 1.00 53.39  ? 231  HIS B O     1 
ATOM   4632 C  CB    . HIS F 3 231 ? 72.785  43.028 -108.860 1.00 93.74  ? 231  HIS B CB    1 
ATOM   4633 C  CG    . HIS F 3 231 ? 72.574  42.797 -107.397 1.00 96.62  ? 231  HIS B CG    1 
ATOM   4634 N  ND1   . HIS F 3 231 ? 71.910  41.692 -106.908 1.00 98.39  ? 231  HIS B ND1   1 
ATOM   4635 C  CD2   . HIS F 3 231 ? 72.926  43.533 -106.317 1.00 97.17  ? 231  HIS B CD2   1 
ATOM   4636 C  CE1   . HIS F 3 231 ? 71.865  41.758 -105.589 1.00 98.54  ? 231  HIS B CE1   1 
ATOM   4637 N  NE2   . HIS F 3 231 ? 72.473  42.865 -105.205 1.00 98.91  ? 231  HIS B NE2   1 
ATOM   4638 N  N     . ARG F 3 232 ? 73.982  41.356 -111.897 1.00 40.15  ? 232  ARG B N     1 
ATOM   4639 C  CA    . ARG F 3 232 ? 73.854  41.440 -113.342 1.00 40.35  ? 232  ARG B CA    1 
ATOM   4640 C  C     . ARG F 3 232 ? 73.510  40.049 -113.822 1.00 39.60  ? 232  ARG B C     1 
ATOM   4641 O  O     . ARG F 3 232 ? 73.797  39.702 -114.966 1.00 39.25  ? 232  ARG B O     1 
ATOM   4642 C  CB    . ARG F 3 232 ? 75.158  41.891 -114.012 1.00 46.63  ? 232  ARG B CB    1 
ATOM   4643 C  CG    . ARG F 3 232 ? 75.393  43.391 -114.059 1.00 47.34  ? 232  ARG B CG    1 
ATOM   4644 C  CD    . ARG F 3 232 ? 76.635  43.724 -114.877 1.00 47.95  ? 232  ARG B CD    1 
ATOM   4645 N  NE    . ARG F 3 232 ? 76.399  43.761 -116.323 1.00 50.95  ? 232  ARG B NE    1 
ATOM   4646 C  CZ    . ARG F 3 232 ? 76.213  42.696 -117.108 1.00 52.46  ? 232  ARG B CZ    1 
ATOM   4647 N  NH1   . ARG F 3 232 ? 76.229  41.464 -116.611 1.00 53.05  ? 232  ARG B NH1   1 
ATOM   4648 N  NH2   . ARG F 3 232 ? 76.014  42.866 -118.410 1.00 52.30  ? 232  ARG B NH2   1 
ATOM   4649 N  N     . ASP F 3 233 ? 72.906  39.249 -112.944 1.00 38.18  ? 233  ASP B N     1 
ATOM   4650 C  CA    . ASP F 3 233 ? 72.548  37.893 -113.320 1.00 38.93  ? 233  ASP B CA    1 
ATOM   4651 C  C     . ASP F 3 233 ? 71.449  37.930 -114.373 1.00 38.84  ? 233  ASP B C     1 
ATOM   4652 O  O     . ASP F 3 233 ? 70.648  38.864 -114.431 1.00 38.12  ? 233  ASP B O     1 
ATOM   4653 C  CB    . ASP F 3 233 ? 72.156  37.050 -112.093 1.00 50.97  ? 233  ASP B CB    1 
ATOM   4654 C  CG    . ASP F 3 233 ? 70.777  37.363 -111.560 1.00 53.19  ? 233  ASP B CG    1 
ATOM   4655 O  OD1   . ASP F 3 233 ? 70.497  38.537 -111.222 1.00 53.62  ? 233  ASP B OD1   1 
ATOM   4656 O  OD2   . ASP F 3 233 ? 69.971  36.414 -111.457 1.00 53.70  ? 233  ASP B OD2   1 
ATOM   4657 N  N     . GLY F 3 234 ? 71.448  36.928 -115.243 1.00 85.93  ? 234  GLY B N     1 
ATOM   4658 C  CA    . GLY F 3 234 ? 70.476  36.895 -116.314 1.00 85.54  ? 234  GLY B CA    1 
ATOM   4659 C  C     . GLY F 3 234 ? 71.103  37.580 -117.512 1.00 85.81  ? 234  GLY B C     1 
ATOM   4660 O  O     . GLY F 3 234 ? 70.731  37.316 -118.655 1.00 88.20  ? 234  GLY B O     1 
ATOM   4661 N  N     . GLU F 3 235 ? 72.066  38.461 -117.248 1.00 40.65  ? 235  GLU B N     1 
ATOM   4662 C  CA    . GLU F 3 235 ? 72.766  39.188 -118.318 1.00 40.48  ? 235  GLU B CA    1 
ATOM   4663 C  C     . GLU F 3 235 ? 73.952  38.401 -118.861 1.00 39.35  ? 235  GLU B C     1 
ATOM   4664 O  O     . GLU F 3 235 ? 74.355  37.398 -118.282 1.00 40.07  ? 235  GLU B O     1 
ATOM   4665 C  CB    . GLU F 3 235 ? 73.273  40.544 -117.816 1.00 50.16  ? 235  GLU B CB    1 
ATOM   4666 C  CG    . GLU F 3 235 ? 72.197  41.590 -117.600 1.00 50.22  ? 235  GLU B CG    1 
ATOM   4667 C  CD    . GLU F 3 235 ? 72.222  42.668 -118.657 1.00 50.31  ? 235  GLU B CD    1 
ATOM   4668 O  OE1   . GLU F 3 235 ? 71.960  42.356 -119.831 1.00 52.94  ? 235  GLU B OE1   1 
ATOM   4669 O  OE2   . GLU F 3 235 ? 72.513  43.831 -118.317 1.00 52.24  ? 235  GLU B OE2   1 
ATOM   4670 N  N     . PRO F 3 236 ? 74.509  38.837 -119.999 1.00 39.11  ? 236  PRO B N     1 
ATOM   4671 C  CA    . PRO F 3 236 ? 75.656  38.122 -120.564 1.00 39.99  ? 236  PRO B CA    1 
ATOM   4672 C  C     . PRO F 3 236 ? 76.990  38.529 -119.922 1.00 39.40  ? 236  PRO B C     1 
ATOM   4673 O  O     . PRO F 3 236 ? 77.167  39.658 -119.477 1.00 38.99  ? 236  PRO B O     1 
ATOM   4674 C  CB    . PRO F 3 236 ? 75.583  38.480 -122.048 1.00 42.75  ? 236  PRO B CB    1 
ATOM   4675 C  CG    . PRO F 3 236 ? 75.037  39.882 -122.019 1.00 41.51  ? 236  PRO B CG    1 
ATOM   4676 C  CD    . PRO F 3 236 ? 73.931  39.760 -120.994 1.00 42.54  ? 236  PRO B CD    1 
ATOM   4677 N  N     . CYS F 3 237 ? 77.924  37.593 -119.879 1.00 61.09  ? 237  CYS B N     1 
ATOM   4678 C  CA    . CYS F 3 237 ? 79.227  37.856 -119.295 1.00 62.08  ? 237  CYS B CA    1 
ATOM   4679 C  C     . CYS F 3 237 ? 80.087  38.739 -120.202 1.00 62.42  ? 237  CYS B C     1 
ATOM   4680 O  O     . CYS F 3 237 ? 80.247  38.460 -121.387 1.00 62.11  ? 237  CYS B O     1 
ATOM   4681 C  CB    . CYS F 3 237 ? 79.948  36.529 -119.017 1.00 42.91  ? 237  CYS B CB    1 
ATOM   4682 S  SG    . CYS F 3 237 ? 81.619  36.689 -118.357 1.00 41.32  ? 237  CYS B SG    1 
ATOM   4683 N  N     . GLU F 3 238 ? 80.628  39.812 -119.637 1.00 50.22  ? 238  GLU B N     1 
ATOM   4684 C  CA    . GLU F 3 238 ? 81.491  40.712 -120.385 1.00 50.58  ? 238  GLU B CA    1 
ATOM   4685 C  C     . GLU F 3 238 ? 82.752  39.969 -120.804 1.00 49.47  ? 238  GLU B C     1 
ATOM   4686 O  O     . GLU F 3 238 ? 83.572  40.516 -121.539 1.00 49.85  ? 238  GLU B O     1 
ATOM   4687 C  CB    . GLU F 3 238 ? 81.900  41.918 -119.532 1.00 65.36  ? 238  GLU B CB    1 
ATOM   4688 C  CG    . GLU F 3 238 ? 80.864  43.014 -119.411 1.00 67.76  ? 238  GLU B CG    1 
ATOM   4689 C  CD    . GLU F 3 238 ? 81.366  44.180 -118.579 1.00 69.98  ? 238  GLU B CD    1 
ATOM   4690 O  OE1   . GLU F 3 238 ? 82.467  44.693 -118.878 1.00 69.15  ? 238  GLU B OE1   1 
ATOM   4691 O  OE2   . GLU F 3 238 ? 80.661  44.582 -117.627 1.00 69.36  ? 238  GLU B OE2   1 
ATOM   4692 N  N     . ARG F 3 239 ? 82.916  38.733 -120.332 1.00 43.08  ? 239  ARG B N     1 
ATOM   4693 C  CA    . ARG F 3 239 ? 84.106  37.970 -120.687 1.00 41.74  ? 239  ARG B CA    1 
ATOM   4694 C  C     . ARG F 3 239 ? 83.911  36.831 -121.675 1.00 41.08  ? 239  ARG B C     1 
ATOM   4695 O  O     . ARG F 3 239 ? 84.479  36.854 -122.757 1.00 41.44  ? 239  ARG B O     1 
ATOM   4696 C  CB    . ARG F 3 239 ? 84.803  37.413 -119.446 1.00 40.15  ? 239  ARG B CB    1 
ATOM   4697 C  CG    . ARG F 3 239 ? 86.172  36.847 -119.794 1.00 38.40  ? 239  ARG B CG    1 
ATOM   4698 C  CD    . ARG F 3 239 ? 86.793  36.111 -118.659 1.00 36.04  ? 239  ARG B CD    1 
ATOM   4699 N  NE    . ARG F 3 239 ? 87.485  37.004 -117.745 1.00 35.57  ? 239  ARG B NE    1 
ATOM   4700 C  CZ    . ARG F 3 239 ? 87.351  36.978 -116.422 1.00 34.53  ? 239  ARG B CZ    1 
ATOM   4701 N  NH1   . ARG F 3 239 ? 86.535  36.099 -115.842 1.00 34.08  ? 239  ARG B NH1   1 
ATOM   4702 N  NH2   . ARG F 3 239 ? 88.048  37.824 -115.682 1.00 33.41  ? 239  ARG B NH2   1 
ATOM   4703 N  N     . CYS F 3 240 ? 83.132  35.828 -121.302 1.00 62.59  ? 240  CYS B N     1 
ATOM   4704 C  CA    . CYS F 3 240 ? 82.911  34.691 -122.186 1.00 63.45  ? 240  CYS B CA    1 
ATOM   4705 C  C     . CYS F 3 240 ? 81.513  34.729 -122.795 1.00 64.26  ? 240  CYS B C     1 
ATOM   4706 O  O     . CYS F 3 240 ? 81.124  33.825 -123.535 1.00 66.13  ? 240  CYS B O     1 
ATOM   4707 C  CB    . CYS F 3 240 ? 83.087  33.385 -121.414 1.00 38.76  ? 240  CYS B CB    1 
ATOM   4708 S  SG    . CYS F 3 240 ? 81.719  33.064 -120.317 1.00 40.04  ? 240  CYS B SG    1 
ATOM   4709 N  N     . GLY F 3 241 ? 80.755  35.767 -122.460 1.00 40.36  ? 241  GLY B N     1 
ATOM   4710 C  CA    . GLY F 3 241 ? 79.412  35.908 -122.995 1.00 39.16  ? 241  GLY B CA    1 
ATOM   4711 C  C     . GLY F 3 241 ? 78.373  35.056 -122.304 1.00 39.72  ? 241  GLY B C     1 
ATOM   4712 O  O     . GLY F 3 241 ? 77.215  35.062 -122.704 1.00 38.75  ? 241  GLY B O     1 
ATOM   4713 N  N     . SER F 3 242 ? 78.766  34.325 -121.265 1.00 57.16  ? 242  SER B N     1 
ATOM   4714 C  CA    . SER F 3 242 ? 77.808  33.479 -120.557 1.00 56.97  ? 242  SER B CA    1 
ATOM   4715 C  C     . SER F 3 242 ? 76.862  34.251 -119.629 1.00 58.05  ? 242  SER B C     1 
ATOM   4716 O  O     . SER F 3 242 ? 77.206  35.298 -119.073 1.00 57.03  ? 242  SER B O     1 
ATOM   4717 C  CB    . SER F 3 242 ? 78.539  32.391 -119.771 1.00 42.66  ? 242  SER B CB    1 
ATOM   4718 O  OG    . SER F 3 242 ? 78.988  31.368 -120.642 1.00 41.19  ? 242  SER B OG    1 
ATOM   4719 N  N     . ILE F 3 243 ? 75.656  33.717 -119.474 1.00 52.69  ? 243  ILE B N     1 
ATOM   4720 C  CA    . ILE F 3 243 ? 74.649  34.342 -118.628 1.00 52.00  ? 243  ILE B CA    1 
ATOM   4721 C  C     . ILE F 3 243 ? 75.015  34.225 -117.150 1.00 50.63  ? 243  ILE B C     1 
ATOM   4722 O  O     . ILE F 3 243 ? 75.162  33.129 -116.607 1.00 47.27  ? 243  ILE B O     1 
ATOM   4723 C  CB    . ILE F 3 243 ? 73.249  33.713 -118.878 1.00 49.74  ? 243  ILE B CB    1 
ATOM   4724 C  CG1   . ILE F 3 243 ? 72.974  33.657 -120.383 1.00 48.87  ? 243  ILE B CG1   1 
ATOM   4725 C  CG2   . ILE F 3 243 ? 72.162  34.545 -118.195 1.00 49.68  ? 243  ILE B CG2   1 
ATOM   4726 C  CD1   . ILE F 3 243 ? 73.071  34.984 -121.082 1.00 50.39  ? 243  ILE B CD1   1 
ATOM   4727 N  N     . ILE F 3 244 ? 75.165  35.376 -116.509 1.00 52.41  ? 244  ILE B N     1 
ATOM   4728 C  CA    . ILE F 3 244 ? 75.523  35.424 -115.101 1.00 53.31  ? 244  ILE B CA    1 
ATOM   4729 C  C     . ILE F 3 244 ? 74.404  34.873 -114.227 1.00 52.45  ? 244  ILE B C     1 
ATOM   4730 O  O     . ILE F 3 244 ? 73.226  35.006 -114.559 1.00 50.92  ? 244  ILE B O     1 
ATOM   4731 C  CB    . ILE F 3 244 ? 75.860  36.860 -114.690 1.00 55.70  ? 244  ILE B CB    1 
ATOM   4732 C  CG1   . ILE F 3 244 ? 77.126  37.302 -115.424 1.00 54.07  ? 244  ILE B CG1   1 
ATOM   4733 C  CG2   . ILE F 3 244 ? 76.041  36.946 -113.184 1.00 55.48  ? 244  ILE B CG2   1 
ATOM   4734 C  CD1   . ILE F 3 244 ? 77.413  38.767 -115.307 1.00 55.73  ? 244  ILE B CD1   1 
ATOM   4735 N  N     . GLU F 3 245 ? 74.784  34.255 -113.111 1.00 33.90  ? 245  GLU B N     1 
ATOM   4736 C  CA    . GLU F 3 245 ? 73.810  33.659 -112.207 1.00 36.00  ? 245  GLU B CA    1 
ATOM   4737 C  C     . GLU F 3 245 ? 73.793  34.256 -110.794 1.00 37.08  ? 245  GLU B C     1 
ATOM   4738 O  O     . GLU F 3 245 ? 74.485  35.227 -110.500 1.00 37.82  ? 245  GLU B O     1 
ATOM   4739 C  CB    . GLU F 3 245 ? 74.057  32.155 -112.125 1.00 58.94  ? 245  GLU B CB    1 
ATOM   4740 C  CG    . GLU F 3 245 ? 74.474  31.549 -113.454 1.00 61.19  ? 245  GLU B CG    1 
ATOM   4741 C  CD    . GLU F 3 245 ? 74.286  30.047 -113.502 1.00 63.06  ? 245  GLU B CD    1 
ATOM   4742 O  OE1   . GLU F 3 245 ? 74.431  29.393 -112.444 1.00 62.68  ? 245  GLU B OE1   1 
ATOM   4743 O  OE2   . GLU F 3 245 ? 74.003  29.523 -114.604 1.00 62.88  ? 245  GLU B OE2   1 
ATOM   4744 N  N     . LYS F 3 246 ? 72.992  33.656 -109.922 1.00 56.98  ? 246  LYS B N     1 
ATOM   4745 C  CA    . LYS F 3 246 ? 72.876  34.117 -108.549 1.00 57.48  ? 246  LYS B CA    1 
ATOM   4746 C  C     . LYS F 3 246 ? 72.423  32.966 -107.659 1.00 58.03  ? 246  LYS B C     1 
ATOM   4747 O  O     . LYS F 3 246 ? 71.978  31.934 -108.153 1.00 58.86  ? 246  LYS B O     1 
ATOM   4748 C  CB    . LYS F 3 246 ? 71.872  35.270 -108.466 1.00 60.57  ? 246  LYS B CB    1 
ATOM   4749 C  CG    . LYS F 3 246 ? 71.765  35.909 -107.092 1.00 61.12  ? 246  LYS B CG    1 
ATOM   4750 C  CD    . LYS F 3 246 ? 70.752  37.033 -107.094 1.00 61.67  ? 246  LYS B CD    1 
ATOM   4751 C  CE    . LYS F 3 246 ? 70.534  37.580 -105.696 1.00 62.04  ? 246  LYS B CE    1 
ATOM   4752 N  NZ    . LYS F 3 246 ? 69.521  38.674 -105.687 1.00 61.69  ? 246  LYS B NZ    1 
ATOM   4753 N  N     . THR F 3 247 ? 72.555  33.156 -106.349 1.00 48.21  ? 247  THR B N     1 
ATOM   4754 C  CA    . THR F 3 247 ? 72.164  32.166 -105.349 1.00 46.86  ? 247  THR B CA    1 
ATOM   4755 C  C     . THR F 3 247 ? 72.832  32.560 -104.044 1.00 45.68  ? 247  THR B C     1 
ATOM   4756 O  O     . THR F 3 247 ? 73.443  33.614 -103.961 1.00 43.87  ? 247  THR B O     1 
ATOM   4757 C  CB    . THR F 3 247 ? 72.633  30.751 -105.717 1.00 90.60  ? 247  THR B CB    1 
ATOM   4758 O  OG1   . THR F 3 247 ? 72.145  29.820 -104.742 1.00 91.28  ? 247  THR B OG1   1 
ATOM   4759 C  CG2   . THR F 3 247 ? 74.159  30.690 -105.760 1.00 93.09  ? 247  THR B CG2   1 
ATOM   4760 N  N     . THR F 3 248 ? 72.733  31.710 -103.030 1.00 73.98  ? 248  THR B N     1 
ATOM   4761 C  CA    . THR F 3 248 ? 73.342  32.024 -101.746 1.00 73.70  ? 248  THR B CA    1 
ATOM   4762 C  C     . THR F 3 248 ? 74.473  31.060 -101.379 1.00 73.97  ? 248  THR B C     1 
ATOM   4763 O  O     . THR F 3 248 ? 74.383  29.853 -101.604 1.00 74.32  ? 248  THR B O     1 
ATOM   4764 C  CB    . THR F 3 248 ? 72.282  32.020 -100.601 1.00 42.26  ? 248  THR B CB    1 
ATOM   4765 O  OG1   . THR F 3 248 ? 71.098  32.707 -101.024 1.00 40.51  ? 248  THR B OG1   1 
ATOM   4766 C  CG2   . THR F 3 248 ? 72.830  32.724 -99.363  1.00 40.84  ? 248  THR B CG2   1 
ATOM   4767 N  N     . LEU F 3 249 ? 75.543  31.625 -100.830 1.00 55.02  ? 249  LEU B N     1 
ATOM   4768 C  CA    . LEU F 3 249 ? 76.719  30.886 -100.376 1.00 55.10  ? 249  LEU B CA    1 
ATOM   4769 C  C     . LEU F 3 249 ? 77.087  31.656 -99.124  1.00 56.50  ? 249  LEU B C     1 
ATOM   4770 O  O     . LEU F 3 249 ? 77.392  32.846 -99.195  1.00 56.15  ? 249  LEU B O     1 
ATOM   4771 C  CB    . LEU F 3 249 ? 77.871  30.976 -101.386 1.00 32.94  ? 249  LEU B CB    1 
ATOM   4772 C  CG    . LEU F 3 249 ? 78.544  29.724 -101.981 1.00 31.46  ? 249  LEU B CG    1 
ATOM   4773 C  CD1   . LEU F 3 249 ? 79.215  28.914 -100.902 1.00 30.38  ? 249  LEU B CD1   1 
ATOM   4774 C  CD2   . LEU F 3 249 ? 77.513  28.862 -102.716 1.00 32.02  ? 249  LEU B CD2   1 
ATOM   4775 N  N     . SER F 3 250 ? 77.029  30.990 -97.976  1.00 54.73  ? 250  SER B N     1 
ATOM   4776 C  CA    . SER F 3 250 ? 77.343  31.641 -96.720  1.00 54.46  ? 250  SER B CA    1 
ATOM   4777 C  C     . SER F 3 250 ? 76.313  32.741 -96.445  1.00 53.97  ? 250  SER B C     1 
ATOM   4778 O  O     . SER F 3 250 ? 76.657  33.884 -96.146  1.00 54.00  ? 250  SER B O     1 
ATOM   4779 C  CB    . SER F 3 250 ? 78.756  32.227 -96.779  1.00 70.89  ? 250  SER B CB    1 
ATOM   4780 O  OG    . SER F 3 250 ? 79.706  31.210 -97.052  1.00 71.85  ? 250  SER B OG    1 
ATOM   4781 N  N     . SER F 3 251 ? 75.042  32.374 -96.558  1.00 56.90  ? 251  SER B N     1 
ATOM   4782 C  CA    . SER F 3 251 ? 73.936  33.291 -96.321  1.00 56.22  ? 251  SER B CA    1 
ATOM   4783 C  C     . SER F 3 251 ? 74.172  34.721 -96.811  1.00 56.48  ? 251  SER B C     1 
ATOM   4784 O  O     . SER F 3 251 ? 73.967  35.685 -96.073  1.00 57.61  ? 251  SER B O     1 
ATOM   4785 C  CB    . SER F 3 251 ? 73.583  33.289 -94.832  1.00 37.27  ? 251  SER B CB    1 
ATOM   4786 O  OG    . SER F 3 251 ? 74.756  33.349 -94.041  1.00 38.61  ? 251  SER B OG    1 
ATOM   4787 N  N     . ARG F 3 252 ? 74.587  34.855 -98.068  1.00 45.61  ? 252  ARG B N     1 
ATOM   4788 C  CA    . ARG F 3 252 ? 74.842  36.167 -98.667  1.00 45.07  ? 252  ARG B CA    1 
ATOM   4789 C  C     . ARG F 3 252 ? 74.743  36.064 -100.188 1.00 44.64  ? 252  ARG B C     1 
ATOM   4790 O  O     . ARG F 3 252 ? 75.141  35.059 -100.766 1.00 43.28  ? 252  ARG B O     1 
ATOM   4791 C  CB    . ARG F 3 252 ? 76.239  36.650 -98.275  1.00 54.79  ? 252  ARG B CB    1 
ATOM   4792 C  CG    . ARG F 3 252 ? 76.481  38.117 -98.564  1.00 54.62  ? 252  ARG B CG    1 
ATOM   4793 C  CD    . ARG F 3 252 ? 76.598  38.910 -97.273  1.00 52.78  ? 252  ARG B CD    1 
ATOM   4794 N  NE    . ARG F 3 252 ? 76.366  40.330 -97.494  1.00 50.08  ? 252  ARG B NE    1 
ATOM   4795 C  CZ    . ARG F 3 252 ? 76.450  41.242 -96.541  1.00 49.56  ? 252  ARG B CZ    1 
ATOM   4796 N  NH1   . ARG F 3 252 ? 76.765  40.872 -95.313  1.00 51.23  ? 252  ARG B NH1   1 
ATOM   4797 N  NH2   . ARG F 3 252 ? 76.213  42.517 -96.811  1.00 50.80  ? 252  ARG B NH2   1 
ATOM   4798 N  N     . PRO F 3 253 ? 74.200  37.095 -100.859 1.00 46.33  ? 253  PRO B N     1 
ATOM   4799 C  CA    . PRO F 3 253 ? 74.090  37.034 -102.326 1.00 46.70  ? 253  PRO B CA    1 
ATOM   4800 C  C     . PRO F 3 253 ? 75.465  36.701 -102.912 1.00 48.25  ? 253  PRO B C     1 
ATOM   4801 O  O     . PRO F 3 253 ? 76.485  37.085 -102.339 1.00 47.97  ? 253  PRO B O     1 
ATOM   4802 C  CB    . PRO F 3 253 ? 73.617  38.437 -102.694 1.00 55.95  ? 253  PRO B CB    1 
ATOM   4803 C  CG    . PRO F 3 253 ? 72.800  38.840 -101.487 1.00 55.18  ? 253  PRO B CG    1 
ATOM   4804 C  CD    . PRO F 3 253 ? 73.684  38.376 -100.346 1.00 56.53  ? 253  PRO B CD    1 
ATOM   4805 N  N     . PHE F 3 254 ? 75.499  35.995 -104.041 1.00 77.12  ? 254  PHE B N     1 
ATOM   4806 C  CA    . PHE F 3 254 ? 76.772  35.593 -104.638 1.00 78.40  ? 254  PHE B CA    1 
ATOM   4807 C  C     . PHE F 3 254 ? 77.128  36.212 -105.996 1.00 78.66  ? 254  PHE B C     1 
ATOM   4808 O  O     . PHE F 3 254 ? 77.869  37.190 -106.051 1.00 78.08  ? 254  PHE B O     1 
ATOM   4809 C  CB    . PHE F 3 254 ? 76.823  34.063 -104.724 1.00 74.69  ? 254  PHE B CB    1 
ATOM   4810 C  CG    . PHE F 3 254 ? 78.198  33.489 -104.512 1.00 76.38  ? 254  PHE B CG    1 
ATOM   4811 C  CD1   . PHE F 3 254 ? 78.956  33.861 -103.408 1.00 75.89  ? 254  PHE B CD1   1 
ATOM   4812 C  CD2   . PHE F 3 254 ? 78.732  32.574 -105.411 1.00 76.19  ? 254  PHE B CD2   1 
ATOM   4813 C  CE1   . PHE F 3 254 ? 80.222  33.334 -103.205 1.00 76.48  ? 254  PHE B CE1   1 
ATOM   4814 C  CE2   . PHE F 3 254 ? 80.000  32.041 -105.213 1.00 76.03  ? 254  PHE B CE2   1 
ATOM   4815 C  CZ    . PHE F 3 254 ? 80.746  32.422 -104.108 1.00 75.76  ? 254  PHE B CZ    1 
ATOM   4816 N  N     . TYR F 3 255 ? 76.625  35.650 -107.090 1.00 54.70  ? 255  TYR B N     1 
ATOM   4817 C  CA    . TYR F 3 255 ? 76.944  36.204 -108.401 1.00 54.85  ? 255  TYR B CA    1 
ATOM   4818 C  C     . TYR F 3 255 ? 78.226  35.624 -108.982 1.00 54.94  ? 255  TYR B C     1 
ATOM   4819 O  O     . TYR F 3 255 ? 79.239  35.546 -108.282 1.00 53.50  ? 255  TYR B O     1 
ATOM   4820 N  N     . TRP F 3 256 ? 78.189  35.229 -110.259 1.00 56.47  ? 256  TRP B N     1 
ATOM   4821 C  CA    . TRP F 3 256 ? 79.350  34.617 -110.926 1.00 57.07  ? 256  TRP B CA    1 
ATOM   4822 C  C     . TRP F 3 256 ? 79.059  34.137 -112.367 1.00 57.64  ? 256  TRP B C     1 
ATOM   4823 O  O     . TRP F 3 256 ? 78.006  34.428 -112.937 1.00 58.52  ? 256  TRP B O     1 
ATOM   4824 C  CB    . TRP F 3 256 ? 79.826  33.428 -110.091 1.00 47.03  ? 256  TRP B CB    1 
ATOM   4825 C  CG    . TRP F 3 256 ? 78.703  32.485 -109.766 1.00 48.60  ? 256  TRP B CG    1 
ATOM   4826 C  CD1   . TRP F 3 256 ? 77.548  32.784 -109.094 1.00 48.20  ? 256  TRP B CD1   1 
ATOM   4827 C  CD2   . TRP F 3 256 ? 78.594  31.109 -110.150 1.00 49.37  ? 256  TRP B CD2   1 
ATOM   4828 N  NE1   . TRP F 3 256 ? 76.731  31.688 -109.046 1.00 47.53  ? 256  TRP B NE1   1 
ATOM   4829 C  CE2   . TRP F 3 256 ? 77.346  30.644 -109.684 1.00 48.91  ? 256  TRP B CE2   1 
ATOM   4830 C  CE3   . TRP F 3 256 ? 79.428  30.226 -110.841 1.00 49.86  ? 256  TRP B CE3   1 
ATOM   4831 C  CZ2   . TRP F 3 256 ? 76.910  29.333 -109.890 1.00 49.89  ? 256  TRP B CZ2   1 
ATOM   4832 C  CZ3   . TRP F 3 256 ? 78.995  28.920 -111.047 1.00 50.48  ? 256  TRP B CZ3   1 
ATOM   4833 C  CH2   . TRP F 3 256 ? 77.747  28.488 -110.572 1.00 50.03  ? 256  TRP B CH2   1 
ATOM   4834 N  N     . CYS F 3 257 ? 80.002  33.398 -112.945 1.00 63.41  ? 257  CYS B N     1 
ATOM   4835 C  CA    . CYS F 3 257 ? 79.861  32.862 -114.301 1.00 63.69  ? 257  CYS B CA    1 
ATOM   4836 C  C     . CYS F 3 257 ? 80.530  31.494 -114.421 1.00 63.61  ? 257  CYS B C     1 
ATOM   4837 O  O     . CYS F 3 257 ? 81.060  31.172 -115.502 1.00 63.79  ? 257  CYS B O     1 
ATOM   4838 C  CB    . CYS F 3 257 ? 80.483  33.819 -115.328 1.00 62.18  ? 257  CYS B CB    1 
ATOM   4839 S  SG    . CYS F 3 257 ? 80.523  33.176 -117.036 1.00 60.41  ? 257  CYS B SG    1 
ATOM   4840 N  N     . CYS F 3 260 ? 83.133  31.482 -116.832 1.00 50.93  ? 260  CYS B N     1 
ATOM   4841 C  CA    . CYS F 3 260 ? 84.596  31.704 -116.682 1.00 47.56  ? 260  CYS B CA    1 
ATOM   4842 C  C     . CYS F 3 260 ? 85.041  31.852 -115.224 1.00 46.68  ? 260  CYS B C     1 
ATOM   4843 O  O     . CYS F 3 260 ? 85.903  32.674 -114.917 1.00 47.81  ? 260  CYS B O     1 
ATOM   4844 C  CB    . CYS F 3 260 ? 85.001  32.943 -117.469 1.00 41.87  ? 260  CYS B CB    1 
ATOM   4845 S  SG    . CYS F 3 260 ? 84.035  34.412 -117.071 1.00 42.93  ? 260  CYS B SG    1 
ATOM   4846 N  N     . GLN F 3 261 ? 84.439  31.071 -114.329 1.00 45.88  ? 261  GLN B N     1 
ATOM   4847 C  CA    . GLN F 3 261 ? 84.784  31.089 -112.900 1.00 45.04  ? 261  GLN B CA    1 
ATOM   4848 C  C     . GLN F 3 261 ? 85.000  29.634 -112.526 1.00 45.07  ? 261  GLN B C     1 
ATOM   4849 O  O     . GLN F 3 261 ? 84.117  28.797 -112.722 1.00 44.67  ? 261  GLN B O     1 
ATOM   4850 C  CB    . GLN F 3 261 ? 83.632  31.641 -112.043 1.00 39.38  ? 261  GLN B CB    1 
ATOM   4851 C  CG    . GLN F 3 261 ? 83.952  32.861 -111.197 1.00 39.36  ? 261  GLN B CG    1 
ATOM   4852 C  CD    . GLN F 3 261 ? 83.419  34.154 -111.803 1.00 38.02  ? 261  GLN B CD    1 
ATOM   4853 O  OE1   . GLN F 3 261 ? 82.466  34.757 -111.296 1.00 37.20  ? 261  GLN B OE1   1 
ATOM   4854 N  NE2   . GLN F 3 261 ? 84.027  34.581 -112.899 1.00 37.56  ? 261  GLN B NE2   1 
ATOM   4855 N  N     . HIS F 3 262 ? 86.169  29.323 -111.991 1.00 42.92  ? 262  HIS B N     1 
ATOM   4856 C  CA    . HIS F 3 262 ? 86.461  27.949 -111.600 1.00 43.32  ? 262  HIS B CA    1 
ATOM   4857 C  C     . HIS F 3 262 ? 87.378  28.021 -110.386 1.00 43.16  ? 262  HIS B C     1 
ATOM   4858 O  O     . HIS F 3 262 ? 87.583  29.104 -109.833 1.00 41.96  ? 262  HIS B O     1 
ATOM   4859 C  CB    . HIS F 3 262 ? 87.145  27.213 -112.758 1.00 47.37  ? 262  HIS B CB    1 
ATOM   4860 C  CG    . HIS F 3 262 ? 86.528  27.499 -114.094 1.00 48.89  ? 262  HIS B CG    1 
ATOM   4861 N  ND1   . HIS F 3 262 ? 85.308  26.983 -114.480 1.00 48.78  ? 262  HIS B ND1   1 
ATOM   4862 C  CD2   . HIS F 3 262 ? 86.930  28.303 -115.107 1.00 48.52  ? 262  HIS B CD2   1 
ATOM   4863 C  CE1   . HIS F 3 262 ? 84.986  27.458 -115.669 1.00 46.32  ? 262  HIS B CE1   1 
ATOM   4864 N  NE2   . HIS F 3 262 ? 85.952  28.262 -116.072 1.00 48.71  ? 262  HIS B NE2   1 
HETATM 4865 NA NA    . NA  G 4 .   ? 68.897  48.355 -98.595  1.00 43.95  ? 701  NA  F NA    1 
HETATM 4866 ZN ZN    . ZN  H 5 .   ? 25.186  34.697 -88.167  1.00 52.88  ? 501  ZN  A ZN    1 
HETATM 4867 S  S     . SO4 I 6 .   ? 30.862  50.569 -104.843 1.00 57.55  ? 601  SO4 A S     1 
HETATM 4868 O  O1    . SO4 I 6 .   ? 30.747  49.101 -104.876 1.00 60.32  ? 601  SO4 A O1    1 
HETATM 4869 O  O2    . SO4 I 6 .   ? 31.942  50.978 -105.756 1.00 59.21  ? 601  SO4 A O2    1 
HETATM 4870 O  O3    . SO4 I 6 .   ? 29.599  51.180 -105.280 1.00 58.37  ? 601  SO4 A O3    1 
HETATM 4871 O  O4    . SO4 I 6 .   ? 31.152  50.991 -103.466 1.00 61.54  ? 601  SO4 A O4    1 
HETATM 4872 ZN ZN    . ZN  J 5 .   ? 82.256  34.489 -118.012 1.00 66.70  ? 501  ZN  B ZN    1 
HETATM 4873 S  S     . SO4 K 6 .   ? 66.940  73.126 -95.360  1.00 57.55  ? 602  SO4 B S     1 
HETATM 4874 O  O1    . SO4 K 6 .   ? 67.089  73.222 -93.897  1.00 60.32  ? 602  SO4 B O1    1 
HETATM 4875 O  O2    . SO4 K 6 .   ? 67.236  71.747 -95.798  1.00 59.21  ? 602  SO4 B O2    1 
HETATM 4876 O  O3    . SO4 K 6 .   ? 65.553  73.471 -95.733  1.00 58.37  ? 602  SO4 B O3    1 
HETATM 4877 O  O4    . SO4 K 6 .   ? 67.861  74.071 -96.013  1.00 61.54  ? 602  SO4 B O4    1 
HETATM 4878 S  S     . SO4 L 6 .   ? 81.585  61.184 -103.632 1.00 24.95  ? 603  SO4 B S     1 
HETATM 4879 O  O1    . SO4 L 6 .   ? 82.635  60.375 -102.936 1.00 30.12  ? 603  SO4 B O1    1 
HETATM 4880 O  O2    . SO4 L 6 .   ? 81.018  62.227 -102.740 1.00 32.47  ? 603  SO4 B O2    1 
HETATM 4881 O  O3    . SO4 L 6 .   ? 82.203  61.835 -104.805 1.00 39.90  ? 603  SO4 B O3    1 
HETATM 4882 O  O4    . SO4 L 6 .   ? 80.490  60.276 -104.068 1.00 34.88  ? 603  SO4 B O4    1 
HETATM 4883 NA NA    . NA  M 4 .   ? 78.429  28.066 -96.630  1.00 60.63  ? 702  NA  B NA    1 
HETATM 4884 O  O     . HOH N 7 .   ? 42.284  46.498 -105.909 1.00 53.26  ? 1103 HOH C O     1 
HETATM 4885 O  O     . HOH N 7 .   ? 35.728  37.149 -114.179 1.00 49.12  ? 1104 HOH C O     1 
HETATM 4886 O  O     . HOH O 7 .   ? 26.028  41.168 -112.373 1.00 42.87  ? 1018 HOH D O     1 
HETATM 4887 O  O     . HOH O 7 .   ? 30.784  41.900 -121.415 1.00 41.95  ? 1028 HOH D O     1 
HETATM 4888 O  O     . HOH O 7 .   ? 27.512  41.370 -110.324 1.00 53.52  ? 1040 HOH D O     1 
HETATM 4889 O  O     . HOH O 7 .   ? 26.083  27.432 -119.303 1.00 64.45  ? 1041 HOH D O     1 
HETATM 4890 O  O     . HOH O 7 .   ? 32.565  47.482 -103.784 1.00 57.25  ? 1053 HOH D O     1 
HETATM 4891 O  O     . HOH O 7 .   ? 45.399  38.645 -113.168 1.00 50.57  ? 1056 HOH D O     1 
HETATM 4892 O  O     . HOH P 7 .   ? 59.288  42.392 -102.464 1.00 48.08  ? 1005 HOH E O     1 
HETATM 4893 O  O     . HOH P 7 .   ? 64.643  42.535 -105.991 1.00 42.38  ? 1065 HOH E O     1 
HETATM 4894 O  O     . HOH Q 7 .   ? 75.614  28.666 -85.276  1.00 55.93  ? 1058 HOH F O     1 
HETATM 4895 O  O     . HOH Q 7 .   ? 76.563  41.292 -85.052  1.00 43.96  ? 1088 HOH F O     1 
HETATM 4896 O  O     . HOH Q 7 .   ? 51.277  41.282 -90.258  1.00 49.00  ? 1092 HOH F O     1 
HETATM 4897 O  O     . HOH Q 7 .   ? 63.966  41.560 -93.299  1.00 53.46  ? 1093 HOH F O     1 
HETATM 4898 O  O     . HOH Q 7 .   ? 63.892  44.129 -102.048 1.00 42.77  ? 1098 HOH F O     1 
HETATM 4899 O  O     . HOH Q 7 .   ? 77.647  29.493 -87.660  1.00 44.00  ? 1114 HOH F O     1 
HETATM 4900 O  O     . HOH R 7 .   ? 27.648  55.816 -116.244 1.00 42.67  ? 1001 HOH A O     1 
HETATM 4901 O  O     . HOH R 7 .   ? 15.628  33.590 -119.661 1.00 57.52  ? 1010 HOH A O     1 
HETATM 4902 O  O     . HOH R 7 .   ? 11.449  48.660 -113.748 1.00 42.39  ? 1011 HOH A O     1 
HETATM 4903 O  O     . HOH R 7 .   ? 31.436  29.662 -107.936 1.00 56.97  ? 1012 HOH A O     1 
HETATM 4904 O  O     . HOH R 7 .   ? 24.732  48.416 -128.219 1.00 56.19  ? 1020 HOH A O     1 
HETATM 4905 O  O     . HOH R 7 .   ? 34.425  46.533 -114.944 1.00 54.69  ? 1021 HOH A O     1 
HETATM 4906 O  O     . HOH R 7 .   ? 18.403  34.159 -123.205 1.00 52.18  ? 1023 HOH A O     1 
HETATM 4907 O  O     . HOH R 7 .   ? 19.631  52.748 -110.323 1.00 36.83  ? 1024 HOH A O     1 
HETATM 4908 O  O     . HOH R 7 .   ? 41.220  61.976 -120.483 1.00 57.29  ? 1025 HOH A O     1 
HETATM 4909 O  O     . HOH R 7 .   ? 13.351  28.573 -113.512 1.00 49.02  ? 1026 HOH A O     1 
HETATM 4910 O  O     . HOH R 7 .   ? 28.362  54.701 -101.850 1.00 49.51  ? 1031 HOH A O     1 
HETATM 4911 O  O     . HOH R 7 .   ? 31.875  45.297 -120.845 1.00 62.82  ? 1032 HOH A O     1 
HETATM 4912 O  O     . HOH R 7 .   ? 19.001  35.245 -117.980 1.00 53.06  ? 1033 HOH A O     1 
HETATM 4913 O  O     . HOH R 7 .   ? 33.313  48.346 -122.686 1.00 54.45  ? 1034 HOH A O     1 
HETATM 4914 O  O     . HOH R 7 .   ? 24.261  25.792 -98.250  1.00 54.96  ? 1042 HOH A O     1 
HETATM 4915 O  O     . HOH R 7 .   ? 2.070   35.119 -112.332 1.00 45.98  ? 1046 HOH A O     1 
HETATM 4916 O  O     . HOH R 7 .   ? 5.228   33.740 -99.982  1.00 44.43  ? 1052 HOH A O     1 
HETATM 4917 O  O     . HOH R 7 .   ? 9.476   35.027 -93.171  1.00 53.05  ? 1055 HOH A O     1 
HETATM 4918 O  O     . HOH R 7 .   ? 27.669  54.980 -97.309  1.00 45.73  ? 1057 HOH A O     1 
HETATM 4919 O  O     . HOH R 7 .   ? 21.696  37.905 -118.508 1.00 48.09  ? 1061 HOH A O     1 
HETATM 4920 O  O     . HOH R 7 .   ? 16.432  28.147 -94.086  1.00 52.66  ? 1063 HOH A O     1 
HETATM 4921 O  O     . HOH R 7 .   ? 27.255  47.581 -127.546 1.00 39.29  ? 1067 HOH A O     1 
HETATM 4922 O  O     . HOH R 7 .   ? 26.990  51.527 -114.039 1.00 49.28  ? 1068 HOH A O     1 
HETATM 4923 O  O     . HOH R 7 .   ? 20.929  69.449 -132.557 1.00 38.50  ? 1069 HOH A O     1 
HETATM 4924 O  O     . HOH R 7 .   ? 35.649  70.813 -116.122 1.00 44.77  ? 1073 HOH A O     1 
HETATM 4925 O  O     . HOH R 7 .   ? 13.844  48.429 -122.891 1.00 52.89  ? 1075 HOH A O     1 
HETATM 4926 O  O     . HOH R 7 .   ? 27.917  49.229 -112.839 1.00 44.84  ? 1076 HOH A O     1 
HETATM 4927 O  O     . HOH R 7 .   ? 20.399  50.200 -87.732  1.00 54.28  ? 1077 HOH A O     1 
HETATM 4928 O  O     . HOH R 7 .   ? 16.190  62.278 -125.663 1.00 49.90  ? 1081 HOH A O     1 
HETATM 4929 O  O     . HOH R 7 .   ? 18.585  73.997 -124.093 1.00 39.45  ? 1083 HOH A O     1 
HETATM 4930 O  O     . HOH R 7 .   ? 21.950  42.595 -94.932  1.00 51.87  ? 1090 HOH A O     1 
HETATM 4931 O  O     . HOH R 7 .   ? 20.396  45.407 -130.519 1.00 48.96  ? 1094 HOH A O     1 
HETATM 4932 O  O     . HOH R 7 .   ? 4.778   29.842 -111.238 1.00 46.59  ? 1095 HOH A O     1 
HETATM 4933 O  O     . HOH R 7 .   ? 12.520  26.585 -115.867 1.00 44.39  ? 1096 HOH A O     1 
HETATM 4934 O  O     . HOH R 7 .   ? 35.384  73.292 -118.714 1.00 53.00  ? 1113 HOH A O     1 
HETATM 4935 O  O     . HOH R 7 .   ? 13.539  62.915 -123.796 1.00 44.88  ? 1115 HOH A O     1 
HETATM 4936 O  O     . HOH R 7 .   ? 12.770  25.874 -97.161  1.00 37.67  ? 1116 HOH A O     1 
HETATM 4937 O  O     . HOH R 7 .   ? 24.607  67.337 -107.915 1.00 44.62  ? 1119 HOH A O     1 
HETATM 4938 O  O     . HOH S 7 .   ? 84.541  46.645 -91.587  1.00 43.99  ? 1003 HOH B O     1 
HETATM 4939 O  O     . HOH S 7 .   ? 88.461  56.451 -65.736  1.00 54.86  ? 1004 HOH B O     1 
HETATM 4940 O  O     . HOH S 7 .   ? 92.270  60.171 -92.119  1.00 45.03  ? 1007 HOH B O     1 
HETATM 4941 O  O     . HOH S 7 .   ? 85.290  69.842 -86.582  1.00 41.10  ? 1008 HOH B O     1 
HETATM 4942 O  O     . HOH S 7 .   ? 85.933  72.041 -75.655  1.00 54.79  ? 1013 HOH B O     1 
HETATM 4943 O  O     . HOH S 7 .   ? 81.992  24.123 -98.591  1.00 42.93  ? 1014 HOH B O     1 
HETATM 4944 O  O     . HOH S 7 .   ? 94.936  41.144 -78.942  1.00 53.43  ? 1016 HOH B O     1 
HETATM 4945 O  O     . HOH S 7 .   ? 80.906  46.910 -84.871  1.00 48.50  ? 1017 HOH B O     1 
HETATM 4946 O  O     . HOH S 7 .   ? 76.044  28.609 -99.070  1.00 52.97  ? 1019 HOH B O     1 
HETATM 4947 O  O     . HOH S 7 .   ? 75.634  78.007 -97.321  1.00 56.64  ? 1022 HOH B O     1 
HETATM 4948 O  O     . HOH S 7 .   ? 90.380  44.247 -75.998  1.00 46.61  ? 1027 HOH B O     1 
HETATM 4949 O  O     . HOH S 7 .   ? 76.860  67.353 -72.377  1.00 52.60  ? 1035 HOH B O     1 
HETATM 4950 O  O     . HOH S 7 .   ? 90.968  31.792 -88.664  1.00 59.93  ? 1036 HOH B O     1 
HETATM 4951 O  O     . HOH S 7 .   ? 90.625  21.668 -99.248  1.00 50.91  ? 1037 HOH B O     1 
HETATM 4952 O  O     . HOH S 7 .   ? 94.569  64.682 -72.911  1.00 59.88  ? 1039 HOH B O     1 
HETATM 4953 O  O     . HOH S 7 .   ? 77.193  76.414 -79.657  1.00 54.62  ? 1044 HOH B O     1 
HETATM 4954 O  O     . HOH S 7 .   ? 92.755  43.470 -110.147 1.00 58.33  ? 1045 HOH B O     1 
HETATM 4955 O  O     . HOH S 7 .   ? 76.501  33.827 -92.724  1.00 55.99  ? 1047 HOH B O     1 
HETATM 4956 O  O     . HOH S 7 .   ? 103.220 41.064 -107.489 1.00 48.38  ? 1048 HOH B O     1 
HETATM 4957 O  O     . HOH S 7 .   ? 91.214  74.381 -84.764  1.00 49.58  ? 1049 HOH B O     1 
HETATM 4958 O  O     . HOH S 7 .   ? 72.899  72.262 -96.802  1.00 47.43  ? 1051 HOH B O     1 
HETATM 4959 O  O     . HOH S 7 .   ? 85.418  73.840 -96.199  1.00 38.22  ? 1054 HOH B O     1 
HETATM 4960 O  O     . HOH S 7 .   ? 87.525  48.419 -74.725  1.00 46.01  ? 1059 HOH B O     1 
HETATM 4961 O  O     . HOH S 7 .   ? 80.913  53.648 -90.417  1.00 48.42  ? 1062 HOH B O     1 
HETATM 4962 O  O     . HOH S 7 .   ? 92.969  74.791 -82.520  1.00 44.33  ? 1066 HOH B O     1 
HETATM 4963 O  O     . HOH S 7 .   ? 77.258  55.304 -102.569 1.00 51.41  ? 1071 HOH B O     1 
HETATM 4964 O  O     . HOH S 7 .   ? 86.387  69.258 -73.622  1.00 55.03  ? 1072 HOH B O     1 
HETATM 4965 O  O     . HOH S 7 .   ? 93.889  40.330 -87.631  1.00 57.11  ? 1074 HOH B O     1 
HETATM 4966 O  O     . HOH S 7 .   ? 75.535  45.835 -110.620 1.00 49.41  ? 1080 HOH B O     1 
HETATM 4967 O  O     . HOH S 7 .   ? 64.820  76.311 -96.239  1.00 43.12  ? 1085 HOH B O     1 
HETATM 4968 O  O     . HOH S 7 .   ? 92.422  54.317 -96.123  1.00 54.34  ? 1087 HOH B O     1 
HETATM 4969 O  O     . HOH S 7 .   ? 97.334  68.737 -90.440  1.00 54.57  ? 1089 HOH B O     1 
HETATM 4970 O  O     . HOH S 7 .   ? 80.529  66.051 -99.299  1.00 43.24  ? 1091 HOH B O     1 
HETATM 4971 O  O     . HOH S 7 .   ? 94.964  64.066 -88.721  1.00 40.48  ? 1097 HOH B O     1 
HETATM 4972 O  O     . HOH S 7 .   ? 88.415  63.507 -72.074  1.00 54.87  ? 1099 HOH B O     1 
HETATM 4973 O  O     . HOH S 7 .   ? 75.263  67.762 -99.453  1.00 50.35  ? 1100 HOH B O     1 
HETATM 4974 O  O     . HOH S 7 .   ? 82.494  60.284 -107.952 1.00 49.40  ? 1101 HOH B O     1 
HETATM 4975 O  O     . HOH S 7 .   ? 96.191  43.767 -79.498  1.00 47.70  ? 1102 HOH B O     1 
HETATM 4976 O  O     . HOH S 7 .   ? 74.773  50.461 -87.573  1.00 51.61  ? 1117 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   401 ?   ?   ?   C . n 
A 1 2   DG  2   402 402 DG  GUA C . n 
A 1 3   DC  3   403 403 DC  CYT C . n 
A 1 4   DT  4   404 404 DT  THY C . n 
A 1 5   DT  5   405 405 DT  THY C . n 
A 1 6   DC  6   406 406 DC  CYT C . n 
A 1 7   DA  7   407 407 DA  ADE C . n 
A 1 8   DT  8   408 408 DT  THY C . n 
A 1 9   DC  9   409 409 DC  CYT C . n 
A 1 10  DC  10  410 410 DC  CYT C . n 
A 1 11  DT  11  411 411 DT  THY C . n 
A 1 12  DG  12  412 412 DG  GUA C . n 
A 1 13  DG  13  413 ?   ?   ?   C . n 
B 2 1   DC  1   421 ?   ?   ?   D . n 
B 2 2   DC  2   422 422 DC  CYT D . n 
B 2 3   DA  3   423 423 DA  ADE D . n 
B 2 4   DG  4   424 424 DG  GUA D . n 
B 2 5   DG  5   425 425 DG  GUA D . n 
B 2 6   DA  6   426 426 DA  ADE D . n 
B 2 7   PED 7   427 427 PED PED D . n 
B 2 8   DG  8   428 428 DG  GUA D . n 
B 2 9   DA  9   429 429 DA  ADE D . n 
B 2 10  DA  10  430 430 DA  ADE D . n 
B 2 11  DG  11  431 431 DG  GUA D . n 
B 2 12  DC  12  432 432 DC  CYT D . n 
B 2 13  DC  13  433 433 DC  CYT D . n 
C 1 1   DG  1   401 ?   ?   ?   E . n 
C 1 2   DG  2   402 ?   ?   ?   E . n 
C 1 3   DC  3   403 ?   ?   ?   E . n 
C 1 4   DT  4   404 404 DT  THY E . n 
C 1 5   DT  5   405 405 DT  THY E . n 
C 1 6   DC  6   406 406 DC  CYT E . n 
C 1 7   DA  7   407 407 DA  ADE E . n 
C 1 8   DT  8   408 408 DT  THY E . n 
C 1 9   DC  9   409 409 DC  CYT E . n 
C 1 10  DC  10  410 410 DC  CYT E . n 
C 1 11  DT  11  411 411 DT  THY E . n 
C 1 12  DG  12  412 412 DG  GUA E . n 
C 1 13  DG  13  413 ?   ?   ?   E . n 
D 2 1   DC  1   421 ?   ?   ?   F . n 
D 2 2   DC  2   422 422 DC  CYT F . n 
D 2 3   DA  3   423 423 DA  ADE F . n 
D 2 4   DG  4   424 424 DG  GUA F . n 
D 2 5   DG  5   425 425 DG  GUA F . n 
D 2 6   DA  6   426 426 DA  ADE F . n 
D 2 7   PED 7   427 427 PED PED F . n 
D 2 8   DG  8   428 428 DG  GUA F . n 
D 2 9   DA  9   429 429 DA  ADE F . n 
D 2 10  DA  10  430 430 DA  ADE F . n 
D 2 11  DG  11  431 431 DG  GUA F . n 
D 2 12  DC  12  432 432 DC  CYT F . n 
D 2 13  DC  13  433 ?   ?   ?   F . n 
E 3 1   PRO 1   1   1   PRO PRO A . n 
E 3 2   GLN 2   2   2   GLN GLN A . n 
E 3 3   GLY 3   3   3   GLY GLY A . n 
E 3 4   PRO 4   4   4   PRO PRO A . n 
E 3 5   GLU 5   5   5   GLU GLU A . n 
E 3 6   ILE 6   6   6   ILE ILE A . n 
E 3 7   ARG 7   7   7   ARG ARG A . n 
E 3 8   ARG 8   8   8   ARG ARG A . n 
E 3 9   ALA 9   9   9   ALA ALA A . n 
E 3 10  ALA 10  10  10  ALA ALA A . n 
E 3 11  ASP 11  11  11  ASP ASP A . n 
E 3 12  ASN 12  12  12  ASN ASN A . n 
E 3 13  LEU 13  13  13  LEU LEU A . n 
E 3 14  GLU 14  14  14  GLU GLU A . n 
E 3 15  ALA 15  15  15  ALA ALA A . n 
E 3 16  ALA 16  16  16  ALA ALA A . n 
E 3 17  ILE 17  17  17  ILE ILE A . n 
E 3 18  LYS 18  18  18  LYS LYS A . n 
E 3 19  GLY 19  19  19  GLY GLY A . n 
E 3 20  LYS 20  20  20  LYS LYS A . n 
E 3 21  PRO 21  21  21  PRO PRO A . n 
E 3 22  LEU 22  22  22  LEU LEU A . n 
E 3 23  THR 23  23  23  THR THR A . n 
E 3 24  ASP 24  24  24  ASP ASP A . n 
E 3 25  VAL 25  25  25  VAL VAL A . n 
E 3 26  TRP 26  26  26  TRP TRP A . n 
E 3 27  PHE 27  27  27  PHE PHE A . n 
E 3 28  ALA 28  28  28  ALA ALA A . n 
E 3 29  PHE 29  29  29  PHE PHE A . n 
E 3 30  PRO 30  30  30  PRO PRO A . n 
E 3 31  GLN 31  31  31  GLN GLN A . n 
E 3 32  LEU 32  32  32  LEU LEU A . n 
E 3 33  LYS 33  33  33  LYS LYS A . n 
E 3 34  THR 34  34  34  THR THR A . n 
E 3 35  TYR 35  35  35  TYR TYR A . n 
E 3 36  GLN 36  36  36  GLN GLN A . n 
E 3 37  SER 37  37  37  SER SER A . n 
E 3 38  GLN 38  38  38  GLN GLN A . n 
E 3 39  LEU 39  39  39  LEU LEU A . n 
E 3 40  ILE 40  40  40  ILE ILE A . n 
E 3 41  GLY 41  41  41  GLY GLY A . n 
E 3 42  GLN 42  42  42  GLN GLN A . n 
E 3 43  HIS 43  43  43  HIS HIS A . n 
E 3 44  VAL 44  44  44  VAL VAL A . n 
E 3 45  THR 45  45  45  THR THR A . n 
E 3 46  HIS 46  46  46  HIS HIS A . n 
E 3 47  VAL 47  47  47  VAL VAL A . n 
E 3 48  GLU 48  48  48  GLU GLU A . n 
E 3 49  THR 49  49  49  THR THR A . n 
E 3 50  ARG 50  50  50  ARG ARG A . n 
E 3 51  GLY 51  51  51  GLY GLY A . n 
E 3 52  LYS 52  52  52  LYS LYS A . n 
E 3 53  ALA 53  53  53  ALA ALA A . n 
E 3 54  LEU 54  54  54  LEU LEU A . n 
E 3 55  LEU 55  55  55  LEU LEU A . n 
E 3 56  THR 56  56  56  THR THR A . n 
E 3 57  HIS 57  57  57  HIS HIS A . n 
E 3 58  PHE 58  58  58  PHE PHE A . n 
E 3 59  SER 59  59  59  SER SER A . n 
E 3 60  ASN 60  60  60  ASN ASN A . n 
E 3 61  ASP 61  61  61  ASP ASP A . n 
E 3 62  LEU 62  62  62  LEU LEU A . n 
E 3 63  THR 63  63  63  THR THR A . n 
E 3 64  LEU 64  64  64  LEU LEU A . n 
E 3 65  TYR 65  65  65  TYR TYR A . n 
E 3 66  SER 66  66  66  SER SER A . n 
E 3 67  HIS 67  67  67  HIS HIS A . n 
E 3 68  ASN 68  68  68  ASN ASN A . n 
E 3 69  GLN 69  69  69  GLN GLN A . n 
E 3 70  LEU 70  70  70  LEU LEU A . n 
E 3 71  TYR 71  71  71  TYR TYR A . n 
E 3 72  GLY 72  72  72  GLY GLY A . n 
E 3 73  VAL 73  73  73  VAL VAL A . n 
E 3 74  TRP 74  74  74  TRP TRP A . n 
E 3 75  ARG 75  75  75  ARG ARG A . n 
E 3 76  VAL 76  76  76  VAL VAL A . n 
E 3 77  VAL 77  77  77  VAL VAL A . n 
E 3 78  ASP 78  78  78  ASP ASP A . n 
E 3 79  THR 79  79  79  THR THR A . n 
E 3 80  GLY 80  80  80  GLY GLY A . n 
E 3 81  GLU 81  81  81  GLU GLU A . n 
E 3 82  GLU 82  82  82  GLU GLU A . n 
E 3 83  PRO 83  83  83  PRO PRO A . n 
E 3 84  GLN 84  84  84  GLN GLN A . n 
E 3 85  THR 85  85  85  THR THR A . n 
E 3 86  THR 86  86  86  THR ALA A . n 
E 3 87  ARG 87  87  87  ARG ARG A . n 
E 3 88  VAL 88  88  88  VAL VAL A . n 
E 3 89  LEU 89  89  89  LEU LEU A . n 
E 3 90  ARG 90  90  90  ARG ARG A . n 
E 3 91  VAL 91  91  91  VAL VAL A . n 
E 3 92  LYS 92  92  92  LYS LYS A . n 
E 3 93  LEU 93  93  93  LEU LEU A . n 
E 3 94  GLN 94  94  94  GLN GLN A . n 
E 3 95  THR 95  95  95  THR THR A . n 
E 3 96  ALA 96  96  96  ALA ALA A . n 
E 3 97  ASP 97  97  97  ASP ASP A . n 
E 3 98  LYS 98  98  98  LYS LYS A . n 
E 3 99  THR 99  99  99  THR THR A . n 
E 3 100 ILE 100 100 100 ILE ILE A . n 
E 3 101 LEU 101 101 101 LEU LEU A . n 
E 3 102 LEU 102 102 102 LEU LEU A . n 
E 3 103 TYR 103 103 103 TYR TYR A . n 
E 3 104 SER 104 104 104 SER SER A . n 
E 3 105 ALA 105 105 105 ALA ALA A . n 
E 3 106 SER 106 106 106 SER SER A . n 
E 3 107 ASP 107 107 107 ASP ASP A . n 
E 3 108 ILE 108 108 108 ILE ILE A . n 
E 3 109 GLU 109 109 109 GLU GLU A . n 
E 3 110 MET 110 110 110 MET MET A . n 
E 3 111 LEU 111 111 111 LEU LEU A . n 
E 3 112 ARG 112 112 112 ARG ARG A . n 
E 3 113 PRO 113 113 113 PRO PRO A . n 
E 3 114 GLU 114 114 114 GLU GLU A . n 
E 3 115 GLN 115 115 115 GLN GLN A . n 
E 3 116 LEU 116 116 116 LEU LEU A . n 
E 3 117 THR 117 117 117 THR THR A . n 
E 3 118 THR 118 118 118 THR THR A . n 
E 3 119 HIS 119 119 119 HIS HIS A . n 
E 3 120 PRO 120 120 120 PRO PRO A . n 
E 3 121 PHE 121 121 121 PHE PHE A . n 
E 3 122 LEU 122 122 122 LEU LEU A . n 
E 3 123 GLN 123 123 123 GLN GLN A . n 
E 3 124 ARG 124 124 124 ARG ARG A . n 
E 3 125 VAL 125 125 125 VAL VAL A . n 
E 3 126 GLY 126 126 126 GLY GLY A . n 
E 3 127 PRO 127 127 127 PRO PRO A . n 
E 3 128 ASP 128 128 128 ASP ASP A . n 
E 3 129 VAL 129 129 129 VAL VAL A . n 
E 3 130 LEU 130 130 130 LEU LEU A . n 
E 3 131 ASP 131 131 131 ASP ASP A . n 
E 3 132 PRO 132 132 132 PRO PRO A . n 
E 3 133 ASN 133 133 133 ASN ASN A . n 
E 3 134 LEU 134 134 134 LEU LEU A . n 
E 3 135 THR 135 135 135 THR THR A . n 
E 3 136 PRO 136 136 136 PRO PRO A . n 
E 3 137 GLU 137 137 137 GLU GLU A . n 
E 3 138 VAL 138 138 138 VAL VAL A . n 
E 3 139 VAL 139 139 139 VAL VAL A . n 
E 3 140 LYS 140 140 140 LYS LYS A . n 
E 3 141 GLU 141 141 141 GLU GLU A . n 
E 3 142 ARG 142 142 142 ARG ARG A . n 
E 3 143 LEU 143 143 143 LEU LEU A . n 
E 3 144 LEU 144 144 144 LEU LEU A . n 
E 3 145 SER 145 145 145 SER SER A . n 
E 3 146 PRO 146 146 146 PRO PRO A . n 
E 3 147 ARG 147 147 147 ARG ARG A . n 
E 3 148 PHE 148 148 148 PHE PHE A . n 
E 3 149 ARG 149 149 149 ARG ALA A . n 
E 3 150 ASN 150 150 150 ASN ASN A . n 
E 3 151 ARG 151 151 151 ARG ARG A . n 
E 3 152 GLN 152 152 152 GLN GLN A . n 
E 3 153 PHE 153 153 153 PHE PHE A . n 
E 3 154 ALA 154 154 154 ALA ALA A . n 
E 3 155 GLY 155 155 155 GLY GLY A . n 
E 3 156 LEU 156 156 156 LEU LEU A . n 
E 3 157 LEU 157 157 157 LEU LEU A . n 
E 3 158 LEU 158 158 158 LEU LEU A . n 
E 3 159 ASP 159 159 159 ASP ASP A . n 
E 3 160 GLN 160 160 160 GLN GLN A . n 
E 3 161 ALA 161 161 161 ALA ALA A . n 
E 3 162 PHE 162 162 162 PHE PHE A . n 
E 3 163 LEU 163 163 163 LEU LEU A . n 
E 3 164 ALA 164 164 164 ALA ALA A . n 
E 3 165 GLY 165 165 165 GLY GLY A . n 
E 3 166 LEU 166 166 166 LEU LEU A . n 
E 3 167 GLY 167 167 167 GLY GLY A . n 
E 3 168 ASN 168 168 168 ASN ASN A . n 
E 3 169 TYR 169 169 169 TYR TYR A . n 
E 3 170 LEU 170 170 170 LEU LEU A . n 
E 3 171 ARG 171 171 171 ARG ARG A . n 
E 3 172 VAL 172 172 172 VAL VAL A . n 
E 3 173 GLU 173 173 173 GLU GLU A . n 
E 3 174 ILE 174 174 174 ILE ILE A . n 
E 3 175 LEU 175 175 175 LEU LEU A . n 
E 3 176 TRP 176 176 176 TRP TRP A . n 
E 3 177 GLN 177 177 177 GLN GLN A . n 
E 3 178 VAL 178 178 178 VAL VAL A . n 
E 3 179 GLY 179 179 179 GLY GLY A . n 
E 3 180 LEU 180 180 180 LEU LEU A . n 
E 3 181 THR 181 181 181 THR THR A . n 
E 3 182 GLY 182 182 182 GLY GLY A . n 
E 3 183 ASN 183 183 183 ASN ASN A . n 
E 3 184 HIS 184 184 184 HIS HIS A . n 
E 3 185 LYS 185 185 185 LYS LYS A . n 
E 3 186 ALA 186 186 186 ALA ALA A . n 
E 3 187 LYS 187 187 187 LYS LYS A . n 
E 3 188 ASP 188 188 188 ASP ASP A . n 
E 3 189 LEU 189 189 189 LEU LEU A . n 
E 3 190 ASN 190 190 190 ASN ASN A . n 
E 3 191 ALA 191 191 191 ALA ALA A . n 
E 3 192 ALA 192 192 192 ALA ALA A . n 
E 3 193 GLN 193 193 193 GLN GLN A . n 
E 3 194 LEU 194 194 194 LEU LEU A . n 
E 3 195 ASP 195 195 195 ASP ASP A . n 
E 3 196 ALA 196 196 196 ALA ALA A . n 
E 3 197 LEU 197 197 197 LEU LEU A . n 
E 3 198 ALA 198 198 198 ALA ALA A . n 
E 3 199 HIS 199 199 199 HIS HIS A . n 
E 3 200 ALA 200 200 200 ALA ALA A . n 
E 3 201 LEU 201 201 201 LEU LEU A . n 
E 3 202 LEU 202 202 202 LEU LEU A . n 
E 3 203 GLU 203 203 203 GLU GLU A . n 
E 3 204 ILE 204 204 204 ILE ILE A . n 
E 3 205 PRO 205 205 205 PRO PRO A . n 
E 3 206 ARG 206 206 206 ARG ARG A . n 
E 3 207 PHE 207 207 207 PHE PHE A . n 
E 3 208 SER 208 208 208 SER SER A . n 
E 3 209 TYR 209 209 209 TYR TYR A . n 
E 3 210 ALA 210 210 210 ALA ALA A . n 
E 3 211 THR 211 211 211 THR THR A . n 
E 3 212 ARG 212 212 212 ARG ARG A . n 
E 3 213 GLY 213 213 213 GLY GLY A . n 
E 3 214 GLN 214 214 ?   ?   ?   A . n 
E 3 215 VAL 215 215 ?   ?   ?   A . n 
E 3 216 ASP 216 216 ?   ?   ?   A . n 
E 3 217 GLU 217 217 ?   ?   ?   A . n 
E 3 218 ASN 218 218 ?   ?   ?   A . n 
E 3 219 LYS 219 219 ?   ?   ?   A . n 
E 3 220 HIS 220 220 ?   ?   ?   A . n 
E 3 221 HIS 221 221 ?   ?   ?   A . n 
E 3 222 GLY 222 222 ?   ?   ?   A . n 
E 3 223 ALA 223 223 ?   ?   ?   A . n 
E 3 224 LEU 224 224 224 LEU LEU A . n 
E 3 225 PHE 225 225 225 PHE PHE A . n 
E 3 226 ARG 226 226 226 ARG ARG A . n 
E 3 227 PHE 227 227 227 PHE PHE A . n 
E 3 228 LYS 228 228 228 LYS LYS A . n 
E 3 229 VAL 229 229 229 VAL VAL A . n 
E 3 230 PHE 230 230 230 PHE PHE A . n 
E 3 231 HIS 231 231 231 HIS HIS A . n 
E 3 232 ARG 232 232 232 ARG ARG A . n 
E 3 233 ASP 233 233 233 ASP ASP A . n 
E 3 234 GLY 234 234 234 GLY GLY A . n 
E 3 235 GLU 235 235 235 GLU GLU A . n 
E 3 236 PRO 236 236 236 PRO PRO A . n 
E 3 237 CYS 237 237 237 CYS CYS A . n 
E 3 238 GLU 238 238 238 GLU GLU A . n 
E 3 239 ARG 239 239 239 ARG ARG A . n 
E 3 240 CYS 240 240 240 CYS CYS A . n 
E 3 241 GLY 241 241 241 GLY GLY A . n 
E 3 242 SER 242 242 242 SER SER A . n 
E 3 243 ILE 243 243 243 ILE ALA A . n 
E 3 244 ILE 244 244 244 ILE ILE A . n 
E 3 245 GLU 245 245 245 GLU GLU A . n 
E 3 246 LYS 246 246 246 LYS LYS A . n 
E 3 247 THR 247 247 247 THR THR A . n 
E 3 248 THR 248 248 248 THR THR A . n 
E 3 249 LEU 249 249 249 LEU LEU A . n 
E 3 250 SER 250 250 250 SER SER A . n 
E 3 251 SER 251 251 251 SER SER A . n 
E 3 252 ARG 252 252 252 ARG ARG A . n 
E 3 253 PRO 253 253 253 PRO PRO A . n 
E 3 254 PHE 254 254 254 PHE PHE A . n 
E 3 255 TYR 255 255 255 TYR TYR A . n 
E 3 256 TRP 256 256 256 TRP TRP A . n 
E 3 257 CYS 257 257 257 CYS CYS A . n 
E 3 258 PRO 258 258 258 PRO PRO A . n 
E 3 259 GLY 259 259 259 GLY GLY A . n 
E 3 260 CYS 260 260 260 CYS CYS A . n 
E 3 261 GLN 261 261 261 GLN GLN A . n 
E 3 262 HIS 262 262 262 HIS HIS A . n 
F 3 1   PRO 1   1   1   PRO PRO B . n 
F 3 2   GLN 2   2   2   GLN GLN B . n 
F 3 3   GLY 3   3   3   GLY GLY B . n 
F 3 4   PRO 4   4   4   PRO PRO B . n 
F 3 5   GLU 5   5   5   GLU GLU B . n 
F 3 6   ILE 6   6   6   ILE ILE B . n 
F 3 7   ARG 7   7   7   ARG ARG B . n 
F 3 8   ARG 8   8   8   ARG ARG B . n 
F 3 9   ALA 9   9   9   ALA ALA B . n 
F 3 10  ALA 10  10  10  ALA ALA B . n 
F 3 11  ASP 11  11  11  ASP ASP B . n 
F 3 12  ASN 12  12  12  ASN ASN B . n 
F 3 13  LEU 13  13  13  LEU LEU B . n 
F 3 14  GLU 14  14  14  GLU GLU B . n 
F 3 15  ALA 15  15  15  ALA ALA B . n 
F 3 16  ALA 16  16  16  ALA ALA B . n 
F 3 17  ILE 17  17  17  ILE ILE B . n 
F 3 18  LYS 18  18  18  LYS LYS B . n 
F 3 19  GLY 19  19  19  GLY GLY B . n 
F 3 20  LYS 20  20  20  LYS LYS B . n 
F 3 21  PRO 21  21  21  PRO PRO B . n 
F 3 22  LEU 22  22  22  LEU LEU B . n 
F 3 23  THR 23  23  23  THR THR B . n 
F 3 24  ASP 24  24  24  ASP ASP B . n 
F 3 25  VAL 25  25  25  VAL VAL B . n 
F 3 26  TRP 26  26  26  TRP TRP B . n 
F 3 27  PHE 27  27  27  PHE PHE B . n 
F 3 28  ALA 28  28  28  ALA ALA B . n 
F 3 29  PHE 29  29  29  PHE PHE B . n 
F 3 30  PRO 30  30  30  PRO PRO B . n 
F 3 31  GLN 31  31  31  GLN GLN B . n 
F 3 32  LEU 32  32  32  LEU LEU B . n 
F 3 33  LYS 33  33  33  LYS LYS B . n 
F 3 34  THR 34  34  34  THR THR B . n 
F 3 35  TYR 35  35  35  TYR TYR B . n 
F 3 36  GLN 36  36  36  GLN GLN B . n 
F 3 37  SER 37  37  37  SER SER B . n 
F 3 38  GLN 38  38  38  GLN GLN B . n 
F 3 39  LEU 39  39  39  LEU LEU B . n 
F 3 40  ILE 40  40  40  ILE ILE B . n 
F 3 41  GLY 41  41  41  GLY GLY B . n 
F 3 42  GLN 42  42  42  GLN GLN B . n 
F 3 43  HIS 43  43  43  HIS HIS B . n 
F 3 44  VAL 44  44  44  VAL VAL B . n 
F 3 45  THR 45  45  45  THR THR B . n 
F 3 46  HIS 46  46  46  HIS HIS B . n 
F 3 47  VAL 47  47  47  VAL VAL B . n 
F 3 48  GLU 48  48  48  GLU GLU B . n 
F 3 49  THR 49  49  49  THR THR B . n 
F 3 50  ARG 50  50  50  ARG ARG B . n 
F 3 51  GLY 51  51  51  GLY GLY B . n 
F 3 52  LYS 52  52  52  LYS LYS B . n 
F 3 53  ALA 53  53  53  ALA ALA B . n 
F 3 54  LEU 54  54  54  LEU LEU B . n 
F 3 55  LEU 55  55  55  LEU LEU B . n 
F 3 56  THR 56  56  56  THR THR B . n 
F 3 57  HIS 57  57  57  HIS HIS B . n 
F 3 58  PHE 58  58  58  PHE PHE B . n 
F 3 59  SER 59  59  59  SER SER B . n 
F 3 60  ASN 60  60  60  ASN ASN B . n 
F 3 61  ASP 61  61  61  ASP ASP B . n 
F 3 62  LEU 62  62  62  LEU LEU B . n 
F 3 63  THR 63  63  63  THR THR B . n 
F 3 64  LEU 64  64  64  LEU LEU B . n 
F 3 65  TYR 65  65  65  TYR TYR B . n 
F 3 66  SER 66  66  66  SER SER B . n 
F 3 67  HIS 67  67  67  HIS HIS B . n 
F 3 68  ASN 68  68  68  ASN ASN B . n 
F 3 69  GLN 69  69  69  GLN GLN B . n 
F 3 70  LEU 70  70  70  LEU LEU B . n 
F 3 71  TYR 71  71  71  TYR TYR B . n 
F 3 72  GLY 72  72  72  GLY GLY B . n 
F 3 73  VAL 73  73  73  VAL VAL B . n 
F 3 74  TRP 74  74  74  TRP TRP B . n 
F 3 75  ARG 75  75  75  ARG ARG B . n 
F 3 76  VAL 76  76  76  VAL VAL B . n 
F 3 77  VAL 77  77  77  VAL VAL B . n 
F 3 78  ASP 78  78  78  ASP ASP B . n 
F 3 79  THR 79  79  79  THR THR B . n 
F 3 80  GLY 80  80  80  GLY GLY B . n 
F 3 81  GLU 81  81  81  GLU GLU B . n 
F 3 82  GLU 82  82  82  GLU GLU B . n 
F 3 83  PRO 83  83  83  PRO PRO B . n 
F 3 84  GLN 84  84  84  GLN GLN B . n 
F 3 85  THR 85  85  85  THR THR B . n 
F 3 86  THR 86  86  86  THR THR B . n 
F 3 87  ARG 87  87  87  ARG ARG B . n 
F 3 88  VAL 88  88  88  VAL VAL B . n 
F 3 89  LEU 89  89  89  LEU LEU B . n 
F 3 90  ARG 90  90  90  ARG ARG B . n 
F 3 91  VAL 91  91  91  VAL VAL B . n 
F 3 92  LYS 92  92  92  LYS LYS B . n 
F 3 93  LEU 93  93  93  LEU LEU B . n 
F 3 94  GLN 94  94  94  GLN GLN B . n 
F 3 95  THR 95  95  95  THR THR B . n 
F 3 96  ALA 96  96  96  ALA ALA B . n 
F 3 97  ASP 97  97  97  ASP ASP B . n 
F 3 98  LYS 98  98  98  LYS LYS B . n 
F 3 99  THR 99  99  99  THR THR B . n 
F 3 100 ILE 100 100 100 ILE ILE B . n 
F 3 101 LEU 101 101 101 LEU LEU B . n 
F 3 102 LEU 102 102 102 LEU LEU B . n 
F 3 103 TYR 103 103 103 TYR TYR B . n 
F 3 104 SER 104 104 104 SER SER B . n 
F 3 105 ALA 105 105 105 ALA ALA B . n 
F 3 106 SER 106 106 106 SER SER B . n 
F 3 107 ASP 107 107 107 ASP ASP B . n 
F 3 108 ILE 108 108 108 ILE ILE B . n 
F 3 109 GLU 109 109 109 GLU GLU B . n 
F 3 110 MET 110 110 110 MET MET B . n 
F 3 111 LEU 111 111 111 LEU LEU B . n 
F 3 112 ARG 112 112 112 ARG ARG B . n 
F 3 113 PRO 113 113 113 PRO PRO B . n 
F 3 114 GLU 114 114 114 GLU GLU B . n 
F 3 115 GLN 115 115 115 GLN GLN B . n 
F 3 116 LEU 116 116 116 LEU LEU B . n 
F 3 117 THR 117 117 117 THR THR B . n 
F 3 118 THR 118 118 118 THR THR B . n 
F 3 119 HIS 119 119 119 HIS HIS B . n 
F 3 120 PRO 120 120 120 PRO PRO B . n 
F 3 121 PHE 121 121 121 PHE PHE B . n 
F 3 122 LEU 122 122 122 LEU LEU B . n 
F 3 123 GLN 123 123 123 GLN GLN B . n 
F 3 124 ARG 124 124 124 ARG ARG B . n 
F 3 125 VAL 125 125 125 VAL VAL B . n 
F 3 126 GLY 126 126 126 GLY GLY B . n 
F 3 127 PRO 127 127 127 PRO PRO B . n 
F 3 128 ASP 128 128 128 ASP ASP B . n 
F 3 129 VAL 129 129 129 VAL VAL B . n 
F 3 130 LEU 130 130 130 LEU LEU B . n 
F 3 131 ASP 131 131 131 ASP ASP B . n 
F 3 132 PRO 132 132 132 PRO PRO B . n 
F 3 133 ASN 133 133 133 ASN ASN B . n 
F 3 134 LEU 134 134 134 LEU LEU B . n 
F 3 135 THR 135 135 135 THR THR B . n 
F 3 136 PRO 136 136 136 PRO PRO B . n 
F 3 137 GLU 137 137 137 GLU GLU B . n 
F 3 138 VAL 138 138 138 VAL VAL B . n 
F 3 139 VAL 139 139 139 VAL VAL B . n 
F 3 140 LYS 140 140 140 LYS LYS B . n 
F 3 141 GLU 141 141 141 GLU GLU B . n 
F 3 142 ARG 142 142 142 ARG ARG B . n 
F 3 143 LEU 143 143 143 LEU LEU B . n 
F 3 144 LEU 144 144 144 LEU LEU B . n 
F 3 145 SER 145 145 145 SER SER B . n 
F 3 146 PRO 146 146 146 PRO PRO B . n 
F 3 147 ARG 147 147 147 ARG ARG B . n 
F 3 148 PHE 148 148 148 PHE PHE B . n 
F 3 149 ARG 149 149 149 ARG ARG B . n 
F 3 150 ASN 150 150 150 ASN ASN B . n 
F 3 151 ARG 151 151 151 ARG ARG B . n 
F 3 152 GLN 152 152 152 GLN GLN B . n 
F 3 153 PHE 153 153 153 PHE PHE B . n 
F 3 154 ALA 154 154 154 ALA ALA B . n 
F 3 155 GLY 155 155 155 GLY GLY B . n 
F 3 156 LEU 156 156 156 LEU LEU B . n 
F 3 157 LEU 157 157 157 LEU LEU B . n 
F 3 158 LEU 158 158 158 LEU LEU B . n 
F 3 159 ASP 159 159 159 ASP ASP B . n 
F 3 160 GLN 160 160 160 GLN GLN B . n 
F 3 161 ALA 161 161 161 ALA ALA B . n 
F 3 162 PHE 162 162 162 PHE PHE B . n 
F 3 163 LEU 163 163 163 LEU LEU B . n 
F 3 164 ALA 164 164 164 ALA ALA B . n 
F 3 165 GLY 165 165 165 GLY GLY B . n 
F 3 166 LEU 166 166 166 LEU LEU B . n 
F 3 167 GLY 167 167 167 GLY GLY B . n 
F 3 168 ASN 168 168 168 ASN ASN B . n 
F 3 169 TYR 169 169 169 TYR TYR B . n 
F 3 170 LEU 170 170 170 LEU LEU B . n 
F 3 171 ARG 171 171 171 ARG ARG B . n 
F 3 172 VAL 172 172 172 VAL VAL B . n 
F 3 173 GLU 173 173 173 GLU GLU B . n 
F 3 174 ILE 174 174 174 ILE ILE B . n 
F 3 175 LEU 175 175 175 LEU LEU B . n 
F 3 176 TRP 176 176 176 TRP TRP B . n 
F 3 177 GLN 177 177 177 GLN GLN B . n 
F 3 178 VAL 178 178 178 VAL VAL B . n 
F 3 179 GLY 179 179 179 GLY GLY B . n 
F 3 180 LEU 180 180 180 LEU LEU B . n 
F 3 181 THR 181 181 181 THR THR B . n 
F 3 182 GLY 182 182 182 GLY GLY B . n 
F 3 183 ASN 183 183 183 ASN ASN B . n 
F 3 184 HIS 184 184 184 HIS HIS B . n 
F 3 185 LYS 185 185 185 LYS LYS B . n 
F 3 186 ALA 186 186 186 ALA ALA B . n 
F 3 187 LYS 187 187 187 LYS LYS B . n 
F 3 188 ASP 188 188 188 ASP ASP B . n 
F 3 189 LEU 189 189 189 LEU LEU B . n 
F 3 190 ASN 190 190 190 ASN ASN B . n 
F 3 191 ALA 191 191 191 ALA ALA B . n 
F 3 192 ALA 192 192 192 ALA ALA B . n 
F 3 193 GLN 193 193 193 GLN GLN B . n 
F 3 194 LEU 194 194 194 LEU LEU B . n 
F 3 195 ASP 195 195 195 ASP GLY B . n 
F 3 196 ALA 196 196 196 ALA ALA B . n 
F 3 197 LEU 197 197 197 LEU LEU B . n 
F 3 198 ALA 198 198 198 ALA ALA B . n 
F 3 199 HIS 199 199 199 HIS HIS B . n 
F 3 200 ALA 200 200 200 ALA ALA B . n 
F 3 201 LEU 201 201 201 LEU LEU B . n 
F 3 202 LEU 202 202 202 LEU LEU B . n 
F 3 203 GLU 203 203 203 GLU GLU B . n 
F 3 204 ILE 204 204 204 ILE ILE B . n 
F 3 205 PRO 205 205 205 PRO PRO B . n 
F 3 206 ARG 206 206 206 ARG ARG B . n 
F 3 207 PHE 207 207 207 PHE PHE B . n 
F 3 208 SER 208 208 208 SER SER B . n 
F 3 209 TYR 209 209 209 TYR TYR B . n 
F 3 210 ALA 210 210 210 ALA ALA B . n 
F 3 211 THR 211 211 211 THR THR B . n 
F 3 212 ARG 212 212 212 ARG ARG B . n 
F 3 213 GLY 213 213 ?   ?   ?   B . n 
F 3 214 GLN 214 214 ?   ?   ?   B . n 
F 3 215 VAL 215 215 ?   ?   ?   B . n 
F 3 216 ASP 216 216 ?   ?   ?   B . n 
F 3 217 GLU 217 217 ?   ?   ?   B . n 
F 3 218 ASN 218 218 ?   ?   ?   B . n 
F 3 219 LYS 219 219 ?   ?   ?   B . n 
F 3 220 HIS 220 220 ?   ?   ?   B . n 
F 3 221 HIS 221 221 ?   ?   ?   B . n 
F 3 222 GLY 222 222 ?   ?   ?   B . n 
F 3 223 ALA 223 223 223 ALA ALA B . n 
F 3 224 LEU 224 224 224 LEU ALA B . n 
F 3 225 PHE 225 225 225 PHE PHE B . n 
F 3 226 ARG 226 226 226 ARG ARG B . n 
F 3 227 PHE 227 227 227 PHE PHE B . n 
F 3 228 LYS 228 228 228 LYS LYS B . n 
F 3 229 VAL 229 229 229 VAL VAL B . n 
F 3 230 PHE 230 230 230 PHE PHE B . n 
F 3 231 HIS 231 231 231 HIS HIS B . n 
F 3 232 ARG 232 232 232 ARG ARG B . n 
F 3 233 ASP 233 233 233 ASP ASP B . n 
F 3 234 GLY 234 234 234 GLY GLY B . n 
F 3 235 GLU 235 235 235 GLU GLU B . n 
F 3 236 PRO 236 236 236 PRO PRO B . n 
F 3 237 CYS 237 237 237 CYS CYS B . n 
F 3 238 GLU 238 238 238 GLU GLU B . n 
F 3 239 ARG 239 239 239 ARG ARG B . n 
F 3 240 CYS 240 240 240 CYS CYS B . n 
F 3 241 GLY 241 241 241 GLY GLY B . n 
F 3 242 SER 242 242 242 SER SER B . n 
F 3 243 ILE 243 243 243 ILE ILE B . n 
F 3 244 ILE 244 244 244 ILE ILE B . n 
F 3 245 GLU 245 245 245 GLU GLU B . n 
F 3 246 LYS 246 246 246 LYS LYS B . n 
F 3 247 THR 247 247 247 THR THR B . n 
F 3 248 THR 248 248 248 THR THR B . n 
F 3 249 LEU 249 249 249 LEU LEU B . n 
F 3 250 SER 250 250 250 SER SER B . n 
F 3 251 SER 251 251 251 SER SER B . n 
F 3 252 ARG 252 252 252 ARG ARG B . n 
F 3 253 PRO 253 253 253 PRO PRO B . n 
F 3 254 PHE 254 254 254 PHE PHE B . n 
F 3 255 TYR 255 255 255 TYR GLY B . n 
F 3 256 TRP 256 256 256 TRP TRP B . n 
F 3 257 CYS 257 257 257 CYS CYS B . n 
F 3 258 PRO 258 258 ?   ?   ?   B . n 
F 3 259 GLY 259 259 ?   ?   ?   B . n 
F 3 260 CYS 260 260 260 CYS CYS B . n 
F 3 261 GLN 261 261 261 GLN GLN B . n 
F 3 262 HIS 262 262 262 HIS HIS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 NA  1  701  701  NA  NA  F . 
H 5 ZN  1  501  501  ZN  ZN  A . 
I 6 SO4 1  601  601  SO4 SO4 A . 
J 5 ZN  1  501  501  ZN  ZN  B . 
K 6 SO4 1  602  602  SO4 SO4 B . 
L 6 SO4 1  603  603  SO4 SO4 B . 
M 4 NA  1  702  702  NA  NA  B . 
N 7 HOH 1  1103 1103 HOH WAT C . 
N 7 HOH 2  1104 1104 HOH WAT C . 
O 7 HOH 1  1018 1018 HOH WAT D . 
O 7 HOH 2  1028 1028 HOH WAT D . 
O 7 HOH 3  1040 1040 HOH WAT D . 
O 7 HOH 4  1041 1041 HOH WAT D . 
O 7 HOH 5  1053 1053 HOH WAT D . 
O 7 HOH 6  1056 1056 HOH WAT D . 
P 7 HOH 1  1005 1005 HOH WAT E . 
P 7 HOH 2  1065 1065 HOH WAT E . 
Q 7 HOH 1  1058 1058 HOH WAT F . 
Q 7 HOH 2  1088 1088 HOH WAT F . 
Q 7 HOH 3  1092 1092 HOH WAT F . 
Q 7 HOH 4  1093 1093 HOH WAT F . 
Q 7 HOH 5  1098 1098 HOH WAT F . 
Q 7 HOH 6  1114 1114 HOH WAT F . 
R 7 HOH 1  1001 1001 HOH WAT A . 
R 7 HOH 2  1010 1010 HOH WAT A . 
R 7 HOH 3  1011 1011 HOH WAT A . 
R 7 HOH 4  1012 1012 HOH WAT A . 
R 7 HOH 5  1020 1020 HOH WAT A . 
R 7 HOH 6  1021 1021 HOH WAT A . 
R 7 HOH 7  1023 1023 HOH WAT A . 
R 7 HOH 8  1024 1024 HOH WAT A . 
R 7 HOH 9  1025 1025 HOH WAT A . 
R 7 HOH 10 1026 1026 HOH WAT A . 
R 7 HOH 11 1031 1031 HOH WAT A . 
R 7 HOH 12 1032 1032 HOH WAT A . 
R 7 HOH 13 1033 1033 HOH WAT A . 
R 7 HOH 14 1034 1034 HOH WAT A . 
R 7 HOH 15 1042 1042 HOH WAT A . 
R 7 HOH 16 1046 1046 HOH WAT A . 
R 7 HOH 17 1052 1052 HOH WAT A . 
R 7 HOH 18 1055 1055 HOH WAT A . 
R 7 HOH 19 1057 1057 HOH WAT A . 
R 7 HOH 20 1061 1061 HOH WAT A . 
R 7 HOH 21 1063 1063 HOH WAT A . 
R 7 HOH 22 1067 1067 HOH WAT A . 
R 7 HOH 23 1068 1068 HOH WAT A . 
R 7 HOH 24 1069 1069 HOH WAT A . 
R 7 HOH 25 1073 1073 HOH WAT A . 
R 7 HOH 26 1075 1075 HOH WAT A . 
R 7 HOH 27 1076 1076 HOH WAT A . 
R 7 HOH 28 1077 1077 HOH WAT A . 
R 7 HOH 29 1081 1081 HOH WAT A . 
R 7 HOH 30 1083 1083 HOH WAT A . 
R 7 HOH 31 1090 1090 HOH WAT A . 
R 7 HOH 32 1094 1094 HOH WAT A . 
R 7 HOH 33 1095 1095 HOH WAT A . 
R 7 HOH 34 1096 1096 HOH WAT A . 
R 7 HOH 35 1113 1113 HOH WAT A . 
R 7 HOH 36 1115 1115 HOH WAT A . 
R 7 HOH 37 1116 1116 HOH WAT A . 
R 7 HOH 38 1119 1119 HOH WAT A . 
S 7 HOH 1  1003 1003 HOH WAT B . 
S 7 HOH 2  1004 1004 HOH WAT B . 
S 7 HOH 3  1007 1007 HOH WAT B . 
S 7 HOH 4  1008 1008 HOH WAT B . 
S 7 HOH 5  1013 1013 HOH WAT B . 
S 7 HOH 6  1014 1014 HOH WAT B . 
S 7 HOH 7  1016 1016 HOH WAT B . 
S 7 HOH 8  1017 1017 HOH WAT B . 
S 7 HOH 9  1019 1019 HOH WAT B . 
S 7 HOH 10 1022 1022 HOH WAT B . 
S 7 HOH 11 1027 1027 HOH WAT B . 
S 7 HOH 12 1035 1035 HOH WAT B . 
S 7 HOH 13 1036 1036 HOH WAT B . 
S 7 HOH 14 1037 1037 HOH WAT B . 
S 7 HOH 15 1039 1039 HOH WAT B . 
S 7 HOH 16 1044 1044 HOH WAT B . 
S 7 HOH 17 1045 1045 HOH WAT B . 
S 7 HOH 18 1047 1047 HOH WAT B . 
S 7 HOH 19 1048 1048 HOH WAT B . 
S 7 HOH 20 1049 1049 HOH WAT B . 
S 7 HOH 21 1051 1051 HOH WAT B . 
S 7 HOH 22 1054 1054 HOH WAT B . 
S 7 HOH 23 1059 1059 HOH WAT B . 
S 7 HOH 24 1062 1062 HOH WAT B . 
S 7 HOH 25 1066 1066 HOH WAT B . 
S 7 HOH 26 1071 1071 HOH WAT B . 
S 7 HOH 27 1072 1072 HOH WAT B . 
S 7 HOH 28 1074 1074 HOH WAT B . 
S 7 HOH 29 1080 1080 HOH WAT B . 
S 7 HOH 30 1085 1085 HOH WAT B . 
S 7 HOH 31 1087 1087 HOH WAT B . 
S 7 HOH 32 1089 1089 HOH WAT B . 
S 7 HOH 33 1091 1091 HOH WAT B . 
S 7 HOH 34 1097 1097 HOH WAT B . 
S 7 HOH 35 1099 1099 HOH WAT B . 
S 7 HOH 36 1100 1100 HOH WAT B . 
S 7 HOH 37 1101 1101 HOH WAT B . 
S 7 HOH 38 1102 1102 HOH WAT B . 
S 7 HOH 39 1117 1117 HOH WAT B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,H,I,N,O,R       
2 1 C,D,F,G,J,K,L,M,P,Q,S 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? E CYS 237 ? A CYS 237 ? 1_555 ZN ? H ZN . ? A ZN 501 ? 1_555 SG ? E CYS 240 ? A CYS 240 ? 1_555 110.4 ? 
2  SG ? E CYS 237 ? A CYS 237 ? 1_555 ZN ? H ZN . ? A ZN 501 ? 1_555 SG ? E CYS 257 ? A CYS 257 ? 1_555 100.5 ? 
3  SG ? E CYS 240 ? A CYS 240 ? 1_555 ZN ? H ZN . ? A ZN 501 ? 1_555 SG ? E CYS 257 ? A CYS 257 ? 1_555 94.6  ? 
4  SG ? E CYS 237 ? A CYS 237 ? 1_555 ZN ? H ZN . ? A ZN 501 ? 1_555 SG ? E CYS 260 ? A CYS 260 ? 1_555 112.2 ? 
5  SG ? E CYS 240 ? A CYS 240 ? 1_555 ZN ? H ZN . ? A ZN 501 ? 1_555 SG ? E CYS 260 ? A CYS 260 ? 1_555 109.8 ? 
6  SG ? E CYS 257 ? A CYS 257 ? 1_555 ZN ? H ZN . ? A ZN 501 ? 1_555 SG ? E CYS 260 ? A CYS 260 ? 1_555 127.7 ? 
7  SG ? F CYS 237 ? B CYS 237 ? 1_555 ZN ? J ZN . ? B ZN 501 ? 1_555 SG ? F CYS 240 ? B CYS 240 ? 1_555 108.2 ? 
8  SG ? F CYS 237 ? B CYS 237 ? 1_555 ZN ? J ZN . ? B ZN 501 ? 1_555 SG ? F CYS 257 ? B CYS 257 ? 1_555 112.6 ? 
9  SG ? F CYS 240 ? B CYS 240 ? 1_555 ZN ? J ZN . ? B ZN 501 ? 1_555 SG ? F CYS 257 ? B CYS 257 ? 1_555 85.2  ? 
10 SG ? F CYS 237 ? B CYS 237 ? 1_555 ZN ? J ZN . ? B ZN 501 ? 1_555 SG ? F CYS 260 ? B CYS 260 ? 1_555 110.4 ? 
11 SG ? F CYS 240 ? B CYS 240 ? 1_555 ZN ? J ZN . ? B ZN 501 ? 1_555 SG ? F CYS 260 ? B CYS 260 ? 1_555 122.8 ? 
12 SG ? F CYS 257 ? B CYS 257 ? 1_555 ZN ? J ZN . ? B ZN 501 ? 1_555 SG ? F CYS 260 ? B CYS 260 ? 1_555 115.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-02-26 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.0 ? 1 
d*TREK 'data reduction' .   ? 2 
d*TREK 'data scaling'   .   ? 3 
CNS    phasing          .   ? 4 
# 
_pdbx_entry_details.sequence_details     
'SEQUENCING AND CRYSTALLOGRAPHY CONFIRM THE SEQUENCE AS THR A 34, THR B 34, ARG A 112, ARG B 112.' 
_pdbx_entry_details.entry_id             2OQ4 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B GLN 2   ? ? O   B GLY 165 ? ? 2.17 
2 1 OG1 A THR 181 ? ? OD1 A ASN 183 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 36  ? ? -58.06  -79.18  
2  1 HIS A 46  ? ? -176.09 143.10  
3  1 ARG A 50  ? ? -158.76 50.27   
4  1 GLN A 69  ? ? 44.94   -111.24 
5  1 THR A 85  ? ? 178.06  167.07  
6  1 SER A 104 ? ? 66.00   -61.60  
7  1 ALA A 105 ? ? -21.09  140.14  
8  1 GLU A 114 ? ? 137.86  -49.43  
9  1 PRO A 127 ? ? -48.51  156.59  
10 1 ASN A 133 ? ? -48.80  -11.30  
11 1 SER A 145 ? ? -48.53  157.00  
12 1 LEU A 157 ? ? -65.81  2.06    
13 1 VAL A 229 ? ? -156.25 -9.76   
14 1 SER A 250 ? ? 72.87   33.72   
15 1 GLN B 2   ? ? -147.96 -13.41  
16 1 GLN B 69  ? ? 37.37   -111.03 
17 1 SER B 104 ? ? 50.85   -37.07  
18 1 LEU B 116 ? ? -62.79  -88.72  
19 1 THR B 117 ? ? -24.30  -51.03  
20 1 PHE B 153 ? ? -55.83  -6.22   
21 1 ARG B 171 ? ? -34.98  -78.74  
22 1 THR B 181 ? ? -95.38  -147.08 
23 1 ALA B 186 ? ? -64.33  12.48   
24 1 LEU B 201 ? ? -58.68  -8.58   
25 1 PHE B 230 ? ? -48.58  103.13  
26 1 ARG B 239 ? ? -106.95 -63.27  
27 1 THR B 247 ? ? 163.55  -172.64 
28 1 SER B 251 ? ? 37.71   50.81   
29 1 PHE B 254 ? ? -113.89 -83.44  
30 1 TYR B 255 ? ? 87.62   133.48  
31 1 TRP B 256 ? ? 175.60  -170.15 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DG D 428 ? ? 0.078 'SIDE CHAIN' 
2 1 DT E 411 ? ? 0.064 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C DG  402 ? P   ? A DG  2   P   
2  1 Y 1 C DG  402 ? OP1 ? A DG  2   OP1 
3  1 Y 1 C DG  402 ? OP2 ? A DG  2   OP2 
4  1 Y 1 D DC  422 ? P   ? B DC  2   P   
5  1 Y 1 D DC  422 ? OP1 ? B DC  2   OP1 
6  1 Y 1 D DC  422 ? OP2 ? B DC  2   OP2 
7  1 Y 1 E DT  404 ? P   ? C DT  4   P   
8  1 Y 1 E DT  404 ? OP1 ? C DT  4   OP1 
9  1 Y 1 E DT  404 ? OP2 ? C DT  4   OP2 
10 1 Y 1 F DC  422 ? P   ? D DC  2   P   
11 1 Y 1 F DC  422 ? OP1 ? D DC  2   OP1 
12 1 Y 1 F DC  422 ? OP2 ? D DC  2   OP2 
13 1 Y 1 A THR 86  ? OG1 ? E THR 86  OG1 
14 1 Y 1 A THR 86  ? CG2 ? E THR 86  CG2 
15 1 Y 1 A ARG 149 ? CG  ? E ARG 149 CG  
16 1 Y 1 A ARG 149 ? CD  ? E ARG 149 CD  
17 1 Y 1 A ARG 149 ? NE  ? E ARG 149 NE  
18 1 Y 1 A ARG 149 ? CZ  ? E ARG 149 CZ  
19 1 Y 1 A ARG 149 ? NH1 ? E ARG 149 NH1 
20 1 Y 1 A ARG 149 ? NH2 ? E ARG 149 NH2 
21 1 Y 1 A ILE 243 ? CG1 ? E ILE 243 CG1 
22 1 Y 1 A ILE 243 ? CG2 ? E ILE 243 CG2 
23 1 Y 1 A ILE 243 ? CD1 ? E ILE 243 CD1 
24 1 Y 1 B ASP 195 ? CB  ? F ASP 195 CB  
25 1 Y 1 B ASP 195 ? CG  ? F ASP 195 CG  
26 1 Y 1 B ASP 195 ? OD1 ? F ASP 195 OD1 
27 1 Y 1 B ASP 195 ? OD2 ? F ASP 195 OD2 
28 1 Y 1 B LEU 224 ? CG  ? F LEU 224 CG  
29 1 Y 1 B LEU 224 ? CD1 ? F LEU 224 CD1 
30 1 Y 1 B LEU 224 ? CD2 ? F LEU 224 CD2 
31 1 Y 1 B TYR 255 ? CB  ? F TYR 255 CB  
32 1 Y 1 B TYR 255 ? CG  ? F TYR 255 CG  
33 1 Y 1 B TYR 255 ? CD1 ? F TYR 255 CD1 
34 1 Y 1 B TYR 255 ? CD2 ? F TYR 255 CD2 
35 1 Y 1 B TYR 255 ? CE1 ? F TYR 255 CE1 
36 1 Y 1 B TYR 255 ? CE2 ? F TYR 255 CE2 
37 1 Y 1 B TYR 255 ? CZ  ? F TYR 255 CZ  
38 1 Y 1 B TYR 255 ? OH  ? F TYR 255 OH  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 C DG  401 ? A DG  1   
2  1 Y 1 C DG  413 ? A DG  13  
3  1 Y 1 D DC  421 ? B DC  1   
4  1 Y 1 E DG  401 ? C DG  1   
5  1 Y 1 E DG  402 ? C DG  2   
6  1 Y 1 E DC  403 ? C DC  3   
7  1 Y 1 E DG  413 ? C DG  13  
8  1 Y 1 F DC  421 ? D DC  1   
9  1 Y 1 F DC  433 ? D DC  13  
10 1 Y 1 A GLN 214 ? E GLN 214 
11 1 Y 1 A VAL 215 ? E VAL 215 
12 1 Y 1 A ASP 216 ? E ASP 216 
13 1 Y 1 A GLU 217 ? E GLU 217 
14 1 Y 1 A ASN 218 ? E ASN 218 
15 1 Y 1 A LYS 219 ? E LYS 219 
16 1 Y 1 A HIS 220 ? E HIS 220 
17 1 Y 1 A HIS 221 ? E HIS 221 
18 1 Y 1 A GLY 222 ? E GLY 222 
19 1 Y 1 A ALA 223 ? E ALA 223 
20 1 Y 1 B GLY 213 ? F GLY 213 
21 1 Y 1 B GLN 214 ? F GLN 214 
22 1 Y 1 B VAL 215 ? F VAL 215 
23 1 Y 1 B ASP 216 ? F ASP 216 
24 1 Y 1 B GLU 217 ? F GLU 217 
25 1 Y 1 B ASN 218 ? F ASN 218 
26 1 Y 1 B LYS 219 ? F LYS 219 
27 1 Y 1 B HIS 220 ? F HIS 220 
28 1 Y 1 B HIS 221 ? F HIS 221 
29 1 Y 1 B GLY 222 ? F GLY 222 
30 1 Y 1 B PRO 258 ? F PRO 258 
31 1 Y 1 B GLY 259 ? F GLY 259 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2OQ4 'double helix'         
2OQ4 'b-form double helix'  
2OQ4 'mismatched base pair' 
2OQ4 'internal loop'        
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 B DC 12 1_555 -2.303 -0.506 -0.460 2.618   -3.757  -38.968 1  C_DG402:DC432_D C 402 ? D 432 ? ?  ? 
1 A DC 3  1_555 B DG 11 1_555 0.861  -0.701 0.195  -0.186  -24.859 -15.302 2  C_DC403:DG431_D C 403 ? D 431 ? 19 1 
1 A DT 5  1_555 B DA 9  1_555 -1.153 -0.562 -0.823 4.780   0.023   -2.474  3  C_DT405:DA429_D C 405 ? D 429 ? 20 1 
1 A DT 8  1_555 B DA 6  1_555 0.112  -0.080 -0.485 -8.380  -5.596  -10.462 4  C_DT408:DA426_D C 408 ? D 426 ? 20 1 
1 A DC 9  1_555 B DG 5  1_555 0.320  -0.291 -0.321 -4.098  -12.650 -13.290 5  C_DC409:DG425_D C 409 ? D 425 ? 19 1 
1 A DC 10 1_555 B DG 4  1_555 -1.185 0.419  0.440  -2.913  -6.828  -2.724  6  C_DC410:DG424_D C 410 ? D 424 ? ?  1 
1 A DG 12 1_555 B DC 2  1_555 -0.592 -0.894 0.335  6.261   -7.788  -6.053  7  C_DG412:DC422_D C 412 ? D 422 ? 19 1 
1 D DC 2  1_555 C DG 12 1_555 -2.885 -0.014 -0.552 8.979   -6.505  1.670   8  F_DC422:DG412_E F 422 ? E 412 ? ?  ? 
1 D DA 3  1_555 C DT 11 1_555 1.299  -0.381 -0.111 35.722  -25.511 1.953   9  F_DA423:DT411_E F 423 ? E 411 ? 20 1 
1 D DG 5  1_555 C DC 9  1_555 0.484  -0.517 0.196  7.251   -6.742  -5.894  10 F_DG425:DC409_E F 425 ? E 409 ? 19 1 
1 D DA 6  1_555 C DT 8  1_555 -1.024 0.337  0.097  13.266  2.180   -3.894  11 F_DA426:DT408_E F 426 ? E 408 ? ?  ? 
1 C DT 4  1_555 D DA 10 1_555 0.507  0.001  0.250  -16.555 -14.094 -6.646  12 E_DT404:DA430_F E 404 ? F 430 ? 20 1 
1 C DT 5  1_555 D DA 9  1_555 -1.130 0.120  0.563  -9.525  4.113   -10.184 13 E_DT405:DA429_F E 405 ? F 429 ? 20 1 
1 C DC 6  1_555 D DG 8  1_555 0.109  -0.314 0.648  8.741   7.170   -2.883  14 E_DC406:DG428_F E 406 ? F 428 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 B DC 12 1_555 A DC 3  1_555 B DG 11 1_555 0.826  -0.536 3.539 -5.260  2.483  53.753  -0.753 -1.255 3.424 2.737  
5.798   54.044  1  CC_DG402DC403:DG431DC432_DD C 402 ? D 432 ? C 403 ? D 431 ? 
1 A DC 3  1_555 B DG 11 1_555 A DT 5  1_555 B DA 9  1_555 1.133  -0.645 6.359 15.113  1.661  62.640  -0.747 0.220  6.438 1.573  
-14.314 64.277  2  CC_DC403DT405:DA429DG431_DD C 403 ? D 431 ? C 405 ? D 429 ? 
1 A DT 8  1_555 B DA 6  1_555 A DC 9  1_555 B DG 5  1_555 0.241  0.201  3.190 3.816   7.147  32.426  -0.818 0.205  3.169 12.555 
-6.703  33.396  3  CC_DT408DC409:DG425DA426_DD C 408 ? D 426 ? C 409 ? D 425 ? 
1 A DC 9  1_555 B DG 5  1_555 A DC 10 1_555 B DG 4  1_555 0.163  -0.129 3.270 -10.372 11.158 27.365  -2.332 -2.247 2.773 21.594 
20.073  31.249  4  CC_DC409DC410:DG424DG425_DD C 409 ? D 425 ? C 410 ? D 424 ? 
1 A DC 10 1_555 B DG 4  1_555 A DG 12 1_555 B DC 2  1_555 -0.497 1.698  6.457 -2.286  -8.269 74.157  1.902  0.272  6.278 -6.835 
1.890   74.581  5  CC_DC410DG412:DC422DG424_DD C 410 ? D 424 ? C 412 ? D 422 ? 
1 A DG 12 1_555 B DC 2  1_555 D DC 2  1_555 C DG 12 1_555 -1.423 2.559  6.326 9.551   -9.889 -13.183 4.042  7.076  6.430 33.378 
32.238  -19.026 6  CF_DG412DC422:DG412DC422_ED C 412 ? D 422 ? F 422 ? E 412 ? 
1 D DC 2  1_555 C DG 12 1_555 D DA 3  1_555 C DT 11 1_555 -0.082 3.478  2.919 7.885   5.465  55.769  3.385  0.502  3.182 5.795  
-8.361  56.523  7  FF_DC422DA423:DT411DG412_EE F 422 ? E 412 ? F 423 ? E 411 ? 
1 D DA 3  1_555 C DT 11 1_555 D DG 5  1_555 C DC 9  1_555 -0.382 -0.309 7.065 -8.309  11.351 78.129  -0.910 -0.188 6.983 8.939  
6.543   79.185  8  FF_DA423DG425:DC409DT411_EE F 423 ? E 411 ? F 425 ? E 409 ? 
1 D DG 5  1_555 C DC 9  1_555 D DA 6  1_555 C DT 8  1_555 0.285  -0.380 3.135 3.096   2.336  20.056  -2.072 0.523  3.079 6.628  
-8.783  20.424  9  FF_DG425DA426:DT408DC409_EE F 425 ? E 409 ? F 426 ? E 408 ? 
1 C DT 4  1_555 D DA 10 1_555 C DT 5  1_555 D DA 9  1_555 -0.166 -0.561 3.035 -2.539  2.327  32.434  -1.373 -0.113 2.993 4.152  
4.530   32.611  10 EE_DT404DT405:DA429DA430_FF E 404 ? F 430 ? E 405 ? F 429 ? 
1 C DT 5  1_555 D DA 9  1_555 C DC 6  1_555 D DG 8  1_555 0.615  -0.998 2.915 -1.777  -2.362 35.050  -1.335 -1.255 2.940 -3.914 
2.945   35.171  11 EE_DT405DC406:DG428DA429_FF E 405 ? F 429 ? E 406 ? F 428 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SODIUM ION'  NA  
5 'ZINC ION'    ZN  
6 'SULFATE ION' SO4 
7 water         HOH 
#