data_2OT3
# 
_entry.id   2OT3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OT3         
RCSB  RCSB041551   
WWPDB D_1000041551 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1TXU 'CRYSTAL STRUCTURE OF THE VPS9 DOMAIN OF RABEX-5' unspecified 
PDB 1Z0I 'GDP-BOUND RAB21 GTPASE'                          unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2OT3 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Delprato, A.'  1 
'Lambright, D.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for Rab GTPase activation by VPS9 domain exchange factors.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            14 
_citation.page_first                406 
_citation.page_last                 412 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17450153 
_citation.pdbx_database_id_DOI      10.1038/nsmb1232 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Delprato, A.'    1 
primary 'Lambright, D.G.' 2 
# 
_cell.entry_id           2OT3 
_cell.length_a           71.897 
_cell.length_b           113.400 
_cell.length_c           60.533 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2OT3 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Rab5 GDP/GTP exchange factor' 32082.791 1   ? ? 'residues 132-297' ? 
2 polymer man 'Ras-related protein Rab-21'   19335.209 1   ? ? 'residues 16-183'  ? 
3 water   nat water                          18.015    463 ? ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Rabex-5, Rabaptin-5-associated exchange factor for Rab5, RAP1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHHHHHHSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPER
VEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRV
PRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAV
AFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAE
;
;GSHHHHHHSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPER
VEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRV
PRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAV
AFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAE
;
A ? 
2 'polypeptide(L)' no no 
;GSRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSN
GAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELF
LDLCKRMIET
;
;GSRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSN
GAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELF
LDLCKRMIET
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   SER n 
1 10  ILE n 
1 11  GLU n 
1 12  THR n 
1 13  ASP n 
1 14  ARG n 
1 15  VAL n 
1 16  SER n 
1 17  LYS n 
1 18  GLU n 
1 19  PHE n 
1 20  ILE n 
1 21  GLU n 
1 22  PHE n 
1 23  LEU n 
1 24  LYS n 
1 25  THR n 
1 26  PHE n 
1 27  HIS n 
1 28  LYS n 
1 29  THR n 
1 30  GLY n 
1 31  GLN n 
1 32  GLU n 
1 33  ILE n 
1 34  TYR n 
1 35  LYS n 
1 36  GLN n 
1 37  THR n 
1 38  LYS n 
1 39  LEU n 
1 40  PHE n 
1 41  LEU n 
1 42  GLU n 
1 43  GLY n 
1 44  MET n 
1 45  HIS n 
1 46  TYR n 
1 47  LYS n 
1 48  ARG n 
1 49  ASP n 
1 50  LEU n 
1 51  SER n 
1 52  ILE n 
1 53  GLU n 
1 54  GLU n 
1 55  GLN n 
1 56  SER n 
1 57  GLU n 
1 58  CYS n 
1 59  ALA n 
1 60  GLN n 
1 61  ASP n 
1 62  PHE n 
1 63  TYR n 
1 64  HIS n 
1 65  ASN n 
1 66  VAL n 
1 67  ALA n 
1 68  GLU n 
1 69  ARG n 
1 70  MET n 
1 71  GLN n 
1 72  THR n 
1 73  ARG n 
1 74  GLY n 
1 75  LYS n 
1 76  VAL n 
1 77  PRO n 
1 78  PRO n 
1 79  GLU n 
1 80  ARG n 
1 81  VAL n 
1 82  GLU n 
1 83  LYS n 
1 84  ILE n 
1 85  MET n 
1 86  ASP n 
1 87  GLN n 
1 88  ILE n 
1 89  GLU n 
1 90  LYS n 
1 91  TYR n 
1 92  ILE n 
1 93  MET n 
1 94  THR n 
1 95  ARG n 
1 96  LEU n 
1 97  TYR n 
1 98  LYS n 
1 99  TYR n 
1 100 VAL n 
1 101 PHE n 
1 102 CYS n 
1 103 PRO n 
1 104 GLU n 
1 105 THR n 
1 106 THR n 
1 107 ASP n 
1 108 ASP n 
1 109 GLU n 
1 110 LYS n 
1 111 LYS n 
1 112 ASP n 
1 113 LEU n 
1 114 ALA n 
1 115 ILE n 
1 116 GLN n 
1 117 LYS n 
1 118 ARG n 
1 119 ILE n 
1 120 ARG n 
1 121 ALA n 
1 122 LEU n 
1 123 ARG n 
1 124 TRP n 
1 125 VAL n 
1 126 THR n 
1 127 PRO n 
1 128 GLN n 
1 129 MET n 
1 130 LEU n 
1 131 CYS n 
1 132 VAL n 
1 133 PRO n 
1 134 VAL n 
1 135 ASN n 
1 136 GLU n 
1 137 ASP n 
1 138 ILE n 
1 139 PRO n 
1 140 GLU n 
1 141 VAL n 
1 142 SER n 
1 143 ASP n 
1 144 MET n 
1 145 VAL n 
1 146 VAL n 
1 147 LYS n 
1 148 ALA n 
1 149 ILE n 
1 150 THR n 
1 151 ASP n 
1 152 ILE n 
1 153 ILE n 
1 154 GLU n 
1 155 MET n 
1 156 ASP n 
1 157 SER n 
1 158 LYS n 
1 159 ARG n 
1 160 VAL n 
1 161 PRO n 
1 162 ARG n 
1 163 ASP n 
1 164 LYS n 
1 165 LEU n 
1 166 ALA n 
1 167 CYS n 
1 168 ILE n 
1 169 THR n 
1 170 LYS n 
1 171 CYS n 
1 172 SER n 
1 173 LYS n 
1 174 HIS n 
1 175 ILE n 
1 176 PHE n 
1 177 ASN n 
1 178 ALA n 
1 179 ILE n 
1 180 LYS n 
1 181 ILE n 
1 182 THR n 
1 183 LYS n 
1 184 ASN n 
1 185 GLU n 
1 186 PRO n 
1 187 ALA n 
1 188 SER n 
1 189 ALA n 
1 190 ASP n 
1 191 ASP n 
1 192 PHE n 
1 193 LEU n 
1 194 PRO n 
1 195 THR n 
1 196 LEU n 
1 197 ILE n 
1 198 TYR n 
1 199 ILE n 
1 200 VAL n 
1 201 LEU n 
1 202 LYS n 
1 203 GLY n 
1 204 ASN n 
1 205 PRO n 
1 206 PRO n 
1 207 ARG n 
1 208 LEU n 
1 209 GLN n 
1 210 SER n 
1 211 ASN n 
1 212 ILE n 
1 213 GLN n 
1 214 TYR n 
1 215 ILE n 
1 216 THR n 
1 217 ARG n 
1 218 PHE n 
1 219 CYS n 
1 220 ASN n 
1 221 PRO n 
1 222 SER n 
1 223 ARG n 
1 224 LEU n 
1 225 MET n 
1 226 THR n 
1 227 GLY n 
1 228 GLU n 
1 229 ASP n 
1 230 GLY n 
1 231 TYR n 
1 232 TYR n 
1 233 PHE n 
1 234 THR n 
1 235 ASN n 
1 236 LEU n 
1 237 CYS n 
1 238 CYS n 
1 239 ALA n 
1 240 VAL n 
1 241 ALA n 
1 242 PHE n 
1 243 ILE n 
1 244 GLU n 
1 245 LYS n 
1 246 LEU n 
1 247 ASP n 
1 248 ALA n 
1 249 GLN n 
1 250 SER n 
1 251 LEU n 
1 252 ASN n 
1 253 LEU n 
1 254 SER n 
1 255 GLN n 
1 256 GLU n 
1 257 ASP n 
1 258 PHE n 
1 259 ASP n 
1 260 ARG n 
1 261 TYR n 
1 262 MET n 
1 263 SER n 
1 264 GLY n 
1 265 GLN n 
1 266 THR n 
1 267 SER n 
1 268 PRO n 
1 269 ARG n 
1 270 LYS n 
1 271 GLN n 
1 272 GLU n 
1 273 ALA n 
1 274 GLU n 
2 1   GLY n 
2 2   SER n 
2 3   ARG n 
2 4   ALA n 
2 5   TYR n 
2 6   SER n 
2 7   PHE n 
2 8   LYS n 
2 9   VAL n 
2 10  VAL n 
2 11  LEU n 
2 12  LEU n 
2 13  GLY n 
2 14  GLU n 
2 15  GLY n 
2 16  CYS n 
2 17  VAL n 
2 18  GLY n 
2 19  LYS n 
2 20  THR n 
2 21  SER n 
2 22  LEU n 
2 23  VAL n 
2 24  LEU n 
2 25  ARG n 
2 26  TYR n 
2 27  CYS n 
2 28  GLU n 
2 29  ASN n 
2 30  LYS n 
2 31  PHE n 
2 32  ASN n 
2 33  ASP n 
2 34  LYS n 
2 35  HIS n 
2 36  ILE n 
2 37  THR n 
2 38  THR n 
2 39  LEU n 
2 40  GLN n 
2 41  ALA n 
2 42  SER n 
2 43  PHE n 
2 44  LEU n 
2 45  THR n 
2 46  LYS n 
2 47  LYS n 
2 48  LEU n 
2 49  ASN n 
2 50  ILE n 
2 51  GLY n 
2 52  GLY n 
2 53  LYS n 
2 54  ARG n 
2 55  VAL n 
2 56  ASN n 
2 57  LEU n 
2 58  ALA n 
2 59  ILE n 
2 60  TRP n 
2 61  ASP n 
2 62  THR n 
2 63  ALA n 
2 64  GLY n 
2 65  GLN n 
2 66  GLU n 
2 67  ARG n 
2 68  PHE n 
2 69  HIS n 
2 70  ALA n 
2 71  LEU n 
2 72  GLY n 
2 73  PRO n 
2 74  ILE n 
2 75  TYR n 
2 76  TYR n 
2 77  ARG n 
2 78  ASP n 
2 79  SER n 
2 80  ASN n 
2 81  GLY n 
2 82  ALA n 
2 83  ILE n 
2 84  LEU n 
2 85  VAL n 
2 86  TYR n 
2 87  ASP n 
2 88  ILE n 
2 89  THR n 
2 90  ASP n 
2 91  GLU n 
2 92  ASP n 
2 93  SER n 
2 94  PHE n 
2 95  GLN n 
2 96  LYS n 
2 97  VAL n 
2 98  LYS n 
2 99  ASN n 
2 100 TRP n 
2 101 VAL n 
2 102 LYS n 
2 103 GLU n 
2 104 LEU n 
2 105 ARG n 
2 106 LYS n 
2 107 MET n 
2 108 LEU n 
2 109 GLY n 
2 110 ASN n 
2 111 GLU n 
2 112 ILE n 
2 113 CYS n 
2 114 LEU n 
2 115 CYS n 
2 116 ILE n 
2 117 VAL n 
2 118 GLY n 
2 119 ASN n 
2 120 LYS n 
2 121 ILE n 
2 122 ASP n 
2 123 LEU n 
2 124 GLU n 
2 125 LYS n 
2 126 GLU n 
2 127 ARG n 
2 128 HIS n 
2 129 VAL n 
2 130 SER n 
2 131 ILE n 
2 132 GLN n 
2 133 GLU n 
2 134 ALA n 
2 135 GLU n 
2 136 SER n 
2 137 TYR n 
2 138 ALA n 
2 139 GLU n 
2 140 SER n 
2 141 VAL n 
2 142 GLY n 
2 143 ALA n 
2 144 LYS n 
2 145 HIS n 
2 146 TYR n 
2 147 HIS n 
2 148 THR n 
2 149 SER n 
2 150 ALA n 
2 151 LYS n 
2 152 GLN n 
2 153 ASN n 
2 154 LYS n 
2 155 GLY n 
2 156 ILE n 
2 157 GLU n 
2 158 GLU n 
2 159 LEU n 
2 160 PHE n 
2 161 LEU n 
2 162 ASP n 
2 163 LEU n 
2 164 CYS n 
2 165 LYS n 
2 166 ARG n 
2 167 MET n 
2 168 ILE n 
2 169 GLU n 
2 170 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'RABGEF1, RABEX5' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'Bl21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? PET15b  ? ? 
2 1 sample ? ? ? human Homo 'RAB21, KIAA0118' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'Bl21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? PGEX4T1 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RABX5_HUMAN Q9UJ41 1 
;SIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQI
EKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACI
TKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDA
QSLNLSQEDFDRYMSGQTSPRKQEAE
;
132 ? 
2 UNP RAB21_HUMAN Q9UL25 2 
;RAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGA
ILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLD
LCKRMIET
;
16  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2OT3 A 9 ? 274 ? Q9UJ41 132 ? 397 ? 132 397 
2 2 2OT3 B 3 ? 170 ? Q9UL25 16  ? 183 ? 16  183 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2OT3 GLY A 1 ? UNP Q9UJ41 ? ? 'CLONING ARTIFACT' 124 1  
1 2OT3 SER A 2 ? UNP Q9UJ41 ? ? 'CLONING ARTIFACT' 125 2  
1 2OT3 HIS A 3 ? UNP Q9UJ41 ? ? 'EXPRESSION TAG'   126 3  
1 2OT3 HIS A 4 ? UNP Q9UJ41 ? ? 'EXPRESSION TAG'   127 4  
1 2OT3 HIS A 5 ? UNP Q9UJ41 ? ? 'EXPRESSION TAG'   128 5  
1 2OT3 HIS A 6 ? UNP Q9UJ41 ? ? 'EXPRESSION TAG'   129 6  
1 2OT3 HIS A 7 ? UNP Q9UJ41 ? ? 'EXPRESSION TAG'   130 7  
1 2OT3 HIS A 8 ? UNP Q9UJ41 ? ? 'EXPRESSION TAG'   131 8  
2 2OT3 GLY B 1 ? UNP Q9UL25 ? ? 'CLONING ARTIFACT' 14  9  
2 2OT3 SER B 2 ? UNP Q9UL25 ? ? 'CLONING ARTIFACT' 15  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2OT3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_percent_sol   48.76 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'10% PEG 6000, 0.2M MgCl2, 0.05 NaMES Microseeded, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                
'Pt-coated toroidal Si mirror for horizontal and vertical focussing followed by double flat Si crystal monochromator' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(11)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     2OT3 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   40412 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              7.5 
_reflns.pdbx_netI_over_sigmaI        22 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.154 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        38.5 
_reflns_shell.meanI_over_sigI_obs    4.0 
_reflns_shell.pdbx_redundancy        1.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      40412 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2OT3 
_refine.ls_number_reflns_obs                     28020 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_R_factor_obs                          0.19099 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18821 
_refine.ls_R_factor_R_free                       0.24272 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1500 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.916 
_refine.B_iso_mean                               33.088 
_refine.aniso_B[1][1]                            -1.17 
_refine.aniso_B[2][2]                            -0.33 
_refine.aniso_B[3][3]                            1.50 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1Z0I, 1TXU' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.209 
_refine.pdbx_overall_ESU_R_Free                  0.187 
_refine.overall_SU_ML                            0.125 
_refine.overall_SU_B                             4.642 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3179 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             463 
_refine_hist.number_atoms_total               3642 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 3234 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.230  1.965  ? 4372 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.240  5.000  ? 407  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.856 24.412 ? 136  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.620 15.000 ? 572  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.829 15.000 ? 17   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.080  0.200  ? 502  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 2392 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.224  0.200  ? 1761 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.304  0.200  ? 2274 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.195  0.200  ? 432  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.179  0.200  ? 49   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.179  0.200  ? 48   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.858  1.500  ? 2105 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.486  2.000  ? 3277 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.994  3.000  ? 1285 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.211  4.500  ? 1095 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.number_reflns_R_work             2022 
_refine_ls_shell.R_factor_R_work                  0.208 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.246 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             93 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2OT3 
_struct.title                     'Crystal structure of rabex-5 VPS9 domain in complex with nucleotide free RAB21' 
_struct.pdbx_descriptor           'Rab5 GDP/GTP exchange factor, Ras-related protein Rab-21' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OT3 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            'Rabex-5, Vps9 Domain, Rab21, vesicular traffic, protein transport' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 18  ? THR A 25  ? GLU A 141 THR A 148 1 ? 8  
HELX_P HELX_P2  2  PHE A 26  ? PHE A 26  ? PHE A 149 PHE A 149 5 ? 1  
HELX_P HELX_P3  3  GLY A 30  ? GLN A 31  ? GLY A 153 GLN A 154 5 ? 2  
HELX_P HELX_P4  4  ILE A 33  ? LYS A 35  ? ILE A 156 LYS A 158 5 ? 3  
HELX_P HELX_P5  5  THR A 37  ? MET A 44  ? THR A 160 MET A 167 1 ? 8  
HELX_P HELX_P6  6  GLN A 55  ? TYR A 63  ? GLN A 178 TYR A 186 1 ? 9  
HELX_P HELX_P7  7  ASN A 65  ? ALA A 67  ? ASN A 188 ALA A 190 5 ? 3  
HELX_P HELX_P8  8  ILE A 84  ? TYR A 97  ? ILE A 207 TYR A 220 1 ? 14 
HELX_P HELX_P9  9  TYR A 99  ? PHE A 101 ? TYR A 222 PHE A 224 5 ? 3  
HELX_P HELX_P10 10 ASP A 107 ? GLN A 116 ? ASP A 230 GLN A 239 1 ? 10 
HELX_P HELX_P11 11 ARG A 118 ? ARG A 123 ? ARG A 241 ARG A 246 5 ? 6  
HELX_P HELX_P12 12 ILE A 138 ? ILE A 153 ? ILE A 261 ILE A 276 1 ? 16 
HELX_P HELX_P13 13 VAL A 160 ? ASN A 184 ? VAL A 283 ASN A 307 1 ? 25 
HELX_P HELX_P14 14 SER A 188 ? ASN A 204 ? SER A 311 ASN A 327 1 ? 17 
HELX_P HELX_P15 15 ARG A 207 ? CYS A 219 ? ARG A 330 CYS A 342 1 ? 13 
HELX_P HELX_P16 16 GLY A 227 ? LEU A 246 ? GLY A 350 LEU A 369 1 ? 20 
HELX_P HELX_P17 17 ALA A 248 ? ASN A 252 ? ALA A 371 ASN A 375 5 ? 5  
HELX_P HELX_P18 18 SER A 254 ? SER A 263 ? SER A 377 SER A 386 1 ? 10 
HELX_P HELX_P19 19 GLU B 14  ? VAL B 17  ? GLU B 27  VAL B 30  5 ? 4  
HELX_P HELX_P20 20 GLY B 18  ? CYS B 27  ? GLY B 31  CYS B 40  1 ? 10 
HELX_P HELX_P21 21 GLN B 65  ? ALA B 70  ? GLN B 78  ALA B 83  5 ? 6  
HELX_P HELX_P22 22 LEU B 71  ? ARG B 77  ? LEU B 84  ARG B 90  1 ? 7  
HELX_P HELX_P23 23 ASP B 90  ? ARG B 105 ? ASP B 103 ARG B 118 1 ? 16 
HELX_P HELX_P24 24 SER B 130 ? ALA B 138 ? SER B 143 ALA B 151 1 ? 9  
HELX_P HELX_P25 25 GLU B 158 ? GLU B 169 ? GLU B 171 GLU B 182 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE B 43  ? LYS B 46  ? PHE B 56  LYS B 59  
A 2 ASN B 56  ? ASP B 61  ? ASN B 69  ASP B 74  
A 3 SER B 6   ? LEU B 12  ? SER B 19  LEU B 25  
A 4 GLY B 81  ? ASP B 87  ? GLY B 94  ASP B 100 
A 5 CYS B 113 ? ASN B 119 ? CYS B 126 ASN B 132 
A 6 LYS B 144 ? HIS B 147 ? LYS B 157 HIS B 160 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU B 44  ? N LEU B 57  O ILE B 59  ? O ILE B 72  
A 2 3 O TRP B 60  ? O TRP B 73  N VAL B 9   ? N VAL B 22  
A 3 4 N LEU B 12  ? N LEU B 25  O ILE B 83  ? O ILE B 96  
A 4 5 N LEU B 84  ? N LEU B 97  O CYS B 115 ? O CYS B 128 
A 5 6 N ILE B 116 ? N ILE B 129 O LYS B 144 ? O LYS B 157 
# 
_database_PDB_matrix.entry_id          2OT3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2OT3 
_atom_sites.fract_transf_matrix[1][1]   0.013909 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008818 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016520 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 16  ? -25.490 13.346 -30.076 1.00 53.21  ? 139 SER A N   1 
ATOM   2    C CA  . SER A 1 16  ? -25.566 14.107 -31.367 1.00 53.10  ? 139 SER A CA  1 
ATOM   3    C C   . SER A 1 16  ? -26.963 14.683 -31.637 1.00 53.14  ? 139 SER A C   1 
ATOM   4    O O   . SER A 1 16  ? -27.093 15.808 -32.141 1.00 53.07  ? 139 SER A O   1 
ATOM   5    C CB  . SER A 1 16  ? -25.120 13.233 -32.542 1.00 53.19  ? 139 SER A CB  1 
ATOM   6    O OG  . SER A 1 16  ? -25.378 13.880 -33.775 1.00 52.28  ? 139 SER A OG  1 
ATOM   7    N N   . LYS A 1 17  ? -27.995 13.902 -31.314 1.00 52.71  ? 140 LYS A N   1 
ATOM   8    C CA  . LYS A 1 17  ? -29.383 14.348 -31.434 1.00 52.42  ? 140 LYS A CA  1 
ATOM   9    C C   . LYS A 1 17  ? -29.676 15.448 -30.422 1.00 51.98  ? 140 LYS A C   1 
ATOM   10   O O   . LYS A 1 17  ? -30.375 16.416 -30.727 1.00 51.99  ? 140 LYS A O   1 
ATOM   11   C CB  . LYS A 1 17  ? -30.341 13.176 -31.248 1.00 52.63  ? 140 LYS A CB  1 
ATOM   12   N N   . GLU A 1 18  ? -29.112 15.295 -29.227 1.00 51.52  ? 141 GLU A N   1 
ATOM   13   C CA  . GLU A 1 18  ? -29.262 16.263 -28.144 1.00 50.80  ? 141 GLU A CA  1 
ATOM   14   C C   . GLU A 1 18  ? -28.617 17.605 -28.466 1.00 49.90  ? 141 GLU A C   1 
ATOM   15   O O   . GLU A 1 18  ? -29.121 18.653 -28.043 1.00 50.13  ? 141 GLU A O   1 
ATOM   16   C CB  . GLU A 1 18  ? -28.668 15.712 -26.848 1.00 51.23  ? 141 GLU A CB  1 
ATOM   17   C CG  . GLU A 1 18  ? -29.333 14.433 -26.341 1.00 53.08  ? 141 GLU A CG  1 
ATOM   18   C CD  . GLU A 1 18  ? -29.081 14.184 -24.856 1.00 55.87  ? 141 GLU A CD  1 
ATOM   19   O OE1 . GLU A 1 18  ? -28.239 14.899 -24.261 1.00 57.27  ? 141 GLU A OE1 1 
ATOM   20   O OE2 . GLU A 1 18  ? -29.732 13.278 -24.283 1.00 56.22  ? 141 GLU A OE2 1 
ATOM   21   N N   . PHE A 1 19  ? -27.505 17.571 -29.204 1.00 48.23  ? 142 PHE A N   1 
ATOM   22   C CA  . PHE A 1 19  ? -26.799 18.785 -29.604 1.00 46.86  ? 142 PHE A CA  1 
ATOM   23   C C   . PHE A 1 19  ? -27.648 19.624 -30.549 1.00 46.64  ? 142 PHE A C   1 
ATOM   24   O O   . PHE A 1 19  ? -27.670 20.851 -30.449 1.00 46.07  ? 142 PHE A O   1 
ATOM   25   C CB  . PHE A 1 19  ? -25.470 18.443 -30.281 1.00 45.73  ? 142 PHE A CB  1 
ATOM   26   C CG  . PHE A 1 19  ? -24.628 19.648 -30.635 1.00 43.92  ? 142 PHE A CG  1 
ATOM   27   C CD1 . PHE A 1 19  ? -24.229 20.554 -29.654 1.00 41.79  ? 142 PHE A CD1 1 
ATOM   28   C CD2 . PHE A 1 19  ? -24.212 19.863 -31.950 1.00 41.87  ? 142 PHE A CD2 1 
ATOM   29   C CE1 . PHE A 1 19  ? -23.434 21.653 -29.976 1.00 40.52  ? 142 PHE A CE1 1 
ATOM   30   C CE2 . PHE A 1 19  ? -23.423 20.959 -32.280 1.00 40.26  ? 142 PHE A CE2 1 
ATOM   31   C CZ  . PHE A 1 19  ? -23.029 21.854 -31.289 1.00 41.00  ? 142 PHE A CZ  1 
ATOM   32   N N   . ILE A 1 20  ? -28.330 18.940 -31.465 1.00 46.91  ? 143 ILE A N   1 
ATOM   33   C CA  . ILE A 1 20  ? -29.195 19.575 -32.454 1.00 47.30  ? 143 ILE A CA  1 
ATOM   34   C C   . ILE A 1 20  ? -30.410 20.203 -31.774 1.00 47.93  ? 143 ILE A C   1 
ATOM   35   O O   . ILE A 1 20  ? -30.719 21.373 -32.000 1.00 48.19  ? 143 ILE A O   1 
ATOM   36   C CB  . ILE A 1 20  ? -29.606 18.580 -33.567 1.00 47.03  ? 143 ILE A CB  1 
ATOM   37   C CG1 . ILE A 1 20  ? -28.388 18.249 -34.439 1.00 46.31  ? 143 ILE A CG1 1 
ATOM   38   C CG2 . ILE A 1 20  ? -30.737 19.156 -34.423 1.00 46.80  ? 143 ILE A CG2 1 
ATOM   39   C CD1 . ILE A 1 20  ? -28.561 17.045 -35.339 1.00 45.62  ? 143 ILE A CD1 1 
ATOM   40   N N   . GLU A 1 21  ? -31.071 19.427 -30.925 1.00 48.78  ? 144 GLU A N   1 
ATOM   41   C CA  . GLU A 1 21  ? -32.204 19.915 -30.147 1.00 49.89  ? 144 GLU A CA  1 
ATOM   42   C C   . GLU A 1 21  ? -31.790 21.064 -29.230 1.00 50.05  ? 144 GLU A C   1 
ATOM   43   O O   . GLU A 1 21  ? -32.520 22.051 -29.088 1.00 50.25  ? 144 GLU A O   1 
ATOM   44   C CB  . GLU A 1 21  ? -32.856 18.775 -29.362 1.00 50.08  ? 144 GLU A CB  1 
ATOM   45   C CG  . GLU A 1 21  ? -33.336 17.623 -30.259 1.00 52.81  ? 144 GLU A CG  1 
ATOM   46   C CD  . GLU A 1 21  ? -34.787 17.210 -29.998 1.00 56.74  ? 144 GLU A CD  1 
ATOM   47   O OE1 . GLU A 1 21  ? -35.128 16.022 -30.236 1.00 57.51  ? 144 GLU A OE1 1 
ATOM   48   O OE2 . GLU A 1 21  ? -35.589 18.075 -29.563 1.00 58.23  ? 144 GLU A OE2 1 
ATOM   49   N N   . PHE A 1 22  ? -30.605 20.955 -28.640 1.00 50.06  ? 145 PHE A N   1 
ATOM   50   C CA  . PHE A 1 22  ? -30.078 22.035 -27.827 1.00 50.30  ? 145 PHE A CA  1 
ATOM   51   C C   . PHE A 1 22  ? -29.915 23.322 -28.640 1.00 50.73  ? 145 PHE A C   1 
ATOM   52   O O   . PHE A 1 22  ? -30.372 24.390 -28.220 1.00 50.79  ? 145 PHE A O   1 
ATOM   53   C CB  . PHE A 1 22  ? -28.750 21.640 -27.176 1.00 50.09  ? 145 PHE A CB  1 
ATOM   54   C CG  . PHE A 1 22  ? -28.150 22.729 -26.336 1.00 49.98  ? 145 PHE A CG  1 
ATOM   55   C CD1 . PHE A 1 22  ? -28.692 23.043 -25.092 1.00 49.65  ? 145 PHE A CD1 1 
ATOM   56   C CD2 . PHE A 1 22  ? -27.058 23.454 -26.794 1.00 49.49  ? 145 PHE A CD2 1 
ATOM   57   C CE1 . PHE A 1 22  ? -28.154 24.055 -24.318 1.00 48.90  ? 145 PHE A CE1 1 
ATOM   58   C CE2 . PHE A 1 22  ? -26.520 24.469 -26.031 1.00 50.05  ? 145 PHE A CE2 1 
ATOM   59   C CZ  . PHE A 1 22  ? -27.069 24.768 -24.784 1.00 49.83  ? 145 PHE A CZ  1 
ATOM   60   N N   . LEU A 1 23  ? -29.263 23.213 -29.798 1.00 50.99  ? 146 LEU A N   1 
ATOM   61   C CA  . LEU A 1 23  ? -29.012 24.363 -30.671 1.00 51.33  ? 146 LEU A CA  1 
ATOM   62   C C   . LEU A 1 23  ? -30.275 24.955 -31.306 1.00 51.75  ? 146 LEU A C   1 
ATOM   63   O O   . LEU A 1 23  ? -30.323 26.160 -31.564 1.00 51.69  ? 146 LEU A O   1 
ATOM   64   C CB  . LEU A 1 23  ? -27.984 24.017 -31.755 1.00 51.15  ? 146 LEU A CB  1 
ATOM   65   C CG  . LEU A 1 23  ? -26.504 24.012 -31.358 1.00 50.58  ? 146 LEU A CG  1 
ATOM   66   C CD1 . LEU A 1 23  ? -25.642 23.801 -32.584 1.00 50.16  ? 146 LEU A CD1 1 
ATOM   67   C CD2 . LEU A 1 23  ? -26.094 25.303 -30.664 1.00 50.53  ? 146 LEU A CD2 1 
ATOM   68   N N   . LYS A 1 24  ? -31.283 24.115 -31.548 1.00 52.20  ? 147 LYS A N   1 
ATOM   69   C CA  . LYS A 1 24  ? -32.559 24.583 -32.085 1.00 53.42  ? 147 LYS A CA  1 
ATOM   70   C C   . LYS A 1 24  ? -33.180 25.666 -31.198 1.00 53.90  ? 147 LYS A C   1 
ATOM   71   O O   . LYS A 1 24  ? -33.788 26.621 -31.697 1.00 54.13  ? 147 LYS A O   1 
ATOM   72   C CB  . LYS A 1 24  ? -33.528 23.417 -32.314 1.00 53.25  ? 147 LYS A CB  1 
ATOM   73   C CG  . LYS A 1 24  ? -33.425 22.831 -33.726 1.00 53.81  ? 147 LYS A CG  1 
ATOM   74   C CD  . LYS A 1 24  ? -34.442 21.724 -34.007 1.00 54.27  ? 147 LYS A CD  1 
ATOM   75   C CE  . LYS A 1 24  ? -33.946 20.355 -33.533 1.00 55.47  ? 147 LYS A CE  1 
ATOM   76   N NZ  . LYS A 1 24  ? -34.668 19.214 -34.177 1.00 55.82  ? 147 LYS A NZ  1 
ATOM   77   N N   . THR A 1 25  ? -32.994 25.515 -29.890 1.00 54.30  ? 148 THR A N   1 
ATOM   78   C CA  . THR A 1 25  ? -33.363 26.516 -28.887 1.00 54.84  ? 148 THR A CA  1 
ATOM   79   C C   . THR A 1 25  ? -32.915 27.940 -29.245 1.00 55.40  ? 148 THR A C   1 
ATOM   80   O O   . THR A 1 25  ? -33.655 28.899 -29.013 1.00 55.98  ? 148 THR A O   1 
ATOM   81   C CB  . THR A 1 25  ? -32.782 26.112 -27.496 1.00 54.73  ? 148 THR A CB  1 
ATOM   82   O OG1 . THR A 1 25  ? -33.456 24.941 -27.018 1.00 54.33  ? 148 THR A OG1 1 
ATOM   83   C CG2 . THR A 1 25  ? -32.902 27.238 -26.465 1.00 55.06  ? 148 THR A CG2 1 
ATOM   84   N N   . PHE A 1 26  ? -31.723 28.077 -29.822 1.00 55.96  ? 149 PHE A N   1 
ATOM   85   C CA  . PHE A 1 26  ? -31.113 29.398 -30.037 1.00 56.36  ? 149 PHE A CA  1 
ATOM   86   C C   . PHE A 1 26  ? -31.435 30.127 -31.360 1.00 56.51  ? 149 PHE A C   1 
ATOM   87   O O   . PHE A 1 26  ? -30.780 31.125 -31.696 1.00 56.89  ? 149 PHE A O   1 
ATOM   88   C CB  . PHE A 1 26  ? -29.600 29.324 -29.795 1.00 56.50  ? 149 PHE A CB  1 
ATOM   89   C CG  . PHE A 1 26  ? -29.237 29.122 -28.353 1.00 57.08  ? 149 PHE A CG  1 
ATOM   90   C CD1 . PHE A 1 26  ? -29.249 27.845 -27.789 1.00 57.64  ? 149 PHE A CD1 1 
ATOM   91   C CD2 . PHE A 1 26  ? -28.905 30.208 -27.550 1.00 57.21  ? 149 PHE A CD2 1 
ATOM   92   C CE1 . PHE A 1 26  ? -28.935 27.650 -26.450 1.00 57.13  ? 149 PHE A CE1 1 
ATOM   93   C CE2 . PHE A 1 26  ? -28.580 30.024 -26.208 1.00 58.02  ? 149 PHE A CE2 1 
ATOM   94   C CZ  . PHE A 1 26  ? -28.598 28.739 -25.657 1.00 57.45  ? 149 PHE A CZ  1 
ATOM   95   N N   . HIS A 1 27  ? -32.441 29.641 -32.091 1.00 56.45  ? 150 HIS A N   1 
ATOM   96   C CA  . HIS A 1 27  ? -32.961 30.318 -33.299 1.00 56.47  ? 150 HIS A CA  1 
ATOM   97   C C   . HIS A 1 27  ? -31.914 30.591 -34.400 1.00 56.39  ? 150 HIS A C   1 
ATOM   98   O O   . HIS A 1 27  ? -31.185 29.683 -34.828 1.00 56.38  ? 150 HIS A O   1 
ATOM   99   C CB  . HIS A 1 27  ? -33.702 31.622 -32.912 1.00 56.31  ? 150 HIS A CB  1 
ATOM   100  N N   . LYS A 1 28  ? -31.869 31.846 -34.853 1.00 56.05  ? 151 LYS A N   1 
ATOM   101  C CA  . LYS A 1 28  ? -30.878 32.313 -35.820 1.00 55.56  ? 151 LYS A CA  1 
ATOM   102  C C   . LYS A 1 28  ? -29.602 32.755 -35.089 1.00 54.89  ? 151 LYS A C   1 
ATOM   103  O O   . LYS A 1 28  ? -29.150 33.908 -35.193 1.00 55.27  ? 151 LYS A O   1 
ATOM   104  C CB  . LYS A 1 28  ? -31.444 33.445 -36.702 1.00 55.83  ? 151 LYS A CB  1 
ATOM   105  N N   . THR A 1 29  ? -29.062 31.804 -34.330 1.00 53.39  ? 152 THR A N   1 
ATOM   106  C CA  . THR A 1 29  ? -27.776 31.889 -33.655 1.00 51.55  ? 152 THR A CA  1 
ATOM   107  C C   . THR A 1 29  ? -27.345 30.435 -33.460 1.00 50.17  ? 152 THR A C   1 
ATOM   108  O O   . THR A 1 29  ? -26.160 30.114 -33.548 1.00 50.26  ? 152 THR A O   1 
ATOM   109  C CB  . THR A 1 29  ? -27.898 32.606 -32.316 1.00 51.78  ? 152 THR A CB  1 
ATOM   110  N N   . GLY A 1 30  ? -28.330 29.564 -33.228 1.00 48.26  ? 153 GLY A N   1 
ATOM   111  C CA  . GLY A 1 30  ? -28.106 28.123 -33.126 1.00 46.06  ? 153 GLY A CA  1 
ATOM   112  C C   . GLY A 1 30  ? -27.789 27.468 -34.458 1.00 44.49  ? 153 GLY A C   1 
ATOM   113  O O   . GLY A 1 30  ? -26.913 26.614 -34.538 1.00 43.79  ? 153 GLY A O   1 
ATOM   114  N N   . GLN A 1 31  ? -28.506 27.866 -35.507 1.00 43.25  ? 154 GLN A N   1 
ATOM   115  C CA  . GLN A 1 31  ? -28.204 27.398 -36.861 1.00 41.76  ? 154 GLN A CA  1 
ATOM   116  C C   . GLN A 1 31  ? -26.789 27.794 -37.263 1.00 40.99  ? 154 GLN A C   1 
ATOM   117  O O   . GLN A 1 31  ? -26.064 26.983 -37.831 1.00 40.99  ? 154 GLN A O   1 
ATOM   118  C CB  . GLN A 1 31  ? -29.237 27.905 -37.889 1.00 41.76  ? 154 GLN A CB  1 
ATOM   119  C CG  . GLN A 1 31  ? -28.829 27.708 -39.375 1.00 41.43  ? 154 GLN A CG  1 
ATOM   120  C CD  . GLN A 1 31  ? -28.542 26.252 -39.736 1.00 41.97  ? 154 GLN A CD  1 
ATOM   121  O OE1 . GLN A 1 31  ? -29.450 25.433 -39.813 1.00 43.59  ? 154 GLN A OE1 1 
ATOM   122  N NE2 . GLN A 1 31  ? -27.274 25.929 -39.958 1.00 41.86  ? 154 GLN A NE2 1 
ATOM   123  N N   . GLU A 1 32  ? -26.404 29.029 -36.946 1.00 40.31  ? 155 GLU A N   1 
ATOM   124  C CA  . GLU A 1 32  ? -25.084 29.570 -37.282 1.00 40.18  ? 155 GLU A CA  1 
ATOM   125  C C   . GLU A 1 32  ? -23.968 28.837 -36.553 1.00 39.63  ? 155 GLU A C   1 
ATOM   126  O O   . GLU A 1 32  ? -22.935 28.524 -37.145 1.00 39.98  ? 155 GLU A O   1 
ATOM   127  C CB  . GLU A 1 32  ? -25.019 31.072 -36.980 1.00 40.18  ? 155 GLU A CB  1 
ATOM   128  N N   . ILE A 1 33  ? -24.183 28.568 -35.269 1.00 39.35  ? 156 ILE A N   1 
ATOM   129  C CA  . ILE A 1 33  ? -23.228 27.796 -34.476 1.00 38.62  ? 156 ILE A CA  1 
ATOM   130  C C   . ILE A 1 33  ? -23.099 26.379 -35.038 1.00 37.67  ? 156 ILE A C   1 
ATOM   131  O O   . ILE A 1 33  ? -21.994 25.863 -35.176 1.00 37.44  ? 156 ILE A O   1 
ATOM   132  C CB  . ILE A 1 33  ? -23.592 27.781 -32.966 1.00 38.86  ? 156 ILE A CB  1 
ATOM   133  C CG1 . ILE A 1 33  ? -23.500 29.196 -32.387 1.00 39.09  ? 156 ILE A CG1 1 
ATOM   134  C CG2 . ILE A 1 33  ? -22.641 26.875 -32.180 1.00 38.87  ? 156 ILE A CG2 1 
ATOM   135  C CD1 . ILE A 1 33  ? -24.097 29.334 -30.997 1.00 39.00  ? 156 ILE A CD1 1 
ATOM   136  N N   . TYR A 1 34  ? -24.226 25.767 -35.377 1.00 36.73  ? 157 TYR A N   1 
ATOM   137  C CA  . TYR A 1 34  ? -24.217 24.423 -35.935 1.00 36.05  ? 157 TYR A CA  1 
ATOM   138  C C   . TYR A 1 34  ? -23.439 24.375 -37.240 1.00 35.51  ? 157 TYR A C   1 
ATOM   139  O O   . TYR A 1 34  ? -22.600 23.482 -37.438 1.00 35.31  ? 157 TYR A O   1 
ATOM   140  C CB  . TYR A 1 34  ? -25.640 23.927 -36.153 1.00 35.69  ? 157 TYR A CB  1 
ATOM   141  C CG  . TYR A 1 34  ? -25.741 22.510 -36.654 1.00 35.72  ? 157 TYR A CG  1 
ATOM   142  C CD1 . TYR A 1 34  ? -25.560 21.424 -35.795 1.00 35.14  ? 157 TYR A CD1 1 
ATOM   143  C CD2 . TYR A 1 34  ? -26.033 22.253 -37.990 1.00 36.09  ? 157 TYR A CD2 1 
ATOM   144  C CE1 . TYR A 1 34  ? -25.674 20.122 -36.253 1.00 35.43  ? 157 TYR A CE1 1 
ATOM   145  C CE2 . TYR A 1 34  ? -26.144 20.951 -38.465 1.00 36.22  ? 157 TYR A CE2 1 
ATOM   146  C CZ  . TYR A 1 34  ? -25.968 19.893 -37.595 1.00 36.24  ? 157 TYR A CZ  1 
ATOM   147  O OH  . TYR A 1 34  ? -26.092 18.616 -38.079 1.00 36.15  ? 157 TYR A OH  1 
ATOM   148  N N   . LYS A 1 35  ? -23.715 25.341 -38.119 1.00 34.87  ? 158 LYS A N   1 
ATOM   149  C CA  . LYS A 1 35  ? -22.992 25.447 -39.384 1.00 34.39  ? 158 LYS A CA  1 
ATOM   150  C C   . LYS A 1 35  ? -21.486 25.588 -39.130 1.00 33.15  ? 158 LYS A C   1 
ATOM   151  O O   . LYS A 1 35  ? -20.695 24.837 -39.686 1.00 32.69  ? 158 LYS A O   1 
ATOM   152  C CB  . LYS A 1 35  ? -23.525 26.604 -40.248 1.00 34.83  ? 158 LYS A CB  1 
ATOM   153  C CG  . LYS A 1 35  ? -22.540 27.037 -41.329 1.00 35.74  ? 158 LYS A CG  1 
ATOM   154  C CD  . LYS A 1 35  ? -23.223 27.510 -42.594 1.00 39.23  ? 158 LYS A CD  1 
ATOM   155  C CE  . LYS A 1 35  ? -22.202 27.593 -43.717 1.00 40.50  ? 158 LYS A CE  1 
ATOM   156  N NZ  . LYS A 1 35  ? -22.694 28.403 -44.863 1.00 41.72  ? 158 LYS A NZ  1 
ATOM   157  N N   . GLN A 1 36  ? -21.110 26.539 -38.281 1.00 32.52  ? 159 GLN A N   1 
ATOM   158  C CA  . GLN A 1 36  ? -19.710 26.772 -37.941 1.00 32.38  ? 159 GLN A CA  1 
ATOM   159  C C   . GLN A 1 36  ? -19.036 25.552 -37.292 1.00 32.20  ? 159 GLN A C   1 
ATOM   160  O O   . GLN A 1 36  ? -17.850 25.304 -37.521 1.00 31.96  ? 159 GLN A O   1 
ATOM   161  C CB  . GLN A 1 36  ? -19.578 27.999 -37.048 1.00 32.90  ? 159 GLN A CB  1 
ATOM   162  N N   . THR A 1 37  ? -19.801 24.801 -36.496 1.00 31.95  ? 160 THR A N   1 
ATOM   163  C CA  . THR A 1 37  ? -19.307 23.586 -35.828 1.00 31.74  ? 160 THR A CA  1 
ATOM   164  C C   . THR A 1 37  ? -19.092 22.488 -36.851 1.00 31.57  ? 160 THR A C   1 
ATOM   165  O O   . THR A 1 37  ? -18.093 21.779 -36.802 1.00 31.42  ? 160 THR A O   1 
ATOM   166  C CB  . THR A 1 37  ? -20.298 23.090 -34.754 1.00 31.69  ? 160 THR A CB  1 
ATOM   167  O OG1 . THR A 1 37  ? -20.496 24.127 -33.773 1.00 32.15  ? 160 THR A OG1 1 
ATOM   168  C CG2 . THR A 1 37  ? -19.782 21.808 -34.070 1.00 30.38  ? 160 THR A CG2 1 
ATOM   169  N N   . LYS A 1 38  ? -20.039 22.357 -37.780 1.00 31.75  ? 161 LYS A N   1 
ATOM   170  C CA  . LYS A 1 38  ? -19.929 21.382 -38.853 1.00 31.95  ? 161 LYS A CA  1 
ATOM   171  C C   . LYS A 1 38  ? -18.768 21.709 -39.793 1.00 31.50  ? 161 LYS A C   1 
ATOM   172  O O   . LYS A 1 38  ? -18.055 20.812 -40.252 1.00 31.59  ? 161 LYS A O   1 
ATOM   173  C CB  . LYS A 1 38  ? -21.260 21.269 -39.601 1.00 32.33  ? 161 LYS A CB  1 
ATOM   174  C CG  . LYS A 1 38  ? -22.268 20.371 -38.906 1.00 34.10  ? 161 LYS A CG  1 
ATOM   175  C CD  . LYS A 1 38  ? -22.308 18.990 -39.543 1.00 38.12  ? 161 LYS A CD  1 
ATOM   176  C CE  . LYS A 1 38  ? -22.923 17.962 -38.635 1.00 39.38  ? 161 LYS A CE  1 
ATOM   177  N NZ  . LYS A 1 38  ? -21.993 17.646 -37.506 1.00 43.48  ? 161 LYS A NZ  1 
ATOM   178  N N   . LEU A 1 39  ? -18.584 22.998 -40.061 1.00 31.57  ? 162 LEU A N   1 
ATOM   179  C CA  . LEU A 1 39  ? -17.470 23.496 -40.863 1.00 31.56  ? 162 LEU A CA  1 
ATOM   180  C C   . LEU A 1 39  ? -16.137 23.150 -40.215 1.00 31.21  ? 162 LEU A C   1 
ATOM   181  O O   . LEU A 1 39  ? -15.228 22.623 -40.863 1.00 30.79  ? 162 LEU A O   1 
ATOM   182  C CB  . LEU A 1 39  ? -17.596 25.017 -41.075 1.00 31.82  ? 162 LEU A CB  1 
ATOM   183  C CG  . LEU A 1 39  ? -17.751 25.705 -42.458 1.00 33.11  ? 162 LEU A CG  1 
ATOM   184  C CD1 . LEU A 1 39  ? -18.127 24.789 -43.637 1.00 33.40  ? 162 LEU A CD1 1 
ATOM   185  C CD2 . LEU A 1 39  ? -18.710 26.898 -42.382 1.00 31.48  ? 162 LEU A CD2 1 
ATOM   186  N N   . PHE A 1 40  ? -16.025 23.444 -38.927 1.00 31.29  ? 163 PHE A N   1 
ATOM   187  C CA  . PHE A 1 40  ? -14.827 23.102 -38.167 1.00 30.96  ? 163 PHE A CA  1 
ATOM   188  C C   . PHE A 1 40  ? -14.520 21.599 -38.232 1.00 31.10  ? 163 PHE A C   1 
ATOM   189  O O   . PHE A 1 40  ? -13.394 21.203 -38.518 1.00 30.95  ? 163 PHE A O   1 
ATOM   190  C CB  . PHE A 1 40  ? -14.979 23.564 -36.714 1.00 30.99  ? 163 PHE A CB  1 
ATOM   191  C CG  . PHE A 1 40  ? -14.184 22.746 -35.738 1.00 30.21  ? 163 PHE A CG  1 
ATOM   192  C CD1 . PHE A 1 40  ? -12.801 22.837 -35.707 1.00 29.14  ? 163 PHE A CD1 1 
ATOM   193  C CD2 . PHE A 1 40  ? -14.824 21.867 -34.868 1.00 30.14  ? 163 PHE A CD2 1 
ATOM   194  C CE1 . PHE A 1 40  ? -12.065 22.075 -34.811 1.00 29.55  ? 163 PHE A CE1 1 
ATOM   195  C CE2 . PHE A 1 40  ? -14.093 21.099 -33.973 1.00 29.88  ? 163 PHE A CE2 1 
ATOM   196  C CZ  . PHE A 1 40  ? -12.707 21.207 -33.946 1.00 29.86  ? 163 PHE A CZ  1 
ATOM   197  N N   . LEU A 1 41  ? -15.538 20.783 -37.977 1.00 31.73  ? 164 LEU A N   1 
ATOM   198  C CA  . LEU A 1 41  ? -15.418 19.333 -37.957 1.00 32.80  ? 164 LEU A CA  1 
ATOM   199  C C   . LEU A 1 41  ? -15.046 18.774 -39.328 1.00 33.72  ? 164 LEU A C   1 
ATOM   200  O O   . LEU A 1 41  ? -14.309 17.795 -39.428 1.00 33.69  ? 164 LEU A O   1 
ATOM   201  C CB  . LEU A 1 41  ? -16.733 18.717 -37.475 1.00 32.73  ? 164 LEU A CB  1 
ATOM   202  C CG  . LEU A 1 41  ? -16.813 17.951 -36.141 1.00 33.47  ? 164 LEU A CG  1 
ATOM   203  C CD1 . LEU A 1 41  ? -15.641 18.167 -35.181 1.00 33.08  ? 164 LEU A CD1 1 
ATOM   204  C CD2 . LEU A 1 41  ? -18.133 18.202 -35.456 1.00 31.45  ? 164 LEU A CD2 1 
ATOM   205  N N   . GLU A 1 42  ? -15.561 19.408 -40.381 1.00 34.60  ? 165 GLU A N   1 
ATOM   206  C CA  . GLU A 1 42  ? -15.208 19.056 -41.752 1.00 35.66  ? 165 GLU A CA  1 
ATOM   207  C C   . GLU A 1 42  ? -13.760 19.444 -42.015 1.00 35.52  ? 165 GLU A C   1 
ATOM   208  O O   . GLU A 1 42  ? -13.013 18.685 -42.650 1.00 35.85  ? 165 GLU A O   1 
ATOM   209  C CB  . GLU A 1 42  ? -16.182 19.744 -42.713 1.00 35.64  ? 165 GLU A CB  1 
ATOM   210  C CG  . GLU A 1 42  ? -15.676 20.061 -44.103 1.00 37.10  ? 165 GLU A CG  1 
ATOM   211  C CD  . GLU A 1 42  ? -16.788 20.650 -44.966 1.00 37.09  ? 165 GLU A CD  1 
ATOM   212  O OE1 . GLU A 1 42  ? -16.692 21.833 -45.325 1.00 37.43  ? 165 GLU A OE1 1 
ATOM   213  O OE2 . GLU A 1 42  ? -17.775 19.934 -45.257 1.00 41.58  ? 165 GLU A OE2 1 
ATOM   214  N N   . GLY A 1 43  ? -13.373 20.621 -41.517 1.00 35.86  ? 166 GLY A N   1 
ATOM   215  C CA  . GLY A 1 43  ? -11.987 21.075 -41.530 1.00 36.28  ? 166 GLY A CA  1 
ATOM   216  C C   . GLY A 1 43  ? -11.058 20.068 -40.863 1.00 37.39  ? 166 GLY A C   1 
ATOM   217  O O   . GLY A 1 43  ? -9.985  19.778 -41.397 1.00 37.43  ? 166 GLY A O   1 
ATOM   218  N N   . MET A 1 44  ? -11.468 19.525 -39.707 1.00 38.00  ? 167 MET A N   1 
ATOM   219  C CA  . MET A 1 44  ? -10.655 18.518 -38.973 1.00 39.06  ? 167 MET A CA  1 
ATOM   220  C C   . MET A 1 44  ? -10.458 17.228 -39.760 1.00 40.05  ? 167 MET A C   1 
ATOM   221  O O   . MET A 1 44  ? -9.380  16.649 -39.721 1.00 40.39  ? 167 MET A O   1 
ATOM   222  C CB  . MET A 1 44  ? -11.235 18.194 -37.591 1.00 38.33  ? 167 MET A CB  1 
ATOM   223  C CG  . MET A 1 44  ? -11.162 19.336 -36.591 1.00 37.98  ? 167 MET A CG  1 
ATOM   224  S SD  . MET A 1 44  ? -9.501  19.839 -36.028 1.00 36.28  ? 167 MET A SD  1 
ATOM   225  C CE  . MET A 1 44  ? -9.152  18.610 -34.776 1.00 36.33  ? 167 MET A CE  1 
ATOM   226  N N   . HIS A 1 45  ? -11.499 16.796 -40.477 1.00 41.62  ? 168 HIS A N   1 
ATOM   227  C CA  . HIS A 1 45  ? -11.446 15.599 -41.326 1.00 43.05  ? 168 HIS A CA  1 
ATOM   228  C C   . HIS A 1 45  ? -10.363 15.742 -42.390 1.00 44.23  ? 168 HIS A C   1 
ATOM   229  O O   . HIS A 1 45  ? -9.590  14.807 -42.642 1.00 44.39  ? 168 HIS A O   1 
ATOM   230  C CB  . HIS A 1 45  ? -12.800 15.351 -41.980 1.00 43.16  ? 168 HIS A CB  1 
ATOM   231  N N   . TYR A 1 46  ? -10.297 16.935 -42.979 1.00 45.38  ? 169 TYR A N   1 
ATOM   232  C CA  . TYR A 1 46  ? -9.299  17.277 -43.990 1.00 46.28  ? 169 TYR A CA  1 
ATOM   233  C C   . TYR A 1 46  ? -7.943  17.687 -43.399 1.00 46.97  ? 169 TYR A C   1 
ATOM   234  O O   . TYR A 1 46  ? -7.070  18.151 -44.134 1.00 47.79  ? 169 TYR A O   1 
ATOM   235  C CB  . TYR A 1 46  ? -9.843  18.389 -44.874 1.00 46.69  ? 169 TYR A CB  1 
ATOM   236  N N   . LYS A 1 47  ? -7.786  17.532 -42.083 1.00 47.12  ? 170 LYS A N   1 
ATOM   237  C CA  . LYS A 1 47  ? -6.542  17.826 -41.352 1.00 47.20  ? 170 LYS A CA  1 
ATOM   238  C C   . LYS A 1 47  ? -6.043  16.599 -40.590 1.00 46.80  ? 170 LYS A C   1 
ATOM   239  O O   . LYS A 1 47  ? -5.006  16.656 -39.922 1.00 46.48  ? 170 LYS A O   1 
ATOM   240  C CB  . LYS A 1 47  ? -6.753  18.957 -40.336 1.00 47.54  ? 170 LYS A CB  1 
ATOM   241  C CG  . LYS A 1 47  ? -6.647  20.363 -40.895 1.00 48.52  ? 170 LYS A CG  1 
ATOM   242  C CD  . LYS A 1 47  ? -6.670  21.385 -39.761 1.00 49.06  ? 170 LYS A CD  1 
ATOM   243  C CE  . LYS A 1 47  ? -6.721  22.809 -40.280 1.00 49.68  ? 170 LYS A CE  1 
ATOM   244  N NZ  . LYS A 1 47  ? -7.975  23.073 -41.029 1.00 51.11  ? 170 LYS A NZ  1 
ATOM   245  N N   . ARG A 1 48  ? -6.792  15.501 -40.693 1.00 46.47  ? 171 ARG A N   1 
ATOM   246  C CA  . ARG A 1 48  ? -6.490  14.260 -39.978 1.00 46.31  ? 171 ARG A CA  1 
ATOM   247  C C   . ARG A 1 48  ? -5.056  13.785 -40.214 1.00 46.15  ? 171 ARG A C   1 
ATOM   248  O O   . ARG A 1 48  ? -4.437  13.189 -39.324 1.00 46.30  ? 171 ARG A O   1 
ATOM   249  C CB  . ARG A 1 48  ? -7.497  13.165 -40.344 1.00 46.27  ? 171 ARG A CB  1 
ATOM   250  N N   . ASP A 1 49  ? -4.525  14.067 -41.403 1.00 45.53  ? 172 ASP A N   1 
ATOM   251  C CA  . ASP A 1 49  ? -3.163  13.665 -41.738 1.00 44.92  ? 172 ASP A CA  1 
ATOM   252  C C   . ASP A 1 49  ? -2.109  14.764 -41.448 1.00 44.30  ? 172 ASP A C   1 
ATOM   253  O O   . ASP A 1 49  ? -0.925  14.600 -41.766 1.00 44.82  ? 172 ASP A O   1 
ATOM   254  C CB  . ASP A 1 49  ? -3.091  13.169 -43.184 1.00 44.92  ? 172 ASP A CB  1 
ATOM   255  N N   . LEU A 1 50  ? -2.543  15.869 -40.842 1.00 42.78  ? 173 LEU A N   1 
ATOM   256  C CA  . LEU A 1 50  ? -1.622  16.888 -40.337 1.00 41.51  ? 173 LEU A CA  1 
ATOM   257  C C   . LEU A 1 50  ? -1.150  16.553 -38.917 1.00 40.59  ? 173 LEU A C   1 
ATOM   258  O O   . LEU A 1 50  ? -1.596  15.567 -38.323 1.00 40.19  ? 173 LEU A O   1 
ATOM   259  C CB  . LEU A 1 50  ? -2.266  18.274 -40.364 1.00 41.60  ? 173 LEU A CB  1 
ATOM   260  C CG  . LEU A 1 50  ? -2.638  18.883 -41.722 1.00 41.87  ? 173 LEU A CG  1 
ATOM   261  C CD1 . LEU A 1 50  ? -2.972  20.360 -41.538 1.00 41.79  ? 173 LEU A CD1 1 
ATOM   262  C CD2 . LEU A 1 50  ? -1.525  18.719 -42.762 1.00 42.21  ? 173 LEU A CD2 1 
ATOM   263  N N   . SER A 1 51  ? -0.240  17.373 -38.389 1.00 39.24  ? 174 SER A N   1 
ATOM   264  C CA  . SER A 1 51  ? 0.332   17.163 -37.062 1.00 38.25  ? 174 SER A CA  1 
ATOM   265  C C   . SER A 1 51  ? -0.737  17.459 -36.017 1.00 37.31  ? 174 SER A C   1 
ATOM   266  O O   . SER A 1 51  ? -1.695  18.190 -36.295 1.00 37.02  ? 174 SER A O   1 
ATOM   267  C CB  . SER A 1 51  ? 1.534   18.080 -36.845 1.00 38.00  ? 174 SER A CB  1 
ATOM   268  O OG  . SER A 1 51  ? 1.116   19.437 -36.773 1.00 39.30  ? 174 SER A OG  1 
ATOM   269  N N   . ILE A 1 52  ? -0.571  16.899 -34.821 1.00 36.15  ? 175 ILE A N   1 
ATOM   270  C CA  . ILE A 1 52  ? -1.533  17.125 -33.743 1.00 35.10  ? 175 ILE A CA  1 
ATOM   271  C C   . ILE A 1 52  ? -1.528  18.586 -33.293 1.00 35.13  ? 175 ILE A C   1 
ATOM   272  O O   . ILE A 1 52  ? -2.579  19.139 -32.939 1.00 34.54  ? 175 ILE A O   1 
ATOM   273  C CB  . ILE A 1 52  ? -1.351  16.122 -32.544 1.00 35.07  ? 175 ILE A CB  1 
ATOM   274  C CG1 . ILE A 1 52  ? -2.676  15.924 -31.807 1.00 34.20  ? 175 ILE A CG1 1 
ATOM   275  C CG2 . ILE A 1 52  ? -0.216  16.554 -31.608 1.00 34.70  ? 175 ILE A CG2 1 
ATOM   276  C CD1 . ILE A 1 52  ? -3.834  15.512 -32.715 1.00 32.85  ? 175 ILE A CD1 1 
ATOM   277  N N   . GLU A 1 53  ? -0.355  19.220 -33.352 1.00 35.10  ? 176 GLU A N   1 
ATOM   278  C CA  . GLU A 1 53  ? -0.253  20.651 -33.105 1.00 35.48  ? 176 GLU A CA  1 
ATOM   279  C C   . GLU A 1 53  ? -1.203  21.430 -34.029 1.00 35.44  ? 176 GLU A C   1 
ATOM   280  O O   . GLU A 1 53  ? -1.949  22.283 -33.568 1.00 35.78  ? 176 GLU A O   1 
ATOM   281  C CB  . GLU A 1 53  ? 1.198   21.129 -33.272 1.00 35.59  ? 176 GLU A CB  1 
ATOM   282  N N   . GLU A 1 54  ? -1.183  21.109 -35.322 1.00 35.41  ? 177 GLU A N   1 
ATOM   283  C CA  . GLU A 1 54  ? -2.010  21.797 -36.312 1.00 35.23  ? 177 GLU A CA  1 
ATOM   284  C C   . GLU A 1 54  ? -3.489  21.525 -36.083 1.00 35.01  ? 177 GLU A C   1 
ATOM   285  O O   . GLU A 1 54  ? -4.320  22.429 -36.207 1.00 34.69  ? 177 GLU A O   1 
ATOM   286  C CB  . GLU A 1 54  ? -1.604  21.392 -37.731 1.00 35.29  ? 177 GLU A CB  1 
ATOM   287  N N   . GLN A 1 55  ? -3.805  20.275 -35.739 1.00 34.73  ? 178 GLN A N   1 
ATOM   288  C CA  . GLN A 1 55  ? -5.162  19.904 -35.361 1.00 34.39  ? 178 GLN A CA  1 
ATOM   289  C C   . GLN A 1 55  ? -5.633  20.641 -34.111 1.00 34.01  ? 178 GLN A C   1 
ATOM   290  O O   . GLN A 1 55  ? -6.784  21.095 -34.057 1.00 34.07  ? 178 GLN A O   1 
ATOM   291  C CB  . GLN A 1 55  ? -5.263  18.395 -35.185 1.00 34.71  ? 178 GLN A CB  1 
ATOM   292  C CG  . GLN A 1 55  ? -4.969  17.643 -36.465 1.00 35.43  ? 178 GLN A CG  1 
ATOM   293  C CD  . GLN A 1 55  ? -5.133  16.153 -36.318 1.00 36.94  ? 178 GLN A CD  1 
ATOM   294  O OE1 . GLN A 1 55  ? -6.218  15.670 -36.016 1.00 38.25  ? 178 GLN A OE1 1 
ATOM   295  N NE2 . GLN A 1 55  ? -4.052  15.410 -36.544 1.00 37.48  ? 178 GLN A NE2 1 
ATOM   296  N N   . SER A 1 56  ? -4.742  20.786 -33.127 1.00 33.27  ? 179 SER A N   1 
ATOM   297  C CA  . SER A 1 56  ? -5.063  21.513 -31.893 1.00 32.96  ? 179 SER A CA  1 
ATOM   298  C C   . SER A 1 56  ? -5.265  23.006 -32.106 1.00 33.62  ? 179 SER A C   1 
ATOM   299  O O   . SER A 1 56  ? -6.164  23.598 -31.511 1.00 33.46  ? 179 SER A O   1 
ATOM   300  C CB  . SER A 1 56  ? -3.995  21.312 -30.817 1.00 32.68  ? 179 SER A CB  1 
ATOM   301  O OG  . SER A 1 56  ? -4.315  22.099 -29.673 1.00 29.83  ? 179 SER A OG  1 
ATOM   302  N N   . GLU A 1 57  ? -4.417  23.619 -32.932 1.00 34.45  ? 180 GLU A N   1 
ATOM   303  C CA  . GLU A 1 57  ? -4.571  25.040 -33.270 1.00 35.87  ? 180 GLU A CA  1 
ATOM   304  C C   . GLU A 1 57  ? -5.940  25.301 -33.908 1.00 34.84  ? 180 GLU A C   1 
ATOM   305  O O   . GLU A 1 57  ? -6.626  26.274 -33.577 1.00 34.56  ? 180 GLU A O   1 
ATOM   306  C CB  . GLU A 1 57  ? -3.400  25.524 -34.145 1.00 35.97  ? 180 GLU A CB  1 
ATOM   307  C CG  . GLU A 1 57  ? -2.102  25.712 -33.330 1.00 37.79  ? 180 GLU A CG  1 
ATOM   308  C CD  . GLU A 1 57  ? -0.813  25.676 -34.158 1.00 39.05  ? 180 GLU A CD  1 
ATOM   309  O OE1 . GLU A 1 57  ? -0.881  25.513 -35.404 1.00 41.25  ? 180 GLU A OE1 1 
ATOM   310  O OE2 . GLU A 1 57  ? 0.282   25.813 -33.544 1.00 42.81  ? 180 GLU A OE2 1 
ATOM   311  N N   . CYS A 1 58  ? -6.351  24.383 -34.777 1.00 35.01  ? 181 CYS A N   1 
ATOM   312  C CA  . CYS A 1 58  ? -7.661  24.446 -35.417 1.00 34.31  ? 181 CYS A CA  1 
ATOM   313  C C   . CYS A 1 58  ? -8.820  24.462 -34.404 1.00 33.73  ? 181 CYS A C   1 
ATOM   314  O O   . CYS A 1 58  ? -9.686  25.342 -34.456 1.00 32.90  ? 181 CYS A O   1 
ATOM   315  C CB  . CYS A 1 58  ? -7.805  23.296 -36.414 1.00 34.43  ? 181 CYS A CB  1 
ATOM   316  S SG  . CYS A 1 58  ? -9.330  23.343 -37.364 1.00 36.47  ? 181 CYS A SG  1 
ATOM   317  N N   . ALA A 1 59  ? -8.819  23.505 -33.474 1.00 33.08  ? 182 ALA A N   1 
ATOM   318  C CA  . ALA A 1 59  ? -9.828  23.453 -32.409 1.00 32.85  ? 182 ALA A CA  1 
ATOM   319  C C   . ALA A 1 59  ? -9.813  24.707 -31.551 1.00 32.92  ? 182 ALA A C   1 
ATOM   320  O O   . ALA A 1 59  ? -10.871 25.228 -31.178 1.00 32.84  ? 182 ALA A O   1 
ATOM   321  C CB  . ALA A 1 59  ? -9.632  22.212 -31.524 1.00 32.41  ? 182 ALA A CB  1 
ATOM   322  N N   . GLN A 1 60  ? -8.616  25.180 -31.228 1.00 33.23  ? 183 GLN A N   1 
ATOM   323  C CA  . GLN A 1 60  ? -8.479  26.340 -30.345 1.00 34.68  ? 183 GLN A CA  1 
ATOM   324  C C   . GLN A 1 60  ? -8.954  27.611 -31.038 1.00 35.17  ? 183 GLN A C   1 
ATOM   325  O O   . GLN A 1 60  ? -9.690  28.397 -30.441 1.00 35.43  ? 183 GLN A O   1 
ATOM   326  C CB  . GLN A 1 60  ? -7.043  26.479 -29.819 1.00 34.51  ? 183 GLN A CB  1 
ATOM   327  C CG  . GLN A 1 60  ? -6.568  25.261 -29.015 1.00 34.90  ? 183 GLN A CG  1 
ATOM   328  C CD  . GLN A 1 60  ? -7.299  25.101 -27.698 1.00 35.37  ? 183 GLN A CD  1 
ATOM   329  O OE1 . GLN A 1 60  ? -7.457  26.062 -26.955 1.00 36.89  ? 183 GLN A OE1 1 
ATOM   330  N NE2 . GLN A 1 60  ? -7.739  23.886 -27.398 1.00 33.90  ? 183 GLN A NE2 1 
ATOM   331  N N   . ASP A 1 61  ? -8.549  27.791 -32.298 1.00 36.14  ? 184 ASP A N   1 
ATOM   332  C CA  . ASP A 1 61  ? -9.085  28.869 -33.142 1.00 36.85  ? 184 ASP A CA  1 
ATOM   333  C C   . ASP A 1 61  ? -10.594 28.790 -33.188 1.00 36.76  ? 184 ASP A C   1 
ATOM   334  O O   . ASP A 1 61  ? -11.268 29.806 -33.043 1.00 36.94  ? 184 ASP A O   1 
ATOM   335  C CB  . ASP A 1 61  ? -8.550  28.761 -34.568 1.00 37.21  ? 184 ASP A CB  1 
ATOM   336  C CG  . ASP A 1 61  ? -7.105  29.147 -34.674 1.00 38.80  ? 184 ASP A CG  1 
ATOM   337  O OD1 . ASP A 1 61  ? -6.629  29.903 -33.808 1.00 41.90  ? 184 ASP A OD1 1 
ATOM   338  O OD2 . ASP A 1 61  ? -6.438  28.692 -35.630 1.00 41.17  ? 184 ASP A OD2 1 
ATOM   339  N N   . PHE A 1 62  ? -11.119 27.579 -33.392 1.00 36.68  ? 185 PHE A N   1 
ATOM   340  C CA  . PHE A 1 62  ? -12.558 27.363 -33.424 1.00 36.82  ? 185 PHE A CA  1 
ATOM   341  C C   . PHE A 1 62  ? -13.253 27.784 -32.120 1.00 37.57  ? 185 PHE A C   1 
ATOM   342  O O   . PHE A 1 62  ? -14.274 28.470 -32.158 1.00 37.72  ? 185 PHE A O   1 
ATOM   343  C CB  . PHE A 1 62  ? -12.889 25.913 -33.787 1.00 36.63  ? 185 PHE A CB  1 
ATOM   344  C CG  . PHE A 1 62  ? -14.326 25.534 -33.546 1.00 36.21  ? 185 PHE A CG  1 
ATOM   345  C CD1 . PHE A 1 62  ? -15.341 26.005 -34.380 1.00 36.17  ? 185 PHE A CD1 1 
ATOM   346  C CD2 . PHE A 1 62  ? -14.667 24.711 -32.481 1.00 35.35  ? 185 PHE A CD2 1 
ATOM   347  C CE1 . PHE A 1 62  ? -16.676 25.648 -34.161 1.00 35.39  ? 185 PHE A CE1 1 
ATOM   348  C CE2 . PHE A 1 62  ? -15.990 24.356 -32.249 1.00 36.23  ? 185 PHE A CE2 1 
ATOM   349  C CZ  . PHE A 1 62  ? -17.003 24.824 -33.090 1.00 36.10  ? 185 PHE A CZ  1 
ATOM   350  N N   . TYR A 1 63  ? -12.711 27.374 -30.974 1.00 38.14  ? 186 TYR A N   1 
ATOM   351  C CA  . TYR A 1 63  ? -13.244 27.813 -29.683 1.00 39.02  ? 186 TYR A CA  1 
ATOM   352  C C   . TYR A 1 63  ? -13.221 29.344 -29.608 1.00 40.22  ? 186 TYR A C   1 
ATOM   353  O O   . TYR A 1 63  ? -14.221 29.958 -29.265 1.00 40.34  ? 186 TYR A O   1 
ATOM   354  C CB  . TYR A 1 63  ? -12.434 27.250 -28.504 1.00 38.00  ? 186 TYR A CB  1 
ATOM   355  C CG  . TYR A 1 63  ? -12.593 25.776 -28.200 1.00 36.53  ? 186 TYR A CG  1 
ATOM   356  C CD1 . TYR A 1 63  ? -13.840 25.231 -27.888 1.00 35.18  ? 186 TYR A CD1 1 
ATOM   357  C CD2 . TYR A 1 63  ? -11.477 24.933 -28.171 1.00 35.26  ? 186 TYR A CD2 1 
ATOM   358  C CE1 . TYR A 1 63  ? -13.981 23.885 -27.594 1.00 35.19  ? 186 TYR A CE1 1 
ATOM   359  C CE2 . TYR A 1 63  ? -11.603 23.595 -27.873 1.00 35.37  ? 186 TYR A CE2 1 
ATOM   360  C CZ  . TYR A 1 63  ? -12.856 23.079 -27.583 1.00 35.89  ? 186 TYR A CZ  1 
ATOM   361  O OH  . TYR A 1 63  ? -12.979 21.752 -27.283 1.00 36.83  ? 186 TYR A OH  1 
ATOM   362  N N   . HIS A 1 64  ? -12.071 29.935 -29.928 1.00 42.03  ? 187 HIS A N   1 
ATOM   363  C CA  . HIS A 1 64  ? -11.883 31.385 -29.911 1.00 44.39  ? 187 HIS A CA  1 
ATOM   364  C C   . HIS A 1 64  ? -12.945 32.058 -30.787 1.00 46.36  ? 187 HIS A C   1 
ATOM   365  O O   . HIS A 1 64  ? -13.727 32.887 -30.302 1.00 46.03  ? 187 HIS A O   1 
ATOM   366  C CB  . HIS A 1 64  ? -10.396 31.754 -29.851 0.00 29.90  ? 187 HIS A CB  1 
ATOM   367  N N   . ASN A 1 65  ? -12.988 31.653 -32.060 1.00 48.04  ? 188 ASN A N   1 
ATOM   368  C CA  . ASN A 1 65  ? -13.861 32.269 -33.068 1.00 49.93  ? 188 ASN A CA  1 
ATOM   369  C C   . ASN A 1 65  ? -15.366 32.099 -32.868 1.00 51.24  ? 188 ASN A C   1 
ATOM   370  O O   . ASN A 1 65  ? -16.125 33.024 -33.152 1.00 51.61  ? 188 ASN A O   1 
ATOM   371  C CB  . ASN A 1 65  ? -13.464 31.831 -34.479 1.00 49.79  ? 188 ASN A CB  1 
ATOM   372  C CG  . ASN A 1 65  ? -12.128 32.408 -34.919 1.00 50.18  ? 188 ASN A CG  1 
ATOM   373  O OD1 . ASN A 1 65  ? -11.409 31.801 -35.711 1.00 50.88  ? 188 ASN A OD1 1 
ATOM   374  N ND2 . ASN A 1 65  ? -11.789 33.585 -34.407 1.00 50.69  ? 188 ASN A ND2 1 
ATOM   375  N N   . VAL A 1 66  ? -15.801 30.936 -32.390 1.00 52.68  ? 189 VAL A N   1 
ATOM   376  C CA  . VAL A 1 66  ? -17.226 30.709 -32.138 1.00 54.38  ? 189 VAL A CA  1 
ATOM   377  C C   . VAL A 1 66  ? -17.719 31.529 -30.949 1.00 55.71  ? 189 VAL A C   1 
ATOM   378  O O   . VAL A 1 66  ? -18.844 32.029 -30.961 1.00 55.78  ? 189 VAL A O   1 
ATOM   379  C CB  . VAL A 1 66  ? -17.563 29.211 -31.968 1.00 54.27  ? 189 VAL A CB  1 
ATOM   380  C CG1 . VAL A 1 66  ? -19.002 29.011 -31.526 1.00 54.51  ? 189 VAL A CG1 1 
ATOM   381  C CG2 . VAL A 1 66  ? -17.372 28.510 -33.275 1.00 55.12  ? 189 VAL A CG2 1 
ATOM   382  N N   . ALA A 1 67  ? -16.864 31.674 -29.940 1.00 57.41  ? 190 ALA A N   1 
ATOM   383  C CA  . ALA A 1 67  ? -17.176 32.475 -28.760 1.00 59.33  ? 190 ALA A CA  1 
ATOM   384  C C   . ALA A 1 67  ? -17.323 33.960 -29.095 1.00 60.69  ? 190 ALA A C   1 
ATOM   385  O O   . ALA A 1 67  ? -18.229 34.628 -28.589 1.00 60.77  ? 190 ALA A O   1 
ATOM   386  C CB  . ALA A 1 67  ? -16.116 32.272 -27.675 1.00 59.10  ? 190 ALA A CB  1 
ATOM   387  N N   . GLU A 1 68  ? -16.426 34.464 -29.943 1.00 62.53  ? 191 GLU A N   1 
ATOM   388  C CA  . GLU A 1 68  ? -16.426 35.869 -30.333 1.00 64.38  ? 191 GLU A CA  1 
ATOM   389  C C   . GLU A 1 68  ? -17.586 36.176 -31.274 1.00 65.77  ? 191 GLU A C   1 
ATOM   390  O O   . GLU A 1 68  ? -18.265 37.187 -31.100 1.00 66.12  ? 191 GLU A O   1 
ATOM   391  C CB  . GLU A 1 68  ? -15.088 36.263 -30.961 1.00 64.20  ? 191 GLU A CB  1 
ATOM   392  N N   . ARG A 1 69  ? -17.821 35.299 -32.252 1.00 67.59  ? 192 ARG A N   1 
ATOM   393  C CA  . ARG A 1 69  ? -18.942 35.452 -33.192 1.00 69.42  ? 192 ARG A CA  1 
ATOM   394  C C   . ARG A 1 69  ? -20.310 35.320 -32.502 1.00 70.87  ? 192 ARG A C   1 
ATOM   395  O O   . ARG A 1 69  ? -21.356 35.493 -33.134 1.00 71.23  ? 192 ARG A O   1 
ATOM   396  C CB  . ARG A 1 69  ? -18.818 34.469 -34.356 1.00 69.07  ? 192 ARG A CB  1 
ATOM   397  N N   . MET A 1 70  ? -20.290 35.016 -31.207 1.00 72.63  ? 193 MET A N   1 
ATOM   398  C CA  . MET A 1 70  ? -21.499 34.986 -30.387 1.00 74.54  ? 193 MET A CA  1 
ATOM   399  C C   . MET A 1 70  ? -21.740 36.324 -29.690 1.00 75.84  ? 193 MET A C   1 
ATOM   400  O O   . MET A 1 70  ? -22.888 36.763 -29.552 1.00 76.08  ? 193 MET A O   1 
ATOM   401  C CB  . MET A 1 70  ? -21.389 33.901 -29.328 1.00 74.50  ? 193 MET A CB  1 
ATOM   402  C CG  . MET A 1 70  ? -21.839 32.532 -29.767 1.00 74.88  ? 193 MET A CG  1 
ATOM   403  S SD  . MET A 1 70  ? -22.161 31.547 -28.298 1.00 74.57  ? 193 MET A SD  1 
ATOM   404  C CE  . MET A 1 70  ? -23.537 32.480 -27.637 1.00 75.72  ? 193 MET A CE  1 
ATOM   405  N N   . GLN A 1 71  ? -20.652 36.943 -29.227 1.00 77.35  ? 194 GLN A N   1 
ATOM   406  C CA  . GLN A 1 71  ? -20.699 38.252 -28.579 1.00 78.82  ? 194 GLN A CA  1 
ATOM   407  C C   . GLN A 1 71  ? -21.024 39.331 -29.605 1.00 79.65  ? 194 GLN A C   1 
ATOM   408  O O   . GLN A 1 71  ? -21.815 40.241 -29.336 1.00 79.94  ? 194 GLN A O   1 
ATOM   409  C CB  . GLN A 1 71  ? -19.363 38.571 -27.904 1.00 78.77  ? 194 GLN A CB  1 
ATOM   410  C CG  . GLN A 1 71  ? -19.048 37.736 -26.668 1.00 78.99  ? 194 GLN A CG  1 
ATOM   411  C CD  . GLN A 1 71  ? -17.833 38.249 -25.909 1.00 79.30  ? 194 GLN A CD  1 
ATOM   412  O OE1 . GLN A 1 71  ? -16.810 38.604 -26.507 1.00 79.63  ? 194 GLN A OE1 1 
ATOM   413  N NE2 . GLN A 1 71  ? -17.939 38.291 -24.583 1.00 79.39  ? 194 GLN A NE2 1 
ATOM   414  N N   . THR A 1 72  ? -20.410 39.219 -30.780 1.00 80.62  ? 195 THR A N   1 
ATOM   415  C CA  . THR A 1 72  ? -20.662 40.141 -31.881 1.00 81.61  ? 195 THR A CA  1 
ATOM   416  C C   . THR A 1 72  ? -22.073 39.937 -32.456 1.00 82.16  ? 195 THR A C   1 
ATOM   417  O O   . THR A 1 72  ? -23.046 40.491 -31.932 1.00 82.23  ? 195 THR A O   1 
ATOM   418  C CB  . THR A 1 72  ? -19.590 40.008 -32.997 1.00 81.71  ? 195 THR A CB  1 
ATOM   419  O OG1 . THR A 1 72  ? -18.325 39.662 -32.418 1.00 82.19  ? 195 THR A OG1 1 
ATOM   420  C CG2 . THR A 1 72  ? -19.457 41.316 -33.785 1.00 81.75  ? 195 THR A CG2 1 
ATOM   421  N N   . ARG A 1 73  ? -22.176 39.117 -33.507 1.00 82.88  ? 196 ARG A N   1 
ATOM   422  C CA  . ARG A 1 73  ? -23.413 38.969 -34.288 1.00 83.44  ? 196 ARG A CA  1 
ATOM   423  C C   . ARG A 1 73  ? -24.401 37.935 -33.721 1.00 83.76  ? 196 ARG A C   1 
ATOM   424  O O   . ARG A 1 73  ? -24.842 37.024 -34.436 1.00 83.74  ? 196 ARG A O   1 
ATOM   425  C CB  . ARG A 1 73  ? -23.076 38.662 -35.763 1.00 83.46  ? 196 ARG A CB  1 
ATOM   426  N N   . GLY A 1 74  ? -24.761 38.094 -32.445 1.00 84.12  ? 197 GLY A N   1 
ATOM   427  C CA  . GLY A 1 74  ? -25.670 37.158 -31.779 1.00 84.51  ? 197 GLY A CA  1 
ATOM   428  C C   . GLY A 1 74  ? -26.382 37.689 -30.544 1.00 84.83  ? 197 GLY A C   1 
ATOM   429  O O   . GLY A 1 74  ? -27.499 37.251 -30.233 1.00 84.87  ? 197 GLY A O   1 
ATOM   430  N N   . LYS A 1 75  ? -25.735 38.636 -29.853 1.00 84.96  ? 198 LYS A N   1 
ATOM   431  C CA  . LYS A 1 75  ? -26.213 39.232 -28.582 1.00 84.99  ? 198 LYS A CA  1 
ATOM   432  C C   . LYS A 1 75  ? -26.806 38.210 -27.589 1.00 84.79  ? 198 LYS A C   1 
ATOM   433  O O   . LYS A 1 75  ? -28.028 38.146 -27.392 1.00 84.77  ? 198 LYS A O   1 
ATOM   434  C CB  . LYS A 1 75  ? -27.199 40.402 -28.809 1.00 85.09  ? 198 LYS A CB  1 
ATOM   435  C CG  . LYS A 1 75  ? -27.339 40.939 -30.243 1.00 85.59  ? 198 LYS A CG  1 
ATOM   436  C CD  . LYS A 1 75  ? -28.605 40.383 -30.921 1.00 85.92  ? 198 LYS A CD  1 
ATOM   437  C CE  . LYS A 1 75  ? -28.973 41.154 -32.188 1.00 85.95  ? 198 LYS A CE  1 
ATOM   438  N NZ  . LYS A 1 75  ? -28.005 40.938 -33.301 1.00 85.80  ? 198 LYS A NZ  1 
ATOM   439  N N   . VAL A 1 76  ? -25.928 37.412 -26.979 1.00 84.43  ? 199 VAL A N   1 
ATOM   440  C CA  . VAL A 1 76  ? -26.325 36.357 -26.034 1.00 83.89  ? 199 VAL A CA  1 
ATOM   441  C C   . VAL A 1 76  ? -25.656 36.633 -24.677 1.00 83.45  ? 199 VAL A C   1 
ATOM   442  O O   . VAL A 1 76  ? -24.493 37.044 -24.647 1.00 83.48  ? 199 VAL A O   1 
ATOM   443  C CB  . VAL A 1 76  ? -25.955 34.940 -26.584 1.00 83.94  ? 199 VAL A CB  1 
ATOM   444  C CG1 . VAL A 1 76  ? -26.401 33.822 -25.641 1.00 83.88  ? 199 VAL A CG1 1 
ATOM   445  C CG2 . VAL A 1 76  ? -26.562 34.722 -27.966 1.00 83.83  ? 199 VAL A CG2 1 
ATOM   446  N N   . PRO A 1 77  ? -26.391 36.430 -23.554 1.00 82.98  ? 200 PRO A N   1 
ATOM   447  C CA  . PRO A 1 77  ? -25.822 36.688 -22.221 1.00 82.49  ? 200 PRO A CA  1 
ATOM   448  C C   . PRO A 1 77  ? -24.684 35.726 -21.874 1.00 81.94  ? 200 PRO A C   1 
ATOM   449  O O   . PRO A 1 77  ? -24.822 34.520 -22.099 1.00 82.11  ? 200 PRO A O   1 
ATOM   450  C CB  . PRO A 1 77  ? -27.007 36.458 -21.268 1.00 82.54  ? 200 PRO A CB  1 
ATOM   451  C CG  . PRO A 1 77  ? -28.224 36.435 -22.124 1.00 82.81  ? 200 PRO A CG  1 
ATOM   452  C CD  . PRO A 1 77  ? -27.786 35.956 -23.467 1.00 82.97  ? 200 PRO A CD  1 
ATOM   453  N N   . PRO A 1 78  ? -23.566 36.253 -21.328 1.00 81.30  ? 201 PRO A N   1 
ATOM   454  C CA  . PRO A 1 78  ? -22.380 35.476 -20.922 1.00 80.72  ? 201 PRO A CA  1 
ATOM   455  C C   . PRO A 1 78  ? -22.659 34.268 -20.005 1.00 80.05  ? 201 PRO A C   1 
ATOM   456  O O   . PRO A 1 78  ? -21.811 33.370 -19.892 1.00 80.00  ? 201 PRO A O   1 
ATOM   457  C CB  . PRO A 1 78  ? -21.516 36.515 -20.193 1.00 80.82  ? 201 PRO A CB  1 
ATOM   458  C CG  . PRO A 1 78  ? -21.898 37.811 -20.816 1.00 81.14  ? 201 PRO A CG  1 
ATOM   459  C CD  . PRO A 1 78  ? -23.376 37.696 -21.082 1.00 81.35  ? 201 PRO A CD  1 
ATOM   460  N N   . GLU A 1 79  ? -23.827 34.257 -19.361 1.00 79.11  ? 202 GLU A N   1 
ATOM   461  C CA  . GLU A 1 79  ? -24.264 33.120 -18.550 1.00 78.09  ? 202 GLU A CA  1 
ATOM   462  C C   . GLU A 1 79  ? -24.494 31.893 -19.436 1.00 77.31  ? 202 GLU A C   1 
ATOM   463  O O   . GLU A 1 79  ? -23.933 30.819 -19.191 1.00 77.36  ? 202 GLU A O   1 
ATOM   464  C CB  . GLU A 1 79  ? -25.533 33.474 -17.772 1.00 78.05  ? 202 GLU A CB  1 
ATOM   465  N N   . ARG A 1 80  ? -25.303 32.079 -20.479 1.00 76.11  ? 203 ARG A N   1 
ATOM   466  C CA  . ARG A 1 80  ? -25.663 31.009 -21.409 1.00 74.91  ? 203 ARG A CA  1 
ATOM   467  C C   . ARG A 1 80  ? -24.553 30.710 -22.420 1.00 73.71  ? 203 ARG A C   1 
ATOM   468  O O   . ARG A 1 80  ? -24.585 29.673 -23.083 1.00 73.67  ? 203 ARG A O   1 
ATOM   469  C CB  . ARG A 1 80  ? -26.968 31.355 -22.139 1.00 75.15  ? 203 ARG A CB  1 
ATOM   470  C CG  . ARG A 1 80  ? -28.163 31.524 -21.213 1.00 76.15  ? 203 ARG A CG  1 
ATOM   471  C CD  . ARG A 1 80  ? -29.292 32.304 -21.875 1.00 77.90  ? 203 ARG A CD  1 
ATOM   472  N NE  . ARG A 1 80  ? -30.206 32.879 -20.882 1.00 78.89  ? 203 ARG A NE  1 
ATOM   473  C CZ  . ARG A 1 80  ? -31.297 32.275 -20.407 1.00 79.50  ? 203 ARG A CZ  1 
ATOM   474  N NH1 . ARG A 1 80  ? -31.637 31.058 -20.826 1.00 80.04  ? 203 ARG A NH1 1 
ATOM   475  N NH2 . ARG A 1 80  ? -32.055 32.890 -19.505 1.00 79.20  ? 203 ARG A NH2 1 
ATOM   476  N N   . VAL A 1 81  ? -23.584 31.620 -22.529 1.00 72.02  ? 204 VAL A N   1 
ATOM   477  C CA  . VAL A 1 81  ? -22.450 31.465 -23.442 1.00 70.43  ? 204 VAL A CA  1 
ATOM   478  C C   . VAL A 1 81  ? -21.497 30.353 -22.991 1.00 69.24  ? 204 VAL A C   1 
ATOM   479  O O   . VAL A 1 81  ? -21.047 29.553 -23.811 1.00 69.31  ? 204 VAL A O   1 
ATOM   480  C CB  . VAL A 1 81  ? -21.685 32.795 -23.645 1.00 70.49  ? 204 VAL A CB  1 
ATOM   481  C CG1 . VAL A 1 81  ? -20.405 32.580 -24.446 1.00 70.34  ? 204 VAL A CG1 1 
ATOM   482  C CG2 . VAL A 1 81  ? -22.573 33.805 -24.343 1.00 70.58  ? 204 VAL A CG2 1 
ATOM   483  N N   . GLU A 1 82  ? -21.196 30.298 -21.696 1.00 67.57  ? 205 GLU A N   1 
ATOM   484  C CA  . GLU A 1 82  ? -20.373 29.218 -21.162 1.00 65.84  ? 205 GLU A CA  1 
ATOM   485  C C   . GLU A 1 82  ? -21.100 27.874 -21.273 1.00 64.69  ? 205 GLU A C   1 
ATOM   486  O O   . GLU A 1 82  ? -20.483 26.861 -21.607 1.00 64.37  ? 205 GLU A O   1 
ATOM   487  C CB  . GLU A 1 82  ? -19.964 29.508 -19.717 1.00 65.91  ? 205 GLU A CB  1 
ATOM   488  N N   . LYS A 1 83  ? -22.411 27.885 -21.018 1.00 63.18  ? 206 LYS A N   1 
ATOM   489  C CA  . LYS A 1 83  ? -23.243 26.676 -21.045 1.00 61.91  ? 206 LYS A CA  1 
ATOM   490  C C   . LYS A 1 83  ? -23.311 26.024 -22.421 1.00 61.00  ? 206 LYS A C   1 
ATOM   491  O O   . LYS A 1 83  ? -23.404 24.797 -22.530 1.00 61.04  ? 206 LYS A O   1 
ATOM   492  C CB  . LYS A 1 83  ? -24.644 26.982 -20.553 1.00 62.12  ? 206 LYS A CB  1 
ATOM   493  N N   . ILE A 1 84  ? -23.278 26.846 -23.467 1.00 59.39  ? 207 ILE A N   1 
ATOM   494  C CA  . ILE A 1 84  ? -23.338 26.335 -24.833 1.00 57.78  ? 207 ILE A CA  1 
ATOM   495  C C   . ILE A 1 84  ? -21.963 25.968 -25.395 1.00 56.15  ? 207 ILE A C   1 
ATOM   496  O O   . ILE A 1 84  ? -21.864 25.105 -26.261 1.00 55.86  ? 207 ILE A O   1 
ATOM   497  C CB  . ILE A 1 84  ? -24.152 27.249 -25.789 1.00 58.09  ? 207 ILE A CB  1 
ATOM   498  C CG1 . ILE A 1 84  ? -23.509 28.619 -25.960 1.00 58.25  ? 207 ILE A CG1 1 
ATOM   499  C CG2 . ILE A 1 84  ? -25.567 27.413 -25.274 1.00 58.40  ? 207 ILE A CG2 1 
ATOM   500  C CD1 . ILE A 1 84  ? -24.502 29.662 -26.441 1.00 59.40  ? 207 ILE A CD1 1 
ATOM   501  N N   . MET A 1 85  ? -20.916 26.614 -24.884 1.00 54.39  ? 208 MET A N   1 
ATOM   502  C CA  . MET A 1 85  ? -19.541 26.234 -25.201 1.00 52.92  ? 208 MET A CA  1 
ATOM   503  C C   . MET A 1 85  ? -19.212 24.856 -24.624 1.00 52.02  ? 208 MET A C   1 
ATOM   504  O O   . MET A 1 85  ? -18.381 24.126 -25.173 1.00 51.53  ? 208 MET A O   1 
ATOM   505  C CB  . MET A 1 85  ? -18.541 27.270 -24.692 1.00 52.84  ? 208 MET A CB  1 
ATOM   506  C CG  . MET A 1 85  ? -18.573 28.593 -25.434 1.00 52.76  ? 208 MET A CG  1 
ATOM   507  S SD  . MET A 1 85  ? -18.360 28.447 -27.219 1.00 51.85  ? 208 MET A SD  1 
ATOM   508  C CE  . MET A 1 85  ? -16.593 28.624 -27.385 1.00 51.86  ? 208 MET A CE  1 
ATOM   509  N N   . ASP A 1 86  ? -19.874 24.516 -23.517 1.00 50.80  ? 209 ASP A N   1 
ATOM   510  C CA  . ASP A 1 86  ? -19.763 23.193 -22.915 1.00 49.65  ? 209 ASP A CA  1 
ATOM   511  C C   . ASP A 1 86  ? -20.432 22.170 -23.812 1.00 48.50  ? 209 ASP A C   1 
ATOM   512  O O   . ASP A 1 86  ? -19.940 21.052 -23.962 1.00 48.50  ? 209 ASP A O   1 
ATOM   513  C CB  . ASP A 1 86  ? -20.403 23.160 -21.522 1.00 49.80  ? 209 ASP A CB  1 
ATOM   514  C CG  . ASP A 1 86  ? -19.645 23.996 -20.499 1.00 50.34  ? 209 ASP A CG  1 
ATOM   515  O OD1 . ASP A 1 86  ? -18.539 24.503 -20.809 1.00 49.70  ? 209 ASP A OD1 1 
ATOM   516  O OD2 . ASP A 1 86  ? -20.167 24.144 -19.369 1.00 50.97  ? 209 ASP A OD2 1 
ATOM   517  N N   . GLN A 1 87  ? -21.553 22.564 -24.407 1.00 46.88  ? 210 GLN A N   1 
ATOM   518  C CA  . GLN A 1 87  ? -22.279 21.685 -25.314 1.00 45.61  ? 210 GLN A CA  1 
ATOM   519  C C   . GLN A 1 87  ? -21.519 21.467 -26.624 1.00 43.98  ? 210 GLN A C   1 
ATOM   520  O O   . GLN A 1 87  ? -21.473 20.347 -27.143 1.00 43.73  ? 210 GLN A O   1 
ATOM   521  C CB  . GLN A 1 87  ? -23.692 22.214 -25.562 1.00 46.02  ? 210 GLN A CB  1 
ATOM   522  C CG  . GLN A 1 87  ? -24.676 21.832 -24.460 1.00 47.54  ? 210 GLN A CG  1 
ATOM   523  C CD  . GLN A 1 87  ? -24.985 20.343 -24.457 1.00 50.68  ? 210 GLN A CD  1 
ATOM   524  O OE1 . GLN A 1 87  ? -25.596 19.820 -25.397 1.00 52.39  ? 210 GLN A OE1 1 
ATOM   525  N NE2 . GLN A 1 87  ? -24.562 19.650 -23.401 1.00 50.72  ? 210 GLN A NE2 1 
ATOM   526  N N   . ILE A 1 88  ? -20.913 22.541 -27.131 1.00 42.11  ? 211 ILE A N   1 
ATOM   527  C CA  . ILE A 1 88  ? -20.053 22.480 -28.311 1.00 40.12  ? 211 ILE A CA  1 
ATOM   528  C C   . ILE A 1 88  ? -18.876 21.532 -28.040 1.00 38.89  ? 211 ILE A C   1 
ATOM   529  O O   . ILE A 1 88  ? -18.691 20.560 -28.779 1.00 38.39  ? 211 ILE A O   1 
ATOM   530  C CB  . ILE A 1 88  ? -19.567 23.885 -28.749 1.00 40.05  ? 211 ILE A CB  1 
ATOM   531  C CG1 . ILE A 1 88  ? -20.725 24.700 -29.328 1.00 40.34  ? 211 ILE A CG1 1 
ATOM   532  C CG2 . ILE A 1 88  ? -18.429 23.791 -29.767 1.00 39.60  ? 211 ILE A CG2 1 
ATOM   533  C CD1 . ILE A 1 88  ? -20.444 26.197 -29.388 1.00 40.05  ? 211 ILE A CD1 1 
ATOM   534  N N   . GLU A 1 89  ? -18.120 21.793 -26.968 1.00 37.08  ? 212 GLU A N   1 
ATOM   535  C CA  . GLU A 1 89  ? -16.978 20.958 -26.605 1.00 35.57  ? 212 GLU A CA  1 
ATOM   536  C C   . GLU A 1 89  ? -17.362 19.490 -26.527 1.00 34.52  ? 212 GLU A C   1 
ATOM   537  O O   . GLU A 1 89  ? -16.628 18.643 -27.015 1.00 34.24  ? 212 GLU A O   1 
ATOM   538  C CB  . GLU A 1 89  ? -16.327 21.396 -25.283 1.00 35.57  ? 212 GLU A CB  1 
ATOM   539  C CG  . GLU A 1 89  ? -14.984 20.677 -25.000 1.00 35.87  ? 212 GLU A CG  1 
ATOM   540  C CD  . GLU A 1 89  ? -14.538 20.749 -23.543 1.00 36.65  ? 212 GLU A CD  1 
ATOM   541  O OE1 . GLU A 1 89  ? -15.092 19.995 -22.704 1.00 34.76  ? 212 GLU A OE1 1 
ATOM   542  O OE2 . GLU A 1 89  ? -13.616 21.548 -23.251 1.00 38.22  ? 212 GLU A OE2 1 
ATOM   543  N N   . LYS A 1 90  ? -18.512 19.191 -25.930 1.00 33.56  ? 213 LYS A N   1 
ATOM   544  C CA  . LYS A 1 90  ? -18.964 17.803 -25.785 1.00 33.47  ? 213 LYS A CA  1 
ATOM   545  C C   . LYS A 1 90  ? -19.282 17.143 -27.124 1.00 32.74  ? 213 LYS A C   1 
ATOM   546  O O   . LYS A 1 90  ? -18.891 16.002 -27.358 1.00 32.42  ? 213 LYS A O   1 
ATOM   547  C CB  . LYS A 1 90  ? -20.159 17.715 -24.832 1.00 33.37  ? 213 LYS A CB  1 
ATOM   548  C CG  . LYS A 1 90  ? -20.894 16.385 -24.849 1.00 33.90  ? 213 LYS A CG  1 
ATOM   549  C CD  . LYS A 1 90  ? -21.984 16.351 -23.772 1.00 35.57  ? 213 LYS A CD  1 
ATOM   550  C CE  . LYS A 1 90  ? -22.473 14.926 -23.549 1.00 38.17  ? 213 LYS A CE  1 
ATOM   551  N NZ  . LYS A 1 90  ? -23.850 14.877 -22.974 1.00 39.62  ? 213 LYS A NZ  1 
ATOM   552  N N   . TYR A 1 91  ? -19.993 17.861 -27.995 1.00 32.01  ? 214 TYR A N   1 
ATOM   553  C CA  . TYR A 1 91  ? -20.271 17.368 -29.350 1.00 31.26  ? 214 TYR A CA  1 
ATOM   554  C C   . TYR A 1 91  ? -18.972 17.137 -30.115 1.00 29.79  ? 214 TYR A C   1 
ATOM   555  O O   . TYR A 1 91  ? -18.687 16.017 -30.558 1.00 29.71  ? 214 TYR A O   1 
ATOM   556  C CB  . TYR A 1 91  ? -21.169 18.365 -30.107 1.00 31.90  ? 214 TYR A CB  1 
ATOM   557  C CG  . TYR A 1 91  ? -21.511 17.967 -31.539 1.00 31.75  ? 214 TYR A CG  1 
ATOM   558  C CD1 . TYR A 1 91  ? -22.472 16.994 -31.802 1.00 31.25  ? 214 TYR A CD1 1 
ATOM   559  C CD2 . TYR A 1 91  ? -20.894 18.592 -32.623 1.00 32.68  ? 214 TYR A CD2 1 
ATOM   560  C CE1 . TYR A 1 91  ? -22.794 16.634 -33.104 1.00 32.45  ? 214 TYR A CE1 1 
ATOM   561  C CE2 . TYR A 1 91  ? -21.206 18.236 -33.938 1.00 32.10  ? 214 TYR A CE2 1 
ATOM   562  C CZ  . TYR A 1 91  ? -22.161 17.263 -34.169 1.00 32.61  ? 214 TYR A CZ  1 
ATOM   563  O OH  . TYR A 1 91  ? -22.494 16.911 -35.467 1.00 32.77  ? 214 TYR A OH  1 
ATOM   564  N N   . ILE A 1 92  ? -18.164 18.183 -30.258 1.00 28.92  ? 215 ILE A N   1 
ATOM   565  C CA  . ILE A 1 92  ? -16.965 18.052 -31.072 1.00 27.96  ? 215 ILE A CA  1 
ATOM   566  C C   . ILE A 1 92  ? -15.993 16.988 -30.541 1.00 27.88  ? 215 ILE A C   1 
ATOM   567  O O   . ILE A 1 92  ? -15.441 16.210 -31.329 1.00 27.06  ? 215 ILE A O   1 
ATOM   568  C CB  . ILE A 1 92  ? -16.261 19.400 -31.364 1.00 28.25  ? 215 ILE A CB  1 
ATOM   569  C CG1 . ILE A 1 92  ? -15.711 20.053 -30.093 1.00 28.02  ? 215 ILE A CG1 1 
ATOM   570  C CG2 . ILE A 1 92  ? -17.220 20.356 -32.098 1.00 28.25  ? 215 ILE A CG2 1 
ATOM   571  C CD1 . ILE A 1 92  ? -14.724 21.149 -30.359 1.00 28.36  ? 215 ILE A CD1 1 
ATOM   572  N N   . MET A 1 93  ? -15.808 16.941 -29.221 1.00 26.89  ? 216 MET A N   1 
ATOM   573  C CA  . MET A 1 93  ? -14.762 16.072 -28.630 1.00 27.66  ? 216 MET A CA  1 
ATOM   574  C C   . MET A 1 93  ? -15.202 14.627 -28.538 1.00 27.93  ? 216 MET A C   1 
ATOM   575  O O   . MET A 1 93  ? -14.384 13.725 -28.654 1.00 27.75  ? 216 MET A O   1 
ATOM   576  C CB  . MET A 1 93  ? -14.261 16.602 -27.279 1.00 27.38  ? 216 MET A CB  1 
ATOM   577  C CG  . MET A 1 93  ? -13.536 17.921 -27.397 1.00 26.34  ? 216 MET A CG  1 
ATOM   578  S SD  . MET A 1 93  ? -12.395 17.940 -28.792 1.00 25.41  ? 216 MET A SD  1 
ATOM   579  C CE  . MET A 1 93  ? -11.930 19.632 -28.768 1.00 30.16  ? 216 MET A CE  1 
ATOM   580  N N   . THR A 1 94  ? -16.503 14.413 -28.367 1.00 29.04  ? 217 THR A N   1 
ATOM   581  C CA  . THR A 1 94  ? -17.095 13.075 -28.499 1.00 30.80  ? 217 THR A CA  1 
ATOM   582  C C   . THR A 1 94  ? -16.815 12.503 -29.903 1.00 31.05  ? 217 THR A C   1 
ATOM   583  O O   . THR A 1 94  ? -16.411 11.345 -30.062 1.00 31.16  ? 217 THR A O   1 
ATOM   584  C CB  . THR A 1 94  ? -18.604 13.122 -28.138 1.00 30.79  ? 217 THR A CB  1 
ATOM   585  O OG1 . THR A 1 94  ? -18.726 13.336 -26.721 1.00 32.46  ? 217 THR A OG1 1 
ATOM   586  C CG2 . THR A 1 94  ? -19.307 11.850 -28.488 1.00 32.14  ? 217 THR A CG2 1 
ATOM   587  N N   . ARG A 1 95  ? -16.982 13.342 -30.918 1.00 31.77  ? 218 ARG A N   1 
ATOM   588  C CA  . ARG A 1 95  ? -16.704 12.933 -32.289 1.00 32.18  ? 218 ARG A CA  1 
ATOM   589  C C   . ARG A 1 95  ? -15.216 12.875 -32.605 1.00 31.32  ? 218 ARG A C   1 
ATOM   590  O O   . ARG A 1 95  ? -14.776 12.016 -33.366 1.00 31.61  ? 218 ARG A O   1 
ATOM   591  C CB  . ARG A 1 95  ? -17.451 13.836 -33.267 1.00 32.74  ? 218 ARG A CB  1 
ATOM   592  C CG  . ARG A 1 95  ? -18.961 13.760 -33.040 1.00 35.91  ? 218 ARG A CG  1 
ATOM   593  C CD  . ARG A 1 95  ? -19.678 14.848 -33.752 1.00 40.17  ? 218 ARG A CD  1 
ATOM   594  N NE  . ARG A 1 95  ? -19.735 14.599 -35.189 1.00 45.11  ? 218 ARG A NE  1 
ATOM   595  C CZ  . ARG A 1 95  ? -20.688 13.899 -35.809 1.00 46.49  ? 218 ARG A CZ  1 
ATOM   596  N NH1 . ARG A 1 95  ? -21.692 13.348 -35.128 1.00 46.22  ? 218 ARG A NH1 1 
ATOM   597  N NH2 . ARG A 1 95  ? -20.633 13.754 -37.125 1.00 46.90  ? 218 ARG A NH2 1 
ATOM   598  N N   . LEU A 1 96  ? -14.435 13.769 -32.005 1.00 30.38  ? 219 LEU A N   1 
ATOM   599  C CA  . LEU A 1 96  ? -13.008 13.817 -32.306 1.00 29.60  ? 219 LEU A CA  1 
ATOM   600  C C   . LEU A 1 96  ? -12.133 12.852 -31.489 1.00 29.46  ? 219 LEU A C   1 
ATOM   601  O O   . LEU A 1 96  ? -11.018 12.549 -31.901 1.00 29.10  ? 219 LEU A O   1 
ATOM   602  C CB  . LEU A 1 96  ? -12.479 15.242 -32.186 1.00 29.43  ? 219 LEU A CB  1 
ATOM   603  C CG  . LEU A 1 96  ? -12.848 16.262 -33.272 1.00 29.42  ? 219 LEU A CG  1 
ATOM   604  C CD1 . LEU A 1 96  ? -12.399 17.642 -32.820 1.00 29.29  ? 219 LEU A CD1 1 
ATOM   605  C CD2 . LEU A 1 96  ? -12.251 15.924 -34.629 1.00 29.45  ? 219 LEU A CD2 1 
ATOM   606  N N   . TYR A 1 97  ? -12.634 12.381 -30.342 1.00 29.26  ? 220 TYR A N   1 
ATOM   607  C CA  . TYR A 1 97  ? -11.828 11.595 -29.387 1.00 29.08  ? 220 TYR A CA  1 
ATOM   608  C C   . TYR A 1 97  ? -11.075 10.435 -30.034 1.00 29.42  ? 220 TYR A C   1 
ATOM   609  O O   . TYR A 1 97  ? -9.853  10.335 -29.898 1.00 28.90  ? 220 TYR A O   1 
ATOM   610  C CB  . TYR A 1 97  ? -12.694 11.098 -28.213 1.00 28.94  ? 220 TYR A CB  1 
ATOM   611  C CG  . TYR A 1 97  ? -11.968 10.171 -27.246 1.00 28.56  ? 220 TYR A CG  1 
ATOM   612  C CD1 . TYR A 1 97  ? -11.239 10.677 -26.156 1.00 27.64  ? 220 TYR A CD1 1 
ATOM   613  C CD2 . TYR A 1 97  ? -11.994 8.792  -27.436 1.00 27.67  ? 220 TYR A CD2 1 
ATOM   614  C CE1 . TYR A 1 97  ? -10.565 9.812  -25.276 1.00 26.76  ? 220 TYR A CE1 1 
ATOM   615  C CE2 . TYR A 1 97  ? -11.320 7.935  -26.576 1.00 28.59  ? 220 TYR A CE2 1 
ATOM   616  C CZ  . TYR A 1 97  ? -10.612 8.449  -25.506 1.00 27.41  ? 220 TYR A CZ  1 
ATOM   617  O OH  . TYR A 1 97  ? -9.974  7.566  -24.676 1.00 28.80  ? 220 TYR A OH  1 
ATOM   618  N N   . LYS A 1 98  ? -11.799 9.573  -30.752 1.00 29.97  ? 221 LYS A N   1 
ATOM   619  C CA  . LYS A 1 98  ? -11.191 8.398  -31.406 1.00 31.14  ? 221 LYS A CA  1 
ATOM   620  C C   . LYS A 1 98  ? -10.015 8.769  -32.307 1.00 31.69  ? 221 LYS A C   1 
ATOM   621  O O   . LYS A 1 98  ? -9.070  7.988  -32.453 1.00 31.86  ? 221 LYS A O   1 
ATOM   622  C CB  . LYS A 1 98  ? -12.243 7.581  -32.181 1.00 31.31  ? 221 LYS A CB  1 
ATOM   623  N N   . TYR A 1 99  ? -10.047 9.973  -32.874 1.00 32.15  ? 222 TYR A N   1 
ATOM   624  C CA  . TYR A 1 99  ? -8.995  10.397 -33.789 1.00 33.02  ? 222 TYR A CA  1 
ATOM   625  C C   . TYR A 1 99  ? -7.879  11.198 -33.137 1.00 32.14  ? 222 TYR A C   1 
ATOM   626  O O   . TYR A 1 99  ? -6.722  11.081 -33.536 1.00 32.21  ? 222 TYR A O   1 
ATOM   627  C CB  . TYR A 1 99  ? -9.583  11.195 -34.962 1.00 35.30  ? 222 TYR A CB  1 
ATOM   628  C CG  . TYR A 1 99  ? -10.692 10.467 -35.668 1.00 37.93  ? 222 TYR A CG  1 
ATOM   629  C CD1 . TYR A 1 99  ? -10.419 9.380  -36.513 1.00 40.02  ? 222 TYR A CD1 1 
ATOM   630  C CD2 . TYR A 1 99  ? -12.021 10.843 -35.478 1.00 40.52  ? 222 TYR A CD2 1 
ATOM   631  C CE1 . TYR A 1 99  ? -11.454 8.692  -37.162 1.00 41.49  ? 222 TYR A CE1 1 
ATOM   632  C CE2 . TYR A 1 99  ? -13.062 10.165 -36.124 1.00 41.90  ? 222 TYR A CE2 1 
ATOM   633  C CZ  . TYR A 1 99  ? -12.771 9.099  -36.962 1.00 40.58  ? 222 TYR A CZ  1 
ATOM   634  O OH  . TYR A 1 99  ? -13.807 8.435  -37.596 1.00 42.62  ? 222 TYR A OH  1 
ATOM   635  N N   . VAL A 1 100 ? -8.221  12.017 -32.144 1.00 30.90  ? 223 VAL A N   1 
ATOM   636  C CA  . VAL A 1 100 ? -7.242  12.947 -31.577 1.00 29.15  ? 223 VAL A CA  1 
ATOM   637  C C   . VAL A 1 100 ? -6.672  12.583 -30.197 1.00 28.30  ? 223 VAL A C   1 
ATOM   638  O O   . VAL A 1 100 ? -5.714  13.212 -29.743 1.00 27.47  ? 223 VAL A O   1 
ATOM   639  C CB  . VAL A 1 100 ? -7.736  14.418 -31.617 1.00 29.00  ? 223 VAL A CB  1 
ATOM   640  C CG1 . VAL A 1 100 ? -8.165  14.801 -33.052 1.00 28.01  ? 223 VAL A CG1 1 
ATOM   641  C CG2 . VAL A 1 100 ? -8.850  14.665 -30.606 1.00 28.53  ? 223 VAL A CG2 1 
ATOM   642  N N   . PHE A 1 101 ? -7.255  11.583 -29.536 1.00 27.59  ? 224 PHE A N   1 
ATOM   643  C CA  . PHE A 1 101 ? -6.680  11.099 -28.275 1.00 26.97  ? 224 PHE A CA  1 
ATOM   644  C C   . PHE A 1 101 ? -5.571  10.082 -28.534 1.00 27.11  ? 224 PHE A C   1 
ATOM   645  O O   . PHE A 1 101 ? -5.760  9.120  -29.285 1.00 26.40  ? 224 PHE A O   1 
ATOM   646  C CB  . PHE A 1 101 ? -7.741  10.521 -27.325 1.00 26.60  ? 224 PHE A CB  1 
ATOM   647  C CG  . PHE A 1 101 ? -7.190  10.154 -25.964 1.00 25.39  ? 224 PHE A CG  1 
ATOM   648  C CD1 . PHE A 1 101 ? -7.151  11.084 -24.936 1.00 25.09  ? 224 PHE A CD1 1 
ATOM   649  C CD2 . PHE A 1 101 ? -6.690  8.881  -25.725 1.00 25.48  ? 224 PHE A CD2 1 
ATOM   650  C CE1 . PHE A 1 101 ? -6.622  10.743 -23.686 1.00 24.85  ? 224 PHE A CE1 1 
ATOM   651  C CE2 . PHE A 1 101 ? -6.150  8.538  -24.477 1.00 25.38  ? 224 PHE A CE2 1 
ATOM   652  C CZ  . PHE A 1 101 ? -6.126  9.460  -23.466 1.00 24.56  ? 224 PHE A CZ  1 
ATOM   653  N N   . CYS A 1 102 ? -4.423  10.308 -27.897 1.00 27.96  ? 225 CYS A N   1 
ATOM   654  C CA  . CYS A 1 102 ? -3.235  9.466  -28.053 1.00 28.81  ? 225 CYS A CA  1 
ATOM   655  C C   . CYS A 1 102 ? -3.001  9.078  -29.525 1.00 29.98  ? 225 CYS A C   1 
ATOM   656  O O   . CYS A 1 102 ? -3.072  7.900  -29.873 1.00 29.78  ? 225 CYS A O   1 
ATOM   657  C CB  . CYS A 1 102 ? -3.334  8.214  -27.166 1.00 28.54  ? 225 CYS A CB  1 
ATOM   658  S SG  . CYS A 1 102 ? -1.775  7.279  -27.058 1.00 28.30  ? 225 CYS A SG  1 
ATOM   659  N N   . PRO A 1 103 ? -2.753  10.074 -30.400 1.00 31.34  ? 226 PRO A N   1 
ATOM   660  C CA  . PRO A 1 103 ? -2.628  9.719  -31.822 1.00 32.77  ? 226 PRO A CA  1 
ATOM   661  C C   . PRO A 1 103 ? -1.324  8.973  -32.103 1.00 33.67  ? 226 PRO A C   1 
ATOM   662  O O   . PRO A 1 103 ? -0.293  9.289  -31.520 1.00 33.87  ? 226 PRO A O   1 
ATOM   663  C CB  . PRO A 1 103 ? -2.637  11.082 -32.532 1.00 32.43  ? 226 PRO A CB  1 
ATOM   664  C CG  . PRO A 1 103 ? -3.053  12.095 -31.459 1.00 32.77  ? 226 PRO A CG  1 
ATOM   665  C CD  . PRO A 1 103 ? -2.575  11.520 -30.179 1.00 31.03  ? 226 PRO A CD  1 
ATOM   666  N N   . GLU A 1 104 ? -1.396  7.977  -32.977 1.00 35.66  ? 227 GLU A N   1 
ATOM   667  C CA  . GLU A 1 104 ? -0.234  7.194  -33.410 1.00 37.32  ? 227 GLU A CA  1 
ATOM   668  C C   . GLU A 1 104 ? 0.920   8.032  -33.980 1.00 37.35  ? 227 GLU A C   1 
ATOM   669  O O   . GLU A 1 104 ? 2.075   7.596  -33.944 1.00 37.98  ? 227 GLU A O   1 
ATOM   670  C CB  . GLU A 1 104 ? -0.666  6.124  -34.414 1.00 38.23  ? 227 GLU A CB  1 
ATOM   671  C CG  . GLU A 1 104 ? -1.599  5.053  -33.812 1.00 41.88  ? 227 GLU A CG  1 
ATOM   672  C CD  . GLU A 1 104 ? -1.444  3.670  -34.442 1.00 46.29  ? 227 GLU A CD  1 
ATOM   673  O OE1 . GLU A 1 104 ? -0.340  3.337  -34.936 1.00 49.13  ? 227 GLU A OE1 1 
ATOM   674  O OE2 . GLU A 1 104 ? -2.428  2.896  -34.426 1.00 48.65  ? 227 GLU A OE2 1 
ATOM   675  N N   . THR A 1 105 ? 0.620   9.234  -34.474 1.00 37.28  ? 228 THR A N   1 
ATOM   676  C CA  . THR A 1 105 ? 1.650   10.114 -35.067 1.00 37.16  ? 228 THR A CA  1 
ATOM   677  C C   . THR A 1 105 ? 2.406   10.914 -34.015 1.00 36.55  ? 228 THR A C   1 
ATOM   678  O O   . THR A 1 105 ? 3.286   11.721 -34.341 1.00 37.14  ? 228 THR A O   1 
ATOM   679  C CB  . THR A 1 105 ? 1.061   11.098 -36.130 1.00 37.57  ? 228 THR A CB  1 
ATOM   680  O OG1 . THR A 1 105 ? 0.441   12.217 -35.479 1.00 38.79  ? 228 THR A OG1 1 
ATOM   681  C CG2 . THR A 1 105 ? 0.042   10.392 -37.036 1.00 38.06  ? 228 THR A CG2 1 
ATOM   682  N N   . THR A 1 106 ? 2.058   10.695 -32.747 1.00 35.35  ? 229 THR A N   1 
ATOM   683  C CA  . THR A 1 106 ? 2.688   11.403 -31.645 1.00 33.34  ? 229 THR A CA  1 
ATOM   684  C C   . THR A 1 106 ? 3.448   10.431 -30.762 1.00 32.20  ? 229 THR A C   1 
ATOM   685  O O   . THR A 1 106 ? 3.363   9.213  -30.935 1.00 31.82  ? 229 THR A O   1 
ATOM   686  C CB  . THR A 1 106 ? 1.644   12.163 -30.758 1.00 33.82  ? 229 THR A CB  1 
ATOM   687  O OG1 . THR A 1 106 ? 0.898   11.219 -29.964 1.00 32.84  ? 229 THR A OG1 1 
ATOM   688  C CG2 . THR A 1 106 ? 0.691   12.996 -31.611 1.00 33.15  ? 229 THR A CG2 1 
ATOM   689  N N   . ASP A 1 107 ? 4.166   10.997 -29.799 1.00 30.99  ? 230 ASP A N   1 
ATOM   690  C CA  . ASP A 1 107 ? 4.862   10.241 -28.767 1.00 30.61  ? 230 ASP A CA  1 
ATOM   691  C C   . ASP A 1 107 ? 4.035   10.122 -27.474 1.00 29.26  ? 230 ASP A C   1 
ATOM   692  O O   . ASP A 1 107 ? 4.612   9.938  -26.399 1.00 28.17  ? 230 ASP A O   1 
ATOM   693  C CB  . ASP A 1 107 ? 6.198   10.920 -28.455 1.00 30.54  ? 230 ASP A CB  1 
ATOM   694  C CG  . ASP A 1 107 ? 7.099   11.037 -29.682 1.00 35.22  ? 230 ASP A CG  1 
ATOM   695  O OD1 . ASP A 1 107 ? 7.297   10.018 -30.415 1.00 36.51  ? 230 ASP A OD1 1 
ATOM   696  O OD2 . ASP A 1 107 ? 7.604   12.165 -29.915 1.00 39.96  ? 230 ASP A OD2 1 
ATOM   697  N N   . ASP A 1 108 ? 2.706   10.254 -27.584 1.00 28.08  ? 231 ASP A N   1 
ATOM   698  C CA  . ASP A 1 108 ? 1.814   10.187 -26.410 1.00 27.07  ? 231 ASP A CA  1 
ATOM   699  C C   . ASP A 1 108 ? 1.910   8.822  -25.722 1.00 26.54  ? 231 ASP A C   1 
ATOM   700  O O   . ASP A 1 108 ? 2.103   8.753  -24.511 1.00 25.76  ? 231 ASP A O   1 
ATOM   701  C CB  . ASP A 1 108 ? 0.359   10.485 -26.786 1.00 26.90  ? 231 ASP A CB  1 
ATOM   702  C CG  . ASP A 1 108 ? 0.078   11.972 -26.943 1.00 26.91  ? 231 ASP A CG  1 
ATOM   703  O OD1 . ASP A 1 108 ? 1.033   12.769 -26.889 1.00 26.30  ? 231 ASP A OD1 1 
ATOM   704  O OD2 . ASP A 1 108 ? -1.109  12.346 -27.116 1.00 26.05  ? 231 ASP A OD2 1 
ATOM   705  N N   . GLU A 1 109 ? 1.785   7.744  -26.500 1.00 26.22  ? 232 GLU A N   1 
ATOM   706  C CA  . GLU A 1 109 ? 1.951   6.396  -25.964 1.00 26.49  ? 232 GLU A CA  1 
ATOM   707  C C   . GLU A 1 109 ? 3.324   6.179  -25.320 1.00 26.47  ? 232 GLU A C   1 
ATOM   708  O O   . GLU A 1 109 ? 3.412   5.733  -24.187 1.00 26.13  ? 232 GLU A O   1 
ATOM   709  C CB  . GLU A 1 109 ? 1.689   5.338  -27.026 1.00 26.51  ? 232 GLU A CB  1 
ATOM   710  C CG  . GLU A 1 109 ? 1.665   3.940  -26.462 1.00 28.05  ? 232 GLU A CG  1 
ATOM   711  C CD  . GLU A 1 109 ? 1.275   2.894  -27.478 1.00 32.85  ? 232 GLU A CD  1 
ATOM   712  O OE1 . GLU A 1 109 ? 1.244   3.199  -28.693 1.00 35.70  ? 232 GLU A OE1 1 
ATOM   713  O OE2 . GLU A 1 109 ? 0.992   1.756  -27.062 1.00 33.55  ? 232 GLU A OE2 1 
ATOM   714  N N   . LYS A 1 110 ? 4.389   6.503  -26.044 1.00 26.61  ? 233 LYS A N   1 
ATOM   715  C CA  . LYS A 1 110 ? 5.733   6.474  -25.491 1.00 27.18  ? 233 LYS A CA  1 
ATOM   716  C C   . LYS A 1 110 ? 5.826   7.199  -24.129 1.00 25.65  ? 233 LYS A C   1 
ATOM   717  O O   . LYS A 1 110 ? 6.399   6.657  -23.174 1.00 24.97  ? 233 LYS A O   1 
ATOM   718  C CB  . LYS A 1 110 ? 6.749   7.059  -26.485 1.00 27.05  ? 233 LYS A CB  1 
ATOM   719  C CG  . LYS A 1 110 ? 8.095   7.414  -25.820 1.00 29.41  ? 233 LYS A CG  1 
ATOM   720  C CD  . LYS A 1 110 ? 9.229   7.794  -26.800 1.00 31.26  ? 233 LYS A CD  1 
ATOM   721  C CE  . LYS A 1 110 ? 9.256   9.290  -27.154 1.00 36.95  ? 233 LYS A CE  1 
ATOM   722  N NZ  . LYS A 1 110 ? 9.226   10.260 -25.995 1.00 39.34  ? 233 LYS A NZ  1 
ATOM   723  N N   . LYS A 1 111 ? 5.272   8.412  -24.053 1.00 24.31  ? 234 LYS A N   1 
ATOM   724  C CA  . LYS A 1 111 ? 5.269   9.203  -22.825 1.00 23.87  ? 234 LYS A CA  1 
ATOM   725  C C   . LYS A 1 111 ? 4.449   8.555  -21.698 1.00 22.19  ? 234 LYS A C   1 
ATOM   726  O O   . LYS A 1 111 ? 4.834   8.622  -20.532 1.00 21.21  ? 234 LYS A O   1 
ATOM   727  C CB  . LYS A 1 111 ? 4.744   10.625 -23.084 1.00 24.67  ? 234 LYS A CB  1 
ATOM   728  C CG  . LYS A 1 111 ? 5.615   11.482 -24.000 1.00 28.43  ? 234 LYS A CG  1 
ATOM   729  C CD  . LYS A 1 111 ? 7.050   11.618 -23.479 1.00 32.31  ? 234 LYS A CD  1 
ATOM   730  C CE  . LYS A 1 111 ? 7.311   12.952 -22.799 1.00 36.01  ? 234 LYS A CE  1 
ATOM   731  N NZ  . LYS A 1 111 ? 8.798   13.164 -22.747 1.00 37.64  ? 234 LYS A NZ  1 
ATOM   732  N N   . ASP A 1 112 ? 3.312   7.956  -22.053 1.00 21.26  ? 235 ASP A N   1 
ATOM   733  C CA  . ASP A 1 112 ? 2.476   7.211  -21.101 1.00 20.06  ? 235 ASP A CA  1 
ATOM   734  C C   . ASP A 1 112 ? 3.245   6.059  -20.443 1.00 19.56  ? 235 ASP A C   1 
ATOM   735  O O   . ASP A 1 112 ? 3.170   5.845  -19.229 1.00 18.66  ? 235 ASP A O   1 
ATOM   736  C CB  . ASP A 1 112 ? 1.262   6.617  -21.816 1.00 19.33  ? 235 ASP A CB  1 
ATOM   737  C CG  . ASP A 1 112 ? 0.168   7.625  -22.066 1.00 19.37  ? 235 ASP A CG  1 
ATOM   738  O OD1 . ASP A 1 112 ? 0.116   8.677  -21.383 1.00 20.53  ? 235 ASP A OD1 1 
ATOM   739  O OD2 . ASP A 1 112 ? -0.670  7.351  -22.953 1.00 20.76  ? 235 ASP A OD2 1 
ATOM   740  N N   . LEU A 1 113 ? 3.956   5.298  -21.266 1.00 19.55  ? 236 LEU A N   1 
ATOM   741  C CA  . LEU A 1 113 ? 4.707   4.144  -20.783 1.00 19.28  ? 236 LEU A CA  1 
ATOM   742  C C   . LEU A 1 113 ? 5.860   4.568  -19.897 1.00 18.67  ? 236 LEU A C   1 
ATOM   743  O O   . LEU A 1 113 ? 6.115   3.942  -18.881 1.00 17.41  ? 236 LEU A O   1 
ATOM   744  C CB  . LEU A 1 113 ? 5.225   3.319  -21.946 1.00 19.89  ? 236 LEU A CB  1 
ATOM   745  C CG  . LEU A 1 113 ? 4.128   2.677  -22.795 1.00 22.63  ? 236 LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 113 ? 4.674   2.253  -24.159 1.00 26.58  ? 236 LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 113 ? 3.513   1.476  -22.065 1.00 26.03  ? 236 LEU A CD2 1 
ATOM   748  N N   . ALA A 1 114 ? 6.548   5.640  -20.278 1.00 18.27  ? 237 ALA A N   1 
ATOM   749  C CA  . ALA A 1 114 ? 7.689   6.098  -19.501 1.00 18.06  ? 237 ALA A CA  1 
ATOM   750  C C   . ALA A 1 114 ? 7.244   6.614  -18.125 1.00 18.11  ? 237 ALA A C   1 
ATOM   751  O O   . ALA A 1 114 ? 7.897   6.325  -17.121 1.00 17.38  ? 237 ALA A O   1 
ATOM   752  C CB  . ALA A 1 114 ? 8.459   7.175  -20.271 1.00 18.89  ? 237 ALA A CB  1 
ATOM   753  N N   . ILE A 1 115 ? 6.138   7.374  -18.075 1.00 17.85  ? 238 ILE A N   1 
ATOM   754  C CA  . ILE A 1 115 ? 5.658   7.877  -16.788 1.00 17.12  ? 238 ILE A CA  1 
ATOM   755  C C   . ILE A 1 115 ? 5.094   6.735  -15.940 1.00 17.42  ? 238 ILE A C   1 
ATOM   756  O O   . ILE A 1 115 ? 5.278   6.701  -14.713 1.00 17.41  ? 238 ILE A O   1 
ATOM   757  C CB  . ILE A 1 115 ? 4.687   9.091  -16.924 1.00 17.07  ? 238 ILE A CB  1 
ATOM   758  C CG1 . ILE A 1 115 ? 4.522   9.826  -15.583 1.00 16.86  ? 238 ILE A CG1 1 
ATOM   759  C CG2 . ILE A 1 115 ? 3.335   8.695  -17.514 1.00 17.61  ? 238 ILE A CG2 1 
ATOM   760  C CD1 . ILE A 1 115 ? 5.860   10.395 -15.011 1.00 18.83  ? 238 ILE A CD1 1 
ATOM   761  N N   . GLN A 1 116 ? 4.435   5.784  -16.597 1.00 16.94  ? 239 GLN A N   1 
ATOM   762  C CA  . GLN A 1 116 ? 3.922   4.616  -15.890 1.00 17.55  ? 239 GLN A CA  1 
ATOM   763  C C   . GLN A 1 116 ? 5.048   3.802  -15.259 1.00 17.64  ? 239 GLN A C   1 
ATOM   764  O O   . GLN A 1 116 ? 4.965   3.407  -14.091 1.00 17.44  ? 239 GLN A O   1 
ATOM   765  C CB  . GLN A 1 116 ? 3.117   3.733  -16.819 1.00 17.73  ? 239 GLN A CB  1 
ATOM   766  C CG  . GLN A 1 116 ? 2.527   2.502  -16.111 1.00 20.18  ? 239 GLN A CG  1 
ATOM   767  C CD  . GLN A 1 116 ? 1.739   1.663  -17.051 1.00 23.22  ? 239 GLN A CD  1 
ATOM   768  O OE1 . GLN A 1 116 ? 2.219   1.272  -18.110 1.00 25.28  ? 239 GLN A OE1 1 
ATOM   769  N NE2 . GLN A 1 116 ? 0.514   1.397  -16.692 1.00 26.14  ? 239 GLN A NE2 1 
ATOM   770  N N   . LYS A 1 117 ? 6.105   3.572  -16.035 1.00 17.19  ? 240 LYS A N   1 
ATOM   771  C CA  . LYS A 1 117 ? 7.286   2.847  -15.551 1.00 17.52  ? 240 LYS A CA  1 
ATOM   772  C C   . LYS A 1 117 ? 8.012   3.598  -14.440 1.00 16.69  ? 240 LYS A C   1 
ATOM   773  O O   . LYS A 1 117 ? 8.462   3.006  -13.465 1.00 16.77  ? 240 LYS A O   1 
ATOM   774  C CB  . LYS A 1 117 ? 8.239   2.560  -16.734 1.00 17.58  ? 240 LYS A CB  1 
ATOM   775  N N   . ARG A 1 118 ? 8.122   4.912  -14.597 1.00 16.79  ? 241 ARG A N   1 
ATOM   776  C CA  . ARG A 1 118 ? 8.692   5.775  -13.573 1.00 16.80  ? 241 ARG A CA  1 
ATOM   777  C C   . ARG A 1 118 ? 7.890   5.757  -12.261 1.00 16.25  ? 241 ARG A C   1 
ATOM   778  O O   . ARG A 1 118 ? 8.455   5.647  -11.161 1.00 15.62  ? 241 ARG A O   1 
ATOM   779  C CB  . ARG A 1 118 ? 8.807   7.205  -14.106 1.00 17.36  ? 241 ARG A CB  1 
ATOM   780  C CG  . ARG A 1 118 ? 9.250   8.218  -13.059 1.00 18.36  ? 241 ARG A CG  1 
ATOM   781  C CD  . ARG A 1 118 ? 10.717  8.096  -12.765 1.00 21.06  ? 241 ARG A CD  1 
ATOM   782  N NE  . ARG A 1 118 ? 11.153  9.238  -11.956 1.00 21.59  ? 241 ARG A NE  1 
ATOM   783  C CZ  . ARG A 1 118 ? 12.283  9.273  -11.266 1.00 22.77  ? 241 ARG A CZ  1 
ATOM   784  N NH1 . ARG A 1 118 ? 13.117  8.226  -11.279 1.00 21.34  ? 241 ARG A NH1 1 
ATOM   785  N NH2 . ARG A 1 118 ? 12.575  10.352 -10.545 1.00 21.69  ? 241 ARG A NH2 1 
ATOM   786  N N   . ILE A 1 119 ? 6.576   5.871  -12.368 1.00 16.14  ? 242 ILE A N   1 
ATOM   787  C CA  . ILE A 1 119 ? 5.738   5.850  -11.166 1.00 15.79  ? 242 ILE A CA  1 
ATOM   788  C C   . ILE A 1 119 ? 5.861   4.486  -10.495 1.00 15.99  ? 242 ILE A C   1 
ATOM   789  O O   . ILE A 1 119 ? 5.973   4.411  -9.281  1.00 16.27  ? 242 ILE A O   1 
ATOM   790  C CB  . ILE A 1 119 ? 4.250   6.237  -11.462 1.00 15.99  ? 242 ILE A CB  1 
ATOM   791  C CG1 . ILE A 1 119 ? 4.138   7.747  -11.686 1.00 14.98  ? 242 ILE A CG1 1 
ATOM   792  C CG2 . ILE A 1 119 ? 3.321   5.826  -10.303 1.00 12.35  ? 242 ILE A CG2 1 
ATOM   793  C CD1 . ILE A 1 119 ? 2.806   8.169  -12.320 1.00 15.63  ? 242 ILE A CD1 1 
ATOM   794  N N   . ARG A 1 120 ? 5.855   3.424  -11.293 1.00 15.77  ? 243 ARG A N   1 
ATOM   795  C CA  . ARG A 1 120 ? 6.059   2.058  -10.782 1.00 16.86  ? 243 ARG A CA  1 
ATOM   796  C C   . ARG A 1 120 ? 7.399   1.958  -10.037 1.00 16.30  ? 243 ARG A C   1 
ATOM   797  O O   . ARG A 1 120 ? 7.445   1.447  -8.938  1.00 16.35  ? 243 ARG A O   1 
ATOM   798  C CB  . ARG A 1 120 ? 6.023   1.047  -11.937 1.00 15.92  ? 243 ARG A CB  1 
ATOM   799  C CG  . ARG A 1 120 ? 6.121   -0.436 -11.538 1.00 17.90  ? 243 ARG A CG  1 
ATOM   800  C CD  . ARG A 1 120 ? 6.117   -1.335 -12.797 1.00 19.09  ? 243 ARG A CD  1 
ATOM   801  N NE  . ARG A 1 120 ? 4.795   -1.378 -13.412 1.00 22.48  ? 243 ARG A NE  1 
ATOM   802  C CZ  . ARG A 1 120 ? 4.526   -1.001 -14.666 1.00 25.70  ? 243 ARG A CZ  1 
ATOM   803  N NH1 . ARG A 1 120 ? 5.493   -0.576 -15.492 1.00 23.73  ? 243 ARG A NH1 1 
ATOM   804  N NH2 . ARG A 1 120 ? 3.273   -1.070 -15.102 1.00 25.08  ? 243 ARG A NH2 1 
ATOM   805  N N   . ALA A 1 121 ? 8.478   2.462  -10.645 1.00 16.16  ? 244 ALA A N   1 
ATOM   806  C CA  . ALA A 1 121 ? 9.818   2.461  -10.014 1.00 16.04  ? 244 ALA A CA  1 
ATOM   807  C C   . ALA A 1 121 ? 9.838   3.114  -8.628  1.00 16.08  ? 244 ALA A C   1 
ATOM   808  O O   . ALA A 1 121 ? 10.636  2.737  -7.770  1.00 16.02  ? 244 ALA A O   1 
ATOM   809  C CB  . ALA A 1 121 ? 10.846  3.150  -10.938 1.00 15.47  ? 244 ALA A CB  1 
ATOM   810  N N   . LEU A 1 122 ? 8.944   4.080  -8.422  1.00 15.57  ? 245 LEU A N   1 
ATOM   811  C CA  . LEU A 1 122 ? 8.889   4.874  -7.205  1.00 15.95  ? 245 LEU A CA  1 
ATOM   812  C C   . LEU A 1 122 ? 7.800   4.391  -6.232  1.00 16.70  ? 245 LEU A C   1 
ATOM   813  O O   . LEU A 1 122 ? 7.402   5.126  -5.332  1.00 17.02  ? 245 LEU A O   1 
ATOM   814  C CB  . LEU A 1 122 ? 8.654   6.370  -7.561  1.00 15.45  ? 245 LEU A CB  1 
ATOM   815  C CG  . LEU A 1 122 ? 9.743   7.120  -8.326  1.00 15.60  ? 245 LEU A CG  1 
ATOM   816  C CD1 . LEU A 1 122 ? 9.269   8.504  -8.899  1.00 14.69  ? 245 LEU A CD1 1 
ATOM   817  C CD2 . LEU A 1 122 ? 11.031  7.241  -7.482  1.00 14.14  ? 245 LEU A CD2 1 
ATOM   818  N N   . ARG A 1 123 ? 7.310   3.166  -6.423  1.00 17.45  ? 246 ARG A N   1 
ATOM   819  C CA  . ARG A 1 123 ? 6.309   2.546  -5.528  1.00 17.16  ? 246 ARG A CA  1 
ATOM   820  C C   . ARG A 1 123 ? 6.723   2.575  -4.047  1.00 17.34  ? 246 ARG A C   1 
ATOM   821  O O   . ARG A 1 123 ? 5.857   2.503  -3.167  1.00 17.02  ? 246 ARG A O   1 
ATOM   822  C CB  . ARG A 1 123 ? 6.038   1.085  -5.956  1.00 17.25  ? 246 ARG A CB  1 
ATOM   823  C CG  . ARG A 1 123 ? 7.307   0.159  -5.923  1.00 16.41  ? 246 ARG A CG  1 
ATOM   824  C CD  . ARG A 1 123 ? 7.021   -1.199 -6.567  1.00 17.00  ? 246 ARG A CD  1 
ATOM   825  N NE  . ARG A 1 123 ? 8.213   -2.047 -6.766  1.00 18.48  ? 246 ARG A NE  1 
ATOM   826  C CZ  . ARG A 1 123 ? 9.021   -1.958 -7.813  1.00 17.39  ? 246 ARG A CZ  1 
ATOM   827  N NH1 . ARG A 1 123 ? 8.789   -1.036 -8.746  1.00 19.23  ? 246 ARG A NH1 1 
ATOM   828  N NH2 . ARG A 1 123 ? 10.057  -2.775 -7.943  1.00 17.50  ? 246 ARG A NH2 1 
ATOM   829  N N   . TRP A 1 124 ? 8.036   2.694  -3.782  1.00 16.56  ? 247 TRP A N   1 
ATOM   830  C CA  . TRP A 1 124 ? 8.577   2.632  -2.411  1.00 16.62  ? 247 TRP A CA  1 
ATOM   831  C C   . TRP A 1 124 ? 8.506   3.966  -1.643  1.00 16.42  ? 247 TRP A C   1 
ATOM   832  O O   . TRP A 1 124 ? 8.692   4.007  -0.423  1.00 17.46  ? 247 TRP A O   1 
ATOM   833  C CB  . TRP A 1 124 ? 10.046  2.169  -2.451  1.00 16.48  ? 247 TRP A CB  1 
ATOM   834  C CG  . TRP A 1 124 ? 10.893  3.008  -3.368  1.00 16.51  ? 247 TRP A CG  1 
ATOM   835  C CD1 . TRP A 1 124 ? 11.153  2.767  -4.690  1.00 15.53  ? 247 TRP A CD1 1 
ATOM   836  C CD2 . TRP A 1 124 ? 11.550  4.245  -3.048  1.00 16.47  ? 247 TRP A CD2 1 
ATOM   837  N NE1 . TRP A 1 124 ? 11.934  3.765  -5.203  1.00 16.87  ? 247 TRP A NE1 1 
ATOM   838  C CE2 . TRP A 1 124 ? 12.201  4.680  -4.219  1.00 15.43  ? 247 TRP A CE2 1 
ATOM   839  C CE3 . TRP A 1 124 ? 11.678  5.011  -1.871  1.00 16.04  ? 247 TRP A CE3 1 
ATOM   840  C CZ2 . TRP A 1 124 ? 12.967  5.863  -4.263  1.00 17.31  ? 247 TRP A CZ2 1 
ATOM   841  C CZ3 . TRP A 1 124 ? 12.450  6.193  -1.914  1.00 16.63  ? 247 TRP A CZ3 1 
ATOM   842  C CH2 . TRP A 1 124 ? 13.082  6.597  -3.099  1.00 16.12  ? 247 TRP A CH2 1 
ATOM   843  N N   . VAL A 1 125 ? 8.278   5.053  -2.363  1.00 16.06  ? 248 VAL A N   1 
ATOM   844  C CA  . VAL A 1 125 ? 8.252   6.401  -1.773  1.00 15.44  ? 248 VAL A CA  1 
ATOM   845  C C   . VAL A 1 125 ? 7.063   6.523  -0.843  1.00 15.86  ? 248 VAL A C   1 
ATOM   846  O O   . VAL A 1 125 ? 5.945   6.224  -1.245  1.00 14.78  ? 248 VAL A O   1 
ATOM   847  C CB  . VAL A 1 125 ? 8.152   7.475  -2.892  1.00 14.87  ? 248 VAL A CB  1 
ATOM   848  C CG1 . VAL A 1 125 ? 8.070   8.885  -2.289  1.00 14.83  ? 248 VAL A CG1 1 
ATOM   849  C CG2 . VAL A 1 125 ? 9.369   7.388  -3.795  1.00 13.51  ? 248 VAL A CG2 1 
ATOM   850  N N   . THR A 1 126 ? 7.332   6.942  0.400   1.00 16.93  ? 249 THR A N   1 
ATOM   851  C CA  . THR A 1 126 ? 6.331   7.028  1.444   1.00 17.64  ? 249 THR A CA  1 
ATOM   852  C C   . THR A 1 126 ? 5.762   8.451  1.523   1.00 17.60  ? 249 THR A C   1 
ATOM   853  O O   . THR A 1 126 ? 6.395   9.387  1.047   1.00 17.59  ? 249 THR A O   1 
ATOM   854  C CB  . THR A 1 126 ? 6.923   6.680  2.812   1.00 18.06  ? 249 THR A CB  1 
ATOM   855  O OG1 . THR A 1 126 ? 7.932   7.644  3.150   1.00 19.40  ? 249 THR A OG1 1 
ATOM   856  C CG2 . THR A 1 126 ? 7.532   5.245  2.832   1.00 19.71  ? 249 THR A CG2 1 
ATOM   857  N N   . PRO A 1 127 ? 4.562   8.613  2.131   1.00 18.27  ? 250 PRO A N   1 
ATOM   858  C CA  . PRO A 1 127 ? 4.053   9.960  2.371   1.00 18.59  ? 250 PRO A CA  1 
ATOM   859  C C   . PRO A 1 127 ? 4.954   10.768 3.306   1.00 19.25  ? 250 PRO A C   1 
ATOM   860  O O   . PRO A 1 127 ? 5.023   11.998 3.187   1.00 18.52  ? 250 PRO A O   1 
ATOM   861  C CB  . PRO A 1 127 ? 2.672   9.718  3.014   1.00 18.57  ? 250 PRO A CB  1 
ATOM   862  C CG  . PRO A 1 127 ? 2.690   8.324  3.496   1.00 18.48  ? 250 PRO A CG  1 
ATOM   863  C CD  . PRO A 1 127 ? 3.624   7.571  2.600   1.00 17.80  ? 250 PRO A CD  1 
ATOM   864  N N   . GLN A 1 128 ? 5.628   10.080 4.231   1.00 19.99  ? 251 GLN A N   1 
ATOM   865  C CA  . GLN A 1 128 ? 6.565   10.732 5.166   1.00 20.90  ? 251 GLN A CA  1 
ATOM   866  C C   . GLN A 1 128 ? 7.736   11.355 4.421   1.00 20.59  ? 251 GLN A C   1 
ATOM   867  O O   . GLN A 1 128 ? 8.153   12.468 4.736   1.00 20.57  ? 251 GLN A O   1 
ATOM   868  C CB  . GLN A 1 128 ? 7.074   9.753  6.234   1.00 20.81  ? 251 GLN A CB  1 
ATOM   869  C CG  . GLN A 1 128 ? 5.995   9.289  7.255   1.00 23.26  ? 251 GLN A CG  1 
ATOM   870  C CD  . GLN A 1 128 ? 5.024   8.221  6.722   1.00 26.81  ? 251 GLN A CD  1 
ATOM   871  O OE1 . GLN A 1 128 ? 5.300   7.530  5.738   1.00 27.70  ? 251 GLN A OE1 1 
ATOM   872  N NE2 . GLN A 1 128 ? 3.879   8.077  7.394   1.00 27.76  ? 251 GLN A NE2 1 
ATOM   873  N N   . MET A 1 129 ? 8.246   10.650 3.415   1.00 20.41  ? 252 MET A N   1 
ATOM   874  C CA  . MET A 1 129 ? 9.310   11.194 2.558   1.00 19.79  ? 252 MET A CA  1 
ATOM   875  C C   . MET A 1 129 ? 8.884   12.452 1.822   1.00 20.10  ? 252 MET A C   1 
ATOM   876  O O   . MET A 1 129 ? 9.700   13.354 1.590   1.00 20.75  ? 252 MET A O   1 
ATOM   877  C CB  . MET A 1 129 ? 9.738   10.169 1.525   1.00 19.63  ? 252 MET A CB  1 
ATOM   878  C CG  . MET A 1 129 ? 10.679  9.104  2.053   1.00 20.04  ? 252 MET A CG  1 
ATOM   879  S SD  . MET A 1 129 ? 10.837  7.771  0.848   1.00 18.32  ? 252 MET A SD  1 
ATOM   880  C CE  . MET A 1 129 ? 11.625  6.553  1.914   1.00 18.24  ? 252 MET A CE  1 
ATOM   881  N N   . LEU A 1 130 ? 7.616   12.506 1.436   1.00 18.98  ? 253 LEU A N   1 
ATOM   882  C CA  . LEU A 1 130 ? 7.078   13.671 0.738   1.00 18.83  ? 253 LEU A CA  1 
ATOM   883  C C   . LEU A 1 130 ? 6.512   14.715 1.707   1.00 18.91  ? 253 LEU A C   1 
ATOM   884  O O   . LEU A 1 130 ? 5.978   15.743 1.288   1.00 18.73  ? 253 LEU A O   1 
ATOM   885  C CB  . LEU A 1 130 ? 5.993   13.225 -0.248  1.00 18.02  ? 253 LEU A CB  1 
ATOM   886  C CG  . LEU A 1 130 ? 6.558   12.414 -1.410  1.00 18.51  ? 253 LEU A CG  1 
ATOM   887  C CD1 . LEU A 1 130 ? 5.503   11.486 -2.011  1.00 16.59  ? 253 LEU A CD1 1 
ATOM   888  C CD2 . LEU A 1 130 ? 7.135   13.386 -2.439  1.00 19.53  ? 253 LEU A CD2 1 
ATOM   889  N N   . CYS A 1 131 ? 6.622   14.439 3.004   1.00 19.91  ? 254 CYS A N   1 
ATOM   890  C CA  . CYS A 1 131 ? 6.044   15.291 4.051   1.00 20.35  ? 254 CYS A CA  1 
ATOM   891  C C   . CYS A 1 131 ? 4.544   15.558 3.806   1.00 20.61  ? 254 CYS A C   1 
ATOM   892  O O   . CYS A 1 131 ? 4.065   16.698 3.895   1.00 21.64  ? 254 CYS A O   1 
ATOM   893  C CB  . CYS A 1 131 ? 6.820   16.609 4.144   1.00 21.27  ? 254 CYS A CB  1 
ATOM   894  S SG  . CYS A 1 131 ? 8.634   16.411 4.431   1.00 24.73  ? 254 CYS A SG  1 
ATOM   895  N N   . VAL A 1 132 ? 3.803   14.504 3.494   1.00 20.01  ? 255 VAL A N   1 
ATOM   896  C CA  . VAL A 1 132 ? 2.385   14.620 3.194   1.00 19.21  ? 255 VAL A CA  1 
ATOM   897  C C   . VAL A 1 132 ? 1.587   14.821 4.473   1.00 19.95  ? 255 VAL A C   1 
ATOM   898  O O   . VAL A 1 132 ? 1.607   13.957 5.366   1.00 19.87  ? 255 VAL A O   1 
ATOM   899  C CB  . VAL A 1 132 ? 1.873   13.362 2.413   1.00 19.33  ? 255 VAL A CB  1 
ATOM   900  C CG1 . VAL A 1 132 ? 0.346   13.400 2.207   1.00 17.07  ? 255 VAL A CG1 1 
ATOM   901  C CG2 . VAL A 1 132 ? 2.599   13.277 1.074   1.00 17.77  ? 255 VAL A CG2 1 
ATOM   902  N N   . PRO A 1 133 ? 0.861   15.959 4.564   1.00 20.02  ? 256 PRO A N   1 
ATOM   903  C CA  . PRO A 1 133 ? 0.062   16.264 5.751   1.00 20.45  ? 256 PRO A CA  1 
ATOM   904  C C   . PRO A 1 133 ? -1.273  15.508 5.818   1.00 20.73  ? 256 PRO A C   1 
ATOM   905  O O   . PRO A 1 133 ? -2.328  16.125 5.999   1.00 20.30  ? 256 PRO A O   1 
ATOM   906  C CB  . PRO A 1 133 ? -0.168  17.783 5.632   1.00 19.79  ? 256 PRO A CB  1 
ATOM   907  C CG  . PRO A 1 133 ? -0.181  18.038 4.134   1.00 20.20  ? 256 PRO A CG  1 
ATOM   908  C CD  . PRO A 1 133 ? 0.772   17.023 3.541   1.00 19.66  ? 256 PRO A CD  1 
ATOM   909  N N   . VAL A 1 134 ? -1.237  14.191 5.659   1.00 21.59  ? 257 VAL A N   1 
ATOM   910  C CA  . VAL A 1 134 ? -2.444  13.392 5.850   1.00 23.23  ? 257 VAL A CA  1 
ATOM   911  C C   . VAL A 1 134 ? -2.126  12.203 6.747   1.00 24.88  ? 257 VAL A C   1 
ATOM   912  O O   . VAL A 1 134 ? -1.064  11.592 6.630   1.00 24.97  ? 257 VAL A O   1 
ATOM   913  C CB  . VAL A 1 134 ? -3.173  12.936 4.507   1.00 23.32  ? 257 VAL A CB  1 
ATOM   914  C CG1 . VAL A 1 134 ? -3.110  14.016 3.424   1.00 21.61  ? 257 VAL A CG1 1 
ATOM   915  C CG2 . VAL A 1 134 ? -2.682  11.611 3.991   1.00 23.53  ? 257 VAL A CG2 1 
ATOM   916  N N   . ASN A 1 135 ? -3.043  11.889 7.651   1.00 26.24  ? 258 ASN A N   1 
ATOM   917  C CA  . ASN A 1 135 ? -2.846  10.774 8.558   1.00 27.39  ? 258 ASN A CA  1 
ATOM   918  C C   . ASN A 1 135 ? -3.833  9.676  8.226   1.00 28.16  ? 258 ASN A C   1 
ATOM   919  O O   . ASN A 1 135 ? -5.011  9.755  8.549   1.00 27.89  ? 258 ASN A O   1 
ATOM   920  C CB  . ASN A 1 135 ? -2.983  11.229 10.019  1.00 27.85  ? 258 ASN A CB  1 
ATOM   921  C CG  . ASN A 1 135 ? -2.772  10.101 11.011  1.00 28.87  ? 258 ASN A CG  1 
ATOM   922  O OD1 . ASN A 1 135 ? -2.498  8.949  10.642  1.00 28.53  ? 258 ASN A OD1 1 
ATOM   923  N ND2 . ASN A 1 135 ? -2.902  10.431 12.291  1.00 30.88  ? 258 ASN A ND2 1 
ATOM   924  N N   . GLU A 1 136 ? -3.332  8.633  7.584   1.00 29.82  ? 259 GLU A N   1 
ATOM   925  C CA  . GLU A 1 136 ? -4.185  7.577  7.079   1.00 31.21  ? 259 GLU A CA  1 
ATOM   926  C C   . GLU A 1 136 ? -4.666  6.599  8.144   1.00 32.08  ? 259 GLU A C   1 
ATOM   927  O O   . GLU A 1 136 ? -5.409  5.676  7.840   1.00 32.44  ? 259 GLU A O   1 
ATOM   928  C CB  . GLU A 1 136 ? -3.505  6.890  5.899   1.00 31.53  ? 259 GLU A CB  1 
ATOM   929  C CG  . GLU A 1 136 ? -3.341  7.849  4.727   1.00 32.46  ? 259 GLU A CG  1 
ATOM   930  C CD  . GLU A 1 136 ? -2.316  7.373  3.730   1.00 34.99  ? 259 GLU A CD  1 
ATOM   931  O OE1 . GLU A 1 136 ? -2.732  6.765  2.734   1.00 33.58  ? 259 GLU A OE1 1 
ATOM   932  O OE2 . GLU A 1 136 ? -1.099  7.593  3.947   1.00 37.08  ? 259 GLU A OE2 1 
ATOM   933  N N   . ASP A 1 137 ? -4.280  6.832  9.397   1.00 33.27  ? 260 ASP A N   1 
ATOM   934  C CA  . ASP A 1 137 ? -4.793  6.046  10.528  1.00 33.84  ? 260 ASP A CA  1 
ATOM   935  C C   . ASP A 1 137 ? -6.175  6.500  10.986  1.00 33.45  ? 260 ASP A C   1 
ATOM   936  O O   . ASP A 1 137 ? -6.870  5.769  11.682  1.00 34.23  ? 260 ASP A O   1 
ATOM   937  C CB  . ASP A 1 137 ? -3.809  6.073  11.704  1.00 34.85  ? 260 ASP A CB  1 
ATOM   938  C CG  . ASP A 1 137 ? -2.503  5.333  11.406  1.00 36.39  ? 260 ASP A CG  1 
ATOM   939  O OD1 . ASP A 1 137 ? -2.501  4.402  10.578  1.00 37.91  ? 260 ASP A OD1 1 
ATOM   940  O OD2 . ASP A 1 137 ? -1.468  5.696  12.011  1.00 41.12  ? 260 ASP A OD2 1 
ATOM   941  N N   . ILE A 1 138 ? -6.563  7.713  10.605  1.00 32.67  ? 261 ILE A N   1 
ATOM   942  C CA  . ILE A 1 138 ? -7.914  8.210  10.818  1.00 32.06  ? 261 ILE A CA  1 
ATOM   943  C C   . ILE A 1 138 ? -8.763  7.608  9.686   1.00 31.59  ? 261 ILE A C   1 
ATOM   944  O O   . ILE A 1 138 ? -8.485  7.881  8.509   1.00 31.14  ? 261 ILE A O   1 
ATOM   945  C CB  . ILE A 1 138 ? -7.933  9.767  10.765  1.00 32.11  ? 261 ILE A CB  1 
ATOM   946  C CG1 . ILE A 1 138 ? -6.969  10.357 11.801  1.00 33.00  ? 261 ILE A CG1 1 
ATOM   947  C CG2 . ILE A 1 138 ? -9.347  10.327 10.955  1.00 32.46  ? 261 ILE A CG2 1 
ATOM   948  C CD1 . ILE A 1 138 ? -6.679  11.869 11.639  1.00 32.72  ? 261 ILE A CD1 1 
ATOM   949  N N   . PRO A 1 139 ? -9.763  6.754  10.021  1.00 31.03  ? 262 PRO A N   1 
ATOM   950  C CA  . PRO A 1 139 ? -10.584 6.095  8.994   1.00 30.80  ? 262 PRO A CA  1 
ATOM   951  C C   . PRO A 1 139 ? -11.188 7.043  7.948   1.00 30.45  ? 262 PRO A C   1 
ATOM   952  O O   . PRO A 1 139 ? -11.211 6.713  6.762   1.00 29.35  ? 262 PRO A O   1 
ATOM   953  C CB  . PRO A 1 139 ? -11.689 5.417  9.808   1.00 30.76  ? 262 PRO A CB  1 
ATOM   954  C CG  . PRO A 1 139 ? -11.017 5.117  11.120  1.00 31.48  ? 262 PRO A CG  1 
ATOM   955  C CD  . PRO A 1 139 ? -10.162 6.326  11.380  1.00 31.49  ? 262 PRO A CD  1 
ATOM   956  N N   . GLU A 1 140 ? -11.655 8.209  8.380   1.00 30.14  ? 263 GLU A N   1 
ATOM   957  C CA  . GLU A 1 140 ? -12.199 9.183  7.439   1.00 30.89  ? 263 GLU A CA  1 
ATOM   958  C C   . GLU A 1 140 ? -11.134 9.709  6.468   1.00 29.18  ? 263 GLU A C   1 
ATOM   959  O O   . GLU A 1 140 ? -11.434 9.964  5.309   1.00 29.46  ? 263 GLU A O   1 
ATOM   960  C CB  . GLU A 1 140 ? -12.869 10.336 8.178   1.00 30.97  ? 263 GLU A CB  1 
ATOM   961  C CG  . GLU A 1 140 ? -13.801 11.174 7.301   1.00 33.59  ? 263 GLU A CG  1 
ATOM   962  C CD  . GLU A 1 140 ? -14.355 12.391 8.045   1.00 34.03  ? 263 GLU A CD  1 
ATOM   963  O OE1 . GLU A 1 140 ? -14.115 12.521 9.278   1.00 39.39  ? 263 GLU A OE1 1 
ATOM   964  O OE2 . GLU A 1 140 ? -15.023 13.219 7.390   1.00 37.88  ? 263 GLU A OE2 1 
ATOM   965  N N   . VAL A 1 141 ? -9.893  9.849  6.927   1.00 28.30  ? 264 VAL A N   1 
ATOM   966  C CA  . VAL A 1 141 ? -8.799  10.273 6.035   1.00 27.26  ? 264 VAL A CA  1 
ATOM   967  C C   . VAL A 1 141 ? -8.505  9.171  5.025   1.00 27.00  ? 264 VAL A C   1 
ATOM   968  O O   . VAL A 1 141 ? -8.388  9.429  3.822   1.00 26.86  ? 264 VAL A O   1 
ATOM   969  C CB  . VAL A 1 141 ? -7.516  10.667 6.804   1.00 27.46  ? 264 VAL A CB  1 
ATOM   970  C CG1 . VAL A 1 141 ? -6.348  10.907 5.844   1.00 25.98  ? 264 VAL A CG1 1 
ATOM   971  C CG2 . VAL A 1 141 ? -7.768  11.914 7.642   1.00 27.24  ? 264 VAL A CG2 1 
ATOM   972  N N   . SER A 1 142 ? -8.419  7.942  5.520   1.00 26.32  ? 265 SER A N   1 
ATOM   973  C CA  . SER A 1 142 ? -8.193  6.787  4.671   1.00 27.32  ? 265 SER A CA  1 
ATOM   974  C C   . SER A 1 142 ? -9.266  6.717  3.562   1.00 26.40  ? 265 SER A C   1 
ATOM   975  O O   . SER A 1 142 ? -8.934  6.522  2.387   1.00 26.56  ? 265 SER A O   1 
ATOM   976  C CB  . SER A 1 142 ? -8.121  5.500  5.519   1.00 27.72  ? 265 SER A CB  1 
ATOM   977  O OG  . SER A 1 142 ? -8.284  4.346  4.723   1.00 30.28  ? 265 SER A OG  1 
ATOM   978  N N   . ASP A 1 143 ? -10.530 6.923  3.929   1.00 25.47  ? 266 ASP A N   1 
ATOM   979  C CA  . ASP A 1 143 ? -11.611 6.965  2.941   1.00 25.53  ? 266 ASP A CA  1 
ATOM   980  C C   . ASP A 1 143 ? -11.443 8.088  1.903   1.00 24.19  ? 266 ASP A C   1 
ATOM   981  O O   . ASP A 1 143 ? -11.691 7.857  0.725   1.00 24.48  ? 266 ASP A O   1 
ATOM   982  C CB  . ASP A 1 143 ? -12.980 7.064  3.609   1.00 26.52  ? 266 ASP A CB  1 
ATOM   983  C CG  . ASP A 1 143 ? -13.510 5.702  4.090   1.00 30.40  ? 266 ASP A CG  1 
ATOM   984  O OD1 . ASP A 1 143 ? -13.827 4.819  3.246   1.00 35.17  ? 266 ASP A OD1 1 
ATOM   985  O OD2 . ASP A 1 143 ? -13.638 5.536  5.318   1.00 33.17  ? 266 ASP A OD2 1 
ATOM   986  N N   . MET A 1 144 ? -11.002 9.280  2.333   1.00 21.87  ? 267 MET A N   1 
ATOM   987  C CA  . MET A 1 144 ? -10.730 10.378 1.387   1.00 19.98  ? 267 MET A CA  1 
ATOM   988  C C   . MET A 1 144 ? -9.620  10.019 0.385   1.00 18.39  ? 267 MET A C   1 
ATOM   989  O O   . MET A 1 144 ? -9.749  10.283 -0.801  1.00 18.13  ? 267 MET A O   1 
ATOM   990  C CB  . MET A 1 144 ? -10.433 11.697 2.126   1.00 18.98  ? 267 MET A CB  1 
ATOM   991  C CG  . MET A 1 144 ? -11.641 12.246 2.880   1.00 19.96  ? 267 MET A CG  1 
ATOM   992  S SD  . MET A 1 144 ? -12.978 12.700 1.730   1.00 20.94  ? 267 MET A SD  1 
ATOM   993  C CE  . MET A 1 144 ? -14.289 13.005 2.882   1.00 21.80  ? 267 MET A CE  1 
ATOM   994  N N   . VAL A 1 145 ? -8.542  9.405  0.880   1.00 17.92  ? 268 VAL A N   1 
ATOM   995  C CA  . VAL A 1 145 ? -7.419  8.980  0.036   1.00 16.82  ? 268 VAL A CA  1 
ATOM   996  C C   . VAL A 1 145 ? -7.851  7.936  -0.991  1.00 17.01  ? 268 VAL A C   1 
ATOM   997  O O   . VAL A 1 145 ? -7.481  8.045  -2.155  1.00 16.96  ? 268 VAL A O   1 
ATOM   998  C CB  . VAL A 1 145 ? -6.207  8.490  0.882   1.00 16.93  ? 268 VAL A CB  1 
ATOM   999  C CG1 . VAL A 1 145 ? -5.101  7.878  -0.008  1.00 16.99  ? 268 VAL A CG1 1 
ATOM   1000 C CG2 . VAL A 1 145 ? -5.648  9.653  1.679   1.00 15.93  ? 268 VAL A CG2 1 
ATOM   1001 N N   . VAL A 1 146 ? -8.621  6.932  -0.555  1.00 16.32  ? 269 VAL A N   1 
ATOM   1002 C CA  . VAL A 1 146 ? -9.169  5.938  -1.469  1.00 16.59  ? 269 VAL A CA  1 
ATOM   1003 C C   . VAL A 1 146 ? -9.969  6.628  -2.595  1.00 15.46  ? 269 VAL A C   1 
ATOM   1004 O O   . VAL A 1 146 ? -9.786  6.300  -3.779  1.00 14.75  ? 269 VAL A O   1 
ATOM   1005 C CB  . VAL A 1 146 ? -9.998  4.859  -0.730  1.00 16.73  ? 269 VAL A CB  1 
ATOM   1006 C CG1 . VAL A 1 146 ? -10.738 3.958  -1.696  1.00 18.95  ? 269 VAL A CG1 1 
ATOM   1007 C CG2 . VAL A 1 146 ? -9.062  3.957  0.072   1.00 19.95  ? 269 VAL A CG2 1 
ATOM   1008 N N   . LYS A 1 147 ? -10.808 7.608  -2.236  1.00 13.95  ? 270 LYS A N   1 
ATOM   1009 C CA  . LYS A 1 147 ? -11.628 8.281  -3.250  1.00 13.78  ? 270 LYS A CA  1 
ATOM   1010 C C   . LYS A 1 147 ? -10.803 9.109  -4.202  1.00 13.10  ? 270 LYS A C   1 
ATOM   1011 O O   . LYS A 1 147 ? -11.053 9.095  -5.417  1.00 13.27  ? 270 LYS A O   1 
ATOM   1012 C CB  . LYS A 1 147 ? -12.755 9.101  -2.614  1.00 13.99  ? 270 LYS A CB  1 
ATOM   1013 C CG  . LYS A 1 147 ? -13.869 8.195  -2.063  1.00 14.52  ? 270 LYS A CG  1 
ATOM   1014 C CD  . LYS A 1 147 ? -14.926 8.982  -1.334  1.00 19.36  ? 270 LYS A CD  1 
ATOM   1015 C CE  . LYS A 1 147 ? -14.377 9.498  -0.035  1.00 24.23  ? 270 LYS A CE  1 
ATOM   1016 N NZ  . LYS A 1 147 ? -15.468 9.654  0.985   1.00 27.04  ? 270 LYS A NZ  1 
ATOM   1017 N N   . ALA A 1 148 ? -9.811  9.817  -3.663  1.00 13.33  ? 271 ALA A N   1 
ATOM   1018 C CA  . ALA A 1 148 ? -8.921  10.648 -4.505  1.00 13.68  ? 271 ALA A CA  1 
ATOM   1019 C C   . ALA A 1 148 ? -8.167  9.806  -5.531  1.00 13.85  ? 271 ALA A C   1 
ATOM   1020 O O   . ALA A 1 148 ? -8.041  10.205 -6.683  1.00 14.92  ? 271 ALA A O   1 
ATOM   1021 C CB  . ALA A 1 148 ? -7.942  11.452 -3.648  1.00 13.08  ? 271 ALA A CB  1 
ATOM   1022 N N   . ILE A 1 149 ? -7.671  8.643  -5.116  1.00 13.89  ? 272 ILE A N   1 
ATOM   1023 C CA  . ILE A 1 149 ? -7.043  7.693  -6.063  1.00 14.11  ? 272 ILE A CA  1 
ATOM   1024 C C   . ILE A 1 149 ? -8.004  7.218  -7.153  1.00 13.87  ? 272 ILE A C   1 
ATOM   1025 O O   . ILE A 1 149 ? -7.660  7.216  -8.330  1.00 14.98  ? 272 ILE A O   1 
ATOM   1026 C CB  . ILE A 1 149 ? -6.374  6.516  -5.314  1.00 13.94  ? 272 ILE A CB  1 
ATOM   1027 C CG1 . ILE A 1 149 ? -5.192  7.061  -4.504  1.00 13.94  ? 272 ILE A CG1 1 
ATOM   1028 C CG2 . ILE A 1 149 ? -5.922  5.404  -6.291  1.00 13.24  ? 272 ILE A CG2 1 
ATOM   1029 C CD1 . ILE A 1 149 ? -4.630  6.094  -3.406  1.00 13.87  ? 272 ILE A CD1 1 
ATOM   1030 N N   . THR A 1 150 ? -9.228  6.861  -6.779  1.00 14.28  ? 273 THR A N   1 
ATOM   1031 C CA  . THR A 1 150 ? -10.235 6.500  -7.763  1.00 13.93  ? 273 THR A CA  1 
ATOM   1032 C C   . THR A 1 150 ? -10.561 7.662  -8.723  1.00 14.33  ? 273 THR A C   1 
ATOM   1033 O O   . THR A 1 150 ? -10.664 7.442  -9.928  1.00 13.52  ? 273 THR A O   1 
ATOM   1034 C CB  . THR A 1 150 ? -11.500 5.989  -7.071  1.00 14.85  ? 273 THR A CB  1 
ATOM   1035 O OG1 . THR A 1 150 ? -11.124 4.918  -6.198  1.00 14.79  ? 273 THR A OG1 1 
ATOM   1036 C CG2 . THR A 1 150 ? -12.523 5.477  -8.098  1.00 14.45  ? 273 THR A CG2 1 
ATOM   1037 N N   . ASP A 1 151 ? -10.700 8.885  -8.198  1.00 13.96  ? 274 ASP A N   1 
ATOM   1038 C CA  . ASP A 1 151 ? -10.944 10.072 -9.050  1.00 15.20  ? 274 ASP A CA  1 
ATOM   1039 C C   . ASP A 1 151 ? -9.864  10.211 -10.133 1.00 15.22  ? 274 ASP A C   1 
ATOM   1040 O O   . ASP A 1 151 ? -10.161 10.386 -11.311 1.00 15.71  ? 274 ASP A O   1 
ATOM   1041 C CB  . ASP A 1 151 ? -11.014 11.398 -8.231  1.00 14.55  ? 274 ASP A CB  1 
ATOM   1042 C CG  . ASP A 1 151 ? -12.101 11.402 -7.148  1.00 16.32  ? 274 ASP A CG  1 
ATOM   1043 O OD1 . ASP A 1 151 ? -13.202 10.838 -7.368  1.00 17.25  ? 274 ASP A OD1 1 
ATOM   1044 O OD2 . ASP A 1 151 ? -11.877 12.004 -6.067  1.00 15.62  ? 274 ASP A OD2 1 
ATOM   1045 N N   . ILE A 1 152 ? -8.601  10.138 -9.745  1.00 15.56  ? 275 ILE A N   1 
ATOM   1046 C CA  . ILE A 1 152 ? -7.549  10.360 -10.734 1.00 15.61  ? 275 ILE A CA  1 
ATOM   1047 C C   . ILE A 1 152 ? -7.447  9.200  -11.741 1.00 16.27  ? 275 ILE A C   1 
ATOM   1048 O O   . ILE A 1 152 ? -7.204  9.419  -12.920 1.00 16.16  ? 275 ILE A O   1 
ATOM   1049 C CB  . ILE A 1 152 ? -6.187  10.761 -10.095 1.00 15.95  ? 275 ILE A CB  1 
ATOM   1050 C CG1 . ILE A 1 152 ? -5.322  11.512 -11.131 1.00 17.35  ? 275 ILE A CG1 1 
ATOM   1051 C CG2 . ILE A 1 152 ? -5.462  9.558  -9.482  1.00 13.88  ? 275 ILE A CG2 1 
ATOM   1052 C CD1 . ILE A 1 152 ? -5.896  12.917 -11.514 1.00 16.78  ? 275 ILE A CD1 1 
ATOM   1053 N N   . ILE A 1 153 ? -7.679  7.976  -11.275 1.00 16.75  ? 276 ILE A N   1 
ATOM   1054 C CA  . ILE A 1 153 ? -7.789  6.811  -12.152 1.00 16.92  ? 276 ILE A CA  1 
ATOM   1055 C C   . ILE A 1 153 ? -8.921  6.972  -13.196 1.00 18.07  ? 276 ILE A C   1 
ATOM   1056 O O   . ILE A 1 153 ? -8.745  6.615  -14.360 1.00 18.36  ? 276 ILE A O   1 
ATOM   1057 C CB  . ILE A 1 153 ? -7.925  5.485  -11.313 1.00 16.71  ? 276 ILE A CB  1 
ATOM   1058 C CG1 . ILE A 1 153 ? -6.603  5.152  -10.609 1.00 17.34  ? 276 ILE A CG1 1 
ATOM   1059 C CG2 . ILE A 1 153 ? -8.409  4.300  -12.177 1.00 16.20  ? 276 ILE A CG2 1 
ATOM   1060 C CD1 . ILE A 1 153 ? -6.655  3.922  -9.674  1.00 15.69  ? 276 ILE A CD1 1 
ATOM   1061 N N   . GLU A 1 154 ? -10.069 7.508  -12.784 1.00 18.54  ? 277 GLU A N   1 
ATOM   1062 C CA  . GLU A 1 154 ? -11.248 7.634  -13.664 1.00 19.31  ? 277 GLU A CA  1 
ATOM   1063 C C   . GLU A 1 154 ? -11.069 8.614  -14.815 1.00 19.81  ? 277 GLU A C   1 
ATOM   1064 O O   . GLU A 1 154 ? -11.821 8.573  -15.803 1.00 19.84  ? 277 GLU A O   1 
ATOM   1065 C CB  . GLU A 1 154 ? -12.481 8.036  -12.858 1.00 18.87  ? 277 GLU A CB  1 
ATOM   1066 N N   . MET A 1 155 ? -10.096 9.511  -14.682 1.00 20.02  ? 278 MET A N   1 
ATOM   1067 C CA  . MET A 1 155 ? -9.844  10.525 -15.704 1.00 20.64  ? 278 MET A CA  1 
ATOM   1068 C C   . MET A 1 155 ? -9.819  9.935  -17.124 1.00 20.97  ? 278 MET A C   1 
ATOM   1069 O O   . MET A 1 155 ? -10.455 10.470 -18.049 1.00 19.92  ? 278 MET A O   1 
ATOM   1070 C CB  . MET A 1 155 ? -8.533  11.263 -15.398 1.00 20.95  ? 278 MET A CB  1 
ATOM   1071 C CG  . MET A 1 155 ? -8.236  12.391 -16.326 1.00 20.97  ? 278 MET A CG  1 
ATOM   1072 S SD  . MET A 1 155 ? -6.720  13.268 -15.877 1.00 22.04  ? 278 MET A SD  1 
ATOM   1073 C CE  . MET A 1 155 ? -5.502  11.960 -15.672 1.00 18.54  ? 278 MET A CE  1 
ATOM   1074 N N   . ASP A 1 156 ? -9.100  8.825  -17.283 1.00 20.72  ? 279 ASP A N   1 
ATOM   1075 C CA  . ASP A 1 156 ? -8.913  8.210  -18.592 1.00 21.52  ? 279 ASP A CA  1 
ATOM   1076 C C   . ASP A 1 156 ? -10.218 7.627  -19.163 1.00 21.92  ? 279 ASP A C   1 
ATOM   1077 O O   . ASP A 1 156 ? -10.326 7.437  -20.375 1.00 22.06  ? 279 ASP A O   1 
ATOM   1078 C CB  . ASP A 1 156 ? -7.856  7.110  -18.508 1.00 21.89  ? 279 ASP A CB  1 
ATOM   1079 C CG  . ASP A 1 156 ? -7.474  6.553  -19.884 1.00 23.57  ? 279 ASP A CG  1 
ATOM   1080 O OD1 . ASP A 1 156 ? -6.908  7.317  -20.696 1.00 23.84  ? 279 ASP A OD1 1 
ATOM   1081 O OD2 . ASP A 1 156 ? -7.753  5.366  -20.147 1.00 23.02  ? 279 ASP A OD2 1 
ATOM   1082 N N   . SER A 1 157 ? -11.195 7.339  -18.299 1.00 21.23  ? 280 SER A N   1 
ATOM   1083 C CA  . SER A 1 157 ? -12.449 6.736  -18.746 1.00 21.83  ? 280 SER A CA  1 
ATOM   1084 C C   . SER A 1 157 ? -13.419 7.767  -19.335 1.00 22.20  ? 280 SER A C   1 
ATOM   1085 O O   . SER A 1 157 ? -14.444 7.390  -19.901 1.00 22.54  ? 280 SER A O   1 
ATOM   1086 C CB  . SER A 1 157 ? -13.150 6.019  -17.584 1.00 21.76  ? 280 SER A CB  1 
ATOM   1087 O OG  . SER A 1 157 ? -13.700 6.990  -16.696 1.00 20.72  ? 280 SER A OG  1 
ATOM   1088 N N   . LYS A 1 158 ? -13.120 9.057  -19.156 1.00 22.49  ? 281 LYS A N   1 
ATOM   1089 C CA  . LYS A 1 158 ? -13.964 10.143 -19.660 1.00 23.13  ? 281 LYS A CA  1 
ATOM   1090 C C   . LYS A 1 158 ? -13.393 10.643 -20.974 1.00 23.59  ? 281 LYS A C   1 
ATOM   1091 O O   . LYS A 1 158 ? -12.183 10.852 -21.085 1.00 22.82  ? 281 LYS A O   1 
ATOM   1092 C CB  . LYS A 1 158 ? -14.004 11.322 -18.681 1.00 23.70  ? 281 LYS A CB  1 
ATOM   1093 C CG  . LYS A 1 158 ? -14.303 10.974 -17.207 1.00 24.55  ? 281 LYS A CG  1 
ATOM   1094 C CD  . LYS A 1 158 ? -15.560 10.133 -17.054 1.00 28.64  ? 281 LYS A CD  1 
ATOM   1095 C CE  . LYS A 1 158 ? -15.865 9.961  -15.576 1.00 32.82  ? 281 LYS A CE  1 
ATOM   1096 N NZ  . LYS A 1 158 ? -16.974 8.987  -15.372 1.00 36.26  ? 281 LYS A NZ  1 
ATOM   1097 N N   . ARG A 1 159 ? -14.269 10.885 -21.943 1.00 23.68  ? 282 ARG A N   1 
ATOM   1098 C CA  . ARG A 1 159 ? -13.837 11.299 -23.268 1.00 24.99  ? 282 ARG A CA  1 
ATOM   1099 C C   . ARG A 1 159 ? -13.702 12.803 -23.453 1.00 24.43  ? 282 ARG A C   1 
ATOM   1100 O O   . ARG A 1 159 ? -12.868 13.257 -24.222 1.00 25.38  ? 282 ARG A O   1 
ATOM   1101 C CB  . ARG A 1 159 ? -14.780 10.738 -24.323 1.00 25.24  ? 282 ARG A CB  1 
ATOM   1102 C CG  . ARG A 1 159 ? -14.381 9.344  -24.780 1.00 28.86  ? 282 ARG A CG  1 
ATOM   1103 C CD  . ARG A 1 159 ? -15.192 8.940  -26.003 1.00 33.48  ? 282 ARG A CD  1 
ATOM   1104 N NE  . ARG A 1 159 ? -16.616 9.057  -25.713 1.00 36.18  ? 282 ARG A NE  1 
ATOM   1105 C CZ  . ARG A 1 159 ? -17.580 8.938  -26.617 1.00 39.86  ? 282 ARG A CZ  1 
ATOM   1106 N NH1 . ARG A 1 159 ? -17.277 8.697  -27.899 1.00 39.10  ? 282 ARG A NH1 1 
ATOM   1107 N NH2 . ARG A 1 159 ? -18.848 9.073  -26.233 1.00 40.42  ? 282 ARG A NH2 1 
ATOM   1108 N N   . VAL A 1 160 ? -14.530 13.563 -22.748 1.00 24.03  ? 283 VAL A N   1 
ATOM   1109 C CA  . VAL A 1 160 ? -14.641 15.006 -22.940 1.00 23.89  ? 283 VAL A CA  1 
ATOM   1110 C C   . VAL A 1 160 ? -13.682 15.738 -21.977 1.00 22.85  ? 283 VAL A C   1 
ATOM   1111 O O   . VAL A 1 160 ? -13.610 15.380 -20.798 1.00 23.14  ? 283 VAL A O   1 
ATOM   1112 C CB  . VAL A 1 160 ? -16.135 15.412 -22.770 1.00 23.87  ? 283 VAL A CB  1 
ATOM   1113 C CG1 . VAL A 1 160 ? -16.326 16.903 -22.690 1.00 24.55  ? 283 VAL A CG1 1 
ATOM   1114 C CG2 . VAL A 1 160 ? -16.956 14.805 -23.936 1.00 26.09  ? 283 VAL A CG2 1 
ATOM   1115 N N   . PRO A 1 161 ? -12.916 16.738 -22.482 1.00 22.45  ? 284 PRO A N   1 
ATOM   1116 C CA  . PRO A 1 161 ? -11.927 17.374 -21.617 1.00 22.01  ? 284 PRO A CA  1 
ATOM   1117 C C   . PRO A 1 161 ? -12.528 17.897 -20.309 1.00 21.86  ? 284 PRO A C   1 
ATOM   1118 O O   . PRO A 1 161 ? -11.958 17.652 -19.253 1.00 21.76  ? 284 PRO A O   1 
ATOM   1119 C CB  . PRO A 1 161 ? -11.355 18.477 -22.501 1.00 21.83  ? 284 PRO A CB  1 
ATOM   1120 C CG  . PRO A 1 161 ? -11.489 17.887 -23.889 1.00 21.83  ? 284 PRO A CG  1 
ATOM   1121 C CD  . PRO A 1 161 ? -12.870 17.320 -23.839 1.00 21.81  ? 284 PRO A CD  1 
ATOM   1122 N N   . ARG A 1 162 ? -13.684 18.543 -20.378 1.00 21.75  ? 285 ARG A N   1 
ATOM   1123 C CA  . ARG A 1 162 ? -14.419 19.001 -19.208 1.00 23.05  ? 285 ARG A CA  1 
ATOM   1124 C C   . ARG A 1 162 ? -14.650 17.899 -18.156 1.00 21.39  ? 285 ARG A C   1 
ATOM   1125 O O   . ARG A 1 162 ? -14.590 18.160 -16.956 1.00 21.99  ? 285 ARG A O   1 
ATOM   1126 C CB  . ARG A 1 162 ? -15.760 19.618 -19.638 1.00 22.36  ? 285 ARG A CB  1 
ATOM   1127 C CG  . ARG A 1 162 ? -16.666 20.040 -18.474 1.00 25.43  ? 285 ARG A CG  1 
ATOM   1128 C CD  . ARG A 1 162 ? -18.032 20.552 -18.957 1.00 28.11  ? 285 ARG A CD  1 
ATOM   1129 N NE  . ARG A 1 162 ? -18.757 21.281 -17.904 1.00 38.16  ? 285 ARG A NE  1 
ATOM   1130 C CZ  . ARG A 1 162 ? -18.557 22.569 -17.600 1.00 43.26  ? 285 ARG A CZ  1 
ATOM   1131 N NH1 . ARG A 1 162 ? -17.647 23.287 -18.264 1.00 44.91  ? 285 ARG A NH1 1 
ATOM   1132 N NH2 . ARG A 1 162 ? -19.265 23.153 -16.629 1.00 46.06  ? 285 ARG A NH2 1 
ATOM   1133 N N   . ASP A 1 163 ? -14.937 16.683 -18.600 1.00 21.08  ? 286 ASP A N   1 
ATOM   1134 C CA  . ASP A 1 163 ? -15.156 15.565 -17.676 1.00 20.40  ? 286 ASP A CA  1 
ATOM   1135 C C   . ASP A 1 163 ? -13.842 14.980 -17.118 1.00 19.19  ? 286 ASP A C   1 
ATOM   1136 O O   . ASP A 1 163 ? -13.789 14.529 -15.967 1.00 19.60  ? 286 ASP A O   1 
ATOM   1137 C CB  . ASP A 1 163 ? -15.962 14.453 -18.338 1.00 20.97  ? 286 ASP A CB  1 
ATOM   1138 C CG  . ASP A 1 163 ? -17.388 14.874 -18.673 1.00 24.17  ? 286 ASP A CG  1 
ATOM   1139 O OD1 . ASP A 1 163 ? -17.985 15.684 -17.921 1.00 24.13  ? 286 ASP A OD1 1 
ATOM   1140 O OD2 . ASP A 1 163 ? -17.906 14.354 -19.682 1.00 25.64  ? 286 ASP A OD2 1 
ATOM   1141 N N   . LYS A 1 164 ? -12.800 14.970 -17.932 1.00 18.20  ? 287 LYS A N   1 
ATOM   1142 C CA  . LYS A 1 164 ? -11.452 14.652 -17.427 1.00 17.79  ? 287 LYS A CA  1 
ATOM   1143 C C   . LYS A 1 164 ? -11.020 15.657 -16.361 1.00 17.29  ? 287 LYS A C   1 
ATOM   1144 O O   . LYS A 1 164 ? -10.551 15.258 -15.303 1.00 17.18  ? 287 LYS A O   1 
ATOM   1145 C CB  . LYS A 1 164 ? -10.431 14.594 -18.559 1.00 17.88  ? 287 LYS A CB  1 
ATOM   1146 C CG  . LYS A 1 164 ? -10.707 13.469 -19.563 1.00 17.74  ? 287 LYS A CG  1 
ATOM   1147 C CD  . LYS A 1 164 ? -9.673  13.523 -20.688 1.00 18.53  ? 287 LYS A CD  1 
ATOM   1148 C CE  . LYS A 1 164 ? -9.843  12.393 -21.670 1.00 18.28  ? 287 LYS A CE  1 
ATOM   1149 N NZ  . LYS A 1 164 ? -9.712  11.061 -21.047 1.00 18.04  ? 287 LYS A NZ  1 
ATOM   1150 N N   . LEU A 1 165 ? -11.207 16.947 -16.631 1.00 16.34  ? 288 LEU A N   1 
ATOM   1151 C CA  . LEU A 1 165 ? -10.952 17.988 -15.642 1.00 16.37  ? 288 LEU A CA  1 
ATOM   1152 C C   . LEU A 1 165 ? -11.748 17.791 -14.347 1.00 15.88  ? 288 LEU A C   1 
ATOM   1153 O O   . LEU A 1 165 ? -11.230 18.043 -13.271 1.00 15.48  ? 288 LEU A O   1 
ATOM   1154 C CB  . LEU A 1 165 ? -11.226 19.389 -16.211 1.00 16.45  ? 288 LEU A CB  1 
ATOM   1155 C CG  . LEU A 1 165 ? -10.197 19.895 -17.223 1.00 18.20  ? 288 LEU A CG  1 
ATOM   1156 C CD1 . LEU A 1 165 ? -10.717 21.176 -17.880 1.00 20.95  ? 288 LEU A CD1 1 
ATOM   1157 C CD2 . LEU A 1 165 ? -8.828  20.129 -16.590 1.00 18.26  ? 288 LEU A CD2 1 
ATOM   1158 N N   . ALA A 1 166 ? -12.996 17.345 -14.451 1.00 15.72  ? 289 ALA A N   1 
ATOM   1159 C CA  . ALA A 1 166 ? -13.840 17.114 -13.279 1.00 15.54  ? 289 ALA A CA  1 
ATOM   1160 C C   . ALA A 1 166 ? -13.303 16.013 -12.381 1.00 15.92  ? 289 ALA A C   1 
ATOM   1161 O O   . ALA A 1 166 ? -13.465 16.083 -11.166 1.00 16.12  ? 289 ALA A O   1 
ATOM   1162 C CB  . ALA A 1 166 ? -15.281 16.785 -13.701 1.00 16.18  ? 289 ALA A CB  1 
ATOM   1163 N N   . CYS A 1 167 ? -12.676 14.997 -12.974 1.00 16.16  ? 290 CYS A N   1 
ATOM   1164 C CA  . CYS A 1 167 ? -11.984 13.955 -12.208 1.00 16.82  ? 290 CYS A CA  1 
ATOM   1165 C C   . CYS A 1 167 ? -10.805 14.561 -11.439 1.00 16.46  ? 290 CYS A C   1 
ATOM   1166 O O   . CYS A 1 167 ? -10.633 14.286 -10.244 1.00 16.39  ? 290 CYS A O   1 
ATOM   1167 C CB  . CYS A 1 167 ? -11.521 12.808 -13.121 1.00 16.74  ? 290 CYS A CB  1 
ATOM   1168 S SG  . CYS A 1 167 ? -12.936 11.907 -13.900 1.00 19.77  ? 290 CYS A SG  1 
ATOM   1169 N N   . ILE A 1 168 ? -10.013 15.403 -12.102 1.00 15.66  ? 291 ILE A N   1 
ATOM   1170 C CA  . ILE A 1 168 ? -8.859  16.025 -11.416 1.00 15.47  ? 291 ILE A CA  1 
ATOM   1171 C C   . ILE A 1 168 ? -9.341  16.893 -10.240 1.00 15.13  ? 291 ILE A C   1 
ATOM   1172 O O   . ILE A 1 168 ? -8.779  16.869 -9.141  1.00 14.82  ? 291 ILE A O   1 
ATOM   1173 C CB  . ILE A 1 168 ? -7.977  16.844 -12.403 1.00 15.93  ? 291 ILE A CB  1 
ATOM   1174 C CG1 . ILE A 1 168 ? -7.572  15.978 -13.602 1.00 15.84  ? 291 ILE A CG1 1 
ATOM   1175 C CG2 . ILE A 1 168 ? -6.730  17.422 -11.696 1.00 16.02  ? 291 ILE A CG2 1 
ATOM   1176 C CD1 . ILE A 1 168 ? -6.910  16.776 -14.770 1.00 15.20  ? 291 ILE A CD1 1 
ATOM   1177 N N   . THR A 1 169 ? -10.405 17.648 -10.481 1.00 14.50  ? 292 THR A N   1 
ATOM   1178 C CA  . THR A 1 169 ? -10.978 18.529 -9.485  1.00 14.09  ? 292 THR A CA  1 
ATOM   1179 C C   . THR A 1 169 ? -11.590 17.778 -8.301  1.00 13.92  ? 292 THR A C   1 
ATOM   1180 O O   . THR A 1 169 ? -11.359 18.154 -7.156  1.00 13.63  ? 292 THR A O   1 
ATOM   1181 C CB  . THR A 1 169 ? -11.978 19.465 -10.156 1.00 14.04  ? 292 THR A CB  1 
ATOM   1182 O OG1 . THR A 1 169 ? -11.237 20.337 -11.022 1.00 15.29  ? 292 THR A OG1 1 
ATOM   1183 C CG2 . THR A 1 169 ? -12.736 20.288 -9.111  1.00 12.98  ? 292 THR A CG2 1 
ATOM   1184 N N   . LYS A 1 170 ? -12.358 16.715 -8.578  1.00 14.11  ? 293 LYS A N   1 
ATOM   1185 C CA  . LYS A 1 170 ? -12.866 15.816 -7.530  1.00 15.21  ? 293 LYS A CA  1 
ATOM   1186 C C   . LYS A 1 170 ? -11.732 15.235 -6.692  1.00 14.34  ? 293 LYS A C   1 
ATOM   1187 O O   . LYS A 1 170 ? -11.832 15.158 -5.457  1.00 14.68  ? 293 LYS A O   1 
ATOM   1188 C CB  . LYS A 1 170 ? -13.669 14.641 -8.121  1.00 14.54  ? 293 LYS A CB  1 
ATOM   1189 C CG  . LYS A 1 170 ? -15.011 15.019 -8.674  1.00 17.00  ? 293 LYS A CG  1 
ATOM   1190 C CD  . LYS A 1 170 ? -15.896 13.769 -8.945  1.00 17.30  ? 293 LYS A CD  1 
ATOM   1191 C CE  . LYS A 1 170 ? -15.241 12.755 -9.853  1.00 21.62  ? 293 LYS A CE  1 
ATOM   1192 N NZ  . LYS A 1 170 ? -16.159 11.605 -10.272 1.00 21.91  ? 293 LYS A NZ  1 
ATOM   1193 N N   . CYS A 1 171 ? -10.680 14.787 -7.374  1.00 13.63  ? 294 CYS A N   1 
ATOM   1194 C CA  . CYS A 1 171 ? -9.517  14.211 -6.708  1.00 13.43  ? 294 CYS A CA  1 
ATOM   1195 C C   . CYS A 1 171 ? -8.935  15.244 -5.731  1.00 12.96  ? 294 CYS A C   1 
ATOM   1196 O O   . CYS A 1 171 ? -8.669  14.950 -4.563  1.00 13.11  ? 294 CYS A O   1 
ATOM   1197 C CB  . CYS A 1 171 ? -8.475  13.791 -7.763  1.00 13.07  ? 294 CYS A CB  1 
ATOM   1198 S SG  . CYS A 1 171 ? -6.860  13.370 -7.091  1.00 14.22  ? 294 CYS A SG  1 
ATOM   1199 N N   . SER A 1 172 ? -8.760  16.460 -6.209  1.00 12.57  ? 295 SER A N   1 
ATOM   1200 C CA  . SER A 1 172 ? -8.209  17.530 -5.379  1.00 13.36  ? 295 SER A CA  1 
ATOM   1201 C C   . SER A 1 172 ? -9.055  17.854 -4.166  1.00 12.93  ? 295 SER A C   1 
ATOM   1202 O O   . SER A 1 172 ? -8.531  18.134 -3.101  1.00 12.96  ? 295 SER A O   1 
ATOM   1203 C CB  . SER A 1 172 ? -8.026  18.795 -6.202  1.00 13.04  ? 295 SER A CB  1 
ATOM   1204 O OG  . SER A 1 172 ? -7.204  18.504 -7.311  1.00 13.39  ? 295 SER A OG  1 
ATOM   1205 N N   . LYS A 1 173 ? -10.370 17.835 -4.318  1.00 13.48  ? 296 LYS A N   1 
ATOM   1206 C CA  . LYS A 1 173 ? -11.223 18.167 -3.180  1.00 12.99  ? 296 LYS A CA  1 
ATOM   1207 C C   . LYS A 1 173 ? -11.267 17.017 -2.154  1.00 12.71  ? 296 LYS A C   1 
ATOM   1208 O O   . LYS A 1 173 ? -11.410 17.247 -0.961  1.00 12.72  ? 296 LYS A O   1 
ATOM   1209 C CB  . LYS A 1 173 ? -12.618 18.575 -3.670  1.00 13.60  ? 296 LYS A CB  1 
ATOM   1210 C CG  . LYS A 1 173 ? -12.629 19.980 -4.346  1.00 12.80  ? 296 LYS A CG  1 
ATOM   1211 C CD  . LYS A 1 173 ? -13.948 20.234 -5.083  1.00 12.89  ? 296 LYS A CD  1 
ATOM   1212 C CE  . LYS A 1 173 ? -13.949 21.646 -5.768  1.00 14.83  ? 296 LYS A CE  1 
ATOM   1213 N NZ  . LYS A 1 173 ? -15.160 21.808 -6.666  1.00 15.87  ? 296 LYS A NZ  1 
ATOM   1214 N N   . HIS A 1 174 ? -11.152 15.780 -2.620  1.00 12.97  ? 297 HIS A N   1 
ATOM   1215 C CA  . HIS A 1 174 ? -11.027 14.679 -1.690  1.00 13.58  ? 297 HIS A CA  1 
ATOM   1216 C C   . HIS A 1 174 ? -9.681  14.826 -0.975  1.00 14.25  ? 297 HIS A C   1 
ATOM   1217 O O   . HIS A 1 174 ? -9.606  14.641 0.223   1.00 14.87  ? 297 HIS A O   1 
ATOM   1218 C CB  . HIS A 1 174 ? -11.161 13.311 -2.388  1.00 14.26  ? 297 HIS A CB  1 
ATOM   1219 C CG  . HIS A 1 174 ? -12.569 12.961 -2.790  1.00 13.36  ? 297 HIS A CG  1 
ATOM   1220 N ND1 . HIS A 1 174 ? -13.634 13.017 -1.915  1.00 18.18  ? 297 HIS A ND1 1 
ATOM   1221 C CD2 . HIS A 1 174 ? -13.079 12.551 -3.971  1.00 13.00  ? 297 HIS A CD2 1 
ATOM   1222 C CE1 . HIS A 1 174 ? -14.739 12.644 -2.536  1.00 15.18  ? 297 HIS A CE1 1 
ATOM   1223 N NE2 . HIS A 1 174 ? -14.433 12.368 -3.788  1.00 18.61  ? 297 HIS A NE2 1 
ATOM   1224 N N   . ILE A 1 175 ? -8.623  15.194 -1.703  1.00 14.77  ? 298 ILE A N   1 
ATOM   1225 C CA  . ILE A 1 175 ? -7.318  15.468 -1.048  1.00 14.45  ? 298 ILE A CA  1 
ATOM   1226 C C   . ILE A 1 175 ? -7.437  16.580 -0.005  1.00 14.48  ? 298 ILE A C   1 
ATOM   1227 O O   . ILE A 1 175 ? -6.927  16.457 1.118   1.00 14.00  ? 298 ILE A O   1 
ATOM   1228 C CB  . ILE A 1 175 ? -6.232  15.868 -2.053  1.00 14.84  ? 298 ILE A CB  1 
ATOM   1229 C CG1 . ILE A 1 175 ? -5.734  14.630 -2.815  1.00 13.65  ? 298 ILE A CG1 1 
ATOM   1230 C CG2 . ILE A 1 175 ? -5.077  16.617 -1.314  1.00 13.20  ? 298 ILE A CG2 1 
ATOM   1231 C CD1 . ILE A 1 175 ? -4.925  14.961 -4.096  1.00 14.00  ? 298 ILE A CD1 1 
ATOM   1232 N N   . PHE A 1 176 ? -8.109  17.666 -0.377  1.00 14.09  ? 299 PHE A N   1 
ATOM   1233 C CA  . PHE A 1 176 ? -8.302  18.766 0.551   1.00 14.57  ? 299 PHE A CA  1 
ATOM   1234 C C   . PHE A 1 176 ? -8.997  18.321 1.837   1.00 14.03  ? 299 PHE A C   1 
ATOM   1235 O O   . PHE A 1 176 ? -8.591  18.718 2.929   1.00 13.82  ? 299 PHE A O   1 
ATOM   1236 C CB  . PHE A 1 176 ? -9.078  19.924 -0.082  1.00 14.67  ? 299 PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 176 ? -8.298  20.721 -1.082  1.00 15.78  ? 299 PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 176 ? -7.017  21.169 -0.797  1.00 16.88  ? 299 PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 176 ? -8.881  21.082 -2.295  1.00 16.63  ? 299 PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 176 ? -6.311  21.925 -1.713  1.00 18.99  ? 299 PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 176 ? -8.176  21.845 -3.219  1.00 18.42  ? 299 PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 176 ? -6.887  22.256 -2.937  1.00 16.75  ? 299 PHE A CZ  1 
ATOM   1243 N N   . ASN A 1 177 ? -10.053 17.515 1.707   1.00 14.31  ? 300 ASN A N   1 
ATOM   1244 C CA  . ASN A 1 177 ? -10.709 16.945 2.888   1.00 15.40  ? 300 ASN A CA  1 
ATOM   1245 C C   . ASN A 1 177 ? -9.753  16.106 3.744   1.00 15.97  ? 300 ASN A C   1 
ATOM   1246 O O   . ASN A 1 177 ? -9.720  16.260 4.959   1.00 16.67  ? 300 ASN A O   1 
ATOM   1247 C CB  . ASN A 1 177 ? -11.935 16.127 2.493   1.00 15.00  ? 300 ASN A CB  1 
ATOM   1248 C CG  . ASN A 1 177 ? -13.129 17.001 2.197   1.00 16.59  ? 300 ASN A CG  1 
ATOM   1249 O OD1 . ASN A 1 177 ? -13.461 17.291 1.031   1.00 19.62  ? 300 ASN A OD1 1 
ATOM   1250 N ND2 . ASN A 1 177 ? -13.747 17.472 3.235   1.00 15.39  ? 300 ASN A ND2 1 
ATOM   1251 N N   . ALA A 1 178 ? -8.981  15.225 3.110   1.00 16.07  ? 301 ALA A N   1 
ATOM   1252 C CA  . ALA A 1 178 ? -7.994  14.422 3.834   1.00 16.58  ? 301 ALA A CA  1 
ATOM   1253 C C   . ALA A 1 178 ? -7.024  15.323 4.629   1.00 16.99  ? 301 ALA A C   1 
ATOM   1254 O O   . ALA A 1 178 ? -6.747  15.070 5.811   1.00 17.43  ? 301 ALA A O   1 
ATOM   1255 C CB  . ALA A 1 178 ? -7.221  13.535 2.858   1.00 16.44  ? 301 ALA A CB  1 
ATOM   1256 N N   . ILE A 1 179 ? -6.530  16.378 3.996   1.00 16.91  ? 302 ILE A N   1 
ATOM   1257 C CA  . ILE A 1 179 ? -5.603  17.300 4.682   1.00 17.98  ? 302 ILE A CA  1 
ATOM   1258 C C   . ILE A 1 179 ? -6.261  18.090 5.821   1.00 19.74  ? 302 ILE A C   1 
ATOM   1259 O O   . ILE A 1 179 ? -5.684  18.221 6.895   1.00 19.93  ? 302 ILE A O   1 
ATOM   1260 C CB  . ILE A 1 179 ? -4.949  18.309 3.735   1.00 17.29  ? 302 ILE A CB  1 
ATOM   1261 C CG1 . ILE A 1 179 ? -4.056  17.610 2.694   1.00 16.77  ? 302 ILE A CG1 1 
ATOM   1262 C CG2 . ILE A 1 179 ? -4.131  19.312 4.559   1.00 19.27  ? 302 ILE A CG2 1 
ATOM   1263 C CD1 . ILE A 1 179 ? -3.675  18.485 1.489   1.00 15.78  ? 302 ILE A CD1 1 
ATOM   1264 N N   . LYS A 1 180 ? -7.459  18.626 5.570   1.00 21.24  ? 303 LYS A N   1 
ATOM   1265 C CA  . LYS A 1 180 ? -8.211  19.386 6.574   1.00 22.54  ? 303 LYS A CA  1 
ATOM   1266 C C   . LYS A 1 180 ? -8.574  18.519 7.791   1.00 23.08  ? 303 LYS A C   1 
ATOM   1267 O O   . LYS A 1 180 ? -8.482  18.978 8.914   1.00 22.89  ? 303 LYS A O   1 
ATOM   1268 C CB  . LYS A 1 180 ? -9.473  20.004 5.950   1.00 22.56  ? 303 LYS A CB  1 
ATOM   1269 C CG  . LYS A 1 180 ? -10.314 20.899 6.873   1.00 24.04  ? 303 LYS A CG  1 
ATOM   1270 C CD  . LYS A 1 180 ? -9.546  22.145 7.314   1.00 25.16  ? 303 LYS A CD  1 
ATOM   1271 C CE  . LYS A 1 180 ? -10.334 23.006 8.315   1.00 25.19  ? 303 LYS A CE  1 
ATOM   1272 N NZ  . LYS A 1 180 ? -11.570 23.543 7.689   1.00 26.07  ? 303 LYS A NZ  1 
ATOM   1273 N N   . ILE A 1 181 ? -8.976  17.270 7.571   1.00 23.65  ? 304 ILE A N   1 
ATOM   1274 C CA  . ILE A 1 181 ? -9.281  16.375 8.705   1.00 24.36  ? 304 ILE A CA  1 
ATOM   1275 C C   . ILE A 1 181 ? -8.030  16.083 9.549   1.00 25.69  ? 304 ILE A C   1 
ATOM   1276 O O   . ILE A 1 181 ? -8.098  16.045 10.788  1.00 26.44  ? 304 ILE A O   1 
ATOM   1277 C CB  . ILE A 1 181 ? -9.908  15.019 8.253   1.00 24.12  ? 304 ILE A CB  1 
ATOM   1278 C CG1 . ILE A 1 181 ? -11.317 15.222 7.678   1.00 24.30  ? 304 ILE A CG1 1 
ATOM   1279 C CG2 . ILE A 1 181 ? -9.961  14.024 9.429   1.00 23.69  ? 304 ILE A CG2 1 
ATOM   1280 C CD1 . ILE A 1 181 ? -11.687 14.167 6.581   1.00 25.51  ? 304 ILE A CD1 1 
ATOM   1281 N N   . THR A 1 182 ? -6.905  15.853 8.880   1.00 25.39  ? 305 THR A N   1 
ATOM   1282 C CA  . THR A 1 182 ? -5.637  15.559 9.560   1.00 25.68  ? 305 THR A CA  1 
ATOM   1283 C C   . THR A 1 182 ? -5.098  16.762 10.338  1.00 26.93  ? 305 THR A C   1 
ATOM   1284 O O   . THR A 1 182 ? -4.672  16.621 11.499  1.00 26.97  ? 305 THR A O   1 
ATOM   1285 C CB  . THR A 1 182 ? -4.571  15.104 8.536   1.00 25.16  ? 305 THR A CB  1 
ATOM   1286 O OG1 . THR A 1 182 ? -5.011  13.903 7.891   1.00 23.07  ? 305 THR A OG1 1 
ATOM   1287 C CG2 . THR A 1 182 ? -3.202  14.866 9.195   1.00 25.20  ? 305 THR A CG2 1 
ATOM   1288 N N   . LYS A 1 183 ? -5.108  17.932 9.691   1.00 27.53  ? 306 LYS A N   1 
ATOM   1289 C CA  . LYS A 1 183 ? -4.358  19.103 10.157  1.00 28.99  ? 306 LYS A CA  1 
ATOM   1290 C C   . LYS A 1 183 ? -5.245  20.123 10.850  1.00 29.37  ? 306 LYS A C   1 
ATOM   1291 O O   . LYS A 1 183 ? -4.771  20.911 11.672  1.00 29.54  ? 306 LYS A O   1 
ATOM   1292 C CB  . LYS A 1 183 ? -3.629  19.765 8.976   1.00 29.19  ? 306 LYS A CB  1 
ATOM   1293 C CG  . LYS A 1 183 ? -2.451  18.938 8.432   1.00 31.27  ? 306 LYS A CG  1 
ATOM   1294 C CD  . LYS A 1 183 ? -1.319  18.867 9.483   1.00 35.35  ? 306 LYS A CD  1 
ATOM   1295 C CE  . LYS A 1 183 ? -0.352  17.717 9.236   1.00 36.73  ? 306 LYS A CE  1 
ATOM   1296 N NZ  . LYS A 1 183 ? 0.866   17.808 10.109  1.00 38.54  ? 306 LYS A NZ  1 
ATOM   1297 N N   . ASN A 1 184 ? -6.528  20.116 10.498  1.00 29.36  ? 307 ASN A N   1 
ATOM   1298 C CA  . ASN A 1 184 ? -7.493  21.082 11.009  1.00 30.15  ? 307 ASN A CA  1 
ATOM   1299 C C   . ASN A 1 184 ? -7.138  22.518 10.619  1.00 29.43  ? 307 ASN A C   1 
ATOM   1300 O O   . ASN A 1 184 ? -7.508  23.473 11.293  1.00 28.93  ? 307 ASN A O   1 
ATOM   1301 C CB  . ASN A 1 184 ? -7.695  20.896 12.526  1.00 31.09  ? 307 ASN A CB  1 
ATOM   1302 C CG  . ASN A 1 184 ? -8.328  19.546 12.860  1.00 34.19  ? 307 ASN A CG  1 
ATOM   1303 O OD1 . ASN A 1 184 ? -7.665  18.650 13.417  1.00 37.78  ? 307 ASN A OD1 1 
ATOM   1304 N ND2 . ASN A 1 184 ? -9.610  19.377 12.488  1.00 34.73  ? 307 ASN A ND2 1 
ATOM   1305 N N   . GLU A 1 185 ? -6.392  22.637 9.521   1.00 28.74  ? 308 GLU A N   1 
ATOM   1306 C CA  . GLU A 1 185 ? -6.162  23.906 8.855   1.00 28.55  ? 308 GLU A CA  1 
ATOM   1307 C C   . GLU A 1 185 ? -6.354  23.672 7.356   1.00 27.05  ? 308 GLU A C   1 
ATOM   1308 O O   . GLU A 1 185 ? -6.099  22.556 6.866   1.00 27.00  ? 308 GLU A O   1 
ATOM   1309 C CB  . GLU A 1 185 ? -4.747  24.432 9.109   1.00 29.21  ? 308 GLU A CB  1 
ATOM   1310 C CG  . GLU A 1 185 ? -4.308  24.473 10.563  1.00 32.86  ? 308 GLU A CG  1 
ATOM   1311 C CD  . GLU A 1 185 ? -4.904  25.628 11.325  1.00 38.01  ? 308 GLU A CD  1 
ATOM   1312 O OE1 . GLU A 1 185 ? -5.531  26.518 10.691  1.00 39.66  ? 308 GLU A OE1 1 
ATOM   1313 O OE2 . GLU A 1 185 ? -4.738  25.645 12.567  1.00 40.47  ? 308 GLU A OE2 1 
ATOM   1314 N N   . PRO A 1 186 ? -6.814  24.710 6.633   1.00 25.01  ? 309 PRO A N   1 
ATOM   1315 C CA  . PRO A 1 186 ? -7.010  24.608 5.186   1.00 23.41  ? 309 PRO A CA  1 
ATOM   1316 C C   . PRO A 1 186 ? -5.663  24.453 4.478   1.00 22.57  ? 309 PRO A C   1 
ATOM   1317 O O   . PRO A 1 186 ? -4.698  25.133 4.835   1.00 22.27  ? 309 PRO A O   1 
ATOM   1318 C CB  . PRO A 1 186 ? -7.677  25.932 4.802   1.00 22.78  ? 309 PRO A CB  1 
ATOM   1319 C CG  . PRO A 1 186 ? -7.605  26.811 5.960   1.00 24.81  ? 309 PRO A CG  1 
ATOM   1320 C CD  . PRO A 1 186 ? -7.166  26.041 7.171   1.00 25.05  ? 309 PRO A CD  1 
ATOM   1321 N N   . ALA A 1 187 ? -5.595  23.545 3.504   1.00 21.34  ? 310 ALA A N   1 
ATOM   1322 C CA  . ALA A 1 187 ? -4.339  23.267 2.798   1.00 19.69  ? 310 ALA A CA  1 
ATOM   1323 C C   . ALA A 1 187 ? -3.862  24.488 2.020   1.00 19.20  ? 310 ALA A C   1 
ATOM   1324 O O   . ALA A 1 187 ? -4.629  25.126 1.288   1.00 17.93  ? 310 ALA A O   1 
ATOM   1325 C CB  . ALA A 1 187 ? -4.513  22.083 1.856   1.00 19.76  ? 310 ALA A CB  1 
ATOM   1326 N N   . SER A 1 188 ? -2.588  24.805 2.188   1.00 18.18  ? 311 SER A N   1 
ATOM   1327 C CA  . SER A 1 188 ? -1.896  25.720 1.278   1.00 17.88  ? 311 SER A CA  1 
ATOM   1328 C C   . SER A 1 188 ? -1.344  24.906 0.073   1.00 17.57  ? 311 SER A C   1 
ATOM   1329 O O   . SER A 1 188 ? -1.412  23.667 0.065   1.00 16.72  ? 311 SER A O   1 
ATOM   1330 C CB  . SER A 1 188 ? -0.747  26.355 2.042   1.00 17.44  ? 311 SER A CB  1 
ATOM   1331 O OG  . SER A 1 188 ? 0.205   25.354 2.324   1.00 18.16  ? 311 SER A OG  1 
ATOM   1332 N N   . ALA A 1 189 ? -0.765  25.581 -0.922  1.00 17.55  ? 312 ALA A N   1 
ATOM   1333 C CA  . ALA A 1 189 ? -0.113  24.856 -2.026  1.00 17.73  ? 312 ALA A CA  1 
ATOM   1334 C C   . ALA A 1 189 ? 0.984   23.952 -1.494  1.00 17.50  ? 312 ALA A C   1 
ATOM   1335 O O   . ALA A 1 189 ? 1.179   22.839 -1.998  1.00 16.91  ? 312 ALA A O   1 
ATOM   1336 C CB  . ALA A 1 189 ? 0.447   25.800 -3.062  1.00 17.53  ? 312 ALA A CB  1 
ATOM   1337 N N   . ASP A 1 190 ? 1.677   24.414 -0.458  1.00 18.27  ? 313 ASP A N   1 
ATOM   1338 C CA  . ASP A 1 190 ? 2.747   23.615 0.166   1.00 19.24  ? 313 ASP A CA  1 
ATOM   1339 C C   . ASP A 1 190 ? 2.227   22.288 0.756   1.00 18.17  ? 313 ASP A C   1 
ATOM   1340 O O   . ASP A 1 190 ? 2.916   21.283 0.720   1.00 17.85  ? 313 ASP A O   1 
ATOM   1341 C CB  . ASP A 1 190 ? 3.515   24.434 1.214   1.00 20.37  ? 313 ASP A CB  1 
ATOM   1342 C CG  . ASP A 1 190 ? 3.934   25.833 0.691   1.00 23.71  ? 313 ASP A CG  1 
ATOM   1343 O OD1 . ASP A 1 190 ? 5.135   26.075 0.590   1.00 26.86  ? 313 ASP A OD1 1 
ATOM   1344 O OD2 . ASP A 1 190 ? 3.071   26.686 0.370   1.00 25.03  ? 313 ASP A OD2 1 
ATOM   1345 N N   . ASP A 1 191 ? 1.015   22.296 1.291   1.00 17.19  ? 314 ASP A N   1 
ATOM   1346 C CA  . ASP A 1 191 ? 0.349   21.066 1.773   1.00 16.32  ? 314 ASP A CA  1 
ATOM   1347 C C   . ASP A 1 191 ? -0.216  20.222 0.612   1.00 15.90  ? 314 ASP A C   1 
ATOM   1348 O O   . ASP A 1 191 ? -0.173  18.984 0.632   1.00 16.27  ? 314 ASP A O   1 
ATOM   1349 C CB  . ASP A 1 191 ? -0.836  21.460 2.636   1.00 16.11  ? 314 ASP A CB  1 
ATOM   1350 C CG  . ASP A 1 191 ? -0.437  22.189 3.894   1.00 17.87  ? 314 ASP A CG  1 
ATOM   1351 O OD1 . ASP A 1 191 ? 0.606   21.848 4.505   1.00 19.72  ? 314 ASP A OD1 1 
ATOM   1352 O OD2 . ASP A 1 191 ? -1.195  23.100 4.299   1.00 20.48  ? 314 ASP A OD2 1 
ATOM   1353 N N   . PHE A 1 192 ? -0.760  20.910 -0.391  1.00 14.85  ? 315 PHE A N   1 
ATOM   1354 C CA  . PHE A 1 192 ? -1.576  20.270 -1.427  1.00 14.73  ? 315 PHE A CA  1 
ATOM   1355 C C   . PHE A 1 192 ? -0.727  19.512 -2.441  1.00 14.45  ? 315 PHE A C   1 
ATOM   1356 O O   . PHE A 1 192 ? -0.994  18.348 -2.742  1.00 14.69  ? 315 PHE A O   1 
ATOM   1357 C CB  . PHE A 1 192 ? -2.484  21.301 -2.140  1.00 14.78  ? 315 PHE A CB  1 
ATOM   1358 C CG  . PHE A 1 192 ? -3.281  20.718 -3.319  1.00 14.25  ? 315 PHE A CG  1 
ATOM   1359 C CD1 . PHE A 1 192 ? -4.241  19.717 -3.112  1.00 15.47  ? 315 PHE A CD1 1 
ATOM   1360 C CD2 . PHE A 1 192 ? -3.080  21.178 -4.604  1.00 16.09  ? 315 PHE A CD2 1 
ATOM   1361 C CE1 . PHE A 1 192 ? -4.969  19.176 -4.174  1.00 14.56  ? 315 PHE A CE1 1 
ATOM   1362 C CE2 . PHE A 1 192 ? -3.799  20.632 -5.693  1.00 15.82  ? 315 PHE A CE2 1 
ATOM   1363 C CZ  . PHE A 1 192 ? -4.746  19.624 -5.465  1.00 14.40  ? 315 PHE A CZ  1 
ATOM   1364 N N   . LEU A 1 193 ? 0.290   20.178 -2.972  1.00 13.91  ? 316 LEU A N   1 
ATOM   1365 C CA  . LEU A 1 193 ? 1.084   19.582 -4.034  1.00 14.16  ? 316 LEU A CA  1 
ATOM   1366 C C   . LEU A 1 193 ? 1.777   18.246 -3.671  1.00 13.99  ? 316 LEU A C   1 
ATOM   1367 O O   . LEU A 1 193 ? 1.713   17.331 -4.458  1.00 13.89  ? 316 LEU A O   1 
ATOM   1368 C CB  . LEU A 1 193 ? 2.065   20.605 -4.664  1.00 13.81  ? 316 LEU A CB  1 
ATOM   1369 C CG  . LEU A 1 193 ? 3.009   20.093 -5.753  1.00 13.59  ? 316 LEU A CG  1 
ATOM   1370 C CD1 . LEU A 1 193 ? 2.210   19.602 -6.980  1.00 13.28  ? 316 LEU A CD1 1 
ATOM   1371 C CD2 . LEU A 1 193 ? 4.020   21.196 -6.138  1.00 12.88  ? 316 LEU A CD2 1 
ATOM   1372 N N   . PRO A 1 194 ? 2.459   18.148 -2.502  1.00 14.44  ? 317 PRO A N   1 
ATOM   1373 C CA  . PRO A 1 194 ? 3.025   16.836 -2.135  1.00 14.67  ? 317 PRO A CA  1 
ATOM   1374 C C   . PRO A 1 194 ? 1.958   15.761 -1.928  1.00 14.80  ? 317 PRO A C   1 
ATOM   1375 O O   . PRO A 1 194 ? 2.208   14.587 -2.191  1.00 15.34  ? 317 PRO A O   1 
ATOM   1376 C CB  . PRO A 1 194 ? 3.739   17.094 -0.788  1.00 14.87  ? 317 PRO A CB  1 
ATOM   1377 C CG  . PRO A 1 194 ? 3.313   18.398 -0.325  1.00 14.83  ? 317 PRO A CG  1 
ATOM   1378 C CD  . PRO A 1 194 ? 2.762   19.187 -1.491  1.00 14.59  ? 317 PRO A CD  1 
ATOM   1379 N N   . THR A 1 195 ? 0.777   16.142 -1.459  1.00 14.20  ? 318 THR A N   1 
ATOM   1380 C CA  . THR A 1 195 ? -0.299  15.163 -1.328  1.00 14.42  ? 318 THR A CA  1 
ATOM   1381 C C   . THR A 1 195 ? -0.798  14.672 -2.691  1.00 14.21  ? 318 THR A C   1 
ATOM   1382 O O   . THR A 1 195 ? -1.003  13.478 -2.889  1.00 14.49  ? 318 THR A O   1 
ATOM   1383 C CB  . THR A 1 195 ? -1.451  15.715 -0.492  1.00 14.93  ? 318 THR A CB  1 
ATOM   1384 O OG1 . THR A 1 195 ? -0.892  16.321 0.679   1.00 16.72  ? 318 THR A OG1 1 
ATOM   1385 C CG2 . THR A 1 195 ? -2.436  14.584 -0.098  1.00 13.54  ? 318 THR A CG2 1 
ATOM   1386 N N   . LEU A 1 196 ? -0.959  15.582 -3.643  1.00 14.69  ? 319 LEU A N   1 
ATOM   1387 C CA  . LEU A 1 196 ? -1.346  15.184 -5.004  1.00 14.76  ? 319 LEU A CA  1 
ATOM   1388 C C   . LEU A 1 196 ? -0.266  14.313 -5.672  1.00 15.46  ? 319 LEU A C   1 
ATOM   1389 O O   . LEU A 1 196 ? -0.566  13.352 -6.370  1.00 16.51  ? 319 LEU A O   1 
ATOM   1390 C CB  . LEU A 1 196 ? -1.649  16.428 -5.854  1.00 14.58  ? 319 LEU A CB  1 
ATOM   1391 C CG  . LEU A 1 196 ? -1.942  16.079 -7.322  1.00 14.06  ? 319 LEU A CG  1 
ATOM   1392 C CD1 . LEU A 1 196 ? -3.217  15.226 -7.419  1.00 13.07  ? 319 LEU A CD1 1 
ATOM   1393 C CD2 . LEU A 1 196 ? -2.032  17.352 -8.152  1.00 14.45  ? 319 LEU A CD2 1 
ATOM   1394 N N   . ILE A 1 197 ? 0.997   14.663 -5.469  1.00 15.36  ? 320 ILE A N   1 
ATOM   1395 C CA  . ILE A 1 197 ? 2.100   13.818 -5.931  1.00 15.04  ? 320 ILE A CA  1 
ATOM   1396 C C   . ILE A 1 197 ? 1.988   12.393 -5.389  1.00 15.09  ? 320 ILE A C   1 
ATOM   1397 O O   . ILE A 1 197 ? 2.137   11.408 -6.123  1.00 14.31  ? 320 ILE A O   1 
ATOM   1398 C CB  . ILE A 1 197 ? 3.455   14.421 -5.531  1.00 14.76  ? 320 ILE A CB  1 
ATOM   1399 C CG1 . ILE A 1 197 ? 3.726   15.672 -6.372  1.00 15.64  ? 320 ILE A CG1 1 
ATOM   1400 C CG2 . ILE A 1 197 ? 4.597   13.373 -5.698  1.00 15.11  ? 320 ILE A CG2 1 
ATOM   1401 C CD1 . ILE A 1 197 ? 4.838   16.555 -5.838  1.00 14.26  ? 320 ILE A CD1 1 
ATOM   1402 N N   . TYR A 1 198 ? 1.733   12.300 -4.089  1.00 15.57  ? 321 TYR A N   1 
ATOM   1403 C CA  . TYR A 1 198 ? 1.563   11.012 -3.440  1.00 15.76  ? 321 TYR A CA  1 
ATOM   1404 C C   . TYR A 1 198 ? 0.382   10.218 -4.027  1.00 15.34  ? 321 TYR A C   1 
ATOM   1405 O O   . TYR A 1 198 ? 0.501   9.039  -4.325  1.00 15.64  ? 321 TYR A O   1 
ATOM   1406 C CB  . TYR A 1 198 ? 1.388   11.226 -1.945  1.00 17.40  ? 321 TYR A CB  1 
ATOM   1407 C CG  . TYR A 1 198 ? 1.144   9.945  -1.202  1.00 20.11  ? 321 TYR A CG  1 
ATOM   1408 C CD1 . TYR A 1 198 ? 2.137   8.961  -1.141  1.00 20.90  ? 321 TYR A CD1 1 
ATOM   1409 C CD2 . TYR A 1 198 ? -0.066  9.716  -0.555  1.00 20.40  ? 321 TYR A CD2 1 
ATOM   1410 C CE1 . TYR A 1 198 ? 1.916   7.765  -0.459  1.00 23.71  ? 321 TYR A CE1 1 
ATOM   1411 C CE2 . TYR A 1 198 ? -0.290  8.522  0.121   1.00 23.02  ? 321 TYR A CE2 1 
ATOM   1412 C CZ  . TYR A 1 198 ? 0.702   7.560  0.156   1.00 21.35  ? 321 TYR A CZ  1 
ATOM   1413 O OH  . TYR A 1 198 ? 0.495   6.386  0.830   1.00 25.14  ? 321 TYR A OH  1 
ATOM   1414 N N   . ILE A 1 199 ? -0.742  10.880 -4.232  1.00 14.46  ? 322 ILE A N   1 
ATOM   1415 C CA  . ILE A 1 199 ? -1.923  10.238 -4.820  1.00 14.11  ? 322 ILE A CA  1 
ATOM   1416 C C   . ILE A 1 199 ? -1.661  9.729  -6.218  1.00 13.97  ? 322 ILE A C   1 
ATOM   1417 O O   . ILE A 1 199 ? -2.125  8.656  -6.550  1.00 13.52  ? 322 ILE A O   1 
ATOM   1418 C CB  . ILE A 1 199 ? -3.148  11.216 -4.842  1.00 13.63  ? 322 ILE A CB  1 
ATOM   1419 C CG1 . ILE A 1 199 ? -3.537  11.608 -3.399  1.00 15.39  ? 322 ILE A CG1 1 
ATOM   1420 C CG2 . ILE A 1 199 ? -4.322  10.667 -5.687  1.00 12.41  ? 322 ILE A CG2 1 
ATOM   1421 C CD1 . ILE A 1 199 ? -4.082  10.470 -2.527  1.00 14.79  ? 322 ILE A CD1 1 
ATOM   1422 N N   . VAL A 1 200 ? -0.977  10.538 -7.042  1.00 13.94  ? 323 VAL A N   1 
ATOM   1423 C CA  . VAL A 1 200 ? -0.574  10.133 -8.377  1.00 13.73  ? 323 VAL A CA  1 
ATOM   1424 C C   . VAL A 1 200 ? 0.369   8.919  -8.330  1.00 13.58  ? 323 VAL A C   1 
ATOM   1425 O O   . VAL A 1 200 ? 0.210   7.986  -9.113  1.00 14.62  ? 323 VAL A O   1 
ATOM   1426 C CB  . VAL A 1 200 ? 0.053   11.321 -9.169  1.00 13.38  ? 323 VAL A CB  1 
ATOM   1427 C CG1 . VAL A 1 200 ? 0.731   10.827 -10.464 1.00 13.42  ? 323 VAL A CG1 1 
ATOM   1428 C CG2 . VAL A 1 200 ? -1.025  12.363 -9.482  1.00 12.95  ? 323 VAL A CG2 1 
ATOM   1429 N N   . LEU A 1 201 ? 1.343   8.932  -7.413  1.00 14.53  ? 324 LEU A N   1 
ATOM   1430 C CA  . LEU A 1 201 ? 2.277   7.788  -7.229  1.00 14.02  ? 324 LEU A CA  1 
ATOM   1431 C C   . LEU A 1 201 ? 1.521   6.520  -6.852  1.00 14.73  ? 324 LEU A C   1 
ATOM   1432 O O   . LEU A 1 201 ? 1.849   5.430  -7.324  1.00 15.20  ? 324 LEU A O   1 
ATOM   1433 C CB  . LEU A 1 201 ? 3.305   8.097  -6.140  1.00 13.66  ? 324 LEU A CB  1 
ATOM   1434 C CG  . LEU A 1 201 ? 4.422   9.075  -6.525  1.00 14.51  ? 324 LEU A CG  1 
ATOM   1435 C CD1 . LEU A 1 201 ? 5.386   9.304  -5.369  1.00 13.89  ? 324 LEU A CD1 1 
ATOM   1436 C CD2 . LEU A 1 201 ? 5.176   8.544  -7.755  1.00 15.43  ? 324 LEU A CD2 1 
ATOM   1437 N N   . LYS A 1 202 ? 0.509   6.655  -6.000  1.00 14.99  ? 325 LYS A N   1 
ATOM   1438 C CA  . LYS A 1 202 ? -0.277  5.481  -5.591  1.00 17.17  ? 325 LYS A CA  1 
ATOM   1439 C C   . LYS A 1 202 ? -1.247  5.023  -6.673  1.00 17.21  ? 325 LYS A C   1 
ATOM   1440 O O   . LYS A 1 202 ? -1.492  3.825  -6.811  1.00 17.55  ? 325 LYS A O   1 
ATOM   1441 C CB  . LYS A 1 202 ? -1.049  5.739  -4.284  1.00 17.54  ? 325 LYS A CB  1 
ATOM   1442 C CG  . LYS A 1 202 ? -0.186  6.080  -3.065  1.00 17.96  ? 325 LYS A CG  1 
ATOM   1443 C CD  . LYS A 1 202 ? 0.768   4.931  -2.712  1.00 22.02  ? 325 LYS A CD  1 
ATOM   1444 C CE  . LYS A 1 202 ? 2.121   5.152  -3.353  1.00 22.08  ? 325 LYS A CE  1 
ATOM   1445 N NZ  . LYS A 1 202 ? 3.142   4.166  -2.901  1.00 20.84  ? 325 LYS A NZ  1 
ATOM   1446 N N   . GLY A 1 203 ? -1.782  5.973  -7.437  1.00 17.11  ? 326 GLY A N   1 
ATOM   1447 C CA  . GLY A 1 203 ? -2.781  5.665  -8.463  1.00 17.59  ? 326 GLY A CA  1 
ATOM   1448 C C   . GLY A 1 203 ? -2.174  5.163  -9.765  1.00 17.74  ? 326 GLY A C   1 
ATOM   1449 O O   . GLY A 1 203 ? -2.791  4.371  -10.487 1.00 18.18  ? 326 GLY A O   1 
ATOM   1450 N N   . ASN A 1 204 ? -0.965  5.626  -10.077 1.00 17.33  ? 327 ASN A N   1 
ATOM   1451 C CA  . ASN A 1 204 ? -0.356  5.362  -11.376 1.00 17.29  ? 327 ASN A CA  1 
ATOM   1452 C C   . ASN A 1 204 ? -1.447  5.401  -12.450 1.00 17.52  ? 327 ASN A C   1 
ATOM   1453 O O   . ASN A 1 204 ? -1.683  4.408  -13.114 1.00 17.55  ? 327 ASN A O   1 
ATOM   1454 C CB  . ASN A 1 204 ? 0.416   4.011  -11.375 1.00 17.03  ? 327 ASN A CB  1 
ATOM   1455 C CG  . ASN A 1 204 ? 1.504   3.952  -12.468 1.00 17.35  ? 327 ASN A CG  1 
ATOM   1456 O OD1 . ASN A 1 204 ? 1.525   4.799  -13.377 1.00 16.06  ? 327 ASN A OD1 1 
ATOM   1457 N ND2 . ASN A 1 204 ? 2.390   2.968  -12.388 1.00 12.71  ? 327 ASN A ND2 1 
ATOM   1458 N N   . PRO A 1 205 ? -2.143  6.548  -12.593 1.00 17.42  ? 328 PRO A N   1 
ATOM   1459 C CA  . PRO A 1 205 ? -3.350  6.621  -13.435 1.00 17.66  ? 328 PRO A CA  1 
ATOM   1460 C C   . PRO A 1 205 ? -3.058  6.263  -14.882 1.00 18.04  ? 328 PRO A C   1 
ATOM   1461 O O   . PRO A 1 205 ? -2.014  6.652  -15.399 1.00 17.86  ? 328 PRO A O   1 
ATOM   1462 C CB  . PRO A 1 205 ? -3.754  8.099  -13.387 1.00 17.24  ? 328 PRO A CB  1 
ATOM   1463 C CG  . PRO A 1 205 ? -2.905  8.747  -12.401 1.00 16.49  ? 328 PRO A CG  1 
ATOM   1464 C CD  . PRO A 1 205 ? -1.815  7.840  -11.963 1.00 17.80  ? 328 PRO A CD  1 
ATOM   1465 N N   . PRO A 1 206 ? -3.974  5.530  -15.528 1.00 18.64  ? 329 PRO A N   1 
ATOM   1466 C CA  . PRO A 1 206 ? -3.755  5.095  -16.911 1.00 19.18  ? 329 PRO A CA  1 
ATOM   1467 C C   . PRO A 1 206 ? -3.598  6.278  -17.895 1.00 19.48  ? 329 PRO A C   1 
ATOM   1468 O O   . PRO A 1 206 ? -4.324  7.278  -17.807 1.00 19.34  ? 329 PRO A O   1 
ATOM   1469 C CB  . PRO A 1 206 ? -5.000  4.237  -17.223 1.00 19.44  ? 329 PRO A CB  1 
ATOM   1470 C CG  . PRO A 1 206 ? -6.035  4.652  -16.200 1.00 19.77  ? 329 PRO A CG  1 
ATOM   1471 C CD  . PRO A 1 206 ? -5.257  5.050  -14.977 1.00 17.83  ? 329 PRO A CD  1 
ATOM   1472 N N   . ARG A 1 207 ? -2.590  6.181  -18.755 1.00 19.48  ? 330 ARG A N   1 
ATOM   1473 C CA  . ARG A 1 207 ? -2.397  7.093  -19.888 1.00 20.32  ? 330 ARG A CA  1 
ATOM   1474 C C   . ARG A 1 207 ? -2.320  8.527  -19.455 1.00 19.76  ? 330 ARG A C   1 
ATOM   1475 O O   . ARG A 1 207 ? -2.968  9.426  -20.012 1.00 19.61  ? 330 ARG A O   1 
ATOM   1476 C CB  . ARG A 1 207 ? -3.502  6.881  -20.924 1.00 20.26  ? 330 ARG A CB  1 
ATOM   1477 C CG  . ARG A 1 207 ? -3.478  5.456  -21.448 1.00 23.11  ? 330 ARG A CG  1 
ATOM   1478 C CD  . ARG A 1 207 ? -4.843  5.078  -21.900 1.00 29.25  ? 330 ARG A CD  1 
ATOM   1479 N NE  . ARG A 1 207 ? -4.942  5.120  -23.341 1.00 31.61  ? 330 ARG A NE  1 
ATOM   1480 C CZ  . ARG A 1 207 ? -6.083  5.079  -24.015 1.00 32.50  ? 330 ARG A CZ  1 
ATOM   1481 N NH1 . ARG A 1 207 ? -7.253  5.042  -23.377 1.00 31.94  ? 330 ARG A NH1 1 
ATOM   1482 N NH2 . ARG A 1 207 ? -6.042  5.099  -25.339 1.00 33.67  ? 330 ARG A NH2 1 
ATOM   1483 N N   . LEU A 1 208 ? -1.512  8.726  -18.431 1.00 19.40  ? 331 LEU A N   1 
ATOM   1484 C CA  . LEU A 1 208 ? -1.431  9.989  -17.778 1.00 19.04  ? 331 LEU A CA  1 
ATOM   1485 C C   . LEU A 1 208 ? -0.976  11.135 -18.701 1.00 20.03  ? 331 LEU A C   1 
ATOM   1486 O O   . LEU A 1 208 ? -1.592  12.205 -18.704 1.00 20.02  ? 331 LEU A O   1 
ATOM   1487 C CB  . LEU A 1 208 ? -0.524  9.846  -16.557 1.00 18.83  ? 331 LEU A CB  1 
ATOM   1488 C CG  . LEU A 1 208 ? -0.315  11.017 -15.630 1.00 16.63  ? 331 LEU A CG  1 
ATOM   1489 C CD1 . LEU A 1 208 ? -1.633  11.614 -15.138 1.00 17.31  ? 331 LEU A CD1 1 
ATOM   1490 C CD2 . LEU A 1 208 ? 0.494   10.462 -14.466 1.00 18.22  ? 331 LEU A CD2 1 
ATOM   1491 N N   . GLN A 1 209 ? 0.092   10.920 -19.473 1.00 20.11  ? 332 GLN A N   1 
ATOM   1492 C CA  . GLN A 1 209 ? 0.573   11.968 -20.378 1.00 20.38  ? 332 GLN A CA  1 
ATOM   1493 C C   . GLN A 1 209 ? -0.385  12.248 -21.538 1.00 19.70  ? 332 GLN A C   1 
ATOM   1494 O O   . GLN A 1 209 ? -0.585  13.395 -21.919 1.00 19.67  ? 332 GLN A O   1 
ATOM   1495 C CB  . GLN A 1 209 ? 1.969   11.631 -20.898 1.00 20.90  ? 332 GLN A CB  1 
ATOM   1496 C CG  . GLN A 1 209 ? 3.039   11.533 -19.801 1.00 22.57  ? 332 GLN A CG  1 
ATOM   1497 C CD  . GLN A 1 209 ? 3.521   12.904 -19.332 1.00 25.61  ? 332 GLN A CD  1 
ATOM   1498 O OE1 . GLN A 1 209 ? 2.743   13.863 -19.237 1.00 27.42  ? 332 GLN A OE1 1 
ATOM   1499 N NE2 . GLN A 1 209 ? 4.799   12.995 -19.019 1.00 25.68  ? 332 GLN A NE2 1 
ATOM   1500 N N   . SER A 1 210 ? -0.973  11.193 -22.094 1.00 19.47  ? 333 SER A N   1 
ATOM   1501 C CA  . SER A 1 210 ? -2.015  11.323 -23.110 1.00 19.40  ? 333 SER A CA  1 
ATOM   1502 C C   . SER A 1 210 ? -3.204  12.153 -22.609 1.00 18.77  ? 333 SER A C   1 
ATOM   1503 O O   . SER A 1 210 ? -3.737  12.977 -23.332 1.00 17.78  ? 333 SER A O   1 
ATOM   1504 C CB  . SER A 1 210 ? -2.519  9.947  -23.555 1.00 18.73  ? 333 SER A CB  1 
ATOM   1505 O OG  . SER A 1 210 ? -1.547  9.275  -24.343 1.00 22.89  ? 333 SER A OG  1 
ATOM   1506 N N   . ASN A 1 211 ? -3.633  11.913 -21.374 1.00 17.94  ? 334 ASN A N   1 
ATOM   1507 C CA  . ASN A 1 211 ? -4.699  12.722 -20.799 1.00 17.68  ? 334 ASN A CA  1 
ATOM   1508 C C   . ASN A 1 211 ? -4.299  14.161 -20.638 1.00 17.43  ? 334 ASN A C   1 
ATOM   1509 O O   . ASN A 1 211 ? -5.071  15.043 -20.927 1.00 17.33  ? 334 ASN A O   1 
ATOM   1510 C CB  . ASN A 1 211 ? -5.158  12.138 -19.465 1.00 17.52  ? 334 ASN A CB  1 
ATOM   1511 C CG  . ASN A 1 211 ? -6.195  11.076 -19.643 1.00 16.59  ? 334 ASN A CG  1 
ATOM   1512 O OD1 . ASN A 1 211 ? -7.359  11.376 -19.863 1.00 18.34  ? 334 ASN A OD1 1 
ATOM   1513 N ND2 . ASN A 1 211 ? -5.780  9.821  -19.575 1.00 16.97  ? 334 ASN A ND2 1 
ATOM   1514 N N   . ILE A 1 212 ? -3.088  14.405 -20.170 1.00 18.44  ? 335 ILE A N   1 
ATOM   1515 C CA  . ILE A 1 212 ? -2.622  15.782 -19.983 1.00 19.78  ? 335 ILE A CA  1 
ATOM   1516 C C   . ILE A 1 212 ? -2.512  16.506 -21.340 1.00 19.97  ? 335 ILE A C   1 
ATOM   1517 O O   . ILE A 1 212 ? -3.031  17.629 -21.507 1.00 20.18  ? 335 ILE A O   1 
ATOM   1518 C CB  . ILE A 1 212 ? -1.298  15.817 -19.205 1.00 19.88  ? 335 ILE A CB  1 
ATOM   1519 C CG1 . ILE A 1 212 ? -1.549  15.461 -17.726 1.00 21.19  ? 335 ILE A CG1 1 
ATOM   1520 C CG2 . ILE A 1 212 ? -0.601  17.189 -19.352 1.00 21.21  ? 335 ILE A CG2 1 
ATOM   1521 C CD1 . ILE A 1 212 ? -0.257  15.149 -16.949 1.00 19.82  ? 335 ILE A CD1 1 
ATOM   1522 N N   . GLN A 1 213 ? -1.885  15.847 -22.312 1.00 20.94  ? 336 GLN A N   1 
ATOM   1523 C CA  . GLN A 1 213 ? -1.704  16.437 -23.650 1.00 22.03  ? 336 GLN A CA  1 
ATOM   1524 C C   . GLN A 1 213 ? -3.047  16.738 -24.312 1.00 21.79  ? 336 GLN A C   1 
ATOM   1525 O O   . GLN A 1 213 ? -3.246  17.827 -24.834 1.00 22.23  ? 336 GLN A O   1 
ATOM   1526 C CB  . GLN A 1 213 ? -0.836  15.553 -24.541 1.00 23.02  ? 336 GLN A CB  1 
ATOM   1527 C CG  . GLN A 1 213 ? 0.642   15.381 -24.073 1.00 26.82  ? 336 GLN A CG  1 
ATOM   1528 C CD  . GLN A 1 213 ? 1.497   16.622 -24.287 1.00 33.98  ? 336 GLN A CD  1 
ATOM   1529 O OE1 . GLN A 1 213 ? 1.470   17.566 -23.486 1.00 35.24  ? 336 GLN A OE1 1 
ATOM   1530 N NE2 . GLN A 1 213 ? 2.282   16.619 -25.373 1.00 37.26  ? 336 GLN A NE2 1 
ATOM   1531 N N   . TYR A 1 214 ? -3.972  15.779 -24.244 1.00 21.58  ? 337 TYR A N   1 
ATOM   1532 C CA  . TYR A 1 214 ? -5.328  15.942 -24.756 1.00 21.27  ? 337 TYR A CA  1 
ATOM   1533 C C   . TYR A 1 214 ? -6.070  17.144 -24.158 1.00 21.00  ? 337 TYR A C   1 
ATOM   1534 O O   . TYR A 1 214 ? -6.764  17.880 -24.865 1.00 20.46  ? 337 TYR A O   1 
ATOM   1535 C CB  . TYR A 1 214 ? -6.102  14.668 -24.470 1.00 21.28  ? 337 TYR A CB  1 
ATOM   1536 C CG  . TYR A 1 214 ? -7.541  14.649 -24.926 1.00 21.90  ? 337 TYR A CG  1 
ATOM   1537 C CD1 . TYR A 1 214 ? -7.864  14.527 -26.280 1.00 21.91  ? 337 TYR A CD1 1 
ATOM   1538 C CD2 . TYR A 1 214 ? -8.585  14.673 -23.997 1.00 20.86  ? 337 TYR A CD2 1 
ATOM   1539 C CE1 . TYR A 1 214 ? -9.200  14.456 -26.703 1.00 21.04  ? 337 TYR A CE1 1 
ATOM   1540 C CE2 . TYR A 1 214 ? -9.909  14.602 -24.412 1.00 21.62  ? 337 TYR A CE2 1 
ATOM   1541 C CZ  . TYR A 1 214 ? -10.199 14.509 -25.766 1.00 20.76  ? 337 TYR A CZ  1 
ATOM   1542 O OH  . TYR A 1 214 ? -11.507 14.441 -26.175 1.00 24.56  ? 337 TYR A OH  1 
ATOM   1543 N N   . ILE A 1 215 ? -5.949  17.326 -22.849 1.00 21.17  ? 338 ILE A N   1 
ATOM   1544 C CA  . ILE A 1 215 ? -6.605  18.451 -22.192 1.00 20.58  ? 338 ILE A CA  1 
ATOM   1545 C C   . ILE A 1 215 ? -5.981  19.761 -22.691 1.00 21.30  ? 338 ILE A C   1 
ATOM   1546 O O   . ILE A 1 215 ? -6.691  20.681 -23.083 1.00 21.19  ? 338 ILE A O   1 
ATOM   1547 C CB  . ILE A 1 215 ? -6.568  18.322 -20.647 1.00 20.64  ? 338 ILE A CB  1 
ATOM   1548 C CG1 . ILE A 1 215 ? -7.485  17.169 -20.186 1.00 20.81  ? 338 ILE A CG1 1 
ATOM   1549 C CG2 . ILE A 1 215 ? -7.019  19.642 -19.966 1.00 20.08  ? 338 ILE A CG2 1 
ATOM   1550 C CD1 . ILE A 1 215 ? -7.202  16.692 -18.730 1.00 20.06  ? 338 ILE A CD1 1 
ATOM   1551 N N   . THR A 1 216 ? -4.656  19.826 -22.687 1.00 21.63  ? 339 THR A N   1 
ATOM   1552 C CA  . THR A 1 216 ? -3.927  20.987 -23.190 1.00 23.09  ? 339 THR A CA  1 
ATOM   1553 C C   . THR A 1 216 ? -4.309  21.296 -24.637 1.00 23.43  ? 339 THR A C   1 
ATOM   1554 O O   . THR A 1 216 ? -4.599  22.440 -24.961 1.00 23.69  ? 339 THR A O   1 
ATOM   1555 C CB  . THR A 1 216 ? -2.413  20.746 -23.109 1.00 22.89  ? 339 THR A CB  1 
ATOM   1556 O OG1 . THR A 1 216 ? -2.068  20.498 -21.747 1.00 24.65  ? 339 THR A OG1 1 
ATOM   1557 C CG2 . THR A 1 216 ? -1.612  21.975 -23.628 1.00 23.97  ? 339 THR A CG2 1 
ATOM   1558 N N   . ARG A 1 217 ? -4.337  20.270 -25.484 1.00 23.77  ? 340 ARG A N   1 
ATOM   1559 C CA  . ARG A 1 217 ? -4.608  20.467 -26.912 1.00 24.78  ? 340 ARG A CA  1 
ATOM   1560 C C   . ARG A 1 217 ? -6.061  20.805 -27.250 1.00 25.48  ? 340 ARG A C   1 
ATOM   1561 O O   . ARG A 1 217 ? -6.312  21.545 -28.211 1.00 25.91  ? 340 ARG A O   1 
ATOM   1562 C CB  . ARG A 1 217 ? -4.213  19.229 -27.714 1.00 24.07  ? 340 ARG A CB  1 
ATOM   1563 C CG  . ARG A 1 217 ? -2.733  18.931 -27.743 1.00 23.96  ? 340 ARG A CG  1 
ATOM   1564 C CD  . ARG A 1 217 ? -2.523  17.559 -28.349 1.00 22.87  ? 340 ARG A CD  1 
ATOM   1565 N NE  . ARG A 1 217 ? -1.136  17.128 -28.262 1.00 22.24  ? 340 ARG A NE  1 
ATOM   1566 C CZ  . ARG A 1 217 ? -0.760  15.863 -28.122 1.00 23.13  ? 340 ARG A CZ  1 
ATOM   1567 N NH1 . ARG A 1 217 ? -1.663  14.887 -28.046 1.00 24.67  ? 340 ARG A NH1 1 
ATOM   1568 N NH2 . ARG A 1 217 ? 0.519   15.573 -28.049 1.00 21.89  ? 340 ARG A NH2 1 
ATOM   1569 N N   . PHE A 1 218 ? -7.012  20.238 -26.503 1.00 26.04  ? 341 PHE A N   1 
ATOM   1570 C CA  . PHE A 1 218 ? -8.417  20.218 -26.949 1.00 26.82  ? 341 PHE A CA  1 
ATOM   1571 C C   . PHE A 1 218 ? -9.466  20.757 -25.991 1.00 28.27  ? 341 PHE A C   1 
ATOM   1572 O O   . PHE A 1 218 ? -10.656 20.852 -26.342 1.00 27.94  ? 341 PHE A O   1 
ATOM   1573 C CB  . PHE A 1 218 ? -8.798  18.823 -27.442 1.00 26.05  ? 341 PHE A CB  1 
ATOM   1574 C CG  . PHE A 1 218 ? -8.077  18.435 -28.694 1.00 25.97  ? 341 PHE A CG  1 
ATOM   1575 C CD1 . PHE A 1 218 ? -8.439  18.997 -29.916 1.00 23.96  ? 341 PHE A CD1 1 
ATOM   1576 C CD2 . PHE A 1 218 ? -7.010  17.549 -28.647 1.00 24.84  ? 341 PHE A CD2 1 
ATOM   1577 C CE1 . PHE A 1 218 ? -7.751  18.680 -31.061 1.00 25.19  ? 341 PHE A CE1 1 
ATOM   1578 C CE2 . PHE A 1 218 ? -6.319  17.227 -29.783 1.00 25.43  ? 341 PHE A CE2 1 
ATOM   1579 C CZ  . PHE A 1 218 ? -6.691  17.794 -31.007 1.00 24.66  ? 341 PHE A CZ  1 
ATOM   1580 N N   . CYS A 1 219 ? -9.045  21.109 -24.782 1.00 30.30  ? 342 CYS A N   1 
ATOM   1581 C CA  . CYS A 1 219 ? -9.989  21.681 -23.832 1.00 31.57  ? 342 CYS A CA  1 
ATOM   1582 C C   . CYS A 1 219 ? -10.290 23.087 -24.298 1.00 32.52  ? 342 CYS A C   1 
ATOM   1583 O O   . CYS A 1 219 ? -9.388  23.781 -24.792 1.00 32.42  ? 342 CYS A O   1 
ATOM   1584 C CB  . CYS A 1 219 ? -9.396  21.705 -22.423 1.00 31.30  ? 342 CYS A CB  1 
ATOM   1585 S SG  . CYS A 1 219 ? -10.518 22.310 -21.183 1.00 33.21  ? 342 CYS A SG  1 
ATOM   1586 N N   . ASN A 1 220 ? -11.547 23.501 -24.174 1.00 34.35  ? 343 ASN A N   1 
ATOM   1587 C CA  . ASN A 1 220 ? -11.896 24.907 -24.372 1.00 36.69  ? 343 ASN A CA  1 
ATOM   1588 C C   . ASN A 1 220 ? -10.931 25.750 -23.530 1.00 38.42  ? 343 ASN A C   1 
ATOM   1589 O O   . ASN A 1 220 ? -10.924 25.640 -22.290 1.00 38.23  ? 343 ASN A O   1 
ATOM   1590 C CB  . ASN A 1 220 ? -13.369 25.168 -24.013 1.00 36.74  ? 343 ASN A CB  1 
ATOM   1591 C CG  . ASN A 1 220 ? -13.781 26.649 -24.148 1.00 37.11  ? 343 ASN A CG  1 
ATOM   1592 O OD1 . ASN A 1 220 ? -14.812 27.044 -23.624 1.00 39.65  ? 343 ASN A OD1 1 
ATOM   1593 N ND2 . ASN A 1 220 ? -12.985 27.453 -24.838 1.00 36.94  ? 343 ASN A ND2 1 
ATOM   1594 N N   . PRO A 1 221 ? -10.086 26.562 -24.200 1.00 40.19  ? 344 PRO A N   1 
ATOM   1595 C CA  . PRO A 1 221 ? -8.935  27.208 -23.555 1.00 41.69  ? 344 PRO A CA  1 
ATOM   1596 C C   . PRO A 1 221 ? -9.291  28.065 -22.355 1.00 43.31  ? 344 PRO A C   1 
ATOM   1597 O O   . PRO A 1 221 ? -8.431  28.308 -21.506 1.00 43.94  ? 344 PRO A O   1 
ATOM   1598 C CB  . PRO A 1 221 ? -8.332  28.074 -24.666 1.00 41.72  ? 344 PRO A CB  1 
ATOM   1599 C CG  . PRO A 1 221 ? -9.407  28.193 -25.709 1.00 41.47  ? 344 PRO A CG  1 
ATOM   1600 C CD  . PRO A 1 221 ? -10.171 26.910 -25.628 1.00 40.54  ? 344 PRO A CD  1 
ATOM   1601 N N   . SER A 1 222 ? -10.545 28.504 -22.279 1.00 44.90  ? 345 SER A N   1 
ATOM   1602 C CA  . SER A 1 222 ? -10.979 29.407 -21.221 1.00 46.44  ? 345 SER A CA  1 
ATOM   1603 C C   . SER A 1 222 ? -11.005 28.734 -19.858 1.00 47.10  ? 345 SER A C   1 
ATOM   1604 O O   . SER A 1 222 ? -10.422 29.256 -18.908 1.00 48.04  ? 345 SER A O   1 
ATOM   1605 C CB  . SER A 1 222 ? -12.346 30.011 -21.539 1.00 46.44  ? 345 SER A CB  1 
ATOM   1606 O OG  . SER A 1 222 ? -13.373 29.060 -21.342 1.00 47.71  ? 345 SER A OG  1 
ATOM   1607 N N   . ARG A 1 223 ? -11.665 27.577 -19.773 1.00 47.67  ? 346 ARG A N   1 
ATOM   1608 C CA  . ARG A 1 223 ? -11.832 26.838 -18.509 1.00 47.93  ? 346 ARG A CA  1 
ATOM   1609 C C   . ARG A 1 223 ? -10.537 26.627 -17.713 1.00 47.44  ? 346 ARG A C   1 
ATOM   1610 O O   . ARG A 1 223 ? -10.579 26.416 -16.485 1.00 47.81  ? 346 ARG A O   1 
ATOM   1611 C CB  . ARG A 1 223 ? -12.540 25.498 -18.743 1.00 48.11  ? 346 ARG A CB  1 
ATOM   1612 C CG  . ARG A 1 223 ? -12.493 24.561 -17.535 1.00 50.00  ? 346 ARG A CG  1 
ATOM   1613 C CD  . ARG A 1 223 ? -13.804 23.838 -17.309 1.00 53.80  ? 346 ARG A CD  1 
ATOM   1614 N NE  . ARG A 1 223 ? -14.779 24.689 -16.628 1.00 56.69  ? 346 ARG A NE  1 
ATOM   1615 C CZ  . ARG A 1 223 ? -15.922 24.252 -16.098 1.00 58.69  ? 346 ARG A CZ  1 
ATOM   1616 N NH1 . ARG A 1 223 ? -16.236 22.960 -16.149 1.00 58.86  ? 346 ARG A NH1 1 
ATOM   1617 N NH2 . ARG A 1 223 ? -16.751 25.104 -15.501 1.00 59.20  ? 346 ARG A NH2 1 
ATOM   1618 N N   . LEU A 1 224 ? -9.405  26.710 -18.411 1.00 46.70  ? 347 LEU A N   1 
ATOM   1619 C CA  . LEU A 1 224 ? -8.091  26.511 -17.815 1.00 46.27  ? 347 LEU A CA  1 
ATOM   1620 C C   . LEU A 1 224 ? -7.389  27.792 -17.329 1.00 46.28  ? 347 LEU A C   1 
ATOM   1621 O O   . LEU A 1 224 ? -6.334  27.720 -16.666 1.00 46.27  ? 347 LEU A O   1 
ATOM   1622 C CB  . LEU A 1 224 ? -7.179  25.779 -18.801 1.00 46.07  ? 347 LEU A CB  1 
ATOM   1623 C CG  . LEU A 1 224 ? -7.513  24.350 -19.227 1.00 45.51  ? 347 LEU A CG  1 
ATOM   1624 C CD1 . LEU A 1 224 ? -6.324  23.755 -19.969 1.00 44.83  ? 347 LEU A CD1 1 
ATOM   1625 C CD2 . LEU A 1 224 ? -7.882  23.485 -18.030 1.00 44.64  ? 347 LEU A CD2 1 
ATOM   1626 N N   . MET A 1 225 ? -7.961  28.952 -17.653 1.00 45.57  ? 348 MET A N   1 
ATOM   1627 C CA  . MET A 1 225 ? -7.223  30.221 -17.542 1.00 44.84  ? 348 MET A CA  1 
ATOM   1628 C C   . MET A 1 225 ? -7.143  30.786 -16.130 1.00 43.29  ? 348 MET A C   1 
ATOM   1629 O O   . MET A 1 225 ? -6.079  31.238 -15.702 1.00 43.44  ? 348 MET A O   1 
ATOM   1630 C CB  . MET A 1 225 ? -7.787  31.278 -18.507 1.00 45.38  ? 348 MET A CB  1 
ATOM   1631 C CG  . MET A 1 225 ? -7.541  30.984 -19.983 1.00 47.62  ? 348 MET A CG  1 
ATOM   1632 S SD  . MET A 1 225 ? -5.798  30.843 -20.457 1.00 53.84  ? 348 MET A SD  1 
ATOM   1633 C CE  . MET A 1 225 ? -5.232  32.526 -20.197 1.00 51.60  ? 348 MET A CE  1 
ATOM   1634 N N   . THR A 1 226 ? -8.272  30.777 -15.425 1.00 41.36  ? 349 THR A N   1 
ATOM   1635 C CA  . THR A 1 226 ? -8.365  31.370 -14.084 1.00 39.52  ? 349 THR A CA  1 
ATOM   1636 C C   . THR A 1 226 ? -9.060  30.461 -13.061 1.00 37.12  ? 349 THR A C   1 
ATOM   1637 O O   . THR A 1 226 ? -8.693  30.495 -11.890 1.00 37.11  ? 349 THR A O   1 
ATOM   1638 C CB  . THR A 1 226 ? -9.167  32.706 -14.092 1.00 40.05  ? 349 THR A CB  1 
ATOM   1639 O OG1 . THR A 1 226 ? -10.485 32.454 -14.603 1.00 41.15  ? 349 THR A OG1 1 
ATOM   1640 C CG2 . THR A 1 226 ? -8.456  33.815 -14.930 1.00 39.90  ? 349 THR A CG2 1 
ATOM   1641 N N   . GLY A 1 227 ? -10.076 29.699 -13.505 1.00 34.41  ? 350 GLY A N   1 
ATOM   1642 C CA  . GLY A 1 227 ? -11.054 29.009 -12.616 1.00 29.85  ? 350 GLY A CA  1 
ATOM   1643 C C   . GLY A 1 227 ? -10.466 27.771 -11.967 1.00 26.84  ? 350 GLY A C   1 
ATOM   1644 O O   . GLY A 1 227 ? -9.335  27.410 -12.264 1.00 25.94  ? 350 GLY A O   1 
ATOM   1645 N N   . GLU A 1 228 ? -11.220 27.108 -11.080 1.00 24.89  ? 351 GLU A N   1 
ATOM   1646 C CA  . GLU A 1 228 ? -10.630 26.043 -10.253 1.00 22.00  ? 351 GLU A CA  1 
ATOM   1647 C C   . GLU A 1 228 ? -10.132 24.837 -11.056 1.00 20.62  ? 351 GLU A C   1 
ATOM   1648 O O   . GLU A 1 228 ? -9.101  24.259 -10.712 1.00 19.50  ? 351 GLU A O   1 
ATOM   1649 C CB  . GLU A 1 228 ? -11.546 25.622 -9.095  1.00 21.89  ? 351 GLU A CB  1 
ATOM   1650 C CG  . GLU A 1 228 ? -12.780 24.828 -9.532  1.00 23.03  ? 351 GLU A CG  1 
ATOM   1651 C CD  . GLU A 1 228 ? -13.603 24.279 -8.376  1.00 21.92  ? 351 GLU A CD  1 
ATOM   1652 O OE1 . GLU A 1 228 ? -13.212 24.454 -7.204  1.00 21.30  ? 351 GLU A OE1 1 
ATOM   1653 O OE2 . GLU A 1 228 ? -14.634 23.641 -8.658  1.00 22.75  ? 351 GLU A OE2 1 
ATOM   1654 N N   . ASP A 1 229 ? -10.830 24.468 -12.132 1.00 18.67  ? 352 ASP A N   1 
ATOM   1655 C CA  . ASP A 1 229 ? -10.386 23.334 -12.957 1.00 18.60  ? 352 ASP A CA  1 
ATOM   1656 C C   . ASP A 1 229 ? -8.979  23.587 -13.510 1.00 18.02  ? 352 ASP A C   1 
ATOM   1657 O O   . ASP A 1 229 ? -8.172  22.666 -13.610 1.00 17.64  ? 352 ASP A O   1 
ATOM   1658 C CB  . ASP A 1 229 ? -11.354 23.060 -14.120 1.00 18.59  ? 352 ASP A CB  1 
ATOM   1659 C CG  . ASP A 1 229 ? -12.652 22.388 -13.681 1.00 20.28  ? 352 ASP A CG  1 
ATOM   1660 O OD1 . ASP A 1 229 ? -12.836 22.080 -12.481 1.00 18.08  ? 352 ASP A OD1 1 
ATOM   1661 O OD2 . ASP A 1 229 ? -13.492 22.131 -14.576 1.00 24.20  ? 352 ASP A OD2 1 
ATOM   1662 N N   . GLY A 1 230 ? -8.710  24.837 -13.888 1.00 16.95  ? 353 GLY A N   1 
ATOM   1663 C CA  . GLY A 1 230 ? -7.385  25.235 -14.366 1.00 16.60  ? 353 GLY A CA  1 
ATOM   1664 C C   . GLY A 1 230 ? -6.307  25.091 -13.308 1.00 16.15  ? 353 GLY A C   1 
ATOM   1665 O O   . GLY A 1 230 ? -5.210  24.608 -13.609 1.00 16.32  ? 353 GLY A O   1 
ATOM   1666 N N   . TYR A 1 231 ? -6.612  25.529 -12.078 1.00 15.58  ? 354 TYR A N   1 
ATOM   1667 C CA  . TYR A 1 231 ? -5.696  25.387 -10.946 1.00 15.85  ? 354 TYR A CA  1 
ATOM   1668 C C   . TYR A 1 231 ? -5.320  23.923 -10.680 1.00 15.64  ? 354 TYR A C   1 
ATOM   1669 O O   . TYR A 1 231 ? -4.141  23.592 -10.553 1.00 16.19  ? 354 TYR A O   1 
ATOM   1670 C CB  . TYR A 1 231 ? -6.258  26.020 -9.659  1.00 15.07  ? 354 TYR A CB  1 
ATOM   1671 C CG  . TYR A 1 231 ? -5.245  25.991 -8.504  1.00 16.93  ? 354 TYR A CG  1 
ATOM   1672 C CD1 . TYR A 1 231 ? -4.140  26.858 -8.494  1.00 15.85  ? 354 TYR A CD1 1 
ATOM   1673 C CD2 . TYR A 1 231 ? -5.401  25.104 -7.419  1.00 17.10  ? 354 TYR A CD2 1 
ATOM   1674 C CE1 . TYR A 1 231 ? -3.204  26.822 -7.442  1.00 14.91  ? 354 TYR A CE1 1 
ATOM   1675 C CE2 . TYR A 1 231 ? -4.462  25.053 -6.375  1.00 16.25  ? 354 TYR A CE2 1 
ATOM   1676 C CZ  . TYR A 1 231 ? -3.371  25.928 -6.406  1.00 15.92  ? 354 TYR A CZ  1 
ATOM   1677 O OH  . TYR A 1 231 ? -2.461  25.917 -5.374  1.00 16.96  ? 354 TYR A OH  1 
ATOM   1678 N N   . TYR A 1 232 ? -6.324  23.055 -10.573 1.00 15.74  ? 355 TYR A N   1 
ATOM   1679 C CA  . TYR A 1 232 ? -6.083  21.638 -10.289 1.00 15.49  ? 355 TYR A CA  1 
ATOM   1680 C C   . TYR A 1 232 ? -5.372  20.936 -11.426 1.00 15.69  ? 355 TYR A C   1 
ATOM   1681 O O   . TYR A 1 232 ? -4.487  20.116 -11.170 1.00 16.00  ? 355 TYR A O   1 
ATOM   1682 C CB  . TYR A 1 232 ? -7.390  20.934 -9.862  1.00 15.98  ? 355 TYR A CB  1 
ATOM   1683 C CG  . TYR A 1 232 ? -7.984  21.668 -8.694  1.00 16.22  ? 355 TYR A CG  1 
ATOM   1684 C CD1 . TYR A 1 232 ? -7.198  21.961 -7.584  1.00 16.68  ? 355 TYR A CD1 1 
ATOM   1685 C CD2 . TYR A 1 232 ? -9.307  22.116 -8.705  1.00 17.18  ? 355 TYR A CD2 1 
ATOM   1686 C CE1 . TYR A 1 232 ? -7.707  22.654 -6.504  1.00 15.69  ? 355 TYR A CE1 1 
ATOM   1687 C CE2 . TYR A 1 232 ? -9.828  22.817 -7.618  1.00 17.07  ? 355 TYR A CE2 1 
ATOM   1688 C CZ  . TYR A 1 232 ? -9.008  23.092 -6.529  1.00 18.04  ? 355 TYR A CZ  1 
ATOM   1689 O OH  . TYR A 1 232 ? -9.474  23.814 -5.435  1.00 18.93  ? 355 TYR A OH  1 
ATOM   1690 N N   . PHE A 1 233 ? -5.709  21.292 -12.670 1.00 14.61  ? 356 PHE A N   1 
ATOM   1691 C CA  . PHE A 1 233 ? -5.013  20.734 -13.817 1.00 14.66  ? 356 PHE A CA  1 
ATOM   1692 C C   . PHE A 1 233 ? -3.531  21.149 -13.802 1.00 14.90  ? 356 PHE A C   1 
ATOM   1693 O O   . PHE A 1 233 ? -2.634  20.322 -13.983 1.00 14.25  ? 356 PHE A O   1 
ATOM   1694 C CB  . PHE A 1 233 ? -5.675  21.162 -15.140 1.00 14.39  ? 356 PHE A CB  1 
ATOM   1695 C CG  . PHE A 1 233 ? -4.920  20.692 -16.351 1.00 14.85  ? 356 PHE A CG  1 
ATOM   1696 C CD1 . PHE A 1 233 ? -4.852  19.333 -16.653 1.00 13.74  ? 356 PHE A CD1 1 
ATOM   1697 C CD2 . PHE A 1 233 ? -4.229  21.597 -17.157 1.00 16.92  ? 356 PHE A CD2 1 
ATOM   1698 C CE1 . PHE A 1 233 ? -4.122  18.891 -17.753 1.00 16.50  ? 356 PHE A CE1 1 
ATOM   1699 C CE2 . PHE A 1 233 ? -3.499  21.165 -18.275 1.00 14.11  ? 356 PHE A CE2 1 
ATOM   1700 C CZ  . PHE A 1 233 ? -3.447  19.811 -18.565 1.00 15.49  ? 356 PHE A CZ  1 
ATOM   1701 N N   . THR A 1 234 ? -3.281  22.437 -13.572 1.00 15.69  ? 357 THR A N   1 
ATOM   1702 C CA  . THR A 1 234 ? -1.910  22.937 -13.416 1.00 16.19  ? 357 THR A CA  1 
ATOM   1703 C C   . THR A 1 234 ? -1.164  22.177 -12.340 1.00 15.72  ? 357 THR A C   1 
ATOM   1704 O O   . THR A 1 234 ? -0.005  21.830 -12.530 1.00 16.95  ? 357 THR A O   1 
ATOM   1705 C CB  . THR A 1 234 ? -1.916  24.429 -13.073 1.00 16.76  ? 357 THR A CB  1 
ATOM   1706 O OG1 . THR A 1 234 ? -2.330  25.154 -14.248 1.00 18.77  ? 357 THR A OG1 1 
ATOM   1707 C CG2 . THR A 1 234 ? -0.522  24.899 -12.602 1.00 17.55  ? 357 THR A CG2 1 
ATOM   1708 N N   . ASN A 1 235 ? -1.831  21.900 -11.225 1.00 14.87  ? 358 ASN A N   1 
ATOM   1709 C CA  . ASN A 1 235 ? -1.207  21.138 -10.151 1.00 15.26  ? 358 ASN A CA  1 
ATOM   1710 C C   . ASN A 1 235 ? -0.878  19.726 -10.570 1.00 14.62  ? 358 ASN A C   1 
ATOM   1711 O O   . ASN A 1 235 ? 0.191   19.221 -10.226 1.00 14.45  ? 358 ASN A O   1 
ATOM   1712 C CB  . ASN A 1 235 ? -2.040  21.147 -8.859  1.00 14.28  ? 358 ASN A CB  1 
ATOM   1713 C CG  . ASN A 1 235 ? -1.694  22.336 -7.992  1.00 16.85  ? 358 ASN A CG  1 
ATOM   1714 O OD1 . ASN A 1 235 ? -0.789  22.255 -7.183  1.00 16.15  ? 358 ASN A OD1 1 
ATOM   1715 N ND2 . ASN A 1 235 ? -2.344  23.480 -8.235  1.00 16.22  ? 358 ASN A ND2 1 
ATOM   1716 N N   . LEU A 1 236 ? -1.787  19.087 -11.307 1.00 14.52  ? 359 LEU A N   1 
ATOM   1717 C CA  . LEU A 1 236 ? -1.455  17.768 -11.871 1.00 14.49  ? 359 LEU A CA  1 
ATOM   1718 C C   . LEU A 1 236 ? -0.173  17.821 -12.723 1.00 14.07  ? 359 LEU A C   1 
ATOM   1719 O O   . LEU A 1 236 ? 0.701   16.944 -12.612 1.00 13.61  ? 359 LEU A O   1 
ATOM   1720 C CB  . LEU A 1 236 ? -2.627  17.192 -12.685 1.00 14.01  ? 359 LEU A CB  1 
ATOM   1721 C CG  . LEU A 1 236 ? -2.396  15.830 -13.349 1.00 13.84  ? 359 LEU A CG  1 
ATOM   1722 C CD1 . LEU A 1 236 ? -2.173  14.720 -12.294 1.00 16.49  ? 359 LEU A CD1 1 
ATOM   1723 C CD2 . LEU A 1 236 ? -3.573  15.467 -14.281 1.00 12.80  ? 359 LEU A CD2 1 
ATOM   1724 N N   . CYS A 1 237 ? -0.085  18.831 -13.590 1.00 14.32  ? 360 CYS A N   1 
ATOM   1725 C CA  . CYS A 1 237 ? 1.124   19.057 -14.393 1.00 15.02  ? 360 CYS A CA  1 
ATOM   1726 C C   . CYS A 1 237 ? 2.367   19.213 -13.533 1.00 14.15  ? 360 CYS A C   1 
ATOM   1727 O O   . CYS A 1 237 ? 3.384   18.603 -13.818 1.00 13.23  ? 360 CYS A O   1 
ATOM   1728 C CB  . CYS A 1 237 ? 0.956   20.263 -15.334 1.00 14.73  ? 360 CYS A CB  1 
ATOM   1729 S SG  . CYS A 1 237 ? -0.315  19.926 -16.624 1.00 18.72  ? 360 CYS A SG  1 
ATOM   1730 N N   . CYS A 1 238 ? 2.271   20.020 -12.478 1.00 15.00  ? 361 CYS A N   1 
ATOM   1731 C CA  . CYS A 1 238 ? 3.376   20.145 -11.487 1.00 15.81  ? 361 CYS A CA  1 
ATOM   1732 C C   . CYS A 1 238 ? 3.776   18.801 -10.818 1.00 15.22  ? 361 CYS A C   1 
ATOM   1733 O O   . CYS A 1 238 ? 4.953   18.517 -10.633 1.00 14.74  ? 361 CYS A O   1 
ATOM   1734 C CB  . CYS A 1 238 ? 3.009   21.156 -10.398 1.00 15.63  ? 361 CYS A CB  1 
ATOM   1735 S SG  . CYS A 1 238 ? 2.882   22.856 -10.985 1.00 18.09  ? 361 CYS A SG  1 
ATOM   1736 N N   . ALA A 1 239 ? 2.777   18.005 -10.444 1.00 14.88  ? 362 ALA A N   1 
ATOM   1737 C CA  . ALA A 1 239 ? 2.987   16.686 -9.850  1.00 14.63  ? 362 ALA A CA  1 
ATOM   1738 C C   . ALA A 1 239 ? 3.774   15.794 -10.803 1.00 14.63  ? 362 ALA A C   1 
ATOM   1739 O O   . ALA A 1 239 ? 4.744   15.168 -10.419 1.00 15.37  ? 362 ALA A O   1 
ATOM   1740 C CB  . ALA A 1 239 ? 1.612   16.038 -9.510  1.00 14.04  ? 362 ALA A CB  1 
ATOM   1741 N N   . VAL A 1 240 ? 3.346   15.730 -12.059 1.00 15.07  ? 363 VAL A N   1 
ATOM   1742 C CA  . VAL A 1 240 ? 3.972   14.839 -13.020 1.00 14.76  ? 363 VAL A CA  1 
ATOM   1743 C C   . VAL A 1 240 ? 5.429   15.279 -13.282 1.00 15.58  ? 363 VAL A C   1 
ATOM   1744 O O   . VAL A 1 240 ? 6.351   14.447 -13.288 1.00 15.81  ? 363 VAL A O   1 
ATOM   1745 C CB  . VAL A 1 240 ? 3.139   14.796 -14.322 1.00 15.04  ? 363 VAL A CB  1 
ATOM   1746 C CG1 . VAL A 1 240 ? 3.892   14.044 -15.433 1.00 15.55  ? 363 VAL A CG1 1 
ATOM   1747 C CG2 . VAL A 1 240 ? 1.752   14.184 -14.062 1.00 14.40  ? 363 VAL A CG2 1 
ATOM   1748 N N   . ALA A 1 241 ? 5.629   16.583 -13.476 1.00 15.56  ? 364 ALA A N   1 
ATOM   1749 C CA  . ALA A 1 241 ? 6.967   17.166 -13.659 1.00 15.83  ? 364 ALA A CA  1 
ATOM   1750 C C   . ALA A 1 241 ? 7.877   16.876 -12.467 1.00 16.13  ? 364 ALA A C   1 
ATOM   1751 O O   . ALA A 1 241 ? 9.053   16.523 -12.665 1.00 17.03  ? 364 ALA A O   1 
ATOM   1752 C CB  . ALA A 1 241 ? 6.866   18.657 -13.886 1.00 16.10  ? 364 ALA A CB  1 
ATOM   1753 N N   . PHE A 1 242 ? 7.349   16.999 -11.238 1.00 15.75  ? 365 PHE A N   1 
ATOM   1754 C CA  . PHE A 1 242 ? 8.130   16.639 -10.025 1.00 15.78  ? 365 PHE A CA  1 
ATOM   1755 C C   . PHE A 1 242 ? 8.517   15.171 -10.000 1.00 16.54  ? 365 PHE A C   1 
ATOM   1756 O O   . PHE A 1 242 ? 9.668   14.820 -9.708  1.00 17.01  ? 365 PHE A O   1 
ATOM   1757 C CB  . PHE A 1 242 ? 7.374   16.986 -8.750  1.00 14.97  ? 365 PHE A CB  1 
ATOM   1758 C CG  . PHE A 1 242 ? 8.117   16.624 -7.470  1.00 16.36  ? 365 PHE A CG  1 
ATOM   1759 C CD1 . PHE A 1 242 ? 9.051   17.494 -6.921  1.00 15.36  ? 365 PHE A CD1 1 
ATOM   1760 C CD2 . PHE A 1 242 ? 7.872   15.411 -6.821  1.00 14.85  ? 365 PHE A CD2 1 
ATOM   1761 C CE1 . PHE A 1 242 ? 9.712   17.165 -5.742  1.00 17.81  ? 365 PHE A CE1 1 
ATOM   1762 C CE2 . PHE A 1 242 ? 8.524   15.075 -5.641  1.00 17.26  ? 365 PHE A CE2 1 
ATOM   1763 C CZ  . PHE A 1 242 ? 9.447   15.956 -5.096  1.00 17.48  ? 365 PHE A CZ  1 
ATOM   1764 N N   . ILE A 1 243 ? 7.554   14.306 -10.301 1.00 17.10  ? 366 ILE A N   1 
ATOM   1765 C CA  . ILE A 1 243 ? 7.800   12.870 -10.345 1.00 17.88  ? 366 ILE A CA  1 
ATOM   1766 C C   . ILE A 1 243 ? 8.875   12.489 -11.373 1.00 19.19  ? 366 ILE A C   1 
ATOM   1767 O O   . ILE A 1 243 ? 9.729   11.646 -11.082 1.00 18.90  ? 366 ILE A O   1 
ATOM   1768 C CB  . ILE A 1 243 ? 6.480   12.080 -10.615 1.00 18.06  ? 366 ILE A CB  1 
ATOM   1769 C CG1 . ILE A 1 243 ? 5.605   12.109 -9.347  1.00 17.56  ? 366 ILE A CG1 1 
ATOM   1770 C CG2 . ILE A 1 243 ? 6.800   10.652 -11.055 1.00 15.66  ? 366 ILE A CG2 1 
ATOM   1771 C CD1 . ILE A 1 243 ? 4.101   11.817 -9.596  1.00 16.63  ? 366 ILE A CD1 1 
ATOM   1772 N N   . GLU A 1 244 ? 8.839   13.116 -12.554 1.00 20.23  ? 367 GLU A N   1 
ATOM   1773 C CA  . GLU A 1 244 ? 9.829   12.861 -13.608 1.00 22.42  ? 367 GLU A CA  1 
ATOM   1774 C C   . GLU A 1 244 ? 11.275  13.134 -13.193 1.00 22.70  ? 367 GLU A C   1 
ATOM   1775 O O   . GLU A 1 244 ? 12.160  12.359 -13.554 1.00 22.91  ? 367 GLU A O   1 
ATOM   1776 C CB  . GLU A 1 244 ? 9.500   13.650 -14.886 1.00 22.56  ? 367 GLU A CB  1 
ATOM   1777 C CG  . GLU A 1 244 ? 8.237   13.180 -15.592 1.00 23.25  ? 367 GLU A CG  1 
ATOM   1778 C CD  . GLU A 1 244 ? 7.885   14.043 -16.800 1.00 26.15  ? 367 GLU A CD  1 
ATOM   1779 O OE1 . GLU A 1 244 ? 7.895   15.299 -16.688 1.00 29.32  ? 367 GLU A OE1 1 
ATOM   1780 O OE2 . GLU A 1 244 ? 7.604   13.462 -17.873 1.00 30.87  ? 367 GLU A OE2 1 
ATOM   1781 N N   . LYS A 1 245 ? 11.503  14.200 -12.417 1.00 22.61  ? 368 LYS A N   1 
ATOM   1782 C CA  . LYS A 1 245 ? 12.861  14.636 -12.048 1.00 23.35  ? 368 LYS A CA  1 
ATOM   1783 C C   . LYS A 1 245 ? 13.259  14.324 -10.599 1.00 23.53  ? 368 LYS A C   1 
ATOM   1784 O O   . LYS A 1 245 ? 14.389  14.623 -10.187 1.00 23.37  ? 368 LYS A O   1 
ATOM   1785 C CB  . LYS A 1 245 ? 13.047  16.147 -12.288 1.00 24.23  ? 368 LYS A CB  1 
ATOM   1786 C CG  . LYS A 1 245 ? 12.572  16.668 -13.641 1.00 26.59  ? 368 LYS A CG  1 
ATOM   1787 C CD  . LYS A 1 245 ? 13.437  16.222 -14.764 1.00 33.62  ? 368 LYS A CD  1 
ATOM   1788 C CE  . LYS A 1 245 ? 12.913  16.730 -16.105 1.00 36.83  ? 368 LYS A CE  1 
ATOM   1789 N NZ  . LYS A 1 245 ? 13.931  16.427 -17.156 1.00 39.37  ? 368 LYS A NZ  1 
ATOM   1790 N N   . LEU A 1 246 ? 12.337  13.729 -9.842  1.00 23.23  ? 369 LEU A N   1 
ATOM   1791 C CA  . LEU A 1 246 ? 12.520  13.398 -8.434  1.00 23.80  ? 369 LEU A CA  1 
ATOM   1792 C C   . LEU A 1 246 ? 13.887  12.704 -8.230  1.00 23.85  ? 369 LEU A C   1 
ATOM   1793 O O   . LEU A 1 246 ? 14.233  11.799 -8.973  1.00 22.97  ? 369 LEU A O   1 
ATOM   1794 C CB  . LEU A 1 246 ? 11.369  12.473 -8.019  1.00 23.72  ? 369 LEU A CB  1 
ATOM   1795 C CG  . LEU A 1 246 ? 11.125  11.943 -6.620  1.00 23.93  ? 369 LEU A CG  1 
ATOM   1796 C CD1 . LEU A 1 246 ? 9.646   11.615 -6.468  1.00 22.20  ? 369 LEU A CD1 1 
ATOM   1797 C CD2 . LEU A 1 246 ? 11.985  10.703 -6.351  1.00 25.17  ? 369 LEU A CD2 1 
ATOM   1798 N N   . ASP A 1 247 ? 14.650  13.147 -7.235  1.00 24.38  ? 370 ASP A N   1 
ATOM   1799 C CA  . ASP A 1 247 ? 15.963  12.548 -6.939  1.00 25.18  ? 370 ASP A CA  1 
ATOM   1800 C C   . ASP A 1 247 ? 16.131  12.380 -5.440  1.00 24.89  ? 370 ASP A C   1 
ATOM   1801 O O   . ASP A 1 247 ? 15.213  12.678 -4.686  1.00 24.82  ? 370 ASP A O   1 
ATOM   1802 C CB  . ASP A 1 247 ? 17.102  13.395 -7.556  1.00 25.51  ? 370 ASP A CB  1 
ATOM   1803 C CG  . ASP A 1 247 ? 17.179  14.799 -6.981  1.00 26.44  ? 370 ASP A CG  1 
ATOM   1804 O OD1 . ASP A 1 247 ? 16.714  15.048 -5.852  1.00 30.02  ? 370 ASP A OD1 1 
ATOM   1805 O OD2 . ASP A 1 247 ? 17.741  15.675 -7.656  1.00 30.65  ? 370 ASP A OD2 1 
ATOM   1806 N N   . ALA A 1 248 ? 17.287  11.892 -4.997  1.00 25.61  ? 371 ALA A N   1 
ATOM   1807 C CA  . ALA A 1 248 ? 17.518  11.652 -3.562  1.00 25.73  ? 371 ALA A CA  1 
ATOM   1808 C C   . ALA A 1 248 ? 17.252  12.903 -2.723  1.00 26.38  ? 371 ALA A C   1 
ATOM   1809 O O   . ALA A 1 248 ? 16.645  12.839 -1.646  1.00 26.02  ? 371 ALA A O   1 
ATOM   1810 C CB  . ALA A 1 248 ? 18.945  11.161 -3.343  1.00 25.85  ? 371 ALA A CB  1 
ATOM   1811 N N   . GLN A 1 249 ? 17.730  14.038 -3.230  1.00 27.44  ? 372 GLN A N   1 
ATOM   1812 C CA  . GLN A 1 249 ? 17.614  15.329 -2.546  1.00 28.79  ? 372 GLN A CA  1 
ATOM   1813 C C   . GLN A 1 249 ? 16.141  15.760 -2.381  1.00 27.80  ? 372 GLN A C   1 
ATOM   1814 O O   . GLN A 1 249 ? 15.749  16.227 -1.310  1.00 27.32  ? 372 GLN A O   1 
ATOM   1815 C CB  . GLN A 1 249 ? 18.452  16.401 -3.283  1.00 29.61  ? 372 GLN A CB  1 
ATOM   1816 C CG  . GLN A 1 249 ? 20.008  16.174 -3.277  1.00 34.25  ? 372 GLN A CG  1 
ATOM   1817 C CD  . GLN A 1 249 ? 20.503  14.913 -4.042  1.00 39.49  ? 372 GLN A CD  1 
ATOM   1818 O OE1 . GLN A 1 249 ? 19.950  14.511 -5.083  1.00 39.98  ? 372 GLN A OE1 1 
ATOM   1819 N NE2 . GLN A 1 249 ? 21.575  14.294 -3.515  1.00 42.02  ? 372 GLN A NE2 1 
ATOM   1820 N N   . SER A 1 250 ? 15.326  15.551 -3.421  1.00 27.32  ? 373 SER A N   1 
ATOM   1821 C CA  . SER A 1 250 ? 13.849  15.755 -3.347  1.00 26.90  ? 373 SER A CA  1 
ATOM   1822 C C   . SER A 1 250 ? 13.193  15.190 -2.092  1.00 26.73  ? 373 SER A C   1 
ATOM   1823 O O   . SER A 1 250 ? 12.310  15.818 -1.490  1.00 27.13  ? 373 SER A O   1 
ATOM   1824 C CB  . SER A 1 250 ? 13.181  15.118 -4.558  1.00 26.32  ? 373 SER A CB  1 
ATOM   1825 O OG  . SER A 1 250 ? 13.787  15.611 -5.723  1.00 27.59  ? 373 SER A OG  1 
ATOM   1826 N N   . LEU A 1 251 ? 13.641  14.000 -1.697  1.00 26.13  ? 374 LEU A N   1 
ATOM   1827 C CA  . LEU A 1 251 ? 13.064  13.280 -0.590  1.00 25.85  ? 374 LEU A CA  1 
ATOM   1828 C C   . LEU A 1 251 ? 13.918  13.314 0.691   1.00 26.60  ? 374 LEU A C   1 
ATOM   1829 O O   . LEU A 1 251 ? 13.693  12.537 1.631   1.00 26.98  ? 374 LEU A O   1 
ATOM   1830 C CB  . LEU A 1 251 ? 12.805  11.841 -1.009  1.00 25.57  ? 374 LEU A CB  1 
ATOM   1831 C CG  . LEU A 1 251 ? 12.006  11.636 -2.290  1.00 25.22  ? 374 LEU A CG  1 
ATOM   1832 C CD1 . LEU A 1 251 ? 12.000  10.150 -2.649  1.00 23.78  ? 374 LEU A CD1 1 
ATOM   1833 C CD2 . LEU A 1 251 ? 10.581  12.185 -2.131  1.00 19.40  ? 374 LEU A CD2 1 
ATOM   1834 N N   . ASN A 1 252 ? 14.877  14.225 0.740   1.00 26.67  ? 375 ASN A N   1 
ATOM   1835 C CA  . ASN A 1 252 ? 15.770  14.312 1.887   1.00 27.52  ? 375 ASN A CA  1 
ATOM   1836 C C   . ASN A 1 252 ? 16.481  12.978 2.162   1.00 26.38  ? 375 ASN A C   1 
ATOM   1837 O O   . ASN A 1 252 ? 16.625  12.577 3.324   1.00 27.15  ? 375 ASN A O   1 
ATOM   1838 C CB  . ASN A 1 252 ? 14.994  14.784 3.135   1.00 28.24  ? 375 ASN A CB  1 
ATOM   1839 C CG  . ASN A 1 252 ? 14.181  16.065 2.884   1.00 31.54  ? 375 ASN A CG  1 
ATOM   1840 O OD1 . ASN A 1 252 ? 14.708  17.068 2.385   1.00 33.25  ? 375 ASN A OD1 1 
ATOM   1841 N ND2 . ASN A 1 252 ? 12.893  16.033 3.247   1.00 33.91  ? 375 ASN A ND2 1 
ATOM   1842 N N   . LEU A 1 253 ? 16.895  12.288 1.100   1.00 25.06  ? 376 LEU A N   1 
ATOM   1843 C CA  . LEU A 1 253 ? 17.609  11.008 1.252   1.00 24.49  ? 376 LEU A CA  1 
ATOM   1844 C C   . LEU A 1 253 ? 19.046  11.115 0.801   1.00 23.70  ? 376 LEU A C   1 
ATOM   1845 O O   . LEU A 1 253 ? 19.360  11.871 -0.114  1.00 23.20  ? 376 LEU A O   1 
ATOM   1846 C CB  . LEU A 1 253 ? 16.947  9.867  0.455   1.00 23.88  ? 376 LEU A CB  1 
ATOM   1847 C CG  . LEU A 1 253 ? 15.531  9.425  0.838   1.00 23.04  ? 376 LEU A CG  1 
ATOM   1848 C CD1 . LEU A 1 253 ? 14.980  8.461  -0.222  1.00 23.11  ? 376 LEU A CD1 1 
ATOM   1849 C CD2 . LEU A 1 253 ? 15.475  8.816  2.226   1.00 22.87  ? 376 LEU A CD2 1 
ATOM   1850 N N   . SER A 1 254 ? 19.905  10.314 1.422   1.00 23.44  ? 377 SER A N   1 
ATOM   1851 C CA  . SER A 1 254 ? 21.245  10.143 0.903   1.00 23.60  ? 377 SER A CA  1 
ATOM   1852 C C   . SER A 1 254 ? 21.145  9.388  -0.424  1.00 23.68  ? 377 SER A C   1 
ATOM   1853 O O   . SER A 1 254 ? 20.176  8.636  -0.658  1.00 23.34  ? 377 SER A O   1 
ATOM   1854 C CB  . SER A 1 254 ? 22.098  9.370  1.903   1.00 23.20  ? 377 SER A CB  1 
ATOM   1855 O OG  . SER A 1 254 ? 21.652  8.033  1.999   1.00 25.34  ? 377 SER A OG  1 
ATOM   1856 N N   . GLN A 1 255 ? 22.130  9.582  -1.292  1.00 23.11  ? 378 GLN A N   1 
ATOM   1857 C CA  . GLN A 1 255 ? 22.196  8.824  -2.523  1.00 24.18  ? 378 GLN A CA  1 
ATOM   1858 C C   . GLN A 1 255 ? 22.274  7.333  -2.202  1.00 24.69  ? 378 GLN A C   1 
ATOM   1859 O O   . GLN A 1 255 ? 21.690  6.528  -2.904  1.00 24.99  ? 378 GLN A O   1 
ATOM   1860 C CB  . GLN A 1 255 ? 23.380  9.250  -3.383  1.00 24.02  ? 378 GLN A CB  1 
ATOM   1861 C CG  . GLN A 1 255 ? 23.279  8.781  -4.839  1.00 24.70  ? 378 GLN A CG  1 
ATOM   1862 C CD  . GLN A 1 255 ? 22.141  9.465  -5.603  1.00 27.30  ? 378 GLN A CD  1 
ATOM   1863 O OE1 . GLN A 1 255 ? 22.048  10.690 -5.626  1.00 27.71  ? 378 GLN A OE1 1 
ATOM   1864 N NE2 . GLN A 1 255 ? 21.277  8.668  -6.240  1.00 29.04  ? 378 GLN A NE2 1 
ATOM   1865 N N   . GLU A 1 256 ? 22.971  6.975  -1.127  1.00 25.16  ? 379 GLU A N   1 
ATOM   1866 C CA  . GLU A 1 256 ? 23.042  5.575  -0.715  1.00 25.90  ? 379 GLU A CA  1 
ATOM   1867 C C   . GLU A 1 256 ? 21.634  4.954  -0.536  1.00 24.86  ? 379 GLU A C   1 
ATOM   1868 O O   . GLU A 1 256 ? 21.339  3.925  -1.123  1.00 24.28  ? 379 GLU A O   1 
ATOM   1869 C CB  . GLU A 1 256 ? 23.860  5.418  0.569   1.00 25.91  ? 379 GLU A CB  1 
ATOM   1870 C CG  . GLU A 1 256 ? 23.961  3.963  1.033   1.00 29.40  ? 379 GLU A CG  1 
ATOM   1871 C CD  . GLU A 1 256 ? 24.929  3.799  2.191   1.00 31.77  ? 379 GLU A CD  1 
ATOM   1872 O OE1 . GLU A 1 256 ? 24.554  4.113  3.336   1.00 31.95  ? 379 GLU A OE1 1 
ATOM   1873 O OE2 . GLU A 1 256 ? 26.069  3.365  1.941   1.00 35.78  ? 379 GLU A OE2 1 
ATOM   1874 N N   . ASP A 1 257 ? 20.796  5.585  0.287   1.00 24.38  ? 380 ASP A N   1 
ATOM   1875 C CA  . ASP A 1 257 ? 19.441  5.103  0.528   1.00 23.57  ? 380 ASP A CA  1 
ATOM   1876 C C   . ASP A 1 257 ? 18.570  5.160  -0.729  1.00 23.06  ? 380 ASP A C   1 
ATOM   1877 O O   . ASP A 1 257 ? 17.908  4.184  -1.062  1.00 21.72  ? 380 ASP A O   1 
ATOM   1878 C CB  . ASP A 1 257 ? 18.791  5.872  1.662   1.00 23.97  ? 380 ASP A CB  1 
ATOM   1879 C CG  . ASP A 1 257 ? 19.461  5.623  3.004   1.00 25.63  ? 380 ASP A CG  1 
ATOM   1880 O OD1 . ASP A 1 257 ? 20.239  4.649  3.138   1.00 26.27  ? 380 ASP A OD1 1 
ATOM   1881 O OD2 . ASP A 1 257 ? 19.199  6.412  3.935   1.00 28.53  ? 380 ASP A OD2 1 
ATOM   1882 N N   . PHE A 1 258 ? 18.565  6.297  -1.423  1.00 22.48  ? 381 PHE A N   1 
ATOM   1883 C CA  . PHE A 1 258 ? 17.770  6.430  -2.657  1.00 21.84  ? 381 PHE A CA  1 
ATOM   1884 C C   . PHE A 1 258 ? 18.061  5.274  -3.632  1.00 22.08  ? 381 PHE A C   1 
ATOM   1885 O O   . PHE A 1 258 ? 17.128  4.622  -4.111  1.00 21.52  ? 381 PHE A O   1 
ATOM   1886 C CB  . PHE A 1 258 ? 18.002  7.803  -3.319  1.00 21.44  ? 381 PHE A CB  1 
ATOM   1887 C CG  . PHE A 1 258 ? 17.148  8.057  -4.535  1.00 21.40  ? 381 PHE A CG  1 
ATOM   1888 C CD1 . PHE A 1 258 ? 15.864  8.582  -4.408  1.00 21.56  ? 381 PHE A CD1 1 
ATOM   1889 C CD2 . PHE A 1 258 ? 17.628  7.791  -5.806  1.00 21.15  ? 381 PHE A CD2 1 
ATOM   1890 C CE1 . PHE A 1 258 ? 15.064  8.819  -5.540  1.00 18.86  ? 381 PHE A CE1 1 
ATOM   1891 C CE2 . PHE A 1 258 ? 16.846  8.052  -6.932  1.00 20.47  ? 381 PHE A CE2 1 
ATOM   1892 C CZ  . PHE A 1 258 ? 15.553  8.552  -6.781  1.00 21.14  ? 381 PHE A CZ  1 
ATOM   1893 N N   . ASP A 1 259 ? 19.345  5.033  -3.923  1.00 21.73  ? 382 ASP A N   1 
ATOM   1894 C CA  . ASP A 1 259 ? 19.764  3.953  -4.821  1.00 22.59  ? 382 ASP A CA  1 
ATOM   1895 C C   . ASP A 1 259 ? 19.327  2.556  -4.340  1.00 22.55  ? 382 ASP A C   1 
ATOM   1896 O O   . ASP A 1 259 ? 18.888  1.735  -5.157  1.00 22.22  ? 382 ASP A O   1 
ATOM   1897 C CB  . ASP A 1 259 ? 21.286  3.935  -5.013  1.00 23.36  ? 382 ASP A CB  1 
ATOM   1898 C CG  . ASP A 1 259 ? 21.803  5.040  -5.950  1.00 25.70  ? 382 ASP A CG  1 
ATOM   1899 O OD1 . ASP A 1 259 ? 21.017  5.733  -6.630  1.00 26.72  ? 382 ASP A OD1 1 
ATOM   1900 O OD2 . ASP A 1 259 ? 23.039  5.203  -5.996  1.00 28.65  ? 382 ASP A OD2 1 
ATOM   1901 N N   . ARG A 1 260 ? 19.474  2.286  -3.040  1.00 21.95  ? 383 ARG A N   1 
ATOM   1902 C CA  . ARG A 1 260 ? 18.934  1.058  -2.432  1.00 23.45  ? 383 ARG A CA  1 
ATOM   1903 C C   . ARG A 1 260 ? 17.424  0.864  -2.648  1.00 22.32  ? 383 ARG A C   1 
ATOM   1904 O O   . ARG A 1 260 ? 16.969  -0.218 -3.007  1.00 22.29  ? 383 ARG A O   1 
ATOM   1905 C CB  . ARG A 1 260 ? 19.234  1.012  -0.929  1.00 22.78  ? 383 ARG A CB  1 
ATOM   1906 C CG  . ARG A 1 260 ? 20.619  0.474  -0.608  1.00 25.45  ? 383 ARG A CG  1 
ATOM   1907 C CD  . ARG A 1 260 ? 21.033  0.704  0.855   1.00 25.65  ? 383 ARG A CD  1 
ATOM   1908 N NE  . ARG A 1 260 ? 22.472  0.467  0.980   1.00 33.00  ? 383 ARG A NE  1 
ATOM   1909 C CZ  . ARG A 1 260 ? 23.173  0.549  2.110   1.00 35.17  ? 383 ARG A CZ  1 
ATOM   1910 N NH1 . ARG A 1 260 ? 22.582  0.868  3.251   1.00 35.75  ? 383 ARG A NH1 1 
ATOM   1911 N NH2 . ARG A 1 260 ? 24.483  0.306  2.091   1.00 37.73  ? 383 ARG A NH2 1 
ATOM   1912 N N   . TYR A 1 261 ? 16.653  1.917  -2.421  1.00 21.69  ? 384 TYR A N   1 
ATOM   1913 C CA  . TYR A 1 261 ? 15.199  1.853  -2.605  1.00 21.02  ? 384 TYR A CA  1 
ATOM   1914 C C   . TYR A 1 261 ? 14.820  1.658  -4.071  1.00 20.45  ? 384 TYR A C   1 
ATOM   1915 O O   . TYR A 1 261 ? 13.919  0.870  -4.382  1.00 19.43  ? 384 TYR A O   1 
ATOM   1916 C CB  . TYR A 1 261 ? 14.535  3.104  -2.030  1.00 20.92  ? 384 TYR A CB  1 
ATOM   1917 C CG  . TYR A 1 261 ? 14.806  3.312  -0.573  1.00 21.13  ? 384 TYR A CG  1 
ATOM   1918 C CD1 . TYR A 1 261 ? 15.042  2.229  0.278   1.00 20.34  ? 384 TYR A CD1 1 
ATOM   1919 C CD2 . TYR A 1 261 ? 14.807  4.587  -0.025  1.00 22.33  ? 384 TYR A CD2 1 
ATOM   1920 C CE1 . TYR A 1 261 ? 15.302  2.417  1.631   1.00 23.57  ? 384 TYR A CE1 1 
ATOM   1921 C CE2 . TYR A 1 261 ? 15.044  4.788  1.338   1.00 21.34  ? 384 TYR A CE2 1 
ATOM   1922 C CZ  . TYR A 1 261 ? 15.296  3.710  2.152   1.00 22.45  ? 384 TYR A CZ  1 
ATOM   1923 O OH  . TYR A 1 261 ? 15.525  3.913  3.491   1.00 24.01  ? 384 TYR A OH  1 
ATOM   1924 N N   . MET A 1 262 ? 15.529  2.359  -4.952  1.00 20.00  ? 385 MET A N   1 
ATOM   1925 C CA  . MET A 1 262 ? 15.297  2.291  -6.382  1.00 20.82  ? 385 MET A CA  1 
ATOM   1926 C C   . MET A 1 262 ? 15.535  0.897  -6.964  1.00 21.43  ? 385 MET A C   1 
ATOM   1927 O O   . MET A 1 262 ? 14.977  0.573  -8.025  1.00 21.20  ? 385 MET A O   1 
ATOM   1928 C CB  . MET A 1 262 ? 16.184  3.296  -7.129  1.00 20.91  ? 385 MET A CB  1 
ATOM   1929 C CG  . MET A 1 262 ? 15.679  4.748  -7.133  1.00 22.49  ? 385 MET A CG  1 
ATOM   1930 S SD  . MET A 1 262 ? 14.000  5.027  -7.759  1.00 22.49  ? 385 MET A SD  1 
ATOM   1931 C CE  . MET A 1 262 ? 14.218  4.747  -9.507  1.00 22.51  ? 385 MET A CE  1 
ATOM   1932 N N   . SER A 1 263 ? 16.385  0.097  -6.290  1.00 21.65  ? 386 SER A N   1 
ATOM   1933 C CA  . SER A 1 263 ? 16.722  -1.270 -6.736  1.00 21.29  ? 386 SER A CA  1 
ATOM   1934 C C   . SER A 1 263 ? 15.529  -2.204 -6.633  1.00 21.82  ? 386 SER A C   1 
ATOM   1935 O O   . SER A 1 263 ? 15.513  -3.275 -7.271  1.00 21.39  ? 386 SER A O   1 
ATOM   1936 C CB  . SER A 1 263 ? 17.893  -1.858 -5.939  1.00 20.93  ? 386 SER A CB  1 
ATOM   1937 O OG  . SER A 1 263 ? 17.540  -2.258 -4.619  1.00 19.96  ? 386 SER A OG  1 
ATOM   1938 N N   . GLY A 1 264 ? 14.541  -1.788 -5.826  1.00 21.45  ? 387 GLY A N   1 
ATOM   1939 C CA  . GLY A 1 264 ? 13.357  -2.585 -5.535  1.00 20.79  ? 387 GLY A CA  1 
ATOM   1940 C C   . GLY A 1 264 ? 13.620  -3.704 -4.536  1.00 21.02  ? 387 GLY A C   1 
ATOM   1941 O O   . GLY A 1 264 ? 12.732  -4.519 -4.270  1.00 19.45  ? 387 GLY A O   1 
ATOM   1942 N N   . GLN A 1 265 ? 14.834  -3.735 -3.967  1.00 21.76  ? 388 GLN A N   1 
ATOM   1943 C CA  . GLN A 1 265 ? 15.255  -4.828 -3.083  1.00 22.40  ? 388 GLN A CA  1 
ATOM   1944 C C   . GLN A 1 265 ? 15.122  -4.513 -1.612  1.00 23.72  ? 388 GLN A C   1 
ATOM   1945 O O   . GLN A 1 265 ? 15.271  -5.401 -0.766  1.00 23.26  ? 388 GLN A O   1 
ATOM   1946 C CB  . GLN A 1 265 ? 16.702  -5.255 -3.379  1.00 22.50  ? 388 GLN A CB  1 
ATOM   1947 C CG  . GLN A 1 265 ? 16.956  -5.624 -4.817  1.00 22.17  ? 388 GLN A CG  1 
ATOM   1948 C CD  . GLN A 1 265 ? 16.169  -6.835 -5.239  1.00 25.11  ? 388 GLN A CD  1 
ATOM   1949 O OE1 . GLN A 1 265 ? 16.061  -7.793 -4.491  1.00 29.54  ? 388 GLN A OE1 1 
ATOM   1950 N NE2 . GLN A 1 265 ? 15.648  -6.816 -6.447  1.00 25.79  ? 388 GLN A NE2 1 
ATOM   1951 N N   . THR A 1 266 ? 14.823  -3.255 -1.302  1.00 25.05  ? 389 THR A N   1 
ATOM   1952 C CA  . THR A 1 266 ? 14.864  -2.773 0.072   1.00 26.47  ? 389 THR A CA  1 
ATOM   1953 C C   . THR A 1 266 ? 13.613  -1.974 0.411   1.00 26.82  ? 389 THR A C   1 
ATOM   1954 O O   . THR A 1 266 ? 13.229  -1.078 -0.338  1.00 26.47  ? 389 THR A O   1 
ATOM   1955 C CB  . THR A 1 266 ? 16.082  -1.793 0.257   1.00 27.31  ? 389 THR A CB  1 
ATOM   1956 O OG1 . THR A 1 266 ? 17.226  -2.280 -0.470  1.00 29.60  ? 389 THR A OG1 1 
ATOM   1957 C CG2 . THR A 1 266 ? 16.421  -1.584 1.741   1.00 27.21  ? 389 THR A CG2 1 
ATOM   1958 N N   . SER A 1 267 ? 13.005  -2.285 1.548   1.00 27.84  ? 390 SER A N   1 
ATOM   1959 C CA  . SER A 1 267 ? 11.920  -1.482 2.125   1.00 29.45  ? 390 SER A CA  1 
ATOM   1960 C C   . SER A 1 267 ? 12.472  -0.292 2.960   1.00 29.93  ? 390 SER A C   1 
ATOM   1961 O O   . SER A 1 267 ? 13.360  -0.487 3.790   1.00 29.66  ? 390 SER A O   1 
ATOM   1962 C CB  . SER A 1 267 ? 11.052  -2.381 3.004   1.00 29.35  ? 390 SER A CB  1 
ATOM   1963 O OG  . SER A 1 267 ? 9.707   -1.942 3.029   1.00 32.35  ? 390 SER A OG  1 
ATOM   1964 N N   . PRO A 1 268 ? 11.989  0.948  2.707   1.00 30.16  ? 391 PRO A N   1 
ATOM   1965 C CA  . PRO A 1 268 ? 12.315  2.057  3.617   1.00 30.64  ? 391 PRO A CA  1 
ATOM   1966 C C   . PRO A 1 268 ? 11.991  1.741  5.088   1.00 30.83  ? 391 PRO A C   1 
ATOM   1967 O O   . PRO A 1 268 ? 10.941  1.137  5.363   1.00 31.52  ? 391 PRO A O   1 
ATOM   1968 C CB  . PRO A 1 268 ? 11.419  3.197  3.105   1.00 30.72  ? 391 PRO A CB  1 
ATOM   1969 C CG  . PRO A 1 268 ? 11.320  2.930  1.641   1.00 30.04  ? 391 PRO A CG  1 
ATOM   1970 C CD  . PRO A 1 268 ? 11.189  1.416  1.556   1.00 30.21  ? 391 PRO A CD  1 
ATOM   1971 N N   . ALA B 2 4   ? -16.261 42.134 -16.606 1.00 45.80  ? 17  ALA B N   1 
ATOM   1972 C CA  . ALA B 2 4   ? -15.553 41.859 -17.903 1.00 45.32  ? 17  ALA B CA  1 
ATOM   1973 C C   . ALA B 2 4   ? -14.130 41.286 -17.714 1.00 44.66  ? 17  ALA B C   1 
ATOM   1974 O O   . ALA B 2 4   ? -13.785 40.265 -18.319 1.00 44.72  ? 17  ALA B O   1 
ATOM   1975 C CB  . ALA B 2 4   ? -15.540 43.123 -18.790 1.00 45.20  ? 17  ALA B CB  1 
ATOM   1976 N N   . TYR B 2 5   ? -13.324 41.932 -16.869 1.00 43.98  ? 18  TYR B N   1 
ATOM   1977 C CA  . TYR B 2 5   ? -11.962 41.461 -16.546 1.00 42.85  ? 18  TYR B CA  1 
ATOM   1978 C C   . TYR B 2 5   ? -11.912 40.187 -15.680 1.00 41.45  ? 18  TYR B C   1 
ATOM   1979 O O   . TYR B 2 5   ? -12.593 40.086 -14.643 1.00 41.10  ? 18  TYR B O   1 
ATOM   1980 C CB  . TYR B 2 5   ? -11.170 42.544 -15.807 1.00 43.85  ? 18  TYR B CB  1 
ATOM   1981 C CG  . TYR B 2 5   ? -10.987 43.850 -16.533 1.00 44.90  ? 18  TYR B CG  1 
ATOM   1982 C CD1 . TYR B 2 5   ? -10.012 43.988 -17.522 1.00 45.32  ? 18  TYR B CD1 1 
ATOM   1983 C CD2 . TYR B 2 5   ? -11.768 44.962 -16.204 1.00 46.22  ? 18  TYR B CD2 1 
ATOM   1984 C CE1 . TYR B 2 5   ? -9.829  45.193 -18.182 1.00 46.29  ? 18  TYR B CE1 1 
ATOM   1985 C CE2 . TYR B 2 5   ? -11.593 46.180 -16.855 1.00 46.04  ? 18  TYR B CE2 1 
ATOM   1986 C CZ  . TYR B 2 5   ? -10.622 46.284 -17.847 1.00 46.17  ? 18  TYR B CZ  1 
ATOM   1987 O OH  . TYR B 2 5   ? -10.432 47.483 -18.497 1.00 46.45  ? 18  TYR B OH  1 
ATOM   1988 N N   . SER B 2 6   ? -11.084 39.233 -16.106 1.00 39.48  ? 19  SER B N   1 
ATOM   1989 C CA  . SER B 2 6   ? -10.743 38.049 -15.307 1.00 37.84  ? 19  SER B CA  1 
ATOM   1990 C C   . SER B 2 6   ? -9.227  37.972 -15.123 1.00 36.26  ? 19  SER B C   1 
ATOM   1991 O O   . SER B 2 6   ? -8.471  37.922 -16.111 1.00 36.08  ? 19  SER B O   1 
ATOM   1992 C CB  . SER B 2 6   ? -11.255 36.771 -15.970 1.00 38.09  ? 19  SER B CB  1 
ATOM   1993 O OG  . SER B 2 6   ? -12.539 36.415 -15.469 1.00 40.01  ? 19  SER B OG  1 
ATOM   1994 N N   . PHE B 2 7   ? -8.778  37.966 -13.867 1.00 33.72  ? 20  PHE B N   1 
ATOM   1995 C CA  . PHE B 2 7   ? -7.339  38.015 -13.592 1.00 31.54  ? 20  PHE B CA  1 
ATOM   1996 C C   . PHE B 2 7   ? -6.815  36.798 -12.817 1.00 29.71  ? 20  PHE B C   1 
ATOM   1997 O O   . PHE B 2 7   ? -7.385  36.411 -11.805 1.00 28.71  ? 20  PHE B O   1 
ATOM   1998 C CB  . PHE B 2 7   ? -6.967  39.317 -12.858 1.00 31.67  ? 20  PHE B CB  1 
ATOM   1999 C CG  . PHE B 2 7   ? -7.178  40.569 -13.675 1.00 31.57  ? 20  PHE B CG  1 
ATOM   2000 C CD1 . PHE B 2 7   ? -6.627  40.693 -14.952 1.00 32.27  ? 20  PHE B CD1 1 
ATOM   2001 C CD2 . PHE B 2 7   ? -7.887  41.642 -13.148 1.00 32.34  ? 20  PHE B CD2 1 
ATOM   2002 C CE1 . PHE B 2 7   ? -6.810  41.849 -15.705 1.00 32.09  ? 20  PHE B CE1 1 
ATOM   2003 C CE2 . PHE B 2 7   ? -8.069  42.806 -13.884 1.00 31.84  ? 20  PHE B CE2 1 
ATOM   2004 C CZ  . PHE B 2 7   ? -7.524  42.911 -15.166 1.00 32.11  ? 20  PHE B CZ  1 
ATOM   2005 N N   . LYS B 2 8   ? -5.725  36.213 -13.318 1.00 27.73  ? 21  LYS B N   1 
ATOM   2006 C CA  . LYS B 2 8   ? -4.987  35.172 -12.604 1.00 26.02  ? 21  LYS B CA  1 
ATOM   2007 C C   . LYS B 2 8   ? -3.848  35.810 -11.811 1.00 24.97  ? 21  LYS B C   1 
ATOM   2008 O O   . LYS B 2 8   ? -2.997  36.489 -12.374 1.00 25.16  ? 21  LYS B O   1 
ATOM   2009 C CB  . LYS B 2 8   ? -4.434  34.133 -13.582 1.00 25.59  ? 21  LYS B CB  1 
ATOM   2010 C CG  . LYS B 2 8   ? -3.491  33.115 -12.936 1.00 23.19  ? 21  LYS B CG  1 
ATOM   2011 C CD  . LYS B 2 8   ? -2.994  32.106 -13.932 1.00 19.79  ? 21  LYS B CD  1 
ATOM   2012 C CE  . LYS B 2 8   ? -1.907  31.211 -13.324 1.00 18.27  ? 21  LYS B CE  1 
ATOM   2013 N NZ  . LYS B 2 8   ? -1.599  30.140 -14.303 1.00 14.93  ? 21  LYS B NZ  1 
ATOM   2014 N N   . VAL B 2 9   ? -3.840  35.586 -10.503 1.00 24.50  ? 22  VAL B N   1 
ATOM   2015 C CA  . VAL B 2 9   ? -2.789  36.109 -9.622  1.00 22.80  ? 22  VAL B CA  1 
ATOM   2016 C C   . VAL B 2 9   ? -2.099  34.959 -8.861  1.00 21.84  ? 22  VAL B C   1 
ATOM   2017 O O   . VAL B 2 9   ? -2.742  34.235 -8.083  1.00 21.42  ? 22  VAL B O   1 
ATOM   2018 C CB  . VAL B 2 9   ? -3.367  37.134 -8.639  1.00 23.16  ? 22  VAL B CB  1 
ATOM   2019 C CG1 . VAL B 2 9   ? -2.327  37.553 -7.590  1.00 22.44  ? 22  VAL B CG1 1 
ATOM   2020 C CG2 . VAL B 2 9   ? -3.918  38.335 -9.398  1.00 22.16  ? 22  VAL B CG2 1 
ATOM   2021 N N   . VAL B 2 10  ? -0.806  34.770 -9.109  1.00 20.31  ? 23  VAL B N   1 
ATOM   2022 C CA  . VAL B 2 10  ? -0.061  33.731 -8.374  1.00 19.52  ? 23  VAL B CA  1 
ATOM   2023 C C   . VAL B 2 10  ? 0.424   34.297 -7.020  1.00 19.48  ? 23  VAL B C   1 
ATOM   2024 O O   . VAL B 2 10  ? 0.785   35.478 -6.930  1.00 19.40  ? 23  VAL B O   1 
ATOM   2025 C CB  . VAL B 2 10  ? 1.066   33.062 -9.223  1.00 19.79  ? 23  VAL B CB  1 
ATOM   2026 C CG1 . VAL B 2 10  ? 0.480   32.182 -10.348 1.00 17.33  ? 23  VAL B CG1 1 
ATOM   2027 C CG2 . VAL B 2 10  ? 2.008   34.089 -9.816  1.00 19.34  ? 23  VAL B CG2 1 
ATOM   2028 N N   . LEU B 2 11  ? 0.375   33.459 -5.975  1.00 18.51  ? 24  LEU B N   1 
ATOM   2029 C CA  . LEU B 2 11  ? 0.837   33.790 -4.631  1.00 17.20  ? 24  LEU B CA  1 
ATOM   2030 C C   . LEU B 2 11  ? 2.139   33.033 -4.323  1.00 16.99  ? 24  LEU B C   1 
ATOM   2031 O O   . LEU B 2 11  ? 2.182   31.805 -4.404  1.00 15.28  ? 24  LEU B O   1 
ATOM   2032 C CB  . LEU B 2 11  ? -0.259  33.457 -3.594  1.00 17.35  ? 24  LEU B CB  1 
ATOM   2033 C CG  . LEU B 2 11  ? 0.023   33.647 -2.089  1.00 17.79  ? 24  LEU B CG  1 
ATOM   2034 C CD1 . LEU B 2 11  ? 0.221   35.128 -1.737  1.00 17.42  ? 24  LEU B CD1 1 
ATOM   2035 C CD2 . LEU B 2 11  ? -1.101  33.088 -1.278  1.00 16.28  ? 24  LEU B CD2 1 
ATOM   2036 N N   . LEU B 2 12  ? 3.213   33.772 -4.019  1.00 16.77  ? 25  LEU B N   1 
ATOM   2037 C CA  . LEU B 2 12  ? 4.524   33.144 -3.801  1.00 17.46  ? 25  LEU B CA  1 
ATOM   2038 C C   . LEU B 2 12  ? 5.012   33.357 -2.369  1.00 18.03  ? 25  LEU B C   1 
ATOM   2039 O O   . LEU B 2 12  ? 4.745   34.399 -1.761  1.00 17.76  ? 25  LEU B O   1 
ATOM   2040 C CB  . LEU B 2 12  ? 5.574   33.643 -4.810  1.00 17.67  ? 25  LEU B CB  1 
ATOM   2041 C CG  . LEU B 2 12  ? 5.411   33.253 -6.283  1.00 18.70  ? 25  LEU B CG  1 
ATOM   2042 C CD1 . LEU B 2 12  ? 4.321   34.062 -6.962  1.00 16.56  ? 25  LEU B CD1 1 
ATOM   2043 C CD2 . LEU B 2 12  ? 6.703   33.452 -7.007  1.00 18.55  ? 25  LEU B CD2 1 
ATOM   2044 N N   . GLY B 2 13  ? 5.704   32.353 -1.834  1.00 18.40  ? 26  GLY B N   1 
ATOM   2045 C CA  . GLY B 2 13  ? 6.229   32.404 -0.480  1.00 18.90  ? 26  GLY B CA  1 
ATOM   2046 C C   . GLY B 2 13  ? 6.128   31.021 0.163   1.00 20.02  ? 26  GLY B C   1 
ATOM   2047 O O   . GLY B 2 13  ? 5.289   30.216 -0.217  1.00 19.43  ? 26  GLY B O   1 
ATOM   2048 N N   . GLU B 2 14  ? 7.007   30.730 1.111   1.00 21.01  ? 27  GLU B N   1 
ATOM   2049 C CA  . GLU B 2 14  ? 6.808   29.566 1.973   1.00 23.37  ? 27  GLU B CA  1 
ATOM   2050 C C   . GLU B 2 14  ? 5.750   29.869 3.022   1.00 22.73  ? 27  GLU B C   1 
ATOM   2051 O O   . GLU B 2 14  ? 5.535   31.016 3.377   1.00 22.65  ? 27  GLU B O   1 
ATOM   2052 C CB  . GLU B 2 14  ? 8.103   29.145 2.666   1.00 23.36  ? 27  GLU B CB  1 
ATOM   2053 C CG  . GLU B 2 14  ? 9.069   28.390 1.789   1.00 25.68  ? 27  GLU B CG  1 
ATOM   2054 C CD  . GLU B 2 14  ? 10.341  27.991 2.545   1.00 27.51  ? 27  GLU B CD  1 
ATOM   2055 O OE1 . GLU B 2 14  ? 10.939  28.851 3.240   1.00 31.96  ? 27  GLU B OE1 1 
ATOM   2056 O OE2 . GLU B 2 14  ? 10.723  26.806 2.461   1.00 32.89  ? 27  GLU B OE2 1 
ATOM   2057 N N   . GLY B 2 15  ? 5.088   28.820 3.501   1.00 23.07  ? 28  GLY B N   1 
ATOM   2058 C CA  . GLY B 2 15  ? 4.125   28.903 4.597   1.00 22.96  ? 28  GLY B CA  1 
ATOM   2059 C C   . GLY B 2 15  ? 4.533   29.756 5.774   1.00 23.21  ? 28  GLY B C   1 
ATOM   2060 O O   . GLY B 2 15  ? 3.698   30.484 6.336   1.00 23.71  ? 28  GLY B O   1 
ATOM   2061 N N   . CYS B 2 16  ? 5.812   29.712 6.137   1.00 22.70  ? 29  CYS B N   1 
ATOM   2062 C CA  . CYS B 2 16  ? 6.289   30.446 7.325   1.00 23.35  ? 29  CYS B CA  1 
ATOM   2063 C C   . CYS B 2 16  ? 6.348   31.981 7.162   1.00 22.61  ? 29  CYS B C   1 
ATOM   2064 O O   . CYS B 2 16  ? 6.549   32.692 8.154   1.00 23.04  ? 29  CYS B O   1 
ATOM   2065 C CB  . CYS B 2 16  ? 7.656   29.909 7.768   1.00 23.60  ? 29  CYS B CB  1 
ATOM   2066 S SG  . CYS B 2 16  ? 8.934   30.111 6.477   1.00 27.63  ? 29  CYS B SG  1 
ATOM   2067 N N   . VAL B 2 17  ? 6.199   32.504 5.938   1.00 20.88  ? 30  VAL B N   1 
ATOM   2068 C CA  . VAL B 2 17  ? 6.146   33.971 5.761   1.00 19.49  ? 30  VAL B CA  1 
ATOM   2069 C C   . VAL B 2 17  ? 4.736   34.524 6.002   1.00 19.53  ? 30  VAL B C   1 
ATOM   2070 O O   . VAL B 2 17  ? 4.523   35.742 5.974   1.00 18.82  ? 30  VAL B O   1 
ATOM   2071 C CB  . VAL B 2 17  ? 6.707   34.461 4.387   1.00 19.56  ? 30  VAL B CB  1 
ATOM   2072 C CG1 . VAL B 2 17  ? 8.124   33.892 4.152   1.00 18.48  ? 30  VAL B CG1 1 
ATOM   2073 C CG2 . VAL B 2 17  ? 5.774   34.096 3.239   1.00 15.76  ? 30  VAL B CG2 1 
ATOM   2074 N N   . GLY B 2 18  ? 3.789   33.622 6.253   1.00 19.34  ? 31  GLY B N   1 
ATOM   2075 C CA  . GLY B 2 18  ? 2.430   33.997 6.637   1.00 19.78  ? 31  GLY B CA  1 
ATOM   2076 C C   . GLY B 2 18  ? 1.542   34.363 5.461   1.00 20.80  ? 31  GLY B C   1 
ATOM   2077 O O   . GLY B 2 18  ? 0.529   35.062 5.648   1.00 21.33  ? 31  GLY B O   1 
ATOM   2078 N N   . LYS B 2 19  ? 1.890   33.870 4.263   1.00 20.10  ? 32  LYS B N   1 
ATOM   2079 C CA  . LYS B 2 19  ? 1.094   34.116 3.051   1.00 20.76  ? 32  LYS B CA  1 
ATOM   2080 C C   . LYS B 2 19  ? -0.357  33.616 3.145   1.00 21.38  ? 32  LYS B C   1 
ATOM   2081 O O   . LYS B 2 19  ? -1.270  34.214 2.549   1.00 20.98  ? 32  LYS B O   1 
ATOM   2082 C CB  . LYS B 2 19  ? 1.743   33.473 1.816   1.00 20.65  ? 32  LYS B CB  1 
ATOM   2083 C CG  . LYS B 2 19  ? 1.832   31.948 1.861   1.00 21.03  ? 32  LYS B CG  1 
ATOM   2084 C CD  . LYS B 2 19  ? 2.093   31.355 0.463   1.00 20.68  ? 32  LYS B CD  1 
ATOM   2085 C CE  . LYS B 2 19  ? 2.341   29.869 0.565   1.00 17.69  ? 32  LYS B CE  1 
ATOM   2086 N NZ  . LYS B 2 19  ? 2.782   29.328 -0.731  1.00 16.78  ? 32  LYS B NZ  1 
ATOM   2087 N N   . THR B 2 20  ? -0.557  32.506 3.847   1.00 21.64  ? 33  THR B N   1 
ATOM   2088 C CA  . THR B 2 20  ? -1.881  31.897 3.888   1.00 22.71  ? 33  THR B CA  1 
ATOM   2089 C C   . THR B 2 20  ? -2.835  32.718 4.754   1.00 23.62  ? 33  THR B C   1 
ATOM   2090 O O   . THR B 2 20  ? -3.981  32.940 4.374   1.00 23.24  ? 33  THR B O   1 
ATOM   2091 C CB  . THR B 2 20  ? -1.842  30.427 4.370   1.00 22.66  ? 33  THR B CB  1 
ATOM   2092 O OG1 . THR B 2 20  ? -1.129  29.632 3.415   1.00 20.80  ? 33  THR B OG1 1 
ATOM   2093 C CG2 . THR B 2 20  ? -3.246  29.881 4.462   1.00 21.84  ? 33  THR B CG2 1 
ATOM   2094 N N   . SER B 2 21  ? -2.367  33.151 5.922   1.00 25.00  ? 34  SER B N   1 
ATOM   2095 C CA  . SER B 2 21  ? -3.184  34.017 6.775   1.00 27.41  ? 34  SER B CA  1 
ATOM   2096 C C   . SER B 2 21  ? -3.601  35.284 6.027   1.00 27.42  ? 34  SER B C   1 
ATOM   2097 O O   . SER B 2 21  ? -4.731  35.764 6.144   1.00 27.61  ? 34  SER B O   1 
ATOM   2098 C CB  . SER B 2 21  ? -2.429  34.394 8.048   1.00 27.57  ? 34  SER B CB  1 
ATOM   2099 O OG  . SER B 2 21  ? -3.246  35.284 8.817   1.00 32.46  ? 34  SER B OG  1 
ATOM   2100 N N   . LEU B 2 22  ? -2.676  35.788 5.224   1.00 27.96  ? 35  LEU B N   1 
ATOM   2101 C CA  . LEU B 2 22  ? -2.844  37.012 4.468   1.00 28.44  ? 35  LEU B CA  1 
ATOM   2102 C C   . LEU B 2 22  ? -3.984  36.867 3.458   1.00 28.76  ? 35  LEU B C   1 
ATOM   2103 O O   . LEU B 2 22  ? -4.893  37.695 3.399   1.00 28.14  ? 35  LEU B O   1 
ATOM   2104 C CB  . LEU B 2 22  ? -1.503  37.327 3.788   1.00 28.86  ? 35  LEU B CB  1 
ATOM   2105 C CG  . LEU B 2 22  ? -1.141  38.672 3.174   1.00 30.58  ? 35  LEU B CG  1 
ATOM   2106 C CD1 . LEU B 2 22  ? 0.372   38.822 3.156   1.00 31.15  ? 35  LEU B CD1 1 
ATOM   2107 C CD2 . LEU B 2 22  ? -1.711  38.787 1.759   1.00 32.13  ? 35  LEU B CD2 1 
ATOM   2108 N N   . VAL B 2 23  ? -3.950  35.803 2.664   1.00 29.06  ? 36  VAL B N   1 
ATOM   2109 C CA  . VAL B 2 23  ? -5.022  35.584 1.700   1.00 29.61  ? 36  VAL B CA  1 
ATOM   2110 C C   . VAL B 2 23  ? -6.361  35.147 2.351   1.00 29.70  ? 36  VAL B C   1 
ATOM   2111 O O   . VAL B 2 23  ? -7.427  35.491 1.854   1.00 29.57  ? 36  VAL B O   1 
ATOM   2112 C CB  . VAL B 2 23  ? -4.575  34.655 0.551   1.00 29.69  ? 36  VAL B CB  1 
ATOM   2113 C CG1 . VAL B 2 23  ? -5.659  34.520 -0.466  1.00 29.67  ? 36  VAL B CG1 1 
ATOM   2114 C CG2 . VAL B 2 23  ? -3.370  35.276 -0.126  1.00 30.15  ? 36  VAL B CG2 1 
ATOM   2115 N N   . LEU B 2 24  ? -6.302  34.409 3.455   1.00 30.07  ? 37  LEU B N   1 
ATOM   2116 C CA  . LEU B 2 24  ? -7.529  34.068 4.180   1.00 30.88  ? 37  LEU B CA  1 
ATOM   2117 C C   . LEU B 2 24  ? -8.190  35.333 4.740   1.00 32.05  ? 37  LEU B C   1 
ATOM   2118 O O   . LEU B 2 24  ? -9.404  35.514 4.585   1.00 32.19  ? 37  LEU B O   1 
ATOM   2119 C CB  . LEU B 2 24  ? -7.280  33.015 5.261   1.00 29.87  ? 37  LEU B CB  1 
ATOM   2120 C CG  . LEU B 2 24  ? -7.046  31.593 4.704   1.00 28.86  ? 37  LEU B CG  1 
ATOM   2121 C CD1 . LEU B 2 24  ? -6.619  30.635 5.802   1.00 27.09  ? 37  LEU B CD1 1 
ATOM   2122 C CD2 . LEU B 2 24  ? -8.278  31.055 3.944   1.00 26.18  ? 37  LEU B CD2 1 
ATOM   2123 N N   . ARG B 2 25  ? -7.384  36.211 5.345   1.00 33.16  ? 38  ARG B N   1 
ATOM   2124 C CA  . ARG B 2 25  ? -7.831  37.556 5.755   1.00 34.76  ? 38  ARG B CA  1 
ATOM   2125 C C   . ARG B 2 25  ? -8.647  38.208 4.652   1.00 34.59  ? 38  ARG B C   1 
ATOM   2126 O O   . ARG B 2 25  ? -9.767  38.631 4.889   1.00 34.78  ? 38  ARG B O   1 
ATOM   2127 C CB  . ARG B 2 25  ? -6.640  38.458 6.095   1.00 35.35  ? 38  ARG B CB  1 
ATOM   2128 C CG  . ARG B 2 25  ? -6.483  38.871 7.556   1.00 38.63  ? 38  ARG B CG  1 
ATOM   2129 C CD  . ARG B 2 25  ? -6.416  37.688 8.499   1.00 42.77  ? 38  ARG B CD  1 
ATOM   2130 N NE  . ARG B 2 25  ? -5.909  38.034 9.835   1.00 46.59  ? 38  ARG B NE  1 
ATOM   2131 C CZ  . ARG B 2 25  ? -6.594  38.679 10.784  1.00 47.88  ? 38  ARG B CZ  1 
ATOM   2132 N NH1 . ARG B 2 25  ? -7.838  39.099 10.563  1.00 48.72  ? 38  ARG B NH1 1 
ATOM   2133 N NH2 . ARG B 2 25  ? -6.020  38.919 11.959  1.00 47.46  ? 38  ARG B NH2 1 
ATOM   2134 N N   . TYR B 2 26  ? -8.088  38.264 3.445   1.00 34.68  ? 39  TYR B N   1 
ATOM   2135 C CA  . TYR B 2 26  ? -8.757  38.897 2.311   1.00 34.54  ? 39  TYR B CA  1 
ATOM   2136 C C   . TYR B 2 26  ? -9.999  38.172 1.780   1.00 35.31  ? 39  TYR B C   1 
ATOM   2137 O O   . TYR B 2 26  ? -11.033 38.798 1.534   1.00 35.07  ? 39  TYR B O   1 
ATOM   2138 C CB  . TYR B 2 26  ? -7.788  39.101 1.164   1.00 33.38  ? 39  TYR B CB  1 
ATOM   2139 C CG  . TYR B 2 26  ? -8.354  39.920 0.033   1.00 31.87  ? 39  TYR B CG  1 
ATOM   2140 C CD1 . TYR B 2 26  ? -8.855  41.217 0.251   1.00 30.64  ? 39  TYR B CD1 1 
ATOM   2141 C CD2 . TYR B 2 26  ? -8.366  39.421 -1.259  1.00 31.58  ? 39  TYR B CD2 1 
ATOM   2142 C CE1 . TYR B 2 26  ? -9.356  41.980 -0.800  1.00 30.65  ? 39  TYR B CE1 1 
ATOM   2143 C CE2 . TYR B 2 26  ? -8.861  40.174 -2.320  1.00 30.87  ? 39  TYR B CE2 1 
ATOM   2144 C CZ  . TYR B 2 26  ? -9.353  41.448 -2.081  1.00 31.91  ? 39  TYR B CZ  1 
ATOM   2145 O OH  . TYR B 2 26  ? -9.835  42.171 -3.140  1.00 33.45  ? 39  TYR B OH  1 
ATOM   2146 N N   . CYS B 2 27  ? -9.871  36.869 1.557   1.00 36.32  ? 40  CYS B N   1 
ATOM   2147 C CA  . CYS B 2 27  ? -10.957 36.072 0.996   1.00 36.93  ? 40  CYS B CA  1 
ATOM   2148 C C   . CYS B 2 27  ? -11.731 35.403 2.116   1.00 37.13  ? 40  CYS B C   1 
ATOM   2149 O O   . CYS B 2 27  ? -12.833 34.916 1.892   1.00 38.31  ? 40  CYS B O   1 
ATOM   2150 C CB  . CYS B 2 27  ? -10.414 35.017 0.033   1.00 37.00  ? 40  CYS B CB  1 
ATOM   2151 S SG  . CYS B 2 27  ? -9.244  35.623 -1.176  1.00 39.30  ? 40  CYS B SG  1 
ATOM   2152 N N   . THR B 2 37  ? -13.878 26.535 9.044   1.00 35.15  ? 50  THR B N   1 
ATOM   2153 C CA  . THR B 2 37  ? -14.843 25.971 8.078   1.00 34.63  ? 50  THR B CA  1 
ATOM   2154 C C   . THR B 2 37  ? -14.318 25.959 6.628   1.00 33.99  ? 50  THR B C   1 
ATOM   2155 O O   . THR B 2 37  ? -14.732 25.130 5.808   1.00 34.98  ? 50  THR B O   1 
ATOM   2156 C CB  . THR B 2 37  ? -16.185 26.715 8.155   1.00 34.77  ? 50  THR B CB  1 
ATOM   2157 N N   . THR B 2 38  ? -13.433 26.898 6.310   1.00 32.24  ? 51  THR B N   1 
ATOM   2158 C CA  . THR B 2 38  ? -12.783 26.954 5.004   1.00 30.21  ? 51  THR B CA  1 
ATOM   2159 C C   . THR B 2 38  ? -12.148 25.592 4.713   1.00 27.78  ? 51  THR B C   1 
ATOM   2160 O O   . THR B 2 38  ? -11.366 25.099 5.514   1.00 27.56  ? 51  THR B O   1 
ATOM   2161 C CB  . THR B 2 38  ? -11.679 28.035 5.021   1.00 30.51  ? 51  THR B CB  1 
ATOM   2162 O OG1 . THR B 2 38  ? -12.193 29.210 5.655   1.00 32.76  ? 51  THR B OG1 1 
ATOM   2163 C CG2 . THR B 2 38  ? -11.197 28.368 3.619   1.00 29.60  ? 51  THR B CG2 1 
ATOM   2164 N N   . LEU B 2 39  ? -12.504 24.983 3.588   1.00 25.29  ? 52  LEU B N   1 
ATOM   2165 C CA  . LEU B 2 39  ? -11.928 23.691 3.207   1.00 22.93  ? 52  LEU B CA  1 
ATOM   2166 C C   . LEU B 2 39  ? -10.431 23.772 2.849   1.00 22.13  ? 52  LEU B C   1 
ATOM   2167 O O   . LEU B 2 39  ? -9.624  22.967 3.299   1.00 21.03  ? 52  LEU B O   1 
ATOM   2168 C CB  . LEU B 2 39  ? -12.712 23.079 2.034   1.00 22.70  ? 52  LEU B CB  1 
ATOM   2169 C CG  . LEU B 2 39  ? -12.134 21.758 1.466   1.00 22.38  ? 52  LEU B CG  1 
ATOM   2170 C CD1 . LEU B 2 39  ? -12.006 20.673 2.543   1.00 21.83  ? 52  LEU B CD1 1 
ATOM   2171 C CD2 . LEU B 2 39  ? -12.959 21.263 0.280   1.00 21.60  ? 52  LEU B CD2 1 
ATOM   2172 N N   . GLN B 2 40  ? -10.085 24.735 1.996   1.00 21.26  ? 53  GLN B N   1 
ATOM   2173 C CA  . GLN B 2 40  ? -8.739  24.817 1.426   1.00 20.47  ? 53  GLN B CA  1 
ATOM   2174 C C   . GLN B 2 40  ? -8.324  26.282 1.220   1.00 19.92  ? 53  GLN B C   1 
ATOM   2175 O O   . GLN B 2 40  ? -9.181  27.192 1.145   1.00 18.86  ? 53  GLN B O   1 
ATOM   2176 C CB  . GLN B 2 40  ? -8.671  24.009 0.118   1.00 19.85  ? 53  GLN B CB  1 
ATOM   2177 C CG  . GLN B 2 40  ? -9.697  24.409 -0.977  1.00 20.79  ? 53  GLN B CG  1 
ATOM   2178 C CD  . GLN B 2 40  ? -9.238  25.590 -1.812  1.00 22.86  ? 53  GLN B CD  1 
ATOM   2179 O OE1 . GLN B 2 40  ? -8.048  25.951 -1.815  1.00 19.27  ? 53  GLN B OE1 1 
ATOM   2180 N NE2 . GLN B 2 40  ? -10.185 26.223 -2.513  1.00 23.04  ? 53  GLN B NE2 1 
ATOM   2181 N N   . ALA B 2 41  ? -7.017  26.516 1.146   1.00 18.73  ? 54  ALA B N   1 
ATOM   2182 C CA  . ALA B 2 41  ? -6.515  27.861 0.967   1.00 18.68  ? 54  ALA B CA  1 
ATOM   2183 C C   . ALA B 2 41  ? -5.527  27.939 -0.189  1.00 19.65  ? 54  ALA B C   1 
ATOM   2184 O O   . ALA B 2 41  ? -4.625  28.785 -0.172  1.00 20.47  ? 54  ALA B O   1 
ATOM   2185 C CB  . ALA B 2 41  ? -5.897  28.383 2.289   1.00 17.92  ? 54  ALA B CB  1 
ATOM   2186 N N   . SER B 2 42  ? -5.704  27.068 -1.195  1.00 19.37  ? 55  SER B N   1 
ATOM   2187 C CA  . SER B 2 42  ? -4.774  26.979 -2.316  1.00 19.25  ? 55  SER B CA  1 
ATOM   2188 C C   . SER B 2 42  ? -5.289  27.719 -3.541  1.00 19.60  ? 55  SER B C   1 
ATOM   2189 O O   . SER B 2 42  ? -4.519  28.314 -4.280  1.00 18.77  ? 55  SER B O   1 
ATOM   2190 C CB  . SER B 2 42  ? -4.473  25.522 -2.673  1.00 19.01  ? 55  SER B CB  1 
ATOM   2191 O OG  . SER B 2 42  ? -3.938  24.833 -1.573  1.00 17.29  ? 55  SER B OG  1 
ATOM   2192 N N   . PHE B 2 43  ? -6.604  27.663 -3.740  1.00 20.65  ? 56  PHE B N   1 
ATOM   2193 C CA  . PHE B 2 43  ? -7.262  28.365 -4.810  1.00 21.03  ? 56  PHE B CA  1 
ATOM   2194 C C   . PHE B 2 43  ? -8.405  29.197 -4.223  1.00 22.81  ? 56  PHE B C   1 
ATOM   2195 O O   . PHE B 2 43  ? -9.340  28.668 -3.621  1.00 22.05  ? 56  PHE B O   1 
ATOM   2196 C CB  . PHE B 2 43  ? -7.823  27.394 -5.846  1.00 20.86  ? 56  PHE B CB  1 
ATOM   2197 C CG  . PHE B 2 43  ? -8.587  28.079 -6.944  1.00 20.47  ? 56  PHE B CG  1 
ATOM   2198 C CD1 . PHE B 2 43  ? -7.911  28.701 -7.984  1.00 20.35  ? 56  PHE B CD1 1 
ATOM   2199 C CD2 . PHE B 2 43  ? -9.971  28.171 -6.893  1.00 20.08  ? 56  PHE B CD2 1 
ATOM   2200 C CE1 . PHE B 2 43  ? -8.612  29.356 -8.994  1.00 21.04  ? 56  PHE B CE1 1 
ATOM   2201 C CE2 . PHE B 2 43  ? -10.680 28.834 -7.886  1.00 18.63  ? 56  PHE B CE2 1 
ATOM   2202 C CZ  . PHE B 2 43  ? -10.006 29.412 -8.943  1.00 20.57  ? 56  PHE B CZ  1 
ATOM   2203 N N   . LEU B 2 44  ? -8.325  30.499 -4.426  1.00 25.01  ? 57  LEU B N   1 
ATOM   2204 C CA  . LEU B 2 44  ? -9.204  31.435 -3.753  1.00 27.59  ? 57  LEU B CA  1 
ATOM   2205 C C   . LEU B 2 44  ? -9.659  32.479 -4.742  1.00 28.78  ? 57  LEU B C   1 
ATOM   2206 O O   . LEU B 2 44  ? -8.925  32.847 -5.649  1.00 28.73  ? 57  LEU B O   1 
ATOM   2207 C CB  . LEU B 2 44  ? -8.489  32.084 -2.560  1.00 27.84  ? 57  LEU B CB  1 
ATOM   2208 C CG  . LEU B 2 44  ? -8.295  31.180 -1.327  1.00 29.07  ? 57  LEU B CG  1 
ATOM   2209 C CD1 . LEU B 2 44  ? -7.609  31.903 -0.184  1.00 29.41  ? 57  LEU B CD1 1 
ATOM   2210 C CD2 . LEU B 2 44  ? -9.635  30.563 -0.838  1.00 32.16  ? 57  LEU B CD2 1 
ATOM   2211 N N   . THR B 2 45  ? -10.884 32.953 -4.578  1.00 30.67  ? 58  THR B N   1 
ATOM   2212 C CA  . THR B 2 45  ? -11.440 33.893 -5.540  1.00 32.35  ? 58  THR B CA  1 
ATOM   2213 C C   . THR B 2 45  ? -12.070 35.088 -4.830  1.00 33.70  ? 58  THR B C   1 
ATOM   2214 O O   . THR B 2 45  ? -12.450 35.010 -3.661  1.00 33.72  ? 58  THR B O   1 
ATOM   2215 C CB  . THR B 2 45  ? -12.510 33.227 -6.447  1.00 32.46  ? 58  THR B CB  1 
ATOM   2216 O OG1 . THR B 2 45  ? -13.439 32.515 -5.631  1.00 32.05  ? 58  THR B OG1 1 
ATOM   2217 C CG2 . THR B 2 45  ? -11.881 32.248 -7.437  1.00 32.68  ? 58  THR B CG2 1 
ATOM   2218 N N   . LYS B 2 46  ? -12.186 36.187 -5.565  1.00 35.60  ? 59  LYS B N   1 
ATOM   2219 C CA  . LYS B 2 46  ? -12.890 37.382 -5.106  1.00 37.45  ? 59  LYS B CA  1 
ATOM   2220 C C   . LYS B 2 46  ? -13.576 38.004 -6.319  1.00 38.37  ? 59  LYS B C   1 
ATOM   2221 O O   . LYS B 2 46  ? -12.986 38.099 -7.401  1.00 38.31  ? 59  LYS B O   1 
ATOM   2222 C CB  . LYS B 2 46  ? -11.896 38.374 -4.468  1.00 37.73  ? 59  LYS B CB  1 
ATOM   2223 C CG  . LYS B 2 46  ? -12.503 39.408 -3.510  1.00 38.70  ? 59  LYS B CG  1 
ATOM   2224 C CD  . LYS B 2 46  ? -12.606 38.892 -2.091  1.00 39.23  ? 59  LYS B CD  1 
ATOM   2225 C CE  . LYS B 2 46  ? -13.434 39.821 -1.221  1.00 41.18  ? 59  LYS B CE  1 
ATOM   2226 N NZ  . LYS B 2 46  ? -12.623 40.773 -0.412  1.00 42.01  ? 59  LYS B NZ  1 
ATOM   2227 N N   . LYS B 2 47  ? -14.840 38.381 -6.153  1.00 40.39  ? 60  LYS B N   1 
ATOM   2228 C CA  . LYS B 2 47  ? -15.539 39.182 -7.163  1.00 41.69  ? 60  LYS B CA  1 
ATOM   2229 C C   . LYS B 2 47  ? -15.512 40.650 -6.733  1.00 42.50  ? 60  LYS B C   1 
ATOM   2230 O O   . LYS B 2 47  ? -15.976 41.003 -5.638  1.00 42.14  ? 60  LYS B O   1 
ATOM   2231 C CB  . LYS B 2 47  ? -16.978 38.678 -7.369  1.00 41.93  ? 60  LYS B CB  1 
ATOM   2232 N N   . LEU B 2 48  ? -14.936 41.496 -7.584  1.00 43.94  ? 61  LEU B N   1 
ATOM   2233 C CA  . LEU B 2 48  ? -14.741 42.910 -7.263  1.00 45.31  ? 61  LEU B CA  1 
ATOM   2234 C C   . LEU B 2 48  ? -15.389 43.834 -8.273  1.00 46.47  ? 61  LEU B C   1 
ATOM   2235 O O   . LEU B 2 48  ? -15.558 43.477 -9.445  1.00 46.33  ? 61  LEU B O   1 
ATOM   2236 C CB  . LEU B 2 48  ? -13.253 43.244 -7.193  1.00 45.18  ? 61  LEU B CB  1 
ATOM   2237 C CG  . LEU B 2 48  ? -12.380 42.241 -6.446  1.00 45.55  ? 61  LEU B CG  1 
ATOM   2238 C CD1 . LEU B 2 48  ? -10.951 42.399 -6.887  1.00 46.40  ? 61  LEU B CD1 1 
ATOM   2239 C CD2 . LEU B 2 48  ? -12.539 42.435 -4.949  1.00 46.47  ? 61  LEU B CD2 1 
ATOM   2240 N N   . ASN B 2 49  ? -15.734 45.028 -7.798  1.00 48.04  ? 62  ASN B N   1 
ATOM   2241 C CA  . ASN B 2 49  ? -16.178 46.119 -8.653  1.00 49.65  ? 62  ASN B CA  1 
ATOM   2242 C C   . ASN B 2 49  ? -15.292 47.357 -8.488  1.00 50.22  ? 62  ASN B C   1 
ATOM   2243 O O   . ASN B 2 49  ? -15.174 47.917 -7.388  1.00 50.42  ? 62  ASN B O   1 
ATOM   2244 C CB  . ASN B 2 49  ? -17.650 46.429 -8.382  1.00 49.96  ? 62  ASN B CB  1 
ATOM   2245 C CG  . ASN B 2 49  ? -18.573 45.349 -8.920  1.00 52.12  ? 62  ASN B CG  1 
ATOM   2246 O OD1 . ASN B 2 49  ? -18.309 44.760 -9.973  1.00 53.34  ? 62  ASN B OD1 1 
ATOM   2247 N ND2 . ASN B 2 49  ? -19.666 45.083 -8.202  1.00 54.27  ? 62  ASN B ND2 1 
ATOM   2248 N N   . ILE B 2 50  ? -14.655 47.767 -9.584  1.00 51.11  ? 63  ILE B N   1 
ATOM   2249 C CA  . ILE B 2 50  ? -13.677 48.858 -9.551  1.00 52.23  ? 63  ILE B CA  1 
ATOM   2250 C C   . ILE B 2 50  ? -13.976 49.888 -10.636 1.00 52.79  ? 63  ILE B C   1 
ATOM   2251 O O   . ILE B 2 50  ? -13.842 49.601 -11.838 1.00 53.12  ? 63  ILE B O   1 
ATOM   2252 C CB  . ILE B 2 50  ? -12.220 48.346 -9.748  1.00 52.20  ? 63  ILE B CB  1 
ATOM   2253 C CG1 . ILE B 2 50  ? -11.926 47.146 -8.845  1.00 52.70  ? 63  ILE B CG1 1 
ATOM   2254 C CG2 . ILE B 2 50  ? -11.211 49.478 -9.507  1.00 52.32  ? 63  ILE B CG2 1 
ATOM   2255 C CD1 . ILE B 2 50  ? -10.892 46.225 -9.416  1.00 53.23  ? 63  ILE B CD1 1 
ATOM   2256 N N   . GLY B 2 51  ? -14.353 51.093 -10.205 1.00 53.39  ? 64  GLY B N   1 
ATOM   2257 C CA  . GLY B 2 51  ? -14.806 52.146 -11.121 1.00 53.44  ? 64  GLY B CA  1 
ATOM   2258 C C   . GLY B 2 51  ? -15.952 51.637 -11.974 1.00 53.45  ? 64  GLY B C   1 
ATOM   2259 O O   . GLY B 2 51  ? -15.936 51.780 -13.203 1.00 53.72  ? 64  GLY B O   1 
ATOM   2260 N N   . GLY B 2 52  ? -16.930 51.011 -11.317 1.00 53.18  ? 65  GLY B N   1 
ATOM   2261 C CA  . GLY B 2 52  ? -18.083 50.415 -11.996 1.00 52.69  ? 65  GLY B CA  1 
ATOM   2262 C C   . GLY B 2 52  ? -17.715 49.342 -13.004 1.00 52.21  ? 65  GLY B C   1 
ATOM   2263 O O   . GLY B 2 52  ? -18.538 48.961 -13.836 1.00 52.43  ? 65  GLY B O   1 
ATOM   2264 N N   . LYS B 2 53  ? -16.470 48.868 -12.939 1.00 51.67  ? 66  LYS B N   1 
ATOM   2265 C CA  . LYS B 2 53  ? -15.987 47.754 -13.769 1.00 50.45  ? 66  LYS B CA  1 
ATOM   2266 C C   . LYS B 2 53  ? -15.880 46.487 -12.918 1.00 49.50  ? 66  LYS B C   1 
ATOM   2267 O O   . LYS B 2 53  ? -15.329 46.521 -11.809 1.00 49.78  ? 66  LYS B O   1 
ATOM   2268 C CB  . LYS B 2 53  ? -14.634 48.100 -14.405 1.00 50.39  ? 66  LYS B CB  1 
ATOM   2269 N N   . ARG B 2 54  ? -16.420 45.384 -13.436 1.00 48.08  ? 67  ARG B N   1 
ATOM   2270 C CA  . ARG B 2 54  ? -16.477 44.106 -12.709 1.00 46.54  ? 67  ARG B CA  1 
ATOM   2271 C C   . ARG B 2 54  ? -15.172 43.321 -12.847 1.00 45.02  ? 67  ARG B C   1 
ATOM   2272 O O   . ARG B 2 54  ? -14.615 43.218 -13.941 1.00 45.19  ? 67  ARG B O   1 
ATOM   2273 C CB  . ARG B 2 54  ? -17.664 43.261 -13.193 1.00 46.71  ? 67  ARG B CB  1 
ATOM   2274 N N   . VAL B 2 55  ? -14.690 42.773 -11.735 1.00 43.30  ? 68  VAL B N   1 
ATOM   2275 C CA  . VAL B 2 55  ? -13.403 42.059 -11.712 1.00 40.82  ? 68  VAL B CA  1 
ATOM   2276 C C   . VAL B 2 55  ? -13.520 40.708 -11.026 1.00 39.57  ? 68  VAL B C   1 
ATOM   2277 O O   . VAL B 2 55  ? -13.914 40.610 -9.850  1.00 38.66  ? 68  VAL B O   1 
ATOM   2278 C CB  . VAL B 2 55  ? -12.286 42.912 -11.045 1.00 41.02  ? 68  VAL B CB  1 
ATOM   2279 C CG1 . VAL B 2 55  ? -11.022 42.082 -10.769 1.00 40.92  ? 68  VAL B CG1 1 
ATOM   2280 C CG2 . VAL B 2 55  ? -11.941 44.111 -11.924 1.00 40.73  ? 68  VAL B CG2 1 
ATOM   2281 N N   . ASN B 2 56  ? -13.180 39.664 -11.776 1.00 37.77  ? 69  ASN B N   1 
ATOM   2282 C CA  . ASN B 2 56  ? -13.028 38.339 -11.201 1.00 36.72  ? 69  ASN B CA  1 
ATOM   2283 C C   . ASN B 2 56  ? -11.565 38.067 -10.867 1.00 35.03  ? 69  ASN B C   1 
ATOM   2284 O O   . ASN B 2 56  ? -10.724 37.969 -11.763 1.00 35.35  ? 69  ASN B O   1 
ATOM   2285 C CB  . ASN B 2 56  ? -13.583 37.265 -12.141 1.00 36.72  ? 69  ASN B CB  1 
ATOM   2286 C CG  . ASN B 2 56  ? -15.071 37.450 -12.426 1.00 38.49  ? 69  ASN B CG  1 
ATOM   2287 O OD1 . ASN B 2 56  ? -15.488 37.506 -13.584 1.00 38.54  ? 69  ASN B OD1 1 
ATOM   2288 N ND2 . ASN B 2 56  ? -15.876 37.545 -11.363 1.00 39.81  ? 69  ASN B ND2 1 
ATOM   2289 N N   . LEU B 2 57  ? -11.282 37.961 -9.575  1.00 33.54  ? 70  LEU B N   1 
ATOM   2290 C CA  . LEU B 2 57  ? -9.931  37.671 -9.077  1.00 32.11  ? 70  LEU B CA  1 
ATOM   2291 C C   . LEU B 2 57  ? -9.816  36.208 -8.680  1.00 30.71  ? 70  LEU B C   1 
ATOM   2292 O O   . LEU B 2 57  ? -10.636 35.707 -7.930  1.00 31.28  ? 70  LEU B O   1 
ATOM   2293 C CB  . LEU B 2 57  ? -9.617  38.564 -7.872  1.00 32.15  ? 70  LEU B CB  1 
ATOM   2294 C CG  . LEU B 2 57  ? -8.215  38.545 -7.259  1.00 32.29  ? 70  LEU B CG  1 
ATOM   2295 C CD1 . LEU B 2 57  ? -7.185  39.025 -8.262  1.00 33.25  ? 70  LEU B CD1 1 
ATOM   2296 C CD2 . LEU B 2 57  ? -8.190  39.407 -6.015  1.00 32.51  ? 70  LEU B CD2 1 
ATOM   2297 N N   . ALA B 2 58  ? -8.807  35.523 -9.211  1.00 29.72  ? 71  ALA B N   1 
ATOM   2298 C CA  . ALA B 2 58  ? -8.463  34.152 -8.792  1.00 27.41  ? 71  ALA B CA  1 
ATOM   2299 C C   . ALA B 2 58  ? -7.053  34.140 -8.229  1.00 26.01  ? 71  ALA B C   1 
ATOM   2300 O O   . ALA B 2 58  ? -6.095  34.502 -8.925  1.00 25.78  ? 71  ALA B O   1 
ATOM   2301 C CB  . ALA B 2 58  ? -8.563  33.199 -9.969  1.00 27.31  ? 71  ALA B CB  1 
ATOM   2302 N N   . ILE B 2 59  ? -6.932  33.718 -6.973  1.00 24.15  ? 72  ILE B N   1 
ATOM   2303 C CA  . ILE B 2 59  ? -5.652  33.616 -6.317  1.00 22.74  ? 72  ILE B CA  1 
ATOM   2304 C C   . ILE B 2 59  ? -5.151  32.177 -6.386  1.00 21.96  ? 72  ILE B C   1 
ATOM   2305 O O   . ILE B 2 59  ? -5.763  31.286 -5.800  1.00 22.40  ? 72  ILE B O   1 
ATOM   2306 C CB  . ILE B 2 59  ? -5.703  34.048 -4.819  1.00 22.35  ? 72  ILE B CB  1 
ATOM   2307 C CG1 . ILE B 2 59  ? -6.482  35.358 -4.616  1.00 22.94  ? 72  ILE B CG1 1 
ATOM   2308 C CG2 . ILE B 2 59  ? -4.281  34.155 -4.271  1.00 21.81  ? 72  ILE B CG2 1 
ATOM   2309 C CD1 . ILE B 2 59  ? -5.829  36.530 -5.197  1.00 28.17  ? 72  ILE B CD1 1 
ATOM   2310 N N   . TRP B 2 60  ? -4.038  31.965 -7.077  1.00 20.64  ? 73  TRP B N   1 
ATOM   2311 C CA  . TRP B 2 60  ? -3.457  30.630 -7.236  1.00 19.89  ? 73  TRP B CA  1 
ATOM   2312 C C   . TRP B 2 60  ? -2.255  30.503 -6.322  1.00 19.38  ? 73  TRP B C   1 
ATOM   2313 O O   . TRP B 2 60  ? -1.193  31.047 -6.631  1.00 19.20  ? 73  TRP B O   1 
ATOM   2314 C CB  . TRP B 2 60  ? -2.958  30.428 -8.661  1.00 20.43  ? 73  TRP B CB  1 
ATOM   2315 C CG  . TRP B 2 60  ? -4.011  30.300 -9.703  1.00 21.52  ? 73  TRP B CG  1 
ATOM   2316 C CD1 . TRP B 2 60  ? -5.211  30.969 -9.763  1.00 22.62  ? 73  TRP B CD1 1 
ATOM   2317 C CD2 . TRP B 2 60  ? -3.957  29.469 -10.858 1.00 21.12  ? 73  TRP B CD2 1 
ATOM   2318 N NE1 . TRP B 2 60  ? -5.902  30.585 -10.882 1.00 24.12  ? 73  TRP B NE1 1 
ATOM   2319 C CE2 . TRP B 2 60  ? -5.156  29.661 -11.568 1.00 22.42  ? 73  TRP B CE2 1 
ATOM   2320 C CE3 . TRP B 2 60  ? -3.018  28.565 -11.354 1.00 20.53  ? 73  TRP B CE3 1 
ATOM   2321 C CZ2 . TRP B 2 60  ? -5.440  28.983 -12.746 1.00 22.72  ? 73  TRP B CZ2 1 
ATOM   2322 C CZ3 . TRP B 2 60  ? -3.304  27.895 -12.526 1.00 22.27  ? 73  TRP B CZ3 1 
ATOM   2323 C CH2 . TRP B 2 60  ? -4.502  28.106 -13.208 1.00 21.29  ? 73  TRP B CH2 1 
ATOM   2324 N N   . ASP B 2 61  ? -2.403  29.804 -5.199  1.00 18.14  ? 74  ASP B N   1 
ATOM   2325 C CA  . ASP B 2 61  ? -1.233  29.560 -4.350  1.00 17.77  ? 74  ASP B CA  1 
ATOM   2326 C C   . ASP B 2 61  ? -0.208  28.659 -5.044  1.00 17.66  ? 74  ASP B C   1 
ATOM   2327 O O   . ASP B 2 61  ? -0.573  27.683 -5.696  1.00 16.79  ? 74  ASP B O   1 
ATOM   2328 C CB  . ASP B 2 61  ? -1.621  28.982 -2.982  1.00 16.82  ? 74  ASP B CB  1 
ATOM   2329 C CG  . ASP B 2 61  ? -0.490  29.102 -1.954  1.00 16.91  ? 74  ASP B CG  1 
ATOM   2330 O OD1 . ASP B 2 61  ? 0.478   29.885 -2.170  1.00 16.43  ? 74  ASP B OD1 1 
ATOM   2331 O OD2 . ASP B 2 61  ? -0.554  28.406 -0.937  1.00 16.60  ? 74  ASP B OD2 1 
ATOM   2332 N N   . THR B 2 62  ? 1.083   28.983 -4.902  1.00 17.87  ? 75  THR B N   1 
ATOM   2333 C CA  . THR B 2 62  ? 2.132   28.137 -5.481  1.00 18.00  ? 75  THR B CA  1 
ATOM   2334 C C   . THR B 2 62  ? 3.057   27.564 -4.373  1.00 18.13  ? 75  THR B C   1 
ATOM   2335 O O   . THR B 2 62  ? 3.349   28.237 -3.401  1.00 17.28  ? 75  THR B O   1 
ATOM   2336 C CB  . THR B 2 62  ? 2.942   28.912 -6.582  1.00 19.18  ? 75  THR B CB  1 
ATOM   2337 O OG1 . THR B 2 62  ? 3.731   29.939 -5.973  1.00 18.95  ? 75  THR B OG1 1 
ATOM   2338 C CG2 . THR B 2 62  ? 1.992   29.569 -7.597  1.00 18.01  ? 75  THR B CG2 1 
ATOM   2339 N N   . ALA B 2 63  ? 3.464   26.308 -4.509  1.00 17.85  ? 76  ALA B N   1 
ATOM   2340 C CA  . ALA B 2 63  ? 4.239   25.615 -3.470  1.00 19.72  ? 76  ALA B CA  1 
ATOM   2341 C C   . ALA B 2 63  ? 5.609   26.284 -3.336  1.00 20.25  ? 76  ALA B C   1 
ATOM   2342 O O   . ALA B 2 63  ? 6.349   26.347 -4.316  1.00 20.17  ? 76  ALA B O   1 
ATOM   2343 C CB  . ALA B 2 63  ? 4.419   24.148 -3.824  1.00 18.77  ? 76  ALA B CB  1 
ATOM   2344 N N   . GLY B 2 64  ? 5.925   26.766 -2.138  1.00 21.36  ? 77  GLY B N   1 
ATOM   2345 C CA  . GLY B 2 64  ? 7.137   27.567 -1.920  1.00 22.85  ? 77  GLY B CA  1 
ATOM   2346 C C   . GLY B 2 64  ? 8.396   26.827 -1.507  1.00 24.03  ? 77  GLY B C   1 
ATOM   2347 O O   . GLY B 2 64  ? 9.485   27.427 -1.466  1.00 23.97  ? 77  GLY B O   1 
ATOM   2348 N N   . GLN B 2 65  ? 8.260   25.542 -1.176  1.00 24.33  ? 78  GLN B N   1 
ATOM   2349 C CA  . GLN B 2 65  ? 9.404   24.738 -0.747  1.00 25.31  ? 78  GLN B CA  1 
ATOM   2350 C C   . GLN B 2 65  ? 10.458  24.617 -1.844  1.00 25.35  ? 78  GLN B C   1 
ATOM   2351 O O   . GLN B 2 65  ? 10.141  24.500 -3.034  1.00 24.48  ? 78  GLN B O   1 
ATOM   2352 C CB  . GLN B 2 65  ? 8.969   23.346 -0.290  1.00 25.26  ? 78  GLN B CB  1 
ATOM   2353 C CG  . GLN B 2 65  ? 8.069   23.352 0.946   1.00 29.20  ? 78  GLN B CG  1 
ATOM   2354 C CD  . GLN B 2 65  ? 7.335   22.034 1.134   1.00 35.57  ? 78  GLN B CD  1 
ATOM   2355 O OE1 . GLN B 2 65  ? 7.940   21.048 1.568   1.00 39.79  ? 78  GLN B OE1 1 
ATOM   2356 N NE2 . GLN B 2 65  ? 6.021   21.999 0.797   1.00 31.39  ? 78  GLN B NE2 1 
ATOM   2357 N N   . GLU B 2 66  ? 11.710  24.597 -1.413  1.00 25.69  ? 79  GLU B N   1 
ATOM   2358 C CA  . GLU B 2 66  ? 12.842  24.434 -2.304  1.00 27.06  ? 79  GLU B CA  1 
ATOM   2359 C C   . GLU B 2 66  ? 12.768  23.227 -3.245  1.00 25.65  ? 79  GLU B C   1 
ATOM   2360 O O   . GLU B 2 66  ? 13.083  23.362 -4.426  1.00 25.62  ? 79  GLU B O   1 
ATOM   2361 C CB  . GLU B 2 66  ? 14.147  24.436 -1.489  1.00 28.95  ? 79  GLU B CB  1 
ATOM   2362 C CG  . GLU B 2 66  ? 15.381  24.012 -2.271  1.00 34.21  ? 79  GLU B CG  1 
ATOM   2363 C CD  . GLU B 2 66  ? 15.698  24.949 -3.433  1.00 40.17  ? 79  GLU B CD  1 
ATOM   2364 O OE1 . GLU B 2 66  ? 15.388  26.169 -3.332  1.00 42.82  ? 79  GLU B OE1 1 
ATOM   2365 O OE2 . GLU B 2 66  ? 16.269  24.458 -4.440  1.00 42.45  ? 79  GLU B OE2 1 
ATOM   2366 N N   . ARG B 2 67  ? 12.333  22.069 -2.744  1.00 24.52  ? 80  ARG B N   1 
ATOM   2367 C CA  . ARG B 2 67  ? 12.132  20.864 -3.588  1.00 23.60  ? 80  ARG B CA  1 
ATOM   2368 C C   . ARG B 2 67  ? 11.210  21.078 -4.805  1.00 22.93  ? 80  ARG B C   1 
ATOM   2369 O O   . ARG B 2 67  ? 11.258  20.304 -5.769  1.00 22.50  ? 80  ARG B O   1 
ATOM   2370 C CB  . ARG B 2 67  ? 11.617  19.681 -2.761  1.00 23.22  ? 80  ARG B CB  1 
ATOM   2371 C CG  . ARG B 2 67  ? 10.291  19.944 -2.040  1.00 24.19  ? 80  ARG B CG  1 
ATOM   2372 C CD  . ARG B 2 67  ? 9.767   18.726 -1.267  1.00 25.31  ? 80  ARG B CD  1 
ATOM   2373 N NE  . ARG B 2 67  ? 8.660   19.098 -0.378  1.00 29.61  ? 80  ARG B NE  1 
ATOM   2374 C CZ  . ARG B 2 67  ? 7.672   18.287 0.018   1.00 30.55  ? 80  ARG B CZ  1 
ATOM   2375 N NH1 . ARG B 2 67  ? 7.599   17.025 -0.393  1.00 29.75  ? 80  ARG B NH1 1 
ATOM   2376 N NH2 . ARG B 2 67  ? 6.730   18.753 0.825   1.00 30.80  ? 80  ARG B NH2 1 
ATOM   2377 N N   . PHE B 2 68  ? 10.375  22.118 -4.755  1.00 21.90  ? 81  PHE B N   1 
ATOM   2378 C CA  . PHE B 2 68  ? 9.471   22.426 -5.870  1.00 22.29  ? 81  PHE B CA  1 
ATOM   2379 C C   . PHE B 2 68  ? 9.955   23.577 -6.737  1.00 23.50  ? 81  PHE B C   1 
ATOM   2380 O O   . PHE B 2 68  ? 9.181   24.131 -7.531  1.00 23.67  ? 81  PHE B O   1 
ATOM   2381 C CB  . PHE B 2 68  ? 8.052   22.704 -5.359  1.00 20.81  ? 81  PHE B CB  1 
ATOM   2382 C CG  . PHE B 2 68  ? 7.474   21.569 -4.588  1.00 19.56  ? 81  PHE B CG  1 
ATOM   2383 C CD1 . PHE B 2 68  ? 7.499   20.265 -5.114  1.00 17.47  ? 81  PHE B CD1 1 
ATOM   2384 C CD2 . PHE B 2 68  ? 6.928   21.778 -3.338  1.00 16.76  ? 81  PHE B CD2 1 
ATOM   2385 C CE1 . PHE B 2 68  ? 6.976   19.186 -4.381  1.00 17.68  ? 81  PHE B CE1 1 
ATOM   2386 C CE2 . PHE B 2 68  ? 6.391   20.714 -2.611  1.00 16.78  ? 81  PHE B CE2 1 
ATOM   2387 C CZ  . PHE B 2 68  ? 6.419   19.417 -3.126  1.00 16.25  ? 81  PHE B CZ  1 
ATOM   2388 N N   . HIS B 2 69  ? 11.240  23.912 -6.624  1.00 24.68  ? 82  HIS B N   1 
ATOM   2389 C CA  . HIS B 2 69  ? 11.754  25.107 -7.296  1.00 26.41  ? 82  HIS B CA  1 
ATOM   2390 C C   . HIS B 2 69  ? 11.608  25.121 -8.821  1.00 25.45  ? 82  HIS B C   1 
ATOM   2391 O O   . HIS B 2 69  ? 11.307  26.152 -9.393  1.00 26.39  ? 82  HIS B O   1 
ATOM   2392 C CB  . HIS B 2 69  ? 13.206  25.419 -6.902  1.00 27.84  ? 82  HIS B CB  1 
ATOM   2393 C CG  . HIS B 2 69  ? 13.755  26.621 -7.615  1.00 33.62  ? 82  HIS B CG  1 
ATOM   2394 N ND1 . HIS B 2 69  ? 13.122  27.851 -7.596  1.00 36.57  ? 82  HIS B ND1 1 
ATOM   2395 C CD2 . HIS B 2 69  ? 14.855  26.774 -8.394  1.00 37.26  ? 82  HIS B CD2 1 
ATOM   2396 C CE1 . HIS B 2 69  ? 13.817  28.710 -8.323  1.00 39.03  ? 82  HIS B CE1 1 
ATOM   2397 N NE2 . HIS B 2 69  ? 14.874  28.084 -8.816  1.00 39.45  ? 82  HIS B NE2 1 
ATOM   2398 N N   . ALA B 2 70  ? 11.767  23.975 -9.473  1.00 24.72  ? 83  ALA B N   1 
ATOM   2399 C CA  . ALA B 2 70  ? 11.705  23.925 -10.930 1.00 23.39  ? 83  ALA B CA  1 
ATOM   2400 C C   . ALA B 2 70  ? 10.280  24.031 -11.497 1.00 23.41  ? 83  ALA B C   1 
ATOM   2401 O O   . ALA B 2 70  ? 10.111  24.155 -12.721 1.00 23.23  ? 83  ALA B O   1 
ATOM   2402 C CB  . ALA B 2 70  ? 12.385  22.655 -11.447 1.00 24.31  ? 83  ALA B CB  1 
ATOM   2403 N N   . LEU B 2 71  ? 9.266   23.999 -10.622 1.00 22.43  ? 84  LEU B N   1 
ATOM   2404 C CA  . LEU B 2 71  ? 7.855   23.919 -11.048 1.00 21.37  ? 84  LEU B CA  1 
ATOM   2405 C C   . LEU B 2 71  ? 7.171   25.267 -11.246 1.00 21.73  ? 84  LEU B C   1 
ATOM   2406 O O   . LEU B 2 71  ? 6.080   25.350 -11.845 1.00 21.38  ? 84  LEU B O   1 
ATOM   2407 C CB  . LEU B 2 71  ? 7.044   23.098 -10.030 1.00 21.03  ? 84  LEU B CB  1 
ATOM   2408 C CG  . LEU B 2 71  ? 7.686   21.768 -9.617  1.00 19.35  ? 84  LEU B CG  1 
ATOM   2409 C CD1 . LEU B 2 71  ? 6.856   21.032 -8.623  1.00 17.60  ? 84  LEU B CD1 1 
ATOM   2410 C CD2 . LEU B 2 71  ? 7.959   20.905 -10.851 1.00 20.96  ? 84  LEU B CD2 1 
ATOM   2411 N N   . GLY B 2 72  ? 7.781   26.312 -10.702 1.00 22.11  ? 85  GLY B N   1 
ATOM   2412 C CA  . GLY B 2 72  ? 7.248   27.677 -10.762 1.00 22.26  ? 85  GLY B CA  1 
ATOM   2413 C C   . GLY B 2 72  ? 6.607   28.061 -12.077 1.00 22.95  ? 85  GLY B C   1 
ATOM   2414 O O   . GLY B 2 72  ? 5.437   28.402 -12.100 1.00 23.52  ? 85  GLY B O   1 
ATOM   2415 N N   . PRO B 2 73  ? 7.373   28.033 -13.177 1.00 23.62  ? 86  PRO B N   1 
ATOM   2416 C CA  . PRO B 2 73  ? 6.900   28.342 -14.531 1.00 23.62  ? 86  PRO B CA  1 
ATOM   2417 C C   . PRO B 2 73  ? 5.570   27.696 -14.914 1.00 23.48  ? 86  PRO B C   1 
ATOM   2418 O O   . PRO B 2 73  ? 4.727   28.350 -15.551 1.00 24.05  ? 86  PRO B O   1 
ATOM   2419 C CB  . PRO B 2 73  ? 8.028   27.795 -15.416 1.00 24.29  ? 86  PRO B CB  1 
ATOM   2420 C CG  . PRO B 2 73  ? 9.246   27.968 -14.592 1.00 23.74  ? 86  PRO B CG  1 
ATOM   2421 C CD  . PRO B 2 73  ? 8.818   27.734 -13.164 1.00 24.23  ? 86  PRO B CD  1 
ATOM   2422 N N   . ILE B 2 74  ? 5.376   26.433 -14.535 1.00 23.01  ? 87  ILE B N   1 
ATOM   2423 C CA  . ILE B 2 74  ? 4.109   25.720 -14.792 1.00 22.14  ? 87  ILE B CA  1 
ATOM   2424 C C   . ILE B 2 74  ? 2.967   26.470 -14.132 1.00 21.46  ? 87  ILE B C   1 
ATOM   2425 O O   . ILE B 2 74  ? 1.960   26.751 -14.771 1.00 21.10  ? 87  ILE B O   1 
ATOM   2426 C CB  . ILE B 2 74  ? 4.160   24.223 -14.332 1.00 22.44  ? 87  ILE B CB  1 
ATOM   2427 C CG1 . ILE B 2 74  ? 5.395   23.532 -14.934 1.00 21.67  ? 87  ILE B CG1 1 
ATOM   2428 C CG2 . ILE B 2 74  ? 2.817   23.494 -14.693 1.00 22.18  ? 87  ILE B CG2 1 
ATOM   2429 C CD1 . ILE B 2 74  ? 5.595   22.063 -14.534 1.00 21.79  ? 87  ILE B CD1 1 
ATOM   2430 N N   . TYR B 2 75  ? 3.136   26.823 -12.857 1.00 21.08  ? 88  TYR B N   1 
ATOM   2431 C CA  . TYR B 2 75  ? 2.164   27.660 -12.171 1.00 21.12  ? 88  TYR B CA  1 
ATOM   2432 C C   . TYR B 2 75  ? 2.013   29.075 -12.766 1.00 21.84  ? 88  TYR B C   1 
ATOM   2433 O O   . TYR B 2 75  ? 0.894   29.608 -12.868 1.00 21.15  ? 88  TYR B O   1 
ATOM   2434 C CB  . TYR B 2 75  ? 2.625   27.900 -10.754 1.00 21.23  ? 88  TYR B CB  1 
ATOM   2435 C CG  . TYR B 2 75  ? 2.424   26.834 -9.705  1.00 19.58  ? 88  TYR B CG  1 
ATOM   2436 C CD1 . TYR B 2 75  ? 1.144   26.490 -9.267  1.00 19.94  ? 88  TYR B CD1 1 
ATOM   2437 C CD2 . TYR B 2 75  ? 3.536   26.266 -9.058  1.00 16.50  ? 88  TYR B CD2 1 
ATOM   2438 C CE1 . TYR B 2 75  ? 0.967   25.545 -8.237  1.00 18.97  ? 88  TYR B CE1 1 
ATOM   2439 C CE2 . TYR B 2 75  ? 3.382   25.339 -8.030  1.00 17.57  ? 88  TYR B CE2 1 
ATOM   2440 C CZ  . TYR B 2 75  ? 2.090   24.990 -7.617  1.00 18.93  ? 88  TYR B CZ  1 
ATOM   2441 O OH  . TYR B 2 75  ? 1.928   24.093 -6.594  1.00 18.90  ? 88  TYR B OH  1 
ATOM   2442 N N   . TYR B 2 76  ? 3.143   29.708 -13.113 1.00 21.88  ? 89  TYR B N   1 
ATOM   2443 C CA  . TYR B 2 76  ? 3.134   31.155 -13.436 1.00 22.87  ? 89  TYR B CA  1 
ATOM   2444 C C   . TYR B 2 76  ? 2.547   31.487 -14.810 1.00 23.91  ? 89  TYR B C   1 
ATOM   2445 O O   . TYR B 2 76  ? 2.155   32.623 -15.058 1.00 23.43  ? 89  TYR B O   1 
ATOM   2446 C CB  . TYR B 2 76  ? 4.546   31.757 -13.363 1.00 22.39  ? 89  TYR B CB  1 
ATOM   2447 C CG  . TYR B 2 76  ? 5.323   31.472 -12.104 1.00 21.24  ? 89  TYR B CG  1 
ATOM   2448 C CD1 . TYR B 2 76  ? 4.681   31.310 -10.871 1.00 21.58  ? 89  TYR B CD1 1 
ATOM   2449 C CD2 . TYR B 2 76  ? 6.715   31.383 -12.147 1.00 21.69  ? 89  TYR B CD2 1 
ATOM   2450 C CE1 . TYR B 2 76  ? 5.405   31.063 -9.718  1.00 20.40  ? 89  TYR B CE1 1 
ATOM   2451 C CE2 . TYR B 2 76  ? 7.446   31.147 -11.012 1.00 18.95  ? 89  TYR B CE2 1 
ATOM   2452 C CZ  . TYR B 2 76  ? 6.805   30.985 -9.809  1.00 20.45  ? 89  TYR B CZ  1 
ATOM   2453 O OH  . TYR B 2 76  ? 7.551   30.727 -8.684  1.00 20.23  ? 89  TYR B OH  1 
ATOM   2454 N N   . ARG B 2 77  ? 2.498   30.490 -15.687 1.00 25.52  ? 90  ARG B N   1 
ATOM   2455 C CA  . ARG B 2 77  ? 2.027   30.657 -17.061 1.00 28.46  ? 90  ARG B CA  1 
ATOM   2456 C C   . ARG B 2 77  ? 0.694   31.415 -17.150 1.00 27.78  ? 90  ARG B C   1 
ATOM   2457 O O   . ARG B 2 77  ? -0.294  31.035 -16.520 1.00 27.57  ? 90  ARG B O   1 
ATOM   2458 C CB  . ARG B 2 77  ? 1.936   29.279 -17.740 1.00 28.25  ? 90  ARG B CB  1 
ATOM   2459 C CG  . ARG B 2 77  ? 1.529   29.303 -19.217 1.00 32.54  ? 90  ARG B CG  1 
ATOM   2460 C CD  . ARG B 2 77  ? 1.387   27.861 -19.748 1.00 33.40  ? 90  ARG B CD  1 
ATOM   2461 N NE  . ARG B 2 77  ? 1.327   27.816 -21.211 1.00 42.82  ? 90  ARG B NE  1 
ATOM   2462 C CZ  . ARG B 2 77  ? 1.614   26.742 -21.952 1.00 46.32  ? 90  ARG B CZ  1 
ATOM   2463 N NH1 . ARG B 2 77  ? 1.995   25.600 -21.378 1.00 47.81  ? 90  ARG B NH1 1 
ATOM   2464 N NH2 . ARG B 2 77  ? 1.531   26.813 -23.282 1.00 47.92  ? 90  ARG B NH2 1 
ATOM   2465 N N   . ASP B 2 78  ? 0.702   32.507 -17.918 1.00 28.34  ? 91  ASP B N   1 
ATOM   2466 C CA  . ASP B 2 78  ? -0.482  33.331 -18.193 1.00 28.01  ? 91  ASP B CA  1 
ATOM   2467 C C   . ASP B 2 78  ? -1.014  34.094 -16.989 1.00 27.51  ? 91  ASP B C   1 
ATOM   2468 O O   . ASP B 2 78  ? -2.130  34.583 -17.025 1.00 26.39  ? 91  ASP B O   1 
ATOM   2469 C CB  . ASP B 2 78  ? -1.605  32.500 -18.849 1.00 29.06  ? 91  ASP B CB  1 
ATOM   2470 C CG  . ASP B 2 78  ? -1.223  32.002 -20.231 1.00 31.31  ? 91  ASP B CG  1 
ATOM   2471 O OD1 . ASP B 2 78  ? -0.607  32.784 -20.996 1.00 36.29  ? 91  ASP B OD1 1 
ATOM   2472 O OD2 . ASP B 2 78  ? -1.509  30.834 -20.548 1.00 32.84  ? 91  ASP B OD2 1 
ATOM   2473 N N   . SER B 2 79  ? -0.211  34.221 -15.932 1.00 26.67  ? 92  SER B N   1 
ATOM   2474 C CA  . SER B 2 79  ? -0.605  35.053 -14.799 1.00 25.96  ? 92  SER B CA  1 
ATOM   2475 C C   . SER B 2 79  ? -0.754  36.492 -15.249 1.00 26.16  ? 92  SER B C   1 
ATOM   2476 O O   . SER B 2 79  ? -0.060  36.937 -16.168 1.00 26.04  ? 92  SER B O   1 
ATOM   2477 C CB  . SER B 2 79  ? 0.420   34.971 -13.657 1.00 26.20  ? 92  SER B CB  1 
ATOM   2478 O OG  . SER B 2 79  ? 0.668   33.614 -13.314 1.00 24.07  ? 92  SER B OG  1 
ATOM   2479 N N   . ASN B 2 80  ? -1.659  37.211 -14.596 1.00 26.19  ? 93  ASN B N   1 
ATOM   2480 C CA  . ASN B 2 80  ? -1.827  38.640 -14.834 1.00 26.19  ? 93  ASN B CA  1 
ATOM   2481 C C   . ASN B 2 80  ? -1.131  39.426 -13.750 1.00 26.03  ? 93  ASN B C   1 
ATOM   2482 O O   . ASN B 2 80  ? -0.719  40.572 -13.964 1.00 26.37  ? 93  ASN B O   1 
ATOM   2483 C CB  . ASN B 2 80  ? -3.313  38.995 -14.911 1.00 26.60  ? 93  ASN B CB  1 
ATOM   2484 C CG  . ASN B 2 80  ? -4.005  38.275 -16.056 1.00 26.81  ? 93  ASN B CG  1 
ATOM   2485 O OD1 . ASN B 2 80  ? -3.771  38.582 -17.223 1.00 32.36  ? 93  ASN B OD1 1 
ATOM   2486 N ND2 . ASN B 2 80  ? -4.795  37.281 -15.734 1.00 26.60  ? 93  ASN B ND2 1 
ATOM   2487 N N   . GLY B 2 81  ? -0.970  38.798 -12.590 1.00 25.21  ? 94  GLY B N   1 
ATOM   2488 C CA  . GLY B 2 81  ? -0.261  39.433 -11.473 1.00 24.45  ? 94  GLY B CA  1 
ATOM   2489 C C   . GLY B 2 81  ? 0.368   38.414 -10.547 1.00 23.52  ? 94  GLY B C   1 
ATOM   2490 O O   . GLY B 2 81  ? 0.064   37.226 -10.635 1.00 23.31  ? 94  GLY B O   1 
ATOM   2491 N N   . ALA B 2 82  ? 1.229   38.890 -9.644  1.00 22.92  ? 95  ALA B N   1 
ATOM   2492 C CA  . ALA B 2 82  ? 1.949   38.023 -8.729  1.00 20.94  ? 95  ALA B CA  1 
ATOM   2493 C C   . ALA B 2 82  ? 2.106   38.729 -7.404  1.00 20.37  ? 95  ALA B C   1 
ATOM   2494 O O   . ALA B 2 82  ? 2.413   39.919 -7.367  1.00 19.37  ? 95  ALA B O   1 
ATOM   2495 C CB  . ALA B 2 82  ? 3.298   37.640 -9.309  1.00 21.06  ? 95  ALA B CB  1 
ATOM   2496 N N   . ILE B 2 83  ? 1.871   37.999 -6.319  1.00 18.88  ? 96  ILE B N   1 
ATOM   2497 C CA  . ILE B 2 83  ? 2.041   38.548 -4.987  1.00 19.07  ? 96  ILE B CA  1 
ATOM   2498 C C   . ILE B 2 83  ? 3.149   37.738 -4.330  1.00 18.78  ? 96  ILE B C   1 
ATOM   2499 O O   . ILE B 2 83  ? 2.967   36.547 -4.027  1.00 18.93  ? 96  ILE B O   1 
ATOM   2500 C CB  . ILE B 2 83  ? 0.740   38.473 -4.145  1.00 19.19  ? 96  ILE B CB  1 
ATOM   2501 C CG1 . ILE B 2 83  ? -0.343  39.365 -4.765  1.00 20.82  ? 96  ILE B CG1 1 
ATOM   2502 C CG2 . ILE B 2 83  ? 0.988   38.896 -2.699  1.00 18.12  ? 96  ILE B CG2 1 
ATOM   2503 C CD1 . ILE B 2 83  ? -1.701  39.183 -4.140  1.00 20.23  ? 96  ILE B CD1 1 
ATOM   2504 N N   . LEU B 2 84  ? 4.293   38.389 -4.123  1.00 18.10  ? 97  LEU B N   1 
ATOM   2505 C CA  . LEU B 2 84  ? 5.477   37.739 -3.536  1.00 16.98  ? 97  LEU B CA  1 
ATOM   2506 C C   . LEU B 2 84  ? 5.648   38.178 -2.115  1.00 16.58  ? 97  LEU B C   1 
ATOM   2507 O O   . LEU B 2 84  ? 5.992   39.329 -1.838  1.00 17.45  ? 97  LEU B O   1 
ATOM   2508 C CB  . LEU B 2 84  ? 6.742   38.048 -4.359  1.00 16.48  ? 97  LEU B CB  1 
ATOM   2509 C CG  . LEU B 2 84  ? 6.693   37.580 -5.807  1.00 16.53  ? 97  LEU B CG  1 
ATOM   2510 C CD1 . LEU B 2 84  ? 6.220   38.698 -6.708  1.00 19.84  ? 97  LEU B CD1 1 
ATOM   2511 C CD2 . LEU B 2 84  ? 8.074   37.051 -6.244  1.00 16.38  ? 97  LEU B CD2 1 
ATOM   2512 N N   . VAL B 2 85  ? 5.423   37.252 -1.197  1.00 16.40  ? 98  VAL B N   1 
ATOM   2513 C CA  . VAL B 2 85  ? 5.435   37.581 0.220   1.00 15.64  ? 98  VAL B CA  1 
ATOM   2514 C C   . VAL B 2 85  ? 6.787   37.176 0.808   1.00 15.55  ? 98  VAL B C   1 
ATOM   2515 O O   . VAL B 2 85  ? 7.328   36.083 0.519   1.00 15.57  ? 98  VAL B O   1 
ATOM   2516 C CB  . VAL B 2 85  ? 4.286   36.868 0.999   1.00 15.48  ? 98  VAL B CB  1 
ATOM   2517 C CG1 . VAL B 2 85  ? 4.213   37.351 2.451   1.00 15.64  ? 98  VAL B CG1 1 
ATOM   2518 C CG2 . VAL B 2 85  ? 2.946   37.051 0.306   1.00 14.69  ? 98  VAL B CG2 1 
ATOM   2519 N N   . TYR B 2 86  ? 7.327   38.070 1.619   1.00 15.40  ? 99  TYR B N   1 
ATOM   2520 C CA  . TYR B 2 86  ? 8.470   37.763 2.453   1.00 16.03  ? 99  TYR B CA  1 
ATOM   2521 C C   . TYR B 2 86  ? 8.155   38.199 3.879   1.00 16.33  ? 99  TYR B C   1 
ATOM   2522 O O   . TYR B 2 86  ? 7.144   38.855 4.133   1.00 16.68  ? 99  TYR B O   1 
ATOM   2523 C CB  . TYR B 2 86  ? 9.764   38.388 1.886   1.00 15.10  ? 99  TYR B CB  1 
ATOM   2524 C CG  . TYR B 2 86  ? 9.835   39.882 2.066   1.00 15.67  ? 99  TYR B CG  1 
ATOM   2525 C CD1 . TYR B 2 86  ? 10.500  40.445 3.163   1.00 15.51  ? 99  TYR B CD1 1 
ATOM   2526 C CD2 . TYR B 2 86  ? 9.244   40.731 1.144   1.00 15.36  ? 99  TYR B CD2 1 
ATOM   2527 C CE1 . TYR B 2 86  ? 10.564  41.836 3.337   1.00 13.37  ? 99  TYR B CE1 1 
ATOM   2528 C CE2 . TYR B 2 86  ? 9.294   42.102 1.309   1.00 15.53  ? 99  TYR B CE2 1 
ATOM   2529 C CZ  . TYR B 2 86  ? 9.969   42.638 2.393   1.00 15.17  ? 99  TYR B CZ  1 
ATOM   2530 O OH  . TYR B 2 86  ? 9.986   43.992 2.531   1.00 14.79  ? 99  TYR B OH  1 
ATOM   2531 N N   . ASP B 2 87  ? 9.006   37.776 4.804   1.00 16.76  ? 100 ASP B N   1 
ATOM   2532 C CA  . ASP B 2 87  ? 8.885   38.049 6.223   1.00 16.59  ? 100 ASP B CA  1 
ATOM   2533 C C   . ASP B 2 87  ? 9.967   39.097 6.528   1.00 16.71  ? 100 ASP B C   1 
ATOM   2534 O O   . ASP B 2 87  ? 11.145  38.843 6.298   1.00 15.00  ? 100 ASP B O   1 
ATOM   2535 C CB  . ASP B 2 87  ? 9.098   36.719 6.950   1.00 15.81  ? 100 ASP B CB  1 
ATOM   2536 C CG  . ASP B 2 87  ? 9.259   36.851 8.469   1.00 18.76  ? 100 ASP B CG  1 
ATOM   2537 O OD1 . ASP B 2 87  ? 9.349   37.963 9.004   1.00 18.41  ? 100 ASP B OD1 1 
ATOM   2538 O OD2 . ASP B 2 87  ? 9.315   35.794 9.132   1.00 18.97  ? 100 ASP B OD2 1 
ATOM   2539 N N   . ILE B 2 88  ? 9.563   40.274 7.023   1.00 17.69  ? 101 ILE B N   1 
ATOM   2540 C CA  . ILE B 2 88  ? 10.512  41.390 7.232   1.00 18.51  ? 101 ILE B CA  1 
ATOM   2541 C C   . ILE B 2 88  ? 11.633  41.082 8.242   1.00 18.84  ? 101 ILE B C   1 
ATOM   2542 O O   . ILE B 2 88  ? 12.650  41.784 8.277   1.00 19.12  ? 101 ILE B O   1 
ATOM   2543 C CB  . ILE B 2 88  ? 9.800   42.748 7.584   1.00 18.78  ? 101 ILE B CB  1 
ATOM   2544 C CG1 . ILE B 2 88  ? 9.143   42.713 8.976   1.00 19.66  ? 101 ILE B CG1 1 
ATOM   2545 C CG2 . ILE B 2 88  ? 8.842   43.169 6.443   1.00 16.70  ? 101 ILE B CG2 1 
ATOM   2546 C CD1 . ILE B 2 88  ? 8.598   44.076 9.441   1.00 19.86  ? 101 ILE B CD1 1 
ATOM   2547 N N   . THR B 2 89  ? 11.442  40.028 9.035   1.00 18.93  ? 102 THR B N   1 
ATOM   2548 C CA  . THR B 2 89  ? 12.432  39.599 10.016  1.00 20.11  ? 102 THR B CA  1 
ATOM   2549 C C   . THR B 2 89  ? 13.411  38.559 9.421   1.00 20.65  ? 102 THR B C   1 
ATOM   2550 O O   . THR B 2 89  ? 14.387  38.163 10.066  1.00 21.51  ? 102 THR B O   1 
ATOM   2551 C CB  . THR B 2 89  ? 11.757  39.026 11.272  1.00 20.09  ? 102 THR B CB  1 
ATOM   2552 O OG1 . THR B 2 89  ? 11.102  37.798 10.955  1.00 21.02  ? 102 THR B OG1 1 
ATOM   2553 C CG2 . THR B 2 89  ? 10.715  40.005 11.825  1.00 20.66  ? 102 THR B CG2 1 
ATOM   2554 N N   . ASP B 2 90  ? 13.176  38.153 8.175   1.00 20.41  ? 103 ASP B N   1 
ATOM   2555 C CA  . ASP B 2 90  ? 13.958  37.069 7.567   1.00 19.34  ? 103 ASP B CA  1 
ATOM   2556 C C   . ASP B 2 90  ? 14.500  37.497 6.214   1.00 18.82  ? 103 ASP B C   1 
ATOM   2557 O O   . ASP B 2 90  ? 13.811  37.432 5.187   1.00 17.92  ? 103 ASP B O   1 
ATOM   2558 C CB  . ASP B 2 90  ? 13.080  35.825 7.468   1.00 19.98  ? 103 ASP B CB  1 
ATOM   2559 C CG  . ASP B 2 90  ? 13.839  34.582 6.990   1.00 22.01  ? 103 ASP B CG  1 
ATOM   2560 O OD1 . ASP B 2 90  ? 15.050  34.653 6.709   1.00 24.60  ? 103 ASP B OD1 1 
ATOM   2561 O OD2 . ASP B 2 90  ? 13.192  33.521 6.897   1.00 23.31  ? 103 ASP B OD2 1 
ATOM   2562 N N   . GLU B 2 91  ? 15.756  37.946 6.222   1.00 18.27  ? 104 GLU B N   1 
ATOM   2563 C CA  . GLU B 2 91  ? 16.419  38.380 5.019   1.00 17.37  ? 104 GLU B CA  1 
ATOM   2564 C C   . GLU B 2 91  ? 16.550  37.270 3.957   1.00 16.62  ? 104 GLU B C   1 
ATOM   2565 O O   . GLU B 2 91  ? 16.598  37.559 2.759   1.00 16.13  ? 104 GLU B O   1 
ATOM   2566 C CB  . GLU B 2 91  ? 17.760  39.059 5.348   1.00 17.48  ? 104 GLU B CB  1 
ATOM   2567 C CG  . GLU B 2 91  ? 18.862  38.158 5.874   1.00 18.66  ? 104 GLU B CG  1 
ATOM   2568 C CD  . GLU B 2 91  ? 18.830  37.893 7.383   1.00 20.62  ? 104 GLU B CD  1 
ATOM   2569 O OE1 . GLU B 2 91  ? 17.890  38.311 8.110   1.00 21.60  ? 104 GLU B OE1 1 
ATOM   2570 O OE2 . GLU B 2 91  ? 19.767  37.232 7.845   1.00 18.72  ? 104 GLU B OE2 1 
ATOM   2571 N N   . ASP B 2 92  ? 16.578  36.014 4.388   1.00 15.85  ? 105 ASP B N   1 
ATOM   2572 C CA  . ASP B 2 92  ? 16.610  34.899 3.439   1.00 16.24  ? 105 ASP B CA  1 
ATOM   2573 C C   . ASP B 2 92  ? 15.312  34.830 2.619   1.00 15.87  ? 105 ASP B C   1 
ATOM   2574 O O   . ASP B 2 92  ? 15.334  34.489 1.444   1.00 15.86  ? 105 ASP B O   1 
ATOM   2575 C CB  . ASP B 2 92  ? 16.830  33.568 4.157   1.00 15.87  ? 105 ASP B CB  1 
ATOM   2576 C CG  . ASP B 2 92  ? 18.249  33.421 4.707   1.00 18.80  ? 105 ASP B CG  1 
ATOM   2577 O OD1 . ASP B 2 92  ? 19.123  34.286 4.438   1.00 19.60  ? 105 ASP B OD1 1 
ATOM   2578 O OD2 . ASP B 2 92  ? 18.491  32.404 5.390   1.00 20.35  ? 105 ASP B OD2 1 
ATOM   2579 N N   . SER B 2 93  ? 14.194  35.140 3.267   1.00 16.26  ? 106 SER B N   1 
ATOM   2580 C CA  . SER B 2 93  ? 12.871  35.158 2.616   1.00 15.88  ? 106 SER B CA  1 
ATOM   2581 C C   . SER B 2 93  ? 12.791  36.246 1.561   1.00 15.61  ? 106 SER B C   1 
ATOM   2582 O O   . SER B 2 93  ? 12.131  36.058 0.550   1.00 15.55  ? 106 SER B O   1 
ATOM   2583 C CB  . SER B 2 93  ? 11.736  35.266 3.648   1.00 15.73  ? 106 SER B CB  1 
ATOM   2584 O OG  . SER B 2 93  ? 11.540  36.593 4.129   1.00 16.11  ? 106 SER B OG  1 
ATOM   2585 N N   . PHE B 2 94  ? 13.482  37.370 1.793   1.00 15.60  ? 107 PHE B N   1 
ATOM   2586 C CA  . PHE B 2 94  ? 13.587  38.449 0.817   1.00 15.65  ? 107 PHE B CA  1 
ATOM   2587 C C   . PHE B 2 94  ? 14.475  38.068 -0.375  1.00 16.43  ? 107 PHE B C   1 
ATOM   2588 O O   . PHE B 2 94  ? 14.149  38.368 -1.554  1.00 16.44  ? 107 PHE B O   1 
ATOM   2589 C CB  . PHE B 2 94  ? 14.145  39.707 1.473   1.00 15.87  ? 107 PHE B CB  1 
ATOM   2590 C CG  . PHE B 2 94  ? 14.157  40.895 0.565   1.00 16.12  ? 107 PHE B CG  1 
ATOM   2591 C CD1 . PHE B 2 94  ? 12.961  41.479 0.167   1.00 16.08  ? 107 PHE B CD1 1 
ATOM   2592 C CD2 . PHE B 2 94  ? 15.365  41.429 0.097   1.00 15.51  ? 107 PHE B CD2 1 
ATOM   2593 C CE1 . PHE B 2 94  ? 12.962  42.590 -0.686  1.00 17.88  ? 107 PHE B CE1 1 
ATOM   2594 C CE2 . PHE B 2 94  ? 15.372  42.548 -0.749  1.00 18.09  ? 107 PHE B CE2 1 
ATOM   2595 C CZ  . PHE B 2 94  ? 14.169  43.122 -1.135  1.00 18.78  ? 107 PHE B CZ  1 
ATOM   2596 N N   . GLN B 2 95  ? 15.590  37.406 -0.076  1.00 16.05  ? 108 GLN B N   1 
ATOM   2597 C CA  . GLN B 2 95  ? 16.445  36.870 -1.137  1.00 16.48  ? 108 GLN B CA  1 
ATOM   2598 C C   . GLN B 2 95  ? 15.644  35.943 -2.056  1.00 16.89  ? 108 GLN B C   1 
ATOM   2599 O O   . GLN B 2 95  ? 15.846  35.959 -3.258  1.00 17.19  ? 108 GLN B O   1 
ATOM   2600 C CB  . GLN B 2 95  ? 17.638  36.107 -0.547  1.00 16.15  ? 108 GLN B CB  1 
ATOM   2601 C CG  . GLN B 2 95  ? 18.748  35.783 -1.601  1.00 17.81  ? 108 GLN B CG  1 
ATOM   2602 C CD  . GLN B 2 95  ? 19.573  37.035 -1.968  1.00 18.48  ? 108 GLN B CD  1 
ATOM   2603 O OE1 . GLN B 2 95  ? 19.844  37.854 -1.115  1.00 19.07  ? 108 GLN B OE1 1 
ATOM   2604 N NE2 . GLN B 2 95  ? 19.967  37.163 -3.231  1.00 20.90  ? 108 GLN B NE2 1 
ATOM   2605 N N   . LYS B 2 96  ? 14.757  35.122 -1.492  1.00 16.97  ? 109 LYS B N   1 
ATOM   2606 C CA  . LYS B 2 96  ? 13.904  34.243 -2.303  1.00 17.89  ? 109 LYS B CA  1 
ATOM   2607 C C   . LYS B 2 96  ? 13.021  35.004 -3.277  1.00 18.30  ? 109 LYS B C   1 
ATOM   2608 O O   . LYS B 2 96  ? 12.834  34.560 -4.397  1.00 18.43  ? 109 LYS B O   1 
ATOM   2609 C CB  . LYS B 2 96  ? 13.020  33.371 -1.418  1.00 17.83  ? 109 LYS B CB  1 
ATOM   2610 C CG  . LYS B 2 96  ? 13.771  32.212 -0.767  1.00 21.54  ? 109 LYS B CG  1 
ATOM   2611 C CD  . LYS B 2 96  ? 12.797  31.222 -0.120  1.00 25.77  ? 109 LYS B CD  1 
ATOM   2612 C CE  . LYS B 2 96  ? 13.500  29.948 0.294   1.00 29.86  ? 109 LYS B CE  1 
ATOM   2613 N NZ  . LYS B 2 96  ? 14.653  30.244 1.206   1.00 34.07  ? 109 LYS B NZ  1 
ATOM   2614 N N   . VAL B 2 97  ? 12.477  36.140 -2.841  1.00 18.49  ? 110 VAL B N   1 
ATOM   2615 C CA  . VAL B 2 97  ? 11.660  36.999 -3.723  1.00 18.90  ? 110 VAL B CA  1 
ATOM   2616 C C   . VAL B 2 97  ? 12.437  37.446 -4.962  1.00 19.44  ? 110 VAL B C   1 
ATOM   2617 O O   . VAL B 2 97  ? 11.935  37.362 -6.087  1.00 19.26  ? 110 VAL B O   1 
ATOM   2618 C CB  . VAL B 2 97  ? 11.120  38.233 -2.967  1.00 19.09  ? 110 VAL B CB  1 
ATOM   2619 C CG1 . VAL B 2 97  ? 10.564  39.315 -3.954  1.00 20.08  ? 110 VAL B CG1 1 
ATOM   2620 C CG2 . VAL B 2 97  ? 10.075  37.805 -1.960  1.00 16.67  ? 110 VAL B CG2 1 
ATOM   2621 N N   . LYS B 2 98  ? 13.674  37.893 -4.767  1.00 19.60  ? 111 LYS B N   1 
ATOM   2622 C CA  . LYS B 2 98  ? 14.483  38.357 -5.884  1.00 20.06  ? 111 LYS B CA  1 
ATOM   2623 C C   . LYS B 2 98  ? 14.676  37.284 -6.971  1.00 20.27  ? 111 LYS B C   1 
ATOM   2624 O O   . LYS B 2 98  ? 14.657  37.589 -8.164  1.00 19.25  ? 111 LYS B O   1 
ATOM   2625 C CB  . LYS B 2 98  ? 15.828  38.891 -5.375  1.00 20.92  ? 111 LYS B CB  1 
ATOM   2626 C CG  . LYS B 2 98  ? 15.653  40.079 -4.419  1.00 22.15  ? 111 LYS B CG  1 
ATOM   2627 C CD  . LYS B 2 98  ? 16.950  40.869 -4.212  1.00 25.53  ? 111 LYS B CD  1 
ATOM   2628 C CE  . LYS B 2 98  ? 17.825  40.209 -3.181  1.00 27.46  ? 111 LYS B CE  1 
ATOM   2629 N NZ  . LYS B 2 98  ? 18.901  41.095 -2.704  1.00 27.29  ? 111 LYS B NZ  1 
ATOM   2630 N N   . ASN B 2 99  ? 14.852  36.029 -6.557  1.00 19.94  ? 112 ASN B N   1 
ATOM   2631 C CA  . ASN B 2 99  ? 14.978  34.931 -7.498  1.00 20.89  ? 112 ASN B CA  1 
ATOM   2632 C C   . ASN B 2 99  ? 13.652  34.619 -8.189  1.00 20.57  ? 112 ASN B C   1 
ATOM   2633 O O   . ASN B 2 99  ? 13.613  34.365 -9.394  1.00 20.67  ? 112 ASN B O   1 
ATOM   2634 C CB  . ASN B 2 99  ? 15.577  33.702 -6.790  1.00 21.87  ? 112 ASN B CB  1 
ATOM   2635 C CG  . ASN B 2 99  ? 16.972  33.989 -6.245  1.00 25.23  ? 112 ASN B CG  1 
ATOM   2636 O OD1 . ASN B 2 99  ? 17.668  34.875 -6.767  1.00 29.19  ? 112 ASN B OD1 1 
ATOM   2637 N ND2 . ASN B 2 99  ? 17.378  33.274 -5.204  1.00 25.70  ? 112 ASN B ND2 1 
ATOM   2638 N N   . TRP B 2 100 ? 12.562  34.682 -7.433  1.00 20.60  ? 113 TRP B N   1 
ATOM   2639 C CA  . TRP B 2 100 ? 11.208  34.511 -8.010  1.00 20.90  ? 113 TRP B CA  1 
ATOM   2640 C C   . TRP B 2 100 ? 10.872  35.572 -9.064  1.00 21.16  ? 113 TRP B C   1 
ATOM   2641 O O   . TRP B 2 100 ? 10.304  35.264 -10.129 1.00 20.90  ? 113 TRP B O   1 
ATOM   2642 C CB  . TRP B 2 100 ? 10.144  34.478 -6.902  1.00 20.57  ? 113 TRP B CB  1 
ATOM   2643 C CG  . TRP B 2 100 ? 10.070  33.158 -6.164  1.00 20.70  ? 113 TRP B CG  1 
ATOM   2644 C CD1 . TRP B 2 100 ? 10.259  31.903 -6.694  1.00 20.95  ? 113 TRP B CD1 1 
ATOM   2645 C CD2 . TRP B 2 100 ? 9.740   32.962 -4.772  1.00 20.62  ? 113 TRP B CD2 1 
ATOM   2646 N NE1 . TRP B 2 100 ? 10.082  30.942 -5.708  1.00 22.61  ? 113 TRP B NE1 1 
ATOM   2647 C CE2 . TRP B 2 100 ? 9.758   31.565 -4.528  1.00 21.75  ? 113 TRP B CE2 1 
ATOM   2648 C CE3 . TRP B 2 100 ? 9.418   33.830 -3.718  1.00 19.30  ? 113 TRP B CE3 1 
ATOM   2649 C CZ2 . TRP B 2 100 ? 9.492   31.016 -3.258  1.00 21.61  ? 113 TRP B CZ2 1 
ATOM   2650 C CZ3 . TRP B 2 100 ? 9.147   33.285 -2.453  1.00 20.40  ? 113 TRP B CZ3 1 
ATOM   2651 C CH2 . TRP B 2 100 ? 9.204   31.894 -2.237  1.00 21.18  ? 113 TRP B CH2 1 
ATOM   2652 N N   . VAL B 2 101 ? 11.239  36.821 -8.775  1.00 21.25  ? 114 VAL B N   1 
ATOM   2653 C CA  . VAL B 2 101 ? 11.056  37.911 -9.732  1.00 21.38  ? 114 VAL B CA  1 
ATOM   2654 C C   . VAL B 2 101 ? 11.772  37.603 -11.065 1.00 21.57  ? 114 VAL B C   1 
ATOM   2655 O O   . VAL B 2 101 ? 11.183  37.759 -12.141 1.00 21.26  ? 114 VAL B O   1 
ATOM   2656 C CB  . VAL B 2 101 ? 11.467  39.284 -9.135  1.00 21.19  ? 114 VAL B CB  1 
ATOM   2657 C CG1 . VAL B 2 101 ? 11.591  40.357 -10.239 1.00 21.93  ? 114 VAL B CG1 1 
ATOM   2658 C CG2 . VAL B 2 101 ? 10.471  39.740 -8.042  1.00 21.88  ? 114 VAL B CG2 1 
ATOM   2659 N N   . LYS B 2 102 ? 13.023  37.142 -10.999 1.00 22.13  ? 115 LYS B N   1 
ATOM   2660 C CA  . LYS B 2 102 ? 13.736  36.719 -12.208 1.00 23.21  ? 115 LYS B CA  1 
ATOM   2661 C C   . LYS B 2 102 ? 12.977  35.694 -13.037 1.00 23.31  ? 115 LYS B C   1 
ATOM   2662 O O   . LYS B 2 102 ? 12.963  35.788 -14.282 1.00 23.21  ? 115 LYS B O   1 
ATOM   2663 C CB  . LYS B 2 102 ? 15.148  36.204 -11.893 1.00 22.88  ? 115 LYS B CB  1 
ATOM   2664 C CG  . LYS B 2 102 ? 16.135  37.296 -11.478 1.00 24.96  ? 115 LYS B CG  1 
ATOM   2665 C CD  . LYS B 2 102 ? 17.513  36.683 -11.203 1.00 25.47  ? 115 LYS B CD  1 
ATOM   2666 C CE  . LYS B 2 102 ? 18.547  37.771 -10.975 1.00 32.38  ? 115 LYS B CE  1 
ATOM   2667 N NZ  . LYS B 2 102 ? 19.812  37.254 -10.310 1.00 36.30  ? 115 LYS B NZ  1 
ATOM   2668 N N   . GLU B 2 103 ? 12.368  34.710 -12.368 1.00 22.84  ? 116 GLU B N   1 
ATOM   2669 C CA  . GLU B 2 103 ? 11.544  33.699 -13.049 1.00 23.17  ? 116 GLU B CA  1 
ATOM   2670 C C   . GLU B 2 103 ? 10.289  34.298 -13.682 1.00 23.07  ? 116 GLU B C   1 
ATOM   2671 O O   . GLU B 2 103 ? 9.965   34.008 -14.841 1.00 23.25  ? 116 GLU B O   1 
ATOM   2672 C CB  . GLU B 2 103 ? 11.127  32.575 -12.086 1.00 23.49  ? 116 GLU B CB  1 
ATOM   2673 C CG  . GLU B 2 103 ? 12.263  31.735 -11.620 1.00 26.77  ? 116 GLU B CG  1 
ATOM   2674 C CD  . GLU B 2 103 ? 11.812  30.483 -10.892 1.00 32.51  ? 116 GLU B CD  1 
ATOM   2675 O OE1 . GLU B 2 103 ? 11.938  30.439 -9.645  1.00 35.00  ? 116 GLU B OE1 1 
ATOM   2676 O OE2 . GLU B 2 103 ? 11.333  29.541 -11.560 1.00 34.71  ? 116 GLU B OE2 1 
ATOM   2677 N N   . LEU B 2 104 ? 9.589   35.120 -12.916 1.00 22.77  ? 117 LEU B N   1 
ATOM   2678 C CA  . LEU B 2 104 ? 8.341   35.744 -13.353 1.00 23.74  ? 117 LEU B CA  1 
ATOM   2679 C C   . LEU B 2 104 ? 8.547   36.618 -14.589 1.00 25.31  ? 117 LEU B C   1 
ATOM   2680 O O   . LEU B 2 104 ? 7.680   36.687 -15.455 1.00 25.16  ? 117 LEU B O   1 
ATOM   2681 C CB  . LEU B 2 104 ? 7.710   36.546 -12.206 1.00 23.09  ? 117 LEU B CB  1 
ATOM   2682 C CG  . LEU B 2 104 ? 7.020   35.656 -11.155 1.00 21.87  ? 117 LEU B CG  1 
ATOM   2683 C CD1 . LEU B 2 104 ? 6.751   36.403 -9.866  1.00 21.39  ? 117 LEU B CD1 1 
ATOM   2684 C CD2 . LEU B 2 104 ? 5.733   35.078 -11.689 1.00 19.33  ? 117 LEU B CD2 1 
ATOM   2685 N N   . ARG B 2 105 ? 9.731   37.230 -14.673 1.00 26.57  ? 118 ARG B N   1 
ATOM   2686 C CA  . ARG B 2 105 ? 10.111  38.097 -15.776 1.00 27.96  ? 118 ARG B CA  1 
ATOM   2687 C C   . ARG B 2 105 ? 10.541  37.349 -17.028 1.00 28.80  ? 118 ARG B C   1 
ATOM   2688 O O   . ARG B 2 105 ? 10.707  37.963 -18.068 1.00 29.78  ? 118 ARG B O   1 
ATOM   2689 C CB  . ARG B 2 105 ? 11.209  39.071 -15.325 1.00 28.22  ? 118 ARG B CB  1 
ATOM   2690 C CG  . ARG B 2 105 ? 10.684  40.185 -14.450 1.00 28.64  ? 118 ARG B CG  1 
ATOM   2691 C CD  . ARG B 2 105 ? 9.812   41.114 -15.288 1.00 30.71  ? 118 ARG B CD  1 
ATOM   2692 N NE  . ARG B 2 105 ? 9.360   42.284 -14.541 1.00 31.81  ? 118 ARG B NE  1 
ATOM   2693 C CZ  . ARG B 2 105 ? 8.098   42.513 -14.187 1.00 31.83  ? 118 ARG B CZ  1 
ATOM   2694 N NH1 . ARG B 2 105 ? 7.129   41.638 -14.495 1.00 31.37  ? 118 ARG B NH1 1 
ATOM   2695 N NH2 . ARG B 2 105 ? 7.811   43.621 -13.511 1.00 30.80  ? 118 ARG B NH2 1 
ATOM   2696 N N   . LYS B 2 106 ? 10.714  36.035 -16.932 1.00 29.32  ? 119 LYS B N   1 
ATOM   2697 C CA  . LYS B 2 106 ? 10.995  35.197 -18.105 1.00 30.18  ? 119 LYS B CA  1 
ATOM   2698 C C   . LYS B 2 106 ? 9.775   34.425 -18.630 1.00 30.72  ? 119 LYS B C   1 
ATOM   2699 O O   . LYS B 2 106 ? 9.912   33.497 -19.442 1.00 30.95  ? 119 LYS B O   1 
ATOM   2700 C CB  . LYS B 2 106 ? 12.158  34.243 -17.803 1.00 30.22  ? 119 LYS B CB  1 
ATOM   2701 C CG  . LYS B 2 106 ? 13.441  34.998 -17.493 1.00 29.83  ? 119 LYS B CG  1 
ATOM   2702 C CD  . LYS B 2 106 ? 14.614  34.077 -17.312 1.00 29.59  ? 119 LYS B CD  1 
ATOM   2703 C CE  . LYS B 2 106 ? 15.806  34.876 -16.809 1.00 31.56  ? 119 LYS B CE  1 
ATOM   2704 N NZ  . LYS B 2 106 ? 15.564  35.544 -15.493 1.00 31.32  ? 119 LYS B NZ  1 
ATOM   2705 N N   . MET B 2 107 ? 8.587   34.807 -18.169 1.00 31.00  ? 120 MET B N   1 
ATOM   2706 C CA  . MET B 2 107 ? 7.363   34.152 -18.585 1.00 31.72  ? 120 MET B CA  1 
ATOM   2707 C C   . MET B 2 107 ? 6.903   34.786 -19.888 1.00 32.71  ? 120 MET B C   1 
ATOM   2708 O O   . MET B 2 107 ? 6.712   36.005 -19.956 1.00 32.30  ? 120 MET B O   1 
ATOM   2709 C CB  . MET B 2 107 ? 6.262   34.286 -17.516 1.00 31.54  ? 120 MET B CB  1 
ATOM   2710 C CG  . MET B 2 107 ? 6.529   33.552 -16.176 1.00 30.12  ? 120 MET B CG  1 
ATOM   2711 S SD  . MET B 2 107 ? 7.086   31.845 -16.339 1.00 29.36  ? 120 MET B SD  1 
ATOM   2712 C CE  . MET B 2 107 ? 5.695   31.064 -17.167 1.00 27.80  ? 120 MET B CE  1 
ATOM   2713 N N   . LEU B 2 108 ? 6.717   33.945 -20.908 1.00 34.08  ? 121 LEU B N   1 
ATOM   2714 C CA  . LEU B 2 108 ? 6.246   34.378 -22.223 1.00 35.32  ? 121 LEU B CA  1 
ATOM   2715 C C   . LEU B 2 108 ? 4.835   34.952 -22.148 1.00 36.34  ? 121 LEU B C   1 
ATOM   2716 O O   . LEU B 2 108 ? 3.894   34.266 -21.749 1.00 36.91  ? 121 LEU B O   1 
ATOM   2717 C CB  . LEU B 2 108 ? 6.303   33.219 -23.221 1.00 35.34  ? 121 LEU B CB  1 
ATOM   2718 C CG  . LEU B 2 108 ? 5.901   33.492 -24.676 1.00 35.59  ? 121 LEU B CG  1 
ATOM   2719 C CD1 . LEU B 2 108 ? 6.947   34.364 -25.389 1.00 34.28  ? 121 LEU B CD1 1 
ATOM   2720 C CD2 . LEU B 2 108 ? 5.692   32.178 -25.419 1.00 34.87  ? 121 LEU B CD2 1 
ATOM   2721 N N   . GLY B 2 109 ? 4.700   36.216 -22.538 1.00 37.14  ? 122 GLY B N   1 
ATOM   2722 C CA  . GLY B 2 109 ? 3.417   36.897 -22.535 1.00 38.19  ? 122 GLY B CA  1 
ATOM   2723 C C   . GLY B 2 109 ? 3.612   38.331 -22.110 1.00 39.40  ? 122 GLY B C   1 
ATOM   2724 O O   . GLY B 2 109 ? 4.729   38.840 -22.119 1.00 39.64  ? 122 GLY B O   1 
ATOM   2725 N N   . ASN B 2 110 ? 2.518   38.970 -21.721 1.00 40.51  ? 123 ASN B N   1 
ATOM   2726 C CA  . ASN B 2 110 ? 2.524   40.334 -21.189 1.00 41.60  ? 123 ASN B CA  1 
ATOM   2727 C C   . ASN B 2 110 ? 3.258   40.458 -19.848 1.00 41.43  ? 123 ASN B C   1 
ATOM   2728 O O   . ASN B 2 110 ? 3.461   39.449 -19.156 1.00 41.59  ? 123 ASN B O   1 
ATOM   2729 C CB  . ASN B 2 110 ? 1.078   40.836 -21.050 1.00 42.44  ? 123 ASN B CB  1 
ATOM   2730 C CG  . ASN B 2 110 ? 0.071   39.696 -20.790 1.00 45.24  ? 123 ASN B CG  1 
ATOM   2731 O OD1 . ASN B 2 110 ? 0.417   38.498 -20.831 1.00 48.20  ? 123 ASN B OD1 1 
ATOM   2732 N ND2 . ASN B 2 110 ? -1.184  40.072 -20.532 1.00 47.04  ? 123 ASN B ND2 1 
ATOM   2733 N N   . GLU B 2 111 ? 3.647   41.685 -19.483 1.00 40.60  ? 124 GLU B N   1 
ATOM   2734 C CA  . GLU B 2 111 ? 4.303   41.919 -18.188 1.00 40.09  ? 124 GLU B CA  1 
ATOM   2735 C C   . GLU B 2 111 ? 3.318   41.616 -17.059 1.00 38.26  ? 124 GLU B C   1 
ATOM   2736 O O   . GLU B 2 111 ? 2.246   42.222 -16.960 1.00 38.55  ? 124 GLU B O   1 
ATOM   2737 C CB  . GLU B 2 111 ? 4.888   43.343 -18.061 1.00 40.19  ? 124 GLU B CB  1 
ATOM   2738 C CG  . GLU B 2 111 ? 5.666   43.571 -16.744 1.00 41.59  ? 124 GLU B CG  1 
ATOM   2739 C CD  . GLU B 2 111 ? 6.531   44.845 -16.701 1.00 42.03  ? 124 GLU B CD  1 
ATOM   2740 O OE1 . GLU B 2 111 ? 6.286   45.701 -15.814 1.00 43.23  ? 124 GLU B OE1 1 
ATOM   2741 O OE2 . GLU B 2 111 ? 7.473   44.981 -17.523 1.00 43.97  ? 124 GLU B OE2 1 
ATOM   2742 N N   . ILE B 2 112 ? 3.681   40.637 -16.241 1.00 35.96  ? 125 ILE B N   1 
ATOM   2743 C CA  . ILE B 2 112 ? 2.941   40.301 -15.025 1.00 33.02  ? 125 ILE B CA  1 
ATOM   2744 C C   . ILE B 2 112 ? 3.094   41.462 -14.042 1.00 32.11  ? 125 ILE B C   1 
ATOM   2745 O O   . ILE B 2 112 ? 4.212   41.935 -13.838 1.00 32.02  ? 125 ILE B O   1 
ATOM   2746 C CB  . ILE B 2 112 ? 3.508   38.984 -14.417 1.00 32.74  ? 125 ILE B CB  1 
ATOM   2747 C CG1 . ILE B 2 112 ? 3.336   37.821 -15.404 1.00 32.30  ? 125 ILE B CG1 1 
ATOM   2748 C CG2 . ILE B 2 112 ? 2.861   38.676 -13.101 1.00 31.00  ? 125 ILE B CG2 1 
ATOM   2749 C CD1 . ILE B 2 112 ? 4.215   36.573 -15.130 1.00 31.41  ? 125 ILE B CD1 1 
ATOM   2750 N N   . CYS B 2 113 ? 1.990   41.924 -13.448 1.00 30.88  ? 126 CYS B N   1 
ATOM   2751 C CA  . CYS B 2 113 ? 2.037   42.960 -12.401 1.00 30.27  ? 126 CYS B CA  1 
ATOM   2752 C C   . CYS B 2 113 ? 2.483   42.420 -11.047 1.00 29.07  ? 126 CYS B C   1 
ATOM   2753 O O   . CYS B 2 113 ? 1.773   41.625 -10.417 1.00 28.14  ? 126 CYS B O   1 
ATOM   2754 C CB  . CYS B 2 113 ? 0.685   43.647 -12.210 1.00 30.45  ? 126 CYS B CB  1 
ATOM   2755 S SG  . CYS B 2 113 ? 0.086   44.510 -13.674 1.00 35.47  ? 126 CYS B SG  1 
ATOM   2756 N N   . LEU B 2 114 ? 3.635   42.894 -10.585 1.00 27.61  ? 127 LEU B N   1 
ATOM   2757 C CA  . LEU B 2 114 ? 4.265   42.345 -9.380  1.00 26.93  ? 127 LEU B CA  1 
ATOM   2758 C C   . LEU B 2 114 ? 3.994   43.137 -8.111  1.00 26.24  ? 127 LEU B C   1 
ATOM   2759 O O   . LEU B 2 114 ? 4.078   44.371 -8.105  1.00 26.00  ? 127 LEU B O   1 
ATOM   2760 C CB  . LEU B 2 114 ? 5.777   42.251 -9.590  1.00 26.76  ? 127 LEU B CB  1 
ATOM   2761 C CG  . LEU B 2 114 ? 6.352   41.507 -10.791 1.00 26.06  ? 127 LEU B CG  1 
ATOM   2762 C CD1 . LEU B 2 114 ? 7.861   41.596 -10.748 1.00 24.80  ? 127 LEU B CD1 1 
ATOM   2763 C CD2 . LEU B 2 114 ? 5.878   40.056 -10.803 1.00 22.64  ? 127 LEU B CD2 1 
ATOM   2764 N N   . CYS B 2 115 ? 3.685   42.423 -7.036  1.00 26.13  ? 128 CYS B N   1 
ATOM   2765 C CA  . CYS B 2 115 ? 3.673   42.995 -5.686  1.00 26.13  ? 128 CYS B CA  1 
ATOM   2766 C C   . CYS B 2 115 ? 4.684   42.281 -4.830  1.00 25.81  ? 128 CYS B C   1 
ATOM   2767 O O   . CYS B 2 115 ? 4.708   41.050 -4.786  1.00 25.64  ? 128 CYS B O   1 
ATOM   2768 C CB  . CYS B 2 115 ? 2.320   42.829 -5.011  1.00 26.54  ? 128 CYS B CB  1 
ATOM   2769 S SG  . CYS B 2 115 ? 0.972   43.373 -6.000  1.00 30.66  ? 128 CYS B SG  1 
ATOM   2770 N N   . ILE B 2 116 ? 5.511   43.067 -4.150  1.00 25.49  ? 129 ILE B N   1 
ATOM   2771 C CA  . ILE B 2 116 ? 6.481   42.569 -3.185  1.00 24.97  ? 129 ILE B CA  1 
ATOM   2772 C C   . ILE B 2 116 ? 5.975   42.952 -1.793  1.00 24.62  ? 129 ILE B C   1 
ATOM   2773 O O   . ILE B 2 116 ? 5.849   44.125 -1.461  1.00 24.81  ? 129 ILE B O   1 
ATOM   2774 C CB  . ILE B 2 116 ? 7.890   43.100 -3.502  1.00 25.19  ? 129 ILE B CB  1 
ATOM   2775 C CG1 . ILE B 2 116 ? 8.315   42.560 -4.867  1.00 26.06  ? 129 ILE B CG1 1 
ATOM   2776 C CG2 . ILE B 2 116 ? 8.922   42.705 -2.405  1.00 24.66  ? 129 ILE B CG2 1 
ATOM   2777 C CD1 . ILE B 2 116 ? 9.361   43.367 -5.510  1.00 29.09  ? 129 ILE B CD1 1 
ATOM   2778 N N   . VAL B 2 117 ? 5.622   41.948 -0.999  1.00 23.60  ? 130 VAL B N   1 
ATOM   2779 C CA  . VAL B 2 117 ? 4.894   42.196 0.221   1.00 21.79  ? 130 VAL B CA  1 
ATOM   2780 C C   . VAL B 2 117 ? 5.719   41.833 1.437   1.00 21.69  ? 130 VAL B C   1 
ATOM   2781 O O   . VAL B 2 117 ? 6.028   40.650 1.668   1.00 20.20  ? 130 VAL B O   1 
ATOM   2782 C CB  . VAL B 2 117 ? 3.548   41.420 0.246   1.00 22.26  ? 130 VAL B CB  1 
ATOM   2783 C CG1 . VAL B 2 117 ? 2.771   41.722 1.510   1.00 20.16  ? 130 VAL B CG1 1 
ATOM   2784 C CG2 . VAL B 2 117 ? 2.710   41.719 -0.988  1.00 21.82  ? 130 VAL B CG2 1 
ATOM   2785 N N   . GLY B 2 118 ? 6.069   42.864 2.200   1.00 21.67  ? 131 GLY B N   1 
ATOM   2786 C CA  . GLY B 2 118 ? 6.779   42.708 3.453   1.00 22.87  ? 131 GLY B CA  1 
ATOM   2787 C C   . GLY B 2 118 ? 5.820   42.433 4.591   1.00 23.89  ? 131 GLY B C   1 
ATOM   2788 O O   . GLY B 2 118 ? 5.264   43.371 5.180   1.00 22.75  ? 131 GLY B O   1 
ATOM   2789 N N   . ASN B 2 119 ? 5.652   41.151 4.923   1.00 24.67  ? 132 ASN B N   1 
ATOM   2790 C CA  . ASN B 2 119 ? 4.683   40.741 5.944   1.00 26.00  ? 132 ASN B CA  1 
ATOM   2791 C C   . ASN B 2 119 ? 5.253   40.773 7.358   1.00 27.58  ? 132 ASN B C   1 
ATOM   2792 O O   . ASN B 2 119 ? 6.472   40.743 7.561   1.00 27.52  ? 132 ASN B O   1 
ATOM   2793 C CB  . ASN B 2 119 ? 4.079   39.344 5.622   1.00 25.25  ? 132 ASN B CB  1 
ATOM   2794 C CG  . ASN B 2 119 ? 2.831   39.014 6.462   1.00 25.03  ? 132 ASN B CG  1 
ATOM   2795 O OD1 . ASN B 2 119 ? 2.091   39.903 6.889   1.00 23.91  ? 132 ASN B OD1 1 
ATOM   2796 N ND2 . ASN B 2 119 ? 2.591   37.733 6.673   1.00 23.07  ? 132 ASN B ND2 1 
ATOM   2797 N N   . LYS B 2 120 ? 4.332   40.803 8.320   1.00 29.63  ? 133 LYS B N   1 
ATOM   2798 C CA  . LYS B 2 120 ? 4.583   40.821 9.769   1.00 32.13  ? 133 LYS B CA  1 
ATOM   2799 C C   . LYS B 2 120 ? 5.202   42.135 10.212  1.00 32.99  ? 133 LYS B C   1 
ATOM   2800 O O   . LYS B 2 120 ? 6.162   42.162 10.957  1.00 33.39  ? 133 LYS B O   1 
ATOM   2801 C CB  . LYS B 2 120 ? 5.392   39.601 10.258  1.00 32.11  ? 133 LYS B CB  1 
ATOM   2802 C CG  . LYS B 2 120 ? 4.933   38.256 9.677   1.00 33.85  ? 133 LYS B CG  1 
ATOM   2803 C CD  . LYS B 2 120 ? 5.812   37.112 10.114  1.00 32.71  ? 133 LYS B CD  1 
ATOM   2804 C CE  . LYS B 2 120 ? 5.287   35.804 9.583   1.00 34.20  ? 133 LYS B CE  1 
ATOM   2805 N NZ  . LYS B 2 120 ? 6.246   34.720 9.928   1.00 35.73  ? 133 LYS B NZ  1 
ATOM   2806 N N   . ILE B 2 121 ? 4.615   43.230 9.755   1.00 35.11  ? 134 ILE B N   1 
ATOM   2807 C CA  . ILE B 2 121 ? 5.061   44.569 10.137  1.00 37.31  ? 134 ILE B CA  1 
ATOM   2808 C C   . ILE B 2 121 ? 4.766   44.880 11.617  1.00 38.46  ? 134 ILE B C   1 
ATOM   2809 O O   . ILE B 2 121 ? 5.241   45.875 12.158  1.00 38.55  ? 134 ILE B O   1 
ATOM   2810 C CB  . ILE B 2 121 ? 4.504   45.657 9.184   1.00 37.27  ? 134 ILE B CB  1 
ATOM   2811 C CG1 . ILE B 2 121 ? 2.989   45.850 9.381   1.00 37.89  ? 134 ILE B CG1 1 
ATOM   2812 C CG2 . ILE B 2 121 ? 4.858   45.294 7.744   1.00 37.54  ? 134 ILE B CG2 1 
ATOM   2813 C CD1 . ILE B 2 121 ? 2.385   47.054 8.618   1.00 37.52  ? 134 ILE B CD1 1 
ATOM   2814 N N   . ASP B 2 122 ? 3.993   43.995 12.246  1.00 39.79  ? 135 ASP B N   1 
ATOM   2815 C CA  . ASP B 2 122 ? 3.773   43.999 13.686  1.00 41.36  ? 135 ASP B CA  1 
ATOM   2816 C C   . ASP B 2 122 ? 5.034   43.546 14.459  1.00 41.94  ? 135 ASP B C   1 
ATOM   2817 O O   . ASP B 2 122 ? 5.080   43.613 15.693  1.00 42.13  ? 135 ASP B O   1 
ATOM   2818 C CB  . ASP B 2 122 ? 2.559   43.117 14.026  1.00 41.73  ? 135 ASP B CB  1 
ATOM   2819 C CG  . ASP B 2 122 ? 2.658   41.706 13.438  1.00 43.02  ? 135 ASP B CG  1 
ATOM   2820 O OD1 . ASP B 2 122 ? 2.496   41.528 12.205  1.00 44.67  ? 135 ASP B OD1 1 
ATOM   2821 O OD2 . ASP B 2 122 ? 2.890   40.767 14.224  1.00 44.51  ? 135 ASP B OD2 1 
ATOM   2822 N N   . LEU B 2 123 ? 6.042   43.069 13.721  1.00 42.27  ? 136 LEU B N   1 
ATOM   2823 C CA  . LEU B 2 123 ? 7.336   42.689 14.297  1.00 42.32  ? 136 LEU B CA  1 
ATOM   2824 C C   . LEU B 2 123 ? 8.448   43.590 13.742  1.00 42.36  ? 136 LEU B C   1 
ATOM   2825 O O   . LEU B 2 123 ? 9.568   43.136 13.480  1.00 42.50  ? 136 LEU B O   1 
ATOM   2826 C CB  . LEU B 2 123 ? 7.643   41.201 14.041  1.00 42.32  ? 136 LEU B CB  1 
ATOM   2827 C CG  . LEU B 2 123 ? 6.616   40.138 14.464  1.00 41.69  ? 136 LEU B CG  1 
ATOM   2828 C CD1 . LEU B 2 123 ? 6.891   38.798 13.755  1.00 42.08  ? 136 LEU B CD1 1 
ATOM   2829 C CD2 . LEU B 2 123 ? 6.538   39.933 15.982  1.00 40.71  ? 136 LEU B CD2 1 
ATOM   2830 N N   . GLU B 2 124 ? 8.131   44.876 13.578  1.00 42.24  ? 137 GLU B N   1 
ATOM   2831 C CA  . GLU B 2 124 ? 9.081   45.869 13.063  1.00 41.86  ? 137 GLU B CA  1 
ATOM   2832 C C   . GLU B 2 124 ? 10.271  46.072 14.010  1.00 41.54  ? 137 GLU B C   1 
ATOM   2833 O O   . GLU B 2 124 ? 11.343  46.515 13.590  1.00 41.55  ? 137 GLU B O   1 
ATOM   2834 C CB  . GLU B 2 124 ? 8.367   47.200 12.802  1.00 42.76  ? 137 GLU B CB  1 
ATOM   2835 N N   . LYS B 2 125 ? 10.068  45.751 15.287  1.00 40.74  ? 138 LYS B N   1 
ATOM   2836 C CA  . LYS B 2 125 ? 11.129  45.812 16.286  1.00 39.74  ? 138 LYS B CA  1 
ATOM   2837 C C   . LYS B 2 125 ? 12.265  44.854 15.918  1.00 38.99  ? 138 LYS B C   1 
ATOM   2838 O O   . LYS B 2 125 ? 13.445  45.124 16.192  1.00 39.87  ? 138 LYS B O   1 
ATOM   2839 C CB  . LYS B 2 125 ? 10.568  45.480 17.658  1.00 40.14  ? 138 LYS B CB  1 
ATOM   2840 N N   . GLU B 2 126 ? 11.899  43.752 15.266  1.00 37.02  ? 139 GLU B N   1 
ATOM   2841 C CA  . GLU B 2 126 ? 12.824  42.689 14.934  1.00 34.77  ? 139 GLU B CA  1 
ATOM   2842 C C   . GLU B 2 126 ? 13.150  42.609 13.432  1.00 32.30  ? 139 GLU B C   1 
ATOM   2843 O O   . GLU B 2 126 ? 13.590  41.558 12.974  1.00 31.21  ? 139 GLU B O   1 
ATOM   2844 C CB  . GLU B 2 126 ? 12.209  41.363 15.373  1.00 35.26  ? 139 GLU B CB  1 
ATOM   2845 C CG  . GLU B 2 126 ? 11.575  41.414 16.729  1.00 38.74  ? 139 GLU B CG  1 
ATOM   2846 C CD  . GLU B 2 126 ? 10.465  40.403 16.897  1.00 43.55  ? 139 GLU B CD  1 
ATOM   2847 O OE1 . GLU B 2 126 ? 9.470   40.763 17.582  1.00 45.92  ? 139 GLU B OE1 1 
ATOM   2848 O OE2 . GLU B 2 126 ? 10.581  39.266 16.348  1.00 44.10  ? 139 GLU B OE2 1 
ATOM   2849 N N   . ARG B 2 127 ? 12.934  43.686 12.670  1.00 29.56  ? 140 ARG B N   1 
ATOM   2850 C CA  . ARG B 2 127 ? 13.054  43.580 11.215  1.00 28.45  ? 140 ARG B CA  1 
ATOM   2851 C C   . ARG B 2 127 ? 14.511  43.478 10.772  1.00 26.36  ? 140 ARG B C   1 
ATOM   2852 O O   . ARG B 2 127 ? 15.391  44.070 11.397  1.00 25.34  ? 140 ARG B O   1 
ATOM   2853 C CB  . ARG B 2 127 ? 12.267  44.661 10.461  1.00 28.52  ? 140 ARG B CB  1 
ATOM   2854 C CG  . ARG B 2 127 ? 12.994  45.935 10.124  1.00 29.87  ? 140 ARG B CG  1 
ATOM   2855 C CD  . ARG B 2 127 ? 11.992  46.970 9.590   1.00 29.90  ? 140 ARG B CD  1 
ATOM   2856 N NE  . ARG B 2 127 ? 11.744  46.737 8.174   1.00 34.52  ? 140 ARG B NE  1 
ATOM   2857 C CZ  . ARG B 2 127 ? 10.592  46.931 7.548   1.00 33.42  ? 140 ARG B CZ  1 
ATOM   2858 N NH1 . ARG B 2 127 ? 9.522   47.359 8.194   1.00 35.48  ? 140 ARG B NH1 1 
ATOM   2859 N NH2 . ARG B 2 127 ? 10.514  46.670 6.262   1.00 34.77  ? 140 ARG B NH2 1 
ATOM   2860 N N   . HIS B 2 128 ? 14.748  42.694 9.723   1.00 24.61  ? 141 HIS B N   1 
ATOM   2861 C CA  . HIS B 2 128 ? 16.095  42.496 9.169   1.00 23.19  ? 141 HIS B CA  1 
ATOM   2862 C C   . HIS B 2 128 ? 16.213  43.051 7.765   1.00 22.85  ? 141 HIS B C   1 
ATOM   2863 O O   . HIS B 2 128 ? 17.319  43.287 7.266   1.00 23.49  ? 141 HIS B O   1 
ATOM   2864 C CB  . HIS B 2 128 ? 16.425  41.021 9.106   1.00 22.69  ? 141 HIS B CB  1 
ATOM   2865 C CG  . HIS B 2 128 ? 16.794  40.418 10.420  1.00 21.67  ? 141 HIS B CG  1 
ATOM   2866 N ND1 . HIS B 2 128 ? 17.403  39.186 10.513  1.00 19.98  ? 141 HIS B ND1 1 
ATOM   2867 C CD2 . HIS B 2 128 ? 16.632  40.858 11.690  1.00 21.44  ? 141 HIS B CD2 1 
ATOM   2868 C CE1 . HIS B 2 128 ? 17.604  38.893 11.784  1.00 21.47  ? 141 HIS B CE1 1 
ATOM   2869 N NE2 . HIS B 2 128 ? 17.149  39.890 12.519  1.00 22.83  ? 141 HIS B NE2 1 
ATOM   2870 N N   . VAL B 2 129 ? 15.077  43.251 7.117   1.00 21.76  ? 142 VAL B N   1 
ATOM   2871 C CA  . VAL B 2 129 ? 15.085  43.817 5.785   1.00 20.70  ? 142 VAL B CA  1 
ATOM   2872 C C   . VAL B 2 129 ? 14.639  45.256 5.938   1.00 20.95  ? 142 VAL B C   1 
ATOM   2873 O O   . VAL B 2 129 ? 13.529  45.514 6.420   1.00 19.99  ? 142 VAL B O   1 
ATOM   2874 C CB  . VAL B 2 129 ? 14.152  43.039 4.819   1.00 20.75  ? 142 VAL B CB  1 
ATOM   2875 C CG1 . VAL B 2 129 ? 14.160  43.687 3.441   1.00 19.45  ? 142 VAL B CG1 1 
ATOM   2876 C CG2 . VAL B 2 129 ? 14.578  41.547 4.719   1.00 20.17  ? 142 VAL B CG2 1 
ATOM   2877 N N   . SER B 2 130 ? 15.499  46.198 5.542   1.00 20.53  ? 143 SER B N   1 
ATOM   2878 C CA  . SER B 2 130 ? 15.163  47.606 5.684   1.00 20.74  ? 143 SER B CA  1 
ATOM   2879 C C   . SER B 2 130 ? 14.082  47.988 4.694   1.00 20.31  ? 143 SER B C   1 
ATOM   2880 O O   . SER B 2 130 ? 13.989  47.430 3.603   1.00 20.52  ? 143 SER B O   1 
ATOM   2881 C CB  . SER B 2 130 ? 16.397  48.486 5.477   1.00 20.71  ? 143 SER B CB  1 
ATOM   2882 O OG  . SER B 2 130 ? 16.703  48.571 4.102   1.00 19.46  ? 143 SER B OG  1 
ATOM   2883 N N   . ILE B 2 131 ? 13.258  48.945 5.080   1.00 21.18  ? 144 ILE B N   1 
ATOM   2884 C CA  . ILE B 2 131 ? 12.228  49.489 4.194   1.00 22.08  ? 144 ILE B CA  1 
ATOM   2885 C C   . ILE B 2 131 ? 12.866  50.053 2.943   1.00 21.55  ? 144 ILE B C   1 
ATOM   2886 O O   . ILE B 2 131 ? 12.391  49.783 1.838   1.00 21.11  ? 144 ILE B O   1 
ATOM   2887 C CB  . ILE B 2 131 ? 11.331  50.551 4.919   1.00 22.38  ? 144 ILE B CB  1 
ATOM   2888 C CG1 . ILE B 2 131 ? 10.526  49.878 6.031   1.00 23.02  ? 144 ILE B CG1 1 
ATOM   2889 C CG2 . ILE B 2 131 ? 10.355  51.193 3.946   1.00 24.09  ? 144 ILE B CG2 1 
ATOM   2890 C CD1 . ILE B 2 131 ? 9.814   50.846 7.011   1.00 23.59  ? 144 ILE B CD1 1 
ATOM   2891 N N   . GLN B 2 132 ? 13.976  50.789 3.100   1.00 21.30  ? 145 GLN B N   1 
ATOM   2892 C CA  . GLN B 2 132 ? 14.653  51.359 1.936   1.00 21.17  ? 145 GLN B CA  1 
ATOM   2893 C C   . GLN B 2 132 ? 15.138  50.283 0.967   1.00 20.30  ? 145 GLN B C   1 
ATOM   2894 O O   . GLN B 2 132 ? 14.977  50.441 -0.238  1.00 20.08  ? 145 GLN B O   1 
ATOM   2895 C CB  . GLN B 2 132 ? 15.829  52.294 2.306   1.00 21.85  ? 145 GLN B CB  1 
ATOM   2896 C CG  . GLN B 2 132 ? 15.475  53.549 3.045   1.00 23.79  ? 145 GLN B CG  1 
ATOM   2897 C CD  . GLN B 2 132 ? 15.263  53.315 4.533   1.00 27.92  ? 145 GLN B CD  1 
ATOM   2898 O OE1 . GLN B 2 132 ? 15.676  52.283 5.090   1.00 27.83  ? 145 GLN B OE1 1 
ATOM   2899 N NE2 . GLN B 2 132 ? 14.619  54.278 5.190   1.00 26.80  ? 145 GLN B NE2 1 
ATOM   2900 N N   . GLU B 2 133 ? 15.715  49.187 1.471   1.00 19.31  ? 146 GLU B N   1 
ATOM   2901 C CA  . GLU B 2 133 ? 16.175  48.130 0.553   1.00 18.87  ? 146 GLU B CA  1 
ATOM   2902 C C   . GLU B 2 133 ? 14.996  47.500 -0.224  1.00 18.48  ? 146 GLU B C   1 
ATOM   2903 O O   . GLU B 2 133 ? 15.078  47.282 -1.426  1.00 18.28  ? 146 GLU B O   1 
ATOM   2904 C CB  . GLU B 2 133 ? 17.001  47.046 1.281   1.00 18.18  ? 146 GLU B CB  1 
ATOM   2905 C CG  . GLU B 2 133 ? 17.374  45.898 0.343   1.00 18.72  ? 146 GLU B CG  1 
ATOM   2906 C CD  . GLU B 2 133 ? 18.391  44.890 0.910   1.00 19.44  ? 146 GLU B CD  1 
ATOM   2907 O OE1 . GLU B 2 133 ? 18.509  44.738 2.159   1.00 17.18  ? 146 GLU B OE1 1 
ATOM   2908 O OE2 . GLU B 2 133 ? 19.049  44.229 0.072   1.00 17.31  ? 146 GLU B OE2 1 
ATOM   2909 N N   . ALA B 2 134 ? 13.917  47.207 0.488   1.00 18.62  ? 147 ALA B N   1 
ATOM   2910 C CA  . ALA B 2 134 ? 12.738  46.553 -0.094  1.00 18.84  ? 147 ALA B CA  1 
ATOM   2911 C C   . ALA B 2 134 ? 12.047  47.427 -1.164  1.00 19.54  ? 147 ALA B C   1 
ATOM   2912 O O   . ALA B 2 134 ? 11.729  46.959 -2.260  1.00 19.51  ? 147 ALA B O   1 
ATOM   2913 C CB  . ALA B 2 134 ? 11.782  46.182 1.016   1.00 17.88  ? 147 ALA B CB  1 
ATOM   2914 N N   . GLU B 2 135 ? 11.861  48.707 -0.852  1.00 20.49  ? 148 GLU B N   1 
ATOM   2915 C CA  . GLU B 2 135 ? 11.185  49.644 -1.762  1.00 21.76  ? 148 GLU B CA  1 
ATOM   2916 C C   . GLU B 2 135 ? 12.032  49.972 -2.979  1.00 21.64  ? 148 GLU B C   1 
ATOM   2917 O O   . GLU B 2 135 ? 11.531  50.026 -4.106  1.00 21.94  ? 148 GLU B O   1 
ATOM   2918 C CB  . GLU B 2 135 ? 10.797  50.914 -0.999  1.00 21.97  ? 148 GLU B CB  1 
ATOM   2919 C CG  . GLU B 2 135 ? 9.578   50.705 -0.109  1.00 23.32  ? 148 GLU B CG  1 
ATOM   2920 C CD  . GLU B 2 135 ? 9.117   51.972 0.600   1.00 24.46  ? 148 GLU B CD  1 
ATOM   2921 O OE1 . GLU B 2 135 ? 9.814   53.006 0.488   1.00 27.96  ? 148 GLU B OE1 1 
ATOM   2922 O OE2 . GLU B 2 135 ? 8.079   51.917 1.300   1.00 26.62  ? 148 GLU B OE2 1 
ATOM   2923 N N   . SER B 2 136 ? 13.329  50.151 -2.746  1.00 22.12  ? 149 SER B N   1 
ATOM   2924 C CA  . SER B 2 136 ? 14.298  50.365 -3.815  1.00 22.93  ? 149 SER B CA  1 
ATOM   2925 C C   . SER B 2 136 ? 14.465  49.124 -4.695  1.00 22.64  ? 149 SER B C   1 
ATOM   2926 O O   . SER B 2 136 ? 14.592  49.230 -5.916  1.00 23.06  ? 149 SER B O   1 
ATOM   2927 C CB  . SER B 2 136 ? 15.657  50.757 -3.225  1.00 23.31  ? 149 SER B CB  1 
ATOM   2928 O OG  . SER B 2 136 ? 16.657  50.622 -4.224  1.00 27.82  ? 149 SER B OG  1 
ATOM   2929 N N   . TYR B 2 137 ? 14.494  47.938 -4.087  1.00 22.71  ? 150 TYR B N   1 
ATOM   2930 C CA  . TYR B 2 137 ? 14.468  46.744 -4.905  1.00 22.36  ? 150 TYR B CA  1 
ATOM   2931 C C   . TYR B 2 137 ? 13.181  46.703 -5.777  1.00 22.48  ? 150 TYR B C   1 
ATOM   2932 O O   . TYR B 2 137 ? 13.260  46.503 -6.984  1.00 23.04  ? 150 TYR B O   1 
ATOM   2933 C CB  . TYR B 2 137 ? 14.638  45.449 -4.092  1.00 22.02  ? 150 TYR B CB  1 
ATOM   2934 C CG  . TYR B 2 137 ? 14.361  44.264 -4.977  1.00 21.43  ? 150 TYR B CG  1 
ATOM   2935 C CD1 . TYR B 2 137 ? 15.314  43.816 -5.893  1.00 21.68  ? 150 TYR B CD1 1 
ATOM   2936 C CD2 . TYR B 2 137 ? 13.112  43.655 -4.971  1.00 22.13  ? 150 TYR B CD2 1 
ATOM   2937 C CE1 . TYR B 2 137 ? 15.036  42.774 -6.748  1.00 20.51  ? 150 TYR B CE1 1 
ATOM   2938 C CE2 . TYR B 2 137 ? 12.820  42.603 -5.823  1.00 22.04  ? 150 TYR B CE2 1 
ATOM   2939 C CZ  . TYR B 2 137 ? 13.771  42.172 -6.705  1.00 21.97  ? 150 TYR B CZ  1 
ATOM   2940 O OH  . TYR B 2 137 ? 13.452  41.128 -7.536  1.00 21.53  ? 150 TYR B OH  1 
ATOM   2941 N N   . ALA B 2 138 ? 12.017  46.875 -5.163  1.00 23.24  ? 151 ALA B N   1 
ATOM   2942 C CA  . ALA B 2 138 ? 10.736  46.822 -5.894  1.00 24.50  ? 151 ALA B CA  1 
ATOM   2943 C C   . ALA B 2 138 ? 10.730  47.739 -7.122  1.00 25.21  ? 151 ALA B C   1 
ATOM   2944 O O   . ALA B 2 138 ? 10.441  47.291 -8.236  1.00 25.95  ? 151 ALA B O   1 
ATOM   2945 C CB  . ALA B 2 138 ? 9.586   47.156 -4.985  1.00 23.89  ? 151 ALA B CB  1 
ATOM   2946 N N   . GLU B 2 139 ? 11.061  49.013 -6.915  1.00 26.22  ? 152 GLU B N   1 
ATOM   2947 C CA  . GLU B 2 139 ? 11.185  49.982 -8.017  1.00 26.70  ? 152 GLU B CA  1 
ATOM   2948 C C   . GLU B 2 139 ? 12.114  49.501 -9.122  1.00 27.00  ? 152 GLU B C   1 
ATOM   2949 O O   . GLU B 2 139 ? 11.831  49.687 -10.314 1.00 27.75  ? 152 GLU B O   1 
ATOM   2950 C CB  . GLU B 2 139 ? 11.651  51.347 -7.479  1.00 26.77  ? 152 GLU B CB  1 
ATOM   2951 N N   . SER B 2 140 ? 13.217  48.862 -8.748  1.00 27.74  ? 153 SER B N   1 
ATOM   2952 C CA  . SER B 2 140 ? 14.212  48.461 -9.734  1.00 28.15  ? 153 SER B CA  1 
ATOM   2953 C C   . SER B 2 140 ? 13.676  47.404 -10.701 1.00 28.66  ? 153 SER B C   1 
ATOM   2954 O O   . SER B 2 140 ? 14.146  47.298 -11.837 1.00 28.26  ? 153 SER B O   1 
ATOM   2955 C CB  . SER B 2 140 ? 15.516  48.003 -9.063  1.00 28.66  ? 153 SER B CB  1 
ATOM   2956 O OG  . SER B 2 140 ? 15.418  46.689 -8.528  1.00 30.04  ? 153 SER B OG  1 
ATOM   2957 N N   . VAL B 2 141 ? 12.686  46.628 -10.257 1.00 29.09  ? 154 VAL B N   1 
ATOM   2958 C CA  . VAL B 2 141 ? 12.134  45.555 -11.091 1.00 28.80  ? 154 VAL B CA  1 
ATOM   2959 C C   . VAL B 2 141 ? 10.703  45.885 -11.565 1.00 29.32  ? 154 VAL B C   1 
ATOM   2960 O O   . VAL B 2 141 ? 9.952   44.996 -11.985 1.00 29.92  ? 154 VAL B O   1 
ATOM   2961 C CB  . VAL B 2 141 ? 12.237  44.137 -10.403 1.00 28.47  ? 154 VAL B CB  1 
ATOM   2962 C CG1 . VAL B 2 141 ? 13.691  43.767 -10.155 1.00 27.95  ? 154 VAL B CG1 1 
ATOM   2963 C CG2 . VAL B 2 141 ? 11.438  44.079 -9.103  1.00 27.36  ? 154 VAL B CG2 1 
ATOM   2964 N N   . GLY B 2 142 ? 10.337  47.164 -11.492 1.00 29.49  ? 155 GLY B N   1 
ATOM   2965 C CA  . GLY B 2 142 ? 9.002   47.630 -11.899 1.00 29.17  ? 155 GLY B CA  1 
ATOM   2966 C C   . GLY B 2 142 ? 7.878   47.077 -11.030 1.00 28.83  ? 155 GLY B C   1 
ATOM   2967 O O   . GLY B 2 142 ? 6.735   46.988 -11.465 1.00 28.68  ? 155 GLY B O   1 
ATOM   2968 N N   . ALA B 2 143 ? 8.206   46.698 -9.796  1.00 28.19  ? 156 ALA B N   1 
ATOM   2969 C CA  . ALA B 2 143 ? 7.217   46.173 -8.858  1.00 27.32  ? 156 ALA B CA  1 
ATOM   2970 C C   . ALA B 2 143 ? 6.759   47.261 -7.927  1.00 27.18  ? 156 ALA B C   1 
ATOM   2971 O O   . ALA B 2 143 ? 7.332   48.347 -7.903  1.00 27.62  ? 156 ALA B O   1 
ATOM   2972 C CB  . ALA B 2 143 ? 7.800   45.026 -8.048  1.00 27.19  ? 156 ALA B CB  1 
ATOM   2973 N N   . LYS B 2 144 ? 5.725   46.959 -7.151  1.00 26.35  ? 157 LYS B N   1 
ATOM   2974 C CA  . LYS B 2 144 ? 5.273   47.837 -6.111  1.00 25.63  ? 157 LYS B CA  1 
ATOM   2975 C C   . LYS B 2 144 ? 5.467   47.064 -4.816  1.00 24.26  ? 157 LYS B C   1 
ATOM   2976 O O   . LYS B 2 144 ? 5.337   45.840 -4.805  1.00 23.26  ? 157 LYS B O   1 
ATOM   2977 C CB  . LYS B 2 144 ? 3.801   48.169 -6.319  1.00 26.54  ? 157 LYS B CB  1 
ATOM   2978 C CG  . LYS B 2 144 ? 3.485   49.576 -6.807  1.00 30.25  ? 157 LYS B CG  1 
ATOM   2979 C CD  . LYS B 2 144 ? 2.277   50.038 -5.997  1.00 34.87  ? 157 LYS B CD  1 
ATOM   2980 C CE  . LYS B 2 144 ? 1.990   51.518 -6.032  1.00 36.54  ? 157 LYS B CE  1 
ATOM   2981 N NZ  . LYS B 2 144 ? 0.731   51.774 -6.804  1.00 38.58  ? 157 LYS B NZ  1 
ATOM   2982 N N   . HIS B 2 145 ? 5.785   47.787 -3.743  1.00 22.66  ? 158 HIS B N   1 
ATOM   2983 C CA  . HIS B 2 145 ? 6.016   47.210 -2.427  1.00 22.27  ? 158 HIS B CA  1 
ATOM   2984 C C   . HIS B 2 145 ? 4.901   47.605 -1.484  1.00 22.76  ? 158 HIS B C   1 
ATOM   2985 O O   . HIS B 2 145 ? 4.431   48.753 -1.516  1.00 22.23  ? 158 HIS B O   1 
ATOM   2986 C CB  . HIS B 2 145 ? 7.339   47.702 -1.847  1.00 21.57  ? 158 HIS B CB  1 
ATOM   2987 C CG  . HIS B 2 145 ? 7.718   47.016 -0.578  1.00 20.51  ? 158 HIS B CG  1 
ATOM   2988 N ND1 . HIS B 2 145 ? 7.324   47.476 0.660   1.00 17.32  ? 158 HIS B ND1 1 
ATOM   2989 C CD2 . HIS B 2 145 ? 8.417   45.874 -0.355  1.00 17.90  ? 158 HIS B CD2 1 
ATOM   2990 C CE1 . HIS B 2 145 ? 7.785   46.660 1.594   1.00 19.06  ? 158 HIS B CE1 1 
ATOM   2991 N NE2 . HIS B 2 145 ? 8.429   45.666 1.004   1.00 15.46  ? 158 HIS B NE2 1 
ATOM   2992 N N   . TYR B 2 146 ? 4.496   46.659 -0.639  1.00 22.82  ? 159 TYR B N   1 
ATOM   2993 C CA  . TYR B 2 146 ? 3.436   46.872 0.339   1.00 23.57  ? 159 TYR B CA  1 
ATOM   2994 C C   . TYR B 2 146 ? 3.850   46.310 1.679   1.00 23.96  ? 159 TYR B C   1 
ATOM   2995 O O   . TYR B 2 146 ? 4.548   45.303 1.753   1.00 23.67  ? 159 TYR B O   1 
ATOM   2996 C CB  . TYR B 2 146 ? 2.134   46.189 -0.106  1.00 24.00  ? 159 TYR B CB  1 
ATOM   2997 C CG  . TYR B 2 146 ? 1.691   46.560 -1.512  1.00 25.15  ? 159 TYR B CG  1 
ATOM   2998 C CD1 . TYR B 2 146 ? 0.702   47.540 -1.735  1.00 25.79  ? 159 TYR B CD1 1 
ATOM   2999 C CD2 . TYR B 2 146 ? 2.266   45.952 -2.611  1.00 23.77  ? 159 TYR B CD2 1 
ATOM   3000 C CE1 . TYR B 2 146 ? 0.304   47.875 -3.034  1.00 26.06  ? 159 TYR B CE1 1 
ATOM   3001 C CE2 . TYR B 2 146 ? 1.881   46.270 -3.901  1.00 27.33  ? 159 TYR B CE2 1 
ATOM   3002 C CZ  . TYR B 2 146 ? 0.900   47.230 -4.115  1.00 26.69  ? 159 TYR B CZ  1 
ATOM   3003 O OH  . TYR B 2 146 ? 0.565   47.516 -5.427  1.00 27.11  ? 159 TYR B OH  1 
ATOM   3004 N N   . HIS B 2 147 ? 3.394   46.940 2.742   1.00 24.85  ? 160 HIS B N   1 
ATOM   3005 C CA  . HIS B 2 147 ? 3.576   46.411 4.074   1.00 26.51  ? 160 HIS B CA  1 
ATOM   3006 C C   . HIS B 2 147 ? 2.240   45.816 4.510   1.00 27.56  ? 160 HIS B C   1 
ATOM   3007 O O   . HIS B 2 147 ? 1.174   46.411 4.284   1.00 27.58  ? 160 HIS B O   1 
ATOM   3008 C CB  . HIS B 2 147 ? 3.965   47.514 5.066   1.00 27.28  ? 160 HIS B CB  1 
ATOM   3009 C CG  . HIS B 2 147 ? 5.155   48.334 4.659   1.00 29.41  ? 160 HIS B CG  1 
ATOM   3010 N ND1 . HIS B 2 147 ? 6.454   47.937 4.898   1.00 30.39  ? 160 HIS B ND1 1 
ATOM   3011 C CD2 . HIS B 2 147 ? 5.236   49.554 4.074   1.00 32.61  ? 160 HIS B CD2 1 
ATOM   3012 C CE1 . HIS B 2 147 ? 7.285   48.859 4.448   1.00 33.43  ? 160 HIS B CE1 1 
ATOM   3013 N NE2 . HIS B 2 147 ? 6.572   49.852 3.941   1.00 34.83  ? 160 HIS B NE2 1 
ATOM   3014 N N   . THR B 2 148 ? 2.292   44.650 5.143   1.00 28.04  ? 161 THR B N   1 
ATOM   3015 C CA  . THR B 2 148 ? 1.099   44.040 5.696   1.00 28.70  ? 161 THR B CA  1 
ATOM   3016 C C   . THR B 2 148 ? 1.381   43.477 7.067   1.00 29.52  ? 161 THR B C   1 
ATOM   3017 O O   . THR B 2 148 ? 2.534   43.198 7.426   1.00 28.80  ? 161 THR B O   1 
ATOM   3018 C CB  . THR B 2 148 ? 0.576   42.877 4.822   1.00 28.28  ? 161 THR B CB  1 
ATOM   3019 O OG1 . THR B 2 148 ? 1.573   41.839 4.763   1.00 29.15  ? 161 THR B OG1 1 
ATOM   3020 C CG2 . THR B 2 148 ? 0.229   43.355 3.419   1.00 28.08  ? 161 THR B CG2 1 
ATOM   3021 N N   . SER B 2 149 ? 0.307   43.287 7.817   1.00 31.01  ? 162 SER B N   1 
ATOM   3022 C CA  . SER B 2 149 ? 0.332   42.491 9.017   1.00 33.36  ? 162 SER B CA  1 
ATOM   3023 C C   . SER B 2 149 ? -0.917  41.620 9.006   1.00 35.20  ? 162 SER B C   1 
ATOM   3024 O O   . SER B 2 149 ? -2.014  42.104 9.332   1.00 35.18  ? 162 SER B O   1 
ATOM   3025 C CB  . SER B 2 149 ? 0.344   43.381 10.258  1.00 33.18  ? 162 SER B CB  1 
ATOM   3026 O OG  . SER B 2 149 ? 0.084   42.603 11.420  1.00 34.92  ? 162 SER B OG  1 
ATOM   3027 N N   . ALA B 2 150 ? -0.769  40.348 8.628   1.00 36.89  ? 163 ALA B N   1 
ATOM   3028 C CA  . ALA B 2 150 ? -1.915  39.428 8.674   1.00 38.91  ? 163 ALA B CA  1 
ATOM   3029 C C   . ALA B 2 150 ? -2.402  39.315 10.112  1.00 40.30  ? 163 ALA B C   1 
ATOM   3030 O O   . ALA B 2 150 ? -3.608  39.291 10.361  1.00 40.95  ? 163 ALA B O   1 
ATOM   3031 C CB  . ALA B 2 150 ? -1.555  38.063 8.115   1.00 38.47  ? 163 ALA B CB  1 
ATOM   3032 N N   . LYS B 2 151 ? -1.451  39.287 11.049  1.00 42.07  ? 164 LYS B N   1 
ATOM   3033 C CA  . LYS B 2 151 ? -1.723  39.212 12.489  1.00 43.73  ? 164 LYS B CA  1 
ATOM   3034 C C   . LYS B 2 151 ? -2.698  40.298 12.958  1.00 44.15  ? 164 LYS B C   1 
ATOM   3035 O O   . LYS B 2 151 ? -3.643  40.004 13.699  1.00 44.66  ? 164 LYS B O   1 
ATOM   3036 C CB  . LYS B 2 151 ? -0.410  39.306 13.275  1.00 44.22  ? 164 LYS B CB  1 
ATOM   3037 C CG  . LYS B 2 151 ? -0.457  38.781 14.710  1.00 46.26  ? 164 LYS B CG  1 
ATOM   3038 C CD  . LYS B 2 151 ? 0.159   37.387 14.825  1.00 48.82  ? 164 LYS B CD  1 
ATOM   3039 C CE  . LYS B 2 151 ? 0.403   37.011 16.286  1.00 50.43  ? 164 LYS B CE  1 
ATOM   3040 N NZ  . LYS B 2 151 ? 1.202   35.743 16.425  1.00 51.23  ? 164 LYS B NZ  1 
ATOM   3041 N N   . GLN B 2 152 ? -2.482  41.534 12.502  1.00 44.39  ? 165 GLN B N   1 
ATOM   3042 C CA  . GLN B 2 152 ? -3.289  42.690 12.915  1.00 44.48  ? 165 GLN B CA  1 
ATOM   3043 C C   . GLN B 2 152 ? -4.221  43.216 11.812  1.00 44.48  ? 165 GLN B C   1 
ATOM   3044 O O   . GLN B 2 152 ? -4.739  44.340 11.894  1.00 45.03  ? 165 GLN B O   1 
ATOM   3045 C CB  . GLN B 2 152 ? -2.372  43.805 13.417  1.00 44.69  ? 165 GLN B CB  1 
ATOM   3046 N N   . ASN B 2 153 ? -4.433  42.392 10.791  1.00 44.31  ? 166 ASN B N   1 
ATOM   3047 C CA  . ASN B 2 153 ? -5.224  42.746 9.600   1.00 44.08  ? 166 ASN B CA  1 
ATOM   3048 C C   . ASN B 2 153 ? -5.008  44.169 9.054   1.00 43.73  ? 166 ASN B C   1 
ATOM   3049 O O   . ASN B 2 153 ? -5.966  44.933 8.890   1.00 44.02  ? 166 ASN B O   1 
ATOM   3050 C CB  . ASN B 2 153 ? -6.732  42.439 9.818   1.00 44.37  ? 166 ASN B CB  1 
ATOM   3051 N N   . LYS B 2 154 ? -3.750  44.502 8.753   1.00 43.04  ? 167 LYS B N   1 
ATOM   3052 C CA  . LYS B 2 154 ? -3.394  45.772 8.098   1.00 42.14  ? 167 LYS B CA  1 
ATOM   3053 C C   . LYS B 2 154 ? -2.791  45.558 6.712   1.00 41.02  ? 167 LYS B C   1 
ATOM   3054 O O   . LYS B 2 154 ? -1.998  44.627 6.518   1.00 40.26  ? 167 LYS B O   1 
ATOM   3055 C CB  . LYS B 2 154 ? -2.389  46.568 8.940   1.00 42.63  ? 167 LYS B CB  1 
ATOM   3056 C CG  . LYS B 2 154 ? -2.786  46.789 10.396  1.00 44.55  ? 167 LYS B CG  1 
ATOM   3057 C CD  . LYS B 2 154 ? -2.219  48.116 10.903  1.00 48.33  ? 167 LYS B CD  1 
ATOM   3058 C CE  . LYS B 2 154 ? -2.366  48.272 12.417  1.00 49.69  ? 167 LYS B CE  1 
ATOM   3059 N NZ  . LYS B 2 154 ? -1.818  49.600 12.859  1.00 51.34  ? 167 LYS B NZ  1 
ATOM   3060 N N   . GLY B 2 155 ? -3.172  46.425 5.766   1.00 39.72  ? 168 GLY B N   1 
ATOM   3061 C CA  . GLY B 2 155 ? -2.515  46.543 4.442   1.00 38.32  ? 168 GLY B CA  1 
ATOM   3062 C C   . GLY B 2 155 ? -3.007  45.583 3.369   1.00 37.17  ? 168 GLY B C   1 
ATOM   3063 O O   . GLY B 2 155 ? -2.722  45.740 2.177   1.00 36.84  ? 168 GLY B O   1 
ATOM   3064 N N   . ILE B 2 156 ? -3.773  44.596 3.813   1.00 36.76  ? 169 ILE B N   1 
ATOM   3065 C CA  . ILE B 2 156 ? -4.261  43.516 2.979   1.00 35.98  ? 169 ILE B CA  1 
ATOM   3066 C C   . ILE B 2 156 ? -5.201  44.010 1.882   1.00 35.27  ? 169 ILE B C   1 
ATOM   3067 O O   . ILE B 2 156 ? -4.978  43.743 0.697   1.00 34.59  ? 169 ILE B O   1 
ATOM   3068 C CB  . ILE B 2 156 ? -4.895  42.441 3.876   1.00 36.43  ? 169 ILE B CB  1 
ATOM   3069 C CG1 . ILE B 2 156 ? -3.797  41.840 4.768   1.00 37.16  ? 169 ILE B CG1 1 
ATOM   3070 C CG2 . ILE B 2 156 ? -5.615  41.370 3.046   1.00 36.52  ? 169 ILE B CG2 1 
ATOM   3071 C CD1 . ILE B 2 156 ? -4.278  41.325 6.093   1.00 40.08  ? 169 ILE B CD1 1 
ATOM   3072 N N   . GLU B 2 157 ? -6.231  44.757 2.276   1.00 35.29  ? 170 GLU B N   1 
ATOM   3073 C CA  . GLU B 2 157 ? -7.201  45.291 1.323   1.00 34.59  ? 170 GLU B CA  1 
ATOM   3074 C C   . GLU B 2 157 ? -6.534  46.172 0.272   1.00 33.91  ? 170 GLU B C   1 
ATOM   3075 O O   . GLU B 2 157 ? -6.766  46.013 -0.935  1.00 33.45  ? 170 GLU B O   1 
ATOM   3076 C CB  . GLU B 2 157 ? -8.291  46.062 2.066   1.00 35.46  ? 170 GLU B CB  1 
ATOM   3077 N N   . GLU B 2 158 ? -5.686  47.086 0.742   1.00 33.59  ? 171 GLU B N   1 
ATOM   3078 C CA  . GLU B 2 158 ? -4.989  48.040 -0.123  1.00 33.26  ? 171 GLU B CA  1 
ATOM   3079 C C   . GLU B 2 158 ? -4.175  47.317 -1.197  1.00 32.68  ? 171 GLU B C   1 
ATOM   3080 O O   . GLU B 2 158 ? -4.188  47.707 -2.370  1.00 32.34  ? 171 GLU B O   1 
ATOM   3081 C CB  . GLU B 2 158 ? -4.091  48.969 0.713   1.00 34.04  ? 171 GLU B CB  1 
ATOM   3082 C CG  . GLU B 2 158 ? -4.810  49.758 1.849   1.00 36.31  ? 171 GLU B CG  1 
ATOM   3083 C CD  . GLU B 2 158 ? -5.123  48.909 3.097   1.00 40.45  ? 171 GLU B CD  1 
ATOM   3084 O OE1 . GLU B 2 158 ? -5.326  47.679 2.971   1.00 39.86  ? 171 GLU B OE1 1 
ATOM   3085 O OE2 . GLU B 2 158 ? -5.177  49.478 4.213   1.00 41.55  ? 171 GLU B OE2 1 
ATOM   3086 N N   . LEU B 2 159 ? -3.484  46.250 -0.790  1.00 32.17  ? 172 LEU B N   1 
ATOM   3087 C CA  . LEU B 2 159 ? -2.678  45.446 -1.704  1.00 31.17  ? 172 LEU B CA  1 
ATOM   3088 C C   . LEU B 2 159 ? -3.501  44.956 -2.888  1.00 31.37  ? 172 LEU B C   1 
ATOM   3089 O O   . LEU B 2 159 ? -3.142  45.193 -4.047  1.00 30.78  ? 172 LEU B O   1 
ATOM   3090 C CB  . LEU B 2 159 ? -2.027  44.271 -0.949  1.00 30.98  ? 172 LEU B CB  1 
ATOM   3091 C CG  . LEU B 2 159 ? -1.470  43.041 -1.687  1.00 31.16  ? 172 LEU B CG  1 
ATOM   3092 C CD1 . LEU B 2 159 ? -0.300  43.387 -2.624  1.00 29.87  ? 172 LEU B CD1 1 
ATOM   3093 C CD2 . LEU B 2 159 ? -1.065  41.974 -0.695  1.00 30.84  ? 172 LEU B CD2 1 
ATOM   3094 N N   . PHE B 2 160 ? -4.605  44.268 -2.597  1.00 32.02  ? 173 PHE B N   1 
ATOM   3095 C CA  . PHE B 2 160 ? -5.376  43.593 -3.657  1.00 32.80  ? 173 PHE B CA  1 
ATOM   3096 C C   . PHE B 2 160 ? -6.108  44.593 -4.546  1.00 33.65  ? 173 PHE B C   1 
ATOM   3097 O O   . PHE B 2 160 ? -6.174  44.434 -5.777  1.00 33.91  ? 173 PHE B O   1 
ATOM   3098 C CB  . PHE B 2 160 ? -6.356  42.578 -3.055  1.00 32.28  ? 173 PHE B CB  1 
ATOM   3099 C CG  . PHE B 2 160 ? -5.691  41.345 -2.464  1.00 31.09  ? 173 PHE B CG  1 
ATOM   3100 C CD1 . PHE B 2 160 ? -5.370  40.259 -3.265  1.00 30.03  ? 173 PHE B CD1 1 
ATOM   3101 C CD2 . PHE B 2 160 ? -5.400  41.274 -1.101  1.00 30.32  ? 173 PHE B CD2 1 
ATOM   3102 C CE1 . PHE B 2 160 ? -4.757  39.116 -2.710  1.00 29.04  ? 173 PHE B CE1 1 
ATOM   3103 C CE2 . PHE B 2 160 ? -4.784  40.142 -0.545  1.00 29.78  ? 173 PHE B CE2 1 
ATOM   3104 C CZ  . PHE B 2 160 ? -4.465  39.068 -1.350  1.00 29.39  ? 173 PHE B CZ  1 
ATOM   3105 N N   . LEU B 2 161 ? -6.650  45.627 -3.906  1.00 34.90  ? 174 LEU B N   1 
ATOM   3106 C CA  . LEU B 2 161 ? -7.308  46.722 -4.609  1.00 35.82  ? 174 LEU B CA  1 
ATOM   3107 C C   . LEU B 2 161 ? -6.346  47.366 -5.607  1.00 36.04  ? 174 LEU B C   1 
ATOM   3108 O O   . LEU B 2 161 ? -6.664  47.510 -6.801  1.00 36.30  ? 174 LEU B O   1 
ATOM   3109 C CB  . LEU B 2 161 ? -7.813  47.750 -3.583  1.00 35.91  ? 174 LEU B CB  1 
ATOM   3110 C CG  . LEU B 2 161 ? -8.883  48.772 -3.966  1.00 37.03  ? 174 LEU B CG  1 
ATOM   3111 C CD1 . LEU B 2 161 ? -10.210 48.087 -4.179  1.00 37.40  ? 174 LEU B CD1 1 
ATOM   3112 C CD2 . LEU B 2 161 ? -9.003  49.844 -2.887  1.00 36.56  ? 174 LEU B CD2 1 
ATOM   3113 N N   . ASP B 2 162 ? -5.158  47.727 -5.125  1.00 36.42  ? 175 ASP B N   1 
ATOM   3114 C CA  . ASP B 2 162 ? -4.156  48.370 -5.979  1.00 36.89  ? 175 ASP B CA  1 
ATOM   3115 C C   . ASP B 2 162 ? -3.697  47.476 -7.136  1.00 36.59  ? 175 ASP B C   1 
ATOM   3116 O O   . ASP B 2 162 ? -3.540  47.939 -8.272  1.00 35.96  ? 175 ASP B O   1 
ATOM   3117 C CB  . ASP B 2 162 ? -2.957  48.852 -5.146  1.00 37.43  ? 175 ASP B CB  1 
ATOM   3118 C CG  . ASP B 2 162 ? -2.044  49.786 -5.929  1.00 39.58  ? 175 ASP B CG  1 
ATOM   3119 O OD1 . ASP B 2 162 ? -2.536  50.829 -6.416  1.00 42.04  ? 175 ASP B OD1 1 
ATOM   3120 O OD2 . ASP B 2 162 ? -0.841  49.480 -6.069  1.00 40.52  ? 175 ASP B OD2 1 
ATOM   3121 N N   . LEU B 2 163 ? -3.490  46.190 -6.844  1.00 36.68  ? 176 LEU B N   1 
ATOM   3122 C CA  . LEU B 2 163 ? -3.042  45.240 -7.866  1.00 36.51  ? 176 LEU B CA  1 
ATOM   3123 C C   . LEU B 2 163 ? -4.041  45.120 -9.016  1.00 36.86  ? 176 LEU B C   1 
ATOM   3124 O O   . LEU B 2 163 ? -3.650  45.104 -10.185 1.00 36.70  ? 176 LEU B O   1 
ATOM   3125 C CB  . LEU B 2 163 ? -2.760  43.863 -7.242  1.00 36.56  ? 176 LEU B CB  1 
ATOM   3126 C CG  . LEU B 2 163 ? -2.329  42.712 -8.154  1.00 35.52  ? 176 LEU B CG  1 
ATOM   3127 C CD1 . LEU B 2 163 ? -1.139  43.085 -9.051  1.00 34.84  ? 176 LEU B CD1 1 
ATOM   3128 C CD2 . LEU B 2 163 ? -2.029  41.476 -7.312  1.00 35.29  ? 176 LEU B CD2 1 
ATOM   3129 N N   . CYS B 2 164 ? -5.326  45.028 -8.683  1.00 37.69  ? 177 CYS B N   1 
ATOM   3130 C CA  . CYS B 2 164 ? -6.381  44.974 -9.706  1.00 38.54  ? 177 CYS B CA  1 
ATOM   3131 C C   . CYS B 2 164 ? -6.395  46.250 -10.545 1.00 38.79  ? 177 CYS B C   1 
ATOM   3132 O O   . CYS B 2 164 ? -6.396  46.205 -11.787 1.00 38.86  ? 177 CYS B O   1 
ATOM   3133 C CB  . CYS B 2 164 ? -7.733  44.738 -9.045  1.00 38.55  ? 177 CYS B CB  1 
ATOM   3134 S SG  . CYS B 2 164 ? -7.919  43.059 -8.418  1.00 40.39  ? 177 CYS B SG  1 
ATOM   3135 N N   . LYS B 2 165 ? -6.364  47.394 -9.865  1.00 39.56  ? 178 LYS B N   1 
ATOM   3136 C CA  . LYS B 2 165 ? -6.174  48.671 -10.562 1.00 40.07  ? 178 LYS B CA  1 
ATOM   3137 C C   . LYS B 2 165 ? -5.014  48.537 -11.547 1.00 40.13  ? 178 LYS B C   1 
ATOM   3138 O O   . LYS B 2 165 ? -5.168  48.818 -12.738 1.00 40.71  ? 178 LYS B O   1 
ATOM   3139 C CB  . LYS B 2 165 ? -5.922  49.815 -9.572  1.00 40.31  ? 178 LYS B CB  1 
ATOM   3140 C CG  . LYS B 2 165 ? -7.119  50.157 -8.680  1.00 41.29  ? 178 LYS B CG  1 
ATOM   3141 C CD  . LYS B 2 165 ? -6.877  51.479 -7.959  1.00 43.54  ? 178 LYS B CD  1 
ATOM   3142 C CE  . LYS B 2 165 ? -7.635  51.577 -6.640  1.00 42.45  ? 178 LYS B CE  1 
ATOM   3143 N NZ  . LYS B 2 165 ? -7.270  52.836 -5.921  1.00 42.83  ? 178 LYS B NZ  1 
ATOM   3144 N N   . ARG B 2 166 ? -3.865  48.061 -11.061 1.00 39.30  ? 179 ARG B N   1 
ATOM   3145 C CA  . ARG B 2 166 ? -2.687  47.926 -11.914 1.00 38.85  ? 179 ARG B CA  1 
ATOM   3146 C C   . ARG B 2 166 ? -2.891  46.960 -13.080 1.00 38.68  ? 179 ARG B C   1 
ATOM   3147 O O   . ARG B 2 166 ? -2.402  47.204 -14.172 1.00 39.08  ? 179 ARG B O   1 
ATOM   3148 C CB  . ARG B 2 166 ? -1.450  47.547 -11.090 1.00 38.72  ? 179 ARG B CB  1 
ATOM   3149 C CG  . ARG B 2 166 ? -0.996  48.640 -10.126 1.00 39.02  ? 179 ARG B CG  1 
ATOM   3150 C CD  . ARG B 2 166 ? 0.032   48.121 -9.122  1.00 37.82  ? 179 ARG B CD  1 
ATOM   3151 N NE  . ARG B 2 166 ? 1.233   47.645 -9.799  1.00 36.02  ? 179 ARG B NE  1 
ATOM   3152 C CZ  . ARG B 2 166 ? 2.038   46.693 -9.344  1.00 33.43  ? 179 ARG B CZ  1 
ATOM   3153 N NH1 . ARG B 2 166 ? 1.770   46.084 -8.196  1.00 32.77  ? 179 ARG B NH1 1 
ATOM   3154 N NH2 . ARG B 2 166 ? 3.102   46.341 -10.051 1.00 30.65  ? 179 ARG B NH2 1 
ATOM   3155 N N   . MET B 2 167 ? -3.623  45.872 -12.850 1.00 39.03  ? 180 MET B N   1 
ATOM   3156 C CA  . MET B 2 167 ? -3.829  44.846 -13.879 1.00 38.84  ? 180 MET B CA  1 
ATOM   3157 C C   . MET B 2 167 ? -4.818  45.288 -14.966 1.00 40.73  ? 180 MET B C   1 
ATOM   3158 O O   . MET B 2 167 ? -4.728  44.836 -16.118 1.00 40.95  ? 180 MET B O   1 
ATOM   3159 C CB  . MET B 2 167 ? -4.285  43.522 -13.250 1.00 38.91  ? 180 MET B CB  1 
ATOM   3160 C CG  . MET B 2 167 ? -3.211  42.802 -12.429 1.00 37.14  ? 180 MET B CG  1 
ATOM   3161 S SD  . MET B 2 167 ? -3.705  41.151 -11.894 1.00 34.91  ? 180 MET B SD  1 
ATOM   3162 C CE  . MET B 2 167 ? -4.941  41.505 -10.669 1.00 29.43  ? 180 MET B CE  1 
ATOM   3163 N N   . ILE B 2 168 ? -5.765  46.145 -14.583 1.00 42.14  ? 181 ILE B N   1 
ATOM   3164 C CA  . ILE B 2 168 ? -6.660  46.819 -15.534 1.00 43.90  ? 181 ILE B CA  1 
ATOM   3165 C C   . ILE B 2 168 ? -5.886  47.787 -16.446 1.00 45.18  ? 181 ILE B C   1 
ATOM   3166 O O   . ILE B 2 168 ? -6.006  47.696 -17.673 1.00 45.21  ? 181 ILE B O   1 
ATOM   3167 C CB  . ILE B 2 168 ? -7.821  47.544 -14.809 1.00 43.76  ? 181 ILE B CB  1 
ATOM   3168 C CG1 . ILE B 2 168 ? -8.838  46.515 -14.300 1.00 43.09  ? 181 ILE B CG1 1 
ATOM   3169 C CG2 . ILE B 2 168 ? -8.482  48.590 -15.735 1.00 44.80  ? 181 ILE B CG2 1 
ATOM   3170 C CD1 . ILE B 2 168 ? -9.899  47.067 -13.374 1.00 43.92  ? 181 ILE B CD1 1 
ATOM   3171 N N   . GLU B 2 169 ? -5.079  48.674 -15.840 1.00 46.30  ? 182 GLU B N   1 
ATOM   3172 C CA  . GLU B 2 169 ? -4.288  49.699 -16.563 1.00 47.80  ? 182 GLU B CA  1 
ATOM   3173 C C   . GLU B 2 169 ? -3.691  49.205 -17.876 1.00 47.51  ? 182 GLU B C   1 
ATOM   3174 O O   . GLU B 2 169 ? -3.111  48.123 -17.930 1.00 48.33  ? 182 GLU B O   1 
ATOM   3175 C CB  . GLU B 2 169 ? -3.153  50.239 -15.687 1.00 47.52  ? 182 GLU B CB  1 
ATOM   3176 C CG  . GLU B 2 169 ? -3.541  51.331 -14.713 1.00 48.97  ? 182 GLU B CG  1 
ATOM   3177 C CD  . GLU B 2 169 ? -2.419  51.644 -13.722 1.00 49.93  ? 182 GLU B CD  1 
ATOM   3178 O OE1 . GLU B 2 169 ? -1.267  51.893 -14.159 1.00 52.90  ? 182 GLU B OE1 1 
ATOM   3179 O OE2 . GLU B 2 169 ? -2.687  51.640 -12.498 1.00 53.75  ? 182 GLU B OE2 1 
HETATM 3180 O O   . HOH C 3 .   ? 5.013   5.732  -3.870  1.00 13.07  ? 398 HOH A O   1 
HETATM 3181 O O   . HOH C 3 .   ? 8.692   -3.658 -4.531  1.00 12.15  ? 399 HOH A O   1 
HETATM 3182 O O   . HOH C 3 .   ? 0.681   6.544  -17.976 1.00 18.47  ? 400 HOH A O   1 
HETATM 3183 O O   . HOH C 3 .   ? -15.430 10.188 -5.826  1.00 19.30  ? 401 HOH A O   1 
HETATM 3184 O O   . HOH C 3 .   ? -14.563 15.562 -4.526  1.00 16.89  ? 402 HOH A O   1 
HETATM 3185 O O   . HOH C 3 .   ? -14.958 20.188 -15.174 1.00 20.05  ? 403 HOH A O   1 
HETATM 3186 O O   . HOH C 3 .   ? -3.544  12.595 -26.188 1.00 20.50  ? 404 HOH A O   1 
HETATM 3187 O O   . HOH C 3 .   ? -6.441  8.272  -15.917 1.00 18.62  ? 405 HOH A O   1 
HETATM 3188 O O   . HOH C 3 .   ? 4.150   6.850  -29.091 1.00 24.14  ? 406 HOH A O   1 
HETATM 3189 O O   . HOH C 3 .   ? 25.150  8.719  -0.232  1.00 21.95  ? 407 HOH A O   1 
HETATM 3190 O O   . HOH C 3 .   ? 0.535   6.469  -15.302 1.00 19.60  ? 408 HOH A O   1 
HETATM 3191 O O   . HOH C 3 .   ? 10.131  -0.856 -11.064 1.00 27.20  ? 409 HOH A O   1 
HETATM 3192 O O   . HOH C 3 .   ? -0.807  4.182  -18.695 1.00 20.67  ? 410 HOH A O   1 
HETATM 3193 O O   . HOH C 3 .   ? 7.717   2.024  1.237   1.00 21.03  ? 411 HOH A O   1 
HETATM 3194 O O   . HOH C 3 .   ? -28.054 17.321 -39.752 1.00 59.23  ? 412 HOH A O   1 
HETATM 3195 O O   . HOH C 3 .   ? -16.738 12.437 -21.055 1.00 24.47  ? 413 HOH A O   1 
HETATM 3196 O O   . HOH C 3 .   ? -6.599  3.045  -2.928  1.00 13.96  ? 414 HOH A O   1 
HETATM 3197 O O   . HOH C 3 .   ? 12.733  -0.854 -2.929  1.00 23.64  ? 415 HOH A O   1 
HETATM 3198 O O   . HOH C 3 .   ? 9.545   0.499  -13.530 1.00 22.07  ? 416 HOH A O   1 
HETATM 3199 O O   . HOH C 3 .   ? -4.527  14.602 -27.793 1.00 18.80  ? 417 HOH A O   1 
HETATM 3200 O O   . HOH C 3 .   ? 9.596   7.094  5.315   1.00 22.13  ? 418 HOH A O   1 
HETATM 3201 O O   . HOH C 3 .   ? 8.682   -1.528 -15.188 1.00 23.85  ? 419 HOH A O   1 
HETATM 3202 O O   . HOH C 3 .   ? -3.010  26.361 6.377   1.00 33.55  ? 420 HOH A O   1 
HETATM 3203 O O   . HOH C 3 .   ? 9.888   15.573 0.180   1.00 25.79  ? 421 HOH A O   1 
HETATM 3204 O O   . HOH C 3 .   ? 10.130  -1.347 -4.062  1.00 18.00  ? 422 HOH A O   1 
HETATM 3205 O O   . HOH C 3 .   ? -10.947 16.218 -28.508 1.00 31.75  ? 423 HOH A O   1 
HETATM 3206 O O   . HOH C 3 .   ? 4.143   14.309 -30.457 1.00 33.91  ? 424 HOH A O   1 
HETATM 3207 O O   . HOH C 3 .   ? 11.702  16.761 -9.220  1.00 18.60  ? 425 HOH A O   1 
HETATM 3208 O O   . HOH C 3 .   ? 7.972   -0.755 -2.410  1.00 17.63  ? 426 HOH A O   1 
HETATM 3209 O O   . HOH C 3 .   ? -14.877 16.328 -1.954  1.00 25.74  ? 427 HOH A O   1 
HETATM 3210 O O   . HOH C 3 .   ? -23.567 31.050 -46.396 1.00 34.52  ? 428 HOH A O   1 
HETATM 3211 O O   . HOH C 3 .   ? -14.580 9.510  -30.840 1.00 27.86  ? 429 HOH A O   1 
HETATM 3212 O O   . HOH C 3 .   ? -9.110  8.544  -22.373 1.00 24.94  ? 430 HOH A O   1 
HETATM 3213 O O   . HOH C 3 .   ? -9.964  5.022  -15.975 1.00 21.89  ? 431 HOH A O   1 
HETATM 3214 O O   . HOH C 3 .   ? 12.208  -2.037 -9.524  1.00 36.25  ? 432 HOH A O   1 
HETATM 3215 O O   . HOH C 3 .   ? 10.428  5.788  -17.301 1.00 24.65  ? 433 HOH A O   1 
HETATM 3216 O O   . HOH C 3 .   ? 19.407  1.590  -7.708  1.00 22.87  ? 434 HOH A O   1 
HETATM 3217 O O   . HOH C 3 .   ? 4.035   17.930 -16.527 1.00 29.46  ? 435 HOH A O   1 
HETATM 3218 O O   . HOH C 3 .   ? 6.411   10.568 -19.812 1.00 25.44  ? 436 HOH A O   1 
HETATM 3219 O O   . HOH C 3 .   ? 4.613   19.315 2.934   1.00 23.07  ? 437 HOH A O   1 
HETATM 3220 O O   . HOH C 3 .   ? -9.059  20.032 -13.160 1.00 17.74  ? 438 HOH A O   1 
HETATM 3221 O O   . HOH C 3 .   ? 15.835  8.447  -10.330 1.00 30.13  ? 439 HOH A O   1 
HETATM 3222 O O   . HOH C 3 .   ? 8.292   -0.497 0.108   1.00 17.63  ? 440 HOH A O   1 
HETATM 3223 O O   . HOH C 3 .   ? 3.267   12.026 6.055   1.00 25.38  ? 441 HOH A O   1 
HETATM 3224 O O   . HOH C 3 .   ? 12.005  1.261  7.895   1.00 47.40  ? 442 HOH A O   1 
HETATM 3225 O O   . HOH C 3 .   ? 13.116  5.664  -12.772 1.00 24.43  ? 443 HOH A O   1 
HETATM 3226 O O   . HOH C 3 .   ? -9.342  4.001  -18.553 1.00 26.89  ? 444 HOH A O   1 
HETATM 3227 O O   . HOH C 3 .   ? -4.188  2.045  -4.138  1.00 19.00  ? 445 HOH A O   1 
HETATM 3228 O O   . HOH C 3 .   ? 11.940  4.679  -14.999 1.00 27.21  ? 446 HOH A O   1 
HETATM 3229 O O   . HOH C 3 .   ? 11.623  19.101 -10.378 1.00 26.52  ? 447 HOH A O   1 
HETATM 3230 O O   . HOH C 3 .   ? -0.932  5.148  -24.093 1.00 24.82  ? 448 HOH A O   1 
HETATM 3231 O O   . HOH C 3 .   ? -3.763  2.012  -6.743  1.00 32.23  ? 449 HOH A O   1 
HETATM 3232 O O   . HOH C 3 .   ? -13.525 25.465 -12.950 1.00 31.99  ? 450 HOH A O   1 
HETATM 3233 O O   . HOH C 3 .   ? 2.917   20.599 4.268   1.00 33.49  ? 451 HOH A O   1 
HETATM 3234 O O   . HOH C 3 .   ? -10.716 30.235 -16.128 1.00 38.14  ? 452 HOH A O   1 
HETATM 3235 O O   . HOH C 3 .   ? -13.829 28.352 -9.949  1.00 27.81  ? 453 HOH A O   1 
HETATM 3236 O O   . HOH C 3 .   ? -12.877 23.896 -2.742  1.00 26.33  ? 454 HOH A O   1 
HETATM 3237 O O   . HOH C 3 .   ? -0.583  25.007 5.899   1.00 34.22  ? 455 HOH A O   1 
HETATM 3238 O O   . HOH C 3 .   ? 7.852   12.540 -26.913 1.00 57.74  ? 456 HOH A O   1 
HETATM 3239 O O   . HOH C 3 .   ? 12.946  18.058 -7.112  1.00 35.25  ? 457 HOH A O   1 
HETATM 3240 O O   . HOH C 3 .   ? 17.648  6.294  -10.333 1.00 33.35  ? 458 HOH A O   1 
HETATM 3241 O O   . HOH C 3 .   ? 3.911   3.872  -7.369  1.00 22.42  ? 459 HOH A O   1 
HETATM 3242 O O   . HOH C 3 .   ? -12.763 9.120  11.078  1.00 30.66  ? 460 HOH A O   1 
HETATM 3243 O O   . HOH C 3 .   ? -17.280 10.142 -7.780  1.00 31.10  ? 461 HOH A O   1 
HETATM 3244 O O   . HOH C 3 .   ? -13.770 21.531 6.292   1.00 37.70  ? 462 HOH A O   1 
HETATM 3245 O O   . HOH C 3 .   ? -24.113 30.544 -43.753 1.00 39.50  ? 463 HOH A O   1 
HETATM 3246 O O   . HOH C 3 .   ? -17.222 9.654  -22.075 1.00 30.27  ? 464 HOH A O   1 
HETATM 3247 O O   . HOH C 3 .   ? -14.531 8.064  -10.999 1.00 33.78  ? 465 HOH A O   1 
HETATM 3248 O O   . HOH C 3 .   ? 19.275  10.817 -7.024  1.00 36.16  ? 466 HOH A O   1 
HETATM 3249 O O   . HOH C 3 .   ? -15.030 7.194  -29.096 1.00 37.12  ? 467 HOH A O   1 
HETATM 3250 O O   . HOH C 3 .   ? 2.872   -1.890 -11.657 1.00 26.67  ? 468 HOH A O   1 
HETATM 3251 O O   . HOH C 3 .   ? 0.734   20.872 -39.434 1.00 57.01  ? 469 HOH A O   1 
HETATM 3252 O O   . HOH C 3 .   ? 10.565  6.587  -23.660 1.00 34.11  ? 470 HOH A O   1 
HETATM 3253 O O   . HOH C 3 .   ? -11.853 24.776 -5.319  1.00 29.89  ? 471 HOH A O   1 
HETATM 3254 O O   . HOH C 3 .   ? -4.798  5.639  3.207   1.00 33.97  ? 472 HOH A O   1 
HETATM 3255 O O   . HOH C 3 .   ? 10.485  18.969 -12.504 1.00 34.63  ? 473 HOH A O   1 
HETATM 3256 O O   . HOH C 3 .   ? 11.827  3.582  7.826   1.00 51.74  ? 474 HOH A O   1 
HETATM 3257 O O   . HOH C 3 .   ? 1.206   14.662 -34.813 1.00 30.35  ? 475 HOH A O   1 
HETATM 3258 O O   . HOH C 3 .   ? 7.962   1.832  3.747   1.00 28.45  ? 476 HOH A O   1 
HETATM 3259 O O   . HOH C 3 .   ? -15.079 22.778 -11.172 1.00 31.55  ? 477 HOH A O   1 
HETATM 3260 O O   . HOH C 3 .   ? -4.769  15.916 -43.550 1.00 58.58  ? 478 HOH A O   1 
HETATM 3261 O O   . HOH C 3 .   ? -36.013 29.878 -32.395 1.00 51.66  ? 479 HOH A O   1 
HETATM 3262 O O   . HOH C 3 .   ? 3.087   16.542 -18.470 1.00 35.09  ? 480 HOH A O   1 
HETATM 3263 O O   . HOH C 3 .   ? 1.583   7.580  -29.627 1.00 30.81  ? 481 HOH A O   1 
HETATM 3264 O O   . HOH C 3 .   ? -17.598 12.834 -12.068 1.00 38.97  ? 482 HOH A O   1 
HETATM 3265 O O   . HOH C 3 .   ? 8.338   4.871  -23.408 1.00 31.13  ? 483 HOH A O   1 
HETATM 3266 O O   . HOH C 3 .   ? -8.806  15.528 -37.013 1.00 39.61  ? 484 HOH A O   1 
HETATM 3267 O O   . HOH C 3 .   ? -15.140 7.837  -33.903 1.00 81.22  ? 485 HOH A O   1 
HETATM 3268 O O   . HOH C 3 .   ? -14.453 8.818  -8.667  1.00 28.47  ? 486 HOH A O   1 
HETATM 3269 O O   . HOH C 3 .   ? -14.546 5.867  -11.035 1.00 21.75  ? 487 HOH A O   1 
HETATM 3270 O O   . HOH C 3 .   ? 0.042   2.710  -22.486 1.00 31.19  ? 488 HOH A O   1 
HETATM 3271 O O   . HOH C 3 .   ? 5.637   16.172 -17.925 1.00 48.40  ? 489 HOH A O   1 
HETATM 3272 O O   . HOH C 3 .   ? -17.643 23.753 -11.111 1.00 51.94  ? 490 HOH A O   1 
HETATM 3273 O O   . HOH C 3 .   ? -15.339 20.386 -12.251 1.00 36.31  ? 491 HOH A O   1 
HETATM 3274 O O   . HOH C 3 .   ? -14.380 10.257 -11.265 1.00 49.07  ? 492 HOH A O   1 
HETATM 3275 O O   . HOH C 3 .   ? 18.782  10.216 -9.229  1.00 37.42  ? 493 HOH A O   1 
HETATM 3276 O O   . HOH C 3 .   ? 0.173   5.529  -30.257 1.00 36.69  ? 494 HOH A O   1 
HETATM 3277 O O   . HOH C 3 .   ? 2.794   2.106  -5.451  1.00 31.62  ? 495 HOH A O   1 
HETATM 3278 O O   . HOH C 3 .   ? -25.294 15.356 -28.717 1.00 43.49  ? 496 HOH A O   1 
HETATM 3279 O O   . HOH C 3 .   ? 12.987  11.518 3.925   1.00 27.72  ? 497 HOH A O   1 
HETATM 3280 O O   . HOH C 3 .   ? -14.657 28.442 -7.688  1.00 40.52  ? 498 HOH A O   1 
HETATM 3281 O O   . HOH C 3 .   ? -6.484  4.870  1.968   1.00 33.76  ? 499 HOH A O   1 
HETATM 3282 O O   . HOH C 3 .   ? 18.763  8.929  3.976   1.00 29.50  ? 500 HOH A O   1 
HETATM 3283 O O   . HOH C 3 .   ? 5.970   26.169 3.010   1.00 48.99  ? 501 HOH A O   1 
HETATM 3284 O O   . HOH C 3 .   ? -2.781  3.925  -26.038 1.00 34.23  ? 502 HOH A O   1 
HETATM 3285 O O   . HOH C 3 .   ? 22.045  1.035  -6.948  1.00 40.30  ? 503 HOH A O   1 
HETATM 3286 O O   . HOH C 3 .   ? -16.179 23.016 -13.512 1.00 35.24  ? 504 HOH A O   1 
HETATM 3287 O O   . HOH C 3 .   ? 27.187  6.971  -1.097  1.00 35.43  ? 505 HOH A O   1 
HETATM 3288 O O   . HOH C 3 .   ? -16.577 13.379 -14.510 1.00 48.74  ? 506 HOH A O   1 
HETATM 3289 O O   . HOH C 3 .   ? 12.424  1.028  -8.621  1.00 31.07  ? 507 HOH A O   1 
HETATM 3290 O O   . HOH C 3 .   ? 15.760  19.188 -3.826  0.00 44.05  ? 508 HOH A O   1 
HETATM 3291 O O   . HOH C 3 .   ? 0.717   21.849 7.200   1.00 30.62  ? 509 HOH A O   1 
HETATM 3292 O O   . HOH C 3 .   ? -9.480  22.596 13.927  1.00 62.51  ? 510 HOH A O   1 
HETATM 3293 O O   . HOH C 3 .   ? -16.239 7.395  0.510   1.00 43.36  ? 511 HOH A O   1 
HETATM 3294 O O   . HOH C 3 .   ? -5.596  3.946  -0.661  1.00 29.02  ? 512 HOH A O   1 
HETATM 3295 O O   . HOH C 3 .   ? 18.913  5.079  -8.119  1.00 42.95  ? 513 HOH A O   1 
HETATM 3296 O O   . HOH C 3 .   ? -0.201  23.786 -5.346  1.00 28.99  ? 514 HOH A O   1 
HETATM 3297 O O   . HOH C 3 .   ? -14.677 10.008 3.680   1.00 44.50  ? 515 HOH A O   1 
HETATM 3298 O O   . HOH C 3 .   ? 3.707   -0.550 -8.907  1.00 40.14  ? 516 HOH A O   1 
HETATM 3299 O O   . HOH C 3 .   ? -21.624 25.559 -46.076 1.00 48.28  ? 517 HOH A O   1 
HETATM 3300 O O   . HOH C 3 .   ? -18.962 18.298 -40.661 1.00 36.90  ? 518 HOH A O   1 
HETATM 3301 O O   . HOH C 3 .   ? -14.898 7.597  5.944   1.00 45.83  ? 519 HOH A O   1 
HETATM 3302 O O   . HOH C 3 .   ? -0.927  2.406  -14.763 1.00 35.25  ? 520 HOH A O   1 
HETATM 3303 O O   . HOH C 3 .   ? -13.074 12.542 -43.310 1.00 43.19  ? 521 HOH A O   1 
HETATM 3304 O O   . HOH C 3 .   ? -10.997 3.160  -14.833 1.00 45.50  ? 522 HOH A O   1 
HETATM 3305 O O   . HOH C 3 .   ? 9.531   9.789  -17.071 1.00 36.27  ? 523 HOH A O   1 
HETATM 3306 O O   . HOH C 3 .   ? -23.832 26.631 -46.178 1.00 33.89  ? 524 HOH A O   1 
HETATM 3307 O O   . HOH C 3 .   ? 3.308   -1.621 -24.719 1.00 35.06  ? 525 HOH A O   1 
HETATM 3308 O O   . HOH C 3 .   ? 2.541   1.577  -9.559  1.00 32.92  ? 526 HOH A O   1 
HETATM 3309 O O   . HOH C 3 .   ? 19.458  -2.735 1.246   1.00 44.14  ? 527 HOH A O   1 
HETATM 3310 O O   . HOH C 3 .   ? -2.892  4.431  -0.806  1.00 41.16  ? 528 HOH A O   1 
HETATM 3311 O O   . HOH C 3 .   ? 0.983   0.910  -24.563 1.00 33.06  ? 529 HOH A O   1 
HETATM 3312 O O   . HOH C 3 .   ? 1.119   3.583  -20.222 1.00 43.00  ? 530 HOH A O   1 
HETATM 3313 O O   . HOH C 3 .   ? -17.782 20.043 -22.305 1.00 43.78  ? 531 HOH A O   1 
HETATM 3314 O O   . HOH C 3 .   ? -27.522 11.396 -31.065 1.00 48.93  ? 532 HOH A O   1 
HETATM 3315 O O   . HOH C 3 .   ? 22.659  5.979  4.012   1.00 48.46  ? 533 HOH A O   1 
HETATM 3316 O O   . HOH C 3 .   ? 10.298  1.750  -18.219 1.00 45.35  ? 534 HOH A O   1 
HETATM 3317 O O   . HOH C 3 .   ? 2.402   -1.724 -21.823 1.00 40.74  ? 535 HOH A O   1 
HETATM 3318 O O   . HOH C 3 .   ? -28.781 30.825 -36.751 1.00 42.87  ? 536 HOH A O   1 
HETATM 3319 O O   . HOH C 3 .   ? 2.389   18.051 -33.675 1.00 37.23  ? 537 HOH A O   1 
HETATM 3320 O O   . HOH C 3 .   ? -13.718 8.679  -6.166  1.00 53.55  ? 538 HOH A O   1 
HETATM 3321 O O   . HOH C 3 .   ? -17.561 19.938 -14.828 1.00 39.27  ? 539 HOH A O   1 
HETATM 3322 O O   . HOH C 3 .   ? 4.039   4.241  -0.344  1.00 36.05  ? 540 HOH A O   1 
HETATM 3323 O O   . HOH C 3 .   ? 10.504  12.105 7.358   1.00 79.03  ? 541 HOH A O   1 
HETATM 3324 O O   . HOH C 3 .   ? 17.253  11.071 5.165   1.00 51.97  ? 542 HOH A O   1 
HETATM 3325 O O   . HOH C 3 .   ? 15.568  17.949 -6.966  1.00 53.92  ? 543 HOH A O   1 
HETATM 3326 O O   . HOH C 3 .   ? 23.123  2.213  -2.477  1.00 37.68  ? 544 HOH A O   1 
HETATM 3327 O O   . HOH C 3 .   ? 12.209  1.467  -14.345 1.00 41.02  ? 545 HOH A O   1 
HETATM 3328 O O   . HOH C 3 .   ? -0.181  8.119  6.218   1.00 46.34  ? 546 HOH A O   1 
HETATM 3329 O O   . HOH C 3 .   ? 12.012  5.933  5.479   1.00 46.92  ? 547 HOH A O   1 
HETATM 3330 O O   . HOH C 3 .   ? -1.188  22.489 8.405   1.00 33.94  ? 548 HOH A O   1 
HETATM 3331 O O   . HOH C 3 .   ? -13.903 15.525 -38.164 1.00 39.21  ? 549 HOH A O   1 
HETATM 3332 O O   . HOH C 3 .   ? -2.514  12.534 -36.006 1.00 50.86  ? 550 HOH A O   1 
HETATM 3333 O O   . HOH C 3 .   ? -20.168 30.010 -44.024 1.00 55.78  ? 551 HOH A O   1 
HETATM 3334 O O   . HOH C 3 .   ? 1.610   12.564 -17.137 1.00 500.00 ? 552 HOH A O   1 
HETATM 3335 O O   . HOH C 3 .   ? 5.821   16.285 -20.633 1.00 44.23  ? 553 HOH A O   1 
HETATM 3336 O O   . HOH C 3 .   ? -4.901  24.601 -37.994 1.00 38.91  ? 554 HOH A O   1 
HETATM 3337 O O   . HOH C 3 .   ? -24.974 16.208 -36.188 1.00 49.86  ? 555 HOH A O   1 
HETATM 3338 O O   . HOH C 3 .   ? -12.406 3.329  6.532   1.00 47.16  ? 556 HOH A O   1 
HETATM 3339 O O   . HOH C 3 .   ? 23.787  2.358  -8.225  1.00 45.45  ? 557 HOH A O   1 
HETATM 3340 O O   . HOH C 3 .   ? 7.582   13.812 7.194   1.00 33.48  ? 558 HOH A O   1 
HETATM 3341 O O   . HOH C 3 .   ? -2.936  22.093 6.433   1.00 32.30  ? 559 HOH A O   1 
HETATM 3342 O O   . HOH C 3 .   ? 11.530  10.134 -15.311 1.00 43.23  ? 560 HOH A O   1 
HETATM 3343 O O   . HOH C 3 .   ? 17.769  -5.253 0.809   1.00 36.05  ? 561 HOH A O   1 
HETATM 3344 O O   . HOH C 3 .   ? -4.275  25.154 -16.165 1.00 33.50  ? 562 HOH A O   1 
HETATM 3345 O O   . HOH C 3 .   ? -2.274  2.642  -2.330  1.00 45.64  ? 563 HOH A O   1 
HETATM 3346 O O   . HOH C 3 .   ? 24.613  0.130  -0.749  1.00 56.07  ? 564 HOH A O   1 
HETATM 3347 O O   . HOH C 3 .   ? 4.576   4.546  -28.860 1.00 40.63  ? 565 HOH A O   1 
HETATM 3348 O O   . HOH C 3 .   ? -26.182 29.155 -41.630 1.00 45.48  ? 566 HOH A O   1 
HETATM 3349 O O   . HOH C 3 .   ? -4.479  1.967  -20.063 1.00 37.90  ? 567 HOH A O   1 
HETATM 3350 O O   . HOH C 3 .   ? 0.660   19.181 -29.098 1.00 35.97  ? 568 HOH A O   1 
HETATM 3351 O O   . HOH C 3 .   ? 7.567   -2.187 2.097   1.00 43.35  ? 569 HOH A O   1 
HETATM 3352 O O   . HOH C 3 .   ? 14.854  6.218  4.559   1.00 49.76  ? 570 HOH A O   1 
HETATM 3353 O O   . HOH C 3 .   ? 17.466  -4.766 -8.631  1.00 42.59  ? 571 HOH A O   1 
HETATM 3354 O O   . HOH C 3 .   ? -19.719 28.053 -45.993 1.00 50.21  ? 572 HOH A O   1 
HETATM 3355 O O   . HOH C 3 .   ? 11.271  4.682  -19.659 1.00 38.71  ? 573 HOH A O   1 
HETATM 3356 O O   . HOH C 3 .   ? -10.903 33.322 -16.995 1.00 43.40  ? 574 HOH A O   1 
HETATM 3357 O O   . HOH C 3 .   ? -13.673 22.250 -20.651 1.00 50.18  ? 575 HOH A O   1 
HETATM 3358 O O   . HOH C 3 .   ? 2.864   18.921 -31.465 1.00 57.71  ? 576 HOH A O   1 
HETATM 3359 O O   . HOH C 3 .   ? 14.442  3.161  -12.436 1.00 47.17  ? 577 HOH A O   1 
HETATM 3360 O O   . HOH C 3 .   ? 24.533  4.539  -4.058  1.00 46.54  ? 578 HOH A O   1 
HETATM 3361 O O   . HOH C 3 .   ? -19.967 14.920 -21.104 1.00 38.60  ? 579 HOH A O   1 
HETATM 3362 O O   . HOH C 3 .   ? -26.028 9.647  -31.547 1.00 63.88  ? 580 HOH A O   1 
HETATM 3363 O O   . HOH C 3 .   ? 5.397   2.489  -27.475 1.00 47.55  ? 581 HOH A O   1 
HETATM 3364 O O   . HOH C 3 .   ? -17.364 24.152 -8.401  1.00 42.75  ? 582 HOH A O   1 
HETATM 3365 O O   . HOH C 3 .   ? 1.847   26.417 4.164   1.00 41.47  ? 583 HOH A O   1 
HETATM 3366 O O   . HOH C 3 .   ? -30.711 36.107 -34.707 1.00 73.89  ? 584 HOH A O   1 
HETATM 3367 O O   . HOH C 3 .   ? -16.140 14.243 -37.158 1.00 43.73  ? 585 HOH A O   1 
HETATM 3368 O O   . HOH C 3 .   ? -32.150 26.145 -39.130 1.00 53.51  ? 586 HOH A O   1 
HETATM 3369 O O   . HOH C 3 .   ? -7.966  24.435 -22.557 1.00 155.91 ? 587 HOH A O   1 
HETATM 3370 O O   . HOH C 3 .   ? 1.625   -0.003 -10.891 1.00 58.91  ? 588 HOH A O   1 
HETATM 3371 O O   . HOH C 3 .   ? 9.315   9.412  -23.456 1.00 51.89  ? 589 HOH A O   1 
HETATM 3372 O O   . HOH C 3 .   ? -16.869 11.221 -36.242 1.00 46.44  ? 590 HOH A O   1 
HETATM 3373 O O   . HOH C 3 .   ? -26.576 26.211 -42.540 1.00 44.58  ? 591 HOH A O   1 
HETATM 3374 O O   . HOH C 3 .   ? 5.158   13.284 7.577   1.00 44.39  ? 592 HOH A O   1 
HETATM 3375 O O   . HOH C 3 .   ? 4.952   0.562  -18.400 1.00 35.79  ? 593 HOH A O   1 
HETATM 3376 O O   . HOH C 3 .   ? -10.333 17.073 12.246  1.00 56.08  ? 594 HOH A O   1 
HETATM 3377 O O   . HOH C 3 .   ? -23.602 10.156 -31.502 1.00 44.45  ? 595 HOH A O   1 
HETATM 3378 O O   . HOH C 3 .   ? 14.888  11.911 -13.595 1.00 38.52  ? 596 HOH A O   1 
HETATM 3379 O O   . HOH C 3 .   ? -6.766  2.855  -20.425 1.00 37.58  ? 597 HOH A O   1 
HETATM 3380 O O   . HOH C 3 .   ? 16.467  10.922 -10.003 1.00 38.61  ? 598 HOH A O   1 
HETATM 3381 O O   . HOH C 3 .   ? -2.498  24.871 -17.960 1.00 43.30  ? 599 HOH A O   1 
HETATM 3382 O O   . HOH C 3 .   ? 14.470  1.524  -10.516 1.00 43.76  ? 600 HOH A O   1 
HETATM 3383 O O   . HOH C 3 .   ? 4.360   0.501  -1.484  1.00 40.12  ? 601 HOH A O   1 
HETATM 3384 O O   . HOH C 3 .   ? -16.018 27.030 -38.424 1.00 34.32  ? 602 HOH A O   1 
HETATM 3385 O O   . HOH C 3 .   ? -6.530  24.129 -24.481 1.00 53.52  ? 603 HOH A O   1 
HETATM 3386 O O   . HOH C 3 .   ? 12.978  -5.547 0.407   1.00 247.37 ? 604 HOH A O   1 
HETATM 3387 O O   . HOH C 3 .   ? -2.268  24.006 -20.621 1.00 41.45  ? 605 HOH A O   1 
HETATM 3388 O O   . HOH C 3 .   ? -25.061 33.908 -30.941 1.00 190.52 ? 606 HOH A O   1 
HETATM 3389 O O   . HOH C 3 .   ? -23.665 26.671 -28.940 1.00 500.00 ? 607 HOH A O   1 
HETATM 3390 O O   . HOH C 3 .   ? 2.484   17.595 -27.994 1.00 56.06  ? 608 HOH A O   1 
HETATM 3391 O O   . HOH C 3 .   ? -20.730 31.055 -34.733 1.00 53.54  ? 609 HOH A O   1 
HETATM 3392 O O   . HOH C 3 .   ? -6.382  8.188  -31.968 1.00 33.69  ? 610 HOH A O   1 
HETATM 3393 O O   . HOH C 3 .   ? -12.826 32.007 -18.789 1.00 56.45  ? 611 HOH A O   1 
HETATM 3394 O O   . HOH C 3 .   ? 19.040  14.976 -10.369 1.00 60.92  ? 612 HOH A O   1 
HETATM 3395 O O   . HOH C 3 .   ? 16.798  0.320  -11.023 1.00 48.49  ? 613 HOH A O   1 
HETATM 3396 O O   . HOH C 3 .   ? -16.650 23.148 -21.961 1.00 48.86  ? 614 HOH A O   1 
HETATM 3397 O O   . HOH C 3 .   ? -19.758 8.966  -9.627  1.00 50.01  ? 615 HOH A O   1 
HETATM 3398 O O   . HOH C 3 .   ? -14.628 28.680 -36.773 1.00 40.83  ? 616 HOH A O   1 
HETATM 3399 O O   . HOH C 3 .   ? -20.995 9.243  -29.296 1.00 48.63  ? 617 HOH A O   1 
HETATM 3400 O O   . HOH C 3 .   ? 3.288   21.027 -18.125 1.00 39.03  ? 618 HOH A O   1 
HETATM 3401 O O   . HOH C 3 .   ? 23.372  13.253 -0.393  1.00 56.70  ? 619 HOH A O   1 
HETATM 3402 O O   . HOH C 3 .   ? -13.105 18.404 5.884   1.00 46.13  ? 620 HOH A O   1 
HETATM 3403 O O   . HOH C 3 .   ? 11.502  13.854 3.702   1.00 43.20  ? 621 HOH A O   1 
HETATM 3404 O O   . HOH C 3 .   ? -2.004  3.678  -28.524 1.00 45.47  ? 622 HOH A O   1 
HETATM 3405 O O   . HOH C 3 .   ? -16.023 6.471  -15.476 1.00 39.62  ? 623 HOH A O   1 
HETATM 3406 O O   . HOH C 3 .   ? 4.484   22.527 4.564   1.00 41.70  ? 624 HOH A O   1 
HETATM 3407 O O   . HOH C 3 .   ? 16.418  12.808 -11.737 1.00 55.22  ? 625 HOH A O   1 
HETATM 3408 O O   . HOH C 3 .   ? -21.250 17.973 -42.775 1.00 41.00  ? 626 HOH A O   1 
HETATM 3409 O O   . HOH C 3 .   ? 11.372  8.196  -17.758 1.00 51.22  ? 627 HOH A O   1 
HETATM 3410 O O   . HOH C 3 .   ? 13.525  18.513 0.526   1.00 40.83  ? 628 HOH A O   1 
HETATM 3411 O O   . HOH C 3 .   ? 7.679   14.685 -19.867 1.00 40.67  ? 629 HOH A O   1 
HETATM 3412 O O   . HOH C 3 .   ? -11.711 20.812 15.373  1.00 59.87  ? 630 HOH A O   1 
HETATM 3413 O O   . HOH C 3 .   ? -3.329  13.197 13.111  1.00 50.27  ? 631 HOH A O   1 
HETATM 3414 O O   . HOH C 3 .   ? 6.399   7.528  -30.780 1.00 35.60  ? 632 HOH A O   1 
HETATM 3415 O O   . HOH C 3 .   ? -0.141  15.102 11.352  1.00 58.20  ? 633 HOH A O   1 
HETATM 3416 O O   . HOH C 3 .   ? -17.453 13.625 7.344   1.00 54.74  ? 634 HOH A O   1 
HETATM 3417 O O   . HOH C 3 .   ? 0.721   1.418  -30.824 1.00 44.25  ? 635 HOH A O   1 
HETATM 3418 O O   . HOH C 3 .   ? 4.823   8.861  -33.388 1.00 58.71  ? 636 HOH A O   1 
HETATM 3419 O O   . HOH C 3 .   ? -15.995 29.836 -23.268 1.00 57.41  ? 637 HOH A O   1 
HETATM 3420 O O   . HOH C 3 .   ? 16.544  15.414 -11.487 1.00 47.30  ? 638 HOH A O   1 
HETATM 3421 O O   . HOH C 3 .   ? 0.988   14.251 9.133   1.00 54.71  ? 639 HOH A O   1 
HETATM 3422 O O   . HOH C 3 .   ? -15.223 15.431 5.494   1.00 50.61  ? 640 HOH A O   1 
HETATM 3423 O O   . HOH C 3 .   ? -12.140 29.036 -36.740 1.00 49.79  ? 641 HOH A O   1 
HETATM 3424 O O   . HOH C 3 .   ? -2.781  11.236 0.579   1.00 500.00 ? 642 HOH A O   1 
HETATM 3425 O O   . HOH C 3 .   ? 6.291   22.401 6.516   1.00 57.40  ? 643 HOH A O   1 
HETATM 3426 O O   . HOH C 3 .   ? -4.084  12.417 -8.252  1.00 500.00 ? 644 HOH A O   1 
HETATM 3427 O O   . HOH C 3 .   ? -4.523  6.632  -33.610 1.00 46.16  ? 645 HOH A O   1 
HETATM 3428 O O   . HOH C 3 .   ? -8.571  27.596 -38.107 1.00 49.98  ? 646 HOH A O   1 
HETATM 3429 O O   . HOH C 3 .   ? 25.516  12.648 -2.988  1.00 48.82  ? 647 HOH A O   1 
HETATM 3430 O O   . HOH C 3 .   ? -1.697  5.120  0.937   1.00 50.42  ? 648 HOH A O   1 
HETATM 3431 O O   . HOH C 3 .   ? 17.761  16.785 3.401   1.00 48.46  ? 649 HOH A O   1 
HETATM 3432 O O   . HOH C 3 .   ? 20.940  13.875 -0.986  1.00 50.76  ? 650 HOH A O   1 
HETATM 3433 O O   . HOH C 3 .   ? -2.270  7.848  14.098  1.00 54.73  ? 651 HOH A O   1 
HETATM 3434 O O   . HOH C 3 .   ? 25.877  2.060  -5.842  1.00 53.58  ? 652 HOH A O   1 
HETATM 3435 O O   . HOH C 3 .   ? 3.170   15.221 -33.609 1.00 53.38  ? 653 HOH A O   1 
HETATM 3436 O O   . HOH C 3 .   ? -9.042  31.487 -37.501 1.00 51.52  ? 654 HOH A O   1 
HETATM 3437 O O   . HOH C 3 .   ? -16.528 8.782  -12.563 1.00 57.38  ? 655 HOH A O   1 
HETATM 3438 O O   . HOH C 3 .   ? -16.474 26.611 -30.023 1.00 500.00 ? 656 HOH A O   1 
HETATM 3439 O O   . HOH C 3 .   ? -16.918 25.230 -27.056 1.00 441.47 ? 657 HOH A O   1 
HETATM 3440 O O   . HOH C 3 .   ? -19.963 15.927 -38.916 1.00 53.00  ? 658 HOH A O   1 
HETATM 3441 O O   . HOH C 3 .   ? 2.798   24.510 5.077   1.00 50.23  ? 659 HOH A O   1 
HETATM 3442 O O   . HOH C 3 .   ? 2.054   4.449  1.336   1.00 49.78  ? 660 HOH A O   1 
HETATM 3443 O O   . HOH C 3 .   ? -13.130 6.277  -23.238 1.00 52.30  ? 661 HOH A O   1 
HETATM 3444 O O   . HOH C 3 .   ? -17.493 10.753 5.554   1.00 74.75  ? 662 HOH A O   1 
HETATM 3445 O O   . HOH C 3 .   ? 7.826   -1.454 -17.958 1.00 52.34  ? 663 HOH A O   1 
HETATM 3446 O O   . HOH C 3 .   ? 8.365   0.929  -20.700 1.00 56.55  ? 664 HOH A O   1 
HETATM 3447 O O   . HOH C 3 .   ? -1.252  13.601 -34.264 1.00 500.00 ? 665 HOH A O   1 
HETATM 3448 O O   . HOH C 3 .   ? -22.704 30.430 -39.781 1.00 49.71  ? 666 HOH A O   1 
HETATM 3449 O O   . HOH C 3 .   ? 15.627  17.604 -9.667  1.00 49.63  ? 667 HOH A O   1 
HETATM 3450 O O   . HOH C 3 .   ? -9.088  25.395 -39.518 1.00 63.39  ? 668 HOH A O   1 
HETATM 3451 O O   . HOH C 3 .   ? 19.054  0.958  3.440   1.00 60.48  ? 669 HOH A O   1 
HETATM 3452 O O   . HOH C 3 .   ? -10.949 13.996 -37.407 1.00 61.80  ? 670 HOH A O   1 
HETATM 3453 O O   . HOH C 3 .   ? 4.023   3.713  3.395   1.00 48.77  ? 671 HOH A O   1 
HETATM 3454 O O   . HOH C 3 .   ? -4.768  8.611  15.126  1.00 52.82  ? 672 HOH A O   1 
HETATM 3455 O O   . HOH C 3 .   ? 24.413  12.050 -5.335  1.00 69.09  ? 673 HOH A O   1 
HETATM 3456 O O   . HOH C 3 .   ? -23.126 14.197 -27.673 1.00 51.52  ? 674 HOH A O   1 
HETATM 3457 O O   . HOH C 3 .   ? -0.432  17.717 12.484  1.00 54.08  ? 675 HOH A O   1 
HETATM 3458 O O   . HOH C 3 .   ? -19.672 31.502 -27.436 1.00 77.87  ? 676 HOH A O   1 
HETATM 3459 O O   . HOH C 3 .   ? -15.620 4.473  -14.022 1.00 56.79  ? 677 HOH A O   1 
HETATM 3460 O O   . HOH C 3 .   ? 0.049   21.674 -29.240 1.00 43.58  ? 678 HOH A O   1 
HETATM 3461 O O   . HOH C 3 .   ? 19.380  14.799 0.977   1.00 46.36  ? 679 HOH A O   1 
HETATM 3462 O O   . HOH C 3 .   ? -20.864 35.328 -26.492 1.00 115.38 ? 680 HOH A O   1 
HETATM 3463 O O   . HOH C 3 .   ? -0.677  0.506  -13.309 0.50 25.56  ? 681 HOH A O   1 
HETATM 3464 O O   . HOH C 3 .   ? -0.691  0.414  -20.101 0.50 19.39  ? 682 HOH A O   1 
HETATM 3465 O O   . HOH C 3 .   ? 23.263  -0.138 5.613   1.00 58.25  ? 683 HOH A O   1 
HETATM 3466 O O   . HOH C 3 .   ? -11.138 20.709 10.668  1.00 42.02  ? 684 HOH A O   1 
HETATM 3467 O O   . HOH C 3 .   ? -0.625  0.187  -32.780 0.50 44.46  ? 685 HOH A O   1 
HETATM 3468 O O   . HOH C 3 .   ? -11.144 12.196 -39.387 1.00 52.14  ? 686 HOH A O   1 
HETATM 3469 O O   . HOH C 3 .   ? 10.934  9.658  6.257   1.00 50.05  ? 687 HOH A O   1 
HETATM 3470 O O   . HOH C 3 .   ? -10.825 26.413 -36.878 1.00 51.03  ? 688 HOH A O   1 
HETATM 3471 O O   . HOH C 3 .   ? 1.274   4.930  4.284   1.00 57.31  ? 689 HOH A O   1 
HETATM 3472 O O   . HOH C 3 .   ? 19.841  16.893 -7.538  1.00 51.58  ? 690 HOH A O   1 
HETATM 3473 O O   . HOH C 3 .   ? -22.478 14.364 -39.422 1.00 62.66  ? 691 HOH A O   1 
HETATM 3474 O O   . HOH C 3 .   ? 3.603   0.486  -27.737 1.00 63.28  ? 692 HOH A O   1 
HETATM 3475 O O   . HOH D 3 .   ? 9.619   34.764 0.776   1.00 14.17  ? 184 HOH B O   1 
HETATM 3476 O O   . HOH D 3 .   ? 9.453   32.196 1.389   1.00 19.75  ? 185 HOH B O   1 
HETATM 3477 O O   . HOH D 3 .   ? 5.792   29.967 -3.484  1.00 19.78  ? 186 HOH B O   1 
HETATM 3478 O O   . HOH D 3 .   ? 18.221  45.914 4.376   1.00 20.64  ? 187 HOH B O   1 
HETATM 3479 O O   . HOH D 3 .   ? 5.926   23.858 -0.655  1.00 21.68  ? 188 HOH B O   1 
HETATM 3480 O O   . HOH D 3 .   ? -2.141  29.558 0.926   1.00 20.33  ? 189 HOH B O   1 
HETATM 3481 O O   . HOH D 3 .   ? 13.140  31.772 -4.893  1.00 20.12  ? 190 HOH B O   1 
HETATM 3482 O O   . HOH D 3 .   ? -7.516  21.450 3.069   1.00 21.03  ? 191 HOH B O   1 
HETATM 3483 O O   . HOH D 3 .   ? 7.039   45.764 5.346   1.00 34.34  ? 192 HOH B O   1 
HETATM 3484 O O   . HOH D 3 .   ? -3.803  31.297 -0.065  1.00 500.00 ? 193 HOH B O   1 
HETATM 3485 O O   . HOH D 3 .   ? 9.234   26.269 -4.836  1.00 19.17  ? 194 HOH B O   1 
HETATM 3486 O O   . HOH D 3 .   ? 15.802  51.762 7.490   1.00 27.87  ? 195 HOH B O   1 
HETATM 3487 O O   . HOH D 3 .   ? 17.003  32.498 0.679   1.00 29.36  ? 196 HOH B O   1 
HETATM 3488 O O   . HOH D 3 .   ? 18.018  44.172 -2.359  1.00 21.74  ? 197 HOH B O   1 
HETATM 3489 O O   . HOH D 3 .   ? -5.477  31.057 -2.233  1.00 41.88  ? 198 HOH B O   1 
HETATM 3490 O O   . HOH D 3 .   ? 17.921  39.808 1.812   1.00 25.92  ? 199 HOH B O   1 
HETATM 3491 O O   . HOH D 3 .   ? 12.316  21.323 0.262   1.00 25.50  ? 200 HOH B O   1 
HETATM 3492 O O   . HOH D 3 .   ? 11.090  31.674 3.519   1.00 25.97  ? 201 HOH B O   1 
HETATM 3493 O O   . HOH D 3 .   ? 11.346  21.236 -8.556  1.00 23.48  ? 202 HOH B O   1 
HETATM 3494 O O   . HOH D 3 .   ? 13.831  49.886 8.007   1.00 27.85  ? 203 HOH B O   1 
HETATM 3495 O O   . HOH D 3 .   ? 15.395  33.167 -13.783 1.00 24.86  ? 204 HOH B O   1 
HETATM 3496 O O   . HOH D 3 .   ? -1.225  27.215 -17.763 1.00 34.68  ? 205 HOH B O   1 
HETATM 3497 O O   . HOH D 3 .   ? 20.724  31.160 5.560   1.00 31.89  ? 206 HOH B O   1 
HETATM 3498 O O   . HOH D 3 .   ? -3.480  29.300 -16.469 1.00 27.80  ? 207 HOH B O   1 
HETATM 3499 O O   . HOH D 3 .   ? 5.037   44.862 -12.079 1.00 24.03  ? 208 HOH B O   1 
HETATM 3500 O O   . HOH D 3 .   ? 20.516  37.667 1.510   1.00 27.12  ? 209 HOH B O   1 
HETATM 3501 O O   . HOH D 3 .   ? -0.660  27.393 -15.075 1.00 25.17  ? 210 HOH B O   1 
HETATM 3502 O O   . HOH D 3 .   ? 17.681  42.095 3.103   1.00 21.24  ? 211 HOH B O   1 
HETATM 3503 O O   . HOH D 3 .   ? 20.351  35.154 2.372   1.00 27.09  ? 212 HOH B O   1 
HETATM 3504 O O   . HOH D 3 .   ? 6.708   39.227 -16.229 1.00 31.69  ? 213 HOH B O   1 
HETATM 3505 O O   . HOH D 3 .   ? 19.225  42.577 5.339   1.00 23.00  ? 214 HOH B O   1 
HETATM 3506 O O   . HOH D 3 .   ? -10.207 44.996 -5.239  1.00 135.65 ? 215 HOH B O   1 
HETATM 3507 O O   . HOH D 3 .   ? 20.044  41.857 -0.179  1.00 24.00  ? 216 HOH B O   1 
HETATM 3508 O O   . HOH D 3 .   ? 1.159   30.904 5.720   1.00 25.92  ? 217 HOH B O   1 
HETATM 3509 O O   . HOH D 3 .   ? 19.887  33.024 0.524   1.00 28.17  ? 218 HOH B O   1 
HETATM 3510 O O   . HOH D 3 .   ? 6.929   20.208 3.762   1.00 33.35  ? 219 HOH B O   1 
HETATM 3511 O O   . HOH D 3 .   ? -9.663  46.098 -0.519  1.00 35.80  ? 220 HOH B O   1 
HETATM 3512 O O   . HOH D 3 .   ? 13.468  31.267 -7.583  1.00 45.26  ? 221 HOH B O   1 
HETATM 3513 O O   . HOH D 3 .   ? 6.439   26.800 -7.055  1.00 34.25  ? 222 HOH B O   1 
HETATM 3514 O O   . HOH D 3 .   ? 9.384   33.378 8.267   1.00 27.39  ? 223 HOH B O   1 
HETATM 3515 O O   . HOH D 3 .   ? 15.691  32.790 -10.464 1.00 29.85  ? 224 HOH B O   1 
HETATM 3516 O O   . HOH D 3 .   ? 11.718  43.776 -14.468 1.00 42.29  ? 225 HOH B O   1 
HETATM 3517 O O   . HOH D 3 .   ? 13.524  32.034 4.316   1.00 40.67  ? 226 HOH B O   1 
HETATM 3518 O O   . HOH D 3 .   ? 7.130   26.915 5.740   1.00 31.80  ? 227 HOH B O   1 
HETATM 3519 O O   . HOH D 3 .   ? 17.682  47.059 -3.040  1.00 27.02  ? 228 HOH B O   1 
HETATM 3520 O O   . HOH D 3 .   ? 2.170   49.539 2.185   1.00 30.82  ? 229 HOH B O   1 
HETATM 3521 O O   . HOH D 3 .   ? 9.910   28.921 -9.165  1.00 29.09  ? 230 HOH B O   1 
HETATM 3522 O O   . HOH D 3 .   ? -15.541 22.635 4.517   1.00 37.52  ? 231 HOH B O   1 
HETATM 3523 O O   . HOH D 3 .   ? 12.295  25.120 1.249   1.00 31.71  ? 232 HOH B O   1 
HETATM 3524 O O   . HOH D 3 .   ? 7.546   50.719 -4.395  1.00 48.24  ? 233 HOH B O   1 
HETATM 3525 O O   . HOH D 3 .   ? -8.990  44.664 -2.629  1.00 209.71 ? 234 HOH B O   1 
HETATM 3526 O O   . HOH D 3 .   ? 10.829  28.101 -5.700  1.00 39.89  ? 235 HOH B O   1 
HETATM 3527 O O   . HOH D 3 .   ? -12.542 31.578 -1.960  1.00 42.65  ? 236 HOH B O   1 
HETATM 3528 O O   . HOH D 3 .   ? -11.505 45.716 0.702   1.00 42.60  ? 237 HOH B O   1 
HETATM 3529 O O   . HOH D 3 .   ? 12.421  53.246 -9.329  1.00 65.21  ? 238 HOH B O   1 
HETATM 3530 O O   . HOH D 3 .   ? 1.920   40.050 -24.523 1.00 66.83  ? 239 HOH B O   1 
HETATM 3531 O O   . HOH D 3 .   ? 12.887  53.507 -3.472  1.00 29.13  ? 240 HOH B O   1 
HETATM 3532 O O   . HOH D 3 .   ? 2.430   35.346 -18.565 1.00 46.20  ? 241 HOH B O   1 
HETATM 3533 O O   . HOH D 3 .   ? 2.484   47.776 -12.344 1.00 39.59  ? 242 HOH B O   1 
HETATM 3534 O O   . HOH D 3 .   ? 3.098   32.987 -19.606 1.00 33.12  ? 243 HOH B O   1 
HETATM 3535 O O   . HOH D 3 .   ? 10.773  33.165 6.404   1.00 46.06  ? 244 HOH B O   1 
HETATM 3536 O O   . HOH D 3 .   ? 15.410  39.993 -8.920  1.00 23.61  ? 245 HOH B O   1 
HETATM 3537 O O   . HOH D 3 .   ? 8.605   26.664 -8.323  1.00 37.07  ? 246 HOH B O   1 
HETATM 3538 O O   . HOH D 3 .   ? -4.861  33.771 -17.441 1.00 37.22  ? 247 HOH B O   1 
HETATM 3539 O O   . HOH D 3 .   ? 8.364   25.336 3.910   1.00 46.11  ? 248 HOH B O   1 
HETATM 3540 O O   . HOH D 3 .   ? 14.235  53.924 -5.656  1.00 37.98  ? 249 HOH B O   1 
HETATM 3541 O O   . HOH D 3 .   ? 0.340   28.247 5.104   1.00 40.03  ? 250 HOH B O   1 
HETATM 3542 O O   . HOH D 3 .   ? 15.045  30.229 3.821   1.00 34.01  ? 251 HOH B O   1 
HETATM 3543 O O   . HOH D 3 .   ? 7.002   19.766 6.332   1.00 39.27  ? 252 HOH B O   1 
HETATM 3544 O O   . HOH D 3 .   ? 12.418  54.286 0.741   1.00 35.43  ? 253 HOH B O   1 
HETATM 3545 O O   . HOH D 3 .   ? 3.598   44.060 -2.394  1.00 500.00 ? 254 HOH B O   1 
HETATM 3546 O O   . HOH D 3 .   ? -4.761  32.171 9.243   1.00 54.96  ? 255 HOH B O   1 
HETATM 3547 O O   . HOH D 3 .   ? -7.401  43.005 7.036   1.00 53.66  ? 256 HOH B O   1 
HETATM 3548 O O   . HOH D 3 .   ? 13.661  56.969 4.276   1.00 30.36  ? 257 HOH B O   1 
HETATM 3549 O O   . HOH D 3 .   ? -4.990  48.290 6.866   1.00 46.29  ? 258 HOH B O   1 
HETATM 3550 O O   . HOH D 3 .   ? 10.320  49.165 11.357  1.00 44.75  ? 259 HOH B O   1 
HETATM 3551 O O   . HOH D 3 .   ? 6.112   51.584 -2.294  1.00 48.76  ? 260 HOH B O   1 
HETATM 3552 O O   . HOH D 3 .   ? 14.100  53.454 -1.195  1.00 42.04  ? 261 HOH B O   1 
HETATM 3553 O O   . HOH D 3 .   ? 10.491  53.922 -4.004  1.00 36.28  ? 262 HOH B O   1 
HETATM 3554 O O   . HOH D 3 .   ? 13.803  42.771 -13.991 1.00 47.05  ? 263 HOH B O   1 
HETATM 3555 O O   . HOH D 3 .   ? 20.270  31.700 -1.927  1.00 40.04  ? 264 HOH B O   1 
HETATM 3556 O O   . HOH D 3 .   ? 17.959  40.481 -8.294  1.00 29.35  ? 265 HOH B O   1 
HETATM 3557 O O   . HOH D 3 .   ? 20.403  38.208 10.483  1.00 31.14  ? 266 HOH B O   1 
HETATM 3558 O O   . HOH D 3 .   ? 15.794  40.769 -11.494 1.00 38.00  ? 267 HOH B O   1 
HETATM 3559 O O   . HOH D 3 .   ? -6.127  35.579 -17.067 1.00 37.46  ? 268 HOH B O   1 
HETATM 3560 O O   . HOH D 3 .   ? -2.997  30.742 8.505   1.00 36.15  ? 269 HOH B O   1 
HETATM 3561 O O   . HOH D 3 .   ? 18.708  35.779 9.937   1.00 41.22  ? 270 HOH B O   1 
HETATM 3562 O O   . HOH D 3 .   ? 12.375  28.570 5.588   1.00 51.98  ? 271 HOH B O   1 
HETATM 3563 O O   . HOH D 3 .   ? -0.159  48.718 -14.318 1.00 43.01  ? 272 HOH B O   1 
HETATM 3564 O O   . HOH D 3 .   ? -6.123  45.261 5.555   1.00 42.61  ? 273 HOH B O   1 
HETATM 3565 O O   . HOH D 3 .   ? 2.799   50.674 -2.092  1.00 43.19  ? 274 HOH B O   1 
HETATM 3566 O O   . HOH D 3 .   ? -0.321  47.011 2.089   1.00 39.35  ? 275 HOH B O   1 
HETATM 3567 O O   . HOH D 3 .   ? 0.960   48.180 11.640  1.00 60.05  ? 276 HOH B O   1 
HETATM 3568 O O   . HOH D 3 .   ? 9.427   22.605 3.905   1.00 121.51 ? 277 HOH B O   1 
HETATM 3569 O O   . HOH D 3 .   ? 11.758  54.952 3.101   1.00 48.49  ? 278 HOH B O   1 
HETATM 3570 O O   . HOH D 3 .   ? 18.233  35.139 12.110  1.00 43.40  ? 279 HOH B O   1 
HETATM 3571 O O   . HOH D 3 .   ? 3.931   45.452 -14.736 1.00 50.39  ? 280 HOH B O   1 
HETATM 3572 O O   . HOH D 3 .   ? -1.561  40.192 -18.117 1.00 35.98  ? 281 HOH B O   1 
HETATM 3573 O O   . HOH D 3 .   ? 6.125   49.955 0.736   1.00 38.76  ? 282 HOH B O   1 
HETATM 3574 O O   . HOH D 3 .   ? -9.681  40.008 -18.833 1.00 48.57  ? 283 HOH B O   1 
HETATM 3575 O O   . HOH D 3 .   ? -11.805 44.337 -2.406  1.00 38.68  ? 284 HOH B O   1 
HETATM 3576 O O   . HOH D 3 .   ? -10.431 40.133 -13.000 1.00 500.00 ? 285 HOH B O   1 
HETATM 3577 O O   . HOH D 3 .   ? 10.611  32.016 10.026  1.00 45.99  ? 286 HOH B O   1 
HETATM 3578 O O   . HOH D 3 .   ? 1.595   36.387 9.708   1.00 24.60  ? 287 HOH B O   1 
HETATM 3579 O O   . HOH D 3 .   ? 10.446  31.297 -16.034 1.00 35.57  ? 288 HOH B O   1 
HETATM 3580 O O   . HOH D 3 .   ? 17.239  34.932 7.791   1.00 40.85  ? 289 HOH B O   1 
HETATM 3581 O O   . HOH D 3 .   ? 3.201   50.978 0.587   1.00 48.39  ? 290 HOH B O   1 
HETATM 3582 O O   . HOH D 3 .   ? -7.133  39.077 -18.505 1.00 46.40  ? 291 HOH B O   1 
HETATM 3583 O O   . HOH D 3 .   ? 19.470  39.130 -7.114  1.00 38.03  ? 292 HOH B O   1 
HETATM 3584 O O   . HOH D 3 .   ? 10.908  45.404 4.383   1.00 50.28  ? 293 HOH B O   1 
HETATM 3585 O O   . HOH D 3 .   ? -12.229 26.722 0.513   1.00 35.63  ? 294 HOH B O   1 
HETATM 3586 O O   . HOH D 3 .   ? 15.071  22.152 -8.617  1.00 41.43  ? 295 HOH B O   1 
HETATM 3587 O O   . HOH D 3 .   ? 14.895  54.412 8.602   1.00 43.98  ? 296 HOH B O   1 
HETATM 3588 O O   . HOH D 3 .   ? 1.283   39.421 10.011  1.00 48.24  ? 297 HOH B O   1 
HETATM 3589 O O   . HOH D 3 .   ? 2.029   25.026 -17.943 1.00 50.00  ? 298 HOH B O   1 
HETATM 3590 O O   . HOH D 3 .   ? 12.479  35.021 11.282  1.00 39.11  ? 299 HOH B O   1 
HETATM 3591 O O   . HOH D 3 .   ? 18.697  52.079 -3.243  1.00 51.82  ? 300 HOH B O   1 
HETATM 3592 O O   . HOH D 3 .   ? 3.744   37.917 12.739  1.00 58.73  ? 301 HOH B O   1 
HETATM 3593 O O   . HOH D 3 .   ? -3.498  42.457 -16.426 1.00 71.23  ? 302 HOH B O   1 
HETATM 3594 O O   . HOH D 3 .   ? 16.340  30.589 5.875   1.00 50.43  ? 303 HOH B O   1 
HETATM 3595 O O   . HOH D 3 .   ? 19.396  48.984 -3.405  1.00 57.27  ? 304 HOH B O   1 
HETATM 3596 O O   . HOH D 3 .   ? -16.339 37.984 -3.898  1.00 44.28  ? 305 HOH B O   1 
HETATM 3597 O O   . HOH D 3 .   ? -4.973  51.524 -4.651  1.00 54.95  ? 306 HOH B O   1 
HETATM 3598 O O   . HOH D 3 .   ? -0.372  42.018 -16.614 1.00 42.12  ? 307 HOH B O   1 
HETATM 3599 O O   . HOH D 3 .   ? -2.073  40.129 -9.922  1.00 331.11 ? 308 HOH B O   1 
HETATM 3600 O O   . HOH D 3 .   ? 17.495  39.429 15.499  1.00 45.60  ? 309 HOH B O   1 
HETATM 3601 O O   . HOH D 3 .   ? 17.250  44.690 -9.130  1.00 37.23  ? 310 HOH B O   1 
HETATM 3602 O O   . HOH D 3 .   ? 19.546  36.717 -6.257  1.00 54.04  ? 311 HOH B O   1 
HETATM 3603 O O   . HOH D 3 .   ? -9.088  48.001 -7.297  1.00 147.87 ? 312 HOH B O   1 
HETATM 3604 O O   . HOH D 3 .   ? 15.836  31.304 -4.064  1.00 35.22  ? 313 HOH B O   1 
HETATM 3605 O O   . HOH D 3 .   ? 14.835  44.737 1.333   1.00 210.84 ? 314 HOH B O   1 
HETATM 3606 O O   . HOH D 3 .   ? 15.785  35.952 10.510  1.00 53.04  ? 315 HOH B O   1 
HETATM 3607 O O   . HOH D 3 .   ? -4.512  50.850 -2.073  1.00 42.88  ? 316 HOH B O   1 
HETATM 3608 O O   . HOH D 3 .   ? -9.231  35.146 8.396   1.00 39.50  ? 317 HOH B O   1 
HETATM 3609 O O   . HOH D 3 .   ? -0.100  23.549 -17.121 1.00 46.36  ? 318 HOH B O   1 
HETATM 3610 O O   . HOH D 3 .   ? 4.432   35.272 12.789  1.00 64.03  ? 319 HOH B O   1 
HETATM 3611 O O   . HOH D 3 .   ? 17.212  30.203 2.067   1.00 50.97  ? 320 HOH B O   1 
HETATM 3612 O O   . HOH D 3 .   ? -2.852  36.078 -19.563 1.00 52.68  ? 321 HOH B O   1 
HETATM 3613 O O   . HOH D 3 .   ? -19.091 37.340 -4.728  1.00 43.97  ? 322 HOH B O   1 
HETATM 3614 O O   . HOH D 3 .   ? 17.361  42.002 15.249  1.00 56.01  ? 323 HOH B O   1 
HETATM 3615 O O   . HOH D 3 .   ? -15.770 40.336 -14.635 1.00 80.64  ? 324 HOH B O   1 
HETATM 3616 O O   . HOH D 3 .   ? 0.971   34.464 -22.422 1.00 56.76  ? 325 HOH B O   1 
HETATM 3617 O O   . HOH D 3 .   ? 14.513  39.397 14.099  1.00 52.50  ? 326 HOH B O   1 
HETATM 3618 O O   . HOH D 3 .   ? 8.934   55.237 -0.738  1.00 56.38  ? 327 HOH B O   1 
HETATM 3619 O O   . HOH D 3 .   ? 18.884  43.461 -4.738  1.00 176.19 ? 328 HOH B O   1 
HETATM 3620 O O   . HOH D 3 .   ? 5.309   41.614 18.373  1.00 68.34  ? 329 HOH B O   1 
HETATM 3621 O O   . HOH D 3 .   ? 17.725  48.453 -5.379  1.00 43.38  ? 330 HOH B O   1 
HETATM 3622 O O   . HOH D 3 .   ? 4.252   48.305 13.262  1.00 50.76  ? 331 HOH B O   1 
HETATM 3623 O O   . HOH D 3 .   ? 9.769   19.728 3.337   1.00 46.21  ? 332 HOH B O   1 
HETATM 3624 O O   . HOH D 3 .   ? 8.061   40.252 10.802  1.00 252.80 ? 333 HOH B O   1 
HETATM 3625 O O   . HOH D 3 .   ? 15.010  20.906 0.087   1.00 46.12  ? 334 HOH B O   1 
HETATM 3626 O O   . HOH D 3 .   ? 9.565   54.953 2.063   1.00 45.10  ? 335 HOH B O   1 
HETATM 3627 O O   . HOH D 3 .   ? 11.644  22.859 2.125   1.00 49.53  ? 336 HOH B O   1 
HETATM 3628 O O   . HOH D 3 .   ? -2.393  29.026 -19.064 1.00 63.17  ? 337 HOH B O   1 
HETATM 3629 O O   . HOH D 3 .   ? 15.370  45.811 14.093  1.00 53.14  ? 338 HOH B O   1 
HETATM 3630 O O   . HOH D 3 .   ? 0.637   51.883 -9.889  1.00 52.60  ? 339 HOH B O   1 
HETATM 3631 O O   . HOH D 3 .   ? 15.004  38.152 -15.314 1.00 40.90  ? 340 HOH B O   1 
HETATM 3632 O O   . HOH D 3 .   ? -21.607 43.875 -6.288  1.00 50.49  ? 341 HOH B O   1 
HETATM 3633 O O   . HOH D 3 .   ? -2.544  51.938 -8.761  1.00 47.81  ? 342 HOH B O   1 
HETATM 3634 O O   . HOH D 3 .   ? -16.372 27.736 5.040   1.00 78.22  ? 343 HOH B O   1 
HETATM 3635 O O   . HOH D 3 .   ? 6.337   29.683 -6.346  1.00 24.58  ? 344 HOH B O   1 
HETATM 3636 O O   . HOH D 3 .   ? 7.782   42.652 17.745  1.00 49.02  ? 345 HOH B O   1 
HETATM 3637 O O   . HOH D 3 .   ? 12.630  27.378 -12.240 1.00 54.95  ? 346 HOH B O   1 
HETATM 3638 O O   . HOH D 3 .   ? 8.136   39.247 -18.360 1.00 66.16  ? 347 HOH B O   1 
HETATM 3639 O O   . HOH D 3 .   ? 17.681  49.141 -1.783  1.00 500.00 ? 348 HOH B O   1 
HETATM 3640 O O   . HOH D 3 .   ? -6.351  51.971 -0.713  1.00 53.36  ? 349 HOH B O   1 
HETATM 3641 O O   . HOH D 3 .   ? 19.753  41.247 -9.980  1.00 52.52  ? 350 HOH B O   1 
HETATM 3642 O O   . HOH D 3 .   ? 0.791   39.821 -17.547 1.00 63.16  ? 351 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   124 ?   ?   ?   A . n 
A 1 2   SER 2   125 ?   ?   ?   A . n 
A 1 3   HIS 3   126 ?   ?   ?   A . n 
A 1 4   HIS 4   127 ?   ?   ?   A . n 
A 1 5   HIS 5   128 ?   ?   ?   A . n 
A 1 6   HIS 6   129 ?   ?   ?   A . n 
A 1 7   HIS 7   130 ?   ?   ?   A . n 
A 1 8   HIS 8   131 ?   ?   ?   A . n 
A 1 9   SER 9   132 ?   ?   ?   A . n 
A 1 10  ILE 10  133 ?   ?   ?   A . n 
A 1 11  GLU 11  134 ?   ?   ?   A . n 
A 1 12  THR 12  135 ?   ?   ?   A . n 
A 1 13  ASP 13  136 ?   ?   ?   A . n 
A 1 14  ARG 14  137 ?   ?   ?   A . n 
A 1 15  VAL 15  138 ?   ?   ?   A . n 
A 1 16  SER 16  139 139 SER SER A . n 
A 1 17  LYS 17  140 140 LYS ALA A . n 
A 1 18  GLU 18  141 141 GLU GLU A . n 
A 1 19  PHE 19  142 142 PHE PHE A . n 
A 1 20  ILE 20  143 143 ILE ILE A . n 
A 1 21  GLU 21  144 144 GLU GLU A . n 
A 1 22  PHE 22  145 145 PHE PHE A . n 
A 1 23  LEU 23  146 146 LEU LEU A . n 
A 1 24  LYS 24  147 147 LYS LYS A . n 
A 1 25  THR 25  148 148 THR THR A . n 
A 1 26  PHE 26  149 149 PHE PHE A . n 
A 1 27  HIS 27  150 150 HIS ALA A . n 
A 1 28  LYS 28  151 151 LYS ALA A . n 
A 1 29  THR 29  152 152 THR ALA A . n 
A 1 30  GLY 30  153 153 GLY GLY A . n 
A 1 31  GLN 31  154 154 GLN GLN A . n 
A 1 32  GLU 32  155 155 GLU ALA A . n 
A 1 33  ILE 33  156 156 ILE ILE A . n 
A 1 34  TYR 34  157 157 TYR TYR A . n 
A 1 35  LYS 35  158 158 LYS LYS A . n 
A 1 36  GLN 36  159 159 GLN ALA A . n 
A 1 37  THR 37  160 160 THR THR A . n 
A 1 38  LYS 38  161 161 LYS LYS A . n 
A 1 39  LEU 39  162 162 LEU LEU A . n 
A 1 40  PHE 40  163 163 PHE PHE A . n 
A 1 41  LEU 41  164 164 LEU LEU A . n 
A 1 42  GLU 42  165 165 GLU GLU A . n 
A 1 43  GLY 43  166 166 GLY GLY A . n 
A 1 44  MET 44  167 167 MET MET A . n 
A 1 45  HIS 45  168 168 HIS ALA A . n 
A 1 46  TYR 46  169 169 TYR ALA A . n 
A 1 47  LYS 47  170 170 LYS LYS A . n 
A 1 48  ARG 48  171 171 ARG ALA A . n 
A 1 49  ASP 49  172 172 ASP ALA A . n 
A 1 50  LEU 50  173 173 LEU LEU A . n 
A 1 51  SER 51  174 174 SER SER A . n 
A 1 52  ILE 52  175 175 ILE ILE A . n 
A 1 53  GLU 53  176 176 GLU ALA A . n 
A 1 54  GLU 54  177 177 GLU ALA A . n 
A 1 55  GLN 55  178 178 GLN GLN A . n 
A 1 56  SER 56  179 179 SER SER A . n 
A 1 57  GLU 57  180 180 GLU GLU A . n 
A 1 58  CYS 58  181 181 CYS CYS A . n 
A 1 59  ALA 59  182 182 ALA ALA A . n 
A 1 60  GLN 60  183 183 GLN GLN A . n 
A 1 61  ASP 61  184 184 ASP ASP A . n 
A 1 62  PHE 62  185 185 PHE PHE A . n 
A 1 63  TYR 63  186 186 TYR TYR A . n 
A 1 64  HIS 64  187 187 HIS ALA A . n 
A 1 65  ASN 65  188 188 ASN ASN A . n 
A 1 66  VAL 66  189 189 VAL VAL A . n 
A 1 67  ALA 67  190 190 ALA ALA A . n 
A 1 68  GLU 68  191 191 GLU ALA A . n 
A 1 69  ARG 69  192 192 ARG ALA A . n 
A 1 70  MET 70  193 193 MET MET A . n 
A 1 71  GLN 71  194 194 GLN GLN A . n 
A 1 72  THR 72  195 195 THR THR A . n 
A 1 73  ARG 73  196 196 ARG ALA A . n 
A 1 74  GLY 74  197 197 GLY GLY A . n 
A 1 75  LYS 75  198 198 LYS LYS A . n 
A 1 76  VAL 76  199 199 VAL VAL A . n 
A 1 77  PRO 77  200 200 PRO PRO A . n 
A 1 78  PRO 78  201 201 PRO PRO A . n 
A 1 79  GLU 79  202 202 GLU ALA A . n 
A 1 80  ARG 80  203 203 ARG ARG A . n 
A 1 81  VAL 81  204 204 VAL VAL A . n 
A 1 82  GLU 82  205 205 GLU ALA A . n 
A 1 83  LYS 83  206 206 LYS ALA A . n 
A 1 84  ILE 84  207 207 ILE ILE A . n 
A 1 85  MET 85  208 208 MET MET A . n 
A 1 86  ASP 86  209 209 ASP ASP A . n 
A 1 87  GLN 87  210 210 GLN GLN A . n 
A 1 88  ILE 88  211 211 ILE ILE A . n 
A 1 89  GLU 89  212 212 GLU GLU A . n 
A 1 90  LYS 90  213 213 LYS LYS A . n 
A 1 91  TYR 91  214 214 TYR TYR A . n 
A 1 92  ILE 92  215 215 ILE ILE A . n 
A 1 93  MET 93  216 216 MET MET A . n 
A 1 94  THR 94  217 217 THR THR A . n 
A 1 95  ARG 95  218 218 ARG ARG A . n 
A 1 96  LEU 96  219 219 LEU LEU A . n 
A 1 97  TYR 97  220 220 TYR TYR A . n 
A 1 98  LYS 98  221 221 LYS ALA A . n 
A 1 99  TYR 99  222 222 TYR TYR A . n 
A 1 100 VAL 100 223 223 VAL VAL A . n 
A 1 101 PHE 101 224 224 PHE PHE A . n 
A 1 102 CYS 102 225 225 CYS CYS A . n 
A 1 103 PRO 103 226 226 PRO PRO A . n 
A 1 104 GLU 104 227 227 GLU GLU A . n 
A 1 105 THR 105 228 228 THR THR A . n 
A 1 106 THR 106 229 229 THR THR A . n 
A 1 107 ASP 107 230 230 ASP ASP A . n 
A 1 108 ASP 108 231 231 ASP ASP A . n 
A 1 109 GLU 109 232 232 GLU GLU A . n 
A 1 110 LYS 110 233 233 LYS LYS A . n 
A 1 111 LYS 111 234 234 LYS LYS A . n 
A 1 112 ASP 112 235 235 ASP ASP A . n 
A 1 113 LEU 113 236 236 LEU LEU A . n 
A 1 114 ALA 114 237 237 ALA ALA A . n 
A 1 115 ILE 115 238 238 ILE ILE A . n 
A 1 116 GLN 116 239 239 GLN GLN A . n 
A 1 117 LYS 117 240 240 LYS ALA A . n 
A 1 118 ARG 118 241 241 ARG ARG A . n 
A 1 119 ILE 119 242 242 ILE ILE A . n 
A 1 120 ARG 120 243 243 ARG ARG A . n 
A 1 121 ALA 121 244 244 ALA ALA A . n 
A 1 122 LEU 122 245 245 LEU LEU A . n 
A 1 123 ARG 123 246 246 ARG ARG A . n 
A 1 124 TRP 124 247 247 TRP TRP A . n 
A 1 125 VAL 125 248 248 VAL VAL A . n 
A 1 126 THR 126 249 249 THR THR A . n 
A 1 127 PRO 127 250 250 PRO PRO A . n 
A 1 128 GLN 128 251 251 GLN GLN A . n 
A 1 129 MET 129 252 252 MET MET A . n 
A 1 130 LEU 130 253 253 LEU LEU A . n 
A 1 131 CYS 131 254 254 CYS CYS A . n 
A 1 132 VAL 132 255 255 VAL VAL A . n 
A 1 133 PRO 133 256 256 PRO PRO A . n 
A 1 134 VAL 134 257 257 VAL VAL A . n 
A 1 135 ASN 135 258 258 ASN ASN A . n 
A 1 136 GLU 136 259 259 GLU GLU A . n 
A 1 137 ASP 137 260 260 ASP ASP A . n 
A 1 138 ILE 138 261 261 ILE ILE A . n 
A 1 139 PRO 139 262 262 PRO PRO A . n 
A 1 140 GLU 140 263 263 GLU GLU A . n 
A 1 141 VAL 141 264 264 VAL VAL A . n 
A 1 142 SER 142 265 265 SER SER A . n 
A 1 143 ASP 143 266 266 ASP ASP A . n 
A 1 144 MET 144 267 267 MET MET A . n 
A 1 145 VAL 145 268 268 VAL VAL A . n 
A 1 146 VAL 146 269 269 VAL VAL A . n 
A 1 147 LYS 147 270 270 LYS LYS A . n 
A 1 148 ALA 148 271 271 ALA ALA A . n 
A 1 149 ILE 149 272 272 ILE ILE A . n 
A 1 150 THR 150 273 273 THR THR A . n 
A 1 151 ASP 151 274 274 ASP ASP A . n 
A 1 152 ILE 152 275 275 ILE ILE A . n 
A 1 153 ILE 153 276 276 ILE ILE A . n 
A 1 154 GLU 154 277 277 GLU ALA A . n 
A 1 155 MET 155 278 278 MET MET A . n 
A 1 156 ASP 156 279 279 ASP ASP A . n 
A 1 157 SER 157 280 280 SER SER A . n 
A 1 158 LYS 158 281 281 LYS LYS A . n 
A 1 159 ARG 159 282 282 ARG ARG A . n 
A 1 160 VAL 160 283 283 VAL VAL A . n 
A 1 161 PRO 161 284 284 PRO PRO A . n 
A 1 162 ARG 162 285 285 ARG ARG A . n 
A 1 163 ASP 163 286 286 ASP ASP A . n 
A 1 164 LYS 164 287 287 LYS LYS A . n 
A 1 165 LEU 165 288 288 LEU LEU A . n 
A 1 166 ALA 166 289 289 ALA ALA A . n 
A 1 167 CYS 167 290 290 CYS CYS A . n 
A 1 168 ILE 168 291 291 ILE ILE A . n 
A 1 169 THR 169 292 292 THR THR A . n 
A 1 170 LYS 170 293 293 LYS LYS A . n 
A 1 171 CYS 171 294 294 CYS CYS A . n 
A 1 172 SER 172 295 295 SER SER A . n 
A 1 173 LYS 173 296 296 LYS LYS A . n 
A 1 174 HIS 174 297 297 HIS HIS A . n 
A 1 175 ILE 175 298 298 ILE ILE A . n 
A 1 176 PHE 176 299 299 PHE PHE A . n 
A 1 177 ASN 177 300 300 ASN ASN A . n 
A 1 178 ALA 178 301 301 ALA ALA A . n 
A 1 179 ILE 179 302 302 ILE ILE A . n 
A 1 180 LYS 180 303 303 LYS LYS A . n 
A 1 181 ILE 181 304 304 ILE ILE A . n 
A 1 182 THR 182 305 305 THR THR A . n 
A 1 183 LYS 183 306 306 LYS LYS A . n 
A 1 184 ASN 184 307 307 ASN ASN A . n 
A 1 185 GLU 185 308 308 GLU GLU A . n 
A 1 186 PRO 186 309 309 PRO PRO A . n 
A 1 187 ALA 187 310 310 ALA ALA A . n 
A 1 188 SER 188 311 311 SER SER A . n 
A 1 189 ALA 189 312 312 ALA ALA A . n 
A 1 190 ASP 190 313 313 ASP ASP A . n 
A 1 191 ASP 191 314 314 ASP ASP A . n 
A 1 192 PHE 192 315 315 PHE PHE A . n 
A 1 193 LEU 193 316 316 LEU LEU A . n 
A 1 194 PRO 194 317 317 PRO PRO A . n 
A 1 195 THR 195 318 318 THR THR A . n 
A 1 196 LEU 196 319 319 LEU LEU A . n 
A 1 197 ILE 197 320 320 ILE ILE A . n 
A 1 198 TYR 198 321 321 TYR TYR A . n 
A 1 199 ILE 199 322 322 ILE ILE A . n 
A 1 200 VAL 200 323 323 VAL VAL A . n 
A 1 201 LEU 201 324 324 LEU LEU A . n 
A 1 202 LYS 202 325 325 LYS LYS A . n 
A 1 203 GLY 203 326 326 GLY GLY A . n 
A 1 204 ASN 204 327 327 ASN ASN A . n 
A 1 205 PRO 205 328 328 PRO PRO A . n 
A 1 206 PRO 206 329 329 PRO PRO A . n 
A 1 207 ARG 207 330 330 ARG ARG A . n 
A 1 208 LEU 208 331 331 LEU LEU A . n 
A 1 209 GLN 209 332 332 GLN GLN A . n 
A 1 210 SER 210 333 333 SER SER A . n 
A 1 211 ASN 211 334 334 ASN ASN A . n 
A 1 212 ILE 212 335 335 ILE ILE A . n 
A 1 213 GLN 213 336 336 GLN GLN A . n 
A 1 214 TYR 214 337 337 TYR TYR A . n 
A 1 215 ILE 215 338 338 ILE ILE A . n 
A 1 216 THR 216 339 339 THR THR A . n 
A 1 217 ARG 217 340 340 ARG ARG A . n 
A 1 218 PHE 218 341 341 PHE PHE A . n 
A 1 219 CYS 219 342 342 CYS CYS A . n 
A 1 220 ASN 220 343 343 ASN ASN A . n 
A 1 221 PRO 221 344 344 PRO PRO A . n 
A 1 222 SER 222 345 345 SER SER A . n 
A 1 223 ARG 223 346 346 ARG ARG A . n 
A 1 224 LEU 224 347 347 LEU LEU A . n 
A 1 225 MET 225 348 348 MET MET A . n 
A 1 226 THR 226 349 349 THR THR A . n 
A 1 227 GLY 227 350 350 GLY GLY A . n 
A 1 228 GLU 228 351 351 GLU GLU A . n 
A 1 229 ASP 229 352 352 ASP ASP A . n 
A 1 230 GLY 230 353 353 GLY GLY A . n 
A 1 231 TYR 231 354 354 TYR TYR A . n 
A 1 232 TYR 232 355 355 TYR TYR A . n 
A 1 233 PHE 233 356 356 PHE PHE A . n 
A 1 234 THR 234 357 357 THR THR A . n 
A 1 235 ASN 235 358 358 ASN ASN A . n 
A 1 236 LEU 236 359 359 LEU LEU A . n 
A 1 237 CYS 237 360 360 CYS CYS A . n 
A 1 238 CYS 238 361 361 CYS CYS A . n 
A 1 239 ALA 239 362 362 ALA ALA A . n 
A 1 240 VAL 240 363 363 VAL VAL A . n 
A 1 241 ALA 241 364 364 ALA ALA A . n 
A 1 242 PHE 242 365 365 PHE PHE A . n 
A 1 243 ILE 243 366 366 ILE ILE A . n 
A 1 244 GLU 244 367 367 GLU GLU A . n 
A 1 245 LYS 245 368 368 LYS LYS A . n 
A 1 246 LEU 246 369 369 LEU LEU A . n 
A 1 247 ASP 247 370 370 ASP ASP A . n 
A 1 248 ALA 248 371 371 ALA ALA A . n 
A 1 249 GLN 249 372 372 GLN GLN A . n 
A 1 250 SER 250 373 373 SER SER A . n 
A 1 251 LEU 251 374 374 LEU LEU A . n 
A 1 252 ASN 252 375 375 ASN ASN A . n 
A 1 253 LEU 253 376 376 LEU LEU A . n 
A 1 254 SER 254 377 377 SER SER A . n 
A 1 255 GLN 255 378 378 GLN GLN A . n 
A 1 256 GLU 256 379 379 GLU GLU A . n 
A 1 257 ASP 257 380 380 ASP ASP A . n 
A 1 258 PHE 258 381 381 PHE PHE A . n 
A 1 259 ASP 259 382 382 ASP ASP A . n 
A 1 260 ARG 260 383 383 ARG ARG A . n 
A 1 261 TYR 261 384 384 TYR TYR A . n 
A 1 262 MET 262 385 385 MET MET A . n 
A 1 263 SER 263 386 386 SER SER A . n 
A 1 264 GLY 264 387 387 GLY GLY A . n 
A 1 265 GLN 265 388 388 GLN GLN A . n 
A 1 266 THR 266 389 389 THR THR A . n 
A 1 267 SER 267 390 390 SER SER A . n 
A 1 268 PRO 268 391 391 PRO PRO A . n 
A 1 269 ARG 269 392 ?   ?   ?   A . n 
A 1 270 LYS 270 393 ?   ?   ?   A . n 
A 1 271 GLN 271 394 ?   ?   ?   A . n 
A 1 272 GLU 272 395 ?   ?   ?   A . n 
A 1 273 ALA 273 396 ?   ?   ?   A . n 
A 1 274 GLU 274 397 ?   ?   ?   A . n 
B 2 1   GLY 1   14  ?   ?   ?   B . n 
B 2 2   SER 2   15  ?   ?   ?   B . n 
B 2 3   ARG 3   16  ?   ?   ?   B . n 
B 2 4   ALA 4   17  17  ALA ALA B . n 
B 2 5   TYR 5   18  18  TYR TYR B . n 
B 2 6   SER 6   19  19  SER SER B . n 
B 2 7   PHE 7   20  20  PHE PHE B . n 
B 2 8   LYS 8   21  21  LYS LYS B . n 
B 2 9   VAL 9   22  22  VAL VAL B . n 
B 2 10  VAL 10  23  23  VAL VAL B . n 
B 2 11  LEU 11  24  24  LEU LEU B . n 
B 2 12  LEU 12  25  25  LEU LEU B . n 
B 2 13  GLY 13  26  26  GLY GLY B . n 
B 2 14  GLU 14  27  27  GLU GLU B . n 
B 2 15  GLY 15  28  28  GLY GLY B . n 
B 2 16  CYS 16  29  29  CYS CYS B . n 
B 2 17  VAL 17  30  30  VAL VAL B . n 
B 2 18  GLY 18  31  31  GLY GLY B . n 
B 2 19  LYS 19  32  32  LYS LYS B . n 
B 2 20  THR 20  33  33  THR THR B . n 
B 2 21  SER 21  34  34  SER SER B . n 
B 2 22  LEU 22  35  35  LEU LEU B . n 
B 2 23  VAL 23  36  36  VAL VAL B . n 
B 2 24  LEU 24  37  37  LEU LEU B . n 
B 2 25  ARG 25  38  38  ARG ARG B . n 
B 2 26  TYR 26  39  39  TYR TYR B . n 
B 2 27  CYS 27  40  40  CYS CYS B . n 
B 2 28  GLU 28  41  ?   ?   ?   B . n 
B 2 29  ASN 29  42  ?   ?   ?   B . n 
B 2 30  LYS 30  43  ?   ?   ?   B . n 
B 2 31  PHE 31  44  ?   ?   ?   B . n 
B 2 32  ASN 32  45  ?   ?   ?   B . n 
B 2 33  ASP 33  46  ?   ?   ?   B . n 
B 2 34  LYS 34  47  ?   ?   ?   B . n 
B 2 35  HIS 35  48  ?   ?   ?   B . n 
B 2 36  ILE 36  49  ?   ?   ?   B . n 
B 2 37  THR 37  50  50  THR ALA B . n 
B 2 38  THR 38  51  51  THR THR B . n 
B 2 39  LEU 39  52  52  LEU LEU B . n 
B 2 40  GLN 40  53  53  GLN GLN B . n 
B 2 41  ALA 41  54  54  ALA ALA B . n 
B 2 42  SER 42  55  55  SER SER B . n 
B 2 43  PHE 43  56  56  PHE PHE B . n 
B 2 44  LEU 44  57  57  LEU LEU B . n 
B 2 45  THR 45  58  58  THR THR B . n 
B 2 46  LYS 46  59  59  LYS LYS B . n 
B 2 47  LYS 47  60  60  LYS ALA B . n 
B 2 48  LEU 48  61  61  LEU LEU B . n 
B 2 49  ASN 49  62  62  ASN ASN B . n 
B 2 50  ILE 50  63  63  ILE ILE B . n 
B 2 51  GLY 51  64  64  GLY GLY B . n 
B 2 52  GLY 52  65  65  GLY GLY B . n 
B 2 53  LYS 53  66  66  LYS ALA B . n 
B 2 54  ARG 54  67  67  ARG ALA B . n 
B 2 55  VAL 55  68  68  VAL VAL B . n 
B 2 56  ASN 56  69  69  ASN ASN B . n 
B 2 57  LEU 57  70  70  LEU LEU B . n 
B 2 58  ALA 58  71  71  ALA ALA B . n 
B 2 59  ILE 59  72  72  ILE ILE B . n 
B 2 60  TRP 60  73  73  TRP TRP B . n 
B 2 61  ASP 61  74  74  ASP ASP B . n 
B 2 62  THR 62  75  75  THR THR B . n 
B 2 63  ALA 63  76  76  ALA ALA B . n 
B 2 64  GLY 64  77  77  GLY GLY B . n 
B 2 65  GLN 65  78  78  GLN GLN B . n 
B 2 66  GLU 66  79  79  GLU GLU B . n 
B 2 67  ARG 67  80  80  ARG ARG B . n 
B 2 68  PHE 68  81  81  PHE PHE B . n 
B 2 69  HIS 69  82  82  HIS HIS B . n 
B 2 70  ALA 70  83  83  ALA ALA B . n 
B 2 71  LEU 71  84  84  LEU LEU B . n 
B 2 72  GLY 72  85  85  GLY GLY B . n 
B 2 73  PRO 73  86  86  PRO PRO B . n 
B 2 74  ILE 74  87  87  ILE ILE B . n 
B 2 75  TYR 75  88  88  TYR TYR B . n 
B 2 76  TYR 76  89  89  TYR TYR B . n 
B 2 77  ARG 77  90  90  ARG ARG B . n 
B 2 78  ASP 78  91  91  ASP ASP B . n 
B 2 79  SER 79  92  92  SER SER B . n 
B 2 80  ASN 80  93  93  ASN ASN B . n 
B 2 81  GLY 81  94  94  GLY GLY B . n 
B 2 82  ALA 82  95  95  ALA ALA B . n 
B 2 83  ILE 83  96  96  ILE ILE B . n 
B 2 84  LEU 84  97  97  LEU LEU B . n 
B 2 85  VAL 85  98  98  VAL VAL B . n 
B 2 86  TYR 86  99  99  TYR TYR B . n 
B 2 87  ASP 87  100 100 ASP ASP B . n 
B 2 88  ILE 88  101 101 ILE ILE B . n 
B 2 89  THR 89  102 102 THR THR B . n 
B 2 90  ASP 90  103 103 ASP ASP B . n 
B 2 91  GLU 91  104 104 GLU GLU B . n 
B 2 92  ASP 92  105 105 ASP ASP B . n 
B 2 93  SER 93  106 106 SER SER B . n 
B 2 94  PHE 94  107 107 PHE PHE B . n 
B 2 95  GLN 95  108 108 GLN GLN B . n 
B 2 96  LYS 96  109 109 LYS LYS B . n 
B 2 97  VAL 97  110 110 VAL VAL B . n 
B 2 98  LYS 98  111 111 LYS LYS B . n 
B 2 99  ASN 99  112 112 ASN ASN B . n 
B 2 100 TRP 100 113 113 TRP TRP B . n 
B 2 101 VAL 101 114 114 VAL VAL B . n 
B 2 102 LYS 102 115 115 LYS LYS B . n 
B 2 103 GLU 103 116 116 GLU GLU B . n 
B 2 104 LEU 104 117 117 LEU LEU B . n 
B 2 105 ARG 105 118 118 ARG ARG B . n 
B 2 106 LYS 106 119 119 LYS LYS B . n 
B 2 107 MET 107 120 120 MET MET B . n 
B 2 108 LEU 108 121 121 LEU LEU B . n 
B 2 109 GLY 109 122 122 GLY GLY B . n 
B 2 110 ASN 110 123 123 ASN ASN B . n 
B 2 111 GLU 111 124 124 GLU GLU B . n 
B 2 112 ILE 112 125 125 ILE ILE B . n 
B 2 113 CYS 113 126 126 CYS CYS B . n 
B 2 114 LEU 114 127 127 LEU LEU B . n 
B 2 115 CYS 115 128 128 CYS CYS B . n 
B 2 116 ILE 116 129 129 ILE ILE B . n 
B 2 117 VAL 117 130 130 VAL VAL B . n 
B 2 118 GLY 118 131 131 GLY GLY B . n 
B 2 119 ASN 119 132 132 ASN ASN B . n 
B 2 120 LYS 120 133 133 LYS LYS B . n 
B 2 121 ILE 121 134 134 ILE ILE B . n 
B 2 122 ASP 122 135 135 ASP ASP B . n 
B 2 123 LEU 123 136 136 LEU LEU B . n 
B 2 124 GLU 124 137 137 GLU ALA B . n 
B 2 125 LYS 125 138 138 LYS ALA B . n 
B 2 126 GLU 126 139 139 GLU GLU B . n 
B 2 127 ARG 127 140 140 ARG ARG B . n 
B 2 128 HIS 128 141 141 HIS HIS B . n 
B 2 129 VAL 129 142 142 VAL VAL B . n 
B 2 130 SER 130 143 143 SER SER B . n 
B 2 131 ILE 131 144 144 ILE ILE B . n 
B 2 132 GLN 132 145 145 GLN GLN B . n 
B 2 133 GLU 133 146 146 GLU GLU B . n 
B 2 134 ALA 134 147 147 ALA ALA B . n 
B 2 135 GLU 135 148 148 GLU GLU B . n 
B 2 136 SER 136 149 149 SER SER B . n 
B 2 137 TYR 137 150 150 TYR TYR B . n 
B 2 138 ALA 138 151 151 ALA ALA B . n 
B 2 139 GLU 139 152 152 GLU ALA B . n 
B 2 140 SER 140 153 153 SER SER B . n 
B 2 141 VAL 141 154 154 VAL VAL B . n 
B 2 142 GLY 142 155 155 GLY GLY B . n 
B 2 143 ALA 143 156 156 ALA ALA B . n 
B 2 144 LYS 144 157 157 LYS LYS B . n 
B 2 145 HIS 145 158 158 HIS HIS B . n 
B 2 146 TYR 146 159 159 TYR TYR B . n 
B 2 147 HIS 147 160 160 HIS HIS B . n 
B 2 148 THR 148 161 161 THR THR B . n 
B 2 149 SER 149 162 162 SER SER B . n 
B 2 150 ALA 150 163 163 ALA ALA B . n 
B 2 151 LYS 151 164 164 LYS LYS B . n 
B 2 152 GLN 152 165 165 GLN ALA B . n 
B 2 153 ASN 153 166 166 ASN ALA B . n 
B 2 154 LYS 154 167 167 LYS LYS B . n 
B 2 155 GLY 155 168 168 GLY GLY B . n 
B 2 156 ILE 156 169 169 ILE ILE B . n 
B 2 157 GLU 157 170 170 GLU ALA B . n 
B 2 158 GLU 158 171 171 GLU GLU B . n 
B 2 159 LEU 159 172 172 LEU LEU B . n 
B 2 160 PHE 160 173 173 PHE PHE B . n 
B 2 161 LEU 161 174 174 LEU LEU B . n 
B 2 162 ASP 162 175 175 ASP ASP B . n 
B 2 163 LEU 163 176 176 LEU LEU B . n 
B 2 164 CYS 164 177 177 CYS CYS B . n 
B 2 165 LYS 165 178 178 LYS LYS B . n 
B 2 166 ARG 166 179 179 ARG ARG B . n 
B 2 167 MET 167 180 180 MET MET B . n 
B 2 168 ILE 168 181 181 ILE ILE B . n 
B 2 169 GLU 169 182 182 GLU GLU B . n 
B 2 170 THR 170 183 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   398 1   HOH HOH A . 
C 3 HOH 2   399 4   HOH HOH A . 
C 3 HOH 3   400 8   HOH HOH A . 
C 3 HOH 4   401 12  HOH HOH A . 
C 3 HOH 5   402 13  HOH HOH A . 
C 3 HOH 6   403 14  HOH HOH A . 
C 3 HOH 7   404 15  HOH HOH A . 
C 3 HOH 8   405 16  HOH HOH A . 
C 3 HOH 9   406 17  HOH HOH A . 
C 3 HOH 10  407 18  HOH HOH A . 
C 3 HOH 11  408 19  HOH HOH A . 
C 3 HOH 12  409 20  HOH HOH A . 
C 3 HOH 13  410 21  HOH HOH A . 
C 3 HOH 14  411 22  HOH HOH A . 
C 3 HOH 15  412 24  HOH HOH A . 
C 3 HOH 16  413 25  HOH HOH A . 
C 3 HOH 17  414 28  HOH HOH A . 
C 3 HOH 18  415 29  HOH HOH A . 
C 3 HOH 19  416 32  HOH HOH A . 
C 3 HOH 20  417 33  HOH HOH A . 
C 3 HOH 21  418 34  HOH HOH A . 
C 3 HOH 22  419 35  HOH HOH A . 
C 3 HOH 23  420 36  HOH HOH A . 
C 3 HOH 24  421 37  HOH HOH A . 
C 3 HOH 25  422 38  HOH HOH A . 
C 3 HOH 26  423 40  HOH HOH A . 
C 3 HOH 27  424 42  HOH HOH A . 
C 3 HOH 28  425 43  HOH HOH A . 
C 3 HOH 29  426 44  HOH HOH A . 
C 3 HOH 30  427 45  HOH HOH A . 
C 3 HOH 31  428 47  HOH HOH A . 
C 3 HOH 32  429 48  HOH HOH A . 
C 3 HOH 33  430 50  HOH HOH A . 
C 3 HOH 34  431 53  HOH HOH A . 
C 3 HOH 35  432 56  HOH HOH A . 
C 3 HOH 36  433 57  HOH HOH A . 
C 3 HOH 37  434 58  HOH HOH A . 
C 3 HOH 38  435 61  HOH HOH A . 
C 3 HOH 39  436 62  HOH HOH A . 
C 3 HOH 40  437 63  HOH HOH A . 
C 3 HOH 41  438 64  HOH HOH A . 
C 3 HOH 42  439 71  HOH HOH A . 
C 3 HOH 43  440 72  HOH HOH A . 
C 3 HOH 44  441 73  HOH HOH A . 
C 3 HOH 45  442 75  HOH HOH A . 
C 3 HOH 46  443 77  HOH HOH A . 
C 3 HOH 47  444 79  HOH HOH A . 
C 3 HOH 48  445 80  HOH HOH A . 
C 3 HOH 49  446 81  HOH HOH A . 
C 3 HOH 50  447 83  HOH HOH A . 
C 3 HOH 51  448 84  HOH HOH A . 
C 3 HOH 52  449 86  HOH HOH A . 
C 3 HOH 53  450 87  HOH HOH A . 
C 3 HOH 54  451 88  HOH HOH A . 
C 3 HOH 55  452 89  HOH HOH A . 
C 3 HOH 56  453 90  HOH HOH A . 
C 3 HOH 57  454 93  HOH HOH A . 
C 3 HOH 58  455 95  HOH HOH A . 
C 3 HOH 59  456 96  HOH HOH A . 
C 3 HOH 60  457 97  HOH HOH A . 
C 3 HOH 61  458 100 HOH HOH A . 
C 3 HOH 62  459 101 HOH HOH A . 
C 3 HOH 63  460 102 HOH HOH A . 
C 3 HOH 64  461 103 HOH HOH A . 
C 3 HOH 65  462 104 HOH HOH A . 
C 3 HOH 66  463 105 HOH HOH A . 
C 3 HOH 67  464 107 HOH HOH A . 
C 3 HOH 68  465 109 HOH HOH A . 
C 3 HOH 69  466 110 HOH HOH A . 
C 3 HOH 70  467 111 HOH HOH A . 
C 3 HOH 71  468 113 HOH HOH A . 
C 3 HOH 72  469 114 HOH HOH A . 
C 3 HOH 73  470 116 HOH HOH A . 
C 3 HOH 74  471 119 HOH HOH A . 
C 3 HOH 75  472 120 HOH HOH A . 
C 3 HOH 76  473 121 HOH HOH A . 
C 3 HOH 77  474 122 HOH HOH A . 
C 3 HOH 78  475 124 HOH HOH A . 
C 3 HOH 79  476 125 HOH HOH A . 
C 3 HOH 80  477 126 HOH HOH A . 
C 3 HOH 81  478 130 HOH HOH A . 
C 3 HOH 82  479 132 HOH HOH A . 
C 3 HOH 83  480 133 HOH HOH A . 
C 3 HOH 84  481 135 HOH HOH A . 
C 3 HOH 85  482 136 HOH HOH A . 
C 3 HOH 86  483 138 HOH HOH A . 
C 3 HOH 87  484 142 HOH HOH A . 
C 3 HOH 88  485 146 HOH HOH A . 
C 3 HOH 89  486 148 HOH HOH A . 
C 3 HOH 90  487 149 HOH HOH A . 
C 3 HOH 91  488 150 HOH HOH A . 
C 3 HOH 92  489 151 HOH HOH A . 
C 3 HOH 93  490 152 HOH HOH A . 
C 3 HOH 94  491 154 HOH HOH A . 
C 3 HOH 95  492 155 HOH HOH A . 
C 3 HOH 96  493 157 HOH HOH A . 
C 3 HOH 97  494 159 HOH HOH A . 
C 3 HOH 98  495 160 HOH HOH A . 
C 3 HOH 99  496 162 HOH HOH A . 
C 3 HOH 100 497 163 HOH HOH A . 
C 3 HOH 101 498 164 HOH HOH A . 
C 3 HOH 102 499 165 HOH HOH A . 
C 3 HOH 103 500 167 HOH HOH A . 
C 3 HOH 104 501 168 HOH HOH A . 
C 3 HOH 105 502 169 HOH HOH A . 
C 3 HOH 106 503 171 HOH HOH A . 
C 3 HOH 107 504 173 HOH HOH A . 
C 3 HOH 108 505 174 HOH HOH A . 
C 3 HOH 109 506 175 HOH HOH A . 
C 3 HOH 110 507 177 HOH HOH A . 
C 3 HOH 111 508 179 HOH HOH A . 
C 3 HOH 112 509 180 HOH HOH A . 
C 3 HOH 113 510 182 HOH HOH A . 
C 3 HOH 114 511 183 HOH HOH A . 
C 3 HOH 115 512 186 HOH HOH A . 
C 3 HOH 116 513 187 HOH HOH A . 
C 3 HOH 117 514 188 HOH HOH A . 
C 3 HOH 118 515 191 HOH HOH A . 
C 3 HOH 119 516 194 HOH HOH A . 
C 3 HOH 120 517 198 HOH HOH A . 
C 3 HOH 121 518 199 HOH HOH A . 
C 3 HOH 122 519 201 HOH HOH A . 
C 3 HOH 123 520 202 HOH HOH A . 
C 3 HOH 124 521 203 HOH HOH A . 
C 3 HOH 125 522 205 HOH HOH A . 
C 3 HOH 126 523 208 HOH HOH A . 
C 3 HOH 127 524 210 HOH HOH A . 
C 3 HOH 128 525 211 HOH HOH A . 
C 3 HOH 129 526 213 HOH HOH A . 
C 3 HOH 130 527 214 HOH HOH A . 
C 3 HOH 131 528 216 HOH HOH A . 
C 3 HOH 132 529 221 HOH HOH A . 
C 3 HOH 133 530 222 HOH HOH A . 
C 3 HOH 134 531 223 HOH HOH A . 
C 3 HOH 135 532 224 HOH HOH A . 
C 3 HOH 136 533 226 HOH HOH A . 
C 3 HOH 137 534 227 HOH HOH A . 
C 3 HOH 138 535 230 HOH HOH A . 
C 3 HOH 139 536 233 HOH HOH A . 
C 3 HOH 140 537 236 HOH HOH A . 
C 3 HOH 141 538 237 HOH HOH A . 
C 3 HOH 142 539 241 HOH HOH A . 
C 3 HOH 143 540 242 HOH HOH A . 
C 3 HOH 144 541 243 HOH HOH A . 
C 3 HOH 145 542 245 HOH HOH A . 
C 3 HOH 146 543 246 HOH HOH A . 
C 3 HOH 147 544 247 HOH HOH A . 
C 3 HOH 148 545 248 HOH HOH A . 
C 3 HOH 149 546 249 HOH HOH A . 
C 3 HOH 150 547 250 HOH HOH A . 
C 3 HOH 151 548 252 HOH HOH A . 
C 3 HOH 152 549 253 HOH HOH A . 
C 3 HOH 153 550 254 HOH HOH A . 
C 3 HOH 154 551 255 HOH HOH A . 
C 3 HOH 155 552 256 HOH HOH A . 
C 3 HOH 156 553 259 HOH HOH A . 
C 3 HOH 157 554 260 HOH HOH A . 
C 3 HOH 158 555 261 HOH HOH A . 
C 3 HOH 159 556 262 HOH HOH A . 
C 3 HOH 160 557 263 HOH HOH A . 
C 3 HOH 161 558 265 HOH HOH A . 
C 3 HOH 162 559 267 HOH HOH A . 
C 3 HOH 163 560 268 HOH HOH A . 
C 3 HOH 164 561 269 HOH HOH A . 
C 3 HOH 165 562 271 HOH HOH A . 
C 3 HOH 166 563 273 HOH HOH A . 
C 3 HOH 167 564 275 HOH HOH A . 
C 3 HOH 168 565 277 HOH HOH A . 
C 3 HOH 169 566 278 HOH HOH A . 
C 3 HOH 170 567 279 HOH HOH A . 
C 3 HOH 171 568 280 HOH HOH A . 
C 3 HOH 172 569 282 HOH HOH A . 
C 3 HOH 173 570 284 HOH HOH A . 
C 3 HOH 174 571 285 HOH HOH A . 
C 3 HOH 175 572 286 HOH HOH A . 
C 3 HOH 176 573 287 HOH HOH A . 
C 3 HOH 177 574 288 HOH HOH A . 
C 3 HOH 178 575 290 HOH HOH A . 
C 3 HOH 179 576 291 HOH HOH A . 
C 3 HOH 180 577 293 HOH HOH A . 
C 3 HOH 181 578 294 HOH HOH A . 
C 3 HOH 182 579 295 HOH HOH A . 
C 3 HOH 183 580 296 HOH HOH A . 
C 3 HOH 184 581 297 HOH HOH A . 
C 3 HOH 185 582 299 HOH HOH A . 
C 3 HOH 186 583 300 HOH HOH A . 
C 3 HOH 187 584 301 HOH HOH A . 
C 3 HOH 188 585 303 HOH HOH A . 
C 3 HOH 189 586 304 HOH HOH A . 
C 3 HOH 190 587 306 HOH HOH A . 
C 3 HOH 191 588 309 HOH HOH A . 
C 3 HOH 192 589 311 HOH HOH A . 
C 3 HOH 193 590 312 HOH HOH A . 
C 3 HOH 194 591 313 HOH HOH A . 
C 3 HOH 195 592 314 HOH HOH A . 
C 3 HOH 196 593 315 HOH HOH A . 
C 3 HOH 197 594 318 HOH HOH A . 
C 3 HOH 198 595 319 HOH HOH A . 
C 3 HOH 199 596 320 HOH HOH A . 
C 3 HOH 200 597 321 HOH HOH A . 
C 3 HOH 201 598 323 HOH HOH A . 
C 3 HOH 202 599 324 HOH HOH A . 
C 3 HOH 203 600 325 HOH HOH A . 
C 3 HOH 204 601 326 HOH HOH A . 
C 3 HOH 205 602 327 HOH HOH A . 
C 3 HOH 206 603 329 HOH HOH A . 
C 3 HOH 207 604 333 HOH HOH A . 
C 3 HOH 208 605 335 HOH HOH A . 
C 3 HOH 209 606 336 HOH HOH A . 
C 3 HOH 210 607 337 HOH HOH A . 
C 3 HOH 211 608 339 HOH HOH A . 
C 3 HOH 212 609 340 HOH HOH A . 
C 3 HOH 213 610 341 HOH HOH A . 
C 3 HOH 214 611 343 HOH HOH A . 
C 3 HOH 215 612 344 HOH HOH A . 
C 3 HOH 216 613 346 HOH HOH A . 
C 3 HOH 217 614 347 HOH HOH A . 
C 3 HOH 218 615 350 HOH HOH A . 
C 3 HOH 219 616 351 HOH HOH A . 
C 3 HOH 220 617 353 HOH HOH A . 
C 3 HOH 221 618 354 HOH HOH A . 
C 3 HOH 222 619 355 HOH HOH A . 
C 3 HOH 223 620 359 HOH HOH A . 
C 3 HOH 224 621 361 HOH HOH A . 
C 3 HOH 225 622 362 HOH HOH A . 
C 3 HOH 226 623 363 HOH HOH A . 
C 3 HOH 227 624 365 HOH HOH A . 
C 3 HOH 228 625 368 HOH HOH A . 
C 3 HOH 229 626 370 HOH HOH A . 
C 3 HOH 230 627 373 HOH HOH A . 
C 3 HOH 231 628 374 HOH HOH A . 
C 3 HOH 232 629 378 HOH HOH A . 
C 3 HOH 233 630 380 HOH HOH A . 
C 3 HOH 234 631 382 HOH HOH A . 
C 3 HOH 235 632 383 HOH HOH A . 
C 3 HOH 236 633 385 HOH HOH A . 
C 3 HOH 237 634 386 HOH HOH A . 
C 3 HOH 238 635 387 HOH HOH A . 
C 3 HOH 239 636 388 HOH HOH A . 
C 3 HOH 240 637 389 HOH HOH A . 
C 3 HOH 241 638 390 HOH HOH A . 
C 3 HOH 242 639 391 HOH HOH A . 
C 3 HOH 243 640 392 HOH HOH A . 
C 3 HOH 244 641 393 HOH HOH A . 
C 3 HOH 245 642 394 HOH HOH A . 
C 3 HOH 246 643 396 HOH HOH A . 
C 3 HOH 247 644 397 HOH HOH A . 
C 3 HOH 248 645 399 HOH HOH A . 
C 3 HOH 249 646 401 HOH HOH A . 
C 3 HOH 250 647 402 HOH HOH A . 
C 3 HOH 251 648 403 HOH HOH A . 
C 3 HOH 252 649 404 HOH HOH A . 
C 3 HOH 253 650 405 HOH HOH A . 
C 3 HOH 254 651 407 HOH HOH A . 
C 3 HOH 255 652 412 HOH HOH A . 
C 3 HOH 256 653 413 HOH HOH A . 
C 3 HOH 257 654 414 HOH HOH A . 
C 3 HOH 258 655 416 HOH HOH A . 
C 3 HOH 259 656 417 HOH HOH A . 
C 3 HOH 260 657 418 HOH HOH A . 
C 3 HOH 261 658 419 HOH HOH A . 
C 3 HOH 262 659 420 HOH HOH A . 
C 3 HOH 263 660 421 HOH HOH A . 
C 3 HOH 264 661 422 HOH HOH A . 
C 3 HOH 265 662 423 HOH HOH A . 
C 3 HOH 266 663 424 HOH HOH A . 
C 3 HOH 267 664 425 HOH HOH A . 
C 3 HOH 268 665 426 HOH HOH A . 
C 3 HOH 269 666 429 HOH HOH A . 
C 3 HOH 270 667 430 HOH HOH A . 
C 3 HOH 271 668 431 HOH HOH A . 
C 3 HOH 272 669 432 HOH HOH A . 
C 3 HOH 273 670 433 HOH HOH A . 
C 3 HOH 274 671 434 HOH HOH A . 
C 3 HOH 275 672 435 HOH HOH A . 
C 3 HOH 276 673 436 HOH HOH A . 
C 3 HOH 277 674 437 HOH HOH A . 
C 3 HOH 278 675 439 HOH HOH A . 
C 3 HOH 279 676 442 HOH HOH A . 
C 3 HOH 280 677 443 HOH HOH A . 
C 3 HOH 281 678 444 HOH HOH A . 
C 3 HOH 282 679 447 HOH HOH A . 
C 3 HOH 283 680 448 HOH HOH A . 
C 3 HOH 284 681 449 HOH HOH A . 
C 3 HOH 285 682 450 HOH HOH A . 
C 3 HOH 286 683 451 HOH HOH A . 
C 3 HOH 287 684 452 HOH HOH A . 
C 3 HOH 288 685 453 HOH HOH A . 
C 3 HOH 289 686 454 HOH HOH A . 
C 3 HOH 290 687 456 HOH HOH A . 
C 3 HOH 291 688 457 HOH HOH A . 
C 3 HOH 292 689 458 HOH HOH A . 
C 3 HOH 293 690 459 HOH HOH A . 
C 3 HOH 294 691 460 HOH HOH A . 
C 3 HOH 295 692 463 HOH HOH A . 
D 3 HOH 1   184 2   HOH HOH B . 
D 3 HOH 2   185 3   HOH HOH B . 
D 3 HOH 3   186 5   HOH HOH B . 
D 3 HOH 4   187 6   HOH HOH B . 
D 3 HOH 5   188 7   HOH HOH B . 
D 3 HOH 6   189 9   HOH HOH B . 
D 3 HOH 7   190 10  HOH HOH B . 
D 3 HOH 8   191 11  HOH HOH B . 
D 3 HOH 9   192 23  HOH HOH B . 
D 3 HOH 10  193 26  HOH HOH B . 
D 3 HOH 11  194 27  HOH HOH B . 
D 3 HOH 12  195 30  HOH HOH B . 
D 3 HOH 13  196 31  HOH HOH B . 
D 3 HOH 14  197 39  HOH HOH B . 
D 3 HOH 15  198 41  HOH HOH B . 
D 3 HOH 16  199 46  HOH HOH B . 
D 3 HOH 17  200 49  HOH HOH B . 
D 3 HOH 18  201 51  HOH HOH B . 
D 3 HOH 19  202 52  HOH HOH B . 
D 3 HOH 20  203 54  HOH HOH B . 
D 3 HOH 21  204 55  HOH HOH B . 
D 3 HOH 22  205 59  HOH HOH B . 
D 3 HOH 23  206 60  HOH HOH B . 
D 3 HOH 24  207 65  HOH HOH B . 
D 3 HOH 25  208 66  HOH HOH B . 
D 3 HOH 26  209 67  HOH HOH B . 
D 3 HOH 27  210 68  HOH HOH B . 
D 3 HOH 28  211 69  HOH HOH B . 
D 3 HOH 29  212 70  HOH HOH B . 
D 3 HOH 30  213 74  HOH HOH B . 
D 3 HOH 31  214 76  HOH HOH B . 
D 3 HOH 32  215 78  HOH HOH B . 
D 3 HOH 33  216 82  HOH HOH B . 
D 3 HOH 34  217 85  HOH HOH B . 
D 3 HOH 35  218 91  HOH HOH B . 
D 3 HOH 36  219 92  HOH HOH B . 
D 3 HOH 37  220 94  HOH HOH B . 
D 3 HOH 38  221 98  HOH HOH B . 
D 3 HOH 39  222 99  HOH HOH B . 
D 3 HOH 40  223 106 HOH HOH B . 
D 3 HOH 41  224 108 HOH HOH B . 
D 3 HOH 42  225 112 HOH HOH B . 
D 3 HOH 43  226 115 HOH HOH B . 
D 3 HOH 44  227 117 HOH HOH B . 
D 3 HOH 45  228 118 HOH HOH B . 
D 3 HOH 46  229 123 HOH HOH B . 
D 3 HOH 47  230 127 HOH HOH B . 
D 3 HOH 48  231 128 HOH HOH B . 
D 3 HOH 49  232 129 HOH HOH B . 
D 3 HOH 50  233 131 HOH HOH B . 
D 3 HOH 51  234 134 HOH HOH B . 
D 3 HOH 52  235 137 HOH HOH B . 
D 3 HOH 53  236 139 HOH HOH B . 
D 3 HOH 54  237 140 HOH HOH B . 
D 3 HOH 55  238 141 HOH HOH B . 
D 3 HOH 56  239 143 HOH HOH B . 
D 3 HOH 57  240 144 HOH HOH B . 
D 3 HOH 58  241 145 HOH HOH B . 
D 3 HOH 59  242 147 HOH HOH B . 
D 3 HOH 60  243 153 HOH HOH B . 
D 3 HOH 61  244 156 HOH HOH B . 
D 3 HOH 62  245 158 HOH HOH B . 
D 3 HOH 63  246 161 HOH HOH B . 
D 3 HOH 64  247 166 HOH HOH B . 
D 3 HOH 65  248 170 HOH HOH B . 
D 3 HOH 66  249 172 HOH HOH B . 
D 3 HOH 67  250 176 HOH HOH B . 
D 3 HOH 68  251 178 HOH HOH B . 
D 3 HOH 69  252 181 HOH HOH B . 
D 3 HOH 70  253 184 HOH HOH B . 
D 3 HOH 71  254 185 HOH HOH B . 
D 3 HOH 72  255 189 HOH HOH B . 
D 3 HOH 73  256 190 HOH HOH B . 
D 3 HOH 74  257 192 HOH HOH B . 
D 3 HOH 75  258 193 HOH HOH B . 
D 3 HOH 76  259 195 HOH HOH B . 
D 3 HOH 77  260 196 HOH HOH B . 
D 3 HOH 78  261 197 HOH HOH B . 
D 3 HOH 79  262 200 HOH HOH B . 
D 3 HOH 80  263 204 HOH HOH B . 
D 3 HOH 81  264 206 HOH HOH B . 
D 3 HOH 82  265 207 HOH HOH B . 
D 3 HOH 83  266 209 HOH HOH B . 
D 3 HOH 84  267 212 HOH HOH B . 
D 3 HOH 85  268 215 HOH HOH B . 
D 3 HOH 86  269 217 HOH HOH B . 
D 3 HOH 87  270 218 HOH HOH B . 
D 3 HOH 88  271 219 HOH HOH B . 
D 3 HOH 89  272 220 HOH HOH B . 
D 3 HOH 90  273 225 HOH HOH B . 
D 3 HOH 91  274 228 HOH HOH B . 
D 3 HOH 92  275 229 HOH HOH B . 
D 3 HOH 93  276 231 HOH HOH B . 
D 3 HOH 94  277 232 HOH HOH B . 
D 3 HOH 95  278 234 HOH HOH B . 
D 3 HOH 96  279 235 HOH HOH B . 
D 3 HOH 97  280 238 HOH HOH B . 
D 3 HOH 98  281 239 HOH HOH B . 
D 3 HOH 99  282 240 HOH HOH B . 
D 3 HOH 100 283 244 HOH HOH B . 
D 3 HOH 101 284 251 HOH HOH B . 
D 3 HOH 102 285 257 HOH HOH B . 
D 3 HOH 103 286 258 HOH HOH B . 
D 3 HOH 104 287 264 HOH HOH B . 
D 3 HOH 105 288 266 HOH HOH B . 
D 3 HOH 106 289 270 HOH HOH B . 
D 3 HOH 107 290 272 HOH HOH B . 
D 3 HOH 108 291 274 HOH HOH B . 
D 3 HOH 109 292 276 HOH HOH B . 
D 3 HOH 110 293 281 HOH HOH B . 
D 3 HOH 111 294 283 HOH HOH B . 
D 3 HOH 112 295 289 HOH HOH B . 
D 3 HOH 113 296 292 HOH HOH B . 
D 3 HOH 114 297 298 HOH HOH B . 
D 3 HOH 115 298 302 HOH HOH B . 
D 3 HOH 116 299 305 HOH HOH B . 
D 3 HOH 117 300 307 HOH HOH B . 
D 3 HOH 118 301 308 HOH HOH B . 
D 3 HOH 119 302 310 HOH HOH B . 
D 3 HOH 120 303 316 HOH HOH B . 
D 3 HOH 121 304 317 HOH HOH B . 
D 3 HOH 122 305 322 HOH HOH B . 
D 3 HOH 123 306 328 HOH HOH B . 
D 3 HOH 124 307 330 HOH HOH B . 
D 3 HOH 125 308 331 HOH HOH B . 
D 3 HOH 126 309 332 HOH HOH B . 
D 3 HOH 127 310 334 HOH HOH B . 
D 3 HOH 128 311 338 HOH HOH B . 
D 3 HOH 129 312 342 HOH HOH B . 
D 3 HOH 130 313 345 HOH HOH B . 
D 3 HOH 131 314 348 HOH HOH B . 
D 3 HOH 132 315 349 HOH HOH B . 
D 3 HOH 133 316 352 HOH HOH B . 
D 3 HOH 134 317 356 HOH HOH B . 
D 3 HOH 135 318 357 HOH HOH B . 
D 3 HOH 136 319 358 HOH HOH B . 
D 3 HOH 137 320 360 HOH HOH B . 
D 3 HOH 138 321 364 HOH HOH B . 
D 3 HOH 139 322 366 HOH HOH B . 
D 3 HOH 140 323 367 HOH HOH B . 
D 3 HOH 141 324 369 HOH HOH B . 
D 3 HOH 142 325 371 HOH HOH B . 
D 3 HOH 143 326 372 HOH HOH B . 
D 3 HOH 144 327 375 HOH HOH B . 
D 3 HOH 145 328 376 HOH HOH B . 
D 3 HOH 146 329 377 HOH HOH B . 
D 3 HOH 147 330 379 HOH HOH B . 
D 3 HOH 148 331 381 HOH HOH B . 
D 3 HOH 149 332 384 HOH HOH B . 
D 3 HOH 150 333 395 HOH HOH B . 
D 3 HOH 151 334 398 HOH HOH B . 
D 3 HOH 152 335 400 HOH HOH B . 
D 3 HOH 153 336 406 HOH HOH B . 
D 3 HOH 154 337 408 HOH HOH B . 
D 3 HOH 155 338 409 HOH HOH B . 
D 3 HOH 156 339 410 HOH HOH B . 
D 3 HOH 157 340 411 HOH HOH B . 
D 3 HOH 158 341 415 HOH HOH B . 
D 3 HOH 159 342 427 HOH HOH B . 
D 3 HOH 160 343 428 HOH HOH B . 
D 3 HOH 161 344 438 HOH HOH B . 
D 3 HOH 162 345 440 HOH HOH B . 
D 3 HOH 163 346 441 HOH HOH B . 
D 3 HOH 164 347 445 HOH HOH B . 
D 3 HOH 165 348 446 HOH HOH B . 
D 3 HOH 166 349 455 HOH HOH B . 
D 3 HOH 167 350 461 HOH HOH B . 
D 3 HOH 168 351 462 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2300  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  18910 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-04-24 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_unobs_or_zero_occ_atoms    
2 4 'Structure model' pdbx_unobs_or_zero_occ_residues 
3 4 'Structure model' reflns_shell                    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_reflns_shell.number_unique_all'    
2 4 'Structure model' '_reflns_shell.percent_possible_all' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0005 ? 1 
HKL-2000  'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
PHASER    phasing           .        ? 5 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
The protein sequence matches to isoform 2 of the UNP 
reference
;
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             HIS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              187 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             HIS 
_pdbx_validate_rmsd_angle.auth_seq_id_2              187 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             HIS 
_pdbx_validate_rmsd_angle.auth_seq_id_3              187 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                126.07 
_pdbx_validate_rmsd_angle.angle_target_value         110.40 
_pdbx_validate_rmsd_angle.angle_deviation            15.67 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.00 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 150 ? ? 56.69   -128.85 
2 1 THR A 152 ? ? -156.05 -34.35  
3 1 THR A 195 ? ? -69.79  -94.10  
4 1 LYS A 198 ? ? 42.15   73.02   
5 1 ASN A 327 ? ? 37.08   59.61   
6 1 THR A 349 ? ? -132.96 -35.51  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 140 ? CG  ? A LYS 17  CG  
2   1 Y 1 A LYS 140 ? CD  ? A LYS 17  CD  
3   1 Y 1 A LYS 140 ? CE  ? A LYS 17  CE  
4   1 Y 1 A LYS 140 ? NZ  ? A LYS 17  NZ  
5   1 Y 1 A HIS 150 ? CG  ? A HIS 27  CG  
6   1 Y 1 A HIS 150 ? ND1 ? A HIS 27  ND1 
7   1 Y 1 A HIS 150 ? CD2 ? A HIS 27  CD2 
8   1 Y 1 A HIS 150 ? CE1 ? A HIS 27  CE1 
9   1 Y 1 A HIS 150 ? NE2 ? A HIS 27  NE2 
10  1 Y 1 A LYS 151 ? CG  ? A LYS 28  CG  
11  1 Y 1 A LYS 151 ? CD  ? A LYS 28  CD  
12  1 Y 1 A LYS 151 ? CE  ? A LYS 28  CE  
13  1 Y 1 A LYS 151 ? NZ  ? A LYS 28  NZ  
14  1 Y 1 A THR 152 ? OG1 ? A THR 29  OG1 
15  1 Y 1 A THR 152 ? CG2 ? A THR 29  CG2 
16  1 Y 1 A GLU 155 ? CG  ? A GLU 32  CG  
17  1 Y 1 A GLU 155 ? CD  ? A GLU 32  CD  
18  1 Y 1 A GLU 155 ? OE1 ? A GLU 32  OE1 
19  1 Y 1 A GLU 155 ? OE2 ? A GLU 32  OE2 
20  1 Y 1 A GLN 159 ? CG  ? A GLN 36  CG  
21  1 Y 1 A GLN 159 ? CD  ? A GLN 36  CD  
22  1 Y 1 A GLN 159 ? OE1 ? A GLN 36  OE1 
23  1 Y 1 A GLN 159 ? NE2 ? A GLN 36  NE2 
24  1 Y 1 A HIS 168 ? CG  ? A HIS 45  CG  
25  1 Y 1 A HIS 168 ? ND1 ? A HIS 45  ND1 
26  1 Y 1 A HIS 168 ? CD2 ? A HIS 45  CD2 
27  1 Y 1 A HIS 168 ? CE1 ? A HIS 45  CE1 
28  1 Y 1 A HIS 168 ? NE2 ? A HIS 45  NE2 
29  1 Y 1 A TYR 169 ? CG  ? A TYR 46  CG  
30  1 Y 1 A TYR 169 ? CD1 ? A TYR 46  CD1 
31  1 Y 1 A TYR 169 ? CD2 ? A TYR 46  CD2 
32  1 Y 1 A TYR 169 ? CE1 ? A TYR 46  CE1 
33  1 Y 1 A TYR 169 ? CE2 ? A TYR 46  CE2 
34  1 Y 1 A TYR 169 ? CZ  ? A TYR 46  CZ  
35  1 Y 1 A TYR 169 ? OH  ? A TYR 46  OH  
36  1 Y 1 A ARG 171 ? CG  ? A ARG 48  CG  
37  1 Y 1 A ARG 171 ? CD  ? A ARG 48  CD  
38  1 Y 1 A ARG 171 ? NE  ? A ARG 48  NE  
39  1 Y 1 A ARG 171 ? CZ  ? A ARG 48  CZ  
40  1 Y 1 A ARG 171 ? NH1 ? A ARG 48  NH1 
41  1 Y 1 A ARG 171 ? NH2 ? A ARG 48  NH2 
42  1 Y 1 A ASP 172 ? CG  ? A ASP 49  CG  
43  1 Y 1 A ASP 172 ? OD1 ? A ASP 49  OD1 
44  1 Y 1 A ASP 172 ? OD2 ? A ASP 49  OD2 
45  1 Y 1 A GLU 176 ? CG  ? A GLU 53  CG  
46  1 Y 1 A GLU 176 ? CD  ? A GLU 53  CD  
47  1 Y 1 A GLU 176 ? OE1 ? A GLU 53  OE1 
48  1 Y 1 A GLU 176 ? OE2 ? A GLU 53  OE2 
49  1 Y 1 A GLU 177 ? CG  ? A GLU 54  CG  
50  1 Y 1 A GLU 177 ? CD  ? A GLU 54  CD  
51  1 Y 1 A GLU 177 ? OE1 ? A GLU 54  OE1 
52  1 Y 1 A GLU 177 ? OE2 ? A GLU 54  OE2 
53  1 Y 1 A HIS 187 ? CG  ? A HIS 64  CG  
54  1 Y 1 A HIS 187 ? ND1 ? A HIS 64  ND1 
55  1 Y 1 A HIS 187 ? CD2 ? A HIS 64  CD2 
56  1 Y 1 A HIS 187 ? CE1 ? A HIS 64  CE1 
57  1 Y 1 A HIS 187 ? NE2 ? A HIS 64  NE2 
58  1 Y 1 A GLU 191 ? CG  ? A GLU 68  CG  
59  1 Y 1 A GLU 191 ? CD  ? A GLU 68  CD  
60  1 Y 1 A GLU 191 ? OE1 ? A GLU 68  OE1 
61  1 Y 1 A GLU 191 ? OE2 ? A GLU 68  OE2 
62  1 Y 1 A ARG 192 ? CG  ? A ARG 69  CG  
63  1 Y 1 A ARG 192 ? CD  ? A ARG 69  CD  
64  1 Y 1 A ARG 192 ? NE  ? A ARG 69  NE  
65  1 Y 1 A ARG 192 ? CZ  ? A ARG 69  CZ  
66  1 Y 1 A ARG 192 ? NH1 ? A ARG 69  NH1 
67  1 Y 1 A ARG 192 ? NH2 ? A ARG 69  NH2 
68  1 Y 1 A ARG 196 ? CG  ? A ARG 73  CG  
69  1 Y 1 A ARG 196 ? CD  ? A ARG 73  CD  
70  1 Y 1 A ARG 196 ? NE  ? A ARG 73  NE  
71  1 Y 1 A ARG 196 ? CZ  ? A ARG 73  CZ  
72  1 Y 1 A ARG 196 ? NH1 ? A ARG 73  NH1 
73  1 Y 1 A ARG 196 ? NH2 ? A ARG 73  NH2 
74  1 Y 1 A GLU 202 ? CG  ? A GLU 79  CG  
75  1 Y 1 A GLU 202 ? CD  ? A GLU 79  CD  
76  1 Y 1 A GLU 202 ? OE1 ? A GLU 79  OE1 
77  1 Y 1 A GLU 202 ? OE2 ? A GLU 79  OE2 
78  1 Y 1 A GLU 205 ? CG  ? A GLU 82  CG  
79  1 Y 1 A GLU 205 ? CD  ? A GLU 82  CD  
80  1 Y 1 A GLU 205 ? OE1 ? A GLU 82  OE1 
81  1 Y 1 A GLU 205 ? OE2 ? A GLU 82  OE2 
82  1 Y 1 A LYS 206 ? CG  ? A LYS 83  CG  
83  1 Y 1 A LYS 206 ? CD  ? A LYS 83  CD  
84  1 Y 1 A LYS 206 ? CE  ? A LYS 83  CE  
85  1 Y 1 A LYS 206 ? NZ  ? A LYS 83  NZ  
86  1 Y 1 A LYS 221 ? CG  ? A LYS 98  CG  
87  1 Y 1 A LYS 221 ? CD  ? A LYS 98  CD  
88  1 Y 1 A LYS 221 ? CE  ? A LYS 98  CE  
89  1 Y 1 A LYS 221 ? NZ  ? A LYS 98  NZ  
90  1 Y 1 A LYS 240 ? CG  ? A LYS 117 CG  
91  1 Y 1 A LYS 240 ? CD  ? A LYS 117 CD  
92  1 Y 1 A LYS 240 ? CE  ? A LYS 117 CE  
93  1 Y 1 A LYS 240 ? NZ  ? A LYS 117 NZ  
94  1 Y 1 A GLU 277 ? CG  ? A GLU 154 CG  
95  1 Y 1 A GLU 277 ? CD  ? A GLU 154 CD  
96  1 Y 1 A GLU 277 ? OE1 ? A GLU 154 OE1 
97  1 Y 1 A GLU 277 ? OE2 ? A GLU 154 OE2 
98  1 Y 1 B THR 50  ? OG1 ? B THR 37  OG1 
99  1 Y 1 B THR 50  ? CG2 ? B THR 37  CG2 
100 1 Y 1 B LYS 60  ? CG  ? B LYS 47  CG  
101 1 Y 1 B LYS 60  ? CD  ? B LYS 47  CD  
102 1 Y 1 B LYS 60  ? CE  ? B LYS 47  CE  
103 1 Y 1 B LYS 60  ? NZ  ? B LYS 47  NZ  
104 1 Y 1 B LYS 66  ? CG  ? B LYS 53  CG  
105 1 Y 1 B LYS 66  ? CD  ? B LYS 53  CD  
106 1 Y 1 B LYS 66  ? CE  ? B LYS 53  CE  
107 1 Y 1 B LYS 66  ? NZ  ? B LYS 53  NZ  
108 1 Y 1 B ARG 67  ? CG  ? B ARG 54  CG  
109 1 Y 1 B ARG 67  ? CD  ? B ARG 54  CD  
110 1 Y 1 B ARG 67  ? NE  ? B ARG 54  NE  
111 1 Y 1 B ARG 67  ? CZ  ? B ARG 54  CZ  
112 1 Y 1 B ARG 67  ? NH1 ? B ARG 54  NH1 
113 1 Y 1 B ARG 67  ? NH2 ? B ARG 54  NH2 
114 1 Y 1 B GLU 137 ? CG  ? B GLU 124 CG  
115 1 Y 1 B GLU 137 ? CD  ? B GLU 124 CD  
116 1 Y 1 B GLU 137 ? OE1 ? B GLU 124 OE1 
117 1 Y 1 B GLU 137 ? OE2 ? B GLU 124 OE2 
118 1 Y 1 B LYS 138 ? CG  ? B LYS 125 CG  
119 1 Y 1 B LYS 138 ? CD  ? B LYS 125 CD  
120 1 Y 1 B LYS 138 ? CE  ? B LYS 125 CE  
121 1 Y 1 B LYS 138 ? NZ  ? B LYS 125 NZ  
122 1 Y 1 B GLU 152 ? CG  ? B GLU 139 CG  
123 1 Y 1 B GLU 152 ? CD  ? B GLU 139 CD  
124 1 Y 1 B GLU 152 ? OE1 ? B GLU 139 OE1 
125 1 Y 1 B GLU 152 ? OE2 ? B GLU 139 OE2 
126 1 Y 1 B GLN 165 ? CG  ? B GLN 152 CG  
127 1 Y 1 B GLN 165 ? CD  ? B GLN 152 CD  
128 1 Y 1 B GLN 165 ? OE1 ? B GLN 152 OE1 
129 1 Y 1 B GLN 165 ? NE2 ? B GLN 152 NE2 
130 1 Y 1 B ASN 166 ? CG  ? B ASN 153 CG  
131 1 Y 1 B ASN 166 ? OD1 ? B ASN 153 OD1 
132 1 Y 1 B ASN 166 ? ND2 ? B ASN 153 ND2 
133 1 Y 1 B GLU 170 ? CG  ? B GLU 157 CG  
134 1 Y 1 B GLU 170 ? CD  ? B GLU 157 CD  
135 1 Y 1 B GLU 170 ? OE1 ? B GLU 157 OE1 
136 1 Y 1 B GLU 170 ? OE2 ? B GLU 157 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 124 ? A GLY 1   
2  1 Y 1 A SER 125 ? A SER 2   
3  1 Y 1 A HIS 126 ? A HIS 3   
4  1 Y 1 A HIS 127 ? A HIS 4   
5  1 Y 1 A HIS 128 ? A HIS 5   
6  1 Y 1 A HIS 129 ? A HIS 6   
7  1 Y 1 A HIS 130 ? A HIS 7   
8  1 Y 1 A HIS 131 ? A HIS 8   
9  1 Y 1 A SER 132 ? A SER 9   
10 1 Y 1 A ILE 133 ? A ILE 10  
11 1 Y 1 A GLU 134 ? A GLU 11  
12 1 Y 1 A THR 135 ? A THR 12  
13 1 Y 1 A ASP 136 ? A ASP 13  
14 1 Y 1 A ARG 137 ? A ARG 14  
15 1 Y 1 A VAL 138 ? A VAL 15  
16 1 Y 1 A ARG 392 ? A ARG 269 
17 1 Y 1 A LYS 393 ? A LYS 270 
18 1 Y 1 A GLN 394 ? A GLN 271 
19 1 Y 1 A GLU 395 ? A GLU 272 
20 1 Y 1 A ALA 396 ? A ALA 273 
21 1 Y 1 A GLU 397 ? A GLU 274 
22 1 Y 1 B GLY 14  ? B GLY 1   
23 1 Y 1 B SER 15  ? B SER 2   
24 1 Y 1 B ARG 16  ? B ARG 3   
25 1 Y 1 B GLU 41  ? B GLU 28  
26 1 Y 1 B ASN 42  ? B ASN 29  
27 1 Y 1 B LYS 43  ? B LYS 30  
28 1 Y 1 B PHE 44  ? B PHE 31  
29 1 Y 1 B ASN 45  ? B ASN 32  
30 1 Y 1 B ASP 46  ? B ASP 33  
31 1 Y 1 B LYS 47  ? B LYS 34  
32 1 Y 1 B HIS 48  ? B HIS 35  
33 1 Y 1 B ILE 49  ? B ILE 36  
34 1 Y 1 B THR 183 ? B THR 170 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#