data_2OWI
# 
_entry.id   2OWI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OWI         
RCSB  RCSB041671   
WWPDB D_1000041671 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2012-08-15 
_pdbx_database_PDB_obs_spr.pdb_id           2OWI 
_pdbx_database_PDB_obs_spr.replace_pdb_id   2H33 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB  2JM5 'Structure calculated from the same restraints, but using a different refinement protocol' unspecified 
BMRB 7106 'chemical shifts'                                                                          unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2OWI 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Higman, V.A.'                         1  
'Leidert, M.'                          2  
'Bray, J.'                             3  
'Elkins, J.'                           4  
'Soundararajan, M.'                    5  
'Doyle, D.A.'                          6  
'Gileadi, C.'                          7  
'Phillips, C.'                         8  
'Schoch, G.'                           9  
'Yang, X.'                             10 
'Brockmann, C.'                        11 
'Schmieder, P.'                        12 
'Diehl, A.'                            13 
'Sundstrom, M.'                        14 
'Arrowsmith, C.'                       15 
'Weigelt, J.'                          16 
'Edwards, A.'                          17 
'Oschkinat, H.'                        18 
'Ball, L.J.'                           19 
'Structural Genomics Consortium (SGC)' 20 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
Proc.Natl.Acad.Sci.Usa 105          6457 6462 2008 PNASA6 US 0027-8424 0040 ? 18434541 10.1073/pnas.0801508105 
1       'NMR Assignment of Human Rgs18'                                                                            J.BIOMOL.NMR 
'36 Suppl 5' 72   72   2006 JBNME9 NE 0925-2738 0800 ? ?        ?                       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Soundararajan, M.' 1  
primary 'Willard, F.S.'     2  
primary 'Kimple, A.J.'      3  
primary 'Turnbull, A.P.'    4  
primary 'Ball, L.J.'        5  
primary 'Schoch, G.A.'      6  
primary 'Gileadi, C.'       7  
primary 'Fedorov, O.Y.'     8  
primary 'Dowler, E.F.'      9  
primary 'Higman, V.A.'      10 
primary 'Hutsell, S.Q.'     11 
primary 'Sundstrom, M.'     12 
primary 'Doyle, D.A.'       13 
primary 'Siderovski, D.P.'  14 
1       'Higman, V.A.'      15 
1       'Leidert, M.'       16 
1       'Diehl, A.'         17 
1       'Elkins, J.'        18 
1       'Soundararajan, M.' 19 
1       'Oschkinat, H.'     20 
1       'Ball, L.J.'        21 
# 
_cell.entry_id           2OWI 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2OWI 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Regulator of G-protein signaling 18' 
_entity.formula_weight             17786.023 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RGS DOMAIN, RESIDUES 75-223' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        RGS18 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVN
LDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVN
LDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   VAL n 
1 4   SER n 
1 5   PRO n 
1 6   GLU n 
1 7   GLU n 
1 8   ALA n 
1 9   VAL n 
1 10  LYS n 
1 11  TRP n 
1 12  GLY n 
1 13  GLU n 
1 14  SER n 
1 15  PHE n 
1 16  ASP n 
1 17  LYS n 
1 18  LEU n 
1 19  LEU n 
1 20  SER n 
1 21  HIS n 
1 22  ARG n 
1 23  ASP n 
1 24  GLY n 
1 25  LEU n 
1 26  GLU n 
1 27  ALA n 
1 28  PHE n 
1 29  THR n 
1 30  ARG n 
1 31  PHE n 
1 32  LEU n 
1 33  LYS n 
1 34  THR n 
1 35  GLU n 
1 36  PHE n 
1 37  SER n 
1 38  GLU n 
1 39  GLU n 
1 40  ASN n 
1 41  ILE n 
1 42  GLU n 
1 43  PHE n 
1 44  TRP n 
1 45  ILE n 
1 46  ALA n 
1 47  CYS n 
1 48  GLU n 
1 49  ASP n 
1 50  PHE n 
1 51  LYS n 
1 52  LYS n 
1 53  SER n 
1 54  LYS n 
1 55  GLY n 
1 56  PRO n 
1 57  GLN n 
1 58  GLN n 
1 59  ILE n 
1 60  HIS n 
1 61  LEU n 
1 62  LYS n 
1 63  ALA n 
1 64  LYS n 
1 65  ALA n 
1 66  ILE n 
1 67  TYR n 
1 68  GLU n 
1 69  LYS n 
1 70  PHE n 
1 71  ILE n 
1 72  GLN n 
1 73  THR n 
1 74  ASP n 
1 75  ALA n 
1 76  PRO n 
1 77  LYS n 
1 78  GLU n 
1 79  VAL n 
1 80  ASN n 
1 81  LEU n 
1 82  ASP n 
1 83  PHE n 
1 84  HIS n 
1 85  THR n 
1 86  LYS n 
1 87  GLU n 
1 88  VAL n 
1 89  ILE n 
1 90  THR n 
1 91  ASN n 
1 92  SER n 
1 93  ILE n 
1 94  THR n 
1 95  GLN n 
1 96  PRO n 
1 97  THR n 
1 98  LEU n 
1 99  HIS n 
1 100 SER n 
1 101 PHE n 
1 102 ASP n 
1 103 ALA n 
1 104 ALA n 
1 105 GLN n 
1 106 SER n 
1 107 ARG n 
1 108 VAL n 
1 109 TYR n 
1 110 GLN n 
1 111 LEU n 
1 112 MET n 
1 113 GLU n 
1 114 GLN n 
1 115 ASP n 
1 116 SER n 
1 117 TYR n 
1 118 THR n 
1 119 ARG n 
1 120 PHE n 
1 121 LEU n 
1 122 LYS n 
1 123 SER n 
1 124 ASP n 
1 125 ILE n 
1 126 TYR n 
1 127 LEU n 
1 128 ASP n 
1 129 LEU n 
1 130 MET n 
1 131 GLU n 
1 132 GLY n 
1 133 ARG n 
1 134 PRO n 
1 135 GLN n 
1 136 ARG n 
1 137 PRO n 
1 138 THR n 
1 139 ASN n 
1 140 LEU n 
1 141 ARG n 
1 142 ARG n 
1 143 ARG n 
1 144 SER n 
1 145 ARG n 
1 146 SER n 
1 147 PHE n 
1 148 THR n 
1 149 CYS n 
1 150 ASN n 
1 151 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'RGS18, RGS13' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) - ROSETTA' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'BL21 (DE3) STRAIN ENRICHED WITH GENES THAT ENCODE RARE TRNAS' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RGS18_HUMAN 
_struct_ref.pdbx_db_accession          Q9NS28 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLD
FHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNE
;
_struct_ref.pdbx_align_begin           75 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2OWI 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 151 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9NS28 
_struct_ref_seq.db_align_beg                  75 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  223 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       151 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2OWI SER A 1 ? UNP Q9NS28 ? ? 'CLONING ARTIFACT' 1 1 
1 2OWI MET A 2 ? UNP Q9NS28 ? ? 'CLONING ARTIFACT' 2 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1  1 '2D 1H-15N HSQC'       2 
2  1 '3D HNCO'              2 
3  1 '3D CBCA(CO)NNH'       2 
4  1 '3D CBCACONNH'         2 
5  1 '3D HN(CA)CO'          2 
6  1 '3D H(CCO)NNH'         2 
7  1 '3D HBHA(CO)NNH'       2 
8  1 '3D HCCH-TOCSY'        2 
9  1 '3D HCCH-COSY'         2 
10 1 '3D 1H-15N NOESY HSQC' 1 
11 1 '3D 1H-13C NOESY HSQC' 2 
12 1 '3D 1H-13C HMQC NOESY' 3 
13 1 '2D 1H-13C HSQC'       3 
14 1 '2D TOCSY'             3 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         297 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1 MM [U-95% 15N] RGS18, 20 MM SODIUM PHOSPHATE, 50 MM SODIUM CHLORIDE, 10 % D2O, 1 MM [U- 99% 2H] DTT, 0.02 % SODIUM AZIDE' 
'90% H2O/10% D2O' 
2 
;1 MM [U-95% 13C, U-95% 15N] RGS18, 20 MM POTASSIUM PHOSPHATE, 50 MM SODIUM CHLORIDE, 10 % D2O, 1 MM [U- 99% 2H] DTT, 0.02 % SODIUM AZIDE
;
'90% H2O/10% D2O' 
3 
;1 MM [U-95% 13C, U-95% 15N] RGS18, 20 MM POTASSIUM PHOSPHATE, 50 MM SODIUM CHLORIDE, 100 % D2O, 1 MM [U- 99% 2H] DTT, 0.02 % SODIUM AZIDE
;
'100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DRX Bruker 600 ? 
2 DMX Bruker 750 ? 
# 
_pdbx_nmr_refine.entry_id           2OWI 
_pdbx_nmr_refine.method             'SIMULATED ANNEALING, MOLECULAR DYNAMICS' 
_pdbx_nmr_refine.details            
;NOE ASSIGNMENT WITH CYANA, REFINEMENT BY SIMULATED ANNEALING IN XPLOR-NIH USING NOE RESTRAINTS AND H-BOND RESTRAINTS FROM H/D EXCHANGE DATA. WATER REFINEMENT IN CNS. THE C-TERMINAL TAIL HAS BEEN TRUNCATED PAST RESIDUE 134 BECAUSE OF FLEXIBILITY AND LACK OF STRUCTURE IN THIS REGION. THIS IS INDICATED (A) BY A LACK OF NOE RESTRAINTS PAST RESIDUE 132 AND (B) BY 15N T1, T2 AND HETERONCULEAR NOE EXPERIMENTS RESIDUE 131 ONWARDS.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2OWI 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2OWI 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CNS                         1.1      ? 1 
'structure solution' 'XWINNMR 2.6 AND'           3.1      ? 2 
'structure solution' 'CCPNMR_ ANALYSIS 1.0.9-10' 1.0.9-10 ? 3 
'structure solution' CYANA                       2.0      ? 4 
'structure solution' X-PLOR_NIH                  2.14     ? 5 
# 
_exptl.entry_id          2OWI 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2OWI 
_struct.title                     'Solution structure of the RGS domain from human RGS18' 
_struct.pdbx_descriptor           'Solution structure of the RGS domain from human RGS18' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OWI 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'SIGNALING PROTEIN, STRUCTURAL GENOMICS, STRUCTURAL GENOMICS CONSORTIUM, SGC' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 4   ? GLY A 12  ? SER A 4   GLY A 12  1 ? 9  
HELX_P HELX_P2 2 SER A 14  ? HIS A 21  ? SER A 14  HIS A 21  1 ? 8  
HELX_P HELX_P3 3 HIS A 21  ? THR A 34  ? HIS A 21  THR A 34  1 ? 14 
HELX_P HELX_P4 4 SER A 37  ? LYS A 52  ? SER A 37  LYS A 52  1 ? 16 
HELX_P HELX_P5 5 GLY A 55  ? PHE A 70  ? GLY A 55  PHE A 70  1 ? 16 
HELX_P HELX_P6 6 ASP A 82  ? ILE A 93  ? ASP A 82  ILE A 93  1 ? 12 
HELX_P HELX_P7 7 PHE A 101 ? SER A 123 ? PHE A 101 SER A 123 1 ? 23 
HELX_P HELX_P8 8 SER A 123 ? GLU A 131 ? SER A 123 GLU A 131 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2OWI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2OWI 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1   ? -16.804 -5.513  -10.205 1.00 0.00 ? 1   SER A N    1  
ATOM 2     C CA   . SER A 1 1   ? -16.816 -6.972  -10.430 1.00 0.00 ? 1   SER A CA   1  
ATOM 3     C C    . SER A 1 1   ? -17.808 -7.648  -9.477  1.00 0.00 ? 1   SER A C    1  
ATOM 4     O O    . SER A 1 1   ? -18.338 -7.004  -8.570  1.00 0.00 ? 1   SER A O    1  
ATOM 5     C CB   . SER A 1 1   ? -15.397 -7.522  -10.255 1.00 0.00 ? 1   SER A CB   1  
ATOM 6     O OG   . SER A 1 1   ? -14.498 -6.887  -11.159 1.00 0.00 ? 1   SER A OG   1  
ATOM 7     H H1   . SER A 1 1   ? -16.538 -5.307  -9.222  1.00 0.00 ? 1   SER A H1   1  
ATOM 8     H H2   . SER A 1 1   ? -17.744 -5.115  -10.384 1.00 0.00 ? 1   SER A H2   1  
ATOM 9     H H3   . SER A 1 1   ? -16.117 -5.058  -10.840 1.00 0.00 ? 1   SER A H3   1  
ATOM 10    H HA   . SER A 1 1   ? -17.140 -7.149  -11.445 1.00 0.00 ? 1   SER A HA   1  
ATOM 11    H HB2  . SER A 1 1   ? -15.061 -7.340  -9.243  1.00 0.00 ? 1   SER A HB2  1  
ATOM 12    H HB3  . SER A 1 1   ? -15.395 -8.584  -10.450 1.00 0.00 ? 1   SER A HB3  1  
ATOM 13    H HG   . SER A 1 1   ? -13.590 -7.131  -10.936 1.00 0.00 ? 1   SER A HG   1  
ATOM 14    N N    . MET A 1 2   ? -18.063 -8.939  -9.698  1.00 0.00 ? 2   MET A N    1  
ATOM 15    C CA   . MET A 1 2   ? -19.075 -9.679  -8.939  1.00 0.00 ? 2   MET A CA   1  
ATOM 16    C C    . MET A 1 2   ? -18.712 -9.792  -7.457  1.00 0.00 ? 2   MET A C    1  
ATOM 17    O O    . MET A 1 2   ? -17.826 -10.560 -7.080  1.00 0.00 ? 2   MET A O    1  
ATOM 18    C CB   . MET A 1 2   ? -19.266 -11.085 -9.533  1.00 0.00 ? 2   MET A CB   1  
ATOM 19    C CG   . MET A 1 2   ? -20.275 -11.944 -8.775  1.00 0.00 ? 2   MET A CG   1  
ATOM 20    S SD   . MET A 1 2   ? -20.459 -13.597 -9.477  1.00 0.00 ? 2   MET A SD   1  
ATOM 21    C CE   . MET A 1 2   ? -18.794 -14.239 -9.302  1.00 0.00 ? 2   MET A CE   1  
ATOM 22    H H    . MET A 1 2   ? -17.554 -9.410  -10.391 1.00 0.00 ? 2   MET A H    1  
ATOM 23    H HA   . MET A 1 2   ? -20.008 -9.140  -9.027  1.00 0.00 ? 2   MET A HA   1  
ATOM 24    H HB2  . MET A 1 2   ? -19.605 -10.987 -10.556 1.00 0.00 ? 2   MET A HB2  1  
ATOM 25    H HB3  . MET A 1 2   ? -18.314 -11.597 -9.530  1.00 0.00 ? 2   MET A HB3  1  
ATOM 26    H HG2  . MET A 1 2   ? -19.950 -12.041 -7.749  1.00 0.00 ? 2   MET A HG2  1  
ATOM 27    H HG3  . MET A 1 2   ? -21.236 -11.450 -8.798  1.00 0.00 ? 2   MET A HG3  1  
ATOM 28    H HE1  . MET A 1 2   ? -18.514 -14.233 -8.259  1.00 0.00 ? 2   MET A HE1  1  
ATOM 29    H HE2  . MET A 1 2   ? -18.109 -13.624 -9.865  1.00 0.00 ? 2   MET A HE2  1  
ATOM 30    H HE3  . MET A 1 2   ? -18.759 -15.252 -9.678  1.00 0.00 ? 2   MET A HE3  1  
ATOM 31    N N    . VAL A 1 3   ? -19.409 -9.024  -6.626  1.00 0.00 ? 3   VAL A N    1  
ATOM 32    C CA   . VAL A 1 3   ? -19.249 -9.093  -5.177  1.00 0.00 ? 3   VAL A CA   1  
ATOM 33    C C    . VAL A 1 3   ? -20.613 -9.046  -4.491  1.00 0.00 ? 3   VAL A C    1  
ATOM 34    O O    . VAL A 1 3   ? -21.507 -8.308  -4.912  1.00 0.00 ? 3   VAL A O    1  
ATOM 35    C CB   . VAL A 1 3   ? -18.353 -7.944  -4.641  1.00 0.00 ? 3   VAL A CB   1  
ATOM 36    C CG1  . VAL A 1 3   ? -18.829 -6.588  -5.162  1.00 0.00 ? 3   VAL A CG1  1  
ATOM 37    C CG2  . VAL A 1 3   ? -18.317 -7.956  -3.111  1.00 0.00 ? 3   VAL A CG2  1  
ATOM 38    H H    . VAL A 1 3   ? -20.050 -8.383  -6.998  1.00 0.00 ? 3   VAL A H    1  
ATOM 39    H HA   . VAL A 1 3   ? -18.770 -10.035 -4.937  1.00 0.00 ? 3   VAL A HA   1  
ATOM 40    H HB   . VAL A 1 3   ? -17.344 -8.106  -4.999  1.00 0.00 ? 3   VAL A HB   1  
ATOM 41    H HG11 . VAL A 1 3   ? -18.812 -6.592  -6.242  1.00 0.00 ? 3   VAL A HG11 1  
ATOM 42    H HG12 . VAL A 1 3   ? -18.175 -5.810  -4.796  1.00 0.00 ? 3   VAL A HG12 1  
ATOM 43    H HG13 . VAL A 1 3   ? -19.837 -6.401  -4.820  1.00 0.00 ? 3   VAL A HG13 1  
ATOM 44    H HG21 . VAL A 1 3   ? -19.318 -7.829  -2.723  1.00 0.00 ? 3   VAL A HG21 1  
ATOM 45    H HG22 . VAL A 1 3   ? -17.692 -7.149  -2.755  1.00 0.00 ? 3   VAL A HG22 1  
ATOM 46    H HG23 . VAL A 1 3   ? -17.916 -8.898  -2.766  1.00 0.00 ? 3   VAL A HG23 1  
ATOM 47    N N    . SER A 1 4   ? -20.771 -9.857  -3.452  1.00 0.00 ? 4   SER A N    1  
ATOM 48    C CA   . SER A 1 4   ? -22.000 -9.895  -2.671  1.00 0.00 ? 4   SER A CA   1  
ATOM 49    C C    . SER A 1 4   ? -21.861 -9.006  -1.428  1.00 0.00 ? 4   SER A C    1  
ATOM 50    O O    . SER A 1 4   ? -20.753 -8.838  -0.911  1.00 0.00 ? 4   SER A O    1  
ATOM 51    C CB   . SER A 1 4   ? -22.302 -11.345 -2.273  1.00 0.00 ? 4   SER A CB   1  
ATOM 52    O OG   . SER A 1 4   ? -22.313 -12.185 -3.420  1.00 0.00 ? 4   SER A OG   1  
ATOM 53    H H    . SER A 1 4   ? -20.031 -10.452 -3.198  1.00 0.00 ? 4   SER A H    1  
ATOM 54    H HA   . SER A 1 4   ? -22.805 -9.519  -3.286  1.00 0.00 ? 4   SER A HA   1  
ATOM 55    H HB2  . SER A 1 4   ? -21.543 -11.700 -1.591  1.00 0.00 ? 4   SER A HB2  1  
ATOM 56    H HB3  . SER A 1 4   ? -23.270 -11.395 -1.796  1.00 0.00 ? 4   SER A HB3  1  
ATOM 57    H HG   . SER A 1 4   ? -22.191 -11.641 -4.213  1.00 0.00 ? 4   SER A HG   1  
ATOM 58    N N    . PRO A 1 5   ? -22.974 -8.417  -0.937  1.00 0.00 ? 5   PRO A N    1  
ATOM 59    C CA   . PRO A 1 5   ? -22.957 -7.531  0.238   1.00 0.00 ? 5   PRO A CA   1  
ATOM 60    C C    . PRO A 1 5   ? -22.239 -8.163  1.434   1.00 0.00 ? 5   PRO A C    1  
ATOM 61    O O    . PRO A 1 5   ? -21.556 -7.472  2.194   1.00 0.00 ? 5   PRO A O    1  
ATOM 62    C CB   . PRO A 1 5   ? -24.449 -7.287  0.548   1.00 0.00 ? 5   PRO A CB   1  
ATOM 63    C CG   . PRO A 1 5   ? -25.202 -8.273  -0.290  1.00 0.00 ? 5   PRO A CG   1  
ATOM 64    C CD   . PRO A 1 5   ? -24.334 -8.556  -1.484  1.00 0.00 ? 5   PRO A CD   1  
ATOM 65    H HA   . PRO A 1 5   ? -22.481 -6.587  0.003   1.00 0.00 ? 5   PRO A HA   1  
ATOM 66    H HB2  . PRO A 1 5   ? -24.636 -7.443  1.603   1.00 0.00 ? 5   PRO A HB2  1  
ATOM 67    H HB3  . PRO A 1 5   ? -24.711 -6.271  0.286   1.00 0.00 ? 5   PRO A HB3  1  
ATOM 68    H HG2  . PRO A 1 5   ? -25.370 -9.181  0.273   1.00 0.00 ? 5   PRO A HG2  1  
ATOM 69    H HG3  . PRO A 1 5   ? -26.145 -7.847  -0.604  1.00 0.00 ? 5   PRO A HG3  1  
ATOM 70    H HD2  . PRO A 1 5   ? -24.506 -9.558  -1.851  1.00 0.00 ? 5   PRO A HD2  1  
ATOM 71    H HD3  . PRO A 1 5   ? -24.511 -7.830  -2.265  1.00 0.00 ? 5   PRO A HD3  1  
ATOM 72    N N    . GLU A 1 6   ? -22.387 -9.479  1.584   1.00 0.00 ? 6   GLU A N    1  
ATOM 73    C CA   . GLU A 1 6   ? -21.699 -10.222 2.641   1.00 0.00 ? 6   GLU A CA   1  
ATOM 74    C C    . GLU A 1 6   ? -20.185 -10.076 2.496   1.00 0.00 ? 6   GLU A C    1  
ATOM 75    O O    . GLU A 1 6   ? -19.488 -9.712  3.444   1.00 0.00 ? 6   GLU A O    1  
ATOM 76    C CB   . GLU A 1 6   ? -22.085 -11.701 2.584   1.00 0.00 ? 6   GLU A CB   1  
ATOM 77    C CG   . GLU A 1 6   ? -21.363 -12.573 3.605   1.00 0.00 ? 6   GLU A CG   1  
ATOM 78    C CD   . GLU A 1 6   ? -21.640 -14.048 3.395   1.00 0.00 ? 6   GLU A CD   1  
ATOM 79    O OE1  . GLU A 1 6   ? -20.913 -14.689 2.607   1.00 0.00 ? 6   GLU A OE1  1  
ATOM 80    O OE2  . GLU A 1 6   ? -22.598 -14.573 4.000   1.00 0.00 ? 6   GLU A OE2  1  
ATOM 81    H H    . GLU A 1 6   ? -22.977 -9.965  0.967   1.00 0.00 ? 6   GLU A H    1  
ATOM 82    H HA   . GLU A 1 6   ? -22.005 -9.811  3.594   1.00 0.00 ? 6   GLU A HA   1  
ATOM 83    H HB2  . GLU A 1 6   ? -23.149 -11.790 2.759   1.00 0.00 ? 6   GLU A HB2  1  
ATOM 84    H HB3  . GLU A 1 6   ? -21.863 -12.081 1.597   1.00 0.00 ? 6   GLU A HB3  1  
ATOM 85    H HG2  . GLU A 1 6   ? -20.297 -12.403 3.518   1.00 0.00 ? 6   GLU A HG2  1  
ATOM 86    H HG3  . GLU A 1 6   ? -21.689 -12.293 4.598   1.00 0.00 ? 6   GLU A HG3  1  
ATOM 87    N N    . GLU A 1 7   ? -19.687 -10.359 1.300   1.00 0.00 ? 7   GLU A N    1  
ATOM 88    C CA   . GLU A 1 7   ? -18.266 -10.215 1.000   1.00 0.00 ? 7   GLU A CA   1  
ATOM 89    C C    . GLU A 1 7   ? -17.822 -8.781  1.291   1.00 0.00 ? 7   GLU A C    1  
ATOM 90    O O    . GLU A 1 7   ? -16.745 -8.549  1.841   1.00 0.00 ? 7   GLU A O    1  
ATOM 91    C CB   . GLU A 1 7   ? -18.013 -10.577 -0.473  1.00 0.00 ? 7   GLU A CB   1  
ATOM 92    C CG   . GLU A 1 7   ? -16.543 -10.581 -0.892  1.00 0.00 ? 7   GLU A CG   1  
ATOM 93    C CD   . GLU A 1 7   ? -15.714 -11.662 -0.209  1.00 0.00 ? 7   GLU A CD   1  
ATOM 94    O OE1  . GLU A 1 7   ? -16.229 -12.783 -0.011  1.00 0.00 ? 7   GLU A OE1  1  
ATOM 95    O OE2  . GLU A 1 7   ? -14.529 -11.405 0.099   1.00 0.00 ? 7   GLU A OE2  1  
ATOM 96    H H    . GLU A 1 7   ? -20.291 -10.671 0.595   1.00 0.00 ? 7   GLU A H    1  
ATOM 97    H HA   . GLU A 1 7   ? -17.717 -10.895 1.637   1.00 0.00 ? 7   GLU A HA   1  
ATOM 98    H HB2  . GLU A 1 7   ? -18.415 -11.562 -0.660  1.00 0.00 ? 7   GLU A HB2  1  
ATOM 99    H HB3  . GLU A 1 7   ? -18.537 -9.866  -1.095  1.00 0.00 ? 7   GLU A HB3  1  
ATOM 100   H HG2  . GLU A 1 7   ? -16.489 -10.738 -1.959  1.00 0.00 ? 7   GLU A HG2  1  
ATOM 101   H HG3  . GLU A 1 7   ? -16.115 -9.615  -0.654  1.00 0.00 ? 7   GLU A HG3  1  
ATOM 102   N N    . ALA A 1 8   ? -18.688 -7.828  0.955   1.00 0.00 ? 8   ALA A N    1  
ATOM 103   C CA   . ALA A 1 8   ? -18.402 -6.411  1.151   1.00 0.00 ? 8   ALA A CA   1  
ATOM 104   C C    . ALA A 1 8   ? -18.249 -6.063  2.636   1.00 0.00 ? 8   ALA A C    1  
ATOM 105   O O    . ALA A 1 8   ? -17.305 -5.366  3.019   1.00 0.00 ? 8   ALA A O    1  
ATOM 106   C CB   . ALA A 1 8   ? -19.491 -5.561  0.510   1.00 0.00 ? 8   ALA A CB   1  
ATOM 107   H H    . ALA A 1 8   ? -19.549 -8.088  0.559   1.00 0.00 ? 8   ALA A H    1  
ATOM 108   H HA   . ALA A 1 8   ? -17.470 -6.191  0.645   1.00 0.00 ? 8   ALA A HA   1  
ATOM 109   H HB1  . ALA A 1 8   ? -19.587 -5.822  -0.534  1.00 0.00 ? 8   ALA A HB1  1  
ATOM 110   H HB2  . ALA A 1 8   ? -19.233 -4.515  0.596   1.00 0.00 ? 8   ALA A HB2  1  
ATOM 111   H HB3  . ALA A 1 8   ? -20.432 -5.742  1.011   1.00 0.00 ? 8   ALA A HB3  1  
ATOM 112   N N    . VAL A 1 9   ? -19.167 -6.549  3.479   1.00 0.00 ? 9   VAL A N    1  
ATOM 113   C CA   . VAL A 1 9   ? -19.099 -6.263  4.916   1.00 0.00 ? 9   VAL A CA   1  
ATOM 114   C C    . VAL A 1 9   ? -17.876 -6.940  5.532   1.00 0.00 ? 9   VAL A C    1  
ATOM 115   O O    . VAL A 1 9   ? -17.312 -6.456  6.516   1.00 0.00 ? 9   VAL A O    1  
ATOM 116   C CB   . VAL A 1 9   ? -20.382 -6.689  5.687   1.00 0.00 ? 9   VAL A CB   1  
ATOM 117   C CG1  . VAL A 1 9   ? -21.617 -5.997  5.113   1.00 0.00 ? 9   VAL A CG1  1  
ATOM 118   C CG2  . VAL A 1 9   ? -20.564 -8.205  5.690   1.00 0.00 ? 9   VAL A CG2  1  
ATOM 119   H H    . VAL A 1 9   ? -19.893 -7.110  3.132   1.00 0.00 ? 9   VAL A H    1  
ATOM 120   H HA   . VAL A 1 9   ? -18.982 -5.191  5.027   1.00 0.00 ? 9   VAL A HA   1  
ATOM 121   H HB   . VAL A 1 9   ? -20.276 -6.365  6.715   1.00 0.00 ? 9   VAL A HB   1  
ATOM 122   H HG11 . VAL A 1 9   ? -21.744 -6.283  4.078   1.00 0.00 ? 9   VAL A HG11 1  
ATOM 123   H HG12 . VAL A 1 9   ? -21.494 -4.925  5.177   1.00 0.00 ? 9   VAL A HG12 1  
ATOM 124   H HG13 . VAL A 1 9   ? -22.491 -6.291  5.677   1.00 0.00 ? 9   VAL A HG13 1  
ATOM 125   H HG21 . VAL A 1 9   ? -19.692 -8.673  6.124   1.00 0.00 ? 9   VAL A HG21 1  
ATOM 126   H HG22 . VAL A 1 9   ? -20.693 -8.556  4.678   1.00 0.00 ? 9   VAL A HG22 1  
ATOM 127   H HG23 . VAL A 1 9   ? -21.437 -8.464  6.275   1.00 0.00 ? 9   VAL A HG23 1  
ATOM 128   N N    . LYS A 1 10  ? -17.458 -8.053  4.933   1.00 0.00 ? 10  LYS A N    1  
ATOM 129   C CA   . LYS A 1 10  ? -16.249 -8.750  5.360   1.00 0.00 ? 10  LYS A CA   1  
ATOM 130   C C    . LYS A 1 10  ? -15.010 -7.936  4.987   1.00 0.00 ? 10  LYS A C    1  
ATOM 131   O O    . LYS A 1 10  ? -14.000 -7.959  5.693   1.00 0.00 ? 10  LYS A O    1  
ATOM 132   C CB   . LYS A 1 10  ? -16.183 -10.150 4.740   1.00 0.00 ? 10  LYS A CB   1  
ATOM 133   C CG   . LYS A 1 10  ? -17.286 -11.092 5.219   1.00 0.00 ? 10  LYS A CG   1  
ATOM 134   C CD   . LYS A 1 10  ? -17.223 -11.313 6.727   1.00 0.00 ? 10  LYS A CD   1  
ATOM 135   C CE   . LYS A 1 10  ? -18.323 -12.249 7.210   1.00 0.00 ? 10  LYS A CE   1  
ATOM 136   N NZ   . LYS A 1 10  ? -18.258 -12.460 8.679   1.00 0.00 ? 10  LYS A NZ   1  
ATOM 137   H H    . LYS A 1 10  ? -17.980 -8.416  4.184   1.00 0.00 ? 10  LYS A H    1  
ATOM 138   H HA   . LYS A 1 10  ? -16.287 -8.844  6.438   1.00 0.00 ? 10  LYS A HA   1  
ATOM 139   H HB2  . LYS A 1 10  ? -16.259 -10.059 3.665   1.00 0.00 ? 10  LYS A HB2  1  
ATOM 140   H HB3  . LYS A 1 10  ? -15.228 -10.593 4.985   1.00 0.00 ? 10  LYS A HB3  1  
ATOM 141   H HG2  . LYS A 1 10  ? -18.246 -10.665 4.968   1.00 0.00 ? 10  LYS A HG2  1  
ATOM 142   H HG3  . LYS A 1 10  ? -17.174 -12.045 4.719   1.00 0.00 ? 10  LYS A HG3  1  
ATOM 143   H HD2  . LYS A 1 10  ? -16.265 -11.744 6.980   1.00 0.00 ? 10  LYS A HD2  1  
ATOM 144   H HD3  . LYS A 1 10  ? -17.331 -10.359 7.227   1.00 0.00 ? 10  LYS A HD3  1  
ATOM 145   H HE2  . LYS A 1 10  ? -19.283 -11.820 6.959   1.00 0.00 ? 10  LYS A HE2  1  
ATOM 146   H HE3  . LYS A 1 10  ? -18.215 -13.202 6.713   1.00 0.00 ? 10  LYS A HE3  1  
ATOM 147   H HZ1  . LYS A 1 10  ? -17.318 -12.812 8.951   1.00 0.00 ? 10  LYS A HZ1  1  
ATOM 148   H HZ2  . LYS A 1 10  ? -18.972 -13.151 8.976   1.00 0.00 ? 10  LYS A HZ2  1  
ATOM 149   H HZ3  . LYS A 1 10  ? -18.438 -11.566 9.178   1.00 0.00 ? 10  LYS A HZ3  1  
ATOM 150   N N    . TRP A 1 11  ? -15.095 -7.206  3.880   1.00 0.00 ? 11  TRP A N    1  
ATOM 151   C CA   . TRP A 1 11  ? -14.034 -6.283  3.488   1.00 0.00 ? 11  TRP A CA   1  
ATOM 152   C C    . TRP A 1 11  ? -13.942 -5.141  4.494   1.00 0.00 ? 11  TRP A C    1  
ATOM 153   O O    . TRP A 1 11  ? -12.907 -4.492  4.616   1.00 0.00 ? 11  TRP A O    1  
ATOM 154   C CB   . TRP A 1 11  ? -14.289 -5.714  2.087   1.00 0.00 ? 11  TRP A CB   1  
ATOM 155   C CG   . TRP A 1 11  ? -14.246 -6.739  0.992   1.00 0.00 ? 11  TRP A CG   1  
ATOM 156   C CD1  . TRP A 1 11  ? -13.818 -8.034  1.087   1.00 0.00 ? 11  TRP A CD1  1  
ATOM 157   C CD2  . TRP A 1 11  ? -14.632 -6.542  -0.372  1.00 0.00 ? 11  TRP A CD2  1  
ATOM 158   N NE1  . TRP A 1 11  ? -13.925 -8.653  -0.132  1.00 0.00 ? 11  TRP A NE1  1  
ATOM 159   C CE2  . TRP A 1 11  ? -14.419 -7.758  -1.045  1.00 0.00 ? 11  TRP A CE2  1  
ATOM 160   C CE3  . TRP A 1 11  ? -15.140 -5.452  -1.088  1.00 0.00 ? 11  TRP A CE3  1  
ATOM 161   C CZ2  . TRP A 1 11  ? -14.696 -7.916  -2.399  1.00 0.00 ? 11  TRP A CZ2  1  
ATOM 162   C CZ3  . TRP A 1 11  ? -15.414 -5.610  -2.432  1.00 0.00 ? 11  TRP A CZ3  1  
ATOM 163   C CH2  . TRP A 1 11  ? -15.192 -6.833  -3.076  1.00 0.00 ? 11  TRP A CH2  1  
ATOM 164   H H    . TRP A 1 11  ? -15.888 -7.295  3.307   1.00 0.00 ? 11  TRP A H    1  
ATOM 165   H HA   . TRP A 1 11  ? -13.098 -6.825  3.486   1.00 0.00 ? 11  TRP A HA   1  
ATOM 166   H HB2  . TRP A 1 11  ? -15.266 -5.254  2.068   1.00 0.00 ? 11  TRP A HB2  1  
ATOM 167   H HB3  . TRP A 1 11  ? -13.542 -4.963  1.869   1.00 0.00 ? 11  TRP A HB3  1  
ATOM 168   H HD1  . TRP A 1 11  ? -13.456 -8.492  1.996   1.00 0.00 ? 11  TRP A HD1  1  
ATOM 169   H HE1  . TRP A 1 11  ? -13.689 -9.590  -0.315  1.00 0.00 ? 11  TRP A HE1  1  
ATOM 170   H HE3  . TRP A 1 11  ? -15.319 -4.502  -0.607  1.00 0.00 ? 11  TRP A HE3  1  
ATOM 171   H HZ2  . TRP A 1 11  ? -14.532 -8.853  -2.912  1.00 0.00 ? 11  TRP A HZ2  1  
ATOM 172   H HZ3  . TRP A 1 11  ? -15.805 -4.780  -3.002  1.00 0.00 ? 11  TRP A HZ3  1  
ATOM 173   H HH2  . TRP A 1 11  ? -15.419 -6.912  -4.130  1.00 0.00 ? 11  TRP A HH2  1  
ATOM 174   N N    . GLY A 1 12  ? -15.040 -4.919  5.220   1.00 0.00 ? 12  GLY A N    1  
ATOM 175   C CA   . GLY A 1 12  ? -15.099 -3.855  6.209   1.00 0.00 ? 12  GLY A CA   1  
ATOM 176   C C    . GLY A 1 12  ? -14.501 -4.257  7.547   1.00 0.00 ? 12  GLY A C    1  
ATOM 177   O O    . GLY A 1 12  ? -14.533 -3.482  8.507   1.00 0.00 ? 12  GLY A O    1  
ATOM 178   H H    . GLY A 1 12  ? -15.823 -5.492  5.080   1.00 0.00 ? 12  GLY A H    1  
ATOM 179   H HA2  . GLY A 1 12  ? -14.562 -2.996  5.832   1.00 0.00 ? 12  GLY A HA2  1  
ATOM 180   H HA3  . GLY A 1 12  ? -16.133 -3.580  6.360   1.00 0.00 ? 12  GLY A HA3  1  
ATOM 181   N N    . GLU A 1 13  ? -13.976 -5.478  7.623   1.00 0.00 ? 13  GLU A N    1  
ATOM 182   C CA   . GLU A 1 13  ? -13.306 -5.954  8.832   1.00 0.00 ? 13  GLU A CA   1  
ATOM 183   C C    . GLU A 1 13  ? -11.896 -6.447  8.505   1.00 0.00 ? 13  GLU A C    1  
ATOM 184   O O    . GLU A 1 13  ? -10.948 -6.175  9.247   1.00 0.00 ? 13  GLU A O    1  
ATOM 185   C CB   . GLU A 1 13  ? -14.125 -7.064  9.515   1.00 0.00 ? 13  GLU A CB   1  
ATOM 186   C CG   . GLU A 1 13  ? -14.458 -8.243  8.610   1.00 0.00 ? 13  GLU A CG   1  
ATOM 187   C CD   . GLU A 1 13  ? -15.172 -9.368  9.338   1.00 0.00 ? 13  GLU A CD   1  
ATOM 188   O OE1  . GLU A 1 13  ? -16.411 -9.307  9.477   1.00 0.00 ? 13  GLU A OE1  1  
ATOM 189   O OE2  . GLU A 1 13  ? -14.494 -10.323 9.777   1.00 0.00 ? 13  GLU A OE2  1  
ATOM 190   H H    . GLU A 1 13  ? -14.043 -6.074  6.847   1.00 0.00 ? 13  GLU A H    1  
ATOM 191   H HA   . GLU A 1 13  ? -13.222 -5.117  9.513   1.00 0.00 ? 13  GLU A HA   1  
ATOM 192   H HB2  . GLU A 1 13  ? -13.566 -7.437  10.362  1.00 0.00 ? 13  GLU A HB2  1  
ATOM 193   H HB3  . GLU A 1 13  ? -15.054 -6.639  9.872   1.00 0.00 ? 13  GLU A HB3  1  
ATOM 194   H HG2  . GLU A 1 13  ? -15.093 -7.894  7.806   1.00 0.00 ? 13  GLU A HG2  1  
ATOM 195   H HG3  . GLU A 1 13  ? -13.537 -8.628  8.191   1.00 0.00 ? 13  GLU A HG3  1  
ATOM 196   N N    . SER A 1 14  ? -11.758 -7.159  7.388   1.00 0.00 ? 14  SER A N    1  
ATOM 197   C CA   . SER A 1 14  ? -10.470 -7.710  6.977   1.00 0.00 ? 14  SER A CA   1  
ATOM 198   C C    . SER A 1 14  ? -9.918  -6.964  5.759   1.00 0.00 ? 14  SER A C    1  
ATOM 199   O O    . SER A 1 14  ? -10.346 -7.200  4.624   1.00 0.00 ? 14  SER A O    1  
ATOM 200   C CB   . SER A 1 14  ? -10.625 -9.203  6.664   1.00 0.00 ? 14  SER A CB   1  
ATOM 201   O OG   . SER A 1 14  ? -11.286 -9.883  7.718   1.00 0.00 ? 14  SER A OG   1  
ATOM 202   H H    . SER A 1 14  ? -12.544 -7.324  6.826   1.00 0.00 ? 14  SER A H    1  
ATOM 203   H HA   . SER A 1 14  ? -9.778  -7.594  7.799   1.00 0.00 ? 14  SER A HA   1  
ATOM 204   H HB2  . SER A 1 14  ? -11.205 -9.322  5.761   1.00 0.00 ? 14  SER A HB2  1  
ATOM 205   H HB3  . SER A 1 14  ? -9.648  -9.644  6.526   1.00 0.00 ? 14  SER A HB3  1  
ATOM 206   H HG   . SER A 1 14  ? -11.012 -9.510  8.566   1.00 0.00 ? 14  SER A HG   1  
ATOM 207   N N    . PHE A 1 15  ? -8.959  -6.072  6.003   1.00 0.00 ? 15  PHE A N    1  
ATOM 208   C CA   . PHE A 1 15  ? -8.357  -5.262  4.942   1.00 0.00 ? 15  PHE A CA   1  
ATOM 209   C C    . PHE A 1 15  ? -7.659  -6.157  3.917   1.00 0.00 ? 15  PHE A C    1  
ATOM 210   O O    . PHE A 1 15  ? -7.737  -5.916  2.712   1.00 0.00 ? 15  PHE A O    1  
ATOM 211   C CB   . PHE A 1 15  ? -7.360  -4.255  5.542   1.00 0.00 ? 15  PHE A CB   1  
ATOM 212   C CG   . PHE A 1 15  ? -6.817  -3.247  4.553   1.00 0.00 ? 15  PHE A CG   1  
ATOM 213   C CD1  . PHE A 1 15  ? -7.536  -2.099  4.247   1.00 0.00 ? 15  PHE A CD1  1  
ATOM 214   C CD2  . PHE A 1 15  ? -5.586  -3.439  3.939   1.00 0.00 ? 15  PHE A CD2  1  
ATOM 215   C CE1  . PHE A 1 15  ? -7.039  -1.168  3.353   1.00 0.00 ? 15  PHE A CE1  1  
ATOM 216   C CE2  . PHE A 1 15  ? -5.087  -2.511  3.043   1.00 0.00 ? 15  PHE A CE2  1  
ATOM 217   C CZ   . PHE A 1 15  ? -5.814  -1.374  2.751   1.00 0.00 ? 15  PHE A CZ   1  
ATOM 218   H H    . PHE A 1 15  ? -8.637  -5.962  6.922   1.00 0.00 ? 15  PHE A H    1  
ATOM 219   H HA   . PHE A 1 15  ? -9.152  -4.720  4.449   1.00 0.00 ? 15  PHE A HA   1  
ATOM 220   H HB2  . PHE A 1 15  ? -7.850  -3.707  6.335   1.00 0.00 ? 15  PHE A HB2  1  
ATOM 221   H HB3  . PHE A 1 15  ? -6.522  -4.797  5.960   1.00 0.00 ? 15  PHE A HB3  1  
ATOM 222   H HD1  . PHE A 1 15  ? -8.496  -1.934  4.716   1.00 0.00 ? 15  PHE A HD1  1  
ATOM 223   H HD2  . PHE A 1 15  ? -5.015  -4.328  4.166   1.00 0.00 ? 15  PHE A HD2  1  
ATOM 224   H HE1  . PHE A 1 15  ? -7.608  -0.278  3.126   1.00 0.00 ? 15  PHE A HE1  1  
ATOM 225   H HE2  . PHE A 1 15  ? -4.127  -2.673  2.576   1.00 0.00 ? 15  PHE A HE2  1  
ATOM 226   H HZ   . PHE A 1 15  ? -5.424  -0.647  2.052   1.00 0.00 ? 15  PHE A HZ   1  
ATOM 227   N N    . ASP A 1 16  ? -6.989  -7.201  4.404   1.00 0.00 ? 16  ASP A N    1  
ATOM 228   C CA   . ASP A 1 16  ? -6.299  -8.148  3.524   1.00 0.00 ? 16  ASP A CA   1  
ATOM 229   C C    . ASP A 1 16  ? -7.303  -8.894  2.648   1.00 0.00 ? 16  ASP A C    1  
ATOM 230   O O    . ASP A 1 16  ? -6.998  -9.252  1.513   1.00 0.00 ? 16  ASP A O    1  
ATOM 231   C CB   . ASP A 1 16  ? -5.466  -9.154  4.333   1.00 0.00 ? 16  ASP A CB   1  
ATOM 232   C CG   . ASP A 1 16  ? -4.713  -10.139 3.439   1.00 0.00 ? 16  ASP A CG   1  
ATOM 233   O OD1  . ASP A 1 16  ? -3.621  -9.786  2.938   1.00 0.00 ? 16  ASP A OD1  1  
ATOM 234   O OD2  . ASP A 1 16  ? -5.209  -11.266 3.229   1.00 0.00 ? 16  ASP A OD2  1  
ATOM 235   H H    . ASP A 1 16  ? -6.950  -7.335  5.376   1.00 0.00 ? 16  ASP A H    1  
ATOM 236   H HA   . ASP A 1 16  ? -5.638  -7.579  2.884   1.00 0.00 ? 16  ASP A HA   1  
ATOM 237   H HB2  . ASP A 1 16  ? -4.746  -8.615  4.933   1.00 0.00 ? 16  ASP A HB2  1  
ATOM 238   H HB3  . ASP A 1 16  ? -6.121  -9.713  4.987   1.00 0.00 ? 16  ASP A HB3  1  
ATOM 239   N N    . LYS A 1 17  ? -8.506  -9.115  3.174   1.00 0.00 ? 17  LYS A N    1  
ATOM 240   C CA   . LYS A 1 17  ? -9.550  -9.812  2.426   1.00 0.00 ? 17  LYS A CA   1  
ATOM 241   C C    . LYS A 1 17  ? -10.054 -8.922  1.294   1.00 0.00 ? 17  LYS A C    1  
ATOM 242   O O    . LYS A 1 17  ? -10.381 -9.405  0.206   1.00 0.00 ? 17  LYS A O    1  
ATOM 243   C CB   . LYS A 1 17  ? -10.695 -10.223 3.364   1.00 0.00 ? 17  LYS A CB   1  
ATOM 244   C CG   . LYS A 1 17  ? -11.842 -10.967 2.681   1.00 0.00 ? 17  LYS A CG   1  
ATOM 245   C CD   . LYS A 1 17  ? -12.805 -11.565 3.706   1.00 0.00 ? 17  LYS A CD   1  
ATOM 246   C CE   . LYS A 1 17  ? -14.035 -12.191 3.056   1.00 0.00 ? 17  LYS A CE   1  
ATOM 247   N NZ   . LYS A 1 17  ? -13.685 -13.206 2.029   1.00 0.00 ? 17  LYS A NZ   1  
ATOM 248   H H    . LYS A 1 17  ? -8.701  -8.786  4.076   1.00 0.00 ? 17  LYS A H    1  
ATOM 249   H HA   . LYS A 1 17  ? -9.110  -10.703 1.997   1.00 0.00 ? 17  LYS A HA   1  
ATOM 250   H HB2  . LYS A 1 17  ? -10.294 -10.863 4.136   1.00 0.00 ? 17  LYS A HB2  1  
ATOM 251   H HB3  . LYS A 1 17  ? -11.099 -9.333  3.828   1.00 0.00 ? 17  LYS A HB3  1  
ATOM 252   H HG2  . LYS A 1 17  ? -12.384 -10.277 2.050   1.00 0.00 ? 17  LYS A HG2  1  
ATOM 253   H HG3  . LYS A 1 17  ? -11.433 -11.766 2.076   1.00 0.00 ? 17  LYS A HG3  1  
ATOM 254   H HD2  . LYS A 1 17  ? -12.286 -12.329 4.268   1.00 0.00 ? 17  LYS A HD2  1  
ATOM 255   H HD3  . LYS A 1 17  ? -13.126 -10.782 4.382   1.00 0.00 ? 17  LYS A HD3  1  
ATOM 256   H HE2  . LYS A 1 17  ? -14.630 -12.665 3.823   1.00 0.00 ? 17  LYS A HE2  1  
ATOM 257   H HE3  . LYS A 1 17  ? -14.615 -11.407 2.589   1.00 0.00 ? 17  LYS A HE3  1  
ATOM 258   H HZ1  . LYS A 1 17  ? -13.277 -12.743 1.192   1.00 0.00 ? 17  LYS A HZ1  1  
ATOM 259   H HZ2  . LYS A 1 17  ? -14.534 -13.727 1.739   1.00 0.00 ? 17  LYS A HZ2  1  
ATOM 260   H HZ3  . LYS A 1 17  ? -12.991 -13.881 2.410   1.00 0.00 ? 17  LYS A HZ3  1  
ATOM 261   N N    . LEU A 1 18  ? -10.092 -7.620  1.563   1.00 0.00 ? 18  LEU A N    1  
ATOM 262   C CA   . LEU A 1 18  ? -10.417 -6.619  0.549   1.00 0.00 ? 18  LEU A CA   1  
ATOM 263   C C    . LEU A 1 18  ? -9.375  -6.649  -0.569  1.00 0.00 ? 18  LEU A C    1  
ATOM 264   O O    . LEU A 1 18  ? -9.713  -6.693  -1.752  1.00 0.00 ? 18  LEU A O    1  
ATOM 265   C CB   . LEU A 1 18  ? -10.461 -5.224  1.201   1.00 0.00 ? 18  LEU A CB   1  
ATOM 266   C CG   . LEU A 1 18  ? -10.616 -4.027  0.242   1.00 0.00 ? 18  LEU A CG   1  
ATOM 267   C CD1  . LEU A 1 18  ? -11.946 -4.086  -0.504  1.00 0.00 ? 18  LEU A CD1  1  
ATOM 268   C CD2  . LEU A 1 18  ? -10.479 -2.708  1.002   1.00 0.00 ? 18  LEU A CD2  1  
ATOM 269   H H    . LEU A 1 18  ? -9.892  -7.320  2.477   1.00 0.00 ? 18  LEU A H    1  
ATOM 270   H HA   . LEU A 1 18  ? -11.389 -6.855  0.139   1.00 0.00 ? 18  LEU A HA   1  
ATOM 271   H HB2  . LEU A 1 18  ? -11.289 -5.207  1.898   1.00 0.00 ? 18  LEU A HB2  1  
ATOM 272   H HB3  . LEU A 1 18  ? -9.546  -5.089  1.761   1.00 0.00 ? 18  LEU A HB3  1  
ATOM 273   H HG   . LEU A 1 18  ? -9.825  -4.066  -0.496  1.00 0.00 ? 18  LEU A HG   1  
ATOM 274   H HD11 . LEU A 1 18  ? -12.760 -4.060  0.207   1.00 0.00 ? 18  LEU A HD11 1  
ATOM 275   H HD12 . LEU A 1 18  ? -11.997 -5.000  -1.078  1.00 0.00 ? 18  LEU A HD12 1  
ATOM 276   H HD13 . LEU A 1 18  ? -12.022 -3.240  -1.170  1.00 0.00 ? 18  LEU A HD13 1  
ATOM 277   H HD21 . LEU A 1 18  ? -9.515  -2.669  1.490   1.00 0.00 ? 18  LEU A HD21 1  
ATOM 278   H HD22 . LEU A 1 18  ? -11.260 -2.633  1.744   1.00 0.00 ? 18  LEU A HD22 1  
ATOM 279   H HD23 . LEU A 1 18  ? -10.563 -1.881  0.309   1.00 0.00 ? 18  LEU A HD23 1  
ATOM 280   N N    . LEU A 1 19  ? -8.107  -6.648  -0.169  1.00 0.00 ? 19  LEU A N    1  
ATOM 281   C CA   . LEU A 1 19  ? -6.985  -6.628  -1.106  1.00 0.00 ? 19  LEU A CA   1  
ATOM 282   C C    . LEU A 1 19  ? -6.917  -7.916  -1.933  1.00 0.00 ? 19  LEU A C    1  
ATOM 283   O O    . LEU A 1 19  ? -6.802  -7.876  -3.158  1.00 0.00 ? 19  LEU A O    1  
ATOM 284   C CB   . LEU A 1 19  ? -5.670  -6.440  -0.334  1.00 0.00 ? 19  LEU A CB   1  
ATOM 285   C CG   . LEU A 1 19  ? -4.392  -6.444  -1.188  1.00 0.00 ? 19  LEU A CG   1  
ATOM 286   C CD1  . LEU A 1 19  ? -4.352  -5.240  -2.128  1.00 0.00 ? 19  LEU A CD1  1  
ATOM 287   C CD2  . LEU A 1 19  ? -3.155  -6.485  -0.296  1.00 0.00 ? 19  LEU A CD2  1  
ATOM 288   H H    . LEU A 1 19  ? -7.917  -6.657  0.794   1.00 0.00 ? 19  LEU A H    1  
ATOM 289   H HA   . LEU A 1 19  ? -7.123  -5.790  -1.774  1.00 0.00 ? 19  LEU A HA   1  
ATOM 290   H HB2  . LEU A 1 19  ? -5.723  -5.497  0.196   1.00 0.00 ? 19  LEU A HB2  1  
ATOM 291   H HB3  . LEU A 1 19  ? -5.591  -7.235  0.395   1.00 0.00 ? 19  LEU A HB3  1  
ATOM 292   H HG   . LEU A 1 19  ? -4.385  -7.335  -1.800  1.00 0.00 ? 19  LEU A HG   1  
ATOM 293   H HD11 . LEU A 1 19  ? -5.198  -5.275  -2.798  1.00 0.00 ? 19  LEU A HD11 1  
ATOM 294   H HD12 . LEU A 1 19  ? -3.438  -5.264  -2.705  1.00 0.00 ? 19  LEU A HD12 1  
ATOM 295   H HD13 . LEU A 1 19  ? -4.386  -4.328  -1.550  1.00 0.00 ? 19  LEU A HD13 1  
ATOM 296   H HD21 . LEU A 1 19  ? -3.147  -5.621  0.352   1.00 0.00 ? 19  LEU A HD21 1  
ATOM 297   H HD22 . LEU A 1 19  ? -2.265  -6.482  -0.910  1.00 0.00 ? 19  LEU A HD22 1  
ATOM 298   H HD23 . LEU A 1 19  ? -3.172  -7.383  0.304   1.00 0.00 ? 19  LEU A HD23 1  
ATOM 299   N N    . SER A 1 20  ? -6.993  -9.053  -1.250  1.00 0.00 ? 20  SER A N    1  
ATOM 300   C CA   . SER A 1 20  ? -6.812  -10.356 -1.886  1.00 0.00 ? 20  SER A CA   1  
ATOM 301   C C    . SER A 1 20  ? -7.949  -10.676 -2.859  1.00 0.00 ? 20  SER A C    1  
ATOM 302   O O    . SER A 1 20  ? -7.746  -11.385 -3.847  1.00 0.00 ? 20  SER A O    1  
ATOM 303   C CB   . SER A 1 20  ? -6.700  -11.447 -0.815  1.00 0.00 ? 20  SER A CB   1  
ATOM 304   O OG   . SER A 1 20  ? -5.629  -11.172 0.076   1.00 0.00 ? 20  SER A OG   1  
ATOM 305   H H    . SER A 1 20  ? -7.175  -9.017  -0.290  1.00 0.00 ? 20  SER A H    1  
ATOM 306   H HA   . SER A 1 20  ? -5.885  -10.322 -2.441  1.00 0.00 ? 20  SER A HA   1  
ATOM 307   H HB2  . SER A 1 20  ? -7.620  -11.491 -0.251  1.00 0.00 ? 20  SER A HB2  1  
ATOM 308   H HB3  . SER A 1 20  ? -6.522  -12.401 -1.290  1.00 0.00 ? 20  SER A HB3  1  
ATOM 309   H HG   . SER A 1 20  ? -5.976  -10.734 0.867   1.00 0.00 ? 20  SER A HG   1  
ATOM 310   N N    . HIS A 1 21  ? -9.142  -10.148 -2.588  1.00 0.00 ? 21  HIS A N    1  
ATOM 311   C CA   . HIS A 1 21  ? -10.286 -10.386 -3.460  1.00 0.00 ? 21  HIS A CA   1  
ATOM 312   C C    . HIS A 1 21  ? -10.146 -9.514  -4.700  1.00 0.00 ? 21  HIS A C    1  
ATOM 313   O O    . HIS A 1 21  ? -10.094 -8.293  -4.593  1.00 0.00 ? 21  HIS A O    1  
ATOM 314   C CB   . HIS A 1 21  ? -11.613 -10.086 -2.734  1.00 0.00 ? 21  HIS A CB   1  
ATOM 315   C CG   . HIS A 1 21  ? -12.632 -11.185 -2.856  1.00 0.00 ? 21  HIS A CG   1  
ATOM 316   N ND1  . HIS A 1 21  ? -13.760 -11.099 -3.651  1.00 0.00 ? 21  HIS A ND1  1  
ATOM 317   C CD2  . HIS A 1 21  ? -12.696 -12.397 -2.253  1.00 0.00 ? 21  HIS A CD2  1  
ATOM 318   C CE1  . HIS A 1 21  ? -14.471 -12.203 -3.524  1.00 0.00 ? 21  HIS A CE1  1  
ATOM 319   N NE2  . HIS A 1 21  ? -13.847 -13.004 -2.684  1.00 0.00 ? 21  HIS A NE2  1  
ATOM 320   H H    . HIS A 1 21  ? -9.248  -9.569  -1.804  1.00 0.00 ? 21  HIS A H    1  
ATOM 321   H HA   . HIS A 1 21  ? -10.267 -11.427 -3.758  1.00 0.00 ? 21  HIS A HA   1  
ATOM 322   H HB2  . HIS A 1 21  ? -11.418 -9.938  -1.682  1.00 0.00 ? 21  HIS A HB2  1  
ATOM 323   H HB3  . HIS A 1 21  ? -12.048 -9.183  -3.138  1.00 0.00 ? 21  HIS A HB3  1  
ATOM 324   H HD1  . HIS A 1 21  ? -13.993 -10.354 -4.246  1.00 0.00 ? 21  HIS A HD1  1  
ATOM 325   H HD2  . HIS A 1 21  ? -11.973 -12.808 -1.563  1.00 0.00 ? 21  HIS A HD2  1  
ATOM 326   H HE1  . HIS A 1 21  ? -15.409 -12.410 -4.019  1.00 0.00 ? 21  HIS A HE1  1  
ATOM 327   H HE2  . HIS A 1 21  ? -14.117 -13.924 -2.473  1.00 0.00 ? 21  HIS A HE2  1  
ATOM 328   N N    . ARG A 1 22  ? -10.081 -10.148 -5.867  1.00 0.00 ? 22  ARG A N    1  
ATOM 329   C CA   . ARG A 1 22  ? -9.878  -9.434  -7.133  1.00 0.00 ? 22  ARG A CA   1  
ATOM 330   C C    . ARG A 1 22  ? -10.887 -8.296  -7.277  1.00 0.00 ? 22  ARG A C    1  
ATOM 331   O O    . ARG A 1 22  ? -10.552 -7.203  -7.737  1.00 0.00 ? 22  ARG A O    1  
ATOM 332   C CB   . ARG A 1 22  ? -10.005 -10.403 -8.326  1.00 0.00 ? 22  ARG A CB   1  
ATOM 333   C CG   . ARG A 1 22  ? -8.795  -11.320 -8.547  1.00 0.00 ? 22  ARG A CG   1  
ATOM 334   C CD   . ARG A 1 22  ? -8.419  -12.118 -7.299  1.00 0.00 ? 22  ARG A CD   1  
ATOM 335   N NE   . ARG A 1 22  ? -7.435  -13.165 -7.583  1.00 0.00 ? 22  ARG A NE   1  
ATOM 336   C CZ   . ARG A 1 22  ? -6.168  -12.947 -7.942  1.00 0.00 ? 22  ARG A CZ   1  
ATOM 337   N NH1  . ARG A 1 22  ? -5.705  -11.707 -8.082  1.00 0.00 ? 22  ARG A NH1  1  
ATOM 338   N NH2  . ARG A 1 22  ? -5.364  -13.978 -8.155  1.00 0.00 ? 22  ARG A NH2  1  
ATOM 339   H H    . ARG A 1 22  ? -10.182 -11.124 -5.879  1.00 0.00 ? 22  ARG A H    1  
ATOM 340   H HA   . ARG A 1 22  ? -8.880  -9.014  -7.125  1.00 0.00 ? 22  ARG A HA   1  
ATOM 341   H HB2  . ARG A 1 22  ? -10.873 -11.028 -8.172  1.00 0.00 ? 22  ARG A HB2  1  
ATOM 342   H HB3  . ARG A 1 22  ? -10.153 -9.824  -9.228  1.00 0.00 ? 22  ARG A HB3  1  
ATOM 343   H HG2  . ARG A 1 22  ? -9.027  -12.014 -9.342  1.00 0.00 ? 22  ARG A HG2  1  
ATOM 344   H HG3  . ARG A 1 22  ? -7.949  -10.711 -8.841  1.00 0.00 ? 22  ARG A HG3  1  
ATOM 345   H HD2  . ARG A 1 22  ? -8.006  -11.441 -6.564  1.00 0.00 ? 22  ARG A HD2  1  
ATOM 346   H HD3  . ARG A 1 22  ? -9.311  -12.578 -6.899  1.00 0.00 ? 22  ARG A HD3  1  
ATOM 347   H HE   . ARG A 1 22  ? -7.739  -14.098 -7.490  1.00 0.00 ? 22  ARG A HE   1  
ATOM 348   H HH11 . ARG A 1 22  ? -6.303  -10.924 -7.914  1.00 0.00 ? 22  ARG A HH11 1  
ATOM 349   H HH12 . ARG A 1 22  ? -4.755  -11.551 -8.373  1.00 0.00 ? 22  ARG A HH12 1  
ATOM 350   H HH21 . ARG A 1 22  ? -5.711  -14.917 -8.047  1.00 0.00 ? 22  ARG A HH21 1  
ATOM 351   H HH22 . ARG A 1 22  ? -4.410  -13.828 -8.427  1.00 0.00 ? 22  ARG A HH22 1  
ATOM 352   N N    . ASP A 1 23  ? -12.116 -8.564  -6.851  1.00 0.00 ? 23  ASP A N    1  
ATOM 353   C CA   . ASP A 1 23  ? -13.199 -7.586  -6.923  1.00 0.00 ? 23  ASP A CA   1  
ATOM 354   C C    . ASP A 1 23  ? -12.915 -6.417  -5.981  1.00 0.00 ? 23  ASP A C    1  
ATOM 355   O O    . ASP A 1 23  ? -13.182 -5.257  -6.308  1.00 0.00 ? 23  ASP A O    1  
ATOM 356   C CB   . ASP A 1 23  ? -14.535 -8.247  -6.543  1.00 0.00 ? 23  ASP A CB   1  
ATOM 357   C CG   . ASP A 1 23  ? -14.646 -9.671  -7.063  1.00 0.00 ? 23  ASP A CG   1  
ATOM 358   O OD1  . ASP A 1 23  ? -15.033 -9.867  -8.233  1.00 0.00 ? 23  ASP A OD1  1  
ATOM 359   O OD2  . ASP A 1 23  ? -14.316 -10.604 -6.300  1.00 0.00 ? 23  ASP A OD2  1  
ATOM 360   H H    . ASP A 1 23  ? -12.304 -9.453  -6.482  1.00 0.00 ? 23  ASP A H    1  
ATOM 361   H HA   . ASP A 1 23  ? -13.257 -7.219  -7.939  1.00 0.00 ? 23  ASP A HA   1  
ATOM 362   H HB2  . ASP A 1 23  ? -14.628 -8.266  -5.465  1.00 0.00 ? 23  ASP A HB2  1  
ATOM 363   H HB3  . ASP A 1 23  ? -15.348 -7.665  -6.956  1.00 0.00 ? 23  ASP A HB3  1  
ATOM 364   N N    . GLY A 1 24  ? -12.357 -6.742  -4.815  1.00 0.00 ? 24  GLY A N    1  
ATOM 365   C CA   . GLY A 1 24  ? -12.055 -5.737  -3.809  1.00 0.00 ? 24  GLY A CA   1  
ATOM 366   C C    . GLY A 1 24  ? -10.886 -4.869  -4.211  1.00 0.00 ? 24  GLY A C    1  
ATOM 367   O O    . GLY A 1 24  ? -10.969 -3.642  -4.172  1.00 0.00 ? 24  GLY A O    1  
ATOM 368   H H    . GLY A 1 24  ? -12.129 -7.675  -4.643  1.00 0.00 ? 24  GLY A H    1  
ATOM 369   H HA2  . GLY A 1 24  ? -12.924 -5.116  -3.657  1.00 0.00 ? 24  GLY A HA2  1  
ATOM 370   H HA3  . GLY A 1 24  ? -11.816 -6.234  -2.879  1.00 0.00 ? 24  GLY A HA3  1  
ATOM 371   N N    . LEU A 1 25  ? -9.798  -5.521  -4.606  1.00 0.00 ? 25  LEU A N    1  
ATOM 372   C CA   . LEU A 1 25  ? -8.614  -4.843  -5.118  1.00 0.00 ? 25  LEU A CA   1  
ATOM 373   C C    . LEU A 1 25  ? -9.003  -3.881  -6.238  1.00 0.00 ? 25  LEU A C    1  
ATOM 374   O O    . LEU A 1 25  ? -8.534  -2.743  -6.283  1.00 0.00 ? 25  LEU A O    1  
ATOM 375   C CB   . LEU A 1 25  ? -7.597  -5.896  -5.603  1.00 0.00 ? 25  LEU A CB   1  
ATOM 376   C CG   . LEU A 1 25  ? -6.310  -5.366  -6.273  1.00 0.00 ? 25  LEU A CG   1  
ATOM 377   C CD1  . LEU A 1 25  ? -5.146  -6.328  -6.035  1.00 0.00 ? 25  LEU A CD1  1  
ATOM 378   C CD2  . LEU A 1 25  ? -6.519  -5.169  -7.776  1.00 0.00 ? 25  LEU A CD2  1  
ATOM 379   H H    . LEU A 1 25  ? -9.788  -6.497  -4.543  1.00 0.00 ? 25  LEU A H    1  
ATOM 380   H HA   . LEU A 1 25  ? -8.178  -4.277  -4.306  1.00 0.00 ? 25  LEU A HA   1  
ATOM 381   H HB2  . LEU A 1 25  ? -7.310  -6.493  -4.748  1.00 0.00 ? 25  LEU A HB2  1  
ATOM 382   H HB3  . LEU A 1 25  ? -8.101  -6.544  -6.309  1.00 0.00 ? 25  LEU A HB3  1  
ATOM 383   H HG   . LEU A 1 25  ? -6.047  -4.411  -5.840  1.00 0.00 ? 25  LEU A HG   1  
ATOM 384   H HD11 . LEU A 1 25  ? -5.380  -7.294  -6.460  1.00 0.00 ? 25  LEU A HD11 1  
ATOM 385   H HD12 . LEU A 1 25  ? -4.978  -6.435  -4.973  1.00 0.00 ? 25  LEU A HD12 1  
ATOM 386   H HD13 . LEU A 1 25  ? -4.252  -5.938  -6.500  1.00 0.00 ? 25  LEU A HD13 1  
ATOM 387   H HD21 . LEU A 1 25  ? -7.286  -4.425  -7.939  1.00 0.00 ? 25  LEU A HD21 1  
ATOM 388   H HD22 . LEU A 1 25  ? -6.828  -6.106  -8.224  1.00 0.00 ? 25  LEU A HD22 1  
ATOM 389   H HD23 . LEU A 1 25  ? -5.595  -4.839  -8.232  1.00 0.00 ? 25  LEU A HD23 1  
ATOM 390   N N    . GLU A 1 26  ? -9.886  -4.346  -7.124  1.00 0.00 ? 26  GLU A N    1  
ATOM 391   C CA   . GLU A 1 26  ? -10.386 -3.533  -8.229  1.00 0.00 ? 26  GLU A CA   1  
ATOM 392   C C    . GLU A 1 26  ? -11.053 -2.262  -7.699  1.00 0.00 ? 26  GLU A C    1  
ATOM 393   O O    . GLU A 1 26  ? -10.668 -1.147  -8.052  1.00 0.00 ? 26  GLU A O    1  
ATOM 394   C CB   . GLU A 1 26  ? -11.393 -4.341  -9.059  1.00 0.00 ? 26  GLU A CB   1  
ATOM 395   C CG   . GLU A 1 26  ? -11.853 -3.643  -10.337 1.00 0.00 ? 26  GLU A CG   1  
ATOM 396   C CD   . GLU A 1 26  ? -10.732 -3.480  -11.349 1.00 0.00 ? 26  GLU A CD   1  
ATOM 397   O OE1  . GLU A 1 26  ? -10.260 -4.505  -11.881 1.00 0.00 ? 26  GLU A OE1  1  
ATOM 398   O OE2  . GLU A 1 26  ? -10.322 -2.334  -11.629 1.00 0.00 ? 26  GLU A OE2  1  
ATOM 399   H H    . GLU A 1 26  ? -10.209 -5.268  -7.031  1.00 0.00 ? 26  GLU A H    1  
ATOM 400   H HA   . GLU A 1 26  ? -9.546  -3.260  -8.853  1.00 0.00 ? 26  GLU A HA   1  
ATOM 401   H HB2  . GLU A 1 26  ? -10.939 -5.283  -9.336  1.00 0.00 ? 26  GLU A HB2  1  
ATOM 402   H HB3  . GLU A 1 26  ? -12.264 -4.541  -8.450  1.00 0.00 ? 26  GLU A HB3  1  
ATOM 403   H HG2  . GLU A 1 26  ? -12.644 -4.228  -10.787 1.00 0.00 ? 26  GLU A HG2  1  
ATOM 404   H HG3  . GLU A 1 26  ? -12.238 -2.664  -10.079 1.00 0.00 ? 26  GLU A HG3  1  
ATOM 405   N N    . ALA A 1 27  ? -12.041 -2.444  -6.828  1.00 0.00 ? 27  ALA A N    1  
ATOM 406   C CA   . ALA A 1 27  ? -12.806 -1.327  -6.284  1.00 0.00 ? 27  ALA A CA   1  
ATOM 407   C C    . ALA A 1 27  ? -11.907 -0.360  -5.514  1.00 0.00 ? 27  ALA A C    1  
ATOM 408   O O    . ALA A 1 27  ? -12.039 0.860   -5.636  1.00 0.00 ? 27  ALA A O    1  
ATOM 409   C CB   . ALA A 1 27  ? -13.925 -1.842  -5.385  1.00 0.00 ? 27  ALA A CB   1  
ATOM 410   H H    . ALA A 1 27  ? -12.261 -3.357  -6.541  1.00 0.00 ? 27  ALA A H    1  
ATOM 411   H HA   . ALA A 1 27  ? -13.258 -0.799  -7.112  1.00 0.00 ? 27  ALA A HA   1  
ATOM 412   H HB1  . ALA A 1 27  ? -14.527 -1.012  -5.042  1.00 0.00 ? 27  ALA A HB1  1  
ATOM 413   H HB2  . ALA A 1 27  ? -13.499 -2.352  -4.532  1.00 0.00 ? 27  ALA A HB2  1  
ATOM 414   H HB3  . ALA A 1 27  ? -14.546 -2.530  -5.940  1.00 0.00 ? 27  ALA A HB3  1  
ATOM 415   N N    . PHE A 1 28  ? -10.971 -0.917  -4.748  1.00 0.00 ? 28  PHE A N    1  
ATOM 416   C CA   . PHE A 1 28  ? -10.118 -0.120  -3.880  1.00 0.00 ? 28  PHE A CA   1  
ATOM 417   C C    . PHE A 1 28  ? -9.141  0.717   -4.701  1.00 0.00 ? 28  PHE A C    1  
ATOM 418   O O    . PHE A 1 28  ? -8.950  1.898   -4.421  1.00 0.00 ? 28  PHE A O    1  
ATOM 419   C CB   . PHE A 1 28  ? -9.357  -1.023  -2.897  1.00 0.00 ? 28  PHE A CB   1  
ATOM 420   C CG   . PHE A 1 28  ? -8.596  -0.264  -1.832  1.00 0.00 ? 28  PHE A CG   1  
ATOM 421   C CD1  . PHE A 1 28  ? -9.274  0.378   -0.803  1.00 0.00 ? 28  PHE A CD1  1  
ATOM 422   C CD2  . PHE A 1 28  ? -7.209  -0.188  -1.861  1.00 0.00 ? 28  PHE A CD2  1  
ATOM 423   C CE1  . PHE A 1 28  ? -8.586  1.076   0.172   1.00 0.00 ? 28  PHE A CE1  1  
ATOM 424   C CE2  . PHE A 1 28  ? -6.518  0.510   -0.888  1.00 0.00 ? 28  PHE A CE2  1  
ATOM 425   C CZ   . PHE A 1 28  ? -7.206  1.142   0.131   1.00 0.00 ? 28  PHE A CZ   1  
ATOM 426   H H    . PHE A 1 28  ? -10.847 -1.888  -4.775  1.00 0.00 ? 28  PHE A H    1  
ATOM 427   H HA   . PHE A 1 28  ? -10.756 0.548   -3.316  1.00 0.00 ? 28  PHE A HA   1  
ATOM 428   H HB2  . PHE A 1 28  ? -10.063 -1.674  -2.398  1.00 0.00 ? 28  PHE A HB2  1  
ATOM 429   H HB3  . PHE A 1 28  ? -8.651  -1.628  -3.448  1.00 0.00 ? 28  PHE A HB3  1  
ATOM 430   H HD1  . PHE A 1 28  ? -10.354 0.330   -0.768  1.00 0.00 ? 28  PHE A HD1  1  
ATOM 431   H HD2  . PHE A 1 28  ? -6.666  -0.681  -2.656  1.00 0.00 ? 28  PHE A HD2  1  
ATOM 432   H HE1  . PHE A 1 28  ? -9.126  1.569   0.968   1.00 0.00 ? 28  PHE A HE1  1  
ATOM 433   H HE2  . PHE A 1 28  ? -5.438  0.560   -0.923  1.00 0.00 ? 28  PHE A HE2  1  
ATOM 434   H HZ   . PHE A 1 28  ? -6.667  1.687   0.894   1.00 0.00 ? 28  PHE A HZ   1  
ATOM 435   N N    . THR A 1 29  ? -8.540  0.112   -5.725  1.00 0.00 ? 29  THR A N    1  
ATOM 436   C CA   . THR A 1 29  ? -7.564  0.818   -6.550  1.00 0.00 ? 29  THR A CA   1  
ATOM 437   C C    . THR A 1 29  ? -8.241  1.923   -7.364  1.00 0.00 ? 29  THR A C    1  
ATOM 438   O O    . THR A 1 29  ? -7.710  3.028   -7.475  1.00 0.00 ? 29  THR A O    1  
ATOM 439   C CB   . THR A 1 29  ? -6.778  -0.134  -7.493  1.00 0.00 ? 29  THR A CB   1  
ATOM 440   O OG1  . THR A 1 29  ? -5.758  0.595   -8.193  1.00 0.00 ? 29  THR A OG1  1  
ATOM 441   C CG2  . THR A 1 29  ? -7.693  -0.810  -8.507  1.00 0.00 ? 29  THR A CG2  1  
ATOM 442   H H    . THR A 1 29  ? -8.758  -0.824  -5.929  1.00 0.00 ? 29  THR A H    1  
ATOM 443   H HA   . THR A 1 29  ? -6.852  1.280   -5.877  1.00 0.00 ? 29  THR A HA   1  
ATOM 444   H HB   . THR A 1 29  ? -6.306  -0.899  -6.890  1.00 0.00 ? 29  THR A HB   1  
ATOM 445   H HG1  . THR A 1 29  ? -4.900  0.192   -8.016  1.00 0.00 ? 29  THR A HG1  1  
ATOM 446   H HG21 . THR A 1 29  ? -8.174  -0.060  -9.118  1.00 0.00 ? 29  THR A HG21 1  
ATOM 447   H HG22 . THR A 1 29  ? -8.445  -1.386  -7.987  1.00 0.00 ? 29  THR A HG22 1  
ATOM 448   H HG23 . THR A 1 29  ? -7.110  -1.466  -9.137  1.00 0.00 ? 29  THR A HG23 1  
ATOM 449   N N    . ARG A 1 30  ? -9.426  1.635   -7.910  1.00 0.00 ? 30  ARG A N    1  
ATOM 450   C CA   . ARG A 1 30  ? -10.160 2.618   -8.709  1.00 0.00 ? 30  ARG A CA   1  
ATOM 451   C C    . ARG A 1 30  ? -10.517 3.832   -7.855  1.00 0.00 ? 30  ARG A C    1  
ATOM 452   O O    . ARG A 1 30  ? -10.372 4.977   -8.288  1.00 0.00 ? 30  ARG A O    1  
ATOM 453   C CB   . ARG A 1 30  ? -11.427 2.000   -9.316  1.00 0.00 ? 30  ARG A CB   1  
ATOM 454   C CG   . ARG A 1 30  ? -11.150 0.843   -10.273 1.00 0.00 ? 30  ARG A CG   1  
ATOM 455   C CD   . ARG A 1 30  ? -12.433 0.306   -10.897 1.00 0.00 ? 30  ARG A CD   1  
ATOM 456   N NE   . ARG A 1 30  ? -13.058 1.284   -11.794 1.00 0.00 ? 30  ARG A NE   1  
ATOM 457   C CZ   . ARG A 1 30  ? -14.369 1.531   -11.844 1.00 0.00 ? 30  ARG A CZ   1  
ATOM 458   N NH1  . ARG A 1 30  ? -15.201 0.915   -11.012 1.00 0.00 ? 30  ARG A NH1  1  
ATOM 459   N NH2  . ARG A 1 30  ? -14.848 2.402   -12.723 1.00 0.00 ? 30  ARG A NH2  1  
ATOM 460   H H    . ARG A 1 30  ? -9.816  0.744   -7.768  1.00 0.00 ? 30  ARG A H    1  
ATOM 461   H HA   . ARG A 1 30  ? -9.508  2.942   -9.512  1.00 0.00 ? 30  ARG A HA   1  
ATOM 462   H HB2  . ARG A 1 30  ? -12.054 1.634   -8.515  1.00 0.00 ? 30  ARG A HB2  1  
ATOM 463   H HB3  . ARG A 1 30  ? -11.964 2.766   -9.859  1.00 0.00 ? 30  ARG A HB3  1  
ATOM 464   H HG2  . ARG A 1 30  ? -10.497 1.189   -11.062 1.00 0.00 ? 30  ARG A HG2  1  
ATOM 465   H HG3  . ARG A 1 30  ? -10.664 0.046   -9.727  1.00 0.00 ? 30  ARG A HG3  1  
ATOM 466   H HD2  . ARG A 1 30  ? -12.199 -0.586  -11.460 1.00 0.00 ? 30  ARG A HD2  1  
ATOM 467   H HD3  . ARG A 1 30  ? -13.129 0.058   -10.105 1.00 0.00 ? 30  ARG A HD3  1  
ATOM 468   H HE   . ARG A 1 30  ? -12.460 1.773   -12.406 1.00 0.00 ? 30  ARG A HE   1  
ATOM 469   H HH11 . ARG A 1 30  ? -14.852 0.259   -10.345 1.00 0.00 ? 30  ARG A HH11 1  
ATOM 470   H HH12 . ARG A 1 30  ? -16.184 1.120   -11.041 1.00 0.00 ? 30  ARG A HH12 1  
ATOM 471   H HH21 . ARG A 1 30  ? -14.227 2.878   -13.353 1.00 0.00 ? 30  ARG A HH21 1  
ATOM 472   H HH22 . ARG A 1 30  ? -15.836 2.581   -12.770 1.00 0.00 ? 30  ARG A HH22 1  
ATOM 473   N N    . PHE A 1 31  ? -10.969 3.569   -6.632  1.00 0.00 ? 31  PHE A N    1  
ATOM 474   C CA   . PHE A 1 31  ? -11.264 4.629   -5.674  1.00 0.00 ? 31  PHE A CA   1  
ATOM 475   C C    . PHE A 1 31  ? -9.982  5.376   -5.311  1.00 0.00 ? 31  PHE A C    1  
ATOM 476   O O    . PHE A 1 31  ? -9.932  6.604   -5.336  1.00 0.00 ? 31  PHE A O    1  
ATOM 477   C CB   . PHE A 1 31  ? -11.913 4.035   -4.411  1.00 0.00 ? 31  PHE A CB   1  
ATOM 478   C CG   . PHE A 1 31  ? -12.162 5.044   -3.312  1.00 0.00 ? 31  PHE A CG   1  
ATOM 479   C CD1  . PHE A 1 31  ? -13.276 5.870   -3.346  1.00 0.00 ? 31  PHE A CD1  1  
ATOM 480   C CD2  . PHE A 1 31  ? -11.279 5.164   -2.243  1.00 0.00 ? 31  PHE A CD2  1  
ATOM 481   C CE1  . PHE A 1 31  ? -13.505 6.794   -2.342  1.00 0.00 ? 31  PHE A CE1  1  
ATOM 482   C CE2  . PHE A 1 31  ? -11.504 6.085   -1.238  1.00 0.00 ? 31  PHE A CE2  1  
ATOM 483   C CZ   . PHE A 1 31  ? -12.619 6.901   -1.288  1.00 0.00 ? 31  PHE A CZ   1  
ATOM 484   H H    . PHE A 1 31  ? -11.112 2.634   -6.366  1.00 0.00 ? 31  PHE A H    1  
ATOM 485   H HA   . PHE A 1 31  ? -11.955 5.318   -6.139  1.00 0.00 ? 31  PHE A HA   1  
ATOM 486   H HB2  . PHE A 1 31  ? -12.864 3.598   -4.678  1.00 0.00 ? 31  PHE A HB2  1  
ATOM 487   H HB3  . PHE A 1 31  ? -11.270 3.261   -4.017  1.00 0.00 ? 31  PHE A HB3  1  
ATOM 488   H HD1  . PHE A 1 31  ? -13.972 5.789   -4.169  1.00 0.00 ? 31  PHE A HD1  1  
ATOM 489   H HD2  . PHE A 1 31  ? -10.407 4.527   -2.201  1.00 0.00 ? 31  PHE A HD2  1  
ATOM 490   H HE1  . PHE A 1 31  ? -14.378 7.431   -2.382  1.00 0.00 ? 31  PHE A HE1  1  
ATOM 491   H HE2  . PHE A 1 31  ? -10.810 6.169   -0.415  1.00 0.00 ? 31  PHE A HE2  1  
ATOM 492   H HZ   . PHE A 1 31  ? -12.796 7.621   -0.503  1.00 0.00 ? 31  PHE A HZ   1  
ATOM 493   N N    . LEU A 1 32  ? -8.939  4.614   -5.012  1.00 0.00 ? 32  LEU A N    1  
ATOM 494   C CA   . LEU A 1 32  ? -7.668  5.172   -4.560  1.00 0.00 ? 32  LEU A CA   1  
ATOM 495   C C    . LEU A 1 32  ? -7.017  6.013   -5.665  1.00 0.00 ? 32  LEU A C    1  
ATOM 496   O O    . LEU A 1 32  ? -6.185  6.886   -5.396  1.00 0.00 ? 32  LEU A O    1  
ATOM 497   C CB   . LEU A 1 32  ? -6.736  4.027   -4.126  1.00 0.00 ? 32  LEU A CB   1  
ATOM 498   C CG   . LEU A 1 32  ? -5.665  4.398   -3.091  1.00 0.00 ? 32  LEU A CG   1  
ATOM 499   C CD1  . LEU A 1 32  ? -6.314  4.915   -1.810  1.00 0.00 ? 32  LEU A CD1  1  
ATOM 500   C CD2  . LEU A 1 32  ? -4.769  3.198   -2.794  1.00 0.00 ? 32  LEU A CD2  1  
ATOM 501   H H    . LEU A 1 32  ? -9.025  3.641   -5.092  1.00 0.00 ? 32  LEU A H    1  
ATOM 502   H HA   . LEU A 1 32  ? -7.867  5.807   -3.708  1.00 0.00 ? 32  LEU A HA   1  
ATOM 503   H HB2  . LEU A 1 32  ? -7.346  3.235   -3.710  1.00 0.00 ? 32  LEU A HB2  1  
ATOM 504   H HB3  . LEU A 1 32  ? -6.237  3.642   -5.006  1.00 0.00 ? 32  LEU A HB3  1  
ATOM 505   H HG   . LEU A 1 32  ? -5.044  5.188   -3.491  1.00 0.00 ? 32  LEU A HG   1  
ATOM 506   H HD11 . LEU A 1 32  ? -6.907  5.790   -2.034  1.00 0.00 ? 32  LEU A HD11 1  
ATOM 507   H HD12 . LEU A 1 32  ? -5.545  5.178   -1.097  1.00 0.00 ? 32  LEU A HD12 1  
ATOM 508   H HD13 . LEU A 1 32  ? -6.948  4.147   -1.388  1.00 0.00 ? 32  LEU A HD13 1  
ATOM 509   H HD21 . LEU A 1 32  ? -5.363  2.391   -2.387  1.00 0.00 ? 32  LEU A HD21 1  
ATOM 510   H HD22 . LEU A 1 32  ? -4.012  3.482   -2.077  1.00 0.00 ? 32  LEU A HD22 1  
ATOM 511   H HD23 . LEU A 1 32  ? -4.292  2.871   -3.706  1.00 0.00 ? 32  LEU A HD23 1  
ATOM 512   N N    . LYS A 1 33  ? -7.415  5.747   -6.909  1.00 0.00 ? 33  LYS A N    1  
ATOM 513   C CA   . LYS A 1 33  ? -6.911  6.482   -8.068  1.00 0.00 ? 33  LYS A CA   1  
ATOM 514   C C    . LYS A 1 33  ? -7.391  7.932   -8.070  1.00 0.00 ? 33  LYS A C    1  
ATOM 515   O O    . LYS A 1 33  ? -6.690  8.818   -8.561  1.00 0.00 ? 33  LYS A O    1  
ATOM 516   C CB   . LYS A 1 33  ? -7.336  5.786   -9.373  1.00 0.00 ? 33  LYS A CB   1  
ATOM 517   C CG   . LYS A 1 33  ? -6.461  4.591   -9.740  1.00 0.00 ? 33  LYS A CG   1  
ATOM 518   C CD   . LYS A 1 33  ? -7.028  3.799   -10.917 1.00 0.00 ? 33  LYS A CD   1  
ATOM 519   C CE   . LYS A 1 33  ? -6.019  2.785   -11.453 1.00 0.00 ? 33  LYS A CE   1  
ATOM 520   N NZ   . LYS A 1 33  ? -5.383  1.997   -10.364 1.00 0.00 ? 33  LYS A NZ   1  
ATOM 521   H H    . LYS A 1 33  ? -8.065  5.025   -7.053  1.00 0.00 ? 33  LYS A H    1  
ATOM 522   H HA   . LYS A 1 33  ? -5.831  6.480   -8.010  1.00 0.00 ? 33  LYS A HA   1  
ATOM 523   H HB2  . LYS A 1 33  ? -8.355  5.442   -9.268  1.00 0.00 ? 33  LYS A HB2  1  
ATOM 524   H HB3  . LYS A 1 33  ? -7.289  6.500   -10.184 1.00 0.00 ? 33  LYS A HB3  1  
ATOM 525   H HG2  . LYS A 1 33  ? -5.477  4.949   -10.002 1.00 0.00 ? 33  LYS A HG2  1  
ATOM 526   H HG3  . LYS A 1 33  ? -6.387  3.937   -8.883  1.00 0.00 ? 33  LYS A HG3  1  
ATOM 527   H HD2  . LYS A 1 33  ? -7.914  3.274   -10.591 1.00 0.00 ? 33  LYS A HD2  1  
ATOM 528   H HD3  . LYS A 1 33  ? -7.290  4.488   -11.710 1.00 0.00 ? 33  LYS A HD3  1  
ATOM 529   H HE2  . LYS A 1 33  ? -6.530  2.109   -12.122 1.00 0.00 ? 33  LYS A HE2  1  
ATOM 530   H HE3  . LYS A 1 33  ? -5.249  3.313   -11.997 1.00 0.00 ? 33  LYS A HE3  1  
ATOM 531   H HZ1  . LYS A 1 33  ? -6.108  1.569   -9.754  1.00 0.00 ? 33  LYS A HZ1  1  
ATOM 532   H HZ2  . LYS A 1 33  ? -4.775  2.612   -9.784  1.00 0.00 ? 33  LYS A HZ2  1  
ATOM 533   H HZ3  . LYS A 1 33  ? -4.797  1.238   -10.768 1.00 0.00 ? 33  LYS A HZ3  1  
ATOM 534   N N    . THR A 1 34  ? -8.572  8.182   -7.504  1.00 0.00 ? 34  THR A N    1  
ATOM 535   C CA   . THR A 1 34  ? -9.146  9.528   -7.509  1.00 0.00 ? 34  THR A CA   1  
ATOM 536   C C    . THR A 1 34  ? -8.290  10.483  -6.673  1.00 0.00 ? 34  THR A C    1  
ATOM 537   O O    . THR A 1 34  ? -8.342  11.700  -6.853  1.00 0.00 ? 34  THR A O    1  
ATOM 538   C CB   . THR A 1 34  ? -10.609 9.542   -6.988  1.00 0.00 ? 34  THR A CB   1  
ATOM 539   O OG1  . THR A 1 34  ? -11.278 10.735  -7.429  1.00 0.00 ? 34  THR A OG1  1  
ATOM 540   C CG2  . THR A 1 34  ? -10.670 9.474   -5.463  1.00 0.00 ? 34  THR A CG2  1  
ATOM 541   H H    . THR A 1 34  ? -9.067  7.450   -7.074  1.00 0.00 ? 34  THR A H    1  
ATOM 542   H HA   . THR A 1 34  ? -9.150  9.877   -8.534  1.00 0.00 ? 34  THR A HA   1  
ATOM 543   H HB   . THR A 1 34  ? -11.127 8.682   -7.392  1.00 0.00 ? 34  THR A HB   1  
ATOM 544   H HG1  . THR A 1 34  ? -10.826 11.511  -7.066  1.00 0.00 ? 34  THR A HG1  1  
ATOM 545   H HG21 . THR A 1 34  ? -11.702 9.434   -5.144  1.00 0.00 ? 34  THR A HG21 1  
ATOM 546   H HG22 . THR A 1 34  ? -10.200 10.353  -5.044  1.00 0.00 ? 34  THR A HG22 1  
ATOM 547   H HG23 . THR A 1 34  ? -10.153 8.592   -5.118  1.00 0.00 ? 34  THR A HG23 1  
ATOM 548   N N    . GLU A 1 35  ? -7.504  9.917   -5.758  1.00 0.00 ? 35  GLU A N    1  
ATOM 549   C CA   . GLU A 1 35  ? -6.622  10.702  -4.900  1.00 0.00 ? 35  GLU A CA   1  
ATOM 550   C C    . GLU A 1 35  ? -5.156  10.319  -5.130  1.00 0.00 ? 35  GLU A C    1  
ATOM 551   O O    . GLU A 1 35  ? -4.264  10.774  -4.407  1.00 0.00 ? 35  GLU A O    1  
ATOM 552   C CB   . GLU A 1 35  ? -7.023  10.523  -3.428  1.00 0.00 ? 35  GLU A CB   1  
ATOM 553   C CG   . GLU A 1 35  ? -7.160  9.069   -2.984  1.00 0.00 ? 35  GLU A CG   1  
ATOM 554   C CD   . GLU A 1 35  ? -7.612  8.947   -1.535  1.00 0.00 ? 35  GLU A CD   1  
ATOM 555   O OE1  . GLU A 1 35  ? -6.754  9.037   -0.634  1.00 0.00 ? 35  GLU A OE1  1  
ATOM 556   O OE2  . GLU A 1 35  ? -8.826  8.782   -1.293  1.00 0.00 ? 35  GLU A OE2  1  
ATOM 557   H H    . GLU A 1 35  ? -7.524  8.943   -5.652  1.00 0.00 ? 35  GLU A H    1  
ATOM 558   H HA   . GLU A 1 35  ? -6.742  11.744  -5.167  1.00 0.00 ? 35  GLU A HA   1  
ATOM 559   H HB2  . GLU A 1 35  ? -6.279  10.998  -2.804  1.00 0.00 ? 35  GLU A HB2  1  
ATOM 560   H HB3  . GLU A 1 35  ? -7.973  11.015  -3.269  1.00 0.00 ? 35  GLU A HB3  1  
ATOM 561   H HG2  . GLU A 1 35  ? -7.885  8.576   -3.618  1.00 0.00 ? 35  GLU A HG2  1  
ATOM 562   H HG3  . GLU A 1 35  ? -6.201  8.580   -3.092  1.00 0.00 ? 35  GLU A HG3  1  
ATOM 563   N N    . PHE A 1 36  ? -4.924  9.482   -6.147  1.00 0.00 ? 36  PHE A N    1  
ATOM 564   C CA   . PHE A 1 36  ? -3.572  9.095   -6.574  1.00 0.00 ? 36  PHE A CA   1  
ATOM 565   C C    . PHE A 1 36  ? -2.778  8.437   -5.434  1.00 0.00 ? 36  PHE A C    1  
ATOM 566   O O    . PHE A 1 36  ? -1.554  8.314   -5.496  1.00 0.00 ? 36  PHE A O    1  
ATOM 567   C CB   . PHE A 1 36  ? -2.827  10.328  -7.132  1.00 0.00 ? 36  PHE A CB   1  
ATOM 568   C CG   . PHE A 1 36  ? -1.465  10.026  -7.720  1.00 0.00 ? 36  PHE A CG   1  
ATOM 569   C CD1  . PHE A 1 36  ? -1.345  9.227   -8.849  1.00 0.00 ? 36  PHE A CD1  1  
ATOM 570   C CD2  . PHE A 1 36  ? -0.309  10.539  -7.144  1.00 0.00 ? 36  PHE A CD2  1  
ATOM 571   C CE1  . PHE A 1 36  ? -0.104  8.946   -9.388  1.00 0.00 ? 36  PHE A CE1  1  
ATOM 572   C CE2  . PHE A 1 36  ? 0.934   10.261  -7.682  1.00 0.00 ? 36  PHE A CE2  1  
ATOM 573   C CZ   . PHE A 1 36  ? 1.035   9.462   -8.804  1.00 0.00 ? 36  PHE A CZ   1  
ATOM 574   H H    . PHE A 1 36  ? -5.691  9.118   -6.635  1.00 0.00 ? 36  PHE A H    1  
ATOM 575   H HA   . PHE A 1 36  ? -3.683  8.371   -7.370  1.00 0.00 ? 36  PHE A HA   1  
ATOM 576   H HB2  . PHE A 1 36  ? -3.428  10.776  -7.911  1.00 0.00 ? 36  PHE A HB2  1  
ATOM 577   H HB3  . PHE A 1 36  ? -2.697  11.048  -6.335  1.00 0.00 ? 36  PHE A HB3  1  
ATOM 578   H HD1  . PHE A 1 36  ? -2.235  8.820   -9.308  1.00 0.00 ? 36  PHE A HD1  1  
ATOM 579   H HD2  . PHE A 1 36  ? -0.387  11.165  -6.266  1.00 0.00 ? 36  PHE A HD2  1  
ATOM 580   H HE1  . PHE A 1 36  ? -0.027  8.321   -10.267 1.00 0.00 ? 36  PHE A HE1  1  
ATOM 581   H HE2  . PHE A 1 36  ? 1.825   10.665  -7.224  1.00 0.00 ? 36  PHE A HE2  1  
ATOM 582   H HZ   . PHE A 1 36  ? 2.006   9.243   -9.226  1.00 0.00 ? 36  PHE A HZ   1  
ATOM 583   N N    . SER A 1 37  ? -3.482  7.958   -4.416  1.00 0.00 ? 37  SER A N    1  
ATOM 584   C CA   . SER A 1 37  ? -2.831  7.347   -3.261  1.00 0.00 ? 37  SER A CA   1  
ATOM 585   C C    . SER A 1 37  ? -2.410  5.908   -3.577  1.00 0.00 ? 37  SER A C    1  
ATOM 586   O O    . SER A 1 37  ? -1.843  5.213   -2.728  1.00 0.00 ? 37  SER A O    1  
ATOM 587   C CB   . SER A 1 37  ? -3.760  7.392   -2.043  1.00 0.00 ? 37  SER A CB   1  
ATOM 588   O OG   . SER A 1 37  ? -4.147  8.725   -1.749  1.00 0.00 ? 37  SER A OG   1  
ATOM 589   H H    . SER A 1 37  ? -4.460  8.007   -4.443  1.00 0.00 ? 37  SER A H    1  
ATOM 590   H HA   . SER A 1 37  ? -1.941  7.923   -3.040  1.00 0.00 ? 37  SER A HA   1  
ATOM 591   H HB2  . SER A 1 37  ? -4.648  6.812   -2.246  1.00 0.00 ? 37  SER A HB2  1  
ATOM 592   H HB3  . SER A 1 37  ? -3.250  6.980   -1.183  1.00 0.00 ? 37  SER A HB3  1  
ATOM 593   H HG   . SER A 1 37  ? -4.939  8.710   -1.193  1.00 0.00 ? 37  SER A HG   1  
ATOM 594   N N    . GLU A 1 38  ? -2.684  5.473   -4.813  1.00 0.00 ? 38  GLU A N    1  
ATOM 595   C CA   . GLU A 1 38  ? -2.276  4.145   -5.280  1.00 0.00 ? 38  GLU A CA   1  
ATOM 596   C C    . GLU A 1 38  ? -0.758  3.990   -5.201  1.00 0.00 ? 38  GLU A C    1  
ATOM 597   O O    . GLU A 1 38  ? -0.237  2.877   -5.132  1.00 0.00 ? 38  GLU A O    1  
ATOM 598   C CB   . GLU A 1 38  ? -2.752  3.899   -6.720  1.00 0.00 ? 38  GLU A CB   1  
ATOM 599   C CG   . GLU A 1 38  ? -2.238  4.924   -7.731  1.00 0.00 ? 38  GLU A CG   1  
ATOM 600   C CD   . GLU A 1 38  ? -2.331  4.439   -9.172  1.00 0.00 ? 38  GLU A CD   1  
ATOM 601   O OE1  . GLU A 1 38  ? -3.398  3.917   -9.570  1.00 0.00 ? 38  GLU A OE1  1  
ATOM 602   O OE2  . GLU A 1 38  ? -1.341  4.584   -9.920  1.00 0.00 ? 38  GLU A OE2  1  
ATOM 603   H H    . GLU A 1 38  ? -3.174  6.059   -5.424  1.00 0.00 ? 38  GLU A H    1  
ATOM 604   H HA   . GLU A 1 38  ? -2.734  3.413   -4.629  1.00 0.00 ? 38  GLU A HA   1  
ATOM 605   H HB2  . GLU A 1 38  ? -2.421  2.920   -7.031  1.00 0.00 ? 38  GLU A HB2  1  
ATOM 606   H HB3  . GLU A 1 38  ? -3.833  3.921   -6.736  1.00 0.00 ? 38  GLU A HB3  1  
ATOM 607   H HG2  . GLU A 1 38  ? -2.822  5.828   -7.635  1.00 0.00 ? 38  GLU A HG2  1  
ATOM 608   H HG3  . GLU A 1 38  ? -1.203  5.144   -7.505  1.00 0.00 ? 38  GLU A HG3  1  
ATOM 609   N N    . GLU A 1 39  ? -0.065  5.123   -5.208  1.00 0.00 ? 39  GLU A N    1  
ATOM 610   C CA   . GLU A 1 39  ? 1.386   5.157   -5.074  1.00 0.00 ? 39  GLU A CA   1  
ATOM 611   C C    . GLU A 1 39  ? 1.807   4.379   -3.821  1.00 0.00 ? 39  GLU A C    1  
ATOM 612   O O    . GLU A 1 39  ? 2.704   3.538   -3.863  1.00 0.00 ? 39  GLU A O    1  
ATOM 613   C CB   . GLU A 1 39  ? 1.839   6.630   -4.989  1.00 0.00 ? 39  GLU A CB   1  
ATOM 614   C CG   . GLU A 1 39  ? 3.273   6.903   -5.435  1.00 0.00 ? 39  GLU A CG   1  
ATOM 615   C CD   . GLU A 1 39  ? 4.328   6.254   -4.554  1.00 0.00 ? 39  GLU A CD   1  
ATOM 616   O OE1  . GLU A 1 39  ? 4.366   6.562   -3.346  1.00 0.00 ? 39  GLU A OE1  1  
ATOM 617   O OE2  . GLU A 1 39  ? 5.125   5.447   -5.080  1.00 0.00 ? 39  GLU A OE2  1  
ATOM 618   H H    . GLU A 1 39  ? -0.548  5.970   -5.310  1.00 0.00 ? 39  GLU A H    1  
ATOM 619   H HA   . GLU A 1 39  ? 1.819   4.694   -5.951  1.00 0.00 ? 39  GLU A HA   1  
ATOM 620   H HB2  . GLU A 1 39  ? 1.183   7.225   -5.608  1.00 0.00 ? 39  GLU A HB2  1  
ATOM 621   H HB3  . GLU A 1 39  ? 1.735   6.964   -3.963  1.00 0.00 ? 39  GLU A HB3  1  
ATOM 622   H HG2  . GLU A 1 39  ? 3.393   6.536   -6.445  1.00 0.00 ? 39  GLU A HG2  1  
ATOM 623   H HG3  . GLU A 1 39  ? 3.435   7.974   -5.431  1.00 0.00 ? 39  GLU A HG3  1  
ATOM 624   N N    . ASN A 1 40  ? 1.100   4.643   -2.724  1.00 0.00 ? 40  ASN A N    1  
ATOM 625   C CA   . ASN A 1 40  ? 1.395   4.041   -1.424  1.00 0.00 ? 40  ASN A CA   1  
ATOM 626   C C    . ASN A 1 40  ? 1.190   2.523   -1.445  1.00 0.00 ? 40  ASN A C    1  
ATOM 627   O O    . ASN A 1 40  ? 2.084   1.752   -1.061  1.00 0.00 ? 40  ASN A O    1  
ATOM 628   C CB   . ASN A 1 40  ? 0.505   4.680   -0.342  1.00 0.00 ? 40  ASN A CB   1  
ATOM 629   C CG   . ASN A 1 40  ? 0.856   6.137   -0.063  1.00 0.00 ? 40  ASN A CG   1  
ATOM 630   O OD1  . ASN A 1 40  ? 2.022   6.530   -0.100  1.00 0.00 ? 40  ASN A OD1  1  
ATOM 631   N ND2  . ASN A 1 40  ? -0.154  6.951   0.213   1.00 0.00 ? 40  ASN A ND2  1  
ATOM 632   H H    . ASN A 1 40  ? 0.347   5.264   -2.794  1.00 0.00 ? 40  ASN A H    1  
ATOM 633   H HA   . ASN A 1 40  ? 2.432   4.248   -1.189  1.00 0.00 ? 40  ASN A HA   1  
ATOM 634   H HB2  . ASN A 1 40  ? -0.526  4.635   -0.664  1.00 0.00 ? 40  ASN A HB2  1  
ATOM 635   H HB3  . ASN A 1 40  ? 0.611   4.123   0.578   1.00 0.00 ? 40  ASN A HB3  1  
ATOM 636   H HD21 . ASN A 1 40  ? -1.061  6.580   0.224   1.00 0.00 ? 40  ASN A HD21 1  
ATOM 637   H HD22 . ASN A 1 40  ? 0.047   7.896   0.386   1.00 0.00 ? 40  ASN A HD22 1  
ATOM 638   N N    . ILE A 1 41  ? 0.012   2.093   -1.899  1.00 0.00 ? 41  ILE A N    1  
ATOM 639   C CA   . ILE A 1 41  ? -0.322  0.670   -1.911  1.00 0.00 ? 41  ILE A CA   1  
ATOM 640   C C    . ILE A 1 41  ? 0.653   -0.098  -2.804  1.00 0.00 ? 41  ILE A C    1  
ATOM 641   O O    . ILE A 1 41  ? 1.173   -1.143  -2.411  1.00 0.00 ? 41  ILE A O    1  
ATOM 642   C CB   . ILE A 1 41  ? -1.795  0.408   -2.357  1.00 0.00 ? 41  ILE A CB   1  
ATOM 643   C CG1  . ILE A 1 41  ? -2.148  -1.087  -2.238  1.00 0.00 ? 41  ILE A CG1  1  
ATOM 644   C CG2  . ILE A 1 41  ? -2.041  0.899   -3.780  1.00 0.00 ? 41  ILE A CG2  1  
ATOM 645   C CD1  . ILE A 1 41  ? -3.582  -1.416  -2.621  1.00 0.00 ? 41  ILE A CD1  1  
ATOM 646   H H    . ILE A 1 41  ? -0.640  2.744   -2.231  1.00 0.00 ? 41  ILE A H    1  
ATOM 647   H HA   . ILE A 1 41  ? -0.212  0.306   -0.897  1.00 0.00 ? 41  ILE A HA   1  
ATOM 648   H HB   . ILE A 1 41  ? -2.443  0.971   -1.699  1.00 0.00 ? 41  ILE A HB   1  
ATOM 649   H HG12 . ILE A 1 41  ? -1.499  -1.656  -2.887  1.00 0.00 ? 41  ILE A HG12 1  
ATOM 650   H HG13 . ILE A 1 41  ? -1.996  -1.407  -1.216  1.00 0.00 ? 41  ILE A HG13 1  
ATOM 651   H HG21 . ILE A 1 41  ? -1.396  0.366   -4.465  1.00 0.00 ? 41  ILE A HG21 1  
ATOM 652   H HG22 . ILE A 1 41  ? -1.830  1.957   -3.838  1.00 0.00 ? 41  ILE A HG22 1  
ATOM 653   H HG23 . ILE A 1 41  ? -3.073  0.726   -4.050  1.00 0.00 ? 41  ILE A HG23 1  
ATOM 654   H HD11 . ILE A 1 41  ? -3.752  -1.153  -3.655  1.00 0.00 ? 41  ILE A HD11 1  
ATOM 655   H HD12 . ILE A 1 41  ? -4.262  -0.858  -1.993  1.00 0.00 ? 41  ILE A HD12 1  
ATOM 656   H HD13 . ILE A 1 41  ? -3.757  -2.473  -2.488  1.00 0.00 ? 41  ILE A HD13 1  
ATOM 657   N N    . GLU A 1 42  ? 0.935   0.448   -3.985  1.00 0.00 ? 42  GLU A N    1  
ATOM 658   C CA   . GLU A 1 42  ? 1.848   -0.197  -4.922  1.00 0.00 ? 42  GLU A CA   1  
ATOM 659   C C    . GLU A 1 42  ? 3.294   -0.078  -4.450  1.00 0.00 ? 42  GLU A C    1  
ATOM 660   O O    . GLU A 1 42  ? 4.150   -0.863  -4.862  1.00 0.00 ? 42  GLU A O    1  
ATOM 661   C CB   . GLU A 1 42  ? 1.691   0.385   -6.333  1.00 0.00 ? 42  GLU A CB   1  
ATOM 662   C CG   . GLU A 1 42  ? 0.368   0.020   -6.999  1.00 0.00 ? 42  GLU A CG   1  
ATOM 663   C CD   . GLU A 1 42  ? 0.314   0.423   -8.463  1.00 0.00 ? 42  GLU A CD   1  
ATOM 664   O OE1  . GLU A 1 42  ? 0.910   -0.288  -9.301  1.00 0.00 ? 42  GLU A OE1  1  
ATOM 665   O OE2  . GLU A 1 42  ? -0.319  1.446   -8.790  1.00 0.00 ? 42  GLU A OE2  1  
ATOM 666   H H    . GLU A 1 42  ? 0.526   1.306   -4.229  1.00 0.00 ? 42  GLU A H    1  
ATOM 667   H HA   . GLU A 1 42  ? 1.589   -1.247  -4.953  1.00 0.00 ? 42  GLU A HA   1  
ATOM 668   H HB2  . GLU A 1 42  ? 1.757   1.463   -6.276  1.00 0.00 ? 42  GLU A HB2  1  
ATOM 669   H HB3  . GLU A 1 42  ? 2.496   0.018   -6.955  1.00 0.00 ? 42  GLU A HB3  1  
ATOM 670   H HG2  . GLU A 1 42  ? 0.230   -1.049  -6.930  1.00 0.00 ? 42  GLU A HG2  1  
ATOM 671   H HG3  . GLU A 1 42  ? -0.434  0.513   -6.469  1.00 0.00 ? 42  GLU A HG3  1  
ATOM 672   N N    . PHE A 1 43  ? 3.562   0.897   -3.585  1.00 0.00 ? 43  PHE A N    1  
ATOM 673   C CA   . PHE A 1 43  ? 4.885   1.044   -2.987  1.00 0.00 ? 43  PHE A CA   1  
ATOM 674   C C    . PHE A 1 43  ? 5.272   -0.226  -2.238  1.00 0.00 ? 43  PHE A C    1  
ATOM 675   O O    . PHE A 1 43  ? 6.268   -0.875  -2.573  1.00 0.00 ? 43  PHE A O    1  
ATOM 676   C CB   . PHE A 1 43  ? 4.935   2.252   -2.040  1.00 0.00 ? 43  PHE A CB   1  
ATOM 677   C CG   . PHE A 1 43  ? 6.143   2.262   -1.132  1.00 0.00 ? 43  PHE A CG   1  
ATOM 678   C CD1  . PHE A 1 43  ? 7.415   2.480   -1.642  1.00 0.00 ? 43  PHE A CD1  1  
ATOM 679   C CD2  . PHE A 1 43  ? 6.004   2.047   0.234   1.00 0.00 ? 43  PHE A CD2  1  
ATOM 680   C CE1  . PHE A 1 43  ? 8.519   2.483   -0.809  1.00 0.00 ? 43  PHE A CE1  1  
ATOM 681   C CE2  . PHE A 1 43  ? 7.104   2.050   1.067   1.00 0.00 ? 43  PHE A CE2  1  
ATOM 682   C CZ   . PHE A 1 43  ? 8.361   2.269   0.546   1.00 0.00 ? 43  PHE A CZ   1  
ATOM 683   H H    . PHE A 1 43  ? 2.859   1.541   -3.351  1.00 0.00 ? 43  PHE A H    1  
ATOM 684   H HA   . PHE A 1 43  ? 5.593   1.200   -3.792  1.00 0.00 ? 43  PHE A HA   1  
ATOM 685   H HB2  . PHE A 1 43  ? 4.952   3.160   -2.625  1.00 0.00 ? 43  PHE A HB2  1  
ATOM 686   H HB3  . PHE A 1 43  ? 4.051   2.251   -1.419  1.00 0.00 ? 43  PHE A HB3  1  
ATOM 687   H HD1  . PHE A 1 43  ? 7.541   2.650   -2.702  1.00 0.00 ? 43  PHE A HD1  1  
ATOM 688   H HD2  . PHE A 1 43  ? 5.019   1.876   0.645   1.00 0.00 ? 43  PHE A HD2  1  
ATOM 689   H HE1  . PHE A 1 43  ? 9.505   2.654   -1.218  1.00 0.00 ? 43  PHE A HE1  1  
ATOM 690   H HE2  . PHE A 1 43  ? 6.979   1.883   2.128   1.00 0.00 ? 43  PHE A HE2  1  
ATOM 691   H HZ   . PHE A 1 43  ? 9.223   2.270   1.198   1.00 0.00 ? 43  PHE A HZ   1  
ATOM 692   N N    . TRP A 1 44  ? 4.485   -0.599  -1.228  1.00 0.00 ? 44  TRP A N    1  
ATOM 693   C CA   . TRP A 1 44  ? 4.827   -1.779  -0.435  1.00 0.00 ? 44  TRP A CA   1  
ATOM 694   C C    . TRP A 1 44  ? 4.511   -3.069  -1.192  1.00 0.00 ? 44  TRP A C    1  
ATOM 695   O O    . TRP A 1 44  ? 5.044   -4.131  -0.862  1.00 0.00 ? 44  TRP A O    1  
ATOM 696   C CB   . TRP A 1 44  ? 4.184   -1.761  0.961   1.00 0.00 ? 44  TRP A CB   1  
ATOM 697   C CG   . TRP A 1 44  ? 2.692   -1.613  0.996   1.00 0.00 ? 44  TRP A CG   1  
ATOM 698   C CD1  . TRP A 1 44  ? 1.998   -0.478  1.293   1.00 0.00 ? 44  TRP A CD1  1  
ATOM 699   C CD2  . TRP A 1 44  ? 1.711   -2.634  0.767   1.00 0.00 ? 44  TRP A CD2  1  
ATOM 700   N NE1  . TRP A 1 44  ? 0.652   -0.727  1.267   1.00 0.00 ? 44  TRP A NE1  1  
ATOM 701   C CE2  . TRP A 1 44  ? 0.448   -2.040  0.935   1.00 0.00 ? 44  TRP A CE2  1  
ATOM 702   C CE3  . TRP A 1 44  ? 1.779   -3.988  0.431   1.00 0.00 ? 44  TRP A CE3  1  
ATOM 703   C CZ2  . TRP A 1 44  ? -0.736  -2.751  0.780   1.00 0.00 ? 44  TRP A CZ2  1  
ATOM 704   C CZ3  . TRP A 1 44  ? 0.602   -4.695  0.276   1.00 0.00 ? 44  TRP A CZ3  1  
ATOM 705   C CH2  . TRP A 1 44  ? -0.642  -4.073  0.449   1.00 0.00 ? 44  TRP A CH2  1  
ATOM 706   H H    . TRP A 1 44  ? 3.673   -0.074  -1.018  1.00 0.00 ? 44  TRP A H    1  
ATOM 707   H HA   . TRP A 1 44  ? 5.902   -1.749  -0.300  1.00 0.00 ? 44  TRP A HA   1  
ATOM 708   H HB2  . TRP A 1 44  ? 4.428   -2.683  1.464   1.00 0.00 ? 44  TRP A HB2  1  
ATOM 709   H HB3  . TRP A 1 44  ? 4.611   -0.941  1.524   1.00 0.00 ? 44  TRP A HB3  1  
ATOM 710   H HD1  . TRP A 1 44  ? 2.458   0.472   1.525   1.00 0.00 ? 44  TRP A HD1  1  
ATOM 711   H HE1  . TRP A 1 44  ? -0.047  -0.070  1.449   1.00 0.00 ? 44  TRP A HE1  1  
ATOM 712   H HE3  . TRP A 1 44  ? 2.730   -4.483  0.292   1.00 0.00 ? 44  TRP A HE3  1  
ATOM 713   H HZ2  . TRP A 1 44  ? -1.703  -2.288  0.910   1.00 0.00 ? 44  TRP A HZ2  1  
ATOM 714   H HZ3  . TRP A 1 44  ? 0.635   -5.741  0.013   1.00 0.00 ? 44  TRP A HZ3  1  
ATOM 715   H HH2  . TRP A 1 44  ? -1.536  -4.661  0.317   1.00 0.00 ? 44  TRP A HH2  1  
ATOM 716   N N    . ILE A 1 45  ? 3.662   -2.978  -2.213  1.00 0.00 ? 45  ILE A N    1  
ATOM 717   C CA   . ILE A 1 45  ? 3.467   -4.097  -3.135  1.00 0.00 ? 45  ILE A CA   1  
ATOM 718   C C    . ILE A 1 45  ? 4.778   -4.377  -3.873  1.00 0.00 ? 45  ILE A C    1  
ATOM 719   O O    . ILE A 1 45  ? 5.180   -5.530  -4.045  1.00 0.00 ? 45  ILE A O    1  
ATOM 720   C CB   . ILE A 1 45  ? 2.324   -3.819  -4.154  1.00 0.00 ? 45  ILE A CB   1  
ATOM 721   C CG1  . ILE A 1 45  ? 0.954   -3.928  -3.461  1.00 0.00 ? 45  ILE A CG1  1  
ATOM 722   C CG2  . ILE A 1 45  ? 2.401   -4.766  -5.355  1.00 0.00 ? 45  ILE A CG2  1  
ATOM 723   C CD1  . ILE A 1 45  ? -0.222  -3.637  -4.373  1.00 0.00 ? 45  ILE A CD1  1  
ATOM 724   H H    . ILE A 1 45  ? 3.155   -2.147  -2.347  1.00 0.00 ? 45  ILE A H    1  
ATOM 725   H HA   . ILE A 1 45  ? 3.202   -4.970  -2.550  1.00 0.00 ? 45  ILE A HA   1  
ATOM 726   H HB   . ILE A 1 45  ? 2.448   -2.809  -4.522  1.00 0.00 ? 45  ILE A HB   1  
ATOM 727   H HG12 . ILE A 1 45  ? 0.832   -4.930  -3.075  1.00 0.00 ? 45  ILE A HG12 1  
ATOM 728   H HG13 . ILE A 1 45  ? 0.916   -3.227  -2.638  1.00 0.00 ? 45  ILE A HG13 1  
ATOM 729   H HG21 . ILE A 1 45  ? 3.351   -4.639  -5.854  1.00 0.00 ? 45  ILE A HG21 1  
ATOM 730   H HG22 . ILE A 1 45  ? 1.602   -4.536  -6.044  1.00 0.00 ? 45  ILE A HG22 1  
ATOM 731   H HG23 . ILE A 1 45  ? 2.304   -5.787  -5.018  1.00 0.00 ? 45  ILE A HG23 1  
ATOM 732   H HD11 . ILE A 1 45  ? -0.231  -4.344  -5.190  1.00 0.00 ? 45  ILE A HD11 1  
ATOM 733   H HD12 . ILE A 1 45  ? -0.134  -2.635  -4.766  1.00 0.00 ? 45  ILE A HD12 1  
ATOM 734   H HD13 . ILE A 1 45  ? -1.141  -3.723  -3.812  1.00 0.00 ? 45  ILE A HD13 1  
ATOM 735   N N    . ALA A 1 46  ? 5.454   -3.302  -4.275  1.00 0.00 ? 46  ALA A N    1  
ATOM 736   C CA   . ALA A 1 46  ? 6.763   -3.404  -4.914  1.00 0.00 ? 46  ALA A CA   1  
ATOM 737   C C    . ALA A 1 46  ? 7.793   -3.945  -3.924  1.00 0.00 ? 46  ALA A C    1  
ATOM 738   O O    . ALA A 1 46  ? 8.738   -4.635  -4.308  1.00 0.00 ? 46  ALA A O    1  
ATOM 739   C CB   . ALA A 1 46  ? 7.201   -2.048  -5.458  1.00 0.00 ? 46  ALA A CB   1  
ATOM 740   H H    . ALA A 1 46  ? 5.061   -2.413  -4.140  1.00 0.00 ? 46  ALA A H    1  
ATOM 741   H HA   . ALA A 1 46  ? 6.678   -4.093  -5.746  1.00 0.00 ? 46  ALA A HA   1  
ATOM 742   H HB1  . ALA A 1 46  ? 6.465   -1.685  -6.162  1.00 0.00 ? 46  ALA A HB1  1  
ATOM 743   H HB2  . ALA A 1 46  ? 8.155   -2.149  -5.957  1.00 0.00 ? 46  ALA A HB2  1  
ATOM 744   H HB3  . ALA A 1 46  ? 7.296   -1.344  -4.643  1.00 0.00 ? 46  ALA A HB3  1  
ATOM 745   N N    . CYS A 1 47  ? 7.594   -3.628  -2.644  1.00 0.00 ? 47  CYS A N    1  
ATOM 746   C CA   . CYS A 1 47  ? 8.459   -4.132  -1.579  1.00 0.00 ? 47  CYS A CA   1  
ATOM 747   C C    . CYS A 1 47  ? 8.285   -5.645  -1.420  1.00 0.00 ? 47  CYS A C    1  
ATOM 748   O O    . CYS A 1 47  ? 9.234   -6.354  -1.085  1.00 0.00 ? 47  CYS A O    1  
ATOM 749   C CB   . CYS A 1 47  ? 8.156   -3.412  -0.258  1.00 0.00 ? 47  CYS A CB   1  
ATOM 750   S SG   . CYS A 1 47  ? 8.370   -1.616  -0.334  1.00 0.00 ? 47  CYS A SG   1  
ATOM 751   H H    . CYS A 1 47  ? 6.850   -3.034  -2.412  1.00 0.00 ? 47  CYS A H    1  
ATOM 752   H HA   . CYS A 1 47  ? 9.483   -3.929  -1.862  1.00 0.00 ? 47  CYS A HA   1  
ATOM 753   H HB2  . CYS A 1 47  ? 7.132   -3.605  0.026   1.00 0.00 ? 47  CYS A HB2  1  
ATOM 754   H HB3  . CYS A 1 47  ? 8.816   -3.788  0.511   1.00 0.00 ? 47  CYS A HB3  1  
ATOM 755   H HG   . CYS A 1 47  ? 7.922   -1.198  -1.510  1.00 0.00 ? 47  CYS A HG   1  
ATOM 756   N N    . GLU A 1 48  ? 7.070   -6.136  -1.670  1.00 0.00 ? 48  GLU A N    1  
ATOM 757   C CA   . GLU A 1 48  ? 6.808   -7.574  -1.656  1.00 0.00 ? 48  GLU A CA   1  
ATOM 758   C C    . GLU A 1 48  ? 7.447   -8.244  -2.871  1.00 0.00 ? 48  GLU A C    1  
ATOM 759   O O    . GLU A 1 48  ? 7.954   -9.362  -2.777  1.00 0.00 ? 48  GLU A O    1  
ATOM 760   C CB   . GLU A 1 48  ? 5.299   -7.860  -1.627  1.00 0.00 ? 48  GLU A CB   1  
ATOM 761   C CG   . GLU A 1 48  ? 4.637   -7.582  -0.281  1.00 0.00 ? 48  GLU A CG   1  
ATOM 762   C CD   . GLU A 1 48  ? 5.106   -8.539  0.807   1.00 0.00 ? 48  GLU A CD   1  
ATOM 763   O OE1  . GLU A 1 48  ? 4.806   -9.753  0.710   1.00 0.00 ? 48  GLU A OE1  1  
ATOM 764   O OE2  . GLU A 1 48  ? 5.763   -8.091  1.769   1.00 0.00 ? 48  GLU A OE2  1  
ATOM 765   H H    . GLU A 1 48  ? 6.334   -5.518  -1.862  1.00 0.00 ? 48  GLU A H    1  
ATOM 766   H HA   . GLU A 1 48  ? 7.259   -7.983  -0.761  1.00 0.00 ? 48  GLU A HA   1  
ATOM 767   H HB2  . GLU A 1 48  ? 4.813   -7.251  -2.375  1.00 0.00 ? 48  GLU A HB2  1  
ATOM 768   H HB3  . GLU A 1 48  ? 5.139   -8.903  -1.868  1.00 0.00 ? 48  GLU A HB3  1  
ATOM 769   H HG2  . GLU A 1 48  ? 4.868   -6.569  0.019   1.00 0.00 ? 48  GLU A HG2  1  
ATOM 770   H HG3  . GLU A 1 48  ? 3.566   -7.685  -0.394  1.00 0.00 ? 48  GLU A HG3  1  
ATOM 771   N N    . ASP A 1 49  ? 7.424   -7.557  -4.009  1.00 0.00 ? 49  ASP A N    1  
ATOM 772   C CA   . ASP A 1 49  ? 8.067   -8.068  -5.221  1.00 0.00 ? 49  ASP A CA   1  
ATOM 773   C C    . ASP A 1 49  ? 9.579   -8.133  -5.005  1.00 0.00 ? 49  ASP A C    1  
ATOM 774   O O    . ASP A 1 49  ? 10.254  -9.053  -5.466  1.00 0.00 ? 49  ASP A O    1  
ATOM 775   C CB   . ASP A 1 49  ? 7.732   -7.182  -6.429  1.00 0.00 ? 49  ASP A CB   1  
ATOM 776   C CG   . ASP A 1 49  ? 8.155   -7.813  -7.748  1.00 0.00 ? 49  ASP A CG   1  
ATOM 777   O OD1  . ASP A 1 49  ? 7.436   -8.712  -8.238  1.00 0.00 ? 49  ASP A OD1  1  
ATOM 778   O OD2  . ASP A 1 49  ? 9.194   -7.411  -8.314  1.00 0.00 ? 49  ASP A OD2  1  
ATOM 779   H H    . ASP A 1 49  ? 6.964   -6.690  -4.037  1.00 0.00 ? 49  ASP A H    1  
ATOM 780   H HA   . ASP A 1 49  ? 7.694   -9.069  -5.397  1.00 0.00 ? 49  ASP A HA   1  
ATOM 781   H HB2  . ASP A 1 49  ? 6.664   -7.012  -6.457  1.00 0.00 ? 49  ASP A HB2  1  
ATOM 782   H HB3  . ASP A 1 49  ? 8.237   -6.231  -6.323  1.00 0.00 ? 49  ASP A HB3  1  
ATOM 783   N N    . PHE A 1 50  ? 10.086  -7.140  -4.279  1.00 0.00 ? 50  PHE A N    1  
ATOM 784   C CA   . PHE A 1 50  ? 11.476  -7.111  -3.834  1.00 0.00 ? 50  PHE A CA   1  
ATOM 785   C C    . PHE A 1 50  ? 11.751  -8.294  -2.903  1.00 0.00 ? 50  PHE A C    1  
ATOM 786   O O    . PHE A 1 50  ? 12.736  -9.015  -3.060  1.00 0.00 ? 50  PHE A O    1  
ATOM 787   C CB   . PHE A 1 50  ? 11.741  -5.775  -3.116  1.00 0.00 ? 50  PHE A CB   1  
ATOM 788   C CG   . PHE A 1 50  ? 13.023  -5.725  -2.320  1.00 0.00 ? 50  PHE A CG   1  
ATOM 789   C CD1  . PHE A 1 50  ? 14.242  -5.548  -2.950  1.00 0.00 ? 50  PHE A CD1  1  
ATOM 790   C CD2  . PHE A 1 50  ? 13.000  -5.847  -0.936  1.00 0.00 ? 50  PHE A CD2  1  
ATOM 791   C CE1  . PHE A 1 50  ? 15.412  -5.497  -2.220  1.00 0.00 ? 50  PHE A CE1  1  
ATOM 792   C CE2  . PHE A 1 50  ? 14.168  -5.794  -0.202  1.00 0.00 ? 50  PHE A CE2  1  
ATOM 793   C CZ   . PHE A 1 50  ? 15.376  -5.618  -0.846  1.00 0.00 ? 50  PHE A CZ   1  
ATOM 794   H H    . PHE A 1 50  ? 9.500   -6.394  -4.035  1.00 0.00 ? 50  PHE A H    1  
ATOM 795   H HA   . PHE A 1 50  ? 12.114  -7.183  -4.703  1.00 0.00 ? 50  PHE A HA   1  
ATOM 796   H HB2  . PHE A 1 50  ? 11.784  -4.985  -3.853  1.00 0.00 ? 50  PHE A HB2  1  
ATOM 797   H HB3  . PHE A 1 50  ? 10.922  -5.574  -2.440  1.00 0.00 ? 50  PHE A HB3  1  
ATOM 798   H HD1  . PHE A 1 50  ? 14.274  -5.452  -4.025  1.00 0.00 ? 50  PHE A HD1  1  
ATOM 799   H HD2  . PHE A 1 50  ? 12.053  -5.988  -0.431  1.00 0.00 ? 50  PHE A HD2  1  
ATOM 800   H HE1  . PHE A 1 50  ? 16.356  -5.361  -2.724  1.00 0.00 ? 50  PHE A HE1  1  
ATOM 801   H HE2  . PHE A 1 50  ? 14.136  -5.890  0.874   1.00 0.00 ? 50  PHE A HE2  1  
ATOM 802   H HZ   . PHE A 1 50  ? 16.291  -5.576  -0.275  1.00 0.00 ? 50  PHE A HZ   1  
ATOM 803   N N    . LYS A 1 51  ? 10.846  -8.491  -1.949  1.00 0.00 ? 51  LYS A N    1  
ATOM 804   C CA   . LYS A 1 51  ? 10.922  -9.591  -0.988  1.00 0.00 ? 51  LYS A CA   1  
ATOM 805   C C    . LYS A 1 51  ? 10.853  -10.953 -1.697  1.00 0.00 ? 51  LYS A C    1  
ATOM 806   O O    . LYS A 1 51  ? 11.303  -11.971 -1.163  1.00 0.00 ? 51  LYS A O    1  
ATOM 807   C CB   . LYS A 1 51  ? 9.790   -9.409  0.059   1.00 0.00 ? 51  LYS A CB   1  
ATOM 808   C CG   . LYS A 1 51  ? 9.165   -10.688 0.627   1.00 0.00 ? 51  LYS A CG   1  
ATOM 809   C CD   . LYS A 1 51  ? 8.097   -11.271 -0.301  1.00 0.00 ? 51  LYS A CD   1  
ATOM 810   C CE   . LYS A 1 51  ? 7.328   -12.410 0.351   1.00 0.00 ? 51  LYS A CE   1  
ATOM 811   N NZ   . LYS A 1 51  ? 6.449   -11.929 1.451   1.00 0.00 ? 51  LYS A NZ   1  
ATOM 812   H H    . LYS A 1 51  ? 10.095  -7.865  -1.884  1.00 0.00 ? 51  LYS A H    1  
ATOM 813   H HA   . LYS A 1 51  ? 11.876  -9.518  -0.483  1.00 0.00 ? 51  LYS A HA   1  
ATOM 814   H HB2  . LYS A 1 51  ? 10.187  -8.844  0.890   1.00 0.00 ? 51  LYS A HB2  1  
ATOM 815   H HB3  . LYS A 1 51  ? 8.998   -8.826  -0.396  1.00 0.00 ? 51  LYS A HB3  1  
ATOM 816   H HG2  . LYS A 1 51  ? 9.943   -11.425 0.769   1.00 0.00 ? 51  LYS A HG2  1  
ATOM 817   H HG3  . LYS A 1 51  ? 8.712   -10.459 1.581   1.00 0.00 ? 51  LYS A HG3  1  
ATOM 818   H HD2  . LYS A 1 51  ? 7.398   -10.490 -0.565  1.00 0.00 ? 51  LYS A HD2  1  
ATOM 819   H HD3  . LYS A 1 51  ? 8.576   -11.640 -1.198  1.00 0.00 ? 51  LYS A HD3  1  
ATOM 820   H HE2  . LYS A 1 51  ? 6.719   -12.895 -0.396  1.00 0.00 ? 51  LYS A HE2  1  
ATOM 821   H HE3  . LYS A 1 51  ? 8.035   -13.122 0.753   1.00 0.00 ? 51  LYS A HE3  1  
ATOM 822   H HZ1  . LYS A 1 51  ? 5.872   -12.715 1.813   1.00 0.00 ? 51  LYS A HZ1  1  
ATOM 823   H HZ2  . LYS A 1 51  ? 5.818   -11.180 1.105   1.00 0.00 ? 51  LYS A HZ2  1  
ATOM 824   H HZ3  . LYS A 1 51  ? 7.022   -11.551 2.231   1.00 0.00 ? 51  LYS A HZ3  1  
ATOM 825   N N    . LYS A 1 52  ? 10.286  -10.954 -2.900  1.00 0.00 ? 52  LYS A N    1  
ATOM 826   C CA   . LYS A 1 52  ? 10.141  -12.170 -3.702  1.00 0.00 ? 52  LYS A CA   1  
ATOM 827   C C    . LYS A 1 52  ? 11.472  -12.562 -4.352  1.00 0.00 ? 52  LYS A C    1  
ATOM 828   O O    . LYS A 1 52  ? 11.655  -13.706 -4.778  1.00 0.00 ? 52  LYS A O    1  
ATOM 829   C CB   . LYS A 1 52  ? 9.075   -11.946 -4.787  1.00 0.00 ? 52  LYS A CB   1  
ATOM 830   C CG   . LYS A 1 52  ? 8.833   -13.147 -5.702  1.00 0.00 ? 52  LYS A CG   1  
ATOM 831   C CD   . LYS A 1 52  ? 8.033   -12.753 -6.940  1.00 0.00 ? 52  LYS A CD   1  
ATOM 832   C CE   . LYS A 1 52  ? 8.778   -11.714 -7.775  1.00 0.00 ? 52  LYS A CE   1  
ATOM 833   N NZ   . LYS A 1 52  ? 7.979   -11.231 -8.931  1.00 0.00 ? 52  LYS A NZ   1  
ATOM 834   H H    . LYS A 1 52  ? 9.950   -10.107 -3.263  1.00 0.00 ? 52  LYS A H    1  
ATOM 835   H HA   . LYS A 1 52  ? 9.818   -12.970 -3.049  1.00 0.00 ? 52  LYS A HA   1  
ATOM 836   H HB2  . LYS A 1 52  ? 8.136   -11.699 -4.304  1.00 0.00 ? 52  LYS A HB2  1  
ATOM 837   H HB3  . LYS A 1 52  ? 9.382   -11.108 -5.402  1.00 0.00 ? 52  LYS A HB3  1  
ATOM 838   H HG2  . LYS A 1 52  ? 9.786   -13.551 -6.015  1.00 0.00 ? 52  LYS A HG2  1  
ATOM 839   H HG3  . LYS A 1 52  ? 8.284   -13.902 -5.154  1.00 0.00 ? 52  LYS A HG3  1  
ATOM 840   H HD2  . LYS A 1 52  ? 7.864   -13.632 -7.546  1.00 0.00 ? 52  LYS A HD2  1  
ATOM 841   H HD3  . LYS A 1 52  ? 7.083   -12.339 -6.630  1.00 0.00 ? 52  LYS A HD3  1  
ATOM 842   H HE2  . LYS A 1 52  ? 9.016   -10.868 -7.146  1.00 0.00 ? 52  LYS A HE2  1  
ATOM 843   H HE3  . LYS A 1 52  ? 9.694   -12.154 -8.143  1.00 0.00 ? 52  LYS A HE3  1  
ATOM 844   H HZ1  . LYS A 1 52  ? 8.510   -10.502 -9.448  1.00 0.00 ? 52  LYS A HZ1  1  
ATOM 845   H HZ2  . LYS A 1 52  ? 7.083   -10.819 -8.602  1.00 0.00 ? 52  LYS A HZ2  1  
ATOM 846   H HZ3  . LYS A 1 52  ? 7.768   -12.015 -9.579  1.00 0.00 ? 52  LYS A HZ3  1  
ATOM 847   N N    . SER A 1 53  ? 12.397  -11.608 -4.425  1.00 0.00 ? 53  SER A N    1  
ATOM 848   C CA   . SER A 1 53  ? 13.678  -11.824 -5.095  1.00 0.00 ? 53  SER A CA   1  
ATOM 849   C C    . SER A 1 53  ? 14.525  -12.858 -4.348  1.00 0.00 ? 53  SER A C    1  
ATOM 850   O O    . SER A 1 53  ? 14.305  -13.127 -3.163  1.00 0.00 ? 53  SER A O    1  
ATOM 851   C CB   . SER A 1 53  ? 14.444  -10.497 -5.216  1.00 0.00 ? 53  SER A CB   1  
ATOM 852   O OG   . SER A 1 53  ? 15.624  -10.647 -5.995  1.00 0.00 ? 53  SER A OG   1  
ATOM 853   H H    . SER A 1 53  ? 12.220  -10.740 -4.008  1.00 0.00 ? 53  SER A H    1  
ATOM 854   H HA   . SER A 1 53  ? 13.471  -12.197 -6.088  1.00 0.00 ? 53  SER A HA   1  
ATOM 855   H HB2  . SER A 1 53  ? 13.811  -9.760  -5.689  1.00 0.00 ? 53  SER A HB2  1  
ATOM 856   H HB3  . SER A 1 53  ? 14.720  -10.152 -4.229  1.00 0.00 ? 53  SER A HB3  1  
ATOM 857   H HG   . SER A 1 53  ? 15.461  -10.311 -6.886  1.00 0.00 ? 53  SER A HG   1  
ATOM 858   N N    . LYS A 1 54  ? 15.489  -13.442 -5.055  1.00 0.00 ? 54  LYS A N    1  
ATOM 859   C CA   . LYS A 1 54  ? 16.392  -14.434 -4.477  1.00 0.00 ? 54  LYS A CA   1  
ATOM 860   C C    . LYS A 1 54  ? 17.821  -14.219 -4.973  1.00 0.00 ? 54  LYS A C    1  
ATOM 861   O O    . LYS A 1 54  ? 18.679  -15.094 -4.840  1.00 0.00 ? 54  LYS A O    1  
ATOM 862   C CB   . LYS A 1 54  ? 15.892  -15.863 -4.784  1.00 0.00 ? 54  LYS A CB   1  
ATOM 863   C CG   . LYS A 1 54  ? 15.363  -16.082 -6.206  1.00 0.00 ? 54  LYS A CG   1  
ATOM 864   C CD   . LYS A 1 54  ? 16.462  -16.061 -7.268  1.00 0.00 ? 54  LYS A CD   1  
ATOM 865   C CE   . LYS A 1 54  ? 15.896  -16.326 -8.658  1.00 0.00 ? 54  LYS A CE   1  
ATOM 866   N NZ   . LYS A 1 54  ? 16.949  -16.298 -9.709  1.00 0.00 ? 54  LYS A NZ   1  
ATOM 867   H H    . LYS A 1 54  ? 15.595  -13.196 -6.000  1.00 0.00 ? 54  LYS A H    1  
ATOM 868   H HA   . LYS A 1 54  ? 16.388  -14.291 -3.405  1.00 0.00 ? 54  LYS A HA   1  
ATOM 869   H HB2  . LYS A 1 54  ? 16.704  -16.556 -4.620  1.00 0.00 ? 54  LYS A HB2  1  
ATOM 870   H HB3  . LYS A 1 54  ? 15.095  -16.101 -4.093  1.00 0.00 ? 54  LYS A HB3  1  
ATOM 871   H HG2  . LYS A 1 54  ? 14.866  -17.041 -6.247  1.00 0.00 ? 54  LYS A HG2  1  
ATOM 872   H HG3  . LYS A 1 54  ? 14.646  -15.302 -6.431  1.00 0.00 ? 54  LYS A HG3  1  
ATOM 873   H HD2  . LYS A 1 54  ? 16.938  -15.092 -7.263  1.00 0.00 ? 54  LYS A HD2  1  
ATOM 874   H HD3  . LYS A 1 54  ? 17.192  -16.825 -7.034  1.00 0.00 ? 54  LYS A HD3  1  
ATOM 875   H HE2  . LYS A 1 54  ? 15.424  -17.299 -8.664  1.00 0.00 ? 54  LYS A HE2  1  
ATOM 876   H HE3  . LYS A 1 54  ? 15.158  -15.570 -8.883  1.00 0.00 ? 54  LYS A HE3  1  
ATOM 877   H HZ1  . LYS A 1 54  ? 16.529  -16.494 -10.640 1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 878   H HZ2  . LYS A 1 54  ? 17.675  -17.017 -9.513  1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 879   H HZ3  . LYS A 1 54  ? 17.404  -15.364 -9.738  1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 880   N N    . GLY A 1 55  ? 18.070  -13.040 -5.536  1.00 0.00 ? 55  GLY A N    1  
ATOM 881   C CA   . GLY A 1 55  ? 19.403  -12.685 -5.991  1.00 0.00 ? 55  GLY A CA   1  
ATOM 882   C C    . GLY A 1 55  ? 20.067  -11.713 -5.032  1.00 0.00 ? 55  GLY A C    1  
ATOM 883   O O    . GLY A 1 55  ? 19.702  -10.540 -5.011  1.00 0.00 ? 55  GLY A O    1  
ATOM 884   H H    . GLY A 1 55  ? 17.340  -12.391 -5.628  1.00 0.00 ? 55  GLY A H    1  
ATOM 885   H HA2  . GLY A 1 55  ? 20.006  -13.579 -6.074  1.00 0.00 ? 55  GLY A HA2  1  
ATOM 886   H HA3  . GLY A 1 55  ? 19.328  -12.220 -6.963  1.00 0.00 ? 55  GLY A HA3  1  
ATOM 887   N N    . PRO A 1 56  ? 21.046  -12.168 -4.222  1.00 0.00 ? 56  PRO A N    1  
ATOM 888   C CA   . PRO A 1 56  ? 21.695  -11.330 -3.197  1.00 0.00 ? 56  PRO A CA   1  
ATOM 889   C C    . PRO A 1 56  ? 22.143  -9.967  -3.738  1.00 0.00 ? 56  PRO A C    1  
ATOM 890   O O    . PRO A 1 56  ? 21.832  -8.923  -3.159  1.00 0.00 ? 56  PRO A O    1  
ATOM 891   C CB   . PRO A 1 56  ? 22.901  -12.175 -2.766  1.00 0.00 ? 56  PRO A CB   1  
ATOM 892   C CG   . PRO A 1 56  ? 22.474  -13.584 -3.011  1.00 0.00 ? 56  PRO A CG   1  
ATOM 893   C CD   . PRO A 1 56  ? 21.601  -13.541 -4.239  1.00 0.00 ? 56  PRO A CD   1  
ATOM 894   H HA   . PRO A 1 56  ? 21.041  -11.176 -2.349  1.00 0.00 ? 56  PRO A HA   1  
ATOM 895   H HB2  . PRO A 1 56  ? 23.764  -11.913 -3.362  1.00 0.00 ? 56  PRO A HB2  1  
ATOM 896   H HB3  . PRO A 1 56  ? 23.113  -12.003 -1.720  1.00 0.00 ? 56  PRO A HB3  1  
ATOM 897   H HG2  . PRO A 1 56  ? 23.341  -14.207 -3.186  1.00 0.00 ? 56  PRO A HG2  1  
ATOM 898   H HG3  . PRO A 1 56  ? 21.912  -13.955 -2.164  1.00 0.00 ? 56  PRO A HG3  1  
ATOM 899   H HD2  . PRO A 1 56  ? 22.193  -13.706 -5.129  1.00 0.00 ? 56  PRO A HD2  1  
ATOM 900   H HD3  . PRO A 1 56  ? 20.812  -14.277 -4.169  1.00 0.00 ? 56  PRO A HD3  1  
ATOM 901   N N    . GLN A 1 57  ? 22.865  -9.979  -4.858  1.00 0.00 ? 57  GLN A N    1  
ATOM 902   C CA   . GLN A 1 57  ? 23.312  -8.738  -5.493  1.00 0.00 ? 57  GLN A CA   1  
ATOM 903   C C    . GLN A 1 57  ? 22.119  -7.932  -6.017  1.00 0.00 ? 57  GLN A C    1  
ATOM 904   O O    . GLN A 1 57  ? 22.116  -6.699  -5.960  1.00 0.00 ? 57  GLN A O    1  
ATOM 905   C CB   . GLN A 1 57  ? 24.333  -9.035  -6.613  1.00 0.00 ? 57  GLN A CB   1  
ATOM 906   C CG   . GLN A 1 57  ? 23.931  -10.157 -7.576  1.00 0.00 ? 57  GLN A CG   1  
ATOM 907   C CD   . GLN A 1 57  ? 22.850  -9.762  -8.571  1.00 0.00 ? 57  GLN A CD   1  
ATOM 908   O OE1  . GLN A 1 57  ? 22.759  -8.607  -8.984  1.00 0.00 ? 57  GLN A OE1  1  
ATOM 909   N NE2  . GLN A 1 57  ? 22.018  -10.719 -8.955  1.00 0.00 ? 57  GLN A NE2  1  
ATOM 910   H H    . GLN A 1 57  ? 23.111  -10.839 -5.256  1.00 0.00 ? 57  GLN A H    1  
ATOM 911   H HA   . GLN A 1 57  ? 23.803  -8.149  -4.729  1.00 0.00 ? 57  GLN A HA   1  
ATOM 912   H HB2  . GLN A 1 57  ? 24.484  -8.133  -7.192  1.00 0.00 ? 57  GLN A HB2  1  
ATOM 913   H HB3  . GLN A 1 57  ? 25.273  -9.308  -6.154  1.00 0.00 ? 57  GLN A HB3  1  
ATOM 914   H HG2  . GLN A 1 57  ? 24.806  -10.461 -8.133  1.00 0.00 ? 57  GLN A HG2  1  
ATOM 915   H HG3  . GLN A 1 57  ? 23.573  -10.995 -6.994  1.00 0.00 ? 57  GLN A HG3  1  
ATOM 916   H HE21 . GLN A 1 57  ? 22.142  -11.618 -8.585  1.00 0.00 ? 57  GLN A HE21 1  
ATOM 917   H HE22 . GLN A 1 57  ? 21.309  -10.489 -9.598  1.00 0.00 ? 57  GLN A HE22 1  
ATOM 918   N N    . GLN A 1 58  ? 21.090  -8.640  -6.485  1.00 0.00 ? 58  GLN A N    1  
ATOM 919   C CA   . GLN A 1 58  ? 19.894  -8.004  -7.033  1.00 0.00 ? 58  GLN A CA   1  
ATOM 920   C C    . GLN A 1 58  ? 19.128  -7.292  -5.922  1.00 0.00 ? 58  GLN A C    1  
ATOM 921   O O    . GLN A 1 58  ? 18.471  -6.282  -6.160  1.00 0.00 ? 58  GLN A O    1  
ATOM 922   C CB   . GLN A 1 58  ? 19.000  -9.050  -7.722  1.00 0.00 ? 58  GLN A CB   1  
ATOM 923   C CG   . GLN A 1 58  ? 17.790  -8.464  -8.449  1.00 0.00 ? 58  GLN A CG   1  
ATOM 924   C CD   . GLN A 1 58  ? 18.178  -7.542  -9.596  1.00 0.00 ? 58  GLN A CD   1  
ATOM 925   O OE1  . GLN A 1 58  ? 18.325  -6.332  -9.418  1.00 0.00 ? 58  GLN A OE1  1  
ATOM 926   N NE2  . GLN A 1 58  ? 18.354  -8.106  -10.781 1.00 0.00 ? 58  GLN A NE2  1  
ATOM 927   H H    . GLN A 1 58  ? 21.133  -9.617  -6.450  1.00 0.00 ? 58  GLN A H    1  
ATOM 928   H HA   . GLN A 1 58  ? 20.211  -7.273  -7.764  1.00 0.00 ? 58  GLN A HA   1  
ATOM 929   H HB2  . GLN A 1 58  ? 19.593  -9.592  -8.444  1.00 0.00 ? 58  GLN A HB2  1  
ATOM 930   H HB3  . GLN A 1 58  ? 18.640  -9.746  -6.976  1.00 0.00 ? 58  GLN A HB3  1  
ATOM 931   H HG2  . GLN A 1 58  ? 17.196  -9.277  -8.845  1.00 0.00 ? 58  GLN A HG2  1  
ATOM 932   H HG3  . GLN A 1 58  ? 17.198  -7.903  -7.739  1.00 0.00 ? 58  GLN A HG3  1  
ATOM 933   H HE21 . GLN A 1 58  ? 18.226  -9.075  -10.856 1.00 0.00 ? 58  GLN A HE21 1  
ATOM 934   H HE22 . GLN A 1 58  ? 18.607  -7.533  -11.536 1.00 0.00 ? 58  GLN A HE22 1  
ATOM 935   N N    . ILE A 1 59  ? 19.231  -7.825  -4.706  1.00 0.00 ? 59  ILE A N    1  
ATOM 936   C CA   . ILE A 1 59  ? 18.616  -7.209  -3.532  1.00 0.00 ? 59  ILE A CA   1  
ATOM 937   C C    . ILE A 1 59  ? 19.117  -5.776  -3.365  1.00 0.00 ? 59  ILE A C    1  
ATOM 938   O O    . ILE A 1 59  ? 18.341  -4.858  -3.114  1.00 0.00 ? 59  ILE A O    1  
ATOM 939   C CB   . ILE A 1 59  ? 18.920  -8.022  -2.242  1.00 0.00 ? 59  ILE A CB   1  
ATOM 940   C CG1  . ILE A 1 59  ? 18.285  -9.421  -2.324  1.00 0.00 ? 59  ILE A CG1  1  
ATOM 941   C CG2  . ILE A 1 59  ? 18.440  -7.285  -0.990  1.00 0.00 ? 59  ILE A CG2  1  
ATOM 942   C CD1  . ILE A 1 59  ? 16.774  -9.405  -2.469  1.00 0.00 ? 59  ILE A CD1  1  
ATOM 943   H H    . ILE A 1 59  ? 19.730  -8.662  -4.597  1.00 0.00 ? 59  ILE A H    1  
ATOM 944   H HA   . ILE A 1 59  ? 17.546  -7.192  -3.684  1.00 0.00 ? 59  ILE A HA   1  
ATOM 945   H HB   . ILE A 1 59  ? 19.993  -8.132  -2.165  1.00 0.00 ? 59  ILE A HB   1  
ATOM 946   H HG12 . ILE A 1 59  ? 18.690  -9.942  -3.178  1.00 0.00 ? 59  ILE A HG12 1  
ATOM 947   H HG13 . ILE A 1 59  ? 18.527  -9.972  -1.427  1.00 0.00 ? 59  ILE A HG13 1  
ATOM 948   H HG21 . ILE A 1 59  ? 17.376  -7.117  -1.054  1.00 0.00 ? 59  ILE A HG21 1  
ATOM 949   H HG22 . ILE A 1 59  ? 18.949  -6.335  -0.910  1.00 0.00 ? 59  ILE A HG22 1  
ATOM 950   H HG23 . ILE A 1 59  ? 18.658  -7.881  -0.115  1.00 0.00 ? 59  ILE A HG23 1  
ATOM 951   H HD11 . ILE A 1 59  ? 16.333  -8.910  -1.617  1.00 0.00 ? 59  ILE A HD11 1  
ATOM 952   H HD12 . ILE A 1 59  ? 16.408  -10.420 -2.523  1.00 0.00 ? 59  ILE A HD12 1  
ATOM 953   H HD13 . ILE A 1 59  ? 16.503  -8.878  -3.373  1.00 0.00 ? 59  ILE A HD13 1  
ATOM 954   N N    . HIS A 1 60  ? 20.422  -5.591  -3.540  1.00 0.00 ? 60  HIS A N    1  
ATOM 955   C CA   . HIS A 1 60  ? 21.036  -4.275  -3.399  1.00 0.00 ? 60  HIS A CA   1  
ATOM 956   C C    . HIS A 1 60  ? 20.609  -3.358  -4.544  1.00 0.00 ? 60  HIS A C    1  
ATOM 957   O O    . HIS A 1 60  ? 20.294  -2.188  -4.329  1.00 0.00 ? 60  HIS A O    1  
ATOM 958   C CB   . HIS A 1 60  ? 22.566  -4.396  -3.350  1.00 0.00 ? 60  HIS A CB   1  
ATOM 959   C CG   . HIS A 1 60  ? 23.077  -5.115  -2.135  1.00 0.00 ? 60  HIS A CG   1  
ATOM 960   N ND1  . HIS A 1 60  ? 23.923  -4.534  -1.215  1.00 0.00 ? 60  HIS A ND1  1  
ATOM 961   C CD2  . HIS A 1 60  ? 22.871  -6.381  -1.698  1.00 0.00 ? 60  HIS A CD2  1  
ATOM 962   C CE1  . HIS A 1 60  ? 24.215  -5.407  -0.271  1.00 0.00 ? 60  HIS A CE1  1  
ATOM 963   N NE2  . HIS A 1 60  ? 23.588  -6.536  -0.539  1.00 0.00 ? 60  HIS A NE2  1  
ATOM 964   H H    . HIS A 1 60  ? 20.980  -6.358  -3.786  1.00 0.00 ? 60  HIS A H    1  
ATOM 965   H HA   . HIS A 1 60  ? 20.689  -3.847  -2.468  1.00 0.00 ? 60  HIS A HA   1  
ATOM 966   H HB2  . HIS A 1 60  ? 22.907  -4.936  -4.221  1.00 0.00 ? 60  HIS A HB2  1  
ATOM 967   H HB3  . HIS A 1 60  ? 23.001  -3.405  -3.356  1.00 0.00 ? 60  HIS A HB3  1  
ATOM 968   H HD1  . HIS A 1 60  ? 24.272  -3.615  -1.258  1.00 0.00 ? 60  HIS A HD1  1  
ATOM 969   H HD2  . HIS A 1 60  ? 22.255  -7.130  -2.175  1.00 0.00 ? 60  HIS A HD2  1  
ATOM 970   H HE1  . HIS A 1 60  ? 24.859  -5.228  0.577   1.00 0.00 ? 60  HIS A HE1  1  
ATOM 971   H HE2  . HIS A 1 60  ? 23.771  -7.395  -0.097  1.00 0.00 ? 60  HIS A HE2  1  
ATOM 972   N N    . LEU A 1 61  ? 20.581  -3.909  -5.756  1.00 0.00 ? 61  LEU A N    1  
ATOM 973   C CA   . LEU A 1 61  ? 20.198  -3.148  -6.946  1.00 0.00 ? 61  LEU A CA   1  
ATOM 974   C C    . LEU A 1 61  ? 18.741  -2.691  -6.853  1.00 0.00 ? 61  LEU A C    1  
ATOM 975   O O    . LEU A 1 61  ? 18.417  -1.541  -7.158  1.00 0.00 ? 61  LEU A O    1  
ATOM 976   C CB   . LEU A 1 61  ? 20.400  -3.999  -8.210  1.00 0.00 ? 61  LEU A CB   1  
ATOM 977   C CG   . LEU A 1 61  ? 21.838  -4.500  -8.442  1.00 0.00 ? 61  LEU A CG   1  
ATOM 978   C CD1  . LEU A 1 61  ? 21.919  -5.350  -9.710  1.00 0.00 ? 61  LEU A CD1  1  
ATOM 979   C CD2  . LEU A 1 61  ? 22.817  -3.329  -8.510  1.00 0.00 ? 61  LEU A CD2  1  
ATOM 980   H H    . LEU A 1 61  ? 20.825  -4.856  -5.854  1.00 0.00 ? 61  LEU A H    1  
ATOM 981   H HA   . LEU A 1 61  ? 20.836  -2.276  -7.003  1.00 0.00 ? 61  LEU A HA   1  
ATOM 982   H HB2  . LEU A 1 61  ? 19.747  -4.860  -8.143  1.00 0.00 ? 61  LEU A HB2  1  
ATOM 983   H HB3  . LEU A 1 61  ? 20.104  -3.410  -9.067  1.00 0.00 ? 61  LEU A HB3  1  
ATOM 984   H HG   . LEU A 1 61  ? 22.128  -5.128  -7.610  1.00 0.00 ? 61  LEU A HG   1  
ATOM 985   H HD11 . LEU A 1 61  ? 22.934  -5.694  -9.848  1.00 0.00 ? 61  LEU A HD11 1  
ATOM 986   H HD12 . LEU A 1 61  ? 21.621  -4.759  -10.564 1.00 0.00 ? 61  LEU A HD12 1  
ATOM 987   H HD13 . LEU A 1 61  ? 21.261  -6.201  -9.617  1.00 0.00 ? 61  LEU A HD13 1  
ATOM 988   H HD21 . LEU A 1 61  ? 22.542  -2.671  -9.322  1.00 0.00 ? 61  LEU A HD21 1  
ATOM 989   H HD22 . LEU A 1 61  ? 23.817  -3.704  -8.676  1.00 0.00 ? 61  LEU A HD22 1  
ATOM 990   H HD23 . LEU A 1 61  ? 22.792  -2.782  -7.578  1.00 0.00 ? 61  LEU A HD23 1  
ATOM 991   N N    . LYS A 1 62  ? 17.870  -3.600  -6.432  1.00 0.00 ? 62  LYS A N    1  
ATOM 992   C CA   . LYS A 1 62  ? 16.450  -3.302  -6.273  1.00 0.00 ? 62  LYS A CA   1  
ATOM 993   C C    . LYS A 1 62  ? 16.237  -2.298  -5.147  1.00 0.00 ? 62  LYS A C    1  
ATOM 994   O O    . LYS A 1 62  ? 15.511  -1.319  -5.305  1.00 0.00 ? 62  LYS A O    1  
ATOM 995   C CB   . LYS A 1 62  ? 15.660  -4.587  -5.990  1.00 0.00 ? 62  LYS A CB   1  
ATOM 996   C CG   . LYS A 1 62  ? 15.523  -5.510  -7.197  1.00 0.00 ? 62  LYS A CG   1  
ATOM 997   C CD   . LYS A 1 62  ? 14.668  -4.877  -8.290  1.00 0.00 ? 62  LYS A CD   1  
ATOM 998   C CE   . LYS A 1 62  ? 14.510  -5.793  -9.496  1.00 0.00 ? 62  LYS A CE   1  
ATOM 999   N NZ   . LYS A 1 62  ? 13.586  -5.212  -10.504 1.00 0.00 ? 62  LYS A NZ   1  
ATOM 1000  H H    . LYS A 1 62  ? 18.192  -4.500  -6.221  1.00 0.00 ? 62  LYS A H    1  
ATOM 1001  H HA   . LYS A 1 62  ? 16.097  -2.868  -7.199  1.00 0.00 ? 62  LYS A HA   1  
ATOM 1002  H HB2  . LYS A 1 62  ? 16.159  -5.135  -5.201  1.00 0.00 ? 62  LYS A HB2  1  
ATOM 1003  H HB3  . LYS A 1 62  ? 14.667  -4.322  -5.653  1.00 0.00 ? 62  LYS A HB3  1  
ATOM 1004  H HG2  . LYS A 1 62  ? 16.507  -5.716  -7.596  1.00 0.00 ? 62  LYS A HG2  1  
ATOM 1005  H HG3  . LYS A 1 62  ? 15.061  -6.435  -6.880  1.00 0.00 ? 62  LYS A HG3  1  
ATOM 1006  H HD2  . LYS A 1 62  ? 13.689  -4.661  -7.888  1.00 0.00 ? 62  LYS A HD2  1  
ATOM 1007  H HD3  . LYS A 1 62  ? 15.136  -3.955  -8.611  1.00 0.00 ? 62  LYS A HD3  1  
ATOM 1008  H HE2  . LYS A 1 62  ? 15.478  -5.945  -9.951  1.00 0.00 ? 62  LYS A HE2  1  
ATOM 1009  H HE3  . LYS A 1 62  ? 14.115  -6.741  -9.164  1.00 0.00 ? 62  LYS A HE3  1  
ATOM 1010  H HZ1  . LYS A 1 62  ? 13.938  -4.285  -10.826 1.00 0.00 ? 62  LYS A HZ1  1  
ATOM 1011  H HZ2  . LYS A 1 62  ? 12.642  -5.083  -10.090 1.00 0.00 ? 62  LYS A HZ2  1  
ATOM 1012  H HZ3  . LYS A 1 62  ? 13.507  -5.843  -11.324 1.00 0.00 ? 62  LYS A HZ3  1  
ATOM 1013  N N    . ALA A 1 63  ? 16.889  -2.546  -4.016  1.00 0.00 ? 63  ALA A N    1  
ATOM 1014  C CA   . ALA A 1 63  ? 16.762  -1.684  -2.847  1.00 0.00 ? 63  ALA A CA   1  
ATOM 1015  C C    . ALA A 1 63  ? 17.226  -0.264  -3.155  1.00 0.00 ? 63  ALA A C    1  
ATOM 1016  O O    . ALA A 1 63  ? 16.609  0.703   -2.716  1.00 0.00 ? 63  ALA A O    1  
ATOM 1017  C CB   . ALA A 1 63  ? 17.545  -2.259  -1.676  1.00 0.00 ? 63  ALA A CB   1  
ATOM 1018  H H    . ALA A 1 63  ? 17.469  -3.336  -3.963  1.00 0.00 ? 63  ALA A H    1  
ATOM 1019  H HA   . ALA A 1 63  ? 15.716  -1.657  -2.569  1.00 0.00 ? 63  ALA A HA   1  
ATOM 1020  H HB1  . ALA A 1 63  ? 17.196  -3.260  -1.466  1.00 0.00 ? 63  ALA A HB1  1  
ATOM 1021  H HB2  . ALA A 1 63  ? 17.401  -1.638  -0.803  1.00 0.00 ? 63  ALA A HB2  1  
ATOM 1022  H HB3  . ALA A 1 63  ? 18.596  -2.291  -1.925  1.00 0.00 ? 63  ALA A HB3  1  
ATOM 1023  N N    . LYS A 1 64  ? 18.314  -0.145  -3.913  1.00 0.00 ? 64  LYS A N    1  
ATOM 1024  C CA   . LYS A 1 64  ? 18.838  1.162   -4.307  1.00 0.00 ? 64  LYS A CA   1  
ATOM 1025  C C    . LYS A 1 64  ? 17.855  1.884   -5.227  1.00 0.00 ? 64  LYS A C    1  
ATOM 1026  O O    . LYS A 1 64  ? 17.690  3.104   -5.135  1.00 0.00 ? 64  LYS A O    1  
ATOM 1027  C CB   . LYS A 1 64  ? 20.210  1.018   -4.987  1.00 0.00 ? 64  LYS A CB   1  
ATOM 1028  C CG   . LYS A 1 64  ? 21.376  0.890   -4.006  1.00 0.00 ? 64  LYS A CG   1  
ATOM 1029  C CD   . LYS A 1 64  ? 21.544  2.162   -3.177  1.00 0.00 ? 64  LYS A CD   1  
ATOM 1030  C CE   . LYS A 1 64  ? 22.803  2.131   -2.316  1.00 0.00 ? 64  LYS A CE   1  
ATOM 1031  N NZ   . LYS A 1 64  ? 22.746  1.088   -1.256  1.00 0.00 ? 64  LYS A NZ   1  
ATOM 1032  H H    . LYS A 1 64  ? 18.775  -0.955  -4.217  1.00 0.00 ? 64  LYS A H    1  
ATOM 1033  H HA   . LYS A 1 64  ? 18.955  1.750   -3.406  1.00 0.00 ? 64  LYS A HA   1  
ATOM 1034  H HB2  . LYS A 1 64  ? 20.198  0.138   -5.614  1.00 0.00 ? 64  LYS A HB2  1  
ATOM 1035  H HB3  . LYS A 1 64  ? 20.388  1.886   -5.608  1.00 0.00 ? 64  LYS A HB3  1  
ATOM 1036  H HG2  . LYS A 1 64  ? 21.188  0.057   -3.343  1.00 0.00 ? 64  LYS A HG2  1  
ATOM 1037  H HG3  . LYS A 1 64  ? 22.285  0.710   -4.564  1.00 0.00 ? 64  LYS A HG3  1  
ATOM 1038  H HD2  . LYS A 1 64  ? 21.601  3.010   -3.845  1.00 0.00 ? 64  LYS A HD2  1  
ATOM 1039  H HD3  . LYS A 1 64  ? 20.683  2.272   -2.532  1.00 0.00 ? 64  LYS A HD3  1  
ATOM 1040  H HE2  . LYS A 1 64  ? 23.655  1.937   -2.951  1.00 0.00 ? 64  LYS A HE2  1  
ATOM 1041  H HE3  . LYS A 1 64  ? 22.923  3.099   -1.848  1.00 0.00 ? 64  LYS A HE3  1  
ATOM 1042  H HZ1  . LYS A 1 64  ? 23.593  1.150   -0.653  1.00 0.00 ? 64  LYS A HZ1  1  
ATOM 1043  H HZ2  . LYS A 1 64  ? 22.714  0.140   -1.680  1.00 0.00 ? 64  LYS A HZ2  1  
ATOM 1044  H HZ3  . LYS A 1 64  ? 21.905  1.221   -0.661  1.00 0.00 ? 64  LYS A HZ3  1  
ATOM 1045  N N    . ALA A 1 65  ? 17.202  1.125   -6.103  1.00 0.00 ? 65  ALA A N    1  
ATOM 1046  C CA   . ALA A 1 65  ? 16.177  1.679   -6.979  1.00 0.00 ? 65  ALA A CA   1  
ATOM 1047  C C    . ALA A 1 65  ? 15.016  2.218   -6.147  1.00 0.00 ? 65  ALA A C    1  
ATOM 1048  O O    . ALA A 1 65  ? 14.639  3.385   -6.262  1.00 0.00 ? 65  ALA A O    1  
ATOM 1049  C CB   . ALA A 1 65  ? 15.689  0.622   -7.965  1.00 0.00 ? 65  ALA A CB   1  
ATOM 1050  H H    . ALA A 1 65  ? 17.417  0.170   -6.163  1.00 0.00 ? 65  ALA A H    1  
ATOM 1051  H HA   . ALA A 1 65  ? 16.618  2.492   -7.541  1.00 0.00 ? 65  ALA A HA   1  
ATOM 1052  H HB1  . ALA A 1 65  ? 16.524  0.261   -8.547  1.00 0.00 ? 65  ALA A HB1  1  
ATOM 1053  H HB2  . ALA A 1 65  ? 14.951  1.055   -8.625  1.00 0.00 ? 65  ALA A HB2  1  
ATOM 1054  H HB3  . ALA A 1 65  ? 15.247  -0.201  -7.422  1.00 0.00 ? 65  ALA A HB3  1  
ATOM 1055  N N    . ILE A 1 66  ? 14.479  1.358   -5.284  1.00 0.00 ? 66  ILE A N    1  
ATOM 1056  C CA   . ILE A 1 66  ? 13.379  1.729   -4.398  1.00 0.00 ? 66  ILE A CA   1  
ATOM 1057  C C    . ILE A 1 66  ? 13.793  2.890   -3.493  1.00 0.00 ? 66  ILE A C    1  
ATOM 1058  O O    . ILE A 1 66  ? 12.994  3.771   -3.184  1.00 0.00 ? 66  ILE A O    1  
ATOM 1059  C CB   . ILE A 1 66  ? 12.921  0.524   -3.531  1.00 0.00 ? 66  ILE A CB   1  
ATOM 1060  C CG1  . ILE A 1 66  ? 12.467  -0.639  -4.433  1.00 0.00 ? 66  ILE A CG1  1  
ATOM 1061  C CG2  . ILE A 1 66  ? 11.799  0.935   -2.574  1.00 0.00 ? 66  ILE A CG2  1  
ATOM 1062  C CD1  . ILE A 1 66  ? 12.059  -1.889  -3.675  1.00 0.00 ? 66  ILE A CD1  1  
ATOM 1063  H H    . ILE A 1 66  ? 14.836  0.446   -5.240  1.00 0.00 ? 66  ILE A H    1  
ATOM 1064  H HA   . ILE A 1 66  ? 12.548  2.043   -5.014  1.00 0.00 ? 66  ILE A HA   1  
ATOM 1065  H HB   . ILE A 1 66  ? 13.765  0.197   -2.936  1.00 0.00 ? 66  ILE A HB   1  
ATOM 1066  H HG12 . ILE A 1 66  ? 11.617  -0.322  -5.020  1.00 0.00 ? 66  ILE A HG12 1  
ATOM 1067  H HG13 . ILE A 1 66  ? 13.275  -0.907  -5.100  1.00 0.00 ? 66  ILE A HG13 1  
ATOM 1068  H HG21 . ILE A 1 66  ? 11.500  0.084   -1.979  1.00 0.00 ? 66  ILE A HG21 1  
ATOM 1069  H HG22 . ILE A 1 66  ? 10.953  1.293   -3.140  1.00 0.00 ? 66  ILE A HG22 1  
ATOM 1070  H HG23 . ILE A 1 66  ? 12.153  1.721   -1.921  1.00 0.00 ? 66  ILE A HG23 1  
ATOM 1071  H HD11 . ILE A 1 66  ? 11.777  -2.659  -4.377  1.00 0.00 ? 66  ILE A HD11 1  
ATOM 1072  H HD12 . ILE A 1 66  ? 11.222  -1.665  -3.031  1.00 0.00 ? 66  ILE A HD12 1  
ATOM 1073  H HD13 . ILE A 1 66  ? 12.890  -2.235  -3.077  1.00 0.00 ? 66  ILE A HD13 1  
ATOM 1074  N N    . TYR A 1 67  ? 15.060  2.889   -3.103  1.00 0.00 ? 67  TYR A N    1  
ATOM 1075  C CA   . TYR A 1 67  ? 15.617  3.923   -2.238  1.00 0.00 ? 67  TYR A CA   1  
ATOM 1076  C C    . TYR A 1 67  ? 15.454  5.311   -2.859  1.00 0.00 ? 67  TYR A C    1  
ATOM 1077  O O    . TYR A 1 67  ? 14.668  6.131   -2.376  1.00 0.00 ? 67  TYR A O    1  
ATOM 1078  C CB   . TYR A 1 67  ? 17.100  3.623   -1.965  1.00 0.00 ? 67  TYR A CB   1  
ATOM 1079  C CG   . TYR A 1 67  ? 17.844  4.715   -1.217  1.00 0.00 ? 67  TYR A CG   1  
ATOM 1080  C CD1  . TYR A 1 67  ? 17.450  5.113   0.055   1.00 0.00 ? 67  TYR A CD1  1  
ATOM 1081  C CD2  . TYR A 1 67  ? 18.947  5.346   -1.787  1.00 0.00 ? 67  TYR A CD2  1  
ATOM 1082  C CE1  . TYR A 1 67  ? 18.132  6.103   0.734   1.00 0.00 ? 67  TYR A CE1  1  
ATOM 1083  C CE2  . TYR A 1 67  ? 19.632  6.336   -1.111  1.00 0.00 ? 67  TYR A CE2  1  
ATOM 1084  C CZ   . TYR A 1 67  ? 19.221  6.711   0.148   1.00 0.00 ? 67  TYR A CZ   1  
ATOM 1085  O OH   . TYR A 1 67  ? 19.902  7.698   0.827   1.00 0.00 ? 67  TYR A OH   1  
ATOM 1086  H H    . TYR A 1 67  ? 15.644  2.165   -3.407  1.00 0.00 ? 67  TYR A H    1  
ATOM 1087  H HA   . TYR A 1 67  ? 15.078  3.896   -1.302  1.00 0.00 ? 67  TYR A HA   1  
ATOM 1088  H HB2  . TYR A 1 67  ? 17.170  2.720   -1.377  1.00 0.00 ? 67  TYR A HB2  1  
ATOM 1089  H HB3  . TYR A 1 67  ? 17.602  3.464   -2.910  1.00 0.00 ? 67  TYR A HB3  1  
ATOM 1090  H HD1  . TYR A 1 67  ? 16.596  4.635   0.516   1.00 0.00 ? 67  TYR A HD1  1  
ATOM 1091  H HD2  . TYR A 1 67  ? 19.268  5.050   -2.775  1.00 0.00 ? 67  TYR A HD2  1  
ATOM 1092  H HE1  . TYR A 1 67  ? 17.811  6.396   1.721   1.00 0.00 ? 67  TYR A HE1  1  
ATOM 1093  H HE2  . TYR A 1 67  ? 20.486  6.813   -1.573  1.00 0.00 ? 67  TYR A HE2  1  
ATOM 1094  H HH   . TYR A 1 67  ? 20.132  8.406   0.212   1.00 0.00 ? 67  TYR A HH   1  
ATOM 1095  N N    . GLU A 1 68  ? 16.173  5.547   -3.949  1.00 0.00 ? 68  GLU A N    1  
ATOM 1096  C CA   . GLU A 1 68  ? 16.232  6.868   -4.571  1.00 0.00 ? 68  GLU A CA   1  
ATOM 1097  C C    . GLU A 1 68  ? 14.885  7.261   -5.177  1.00 0.00 ? 68  GLU A C    1  
ATOM 1098  O O    . GLU A 1 68  ? 14.509  8.435   -5.179  1.00 0.00 ? 68  GLU A O    1  
ATOM 1099  C CB   . GLU A 1 68  ? 17.312  6.883   -5.660  1.00 0.00 ? 68  GLU A CB   1  
ATOM 1100  C CG   . GLU A 1 68  ? 18.685  6.424   -5.174  1.00 0.00 ? 68  GLU A CG   1  
ATOM 1101  C CD   . GLU A 1 68  ? 19.746  6.481   -6.261  1.00 0.00 ? 68  GLU A CD   1  
ATOM 1102  O OE1  . GLU A 1 68  ? 19.848  5.521   -7.057  1.00 0.00 ? 68  GLU A OE1  1  
ATOM 1103  O OE2  . GLU A 1 68  ? 20.487  7.487   -6.323  1.00 0.00 ? 68  GLU A OE2  1  
ATOM 1104  H H    . GLU A 1 68  ? 16.678  4.807   -4.355  1.00 0.00 ? 68  GLU A H    1  
ATOM 1105  H HA   . GLU A 1 68  ? 16.494  7.586   -3.807  1.00 0.00 ? 68  GLU A HA   1  
ATOM 1106  H HB2  . GLU A 1 68  ? 17.004  6.231   -6.466  1.00 0.00 ? 68  GLU A HB2  1  
ATOM 1107  H HB3  . GLU A 1 68  ? 17.408  7.890   -6.041  1.00 0.00 ? 68  GLU A HB3  1  
ATOM 1108  H HG2  . GLU A 1 68  ? 18.994  7.058   -4.354  1.00 0.00 ? 68  GLU A HG2  1  
ATOM 1109  H HG3  . GLU A 1 68  ? 18.604  5.403   -4.821  1.00 0.00 ? 68  GLU A HG3  1  
ATOM 1110  N N    . LYS A 1 69  ? 14.165  6.270   -5.682  1.00 0.00 ? 69  LYS A N    1  
ATOM 1111  C CA   . LYS A 1 69  ? 12.938  6.516   -6.432  1.00 0.00 ? 69  LYS A CA   1  
ATOM 1112  C C    . LYS A 1 69  ? 11.714  6.628   -5.515  1.00 0.00 ? 69  LYS A C    1  
ATOM 1113  O O    . LYS A 1 69  ? 10.760  7.339   -5.838  1.00 0.00 ? 69  LYS A O    1  
ATOM 1114  C CB   . LYS A 1 69  ? 12.744  5.400   -7.467  1.00 0.00 ? 69  LYS A CB   1  
ATOM 1115  C CG   . LYS A 1 69  ? 11.569  5.612   -8.417  1.00 0.00 ? 69  LYS A CG   1  
ATOM 1116  C CD   . LYS A 1 69  ? 11.534  4.536   -9.499  1.00 0.00 ? 69  LYS A CD   1  
ATOM 1117  C CE   . LYS A 1 69  ? 10.366  4.720   -10.456 1.00 0.00 ? 69  LYS A CE   1  
ATOM 1118  N NZ   . LYS A 1 69  ? 10.388  3.713   -11.549 1.00 0.00 ? 69  LYS A NZ   1  
ATOM 1119  H H    . LYS A 1 69  ? 14.469  5.345   -5.556  1.00 0.00 ? 69  LYS A H    1  
ATOM 1120  H HA   . LYS A 1 69  ? 13.059  7.452   -6.957  1.00 0.00 ? 69  LYS A HA   1  
ATOM 1121  H HB2  . LYS A 1 69  ? 13.644  5.320   -8.061  1.00 0.00 ? 69  LYS A HB2  1  
ATOM 1122  H HB3  . LYS A 1 69  ? 12.591  4.465   -6.943  1.00 0.00 ? 69  LYS A HB3  1  
ATOM 1123  H HG2  . LYS A 1 69  ? 10.649  5.574   -7.851  1.00 0.00 ? 69  LYS A HG2  1  
ATOM 1124  H HG3  . LYS A 1 69  ? 11.666  6.581   -8.886  1.00 0.00 ? 69  LYS A HG3  1  
ATOM 1125  H HD2  . LYS A 1 69  ? 12.455  4.578   -10.063 1.00 0.00 ? 69  LYS A HD2  1  
ATOM 1126  H HD3  . LYS A 1 69  ? 11.449  3.567   -9.024  1.00 0.00 ? 69  LYS A HD3  1  
ATOM 1127  H HE2  . LYS A 1 69  ? 9.441   4.620   -9.906  1.00 0.00 ? 69  LYS A HE2  1  
ATOM 1128  H HE3  . LYS A 1 69  ? 10.420  5.710   -10.890 1.00 0.00 ? 69  LYS A HE3  1  
ATOM 1129  H HZ1  . LYS A 1 69  ? 9.569   3.850   -12.180 1.00 0.00 ? 69  LYS A HZ1  1  
ATOM 1130  H HZ2  . LYS A 1 69  ? 10.349  2.752   -11.154 1.00 0.00 ? 69  LYS A HZ2  1  
ATOM 1131  H HZ3  . LYS A 1 69  ? 11.257  3.809   -12.107 1.00 0.00 ? 69  LYS A HZ3  1  
ATOM 1132  N N    . PHE A 1 70  ? 11.744  5.945   -4.367  1.00 0.00 ? 70  PHE A N    1  
ATOM 1133  C CA   . PHE A 1 70  ? 10.579  5.889   -3.474  1.00 0.00 ? 70  PHE A CA   1  
ATOM 1134  C C    . PHE A 1 70  ? 10.919  6.346   -2.050  1.00 0.00 ? 70  PHE A C    1  
ATOM 1135  O O    . PHE A 1 70  ? 10.265  7.241   -1.506  1.00 0.00 ? 70  PHE A O    1  
ATOM 1136  C CB   . PHE A 1 70  ? 10.011  4.459   -3.424  1.00 0.00 ? 70  PHE A CB   1  
ATOM 1137  C CG   . PHE A 1 70  ? 9.450   3.956   -4.732  1.00 0.00 ? 70  PHE A CG   1  
ATOM 1138  C CD1  . PHE A 1 70  ? 10.265  3.331   -5.665  1.00 0.00 ? 70  PHE A CD1  1  
ATOM 1139  C CD2  . PHE A 1 70  ? 8.100   4.094   -5.021  1.00 0.00 ? 70  PHE A CD2  1  
ATOM 1140  C CE1  . PHE A 1 70  ? 9.748   2.856   -6.855  1.00 0.00 ? 70  PHE A CE1  1  
ATOM 1141  C CE2  . PHE A 1 70  ? 7.579   3.624   -6.212  1.00 0.00 ? 70  PHE A CE2  1  
ATOM 1142  C CZ   . PHE A 1 70  ? 8.403   3.003   -7.129  1.00 0.00 ? 70  PHE A CZ   1  
ATOM 1143  H H    . PHE A 1 70  ? 12.563  5.472   -4.114  1.00 0.00 ? 70  PHE A H    1  
ATOM 1144  H HA   . PHE A 1 70  ? 9.820   6.548   -3.874  1.00 0.00 ? 70  PHE A HA   1  
ATOM 1145  H HB2  . PHE A 1 70  ? 10.798  3.782   -3.122  1.00 0.00 ? 70  PHE A HB2  1  
ATOM 1146  H HB3  . PHE A 1 70  ? 9.220   4.421   -2.687  1.00 0.00 ? 70  PHE A HB3  1  
ATOM 1147  H HD1  . PHE A 1 70  ? 11.318  3.218   -5.456  1.00 0.00 ? 70  PHE A HD1  1  
ATOM 1148  H HD2  . PHE A 1 70  ? 7.451   4.580   -4.306  1.00 0.00 ? 70  PHE A HD2  1  
ATOM 1149  H HE1  . PHE A 1 70  ? 10.396  2.372   -7.572  1.00 0.00 ? 70  PHE A HE1  1  
ATOM 1150  H HE2  . PHE A 1 70  ? 6.526   3.740   -6.424  1.00 0.00 ? 70  PHE A HE2  1  
ATOM 1151  H HZ   . PHE A 1 70  ? 7.995   2.632   -8.059  1.00 0.00 ? 70  PHE A HZ   1  
ATOM 1152  N N    . ILE A 1 71  ? 11.948  5.738   -1.460  1.00 0.00 ? 71  ILE A N    1  
ATOM 1153  C CA   . ILE A 1 71  ? 12.241  5.905   -0.033  1.00 0.00 ? 71  ILE A CA   1  
ATOM 1154  C C    . ILE A 1 71  ? 12.617  7.343   0.310   1.00 0.00 ? 71  ILE A C    1  
ATOM 1155  O O    . ILE A 1 71  ? 12.290  7.833   1.392   1.00 0.00 ? 71  ILE A O    1  
ATOM 1156  C CB   . ILE A 1 71  ? 13.376  4.949   0.428   1.00 0.00 ? 71  ILE A CB   1  
ATOM 1157  C CG1  . ILE A 1 71  ? 12.936  3.479   0.276   1.00 0.00 ? 71  ILE A CG1  1  
ATOM 1158  C CG2  . ILE A 1 71  ? 13.796  5.242   1.871   1.00 0.00 ? 71  ILE A CG2  1  
ATOM 1159  C CD1  . ILE A 1 71  ? 11.750  3.098   1.141   1.00 0.00 ? 71  ILE A CD1  1  
ATOM 1160  H H    . ILE A 1 71  ? 12.541  5.174   -2.001  1.00 0.00 ? 71  ILE A H    1  
ATOM 1161  H HA   . ILE A 1 71  ? 11.344  5.645   0.516   1.00 0.00 ? 71  ILE A HA   1  
ATOM 1162  H HB   . ILE A 1 71  ? 14.234  5.123   -0.207  1.00 0.00 ? 71  ILE A HB   1  
ATOM 1163  H HG12 . ILE A 1 71  ? 12.663  3.295   -0.753  1.00 0.00 ? 71  ILE A HG12 1  
ATOM 1164  H HG13 . ILE A 1 71  ? 13.762  2.833   0.544   1.00 0.00 ? 71  ILE A HG13 1  
ATOM 1165  H HG21 . ILE A 1 71  ? 14.574  4.551   2.167   1.00 0.00 ? 71  ILE A HG21 1  
ATOM 1166  H HG22 . ILE A 1 71  ? 12.946  5.126   2.528   1.00 0.00 ? 71  ILE A HG22 1  
ATOM 1167  H HG23 . ILE A 1 71  ? 14.169  6.253   1.941   1.00 0.00 ? 71  ILE A HG23 1  
ATOM 1168  H HD11 . ILE A 1 71  ? 11.502  2.060   0.975   1.00 0.00 ? 71  ILE A HD11 1  
ATOM 1169  H HD12 . ILE A 1 71  ? 10.902  3.714   0.883   1.00 0.00 ? 71  ILE A HD12 1  
ATOM 1170  H HD13 . ILE A 1 71  ? 11.998  3.246   2.183   1.00 0.00 ? 71  ILE A HD13 1  
ATOM 1171  N N    . GLN A 1 72  ? 13.295  8.016   -0.611  1.00 0.00 ? 72  GLN A N    1  
ATOM 1172  C CA   . GLN A 1 72  ? 13.755  9.381   -0.372  1.00 0.00 ? 72  GLN A CA   1  
ATOM 1173  C C    . GLN A 1 72  ? 12.600  10.324  -0.047  1.00 0.00 ? 72  GLN A C    1  
ATOM 1174  O O    . GLN A 1 72  ? 11.446  10.078  -0.409  1.00 0.00 ? 72  GLN A O    1  
ATOM 1175  C CB   . GLN A 1 72  ? 14.538  9.910   -1.575  1.00 0.00 ? 72  GLN A CB   1  
ATOM 1176  C CG   . GLN A 1 72  ? 15.917  9.284   -1.738  1.00 0.00 ? 72  GLN A CG   1  
ATOM 1177  C CD   . GLN A 1 72  ? 16.883  9.636   -0.614  1.00 0.00 ? 72  GLN A CD   1  
ATOM 1178  O OE1  . GLN A 1 72  ? 16.485  9.876   0.526   1.00 0.00 ? 72  GLN A OE1  1  
ATOM 1179  N NE2  . GLN A 1 72  ? 18.166  9.666   -0.934  1.00 0.00 ? 72  GLN A NE2  1  
ATOM 1180  H H    . GLN A 1 72  ? 13.490  7.586   -1.470  1.00 0.00 ? 72  GLN A H    1  
ATOM 1181  H HA   . GLN A 1 72  ? 14.416  9.353   0.483   1.00 0.00 ? 72  GLN A HA   1  
ATOM 1182  H HB2  . GLN A 1 72  ? 13.969  9.712   -2.474  1.00 0.00 ? 72  GLN A HB2  1  
ATOM 1183  H HB3  . GLN A 1 72  ? 14.663  10.981  -1.468  1.00 0.00 ? 72  GLN A HB3  1  
ATOM 1184  H HG2  . GLN A 1 72  ? 15.810  8.209   -1.773  1.00 0.00 ? 72  GLN A HG2  1  
ATOM 1185  H HG3  . GLN A 1 72  ? 16.335  9.631   -2.667  1.00 0.00 ? 72  GLN A HG3  1  
ATOM 1186  H HE21 . GLN A 1 72  ? 18.419  9.463   -1.858  1.00 0.00 ? 72  GLN A HE21 1  
ATOM 1187  H HE22 . GLN A 1 72  ? 18.814  9.892   -0.232  1.00 0.00 ? 72  GLN A HE22 1  
ATOM 1188  N N    . THR A 1 73  ? 12.928  11.404  0.650   1.00 0.00 ? 73  THR A N    1  
ATOM 1189  C CA   . THR A 1 73  ? 11.945  12.406  1.024   1.00 0.00 ? 73  THR A CA   1  
ATOM 1190  C C    . THR A 1 73  ? 11.568  13.249  -0.194  1.00 0.00 ? 73  THR A C    1  
ATOM 1191  O O    . THR A 1 73  ? 10.455  13.767  -0.287  1.00 0.00 ? 73  THR A O    1  
ATOM 1192  C CB   . THR A 1 73  ? 12.484  13.308  2.161   1.00 0.00 ? 73  THR A CB   1  
ATOM 1193  O OG1  . THR A 1 73  ? 11.393  13.940  2.847   1.00 0.00 ? 73  THR A OG1  1  
ATOM 1194  C CG2  . THR A 1 73  ? 13.435  14.376  1.629   1.00 0.00 ? 73  THR A CG2  1  
ATOM 1195  H H    . THR A 1 73  ? 13.861  11.526  0.927   1.00 0.00 ? 73  THR A H    1  
ATOM 1196  H HA   . THR A 1 73  ? 11.063  11.892  1.384   1.00 0.00 ? 73  THR A HA   1  
ATOM 1197  H HB   . THR A 1 73  ? 13.027  12.682  2.857   1.00 0.00 ? 73  THR A HB   1  
ATOM 1198  H HG1  . THR A 1 73  ? 11.380  14.881  2.634   1.00 0.00 ? 73  THR A HG1  1  
ATOM 1199  H HG21 . THR A 1 73  ? 14.261  13.902  1.119   1.00 0.00 ? 73  THR A HG21 1  
ATOM 1200  H HG22 . THR A 1 73  ? 13.813  14.963  2.453   1.00 0.00 ? 73  THR A HG22 1  
ATOM 1201  H HG23 . THR A 1 73  ? 12.908  15.020  0.940   1.00 0.00 ? 73  THR A HG23 1  
ATOM 1202  N N    . ASP A 1 74  ? 12.515  13.372  -1.120  1.00 0.00 ? 74  ASP A N    1  
ATOM 1203  C CA   . ASP A 1 74  ? 12.286  14.066  -2.379  1.00 0.00 ? 74  ASP A CA   1  
ATOM 1204  C C    . ASP A 1 74  ? 11.719  13.082  -3.399  1.00 0.00 ? 74  ASP A C    1  
ATOM 1205  O O    . ASP A 1 74  ? 10.503  12.995  -3.565  1.00 0.00 ? 74  ASP A O    1  
ATOM 1206  C CB   . ASP A 1 74  ? 13.597  14.699  -2.879  1.00 0.00 ? 74  ASP A CB   1  
ATOM 1207  C CG   . ASP A 1 74  ? 13.482  15.301  -4.272  1.00 0.00 ? 74  ASP A CG   1  
ATOM 1208  O OD1  . ASP A 1 74  ? 12.830  16.351  -4.419  1.00 0.00 ? 74  ASP A OD1  1  
ATOM 1209  O OD2  . ASP A 1 74  ? 14.053  14.727  -5.225  1.00 0.00 ? 74  ASP A OD2  1  
ATOM 1210  H H    . ASP A 1 74  ? 13.394  12.977  -0.952  1.00 0.00 ? 74  ASP A H    1  
ATOM 1211  H HA   . ASP A 1 74  ? 11.558  14.849  -2.205  1.00 0.00 ? 74  ASP A HA   1  
ATOM 1212  H HB2  . ASP A 1 74  ? 13.891  15.482  -2.195  1.00 0.00 ? 74  ASP A HB2  1  
ATOM 1213  H HB3  . ASP A 1 74  ? 14.367  13.940  -2.895  1.00 0.00 ? 74  ASP A HB3  1  
ATOM 1214  N N    . ALA A 1 75  ? 12.609  12.318  -4.039  1.00 0.00 ? 75  ALA A N    1  
ATOM 1215  C CA   . ALA A 1 75  ? 12.229  11.246  -4.965  1.00 0.00 ? 75  ALA A CA   1  
ATOM 1216  C C    . ALA A 1 75  ? 11.346  11.740  -6.128  1.00 0.00 ? 75  ALA A C    1  
ATOM 1217  O O    . ALA A 1 75  ? 10.734  12.806  -6.059  1.00 0.00 ? 75  ALA A O    1  
ATOM 1218  C CB   . ALA A 1 75  ? 11.530  10.125  -4.195  1.00 0.00 ? 75  ALA A CB   1  
ATOM 1219  H H    . ALA A 1 75  ? 13.560  12.481  -3.883  1.00 0.00 ? 75  ALA A H    1  
ATOM 1220  H HA   . ALA A 1 75  ? 13.142  10.840  -5.379  1.00 0.00 ? 75  ALA A HA   1  
ATOM 1221  H HB1  . ALA A 1 75  ? 11.324  9.301   -4.864  1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1222  H HB2  . ALA A 1 75  ? 10.602  10.493  -3.783  1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1223  H HB3  . ALA A 1 75  ? 12.170  9.783   -3.395  1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1224  N N    . PRO A 1 76  ? 11.303  10.983  -7.241  1.00 0.00 ? 76  PRO A N    1  
ATOM 1225  C CA   . PRO A 1 76  ? 10.355  11.243  -8.330  1.00 0.00 ? 76  PRO A CA   1  
ATOM 1226  C C    . PRO A 1 76  ? 8.937   10.793  -7.963  1.00 0.00 ? 76  PRO A C    1  
ATOM 1227  O O    . PRO A 1 76  ? 7.961   11.181  -8.612  1.00 0.00 ? 76  PRO A O    1  
ATOM 1228  C CB   . PRO A 1 76  ? 10.910  10.408  -9.490  1.00 0.00 ? 76  PRO A CB   1  
ATOM 1229  C CG   . PRO A 1 76  ? 11.632  9.285   -8.828  1.00 0.00 ? 76  PRO A CG   1  
ATOM 1230  C CD   . PRO A 1 76  ? 12.205  9.855   -7.554  1.00 0.00 ? 76  PRO A CD   1  
ATOM 1231  H HA   . PRO A 1 76  ? 10.341  12.289  -8.604  1.00 0.00 ? 76  PRO A HA   1  
ATOM 1232  H HB2  . PRO A 1 76  ? 10.097  10.052  -10.110 1.00 0.00 ? 76  PRO A HB2  1  
ATOM 1233  H HB3  . PRO A 1 76  ? 11.581  11.013  -10.085 1.00 0.00 ? 76  PRO A HB3  1  
ATOM 1234  H HG2  . PRO A 1 76  ? 10.940  8.484   -8.605  1.00 0.00 ? 76  PRO A HG2  1  
ATOM 1235  H HG3  . PRO A 1 76  ? 12.425  8.927   -9.470  1.00 0.00 ? 76  PRO A HG3  1  
ATOM 1236  H HD2  . PRO A 1 76  ? 12.185  9.114   -6.767  1.00 0.00 ? 76  PRO A HD2  1  
ATOM 1237  H HD3  . PRO A 1 76  ? 13.216  10.205  -7.717  1.00 0.00 ? 76  PRO A HD3  1  
ATOM 1238  N N    . LYS A 1 77  ? 8.835   9.962   -6.923  1.00 0.00 ? 77  LYS A N    1  
ATOM 1239  C CA   . LYS A 1 77  ? 7.543   9.484   -6.428  1.00 0.00 ? 77  LYS A CA   1  
ATOM 1240  C C    . LYS A 1 77  ? 7.181   10.185  -5.120  1.00 0.00 ? 77  LYS A C    1  
ATOM 1241  O O    . LYS A 1 77  ? 6.092   10.748  -4.989  1.00 0.00 ? 77  LYS A O    1  
ATOM 1242  C CB   . LYS A 1 77  ? 7.576   7.962   -6.204  1.00 0.00 ? 77  LYS A CB   1  
ATOM 1243  C CG   . LYS A 1 77  ? 7.910   7.145   -7.450  1.00 0.00 ? 77  LYS A CG   1  
ATOM 1244  C CD   . LYS A 1 77  ? 6.893   7.346   -8.574  1.00 0.00 ? 77  LYS A CD   1  
ATOM 1245  C CE   . LYS A 1 77  ? 5.477   6.959   -8.157  1.00 0.00 ? 77  LYS A CE   1  
ATOM 1246  N NZ   . LYS A 1 77  ? 5.393   5.555   -7.667  1.00 0.00 ? 77  LYS A NZ   1  
ATOM 1247  H H    . LYS A 1 77  ? 9.654   9.661   -6.478  1.00 0.00 ? 77  LYS A H    1  
ATOM 1248  H HA   . LYS A 1 77  ? 6.789   9.715   -7.170  1.00 0.00 ? 77  LYS A HA   1  
ATOM 1249  H HB2  . LYS A 1 77  ? 8.320   7.740   -5.451  1.00 0.00 ? 77  LYS A HB2  1  
ATOM 1250  H HB3  . LYS A 1 77  ? 6.609   7.643   -5.839  1.00 0.00 ? 77  LYS A HB3  1  
ATOM 1251  H HG2  . LYS A 1 77  ? 8.885   7.441   -7.809  1.00 0.00 ? 77  LYS A HG2  1  
ATOM 1252  H HG3  . LYS A 1 77  ? 7.933   6.097   -7.182  1.00 0.00 ? 77  LYS A HG3  1  
ATOM 1253  H HD2  . LYS A 1 77  ? 6.897   8.386   -8.868  1.00 0.00 ? 77  LYS A HD2  1  
ATOM 1254  H HD3  . LYS A 1 77  ? 7.186   6.736   -9.419  1.00 0.00 ? 77  LYS A HD3  1  
ATOM 1255  H HE2  . LYS A 1 77  ? 5.153   7.623   -7.367  1.00 0.00 ? 77  LYS A HE2  1  
ATOM 1256  H HE3  . LYS A 1 77  ? 4.822   7.072   -9.008  1.00 0.00 ? 77  LYS A HE3  1  
ATOM 1257  H HZ1  . LYS A 1 77  ? 5.838   4.908   -8.344  1.00 0.00 ? 77  LYS A HZ1  1  
ATOM 1258  H HZ2  . LYS A 1 77  ? 4.398   5.276   -7.554  1.00 0.00 ? 77  LYS A HZ2  1  
ATOM 1259  H HZ3  . LYS A 1 77  ? 5.870   5.464   -6.742  1.00 0.00 ? 77  LYS A HZ3  1  
ATOM 1260  N N    . GLU A 1 78  ? 8.119   10.154  -4.170  1.00 0.00 ? 78  GLU A N    1  
ATOM 1261  C CA   . GLU A 1 78  ? 7.912   10.693  -2.824  1.00 0.00 ? 78  GLU A CA   1  
ATOM 1262  C C    . GLU A 1 78  ? 6.826   9.901   -2.097  1.00 0.00 ? 78  GLU A C    1  
ATOM 1263  O O    . GLU A 1 78  ? 5.631   10.183  -2.235  1.00 0.00 ? 78  GLU A O    1  
ATOM 1264  C CB   . GLU A 1 78  ? 7.551   12.185  -2.859  1.00 0.00 ? 78  GLU A CB   1  
ATOM 1265  C CG   . GLU A 1 78  ? 7.400   12.813  -1.475  1.00 0.00 ? 78  GLU A CG   1  
ATOM 1266  C CD   . GLU A 1 78  ? 6.895   14.244  -1.530  1.00 0.00 ? 78  GLU A CD   1  
ATOM 1267  O OE1  . GLU A 1 78  ? 5.667   14.440  -1.656  1.00 0.00 ? 78  GLU A OE1  1  
ATOM 1268  O OE2  . GLU A 1 78  ? 7.716   15.182  -1.461  1.00 0.00 ? 78  GLU A OE2  1  
ATOM 1269  H H    . GLU A 1 78  ? 8.984   9.747   -4.380  1.00 0.00 ? 78  GLU A H    1  
ATOM 1270  H HA   . GLU A 1 78  ? 8.842   10.572  -2.284  1.00 0.00 ? 78  GLU A HA   1  
ATOM 1271  H HB2  . GLU A 1 78  ? 8.326   12.718  -3.391  1.00 0.00 ? 78  GLU A HB2  1  
ATOM 1272  H HB3  . GLU A 1 78  ? 6.617   12.305  -3.390  1.00 0.00 ? 78  GLU A HB3  1  
ATOM 1273  H HG2  . GLU A 1 78  ? 6.699   12.223  -0.899  1.00 0.00 ? 78  GLU A HG2  1  
ATOM 1274  H HG3  . GLU A 1 78  ? 8.364   12.802  -0.982  1.00 0.00 ? 78  GLU A HG3  1  
ATOM 1275  N N    . VAL A 1 79  ? 7.249   8.899   -1.335  1.00 0.00 ? 79  VAL A N    1  
ATOM 1276  C CA   . VAL A 1 79  ? 6.317   8.041   -0.610  1.00 0.00 ? 79  VAL A CA   1  
ATOM 1277  C C    . VAL A 1 79  ? 5.963   8.650   0.746   1.00 0.00 ? 79  VAL A C    1  
ATOM 1278  O O    . VAL A 1 79  ? 6.827   9.208   1.434   1.00 0.00 ? 79  VAL A O    1  
ATOM 1279  C CB   . VAL A 1 79  ? 6.898   6.619   -0.409  1.00 0.00 ? 79  VAL A CB   1  
ATOM 1280  C CG1  . VAL A 1 79  ? 5.920   5.726   0.357   1.00 0.00 ? 79  VAL A CG1  1  
ATOM 1281  C CG2  . VAL A 1 79  ? 7.254   5.998   -1.757  1.00 0.00 ? 79  VAL A CG2  1  
ATOM 1282  H H    . VAL A 1 79  ? 8.213   8.735   -1.255  1.00 0.00 ? 79  VAL A H    1  
ATOM 1283  H HA   . VAL A 1 79  ? 5.414   7.958   -1.201  1.00 0.00 ? 79  VAL A HA   1  
ATOM 1284  H HB   . VAL A 1 79  ? 7.806   6.701   0.174   1.00 0.00 ? 79  VAL A HB   1  
ATOM 1285  H HG11 . VAL A 1 79  ? 4.993   5.649   -0.193  1.00 0.00 ? 79  VAL A HG11 1  
ATOM 1286  H HG12 . VAL A 1 79  ? 5.726   6.153   1.330   1.00 0.00 ? 79  VAL A HG12 1  
ATOM 1287  H HG13 . VAL A 1 79  ? 6.349   4.741   0.477   1.00 0.00 ? 79  VAL A HG13 1  
ATOM 1288  H HG21 . VAL A 1 79  ? 7.682   5.017   -1.601  1.00 0.00 ? 79  VAL A HG21 1  
ATOM 1289  H HG22 . VAL A 1 79  ? 7.971   6.625   -2.267  1.00 0.00 ? 79  VAL A HG22 1  
ATOM 1290  H HG23 . VAL A 1 79  ? 6.362   5.907   -2.362  1.00 0.00 ? 79  VAL A HG23 1  
ATOM 1291  N N    . ASN A 1 80  ? 4.696   8.501   1.134   1.00 0.00 ? 80  ASN A N    1  
ATOM 1292  C CA   . ASN A 1 80  ? 4.169   9.082   2.374   1.00 0.00 ? 80  ASN A CA   1  
ATOM 1293  C C    . ASN A 1 80  ? 4.581   8.255   3.600   1.00 0.00 ? 80  ASN A C    1  
ATOM 1294  O O    . ASN A 1 80  ? 3.933   8.307   4.643   1.00 0.00 ? 80  ASN A O    1  
ATOM 1295  C CB   . ASN A 1 80  ? 2.633   9.183   2.298   1.00 0.00 ? 80  ASN A CB   1  
ATOM 1296  C CG   . ASN A 1 80  ? 2.152   10.034  1.131   1.00 0.00 ? 80  ASN A CG   1  
ATOM 1297  O OD1  . ASN A 1 80  ? 2.001   11.251  1.249   1.00 0.00 ? 80  ASN A OD1  1  
ATOM 1298  N ND2  . ASN A 1 80  ? 1.902   9.400   -0.006  1.00 0.00 ? 80  ASN A ND2  1  
ATOM 1299  H H    . ASN A 1 80  ? 4.089   7.983   0.562   1.00 0.00 ? 80  ASN A H    1  
ATOM 1300  H HA   . ASN A 1 80  ? 4.579   10.077  2.476   1.00 0.00 ? 80  ASN A HA   1  
ATOM 1301  H HB2  . ASN A 1 80  ? 2.217   8.192   2.190   1.00 0.00 ? 80  ASN A HB2  1  
ATOM 1302  H HB3  . ASN A 1 80  ? 2.263   9.621   3.215   1.00 0.00 ? 80  ASN A HB3  1  
ATOM 1303  H HD21 . ASN A 1 80  ? 2.041   8.430   -0.039  1.00 0.00 ? 80  ASN A HD21 1  
ATOM 1304  H HD22 . ASN A 1 80  ? 1.587   9.926   -0.773  1.00 0.00 ? 80  ASN A HD22 1  
ATOM 1305  N N    . LEU A 1 81  ? 5.669   7.502   3.465   1.00 0.00 ? 81  LEU A N    1  
ATOM 1306  C CA   . LEU A 1 81  ? 6.207   6.698   4.561   1.00 0.00 ? 81  LEU A CA   1  
ATOM 1307  C C    . LEU A 1 81  ? 6.715   7.591   5.698   1.00 0.00 ? 81  LEU A C    1  
ATOM 1308  O O    . LEU A 1 81  ? 7.276   8.661   5.452   1.00 0.00 ? 81  LEU A O    1  
ATOM 1309  C CB   . LEU A 1 81  ? 7.330   5.792   4.026   1.00 0.00 ? 81  LEU A CB   1  
ATOM 1310  C CG   . LEU A 1 81  ? 8.277   5.174   5.071   1.00 0.00 ? 81  LEU A CG   1  
ATOM 1311  C CD1  . LEU A 1 81  ? 7.533   4.188   5.961   1.00 0.00 ? 81  LEU A CD1  1  
ATOM 1312  C CD2  . LEU A 1 81  ? 9.464   4.498   4.385   1.00 0.00 ? 81  LEU A CD2  1  
ATOM 1313  H H    . LEU A 1 81  ? 6.133   7.494   2.607   1.00 0.00 ? 81  LEU A H    1  
ATOM 1314  H HA   . LEU A 1 81  ? 5.405   6.078   4.937   1.00 0.00 ? 81  LEU A HA   1  
ATOM 1315  H HB2  . LEU A 1 81  ? 6.863   4.977   3.489   1.00 0.00 ? 81  LEU A HB2  1  
ATOM 1316  H HB3  . LEU A 1 81  ? 7.924   6.365   3.328   1.00 0.00 ? 81  LEU A HB3  1  
ATOM 1317  H HG   . LEU A 1 81  ? 8.664   5.960   5.704   1.00 0.00 ? 81  LEU A HG   1  
ATOM 1318  H HD11 . LEU A 1 81  ? 7.117   3.396   5.356   1.00 0.00 ? 81  LEU A HD11 1  
ATOM 1319  H HD12 . LEU A 1 81  ? 6.735   4.701   6.478   1.00 0.00 ? 81  LEU A HD12 1  
ATOM 1320  H HD13 . LEU A 1 81  ? 8.216   3.769   6.684   1.00 0.00 ? 81  LEU A HD13 1  
ATOM 1321  H HD21 . LEU A 1 81  ? 9.108   3.716   3.729   1.00 0.00 ? 81  LEU A HD21 1  
ATOM 1322  H HD22 . LEU A 1 81  ? 10.118  4.070   5.132   1.00 0.00 ? 81  LEU A HD22 1  
ATOM 1323  H HD23 . LEU A 1 81  ? 10.011  5.229   3.809   1.00 0.00 ? 81  LEU A HD23 1  
ATOM 1324  N N    . ASP A 1 82  ? 6.504   7.129   6.935   1.00 0.00 ? 82  ASP A N    1  
ATOM 1325  C CA   . ASP A 1 82  ? 6.904   7.857   8.145   1.00 0.00 ? 82  ASP A CA   1  
ATOM 1326  C C    . ASP A 1 82  ? 8.351   8.349   8.068   1.00 0.00 ? 82  ASP A C    1  
ATOM 1327  O O    . ASP A 1 82  ? 9.241   7.629   7.600   1.00 0.00 ? 82  ASP A O    1  
ATOM 1328  C CB   . ASP A 1 82  ? 6.726   6.967   9.381   1.00 0.00 ? 82  ASP A CB   1  
ATOM 1329  C CG   . ASP A 1 82  ? 7.323   7.587   10.636  1.00 0.00 ? 82  ASP A CG   1  
ATOM 1330  O OD1  . ASP A 1 82  ? 6.756   8.574   11.149  1.00 0.00 ? 82  ASP A OD1  1  
ATOM 1331  O OD2  . ASP A 1 82  ? 8.375   7.102   11.107  1.00 0.00 ? 82  ASP A OD2  1  
ATOM 1332  H H    . ASP A 1 82  ? 6.052   6.268   7.039   1.00 0.00 ? 82  ASP A H    1  
ATOM 1333  H HA   . ASP A 1 82  ? 6.251   8.715   8.239   1.00 0.00 ? 82  ASP A HA   1  
ATOM 1334  H HB2  . ASP A 1 82  ? 5.671   6.803   9.551   1.00 0.00 ? 82  ASP A HB2  1  
ATOM 1335  H HB3  . ASP A 1 82  ? 7.206   6.014   9.205   1.00 0.00 ? 82  ASP A HB3  1  
ATOM 1336  N N    . PHE A 1 83  ? 8.574   9.568   8.561   1.00 0.00 ? 83  PHE A N    1  
ATOM 1337  C CA   . PHE A 1 83  ? 9.878   10.221  8.493   1.00 0.00 ? 83  PHE A CA   1  
ATOM 1338  C C    . PHE A 1 83  ? 10.941  9.421   9.242   1.00 0.00 ? 83  PHE A C    1  
ATOM 1339  O O    . PHE A 1 83  ? 11.989  9.095   8.684   1.00 0.00 ? 83  PHE A O    1  
ATOM 1340  C CB   . PHE A 1 83  ? 9.791   11.645  9.063   1.00 0.00 ? 83  PHE A CB   1  
ATOM 1341  C CG   . PHE A 1 83  ? 11.093  12.411  9.000   1.00 0.00 ? 83  PHE A CG   1  
ATOM 1342  C CD1  . PHE A 1 83  ? 11.488  13.041  7.827   1.00 0.00 ? 83  PHE A CD1  1  
ATOM 1343  C CD2  . PHE A 1 83  ? 11.923  12.500  10.112  1.00 0.00 ? 83  PHE A CD2  1  
ATOM 1344  C CE1  . PHE A 1 83  ? 12.678  13.741  7.764   1.00 0.00 ? 83  PHE A CE1  1  
ATOM 1345  C CE2  . PHE A 1 83  ? 13.115  13.199  10.053  1.00 0.00 ? 83  PHE A CE2  1  
ATOM 1346  C CZ   . PHE A 1 83  ? 13.493  13.821  8.879   1.00 0.00 ? 83  PHE A CZ   1  
ATOM 1347  H H    . PHE A 1 83  ? 7.833   10.041  8.992   1.00 0.00 ? 83  PHE A H    1  
ATOM 1348  H HA   . PHE A 1 83  ? 10.161  10.281  7.451   1.00 0.00 ? 83  PHE A HA   1  
ATOM 1349  H HB2  . PHE A 1 83  ? 9.051   12.202  8.504   1.00 0.00 ? 83  PHE A HB2  1  
ATOM 1350  H HB3  . PHE A 1 83  ? 9.484   11.593  10.100  1.00 0.00 ? 83  PHE A HB3  1  
ATOM 1351  H HD1  . PHE A 1 83  ? 10.853  12.983  6.954   1.00 0.00 ? 83  PHE A HD1  1  
ATOM 1352  H HD2  . PHE A 1 83  ? 11.631  12.013  11.032  1.00 0.00 ? 83  PHE A HD2  1  
ATOM 1353  H HE1  . PHE A 1 83  ? 12.973  14.225  6.844   1.00 0.00 ? 83  PHE A HE1  1  
ATOM 1354  H HE2  . PHE A 1 83  ? 13.751  13.260  10.925  1.00 0.00 ? 83  PHE A HE2  1  
ATOM 1355  H HZ   . PHE A 1 83  ? 14.423  14.368  8.831   1.00 0.00 ? 83  PHE A HZ   1  
ATOM 1356  N N    . HIS A 1 84  ? 10.661  9.098   10.502  1.00 0.00 ? 84  HIS A N    1  
ATOM 1357  C CA   . HIS A 1 84  ? 11.625  8.389   11.339  1.00 0.00 ? 84  HIS A CA   1  
ATOM 1358  C C    . HIS A 1 84  ? 11.990  7.045   10.718  1.00 0.00 ? 84  HIS A C    1  
ATOM 1359  O O    . HIS A 1 84  ? 13.148  6.625   10.755  1.00 0.00 ? 84  HIS A O    1  
ATOM 1360  C CB   . HIS A 1 84  ? 11.074  8.181   12.757  1.00 0.00 ? 84  HIS A CB   1  
ATOM 1361  C CG   . HIS A 1 84  ? 12.060  7.537   13.686  1.00 0.00 ? 84  HIS A CG   1  
ATOM 1362  N ND1  . HIS A 1 84  ? 12.959  8.260   14.437  1.00 0.00 ? 84  HIS A ND1  1  
ATOM 1363  C CD2  . HIS A 1 84  ? 12.303  6.232   13.967  1.00 0.00 ? 84  HIS A CD2  1  
ATOM 1364  C CE1  . HIS A 1 84  ? 13.714  7.434   15.133  1.00 0.00 ? 84  HIS A CE1  1  
ATOM 1365  N NE2  . HIS A 1 84  ? 13.336  6.200   14.869  1.00 0.00 ? 84  HIS A NE2  1  
ATOM 1366  H H    . HIS A 1 84  ? 9.787   9.342   10.878  1.00 0.00 ? 84  HIS A H    1  
ATOM 1367  H HA   . HIS A 1 84  ? 12.518  8.997   11.397  1.00 0.00 ? 84  HIS A HA   1  
ATOM 1368  H HB2  . HIS A 1 84  ? 10.800  9.139   13.174  1.00 0.00 ? 84  HIS A HB2  1  
ATOM 1369  H HB3  . HIS A 1 84  ? 10.196  7.551   12.709  1.00 0.00 ? 84  HIS A HB3  1  
ATOM 1370  H HD1  . HIS A 1 84  ? 13.023  9.242   14.465  1.00 0.00 ? 84  HIS A HD1  1  
ATOM 1371  H HD2  . HIS A 1 84  ? 11.780  5.377   13.560  1.00 0.00 ? 84  HIS A HD2  1  
ATOM 1372  H HE1  . HIS A 1 84  ? 14.511  7.718   15.800  1.00 0.00 ? 84  HIS A HE1  1  
ATOM 1373  H HE2  . HIS A 1 84  ? 13.804  5.392   15.172  1.00 0.00 ? 84  HIS A HE2  1  
ATOM 1374  N N    . THR A 1 85  ? 10.995  6.384   10.137  1.00 0.00 ? 85  THR A N    1  
ATOM 1375  C CA   . THR A 1 85  ? 11.199  5.084   9.517   1.00 0.00 ? 85  THR A CA   1  
ATOM 1376  C C    . THR A 1 85  ? 12.108  5.204   8.292   1.00 0.00 ? 85  THR A C    1  
ATOM 1377  O O    . THR A 1 85  ? 13.113  4.497   8.184   1.00 0.00 ? 85  THR A O    1  
ATOM 1378  C CB   . THR A 1 85  ? 9.853   4.449   9.104   1.00 0.00 ? 85  THR A CB   1  
ATOM 1379  O OG1  . THR A 1 85  ? 8.970   4.396   10.235  1.00 0.00 ? 85  THR A OG1  1  
ATOM 1380  C CG2  . THR A 1 85  ? 10.051  3.040   8.547   1.00 0.00 ? 85  THR A CG2  1  
ATOM 1381  H H    . THR A 1 85  ? 10.099  6.787   10.125  1.00 0.00 ? 85  THR A H    1  
ATOM 1382  H HA   . THR A 1 85  ? 11.671  4.437   10.245  1.00 0.00 ? 85  THR A HA   1  
ATOM 1383  H HB   . THR A 1 85  ? 9.401   5.064   8.336   1.00 0.00 ? 85  THR A HB   1  
ATOM 1384  H HG1  . THR A 1 85  ? 8.941   5.263   10.661  1.00 0.00 ? 85  THR A HG1  1  
ATOM 1385  H HG21 . THR A 1 85  ? 10.505  2.412   9.301   1.00 0.00 ? 85  THR A HG21 1  
ATOM 1386  H HG22 . THR A 1 85  ? 10.695  3.080   7.679   1.00 0.00 ? 85  THR A HG22 1  
ATOM 1387  H HG23 . THR A 1 85  ? 9.093   2.625   8.264   1.00 0.00 ? 85  THR A HG23 1  
ATOM 1388  N N    . LYS A 1 86  ? 11.769  6.122   7.385   1.00 0.00 ? 86  LYS A N    1  
ATOM 1389  C CA   . LYS A 1 86  ? 12.534  6.292   6.149   1.00 0.00 ? 86  LYS A CA   1  
ATOM 1390  C C    . LYS A 1 86  ? 13.933  6.830   6.452   1.00 0.00 ? 86  LYS A C    1  
ATOM 1391  O O    . LYS A 1 86  ? 14.870  6.592   5.695   1.00 0.00 ? 86  LYS A O    1  
ATOM 1392  C CB   . LYS A 1 86  ? 11.781  7.202   5.154   1.00 0.00 ? 86  LYS A CB   1  
ATOM 1393  C CG   . LYS A 1 86  ? 11.562  8.635   5.638   1.00 0.00 ? 86  LYS A CG   1  
ATOM 1394  C CD   . LYS A 1 86  ? 10.467  9.356   4.841   1.00 0.00 ? 86  LYS A CD   1  
ATOM 1395  C CE   . LYS A 1 86  ? 10.775  9.415   3.348   1.00 0.00 ? 86  LYS A CE   1  
ATOM 1396  N NZ   . LYS A 1 86  ? 9.694   10.088  2.575   1.00 0.00 ? 86  LYS A NZ   1  
ATOM 1397  H H    . LYS A 1 86  ? 10.994  6.701   7.552   1.00 0.00 ? 86  LYS A H    1  
ATOM 1398  H HA   . LYS A 1 86  ? 12.641  5.312   5.702   1.00 0.00 ? 86  LYS A HA   1  
ATOM 1399  H HB2  . LYS A 1 86  ? 12.344  7.241   4.232   1.00 0.00 ? 86  LYS A HB2  1  
ATOM 1400  H HB3  . LYS A 1 86  ? 10.815  6.761   4.951   1.00 0.00 ? 86  LYS A HB3  1  
ATOM 1401  H HG2  . LYS A 1 86  ? 11.273  8.613   6.679   1.00 0.00 ? 86  LYS A HG2  1  
ATOM 1402  H HG3  . LYS A 1 86  ? 12.488  9.184   5.535   1.00 0.00 ? 86  LYS A HG3  1  
ATOM 1403  H HD2  . LYS A 1 86  ? 9.531   8.834   4.982   1.00 0.00 ? 86  LYS A HD2  1  
ATOM 1404  H HD3  . LYS A 1 86  ? 10.371  10.366  5.219   1.00 0.00 ? 86  LYS A HD3  1  
ATOM 1405  H HE2  . LYS A 1 86  ? 11.697  9.960   3.206   1.00 0.00 ? 86  LYS A HE2  1  
ATOM 1406  H HE3  . LYS A 1 86  ? 10.896  8.406   2.978   1.00 0.00 ? 86  LYS A HE3  1  
ATOM 1407  H HZ1  . LYS A 1 86  ? 9.563   11.064  2.914   1.00 0.00 ? 86  LYS A HZ1  1  
ATOM 1408  H HZ2  . LYS A 1 86  ? 8.797   9.575   2.688   1.00 0.00 ? 86  LYS A HZ2  1  
ATOM 1409  H HZ3  . LYS A 1 86  ? 9.939   10.114  1.565   1.00 0.00 ? 86  LYS A HZ3  1  
ATOM 1410  N N    . GLU A 1 87  ? 14.069  7.530   7.577   1.00 0.00 ? 87  GLU A N    1  
ATOM 1411  C CA   . GLU A 1 87  ? 15.364  8.031   8.038   1.00 0.00 ? 87  GLU A CA   1  
ATOM 1412  C C    . GLU A 1 87  ? 16.286  6.845   8.356   1.00 0.00 ? 87  GLU A C    1  
ATOM 1413  O O    . GLU A 1 87  ? 17.408  6.741   7.840   1.00 0.00 ? 87  GLU A O    1  
ATOM 1414  C CB   . GLU A 1 87  ? 15.147  8.924   9.278   1.00 0.00 ? 87  GLU A CB   1  
ATOM 1415  C CG   . GLU A 1 87  ? 16.310  9.854   9.632   1.00 0.00 ? 87  GLU A CG   1  
ATOM 1416  C CD   . GLU A 1 87  ? 17.485  9.151   10.295  1.00 0.00 ? 87  GLU A CD   1  
ATOM 1417  O OE1  . GLU A 1 87  ? 17.324  8.642   11.428  1.00 0.00 ? 87  GLU A OE1  1  
ATOM 1418  O OE2  . GLU A 1 87  ? 18.580  9.122   9.701   1.00 0.00 ? 87  GLU A OE2  1  
ATOM 1419  H H    . GLU A 1 87  ? 13.271  7.725   8.112   1.00 0.00 ? 87  GLU A H    1  
ATOM 1420  H HA   . GLU A 1 87  ? 15.803  8.619   7.242   1.00 0.00 ? 87  GLU A HA   1  
ATOM 1421  H HB2  . GLU A 1 87  ? 14.275  9.538   9.106   1.00 0.00 ? 87  GLU A HB2  1  
ATOM 1422  H HB3  . GLU A 1 87  ? 14.954  8.287   10.132  1.00 0.00 ? 87  GLU A HB3  1  
ATOM 1423  H HG2  . GLU A 1 87  ? 16.659  10.327  8.725   1.00 0.00 ? 87  GLU A HG2  1  
ATOM 1424  H HG3  . GLU A 1 87  ? 15.944  10.617  10.305  1.00 0.00 ? 87  GLU A HG3  1  
ATOM 1425  N N    . VAL A 1 88  ? 15.786  5.931   9.179   1.00 0.00 ? 88  VAL A N    1  
ATOM 1426  C CA   . VAL A 1 88  ? 16.527  4.723   9.521   1.00 0.00 ? 88  VAL A CA   1  
ATOM 1427  C C    . VAL A 1 88  ? 16.848  3.920   8.256   1.00 0.00 ? 88  VAL A C    1  
ATOM 1428  O O    . VAL A 1 88  ? 17.936  3.348   8.128   1.00 0.00 ? 88  VAL A O    1  
ATOM 1429  C CB   . VAL A 1 88  ? 15.737  3.845   10.529  1.00 0.00 ? 88  VAL A CB   1  
ATOM 1430  C CG1  . VAL A 1 88  ? 16.477  2.538   10.821  1.00 0.00 ? 88  VAL A CG1  1  
ATOM 1431  C CG2  . VAL A 1 88  ? 15.472  4.618   11.822  1.00 0.00 ? 88  VAL A CG2  1  
ATOM 1432  H H    . VAL A 1 88  ? 14.896  6.073   9.568   1.00 0.00 ? 88  VAL A H    1  
ATOM 1433  H HA   . VAL A 1 88  ? 17.455  5.026   9.987   1.00 0.00 ? 88  VAL A HA   1  
ATOM 1434  H HB   . VAL A 1 88  ? 14.782  3.599   10.086  1.00 0.00 ? 88  VAL A HB   1  
ATOM 1435  H HG11 . VAL A 1 88  ? 17.453  2.758   11.229  1.00 0.00 ? 88  VAL A HG11 1  
ATOM 1436  H HG12 . VAL A 1 88  ? 16.589  1.973   9.907   1.00 0.00 ? 88  VAL A HG12 1  
ATOM 1437  H HG13 . VAL A 1 88  ? 15.912  1.954   11.535  1.00 0.00 ? 88  VAL A HG13 1  
ATOM 1438  H HG21 . VAL A 1 88  ? 16.412  4.907   12.272  1.00 0.00 ? 88  VAL A HG21 1  
ATOM 1439  H HG22 . VAL A 1 88  ? 14.921  3.992   12.512  1.00 0.00 ? 88  VAL A HG22 1  
ATOM 1440  H HG23 . VAL A 1 88  ? 14.892  5.503   11.602  1.00 0.00 ? 88  VAL A HG23 1  
ATOM 1441  N N    . ILE A 1 89  ? 15.911  3.908   7.309   1.00 0.00 ? 89  ILE A N    1  
ATOM 1442  C CA   . ILE A 1 89  ? 16.098  3.192   6.050   1.00 0.00 ? 89  ILE A CA   1  
ATOM 1443  C C    . ILE A 1 89  ? 17.203  3.835   5.205   1.00 0.00 ? 89  ILE A C    1  
ATOM 1444  O O    . ILE A 1 89  ? 18.065  3.131   4.675   1.00 0.00 ? 89  ILE A O    1  
ATOM 1445  C CB   . ILE A 1 89  ? 14.787  3.118   5.223   1.00 0.00 ? 89  ILE A CB   1  
ATOM 1446  C CG1  . ILE A 1 89  ? 13.708  2.341   5.999   1.00 0.00 ? 89  ILE A CG1  1  
ATOM 1447  C CG2  . ILE A 1 89  ? 15.040  2.469   3.859   1.00 0.00 ? 89  ILE A CG2  1  
ATOM 1448  C CD1  . ILE A 1 89  ? 12.376  2.250   5.282   1.00 0.00 ? 89  ILE A CD1  1  
ATOM 1449  H H    . ILE A 1 89  ? 15.069  4.392   7.465   1.00 0.00 ? 89  ILE A H    1  
ATOM 1450  H HA   . ILE A 1 89  ? 16.398  2.178   6.292   1.00 0.00 ? 89  ILE A HA   1  
ATOM 1451  H HB   . ILE A 1 89  ? 14.441  4.128   5.053   1.00 0.00 ? 89  ILE A HB   1  
ATOM 1452  H HG12 . ILE A 1 89  ? 14.053  1.333   6.175   1.00 0.00 ? 89  ILE A HG12 1  
ATOM 1453  H HG13 . ILE A 1 89  ? 13.539  2.827   6.950   1.00 0.00 ? 89  ILE A HG13 1  
ATOM 1454  H HG21 . ILE A 1 89  ? 15.412  1.463   3.999   1.00 0.00 ? 89  ILE A HG21 1  
ATOM 1455  H HG22 . ILE A 1 89  ? 15.771  3.048   3.313   1.00 0.00 ? 89  ILE A HG22 1  
ATOM 1456  H HG23 . ILE A 1 89  ? 14.117  2.437   3.297   1.00 0.00 ? 89  ILE A HG23 1  
ATOM 1457  H HD11 . ILE A 1 89  ? 11.990  3.245   5.111   1.00 0.00 ? 89  ILE A HD11 1  
ATOM 1458  H HD12 . ILE A 1 89  ? 11.679  1.693   5.889   1.00 0.00 ? 89  ILE A HD12 1  
ATOM 1459  H HD13 . ILE A 1 89  ? 12.508  1.747   4.334   1.00 0.00 ? 89  ILE A HD13 1  
ATOM 1460  N N    . THR A 1 90  ? 17.192  5.171   5.098   1.00 0.00 ? 90  THR A N    1  
ATOM 1461  C CA   . THR A 1 90  ? 18.190  5.881   4.289   1.00 0.00 ? 90  THR A CA   1  
ATOM 1462  C C    . THR A 1 90  ? 19.605  5.553   4.764   1.00 0.00 ? 90  THR A C    1  
ATOM 1463  O O    . THR A 1 90  ? 20.565  5.620   3.993   1.00 0.00 ? 90  THR A O    1  
ATOM 1464  C CB   . THR A 1 90  ? 17.980  7.422   4.299   1.00 0.00 ? 90  THR A CB   1  
ATOM 1465  O OG1  . THR A 1 90  ? 17.969  7.918   5.641   1.00 0.00 ? 90  THR A OG1  1  
ATOM 1466  C CG2  . THR A 1 90  ? 16.681  7.816   3.599   1.00 0.00 ? 90  THR A CG2  1  
ATOM 1467  H H    . THR A 1 90  ? 16.500  5.685   5.565   1.00 0.00 ? 90  THR A H    1  
ATOM 1468  H HA   . THR A 1 90  ? 18.087  5.536   3.272   1.00 0.00 ? 90  THR A HA   1  
ATOM 1469  H HB   . THR A 1 90  ? 18.804  7.882   3.768   1.00 0.00 ? 90  THR A HB   1  
ATOM 1470  H HG1  . THR A 1 90  ? 18.131  7.194   6.250   1.00 0.00 ? 90  THR A HG1  1  
ATOM 1471  H HG21 . THR A 1 90  ? 15.849  7.324   4.080   1.00 0.00 ? 90  THR A HG21 1  
ATOM 1472  H HG22 . THR A 1 90  ? 16.722  7.520   2.562   1.00 0.00 ? 90  THR A HG22 1  
ATOM 1473  H HG23 . THR A 1 90  ? 16.548  8.887   3.661   1.00 0.00 ? 90  THR A HG23 1  
ATOM 1474  N N    . ASN A 1 91  ? 19.728  5.191   6.038   1.00 0.00 ? 91  ASN A N    1  
ATOM 1475  C CA   . ASN A 1 91  ? 21.013  4.768   6.595   1.00 0.00 ? 91  ASN A CA   1  
ATOM 1476  C C    . ASN A 1 91  ? 21.231  3.268   6.401   1.00 0.00 ? 91  ASN A C    1  
ATOM 1477  O O    . ASN A 1 91  ? 22.328  2.832   6.044   1.00 0.00 ? 91  ASN A O    1  
ATOM 1478  C CB   . ASN A 1 91  ? 21.087  5.126   8.082   1.00 0.00 ? 91  ASN A CB   1  
ATOM 1479  C CG   . ASN A 1 91  ? 21.026  6.624   8.311   1.00 0.00 ? 91  ASN A CG   1  
ATOM 1480  O OD1  . ASN A 1 91  ? 21.575  7.410   7.532   1.00 0.00 ? 91  ASN A OD1  1  
ATOM 1481  N ND2  . ASN A 1 91  ? 20.345  7.033   9.361   1.00 0.00 ? 91  ASN A ND2  1  
ATOM 1482  H H    . ASN A 1 91  ? 18.934  5.230   6.628   1.00 0.00 ? 91  ASN A H    1  
ATOM 1483  H HA   . ASN A 1 91  ? 21.794  5.302   6.070   1.00 0.00 ? 91  ASN A HA   1  
ATOM 1484  H HB2  . ASN A 1 91  ? 20.257  4.664   8.599   1.00 0.00 ? 91  ASN A HB2  1  
ATOM 1485  H HB3  . ASN A 1 91  ? 22.015  4.755   8.492   1.00 0.00 ? 91  ASN A HB3  1  
ATOM 1486  H HD21 . ASN A 1 91  ? 19.924  6.357   9.935   1.00 0.00 ? 91  ASN A HD21 1  
ATOM 1487  H HD22 . ASN A 1 91  ? 20.263  7.995   9.512   1.00 0.00 ? 91  ASN A HD22 1  
ATOM 1488  N N    . SER A 1 92  ? 20.177  2.485   6.611   1.00 0.00 ? 92  SER A N    1  
ATOM 1489  C CA   . SER A 1 92  ? 20.273  1.024   6.566   1.00 0.00 ? 92  SER A CA   1  
ATOM 1490  C C    . SER A 1 92  ? 20.273  0.502   5.124   1.00 0.00 ? 92  SER A C    1  
ATOM 1491  O O    . SER A 1 92  ? 20.373  -0.706  4.897   1.00 0.00 ? 92  SER A O    1  
ATOM 1492  C CB   . SER A 1 92  ? 19.111  0.399   7.356   1.00 0.00 ? 92  SER A CB   1  
ATOM 1493  O OG   . SER A 1 92  ? 19.262  -1.009  7.490   1.00 0.00 ? 92  SER A OG   1  
ATOM 1494  H H    . SER A 1 92  ? 19.306  2.897   6.803   1.00 0.00 ? 92  SER A H    1  
ATOM 1495  H HA   . SER A 1 92  ? 21.204  0.739   7.036   1.00 0.00 ? 92  SER A HA   1  
ATOM 1496  H HB2  . SER A 1 92  ? 19.076  0.835   8.343   1.00 0.00 ? 92  SER A HB2  1  
ATOM 1497  H HB3  . SER A 1 92  ? 18.180  0.601   6.844   1.00 0.00 ? 92  SER A HB3  1  
ATOM 1498  H HG   . SER A 1 92  ? 19.559  -1.382  6.647   1.00 0.00 ? 92  SER A HG   1  
ATOM 1499  N N    . ILE A 1 93  ? 20.170  1.412   4.155   1.00 0.00 ? 93  ILE A N    1  
ATOM 1500  C CA   . ILE A 1 93  ? 20.100  1.037   2.741   1.00 0.00 ? 93  ILE A CA   1  
ATOM 1501  C C    . ILE A 1 93  ? 21.470  0.590   2.207   1.00 0.00 ? 93  ILE A C    1  
ATOM 1502  O O    . ILE A 1 93  ? 21.591  0.157   1.055   1.00 0.00 ? 93  ILE A O    1  
ATOM 1503  C CB   . ILE A 1 93  ? 19.554  2.213   1.881   1.00 0.00 ? 93  ILE A CB   1  
ATOM 1504  C CG1  . ILE A 1 93  ? 19.208  1.742   0.456   1.00 0.00 ? 93  ILE A CG1  1  
ATOM 1505  C CG2  . ILE A 1 93  ? 20.559  3.363   1.838   1.00 0.00 ? 93  ILE A CG2  1  
ATOM 1506  C CD1  . ILE A 1 93  ? 18.127  0.680   0.410   1.00 0.00 ? 93  ILE A CD1  1  
ATOM 1507  H H    . ILE A 1 93  ? 20.126  2.361   4.399   1.00 0.00 ? 93  ILE A H    1  
ATOM 1508  H HA   . ILE A 1 93  ? 19.409  0.210   2.655   1.00 0.00 ? 93  ILE A HA   1  
ATOM 1509  H HB   . ILE A 1 93  ? 18.655  2.581   2.353   1.00 0.00 ? 93  ILE A HB   1  
ATOM 1510  H HG12 . ILE A 1 93  ? 18.862  2.586   -0.123  1.00 0.00 ? 93  ILE A HG12 1  
ATOM 1511  H HG13 . ILE A 1 93  ? 20.093  1.333   -0.010  1.00 0.00 ? 93  ILE A HG13 1  
ATOM 1512  H HG21 . ILE A 1 93  ? 20.751  3.712   2.843   1.00 0.00 ? 93  ILE A HG21 1  
ATOM 1513  H HG22 . ILE A 1 93  ? 20.157  4.174   1.247   1.00 0.00 ? 93  ILE A HG22 1  
ATOM 1514  H HG23 . ILE A 1 93  ? 21.482  3.021   1.395   1.00 0.00 ? 93  ILE A HG23 1  
ATOM 1515  H HD11 . ILE A 1 93  ? 18.461  -0.198  0.943   1.00 0.00 ? 93  ILE A HD11 1  
ATOM 1516  H HD12 . ILE A 1 93  ? 17.922  0.420   -0.618  1.00 0.00 ? 93  ILE A HD12 1  
ATOM 1517  H HD13 . ILE A 1 93  ? 17.226  1.060   0.872   1.00 0.00 ? 93  ILE A HD13 1  
ATOM 1518  N N    . THR A 1 94  ? 22.502  0.695   3.044   1.00 0.00 ? 94  THR A N    1  
ATOM 1519  C CA   . THR A 1 94  ? 23.848  0.283   2.658   1.00 0.00 ? 94  THR A CA   1  
ATOM 1520  C C    . THR A 1 94  ? 23.908  -1.234  2.414   1.00 0.00 ? 94  THR A C    1  
ATOM 1521  O O    . THR A 1 94  ? 24.424  -1.683  1.386   1.00 0.00 ? 94  THR A O    1  
ATOM 1522  C CB   . THR A 1 94  ? 24.904  0.720   3.709   1.00 0.00 ? 94  THR A CB   1  
ATOM 1523  O OG1  . THR A 1 94  ? 26.197  0.202   3.368   1.00 0.00 ? 94  THR A OG1  1  
ATOM 1524  C CG2  . THR A 1 94  ? 24.522  0.272   5.115   1.00 0.00 ? 94  THR A CG2  1  
ATOM 1525  H H    . THR A 1 94  ? 22.353  1.062   3.939   1.00 0.00 ? 94  THR A H    1  
ATOM 1526  H HA   . THR A 1 94  ? 24.083  0.783   1.725   1.00 0.00 ? 94  THR A HA   1  
ATOM 1527  H HB   . THR A 1 94  ? 24.956  1.801   3.703   1.00 0.00 ? 94  THR A HB   1  
ATOM 1528  H HG1  . THR A 1 94  ? 26.717  0.079   4.172   1.00 0.00 ? 94  THR A HG1  1  
ATOM 1529  H HG21 . THR A 1 94  ? 23.572  0.708   5.388   1.00 0.00 ? 94  THR A HG21 1  
ATOM 1530  H HG22 . THR A 1 94  ? 25.279  0.592   5.816   1.00 0.00 ? 94  THR A HG22 1  
ATOM 1531  H HG23 . THR A 1 94  ? 24.443  -0.806  5.141   1.00 0.00 ? 94  THR A HG23 1  
ATOM 1532  N N    . GLN A 1 95  ? 23.347  -2.018  3.338   1.00 0.00 ? 95  GLN A N    1  
ATOM 1533  C CA   . GLN A 1 95  ? 23.260  -3.472  3.169   1.00 0.00 ? 95  GLN A CA   1  
ATOM 1534  C C    . GLN A 1 95  ? 21.843  -3.961  3.485   1.00 0.00 ? 95  GLN A C    1  
ATOM 1535  O O    . GLN A 1 95  ? 21.564  -4.438  4.586   1.00 0.00 ? 95  GLN A O    1  
ATOM 1536  C CB   . GLN A 1 95  ? 24.315  -4.221  4.020   1.00 0.00 ? 95  GLN A CB   1  
ATOM 1537  C CG   . GLN A 1 95  ? 25.019  -3.383  5.091   1.00 0.00 ? 95  GLN A CG   1  
ATOM 1538  C CD   . GLN A 1 95  ? 24.136  -2.993  6.270   1.00 0.00 ? 95  GLN A CD   1  
ATOM 1539  O OE1  . GLN A 1 95  ? 22.927  -2.793  6.136   1.00 0.00 ? 95  GLN A OE1  1  
ATOM 1540  N NE2  . GLN A 1 95  ? 24.741  -2.882  7.440   1.00 0.00 ? 95  GLN A NE2  1  
ATOM 1541  H H    . GLN A 1 95  ? 22.972  -1.612  4.148   1.00 0.00 ? 95  GLN A H    1  
ATOM 1542  H HA   . GLN A 1 95  ? 23.455  -3.683  2.125   1.00 0.00 ? 95  GLN A HA   1  
ATOM 1543  H HB2  . GLN A 1 95  ? 23.836  -5.053  4.517   1.00 0.00 ? 95  GLN A HB2  1  
ATOM 1544  H HB3  . GLN A 1 95  ? 25.073  -4.613  3.356   1.00 0.00 ? 95  GLN A HB3  1  
ATOM 1545  H HG2  . GLN A 1 95  ? 25.856  -3.949  5.471   1.00 0.00 ? 95  GLN A HG2  1  
ATOM 1546  H HG3  . GLN A 1 95  ? 25.389  -2.478  4.628   1.00 0.00 ? 95  GLN A HG3  1  
ATOM 1547  H HE21 . GLN A 1 95  ? 25.708  -3.058  7.479   1.00 0.00 ? 95  GLN A HE21 1  
ATOM 1548  H HE22 . GLN A 1 95  ? 24.204  -2.625  8.220   1.00 0.00 ? 95  GLN A HE22 1  
ATOM 1549  N N    . PRO A 1 96  ? 20.926  -3.835  2.510   1.00 0.00 ? 96  PRO A N    1  
ATOM 1550  C CA   . PRO A 1 96  ? 19.516  -4.193  2.696   1.00 0.00 ? 96  PRO A CA   1  
ATOM 1551  C C    . PRO A 1 96  ? 19.297  -5.703  2.787   1.00 0.00 ? 96  PRO A C    1  
ATOM 1552  O O    . PRO A 1 96  ? 19.935  -6.482  2.074   1.00 0.00 ? 96  PRO A O    1  
ATOM 1553  C CB   . PRO A 1 96  ? 18.844  -3.624  1.440   1.00 0.00 ? 96  PRO A CB   1  
ATOM 1554  C CG   . PRO A 1 96  ? 19.919  -3.639  0.406   1.00 0.00 ? 96  PRO A CG   1  
ATOM 1555  C CD   . PRO A 1 96  ? 21.194  -3.338  1.144   1.00 0.00 ? 96  PRO A CD   1  
ATOM 1556  H HA   . PRO A 1 96  ? 19.102  -3.716  3.575   1.00 0.00 ? 96  PRO A HA   1  
ATOM 1557  H HB2  . PRO A 1 96  ? 18.006  -4.247  1.156   1.00 0.00 ? 96  PRO A HB2  1  
ATOM 1558  H HB3  . PRO A 1 96  ? 18.499  -2.617  1.636   1.00 0.00 ? 96  PRO A HB3  1  
ATOM 1559  H HG2  . PRO A 1 96  ? 19.972  -4.615  -0.056  1.00 0.00 ? 96  PRO A HG2  1  
ATOM 1560  H HG3  . PRO A 1 96  ? 19.725  -2.880  -0.339  1.00 0.00 ? 96  PRO A HG3  1  
ATOM 1561  H HD2  . PRO A 1 96  ? 22.025  -3.865  0.695   1.00 0.00 ? 96  PRO A HD2  1  
ATOM 1562  H HD3  . PRO A 1 96  ? 21.384  -2.272  1.153   1.00 0.00 ? 96  PRO A HD3  1  
ATOM 1563  N N    . THR A 1 97  ? 18.412  -6.103  3.693   1.00 0.00 ? 97  THR A N    1  
ATOM 1564  C CA   . THR A 1 97  ? 17.987  -7.490  3.812   1.00 0.00 ? 97  THR A CA   1  
ATOM 1565  C C    . THR A 1 97  ? 16.810  -7.771  2.872   1.00 0.00 ? 97  THR A C    1  
ATOM 1566  O O    . THR A 1 97  ? 16.269  -6.848  2.252   1.00 0.00 ? 97  THR A O    1  
ATOM 1567  C CB   . THR A 1 97  ? 17.580  -7.803  5.271   1.00 0.00 ? 97  THR A CB   1  
ATOM 1568  O OG1  . THR A 1 97  ? 16.621  -6.836  5.725   1.00 0.00 ? 97  THR A OG1  1  
ATOM 1569  C CG2  . THR A 1 97  ? 18.794  -7.783  6.193   1.00 0.00 ? 97  THR A CG2  1  
ATOM 1570  H H    . THR A 1 97  ? 18.040  -5.447  4.313   1.00 0.00 ? 97  THR A H    1  
ATOM 1571  H HA   . THR A 1 97  ? 18.818  -8.129  3.540   1.00 0.00 ? 97  THR A HA   1  
ATOM 1572  H HB   . THR A 1 97  ? 17.133  -8.787  5.307   1.00 0.00 ? 97  THR A HB   1  
ATOM 1573  H HG1  . THR A 1 97  ? 16.877  -6.516  6.600   1.00 0.00 ? 97  THR A HG1  1  
ATOM 1574  H HG21 . THR A 1 97  ? 19.257  -6.806  6.162   1.00 0.00 ? 97  THR A HG21 1  
ATOM 1575  H HG22 . THR A 1 97  ? 19.507  -8.528  5.872   1.00 0.00 ? 97  THR A HG22 1  
ATOM 1576  H HG23 . THR A 1 97  ? 18.483  -7.999  7.206   1.00 0.00 ? 97  THR A HG23 1  
ATOM 1577  N N    . LEU A 1 98  ? 16.416  -9.041  2.774   1.00 0.00 ? 98  LEU A N    1  
ATOM 1578  C CA   . LEU A 1 98  ? 15.310  -9.454  1.906   1.00 0.00 ? 98  LEU A CA   1  
ATOM 1579  C C    . LEU A 1 98  ? 14.022  -8.711  2.276   1.00 0.00 ? 98  LEU A C    1  
ATOM 1580  O O    . LEU A 1 98  ? 13.216  -8.364  1.413   1.00 0.00 ? 98  LEU A O    1  
ATOM 1581  C CB   . LEU A 1 98  ? 15.091  -10.972 2.015   1.00 0.00 ? 98  LEU A CB   1  
ATOM 1582  C CG   . LEU A 1 98  ? 14.058  -11.563 1.041   1.00 0.00 ? 98  LEU A CG   1  
ATOM 1583  C CD1  . LEU A 1 98  ? 14.510  -11.378 -0.406  1.00 0.00 ? 98  LEU A CD1  1  
ATOM 1584  C CD2  . LEU A 1 98  ? 13.810  -13.040 1.348   1.00 0.00 ? 98  LEU A CD2  1  
ATOM 1585  H H    . LEU A 1 98  ? 16.889  -9.726  3.294   1.00 0.00 ? 98  LEU A H    1  
ATOM 1586  H HA   . LEU A 1 98  ? 15.577  -9.209  0.888   1.00 0.00 ? 98  LEU A HA   1  
ATOM 1587  H HB2  . LEU A 1 98  ? 16.040  -11.464 1.846   1.00 0.00 ? 98  LEU A HB2  1  
ATOM 1588  H HB3  . LEU A 1 98  ? 14.769  -11.195 3.024   1.00 0.00 ? 98  LEU A HB3  1  
ATOM 1589  H HG   . LEU A 1 98  ? 13.121  -11.038 1.162   1.00 0.00 ? 98  LEU A HG   1  
ATOM 1590  H HD11 . LEU A 1 98  ? 15.459  -11.873 -0.557  1.00 0.00 ? 98  LEU A HD11 1  
ATOM 1591  H HD12 . LEU A 1 98  ? 14.615  -10.324 -0.619  1.00 0.00 ? 98  LEU A HD12 1  
ATOM 1592  H HD13 . LEU A 1 98  ? 13.772  -11.805 -1.073  1.00 0.00 ? 98  LEU A HD13 1  
ATOM 1593  H HD21 . LEU A 1 98  ? 13.444  -13.141 2.360   1.00 0.00 ? 98  LEU A HD21 1  
ATOM 1594  H HD22 . LEU A 1 98  ? 14.732  -13.594 1.243   1.00 0.00 ? 98  LEU A HD22 1  
ATOM 1595  H HD23 . LEU A 1 98  ? 13.075  -13.434 0.660   1.00 0.00 ? 98  LEU A HD23 1  
ATOM 1596  N N    . HIS A 1 99  ? 13.835  -8.482  3.572   1.00 0.00 ? 99  HIS A N    1  
ATOM 1597  C CA   . HIS A 1 99  ? 12.685  -7.732  4.075   1.00 0.00 ? 99  HIS A CA   1  
ATOM 1598  C C    . HIS A 1 99  ? 13.146  -6.412  4.687   1.00 0.00 ? 99  HIS A C    1  
ATOM 1599  O O    . HIS A 1 99  ? 12.612  -5.968  5.701   1.00 0.00 ? 99  HIS A O    1  
ATOM 1600  C CB   . HIS A 1 99  ? 11.915  -8.558  5.118   1.00 0.00 ? 99  HIS A CB   1  
ATOM 1601  C CG   . HIS A 1 99  ? 11.232  -9.768  4.553   1.00 0.00 ? 99  HIS A CG   1  
ATOM 1602  N ND1  . HIS A 1 99  ? 9.859   -9.906  4.507   1.00 0.00 ? 99  HIS A ND1  1  
ATOM 1603  C CD2  . HIS A 1 99  ? 11.737  -10.904 4.014   1.00 0.00 ? 99  HIS A CD2  1  
ATOM 1604  C CE1  . HIS A 1 99  ? 9.554   -11.068 3.964   1.00 0.00 ? 99  HIS A CE1  1  
ATOM 1605  N NE2  . HIS A 1 99  ? 10.673  -11.695 3.657   1.00 0.00 ? 99  HIS A NE2  1  
ATOM 1606  H H    . HIS A 1 99  ? 14.492  -8.831  4.215   1.00 0.00 ? 99  HIS A H    1  
ATOM 1607  H HA   . HIS A 1 99  ? 12.030  -7.516  3.242   1.00 0.00 ? 99  HIS A HA   1  
ATOM 1608  H HB2  . HIS A 1 99  ? 12.602  -8.894  5.881   1.00 0.00 ? 99  HIS A HB2  1  
ATOM 1609  H HB3  . HIS A 1 99  ? 11.159  -7.934  5.575   1.00 0.00 ? 99  HIS A HB3  1  
ATOM 1610  H HD1  . HIS A 1 99  ? 9.205   -9.253  4.839   1.00 0.00 ? 99  HIS A HD1  1  
ATOM 1611  H HD2  . HIS A 1 99  ? 12.784  -11.143 3.889   1.00 0.00 ? 99  HIS A HD2  1  
ATOM 1612  H HE1  . HIS A 1 99  ? 8.553   -11.435 3.783   1.00 0.00 ? 99  HIS A HE1  1  
ATOM 1613  H HE2  . HIS A 1 99  ? 10.732  -12.640 3.393   1.00 0.00 ? 99  HIS A HE2  1  
ATOM 1614  N N    . SER A 1 100 ? 14.129  -5.783  4.055   1.00 0.00 ? 100 SER A N    1  
ATOM 1615  C CA   . SER A 1 100 ? 14.675  -4.510  4.529   1.00 0.00 ? 100 SER A CA   1  
ATOM 1616  C C    . SER A 1 100 ? 13.579  -3.455  4.683   1.00 0.00 ? 100 SER A C    1  
ATOM 1617  O O    . SER A 1 100 ? 13.579  -2.672  5.636   1.00 0.00 ? 100 SER A O    1  
ATOM 1618  C CB   . SER A 1 100 ? 15.747  -4.017  3.552   1.00 0.00 ? 100 SER A CB   1  
ATOM 1619  O OG   . SER A 1 100 ? 15.305  -4.132  2.210   1.00 0.00 ? 100 SER A OG   1  
ATOM 1620  H H    . SER A 1 100 ? 14.503  -6.183  3.240   1.00 0.00 ? 100 SER A H    1  
ATOM 1621  H HA   . SER A 1 100 ? 15.132  -4.683  5.493   1.00 0.00 ? 100 SER A HA   1  
ATOM 1622  H HB2  . SER A 1 100 ? 15.973  -2.979  3.755   1.00 0.00 ? 100 SER A HB2  1  
ATOM 1623  H HB3  . SER A 1 100 ? 16.642  -4.608  3.673   1.00 0.00 ? 100 SER A HB3  1  
ATOM 1624  H HG   . SER A 1 100 ? 15.696  -4.919  1.811   1.00 0.00 ? 100 SER A HG   1  
ATOM 1625  N N    . PHE A 1 101 ? 12.638  -3.455  3.748   1.00 0.00 ? 101 PHE A N    1  
ATOM 1626  C CA   . PHE A 1 101 ? 11.562  -2.470  3.734   1.00 0.00 ? 101 PHE A CA   1  
ATOM 1627  C C    . PHE A 1 101 ? 10.316  -2.994  4.450   1.00 0.00 ? 101 PHE A C    1  
ATOM 1628  O O    . PHE A 1 101 ? 9.216   -2.491  4.227   1.00 0.00 ? 101 PHE A O    1  
ATOM 1629  C CB   . PHE A 1 101 ? 11.217  -2.093  2.285   1.00 0.00 ? 101 PHE A CB   1  
ATOM 1630  C CG   . PHE A 1 101 ? 12.394  -1.581  1.496   1.00 0.00 ? 101 PHE A CG   1  
ATOM 1631  C CD1  . PHE A 1 101 ? 12.978  -0.361  1.807   1.00 0.00 ? 101 PHE A CD1  1  
ATOM 1632  C CD2  . PHE A 1 101 ? 12.922  -2.323  0.448   1.00 0.00 ? 101 PHE A CD2  1  
ATOM 1633  C CE1  . PHE A 1 101 ? 14.061  0.107   1.088   1.00 0.00 ? 101 PHE A CE1  1  
ATOM 1634  C CE2  . PHE A 1 101 ? 14.004  -1.857  -0.272  1.00 0.00 ? 101 PHE A CE2  1  
ATOM 1635  C CZ   . PHE A 1 101 ? 14.575  -0.641  0.047   1.00 0.00 ? 101 PHE A CZ   1  
ATOM 1636  H H    . PHE A 1 101 ? 12.675  -4.129  3.041   1.00 0.00 ? 101 PHE A H    1  
ATOM 1637  H HA   . PHE A 1 101 ? 11.910  -1.585  4.250   1.00 0.00 ? 101 PHE A HA   1  
ATOM 1638  H HB2  . PHE A 1 101 ? 10.827  -2.964  1.777   1.00 0.00 ? 101 PHE A HB2  1  
ATOM 1639  H HB3  . PHE A 1 101 ? 10.460  -1.321  2.292   1.00 0.00 ? 101 PHE A HB3  1  
ATOM 1640  H HD1  . PHE A 1 101 ? 12.578  0.227   2.621   1.00 0.00 ? 101 PHE A HD1  1  
ATOM 1641  H HD2  . PHE A 1 101 ? 12.477  -3.273  0.195   1.00 0.00 ? 101 PHE A HD2  1  
ATOM 1642  H HE1  . PHE A 1 101 ? 14.506  1.060   1.339   1.00 0.00 ? 101 PHE A HE1  1  
ATOM 1643  H HE2  . PHE A 1 101 ? 14.405  -2.447  -1.086  1.00 0.00 ? 101 PHE A HE2  1  
ATOM 1644  H HZ   . PHE A 1 101 ? 15.422  -0.277  -0.515  1.00 0.00 ? 101 PHE A HZ   1  
ATOM 1645  N N    . ASP A 1 102 ? 10.490  -3.983  5.330   1.00 0.00 ? 102 ASP A N    1  
ATOM 1646  C CA   . ASP A 1 102 ? 9.357   -4.564  6.061   1.00 0.00 ? 102 ASP A CA   1  
ATOM 1647  C C    . ASP A 1 102 ? 8.721   -3.513  6.970   1.00 0.00 ? 102 ASP A C    1  
ATOM 1648  O O    . ASP A 1 102 ? 7.503   -3.494  7.163   1.00 0.00 ? 102 ASP A O    1  
ATOM 1649  C CB   . ASP A 1 102 ? 9.794   -5.791  6.885   1.00 0.00 ? 102 ASP A CB   1  
ATOM 1650  C CG   . ASP A 1 102 ? 10.578  -5.443  8.146   1.00 0.00 ? 102 ASP A CG   1  
ATOM 1651  O OD1  . ASP A 1 102 ? 11.459  -4.558  8.094   1.00 0.00 ? 102 ASP A OD1  1  
ATOM 1652  O OD2  . ASP A 1 102 ? 10.315  -6.057  9.202   1.00 0.00 ? 102 ASP A OD2  1  
ATOM 1653  H H    . ASP A 1 102 ? 11.395  -4.321  5.502   1.00 0.00 ? 102 ASP A H    1  
ATOM 1654  H HA   . ASP A 1 102 ? 8.623   -4.878  5.330   1.00 0.00 ? 102 ASP A HA   1  
ATOM 1655  H HB2  . ASP A 1 102 ? 8.912   -6.346  7.175   1.00 0.00 ? 102 ASP A HB2  1  
ATOM 1656  H HB3  . ASP A 1 102 ? 10.413  -6.425  6.264   1.00 0.00 ? 102 ASP A HB3  1  
ATOM 1657  N N    . ALA A 1 103 ? 9.560   -2.640  7.523   1.00 0.00 ? 103 ALA A N    1  
ATOM 1658  C CA   . ALA A 1 103 ? 9.091   -1.515  8.322   1.00 0.00 ? 103 ALA A CA   1  
ATOM 1659  C C    . ALA A 1 103 ? 8.259   -0.576  7.457   1.00 0.00 ? 103 ALA A C    1  
ATOM 1660  O O    . ALA A 1 103 ? 7.150   -0.191  7.826   1.00 0.00 ? 103 ALA A O    1  
ATOM 1661  C CB   . ALA A 1 103 ? 10.269  -0.768  8.943   1.00 0.00 ? 103 ALA A CB   1  
ATOM 1662  H H    . ALA A 1 103 ? 10.526  -2.766  7.398   1.00 0.00 ? 103 ALA A H    1  
ATOM 1663  H HA   . ALA A 1 103 ? 8.473   -1.904  9.122   1.00 0.00 ? 103 ALA A HA   1  
ATOM 1664  H HB1  . ALA A 1 103 ? 10.899  -0.373  8.159   1.00 0.00 ? 103 ALA A HB1  1  
ATOM 1665  H HB2  . ALA A 1 103 ? 10.844  -1.445  9.558   1.00 0.00 ? 103 ALA A HB2  1  
ATOM 1666  H HB3  . ALA A 1 103 ? 9.901   0.045   9.552   1.00 0.00 ? 103 ALA A HB3  1  
ATOM 1667  N N    . ALA A 1 104 ? 8.802   -0.236  6.288   1.00 0.00 ? 104 ALA A N    1  
ATOM 1668  C CA   . ALA A 1 104 ? 8.124   0.643   5.340   1.00 0.00 ? 104 ALA A CA   1  
ATOM 1669  C C    . ALA A 1 104 ? 6.772   0.057   4.940   1.00 0.00 ? 104 ALA A C    1  
ATOM 1670  O O    . ALA A 1 104 ? 5.766   0.770   4.875   1.00 0.00 ? 104 ALA A O    1  
ATOM 1671  C CB   . ALA A 1 104 ? 8.998   0.864   4.109   1.00 0.00 ? 104 ALA A CB   1  
ATOM 1672  H H    . ALA A 1 104 ? 9.682   -0.597  6.055   1.00 0.00 ? 104 ALA A H    1  
ATOM 1673  H HA   . ALA A 1 104 ? 7.967   1.599   5.822   1.00 0.00 ? 104 ALA A HA   1  
ATOM 1674  H HB1  . ALA A 1 104 ? 9.158   -0.078  3.606   1.00 0.00 ? 104 ALA A HB1  1  
ATOM 1675  H HB2  . ALA A 1 104 ? 9.950   1.275   4.412   1.00 0.00 ? 104 ALA A HB2  1  
ATOM 1676  H HB3  . ALA A 1 104 ? 8.508   1.552   3.435   1.00 0.00 ? 104 ALA A HB3  1  
ATOM 1677  N N    . GLN A 1 105 ? 6.768   -1.251  4.689   1.00 0.00 ? 105 GLN A N    1  
ATOM 1678  C CA   . GLN A 1 105 ? 5.556   -1.976  4.328   1.00 0.00 ? 105 GLN A CA   1  
ATOM 1679  C C    . GLN A 1 105 ? 4.503   -1.794  5.415   1.00 0.00 ? 105 GLN A C    1  
ATOM 1680  O O    . GLN A 1 105 ? 3.379   -1.370  5.138   1.00 0.00 ? 105 GLN A O    1  
ATOM 1681  C CB   . GLN A 1 105 ? 5.887   -3.469  4.114   1.00 0.00 ? 105 GLN A CB   1  
ATOM 1682  C CG   . GLN A 1 105 ? 4.734   -4.335  3.586   1.00 0.00 ? 105 GLN A CG   1  
ATOM 1683  C CD   . GLN A 1 105 ? 3.762   -4.793  4.663   1.00 0.00 ? 105 GLN A CD   1  
ATOM 1684  O OE1  . GLN A 1 105 ? 3.961   -5.836  5.290   1.00 0.00 ? 105 GLN A OE1  1  
ATOM 1685  N NE2  . GLN A 1 105 ? 2.694   -4.038  4.870   1.00 0.00 ? 105 GLN A NE2  1  
ATOM 1686  H H    . GLN A 1 105 ? 7.611   -1.742  4.747   1.00 0.00 ? 105 GLN A H    1  
ATOM 1687  H HA   . GLN A 1 105 ? 5.182   -1.560  3.404   1.00 0.00 ? 105 GLN A HA   1  
ATOM 1688  H HB2  . GLN A 1 105 ? 6.702   -3.537  3.408   1.00 0.00 ? 105 GLN A HB2  1  
ATOM 1689  H HB3  . GLN A 1 105 ? 6.217   -3.886  5.057   1.00 0.00 ? 105 GLN A HB3  1  
ATOM 1690  H HG2  . GLN A 1 105 ? 4.184   -3.766  2.853   1.00 0.00 ? 105 GLN A HG2  1  
ATOM 1691  H HG3  . GLN A 1 105 ? 5.154   -5.211  3.109   1.00 0.00 ? 105 GLN A HG3  1  
ATOM 1692  H HE21 . GLN A 1 105 ? 2.583   -3.230  4.324   1.00 0.00 ? 105 GLN A HE21 1  
ATOM 1693  H HE22 . GLN A 1 105 ? 2.056   -4.316  5.564   1.00 0.00 ? 105 GLN A HE22 1  
ATOM 1694  N N    . SER A 1 106 ? 4.888   -2.092  6.653   1.00 0.00 ? 106 SER A N    1  
ATOM 1695  C CA   . SER A 1 106 ? 3.985   -1.993  7.794   1.00 0.00 ? 106 SER A CA   1  
ATOM 1696  C C    . SER A 1 106 ? 3.438   -0.569  7.945   1.00 0.00 ? 106 SER A C    1  
ATOM 1697  O O    . SER A 1 106 ? 2.228   -0.375  8.081   1.00 0.00 ? 106 SER A O    1  
ATOM 1698  C CB   . SER A 1 106 ? 4.714   -2.429  9.071   1.00 0.00 ? 106 SER A CB   1  
ATOM 1699  O OG   . SER A 1 106 ? 5.206   -3.758  8.945   1.00 0.00 ? 106 SER A OG   1  
ATOM 1700  H H    . SER A 1 106 ? 5.811   -2.389  6.804   1.00 0.00 ? 106 SER A H    1  
ATOM 1701  H HA   . SER A 1 106 ? 3.156   -2.667  7.617   1.00 0.00 ? 106 SER A HA   1  
ATOM 1702  H HB2  . SER A 1 106 ? 5.546   -1.766  9.253   1.00 0.00 ? 106 SER A HB2  1  
ATOM 1703  H HB3  . SER A 1 106 ? 4.030   -2.389  9.907   1.00 0.00 ? 106 SER A HB3  1  
ATOM 1704  H HG   . SER A 1 106 ? 6.100   -3.735  8.584   1.00 0.00 ? 106 SER A HG   1  
ATOM 1705  N N    . ARG A 1 107 ? 4.335   0.418   7.891   1.00 0.00 ? 107 ARG A N    1  
ATOM 1706  C CA   . ARG A 1 107 ? 3.957   1.824   8.051   1.00 0.00 ? 107 ARG A CA   1  
ATOM 1707  C C    . ARG A 1 107 ? 2.899   2.223   7.026   1.00 0.00 ? 107 ARG A C    1  
ATOM 1708  O O    . ARG A 1 107 ? 1.754   2.519   7.378   1.00 0.00 ? 107 ARG A O    1  
ATOM 1709  C CB   . ARG A 1 107 ? 5.180   2.739   7.907   1.00 0.00 ? 107 ARG A CB   1  
ATOM 1710  C CG   . ARG A 1 107 ? 6.268   2.528   8.958   1.00 0.00 ? 107 ARG A CG   1  
ATOM 1711  C CD   . ARG A 1 107 ? 5.777   2.810   10.374  1.00 0.00 ? 107 ARG A CD   1  
ATOM 1712  N NE   . ARG A 1 107 ? 6.887   2.865   11.330  1.00 0.00 ? 107 ARG A NE   1  
ATOM 1713  C CZ   . ARG A 1 107 ? 6.793   2.535   12.620  1.00 0.00 ? 107 ARG A CZ   1  
ATOM 1714  N NH1  . ARG A 1 107 ? 5.662   2.038   13.106  1.00 0.00 ? 107 ARG A NH1  1  
ATOM 1715  N NH2  . ARG A 1 107 ? 7.844   2.680   13.417  1.00 0.00 ? 107 ARG A NH2  1  
ATOM 1716  H H    . ARG A 1 107 ? 5.277   0.195   7.736   1.00 0.00 ? 107 ARG A H    1  
ATOM 1717  H HA   . ARG A 1 107 ? 3.546   1.949   9.038   1.00 0.00 ? 107 ARG A HA   1  
ATOM 1718  H HB2  . ARG A 1 107 ? 5.619   2.575   6.934   1.00 0.00 ? 107 ARG A HB2  1  
ATOM 1719  H HB3  . ARG A 1 107 ? 4.851   3.769   7.968   1.00 0.00 ? 107 ARG A HB3  1  
ATOM 1720  H HG2  . ARG A 1 107 ? 6.605   1.504   8.908   1.00 0.00 ? 107 ARG A HG2  1  
ATOM 1721  H HG3  . ARG A 1 107 ? 7.096   3.187   8.739   1.00 0.00 ? 107 ARG A HG3  1  
ATOM 1722  H HD2  . ARG A 1 107 ? 5.259   3.759   10.383  1.00 0.00 ? 107 ARG A HD2  1  
ATOM 1723  H HD3  . ARG A 1 107 ? 5.093   2.026   10.671  1.00 0.00 ? 107 ARG A HD3  1  
ATOM 1724  H HE   . ARG A 1 107 ? 7.751   3.191   10.990  1.00 0.00 ? 107 ARG A HE   1  
ATOM 1725  H HH11 . ARG A 1 107 ? 4.871   1.901   12.506  1.00 0.00 ? 107 ARG A HH11 1  
ATOM 1726  H HH12 . ARG A 1 107 ? 5.594   1.793   14.079  1.00 0.00 ? 107 ARG A HH12 1  
ATOM 1727  H HH21 . ARG A 1 107 ? 8.712   3.031   13.052  1.00 0.00 ? 107 ARG A HH21 1  
ATOM 1728  H HH22 . ARG A 1 107 ? 7.776   2.439   14.391  1.00 0.00 ? 107 ARG A HH22 1  
ATOM 1729  N N    . VAL A 1 108 ? 3.287   2.195   5.753   1.00 0.00 ? 108 VAL A N    1  
ATOM 1730  C CA   . VAL A 1 108 ? 2.433   2.667   4.665   1.00 0.00 ? 108 VAL A CA   1  
ATOM 1731  C C    . VAL A 1 108 ? 1.109   1.904   4.624   1.00 0.00 ? 108 VAL A C    1  
ATOM 1732  O O    . VAL A 1 108 ? 0.050   2.486   4.377   1.00 0.00 ? 108 VAL A O    1  
ATOM 1733  C CB   . VAL A 1 108 ? 3.153   2.543   3.299   1.00 0.00 ? 108 VAL A CB   1  
ATOM 1734  C CG1  . VAL A 1 108 ? 2.261   3.034   2.161   1.00 0.00 ? 108 VAL A CG1  1  
ATOM 1735  C CG2  . VAL A 1 108 ? 4.475   3.308   3.320   1.00 0.00 ? 108 VAL A CG2  1  
ATOM 1736  H H    . VAL A 1 108 ? 4.174   1.832   5.535   1.00 0.00 ? 108 VAL A H    1  
ATOM 1737  H HA   . VAL A 1 108 ? 2.224   3.715   4.842   1.00 0.00 ? 108 VAL A HA   1  
ATOM 1738  H HB   . VAL A 1 108 ? 3.372   1.497   3.125   1.00 0.00 ? 108 VAL A HB   1  
ATOM 1739  H HG11 . VAL A 1 108 ? 2.788   2.942   1.222   1.00 0.00 ? 108 VAL A HG11 1  
ATOM 1740  H HG12 . VAL A 1 108 ? 2.001   4.070   2.327   1.00 0.00 ? 108 VAL A HG12 1  
ATOM 1741  H HG13 . VAL A 1 108 ? 1.359   2.439   2.125   1.00 0.00 ? 108 VAL A HG13 1  
ATOM 1742  H HG21 . VAL A 1 108 ? 4.285   4.354   3.513   1.00 0.00 ? 108 VAL A HG21 1  
ATOM 1743  H HG22 . VAL A 1 108 ? 4.969   3.204   2.364   1.00 0.00 ? 108 VAL A HG22 1  
ATOM 1744  H HG23 . VAL A 1 108 ? 5.111   2.908   4.097   1.00 0.00 ? 108 VAL A HG23 1  
ATOM 1745  N N    . TYR A 1 109 ? 1.178   0.605   4.888   1.00 0.00 ? 109 TYR A N    1  
ATOM 1746  C CA   . TYR A 1 109 ? -0.004  -0.253  4.907   1.00 0.00 ? 109 TYR A CA   1  
ATOM 1747  C C    . TYR A 1 109 ? -1.045  0.278   5.898   1.00 0.00 ? 109 TYR A C    1  
ATOM 1748  O O    . TYR A 1 109 ? -2.185  0.573   5.519   1.00 0.00 ? 109 TYR A O    1  
ATOM 1749  C CB   . TYR A 1 109 ? 0.420   -1.685  5.267   1.00 0.00 ? 109 TYR A CB   1  
ATOM 1750  C CG   . TYR A 1 109 ? -0.710  -2.696  5.377   1.00 0.00 ? 109 TYR A CG   1  
ATOM 1751  C CD1  . TYR A 1 109 ? -1.215  -3.327  4.245   1.00 0.00 ? 109 TYR A CD1  1  
ATOM 1752  C CD2  . TYR A 1 109 ? -1.253  -3.037  6.613   1.00 0.00 ? 109 TYR A CD2  1  
ATOM 1753  C CE1  . TYR A 1 109 ? -2.224  -4.265  4.342   1.00 0.00 ? 109 TYR A CE1  1  
ATOM 1754  C CE2  . TYR A 1 109 ? -2.266  -3.972  6.715   1.00 0.00 ? 109 TYR A CE2  1  
ATOM 1755  C CZ   . TYR A 1 109 ? -2.746  -4.583  5.577   1.00 0.00 ? 109 TYR A CZ   1  
ATOM 1756  O OH   . TYR A 1 109 ? -3.748  -5.525  5.673   1.00 0.00 ? 109 TYR A OH   1  
ATOM 1757  H H    . TYR A 1 109 ? 2.055   0.206   5.079   1.00 0.00 ? 109 TYR A H    1  
ATOM 1758  H HA   . TYR A 1 109 ? -0.432  -0.252  3.914   1.00 0.00 ? 109 TYR A HA   1  
ATOM 1759  H HB2  . TYR A 1 109 ? 1.101   -2.045  4.510   1.00 0.00 ? 109 TYR A HB2  1  
ATOM 1760  H HB3  . TYR A 1 109 ? 0.938   -1.661  6.211   1.00 0.00 ? 109 TYR A HB3  1  
ATOM 1761  H HD1  . TYR A 1 109 ? -0.807  -3.077  3.278   1.00 0.00 ? 109 TYR A HD1  1  
ATOM 1762  H HD2  . TYR A 1 109 ? -0.876  -2.557  7.504   1.00 0.00 ? 109 TYR A HD2  1  
ATOM 1763  H HE1  . TYR A 1 109 ? -2.602  -4.744  3.450   1.00 0.00 ? 109 TYR A HE1  1  
ATOM 1764  H HE2  . TYR A 1 109 ? -2.676  -4.220  7.684   1.00 0.00 ? 109 TYR A HE2  1  
ATOM 1765  H HH   . TYR A 1 109 ? -3.565  -6.247  5.053   1.00 0.00 ? 109 TYR A HH   1  
ATOM 1766  N N    . GLN A 1 110 ? -0.643  0.436   7.160   1.00 0.00 ? 110 GLN A N    1  
ATOM 1767  C CA   . GLN A 1 110 ? -1.569  0.882   8.199   1.00 0.00 ? 110 GLN A CA   1  
ATOM 1768  C C    . GLN A 1 110 ? -1.857  2.381   8.079   1.00 0.00 ? 110 GLN A C    1  
ATOM 1769  O O    . GLN A 1 110 ? -2.788  2.892   8.702   1.00 0.00 ? 110 GLN A O    1  
ATOM 1770  C CB   . GLN A 1 110 ? -1.061  0.499   9.606   1.00 0.00 ? 110 GLN A CB   1  
ATOM 1771  C CG   . GLN A 1 110 ? 0.291   1.093   10.019  1.00 0.00 ? 110 GLN A CG   1  
ATOM 1772  C CD   . GLN A 1 110 ? 0.187   2.508   10.571  1.00 0.00 ? 110 GLN A CD   1  
ATOM 1773  O OE1  . GLN A 1 110 ? -0.052  2.702   11.761  1.00 0.00 ? 110 GLN A OE1  1  
ATOM 1774  N NE2  . GLN A 1 110 ? 0.400   3.500   9.724   1.00 0.00 ? 110 GLN A NE2  1  
ATOM 1775  H H    . GLN A 1 110 ? 0.293   0.249   7.395   1.00 0.00 ? 110 GLN A H    1  
ATOM 1776  H HA   . GLN A 1 110 ? -2.503  0.360   8.028   1.00 0.00 ? 110 GLN A HA   1  
ATOM 1777  H HB2  . GLN A 1 110 ? -1.795  0.815   10.333  1.00 0.00 ? 110 GLN A HB2  1  
ATOM 1778  H HB3  . GLN A 1 110 ? -0.978  -0.579  9.654   1.00 0.00 ? 110 GLN A HB3  1  
ATOM 1779  H HG2  . GLN A 1 110 ? 0.728   0.463   10.780  1.00 0.00 ? 110 GLN A HG2  1  
ATOM 1780  H HG3  . GLN A 1 110 ? 0.941   1.106   9.155   1.00 0.00 ? 110 GLN A HG3  1  
ATOM 1781  H HE21 . GLN A 1 110 ? 0.614   3.279   8.794   1.00 0.00 ? 110 GLN A HE21 1  
ATOM 1782  H HE22 . GLN A 1 110 ? 0.334   4.418   10.063  1.00 0.00 ? 110 GLN A HE22 1  
ATOM 1783  N N    . LEU A 1 111 ? -1.057  3.082   7.269   1.00 0.00 ? 111 LEU A N    1  
ATOM 1784  C CA   . LEU A 1 111 ? -1.325  4.489   6.963   1.00 0.00 ? 111 LEU A CA   1  
ATOM 1785  C C    . LEU A 1 111 ? -2.523  4.596   6.025   1.00 0.00 ? 111 LEU A C    1  
ATOM 1786  O O    . LEU A 1 111 ? -3.422  5.405   6.245   1.00 0.00 ? 111 LEU A O    1  
ATOM 1787  C CB   . LEU A 1 111 ? -0.095  5.173   6.336   1.00 0.00 ? 111 LEU A CB   1  
ATOM 1788  C CG   . LEU A 1 111 ? 1.049   5.510   7.312   1.00 0.00 ? 111 LEU A CG   1  
ATOM 1789  C CD1  . LEU A 1 111 ? 2.250   6.082   6.563   1.00 0.00 ? 111 LEU A CD1  1  
ATOM 1790  C CD2  . LEU A 1 111 ? 0.568   6.483   8.389   1.00 0.00 ? 111 LEU A CD2  1  
ATOM 1791  H H    . LEU A 1 111 ? -0.276  2.644   6.870   1.00 0.00 ? 111 LEU A H    1  
ATOM 1792  H HA   . LEU A 1 111 ? -1.569  4.986   7.893   1.00 0.00 ? 111 LEU A HA   1  
ATOM 1793  H HB2  . LEU A 1 111 ? 0.297   4.522   5.567   1.00 0.00 ? 111 LEU A HB2  1  
ATOM 1794  H HB3  . LEU A 1 111 ? -0.420  6.093   5.871   1.00 0.00 ? 111 LEU A HB3  1  
ATOM 1795  H HG   . LEU A 1 111 ? 1.368   4.602   7.804   1.00 0.00 ? 111 LEU A HG   1  
ATOM 1796  H HD11 . LEU A 1 111 ? 1.962   6.989   6.050   1.00 0.00 ? 111 LEU A HD11 1  
ATOM 1797  H HD12 . LEU A 1 111 ? 2.603   5.359   5.841   1.00 0.00 ? 111 LEU A HD12 1  
ATOM 1798  H HD13 . LEU A 1 111 ? 3.042   6.303   7.265   1.00 0.00 ? 111 LEU A HD13 1  
ATOM 1799  H HD21 . LEU A 1 111 ? 1.382   6.705   9.065   1.00 0.00 ? 111 LEU A HD21 1  
ATOM 1800  H HD22 . LEU A 1 111 ? -0.245  6.037   8.943   1.00 0.00 ? 111 LEU A HD22 1  
ATOM 1801  H HD23 . LEU A 1 111 ? 0.228   7.399   7.926   1.00 0.00 ? 111 LEU A HD23 1  
ATOM 1802  N N    . MET A 1 112 ? -2.542  3.757   4.986   1.00 0.00 ? 112 MET A N    1  
ATOM 1803  C CA   . MET A 1 112 ? -3.656  3.745   4.040   1.00 0.00 ? 112 MET A CA   1  
ATOM 1804  C C    . MET A 1 112 ? -4.938  3.369   4.765   1.00 0.00 ? 112 MET A C    1  
ATOM 1805  O O    . MET A 1 112 ? -6.015  3.858   4.435   1.00 0.00 ? 112 MET A O    1  
ATOM 1806  C CB   . MET A 1 112 ? -3.417  2.749   2.900   1.00 0.00 ? 112 MET A CB   1  
ATOM 1807  C CG   . MET A 1 112 ? -2.147  2.995   2.098   1.00 0.00 ? 112 MET A CG   1  
ATOM 1808  S SD   . MET A 1 112 ? -2.030  1.911   0.661   1.00 0.00 ? 112 MET A SD   1  
ATOM 1809  C CE   . MET A 1 112 ? -2.446  0.325   1.389   1.00 0.00 ? 112 MET A CE   1  
ATOM 1810  H H    . MET A 1 112 ? -1.798  3.130   4.860   1.00 0.00 ? 112 MET A H    1  
ATOM 1811  H HA   . MET A 1 112 ? -3.760  4.740   3.628   1.00 0.00 ? 112 MET A HA   1  
ATOM 1812  H HB2  . MET A 1 112 ? -3.361  1.753   3.316   1.00 0.00 ? 112 MET A HB2  1  
ATOM 1813  H HB3  . MET A 1 112 ? -4.257  2.793   2.220   1.00 0.00 ? 112 MET A HB3  1  
ATOM 1814  H HG2  . MET A 1 112 ? -2.143  4.022   1.758   1.00 0.00 ? 112 MET A HG2  1  
ATOM 1815  H HG3  . MET A 1 112 ? -1.291  2.823   2.734   1.00 0.00 ? 112 MET A HG3  1  
ATOM 1816  H HE1  . MET A 1 112 ? -3.441  0.368   1.806   1.00 0.00 ? 112 MET A HE1  1  
ATOM 1817  H HE2  . MET A 1 112 ? -1.739  0.092   2.170   1.00 0.00 ? 112 MET A HE2  1  
ATOM 1818  H HE3  . MET A 1 112 ? -2.408  -0.442  0.629   1.00 0.00 ? 112 MET A HE3  1  
ATOM 1819  N N    . GLU A 1 113 ? -4.805  2.489   5.750   1.00 0.00 ? 113 GLU A N    1  
ATOM 1820  C CA   . GLU A 1 113 ? -5.931  2.068   6.573   1.00 0.00 ? 113 GLU A CA   1  
ATOM 1821  C C    . GLU A 1 113 ? -6.589  3.286   7.232   1.00 0.00 ? 113 GLU A C    1  
ATOM 1822  O O    . GLU A 1 113 ? -7.696  3.688   6.861   1.00 0.00 ? 113 GLU A O    1  
ATOM 1823  C CB   . GLU A 1 113 ? -5.447  1.044   7.623   1.00 0.00 ? 113 GLU A CB   1  
ATOM 1824  C CG   . GLU A 1 113 ? -6.546  0.426   8.497   1.00 0.00 ? 113 GLU A CG   1  
ATOM 1825  C CD   . GLU A 1 113 ? -6.989  1.328   9.642   1.00 0.00 ? 113 GLU A CD   1  
ATOM 1826  O OE1  . GLU A 1 113 ? -6.163  1.606   10.536  1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1827  O OE2  . GLU A 1 113 ? -8.160  1.764   9.654   1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1828  H H    . GLU A 1 113 ? -3.918  2.104   5.925   1.00 0.00 ? 113 GLU A H    1  
ATOM 1829  H HA   . GLU A 1 113 ? -6.652  1.590   5.925   1.00 0.00 ? 113 GLU A HA   1  
ATOM 1830  H HB2  . GLU A 1 113 ? -4.943  0.238   7.108   1.00 0.00 ? 113 GLU A HB2  1  
ATOM 1831  H HB3  . GLU A 1 113 ? -4.735  1.532   8.275   1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1832  H HG2  . GLU A 1 113 ? -7.404  0.214   7.874   1.00 0.00 ? 113 GLU A HG2  1  
ATOM 1833  H HG3  . GLU A 1 113 ? -6.176  -0.501  8.914   1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1834  N N    . GLN A 1 114 ? -5.870  3.899   8.164   1.00 0.00 ? 114 GLN A N    1  
ATOM 1835  C CA   . GLN A 1 114 ? -6.404  4.995   8.971   1.00 0.00 ? 114 GLN A CA   1  
ATOM 1836  C C    . GLN A 1 114 ? -6.756  6.225   8.123   1.00 0.00 ? 114 GLN A C    1  
ATOM 1837  O O    . GLN A 1 114 ? -7.530  7.082   8.558   1.00 0.00 ? 114 GLN A O    1  
ATOM 1838  C CB   . GLN A 1 114 ? -5.399  5.364   10.070  1.00 0.00 ? 114 GLN A CB   1  
ATOM 1839  C CG   . GLN A 1 114 ? -4.028  5.772   9.542   1.00 0.00 ? 114 GLN A CG   1  
ATOM 1840  C CD   . GLN A 1 114 ? -2.983  5.863   10.641  1.00 0.00 ? 114 GLN A CD   1  
ATOM 1841  O OE1  . GLN A 1 114 ? -2.792  6.914   11.252  1.00 0.00 ? 114 GLN A OE1  1  
ATOM 1842  N NE2  . GLN A 1 114 ? -2.303  4.756   10.903  1.00 0.00 ? 114 GLN A NE2  1  
ATOM 1843  H H    . GLN A 1 114 ? -4.946  3.604   8.319   1.00 0.00 ? 114 GLN A H    1  
ATOM 1844  H HA   . GLN A 1 114 ? -7.310  4.637   9.442   1.00 0.00 ? 114 GLN A HA   1  
ATOM 1845  H HB2  . GLN A 1 114 ? -5.799  6.187   10.647  1.00 0.00 ? 114 GLN A HB2  1  
ATOM 1846  H HB3  . GLN A 1 114 ? -5.271  4.511   10.722  1.00 0.00 ? 114 GLN A HB3  1  
ATOM 1847  H HG2  . GLN A 1 114 ? -3.703  5.044   8.813   1.00 0.00 ? 114 GLN A HG2  1  
ATOM 1848  H HG3  . GLN A 1 114 ? -4.114  6.739   9.066   1.00 0.00 ? 114 GLN A HG3  1  
ATOM 1849  H HE21 . GLN A 1 114 ? -2.505  3.952   10.380  1.00 0.00 ? 114 GLN A HE21 1  
ATOM 1850  H HE22 . GLN A 1 114 ? -1.628  4.784   11.616  1.00 0.00 ? 114 GLN A HE22 1  
ATOM 1851  N N    . ASP A 1 115 ? -6.194  6.312   6.920   1.00 0.00 ? 115 ASP A N    1  
ATOM 1852  C CA   . ASP A 1 115 ? -6.445  7.455   6.036   1.00 0.00 ? 115 ASP A CA   1  
ATOM 1853  C C    . ASP A 1 115 ? -7.466  7.111   4.950   1.00 0.00 ? 115 ASP A C    1  
ATOM 1854  O O    . ASP A 1 115 ? -8.610  7.566   4.988   1.00 0.00 ? 115 ASP A O    1  
ATOM 1855  C CB   . ASP A 1 115 ? -5.134  7.930   5.389   1.00 0.00 ? 115 ASP A CB   1  
ATOM 1856  C CG   . ASP A 1 115 ? -5.345  9.083   4.415   1.00 0.00 ? 115 ASP A CG   1  
ATOM 1857  O OD1  . ASP A 1 115 ? -5.442  10.245  4.872   1.00 0.00 ? 115 ASP A OD1  1  
ATOM 1858  O OD2  . ASP A 1 115 ? -5.425  8.834   3.193   1.00 0.00 ? 115 ASP A OD2  1  
ATOM 1859  H H    . ASP A 1 115 ? -5.593  5.598   6.618   1.00 0.00 ? 115 ASP A H    1  
ATOM 1860  H HA   . ASP A 1 115 ? -6.844  8.260   6.639   1.00 0.00 ? 115 ASP A HA   1  
ATOM 1861  H HB2  . ASP A 1 115 ? -4.456  8.257   6.164   1.00 0.00 ? 115 ASP A HB2  1  
ATOM 1862  H HB3  . ASP A 1 115 ? -4.685  7.104   4.854   1.00 0.00 ? 115 ASP A HB3  1  
ATOM 1863  N N    . SER A 1 116 ? -7.050  6.287   4.000   1.00 0.00 ? 116 SER A N    1  
ATOM 1864  C CA   . SER A 1 116 ? -7.840  6.013   2.805   1.00 0.00 ? 116 SER A CA   1  
ATOM 1865  C C    . SER A 1 116 ? -8.959  4.999   3.072   1.00 0.00 ? 116 SER A C    1  
ATOM 1866  O O    . SER A 1 116 ? -10.041 5.093   2.490   1.00 0.00 ? 116 SER A O    1  
ATOM 1867  C CB   . SER A 1 116 ? -6.913  5.496   1.700   1.00 0.00 ? 116 SER A CB   1  
ATOM 1868  O OG   . SER A 1 116 ? -5.758  6.312   1.579   1.00 0.00 ? 116 SER A OG   1  
ATOM 1869  H H    . SER A 1 116 ? -6.180  5.847   4.100   1.00 0.00 ? 116 SER A H    1  
ATOM 1870  H HA   . SER A 1 116 ? -8.283  6.943   2.479   1.00 0.00 ? 116 SER A HA   1  
ATOM 1871  H HB2  . SER A 1 116 ? -6.601  4.487   1.934   1.00 0.00 ? 116 SER A HB2  1  
ATOM 1872  H HB3  . SER A 1 116 ? -7.441  5.499   0.757   1.00 0.00 ? 116 SER A HB3  1  
ATOM 1873  H HG   . SER A 1 116 ? -5.924  7.175   1.986   1.00 0.00 ? 116 SER A HG   1  
ATOM 1874  N N    . TYR A 1 117 ? -8.710  4.044   3.965   1.00 0.00 ? 117 TYR A N    1  
ATOM 1875  C CA   . TYR A 1 117 ? -9.645  2.943   4.191   1.00 0.00 ? 117 TYR A CA   1  
ATOM 1876  C C    . TYR A 1 117 ? -10.855 3.416   4.996   1.00 0.00 ? 117 TYR A C    1  
ATOM 1877  O O    . TYR A 1 117 ? -11.965 2.914   4.815   1.00 0.00 ? 117 TYR A O    1  
ATOM 1878  C CB   . TYR A 1 117 ? -8.918  1.788   4.891   1.00 0.00 ? 117 TYR A CB   1  
ATOM 1879  C CG   . TYR A 1 117 ? -9.786  0.603   5.275   1.00 0.00 ? 117 TYR A CG   1  
ATOM 1880  C CD1  . TYR A 1 117 ? -10.512 -0.105  4.321   1.00 0.00 ? 117 TYR A CD1  1  
ATOM 1881  C CD2  . TYR A 1 117 ? -9.852  0.175   6.599   1.00 0.00 ? 117 TYR A CD2  1  
ATOM 1882  C CE1  . TYR A 1 117 ? -11.279 -1.198  4.679   1.00 0.00 ? 117 TYR A CE1  1  
ATOM 1883  C CE2  . TYR A 1 117 ? -10.618 -0.913  6.960   1.00 0.00 ? 117 TYR A CE2  1  
ATOM 1884  C CZ   . TYR A 1 117 ? -11.328 -1.596  6.000   1.00 0.00 ? 117 TYR A CZ   1  
ATOM 1885  O OH   . TYR A 1 117 ? -12.087 -2.681  6.363   1.00 0.00 ? 117 TYR A OH   1  
ATOM 1886  H H    . TYR A 1 117 ? -7.885  4.088   4.500   1.00 0.00 ? 117 TYR A H    1  
ATOM 1887  H HA   . TYR A 1 117 ? -9.988  2.602   3.224   1.00 0.00 ? 117 TYR A HA   1  
ATOM 1888  H HB2  . TYR A 1 117 ? -8.141  1.417   4.231   1.00 0.00 ? 117 TYR A HB2  1  
ATOM 1889  H HB3  . TYR A 1 117 ? -8.458  2.169   5.795   1.00 0.00 ? 117 TYR A HB3  1  
ATOM 1890  H HD1  . TYR A 1 117 ? -10.475 0.211   3.289   1.00 0.00 ? 117 TYR A HD1  1  
ATOM 1891  H HD2  . TYR A 1 117 ? -9.295  0.712   7.352   1.00 0.00 ? 117 TYR A HD2  1  
ATOM 1892  H HE1  . TYR A 1 117 ? -11.837 -1.738  3.927   1.00 0.00 ? 117 TYR A HE1  1  
ATOM 1893  H HE2  . TYR A 1 117 ? -10.657 -1.227  7.994   1.00 0.00 ? 117 TYR A HE2  1  
ATOM 1894  H HH   . TYR A 1 117 ? -11.962 -3.384  5.720   1.00 0.00 ? 117 TYR A HH   1  
ATOM 1895  N N    . THR A 1 118 ? -10.642 4.401   5.862   1.00 0.00 ? 118 THR A N    1  
ATOM 1896  C CA   . THR A 1 118 ? -11.724 4.973   6.654   1.00 0.00 ? 118 THR A CA   1  
ATOM 1897  C C    . THR A 1 118 ? -12.754 5.659   5.747   1.00 0.00 ? 118 THR A C    1  
ATOM 1898  O O    . THR A 1 118 ? -13.947 5.320   5.765   1.00 0.00 ? 118 THR A O    1  
ATOM 1899  C CB   . THR A 1 118 ? -11.175 5.981   7.689   1.00 0.00 ? 118 THR A CB   1  
ATOM 1900  O OG1  . THR A 1 118 ? -10.332 6.935   7.033   1.00 0.00 ? 118 THR A OG1  1  
ATOM 1901  C CG2  . THR A 1 118 ? -10.388 5.268   8.786   1.00 0.00 ? 118 THR A CG2  1  
ATOM 1902  H H    . THR A 1 118 ? -9.733  4.755   5.970   1.00 0.00 ? 118 THR A H    1  
ATOM 1903  H HA   . THR A 1 118 ? -12.210 4.165   7.188   1.00 0.00 ? 118 THR A HA   1  
ATOM 1904  H HB   . THR A 1 118 ? -12.007 6.501   8.144   1.00 0.00 ? 118 THR A HB   1  
ATOM 1905  H HG1  . THR A 1 118 ? -9.521  7.057   7.544   1.00 0.00 ? 118 THR A HG1  1  
ATOM 1906  H HG21 . THR A 1 118 ? -10.032 5.994   9.502   1.00 0.00 ? 118 THR A HG21 1  
ATOM 1907  H HG22 . THR A 1 118 ? -9.545  4.752   8.350   1.00 0.00 ? 118 THR A HG22 1  
ATOM 1908  H HG23 . THR A 1 118 ? -11.027 4.554   9.285   1.00 0.00 ? 118 THR A HG23 1  
ATOM 1909  N N    . ARG A 1 119 ? -12.282 6.610   4.937   1.00 0.00 ? 119 ARG A N    1  
ATOM 1910  C CA   . ARG A 1 119 ? -13.152 7.310   3.991   1.00 0.00 ? 119 ARG A CA   1  
ATOM 1911  C C    . ARG A 1 119 ? -13.758 6.315   3.003   1.00 0.00 ? 119 ARG A C    1  
ATOM 1912  O O    . ARG A 1 119 ? -14.891 6.481   2.555   1.00 0.00 ? 119 ARG A O    1  
ATOM 1913  C CB   . ARG A 1 119 ? -12.385 8.417   3.242   1.00 0.00 ? 119 ARG A CB   1  
ATOM 1914  C CG   . ARG A 1 119 ? -11.327 7.906   2.266   1.00 0.00 ? 119 ARG A CG   1  
ATOM 1915  C CD   . ARG A 1 119 ? -10.541 9.048   1.630   1.00 0.00 ? 119 ARG A CD   1  
ATOM 1916  N NE   . ARG A 1 119 ? -9.830  9.838   2.637   1.00 0.00 ? 119 ARG A NE   1  
ATOM 1917  C CZ   . ARG A 1 119 ? -8.503  9.904   2.741   1.00 0.00 ? 119 ARG A CZ   1  
ATOM 1918  N NH1  . ARG A 1 119 ? -7.722  9.329   1.834   1.00 0.00 ? 119 ARG A NH1  1  
ATOM 1919  N NH2  . ARG A 1 119 ? -7.957  10.576  3.744   1.00 0.00 ? 119 ARG A NH2  1  
ATOM 1920  H H    . ARG A 1 119 ? -11.329 6.850   4.986   1.00 0.00 ? 119 ARG A H    1  
ATOM 1921  H HA   . ARG A 1 119 ? -13.954 7.762   4.560   1.00 0.00 ? 119 ARG A HA   1  
ATOM 1922  H HB2  . ARG A 1 119 ? -13.096 9.012   2.685   1.00 0.00 ? 119 ARG A HB2  1  
ATOM 1923  H HB3  . ARG A 1 119 ? -11.896 9.050   3.969   1.00 0.00 ? 119 ARG A HB3  1  
ATOM 1924  H HG2  . ARG A 1 119 ? -10.640 7.266   2.800   1.00 0.00 ? 119 ARG A HG2  1  
ATOM 1925  H HG3  . ARG A 1 119 ? -11.815 7.338   1.485   1.00 0.00 ? 119 ARG A HG3  1  
ATOM 1926  H HD2  . ARG A 1 119 ? -9.826  8.635   0.931   1.00 0.00 ? 119 ARG A HD2  1  
ATOM 1927  H HD3  . ARG A 1 119 ? -11.228 9.693   1.100   1.00 0.00 ? 119 ARG A HD3  1  
ATOM 1928  H HE   . ARG A 1 119 ? -10.377 10.320  3.296   1.00 0.00 ? 119 ARG A HE   1  
ATOM 1929  H HH11 . ARG A 1 119 ? -8.121  8.843   1.049   1.00 0.00 ? 119 ARG A HH11 1  
ATOM 1930  H HH12 . ARG A 1 119 ? -6.720  9.371   1.932   1.00 0.00 ? 119 ARG A HH12 1  
ATOM 1931  H HH21 . ARG A 1 119 ? -8.542  11.037  4.419   1.00 0.00 ? 119 ARG A HH21 1  
ATOM 1932  H HH22 . ARG A 1 119 ? -6.956  10.609  3.846   1.00 0.00 ? 119 ARG A HH22 1  
ATOM 1933  N N    . PHE A 1 120 ? -12.998 5.266   2.685   1.00 0.00 ? 120 PHE A N    1  
ATOM 1934  C CA   . PHE A 1 120 ? -13.469 4.209   1.794   1.00 0.00 ? 120 PHE A CA   1  
ATOM 1935  C C    . PHE A 1 120 ? -14.706 3.527   2.378   1.00 0.00 ? 120 PHE A C    1  
ATOM 1936  O O    . PHE A 1 120 ? -15.654 3.227   1.658   1.00 0.00 ? 120 PHE A O    1  
ATOM 1937  C CB   . PHE A 1 120 ? -12.356 3.179   1.546   1.00 0.00 ? 120 PHE A CB   1  
ATOM 1938  C CG   . PHE A 1 120 ? -12.760 2.035   0.643   1.00 0.00 ? 120 PHE A CG   1  
ATOM 1939  C CD1  . PHE A 1 120 ? -12.837 2.212   -0.732  1.00 0.00 ? 120 PHE A CD1  1  
ATOM 1940  C CD2  . PHE A 1 120 ? -13.064 0.785   1.170   1.00 0.00 ? 120 PHE A CD2  1  
ATOM 1941  C CE1  . PHE A 1 120 ? -13.207 1.169   -1.561  1.00 0.00 ? 120 PHE A CE1  1  
ATOM 1942  C CE2  . PHE A 1 120 ? -13.435 -0.259  0.344   1.00 0.00 ? 120 PHE A CE2  1  
ATOM 1943  C CZ   . PHE A 1 120 ? -13.506 -0.068  -1.022  1.00 0.00 ? 120 PHE A CZ   1  
ATOM 1944  H H    . PHE A 1 120 ? -12.092 5.205   3.055   1.00 0.00 ? 120 PHE A H    1  
ATOM 1945  H HA   . PHE A 1 120 ? -13.738 4.668   0.851   1.00 0.00 ? 120 PHE A HA   1  
ATOM 1946  H HB2  . PHE A 1 120 ? -11.512 3.677   1.091   1.00 0.00 ? 120 PHE A HB2  1  
ATOM 1947  H HB3  . PHE A 1 120 ? -12.045 2.762   2.496   1.00 0.00 ? 120 PHE A HB3  1  
ATOM 1948  H HD1  . PHE A 1 120 ? -12.603 3.178   -1.157  1.00 0.00 ? 120 PHE A HD1  1  
ATOM 1949  H HD2  . PHE A 1 120 ? -13.009 0.633   2.238   1.00 0.00 ? 120 PHE A HD2  1  
ATOM 1950  H HE1  . PHE A 1 120 ? -13.264 1.321   -2.629  1.00 0.00 ? 120 PHE A HE1  1  
ATOM 1951  H HE2  . PHE A 1 120 ? -13.666 -1.225  0.768   1.00 0.00 ? 120 PHE A HE2  1  
ATOM 1952  H HZ   . PHE A 1 120 ? -13.796 -0.883  -1.667  1.00 0.00 ? 120 PHE A HZ   1  
ATOM 1953  N N    . LEU A 1 121 ? -14.698 3.305   3.689   1.00 0.00 ? 121 LEU A N    1  
ATOM 1954  C CA   . LEU A 1 121 ? -15.805 2.628   4.362   1.00 0.00 ? 121 LEU A CA   1  
ATOM 1955  C C    . LEU A 1 121 ? -17.049 3.513   4.436   1.00 0.00 ? 121 LEU A C    1  
ATOM 1956  O O    . LEU A 1 121 ? -18.172 3.006   4.512   1.00 0.00 ? 121 LEU A O    1  
ATOM 1957  C CB   . LEU A 1 121 ? -15.386 2.192   5.771   1.00 0.00 ? 121 LEU A CB   1  
ATOM 1958  C CG   . LEU A 1 121 ? -14.305 1.100   5.823   1.00 0.00 ? 121 LEU A CG   1  
ATOM 1959  C CD1  . LEU A 1 121 ? -13.914 0.795   7.266   1.00 0.00 ? 121 LEU A CD1  1  
ATOM 1960  C CD2  . LEU A 1 121 ? -14.783 -0.165  5.111   1.00 0.00 ? 121 LEU A CD2  1  
ATOM 1961  H H    . LEU A 1 121 ? -13.924 3.598   4.218   1.00 0.00 ? 121 LEU A H    1  
ATOM 1962  H HA   . LEU A 1 121 ? -16.047 1.745   3.785   1.00 0.00 ? 121 LEU A HA   1  
ATOM 1963  H HB2  . LEU A 1 121 ? -15.017 3.061   6.299   1.00 0.00 ? 121 LEU A HB2  1  
ATOM 1964  H HB3  . LEU A 1 121 ? -16.262 1.824   6.288   1.00 0.00 ? 121 LEU A HB3  1  
ATOM 1965  H HG   . LEU A 1 121 ? -13.423 1.457   5.310   1.00 0.00 ? 121 LEU A HG   1  
ATOM 1966  H HD11 . LEU A 1 121 ? -14.781 0.454   7.813   1.00 0.00 ? 121 LEU A HD11 1  
ATOM 1967  H HD12 . LEU A 1 121 ? -13.524 1.689   7.731   1.00 0.00 ? 121 LEU A HD12 1  
ATOM 1968  H HD13 . LEU A 1 121 ? -13.155 0.027   7.279   1.00 0.00 ? 121 LEU A HD13 1  
ATOM 1969  H HD21 . LEU A 1 121 ? -15.689 -0.526  5.580   1.00 0.00 ? 121 LEU A HD21 1  
ATOM 1970  H HD22 . LEU A 1 121 ? -14.019 -0.926  5.173   1.00 0.00 ? 121 LEU A HD22 1  
ATOM 1971  H HD23 . LEU A 1 121 ? -14.981 0.058   4.072   1.00 0.00 ? 121 LEU A HD23 1  
ATOM 1972  N N    . LYS A 1 122 ? -16.855 4.829   4.433   1.00 0.00 ? 122 LYS A N    1  
ATOM 1973  C CA   . LYS A 1 122 ? -17.983 5.763   4.504   1.00 0.00 ? 122 LYS A CA   1  
ATOM 1974  C C    . LYS A 1 122 ? -18.230 6.446   3.149   1.00 0.00 ? 122 LYS A C    1  
ATOM 1975  O O    . LYS A 1 122 ? -19.069 7.344   3.034   1.00 0.00 ? 122 LYS A O    1  
ATOM 1976  C CB   . LYS A 1 122 ? -17.737 6.800   5.616   1.00 0.00 ? 122 LYS A CB   1  
ATOM 1977  C CG   . LYS A 1 122 ? -18.932 7.716   5.911   1.00 0.00 ? 122 LYS A CG   1  
ATOM 1978  C CD   . LYS A 1 122 ? -20.209 6.931   6.233   1.00 0.00 ? 122 LYS A CD   1  
ATOM 1979  C CE   . LYS A 1 122 ? -20.055 6.053   7.473   1.00 0.00 ? 122 LYS A CE   1  
ATOM 1980  N NZ   . LYS A 1 122 ? -21.321 5.350   7.816   1.00 0.00 ? 122 LYS A NZ   1  
ATOM 1981  H H    . LYS A 1 122 ? -15.934 5.181   4.405   1.00 0.00 ? 122 LYS A H    1  
ATOM 1982  H HA   . LYS A 1 122 ? -18.866 5.192   4.755   1.00 0.00 ? 122 LYS A HA   1  
ATOM 1983  H HB2  . LYS A 1 122 ? -17.484 6.276   6.526   1.00 0.00 ? 122 LYS A HB2  1  
ATOM 1984  H HB3  . LYS A 1 122 ? -16.900 7.422   5.331   1.00 0.00 ? 122 LYS A HB3  1  
ATOM 1985  H HG2  . LYS A 1 122 ? -18.689 8.344   6.757   1.00 0.00 ? 122 LYS A HG2  1  
ATOM 1986  H HG3  . LYS A 1 122 ? -19.114 8.340   5.046   1.00 0.00 ? 122 LYS A HG3  1  
ATOM 1987  H HD2  . LYS A 1 122 ? -21.014 7.631   6.403   1.00 0.00 ? 122 LYS A HD2  1  
ATOM 1988  H HD3  . LYS A 1 122 ? -20.455 6.304   5.388   1.00 0.00 ? 122 LYS A HD3  1  
ATOM 1989  H HE2  . LYS A 1 122 ? -19.289 5.316   7.283   1.00 0.00 ? 122 LYS A HE2  1  
ATOM 1990  H HE3  . LYS A 1 122 ? -19.759 6.673   8.307   1.00 0.00 ? 122 LYS A HE3  1  
ATOM 1991  H HZ1  . LYS A 1 122 ? -22.107 6.029   7.867   1.00 0.00 ? 122 LYS A HZ1  1  
ATOM 1992  H HZ2  . LYS A 1 122 ? -21.232 4.876   8.738   1.00 0.00 ? 122 LYS A HZ2  1  
ATOM 1993  H HZ3  . LYS A 1 122 ? -21.543 4.634   7.096   1.00 0.00 ? 122 LYS A HZ3  1  
ATOM 1994  N N    . SER A 1 123 ? -17.516 6.001   2.117   1.00 0.00 ? 123 SER A N    1  
ATOM 1995  C CA   . SER A 1 123 ? -17.690 6.551   0.777   1.00 0.00 ? 123 SER A CA   1  
ATOM 1996  C C    . SER A 1 123 ? -18.985 6.037   0.160   1.00 0.00 ? 123 SER A C    1  
ATOM 1997  O O    . SER A 1 123 ? -19.484 4.973   0.541   1.00 0.00 ? 123 SER A O    1  
ATOM 1998  C CB   . SER A 1 123 ? -16.510 6.167   -0.122  1.00 0.00 ? 123 SER A CB   1  
ATOM 1999  O OG   . SER A 1 123 ? -16.497 4.771   -0.381  1.00 0.00 ? 123 SER A OG   1  
ATOM 2000  H H    . SER A 1 123 ? -16.862 5.288   2.258   1.00 0.00 ? 123 SER A H    1  
ATOM 2001  H HA   . SER A 1 123 ? -17.740 7.629   0.858   1.00 0.00 ? 123 SER A HA   1  
ATOM 2002  H HB2  . SER A 1 123 ? -16.588 6.693   -1.063  1.00 0.00 ? 123 SER A HB2  1  
ATOM 2003  H HB3  . SER A 1 123 ? -15.584 6.439   0.364   1.00 0.00 ? 123 SER A HB3  1  
ATOM 2004  H HG   . SER A 1 123 ? -15.874 4.342   0.212   1.00 0.00 ? 123 SER A HG   1  
ATOM 2005  N N    . ASP A 1 124 ? -19.516 6.782   -0.804  1.00 0.00 ? 124 ASP A N    1  
ATOM 2006  C CA   . ASP A 1 124 ? -20.695 6.350   -1.549  1.00 0.00 ? 124 ASP A CA   1  
ATOM 2007  C C    . ASP A 1 124 ? -20.421 5.017   -2.241  1.00 0.00 ? 124 ASP A C    1  
ATOM 2008  O O    . ASP A 1 124 ? -21.342 4.255   -2.529  1.00 0.00 ? 124 ASP A O    1  
ATOM 2009  C CB   . ASP A 1 124 ? -21.104 7.406   -2.587  1.00 0.00 ? 124 ASP A CB   1  
ATOM 2010  C CG   . ASP A 1 124 ? -20.026 7.655   -3.635  1.00 0.00 ? 124 ASP A CG   1  
ATOM 2011  O OD1  . ASP A 1 124 ? -20.004 6.944   -4.663  1.00 0.00 ? 124 ASP A OD1  1  
ATOM 2012  O OD2  . ASP A 1 124 ? -19.194 8.568   -3.433  1.00 0.00 ? 124 ASP A OD2  1  
ATOM 2013  H H    . ASP A 1 124 ? -19.103 7.646   -1.019  1.00 0.00 ? 124 ASP A H    1  
ATOM 2014  H HA   . ASP A 1 124 ? -21.504 6.218   -0.842  1.00 0.00 ? 124 ASP A HA   1  
ATOM 2015  H HB2  . ASP A 1 124 ? -22.002 7.078   -3.091  1.00 0.00 ? 124 ASP A HB2  1  
ATOM 2016  H HB3  . ASP A 1 124 ? -21.309 8.339   -2.078  1.00 0.00 ? 124 ASP A HB3  1  
ATOM 2017  N N    . ILE A 1 125 ? -19.143 4.747   -2.498  1.00 0.00 ? 125 ILE A N    1  
ATOM 2018  C CA   . ILE A 1 125 ? -18.717 3.501   -3.128  1.00 0.00 ? 125 ILE A CA   1  
ATOM 2019  C C    . ILE A 1 125 ? -19.086 2.303   -2.253  1.00 0.00 ? 125 ILE A C    1  
ATOM 2020  O O    . ILE A 1 125 ? -19.799 1.390   -2.687  1.00 0.00 ? 125 ILE A O    1  
ATOM 2021  C CB   . ILE A 1 125 ? -17.185 3.501   -3.377  1.00 0.00 ? 125 ILE A CB   1  
ATOM 2022  C CG1  . ILE A 1 125 ? -16.774 4.705   -4.244  1.00 0.00 ? 125 ILE A CG1  1  
ATOM 2023  C CG2  . ILE A 1 125 ? -16.736 2.188   -4.021  1.00 0.00 ? 125 ILE A CG2  1  
ATOM 2024  C CD1  . ILE A 1 125 ? -17.431 4.740   -5.609  1.00 0.00 ? 125 ILE A CD1  1  
ATOM 2025  H H    . ILE A 1 125 ? -18.465 5.410   -2.256  1.00 0.00 ? 125 ILE A H    1  
ATOM 2026  H HA   . ILE A 1 125 ? -19.220 3.414   -4.082  1.00 0.00 ? 125 ILE A HA   1  
ATOM 2027  H HB   . ILE A 1 125 ? -16.692 3.579   -2.417  1.00 0.00 ? 125 ILE A HB   1  
ATOM 2028  H HG12 . ILE A 1 125 ? -17.042 5.616   -3.730  1.00 0.00 ? 125 ILE A HG12 1  
ATOM 2029  H HG13 . ILE A 1 125 ? -15.703 4.686   -4.392  1.00 0.00 ? 125 ILE A HG13 1  
ATOM 2030  H HG21 . ILE A 1 125 ? -16.981 1.363   -3.368  1.00 0.00 ? 125 ILE A HG21 1  
ATOM 2031  H HG22 . ILE A 1 125 ? -15.667 2.212   -4.181  1.00 0.00 ? 125 ILE A HG22 1  
ATOM 2032  H HG23 . ILE A 1 125 ? -17.239 2.058   -4.969  1.00 0.00 ? 125 ILE A HG23 1  
ATOM 2033  H HD11 . ILE A 1 125 ? -18.504 4.800   -5.494  1.00 0.00 ? 125 ILE A HD11 1  
ATOM 2034  H HD12 . ILE A 1 125 ? -17.176 3.844   -6.157  1.00 0.00 ? 125 ILE A HD12 1  
ATOM 2035  H HD13 . ILE A 1 125 ? -17.080 5.605   -6.153  1.00 0.00 ? 125 ILE A HD13 1  
ATOM 2036  N N    . TYR A 1 126 ? -18.610 2.324   -1.013  1.00 0.00 ? 126 TYR A N    1  
ATOM 2037  C CA   . TYR A 1 126 ? -18.846 1.225   -0.083  1.00 0.00 ? 126 TYR A CA   1  
ATOM 2038  C C    . TYR A 1 126 ? -20.302 1.219   0.382   1.00 0.00 ? 126 TYR A C    1  
ATOM 2039  O O    . TYR A 1 126 ? -20.908 0.159   0.542   1.00 0.00 ? 126 TYR A O    1  
ATOM 2040  C CB   . TYR A 1 126 ? -17.899 1.321   1.117   1.00 0.00 ? 126 TYR A CB   1  
ATOM 2041  C CG   . TYR A 1 126 ? -17.955 0.116   2.039   1.00 0.00 ? 126 TYR A CG   1  
ATOM 2042  C CD1  . TYR A 1 126 ? -17.395 -1.099  1.656   1.00 0.00 ? 126 TYR A CD1  1  
ATOM 2043  C CD2  . TYR A 1 126 ? -18.569 0.191   3.284   1.00 0.00 ? 126 TYR A CD2  1  
ATOM 2044  C CE1  . TYR A 1 126 ? -17.446 -2.201  2.488   1.00 0.00 ? 126 TYR A CE1  1  
ATOM 2045  C CE2  . TYR A 1 126 ? -18.623 -0.906  4.120   1.00 0.00 ? 126 TYR A CE2  1  
ATOM 2046  C CZ   . TYR A 1 126 ? -18.061 -2.099  3.718   1.00 0.00 ? 126 TYR A CZ   1  
ATOM 2047  O OH   . TYR A 1 126 ? -18.120 -3.196  4.548   1.00 0.00 ? 126 TYR A OH   1  
ATOM 2048  H H    . TYR A 1 126 ? -18.084 3.101   -0.714  1.00 0.00 ? 126 TYR A H    1  
ATOM 2049  H HA   . TYR A 1 126 ? -18.649 0.301   -0.610  1.00 0.00 ? 126 TYR A HA   1  
ATOM 2050  H HB2  . TYR A 1 126 ? -16.883 1.418   0.759   1.00 0.00 ? 126 TYR A HB2  1  
ATOM 2051  H HB3  . TYR A 1 126 ? -18.151 2.199   1.698   1.00 0.00 ? 126 TYR A HB3  1  
ATOM 2052  H HD1  . TYR A 1 126 ? -16.914 -1.176  0.692   1.00 0.00 ? 126 TYR A HD1  1  
ATOM 2053  H HD2  . TYR A 1 126 ? -19.009 1.127   3.598   1.00 0.00 ? 126 TYR A HD2  1  
ATOM 2054  H HE1  . TYR A 1 126 ? -17.005 -3.137  2.171   1.00 0.00 ? 126 TYR A HE1  1  
ATOM 2055  H HE2  . TYR A 1 126 ? -19.106 -0.827  5.083   1.00 0.00 ? 126 TYR A HE2  1  
ATOM 2056  H HH   . TYR A 1 126 ? -17.326 -3.730  4.428   1.00 0.00 ? 126 TYR A HH   1  
ATOM 2057  N N    . LEU A 1 127 ? -20.864 2.410   0.587   1.00 0.00 ? 127 LEU A N    1  
ATOM 2058  C CA   . LEU A 1 127 ? -22.266 2.537   0.984   1.00 0.00 ? 127 LEU A CA   1  
ATOM 2059  C C    . LEU A 1 127 ? -23.180 2.003   -0.119  1.00 0.00 ? 127 LEU A C    1  
ATOM 2060  O O    . LEU A 1 127 ? -24.265 1.488   0.156   1.00 0.00 ? 127 LEU A O    1  
ATOM 2061  C CB   . LEU A 1 127 ? -22.611 3.998   1.318   1.00 0.00 ? 127 LEU A CB   1  
ATOM 2062  C CG   . LEU A 1 127 ? -21.898 4.576   2.555   1.00 0.00 ? 127 LEU A CG   1  
ATOM 2063  C CD1  . LEU A 1 127 ? -22.319 6.022   2.796   1.00 0.00 ? 127 LEU A CD1  1  
ATOM 2064  C CD2  . LEU A 1 127 ? -22.174 3.721   3.791   1.00 0.00 ? 127 LEU A CD2  1  
ATOM 2065  H H    . LEU A 1 127 ? -20.323 3.222   0.471   1.00 0.00 ? 127 LEU A H    1  
ATOM 2066  H HA   . LEU A 1 127 ? -22.410 1.934   1.870   1.00 0.00 ? 127 LEU A HA   1  
ATOM 2067  H HB2  . LEU A 1 127 ? -22.354 4.609   0.464   1.00 0.00 ? 127 LEU A HB2  1  
ATOM 2068  H HB3  . LEU A 1 127 ? -23.678 4.068   1.479   1.00 0.00 ? 127 LEU A HB3  1  
ATOM 2069  H HG   . LEU A 1 127 ? -20.831 4.571   2.378   1.00 0.00 ? 127 LEU A HG   1  
ATOM 2070  H HD11 . LEU A 1 127 ? -22.062 6.620   1.933   1.00 0.00 ? 127 LEU A HD11 1  
ATOM 2071  H HD12 . LEU A 1 127 ? -21.804 6.407   3.665   1.00 0.00 ? 127 LEU A HD12 1  
ATOM 2072  H HD13 . LEU A 1 127 ? -23.385 6.067   2.961   1.00 0.00 ? 127 LEU A HD13 1  
ATOM 2073  H HD21 . LEU A 1 127 ? -21.809 2.717   3.624   1.00 0.00 ? 127 LEU A HD21 1  
ATOM 2074  H HD22 . LEU A 1 127 ? -23.236 3.690   3.982   1.00 0.00 ? 127 LEU A HD22 1  
ATOM 2075  H HD23 . LEU A 1 127 ? -21.669 4.149   4.645   1.00 0.00 ? 127 LEU A HD23 1  
ATOM 2076  N N    . ASP A 1 128 ? -22.723 2.116   -1.364  1.00 0.00 ? 128 ASP A N    1  
ATOM 2077  C CA   . ASP A 1 128 ? -23.434 1.543   -2.507  1.00 0.00 ? 128 ASP A CA   1  
ATOM 2078  C C    . ASP A 1 128 ? -23.420 0.022   -2.423  1.00 0.00 ? 128 ASP A C    1  
ATOM 2079  O O    . ASP A 1 128 ? -24.406 -0.639  -2.750  1.00 0.00 ? 128 ASP A O    1  
ATOM 2080  C CB   . ASP A 1 128 ? -22.792 1.999   -3.824  1.00 0.00 ? 128 ASP A CB   1  
ATOM 2081  C CG   . ASP A 1 128 ? -23.392 1.315   -5.044  1.00 0.00 ? 128 ASP A CG   1  
ATOM 2082  O OD1  . ASP A 1 128 ? -24.430 1.793   -5.554  1.00 0.00 ? 128 ASP A OD1  1  
ATOM 2083  O OD2  . ASP A 1 128 ? -22.823 0.304   -5.509  1.00 0.00 ? 128 ASP A OD2  1  
ATOM 2084  H H    . ASP A 1 128 ? -21.887 2.604   -1.522  1.00 0.00 ? 128 ASP A H    1  
ATOM 2085  H HA   . ASP A 1 128 ? -24.457 1.889   -2.472  1.00 0.00 ? 128 ASP A HA   1  
ATOM 2086  H HB2  . ASP A 1 128 ? -22.927 3.067   -3.930  1.00 0.00 ? 128 ASP A HB2  1  
ATOM 2087  H HB3  . ASP A 1 128 ? -21.732 1.781   -3.794  1.00 0.00 ? 128 ASP A HB3  1  
ATOM 2088  N N    . LEU A 1 129 ? -22.292 -0.531  -1.986  1.00 0.00 ? 129 LEU A N    1  
ATOM 2089  C CA   . LEU A 1 129 ? -22.172 -1.973  -1.777  1.00 0.00 ? 129 LEU A CA   1  
ATOM 2090  C C    . LEU A 1 129 ? -23.088 -2.422  -0.638  1.00 0.00 ? 129 LEU A C    1  
ATOM 2091  O O    . LEU A 1 129 ? -23.552 -3.563  -0.610  1.00 0.00 ? 129 LEU A O    1  
ATOM 2092  C CB   . LEU A 1 129 ? -20.716 -2.358  -1.468  1.00 0.00 ? 129 LEU A CB   1  
ATOM 2093  C CG   . LEU A 1 129 ? -19.704 -2.067  -2.590  1.00 0.00 ? 129 LEU A CG   1  
ATOM 2094  C CD1  . LEU A 1 129 ? -18.287 -2.436  -2.153  1.00 0.00 ? 129 LEU A CD1  1  
ATOM 2095  C CD2  . LEU A 1 129 ? -20.087 -2.809  -3.871  1.00 0.00 ? 129 LEU A CD2  1  
ATOM 2096  H H    . LEU A 1 129 ? -21.515 0.046   -1.809  1.00 0.00 ? 129 LEU A H    1  
ATOM 2097  H HA   . LEU A 1 129 ? -22.482 -2.468  -2.688  1.00 0.00 ? 129 LEU A HA   1  
ATOM 2098  H HB2  . LEU A 1 129 ? -20.405 -1.818  -0.582  1.00 0.00 ? 129 LEU A HB2  1  
ATOM 2099  H HB3  . LEU A 1 129 ? -20.684 -3.416  -1.250  1.00 0.00 ? 129 LEU A HB3  1  
ATOM 2100  H HG   . LEU A 1 129 ? -19.715 -1.007  -2.803  1.00 0.00 ? 129 LEU A HG   1  
ATOM 2101  H HD11 . LEU A 1 129 ? -18.244 -3.489  -1.913  1.00 0.00 ? 129 LEU A HD11 1  
ATOM 2102  H HD12 . LEU A 1 129 ? -18.016 -1.858  -1.281  1.00 0.00 ? 129 LEU A HD12 1  
ATOM 2103  H HD13 . LEU A 1 129 ? -17.595 -2.221  -2.955  1.00 0.00 ? 129 LEU A HD13 1  
ATOM 2104  H HD21 . LEU A 1 129 ? -21.066 -2.486  -4.195  1.00 0.00 ? 129 LEU A HD21 1  
ATOM 2105  H HD22 . LEU A 1 129 ? -20.104 -3.873  -3.683  1.00 0.00 ? 129 LEU A HD22 1  
ATOM 2106  H HD23 . LEU A 1 129 ? -19.364 -2.591  -4.643  1.00 0.00 ? 129 LEU A HD23 1  
ATOM 2107  N N    . MET A 1 130 ? -23.339 -1.513  0.301   1.00 0.00 ? 130 MET A N    1  
ATOM 2108  C CA   . MET A 1 130 ? -24.211 -1.796  1.439   1.00 0.00 ? 130 MET A CA   1  
ATOM 2109  C C    . MET A 1 130 ? -25.682 -1.680  1.036   1.00 0.00 ? 130 MET A C    1  
ATOM 2110  O O    . MET A 1 130 ? -26.521 -2.461  1.492   1.00 0.00 ? 130 MET A O    1  
ATOM 2111  C CB   . MET A 1 130 ? -23.916 -0.831  2.601   1.00 0.00 ? 130 MET A CB   1  
ATOM 2112  C CG   . MET A 1 130 ? -22.485 -0.882  3.143   1.00 0.00 ? 130 MET A CG   1  
ATOM 2113  S SD   . MET A 1 130 ? -22.070 -2.435  3.981   1.00 0.00 ? 130 MET A SD   1  
ATOM 2114  C CE   . MET A 1 130 ? -21.626 -3.493  2.600   1.00 0.00 ? 130 MET A CE   1  
ATOM 2115  H H    . MET A 1 130 ? -22.925 -0.626  0.227   1.00 0.00 ? 130 MET A H    1  
ATOM 2116  H HA   . MET A 1 130 ? -24.018 -2.808  1.766   1.00 0.00 ? 130 MET A HA   1  
ATOM 2117  H HB2  . MET A 1 130 ? -24.106 0.179   2.264   1.00 0.00 ? 130 MET A HB2  1  
ATOM 2118  H HB3  . MET A 1 130 ? -24.592 -1.055  3.416   1.00 0.00 ? 130 MET A HB3  1  
ATOM 2119  H HG2  . MET A 1 130 ? -21.800 -0.746  2.321   1.00 0.00 ? 130 MET A HG2  1  
ATOM 2120  H HG3  . MET A 1 130 ? -22.356 -0.070  3.847   1.00 0.00 ? 130 MET A HG3  1  
ATOM 2121  H HE1  . MET A 1 130 ? -20.813 -3.044  2.047   1.00 0.00 ? 130 MET A HE1  1  
ATOM 2122  H HE2  . MET A 1 130 ? -22.479 -3.618  1.951   1.00 0.00 ? 130 MET A HE2  1  
ATOM 2123  H HE3  . MET A 1 130 ? -21.314 -4.458  2.972   1.00 0.00 ? 130 MET A HE3  1  
ATOM 2124  N N    . GLU A 1 131 ? -25.980 -0.694  0.181   1.00 0.00 ? 131 GLU A N    1  
ATOM 2125  C CA   . GLU A 1 131 ? -27.354 -0.408  -0.256  1.00 0.00 ? 131 GLU A CA   1  
ATOM 2126  C C    . GLU A 1 131 ? -28.260 -0.115  0.939   1.00 0.00 ? 131 GLU A C    1  
ATOM 2127  O O    . GLU A 1 131 ? -29.479 -0.296  0.874   1.00 0.00 ? 131 GLU A O    1  
ATOM 2128  C CB   . GLU A 1 131 ? -27.915 -1.570  -1.091  1.00 0.00 ? 131 GLU A CB   1  
ATOM 2129  C CG   . GLU A 1 131 ? -27.249 -1.718  -2.454  1.00 0.00 ? 131 GLU A CG   1  
ATOM 2130  C CD   . GLU A 1 131 ? -27.819 -2.862  -3.272  1.00 0.00 ? 131 GLU A CD   1  
ATOM 2131  O OE1  . GLU A 1 131 ? -28.989 -2.771  -3.703  1.00 0.00 ? 131 GLU A OE1  1  
ATOM 2132  O OE2  . GLU A 1 131 ? -27.104 -3.862  -3.490  1.00 0.00 ? 131 GLU A OE2  1  
ATOM 2133  H H    . GLU A 1 131 ? -25.252 -0.140  -0.169  1.00 0.00 ? 131 GLU A H    1  
ATOM 2134  H HA   . GLU A 1 131 ? -27.315 0.477   -0.876  1.00 0.00 ? 131 GLU A HA   1  
ATOM 2135  H HB2  . GLU A 1 131 ? -27.779 -2.492  -0.543  1.00 0.00 ? 131 GLU A HB2  1  
ATOM 2136  H HB3  . GLU A 1 131 ? -28.974 -1.409  -1.248  1.00 0.00 ? 131 GLU A HB3  1  
ATOM 2137  H HG2  . GLU A 1 131 ? -27.386 -0.799  -3.008  1.00 0.00 ? 131 GLU A HG2  1  
ATOM 2138  H HG3  . GLU A 1 131 ? -26.191 -1.889  -2.306  1.00 0.00 ? 131 GLU A HG3  1  
ATOM 2139  N N    . GLY A 1 132 ? -27.652 0.365   2.020   1.00 0.00 ? 132 GLY A N    1  
ATOM 2140  C CA   . GLY A 1 132 ? -28.392 0.669   3.227   1.00 0.00 ? 132 GLY A CA   1  
ATOM 2141  C C    . GLY A 1 132 ? -29.232 1.924   3.089   1.00 0.00 ? 132 GLY A C    1  
ATOM 2142  O O    . GLY A 1 132 ? -30.366 1.871   2.605   1.00 0.00 ? 132 GLY A O    1  
ATOM 2143  H H    . GLY A 1 132 ? -26.686 0.518   1.993   1.00 0.00 ? 132 GLY A H    1  
ATOM 2144  H HA2  . GLY A 1 132 ? -29.041 -0.164  3.462   1.00 0.00 ? 132 GLY A HA2  1  
ATOM 2145  H HA3  . GLY A 1 132 ? -27.692 0.803   4.039   1.00 0.00 ? 132 GLY A HA3  1  
ATOM 2146  N N    . ARG A 1 133 ? -28.669 3.061   3.489   1.00 0.00 ? 133 ARG A N    1  
ATOM 2147  C CA   . ARG A 1 133 ? -29.398 4.327   3.475   1.00 0.00 ? 133 ARG A CA   1  
ATOM 2148  C C    . ARG A 1 133 ? -28.437 5.519   3.443   1.00 0.00 ? 133 ARG A C    1  
ATOM 2149  O O    . ARG A 1 133 ? -27.449 5.545   4.180   1.00 0.00 ? 133 ARG A O    1  
ATOM 2150  C CB   . ARG A 1 133 ? -30.303 4.421   4.713   1.00 0.00 ? 133 ARG A CB   1  
ATOM 2151  C CG   . ARG A 1 133 ? -29.548 4.255   6.030   1.00 0.00 ? 133 ARG A CG   1  
ATOM 2152  C CD   . ARG A 1 133 ? -30.475 4.320   7.234   1.00 0.00 ? 133 ARG A CD   1  
ATOM 2153  N NE   . ARG A 1 133 ? -29.762 4.048   8.484   1.00 0.00 ? 133 ARG A NE   1  
ATOM 2154  C CZ   . ARG A 1 133 ? -30.335 3.540   9.575   1.00 0.00 ? 133 ARG A CZ   1  
ATOM 2155  N NH1  . ARG A 1 133 ? -31.637 3.267   9.583   1.00 0.00 ? 133 ARG A NH1  1  
ATOM 2156  N NH2  . ARG A 1 133 ? -29.607 3.303   10.657  1.00 0.00 ? 133 ARG A NH2  1  
ATOM 2157  H H    . ARG A 1 133 ? -27.738 3.049   3.804   1.00 0.00 ? 133 ARG A H    1  
ATOM 2158  H HA   . ARG A 1 133 ? -30.015 4.347   2.587   1.00 0.00 ? 133 ARG A HA   1  
ATOM 2159  H HB2  . ARG A 1 133 ? -30.793 5.384   4.718   1.00 0.00 ? 133 ARG A HB2  1  
ATOM 2160  H HB3  . ARG A 1 133 ? -31.055 3.645   4.654   1.00 0.00 ? 133 ARG A HB3  1  
ATOM 2161  H HG2  . ARG A 1 133 ? -29.050 3.295   6.027   1.00 0.00 ? 133 ARG A HG2  1  
ATOM 2162  H HG3  . ARG A 1 133 ? -28.809 5.041   6.111   1.00 0.00 ? 133 ARG A HG3  1  
ATOM 2163  H HD2  . ARG A 1 133 ? -30.910 5.308   7.287   1.00 0.00 ? 133 ARG A HD2  1  
ATOM 2164  H HD3  . ARG A 1 133 ? -31.260 3.587   7.110   1.00 0.00 ? 133 ARG A HD3  1  
ATOM 2165  H HE   . ARG A 1 133 ? -28.798 4.252   8.504   1.00 0.00 ? 133 ARG A HE   1  
ATOM 2166  H HH11 . ARG A 1 133 ? -32.196 3.440   8.766   1.00 0.00 ? 133 ARG A HH11 1  
ATOM 2167  H HH12 . ARG A 1 133 ? -32.071 2.899   10.410  1.00 0.00 ? 133 ARG A HH12 1  
ATOM 2168  H HH21 . ARG A 1 133 ? -28.621 3.505   10.659  1.00 0.00 ? 133 ARG A HH21 1  
ATOM 2169  H HH22 . ARG A 1 133 ? -30.037 2.924   11.481  1.00 0.00 ? 133 ARG A HH22 1  
ATOM 2170  N N    . PRO A 1 134 ? -28.696 6.506   2.564   1.00 0.00 ? 134 PRO A N    1  
ATOM 2171  C CA   . PRO A 1 134 ? -27.970 7.773   2.558   1.00 0.00 ? 134 PRO A CA   1  
ATOM 2172  C C    . PRO A 1 134 ? -28.632 8.798   3.486   1.00 0.00 ? 134 PRO A C    1  
ATOM 2173  O O    . PRO A 1 134 ? -29.845 8.751   3.704   1.00 0.00 ? 134 PRO A O    1  
ATOM 2174  C CB   . PRO A 1 134 ? -28.075 8.205   1.094   1.00 0.00 ? 134 PRO A CB   1  
ATOM 2175  C CG   . PRO A 1 134 ? -29.405 7.685   0.644   1.00 0.00 ? 134 PRO A CG   1  
ATOM 2176  C CD   . PRO A 1 134 ? -29.704 6.457   1.483   1.00 0.00 ? 134 PRO A CD   1  
ATOM 2177  H HA   . PRO A 1 134 ? -26.933 7.644   2.835   1.00 0.00 ? 134 PRO A HA   1  
ATOM 2178  H HB2  . PRO A 1 134 ? -28.025 9.283   1.024   1.00 0.00 ? 134 PRO A HB2  1  
ATOM 2179  H HB3  . PRO A 1 134 ? -27.267 7.766   0.525   1.00 0.00 ? 134 PRO A HB3  1  
ATOM 2180  H HG2  . PRO A 1 134 ? -30.164 8.439   0.801   1.00 0.00 ? 134 PRO A HG2  1  
ATOM 2181  H HG3  . PRO A 1 134 ? -29.358 7.419   -0.404  1.00 0.00 ? 134 PRO A HG3  1  
ATOM 2182  H HD2  . PRO A 1 134 ? -30.705 6.512   1.890   1.00 0.00 ? 134 PRO A HD2  1  
ATOM 2183  H HD3  . PRO A 1 134 ? -29.590 5.559   0.893   1.00 0.00 ? 134 PRO A HD3  1  
ATOM 2184  N N    . SER A 1 1   ? -15.400 -5.200  -10.120 1.00 0.00 ? 1   SER A N    2  
ATOM 2185  C CA   . SER A 1 1   ? -16.819 -5.588  -10.284 1.00 0.00 ? 1   SER A CA   2  
ATOM 2186  C C    . SER A 1 1   ? -17.614 -5.171  -9.042  1.00 0.00 ? 1   SER A C    2  
ATOM 2187  O O    . SER A 1 1   ? -17.225 -4.231  -8.339  1.00 0.00 ? 1   SER A O    2  
ATOM 2188  C CB   . SER A 1 1   ? -16.910 -7.106  -10.521 1.00 0.00 ? 1   SER A CB   2  
ATOM 2189  O OG   . SER A 1 1   ? -18.223 -7.503  -10.899 1.00 0.00 ? 1   SER A OG   2  
ATOM 2190  H H1   . SER A 1 1   ? -15.317 -4.168  -10.060 1.00 0.00 ? 1   SER A H1   2  
ATOM 2191  H H2   . SER A 1 1   ? -14.838 -5.538  -10.925 1.00 0.00 ? 1   SER A H2   2  
ATOM 2192  H H3   . SER A 1 1   ? -15.019 -5.618  -9.246  1.00 0.00 ? 1   SER A H3   2  
ATOM 2193  H HA   . SER A 1 1   ? -17.216 -5.067  -11.144 1.00 0.00 ? 1   SER A HA   2  
ATOM 2194  H HB2  . SER A 1 1   ? -16.227 -7.384  -11.311 1.00 0.00 ? 1   SER A HB2  2  
ATOM 2195  H HB3  . SER A 1 1   ? -16.636 -7.627  -9.614  1.00 0.00 ? 1   SER A HB3  2  
ATOM 2196  H HG   . SER A 1 1   ? -18.335 -7.374  -11.850 1.00 0.00 ? 1   SER A HG   2  
ATOM 2197  N N    . MET A 1 2   ? -18.734 -5.845  -8.787  1.00 0.00 ? 2   MET A N    2  
ATOM 2198  C CA   . MET A 1 2   ? -19.560 -5.565  -7.614  1.00 0.00 ? 2   MET A CA   2  
ATOM 2199  C C    . MET A 1 2   ? -19.662 -6.805  -6.723  1.00 0.00 ? 2   MET A C    2  
ATOM 2200  O O    . MET A 1 2   ? -20.130 -7.861  -7.159  1.00 0.00 ? 2   MET A O    2  
ATOM 2201  C CB   . MET A 1 2   ? -20.962 -5.084  -8.032  1.00 0.00 ? 2   MET A CB   2  
ATOM 2202  C CG   . MET A 1 2   ? -21.736 -6.072  -8.899  1.00 0.00 ? 2   MET A CG   2  
ATOM 2203  S SD   . MET A 1 2   ? -23.418 -5.517  -9.256  1.00 0.00 ? 2   MET A SD   2  
ATOM 2204  C CE   . MET A 1 2   ? -24.120 -5.475  -7.607  1.00 0.00 ? 2   MET A CE   2  
ATOM 2205  H H    . MET A 1 2   ? -19.006 -6.564  -9.396  1.00 0.00 ? 2   MET A H    2  
ATOM 2206  H HA   . MET A 1 2   ? -19.078 -4.777  -7.049  1.00 0.00 ? 2   MET A HA   2  
ATOM 2207  H HB2  . MET A 1 2   ? -21.543 -4.891  -7.143  1.00 0.00 ? 2   MET A HB2  2  
ATOM 2208  H HB3  . MET A 1 2   ? -20.859 -4.161  -8.586  1.00 0.00 ? 2   MET A HB3  2  
ATOM 2209  H HG2  . MET A 1 2   ? -21.210 -6.200  -9.833  1.00 0.00 ? 2   MET A HG2  2  
ATOM 2210  H HG3  . MET A 1 2   ? -21.787 -7.021  -8.385  1.00 0.00 ? 2   MET A HG3  2  
ATOM 2211  H HE1  . MET A 1 2   ? -24.073 -6.462  -7.169  1.00 0.00 ? 2   MET A HE1  2  
ATOM 2212  H HE2  . MET A 1 2   ? -25.151 -5.157  -7.663  1.00 0.00 ? 2   MET A HE2  2  
ATOM 2213  H HE3  . MET A 1 2   ? -23.562 -4.782  -6.994  1.00 0.00 ? 2   MET A HE3  2  
ATOM 2214  N N    . VAL A 1 3   ? -19.199 -6.675  -5.487  1.00 0.00 ? 3   VAL A N    2  
ATOM 2215  C CA   . VAL A 1 3   ? -19.264 -7.758  -4.511  1.00 0.00 ? 3   VAL A CA   2  
ATOM 2216  C C    . VAL A 1 3   ? -20.633 -7.778  -3.829  1.00 0.00 ? 3   VAL A C    2  
ATOM 2217  O O    . VAL A 1 3   ? -21.333 -6.762  -3.787  1.00 0.00 ? 3   VAL A O    2  
ATOM 2218  C CB   . VAL A 1 3   ? -18.159 -7.606  -3.432  1.00 0.00 ? 3   VAL A CB   2  
ATOM 2219  C CG1  . VAL A 1 3   ? -18.390 -6.346  -2.596  1.00 0.00 ? 3   VAL A CG1  2  
ATOM 2220  C CG2  . VAL A 1 3   ? -18.079 -8.848  -2.542  1.00 0.00 ? 3   VAL A CG2  2  
ATOM 2221  H H    . VAL A 1 3   ? -18.793 -5.821  -5.221  1.00 0.00 ? 3   VAL A H    2  
ATOM 2222  H HA   . VAL A 1 3   ? -19.112 -8.694  -5.031  1.00 0.00 ? 3   VAL A HA   2  
ATOM 2223  H HB   . VAL A 1 3   ? -17.207 -7.497  -3.938  1.00 0.00 ? 3   VAL A HB   2  
ATOM 2224  H HG11 . VAL A 1 3   ? -18.382 -5.479  -3.243  1.00 0.00 ? 3   VAL A HG11 2  
ATOM 2225  H HG12 . VAL A 1 3   ? -17.605 -6.251  -1.860  1.00 0.00 ? 3   VAL A HG12 2  
ATOM 2226  H HG13 . VAL A 1 3   ? -19.346 -6.412  -2.097  1.00 0.00 ? 3   VAL A HG13 2  
ATOM 2227  H HG21 . VAL A 1 3   ? -19.022 -8.991  -2.034  1.00 0.00 ? 3   VAL A HG21 2  
ATOM 2228  H HG22 . VAL A 1 3   ? -17.292 -8.720  -1.811  1.00 0.00 ? 3   VAL A HG22 2  
ATOM 2229  H HG23 . VAL A 1 3   ? -17.863 -9.714  -3.150  1.00 0.00 ? 3   VAL A HG23 2  
ATOM 2230  N N    . SER A 1 4   ? -21.018 -8.941  -3.313  1.00 0.00 ? 4   SER A N    2  
ATOM 2231  C CA   . SER A 1 4   ? -22.250 -9.078  -2.552  1.00 0.00 ? 4   SER A CA   2  
ATOM 2232  C C    . SER A 1 4   ? -22.156 -8.285  -1.241  1.00 0.00 ? 4   SER A C    2  
ATOM 2233  O O    . SER A 1 4   ? -21.133 -8.351  -0.550  1.00 0.00 ? 4   SER A O    2  
ATOM 2234  C CB   . SER A 1 4   ? -22.505 -10.561 -2.254  1.00 0.00 ? 4   SER A CB   2  
ATOM 2235  O OG   . SER A 1 4   ? -22.419 -11.341 -3.435  1.00 0.00 ? 4   SER A OG   2  
ATOM 2236  H H    . SER A 1 4   ? -20.458 -9.731  -3.456  1.00 0.00 ? 4   SER A H    2  
ATOM 2237  H HA   . SER A 1 4   ? -23.061 -8.689  -3.151  1.00 0.00 ? 4   SER A HA   2  
ATOM 2238  H HB2  . SER A 1 4   ? -21.768 -10.919 -1.549  1.00 0.00 ? 4   SER A HB2  2  
ATOM 2239  H HB3  . SER A 1 4   ? -23.493 -10.679 -1.832  1.00 0.00 ? 4   SER A HB3  2  
ATOM 2240  H HG   . SER A 1 4   ? -22.603 -12.263 -3.221  1.00 0.00 ? 4   SER A HG   2  
ATOM 2241  N N    . PRO A 1 5   ? -23.221 -7.532  -0.876  1.00 0.00 ? 5   PRO A N    2  
ATOM 2242  C CA   . PRO A 1 5   ? -23.251 -6.728  0.358   1.00 0.00 ? 5   PRO A CA   2  
ATOM 2243  C C    . PRO A 1 5   ? -22.810 -7.531  1.585   1.00 0.00 ? 5   PRO A C    2  
ATOM 2244  O O    . PRO A 1 5   ? -22.252 -6.980  2.538   1.00 0.00 ? 5   PRO A O    2  
ATOM 2245  C CB   . PRO A 1 5   ? -24.724 -6.318  0.476   1.00 0.00 ? 5   PRO A CB   2  
ATOM 2246  C CG   . PRO A 1 5   ? -25.217 -6.296  -0.931  1.00 0.00 ? 5   PRO A CG   2  
ATOM 2247  C CD   . PRO A 1 5   ? -24.479 -7.402  -1.643  1.00 0.00 ? 5   PRO A CD   2  
ATOM 2248  H HA   . PRO A 1 5   ? -22.633 -5.844  0.268   1.00 0.00 ? 5   PRO A HA   2  
ATOM 2249  H HB2  . PRO A 1 5   ? -25.262 -7.044  1.073   1.00 0.00 ? 5   PRO A HB2  2  
ATOM 2250  H HB3  . PRO A 1 5   ? -24.798 -5.343  0.936   1.00 0.00 ? 5   PRO A HB3  2  
ATOM 2251  H HG2  . PRO A 1 5   ? -26.283 -6.480  -0.951  1.00 0.00 ? 5   PRO A HG2  2  
ATOM 2252  H HG3  . PRO A 1 5   ? -24.993 -5.342  -1.385  1.00 0.00 ? 5   PRO A HG3  2  
ATOM 2253  H HD2  . PRO A 1 5   ? -25.048 -8.321  -1.606  1.00 0.00 ? 5   PRO A HD2  2  
ATOM 2254  H HD3  . PRO A 1 5   ? -24.278 -7.124  -2.668  1.00 0.00 ? 5   PRO A HD3  2  
ATOM 2255  N N    . GLU A 1 6   ? -23.064 -8.840  1.529   1.00 0.00 ? 6   GLU A N    2  
ATOM 2256  C CA   . GLU A 1 6   ? -22.673 -9.773  2.584   1.00 0.00 ? 6   GLU A CA   2  
ATOM 2257  C C    . GLU A 1 6   ? -21.183 -9.634  2.906   1.00 0.00 ? 6   GLU A C    2  
ATOM 2258  O O    . GLU A 1 6   ? -20.800 -9.302  4.031   1.00 0.00 ? 6   GLU A O    2  
ATOM 2259  C CB   . GLU A 1 6   ? -22.974 -11.211 2.132   1.00 0.00 ? 6   GLU A CB   2  
ATOM 2260  C CG   . GLU A 1 6   ? -24.419 -11.428 1.688   1.00 0.00 ? 6   GLU A CG   2  
ATOM 2261  C CD   . GLU A 1 6   ? -24.643 -12.786 1.041   1.00 0.00 ? 6   GLU A CD   2  
ATOM 2262  O OE1  . GLU A 1 6   ? -24.399 -12.913 -0.177  1.00 0.00 ? 6   GLU A OE1  2  
ATOM 2263  O OE2  . GLU A 1 6   ? -25.063 -13.732 1.744   1.00 0.00 ? 6   GLU A OE2  2  
ATOM 2264  H H    . GLU A 1 6   ? -23.537 -9.189  0.747   1.00 0.00 ? 6   GLU A H    2  
ATOM 2265  H HA   . GLU A 1 6   ? -23.253 -9.548  3.468   1.00 0.00 ? 6   GLU A HA   2  
ATOM 2266  H HB2  . GLU A 1 6   ? -22.325 -11.458 1.303   1.00 0.00 ? 6   GLU A HB2  2  
ATOM 2267  H HB3  . GLU A 1 6   ? -22.766 -11.887 2.952   1.00 0.00 ? 6   GLU A HB3  2  
ATOM 2268  H HG2  . GLU A 1 6   ? -25.063 -11.347 2.553   1.00 0.00 ? 6   GLU A HG2  2  
ATOM 2269  H HG3  . GLU A 1 6   ? -24.682 -10.657 0.977   1.00 0.00 ? 6   GLU A HG3  2  
ATOM 2270  N N    . GLU A 1 7   ? -20.342 -9.866  1.904   1.00 0.00 ? 7   GLU A N    2  
ATOM 2271  C CA   . GLU A 1 7   ? -18.901 -9.814  2.106   1.00 0.00 ? 7   GLU A CA   2  
ATOM 2272  C C    . GLU A 1 7   ? -18.404 -8.369  2.104   1.00 0.00 ? 7   GLU A C    2  
ATOM 2273  O O    . GLU A 1 7   ? -17.354 -8.069  2.674   1.00 0.00 ? 7   GLU A O    2  
ATOM 2274  C CB   . GLU A 1 7   ? -18.165 -10.653 1.054   1.00 0.00 ? 7   GLU A CB   2  
ATOM 2275  C CG   . GLU A 1 7   ? -16.646 -10.594 1.196   1.00 0.00 ? 7   GLU A CG   2  
ATOM 2276  C CD   . GLU A 1 7   ? -15.925 -11.747 0.525   1.00 0.00 ? 7   GLU A CD   2  
ATOM 2277  O OE1  . GLU A 1 7   ? -16.234 -12.056 -0.644  1.00 0.00 ? 7   GLU A OE1  2  
ATOM 2278  O OE2  . GLU A 1 7   ? -15.026 -12.333 1.162   1.00 0.00 ? 7   GLU A OE2  2  
ATOM 2279  H H    . GLU A 1 7   ? -20.696 -10.063 1.012   1.00 0.00 ? 7   GLU A H    2  
ATOM 2280  H HA   . GLU A 1 7   ? -18.699 -10.236 3.081   1.00 0.00 ? 7   GLU A HA   2  
ATOM 2281  H HB2  . GLU A 1 7   ? -18.479 -11.684 1.148   1.00 0.00 ? 7   GLU A HB2  2  
ATOM 2282  H HB3  . GLU A 1 7   ? -18.430 -10.295 0.068   1.00 0.00 ? 7   GLU A HB3  2  
ATOM 2283  H HG2  . GLU A 1 7   ? -16.295 -9.672  0.755   1.00 0.00 ? 7   GLU A HG2  2  
ATOM 2284  H HG3  . GLU A 1 7   ? -16.399 -10.597 2.250   1.00 0.00 ? 7   GLU A HG3  2  
ATOM 2285  N N    . ALA A 1 8   ? -19.172 -7.473  1.486   1.00 0.00 ? 8   ALA A N    2  
ATOM 2286  C CA   . ALA A 1 8   ? -18.833 -6.053  1.479   1.00 0.00 ? 8   ALA A CA   2  
ATOM 2287  C C    . ALA A 1 8   ? -18.700 -5.532  2.911   1.00 0.00 ? 8   ALA A C    2  
ATOM 2288  O O    . ALA A 1 8   ? -17.731 -4.849  3.248   1.00 0.00 ? 8   ALA A O    2  
ATOM 2289  C CB   . ALA A 1 8   ? -19.882 -5.257  0.709   1.00 0.00 ? 8   ALA A CB   2  
ATOM 2290  H H    . ALA A 1 8   ? -19.982 -7.775  1.021   1.00 0.00 ? 8   ALA A H    2  
ATOM 2291  H HA   . ALA A 1 8   ? -17.883 -5.939  0.973   1.00 0.00 ? 8   ALA A HA   2  
ATOM 2292  H HB1  . ALA A 1 8   ? -19.605 -4.212  0.693   1.00 0.00 ? 8   ALA A HB1  2  
ATOM 2293  H HB2  . ALA A 1 8   ? -20.843 -5.367  1.189   1.00 0.00 ? 8   ALA A HB2  2  
ATOM 2294  H HB3  . ALA A 1 8   ? -19.943 -5.628  -0.304  1.00 0.00 ? 8   ALA A HB3  2  
ATOM 2295  N N    . VAL A 1 9   ? -19.670 -5.880  3.758   1.00 0.00 ? 9   VAL A N    2  
ATOM 2296  C CA   . VAL A 1 9   ? -19.623 -5.496  5.168   1.00 0.00 ? 9   VAL A CA   2  
ATOM 2297  C C    . VAL A 1 9   ? -18.625 -6.373  5.926   1.00 0.00 ? 9   VAL A C    2  
ATOM 2298  O O    . VAL A 1 9   ? -18.024 -5.937  6.908   1.00 0.00 ? 9   VAL A O    2  
ATOM 2299  C CB   . VAL A 1 9   ? -21.018 -5.571  5.849   1.00 0.00 ? 9   VAL A CB   2  
ATOM 2300  C CG1  . VAL A 1 9   ? -22.006 -4.628  5.164   1.00 0.00 ? 9   VAL A CG1  2  
ATOM 2301  C CG2  . VAL A 1 9   ? -21.554 -7.002  5.861   1.00 0.00 ? 9   VAL A CG2  2  
ATOM 2302  H H    . VAL A 1 9   ? -20.431 -6.407  3.429   1.00 0.00 ? 9   VAL A H    2  
ATOM 2303  H HA   . VAL A 1 9   ? -19.280 -4.469  5.215   1.00 0.00 ? 9   VAL A HA   2  
ATOM 2304  H HB   . VAL A 1 9   ? -20.907 -5.246  6.875   1.00 0.00 ? 9   VAL A HB   2  
ATOM 2305  H HG11 . VAL A 1 9   ? -21.631 -3.614  5.211   1.00 0.00 ? 9   VAL A HG11 2  
ATOM 2306  H HG12 . VAL A 1 9   ? -22.962 -4.678  5.665   1.00 0.00 ? 9   VAL A HG12 2  
ATOM 2307  H HG13 . VAL A 1 9   ? -22.127 -4.918  4.130   1.00 0.00 ? 9   VAL A HG13 2  
ATOM 2308  H HG21 . VAL A 1 9   ? -20.866 -7.641  6.398   1.00 0.00 ? 9   VAL A HG21 2  
ATOM 2309  H HG22 . VAL A 1 9   ? -21.657 -7.359  4.846   1.00 0.00 ? 9   VAL A HG22 2  
ATOM 2310  H HG23 . VAL A 1 9   ? -22.518 -7.024  6.350   1.00 0.00 ? 9   VAL A HG23 2  
ATOM 2311  N N    . LYS A 1 10  ? -18.444 -7.608  5.454   1.00 0.00 ? 10  LYS A N    2  
ATOM 2312  C CA   . LYS A 1 10  ? -17.463 -8.522  6.044   1.00 0.00 ? 10  LYS A CA   2  
ATOM 2313  C C    . LYS A 1 10  ? -16.037 -7.992  5.847   1.00 0.00 ? 10  LYS A C    2  
ATOM 2314  O O    . LYS A 1 10  ? -15.146 -8.285  6.640   1.00 0.00 ? 10  LYS A O    2  
ATOM 2315  C CB   . LYS A 1 10  ? -17.611 -9.932  5.445   1.00 0.00 ? 10  LYS A CB   2  
ATOM 2316  C CG   . LYS A 1 10  ? -16.611 -10.965 5.973   1.00 0.00 ? 10  LYS A CG   2  
ATOM 2317  C CD   . LYS A 1 10  ? -16.612 -11.058 7.500   1.00 0.00 ? 10  LYS A CD   2  
ATOM 2318  C CE   . LYS A 1 10  ? -17.979 -11.435 8.059   1.00 0.00 ? 10  LYS A CE   2  
ATOM 2319  N NZ   . LYS A 1 10  ? -17.991 -11.430 9.546   1.00 0.00 ? 10  LYS A NZ   2  
ATOM 2320  H H    . LYS A 1 10  ? -18.996 -7.920  4.704   1.00 0.00 ? 10  LYS A H    2  
ATOM 2321  H HA   . LYS A 1 10  ? -17.665 -8.572  7.106   1.00 0.00 ? 10  LYS A HA   2  
ATOM 2322  H HB2  . LYS A 1 10  ? -18.608 -10.293 5.655   1.00 0.00 ? 10  LYS A HB2  2  
ATOM 2323  H HB3  . LYS A 1 10  ? -17.487 -9.865  4.372   1.00 0.00 ? 10  LYS A HB3  2  
ATOM 2324  H HG2  . LYS A 1 10  ? -16.864 -11.934 5.568   1.00 0.00 ? 10  LYS A HG2  2  
ATOM 2325  H HG3  . LYS A 1 10  ? -15.619 -10.688 5.641   1.00 0.00 ? 10  LYS A HG3  2  
ATOM 2326  H HD2  . LYS A 1 10  ? -15.896 -11.807 7.803   1.00 0.00 ? 10  LYS A HD2  2  
ATOM 2327  H HD3  . LYS A 1 10  ? -16.321 -10.099 7.907   1.00 0.00 ? 10  LYS A HD3  2  
ATOM 2328  H HE2  . LYS A 1 10  ? -18.712 -10.726 7.702   1.00 0.00 ? 10  LYS A HE2  2  
ATOM 2329  H HE3  . LYS A 1 10  ? -18.239 -12.425 7.710   1.00 0.00 ? 10  LYS A HE3  2  
ATOM 2330  H HZ1  . LYS A 1 10  ? -17.631 -10.520 9.905   1.00 0.00 ? 10  LYS A HZ1  2  
ATOM 2331  H HZ2  . LYS A 1 10  ? -17.392 -12.194 9.914   1.00 0.00 ? 10  LYS A HZ2  2  
ATOM 2332  H HZ3  . LYS A 1 10  ? -18.961 -11.567 9.897   1.00 0.00 ? 10  LYS A HZ3  2  
ATOM 2333  N N    . TRP A 1 11  ? -15.827 -7.213  4.788   1.00 0.00 ? 11  TRP A N    2  
ATOM 2334  C CA   . TRP A 1 11  ? -14.530 -6.572  4.555   1.00 0.00 ? 11  TRP A CA   2  
ATOM 2335  C C    . TRP A 1 11  ? -14.237 -5.543  5.641   1.00 0.00 ? 11  TRP A C    2  
ATOM 2336  O O    . TRP A 1 11  ? -13.081 -5.290  5.969   1.00 0.00 ? 11  TRP A O    2  
ATOM 2337  C CB   . TRP A 1 11  ? -14.487 -5.883  3.182   1.00 0.00 ? 11  TRP A CB   2  
ATOM 2338  C CG   . TRP A 1 11  ? -14.413 -6.824  2.017   1.00 0.00 ? 11  TRP A CG   2  
ATOM 2339  C CD1  . TRP A 1 11  ? -14.061 -8.143  2.037   1.00 0.00 ? 11  TRP A CD1  2  
ATOM 2340  C CD2  . TRP A 1 11  ? -14.671 -6.497  0.649   1.00 0.00 ? 11  TRP A CD2  2  
ATOM 2341  N NE1  . TRP A 1 11  ? -14.092 -8.657  0.765   1.00 0.00 ? 11  TRP A NE1  2  
ATOM 2342  C CE2  . TRP A 1 11  ? -14.466 -7.664  -0.106  1.00 0.00 ? 11  TRP A CE2  2  
ATOM 2343  C CE3  . TRP A 1 11  ? -15.062 -5.327  -0.007  1.00 0.00 ? 11  TRP A CE3  2  
ATOM 2344  C CZ2  . TRP A 1 11  ? -14.635 -7.692  -1.486  1.00 0.00 ? 11  TRP A CZ2  2  
ATOM 2345  C CZ3  . TRP A 1 11  ? -15.229 -5.357  -1.376  1.00 0.00 ? 11  TRP A CZ3  2  
ATOM 2346  C CH2  . TRP A 1 11  ? -15.017 -6.533  -2.104  1.00 0.00 ? 11  TRP A CH2  2  
ATOM 2347  H H    . TRP A 1 11  ? -16.555 -7.068  4.146   1.00 0.00 ? 11  TRP A H    2  
ATOM 2348  H HA   . TRP A 1 11  ? -13.769 -7.340  4.589   1.00 0.00 ? 11  TRP A HA   2  
ATOM 2349  H HB2  . TRP A 1 11  ? -15.377 -5.283  3.061   1.00 0.00 ? 11  TRP A HB2  2  
ATOM 2350  H HB3  . TRP A 1 11  ? -13.621 -5.237  3.139   1.00 0.00 ? 11  TRP A HB3  2  
ATOM 2351  H HD1  . TRP A 1 11  ? -13.802 -8.690  2.932   1.00 0.00 ? 11  TRP A HD1  2  
ATOM 2352  H HE1  . TRP A 1 11  ? -13.883 -9.585  0.521   1.00 0.00 ? 11  TRP A HE1  2  
ATOM 2353  H HE3  . TRP A 1 11  ? -15.229 -4.411  0.539   1.00 0.00 ? 11  TRP A HE3  2  
ATOM 2354  H HZ2  . TRP A 1 11  ? -14.476 -8.591  -2.063  1.00 0.00 ? 11  TRP A HZ2  2  
ATOM 2355  H HZ3  . TRP A 1 11  ? -15.530 -4.461  -1.900  1.00 0.00 ? 11  TRP A HZ3  2  
ATOM 2356  H HH2  . TRP A 1 11  ? -15.161 -6.510  -3.175  1.00 0.00 ? 11  TRP A HH2  2  
ATOM 2357  N N    . GLY A 1 12  ? -15.302 -4.989  6.214   1.00 0.00 ? 12  GLY A N    2  
ATOM 2358  C CA   . GLY A 1 12  ? -15.181 -3.888  7.157   1.00 0.00 ? 12  GLY A CA   2  
ATOM 2359  C C    . GLY A 1 12  ? -14.393 -4.226  8.412   1.00 0.00 ? 12  GLY A C    2  
ATOM 2360  O O    . GLY A 1 12  ? -14.025 -3.327  9.169   1.00 0.00 ? 12  GLY A O    2  
ATOM 2361  H H    . GLY A 1 12  ? -16.190 -5.337  5.996   1.00 0.00 ? 12  GLY A H    2  
ATOM 2362  H HA2  . GLY A 1 12  ? -14.697 -3.060  6.661   1.00 0.00 ? 12  GLY A HA2  2  
ATOM 2363  H HA3  . GLY A 1 12  ? -16.176 -3.579  7.447   1.00 0.00 ? 12  GLY A HA3  2  
ATOM 2364  N N    . GLU A 1 13  ? -14.129 -5.509  8.641   1.00 0.00 ? 13  GLU A N    2  
ATOM 2365  C CA   . GLU A 1 13  ? -13.403 -5.939  9.837   1.00 0.00 ? 13  GLU A CA   2  
ATOM 2366  C C    . GLU A 1 13  ? -11.954 -6.318  9.520   1.00 0.00 ? 13  GLU A C    2  
ATOM 2367  O O    . GLU A 1 13  ? -11.124 -6.420  10.429  1.00 0.00 ? 13  GLU A O    2  
ATOM 2368  C CB   . GLU A 1 13  ? -14.121 -7.125  10.494  1.00 0.00 ? 13  GLU A CB   2  
ATOM 2369  C CG   . GLU A 1 13  ? -14.281 -8.332  9.578   1.00 0.00 ? 13  GLU A CG   2  
ATOM 2370  C CD   . GLU A 1 13  ? -15.022 -9.481  10.238  1.00 0.00 ? 13  GLU A CD   2  
ATOM 2371  O OE1  . GLU A 1 13  ? -16.265 -9.411  10.348  1.00 0.00 ? 13  GLU A OE1  2  
ATOM 2372  O OE2  . GLU A 1 13  ? -14.367 -10.467 10.645  1.00 0.00 ? 13  GLU A OE2  2  
ATOM 2373  H H    . GLU A 1 13  ? -14.431 -6.181  7.997   1.00 0.00 ? 13  GLU A H    2  
ATOM 2374  H HA   . GLU A 1 13  ? -13.393 -5.112  10.535  1.00 0.00 ? 13  GLU A HA   2  
ATOM 2375  H HB2  . GLU A 1 13  ? -13.561 -7.431  11.368  1.00 0.00 ? 13  GLU A HB2  2  
ATOM 2376  H HB3  . GLU A 1 13  ? -15.105 -6.805  10.807  1.00 0.00 ? 13  GLU A HB3  2  
ATOM 2377  H HG2  . GLU A 1 13  ? -14.831 -8.028  8.699   1.00 0.00 ? 13  GLU A HG2  2  
ATOM 2378  H HG3  . GLU A 1 13  ? -13.299 -8.675  9.282   1.00 0.00 ? 13  GLU A HG3  2  
ATOM 2379  N N    . SER A 1 14  ? -11.635 -6.508  8.240   1.00 0.00 ? 14  SER A N    2  
ATOM 2380  C CA   . SER A 1 14  ? -10.317 -7.011  7.857   1.00 0.00 ? 14  SER A CA   2  
ATOM 2381  C C    . SER A 1 14  ? -9.832  -6.398  6.537   1.00 0.00 ? 14  SER A C    2  
ATOM 2382  O O    . SER A 1 14  ? -10.159 -6.888  5.449   1.00 0.00 ? 14  SER A O    2  
ATOM 2383  C CB   . SER A 1 14  ? -10.347 -8.543  7.753   1.00 0.00 ? 14  SER A CB   2  
ATOM 2384  O OG   . SER A 1 14  ? -10.846 -9.133  8.944   1.00 0.00 ? 14  SER A OG   2  
ATOM 2385  H H    . SER A 1 14  ? -12.287 -6.285  7.542   1.00 0.00 ? 14  SER A H    2  
ATOM 2386  H HA   . SER A 1 14  ? -9.620  -6.735  8.637   1.00 0.00 ? 14  SER A HA   2  
ATOM 2387  H HB2  . SER A 1 14  ? -10.984 -8.836  6.932   1.00 0.00 ? 14  SER A HB2  2  
ATOM 2388  H HB3  . SER A 1 14  ? -9.346  -8.911  7.579   1.00 0.00 ? 14  SER A HB3  2  
ATOM 2389  H HG   . SER A 1 14  ? -10.433 -8.706  9.710   1.00 0.00 ? 14  SER A HG   2  
ATOM 2390  N N    . PHE A 1 15  ? -9.043  -5.329  6.646   1.00 0.00 ? 15  PHE A N    2  
ATOM 2391  C CA   . PHE A 1 15  ? -8.413  -4.692  5.484   1.00 0.00 ? 15  PHE A CA   2  
ATOM 2392  C C    . PHE A 1 15  ? -7.608  -5.728  4.695   1.00 0.00 ? 15  PHE A C    2  
ATOM 2393  O O    . PHE A 1 15  ? -7.509  -5.665  3.466   1.00 0.00 ? 15  PHE A O    2  
ATOM 2394  C CB   . PHE A 1 15  ? -7.512  -3.541  5.965   1.00 0.00 ? 15  PHE A CB   2  
ATOM 2395  C CG   . PHE A 1 15  ? -6.876  -2.714  4.868   1.00 0.00 ? 15  PHE A CG   2  
ATOM 2396  C CD1  . PHE A 1 15  ? -7.613  -2.295  3.771   1.00 0.00 ? 15  PHE A CD1  2  
ATOM 2397  C CD2  . PHE A 1 15  ? -5.544  -2.335  4.953   1.00 0.00 ? 15  PHE A CD2  2  
ATOM 2398  C CE1  . PHE A 1 15  ? -7.035  -1.518  2.785   1.00 0.00 ? 15  PHE A CE1  2  
ATOM 2399  C CE2  . PHE A 1 15  ? -4.962  -1.562  3.967   1.00 0.00 ? 15  PHE A CE2  2  
ATOM 2400  C CZ   . PHE A 1 15  ? -5.710  -1.153  2.884   1.00 0.00 ? 15  PHE A CZ   2  
ATOM 2401  H H    . PHE A 1 15  ? -8.883  -4.949  7.537   1.00 0.00 ? 15  PHE A H    2  
ATOM 2402  H HA   . PHE A 1 15  ? -9.196  -4.295  4.853   1.00 0.00 ? 15  PHE A HA   2  
ATOM 2403  H HB2  . PHE A 1 15  ? -8.100  -2.871  6.574   1.00 0.00 ? 15  PHE A HB2  2  
ATOM 2404  H HB3  . PHE A 1 15  ? -6.716  -3.954  6.570   1.00 0.00 ? 15  PHE A HB3  2  
ATOM 2405  H HD1  . PHE A 1 15  ? -8.653  -2.580  3.688   1.00 0.00 ? 15  PHE A HD1  2  
ATOM 2406  H HD2  . PHE A 1 15  ? -4.955  -2.654  5.800   1.00 0.00 ? 15  PHE A HD2  2  
ATOM 2407  H HE1  . PHE A 1 15  ? -7.621  -1.200  1.935   1.00 0.00 ? 15  PHE A HE1  2  
ATOM 2408  H HE2  . PHE A 1 15  ? -3.923  -1.278  4.044   1.00 0.00 ? 15  PHE A HE2  2  
ATOM 2409  H HZ   . PHE A 1 15  ? -5.258  -0.543  2.115   1.00 0.00 ? 15  PHE A HZ   2  
ATOM 2410  N N    . ASP A 1 16  ? -7.061  -6.699  5.422   1.00 0.00 ? 16  ASP A N    2  
ATOM 2411  C CA   . ASP A 1 16  ? -6.315  -7.807  4.823   1.00 0.00 ? 16  ASP A CA   2  
ATOM 2412  C C    . ASP A 1 16  ? -7.167  -8.569  3.805   1.00 0.00 ? 16  ASP A C    2  
ATOM 2413  O O    . ASP A 1 16  ? -6.739  -8.787  2.670   1.00 0.00 ? 16  ASP A O    2  
ATOM 2414  C CB   . ASP A 1 16  ? -5.822  -8.769  5.913   1.00 0.00 ? 16  ASP A CB   2  
ATOM 2415  C CG   . ASP A 1 16  ? -5.234  -10.057 5.346   1.00 0.00 ? 16  ASP A CG   2  
ATOM 2416  O OD1  . ASP A 1 16  ? -4.111  -10.025 4.799   1.00 0.00 ? 16  ASP A OD1  2  
ATOM 2417  O OD2  . ASP A 1 16  ? -5.893  -11.118 5.452   1.00 0.00 ? 16  ASP A OD2  2  
ATOM 2418  H H    . ASP A 1 16  ? -7.149  -6.661  6.397   1.00 0.00 ? 16  ASP A H    2  
ATOM 2419  H HA   . ASP A 1 16  ? -5.458  -7.387  4.316   1.00 0.00 ? 16  ASP A HA   2  
ATOM 2420  H HB2  . ASP A 1 16  ? -5.059  -8.277  6.500   1.00 0.00 ? 16  ASP A HB2  2  
ATOM 2421  H HB3  . ASP A 1 16  ? -6.652  -9.025  6.559   1.00 0.00 ? 16  ASP A HB3  2  
ATOM 2422  N N    . LYS A 1 17  ? -8.383  -8.960  4.204   1.00 0.00 ? 17  LYS A N    2  
ATOM 2423  C CA   . LYS A 1 17  ? -9.234  -9.772  3.331   1.00 0.00 ? 17  LYS A CA   2  
ATOM 2424  C C    . LYS A 1 17  ? -9.721  -8.938  2.152   1.00 0.00 ? 17  LYS A C    2  
ATOM 2425  O O    . LYS A 1 17  ? -10.081 -9.482  1.105   1.00 0.00 ? 17  LYS A O    2  
ATOM 2426  C CB   . LYS A 1 17  ? -10.427 -10.382 4.094   1.00 0.00 ? 17  LYS A CB   2  
ATOM 2427  C CG   . LYS A 1 17  ? -11.579 -9.414  4.364   1.00 0.00 ? 17  LYS A CG   2  
ATOM 2428  C CD   . LYS A 1 17  ? -12.646 -10.026 5.272   1.00 0.00 ? 17  LYS A CD   2  
ATOM 2429  C CE   . LYS A 1 17  ? -13.186 -11.348 4.733   1.00 0.00 ? 17  LYS A CE   2  
ATOM 2430  N NZ   . LYS A 1 17  ? -13.877 -11.196 3.421   1.00 0.00 ? 17  LYS A NZ   2  
ATOM 2431  H H    . LYS A 1 17  ? -8.712  -8.689  5.085   1.00 0.00 ? 17  LYS A H    2  
ATOM 2432  H HA   . LYS A 1 17  ? -8.623  -10.578 2.946   1.00 0.00 ? 17  LYS A HA   2  
ATOM 2433  H HB2  . LYS A 1 17  ? -10.816 -11.209 3.516   1.00 0.00 ? 17  LYS A HB2  2  
ATOM 2434  H HB3  . LYS A 1 17  ? -10.074 -10.760 5.040   1.00 0.00 ? 17  LYS A HB3  2  
ATOM 2435  H HG2  . LYS A 1 17  ? -11.187 -8.527  4.838   1.00 0.00 ? 17  LYS A HG2  2  
ATOM 2436  H HG3  . LYS A 1 17  ? -12.035 -9.144  3.422   1.00 0.00 ? 17  LYS A HG3  2  
ATOM 2437  H HD2  . LYS A 1 17  ? -12.214 -10.201 6.247   1.00 0.00 ? 17  LYS A HD2  2  
ATOM 2438  H HD3  . LYS A 1 17  ? -13.465 -9.326  5.366   1.00 0.00 ? 17  LYS A HD3  2  
ATOM 2439  H HE2  . LYS A 1 17  ? -12.365 -12.039 4.615   1.00 0.00 ? 17  LYS A HE2  2  
ATOM 2440  H HE3  . LYS A 1 17  ? -13.887 -11.752 5.450   1.00 0.00 ? 17  LYS A HE3  2  
ATOM 2441  H HZ1  . LYS A 1 17  ? -14.234 -12.122 3.092   1.00 0.00 ? 17  LYS A HZ1  2  
ATOM 2442  H HZ2  . LYS A 1 17  ? -13.219 -10.826 2.710   1.00 0.00 ? 17  LYS A HZ2  2  
ATOM 2443  H HZ3  . LYS A 1 17  ? -14.677 -10.542 3.508   1.00 0.00 ? 17  LYS A HZ3  2  
ATOM 2444  N N    . LEU A 1 18  ? -9.729  -7.616  2.331   1.00 0.00 ? 18  LEU A N    2  
ATOM 2445  C CA   . LEU A 1 18  ? -10.067 -6.695  1.250   1.00 0.00 ? 18  LEU A CA   2  
ATOM 2446  C C    . LEU A 1 18  ? -9.093  -6.879  0.085   1.00 0.00 ? 18  LEU A C    2  
ATOM 2447  O O    . LEU A 1 18  ? -9.508  -7.134  -1.045  1.00 0.00 ? 18  LEU A O    2  
ATOM 2448  C CB   . LEU A 1 18  ? -10.036 -5.241  1.752   1.00 0.00 ? 18  LEU A CB   2  
ATOM 2449  C CG   . LEU A 1 18  ? -10.336 -4.167  0.690   1.00 0.00 ? 18  LEU A CG   2  
ATOM 2450  C CD1  . LEU A 1 18  ? -11.730 -4.362  0.100   1.00 0.00 ? 18  LEU A CD1  2  
ATOM 2451  C CD2  . LEU A 1 18  ? -10.191 -2.767  1.282   1.00 0.00 ? 18  LEU A CD2  2  
ATOM 2452  H H    . LEU A 1 18  ? -9.505  -7.252  3.219   1.00 0.00 ? 18  LEU A H    2  
ATOM 2453  H HA   . LEU A 1 18  ? -11.067 -6.932  0.914   1.00 0.00 ? 18  LEU A HA   2  
ATOM 2454  H HB2  . LEU A 1 18  ? -10.759 -5.144  2.550   1.00 0.00 ? 18  LEU A HB2  2  
ATOM 2455  H HB3  . LEU A 1 18  ? -9.052  -5.046  2.158   1.00 0.00 ? 18  LEU A HB3  2  
ATOM 2456  H HG   . LEU A 1 18  ? -9.623  -4.261  -0.117  1.00 0.00 ? 18  LEU A HG   2  
ATOM 2457  H HD11 . LEU A 1 18  ? -12.470 -4.288  0.884   1.00 0.00 ? 18  LEU A HD11 2  
ATOM 2458  H HD12 . LEU A 1 18  ? -11.794 -5.335  -0.363  1.00 0.00 ? 18  LEU A HD12 2  
ATOM 2459  H HD13 . LEU A 1 18  ? -11.916 -3.599  -0.644  1.00 0.00 ? 18  LEU A HD13 2  
ATOM 2460  H HD21 . LEU A 1 18  ? -10.883 -2.647  2.105   1.00 0.00 ? 18  LEU A HD21 2  
ATOM 2461  H HD22 . LEU A 1 18  ? -10.406 -2.029  0.522   1.00 0.00 ? 18  LEU A HD22 2  
ATOM 2462  H HD23 . LEU A 1 18  ? -9.181  -2.629  1.638   1.00 0.00 ? 18  LEU A HD23 2  
ATOM 2463  N N    . LEU A 1 19  ? -7.794  -6.771  0.378   1.00 0.00 ? 19  LEU A N    2  
ATOM 2464  C CA   . LEU A 1 19  ? -6.754  -6.972  -0.638  1.00 0.00 ? 19  LEU A CA   2  
ATOM 2465  C C    . LEU A 1 19  ? -6.702  -8.436  -1.074  1.00 0.00 ? 19  LEU A C    2  
ATOM 2466  O O    . LEU A 1 19  ? -6.440  -8.739  -2.238  1.00 0.00 ? 19  LEU A O    2  
ATOM 2467  C CB   . LEU A 1 19  ? -5.370  -6.530  -0.119  1.00 0.00 ? 19  LEU A CB   2  
ATOM 2468  C CG   . LEU A 1 19  ? -5.136  -5.007  -0.027  1.00 0.00 ? 19  LEU A CG   2  
ATOM 2469  C CD1  . LEU A 1 19  ? -5.349  -4.339  -1.385  1.00 0.00 ? 19  LEU A CD1  2  
ATOM 2470  C CD2  . LEU A 1 19  ? -6.025  -4.374  1.040   1.00 0.00 ? 19  LEU A CD2  2  
ATOM 2471  H H    . LEU A 1 19  ? -7.527  -6.550  1.299   1.00 0.00 ? 19  LEU A H    2  
ATOM 2472  H HA   . LEU A 1 19  ? -7.013  -6.369  -1.497  1.00 0.00 ? 19  LEU A HA   2  
ATOM 2473  H HB2  . LEU A 1 19  ? -5.232  -6.952  0.867   1.00 0.00 ? 19  LEU A HB2  2  
ATOM 2474  H HB3  . LEU A 1 19  ? -4.616  -6.944  -0.773  1.00 0.00 ? 19  LEU A HB3  2  
ATOM 2475  H HG   . LEU A 1 19  ? -4.107  -4.834  0.258   1.00 0.00 ? 19  LEU A HG   2  
ATOM 2476  H HD11 . LEU A 1 19  ? -4.670  -4.766  -2.107  1.00 0.00 ? 19  LEU A HD11 2  
ATOM 2477  H HD12 . LEU A 1 19  ? -5.159  -3.278  -1.299  1.00 0.00 ? 19  LEU A HD12 2  
ATOM 2478  H HD13 . LEU A 1 19  ? -6.366  -4.495  -1.713  1.00 0.00 ? 19  LEU A HD13 2  
ATOM 2479  H HD21 . LEU A 1 19  ? -5.808  -4.819  2.000   1.00 0.00 ? 19  LEU A HD21 2  
ATOM 2480  H HD22 . LEU A 1 19  ? -7.064  -4.539  0.794   1.00 0.00 ? 19  LEU A HD22 2  
ATOM 2481  H HD23 . LEU A 1 19  ? -5.832  -3.312  1.086   1.00 0.00 ? 19  LEU A HD23 2  
ATOM 2482  N N    . SER A 1 20  ? -6.959  -9.337  -0.131  1.00 0.00 ? 20  SER A N    2  
ATOM 2483  C CA   . SER A 1 20  ? -6.958  -10.772 -0.407  1.00 0.00 ? 20  SER A CA   2  
ATOM 2484  C C    . SER A 1 20  ? -8.076  -11.130 -1.391  1.00 0.00 ? 20  SER A C    2  
ATOM 2485  O O    . SER A 1 20  ? -7.994  -12.133 -2.107  1.00 0.00 ? 20  SER A O    2  
ATOM 2486  C CB   . SER A 1 20  ? -7.116  -11.558 0.903   1.00 0.00 ? 20  SER A CB   2  
ATOM 2487  O OG   . SER A 1 20  ? -6.978  -12.953 0.694   1.00 0.00 ? 20  SER A OG   2  
ATOM 2488  H H    . SER A 1 20  ? -7.147  -9.029  0.780   1.00 0.00 ? 20  SER A H    2  
ATOM 2489  H HA   . SER A 1 20  ? -6.006  -11.023 -0.854  1.00 0.00 ? 20  SER A HA   2  
ATOM 2490  H HB2  . SER A 1 20  ? -6.359  -11.239 1.605   1.00 0.00 ? 20  SER A HB2  2  
ATOM 2491  H HB3  . SER A 1 20  ? -8.094  -11.364 1.322   1.00 0.00 ? 20  SER A HB3  2  
ATOM 2492  H HG   . SER A 1 20  ? -6.109  -13.131 0.306   1.00 0.00 ? 20  SER A HG   2  
ATOM 2493  N N    . HIS A 1 21  ? -9.118  -10.302 -1.422  1.00 0.00 ? 21  HIS A N    2  
ATOM 2494  C CA   . HIS A 1 21  ? -10.231 -10.491 -2.348  1.00 0.00 ? 21  HIS A CA   2  
ATOM 2495  C C    . HIS A 1 21  ? -9.916  -9.765  -3.647  1.00 0.00 ? 21  HIS A C    2  
ATOM 2496  O O    . HIS A 1 21  ? -9.838  -8.544  -3.652  1.00 0.00 ? 21  HIS A O    2  
ATOM 2497  C CB   . HIS A 1 21  ? -11.531 -9.933  -1.742  1.00 0.00 ? 21  HIS A CB   2  
ATOM 2498  C CG   . HIS A 1 21  ? -12.783 -10.539 -2.303  1.00 0.00 ? 21  HIS A CG   2  
ATOM 2499  N ND1  . HIS A 1 21  ? -13.492 -9.999  -3.356  1.00 0.00 ? 21  HIS A ND1  2  
ATOM 2500  C CD2  . HIS A 1 21  ? -13.467 -11.643 -1.924  1.00 0.00 ? 21  HIS A CD2  2  
ATOM 2501  C CE1  . HIS A 1 21  ? -14.554 -10.747 -3.595  1.00 0.00 ? 21  HIS A CE1  2  
ATOM 2502  N NE2  . HIS A 1 21  ? -14.562 -11.750 -2.741  1.00 0.00 ? 21  HIS A NE2  2  
ATOM 2503  H H    . HIS A 1 21  ? -9.131  -9.533  -0.815  1.00 0.00 ? 21  HIS A H    2  
ATOM 2504  H HA   . HIS A 1 21  ? -10.344 -11.549 -2.541  1.00 0.00 ? 21  HIS A HA   2  
ATOM 2505  H HB2  . HIS A 1 21  ? -11.531 -10.114 -0.678  1.00 0.00 ? 21  HIS A HB2  2  
ATOM 2506  H HB3  . HIS A 1 21  ? -11.574 -8.865  -1.912  1.00 0.00 ? 21  HIS A HB3  2  
ATOM 2507  H HD1  . HIS A 1 21  ? -13.262 -9.187  -3.849  1.00 0.00 ? 21  HIS A HD1  2  
ATOM 2508  H HD2  . HIS A 1 21  ? -13.207 -12.306 -1.107  1.00 0.00 ? 21  HIS A HD2  2  
ATOM 2509  H HE1  . HIS A 1 21  ? -15.292 -10.566 -4.362  1.00 0.00 ? 21  HIS A HE1  2  
ATOM 2510  H HE2  . HIS A 1 21  ? -15.349 -12.309 -2.549  1.00 0.00 ? 21  HIS A HE2  2  
ATOM 2511  N N    . ARG A 1 22  ? -9.732  -10.507 -4.735  1.00 0.00 ? 22  ARG A N    2  
ATOM 2512  C CA   . ARG A 1 22  ? -9.348  -9.914  -6.024  1.00 0.00 ? 22  ARG A CA   2  
ATOM 2513  C C    . ARG A 1 22  ? -10.211 -8.693  -6.363  1.00 0.00 ? 22  ARG A C    2  
ATOM 2514  O O    . ARG A 1 22  ? -9.696  -7.650  -6.769  1.00 0.00 ? 22  ARG A O    2  
ATOM 2515  C CB   . ARG A 1 22  ? -9.445  -10.960 -7.147  1.00 0.00 ? 22  ARG A CB   2  
ATOM 2516  C CG   . ARG A 1 22  ? -10.821 -11.613 -7.267  1.00 0.00 ? 22  ARG A CG   2  
ATOM 2517  C CD   . ARG A 1 22  ? -10.898 -12.583 -8.438  1.00 0.00 ? 22  ARG A CD   2  
ATOM 2518  N NE   . ARG A 1 22  ? -10.689 -11.910 -9.721  1.00 0.00 ? 22  ARG A NE   2  
ATOM 2519  C CZ   . ARG A 1 22  ? -11.260 -12.280 -10.866 1.00 0.00 ? 22  ARG A CZ   2  
ATOM 2520  N NH1  . ARG A 1 22  ? -12.081 -13.327 -10.896 1.00 0.00 ? 22  ARG A NH1  2  
ATOM 2521  N NH2  . ARG A 1 22  ? -11.003 -11.606 -11.979 1.00 0.00 ? 22  ARG A NH2  2  
ATOM 2522  H H    . ARG A 1 22  ? -9.853  -11.481 -4.673  1.00 0.00 ? 22  ARG A H    2  
ATOM 2523  H HA   . ARG A 1 22  ? -8.318  -9.591  -5.940  1.00 0.00 ? 22  ARG A HA   2  
ATOM 2524  H HB2  . ARG A 1 22  ? -9.212  -10.483 -8.088  1.00 0.00 ? 22  ARG A HB2  2  
ATOM 2525  H HB3  . ARG A 1 22  ? -8.717  -11.738 -6.960  1.00 0.00 ? 22  ARG A HB3  2  
ATOM 2526  H HG2  . ARG A 1 22  ? -11.033 -12.152 -6.356  1.00 0.00 ? 22  ARG A HG2  2  
ATOM 2527  H HG3  . ARG A 1 22  ? -11.564 -10.838 -7.405  1.00 0.00 ? 22  ARG A HG3  2  
ATOM 2528  H HD2  . ARG A 1 22  ? -10.139 -13.342 -8.314  1.00 0.00 ? 22  ARG A HD2  2  
ATOM 2529  H HD3  . ARG A 1 22  ? -11.875 -13.048 -8.440  1.00 0.00 ? 22  ARG A HD3  2  
ATOM 2530  H HE   . ARG A 1 22  ? -10.085 -11.134 -9.727  1.00 0.00 ? 22  ARG A HE   2  
ATOM 2531  H HH11 . ARG A 1 22  ? -12.274 -13.844 -10.056 1.00 0.00 ? 22  ARG A HH11 2  
ATOM 2532  H HH12 . ARG A 1 22  ? -12.512 -13.606 -11.758 1.00 0.00 ? 22  ARG A HH12 2  
ATOM 2533  H HH21 . ARG A 1 22  ? -10.376 -10.820 -11.959 1.00 0.00 ? 22  ARG A HH21 2  
ATOM 2534  H HH22 . ARG A 1 22  ? -11.436 -11.873 -12.845 1.00 0.00 ? 22  ARG A HH22 2  
ATOM 2535  N N    . ASP A 1 23  ? -11.523 -8.827  -6.171  1.00 0.00 ? 23  ASP A N    2  
ATOM 2536  C CA   . ASP A 1 23  ? -12.462 -7.737  -6.450  1.00 0.00 ? 23  ASP A CA   2  
ATOM 2537  C C    . ASP A 1 23  ? -12.264 -6.579  -5.475  1.00 0.00 ? 23  ASP A C    2  
ATOM 2538  O O    . ASP A 1 23  ? -12.405 -5.413  -5.842  1.00 0.00 ? 23  ASP A O    2  
ATOM 2539  C CB   . ASP A 1 23  ? -13.906 -8.243  -6.373  1.00 0.00 ? 23  ASP A CB   2  
ATOM 2540  C CG   . ASP A 1 23  ? -14.922 -7.164  -6.713  1.00 0.00 ? 23  ASP A CG   2  
ATOM 2541  O OD1  . ASP A 1 23  ? -15.037 -6.813  -7.909  1.00 0.00 ? 23  ASP A OD1  2  
ATOM 2542  O OD2  . ASP A 1 23  ? -15.600 -6.667  -5.793  1.00 0.00 ? 23  ASP A OD2  2  
ATOM 2543  H H    . ASP A 1 23  ? -11.871 -9.684  -5.850  1.00 0.00 ? 23  ASP A H    2  
ATOM 2544  H HA   . ASP A 1 23  ? -12.268 -7.383  -7.454  1.00 0.00 ? 23  ASP A HA   2  
ATOM 2545  H HB2  . ASP A 1 23  ? -14.032 -9.061  -7.069  1.00 0.00 ? 23  ASP A HB2  2  
ATOM 2546  H HB3  . ASP A 1 23  ? -14.104 -8.601  -5.371  1.00 0.00 ? 23  ASP A HB3  2  
ATOM 2547  N N    . GLY A 1 24  ? -11.911 -6.910  -4.235  1.00 0.00 ? 24  GLY A N    2  
ATOM 2548  C CA   . GLY A 1 24  ? -11.712 -5.892  -3.218  1.00 0.00 ? 24  GLY A CA   2  
ATOM 2549  C C    . GLY A 1 24  ? -10.440 -5.112  -3.460  1.00 0.00 ? 24  GLY A C    2  
ATOM 2550  O O    . GLY A 1 24  ? -10.404 -3.891  -3.310  1.00 0.00 ? 24  GLY A O    2  
ATOM 2551  H H    . GLY A 1 24  ? -11.750 -7.847  -4.020  1.00 0.00 ? 24  GLY A H    2  
ATOM 2552  H HA2  . GLY A 1 24  ? -12.554 -5.214  -3.226  1.00 0.00 ? 24  GLY A HA2  2  
ATOM 2553  H HA3  . GLY A 1 24  ? -11.653 -6.369  -2.250  1.00 0.00 ? 24  GLY A HA3  2  
ATOM 2554  N N    . LEU A 1 25  ? -9.394  -5.836  -3.836  1.00 0.00 ? 25  LEU A N    2  
ATOM 2555  C CA   . LEU A 1 25  ? -8.125  -5.244  -4.224  1.00 0.00 ? 25  LEU A CA   2  
ATOM 2556  C C    . LEU A 1 25  ? -8.335  -4.326  -5.423  1.00 0.00 ? 25  LEU A C    2  
ATOM 2557  O O    . LEU A 1 25  ? -7.784  -3.222  -5.479  1.00 0.00 ? 25  LEU A O    2  
ATOM 2558  C CB   . LEU A 1 25  ? -7.113  -6.366  -4.533  1.00 0.00 ? 25  LEU A CB   2  
ATOM 2559  C CG   . LEU A 1 25  ? -5.741  -5.929  -5.095  1.00 0.00 ? 25  LEU A CG   2  
ATOM 2560  C CD1  . LEU A 1 25  ? -4.644  -6.898  -4.651  1.00 0.00 ? 25  LEU A CD1  2  
ATOM 2561  C CD2  . LEU A 1 25  ? -5.782  -5.851  -6.623  1.00 0.00 ? 25  LEU A CD2  2  
ATOM 2562  H H    . LEU A 1 25  ? -9.479  -6.808  -3.848  1.00 0.00 ? 25  LEU A H    2  
ATOM 2563  H HA   . LEU A 1 25  ? -7.762  -4.657  -3.392  1.00 0.00 ? 25  LEU A HA   2  
ATOM 2564  H HB2  . LEU A 1 25  ? -6.941  -6.912  -3.616  1.00 0.00 ? 25  LEU A HB2  2  
ATOM 2565  H HB3  . LEU A 1 25  ? -7.569  -7.041  -5.244  1.00 0.00 ? 25  LEU A HB3  2  
ATOM 2566  H HG   . LEU A 1 25  ? -5.495  -4.948  -4.714  1.00 0.00 ? 25  LEU A HG   2  
ATOM 2567  H HD11 . LEU A 1 25  ? -4.597  -6.918  -3.573  1.00 0.00 ? 25  LEU A HD11 2  
ATOM 2568  H HD12 . LEU A 1 25  ? -3.693  -6.572  -5.046  1.00 0.00 ? 25  LEU A HD12 2  
ATOM 2569  H HD13 . LEU A 1 25  ? -4.866  -7.890  -5.020  1.00 0.00 ? 25  LEU A HD13 2  
ATOM 2570  H HD21 . LEU A 1 25  ? -6.505  -5.108  -6.927  1.00 0.00 ? 25  LEU A HD21 2  
ATOM 2571  H HD22 . LEU A 1 25  ? -6.069  -6.814  -7.025  1.00 0.00 ? 25  LEU A HD22 2  
ATOM 2572  H HD23 . LEU A 1 25  ? -4.806  -5.581  -7.000  1.00 0.00 ? 25  LEU A HD23 2  
ATOM 2573  N N    . GLU A 1 26  ? -9.151  -4.784  -6.372  1.00 0.00 ? 26  GLU A N    2  
ATOM 2574  C CA   . GLU A 1 26  ? -9.499  -3.984  -7.539  1.00 0.00 ? 26  GLU A CA   2  
ATOM 2575  C C    . GLU A 1 26  ? -10.193 -2.700  -7.096  1.00 0.00 ? 26  GLU A C    2  
ATOM 2576  O O    . GLU A 1 26  ? -9.750  -1.597  -7.417  1.00 0.00 ? 26  GLU A O    2  
ATOM 2577  C CB   . GLU A 1 26  ? -10.419 -4.770  -8.489  1.00 0.00 ? 26  GLU A CB   2  
ATOM 2578  C CG   . GLU A 1 26  ? -10.710 -4.037  -9.798  1.00 0.00 ? 26  GLU A CG   2  
ATOM 2579  C CD   . GLU A 1 26  ? -11.817 -4.687  -10.616 1.00 0.00 ? 26  GLU A CD   2  
ATOM 2580  O OE1  . GLU A 1 26  ? -11.623 -5.827  -11.092 1.00 0.00 ? 26  GLU A OE1  2  
ATOM 2581  O OE2  . GLU A 1 26  ? -12.879 -4.049  -10.805 1.00 0.00 ? 26  GLU A OE2  2  
ATOM 2582  H H    . GLU A 1 26  ? -9.527  -5.686  -6.282  1.00 0.00 ? 26  GLU A H    2  
ATOM 2583  H HA   . GLU A 1 26  ? -8.585  -3.731  -8.057  1.00 0.00 ? 26  GLU A HA   2  
ATOM 2584  H HB2  . GLU A 1 26  ? -9.950  -5.714  -8.725  1.00 0.00 ? 26  GLU A HB2  2  
ATOM 2585  H HB3  . GLU A 1 26  ? -11.358 -4.961  -7.989  1.00 0.00 ? 26  GLU A HB3  2  
ATOM 2586  H HG2  . GLU A 1 26  ? -11.001 -3.021  -9.569  1.00 0.00 ? 26  GLU A HG2  2  
ATOM 2587  H HG3  . GLU A 1 26  ? -9.807  -4.021  -10.393 1.00 0.00 ? 26  GLU A HG3  2  
ATOM 2588  N N    . ALA A 1 27  ? -11.268 -2.855  -6.332  1.00 0.00 ? 27  ALA A N    2  
ATOM 2589  C CA   . ALA A 1 27  ? -12.056 -1.722  -5.862  1.00 0.00 ? 27  ALA A CA   2  
ATOM 2590  C C    . ALA A 1 27  ? -11.194 -0.731  -5.082  1.00 0.00 ? 27  ALA A C    2  
ATOM 2591  O O    . ALA A 1 27  ? -11.288 0.482   -5.286  1.00 0.00 ? 27  ALA A O    2  
ATOM 2592  C CB   . ALA A 1 27  ? -13.218 -2.211  -5.003  1.00 0.00 ? 27  ALA A CB   2  
ATOM 2593  H H    . ALA A 1 27  ? -11.541 -3.762  -6.077  1.00 0.00 ? 27  ALA A H    2  
ATOM 2594  H HA   . ALA A 1 27  ? -12.468 -1.221  -6.728  1.00 0.00 ? 27  ALA A HA   2  
ATOM 2595  H HB1  . ALA A 1 27  ? -13.825 -1.369  -4.700  1.00 0.00 ? 27  ALA A HB1  2  
ATOM 2596  H HB2  . ALA A 1 27  ? -12.833 -2.709  -4.124  1.00 0.00 ? 27  ALA A HB2  2  
ATOM 2597  H HB3  . ALA A 1 27  ? -13.820 -2.903  -5.572  1.00 0.00 ? 27  ALA A HB3  2  
ATOM 2598  N N    . PHE A 1 28  ? -10.338 -1.255  -4.206  1.00 0.00 ? 28  PHE A N    2  
ATOM 2599  C CA   . PHE A 1 28  ? -9.508  -0.415  -3.349  1.00 0.00 ? 28  PHE A CA   2  
ATOM 2600  C C    . PHE A 1 28  ? -8.458  0.334   -4.166  1.00 0.00 ? 28  PHE A C    2  
ATOM 2601  O O    . PHE A 1 28  ? -8.233  1.520   -3.945  1.00 0.00 ? 28  PHE A O    2  
ATOM 2602  C CB   . PHE A 1 28  ? -8.828  -1.238  -2.244  1.00 0.00 ? 28  PHE A CB   2  
ATOM 2603  C CG   . PHE A 1 28  ? -8.021  -0.392  -1.284  1.00 0.00 ? 28  PHE A CG   2  
ATOM 2604  C CD1  . PHE A 1 28  ? -8.660  0.428   -0.361  1.00 0.00 ? 28  PHE A CD1  2  
ATOM 2605  C CD2  . PHE A 1 28  ? -6.632  -0.407  -1.308  1.00 0.00 ? 28  PHE A CD2  2  
ATOM 2606  C CE1  . PHE A 1 28  ? -7.932  1.215   0.512   1.00 0.00 ? 28  PHE A CE1  2  
ATOM 2607  C CE2  . PHE A 1 28  ? -5.901  0.378   -0.435  1.00 0.00 ? 28  PHE A CE2  2  
ATOM 2608  C CZ   . PHE A 1 28  ? -6.551  1.189   0.476   1.00 0.00 ? 28  PHE A CZ   2  
ATOM 2609  H H    . PHE A 1 28  ? -10.265 -2.229  -4.136  1.00 0.00 ? 28  PHE A H    2  
ATOM 2610  H HA   . PHE A 1 28  ? -10.160 0.315   -2.884  1.00 0.00 ? 28  PHE A HA   2  
ATOM 2611  H HB2  . PHE A 1 28  ? -9.586  -1.761  -1.677  1.00 0.00 ? 28  PHE A HB2  2  
ATOM 2612  H HB3  . PHE A 1 28  ? -8.163  -1.961  -2.699  1.00 0.00 ? 28  PHE A HB3  2  
ATOM 2613  H HD1  . PHE A 1 28  ? -9.740  0.449   -0.329  1.00 0.00 ? 28  PHE A HD1  2  
ATOM 2614  H HD2  . PHE A 1 28  ? -6.121  -1.039  -2.020  1.00 0.00 ? 28  PHE A HD2  2  
ATOM 2615  H HE1  . PHE A 1 28  ? -8.442  1.848   1.225   1.00 0.00 ? 28  PHE A HE1  2  
ATOM 2616  H HE2  . PHE A 1 28  ? -4.821  0.357   -0.463  1.00 0.00 ? 28  PHE A HE2  2  
ATOM 2617  H HZ   . PHE A 1 28  ? -5.980  1.803   1.157   1.00 0.00 ? 28  PHE A HZ   2  
ATOM 2618  N N    . THR A 1 29  ? -7.816  -0.353  -5.111  1.00 0.00 ? 29  THR A N    2  
ATOM 2619  C CA   . THR A 1 29  ? -6.789  0.286   -5.928  1.00 0.00 ? 29  THR A CA   2  
ATOM 2620  C C    . THR A 1 29  ? -7.421  1.351   -6.829  1.00 0.00 ? 29  THR A C    2  
ATOM 2621  O O    . THR A 1 29  ? -6.833  2.406   -7.054  1.00 0.00 ? 29  THR A O    2  
ATOM 2622  C CB   . THR A 1 29  ? -5.971  -0.734  -6.773  1.00 0.00 ? 29  THR A CB   2  
ATOM 2623  O OG1  . THR A 1 29  ? -4.823  -0.090  -7.347  1.00 0.00 ? 29  THR A OG1  2  
ATOM 2624  C CG2  . THR A 1 29  ? -6.806  -1.356  -7.889  1.00 0.00 ? 29  THR A CG2  2  
ATOM 2625  H H    . THR A 1 29  ? -8.037  -1.298  -5.261  1.00 0.00 ? 29  THR A H    2  
ATOM 2626  H HA   . THR A 1 29  ? -6.103  0.780   -5.249  1.00 0.00 ? 29  THR A HA   2  
ATOM 2627  H HB   . THR A 1 29  ? -5.632  -1.527  -6.118  1.00 0.00 ? 29  THR A HB   2  
ATOM 2628  H HG1  . THR A 1 29  ? -4.478  0.560   -6.726  1.00 0.00 ? 29  THR A HG1  2  
ATOM 2629  H HG21 . THR A 1 29  ? -7.653  -1.872  -7.463  1.00 0.00 ? 29  THR A HG21 2  
ATOM 2630  H HG22 . THR A 1 29  ? -6.201  -2.058  -8.444  1.00 0.00 ? 29  THR A HG22 2  
ATOM 2631  H HG23 . THR A 1 29  ? -7.155  -0.580  -8.556  1.00 0.00 ? 29  THR A HG23 2  
ATOM 2632  N N    . ARG A 1 30  ? -8.637  1.083   -7.308  1.00 0.00 ? 30  ARG A N    2  
ATOM 2633  C CA   . ARG A 1 30  ? -9.382  2.054   -8.114  1.00 0.00 ? 30  ARG A CA   2  
ATOM 2634  C C    . ARG A 1 30  ? -9.713  3.281   -7.268  1.00 0.00 ? 30  ARG A C    2  
ATOM 2635  O O    . ARG A 1 30  ? -9.528  4.423   -7.701  1.00 0.00 ? 30  ARG A O    2  
ATOM 2636  C CB   . ARG A 1 30  ? -10.673 1.421   -8.662  1.00 0.00 ? 30  ARG A CB   2  
ATOM 2637  C CG   . ARG A 1 30  ? -10.427 0.257   -9.621  1.00 0.00 ? 30  ARG A CG   2  
ATOM 2638  C CD   . ARG A 1 30  ? -11.713 -0.495  -9.962  1.00 0.00 ? 30  ARG A CD   2  
ATOM 2639  N NE   . ARG A 1 30  ? -12.662 0.328   -10.714 1.00 0.00 ? 30  ARG A NE   2  
ATOM 2640  C CZ   . ARG A 1 30  ? -13.631 -0.165  -11.493 1.00 0.00 ? 30  ARG A CZ   2  
ATOM 2641  N NH1  . ARG A 1 30  ? -13.813 -1.479  -11.596 1.00 0.00 ? 30  ARG A NH1  2  
ATOM 2642  N NH2  . ARG A 1 30  ? -14.426 0.662   -12.160 1.00 0.00 ? 30  ARG A NH2  2  
ATOM 2643  H H    . ARG A 1 30  ? -9.046  0.212   -7.111  1.00 0.00 ? 30  ARG A H    2  
ATOM 2644  H HA   . ARG A 1 30  ? -8.752  2.355   -8.941  1.00 0.00 ? 30  ARG A HA   2  
ATOM 2645  H HB2  . ARG A 1 30  ? -11.262 1.057   -7.832  1.00 0.00 ? 30  ARG A HB2  2  
ATOM 2646  H HB3  . ARG A 1 30  ? -11.238 2.179   -9.187  1.00 0.00 ? 30  ARG A HB3  2  
ATOM 2647  H HG2  . ARG A 1 30  ? -9.998  0.641   -10.535 1.00 0.00 ? 30  ARG A HG2  2  
ATOM 2648  H HG3  . ARG A 1 30  ? -9.732  -0.432  -9.162  1.00 0.00 ? 30  ARG A HG3  2  
ATOM 2649  H HD2  . ARG A 1 30  ? -11.459 -1.362  -10.555 1.00 0.00 ? 30  ARG A HD2  2  
ATOM 2650  H HD3  . ARG A 1 30  ? -12.182 -0.818  -9.042  1.00 0.00 ? 30  ARG A HD3  2  
ATOM 2651  H HE   . ARG A 1 30  ? -12.568 1.305   -10.642 1.00 0.00 ? 30  ARG A HE   2  
ATOM 2652  H HH11 . ARG A 1 30  ? -13.226 -2.119  -11.089 1.00 0.00 ? 30  ARG A HH11 2  
ATOM 2653  H HH12 . ARG A 1 30  ? -14.542 -1.841  -12.189 1.00 0.00 ? 30  ARG A HH12 2  
ATOM 2654  H HH21 . ARG A 1 30  ? -14.303 1.656   -12.076 1.00 0.00 ? 30  ARG A HH21 2  
ATOM 2655  H HH22 . ARG A 1 30  ? -15.145 0.296   -12.760 1.00 0.00 ? 30  ARG A HH22 2  
ATOM 2656  N N    . PHE A 1 31  ? -10.184 3.029   -6.049  1.00 0.00 ? 31  PHE A N    2  
ATOM 2657  C CA   . PHE A 1 31  ? -10.494 4.091   -5.096  1.00 0.00 ? 31  PHE A CA   2  
ATOM 2658  C C    . PHE A 1 31  ? -9.234  4.880   -4.743  1.00 0.00 ? 31  PHE A C    2  
ATOM 2659  O O    . PHE A 1 31  ? -9.256  6.108   -4.671  1.00 0.00 ? 31  PHE A O    2  
ATOM 2660  C CB   . PHE A 1 31  ? -11.119 3.490   -3.826  1.00 0.00 ? 31  PHE A CB   2  
ATOM 2661  C CG   . PHE A 1 31  ? -11.314 4.483   -2.704  1.00 0.00 ? 31  PHE A CG   2  
ATOM 2662  C CD1  . PHE A 1 31  ? -12.350 5.406   -2.745  1.00 0.00 ? 31  PHE A CD1  2  
ATOM 2663  C CD2  . PHE A 1 31  ? -10.453 4.498   -1.611  1.00 0.00 ? 31  PHE A CD2  2  
ATOM 2664  C CE1  . PHE A 1 31  ? -12.525 6.318   -1.722  1.00 0.00 ? 31  PHE A CE1  2  
ATOM 2665  C CE2  . PHE A 1 31  ? -10.626 5.411   -0.587  1.00 0.00 ? 31  PHE A CE2  2  
ATOM 2666  C CZ   . PHE A 1 31  ? -11.662 6.321   -0.643  1.00 0.00 ? 31  PHE A CZ   2  
ATOM 2667  H H    . PHE A 1 31  ? -10.330 2.097   -5.781  1.00 0.00 ? 31  PHE A H    2  
ATOM 2668  H HA   . PHE A 1 31  ? -11.209 4.756   -5.560  1.00 0.00 ? 31  PHE A HA   2  
ATOM 2669  H HB2  . PHE A 1 31  ? -12.086 3.074   -4.073  1.00 0.00 ? 31  PHE A HB2  2  
ATOM 2670  H HB3  . PHE A 1 31  ? -10.479 2.696   -3.463  1.00 0.00 ? 31  PHE A HB3  2  
ATOM 2671  H HD1  . PHE A 1 31  ? -13.027 5.407   -3.587  1.00 0.00 ? 31  PHE A HD1  2  
ATOM 2672  H HD2  . PHE A 1 31  ? -9.641  3.787   -1.564  1.00 0.00 ? 31  PHE A HD2  2  
ATOM 2673  H HE1  . PHE A 1 31  ? -13.337 7.031   -1.766  1.00 0.00 ? 31  PHE A HE1  2  
ATOM 2674  H HE2  . PHE A 1 31  ? -9.950  5.412   0.257   1.00 0.00 ? 31  PHE A HE2  2  
ATOM 2675  H HZ   . PHE A 1 31  ? -11.799 7.035   0.156   1.00 0.00 ? 31  PHE A HZ   2  
ATOM 2676  N N    . LEU A 1 32  ? -8.136  4.166   -4.544  1.00 0.00 ? 32  LEU A N    2  
ATOM 2677  C CA   . LEU A 1 32  ? -6.883  4.781   -4.127  1.00 0.00 ? 32  LEU A CA   2  
ATOM 2678  C C    . LEU A 1 32  ? -6.225  5.508   -5.303  1.00 0.00 ? 32  LEU A C    2  
ATOM 2679  O O    . LEU A 1 32  ? -5.418  6.421   -5.110  1.00 0.00 ? 32  LEU A O    2  
ATOM 2680  C CB   . LEU A 1 32  ? -5.947  3.717   -3.530  1.00 0.00 ? 32  LEU A CB   2  
ATOM 2681  C CG   . LEU A 1 32  ? -4.767  4.261   -2.708  1.00 0.00 ? 32  LEU A CG   2  
ATOM 2682  C CD1  . LEU A 1 32  ? -5.259  5.179   -1.591  1.00 0.00 ? 32  LEU A CD1  2  
ATOM 2683  C CD2  . LEU A 1 32  ? -3.940  3.115   -2.130  1.00 0.00 ? 32  LEU A CD2  2  
ATOM 2684  H H    . LEU A 1 32  ? -8.168  3.197   -4.680  1.00 0.00 ? 32  LEU A H    2  
ATOM 2685  H HA   . LEU A 1 32  ? -7.116  5.509   -3.360  1.00 0.00 ? 32  LEU A HA   2  
ATOM 2686  H HB2  . LEU A 1 32  ? -6.534  3.070   -2.892  1.00 0.00 ? 32  LEU A HB2  2  
ATOM 2687  H HB3  . LEU A 1 32  ? -5.548  3.123   -4.341  1.00 0.00 ? 32  LEU A HB3  2  
ATOM 2688  H HG   . LEU A 1 32  ? -4.125  4.843   -3.354  1.00 0.00 ? 32  LEU A HG   2  
ATOM 2689  H HD11 . LEU A 1 32  ? -5.797  6.013   -2.020  1.00 0.00 ? 32  LEU A HD11 2  
ATOM 2690  H HD12 . LEU A 1 32  ? -4.414  5.550   -1.029  1.00 0.00 ? 32  LEU A HD12 2  
ATOM 2691  H HD13 . LEU A 1 32  ? -5.916  4.630   -0.932  1.00 0.00 ? 32  LEU A HD13 2  
ATOM 2692  H HD21 . LEU A 1 32  ? -4.562  2.506   -1.488  1.00 0.00 ? 32  LEU A HD21 2  
ATOM 2693  H HD22 . LEU A 1 32  ? -3.117  3.516   -1.557  1.00 0.00 ? 32  LEU A HD22 2  
ATOM 2694  H HD23 . LEU A 1 32  ? -3.553  2.508   -2.935  1.00 0.00 ? 32  LEU A HD23 2  
ATOM 2695  N N    . LYS A 1 33  ? -6.591  5.108   -6.525  1.00 0.00 ? 33  LYS A N    2  
ATOM 2696  C CA   . LYS A 1 33  ? -6.134  5.797   -7.731  1.00 0.00 ? 33  LYS A CA   2  
ATOM 2697  C C    . LYS A 1 33  ? -6.825  7.156   -7.851  1.00 0.00 ? 33  LYS A C    2  
ATOM 2698  O O    . LYS A 1 33  ? -6.174  8.171   -8.092  1.00 0.00 ? 33  LYS A O    2  
ATOM 2699  C CB   . LYS A 1 33  ? -6.393  4.949   -8.997  1.00 0.00 ? 33  LYS A CB   2  
ATOM 2700  C CG   . LYS A 1 33  ? -5.128  4.351   -9.620  1.00 0.00 ? 33  LYS A CG   2  
ATOM 2701  C CD   . LYS A 1 33  ? -4.476  3.304   -8.720  1.00 0.00 ? 33  LYS A CD   2  
ATOM 2702  C CE   . LYS A 1 33  ? -3.148  2.811   -9.290  1.00 0.00 ? 33  LYS A CE   2  
ATOM 2703  N NZ   . LYS A 1 33  ? -3.291  2.232   -10.653 1.00 0.00 ? 33  LYS A NZ   2  
ATOM 2704  H H    . LYS A 1 33  ? -7.177  4.327   -6.614  1.00 0.00 ? 33  LYS A H    2  
ATOM 2705  H HA   . LYS A 1 33  ? -5.068  5.963   -7.630  1.00 0.00 ? 33  LYS A HA   2  
ATOM 2706  H HB2  . LYS A 1 33  ? -7.059  4.137   -8.742  1.00 0.00 ? 33  LYS A HB2  2  
ATOM 2707  H HB3  . LYS A 1 33  ? -6.872  5.568   -9.743  1.00 0.00 ? 33  LYS A HB3  2  
ATOM 2708  H HG2  . LYS A 1 33  ? -5.387  3.887   -10.562 1.00 0.00 ? 33  LYS A HG2  2  
ATOM 2709  H HG3  . LYS A 1 33  ? -4.419  5.149   -9.798  1.00 0.00 ? 33  LYS A HG3  2  
ATOM 2710  H HD2  . LYS A 1 33  ? -4.299  3.739   -7.747  1.00 0.00 ? 33  LYS A HD2  2  
ATOM 2711  H HD3  . LYS A 1 33  ? -5.149  2.463   -8.619  1.00 0.00 ? 33  LYS A HD3  2  
ATOM 2712  H HE2  . LYS A 1 33  ? -2.461  3.643   -9.336  1.00 0.00 ? 33  LYS A HE2  2  
ATOM 2713  H HE3  . LYS A 1 33  ? -2.749  2.056   -8.629  1.00 0.00 ? 33  LYS A HE3  2  
ATOM 2714  H HZ1  . LYS A 1 33  ? -2.378  1.844   -10.972 1.00 0.00 ? 33  LYS A HZ1  2  
ATOM 2715  H HZ2  . LYS A 1 33  ? -3.597  2.964   -11.325 1.00 0.00 ? 33  LYS A HZ2  2  
ATOM 2716  H HZ3  . LYS A 1 33  ? -3.997  1.469   -10.650 1.00 0.00 ? 33  LYS A HZ3  2  
ATOM 2717  N N    . THR A 1 34  ? -8.146  7.173   -7.668  1.00 0.00 ? 34  THR A N    2  
ATOM 2718  C CA   . THR A 1 34  ? -8.900  8.424   -7.707  1.00 0.00 ? 34  THR A CA   2  
ATOM 2719  C C    . THR A 1 34  ? -8.635  9.238   -6.436  1.00 0.00 ? 34  THR A C    2  
ATOM 2720  O O    . THR A 1 34  ? -8.897  10.441  -6.390  1.00 0.00 ? 34  THR A O    2  
ATOM 2721  C CB   . THR A 1 34  ? -10.423 8.184   -7.891  1.00 0.00 ? 34  THR A CB   2  
ATOM 2722  O OG1  . THR A 1 34  ? -11.104 9.434   -8.087  1.00 0.00 ? 34  THR A OG1  2  
ATOM 2723  C CG2  . THR A 1 34  ? -11.034 7.462   -6.695  1.00 0.00 ? 34  THR A CG2  2  
ATOM 2724  H H    . THR A 1 34  ? -8.622  6.329   -7.508  1.00 0.00 ? 34  THR A H    2  
ATOM 2725  H HA   . THR A 1 34  ? -8.543  8.993   -8.558  1.00 0.00 ? 34  THR A HA   2  
ATOM 2726  H HB   . THR A 1 34  ? -10.567 7.571   -8.771  1.00 0.00 ? 34  THR A HB   2  
ATOM 2727  H HG1  . THR A 1 34  ? -10.594 10.145  -7.678  1.00 0.00 ? 34  THR A HG1  2  
ATOM 2728  H HG21 . THR A 1 34  ? -10.546 6.507   -6.562  1.00 0.00 ? 34  THR A HG21 2  
ATOM 2729  H HG22 . THR A 1 34  ? -12.090 7.305   -6.868  1.00 0.00 ? 34  THR A HG22 2  
ATOM 2730  H HG23 . THR A 1 34  ? -10.901 8.059   -5.805  1.00 0.00 ? 34  THR A HG23 2  
ATOM 2731  N N    . GLU A 1 35  ? -8.127  8.559   -5.407  1.00 0.00 ? 35  GLU A N    2  
ATOM 2732  C CA   . GLU A 1 35  ? -7.649  9.219   -4.192  1.00 0.00 ? 35  GLU A CA   2  
ATOM 2733  C C    . GLU A 1 35  ? -6.301  9.883   -4.474  1.00 0.00 ? 35  GLU A C    2  
ATOM 2734  O O    . GLU A 1 35  ? -5.918  10.851  -3.812  1.00 0.00 ? 35  GLU A O    2  
ATOM 2735  C CB   . GLU A 1 35  ? -7.519  8.191   -3.055  1.00 0.00 ? 35  GLU A CB   2  
ATOM 2736  C CG   . GLU A 1 35  ? -7.021  8.761   -1.728  1.00 0.00 ? 35  GLU A CG   2  
ATOM 2737  C CD   . GLU A 1 35  ? -8.002  9.729   -1.086  1.00 0.00 ? 35  GLU A CD   2  
ATOM 2738  O OE1  . GLU A 1 35  ? -8.921  9.268   -0.374  1.00 0.00 ? 35  GLU A OE1  2  
ATOM 2739  O OE2  . GLU A 1 35  ? -7.851  10.954  -1.275  1.00 0.00 ? 35  GLU A OE2  2  
ATOM 2740  H H    . GLU A 1 35  ? -8.085  7.582   -5.460  1.00 0.00 ? 35  GLU A H    2  
ATOM 2741  H HA   . GLU A 1 35  ? -8.364  9.978   -3.913  1.00 0.00 ? 35  GLU A HA   2  
ATOM 2742  H HB2  . GLU A 1 35  ? -8.487  7.741   -2.885  1.00 0.00 ? 35  GLU A HB2  2  
ATOM 2743  H HB3  . GLU A 1 35  ? -6.830  7.417   -3.368  1.00 0.00 ? 35  GLU A HB3  2  
ATOM 2744  H HG2  . GLU A 1 35  ? -6.849  7.942   -1.044  1.00 0.00 ? 35  GLU A HG2  2  
ATOM 2745  H HG3  . GLU A 1 35  ? -6.087  9.277   -1.903  1.00 0.00 ? 35  GLU A HG3  2  
ATOM 2746  N N    . PHE A 1 36  ? -5.598  9.343   -5.476  1.00 0.00 ? 36  PHE A N    2  
ATOM 2747  C CA   . PHE A 1 36  ? -4.312  9.873   -5.929  1.00 0.00 ? 36  PHE A CA   2  
ATOM 2748  C C    . PHE A 1 36  ? -3.243  9.653   -4.854  1.00 0.00 ? 36  PHE A C    2  
ATOM 2749  O O    . PHE A 1 36  ? -2.315  10.447  -4.695  1.00 0.00 ? 36  PHE A O    2  
ATOM 2750  C CB   . PHE A 1 36  ? -4.453  11.363  -6.296  1.00 0.00 ? 36  PHE A CB   2  
ATOM 2751  C CG   . PHE A 1 36  ? -3.284  11.925  -7.064  1.00 0.00 ? 36  PHE A CG   2  
ATOM 2752  C CD1  . PHE A 1 36  ? -3.005  11.476  -8.347  1.00 0.00 ? 36  PHE A CD1  2  
ATOM 2753  C CD2  . PHE A 1 36  ? -2.472  12.906  -6.510  1.00 0.00 ? 36  PHE A CD2  2  
ATOM 2754  C CE1  . PHE A 1 36  ? -1.940  11.991  -9.061  1.00 0.00 ? 36  PHE A CE1  2  
ATOM 2755  C CE2  . PHE A 1 36  ? -1.405  13.422  -7.220  1.00 0.00 ? 36  PHE A CE2  2  
ATOM 2756  C CZ   . PHE A 1 36  ? -1.140  12.966  -8.497  1.00 0.00 ? 36  PHE A CZ   2  
ATOM 2757  H H    . PHE A 1 36  ? -5.963  8.557   -5.932  1.00 0.00 ? 36  PHE A H    2  
ATOM 2758  H HA   . PHE A 1 36  ? -4.027  9.320   -6.813  1.00 0.00 ? 36  PHE A HA   2  
ATOM 2759  H HB2  . PHE A 1 36  ? -5.338  11.492  -6.905  1.00 0.00 ? 36  PHE A HB2  2  
ATOM 2760  H HB3  . PHE A 1 36  ? -4.568  11.940  -5.388  1.00 0.00 ? 36  PHE A HB3  2  
ATOM 2761  H HD1  . PHE A 1 36  ? -3.630  10.712  -8.788  1.00 0.00 ? 36  PHE A HD1  2  
ATOM 2762  H HD2  . PHE A 1 36  ? -2.679  13.263  -5.512  1.00 0.00 ? 36  PHE A HD2  2  
ATOM 2763  H HE1  . PHE A 1 36  ? -1.734  11.632  -10.060 1.00 0.00 ? 36  PHE A HE1  2  
ATOM 2764  H HE2  . PHE A 1 36  ? -0.779  14.184  -6.777  1.00 0.00 ? 36  PHE A HE2  2  
ATOM 2765  H HZ   . PHE A 1 36  ? -0.307  13.370  -9.054  1.00 0.00 ? 36  PHE A HZ   2  
ATOM 2766  N N    . SER A 1 37  ? -3.372  8.545   -4.131  1.00 0.00 ? 37  SER A N    2  
ATOM 2767  C CA   . SER A 1 37  ? -2.448  8.209   -3.051  1.00 0.00 ? 37  SER A CA   2  
ATOM 2768  C C    . SER A 1 37  ? -2.067  6.727   -3.111  1.00 0.00 ? 37  SER A C    2  
ATOM 2769  O O    . SER A 1 37  ? -1.761  6.106   -2.088  1.00 0.00 ? 37  SER A O    2  
ATOM 2770  C CB   . SER A 1 37  ? -3.095  8.551   -1.702  1.00 0.00 ? 37  SER A CB   2  
ATOM 2771  O OG   . SER A 1 37  ? -3.514  9.909   -1.667  1.00 0.00 ? 37  SER A OG   2  
ATOM 2772  H H    . SER A 1 37  ? -4.113  7.932   -4.331  1.00 0.00 ? 37  SER A H    2  
ATOM 2773  H HA   . SER A 1 37  ? -1.552  8.804   -3.173  1.00 0.00 ? 37  SER A HA   2  
ATOM 2774  H HB2  . SER A 1 37  ? -3.957  7.919   -1.546  1.00 0.00 ? 37  SER A HB2  2  
ATOM 2775  H HB3  . SER A 1 37  ? -2.380  8.386   -0.908  1.00 0.00 ? 37  SER A HB3  2  
ATOM 2776  H HG   . SER A 1 37  ? -3.113  10.384  -2.405  1.00 0.00 ? 37  SER A HG   2  
ATOM 2777  N N    . GLU A 1 38  ? -2.053  6.176   -4.324  1.00 0.00 ? 38  GLU A N    2  
ATOM 2778  C CA   . GLU A 1 38  ? -1.751  4.757   -4.528  1.00 0.00 ? 38  GLU A CA   2  
ATOM 2779  C C    . GLU A 1 38  ? -0.276  4.461   -4.255  1.00 0.00 ? 38  GLU A C    2  
ATOM 2780  O O    . GLU A 1 38  ? 0.124   3.299   -4.156  1.00 0.00 ? 38  GLU A O    2  
ATOM 2781  C CB   . GLU A 1 38  ? -2.132  4.304   -5.948  1.00 0.00 ? 38  GLU A CB   2  
ATOM 2782  C CG   . GLU A 1 38  ? -1.298  4.927   -7.067  1.00 0.00 ? 38  GLU A CG   2  
ATOM 2783  C CD   . GLU A 1 38  ? -1.568  6.405   -7.272  1.00 0.00 ? 38  GLU A CD   2  
ATOM 2784  O OE1  . GLU A 1 38  ? -2.474  6.743   -8.061  1.00 0.00 ? 38  GLU A OE1  2  
ATOM 2785  O OE2  . GLU A 1 38  ? -0.870  7.235   -6.658  1.00 0.00 ? 38  GLU A OE2  2  
ATOM 2786  H H    . GLU A 1 38  ? -2.238  6.743   -5.104  1.00 0.00 ? 38  GLU A H    2  
ATOM 2787  H HA   . GLU A 1 38  ? -2.346  4.196   -3.820  1.00 0.00 ? 38  GLU A HA   2  
ATOM 2788  H HB2  . GLU A 1 38  ? -2.023  3.230   -6.008  1.00 0.00 ? 38  GLU A HB2  2  
ATOM 2789  H HB3  . GLU A 1 38  ? -3.168  4.555   -6.122  1.00 0.00 ? 38  GLU A HB3  2  
ATOM 2790  H HG2  . GLU A 1 38  ? -0.251  4.799   -6.831  1.00 0.00 ? 38  GLU A HG2  2  
ATOM 2791  H HG3  . GLU A 1 38  ? -1.516  4.405   -7.989  1.00 0.00 ? 38  GLU A HG3  2  
ATOM 2792  N N    . GLU A 1 39  ? 0.513   5.525   -4.124  1.00 0.00 ? 39  GLU A N    2  
ATOM 2793  C CA   . GLU A 1 39  ? 1.935   5.426   -3.784  1.00 0.00 ? 39  GLU A CA   2  
ATOM 2794  C C    . GLU A 1 39  ? 2.165   4.436   -2.634  1.00 0.00 ? 39  GLU A C    2  
ATOM 2795  O O    . GLU A 1 39  ? 3.138   3.683   -2.635  1.00 0.00 ? 39  GLU A O    2  
ATOM 2796  C CB   . GLU A 1 39  ? 2.463   6.823   -3.410  1.00 0.00 ? 39  GLU A CB   2  
ATOM 2797  C CG   . GLU A 1 39  ? 1.650   7.510   -2.313  1.00 0.00 ? 39  GLU A CG   2  
ATOM 2798  C CD   . GLU A 1 39  ? 1.974   8.989   -2.164  1.00 0.00 ? 39  GLU A CD   2  
ATOM 2799  O OE1  . GLU A 1 39  ? 1.641   9.763   -3.088  1.00 0.00 ? 39  GLU A OE1  2  
ATOM 2800  O OE2  . GLU A 1 39  ? 2.550   9.386   -1.126  1.00 0.00 ? 39  GLU A OE2  2  
ATOM 2801  H H    . GLU A 1 39  ? 0.128   6.413   -4.273  1.00 0.00 ? 39  GLU A H    2  
ATOM 2802  H HA   . GLU A 1 39  ? 2.462   5.073   -4.659  1.00 0.00 ? 39  GLU A HA   2  
ATOM 2803  H HB2  . GLU A 1 39  ? 3.487   6.733   -3.070  1.00 0.00 ? 39  GLU A HB2  2  
ATOM 2804  H HB3  . GLU A 1 39  ? 2.442   7.450   -4.290  1.00 0.00 ? 39  GLU A HB3  2  
ATOM 2805  H HG2  . GLU A 1 39  ? 0.600   7.413   -2.550  1.00 0.00 ? 39  GLU A HG2  2  
ATOM 2806  H HG3  . GLU A 1 39  ? 1.850   7.012   -1.373  1.00 0.00 ? 39  GLU A HG3  2  
ATOM 2807  N N    . ASN A 1 40  ? 1.241   4.426   -1.674  1.00 0.00 ? 40  ASN A N    2  
ATOM 2808  C CA   . ASN A 1 40  ? 1.344   3.555   -0.503  1.00 0.00 ? 40  ASN A CA   2  
ATOM 2809  C C    . ASN A 1 40  ? 1.152   2.078   -0.870  1.00 0.00 ? 40  ASN A C    2  
ATOM 2810  O O    . ASN A 1 40  ? 1.972   1.221   -0.503  1.00 0.00 ? 40  ASN A O    2  
ATOM 2811  C CB   . ASN A 1 40  ? 0.315   3.963   0.566   1.00 0.00 ? 40  ASN A CB   2  
ATOM 2812  C CG   . ASN A 1 40  ? 0.706   5.225   1.326   1.00 0.00 ? 40  ASN A CG   2  
ATOM 2813  O OD1  . ASN A 1 40  ? 1.333   6.135   0.783   1.00 0.00 ? 40  ASN A OD1  2  
ATOM 2814  N ND2  . ASN A 1 40  ? 0.349   5.278   2.604   1.00 0.00 ? 40  ASN A ND2  2  
ATOM 2815  H H    . ASN A 1 40  ? 0.471   5.027   -1.753  1.00 0.00 ? 40  ASN A H    2  
ATOM 2816  H HA   . ASN A 1 40  ? 2.336   3.679   -0.091  1.00 0.00 ? 40  ASN A HA   2  
ATOM 2817  H HB2  . ASN A 1 40  ? -0.638  4.140   0.090   1.00 0.00 ? 40  ASN A HB2  2  
ATOM 2818  H HB3  . ASN A 1 40  ? 0.208   3.156   1.279   1.00 0.00 ? 40  ASN A HB3  2  
ATOM 2819  H HD21 . ASN A 1 40  ? -0.137  4.516   2.981   1.00 0.00 ? 40  ASN A HD21 2  
ATOM 2820  H HD22 . ASN A 1 40  ? 0.593   6.074   3.120   1.00 0.00 ? 40  ASN A HD22 2  
ATOM 2821  N N    . ILE A 1 41  ? 0.078   1.777   -1.597  1.00 0.00 ? 41  ILE A N    2  
ATOM 2822  C CA   . ILE A 1 41  ? -0.253  0.390   -1.912  1.00 0.00 ? 41  ILE A CA   2  
ATOM 2823  C C    . ILE A 1 41  ? 0.830   -0.225  -2.800  1.00 0.00 ? 41  ILE A C    2  
ATOM 2824  O O    . ILE A 1 41  ? 1.274   -1.347  -2.561  1.00 0.00 ? 41  ILE A O    2  
ATOM 2825  C CB   . ILE A 1 41  ? -1.656  0.248   -2.578  1.00 0.00 ? 41  ILE A CB   2  
ATOM 2826  C CG1  . ILE A 1 41  ? -2.077  -1.232  -2.636  1.00 0.00 ? 41  ILE A CG1  2  
ATOM 2827  C CG2  . ILE A 1 41  ? -1.678  0.870   -3.974  1.00 0.00 ? 41  ILE A CG2  2  
ATOM 2828  C CD1  . ILE A 1 41  ? -3.434  -1.461  -3.275  1.00 0.00 ? 41  ILE A CD1  2  
ATOM 2829  H H    . ILE A 1 41  ? -0.489  2.498   -1.939  1.00 0.00 ? 41  ILE A H    2  
ATOM 2830  H HA   . ILE A 1 41  ? -0.273  -0.154  -0.974  1.00 0.00 ? 41  ILE A HA   2  
ATOM 2831  H HB   . ILE A 1 41  ? -2.368  0.786   -1.967  1.00 0.00 ? 41  ILE A HB   2  
ATOM 2832  H HG12 . ILE A 1 41  ? -1.348  -1.788  -3.207  1.00 0.00 ? 41  ILE A HG12 2  
ATOM 2833  H HG13 . ILE A 1 41  ? -2.114  -1.628  -1.632  1.00 0.00 ? 41  ILE A HG13 2  
ATOM 2834  H HG21 . ILE A 1 41  ? -2.664  0.760   -4.405  1.00 0.00 ? 41  ILE A HG21 2  
ATOM 2835  H HG22 . ILE A 1 41  ? -0.954  0.372   -4.605  1.00 0.00 ? 41  ILE A HG22 2  
ATOM 2836  H HG23 . ILE A 1 41  ? -1.433  1.919   -3.905  1.00 0.00 ? 41  ILE A HG23 2  
ATOM 2837  H HD11 . ILE A 1 41  ? -4.186  -0.901  -2.737  1.00 0.00 ? 41  ILE A HD11 2  
ATOM 2838  H HD12 . ILE A 1 41  ? -3.674  -2.513  -3.238  1.00 0.00 ? 41  ILE A HD12 2  
ATOM 2839  H HD13 . ILE A 1 41  ? -3.408  -1.133  -4.304  1.00 0.00 ? 41  ILE A HD13 2  
ATOM 2840  N N    . GLU A 1 42  ? 1.288   0.539   -3.794  1.00 0.00 ? 42  GLU A N    2  
ATOM 2841  C CA   . GLU A 1 42  ? 2.341   0.077   -4.696  1.00 0.00 ? 42  GLU A CA   2  
ATOM 2842  C C    . GLU A 1 42  ? 3.673   -0.022  -3.956  1.00 0.00 ? 42  GLU A C    2  
ATOM 2843  O O    . GLU A 1 42  ? 4.550   -0.797  -4.340  1.00 0.00 ? 42  GLU A O    2  
ATOM 2844  C CB   . GLU A 1 42  ? 2.471   1.013   -5.905  1.00 0.00 ? 42  GLU A CB   2  
ATOM 2845  C CG   . GLU A 1 42  ? 1.251   1.002   -6.818  1.00 0.00 ? 42  GLU A CG   2  
ATOM 2846  C CD   . GLU A 1 42  ? 1.375   1.981   -7.978  1.00 0.00 ? 42  GLU A CD   2  
ATOM 2847  O OE1  . GLU A 1 42  ? 1.289   3.201   -7.742  1.00 0.00 ? 42  GLU A OE1  2  
ATOM 2848  O OE2  . GLU A 1 42  ? 1.567   1.533   -9.131  1.00 0.00 ? 42  GLU A OE2  2  
ATOM 2849  H H    . GLU A 1 42  ? 0.912   1.438   -3.921  1.00 0.00 ? 42  GLU A H    2  
ATOM 2850  H HA   . GLU A 1 42  ? 2.067   -0.911  -5.045  1.00 0.00 ? 42  GLU A HA   2  
ATOM 2851  H HB2  . GLU A 1 42  ? 2.620   2.023   -5.549  1.00 0.00 ? 42  GLU A HB2  2  
ATOM 2852  H HB3  . GLU A 1 42  ? 3.332   0.717   -6.487  1.00 0.00 ? 42  GLU A HB3  2  
ATOM 2853  H HG2  . GLU A 1 42  ? 1.127   0.004   -7.218  1.00 0.00 ? 42  GLU A HG2  2  
ATOM 2854  H HG3  . GLU A 1 42  ? 0.378   1.260   -6.238  1.00 0.00 ? 42  GLU A HG3  2  
ATOM 2855  N N    . PHE A 1 43  ? 3.808   0.765   -2.890  1.00 0.00 ? 43  PHE A N    2  
ATOM 2856  C CA   . PHE A 1 43  ? 5.011   0.754   -2.064  1.00 0.00 ? 43  PHE A CA   2  
ATOM 2857  C C    . PHE A 1 43  ? 5.277   -0.645  -1.516  1.00 0.00 ? 43  PHE A C    2  
ATOM 2858  O O    . PHE A 1 43  ? 6.314   -1.247  -1.812  1.00 0.00 ? 43  PHE A O    2  
ATOM 2859  C CB   . PHE A 1 43  ? 4.871   1.757   -0.912  1.00 0.00 ? 43  PHE A CB   2  
ATOM 2860  C CG   . PHE A 1 43  ? 6.080   1.852   -0.015  1.00 0.00 ? 43  PHE A CG   2  
ATOM 2861  C CD1  . PHE A 1 43  ? 7.142   2.675   -0.350  1.00 0.00 ? 43  PHE A CD1  2  
ATOM 2862  C CD2  . PHE A 1 43  ? 6.143   1.136   1.173   1.00 0.00 ? 43  PHE A CD2  2  
ATOM 2863  C CE1  . PHE A 1 43  ? 8.241   2.782   0.477   1.00 0.00 ? 43  PHE A CE1  2  
ATOM 2864  C CE2  . PHE A 1 43  ? 7.239   1.244   2.005   1.00 0.00 ? 43  PHE A CE2  2  
ATOM 2865  C CZ   . PHE A 1 43  ? 8.290   2.068   1.656   1.00 0.00 ? 43  PHE A CZ   2  
ATOM 2866  H H    . PHE A 1 43  ? 3.081   1.380   -2.659  1.00 0.00 ? 43  PHE A H    2  
ATOM 2867  H HA   . PHE A 1 43  ? 5.843   1.049   -2.688  1.00 0.00 ? 43  PHE A HA   2  
ATOM 2868  H HB2  . PHE A 1 43  ? 4.689   2.739   -1.325  1.00 0.00 ? 43  PHE A HB2  2  
ATOM 2869  H HB3  . PHE A 1 43  ? 4.025   1.473   -0.302  1.00 0.00 ? 43  PHE A HB3  2  
ATOM 2870  H HD1  . PHE A 1 43  ? 7.109   3.236   -1.274  1.00 0.00 ? 43  PHE A HD1  2  
ATOM 2871  H HD2  . PHE A 1 43  ? 5.322   0.489   1.446   1.00 0.00 ? 43  PHE A HD2  2  
ATOM 2872  H HE1  . PHE A 1 43  ? 9.062   3.429   0.203   1.00 0.00 ? 43  PHE A HE1  2  
ATOM 2873  H HE2  . PHE A 1 43  ? 7.275   0.680   2.927   1.00 0.00 ? 43  PHE A HE2  2  
ATOM 2874  H HZ   . PHE A 1 43  ? 9.144   2.162   2.309   1.00 0.00 ? 43  PHE A HZ   2  
ATOM 2875  N N    . TRP A 1 44  ? 4.340   -1.183  -0.730  1.00 0.00 ? 44  TRP A N    2  
ATOM 2876  C CA   . TRP A 1 44  ? 4.555   -2.509  -0.144  1.00 0.00 ? 44  TRP A CA   2  
ATOM 2877  C C    . TRP A 1 44  ? 4.289   -3.627  -1.154  1.00 0.00 ? 44  TRP A C    2  
ATOM 2878  O O    . TRP A 1 44  ? 4.726   -4.765  -0.960  1.00 0.00 ? 44  TRP A O    2  
ATOM 2879  C CB   . TRP A 1 44  ? 3.771   -2.721  1.163   1.00 0.00 ? 44  TRP A CB   2  
ATOM 2880  C CG   . TRP A 1 44  ? 2.315   -2.377  1.121   1.00 0.00 ? 44  TRP A CG   2  
ATOM 2881  C CD1  . TRP A 1 44  ? 1.743   -1.238  1.601   1.00 0.00 ? 44  TRP A CD1  2  
ATOM 2882  C CD2  . TRP A 1 44  ? 1.245   -3.181  0.608   1.00 0.00 ? 44  TRP A CD2  2  
ATOM 2883  N NE1  . TRP A 1 44  ? 0.388   -1.283  1.427   1.00 0.00 ? 44  TRP A NE1  2  
ATOM 2884  C CE2  . TRP A 1 44  ? 0.054   -2.463  0.812   1.00 0.00 ? 44  TRP A CE2  2  
ATOM 2885  C CE3  . TRP A 1 44  ? 1.177   -4.436  -0.006  1.00 0.00 ? 44  TRP A CE3  2  
ATOM 2886  C CZ2  . TRP A 1 44  ? -1.189  -2.958  0.426   1.00 0.00 ? 44  TRP A CZ2  2  
ATOM 2887  C CZ3  . TRP A 1 44  ? -0.057  -4.925  -0.390  1.00 0.00 ? 44  TRP A CZ3  2  
ATOM 2888  C CH2  . TRP A 1 44  ? -1.227  -4.185  -0.173  1.00 0.00 ? 44  TRP A CH2  2  
ATOM 2889  H H    . TRP A 1 44  ? 3.505   -0.686  -0.548  1.00 0.00 ? 44  TRP A H    2  
ATOM 2890  H HA   . TRP A 1 44  ? 5.609   -2.557  0.101   1.00 0.00 ? 44  TRP A HA   2  
ATOM 2891  H HB2  . TRP A 1 44  ? 3.846   -3.760  1.447   1.00 0.00 ? 44  TRP A HB2  2  
ATOM 2892  H HB3  . TRP A 1 44  ? 4.229   -2.121  1.937   1.00 0.00 ? 44  TRP A HB3  2  
ATOM 2893  H HD1  . TRP A 1 44  ? 2.292   -0.428  2.060   1.00 0.00 ? 44  TRP A HD1  2  
ATOM 2894  H HE1  . TRP A 1 44  ? -0.237  -0.581  1.695   1.00 0.00 ? 44  TRP A HE1  2  
ATOM 2895  H HE3  . TRP A 1 44  ? 2.068   -5.020  -0.183  1.00 0.00 ? 44  TRP A HE3  2  
ATOM 2896  H HZ2  . TRP A 1 44  ? -2.101  -2.399  0.586   1.00 0.00 ? 44  TRP A HZ2  2  
ATOM 2897  H HZ3  . TRP A 1 44  ? -0.129  -5.893  -0.866  1.00 0.00 ? 44  TRP A HZ3  2  
ATOM 2898  H HH2  . TRP A 1 44  ? -2.170  -4.606  -0.488  1.00 0.00 ? 44  TRP A HH2  2  
ATOM 2899  N N    . ILE A 1 45  ? 3.595   -3.309  -2.241  1.00 0.00 ? 45  ILE A N    2  
ATOM 2900  C CA   . ILE A 1 45  ? 3.507   -4.228  -3.373  1.00 0.00 ? 45  ILE A CA   2  
ATOM 2901  C C    . ILE A 1 45  ? 4.905   -4.423  -3.969  1.00 0.00 ? 45  ILE A C    2  
ATOM 2902  O O    . ILE A 1 45  ? 5.295   -5.532  -4.349  1.00 0.00 ? 45  ILE A O    2  
ATOM 2903  C CB   . ILE A 1 45  ? 2.516   -3.712  -4.457  1.00 0.00 ? 45  ILE A CB   2  
ATOM 2904  C CG1  . ILE A 1 45  ? 1.061   -3.938  -4.004  1.00 0.00 ? 45  ILE A CG1  2  
ATOM 2905  C CG2  . ILE A 1 45  ? 2.768   -4.371  -5.815  1.00 0.00 ? 45  ILE A CG2  2  
ATOM 2906  C CD1  . ILE A 1 45  ? 0.023   -3.421  -4.982  1.00 0.00 ? 45  ILE A CD1  2  
ATOM 2907  H H    . ILE A 1 45  ? 3.128   -2.446  -2.281  1.00 0.00 ? 45  ILE A H    2  
ATOM 2908  H HA   . ILE A 1 45  ? 3.149   -5.181  -3.002  1.00 0.00 ? 45  ILE A HA   2  
ATOM 2909  H HB   . ILE A 1 45  ? 2.681   -2.650  -4.575  1.00 0.00 ? 45  ILE A HB   2  
ATOM 2910  H HG12 . ILE A 1 45  ? 0.891   -4.997  -3.875  1.00 0.00 ? 45  ILE A HG12 2  
ATOM 2911  H HG13 . ILE A 1 45  ? 0.902   -3.438  -3.059  1.00 0.00 ? 45  ILE A HG13 2  
ATOM 2912  H HG21 . ILE A 1 45  ? 2.075   -3.972  -6.543  1.00 0.00 ? 45  ILE A HG21 2  
ATOM 2913  H HG22 . ILE A 1 45  ? 2.626   -5.439  -5.733  1.00 0.00 ? 45  ILE A HG22 2  
ATOM 2914  H HG23 . ILE A 1 45  ? 3.779   -4.166  -6.135  1.00 0.00 ? 45  ILE A HG23 2  
ATOM 2915  H HD11 . ILE A 1 45  ? -0.965  -3.616  -4.592  1.00 0.00 ? 45  ILE A HD11 2  
ATOM 2916  H HD12 . ILE A 1 45  ? 0.138   -3.922  -5.933  1.00 0.00 ? 45  ILE A HD12 2  
ATOM 2917  H HD13 . ILE A 1 45  ? 0.154   -2.357  -5.117  1.00 0.00 ? 45  ILE A HD13 2  
ATOM 2918  N N    . ALA A 1 46  ? 5.666   -3.330  -4.006  1.00 0.00 ? 46  ALA A N    2  
ATOM 2919  C CA   . ALA A 1 46  ? 7.031   -3.350  -4.511  1.00 0.00 ? 46  ALA A CA   2  
ATOM 2920  C C    . ALA A 1 46  ? 7.971   -4.050  -3.529  1.00 0.00 ? 46  ALA A C    2  
ATOM 2921  O O    . ALA A 1 46  ? 8.915   -4.727  -3.944  1.00 0.00 ? 46  ALA A O    2  
ATOM 2922  C CB   . ALA A 1 46  ? 7.516   -1.930  -4.793  1.00 0.00 ? 46  ALA A CB   2  
ATOM 2923  H H    . ALA A 1 46  ? 5.293   -2.480  -3.684  1.00 0.00 ? 46  ALA A H    2  
ATOM 2924  H HA   . ALA A 1 46  ? 7.034   -3.897  -5.448  1.00 0.00 ? 46  ALA A HA   2  
ATOM 2925  H HB1  . ALA A 1 46  ? 6.851   -1.454  -5.498  1.00 0.00 ? 46  ALA A HB1  2  
ATOM 2926  H HB2  . ALA A 1 46  ? 8.514   -1.963  -5.208  1.00 0.00 ? 46  ALA A HB2  2  
ATOM 2927  H HB3  . ALA A 1 46  ? 7.528   -1.364  -3.873  1.00 0.00 ? 46  ALA A HB3  2  
ATOM 2928  N N    . CYS A 1 47  ? 7.710   -3.891  -2.229  1.00 0.00 ? 47  CYS A N    2  
ATOM 2929  C CA   . CYS A 1 47  ? 8.556   -4.504  -1.206  1.00 0.00 ? 47  CYS A CA   2  
ATOM 2930  C C    . CYS A 1 47  ? 8.335   -6.016  -1.164  1.00 0.00 ? 47  CYS A C    2  
ATOM 2931  O O    . CYS A 1 47  ? 9.208   -6.767  -0.712  1.00 0.00 ? 47  CYS A O    2  
ATOM 2932  C CB   . CYS A 1 47  ? 8.306   -3.886  0.176   1.00 0.00 ? 47  CYS A CB   2  
ATOM 2933  S SG   . CYS A 1 47  ? 6.722   -4.324  0.918   1.00 0.00 ? 47  CYS A SG   2  
ATOM 2934  H H    . CYS A 1 47  ? 6.939   -3.347  -1.955  1.00 0.00 ? 47  CYS A H    2  
ATOM 2935  H HA   . CYS A 1 47  ? 9.585   -4.318  -1.484  1.00 0.00 ? 47  CYS A HA   2  
ATOM 2936  H HB2  . CYS A 1 47  ? 9.082   -4.212  0.855   1.00 0.00 ? 47  CYS A HB2  2  
ATOM 2937  H HB3  . CYS A 1 47  ? 8.341   -2.809  0.092   1.00 0.00 ? 47  CYS A HB3  2  
ATOM 2938  H HG   . CYS A 1 47  ? 6.962   -4.897  2.088   1.00 0.00 ? 47  CYS A HG   2  
ATOM 2939  N N    . GLU A 1 48  ? 7.166   -6.464  -1.629  1.00 0.00 ? 48  GLU A N    2  
ATOM 2940  C CA   . GLU A 1 48  ? 6.928   -7.892  -1.818  1.00 0.00 ? 48  GLU A CA   2  
ATOM 2941  C C    . GLU A 1 48  ? 7.807   -8.398  -2.952  1.00 0.00 ? 48  GLU A C    2  
ATOM 2942  O O    . GLU A 1 48  ? 8.551   -9.363  -2.791  1.00 0.00 ? 48  GLU A O    2  
ATOM 2943  C CB   . GLU A 1 48  ? 5.457   -8.197  -2.133  1.00 0.00 ? 48  GLU A CB   2  
ATOM 2944  C CG   . GLU A 1 48  ? 5.201   -9.686  -2.363  1.00 0.00 ? 48  GLU A CG   2  
ATOM 2945  C CD   . GLU A 1 48  ? 3.799   -9.990  -2.860  1.00 0.00 ? 48  GLU A CD   2  
ATOM 2946  O OE1  . GLU A 1 48  ? 2.884   -10.136 -2.023  1.00 0.00 ? 48  GLU A OE1  2  
ATOM 2947  O OE2  . GLU A 1 48  ? 3.613   -10.111 -4.092  1.00 0.00 ? 48  GLU A OE2  2  
ATOM 2948  H H    . GLU A 1 48  ? 6.450   -5.823  -1.835  1.00 0.00 ? 48  GLU A H    2  
ATOM 2949  H HA   . GLU A 1 48  ? 7.207   -8.400  -0.902  1.00 0.00 ? 48  GLU A HA   2  
ATOM 2950  H HB2  . GLU A 1 48  ? 4.844   -7.866  -1.307  1.00 0.00 ? 48  GLU A HB2  2  
ATOM 2951  H HB3  . GLU A 1 48  ? 5.170   -7.658  -3.024  1.00 0.00 ? 48  GLU A HB3  2  
ATOM 2952  H HG2  . GLU A 1 48  ? 5.910   -10.050 -3.095  1.00 0.00 ? 48  GLU A HG2  2  
ATOM 2953  H HG3  . GLU A 1 48  ? 5.358   -10.211 -1.429  1.00 0.00 ? 48  GLU A HG3  2  
ATOM 2954  N N    . ASP A 1 49  ? 7.724   -7.721  -4.096  1.00 0.00 ? 49  ASP A N    2  
ATOM 2955  C CA   . ASP A 1 49  ? 8.572   -8.032  -5.250  1.00 0.00 ? 49  ASP A CA   2  
ATOM 2956  C C    . ASP A 1 49  ? 10.050  -7.968  -4.856  1.00 0.00 ? 49  ASP A C    2  
ATOM 2957  O O    . ASP A 1 49  ? 10.898  -8.650  -5.435  1.00 0.00 ? 49  ASP A O    2  
ATOM 2958  C CB   . ASP A 1 49  ? 8.280   -7.054  -6.400  1.00 0.00 ? 49  ASP A CB   2  
ATOM 2959  C CG   . ASP A 1 49  ? 9.278   -7.169  -7.546  1.00 0.00 ? 49  ASP A CG   2  
ATOM 2960  O OD1  . ASP A 1 49  ? 9.206   -8.146  -8.316  1.00 0.00 ? 49  ASP A OD1  2  
ATOM 2961  O OD2  . ASP A 1 49  ? 10.153  -6.285  -7.669  1.00 0.00 ? 49  ASP A OD2  2  
ATOM 2962  H H    . ASP A 1 49  ? 7.071   -6.991  -4.171  1.00 0.00 ? 49  ASP A H    2  
ATOM 2963  H HA   . ASP A 1 49  ? 8.339   -9.038  -5.573  1.00 0.00 ? 49  ASP A HA   2  
ATOM 2964  H HB2  . ASP A 1 49  ? 7.290   -7.254  -6.789  1.00 0.00 ? 49  ASP A HB2  2  
ATOM 2965  H HB3  . ASP A 1 49  ? 8.308   -6.042  -6.018  1.00 0.00 ? 49  ASP A HB3  2  
ATOM 2966  N N    . PHE A 1 50  ? 10.338  -7.145  -3.851  1.00 0.00 ? 50  PHE A N    2  
ATOM 2967  C CA   . PHE A 1 50  ? 11.689  -6.996  -3.323  1.00 0.00 ? 50  PHE A CA   2  
ATOM 2968  C C    . PHE A 1 50  ? 12.130  -8.260  -2.580  1.00 0.00 ? 50  PHE A C    2  
ATOM 2969  O O    . PHE A 1 50  ? 13.204  -8.796  -2.845  1.00 0.00 ? 50  PHE A O    2  
ATOM 2970  C CB   . PHE A 1 50  ? 11.753  -5.767  -2.405  1.00 0.00 ? 50  PHE A CB   2  
ATOM 2971  C CG   . PHE A 1 50  ? 13.086  -5.550  -1.740  1.00 0.00 ? 50  PHE A CG   2  
ATOM 2972  C CD1  . PHE A 1 50  ? 14.226  -5.335  -2.496  1.00 0.00 ? 50  PHE A CD1  2  
ATOM 2973  C CD2  . PHE A 1 50  ? 13.197  -5.562  -0.357  1.00 0.00 ? 50  PHE A CD2  2  
ATOM 2974  C CE1  . PHE A 1 50  ? 15.447  -5.136  -1.887  1.00 0.00 ? 50  PHE A CE1  2  
ATOM 2975  C CE2  . PHE A 1 50  ? 14.418  -5.364  0.256   1.00 0.00 ? 50  PHE A CE2  2  
ATOM 2976  C CZ   . PHE A 1 50  ? 15.545  -5.150  -0.511  1.00 0.00 ? 50  PHE A CZ   2  
ATOM 2977  H H    . PHE A 1 50  ? 9.617   -6.611  -3.459  1.00 0.00 ? 50  PHE A H    2  
ATOM 2978  H HA   . PHE A 1 50  ? 12.352  -6.842  -4.162  1.00 0.00 ? 50  PHE A HA   2  
ATOM 2979  H HB2  . PHE A 1 50  ? 11.531  -4.883  -2.987  1.00 0.00 ? 50  PHE A HB2  2  
ATOM 2980  H HB3  . PHE A 1 50  ? 11.005  -5.869  -1.630  1.00 0.00 ? 50  PHE A HB3  2  
ATOM 2981  H HD1  . PHE A 1 50  ? 14.154  -5.323  -3.574  1.00 0.00 ? 50  PHE A HD1  2  
ATOM 2982  H HD2  . PHE A 1 50  ? 12.315  -5.732  0.245   1.00 0.00 ? 50  PHE A HD2  2  
ATOM 2983  H HE1  . PHE A 1 50  ? 16.328  -4.969  -2.486  1.00 0.00 ? 50  PHE A HE1  2  
ATOM 2984  H HE2  . PHE A 1 50  ? 14.489  -5.375  1.334   1.00 0.00 ? 50  PHE A HE2  2  
ATOM 2985  H HZ   . PHE A 1 50  ? 16.501  -4.994  -0.035  1.00 0.00 ? 50  PHE A HZ   2  
ATOM 2986  N N    . LYS A 1 51  ? 11.294  -8.743  -1.662  1.00 0.00 ? 51  LYS A N    2  
ATOM 2987  C CA   . LYS A 1 51  ? 11.608  -9.965  -0.914  1.00 0.00 ? 51  LYS A CA   2  
ATOM 2988  C C    . LYS A 1 51  ? 11.470  -11.188 -1.821  1.00 0.00 ? 51  LYS A C    2  
ATOM 2989  O O    . LYS A 1 51  ? 12.029  -12.254 -1.548  1.00 0.00 ? 51  LYS A O    2  
ATOM 2990  C CB   . LYS A 1 51  ? 10.683  -10.117 0.307   1.00 0.00 ? 51  LYS A CB   2  
ATOM 2991  C CG   . LYS A 1 51  ? 9.234   -10.437 -0.054  1.00 0.00 ? 51  LYS A CG   2  
ATOM 2992  C CD   . LYS A 1 51  ? 8.366   -10.700 1.176   1.00 0.00 ? 51  LYS A CD   2  
ATOM 2993  C CE   . LYS A 1 51  ? 6.962   -11.134 0.770   1.00 0.00 ? 51  LYS A CE   2  
ATOM 2994  N NZ   . LYS A 1 51  ? 6.086   -11.411 1.940   1.00 0.00 ? 51  LYS A NZ   2  
ATOM 2995  H H    . LYS A 1 51  ? 10.450  -8.276  -1.487  1.00 0.00 ? 51  LYS A H    2  
ATOM 2996  H HA   . LYS A 1 51  ? 12.633  -9.894  -0.575  1.00 0.00 ? 51  LYS A HA   2  
ATOM 2997  H HB2  . LYS A 1 51  ? 11.061  -10.914 0.932   1.00 0.00 ? 51  LYS A HB2  2  
ATOM 2998  H HB3  . LYS A 1 51  ? 10.697  -9.195  0.871   1.00 0.00 ? 51  LYS A HB3  2  
ATOM 2999  H HG2  . LYS A 1 51  ? 8.820   -9.602  -0.599  1.00 0.00 ? 51  LYS A HG2  2  
ATOM 3000  H HG3  . LYS A 1 51  ? 9.220   -11.315 -0.685  1.00 0.00 ? 51  LYS A HG3  2  
ATOM 3001  H HD2  . LYS A 1 51  ? 8.820   -11.482 1.770   1.00 0.00 ? 51  LYS A HD2  2  
ATOM 3002  H HD3  . LYS A 1 51  ? 8.299   -9.794  1.762   1.00 0.00 ? 51  LYS A HD3  2  
ATOM 3003  H HE2  . LYS A 1 51  ? 6.514   -10.351 0.178   1.00 0.00 ? 51  LYS A HE2  2  
ATOM 3004  H HE3  . LYS A 1 51  ? 7.040   -12.031 0.172   1.00 0.00 ? 51  LYS A HE3  2  
ATOM 3005  H HZ1  . LYS A 1 51  ? 5.143   -11.714 1.617   1.00 0.00 ? 51  LYS A HZ1  2  
ATOM 3006  H HZ2  . LYS A 1 51  ? 5.978   -10.557 2.518   1.00 0.00 ? 51  LYS A HZ2  2  
ATOM 3007  H HZ3  . LYS A 1 51  ? 6.494   -12.166 2.529   1.00 0.00 ? 51  LYS A HZ3  2  
ATOM 3008  N N    . LYS A 1 52  ? 10.709  -11.014 -2.898  1.00 0.00 ? 52  LYS A N    2  
ATOM 3009  C CA   . LYS A 1 52  ? 10.415  -12.088 -3.836  1.00 0.00 ? 52  LYS A CA   2  
ATOM 3010  C C    . LYS A 1 52  ? 11.627  -12.393 -4.715  1.00 0.00 ? 52  LYS A C    2  
ATOM 3011  O O    . LYS A 1 52  ? 11.904  -13.555 -5.020  1.00 0.00 ? 52  LYS A O    2  
ATOM 3012  C CB   . LYS A 1 52  ? 9.204   -11.697 -4.692  1.00 0.00 ? 52  LYS A CB   2  
ATOM 3013  C CG   . LYS A 1 52  ? 8.750   -12.771 -5.673  1.00 0.00 ? 52  LYS A CG   2  
ATOM 3014  C CD   . LYS A 1 52  ? 7.424   -12.404 -6.342  1.00 0.00 ? 52  LYS A CD   2  
ATOM 3015  C CE   . LYS A 1 52  ? 6.310   -12.209 -5.315  1.00 0.00 ? 52  LYS A CE   2  
ATOM 3016  N NZ   . LYS A 1 52  ? 5.017   -11.839 -5.950  1.00 0.00 ? 52  LYS A NZ   2  
ATOM 3017  H H    . LYS A 1 52  ? 10.327  -10.128 -3.064  1.00 0.00 ? 52  LYS A H    2  
ATOM 3018  H HA   . LYS A 1 52  ? 10.169  -12.972 -3.264  1.00 0.00 ? 52  LYS A HA   2  
ATOM 3019  H HB2  . LYS A 1 52  ? 8.374   -11.474 -4.030  1.00 0.00 ? 52  LYS A HB2  2  
ATOM 3020  H HB3  . LYS A 1 52  ? 9.452   -10.805 -5.255  1.00 0.00 ? 52  LYS A HB3  2  
ATOM 3021  H HG2  . LYS A 1 52  ? 9.507   -12.884 -6.437  1.00 0.00 ? 52  LYS A HG2  2  
ATOM 3022  H HG3  . LYS A 1 52  ? 8.631   -13.706 -5.142  1.00 0.00 ? 52  LYS A HG3  2  
ATOM 3023  H HD2  . LYS A 1 52  ? 7.552   -11.485 -6.896  1.00 0.00 ? 52  LYS A HD2  2  
ATOM 3024  H HD3  . LYS A 1 52  ? 7.142   -13.197 -7.019  1.00 0.00 ? 52  LYS A HD3  2  
ATOM 3025  H HE2  . LYS A 1 52  ? 6.177   -13.129 -4.765  1.00 0.00 ? 52  LYS A HE2  2  
ATOM 3026  H HE3  . LYS A 1 52  ? 6.601   -11.424 -4.630  1.00 0.00 ? 52  LYS A HE3  2  
ATOM 3027  H HZ1  . LYS A 1 52  ? 4.701   -12.597 -6.587  1.00 0.00 ? 52  LYS A HZ1  2  
ATOM 3028  H HZ2  . LYS A 1 52  ? 5.125   -10.962 -6.496  1.00 0.00 ? 52  LYS A HZ2  2  
ATOM 3029  H HZ3  . LYS A 1 52  ? 4.290   -11.691 -5.219  1.00 0.00 ? 52  LYS A HZ3  2  
ATOM 3030  N N    . SER A 1 53  ? 12.351  -11.349 -5.113  1.00 0.00 ? 53  SER A N    2  
ATOM 3031  C CA   . SER A 1 53  ? 13.572  -11.525 -5.890  1.00 0.00 ? 53  SER A CA   2  
ATOM 3032  C C    . SER A 1 53  ? 14.615  -12.288 -5.074  1.00 0.00 ? 53  SER A C    2  
ATOM 3033  O O    . SER A 1 53  ? 14.903  -11.937 -3.929  1.00 0.00 ? 53  SER A O    2  
ATOM 3034  C CB   . SER A 1 53  ? 14.113  -10.166 -6.353  1.00 0.00 ? 53  SER A CB   2  
ATOM 3035  O OG   . SER A 1 53  ? 13.879  -9.154  -5.386  1.00 0.00 ? 53  SER A OG   2  
ATOM 3036  H H    . SER A 1 53  ? 12.061  -10.444 -4.877  1.00 0.00 ? 53  SER A H    2  
ATOM 3037  H HA   . SER A 1 53  ? 13.320  -12.114 -6.762  1.00 0.00 ? 53  SER A HA   2  
ATOM 3038  H HB2  . SER A 1 53  ? 15.177  -10.239 -6.525  1.00 0.00 ? 53  SER A HB2  2  
ATOM 3039  H HB3  . SER A 1 53  ? 13.623  -9.881  -7.273  1.00 0.00 ? 53  SER A HB3  2  
ATOM 3040  H HG   . SER A 1 53  ? 14.111  -9.487  -4.506  1.00 0.00 ? 53  SER A HG   2  
ATOM 3041  N N    . LYS A 1 54  ? 15.162  -13.343 -5.668  1.00 0.00 ? 54  LYS A N    2  
ATOM 3042  C CA   . LYS A 1 54  ? 16.089  -14.238 -4.976  1.00 0.00 ? 54  LYS A CA   2  
ATOM 3043  C C    . LYS A 1 54  ? 17.534  -13.957 -5.381  1.00 0.00 ? 54  LYS A C    2  
ATOM 3044  O O    . LYS A 1 54  ? 18.464  -14.597 -4.882  1.00 0.00 ? 54  LYS A O    2  
ATOM 3045  C CB   . LYS A 1 54  ? 15.702  -15.704 -5.257  1.00 0.00 ? 54  LYS A CB   2  
ATOM 3046  C CG   . LYS A 1 54  ? 15.618  -16.075 -6.744  1.00 0.00 ? 54  LYS A CG   2  
ATOM 3047  C CD   . LYS A 1 54  ? 16.958  -16.550 -7.312  1.00 0.00 ? 54  LYS A CD   2  
ATOM 3048  C CE   . LYS A 1 54  ? 17.422  -17.847 -6.652  1.00 0.00 ? 54  LYS A CE   2  
ATOM 3049  N NZ   . LYS A 1 54  ? 16.420  -18.936 -6.797  1.00 0.00 ? 54  LYS A NZ   2  
ATOM 3050  H H    . LYS A 1 54  ? 14.939  -13.523 -6.607  1.00 0.00 ? 54  LYS A H    2  
ATOM 3051  H HA   . LYS A 1 54  ? 15.994  -14.055 -3.914  1.00 0.00 ? 54  LYS A HA   2  
ATOM 3052  H HB2  . LYS A 1 54  ? 16.431  -16.350 -4.787  1.00 0.00 ? 54  LYS A HB2  2  
ATOM 3053  H HB3  . LYS A 1 54  ? 14.735  -15.895 -4.809  1.00 0.00 ? 54  LYS A HB3  2  
ATOM 3054  H HG2  . LYS A 1 54  ? 14.892  -16.867 -6.866  1.00 0.00 ? 54  LYS A HG2  2  
ATOM 3055  H HG3  . LYS A 1 54  ? 15.291  -15.207 -7.301  1.00 0.00 ? 54  LYS A HG3  2  
ATOM 3056  H HD2  . LYS A 1 54  ? 16.849  -16.719 -8.374  1.00 0.00 ? 54  LYS A HD2  2  
ATOM 3057  H HD3  . LYS A 1 54  ? 17.702  -15.784 -7.145  1.00 0.00 ? 54  LYS A HD3  2  
ATOM 3058  H HE2  . LYS A 1 54  ? 18.348  -18.160 -7.112  1.00 0.00 ? 54  LYS A HE2  2  
ATOM 3059  H HE3  . LYS A 1 54  ? 17.591  -17.661 -5.600  1.00 0.00 ? 54  LYS A HE3  2  
ATOM 3060  H HZ1  . LYS A 1 54  ? 16.737  -19.787 -6.286  1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 3061  H HZ2  . LYS A 1 54  ? 16.293  -19.178 -7.801  1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 3062  H HZ3  . LYS A 1 54  ? 15.505  -18.636 -6.408  1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 3063  N N    . GLY A 1 55  ? 17.713  -13.005 -6.292  1.00 0.00 ? 55  GLY A N    2  
ATOM 3064  C CA   . GLY A 1 55  ? 19.044  -12.616 -6.718  1.00 0.00 ? 55  GLY A CA   2  
ATOM 3065  C C    . GLY A 1 55  ? 19.623  -11.520 -5.836  1.00 0.00 ? 55  GLY A C    2  
ATOM 3066  O O    . GLY A 1 55  ? 19.090  -10.409 -5.812  1.00 0.00 ? 55  GLY A O    2  
ATOM 3067  H H    . GLY A 1 55  ? 16.930  -12.560 -6.679  1.00 0.00 ? 55  GLY A H    2  
ATOM 3068  H HA2  . GLY A 1 55  ? 19.695  -13.479 -6.693  1.00 0.00 ? 55  GLY A HA2  2  
ATOM 3069  H HA3  . GLY A 1 55  ? 18.991  -12.251 -7.733  1.00 0.00 ? 55  GLY A HA3  2  
ATOM 3070  N N    . PRO A 1 56  ? 20.715  -11.802 -5.091  1.00 0.00 ? 56  PRO A N    2  
ATOM 3071  C CA   . PRO A 1 56  ? 21.341  -10.822 -4.186  1.00 0.00 ? 56  PRO A CA   2  
ATOM 3072  C C    . PRO A 1 56  ? 21.684  -9.511  -4.895  1.00 0.00 ? 56  PRO A C    2  
ATOM 3073  O O    . PRO A 1 56  ? 21.613  -8.430  -4.305  1.00 0.00 ? 56  PRO A O    2  
ATOM 3074  C CB   . PRO A 1 56  ? 22.618  -11.535 -3.714  1.00 0.00 ? 56  PRO A CB   2  
ATOM 3075  C CG   . PRO A 1 56  ? 22.309  -12.987 -3.855  1.00 0.00 ? 56  PRO A CG   2  
ATOM 3076  C CD   . PRO A 1 56  ? 21.421  -13.100 -5.065  1.00 0.00 ? 56  PRO A CD   2  
ATOM 3077  H HA   . PRO A 1 56  ? 20.707  -10.613 -3.335  1.00 0.00 ? 56  PRO A HA   2  
ATOM 3078  H HB2  . PRO A 1 56  ? 23.454  -11.246 -4.339  1.00 0.00 ? 56  PRO A HB2  2  
ATOM 3079  H HB3  . PRO A 1 56  ? 22.824  -11.272 -2.686  1.00 0.00 ? 56  PRO A HB3  2  
ATOM 3080  H HG2  . PRO A 1 56  ? 23.224  -13.547 -4.002  1.00 0.00 ? 56  PRO A HG2  2  
ATOM 3081  H HG3  . PRO A 1 56  ? 21.791  -13.342 -2.974  1.00 0.00 ? 56  PRO A HG3  2  
ATOM 3082  H HD2  . PRO A 1 56  ? 22.014  -13.233 -5.961  1.00 0.00 ? 56  PRO A HD2  2  
ATOM 3083  H HD3  . PRO A 1 56  ? 20.723  -13.917 -4.950  1.00 0.00 ? 56  PRO A HD3  2  
ATOM 3084  N N    . GLN A 1 57  ? 22.051  -9.618  -6.169  1.00 0.00 ? 57  GLN A N    2  
ATOM 3085  C CA   . GLN A 1 57  ? 22.373  -8.448  -6.981  1.00 0.00 ? 57  GLN A CA   2  
ATOM 3086  C C    . GLN A 1 57  ? 21.122  -7.594  -7.167  1.00 0.00 ? 57  GLN A C    2  
ATOM 3087  O O    . GLN A 1 57  ? 21.137  -6.381  -6.934  1.00 0.00 ? 57  GLN A O    2  
ATOM 3088  C CB   . GLN A 1 57  ? 22.914  -8.885  -8.349  1.00 0.00 ? 57  GLN A CB   2  
ATOM 3089  C CG   . GLN A 1 57  ? 24.052  -9.900  -8.268  1.00 0.00 ? 57  GLN A CG   2  
ATOM 3090  C CD   . GLN A 1 57  ? 24.455  -10.433 -9.632  1.00 0.00 ? 57  GLN A CD   2  
ATOM 3091  O OE1  . GLN A 1 57  ? 24.352  -9.733  -10.640 1.00 0.00 ? 57  GLN A OE1  2  
ATOM 3092  N NE2  . GLN A 1 57  ? 24.907  -11.675 -9.676  1.00 0.00 ? 57  GLN A NE2  2  
ATOM 3093  H H    . GLN A 1 57  ? 22.094  -10.507 -6.577  1.00 0.00 ? 57  GLN A H    2  
ATOM 3094  H HA   . GLN A 1 57  ? 23.128  -7.870  -6.463  1.00 0.00 ? 57  GLN A HA   2  
ATOM 3095  H HB2  . GLN A 1 57  ? 22.107  -9.326  -8.919  1.00 0.00 ? 57  GLN A HB2  2  
ATOM 3096  H HB3  . GLN A 1 57  ? 23.277  -8.014  -8.876  1.00 0.00 ? 57  GLN A HB3  2  
ATOM 3097  H HG2  . GLN A 1 57  ? 24.910  -9.427  -7.816  1.00 0.00 ? 57  GLN A HG2  2  
ATOM 3098  H HG3  . GLN A 1 57  ? 23.733  -10.732 -7.652  1.00 0.00 ? 57  GLN A HG3  2  
ATOM 3099  H HE21 . GLN A 1 57  ? 24.957  -12.182 -8.837  1.00 0.00 ? 57  GLN A HE21 2  
ATOM 3100  H HE22 . GLN A 1 57  ? 25.165  -12.044 -10.549 1.00 0.00 ? 57  GLN A HE22 2  
ATOM 3101  N N    . GLN A 1 58  ? 20.037  -8.262  -7.563  1.00 0.00 ? 58  GLN A N    2  
ATOM 3102  C CA   . GLN A 1 58  ? 18.745  -7.617  -7.786  1.00 0.00 ? 58  GLN A CA   2  
ATOM 3103  C C    . GLN A 1 58  ? 18.258  -6.937  -6.508  1.00 0.00 ? 58  GLN A C    2  
ATOM 3104  O O    . GLN A 1 58  ? 17.700  -5.845  -6.554  1.00 0.00 ? 58  GLN A O    2  
ATOM 3105  C CB   . GLN A 1 58  ? 17.722  -8.663  -8.264  1.00 0.00 ? 58  GLN A CB   2  
ATOM 3106  C CG   . GLN A 1 58  ? 16.324  -8.114  -8.538  1.00 0.00 ? 58  GLN A CG   2  
ATOM 3107  C CD   . GLN A 1 58  ? 16.293  -7.066  -9.641  1.00 0.00 ? 58  GLN A CD   2  
ATOM 3108  O OE1  . GLN A 1 58  ? 16.416  -5.868  -9.383  1.00 0.00 ? 58  GLN A OE1  2  
ATOM 3109  N NE2  . GLN A 1 58  ? 16.130  -7.512  -10.876 1.00 0.00 ? 58  GLN A NE2  2  
ATOM 3110  H H    . GLN A 1 58  ? 20.110  -9.229  -7.710  1.00 0.00 ? 58  GLN A H    2  
ATOM 3111  H HA   . GLN A 1 58  ? 18.872  -6.870  -8.556  1.00 0.00 ? 58  GLN A HA   2  
ATOM 3112  H HB2  . GLN A 1 58  ? 18.089  -9.113  -9.176  1.00 0.00 ? 58  GLN A HB2  2  
ATOM 3113  H HB3  . GLN A 1 58  ? 17.638  -9.435  -7.510  1.00 0.00 ? 58  GLN A HB3  2  
ATOM 3114  H HG2  . GLN A 1 58  ? 15.680  -8.933  -8.827  1.00 0.00 ? 58  GLN A HG2  2  
ATOM 3115  H HG3  . GLN A 1 58  ? 15.942  -7.671  -7.628  1.00 0.00 ? 58  GLN A HG3  2  
ATOM 3116  H HE21 . GLN A 1 58  ? 16.041  -8.479  -11.013 1.00 0.00 ? 58  GLN A HE21 2  
ATOM 3117  H HE22 . GLN A 1 58  ? 16.093  -6.857  -11.606 1.00 0.00 ? 58  GLN A HE22 2  
ATOM 3118  N N    . ILE A 1 59  ? 18.494  -7.587  -5.370  1.00 0.00 ? 59  ILE A N    2  
ATOM 3119  C CA   . ILE A 1 59  ? 18.104  -7.045  -4.068  1.00 0.00 ? 59  ILE A CA   2  
ATOM 3120  C C    . ILE A 1 59  ? 18.674  -5.639  -3.865  1.00 0.00 ? 59  ILE A C    2  
ATOM 3121  O O    . ILE A 1 59  ? 17.937  -4.693  -3.589  1.00 0.00 ? 59  ILE A O    2  
ATOM 3122  C CB   . ILE A 1 59  ? 18.581  -7.966  -2.908  1.00 0.00 ? 59  ILE A CB   2  
ATOM 3123  C CG1  . ILE A 1 59  ? 17.895  -9.342  -2.988  1.00 0.00 ? 59  ILE A CG1  2  
ATOM 3124  C CG2  . ILE A 1 59  ? 18.329  -7.317  -1.544  1.00 0.00 ? 59  ILE A CG2  2  
ATOM 3125  C CD1  . ILE A 1 59  ? 16.389  -9.289  -2.836  1.00 0.00 ? 59  ILE A CD1  2  
ATOM 3126  H H    . ILE A 1 59  ? 18.936  -8.462  -5.409  1.00 0.00 ? 59  ILE A H    2  
ATOM 3127  H HA   . ILE A 1 59  ? 17.023  -6.993  -4.039  1.00 0.00 ? 59  ILE A HA   2  
ATOM 3128  H HB   . ILE A 1 59  ? 19.649  -8.104  -3.013  1.00 0.00 ? 59  ILE A HB   2  
ATOM 3129  H HG12 . ILE A 1 59  ? 18.112  -9.790  -3.948  1.00 0.00 ? 59  ILE A HG12 2  
ATOM 3130  H HG13 . ILE A 1 59  ? 18.286  -9.977  -2.206  1.00 0.00 ? 59  ILE A HG13 2  
ATOM 3131  H HG21 . ILE A 1 59  ? 18.647  -7.989  -0.760  1.00 0.00 ? 59  ILE A HG21 2  
ATOM 3132  H HG22 . ILE A 1 59  ? 17.275  -7.106  -1.431  1.00 0.00 ? 59  ILE A HG22 2  
ATOM 3133  H HG23 . ILE A 1 59  ? 18.888  -6.394  -1.474  1.00 0.00 ? 59  ILE A HG23 2  
ATOM 3134  H HD11 . ILE A 1 59  ? 15.985  -10.288 -2.907  1.00 0.00 ? 59  ILE A HD11 2  
ATOM 3135  H HD12 . ILE A 1 59  ? 15.967  -8.674  -3.617  1.00 0.00 ? 59  ILE A HD12 2  
ATOM 3136  H HD13 . ILE A 1 59  ? 16.139  -8.869  -1.873  1.00 0.00 ? 59  ILE A HD13 2  
ATOM 3137  N N    . HIS A 1 60  ? 19.987  -5.506  -4.027  1.00 0.00 ? 60  HIS A N    2  
ATOM 3138  C CA   . HIS A 1 60  ? 20.665  -4.232  -3.784  1.00 0.00 ? 60  HIS A CA   2  
ATOM 3139  C C    . HIS A 1 60  ? 20.181  -3.151  -4.752  1.00 0.00 ? 60  HIS A C    2  
ATOM 3140  O O    . HIS A 1 60  ? 19.861  -2.034  -4.339  1.00 0.00 ? 60  HIS A O    2  
ATOM 3141  C CB   . HIS A 1 60  ? 22.187  -4.395  -3.892  1.00 0.00 ? 60  HIS A CB   2  
ATOM 3142  C CG   . HIS A 1 60  ? 22.799  -5.159  -2.753  1.00 0.00 ? 60  HIS A CG   2  
ATOM 3143  N ND1  . HIS A 1 60  ? 23.790  -4.642  -1.949  1.00 0.00 ? 60  HIS A ND1  2  
ATOM 3144  C CD2  . HIS A 1 60  ? 22.563  -6.410  -2.292  1.00 0.00 ? 60  HIS A CD2  2  
ATOM 3145  C CE1  . HIS A 1 60  ? 24.136  -5.540  -1.047  1.00 0.00 ? 60  HIS A CE1  2  
ATOM 3146  N NE2  . HIS A 1 60  ? 23.408  -6.623  -1.232  1.00 0.00 ? 60  HIS A NE2  2  
ATOM 3147  H H    . HIS A 1 60  ? 20.510  -6.280  -4.330  1.00 0.00 ? 60  HIS A H    2  
ATOM 3148  H HA   . HIS A 1 60  ? 20.418  -3.922  -2.777  1.00 0.00 ? 60  HIS A HA   2  
ATOM 3149  H HB2  . HIS A 1 60  ? 22.423  -4.920  -4.804  1.00 0.00 ? 60  HIS A HB2  2  
ATOM 3150  H HB3  . HIS A 1 60  ? 22.647  -3.416  -3.918  1.00 0.00 ? 60  HIS A HB3  2  
ATOM 3151  H HD1  . HIS A 1 60  ? 24.194  -3.749  -2.038  1.00 0.00 ? 60  HIS A HD1  2  
ATOM 3152  H HD2  . HIS A 1 60  ? 21.841  -7.111  -2.685  1.00 0.00 ? 60  HIS A HD2  2  
ATOM 3153  H HE1  . HIS A 1 60  ? 24.889  -5.409  -0.285  1.00 0.00 ? 60  HIS A HE1  2  
ATOM 3154  H HE2  . HIS A 1 60  ? 23.612  -7.502  -0.843  1.00 0.00 ? 60  HIS A HE2  2  
ATOM 3155  N N    . LEU A 1 61  ? 20.115  -3.497  -6.032  1.00 0.00 ? 61  LEU A N    2  
ATOM 3156  C CA   . LEU A 1 61  ? 19.742  -2.538  -7.070  1.00 0.00 ? 61  LEU A CA   2  
ATOM 3157  C C    . LEU A 1 61  ? 18.281  -2.115  -6.929  1.00 0.00 ? 61  LEU A C    2  
ATOM 3158  O O    . LEU A 1 61  ? 17.954  -0.931  -7.018  1.00 0.00 ? 61  LEU A O    2  
ATOM 3159  C CB   . LEU A 1 61  ? 19.993  -3.146  -8.456  1.00 0.00 ? 61  LEU A CB   2  
ATOM 3160  C CG   . LEU A 1 61  ? 21.448  -3.568  -8.726  1.00 0.00 ? 61  LEU A CG   2  
ATOM 3161  C CD1  . LEU A 1 61  ? 21.582  -4.203  -10.105 1.00 0.00 ? 61  LEU A CD1  2  
ATOM 3162  C CD2  . LEU A 1 61  ? 22.394  -2.374  -8.584  1.00 0.00 ? 61  LEU A CD2  2  
ATOM 3163  H H    . LEU A 1 61  ? 20.317  -4.422  -6.288  1.00 0.00 ? 61  LEU A H    2  
ATOM 3164  H HA   . LEU A 1 61  ? 20.369  -1.665  -6.954  1.00 0.00 ? 61  LEU A HA   2  
ATOM 3165  H HB2  . LEU A 1 61  ? 19.358  -4.015  -8.565  1.00 0.00 ? 61  LEU A HB2  2  
ATOM 3166  H HB3  . LEU A 1 61  ? 19.707  -2.419  -9.205  1.00 0.00 ? 61  LEU A HB3  2  
ATOM 3167  H HG   . LEU A 1 61  ? 21.739  -4.309  -7.994  1.00 0.00 ? 61  LEU A HG   2  
ATOM 3168  H HD11 . LEU A 1 61  ? 22.608  -4.503  -10.266 1.00 0.00 ? 61  LEU A HD11 2  
ATOM 3169  H HD12 . LEU A 1 61  ? 21.294  -3.488  -10.864 1.00 0.00 ? 61  LEU A HD12 2  
ATOM 3170  H HD13 . LEU A 1 61  ? 20.941  -5.070  -10.167 1.00 0.00 ? 61  LEU A HD13 2  
ATOM 3171  H HD21 . LEU A 1 61  ? 22.324  -1.977  -7.582  1.00 0.00 ? 61  LEU A HD21 2  
ATOM 3172  H HD22 . LEU A 1 61  ? 22.120  -1.609  -9.294  1.00 0.00 ? 61  LEU A HD22 2  
ATOM 3173  H HD23 . LEU A 1 61  ? 23.409  -2.695  -8.773  1.00 0.00 ? 61  LEU A HD23 2  
ATOM 3174  N N    . LYS A 1 62  ? 17.412  -3.089  -6.687  1.00 0.00 ? 62  LYS A N    2  
ATOM 3175  C CA   . LYS A 1 62  ? 15.981  -2.836  -6.554  1.00 0.00 ? 62  LYS A CA   2  
ATOM 3176  C C    . LYS A 1 62  ? 15.704  -1.957  -5.341  1.00 0.00 ? 62  LYS A C    2  
ATOM 3177  O O    . LYS A 1 62  ? 14.874  -1.051  -5.397  1.00 0.00 ? 62  LYS A O    2  
ATOM 3178  C CB   . LYS A 1 62  ? 15.217  -4.157  -6.427  1.00 0.00 ? 62  LYS A CB   2  
ATOM 3179  C CG   . LYS A 1 62  ? 13.704  -3.988  -6.349  1.00 0.00 ? 62  LYS A CG   2  
ATOM 3180  C CD   . LYS A 1 62  ? 12.997  -5.328  -6.186  1.00 0.00 ? 62  LYS A CD   2  
ATOM 3181  C CE   . LYS A 1 62  ? 13.307  -6.280  -7.333  1.00 0.00 ? 62  LYS A CE   2  
ATOM 3182  N NZ   . LYS A 1 62  ? 12.565  -7.558  -7.199  1.00 0.00 ? 62  LYS A NZ   2  
ATOM 3183  H H    . LYS A 1 62  ? 17.742  -4.006  -6.594  1.00 0.00 ? 62  LYS A H    2  
ATOM 3184  H HA   . LYS A 1 62  ? 15.650  -2.321  -7.444  1.00 0.00 ? 62  LYS A HA   2  
ATOM 3185  H HB2  . LYS A 1 62  ? 15.446  -4.774  -7.285  1.00 0.00 ? 62  LYS A HB2  2  
ATOM 3186  H HB3  . LYS A 1 62  ? 15.549  -4.667  -5.533  1.00 0.00 ? 62  LYS A HB3  2  
ATOM 3187  H HG2  . LYS A 1 62  ? 13.465  -3.362  -5.500  1.00 0.00 ? 62  LYS A HG2  2  
ATOM 3188  H HG3  . LYS A 1 62  ? 13.357  -3.514  -7.256  1.00 0.00 ? 62  LYS A HG3  2  
ATOM 3189  H HD2  . LYS A 1 62  ? 13.317  -5.783  -5.260  1.00 0.00 ? 62  LYS A HD2  2  
ATOM 3190  H HD3  . LYS A 1 62  ? 11.930  -5.157  -6.152  1.00 0.00 ? 62  LYS A HD3  2  
ATOM 3191  H HE2  . LYS A 1 62  ? 13.028  -5.809  -8.266  1.00 0.00 ? 62  LYS A HE2  2  
ATOM 3192  H HE3  . LYS A 1 62  ? 14.367  -6.488  -7.339  1.00 0.00 ? 62  LYS A HE3  2  
ATOM 3193  H HZ1  . LYS A 1 62  ? 11.540  -7.379  -7.209  1.00 0.00 ? 62  LYS A HZ1  2  
ATOM 3194  H HZ2  . LYS A 1 62  ? 12.814  -8.029  -6.304  1.00 0.00 ? 62  LYS A HZ2  2  
ATOM 3195  H HZ3  . LYS A 1 62  ? 12.800  -8.190  -7.987  1.00 0.00 ? 62  LYS A HZ3  2  
ATOM 3196  N N    . ALA A 1 63  ? 16.408  -2.230  -4.246  1.00 0.00 ? 63  ALA A N    2  
ATOM 3197  C CA   . ALA A 1 63  ? 16.269  -1.439  -3.028  1.00 0.00 ? 63  ALA A CA   2  
ATOM 3198  C C    . ALA A 1 63  ? 16.636  0.015   -3.294  1.00 0.00 ? 63  ALA A C    2  
ATOM 3199  O O    . ALA A 1 63  ? 15.970  0.934   -2.816  1.00 0.00 ? 63  ALA A O    2  
ATOM 3200  C CB   . ALA A 1 63  ? 17.145  -2.006  -1.921  1.00 0.00 ? 63  ALA A CB   2  
ATOM 3201  H H    . ALA A 1 63  ? 17.035  -2.984  -4.257  1.00 0.00 ? 63  ALA A H    2  
ATOM 3202  H HA   . ALA A 1 63  ? 15.238  -1.492  -2.707  1.00 0.00 ? 63  ALA A HA   2  
ATOM 3203  H HB1  . ALA A 1 63  ? 16.884  -3.040  -1.748  1.00 0.00 ? 63  ALA A HB1  2  
ATOM 3204  H HB2  . ALA A 1 63  ? 16.992  -1.441  -1.014  1.00 0.00 ? 63  ALA A HB2  2  
ATOM 3205  H HB3  . ALA A 1 63  ? 18.184  -1.944  -2.214  1.00 0.00 ? 63  ALA A HB3  2  
ATOM 3206  N N    . LYS A 1 64  ? 17.698  0.209   -4.072  1.00 0.00 ? 64  LYS A N    2  
ATOM 3207  C CA   . LYS A 1 64  ? 18.154  1.544   -4.441  1.00 0.00 ? 64  LYS A CA   2  
ATOM 3208  C C    . LYS A 1 64  ? 17.110  2.232   -5.322  1.00 0.00 ? 64  LYS A C    2  
ATOM 3209  O O    . LYS A 1 64  ? 16.865  3.433   -5.193  1.00 0.00 ? 64  LYS A O    2  
ATOM 3210  C CB   . LYS A 1 64  ? 19.507  1.462   -5.163  1.00 0.00 ? 64  LYS A CB   2  
ATOM 3211  C CG   . LYS A 1 64  ? 20.116  2.820   -5.496  1.00 0.00 ? 64  LYS A CG   2  
ATOM 3212  C CD   . LYS A 1 64  ? 21.531  2.684   -6.052  1.00 0.00 ? 64  LYS A CD   2  
ATOM 3213  C CE   . LYS A 1 64  ? 22.148  4.042   -6.366  1.00 0.00 ? 64  LYS A CE   2  
ATOM 3214  N NZ   . LYS A 1 64  ? 21.439  4.729   -7.480  1.00 0.00 ? 64  LYS A NZ   2  
ATOM 3215  H H    . LYS A 1 64  ? 18.190  -0.571  -4.408  1.00 0.00 ? 64  LYS A H    2  
ATOM 3216  H HA   . LYS A 1 64  ? 18.275  2.117   -3.530  1.00 0.00 ? 64  LYS A HA   2  
ATOM 3217  H HB2  . LYS A 1 64  ? 20.203  0.922   -4.537  1.00 0.00 ? 64  LYS A HB2  2  
ATOM 3218  H HB3  . LYS A 1 64  ? 19.374  0.917   -6.088  1.00 0.00 ? 64  LYS A HB3  2  
ATOM 3219  H HG2  . LYS A 1 64  ? 19.495  3.312   -6.233  1.00 0.00 ? 64  LYS A HG2  2  
ATOM 3220  H HG3  . LYS A 1 64  ? 20.149  3.420   -4.596  1.00 0.00 ? 64  LYS A HG3  2  
ATOM 3221  H HD2  . LYS A 1 64  ? 22.148  2.179   -5.323  1.00 0.00 ? 64  LYS A HD2  2  
ATOM 3222  H HD3  . LYS A 1 64  ? 21.495  2.097   -6.960  1.00 0.00 ? 64  LYS A HD3  2  
ATOM 3223  H HE2  . LYS A 1 64  ? 22.095  4.659   -5.479  1.00 0.00 ? 64  LYS A HE2  2  
ATOM 3224  H HE3  . LYS A 1 64  ? 23.184  3.899   -6.642  1.00 0.00 ? 64  LYS A HE3  2  
ATOM 3225  H HZ1  . LYS A 1 64  ? 20.435  4.850   -7.245  1.00 0.00 ? 64  LYS A HZ1  2  
ATOM 3226  H HZ2  . LYS A 1 64  ? 21.510  4.167   -8.354  1.00 0.00 ? 64  LYS A HZ2  2  
ATOM 3227  H HZ3  . LYS A 1 64  ? 21.858  5.665   -7.654  1.00 0.00 ? 64  LYS A HZ3  2  
ATOM 3228  N N    . ALA A 1 65  ? 16.487  1.453   -6.205  1.00 0.00 ? 65  ALA A N    2  
ATOM 3229  C CA   . ALA A 1 65  ? 15.416  1.959   -7.061  1.00 0.00 ? 65  ALA A CA   2  
ATOM 3230  C C    . ALA A 1 65  ? 14.235  2.432   -6.213  1.00 0.00 ? 65  ALA A C    2  
ATOM 3231  O O    . ALA A 1 65  ? 13.770  3.566   -6.350  1.00 0.00 ? 65  ALA A O    2  
ATOM 3232  C CB   . ALA A 1 65  ? 14.971  0.886   -8.054  1.00 0.00 ? 65  ALA A CB   2  
ATOM 3233  H H    . ALA A 1 65  ? 16.758  0.514   -6.285  1.00 0.00 ? 65  ALA A H    2  
ATOM 3234  H HA   . ALA A 1 65  ? 15.804  2.799   -7.623  1.00 0.00 ? 65  ALA A HA   2  
ATOM 3235  H HB1  . ALA A 1 65  ? 15.818  0.563   -8.642  1.00 0.00 ? 65  ALA A HB1  2  
ATOM 3236  H HB2  . ALA A 1 65  ? 14.213  1.292   -8.710  1.00 0.00 ? 65  ALA A HB2  2  
ATOM 3237  H HB3  . ALA A 1 65  ? 14.564  0.041   -7.515  1.00 0.00 ? 65  ALA A HB3  2  
ATOM 3238  N N    . ILE A 1 66  ? 13.769  1.560   -5.318  1.00 0.00 ? 66  ILE A N    2  
ATOM 3239  C CA   . ILE A 1 66  ? 12.670  1.883   -4.408  1.00 0.00 ? 66  ILE A CA   2  
ATOM 3240  C C    . ILE A 1 66  ? 13.043  3.088   -3.544  1.00 0.00 ? 66  ILE A C    2  
ATOM 3241  O O    . ILE A 1 66  ? 12.203  3.938   -3.233  1.00 0.00 ? 66  ILE A O    2  
ATOM 3242  C CB   . ILE A 1 66  ? 12.318  0.674   -3.495  1.00 0.00 ? 66  ILE A CB   2  
ATOM 3243  C CG1  . ILE A 1 66  ? 11.876  -0.531  -4.347  1.00 0.00 ? 66  ILE A CG1  2  
ATOM 3244  C CG2  . ILE A 1 66  ? 11.233  1.049   -2.481  1.00 0.00 ? 66  ILE A CG2  2  
ATOM 3245  C CD1  . ILE A 1 66  ? 11.581  -1.781  -3.539  1.00 0.00 ? 66  ILE A CD1  2  
ATOM 3246  H H    . ILE A 1 66  ? 14.182  0.672   -5.266  1.00 0.00 ? 66  ILE A H    2  
ATOM 3247  H HA   . ILE A 1 66  ? 11.801  2.130   -5.004  1.00 0.00 ? 66  ILE A HA   2  
ATOM 3248  H HB   . ILE A 1 66  ? 13.208  0.403   -2.941  1.00 0.00 ? 66  ILE A HB   2  
ATOM 3249  H HG12 . ILE A 1 66  ? 10.980  -0.272  -4.891  1.00 0.00 ? 66  ILE A HG12 2  
ATOM 3250  H HG13 . ILE A 1 66  ? 12.660  -0.771  -5.051  1.00 0.00 ? 66  ILE A HG13 2  
ATOM 3251  H HG21 . ILE A 1 66  ? 10.337  1.353   -3.004  1.00 0.00 ? 66  ILE A HG21 2  
ATOM 3252  H HG22 . ILE A 1 66  ? 11.581  1.863   -1.862  1.00 0.00 ? 66  ILE A HG22 2  
ATOM 3253  H HG23 . ILE A 1 66  ? 11.010  0.194   -1.857  1.00 0.00 ? 66  ILE A HG23 2  
ATOM 3254  H HD11 . ILE A 1 66  ? 11.280  -2.576  -4.206  1.00 0.00 ? 66  ILE A HD11 2  
ATOM 3255  H HD12 . ILE A 1 66  ? 10.784  -1.581  -2.837  1.00 0.00 ? 66  ILE A HD12 2  
ATOM 3256  H HD13 . ILE A 1 66  ? 12.468  -2.081  -3.001  1.00 0.00 ? 66  ILE A HD13 2  
ATOM 3257  N N    . TYR A 1 67  ? 14.317  3.156   -3.180  1.00 0.00 ? 67  TYR A N    2  
ATOM 3258  C CA   . TYR A 1 67  ? 14.843  4.256   -2.385  1.00 0.00 ? 67  TYR A CA   2  
ATOM 3259  C C    . TYR A 1 67  ? 14.616  5.589   -3.096  1.00 0.00 ? 67  TYR A C    2  
ATOM 3260  O O    . TYR A 1 67  ? 13.901  6.456   -2.596  1.00 0.00 ? 67  TYR A O    2  
ATOM 3261  C CB   . TYR A 1 67  ? 16.340  4.034   -2.126  1.00 0.00 ? 67  TYR A CB   2  
ATOM 3262  C CG   . TYR A 1 67  ? 17.008  5.118   -1.298  1.00 0.00 ? 67  TYR A CG   2  
ATOM 3263  C CD1  . TYR A 1 67  ? 16.827  5.175   0.079   1.00 0.00 ? 67  TYR A CD1  2  
ATOM 3264  C CD2  . TYR A 1 67  ? 17.830  6.073   -1.891  1.00 0.00 ? 67  TYR A CD2  2  
ATOM 3265  C CE1  . TYR A 1 67  ? 17.444  6.148   0.838   1.00 0.00 ? 67  TYR A CE1  2  
ATOM 3266  C CE2  . TYR A 1 67  ? 18.448  7.050   -1.135  1.00 0.00 ? 67  TYR A CE2  2  
ATOM 3267  C CZ   . TYR A 1 67  ? 18.253  7.083   0.228   1.00 0.00 ? 67  TYR A CZ   2  
ATOM 3268  O OH   . TYR A 1 67  ? 18.873  8.051   0.987   1.00 0.00 ? 67  TYR A OH   2  
ATOM 3269  H H    . TYR A 1 67  ? 14.926  2.437   -3.453  1.00 0.00 ? 67  TYR A H    2  
ATOM 3270  H HA   . TYR A 1 67  ? 14.318  4.266   -1.440  1.00 0.00 ? 67  TYR A HA   2  
ATOM 3271  H HB2  . TYR A 1 67  ? 16.469  3.096   -1.604  1.00 0.00 ? 67  TYR A HB2  2  
ATOM 3272  H HB3  . TYR A 1 67  ? 16.853  3.978   -3.076  1.00 0.00 ? 67  TYR A HB3  2  
ATOM 3273  H HD1  . TYR A 1 67  ? 16.192  4.443   0.558   1.00 0.00 ? 67  TYR A HD1  2  
ATOM 3274  H HD2  . TYR A 1 67  ? 17.980  6.044   -2.960  1.00 0.00 ? 67  TYR A HD2  2  
ATOM 3275  H HE1  . TYR A 1 67  ? 17.290  6.175   1.907   1.00 0.00 ? 67  TYR A HE1  2  
ATOM 3276  H HE2  . TYR A 1 67  ? 19.081  7.783   -1.615  1.00 0.00 ? 67  TYR A HE2  2  
ATOM 3277  H HH   . TYR A 1 67  ? 18.755  8.912   0.568   1.00 0.00 ? 67  TYR A HH   2  
ATOM 3278  N N    . GLU A 1 68  ? 15.197  5.720   -4.282  1.00 0.00 ? 68  GLU A N    2  
ATOM 3279  C CA   . GLU A 1 68  ? 15.166  6.975   -5.035  1.00 0.00 ? 68  GLU A CA   2  
ATOM 3280  C C    . GLU A 1 68  ? 13.767  7.283   -5.573  1.00 0.00 ? 68  GLU A C    2  
ATOM 3281  O O    . GLU A 1 68  ? 13.474  8.423   -5.945  1.00 0.00 ? 68  GLU A O    2  
ATOM 3282  C CB   . GLU A 1 68  ? 16.155  6.903   -6.202  1.00 0.00 ? 68  GLU A CB   2  
ATOM 3283  C CG   . GLU A 1 68  ? 17.590  6.613   -5.778  1.00 0.00 ? 68  GLU A CG   2  
ATOM 3284  C CD   . GLU A 1 68  ? 18.530  6.491   -6.964  1.00 0.00 ? 68  GLU A CD   2  
ATOM 3285  O OE1  . GLU A 1 68  ? 19.017  7.532   -7.452  1.00 0.00 ? 68  GLU A OE1  2  
ATOM 3286  O OE2  . GLU A 1 68  ? 18.784  5.359   -7.418  1.00 0.00 ? 68  GLU A OE2  2  
ATOM 3287  H H    . GLU A 1 68  ? 15.665  4.947   -4.670  1.00 0.00 ? 68  GLU A H    2  
ATOM 3288  H HA   . GLU A 1 68  ? 15.467  7.771   -4.369  1.00 0.00 ? 68  GLU A HA   2  
ATOM 3289  H HB2  . GLU A 1 68  ? 15.836  6.122   -6.880  1.00 0.00 ? 68  GLU A HB2  2  
ATOM 3290  H HB3  . GLU A 1 68  ? 16.141  7.850   -6.727  1.00 0.00 ? 68  GLU A HB3  2  
ATOM 3291  H HG2  . GLU A 1 68  ? 17.935  7.418   -5.144  1.00 0.00 ? 68  GLU A HG2  2  
ATOM 3292  H HG3  . GLU A 1 68  ? 17.609  5.685   -5.220  1.00 0.00 ? 68  GLU A HG3  2  
ATOM 3293  N N    . LYS A 1 69  ? 12.914  6.267   -5.628  1.00 0.00 ? 69  LYS A N    2  
ATOM 3294  C CA   . LYS A 1 69  ? 11.591  6.408   -6.231  1.00 0.00 ? 69  LYS A CA   2  
ATOM 3295  C C    . LYS A 1 69  ? 10.511  6.668   -5.181  1.00 0.00 ? 69  LYS A C    2  
ATOM 3296  O O    . LYS A 1 69  ? 9.507   7.324   -5.470  1.00 0.00 ? 69  LYS A O    2  
ATOM 3297  C CB   . LYS A 1 69  ? 11.257  5.148   -7.044  1.00 0.00 ? 69  LYS A CB   2  
ATOM 3298  C CG   . LYS A 1 69  ? 10.001  5.265   -7.906  1.00 0.00 ? 69  LYS A CG   2  
ATOM 3299  C CD   . LYS A 1 69  ? 9.814   4.037   -8.798  1.00 0.00 ? 69  LYS A CD   2  
ATOM 3300  C CE   . LYS A 1 69  ? 8.623   4.190   -9.736  1.00 0.00 ? 69  LYS A CE   2  
ATOM 3301  N NZ   . LYS A 1 69  ? 8.486   3.027   -10.652 1.00 0.00 ? 69  LYS A NZ   2  
ATOM 3302  H H    . LYS A 1 69  ? 13.186  5.394   -5.270  1.00 0.00 ? 69  LYS A H    2  
ATOM 3303  H HA   . LYS A 1 69  ? 11.624  7.255   -6.905  1.00 0.00 ? 69  LYS A HA   2  
ATOM 3304  H HB2  . LYS A 1 69  ? 12.092  4.928   -7.695  1.00 0.00 ? 69  LYS A HB2  2  
ATOM 3305  H HB3  . LYS A 1 69  ? 11.122  4.320   -6.362  1.00 0.00 ? 69  LYS A HB3  2  
ATOM 3306  H HG2  . LYS A 1 69  ? 9.140   5.364   -7.260  1.00 0.00 ? 69  LYS A HG2  2  
ATOM 3307  H HG3  . LYS A 1 69  ? 10.086  6.145   -8.530  1.00 0.00 ? 69  LYS A HG3  2  
ATOM 3308  H HD2  . LYS A 1 69  ? 10.706  3.895   -9.391  1.00 0.00 ? 69  LYS A HD2  2  
ATOM 3309  H HD3  . LYS A 1 69  ? 9.657   3.170   -8.172  1.00 0.00 ? 69  LYS A HD3  2  
ATOM 3310  H HE2  . LYS A 1 69  ? 7.724   4.281   -9.146  1.00 0.00 ? 69  LYS A HE2  2  
ATOM 3311  H HE3  . LYS A 1 69  ? 8.758   5.087   -10.326 1.00 0.00 ? 69  LYS A HE3  2  
ATOM 3312  H HZ1  . LYS A 1 69  ? 9.378   2.865   -11.163 1.00 0.00 ? 69  LYS A HZ1  2  
ATOM 3313  H HZ2  . LYS A 1 69  ? 7.732   3.208   -11.348 1.00 0.00 ? 69  LYS A HZ2  2  
ATOM 3314  H HZ3  . LYS A 1 69  ? 8.245   2.171   -10.113 1.00 0.00 ? 69  LYS A HZ3  2  
ATOM 3315  N N    . PHE A 1 70  ? 10.719  6.171   -3.960  1.00 0.00 ? 70  PHE A N    2  
ATOM 3316  C CA   . PHE A 1 70  ? 9.688   6.248   -2.920  1.00 0.00 ? 70  PHE A CA   2  
ATOM 3317  C C    . PHE A 1 70  ? 10.233  6.791   -1.595  1.00 0.00 ? 70  PHE A C    2  
ATOM 3318  O O    . PHE A 1 70  ? 9.617   7.660   -0.976  1.00 0.00 ? 70  PHE A O    2  
ATOM 3319  C CB   . PHE A 1 70  ? 9.067   4.862   -2.686  1.00 0.00 ? 70  PHE A CB   2  
ATOM 3320  C CG   . PHE A 1 70  ? 8.415   4.257   -3.909  1.00 0.00 ? 70  PHE A CG   2  
ATOM 3321  C CD1  . PHE A 1 70  ? 7.249   4.800   -4.434  1.00 0.00 ? 70  PHE A CD1  2  
ATOM 3322  C CD2  . PHE A 1 70  ? 8.962   3.140   -4.527  1.00 0.00 ? 70  PHE A CD2  2  
ATOM 3323  C CE1  . PHE A 1 70  ? 6.647   4.242   -5.545  1.00 0.00 ? 70  PHE A CE1  2  
ATOM 3324  C CE2  . PHE A 1 70  ? 8.363   2.581   -5.639  1.00 0.00 ? 70  PHE A CE2  2  
ATOM 3325  C CZ   . PHE A 1 70  ? 7.203   3.133   -6.149  1.00 0.00 ? 70  PHE A CZ   2  
ATOM 3326  H H    . PHE A 1 70  ? 11.577  5.745   -3.756  1.00 0.00 ? 70  PHE A H    2  
ATOM 3327  H HA   . PHE A 1 70  ? 8.913   6.917   -3.272  1.00 0.00 ? 70  PHE A HA   2  
ATOM 3328  H HB2  . PHE A 1 70  ? 9.840   4.184   -2.352  1.00 0.00 ? 70  PHE A HB2  2  
ATOM 3329  H HB3  . PHE A 1 70  ? 8.314   4.941   -1.914  1.00 0.00 ? 70  PHE A HB3  2  
ATOM 3330  H HD1  . PHE A 1 70  ? 6.811   5.670   -3.966  1.00 0.00 ? 70  PHE A HD1  2  
ATOM 3331  H HD2  . PHE A 1 70  ? 9.869   2.706   -4.130  1.00 0.00 ? 70  PHE A HD2  2  
ATOM 3332  H HE1  . PHE A 1 70  ? 5.739   4.675   -5.943  1.00 0.00 ? 70  PHE A HE1  2  
ATOM 3333  H HE2  . PHE A 1 70  ? 8.800   1.712   -6.109  1.00 0.00 ? 70  PHE A HE2  2  
ATOM 3334  H HZ   . PHE A 1 70  ? 6.732   2.697   -7.018  1.00 0.00 ? 70  PHE A HZ   2  
ATOM 3335  N N    . ILE A 1 71  ? 11.383  6.275   -1.161  1.00 0.00 ? 71  ILE A N    2  
ATOM 3336  C CA   . ILE A 1 71  ? 11.930  6.608   0.161   1.00 0.00 ? 71  ILE A CA   2  
ATOM 3337  C C    . ILE A 1 71  ? 12.520  8.016   0.181   1.00 0.00 ? 71  ILE A C    2  
ATOM 3338  O O    . ILE A 1 71  ? 12.450  8.722   1.191   1.00 0.00 ? 71  ILE A O    2  
ATOM 3339  C CB   . ILE A 1 71  ? 13.028  5.595   0.588   1.00 0.00 ? 71  ILE A CB   2  
ATOM 3340  C CG1  . ILE A 1 71  ? 12.477  4.160   0.564   1.00 0.00 ? 71  ILE A CG1  2  
ATOM 3341  C CG2  . ILE A 1 71  ? 13.582  5.937   1.974   1.00 0.00 ? 71  ILE A CG2  2  
ATOM 3342  C CD1  . ILE A 1 71  ? 11.313  3.934   1.506   1.00 0.00 ? 71  ILE A CD1  2  
ATOM 3343  H H    . ILE A 1 71  ? 11.881  5.663   -1.742  1.00 0.00 ? 71  ILE A H    2  
ATOM 3344  H HA   . ILE A 1 71  ? 11.123  6.556   0.880   1.00 0.00 ? 71  ILE A HA   2  
ATOM 3345  H HB   . ILE A 1 71  ? 13.841  5.667   -0.122  1.00 0.00 ? 71  ILE A HB   2  
ATOM 3346  H HG12 . ILE A 1 71  ? 12.139  3.928   -0.436  1.00 0.00 ? 71  ILE A HG12 2  
ATOM 3347  H HG13 . ILE A 1 71  ? 13.265  3.472   0.838   1.00 0.00 ? 71  ILE A HG13 2  
ATOM 3348  H HG21 . ILE A 1 71  ? 14.022  6.924   1.954   1.00 0.00 ? 71  ILE A HG21 2  
ATOM 3349  H HG22 . ILE A 1 71  ? 14.339  5.215   2.249   1.00 0.00 ? 71  ILE A HG22 2  
ATOM 3350  H HG23 . ILE A 1 71  ? 12.783  5.913   2.701   1.00 0.00 ? 71  ILE A HG23 2  
ATOM 3351  H HD11 . ILE A 1 71  ? 10.493  4.579   1.229   1.00 0.00 ? 71  ILE A HD11 2  
ATOM 3352  H HD12 . ILE A 1 71  ? 11.620  4.154   2.517   1.00 0.00 ? 71  ILE A HD12 2  
ATOM 3353  H HD13 . ILE A 1 71  ? 10.997  2.903   1.443   1.00 0.00 ? 71  ILE A HD13 2  
ATOM 3354  N N    . GLN A 1 72  ? 13.091  8.409   -0.948  1.00 0.00 ? 72  GLN A N    2  
ATOM 3355  C CA   . GLN A 1 72  ? 13.807  9.671   -1.070  1.00 0.00 ? 72  GLN A CA   2  
ATOM 3356  C C    . GLN A 1 72  ? 12.886  10.861  -0.801  1.00 0.00 ? 72  GLN A C    2  
ATOM 3357  O O    . GLN A 1 72  ? 11.745  10.886  -1.263  1.00 0.00 ? 72  GLN A O    2  
ATOM 3358  C CB   . GLN A 1 72  ? 14.419  9.783   -2.481  1.00 0.00 ? 72  GLN A CB   2  
ATOM 3359  C CG   . GLN A 1 72  ? 15.912  10.087  -2.496  1.00 0.00 ? 72  GLN A CG   2  
ATOM 3360  C CD   . GLN A 1 72  ? 16.264  11.368  -1.763  1.00 0.00 ? 72  GLN A CD   2  
ATOM 3361  O OE1  . GLN A 1 72  ? 16.532  11.362  -0.560  1.00 0.00 ? 72  GLN A OE1  2  
ATOM 3362  N NE2  . GLN A 1 72  ? 16.264  12.474  -2.481  1.00 0.00 ? 72  GLN A NE2  2  
ATOM 3363  H H    . GLN A 1 72  ? 13.020  7.831   -1.734  1.00 0.00 ? 72  GLN A H    2  
ATOM 3364  H HA   . GLN A 1 72  ? 14.604  9.672   -0.340  1.00 0.00 ? 72  GLN A HA   2  
ATOM 3365  H HB2  . GLN A 1 72  ? 14.266  8.844   -3.002  1.00 0.00 ? 72  GLN A HB2  2  
ATOM 3366  H HB3  . GLN A 1 72  ? 13.909  10.567  -3.027  1.00 0.00 ? 72  GLN A HB3  2  
ATOM 3367  H HG2  . GLN A 1 72  ? 16.440  9.266   -2.030  1.00 0.00 ? 72  GLN A HG2  2  
ATOM 3368  H HG3  . GLN A 1 72  ? 16.231  10.178  -3.525  1.00 0.00 ? 72  GLN A HG3  2  
ATOM 3369  H HE21 . GLN A 1 72  ? 16.037  12.406  -3.435  1.00 0.00 ? 72  GLN A HE21 2  
ATOM 3370  H HE22 . GLN A 1 72  ? 16.502  13.318  -2.039  1.00 0.00 ? 72  GLN A HE22 2  
ATOM 3371  N N    . THR A 1 73  ? 13.389  11.841  -0.053  1.00 0.00 ? 73  THR A N    2  
ATOM 3372  C CA   . THR A 1 73  ? 12.654  13.079  0.186   1.00 0.00 ? 73  THR A CA   2  
ATOM 3373  C C    . THR A 1 73  ? 12.503  13.850  -1.127  1.00 0.00 ? 73  THR A C    2  
ATOM 3374  O O    . THR A 1 73  ? 11.595  14.666  -1.291  1.00 0.00 ? 73  THR A O    2  
ATOM 3375  C CB   . THR A 1 73  ? 13.363  13.952  1.246   1.00 0.00 ? 73  THR A CB   2  
ATOM 3376  O OG1  . THR A 1 73  ? 13.655  13.157  2.404   1.00 0.00 ? 73  THR A OG1  2  
ATOM 3377  C CG2  . THR A 1 73  ? 12.499  15.144  1.655   1.00 0.00 ? 73  THR A CG2  2  
ATOM 3378  H H    . THR A 1 73  ? 14.272  11.725  0.359   1.00 0.00 ? 73  THR A H    2  
ATOM 3379  H HA   . THR A 1 73  ? 11.671  12.818  0.558   1.00 0.00 ? 73  THR A HA   2  
ATOM 3380  H HB   . THR A 1 73  ? 14.292  14.321  0.829   1.00 0.00 ? 73  THR A HB   2  
ATOM 3381  H HG1  . THR A 1 73  ? 14.587  13.271  2.638   1.00 0.00 ? 73  THR A HG1  2  
ATOM 3382  H HG21 . THR A 1 73  ? 13.026  15.735  2.390   1.00 0.00 ? 73  THR A HG21 2  
ATOM 3383  H HG22 . THR A 1 73  ? 11.571  14.787  2.078   1.00 0.00 ? 73  THR A HG22 2  
ATOM 3384  H HG23 . THR A 1 73  ? 12.288  15.753  0.788   1.00 0.00 ? 73  THR A HG23 2  
ATOM 3385  N N    . ASP A 1 74  ? 13.416  13.585  -2.056  1.00 0.00 ? 74  ASP A N    2  
ATOM 3386  C CA   . ASP A 1 74  ? 13.295  14.062  -3.429  1.00 0.00 ? 74  ASP A CA   2  
ATOM 3387  C C    . ASP A 1 74  ? 12.916  12.888  -4.325  1.00 0.00 ? 74  ASP A C    2  
ATOM 3388  O O    . ASP A 1 74  ? 13.782  12.196  -4.862  1.00 0.00 ? 74  ASP A O    2  
ATOM 3389  C CB   . ASP A 1 74  ? 14.607  14.704  -3.908  1.00 0.00 ? 74  ASP A CB   2  
ATOM 3390  C CG   . ASP A 1 74  ? 14.573  15.106  -5.379  1.00 0.00 ? 74  ASP A CG   2  
ATOM 3391  O OD1  . ASP A 1 74  ? 14.023  16.180  -5.699  1.00 0.00 ? 74  ASP A OD1  2  
ATOM 3392  O OD2  . ASP A 1 74  ? 15.106  14.352  -6.224  1.00 0.00 ? 74  ASP A OD2  2  
ATOM 3393  H H    . ASP A 1 74  ? 14.194  13.043  -1.814  1.00 0.00 ? 74  ASP A H    2  
ATOM 3394  H HA   . ASP A 1 74  ? 12.503  14.801  -3.463  1.00 0.00 ? 74  ASP A HA   2  
ATOM 3395  H HB2  . ASP A 1 74  ? 14.802  15.588  -3.318  1.00 0.00 ? 74  ASP A HB2  2  
ATOM 3396  H HB3  . ASP A 1 74  ? 15.416  14.002  -3.763  1.00 0.00 ? 74  ASP A HB3  2  
ATOM 3397  N N    . ALA A 1 75  ? 11.618  12.629  -4.420  1.00 0.00 ? 75  ALA A N    2  
ATOM 3398  C CA   . ALA A 1 75  ? 11.096  11.533  -5.229  1.00 0.00 ? 75  ALA A CA   2  
ATOM 3399  C C    . ALA A 1 75  ? 9.853   11.989  -5.993  1.00 0.00 ? 75  ALA A C    2  
ATOM 3400  O O    . ALA A 1 75  ? 9.151   12.898  -5.544  1.00 0.00 ? 75  ALA A O    2  
ATOM 3401  C CB   . ALA A 1 75  ? 10.779  10.332  -4.342  1.00 0.00 ? 75  ALA A CB   2  
ATOM 3402  H H    . ALA A 1 75  ? 10.985  13.189  -3.927  1.00 0.00 ? 75  ALA A H    2  
ATOM 3403  H HA   . ALA A 1 75  ? 11.858  11.240  -5.941  1.00 0.00 ? 75  ALA A HA   2  
ATOM 3404  H HB1  . ALA A 1 75  ? 11.672  10.025  -3.817  1.00 0.00 ? 75  ALA A HB1  2  
ATOM 3405  H HB2  . ALA A 1 75  ? 10.423  9.515   -4.954  1.00 0.00 ? 75  ALA A HB2  2  
ATOM 3406  H HB3  . ALA A 1 75  ? 10.015  10.602  -3.626  1.00 0.00 ? 75  ALA A HB3  2  
ATOM 3407  N N    . PRO A 1 76  ? 9.574   11.370  -7.162  1.00 0.00 ? 76  PRO A N    2  
ATOM 3408  C CA   . PRO A 1 76  ? 8.421   11.728  -8.008  1.00 0.00 ? 76  PRO A CA   2  
ATOM 3409  C C    . PRO A 1 76  ? 7.123   11.868  -7.214  1.00 0.00 ? 76  PRO A C    2  
ATOM 3410  O O    . PRO A 1 76  ? 6.394   12.850  -7.362  1.00 0.00 ? 76  PRO A O    2  
ATOM 3411  C CB   . PRO A 1 76  ? 8.334   10.550  -8.986  1.00 0.00 ? 76  PRO A CB   2  
ATOM 3412  C CG   . PRO A 1 76  ? 9.742   10.080  -9.119  1.00 0.00 ? 76  PRO A CG   2  
ATOM 3413  C CD   . PRO A 1 76  ? 10.376  10.283  -7.765  1.00 0.00 ? 76  PRO A CD   2  
ATOM 3414  H HA   . PRO A 1 76  ? 8.605   12.642  -8.556  1.00 0.00 ? 76  PRO A HA   2  
ATOM 3415  H HB2  . PRO A 1 76  ? 7.694   9.779   -8.577  1.00 0.00 ? 76  PRO A HB2  2  
ATOM 3416  H HB3  . PRO A 1 76  ? 7.939   10.889  -9.933  1.00 0.00 ? 76  PRO A HB3  2  
ATOM 3417  H HG2  . PRO A 1 76  ? 9.758   9.033   -9.391  1.00 0.00 ? 76  PRO A HG2  2  
ATOM 3418  H HG3  . PRO A 1 76  ? 10.258  10.669  -9.867  1.00 0.00 ? 76  PRO A HG3  2  
ATOM 3419  H HD2  . PRO A 1 76  ? 10.303  9.380   -7.174  1.00 0.00 ? 76  PRO A HD2  2  
ATOM 3420  H HD3  . PRO A 1 76  ? 11.410  10.581  -7.871  1.00 0.00 ? 76  PRO A HD3  2  
ATOM 3421  N N    . LYS A 1 77  ? 6.837   10.873  -6.379  1.00 0.00 ? 77  LYS A N    2  
ATOM 3422  C CA   . LYS A 1 77  ? 5.641   10.891  -5.539  1.00 0.00 ? 77  LYS A CA   2  
ATOM 3423  C C    . LYS A 1 77  ? 6.006   10.923  -4.061  1.00 0.00 ? 77  LYS A C    2  
ATOM 3424  O O    . LYS A 1 77  ? 5.340   11.597  -3.270  1.00 0.00 ? 77  LYS A O    2  
ATOM 3425  C CB   . LYS A 1 77  ? 4.765   9.653   -5.795  1.00 0.00 ? 77  LYS A CB   2  
ATOM 3426  C CG   . LYS A 1 77  ? 4.037   9.645   -7.134  1.00 0.00 ? 77  LYS A CG   2  
ATOM 3427  C CD   . LYS A 1 77  ? 3.062   8.470   -7.218  1.00 0.00 ? 77  LYS A CD   2  
ATOM 3428  C CE   . LYS A 1 77  ? 2.198   8.528   -8.472  1.00 0.00 ? 77  LYS A CE   2  
ATOM 3429  N NZ   . LYS A 1 77  ? 1.184   7.442   -8.488  1.00 0.00 ? 77  LYS A NZ   2  
ATOM 3430  H H    . LYS A 1 77  ? 7.446   10.110  -6.326  1.00 0.00 ? 77  LYS A H    2  
ATOM 3431  H HA   . LYS A 1 77  ? 5.072   11.779  -5.778  1.00 0.00 ? 77  LYS A HA   2  
ATOM 3432  H HB2  . LYS A 1 77  ? 5.391   8.773   -5.750  1.00 0.00 ? 77  LYS A HB2  2  
ATOM 3433  H HB3  . LYS A 1 77  ? 4.023   9.589   -5.010  1.00 0.00 ? 77  LYS A HB3  2  
ATOM 3434  H HG2  . LYS A 1 77  ? 3.487   10.569  -7.242  1.00 0.00 ? 77  LYS A HG2  2  
ATOM 3435  H HG3  . LYS A 1 77  ? 4.764   9.560   -7.931  1.00 0.00 ? 77  LYS A HG3  2  
ATOM 3436  H HD2  . LYS A 1 77  ? 3.625   7.547   -7.230  1.00 0.00 ? 77  LYS A HD2  2  
ATOM 3437  H HD3  . LYS A 1 77  ? 2.419   8.486   -6.350  1.00 0.00 ? 77  LYS A HD3  2  
ATOM 3438  H HE2  . LYS A 1 77  ? 1.690   9.481   -8.504  1.00 0.00 ? 77  LYS A HE2  2  
ATOM 3439  H HE3  . LYS A 1 77  ? 2.834   8.428   -9.340  1.00 0.00 ? 77  LYS A HE3  2  
ATOM 3440  H HZ1  . LYS A 1 77  ? 1.651   6.514   -8.555  1.00 0.00 ? 77  LYS A HZ1  2  
ATOM 3441  H HZ2  . LYS A 1 77  ? 0.546   7.558   -9.300  1.00 0.00 ? 77  LYS A HZ2  2  
ATOM 3442  H HZ3  . LYS A 1 77  ? 0.617   7.468   -7.613  1.00 0.00 ? 77  LYS A HZ3  2  
ATOM 3443  N N    . GLU A 1 78  ? 7.078   10.207  -3.710  1.00 0.00 ? 78  GLU A N    2  
ATOM 3444  C CA   . GLU A 1 78  ? 7.364   9.852   -2.320  1.00 0.00 ? 78  GLU A CA   2  
ATOM 3445  C C    . GLU A 1 78  ? 6.281   8.891   -1.825  1.00 0.00 ? 78  GLU A C    2  
ATOM 3446  O O    . GLU A 1 78  ? 5.401   8.490   -2.592  1.00 0.00 ? 78  GLU A O    2  
ATOM 3447  C CB   . GLU A 1 78  ? 7.441   11.090  -1.407  1.00 0.00 ? 78  GLU A CB   2  
ATOM 3448  C CG   . GLU A 1 78  ? 8.591   12.039  -1.725  1.00 0.00 ? 78  GLU A CG   2  
ATOM 3449  C CD   . GLU A 1 78  ? 8.597   13.263  -0.819  1.00 0.00 ? 78  GLU A CD   2  
ATOM 3450  O OE1  . GLU A 1 78  ? 9.049   13.150  0.343   1.00 0.00 ? 78  GLU A OE1  2  
ATOM 3451  O OE2  . GLU A 1 78  ? 8.136   14.342  -1.259  1.00 0.00 ? 78  GLU A OE2  2  
ATOM 3452  H H    . GLU A 1 78  ? 7.691   9.904   -4.404  1.00 0.00 ? 78  GLU A H    2  
ATOM 3453  H HA   . GLU A 1 78  ? 8.314   9.336   -2.304  1.00 0.00 ? 78  GLU A HA   2  
ATOM 3454  H HB2  . GLU A 1 78  ? 6.516   11.643  -1.492  1.00 0.00 ? 78  GLU A HB2  2  
ATOM 3455  H HB3  . GLU A 1 78  ? 7.552   10.758  -0.384  1.00 0.00 ? 78  GLU A HB3  2  
ATOM 3456  H HG2  . GLU A 1 78  ? 9.527   11.511  -1.599  1.00 0.00 ? 78  GLU A HG2  2  
ATOM 3457  H HG3  . GLU A 1 78  ? 8.501   12.367  -2.752  1.00 0.00 ? 78  GLU A HG3  2  
ATOM 3458  N N    . VAL A 1 79  ? 6.357   8.505   -0.559  1.00 0.00 ? 79  VAL A N    2  
ATOM 3459  C CA   . VAL A 1 79  ? 5.350   7.632   0.045   1.00 0.00 ? 79  VAL A CA   2  
ATOM 3460  C C    . VAL A 1 79  ? 5.120   8.017   1.500   1.00 0.00 ? 79  VAL A C    2  
ATOM 3461  O O    . VAL A 1 79  ? 6.067   8.366   2.217   1.00 0.00 ? 79  VAL A O    2  
ATOM 3462  C CB   . VAL A 1 79  ? 5.746   6.130   -0.031  1.00 0.00 ? 79  VAL A CB   2  
ATOM 3463  C CG1  . VAL A 1 79  ? 4.782   5.264   0.783   1.00 0.00 ? 79  VAL A CG1  2  
ATOM 3464  C CG2  . VAL A 1 79  ? 5.783   5.655   -1.481  1.00 0.00 ? 79  VAL A CG2  2  
ATOM 3465  H H    . VAL A 1 79  ? 7.106   8.819   -0.011  1.00 0.00 ? 79  VAL A H    2  
ATOM 3466  H HA   . VAL A 1 79  ? 4.422   7.768   -0.498  1.00 0.00 ? 79  VAL A HA   2  
ATOM 3467  H HB   . VAL A 1 79  ? 6.737   6.018   0.388   1.00 0.00 ? 79  VAL A HB   2  
ATOM 3468  H HG11 . VAL A 1 79  ? 3.777   5.384   0.405   1.00 0.00 ? 79  VAL A HG11 2  
ATOM 3469  H HG12 . VAL A 1 79  ? 4.813   5.564   1.822   1.00 0.00 ? 79  VAL A HG12 2  
ATOM 3470  H HG13 . VAL A 1 79  ? 5.073   4.226   0.702   1.00 0.00 ? 79  VAL A HG13 2  
ATOM 3471  H HG21 . VAL A 1 79  ? 4.804   5.773   -1.926  1.00 0.00 ? 79  VAL A HG21 2  
ATOM 3472  H HG22 . VAL A 1 79  ? 6.068   4.613   -1.514  1.00 0.00 ? 79  VAL A HG22 2  
ATOM 3473  H HG23 . VAL A 1 79  ? 6.502   6.241   -2.035  1.00 0.00 ? 79  VAL A HG23 2  
ATOM 3474  N N    . ASN A 1 80  ? 3.859   7.958   1.919   1.00 0.00 ? 80  ASN A N    2  
ATOM 3475  C CA   . ASN A 1 80  ? 3.481   8.232   3.301   1.00 0.00 ? 80  ASN A CA   2  
ATOM 3476  C C    . ASN A 1 80  ? 4.089   7.182   4.228   1.00 0.00 ? 80  ASN A C    2  
ATOM 3477  O O    . ASN A 1 80  ? 3.442   6.198   4.593   1.00 0.00 ? 80  ASN A O    2  
ATOM 3478  C CB   . ASN A 1 80  ? 1.952   8.260   3.450   1.00 0.00 ? 80  ASN A CB   2  
ATOM 3479  C CG   . ASN A 1 80  ? 1.303   9.349   2.612   1.00 0.00 ? 80  ASN A CG   2  
ATOM 3480  O OD1  . ASN A 1 80  ? 1.111   10.472  3.076   1.00 0.00 ? 80  ASN A OD1  2  
ATOM 3481  N ND2  . ASN A 1 80  ? 0.956   9.025   1.373   1.00 0.00 ? 80  ASN A ND2  2  
ATOM 3482  H H    . ASN A 1 80  ? 3.158   7.729   1.272   1.00 0.00 ? 80  ASN A H    2  
ATOM 3483  H HA   . ASN A 1 80  ? 3.877   9.203   3.568   1.00 0.00 ? 80  ASN A HA   2  
ATOM 3484  H HB2  . ASN A 1 80  ? 1.549   7.305   3.140   1.00 0.00 ? 80  ASN A HB2  2  
ATOM 3485  H HB3  . ASN A 1 80  ? 1.700   8.429   4.488   1.00 0.00 ? 80  ASN A HB3  2  
ATOM 3486  H HD21 . ASN A 1 80  ? 1.126   8.109   1.063   1.00 0.00 ? 80  ASN A HD21 2  
ATOM 3487  H HD22 . ASN A 1 80  ? 0.559   9.721   0.808   1.00 0.00 ? 80  ASN A HD22 2  
ATOM 3488  N N    . LEU A 1 81  ? 5.359   7.378   4.555   1.00 0.00 ? 81  LEU A N    2  
ATOM 3489  C CA   . LEU A 1 81  ? 6.095   6.491   5.445   1.00 0.00 ? 81  LEU A CA   2  
ATOM 3490  C C    . LEU A 1 81  ? 6.740   7.303   6.564   1.00 0.00 ? 81  LEU A C    2  
ATOM 3491  O O    . LEU A 1 81  ? 7.176   8.434   6.339   1.00 0.00 ? 81  LEU A O    2  
ATOM 3492  C CB   . LEU A 1 81  ? 7.162   5.728   4.642   1.00 0.00 ? 81  LEU A CB   2  
ATOM 3493  C CG   . LEU A 1 81  ? 8.199   4.949   5.467   1.00 0.00 ? 81  LEU A CG   2  
ATOM 3494  C CD1  . LEU A 1 81  ? 7.533   3.833   6.254   1.00 0.00 ? 81  LEU A CD1  2  
ATOM 3495  C CD2  . LEU A 1 81  ? 9.299   4.392   4.565   1.00 0.00 ? 81  LEU A CD2  2  
ATOM 3496  H H    . LEU A 1 81  ? 5.828   8.145   4.168   1.00 0.00 ? 81  LEU A H    2  
ATOM 3497  H HA   . LEU A 1 81  ? 5.398   5.784   5.876   1.00 0.00 ? 81  LEU A HA   2  
ATOM 3498  H HB2  . LEU A 1 81  ? 6.652   5.025   3.998   1.00 0.00 ? 81  LEU A HB2  2  
ATOM 3499  H HB3  . LEU A 1 81  ? 7.690   6.439   4.019   1.00 0.00 ? 81  LEU A HB3  2  
ATOM 3500  H HG   . LEU A 1 81  ? 8.662   5.620   6.177   1.00 0.00 ? 81  LEU A HG   2  
ATOM 3501  H HD11 . LEU A 1 81  ? 7.044   3.151   5.573   1.00 0.00 ? 81  LEU A HD11 2  
ATOM 3502  H HD12 . LEU A 1 81  ? 6.802   4.254   6.927   1.00 0.00 ? 81  LEU A HD12 2  
ATOM 3503  H HD13 . LEU A 1 81  ? 8.278   3.298   6.824   1.00 0.00 ? 81  LEU A HD13 2  
ATOM 3504  H HD21 . LEU A 1 81  ? 9.782   5.204   4.042   1.00 0.00 ? 81  LEU A HD21 2  
ATOM 3505  H HD22 . LEU A 1 81  ? 8.869   3.707   3.848   1.00 0.00 ? 81  LEU A HD22 2  
ATOM 3506  H HD23 . LEU A 1 81  ? 10.028  3.869   5.167   1.00 0.00 ? 81  LEU A HD23 2  
ATOM 3507  N N    . ASP A 1 82  ? 6.781   6.726   7.764   1.00 0.00 ? 82  ASP A N    2  
ATOM 3508  C CA   . ASP A 1 82  ? 7.410   7.362   8.926   1.00 0.00 ? 82  ASP A CA   2  
ATOM 3509  C C    . ASP A 1 82  ? 8.821   7.850   8.593   1.00 0.00 ? 82  ASP A C    2  
ATOM 3510  O O    . ASP A 1 82  ? 9.628   7.111   8.020   1.00 0.00 ? 82  ASP A O    2  
ATOM 3511  C CB   . ASP A 1 82  ? 7.448   6.378   10.106  1.00 0.00 ? 82  ASP A CB   2  
ATOM 3512  C CG   . ASP A 1 82  ? 8.404   6.796   11.220  1.00 0.00 ? 82  ASP A CG   2  
ATOM 3513  O OD1  . ASP A 1 82  ? 8.436   7.992   11.574  1.00 0.00 ? 82  ASP A OD1  2  
ATOM 3514  O OD2  . ASP A 1 82  ? 9.142   5.920   11.728  1.00 0.00 ? 82  ASP A OD2  2  
ATOM 3515  H H    . ASP A 1 82  ? 6.373   5.844   7.876   1.00 0.00 ? 82  ASP A H    2  
ATOM 3516  H HA   . ASP A 1 82  ? 6.803   8.214   9.201   1.00 0.00 ? 82  ASP A HA   2  
ATOM 3517  H HB2  . ASP A 1 82  ? 6.456   6.299   10.527  1.00 0.00 ? 82  ASP A HB2  2  
ATOM 3518  H HB3  . ASP A 1 82  ? 7.751   5.407   9.740   1.00 0.00 ? 82  ASP A HB3  2  
ATOM 3519  N N    . PHE A 1 83  ? 9.105   9.094   8.969   1.00 0.00 ? 83  PHE A N    2  
ATOM 3520  C CA   . PHE A 1 83  ? 10.388  9.725   8.676   1.00 0.00 ? 83  PHE A CA   2  
ATOM 3521  C C    . PHE A 1 83  ? 11.529  8.978   9.355   1.00 0.00 ? 83  PHE A C    2  
ATOM 3522  O O    . PHE A 1 83  ? 12.603  8.816   8.774   1.00 0.00 ? 83  PHE A O    2  
ATOM 3523  C CB   . PHE A 1 83  ? 10.379  11.194  9.116   1.00 0.00 ? 83  PHE A CB   2  
ATOM 3524  C CG   . PHE A 1 83  ? 9.393   12.044  8.353   1.00 0.00 ? 83  PHE A CG   2  
ATOM 3525  C CD1  . PHE A 1 83  ? 9.730   12.576  7.115   1.00 0.00 ? 83  PHE A CD1  2  
ATOM 3526  C CD2  . PHE A 1 83  ? 8.132   12.309  8.868   1.00 0.00 ? 83  PHE A CD2  2  
ATOM 3527  C CE1  . PHE A 1 83  ? 8.832   13.352  6.410   1.00 0.00 ? 83  PHE A CE1  2  
ATOM 3528  C CE2  . PHE A 1 83  ? 7.230   13.085  8.166   1.00 0.00 ? 83  PHE A CE2  2  
ATOM 3529  C CZ   . PHE A 1 83  ? 7.580   13.608  6.937   1.00 0.00 ? 83  PHE A CZ   2  
ATOM 3530  H H    . PHE A 1 83  ? 8.433   9.599   9.473   1.00 0.00 ? 83  PHE A H    2  
ATOM 3531  H HA   . PHE A 1 83  ? 10.537  9.684   7.606   1.00 0.00 ? 83  PHE A HA   2  
ATOM 3532  H HB2  . PHE A 1 83  ? 10.123  11.248  10.165  1.00 0.00 ? 83  PHE A HB2  2  
ATOM 3533  H HB3  . PHE A 1 83  ? 11.365  11.616  8.972   1.00 0.00 ? 83  PHE A HB3  2  
ATOM 3534  H HD1  . PHE A 1 83  ? 10.710  12.375  6.701   1.00 0.00 ? 83  PHE A HD1  2  
ATOM 3535  H HD2  . PHE A 1 83  ? 7.855   11.902  9.830   1.00 0.00 ? 83  PHE A HD2  2  
ATOM 3536  H HE1  . PHE A 1 83  ? 9.108   13.759  5.448   1.00 0.00 ? 83  PHE A HE1  2  
ATOM 3537  H HE2  . PHE A 1 83  ? 6.251   13.284  8.579   1.00 0.00 ? 83  PHE A HE2  2  
ATOM 3538  H HZ   . PHE A 1 83  ? 6.877   14.217  6.388   1.00 0.00 ? 83  PHE A HZ   2  
ATOM 3539  N N    . HIS A 1 84  ? 11.288  8.505   10.576  1.00 0.00 ? 84  HIS A N    2  
ATOM 3540  C CA   . HIS A 1 84  ? 12.300  7.754   11.315  1.00 0.00 ? 84  HIS A CA   2  
ATOM 3541  C C    . HIS A 1 84  ? 12.596  6.437   10.606  1.00 0.00 ? 84  HIS A C    2  
ATOM 3542  O O    . HIS A 1 84  ? 13.742  5.987   10.564  1.00 0.00 ? 84  HIS A O    2  
ATOM 3543  C CB   . HIS A 1 84  ? 11.854  7.504   12.763  1.00 0.00 ? 84  HIS A CB   2  
ATOM 3544  C CG   . HIS A 1 84  ? 12.820  6.667   13.555  1.00 0.00 ? 84  HIS A CG   2  
ATOM 3545  N ND1  . HIS A 1 84  ? 14.061  7.121   13.949  1.00 0.00 ? 84  HIS A ND1  2  
ATOM 3546  C CD2  . HIS A 1 84  ? 12.726  5.396   14.013  1.00 0.00 ? 84  HIS A CD2  2  
ATOM 3547  C CE1  . HIS A 1 84  ? 14.687  6.167   14.611  1.00 0.00 ? 84  HIS A CE1  2  
ATOM 3548  N NE2  . HIS A 1 84  ? 13.899  5.110   14.667  1.00 0.00 ? 84  HIS A NE2  2  
ATOM 3549  H H    . HIS A 1 84  ? 10.407  8.658   10.987  1.00 0.00 ? 84  HIS A H    2  
ATOM 3550  H HA   . HIS A 1 84  ? 13.205  8.351   11.326  1.00 0.00 ? 84  HIS A HA   2  
ATOM 3551  H HB2  . HIS A 1 84  ? 11.746  8.452   13.269  1.00 0.00 ? 84  HIS A HB2  2  
ATOM 3552  H HB3  . HIS A 1 84  ? 10.899  6.997   12.756  1.00 0.00 ? 84  HIS A HB3  2  
ATOM 3553  H HD1  . HIS A 1 84  ? 14.431  8.014   13.768  1.00 0.00 ? 84  HIS A HD1  2  
ATOM 3554  H HD2  . HIS A 1 84  ? 11.886  4.727   13.884  1.00 0.00 ? 84  HIS A HD2  2  
ATOM 3555  H HE1  . HIS A 1 84  ? 15.680  6.237   15.029  1.00 0.00 ? 84  HIS A HE1  2  
ATOM 3556  H HE2  . HIS A 1 84  ? 14.059  4.319   15.230  1.00 0.00 ? 84  HIS A HE2  2  
ATOM 3557  N N    . THR A 1 85  ? 11.558  5.830   10.038  1.00 0.00 ? 85  THR A N    2  
ATOM 3558  C CA   . THR A 1 85  ? 11.721  4.612   9.255   1.00 0.00 ? 85  THR A CA   2  
ATOM 3559  C C    . THR A 1 85  ? 12.521  4.907   7.981   1.00 0.00 ? 85  THR A C    2  
ATOM 3560  O O    . THR A 1 85  ? 13.397  4.129   7.594   1.00 0.00 ? 85  THR A O    2  
ATOM 3561  C CB   . THR A 1 85  ? 10.355  3.988   8.882   1.00 0.00 ? 85  THR A CB   2  
ATOM 3562  O OG1  . THR A 1 85  ? 9.575   3.767   10.067  1.00 0.00 ? 85  THR A OG1  2  
ATOM 3563  C CG2  . THR A 1 85  ? 10.538  2.664   8.145   1.00 0.00 ? 85  THR A CG2  2  
ATOM 3564  H H    . THR A 1 85  ? 10.661  6.212   10.152  1.00 0.00 ? 85  THR A H    2  
ATOM 3565  H HA   . THR A 1 85  ? 12.269  3.900   9.857   1.00 0.00 ? 85  THR A HA   2  
ATOM 3566  H HB   . THR A 1 85  ? 9.825   4.674   8.235   1.00 0.00 ? 85  THR A HB   2  
ATOM 3567  H HG1  . THR A 1 85  ? 9.851   4.387   10.752  1.00 0.00 ? 85  THR A HG1  2  
ATOM 3568  H HG21 . THR A 1 85  ? 9.569   2.246   7.910   1.00 0.00 ? 85  THR A HG21 2  
ATOM 3569  H HG22 . THR A 1 85  ? 11.083  1.973   8.770   1.00 0.00 ? 85  THR A HG22 2  
ATOM 3570  H HG23 . THR A 1 85  ? 11.087  2.833   7.230   1.00 0.00 ? 85  THR A HG23 2  
ATOM 3571  N N    . LYS A 1 86  ? 12.224  6.042   7.341   1.00 0.00 ? 86  LYS A N    2  
ATOM 3572  C CA   . LYS A 1 86  ? 12.976  6.478   6.162   1.00 0.00 ? 86  LYS A CA   2  
ATOM 3573  C C    . LYS A 1 86  ? 14.442  6.691   6.531   1.00 0.00 ? 86  LYS A C    2  
ATOM 3574  O O    . LYS A 1 86  ? 15.339  6.313   5.782   1.00 0.00 ? 86  LYS A O    2  
ATOM 3575  C CB   . LYS A 1 86  ? 12.395  7.777   5.571   1.00 0.00 ? 86  LYS A CB   2  
ATOM 3576  C CG   . LYS A 1 86  ? 10.998  7.632   4.973   1.00 0.00 ? 86  LYS A CG   2  
ATOM 3577  C CD   . LYS A 1 86  ? 10.560  8.909   4.252   1.00 0.00 ? 86  LYS A CD   2  
ATOM 3578  C CE   . LYS A 1 86  ? 9.186   8.762   3.606   1.00 0.00 ? 86  LYS A CE   2  
ATOM 3579  N NZ   . LYS A 1 86  ? 8.818   9.960   2.802   1.00 0.00 ? 86  LYS A NZ   2  
ATOM 3580  H H    . LYS A 1 86  ? 11.485  6.599   7.672   1.00 0.00 ? 86  LYS A H    2  
ATOM 3581  H HA   . LYS A 1 86  ? 12.913  5.693   5.420   1.00 0.00 ? 86  LYS A HA   2  
ATOM 3582  H HB2  . LYS A 1 86  ? 12.350  8.523   6.352   1.00 0.00 ? 86  LYS A HB2  2  
ATOM 3583  H HB3  . LYS A 1 86  ? 13.059  8.130   4.792   1.00 0.00 ? 86  LYS A HB3  2  
ATOM 3584  H HG2  . LYS A 1 86  ? 11.002  6.813   4.266   1.00 0.00 ? 86  LYS A HG2  2  
ATOM 3585  H HG3  . LYS A 1 86  ? 10.296  7.418   5.768   1.00 0.00 ? 86  LYS A HG3  2  
ATOM 3586  H HD2  . LYS A 1 86  ? 10.524  9.719   4.966   1.00 0.00 ? 86  LYS A HD2  2  
ATOM 3587  H HD3  . LYS A 1 86  ? 11.285  9.141   3.483   1.00 0.00 ? 86  LYS A HD3  2  
ATOM 3588  H HE2  . LYS A 1 86  ? 9.195   7.898   2.957   1.00 0.00 ? 86  LYS A HE2  2  
ATOM 3589  H HE3  . LYS A 1 86  ? 8.449   8.620   4.383   1.00 0.00 ? 86  LYS A HE3  2  
ATOM 3590  H HZ1  . LYS A 1 86  ? 9.448   10.049  1.981   1.00 0.00 ? 86  LYS A HZ1  2  
ATOM 3591  H HZ2  . LYS A 1 86  ? 8.909   10.823  3.377   1.00 0.00 ? 86  LYS A HZ2  2  
ATOM 3592  H HZ3  . LYS A 1 86  ? 7.834   9.887   2.465   1.00 0.00 ? 86  LYS A HZ3  2  
ATOM 3593  N N    . GLU A 1 87  ? 14.660  7.288   7.700   1.00 0.00 ? 87  GLU A N    2  
ATOM 3594  C CA   . GLU A 1 87  ? 16.001  7.549   8.219   1.00 0.00 ? 87  GLU A CA   2  
ATOM 3595  C C    . GLU A 1 87  ? 16.797  6.248   8.336   1.00 0.00 ? 87  GLU A C    2  
ATOM 3596  O O    . GLU A 1 87  ? 17.973  6.180   7.962   1.00 0.00 ? 87  GLU A O    2  
ATOM 3597  C CB   . GLU A 1 87  ? 15.892  8.238   9.584   1.00 0.00 ? 87  GLU A CB   2  
ATOM 3598  C CG   . GLU A 1 87  ? 17.228  8.548   10.248  1.00 0.00 ? 87  GLU A CG   2  
ATOM 3599  C CD   . GLU A 1 87  ? 17.054  9.230   11.595  1.00 0.00 ? 87  GLU A CD   2  
ATOM 3600  O OE1  . GLU A 1 87  ? 16.946  8.522   12.618  1.00 0.00 ? 87  GLU A OE1  2  
ATOM 3601  O OE2  . GLU A 1 87  ? 17.007  10.477  11.634  1.00 0.00 ? 87  GLU A OE2  2  
ATOM 3602  H H    . GLU A 1 87  ? 13.889  7.566   8.235   1.00 0.00 ? 87  GLU A H    2  
ATOM 3603  H HA   . GLU A 1 87  ? 16.505  8.211   7.527   1.00 0.00 ? 87  GLU A HA   2  
ATOM 3604  H HB2  . GLU A 1 87  ? 15.356  9.169   9.460   1.00 0.00 ? 87  GLU A HB2  2  
ATOM 3605  H HB3  . GLU A 1 87  ? 15.326  7.600   10.248  1.00 0.00 ? 87  GLU A HB3  2  
ATOM 3606  H HG2  . GLU A 1 87  ? 17.770  7.624   10.392  1.00 0.00 ? 87  GLU A HG2  2  
ATOM 3607  H HG3  . GLU A 1 87  ? 17.797  9.199   9.600   1.00 0.00 ? 87  GLU A HG3  2  
ATOM 3608  N N    . VAL A 1 88  ? 16.144  5.214   8.856   1.00 0.00 ? 88  VAL A N    2  
ATOM 3609  C CA   . VAL A 1 88  ? 16.754  3.892   8.951   1.00 0.00 ? 88  VAL A CA   2  
ATOM 3610  C C    . VAL A 1 88  ? 17.198  3.418   7.569   1.00 0.00 ? 88  VAL A C    2  
ATOM 3611  O O    . VAL A 1 88  ? 18.316  2.930   7.391   1.00 0.00 ? 88  VAL A O    2  
ATOM 3612  C CB   . VAL A 1 88  ? 15.768  2.860   9.561   1.00 0.00 ? 88  VAL A CB   2  
ATOM 3613  C CG1  . VAL A 1 88  ? 16.379  1.458   9.579   1.00 0.00 ? 88  VAL A CG1  2  
ATOM 3614  C CG2  . VAL A 1 88  ? 15.342  3.283   10.965  1.00 0.00 ? 88  VAL A CG2  2  
ATOM 3615  H H    . VAL A 1 88  ? 15.229  5.344   9.185   1.00 0.00 ? 88  VAL A H    2  
ATOM 3616  H HA   . VAL A 1 88  ? 17.619  3.966   9.596   1.00 0.00 ? 88  VAL A HA   2  
ATOM 3617  H HB   . VAL A 1 88  ? 14.884  2.830   8.939   1.00 0.00 ? 88  VAL A HB   2  
ATOM 3618  H HG11 . VAL A 1 88  ? 16.623  1.155   8.570   1.00 0.00 ? 88  VAL A HG11 2  
ATOM 3619  H HG12 . VAL A 1 88  ? 15.669  0.759   10.000  1.00 0.00 ? 88  VAL A HG12 2  
ATOM 3620  H HG13 . VAL A 1 88  ? 17.278  1.461   10.179  1.00 0.00 ? 88  VAL A HG13 2  
ATOM 3621  H HG21 . VAL A 1 88  ? 14.654  2.554   11.370  1.00 0.00 ? 88  VAL A HG21 2  
ATOM 3622  H HG22 . VAL A 1 88  ? 14.855  4.246   10.919  1.00 0.00 ? 88  VAL A HG22 2  
ATOM 3623  H HG23 . VAL A 1 88  ? 16.211  3.351   11.603  1.00 0.00 ? 88  VAL A HG23 2  
ATOM 3624  N N    . ILE A 1 89  ? 16.325  3.606   6.588   1.00 0.00 ? 89  ILE A N    2  
ATOM 3625  C CA   . ILE A 1 89  ? 16.580  3.153   5.226   1.00 0.00 ? 89  ILE A CA   2  
ATOM 3626  C C    . ILE A 1 89  ? 17.680  3.985   4.559   1.00 0.00 ? 89  ILE A C    2  
ATOM 3627  O O    . ILE A 1 89  ? 18.517  3.444   3.837   1.00 0.00 ? 89  ILE A O    2  
ATOM 3628  C CB   . ILE A 1 89  ? 15.285  3.206   4.374   1.00 0.00 ? 89  ILE A CB   2  
ATOM 3629  C CG1  . ILE A 1 89  ? 14.188  2.345   5.029   1.00 0.00 ? 89  ILE A CG1  2  
ATOM 3630  C CG2  . ILE A 1 89  ? 15.555  2.740   2.941   1.00 0.00 ? 89  ILE A CG2  2  
ATOM 3631  C CD1  . ILE A 1 89  ? 12.843  2.421   4.334   1.00 0.00 ? 89  ILE A CD1  2  
ATOM 3632  H H    . ILE A 1 89  ? 15.481  4.068   6.785   1.00 0.00 ? 89  ILE A H    2  
ATOM 3633  H HA   . ILE A 1 89  ? 16.908  2.123   5.276   1.00 0.00 ? 89  ILE A HA   2  
ATOM 3634  H HB   . ILE A 1 89  ? 14.950  4.233   4.333   1.00 0.00 ? 89  ILE A HB   2  
ATOM 3635  H HG12 . ILE A 1 89  ? 14.501  1.311   5.026   1.00 0.00 ? 89  ILE A HG12 2  
ATOM 3636  H HG13 . ILE A 1 89  ? 14.051  2.668   6.051   1.00 0.00 ? 89  ILE A HG13 2  
ATOM 3637  H HG21 . ILE A 1 89  ? 14.640  2.786   2.368   1.00 0.00 ? 89  ILE A HG21 2  
ATOM 3638  H HG22 . ILE A 1 89  ? 15.919  1.722   2.953   1.00 0.00 ? 89  ILE A HG22 2  
ATOM 3639  H HG23 . ILE A 1 89  ? 16.296  3.381   2.486   1.00 0.00 ? 89  ILE A HG23 2  
ATOM 3640  H HD11 . ILE A 1 89  ? 12.495  3.443   4.331   1.00 0.00 ? 89  ILE A HD11 2  
ATOM 3641  H HD12 . ILE A 1 89  ? 12.133  1.802   4.862   1.00 0.00 ? 89  ILE A HD12 2  
ATOM 3642  H HD13 . ILE A 1 89  ? 12.939  2.070   3.318   1.00 0.00 ? 89  ILE A HD13 2  
ATOM 3643  N N    . THR A 1 90  ? 17.696  5.292   4.821   1.00 0.00 ? 90  THR A N    2  
ATOM 3644  C CA   . THR A 1 90  ? 18.673  6.185   4.204   1.00 0.00 ? 90  THR A CA   2  
ATOM 3645  C C    . THR A 1 90  ? 20.093  5.847   4.662   1.00 0.00 ? 90  THR A C    2  
ATOM 3646  O O    . THR A 1 90  ? 21.065  6.106   3.945   1.00 0.00 ? 90  THR A O    2  
ATOM 3647  C CB   . THR A 1 90  ? 18.363  7.674   4.504   1.00 0.00 ? 90  THR A CB   2  
ATOM 3648  O OG1  . THR A 1 90  ? 18.256  7.880   5.916   1.00 0.00 ? 90  THR A OG1  2  
ATOM 3649  C CG2  . THR A 1 90  ? 17.069  8.119   3.828   1.00 0.00 ? 90  THR A CG2  2  
ATOM 3650  H H    . THR A 1 90  ? 17.040  5.663   5.447   1.00 0.00 ? 90  THR A H    2  
ATOM 3651  H HA   . THR A 1 90  ? 18.615  6.041   3.132   1.00 0.00 ? 90  THR A HA   2  
ATOM 3652  H HB   . THR A 1 90  ? 19.174  8.279   4.122   1.00 0.00 ? 90  THR A HB   2  
ATOM 3653  H HG1  . THR A 1 90  ? 18.836  8.602   6.178   1.00 0.00 ? 90  THR A HG1  2  
ATOM 3654  H HG21 . THR A 1 90  ? 17.159  7.998   2.758   1.00 0.00 ? 90  THR A HG21 2  
ATOM 3655  H HG22 . THR A 1 90  ? 16.882  9.159   4.056   1.00 0.00 ? 90  THR A HG22 2  
ATOM 3656  H HG23 . THR A 1 90  ? 16.246  7.519   4.190   1.00 0.00 ? 90  THR A HG23 2  
ATOM 3657  N N    . ASN A 1 91  ? 20.208  5.267   5.855   1.00 0.00 ? 91  ASN A N    2  
ATOM 3658  C CA   . ASN A 1 91  ? 21.502  4.813   6.365   1.00 0.00 ? 91  ASN A CA   2  
ATOM 3659  C C    . ASN A 1 91  ? 21.814  3.397   5.878   1.00 0.00 ? 91  ASN A C    2  
ATOM 3660  O O    . ASN A 1 91  ? 22.920  3.120   5.410   1.00 0.00 ? 91  ASN A O    2  
ATOM 3661  C CB   . ASN A 1 91  ? 21.541  4.855   7.903   1.00 0.00 ? 91  ASN A CB   2  
ATOM 3662  C CG   . ASN A 1 91  ? 21.664  6.267   8.463   1.00 0.00 ? 91  ASN A CG   2  
ATOM 3663  O OD1  . ASN A 1 91  ? 22.768  6.795   8.611   1.00 0.00 ? 91  ASN A OD1  2  
ATOM 3664  N ND2  . ASN A 1 91  ? 20.537  6.882   8.790   1.00 0.00 ? 91  ASN A ND2  2  
ATOM 3665  H H    . ASN A 1 91  ? 19.404  5.151   6.408   1.00 0.00 ? 91  ASN A H    2  
ATOM 3666  H HA   . ASN A 1 91  ? 22.261  5.482   5.981   1.00 0.00 ? 91  ASN A HA   2  
ATOM 3667  H HB2  . ASN A 1 91  ? 20.632  4.416   8.290   1.00 0.00 ? 91  ASN A HB2  2  
ATOM 3668  H HB3  . ASN A 1 91  ? 22.386  4.277   8.253   1.00 0.00 ? 91  ASN A HB3  2  
ATOM 3669  H HD21 . ASN A 1 91  ? 19.688  6.404   8.652   1.00 0.00 ? 91  ASN A HD21 2  
ATOM 3670  H HD22 . ASN A 1 91  ? 20.593  7.783   9.176   1.00 0.00 ? 91  ASN A HD22 2  
ATOM 3671  N N    . SER A 1 92  ? 20.828  2.509   5.975   1.00 0.00 ? 92  SER A N    2  
ATOM 3672  C CA   . SER A 1 92  ? 21.028  1.088   5.673   1.00 0.00 ? 92  SER A CA   2  
ATOM 3673  C C    . SER A 1 92  ? 20.953  0.788   4.169   1.00 0.00 ? 92  SER A C    2  
ATOM 3674  O O    . SER A 1 92  ? 21.181  -0.348  3.750   1.00 0.00 ? 92  SER A O    2  
ATOM 3675  C CB   . SER A 1 92  ? 19.990  0.256   6.434   1.00 0.00 ? 92  SER A CB   2  
ATOM 3676  O OG   . SER A 1 92  ? 20.037  0.540   7.824   1.00 0.00 ? 92  SER A OG   2  
ATOM 3677  H H    . SER A 1 92  ? 19.942  2.810   6.270   1.00 0.00 ? 92  SER A H    2  
ATOM 3678  H HA   . SER A 1 92  ? 22.012  0.814   6.027   1.00 0.00 ? 92  SER A HA   2  
ATOM 3679  H HB2  . SER A 1 92  ? 19.002  0.488   6.065   1.00 0.00 ? 92  SER A HB2  2  
ATOM 3680  H HB3  . SER A 1 92  ? 20.194  -0.795  6.287   1.00 0.00 ? 92  SER A HB3  2  
ATOM 3681  H HG   . SER A 1 92  ? 19.242  0.191   8.248   1.00 0.00 ? 92  SER A HG   2  
ATOM 3682  N N    . ILE A 1 93  ? 20.650  1.808   3.362   1.00 0.00 ? 93  ILE A N    2  
ATOM 3683  C CA   . ILE A 1 93  ? 20.546  1.648   1.904   1.00 0.00 ? 93  ILE A CA   2  
ATOM 3684  C C    . ILE A 1 93  ? 21.841  1.075   1.311   1.00 0.00 ? 93  ILE A C    2  
ATOM 3685  O O    . ILE A 1 93  ? 21.834  0.472   0.236   1.00 0.00 ? 93  ILE A O    2  
ATOM 3686  C CB   . ILE A 1 93  ? 20.209  3.000   1.210   1.00 0.00 ? 93  ILE A CB   2  
ATOM 3687  C CG1  . ILE A 1 93  ? 19.982  2.815   -0.305  1.00 0.00 ? 93  ILE A CG1  2  
ATOM 3688  C CG2  . ILE A 1 93  ? 21.309  4.030   1.466   1.00 0.00 ? 93  ILE A CG2  2  
ATOM 3689  C CD1  . ILE A 1 93  ? 18.887  1.821   -0.646  1.00 0.00 ? 93  ILE A CD1  2  
ATOM 3690  H H    . ILE A 1 93  ? 20.478  2.689   3.755   1.00 0.00 ? 93  ILE A H    2  
ATOM 3691  H HA   . ILE A 1 93  ? 19.738  0.956   1.706   1.00 0.00 ? 93  ILE A HA   2  
ATOM 3692  H HB   . ILE A 1 93  ? 19.298  3.378   1.655   1.00 0.00 ? 93  ILE A HB   2  
ATOM 3693  H HG12 . ILE A 1 93  ? 19.704  3.766   -0.737  1.00 0.00 ? 93  ILE A HG12 2  
ATOM 3694  H HG13 . ILE A 1 93  ? 20.898  2.472   -0.768  1.00 0.00 ? 93  ILE A HG13 2  
ATOM 3695  H HG21 . ILE A 1 93  ? 21.051  4.962   0.986   1.00 0.00 ? 93  ILE A HG21 2  
ATOM 3696  H HG22 . ILE A 1 93  ? 22.246  3.667   1.066   1.00 0.00 ? 93  ILE A HG22 2  
ATOM 3697  H HG23 . ILE A 1 93  ? 21.414  4.192   2.530   1.00 0.00 ? 93  ILE A HG23 2  
ATOM 3698  H HD11 . ILE A 1 93  ? 17.952  2.156   -0.220  1.00 0.00 ? 93  ILE A HD11 2  
ATOM 3699  H HD12 . ILE A 1 93  ? 19.140  0.852   -0.242  1.00 0.00 ? 93  ILE A HD12 2  
ATOM 3700  H HD13 . ILE A 1 93  ? 18.788  1.750   -1.718  1.00 0.00 ? 93  ILE A HD13 2  
ATOM 3701  N N    . THR A 1 94  ? 22.945  1.259   2.030   1.00 0.00 ? 94  THR A N    2  
ATOM 3702  C CA   . THR A 1 94  ? 24.248  0.787   1.582   1.00 0.00 ? 94  THR A CA   2  
ATOM 3703  C C    . THR A 1 94  ? 24.287  -0.743  1.487   1.00 0.00 ? 94  THR A C    2  
ATOM 3704  O O    . THR A 1 94  ? 24.954  -1.301  0.612   1.00 0.00 ? 94  THR A O    2  
ATOM 3705  C CB   . THR A 1 94  ? 25.373  1.289   2.522   1.00 0.00 ? 94  THR A CB   2  
ATOM 3706  O OG1  . THR A 1 94  ? 26.659  0.915   2.006   1.00 0.00 ? 94  THR A OG1  2  
ATOM 3707  C CG2  . THR A 1 94  ? 25.209  0.738   3.937   1.00 0.00 ? 94  THR A CG2  2  
ATOM 3708  H H    . THR A 1 94  ? 22.878  1.731   2.885   1.00 0.00 ? 94  THR A H    2  
ATOM 3709  H HA   . THR A 1 94  ? 24.425  1.199   0.596   1.00 0.00 ? 94  THR A HA   2  
ATOM 3710  H HB   . THR A 1 94  ? 25.321  2.368   2.569   1.00 0.00 ? 94  THR A HB   2  
ATOM 3711  H HG1  . THR A 1 94  ? 26.648  0.989   1.041   1.00 0.00 ? 94  THR A HG1  2  
ATOM 3712  H HG21 . THR A 1 94  ? 25.994  1.129   4.568   1.00 0.00 ? 94  THR A HG21 2  
ATOM 3713  H HG22 . THR A 1 94  ? 25.272  -0.341  3.914   1.00 0.00 ? 94  THR A HG22 2  
ATOM 3714  H HG23 . THR A 1 94  ? 24.248  1.033   4.332   1.00 0.00 ? 94  THR A HG23 2  
ATOM 3715  N N    . GLN A 1 95  ? 23.561  -1.418  2.382   1.00 0.00 ? 95  GLN A N    2  
ATOM 3716  C CA   . GLN A 1 95  ? 23.529  -2.883  2.418   1.00 0.00 ? 95  GLN A CA   2  
ATOM 3717  C C    . GLN A 1 95  ? 22.110  -3.375  2.717   1.00 0.00 ? 95  GLN A C    2  
ATOM 3718  O O    . GLN A 1 95  ? 21.803  -3.767  3.846   1.00 0.00 ? 95  GLN A O    2  
ATOM 3719  C CB   . GLN A 1 95  ? 24.514  -3.431  3.470   1.00 0.00 ? 95  GLN A CB   2  
ATOM 3720  C CG   . GLN A 1 95  ? 25.978  -3.071  3.219   1.00 0.00 ? 95  GLN A CG   2  
ATOM 3721  C CD   . GLN A 1 95  ? 26.572  -3.746  1.988   1.00 0.00 ? 95  GLN A CD   2  
ATOM 3722  O OE1  . GLN A 1 95  ? 25.872  -4.056  1.025   1.00 0.00 ? 95  GLN A OE1  2  
ATOM 3723  N NE2  . GLN A 1 95  ? 27.878  -3.969  2.011   1.00 0.00 ? 95  GLN A NE2  2  
ATOM 3724  H H    . GLN A 1 95  ? 23.018  -0.920  3.028   1.00 0.00 ? 95  GLN A H    2  
ATOM 3725  H HA   . GLN A 1 95  ? 23.820  -3.247  1.441   1.00 0.00 ? 95  GLN A HA   2  
ATOM 3726  H HB2  . GLN A 1 95  ? 24.235  -3.042  4.439   1.00 0.00 ? 95  GLN A HB2  2  
ATOM 3727  H HB3  . GLN A 1 95  ? 24.431  -4.509  3.493   1.00 0.00 ? 95  GLN A HB3  2  
ATOM 3728  H HG2  . GLN A 1 95  ? 26.053  -2.001  3.087   1.00 0.00 ? 95  GLN A HG2  2  
ATOM 3729  H HG3  . GLN A 1 95  ? 26.557  -3.362  4.085   1.00 0.00 ? 95  GLN A HG3  2  
ATOM 3730  H HE21 . GLN A 1 95  ? 28.382  -3.695  2.810   1.00 0.00 ? 95  GLN A HE21 2  
ATOM 3731  H HE22 . GLN A 1 95  ? 28.292  -4.388  1.226   1.00 0.00 ? 95  GLN A HE22 2  
ATOM 3732  N N    . PRO A 1 96  ? 21.215  -3.337  1.716   1.00 0.00 ? 96  PRO A N    2  
ATOM 3733  C CA   . PRO A 1 96  ? 19.830  -3.785  1.880   1.00 0.00 ? 96  PRO A CA   2  
ATOM 3734  C C    . PRO A 1 96  ? 19.714  -5.312  1.872   1.00 0.00 ? 96  PRO A C    2  
ATOM 3735  O O    . PRO A 1 96  ? 20.364  -5.991  1.076   1.00 0.00 ? 96  PRO A O    2  
ATOM 3736  C CB   . PRO A 1 96  ? 19.124  -3.176  0.666   1.00 0.00 ? 96  PRO A CB   2  
ATOM 3737  C CG   . PRO A 1 96  ? 20.184  -3.099  -0.381  1.00 0.00 ? 96  PRO A CG   2  
ATOM 3738  C CD   . PRO A 1 96  ? 21.481  -2.846  0.347   1.00 0.00 ? 96  PRO A CD   2  
ATOM 3739  H HA   . PRO A 1 96  ? 19.394  -3.394  2.789   1.00 0.00 ? 96  PRO A HA   2  
ATOM 3740  H HB2  . PRO A 1 96  ? 18.304  -3.812  0.360   1.00 0.00 ? 96  PRO A HB2  2  
ATOM 3741  H HB3  . PRO A 1 96  ? 18.748  -2.195  0.920   1.00 0.00 ? 96  PRO A HB3  2  
ATOM 3742  H HG2  . PRO A 1 96  ? 20.234  -4.035  -0.922  1.00 0.00 ? 96  PRO A HG2  2  
ATOM 3743  H HG3  . PRO A 1 96  ? 19.970  -2.287  -1.062  1.00 0.00 ? 96  PRO A HG3  2  
ATOM 3744  H HD2  . PRO A 1 96  ? 22.285  -3.402  -0.112  1.00 0.00 ? 96  PRO A HD2  2  
ATOM 3745  H HD3  . PRO A 1 96  ? 21.710  -1.789  0.356   1.00 0.00 ? 96  PRO A HD3  2  
ATOM 3746  N N    . THR A 1 97  ? 18.884  -5.837  2.769   1.00 0.00 ? 97  THR A N    2  
ATOM 3747  C CA   . THR A 1 97  ? 18.680  -7.275  2.899   1.00 0.00 ? 97  THR A CA   2  
ATOM 3748  C C    . THR A 1 97  ? 17.314  -7.678  2.318   1.00 0.00 ? 97  THR A C    2  
ATOM 3749  O O    . THR A 1 97  ? 16.448  -6.817  2.150   1.00 0.00 ? 97  THR A O    2  
ATOM 3750  C CB   . THR A 1 97  ? 18.765  -7.688  4.389   1.00 0.00 ? 97  THR A CB   2  
ATOM 3751  O OG1  . THR A 1 97  ? 19.881  -7.025  5.005   1.00 0.00 ? 97  THR A OG1  2  
ATOM 3752  C CG2  . THR A 1 97  ? 18.927  -9.198  4.548   1.00 0.00 ? 97  THR A CG2  2  
ATOM 3753  H H    . THR A 1 97  ? 18.392  -5.237  3.364   1.00 0.00 ? 97  THR A H    2  
ATOM 3754  H HA   . THR A 1 97  ? 19.463  -7.785  2.354   1.00 0.00 ? 97  THR A HA   2  
ATOM 3755  H HB   . THR A 1 97  ? 17.857  -7.381  4.889   1.00 0.00 ? 97  THR A HB   2  
ATOM 3756  H HG1  . THR A 1 97  ? 20.429  -6.620  4.324   1.00 0.00 ? 97  THR A HG1  2  
ATOM 3757  H HG21 . THR A 1 97  ? 19.836  -9.518  4.060   1.00 0.00 ? 97  THR A HG21 2  
ATOM 3758  H HG22 . THR A 1 97  ? 18.083  -9.701  4.098   1.00 0.00 ? 97  THR A HG22 2  
ATOM 3759  H HG23 . THR A 1 97  ? 18.975  -9.448  5.598   1.00 0.00 ? 97  THR A HG23 2  
ATOM 3760  N N    . LEU A 1 98  ? 17.150  -8.988  2.045   1.00 0.00 ? 98  LEU A N    2  
ATOM 3761  C CA   . LEU A 1 98  ? 15.931  -9.588  1.441   1.00 0.00 ? 98  LEU A CA   2  
ATOM 3762  C C    . LEU A 1 98  ? 14.707  -8.681  1.484   1.00 0.00 ? 98  LEU A C    2  
ATOM 3763  O O    . LEU A 1 98  ? 14.102  -8.365  0.462   1.00 0.00 ? 98  LEU A O    2  
ATOM 3764  C CB   . LEU A 1 98  ? 15.534  -10.885 2.179   1.00 0.00 ? 98  LEU A CB   2  
ATOM 3765  C CG   . LEU A 1 98  ? 16.356  -12.151 1.899   1.00 0.00 ? 98  LEU A CG   2  
ATOM 3766  C CD1  . LEU A 1 98  ? 16.400  -12.458 0.404   1.00 0.00 ? 98  LEU A CD1  2  
ATOM 3767  C CD2  . LEU A 1 98  ? 17.764  -12.050 2.480   1.00 0.00 ? 98  LEU A CD2  2  
ATOM 3768  H H    . LEU A 1 98  ? 17.892  -9.588  2.252   1.00 0.00 ? 98  LEU A H    2  
ATOM 3769  H HA   . LEU A 1 98  ? 16.153  -9.830  0.412   1.00 0.00 ? 98  LEU A HA   2  
ATOM 3770  H HB2  . LEU A 1 98  ? 15.588  -10.688 3.240   1.00 0.00 ? 98  LEU A HB2  2  
ATOM 3771  H HB3  . LEU A 1 98  ? 14.499  -11.104 1.934   1.00 0.00 ? 98  LEU A HB3  2  
ATOM 3772  H HG   . LEU A 1 98  ? 15.857  -12.980 2.388   1.00 0.00 ? 98  LEU A HG   2  
ATOM 3773  H HD11 . LEU A 1 98  ? 16.950  -13.374 0.241   1.00 0.00 ? 98  LEU A HD11 2  
ATOM 3774  H HD12 . LEU A 1 98  ? 16.888  -11.647 -0.118  1.00 0.00 ? 98  LEU A HD12 2  
ATOM 3775  H HD13 . LEU A 1 98  ? 15.393  -12.571 0.030   1.00 0.00 ? 98  LEU A HD13 2  
ATOM 3776  H HD21 . LEU A 1 98  ? 17.704  -11.786 3.526   1.00 0.00 ? 98  LEU A HD21 2  
ATOM 3777  H HD22 . LEU A 1 98  ? 18.324  -11.296 1.948   1.00 0.00 ? 98  LEU A HD22 2  
ATOM 3778  H HD23 . LEU A 1 98  ? 18.262  -13.003 2.380   1.00 0.00 ? 98  LEU A HD23 2  
ATOM 3779  N N    . HIS A 1 99  ? 14.349  -8.288  2.693   1.00 0.00 ? 99  HIS A N    2  
ATOM 3780  C CA   . HIS A 1 99  ? 13.040  -7.733  2.972   1.00 0.00 ? 99  HIS A CA   2  
ATOM 3781  C C    . HIS A 1 99  ? 13.156  -6.670  4.067   1.00 0.00 ? 99  HIS A C    2  
ATOM 3782  O O    . HIS A 1 99  ? 12.252  -6.477  4.878   1.00 0.00 ? 99  HIS A O    2  
ATOM 3783  C CB   . HIS A 1 99  ? 12.139  -8.913  3.374   1.00 0.00 ? 99  HIS A CB   2  
ATOM 3784  C CG   . HIS A 1 99  ? 10.765  -8.569  3.843   1.00 0.00 ? 99  HIS A CG   2  
ATOM 3785  N ND1  . HIS A 1 99  ? 9.854   -7.843  3.103   1.00 0.00 ? 99  HIS A ND1  2  
ATOM 3786  C CD2  . HIS A 1 99  ? 10.149  -8.890  4.993   1.00 0.00 ? 99  HIS A CD2  2  
ATOM 3787  C CE1  . HIS A 1 99  ? 8.731   -7.733  3.790   1.00 0.00 ? 99  HIS A CE1  2  
ATOM 3788  N NE2  . HIS A 1 99  ? 8.886   -8.360  4.943   1.00 0.00 ? 99  HIS A NE2  2  
ATOM 3789  H H    . HIS A 1 99  ? 14.994  -8.371  3.425   1.00 0.00 ? 99  HIS A H    2  
ATOM 3790  H HA   . HIS A 1 99  ? 12.656  -7.276  2.071   1.00 0.00 ? 99  HIS A HA   2  
ATOM 3791  H HB2  . HIS A 1 99  ? 12.028  -9.565  2.522   1.00 0.00 ? 99  HIS A HB2  2  
ATOM 3792  H HB3  . HIS A 1 99  ? 12.628  -9.463  4.167   1.00 0.00 ? 99  HIS A HB3  2  
ATOM 3793  H HD1  . HIS A 1 99  ? 10.003  -7.471  2.207   1.00 0.00 ? 99  HIS A HD1  2  
ATOM 3794  H HD2  . HIS A 1 99  ? 10.576  -9.483  5.792   1.00 0.00 ? 99  HIS A HD2  2  
ATOM 3795  H HE1  . HIS A 1 99  ? 7.837   -7.225  3.461   1.00 0.00 ? 99  HIS A HE1  2  
ATOM 3796  H HE2  . HIS A 1 99  ? 8.164   -8.547  5.588   1.00 0.00 ? 99  HIS A HE2  2  
ATOM 3797  N N    . SER A 1 100 ? 14.270  -5.939  4.026   1.00 0.00 ? 100 SER A N    2  
ATOM 3798  C CA   . SER A 1 100 ? 14.599  -4.936  5.042   1.00 0.00 ? 100 SER A CA   2  
ATOM 3799  C C    . SER A 1 100 ? 13.547  -3.817  5.111   1.00 0.00 ? 100 SER A C    2  
ATOM 3800  O O    . SER A 1 100 ? 13.560  -3.001  6.034   1.00 0.00 ? 100 SER A O    2  
ATOM 3801  C CB   . SER A 1 100 ? 15.988  -4.341  4.755   1.00 0.00 ? 100 SER A CB   2  
ATOM 3802  O OG   . SER A 1 100 ? 16.403  -3.464  5.792   1.00 0.00 ? 100 SER A OG   2  
ATOM 3803  H H    . SER A 1 100 ? 14.899  -6.084  3.285   1.00 0.00 ? 100 SER A H    2  
ATOM 3804  H HA   . SER A 1 100 ? 14.630  -5.439  5.999   1.00 0.00 ? 100 SER A HA   2  
ATOM 3805  H HB2  . SER A 1 100 ? 16.710  -5.139  4.672   1.00 0.00 ? 100 SER A HB2  2  
ATOM 3806  H HB3  . SER A 1 100 ? 15.956  -3.789  3.827   1.00 0.00 ? 100 SER A HB3  2  
ATOM 3807  H HG   . SER A 1 100 ? 15.804  -2.707  5.830   1.00 0.00 ? 100 SER A HG   2  
ATOM 3808  N N    . PHE A 1 101 ? 12.645  -3.779  4.131   1.00 0.00 ? 101 PHE A N    2  
ATOM 3809  C CA   . PHE A 1 101 ? 11.571  -2.785  4.104   1.00 0.00 ? 101 PHE A CA   2  
ATOM 3810  C C    . PHE A 1 101 ? 10.348  -3.269  4.888   1.00 0.00 ? 101 PHE A C    2  
ATOM 3811  O O    . PHE A 1 101 ? 9.268   -2.696  4.770   1.00 0.00 ? 101 PHE A O    2  
ATOM 3812  C CB   . PHE A 1 101 ? 11.171  -2.468  2.654   1.00 0.00 ? 101 PHE A CB   2  
ATOM 3813  C CG   . PHE A 1 101 ? 12.211  -1.688  1.884   1.00 0.00 ? 101 PHE A CG   2  
ATOM 3814  C CD1  . PHE A 1 101 ? 13.257  -2.336  1.243   1.00 0.00 ? 101 PHE A CD1  2  
ATOM 3815  C CD2  . PHE A 1 101 ? 12.139  -0.304  1.800   1.00 0.00 ? 101 PHE A CD2  2  
ATOM 3816  C CE1  . PHE A 1 101 ? 14.208  -1.622  0.536   1.00 0.00 ? 101 PHE A CE1  2  
ATOM 3817  C CE2  . PHE A 1 101 ? 13.086  0.413   1.092   1.00 0.00 ? 101 PHE A CE2  2  
ATOM 3818  C CZ   . PHE A 1 101 ? 14.121  -0.246  0.459   1.00 0.00 ? 101 PHE A CZ   2  
ATOM 3819  H H    . PHE A 1 101 ? 12.702  -4.434  3.409   1.00 0.00 ? 101 PHE A H    2  
ATOM 3820  H HA   . PHE A 1 101 ? 11.941  -1.881  4.570   1.00 0.00 ? 101 PHE A HA   2  
ATOM 3821  H HB2  . PHE A 1 101 ? 10.996  -3.396  2.128   1.00 0.00 ? 101 PHE A HB2  2  
ATOM 3822  H HB3  . PHE A 1 101 ? 10.257  -1.889  2.660   1.00 0.00 ? 101 PHE A HB3  2  
ATOM 3823  H HD1  . PHE A 1 101 ? 13.329  -3.414  1.301   1.00 0.00 ? 101 PHE A HD1  2  
ATOM 3824  H HD2  . PHE A 1 101 ? 11.331  0.216   2.294   1.00 0.00 ? 101 PHE A HD2  2  
ATOM 3825  H HE1  . PHE A 1 101 ? 15.017  -2.141  0.041   1.00 0.00 ? 101 PHE A HE1  2  
ATOM 3826  H HE2  . PHE A 1 101 ? 13.016  1.490   1.034   1.00 0.00 ? 101 PHE A HE2  2  
ATOM 3827  H HZ   . PHE A 1 101 ? 14.862  0.315   -0.095  1.00 0.00 ? 101 PHE A HZ   2  
ATOM 3828  N N    . ASP A 1 102 ? 10.528  -4.313  5.697   1.00 0.00 ? 102 ASP A N    2  
ATOM 3829  C CA   . ASP A 1 102 ? 9.434   -4.880  6.490   1.00 0.00 ? 102 ASP A CA   2  
ATOM 3830  C C    . ASP A 1 102 ? 8.840   -3.827  7.428   1.00 0.00 ? 102 ASP A C    2  
ATOM 3831  O O    . ASP A 1 102 ? 7.620   -3.695  7.537   1.00 0.00 ? 102 ASP A O    2  
ATOM 3832  C CB   . ASP A 1 102 ? 9.917   -6.100  7.294   1.00 0.00 ? 102 ASP A CB   2  
ATOM 3833  C CG   . ASP A 1 102 ? 10.968  -5.752  8.341   1.00 0.00 ? 102 ASP A CG   2  
ATOM 3834  O OD1  . ASP A 1 102 ? 12.081  -5.338  7.960   1.00 0.00 ? 102 ASP A OD1  2  
ATOM 3835  O OD2  . ASP A 1 102 ? 10.691  -5.905  9.549   1.00 0.00 ? 102 ASP A OD2  2  
ATOM 3836  H H    . ASP A 1 102 ? 11.422  -4.713  5.767   1.00 0.00 ? 102 ASP A H    2  
ATOM 3837  H HA   . ASP A 1 102 ? 8.664   -5.201  5.800   1.00 0.00 ? 102 ASP A HA   2  
ATOM 3838  H HB2  . ASP A 1 102 ? 9.070   -6.547  7.795   1.00 0.00 ? 102 ASP A HB2  2  
ATOM 3839  H HB3  . ASP A 1 102 ? 10.342  -6.824  6.612   1.00 0.00 ? 102 ASP A HB3  2  
ATOM 3840  N N    . ALA A 1 103 ? 9.713   -3.069  8.089   1.00 0.00 ? 103 ALA A N    2  
ATOM 3841  C CA   . ALA A 1 103 ? 9.281   -1.994  8.984   1.00 0.00 ? 103 ALA A CA   2  
ATOM 3842  C C    . ALA A 1 103 ? 8.484   -0.947  8.211   1.00 0.00 ? 103 ALA A C    2  
ATOM 3843  O O    . ALA A 1 103 ? 7.449   -0.461  8.674   1.00 0.00 ? 103 ALA A O    2  
ATOM 3844  C CB   . ALA A 1 103 ? 10.488  -1.353  9.664   1.00 0.00 ? 103 ALA A CB   2  
ATOM 3845  H H    . ALA A 1 103 ? 10.673  -3.244  7.981   1.00 0.00 ? 103 ALA A H    2  
ATOM 3846  H HA   . ALA A 1 103 ? 8.650   -2.427  9.749   1.00 0.00 ? 103 ALA A HA   2  
ATOM 3847  H HB1  . ALA A 1 103 ? 11.040  -2.110  10.205  1.00 0.00 ? 103 ALA A HB1  2  
ATOM 3848  H HB2  . ALA A 1 103 ? 10.155  -0.592  10.353  1.00 0.00 ? 103 ALA A HB2  2  
ATOM 3849  H HB3  . ALA A 1 103 ? 11.130  -0.907  8.917   1.00 0.00 ? 103 ALA A HB3  2  
ATOM 3850  N N    . ALA A 1 104 ? 8.972   -0.624  7.018   1.00 0.00 ? 104 ALA A N    2  
ATOM 3851  C CA   . ALA A 1 104 ? 8.327   0.357   6.154   1.00 0.00 ? 104 ALA A CA   2  
ATOM 3852  C C    . ALA A 1 104 ? 6.961   -0.145  5.697   1.00 0.00 ? 104 ALA A C    2  
ATOM 3853  O O    . ALA A 1 104 ? 5.994   0.617   5.631   1.00 0.00 ? 104 ALA A O    2  
ATOM 3854  C CB   . ALA A 1 104 ? 9.218   0.665   4.956   1.00 0.00 ? 104 ALA A CB   2  
ATOM 3855  H H    . ALA A 1 104 ? 9.788   -1.065  6.707   1.00 0.00 ? 104 ALA A H    2  
ATOM 3856  H HA   . ALA A 1 104 ? 8.196   1.269   6.722   1.00 0.00 ? 104 ALA A HA   2  
ATOM 3857  H HB1  . ALA A 1 104 ? 10.172  1.037   5.301   1.00 0.00 ? 104 ALA A HB1  2  
ATOM 3858  H HB2  . ALA A 1 104 ? 8.744   1.413   4.337   1.00 0.00 ? 104 ALA A HB2  2  
ATOM 3859  H HB3  . ALA A 1 104 ? 9.372   -0.236  4.379   1.00 0.00 ? 104 ALA A HB3  2  
ATOM 3860  N N    . GLN A 1 105 ? 6.898   -1.438  5.401   1.00 0.00 ? 105 GLN A N    2  
ATOM 3861  C CA   . GLN A 1 105 ? 5.666   -2.087  4.971   1.00 0.00 ? 105 GLN A CA   2  
ATOM 3862  C C    . GLN A 1 105 ? 4.599   -1.965  6.056   1.00 0.00 ? 105 GLN A C    2  
ATOM 3863  O O    . GLN A 1 105 ? 3.443   -1.647  5.773   1.00 0.00 ? 105 GLN A O    2  
ATOM 3864  C CB   . GLN A 1 105 ? 5.950   -3.562  4.647   1.00 0.00 ? 105 GLN A CB   2  
ATOM 3865  C CG   . GLN A 1 105 ? 4.725   -4.362  4.216   1.00 0.00 ? 105 GLN A CG   2  
ATOM 3866  C CD   . GLN A 1 105 ? 5.072   -5.787  3.812   1.00 0.00 ? 105 GLN A CD   2  
ATOM 3867  O OE1  . GLN A 1 105 ? 6.164   -6.055  3.312   1.00 0.00 ? 105 GLN A OE1  2  
ATOM 3868  N NE2  . GLN A 1 105 ? 4.154   -6.710  4.045   1.00 0.00 ? 105 GLN A NE2  2  
ATOM 3869  H H    . GLN A 1 105 ? 7.710   -1.977  5.479   1.00 0.00 ? 105 GLN A H    2  
ATOM 3870  H HA   . GLN A 1 105 ? 5.320   -1.588  4.077   1.00 0.00 ? 105 GLN A HA   2  
ATOM 3871  H HB2  . GLN A 1 105 ? 6.678   -3.608  3.849   1.00 0.00 ? 105 GLN A HB2  2  
ATOM 3872  H HB3  . GLN A 1 105 ? 6.370   -4.035  5.525   1.00 0.00 ? 105 GLN A HB3  2  
ATOM 3873  H HG2  . GLN A 1 105 ? 4.024   -4.398  5.040   1.00 0.00 ? 105 GLN A HG2  2  
ATOM 3874  H HG3  . GLN A 1 105 ? 4.263   -3.867  3.375   1.00 0.00 ? 105 GLN A HG3  2  
ATOM 3875  H HE21 . GLN A 1 105 ? 3.312   -6.430  4.467   1.00 0.00 ? 105 GLN A HE21 2  
ATOM 3876  H HE22 . GLN A 1 105 ? 4.348   -7.634  3.782   1.00 0.00 ? 105 GLN A HE22 2  
ATOM 3877  N N    . SER A 1 106 ? 5.009   -2.205  7.299   1.00 0.00 ? 106 SER A N    2  
ATOM 3878  C CA   . SER A 1 106 ? 4.117   -2.091  8.449   1.00 0.00 ? 106 SER A CA   2  
ATOM 3879  C C    . SER A 1 106 ? 3.549   -0.672  8.543   1.00 0.00 ? 106 SER A C    2  
ATOM 3880  O O    . SER A 1 106 ? 2.331   -0.482  8.611   1.00 0.00 ? 106 SER A O    2  
ATOM 3881  C CB   . SER A 1 106 ? 4.873   -2.453  9.737   1.00 0.00 ? 106 SER A CB   2  
ATOM 3882  O OG   . SER A 1 106 ? 4.024   -2.405  10.872  1.00 0.00 ? 106 SER A OG   2  
ATOM 3883  H H    . SER A 1 106 ? 5.942   -2.471  7.449   1.00 0.00 ? 106 SER A H    2  
ATOM 3884  H HA   . SER A 1 106 ? 3.302   -2.787  8.309   1.00 0.00 ? 106 SER A HA   2  
ATOM 3885  H HB2  . SER A 1 106 ? 5.272   -3.452  9.648   1.00 0.00 ? 106 SER A HB2  2  
ATOM 3886  H HB3  . SER A 1 106 ? 5.687   -1.755  9.883   1.00 0.00 ? 106 SER A HB3  2  
ATOM 3887  H HG   . SER A 1 106 ? 3.894   -3.302  11.209  1.00 0.00 ? 106 SER A HG   2  
ATOM 3888  N N    . ARG A 1 107 ? 4.447   0.315   8.519   1.00 0.00 ? 107 ARG A N    2  
ATOM 3889  C CA   . ARG A 1 107 ? 4.066   1.726   8.609   1.00 0.00 ? 107 ARG A CA   2  
ATOM 3890  C C    . ARG A 1 107 ? 3.040   2.090   7.536   1.00 0.00 ? 107 ARG A C    2  
ATOM 3891  O O    . ARG A 1 107 ? 1.915   2.478   7.840   1.00 0.00 ? 107 ARG A O    2  
ATOM 3892  C CB   . ARG A 1 107 ? 5.299   2.625   8.445   1.00 0.00 ? 107 ARG A CB   2  
ATOM 3893  C CG   . ARG A 1 107 ? 6.323   2.534   9.571   1.00 0.00 ? 107 ARG A CG   2  
ATOM 3894  C CD   . ARG A 1 107 ? 5.763   3.032   10.899  1.00 0.00 ? 107 ARG A CD   2  
ATOM 3895  N NE   . ARG A 1 107 ? 6.806   3.617   11.747  1.00 0.00 ? 107 ARG A NE   2  
ATOM 3896  C CZ   . ARG A 1 107 ? 6.681   3.826   13.058  1.00 0.00 ? 107 ARG A CZ   2  
ATOM 3897  N NH1  . ARG A 1 107 ? 5.615   3.379   13.711  1.00 0.00 ? 107 ARG A NH1  2  
ATOM 3898  N NH2  . ARG A 1 107 ? 7.633   4.470   13.720  1.00 0.00 ? 107 ARG A NH2  2  
ATOM 3899  H H    . ARG A 1 107 ? 5.398   0.086   8.436   1.00 0.00 ? 107 ARG A H    2  
ATOM 3900  H HA   . ARG A 1 107 ? 3.634   1.897   9.582   1.00 0.00 ? 107 ARG A HA   2  
ATOM 3901  H HB2  . ARG A 1 107 ? 5.797   2.357   7.523   1.00 0.00 ? 107 ARG A HB2  2  
ATOM 3902  H HB3  . ARG A 1 107 ? 4.970   3.654   8.372   1.00 0.00 ? 107 ARG A HB3  2  
ATOM 3903  H HG2  . ARG A 1 107 ? 6.627   1.504   9.685   1.00 0.00 ? 107 ARG A HG2  2  
ATOM 3904  H HG3  . ARG A 1 107 ? 7.185   3.133   9.307   1.00 0.00 ? 107 ARG A HG3  2  
ATOM 3905  H HD2  . ARG A 1 107 ? 5.011   3.784   10.704  1.00 0.00 ? 107 ARG A HD2  2  
ATOM 3906  H HD3  . ARG A 1 107 ? 5.311   2.199   11.421  1.00 0.00 ? 107 ARG A HD3  2  
ATOM 3907  H HE   . ARG A 1 107 ? 7.634   3.911   11.300  1.00 0.00 ? 107 ARG A HE   2  
ATOM 3908  H HH11 . ARG A 1 107 ? 4.895   2.877   13.223  1.00 0.00 ? 107 ARG A HH11 2  
ATOM 3909  H HH12 . ARG A 1 107 ? 5.527   3.540   14.699  1.00 0.00 ? 107 ARG A HH12 2  
ATOM 3910  H HH21 . ARG A 1 107 ? 8.448   4.808   13.234  1.00 0.00 ? 107 ARG A HH21 2  
ATOM 3911  H HH22 . ARG A 1 107 ? 7.539   4.631   14.707  1.00 0.00 ? 107 ARG A HH22 2  
ATOM 3912  N N    . VAL A 1 108 ? 3.445   1.939   6.282   1.00 0.00 ? 108 VAL A N    2  
ATOM 3913  C CA   . VAL A 1 108 ? 2.642   2.364   5.140   1.00 0.00 ? 108 VAL A CA   2  
ATOM 3914  C C    . VAL A 1 108 ? 1.268   1.690   5.121   1.00 0.00 ? 108 VAL A C    2  
ATOM 3915  O O    . VAL A 1 108 ? 0.243   2.353   4.927   1.00 0.00 ? 108 VAL A O    2  
ATOM 3916  C CB   . VAL A 1 108 ? 3.391   2.077   3.817   1.00 0.00 ? 108 VAL A CB   2  
ATOM 3917  C CG1  . VAL A 1 108 ? 2.488   2.305   2.610   1.00 0.00 ? 108 VAL A CG1  2  
ATOM 3918  C CG2  . VAL A 1 108 ? 4.648   2.941   3.727   1.00 0.00 ? 108 VAL A CG2  2  
ATOM 3919  H H    . VAL A 1 108 ? 4.315   1.520   6.115   1.00 0.00 ? 108 VAL A H    2  
ATOM 3920  H HA   . VAL A 1 108 ? 2.500   3.434   5.218   1.00 0.00 ? 108 VAL A HA   2  
ATOM 3921  H HB   . VAL A 1 108 ? 3.695   1.039   3.818   1.00 0.00 ? 108 VAL A HB   2  
ATOM 3922  H HG11 . VAL A 1 108 ? 2.145   3.331   2.605   1.00 0.00 ? 108 VAL A HG11 2  
ATOM 3923  H HG12 . VAL A 1 108 ? 1.636   1.641   2.662   1.00 0.00 ? 108 VAL A HG12 2  
ATOM 3924  H HG13 . VAL A 1 108 ? 3.041   2.108   1.703   1.00 0.00 ? 108 VAL A HG13 2  
ATOM 3925  H HG21 . VAL A 1 108 ? 5.304   2.711   4.555   1.00 0.00 ? 108 VAL A HG21 2  
ATOM 3926  H HG22 . VAL A 1 108 ? 4.373   3.986   3.768   1.00 0.00 ? 108 VAL A HG22 2  
ATOM 3927  H HG23 . VAL A 1 108 ? 5.160   2.741   2.798   1.00 0.00 ? 108 VAL A HG23 2  
ATOM 3928  N N    . TYR A 1 109 ? 1.257   0.379   5.334   1.00 0.00 ? 109 TYR A N    2  
ATOM 3929  C CA   . TYR A 1 109 ? 0.022   -0.402  5.310   1.00 0.00 ? 109 TYR A CA   2  
ATOM 3930  C C    . TYR A 1 109 ? -0.984  0.132   6.332   1.00 0.00 ? 109 TYR A C    2  
ATOM 3931  O O    . TYR A 1 109 ? -2.124  0.449   5.986   1.00 0.00 ? 109 TYR A O    2  
ATOM 3932  C CB   . TYR A 1 109 ? 0.342   -1.884  5.570   1.00 0.00 ? 109 TYR A CB   2  
ATOM 3933  C CG   . TYR A 1 109 ? -0.873  -2.782  5.759   1.00 0.00 ? 109 TYR A CG   2  
ATOM 3934  C CD1  . TYR A 1 109 ? -1.533  -3.340  4.668   1.00 0.00 ? 109 TYR A CD1  2  
ATOM 3935  C CD2  . TYR A 1 109 ? -1.352  -3.077  7.032   1.00 0.00 ? 109 TYR A CD2  2  
ATOM 3936  C CE1  . TYR A 1 109 ? -2.629  -4.164  4.842   1.00 0.00 ? 109 TYR A CE1  2  
ATOM 3937  C CE2  . TYR A 1 109 ? -2.449  -3.898  7.212   1.00 0.00 ? 109 TYR A CE2  2  
ATOM 3938  C CZ   . TYR A 1 109 ? -3.084  -4.437  6.116   1.00 0.00 ? 109 TYR A CZ   2  
ATOM 3939  O OH   . TYR A 1 109 ? -4.177  -5.256  6.294   1.00 0.00 ? 109 TYR A OH   2  
ATOM 3940  H H    . TYR A 1 109 ? 2.104   -0.081  5.520   1.00 0.00 ? 109 TYR A H    2  
ATOM 3941  H HA   . TYR A 1 109 ? -0.407  -0.307  4.322   1.00 0.00 ? 109 TYR A HA   2  
ATOM 3942  H HB2  . TYR A 1 109 ? 0.905   -2.272  4.733   1.00 0.00 ? 109 TYR A HB2  2  
ATOM 3943  H HB3  . TYR A 1 109 ? 0.949   -1.957  6.458   1.00 0.00 ? 109 TYR A HB3  2  
ATOM 3944  H HD1  . TYR A 1 109 ? -1.176  -3.123  3.670   1.00 0.00 ? 109 TYR A HD1  2  
ATOM 3945  H HD2  . TYR A 1 109 ? -0.855  -2.652  7.892   1.00 0.00 ? 109 TYR A HD2  2  
ATOM 3946  H HE1  . TYR A 1 109 ? -3.128  -4.588  3.982   1.00 0.00 ? 109 TYR A HE1  2  
ATOM 3947  H HE2  . TYR A 1 109 ? -2.804  -4.112  8.209   1.00 0.00 ? 109 TYR A HE2  2  
ATOM 3948  H HH   . TYR A 1 109 ? -4.762  -4.867  6.954   1.00 0.00 ? 109 TYR A HH   2  
ATOM 3949  N N    . GLN A 1 110 ? -0.546  0.265   7.584   1.00 0.00 ? 110 GLN A N    2  
ATOM 3950  C CA   . GLN A 1 110 ? -1.434  0.691   8.666   1.00 0.00 ? 110 GLN A CA   2  
ATOM 3951  C C    . GLN A 1 110 ? -1.783  2.174   8.533   1.00 0.00 ? 110 GLN A C    2  
ATOM 3952  O O    . GLN A 1 110 ? -2.880  2.602   8.898   1.00 0.00 ? 110 GLN A O    2  
ATOM 3953  C CB   . GLN A 1 110 ? -0.788  0.408   10.036  1.00 0.00 ? 110 GLN A CB   2  
ATOM 3954  C CG   . GLN A 1 110 ? 0.381   1.332   10.407  1.00 0.00 ? 110 GLN A CG   2  
ATOM 3955  C CD   . GLN A 1 110 ? -0.048  2.625   11.094  1.00 0.00 ? 110 GLN A CD   2  
ATOM 3956  O OE1  . GLN A 1 110 ? 0.615   3.654   10.971  1.00 0.00 ? 110 GLN A OE1  2  
ATOM 3957  N NE2  . GLN A 1 110 ? -1.154  2.580   11.824  1.00 0.00 ? 110 GLN A NE2  2  
ATOM 3958  H H    . GLN A 1 110 ? 0.396   0.070   7.786   1.00 0.00 ? 110 GLN A H    2  
ATOM 3959  H HA   . GLN A 1 110 ? -2.346  0.115   8.586   1.00 0.00 ? 110 GLN A HA   2  
ATOM 3960  H HB2  . GLN A 1 110 ? -1.546  0.503   10.801  1.00 0.00 ? 110 GLN A HB2  2  
ATOM 3961  H HB3  . GLN A 1 110 ? -0.424  -0.611  10.038  1.00 0.00 ? 110 GLN A HB3  2  
ATOM 3962  H HG2  . GLN A 1 110 ? 1.047   0.801   11.071  1.00 0.00 ? 110 GLN A HG2  2  
ATOM 3963  H HG3  . GLN A 1 110 ? 0.916   1.591   9.501   1.00 0.00 ? 110 GLN A HG3  2  
ATOM 3964  H HE21 . GLN A 1 110 ? -1.638  1.730   11.888  1.00 0.00 ? 110 GLN A HE21 2  
ATOM 3965  H HE22 . GLN A 1 110 ? -1.446  3.404   12.268  1.00 0.00 ? 110 GLN A HE22 2  
ATOM 3966  N N    . LEU A 1 111 ? -0.844  2.946   7.996   1.00 0.00 ? 111 LEU A N    2  
ATOM 3967  C CA   . LEU A 1 111 ? -0.995  4.394   7.903   1.00 0.00 ? 111 LEU A CA   2  
ATOM 3968  C C    . LEU A 1 111 ? -2.082  4.766   6.898   1.00 0.00 ? 111 LEU A C    2  
ATOM 3969  O O    . LEU A 1 111 ? -2.844  5.706   7.117   1.00 0.00 ? 111 LEU A O    2  
ATOM 3970  C CB   . LEU A 1 111 ? 0.341   5.048   7.524   1.00 0.00 ? 111 LEU A CB   2  
ATOM 3971  C CG   . LEU A 1 111 ? 0.363   6.581   7.594   1.00 0.00 ? 111 LEU A CG   2  
ATOM 3972  C CD1  . LEU A 1 111 ? 0.040   7.067   9.009   1.00 0.00 ? 111 LEU A CD1  2  
ATOM 3973  C CD2  . LEU A 1 111 ? 1.712   7.126   7.131   1.00 0.00 ? 111 LEU A CD2  2  
ATOM 3974  H H    . LEU A 1 111 ? -0.021  2.531   7.660   1.00 0.00 ? 111 LEU A H    2  
ATOM 3975  H HA   . LEU A 1 111 ? -1.291  4.752   8.880   1.00 0.00 ? 111 LEU A HA   2  
ATOM 3976  H HB2  . LEU A 1 111 ? 1.106   4.664   8.187   1.00 0.00 ? 111 LEU A HB2  2  
ATOM 3977  H HB3  . LEU A 1 111 ? 0.587   4.752   6.513   1.00 0.00 ? 111 LEU A HB3  2  
ATOM 3978  H HG   . LEU A 1 111 ? -0.396  6.968   6.935   1.00 0.00 ? 111 LEU A HG   2  
ATOM 3979  H HD11 . LEU A 1 111 ? 0.771   6.675   9.702   1.00 0.00 ? 111 LEU A HD11 2  
ATOM 3980  H HD12 . LEU A 1 111 ? -0.944  6.726   9.293   1.00 0.00 ? 111 LEU A HD12 2  
ATOM 3981  H HD13 . LEU A 1 111 ? 0.066   8.147   9.033   1.00 0.00 ? 111 LEU A HD13 2  
ATOM 3982  H HD21 . LEU A 1 111 ? 1.890   6.825   6.108   1.00 0.00 ? 111 LEU A HD21 2  
ATOM 3983  H HD22 . LEU A 1 111 ? 2.497   6.735   7.762   1.00 0.00 ? 111 LEU A HD22 2  
ATOM 3984  H HD23 . LEU A 1 111 ? 1.707   8.204   7.193   1.00 0.00 ? 111 LEU A HD23 2  
ATOM 3985  N N    . MET A 1 112 ? -2.156  4.030   5.792   1.00 0.00 ? 112 MET A N    2  
ATOM 3986  C CA   . MET A 1 112 ? -3.209  4.264   4.804   1.00 0.00 ? 112 MET A CA   2  
ATOM 3987  C C    . MET A 1 112 ? -4.490  3.557   5.238   1.00 0.00 ? 112 MET A C    2  
ATOM 3988  O O    . MET A 1 112 ? -5.586  3.922   4.821   1.00 0.00 ? 112 MET A O    2  
ATOM 3989  C CB   . MET A 1 112 ? -2.783  3.789   3.407   1.00 0.00 ? 112 MET A CB   2  
ATOM 3990  C CG   . MET A 1 112 ? -2.683  2.278   3.256   1.00 0.00 ? 112 MET A CG   2  
ATOM 3991  S SD   . MET A 1 112 ? -2.255  1.789   1.575   1.00 0.00 ? 112 MET A SD   2  
ATOM 3992  C CE   . MET A 1 112 ? -2.489  0.020   1.680   1.00 0.00 ? 112 MET A CE   2  
ATOM 3993  H H    . MET A 1 112 ? -1.497  3.320   5.639   1.00 0.00 ? 112 MET A H    2  
ATOM 3994  H HA   . MET A 1 112 ? -3.398  5.329   4.770   1.00 0.00 ? 112 MET A HA   2  
ATOM 3995  H HB2  . MET A 1 112 ? -3.504  4.146   2.685   1.00 0.00 ? 112 MET A HB2  2  
ATOM 3996  H HB3  . MET A 1 112 ? -1.818  4.216   3.174   1.00 0.00 ? 112 MET A HB3  2  
ATOM 3997  H HG2  . MET A 1 112 ? -1.920  1.909   3.927   1.00 0.00 ? 112 MET A HG2  2  
ATOM 3998  H HG3  . MET A 1 112 ? -3.634  1.837   3.513   1.00 0.00 ? 112 MET A HG3  2  
ATOM 3999  H HE1  . MET A 1 112 ? -3.505  -0.192  1.969   1.00 0.00 ? 112 MET A HE1  2  
ATOM 4000  H HE2  . MET A 1 112 ? -1.809  -0.387  2.416   1.00 0.00 ? 112 MET A HE2  2  
ATOM 4001  H HE3  . MET A 1 112 ? -2.287  -0.425  0.718   1.00 0.00 ? 112 MET A HE3  2  
ATOM 4002  N N    . GLU A 1 113 ? -4.338  2.546   6.084   1.00 0.00 ? 113 GLU A N    2  
ATOM 4003  C CA   . GLU A 1 113 ? -5.472  1.800   6.615   1.00 0.00 ? 113 GLU A CA   2  
ATOM 4004  C C    . GLU A 1 113 ? -6.380  2.728   7.427   1.00 0.00 ? 113 GLU A C    2  
ATOM 4005  O O    . GLU A 1 113 ? -7.547  2.929   7.087   1.00 0.00 ? 113 GLU A O    2  
ATOM 4006  C CB   . GLU A 1 113 ? -4.966  0.643   7.489   1.00 0.00 ? 113 GLU A CB   2  
ATOM 4007  C CG   . GLU A 1 113 ? -6.064  -0.247  8.059   1.00 0.00 ? 113 GLU A CG   2  
ATOM 4008  C CD   . GLU A 1 113 ? -5.519  -1.276  9.037   1.00 0.00 ? 113 GLU A CD   2  
ATOM 4009  O OE1  . GLU A 1 113 ? -5.385  -0.946  10.234  1.00 0.00 ? 113 GLU A OE1  2  
ATOM 4010  O OE2  . GLU A 1 113 ? -5.218  -2.414  8.619   1.00 0.00 ? 113 GLU A OE2  2  
ATOM 4011  H H    . GLU A 1 113 ? -3.433  2.289   6.359   1.00 0.00 ? 113 GLU A H    2  
ATOM 4012  H HA   . GLU A 1 113 ? -6.031  1.398   5.782   1.00 0.00 ? 113 GLU A HA   2  
ATOM 4013  H HB2  . GLU A 1 113 ? -4.310  0.023   6.894   1.00 0.00 ? 113 GLU A HB2  2  
ATOM 4014  H HB3  . GLU A 1 113 ? -4.400  1.053   8.315   1.00 0.00 ? 113 GLU A HB3  2  
ATOM 4015  H HG2  . GLU A 1 113 ? -6.785  0.374   8.572   1.00 0.00 ? 113 GLU A HG2  2  
ATOM 4016  H HG3  . GLU A 1 113 ? -6.553  -0.764  7.244   1.00 0.00 ? 113 GLU A HG3  2  
ATOM 4017  N N    . GLN A 1 114 ? -5.814  3.328   8.469   1.00 0.00 ? 114 GLN A N    2  
ATOM 4018  C CA   . GLN A 1 114 ? -6.566  4.191   9.383   1.00 0.00 ? 114 GLN A CA   2  
ATOM 4019  C C    . GLN A 1 114 ? -7.408  5.236   8.634   1.00 0.00 ? 114 GLN A C    2  
ATOM 4020  O O    . GLN A 1 114 ? -8.518  5.567   9.061   1.00 0.00 ? 114 GLN A O    2  
ATOM 4021  C CB   . GLN A 1 114 ? -5.604  4.895   10.353  1.00 0.00 ? 114 GLN A CB   2  
ATOM 4022  C CG   . GLN A 1 114 ? -4.528  5.714   9.649   1.00 0.00 ? 114 GLN A CG   2  
ATOM 4023  C CD   . GLN A 1 114 ? -3.656  6.513   10.602  1.00 0.00 ? 114 GLN A CD   2  
ATOM 4024  O OE1  . GLN A 1 114 ? -3.419  6.111   11.744  1.00 0.00 ? 114 GLN A OE1  2  
ATOM 4025  N NE2  . GLN A 1 114 ? -3.187  7.663   10.147  1.00 0.00 ? 114 GLN A NE2  2  
ATOM 4026  H H    . GLN A 1 114 ? -4.856  3.185   8.635   1.00 0.00 ? 114 GLN A H    2  
ATOM 4027  H HA   . GLN A 1 114 ? -7.231  3.559   9.955   1.00 0.00 ? 114 GLN A HA   2  
ATOM 4028  H HB2  . GLN A 1 114 ? -6.172  5.556   10.994  1.00 0.00 ? 114 GLN A HB2  2  
ATOM 4029  H HB3  . GLN A 1 114 ? -5.117  4.149   10.965  1.00 0.00 ? 114 GLN A HB3  2  
ATOM 4030  H HG2  . GLN A 1 114 ? -3.893  5.043   9.089   1.00 0.00 ? 114 GLN A HG2  2  
ATOM 4031  H HG3  . GLN A 1 114 ? -5.010  6.400   8.967   1.00 0.00 ? 114 GLN A HG3  2  
ATOM 4032  H HE21 . GLN A 1 114 ? -3.431  7.932   9.230   1.00 0.00 ? 114 GLN A HE21 2  
ATOM 4033  H HE22 . GLN A 1 114 ? -2.616  8.199   10.735  1.00 0.00 ? 114 GLN A HE22 2  
ATOM 4034  N N    . ASP A 1 115 ? -6.889  5.740   7.513   1.00 0.00 ? 115 ASP A N    2  
ATOM 4035  C CA   . ASP A 1 115 ? -7.555  6.814   6.766   1.00 0.00 ? 115 ASP A CA   2  
ATOM 4036  C C    . ASP A 1 115 ? -8.228  6.297   5.491   1.00 0.00 ? 115 ASP A C    2  
ATOM 4037  O O    . ASP A 1 115 ? -9.455  6.313   5.378   1.00 0.00 ? 115 ASP A O    2  
ATOM 4038  C CB   . ASP A 1 115 ? -6.554  7.936   6.424   1.00 0.00 ? 115 ASP A CB   2  
ATOM 4039  C CG   . ASP A 1 115 ? -6.274  8.858   7.607   1.00 0.00 ? 115 ASP A CG   2  
ATOM 4040  O OD1  . ASP A 1 115 ? -7.038  9.831   7.795   1.00 0.00 ? 115 ASP A OD1  2  
ATOM 4041  O OD2  . ASP A 1 115 ? -5.301  8.616   8.354   1.00 0.00 ? 115 ASP A OD2  2  
ATOM 4042  H H    . ASP A 1 115 ? -6.039  5.381   7.181   1.00 0.00 ? 115 ASP A H    2  
ATOM 4043  H HA   . ASP A 1 115 ? -8.323  7.228   7.407   1.00 0.00 ? 115 ASP A HA   2  
ATOM 4044  H HB2  . ASP A 1 115 ? -5.619  7.492   6.108   1.00 0.00 ? 115 ASP A HB2  2  
ATOM 4045  H HB3  . ASP A 1 115 ? -6.950  8.532   5.613   1.00 0.00 ? 115 ASP A HB3  2  
ATOM 4046  N N    . SER A 1 116 ? -7.431  5.827   4.540   1.00 0.00 ? 116 SER A N    2  
ATOM 4047  C CA   . SER A 1 116 ? -7.941  5.443   3.222   1.00 0.00 ? 116 SER A CA   2  
ATOM 4048  C C    . SER A 1 116 ? -8.915  4.262   3.313   1.00 0.00 ? 116 SER A C    2  
ATOM 4049  O O    . SER A 1 116 ? -9.903  4.214   2.577   1.00 0.00 ? 116 SER A O    2  
ATOM 4050  C CB   . SER A 1 116 ? -6.778  5.104   2.276   1.00 0.00 ? 116 SER A CB   2  
ATOM 4051  O OG   . SER A 1 116 ? -7.241  4.808   0.968   1.00 0.00 ? 116 SER A OG   2  
ATOM 4052  H H    . SER A 1 116 ? -6.475  5.729   4.726   1.00 0.00 ? 116 SER A H    2  
ATOM 4053  H HA   . SER A 1 116 ? -8.474  6.295   2.821   1.00 0.00 ? 116 SER A HA   2  
ATOM 4054  H HB2  . SER A 1 116 ? -6.105  5.947   2.221   1.00 0.00 ? 116 SER A HB2  2  
ATOM 4055  H HB3  . SER A 1 116 ? -6.245  4.245   2.657   1.00 0.00 ? 116 SER A HB3  2  
ATOM 4056  H HG   . SER A 1 116 ? -8.192  4.940   0.925   1.00 0.00 ? 116 SER A HG   2  
ATOM 4057  N N    . TYR A 1 117 ? -8.646  3.320   4.217   1.00 0.00 ? 117 TYR A N    2  
ATOM 4058  C CA   . TYR A 1 117 ? -9.484  2.125   4.358   1.00 0.00 ? 117 TYR A CA   2  
ATOM 4059  C C    . TYR A 1 117 ? -10.850 2.482   4.947   1.00 0.00 ? 117 TYR A C    2  
ATOM 4060  O O    . TYR A 1 117 ? -11.875 1.968   4.501   1.00 0.00 ? 117 TYR A O    2  
ATOM 4061  C CB   . TYR A 1 117 ? -8.750  1.070   5.203   1.00 0.00 ? 117 TYR A CB   2  
ATOM 4062  C CG   . TYR A 1 117 ? -9.611  -0.055  5.753   1.00 0.00 ? 117 TYR A CG   2  
ATOM 4063  C CD1  . TYR A 1 117 ? -10.343 -0.889  4.912   1.00 0.00 ? 117 TYR A CD1  2  
ATOM 4064  C CD2  . TYR A 1 117 ? -9.667  -0.293  7.122   1.00 0.00 ? 117 TYR A CD2  2  
ATOM 4065  C CE1  . TYR A 1 117 ? -11.106 -1.923  5.424   1.00 0.00 ? 117 TYR A CE1  2  
ATOM 4066  C CE2  . TYR A 1 117 ? -10.422 -1.325  7.638   1.00 0.00 ? 117 TYR A CE2  2  
ATOM 4067  C CZ   . TYR A 1 117 ? -11.138 -2.135  6.788   1.00 0.00 ? 117 TYR A CZ   2  
ATOM 4068  O OH   . TYR A 1 117 ? -11.885 -3.167  7.302   1.00 0.00 ? 117 TYR A OH   2  
ATOM 4069  H H    . TYR A 1 117 ? -7.872  3.435   4.814   1.00 0.00 ? 117 TYR A H    2  
ATOM 4070  H HA   . TYR A 1 117 ? -9.639  1.721   3.365   1.00 0.00 ? 117 TYR A HA   2  
ATOM 4071  H HB2  . TYR A 1 117 ? -7.980  0.614   4.592   1.00 0.00 ? 117 TYR A HB2  2  
ATOM 4072  H HB3  . TYR A 1 117 ? -8.282  1.567   6.043   1.00 0.00 ? 117 TYR A HB3  2  
ATOM 4073  H HD1  . TYR A 1 117 ? -10.315 -0.719  3.845   1.00 0.00 ? 117 TYR A HD1  2  
ATOM 4074  H HD2  . TYR A 1 117 ? -9.104  0.344   7.790   1.00 0.00 ? 117 TYR A HD2  2  
ATOM 4075  H HE1  . TYR A 1 117 ? -11.669 -2.559  4.757   1.00 0.00 ? 117 TYR A HE1  2  
ATOM 4076  H HE2  . TYR A 1 117 ? -10.451 -1.490  8.705   1.00 0.00 ? 117 TYR A HE2  2  
ATOM 4077  H HH   . TYR A 1 117 ? -12.283 -2.892  8.134   1.00 0.00 ? 117 TYR A HH   2  
ATOM 4078  N N    . THR A 1 118 ? -10.869 3.382   5.924   1.00 0.00 ? 118 THR A N    2  
ATOM 4079  C CA   . THR A 1 118 ? -12.131 3.849   6.496   1.00 0.00 ? 118 THR A CA   2  
ATOM 4080  C C    . THR A 1 118 ? -12.928 4.624   5.442   1.00 0.00 ? 118 THR A C    2  
ATOM 4081  O O    . THR A 1 118 ? -14.141 4.420   5.275   1.00 0.00 ? 118 THR A O    2  
ATOM 4082  C CB   . THR A 1 118 ? -11.895 4.730   7.747   1.00 0.00 ? 118 THR A CB   2  
ATOM 4083  O OG1  . THR A 1 118 ? -10.943 5.762   7.452   1.00 0.00 ? 118 THR A OG1  2  
ATOM 4084  C CG2  . THR A 1 118 ? -11.390 3.896   8.918   1.00 0.00 ? 118 THR A CG2  2  
ATOM 4085  H H    . THR A 1 118 ? -10.024 3.745   6.264   1.00 0.00 ? 118 THR A H    2  
ATOM 4086  H HA   . THR A 1 118 ? -12.703 2.979   6.793   1.00 0.00 ? 118 THR A HA   2  
ATOM 4087  H HB   . THR A 1 118 ? -12.833 5.187   8.030   1.00 0.00 ? 118 THR A HB   2  
ATOM 4088  H HG1  . THR A 1 118 ? -10.160 5.641   8.006   1.00 0.00 ? 118 THR A HG1  2  
ATOM 4089  H HG21 . THR A 1 118 ? -10.458 3.420   8.647   1.00 0.00 ? 118 THR A HG21 2  
ATOM 4090  H HG22 . THR A 1 118 ? -12.120 3.140   9.167   1.00 0.00 ? 118 THR A HG22 2  
ATOM 4091  H HG23 . THR A 1 118 ? -11.229 4.535   9.775   1.00 0.00 ? 118 THR A HG23 2  
ATOM 4092  N N    . ARG A 1 119 ? -12.228 5.495   4.711   1.00 0.00 ? 119 ARG A N    2  
ATOM 4093  C CA   . ARG A 1 119 ? -12.829 6.225   3.596   1.00 0.00 ? 119 ARG A CA   2  
ATOM 4094  C C    . ARG A 1 119 ? -13.403 5.245   2.577   1.00 0.00 ? 119 ARG A C    2  
ATOM 4095  O O    . ARG A 1 119 ? -14.488 5.458   2.043   1.00 0.00 ? 119 ARG A O    2  
ATOM 4096  C CB   . ARG A 1 119 ? -11.802 7.151   2.927   1.00 0.00 ? 119 ARG A CB   2  
ATOM 4097  C CG   . ARG A 1 119 ? -11.370 8.323   3.804   1.00 0.00 ? 119 ARG A CG   2  
ATOM 4098  C CD   . ARG A 1 119 ? -10.339 9.208   3.111   1.00 0.00 ? 119 ARG A CD   2  
ATOM 4099  N NE   . ARG A 1 119 ? -10.821 9.727   1.826   1.00 0.00 ? 119 ARG A NE   2  
ATOM 4100  C CZ   . ARG A 1 119 ? -11.432 10.903  1.667   1.00 0.00 ? 119 ARG A CZ   2  
ATOM 4101  N NH1  . ARG A 1 119 ? -11.614 11.715  2.704   1.00 0.00 ? 119 ARG A NH1  2  
ATOM 4102  N NH2  . ARG A 1 119 ? -11.849 11.271  0.465   1.00 0.00 ? 119 ARG A NH2  2  
ATOM 4103  H H    . ARG A 1 119 ? -11.284 5.655   4.934   1.00 0.00 ? 119 ARG A H    2  
ATOM 4104  H HA   . ARG A 1 119 ? -13.637 6.823   3.994   1.00 0.00 ? 119 ARG A HA   2  
ATOM 4105  H HB2  . ARG A 1 119 ? -10.924 6.573   2.676   1.00 0.00 ? 119 ARG A HB2  2  
ATOM 4106  H HB3  . ARG A 1 119 ? -12.231 7.550   2.017   1.00 0.00 ? 119 ARG A HB3  2  
ATOM 4107  H HG2  . ARG A 1 119 ? -12.238 8.921   4.041   1.00 0.00 ? 119 ARG A HG2  2  
ATOM 4108  H HG3  . ARG A 1 119 ? -10.941 7.934   4.718   1.00 0.00 ? 119 ARG A HG3  2  
ATOM 4109  H HD2  . ARG A 1 119 ? -10.103 10.040  3.760   1.00 0.00 ? 119 ARG A HD2  2  
ATOM 4110  H HD3  . ARG A 1 119 ? -9.444  8.627   2.938   1.00 0.00 ? 119 ARG A HD3  2  
ATOM 4111  H HE   . ARG A 1 119 ? -10.676 9.162   1.033   1.00 0.00 ? 119 ARG A HE   2  
ATOM 4112  H HH11 . ARG A 1 119 ? -11.289 11.450  3.612   1.00 0.00 ? 119 ARG A HH11 2  
ATOM 4113  H HH12 . ARG A 1 119 ? -12.076 12.599  2.579   1.00 0.00 ? 119 ARG A HH12 2  
ATOM 4114  H HH21 . ARG A 1 119 ? -11.707 10.666  -0.325  1.00 0.00 ? 119 ARG A HH21 2  
ATOM 4115  H HH22 . ARG A 1 119 ? -12.309 12.153  0.335   1.00 0.00 ? 119 ARG A HH22 2  
ATOM 4116  N N    . PHE A 1 120 ? -12.679 4.158   2.330   1.00 0.00 ? 120 PHE A N    2  
ATOM 4117  C CA   . PHE A 1 120 ? -13.154 3.115   1.428   1.00 0.00 ? 120 PHE A CA   2  
ATOM 4118  C C    . PHE A 1 120 ? -14.451 2.510   1.962   1.00 0.00 ? 120 PHE A C    2  
ATOM 4119  O O    . PHE A 1 120 ? -15.387 2.257   1.204   1.00 0.00 ? 120 PHE A O    2  
ATOM 4120  C CB   . PHE A 1 120 ? -12.092 2.021   1.246   1.00 0.00 ? 120 PHE A CB   2  
ATOM 4121  C CG   . PHE A 1 120 ? -12.532 0.904   0.329   1.00 0.00 ? 120 PHE A CG   2  
ATOM 4122  C CD1  . PHE A 1 120 ? -12.450 1.049   -1.050  1.00 0.00 ? 120 PHE A CD1  2  
ATOM 4123  C CD2  . PHE A 1 120 ? -13.038 -0.283  0.843   1.00 0.00 ? 120 PHE A CD2  2  
ATOM 4124  C CE1  . PHE A 1 120 ? -12.860 0.033   -1.892  1.00 0.00 ? 120 PHE A CE1  2  
ATOM 4125  C CE2  . PHE A 1 120 ? -13.452 -1.298  0.003   1.00 0.00 ? 120 PHE A CE2  2  
ATOM 4126  C CZ   . PHE A 1 120 ? -13.361 -1.141  -1.366  1.00 0.00 ? 120 PHE A CZ   2  
ATOM 4127  H H    . PHE A 1 120 ? -11.803 4.058   2.758   1.00 0.00 ? 120 PHE A H    2  
ATOM 4128  H HA   . PHE A 1 120 ? -13.353 3.575   0.469   1.00 0.00 ? 120 PHE A HA   2  
ATOM 4129  H HB2  . PHE A 1 120 ? -11.197 2.462   0.830   1.00 0.00 ? 120 PHE A HB2  2  
ATOM 4130  H HB3  . PHE A 1 120 ? -11.858 1.589   2.211   1.00 0.00 ? 120 PHE A HB3  2  
ATOM 4131  H HD1  . PHE A 1 120 ? -12.059 1.966   -1.466  1.00 0.00 ? 120 PHE A HD1  2  
ATOM 4132  H HD2  . PHE A 1 120 ? -13.108 -0.410  1.914   1.00 0.00 ? 120 PHE A HD2  2  
ATOM 4133  H HE1  . PHE A 1 120 ? -12.790 0.160   -2.963  1.00 0.00 ? 120 PHE A HE1  2  
ATOM 4134  H HE2  . PHE A 1 120 ? -13.842 -2.218  0.416   1.00 0.00 ? 120 PHE A HE2  2  
ATOM 4135  H HZ   . PHE A 1 120 ? -13.685 -1.935  -2.024  1.00 0.00 ? 120 PHE A HZ   2  
ATOM 4136  N N    . LEU A 1 121 ? -14.508 2.304   3.275   1.00 0.00 ? 121 LEU A N    2  
ATOM 4137  C CA   . LEU A 1 121 ? -15.696 1.745   3.920   1.00 0.00 ? 121 LEU A CA   2  
ATOM 4138  C C    . LEU A 1 121 ? -16.865 2.733   3.879   1.00 0.00 ? 121 LEU A C    2  
ATOM 4139  O O    . LEU A 1 121 ? -17.990 2.393   4.257   1.00 0.00 ? 121 LEU A O    2  
ATOM 4140  C CB   . LEU A 1 121 ? -15.390 1.350   5.372   1.00 0.00 ? 121 LEU A CB   2  
ATOM 4141  C CG   . LEU A 1 121 ? -14.344 0.237   5.545   1.00 0.00 ? 121 LEU A CG   2  
ATOM 4142  C CD1  . LEU A 1 121 ? -14.116 -0.063  7.025   1.00 0.00 ? 121 LEU A CD1  2  
ATOM 4143  C CD2  . LEU A 1 121 ? -14.769 -1.025  4.793   1.00 0.00 ? 121 LEU A CD2  2  
ATOM 4144  H H    . LEU A 1 121 ? -13.727 2.526   3.826   1.00 0.00 ? 121 LEU A H    2  
ATOM 4145  H HA   . LEU A 1 121 ? -15.981 0.857   3.371   1.00 0.00 ? 121 LEU A HA   2  
ATOM 4146  H HB2  . LEU A 1 121 ? -15.039 2.230   5.894   1.00 0.00 ? 121 LEU A HB2  2  
ATOM 4147  H HB3  . LEU A 1 121 ? -16.310 1.023   5.835   1.00 0.00 ? 121 LEU A HB3  2  
ATOM 4148  H HG   . LEU A 1 121 ? -13.404 0.570   5.129   1.00 0.00 ? 121 LEU A HG   2  
ATOM 4149  H HD11 . LEU A 1 121 ? -13.756 0.828   7.522   1.00 0.00 ? 121 LEU A HD11 2  
ATOM 4150  H HD12 . LEU A 1 121 ? -13.382 -0.849  7.127   1.00 0.00 ? 121 LEU A HD12 2  
ATOM 4151  H HD13 . LEU A 1 121 ? -15.045 -0.378  7.480   1.00 0.00 ? 121 LEU A HD13 2  
ATOM 4152  H HD21 . LEU A 1 121 ? -14.857 -0.805  3.738   1.00 0.00 ? 121 LEU A HD21 2  
ATOM 4153  H HD22 . LEU A 1 121 ? -15.724 -1.367  5.168   1.00 0.00 ? 121 LEU A HD22 2  
ATOM 4154  H HD23 . LEU A 1 121 ? -14.029 -1.798  4.938   1.00 0.00 ? 121 LEU A HD23 2  
ATOM 4155  N N    . LYS A 1 122 ? -16.600 3.966   3.459   1.00 0.00 ? 122 LYS A N    2  
ATOM 4156  C CA   . LYS A 1 122 ? -17.673 4.940   3.253   1.00 0.00 ? 122 LYS A CA   2  
ATOM 4157  C C    . LYS A 1 122 ? -17.558 5.620   1.881   1.00 0.00 ? 122 LYS A C    2  
ATOM 4158  O O    . LYS A 1 122 ? -18.121 6.693   1.657   1.00 0.00 ? 122 LYS A O    2  
ATOM 4159  C CB   . LYS A 1 122 ? -17.665 5.975   4.393   1.00 0.00 ? 122 LYS A CB   2  
ATOM 4160  C CG   . LYS A 1 122 ? -18.966 6.763   4.523   1.00 0.00 ? 122 LYS A CG   2  
ATOM 4161  C CD   . LYS A 1 122 ? -20.194 5.852   4.637   1.00 0.00 ? 122 LYS A CD   2  
ATOM 4162  C CE   . LYS A 1 122 ? -20.270 5.092   5.965   1.00 0.00 ? 122 LYS A CE   2  
ATOM 4163  N NZ   . LYS A 1 122 ? -19.204 4.055   6.123   1.00 0.00 ? 122 LYS A NZ   2  
ATOM 4164  H H    . LYS A 1 122 ? -15.662 4.241   3.327   1.00 0.00 ? 122 LYS A H    2  
ATOM 4165  H HA   . LYS A 1 122 ? -18.612 4.403   3.282   1.00 0.00 ? 122 LYS A HA   2  
ATOM 4166  H HB2  . LYS A 1 122 ? -17.489 5.462   5.327   1.00 0.00 ? 122 LYS A HB2  2  
ATOM 4167  H HB3  . LYS A 1 122 ? -16.859 6.676   4.223   1.00 0.00 ? 122 LYS A HB3  2  
ATOM 4168  H HG2  . LYS A 1 122 ? -18.911 7.383   5.406   1.00 0.00 ? 122 LYS A HG2  2  
ATOM 4169  H HG3  . LYS A 1 122 ? -19.079 7.394   3.652   1.00 0.00 ? 122 LYS A HG3  2  
ATOM 4170  H HD2  . LYS A 1 122 ? -21.081 6.461   4.543   1.00 0.00 ? 122 LYS A HD2  2  
ATOM 4171  H HD3  . LYS A 1 122 ? -20.171 5.136   3.827   1.00 0.00 ? 122 LYS A HD3  2  
ATOM 4172  H HE2  . LYS A 1 122 ? -20.181 5.802   6.774   1.00 0.00 ? 122 LYS A HE2  2  
ATOM 4173  H HE3  . LYS A 1 122 ? -21.235 4.609   6.025   1.00 0.00 ? 122 LYS A HE3  2  
ATOM 4174  H HZ1  . LYS A 1 122 ? -19.359 3.521   7.005   1.00 0.00 ? 122 LYS A HZ1  2  
ATOM 4175  H HZ2  . LYS A 1 122 ? -18.267 4.502   6.168   1.00 0.00 ? 122 LYS A HZ2  2  
ATOM 4176  H HZ3  . LYS A 1 122 ? -19.221 3.390   5.322   1.00 0.00 ? 122 LYS A HZ3  2  
ATOM 4177  N N    . SER A 1 123 ? -16.837 4.982   0.961   1.00 0.00 ? 123 SER A N    2  
ATOM 4178  C CA   . SER A 1 123 ? -16.702 5.487   -0.406  1.00 0.00 ? 123 SER A CA   2  
ATOM 4179  C C    . SER A 1 123 ? -18.046 5.451   -1.138  1.00 0.00 ? 123 SER A C    2  
ATOM 4180  O O    . SER A 1 123 ? -18.967 4.735   -0.733  1.00 0.00 ? 123 SER A O    2  
ATOM 4181  C CB   . SER A 1 123 ? -15.666 4.661   -1.178  1.00 0.00 ? 123 SER A CB   2  
ATOM 4182  O OG   . SER A 1 123 ? -16.069 3.304   -1.289  1.00 0.00 ? 123 SER A OG   2  
ATOM 4183  H H    . SER A 1 123 ? -16.364 4.163   1.212   1.00 0.00 ? 123 SER A H    2  
ATOM 4184  H HA   . SER A 1 123 ? -16.363 6.512   -0.350  1.00 0.00 ? 123 SER A HA   2  
ATOM 4185  H HB2  . SER A 1 123 ? -15.549 5.068   -2.172  1.00 0.00 ? 123 SER A HB2  2  
ATOM 4186  H HB3  . SER A 1 123 ? -14.718 4.699   -0.661  1.00 0.00 ? 123 SER A HB3  2  
ATOM 4187  H HG   . SER A 1 123 ? -15.672 2.792   -0.577  1.00 0.00 ? 123 SER A HG   2  
ATOM 4188  N N    . ASP A 1 124 ? -18.141 6.210   -2.227  1.00 0.00 ? 124 ASP A N    2  
ATOM 4189  C CA   . ASP A 1 124 ? -19.366 6.284   -3.020  1.00 0.00 ? 124 ASP A CA   2  
ATOM 4190  C C    . ASP A 1 124 ? -19.699 4.915   -3.613  1.00 0.00 ? 124 ASP A C    2  
ATOM 4191  O O    . ASP A 1 124 ? -20.851 4.471   -3.577  1.00 0.00 ? 124 ASP A O    2  
ATOM 4192  C CB   . ASP A 1 124 ? -19.223 7.337   -4.136  1.00 0.00 ? 124 ASP A CB   2  
ATOM 4193  C CG   . ASP A 1 124 ? -18.190 6.966   -5.198  1.00 0.00 ? 124 ASP A CG   2  
ATOM 4194  O OD1  . ASP A 1 124 ? -17.065 6.561   -4.829  1.00 0.00 ? 124 ASP A OD1  2  
ATOM 4195  O OD2  . ASP A 1 124 ? -18.495 7.095   -6.406  1.00 0.00 ? 124 ASP A OD2  2  
ATOM 4196  H H    . ASP A 1 124 ? -17.360 6.730   -2.516  1.00 0.00 ? 124 ASP A H    2  
ATOM 4197  H HA   . ASP A 1 124 ? -20.168 6.581   -2.359  1.00 0.00 ? 124 ASP A HA   2  
ATOM 4198  H HB2  . ASP A 1 124 ? -20.180 7.465   -4.621  1.00 0.00 ? 124 ASP A HB2  2  
ATOM 4199  H HB3  . ASP A 1 124 ? -18.929 8.279   -3.692  1.00 0.00 ? 124 ASP A HB3  2  
ATOM 4200  N N    . ILE A 1 125 ? -18.676 4.241   -4.134  1.00 0.00 ? 125 ILE A N    2  
ATOM 4201  C CA   . ILE A 1 125 ? -18.837 2.907   -4.703  1.00 0.00 ? 125 ILE A CA   2  
ATOM 4202  C C    . ILE A 1 125 ? -19.299 1.916   -3.631  1.00 0.00 ? 125 ILE A C    2  
ATOM 4203  O O    . ILE A 1 125 ? -20.151 1.062   -3.887  1.00 0.00 ? 125 ILE A O    2  
ATOM 4204  C CB   . ILE A 1 125 ? -17.522 2.406   -5.367  1.00 0.00 ? 125 ILE A CB   2  
ATOM 4205  C CG1  . ILE A 1 125 ? -17.715 1.009   -5.989  1.00 0.00 ? 125 ILE A CG1  2  
ATOM 4206  C CG2  . ILE A 1 125 ? -16.365 2.394   -4.365  1.00 0.00 ? 125 ILE A CG2  2  
ATOM 4207  C CD1  . ILE A 1 125 ? -18.750 0.969   -7.096  1.00 0.00 ? 125 ILE A CD1  2  
ATOM 4208  H H    . ILE A 1 125 ? -17.789 4.662   -4.144  1.00 0.00 ? 125 ILE A H    2  
ATOM 4209  H HA   . ILE A 1 125 ? -19.600 2.969   -5.470  1.00 0.00 ? 125 ILE A HA   2  
ATOM 4210  H HB   . ILE A 1 125 ? -17.264 3.102   -6.153  1.00 0.00 ? 125 ILE A HB   2  
ATOM 4211  H HG12 . ILE A 1 125 ? -16.777 0.675   -6.407  1.00 0.00 ? 125 ILE A HG12 2  
ATOM 4212  H HG13 . ILE A 1 125 ? -18.026 0.315   -5.220  1.00 0.00 ? 125 ILE A HG13 2  
ATOM 4213  H HG21 . ILE A 1 125 ? -15.465 2.052   -4.854  1.00 0.00 ? 125 ILE A HG21 2  
ATOM 4214  H HG22 . ILE A 1 125 ? -16.603 1.732   -3.544  1.00 0.00 ? 125 ILE A HG22 2  
ATOM 4215  H HG23 . ILE A 1 125 ? -16.207 3.394   -3.983  1.00 0.00 ? 125 ILE A HG23 2  
ATOM 4216  H HD11 . ILE A 1 125 ? -18.820 -0.035  -7.488  1.00 0.00 ? 125 ILE A HD11 2  
ATOM 4217  H HD12 . ILE A 1 125 ? -18.460 1.644   -7.887  1.00 0.00 ? 125 ILE A HD12 2  
ATOM 4218  H HD13 . ILE A 1 125 ? -19.712 1.267   -6.703  1.00 0.00 ? 125 ILE A HD13 2  
ATOM 4219  N N    . TYR A 1 126 ? -18.756 2.051   -2.422  1.00 0.00 ? 126 TYR A N    2  
ATOM 4220  C CA   . TYR A 1 126 ? -19.123 1.169   -1.319  1.00 0.00 ? 126 TYR A CA   2  
ATOM 4221  C C    . TYR A 1 126 ? -20.578 1.404   -0.920  1.00 0.00 ? 126 TYR A C    2  
ATOM 4222  O O    . TYR A 1 126 ? -21.316 0.457   -0.641  1.00 0.00 ? 126 TYR A O    2  
ATOM 4223  C CB   . TYR A 1 126 ? -18.195 1.393   -0.119  1.00 0.00 ? 126 TYR A CB   2  
ATOM 4224  C CG   . TYR A 1 126 ? -18.362 0.367   0.989   1.00 0.00 ? 126 TYR A CG   2  
ATOM 4225  C CD1  . TYR A 1 126 ? -17.747 -0.879  0.904   1.00 0.00 ? 126 TYR A CD1  2  
ATOM 4226  C CD2  . TYR A 1 126 ? -19.129 0.642   2.115   1.00 0.00 ? 126 TYR A CD2  2  
ATOM 4227  C CE1  . TYR A 1 126 ? -17.893 -1.816  1.909   1.00 0.00 ? 126 TYR A CE1  2  
ATOM 4228  C CE2  . TYR A 1 126 ? -19.277 -0.289  3.124   1.00 0.00 ? 126 TYR A CE2  2  
ATOM 4229  C CZ   . TYR A 1 126 ? -18.657 -1.516  3.018   1.00 0.00 ? 126 TYR A CZ   2  
ATOM 4230  O OH   . TYR A 1 126 ? -18.805 -2.447  4.022   1.00 0.00 ? 126 TYR A OH   2  
ATOM 4231  H H    . TYR A 1 126 ? -18.094 2.761   -2.269  1.00 0.00 ? 126 TYR A H    2  
ATOM 4232  H HA   . TYR A 1 126 ? -19.015 0.148   -1.663  1.00 0.00 ? 126 TYR A HA   2  
ATOM 4233  H HB2  . TYR A 1 126 ? -17.168 1.351   -0.455  1.00 0.00 ? 126 TYR A HB2  2  
ATOM 4234  H HB3  . TYR A 1 126 ? -18.388 2.371   0.299   1.00 0.00 ? 126 TYR A HB3  2  
ATOM 4235  H HD1  . TYR A 1 126 ? -17.148 -1.112  0.035   1.00 0.00 ? 126 TYR A HD1  2  
ATOM 4236  H HD2  . TYR A 1 126 ? -19.615 1.605   2.197   1.00 0.00 ? 126 TYR A HD2  2  
ATOM 4237  H HE1  . TYR A 1 126 ? -17.407 -2.777  1.825   1.00 0.00 ? 126 TYR A HE1  2  
ATOM 4238  H HE2  . TYR A 1 126 ? -19.877 -0.054  3.992   1.00 0.00 ? 126 TYR A HE2  2  
ATOM 4239  H HH   . TYR A 1 126 ? -18.020 -3.010  4.051   1.00 0.00 ? 126 TYR A HH   2  
ATOM 4240  N N    . LEU A 1 127 ? -20.987 2.672   -0.904  1.00 0.00 ? 127 LEU A N    2  
ATOM 4241  C CA   . LEU A 1 127 ? -22.371 3.035   -0.600  1.00 0.00 ? 127 LEU A CA   2  
ATOM 4242  C C    . LEU A 1 127 ? -23.317 2.433   -1.637  1.00 0.00 ? 127 LEU A C    2  
ATOM 4243  O O    . LEU A 1 127 ? -24.420 1.996   -1.303  1.00 0.00 ? 127 LEU A O    2  
ATOM 4244  C CB   . LEU A 1 127 ? -22.533 4.562   -0.545  1.00 0.00 ? 127 LEU A CB   2  
ATOM 4245  C CG   . LEU A 1 127 ? -21.851 5.252   0.649   1.00 0.00 ? 127 LEU A CG   2  
ATOM 4246  C CD1  . LEU A 1 127 ? -22.003 6.768   0.557   1.00 0.00 ? 127 LEU A CD1  2  
ATOM 4247  C CD2  . LEU A 1 127 ? -22.420 4.729   1.967   1.00 0.00 ? 127 LEU A CD2  2  
ATOM 4248  H H    . LEU A 1 127 ? -20.338 3.383   -1.104  1.00 0.00 ? 127 LEU A H    2  
ATOM 4249  H HA   . LEU A 1 127 ? -22.613 2.620   0.369   1.00 0.00 ? 127 LEU A HA   2  
ATOM 4250  H HB2  . LEU A 1 127 ? -22.126 4.978   -1.454  1.00 0.00 ? 127 LEU A HB2  2  
ATOM 4251  H HB3  . LEU A 1 127 ? -23.591 4.790   -0.508  1.00 0.00 ? 127 LEU A HB3  2  
ATOM 4252  H HG   . LEU A 1 127 ? -20.794 5.024   0.628   1.00 0.00 ? 127 LEU A HG   2  
ATOM 4253  H HD11 . LEU A 1 127 ? -21.557 7.120   -0.362  1.00 0.00 ? 127 LEU A HD11 2  
ATOM 4254  H HD12 . LEU A 1 127 ? -21.504 7.232   1.396   1.00 0.00 ? 127 LEU A HD12 2  
ATOM 4255  H HD13 . LEU A 1 127 ? -23.051 7.031   0.573   1.00 0.00 ? 127 LEU A HD13 2  
ATOM 4256  H HD21 . LEU A 1 127 ? -22.243 3.666   2.039   1.00 0.00 ? 127 LEU A HD21 2  
ATOM 4257  H HD22 . LEU A 1 127 ? -23.483 4.920   2.004   1.00 0.00 ? 127 LEU A HD22 2  
ATOM 4258  H HD23 . LEU A 1 127 ? -21.936 5.229   2.792   1.00 0.00 ? 127 LEU A HD23 2  
ATOM 4259  N N    . ASP A 1 128 ? -22.871 2.405   -2.890  1.00 0.00 ? 128 ASP A N    2  
ATOM 4260  C CA   . ASP A 1 128 ? -23.626 1.764   -3.966  1.00 0.00 ? 128 ASP A CA   2  
ATOM 4261  C C    . ASP A 1 128 ? -23.774 0.268   -3.688  1.00 0.00 ? 128 ASP A C    2  
ATOM 4262  O O    . ASP A 1 128 ? -24.851 -0.304  -3.853  1.00 0.00 ? 128 ASP A O    2  
ATOM 4263  C CB   . ASP A 1 128 ? -22.937 1.990   -5.319  1.00 0.00 ? 128 ASP A CB   2  
ATOM 4264  C CG   . ASP A 1 128 ? -23.598 1.220   -6.453  1.00 0.00 ? 128 ASP A CG   2  
ATOM 4265  O OD1  . ASP A 1 128 ? -24.714 1.601   -6.872  1.00 0.00 ? 128 ASP A OD1  2  
ATOM 4266  O OD2  . ASP A 1 128 ? -23.011 0.223   -6.927  1.00 0.00 ? 128 ASP A OD2  2  
ATOM 4267  H H    . ASP A 1 128 ? -22.011 2.832   -3.100  1.00 0.00 ? 128 ASP A H    2  
ATOM 4268  H HA   . ASP A 1 128 ? -24.611 2.213   -3.992  1.00 0.00 ? 128 ASP A HA   2  
ATOM 4269  H HB2  . ASP A 1 128 ? -22.966 3.044   -5.561  1.00 0.00 ? 128 ASP A HB2  2  
ATOM 4270  H HB3  . ASP A 1 128 ? -21.904 1.677   -5.247  1.00 0.00 ? 128 ASP A HB3  2  
ATOM 4271  N N    . LEU A 1 129 ? -22.683 -0.352  -3.243  1.00 0.00 ? 129 LEU A N    2  
ATOM 4272  C CA   . LEU A 1 129 ? -22.690 -1.769  -2.871  1.00 0.00 ? 129 LEU A CA   2  
ATOM 4273  C C    . LEU A 1 129 ? -23.618 -2.008  -1.679  1.00 0.00 ? 129 LEU A C    2  
ATOM 4274  O O    . LEU A 1 129 ? -24.196 -3.084  -1.535  1.00 0.00 ? 129 LEU A O    2  
ATOM 4275  C CB   . LEU A 1 129 ? -21.267 -2.245  -2.532  1.00 0.00 ? 129 LEU A CB   2  
ATOM 4276  C CG   . LEU A 1 129 ? -20.248 -2.141  -3.680  1.00 0.00 ? 129 LEU A CG   2  
ATOM 4277  C CD1  . LEU A 1 129 ? -18.858 -2.567  -3.210  1.00 0.00 ? 129 LEU A CD1  2  
ATOM 4278  C CD2  . LEU A 1 129 ? -20.696 -2.979  -4.877  1.00 0.00 ? 129 LEU A CD2  2  
ATOM 4279  H H    . LEU A 1 129 ? -21.845 0.154   -3.171  1.00 0.00 ? 129 LEU A H    2  
ATOM 4280  H HA   . LEU A 1 129 ? -23.058 -2.334  -3.718  1.00 0.00 ? 129 LEU A HA   2  
ATOM 4281  H HB2  . LEU A 1 129 ? -20.902 -1.657  -1.700  1.00 0.00 ? 129 LEU A HB2  2  
ATOM 4282  H HB3  . LEU A 1 129 ? -21.318 -3.280  -2.221  1.00 0.00 ? 129 LEU A HB3  2  
ATOM 4283  H HG   . LEU A 1 129 ? -20.185 -1.110  -4.000  1.00 0.00 ? 129 LEU A HG   2  
ATOM 4284  H HD11 . LEU A 1 129 ? -18.889 -3.592  -2.866  1.00 0.00 ? 129 LEU A HD11 2  
ATOM 4285  H HD12 . LEU A 1 129 ? -18.538 -1.926  -2.400  1.00 0.00 ? 129 LEU A HD12 2  
ATOM 4286  H HD13 . LEU A 1 129 ? -18.158 -2.484  -4.029  1.00 0.00 ? 129 LEU A HD13 2  
ATOM 4287  H HD21 . LEU A 1 129 ? -20.786 -4.016  -4.583  1.00 0.00 ? 129 LEU A HD21 2  
ATOM 4288  H HD22 . LEU A 1 129 ? -19.968 -2.895  -5.671  1.00 0.00 ? 129 LEU A HD22 2  
ATOM 4289  H HD23 . LEU A 1 129 ? -21.653 -2.623  -5.230  1.00 0.00 ? 129 LEU A HD23 2  
ATOM 4290  N N    . MET A 1 130 ? -23.748 -0.993  -0.825  1.00 0.00 ? 130 MET A N    2  
ATOM 4291  C CA   . MET A 1 130 ? -24.640 -1.062  0.334   1.00 0.00 ? 130 MET A CA   2  
ATOM 4292  C C    . MET A 1 130 ? -26.088 -0.832  -0.088  1.00 0.00 ? 130 MET A C    2  
ATOM 4293  O O    . MET A 1 130 ? -27.010 -1.310  0.572   1.00 0.00 ? 130 MET A O    2  
ATOM 4294  C CB   . MET A 1 130 ? -24.236 -0.027  1.397   1.00 0.00 ? 130 MET A CB   2  
ATOM 4295  C CG   . MET A 1 130 ? -22.838 -0.219  1.988   1.00 0.00 ? 130 MET A CG   2  
ATOM 4296  S SD   . MET A 1 130 ? -22.686 -1.675  3.053   1.00 0.00 ? 130 MET A SD   2  
ATOM 4297  C CE   . MET A 1 130 ? -22.466 -2.999  1.864   1.00 0.00 ? 130 MET A CE   2  
ATOM 4298  H H    . MET A 1 130 ? -23.226 -0.176  -0.976  1.00 0.00 ? 130 MET A H    2  
ATOM 4299  H HA   . MET A 1 130 ? -24.556 -2.054  0.760   1.00 0.00 ? 130 MET A HA   2  
ATOM 4300  H HB2  . MET A 1 130 ? -24.276 0.957   0.952   1.00 0.00 ? 130 MET A HB2  2  
ATOM 4301  H HB3  . MET A 1 130 ? -24.950 -0.069  2.207   1.00 0.00 ? 130 MET A HB3  2  
ATOM 4302  H HG2  . MET A 1 130 ? -22.132 -0.315  1.177   1.00 0.00 ? 130 MET A HG2  2  
ATOM 4303  H HG3  . MET A 1 130 ? -22.590 0.658   2.570   1.00 0.00 ? 130 MET A HG3  2  
ATOM 4304  H HE1  . MET A 1 130 ? -23.337 -3.065  1.227   1.00 0.00 ? 130 MET A HE1  2  
ATOM 4305  H HE2  . MET A 1 130 ? -22.333 -3.935  2.388   1.00 0.00 ? 130 MET A HE2  2  
ATOM 4306  H HE3  . MET A 1 130 ? -21.593 -2.800  1.260   1.00 0.00 ? 130 MET A HE3  2  
ATOM 4307  N N    . GLU A 1 131 ? -26.265 -0.076  -1.182  1.00 0.00 ? 131 GLU A N    2  
ATOM 4308  C CA   . GLU A 1 131 ? -27.582 0.256   -1.762  1.00 0.00 ? 131 GLU A CA   2  
ATOM 4309  C C    . GLU A 1 131 ? -28.619 0.668   -0.702  1.00 0.00 ? 131 GLU A C    2  
ATOM 4310  O O    . GLU A 1 131 ? -29.828 0.613   -0.943  1.00 0.00 ? 131 GLU A O    2  
ATOM 4311  C CB   . GLU A 1 131 ? -28.109 -0.897  -2.648  1.00 0.00 ? 131 GLU A CB   2  
ATOM 4312  C CG   . GLU A 1 131 ? -28.252 -2.247  -1.947  1.00 0.00 ? 131 GLU A CG   2  
ATOM 4313  C CD   . GLU A 1 131 ? -28.719 -3.351  -2.882  1.00 0.00 ? 131 GLU A CD   2  
ATOM 4314  O OE1  . GLU A 1 131 ? -27.971 -3.700  -3.821  1.00 0.00 ? 131 GLU A OE1  2  
ATOM 4315  O OE2  . GLU A 1 131 ? -29.831 -3.883  -2.679  1.00 0.00 ? 131 GLU A OE2  2  
ATOM 4316  H H    . GLU A 1 131 ? -25.466 0.276   -1.629  1.00 0.00 ? 131 GLU A H    2  
ATOM 4317  H HA   . GLU A 1 131 ? -27.423 1.113   -2.400  1.00 0.00 ? 131 GLU A HA   2  
ATOM 4318  H HB2  . GLU A 1 131 ? -29.079 -0.620  -3.033  1.00 0.00 ? 131 GLU A HB2  2  
ATOM 4319  H HB3  . GLU A 1 131 ? -27.430 -1.022  -3.482  1.00 0.00 ? 131 GLU A HB3  2  
ATOM 4320  H HG2  . GLU A 1 131 ? -27.292 -2.528  -1.535  1.00 0.00 ? 131 GLU A HG2  2  
ATOM 4321  H HG3  . GLU A 1 131 ? -28.967 -2.144  -1.142  1.00 0.00 ? 131 GLU A HG3  2  
ATOM 4322  N N    . GLY A 1 132 ? -28.134 1.124   0.450   1.00 0.00 ? 132 GLY A N    2  
ATOM 4323  C CA   . GLY A 1 132 ? -29.016 1.587   1.507   1.00 0.00 ? 132 GLY A CA   2  
ATOM 4324  C C    . GLY A 1 132 ? -29.302 3.072   1.390   1.00 0.00 ? 132 GLY A C    2  
ATOM 4325  O O    . GLY A 1 132 ? -30.328 3.559   1.868   1.00 0.00 ? 132 GLY A O    2  
ATOM 4326  H H    . GLY A 1 132 ? -27.166 1.143   0.583   1.00 0.00 ? 132 GLY A H    2  
ATOM 4327  H HA2  . GLY A 1 132 ? -29.950 1.042   1.457   1.00 0.00 ? 132 GLY A HA2  2  
ATOM 4328  H HA3  . GLY A 1 132 ? -28.550 1.394   2.461   1.00 0.00 ? 132 GLY A HA3  2  
ATOM 4329  N N    . ARG A 1 133 ? -28.383 3.793   0.750   1.00 0.00 ? 133 ARG A N    2  
ATOM 4330  C CA   . ARG A 1 133 ? -28.516 5.233   0.541   1.00 0.00 ? 133 ARG A CA   2  
ATOM 4331  C C    . ARG A 1 133 ? -28.154 5.584   -0.904  1.00 0.00 ? 133 ARG A C    2  
ATOM 4332  O O    . ARG A 1 133 ? -27.068 5.235   -1.373  1.00 0.00 ? 133 ARG A O    2  
ATOM 4333  C CB   . ARG A 1 133 ? -27.614 6.017   1.517   1.00 0.00 ? 133 ARG A CB   2  
ATOM 4334  C CG   . ARG A 1 133 ? -28.012 5.873   2.985   1.00 0.00 ? 133 ARG A CG   2  
ATOM 4335  C CD   . ARG A 1 133 ? -29.419 6.403   3.244   1.00 0.00 ? 133 ARG A CD   2  
ATOM 4336  N NE   . ARG A 1 133 ? -29.840 6.203   4.631   1.00 0.00 ? 133 ARG A NE   2  
ATOM 4337  C CZ   . ARG A 1 133 ? -31.115 6.171   5.028   1.00 0.00 ? 133 ARG A CZ   2  
ATOM 4338  N NH1  . ARG A 1 133 ? -32.093 6.332   4.147   1.00 0.00 ? 133 ARG A NH1  2  
ATOM 4339  N NH2  . ARG A 1 133 ? -31.409 5.983   6.307   1.00 0.00 ? 133 ARG A NH2  2  
ATOM 4340  H H    . ARG A 1 133 ? -27.593 3.339   0.393   1.00 0.00 ? 133 ARG A H    2  
ATOM 4341  H HA   . ARG A 1 133 ? -29.548 5.504   0.722   1.00 0.00 ? 133 ARG A HA   2  
ATOM 4342  H HB2  . ARG A 1 133 ? -26.596 5.665   1.407   1.00 0.00 ? 133 ARG A HB2  2  
ATOM 4343  H HB3  . ARG A 1 133 ? -27.648 7.067   1.259   1.00 0.00 ? 133 ARG A HB3  2  
ATOM 4344  H HG2  . ARG A 1 133 ? -27.978 4.828   3.257   1.00 0.00 ? 133 ARG A HG2  2  
ATOM 4345  H HG3  . ARG A 1 133 ? -27.311 6.427   3.595   1.00 0.00 ? 133 ARG A HG3  2  
ATOM 4346  H HD2  . ARG A 1 133 ? -29.441 7.460   3.022   1.00 0.00 ? 133 ARG A HD2  2  
ATOM 4347  H HD3  . ARG A 1 133 ? -30.111 5.887   2.590   1.00 0.00 ? 133 ARG A HD3  2  
ATOM 4348  H HE   . ARG A 1 133 ? -29.132 6.084   5.303   1.00 0.00 ? 133 ARG A HE   2  
ATOM 4349  H HH11 . ARG A 1 133 ? -31.881 6.482   3.177   1.00 0.00 ? 133 ARG A HH11 2  
ATOM 4350  H HH12 . ARG A 1 133 ? -33.052 6.298   4.445   1.00 0.00 ? 133 ARG A HH12 2  
ATOM 4351  H HH21 . ARG A 1 133 ? -30.676 5.868   6.983   1.00 0.00 ? 133 ARG A HH21 2  
ATOM 4352  H HH22 . ARG A 1 133 ? -32.368 5.951   6.604   1.00 0.00 ? 133 ARG A HH22 2  
ATOM 4353  N N    . PRO A 1 134 ? -29.069 6.248   -1.637  1.00 0.00 ? 134 PRO A N    2  
ATOM 4354  C CA   . PRO A 1 134 ? -28.813 6.681   -3.017  1.00 0.00 ? 134 PRO A CA   2  
ATOM 4355  C C    . PRO A 1 134 ? -27.782 7.813   -3.073  1.00 0.00 ? 134 PRO A C    2  
ATOM 4356  O O    . PRO A 1 134 ? -27.857 8.773   -2.298  1.00 0.00 ? 134 PRO A O    2  
ATOM 4357  C CB   . PRO A 1 134 ? -30.189 7.164   -3.503  1.00 0.00 ? 134 PRO A CB   2  
ATOM 4358  C CG   . PRO A 1 134 ? -30.916 7.554   -2.261  1.00 0.00 ? 134 PRO A CG   2  
ATOM 4359  C CD   . PRO A 1 134 ? -30.427 6.622   -1.184  1.00 0.00 ? 134 PRO A CD   2  
ATOM 4360  H HA   . PRO A 1 134 ? -28.476 5.858   -3.632  1.00 0.00 ? 134 PRO A HA   2  
ATOM 4361  H HB2  . PRO A 1 134 ? -30.067 8.004   -4.175  1.00 0.00 ? 134 PRO A HB2  2  
ATOM 4362  H HB3  . PRO A 1 134 ? -30.693 6.359   -4.018  1.00 0.00 ? 134 PRO A HB3  2  
ATOM 4363  H HG2  . PRO A 1 134 ? -30.684 8.581   -2.004  1.00 0.00 ? 134 PRO A HG2  2  
ATOM 4364  H HG3  . PRO A 1 134 ? -31.981 7.437   -2.405  1.00 0.00 ? 134 PRO A HG3  2  
ATOM 4365  H HD2  . PRO A 1 134 ? -30.389 7.131   -0.231  1.00 0.00 ? 134 PRO A HD2  2  
ATOM 4366  H HD3  . PRO A 1 134 ? -31.063 5.750   -1.120  1.00 0.00 ? 134 PRO A HD3  2  
ATOM 4367  N N    . SER A 1 1   ? -16.188 -10.170 -12.598 1.00 0.00 ? 1   SER A N    3  
ATOM 4368  C CA   . SER A 1 1   ? -15.721 -9.800  -11.243 1.00 0.00 ? 1   SER A CA   3  
ATOM 4369  C C    . SER A 1 1   ? -16.763 -8.932  -10.537 1.00 0.00 ? 1   SER A C    3  
ATOM 4370  O O    . SER A 1 1   ? -17.149 -7.878  -11.045 1.00 0.00 ? 1   SER A O    3  
ATOM 4371  C CB   . SER A 1 1   ? -14.386 -9.051  -11.335 1.00 0.00 ? 1   SER A CB   3  
ATOM 4372  O OG   . SER A 1 1   ? -13.401 -9.837  -11.992 1.00 0.00 ? 1   SER A OG   3  
ATOM 4373  H H1   . SER A 1 1   ? -15.466 -10.742 -13.080 1.00 0.00 ? 1   SER A H1   3  
ATOM 4374  H H2   . SER A 1 1   ? -16.370 -9.315  -13.161 1.00 0.00 ? 1   SER A H2   3  
ATOM 4375  H H3   . SER A 1 1   ? -17.065 -10.724 -12.533 1.00 0.00 ? 1   SER A H3   3  
ATOM 4376  H HA   . SER A 1 1   ? -15.579 -10.709 -10.675 1.00 0.00 ? 1   SER A HA   3  
ATOM 4377  H HB2  . SER A 1 1   ? -14.524 -8.136  -11.893 1.00 0.00 ? 1   SER A HB2  3  
ATOM 4378  H HB3  . SER A 1 1   ? -14.036 -8.817  -10.340 1.00 0.00 ? 1   SER A HB3  3  
ATOM 4379  H HG   . SER A 1 1   ? -13.527 -9.774  -12.949 1.00 0.00 ? 1   SER A HG   3  
ATOM 4380  N N    . MET A 1 2   ? -17.222 -9.377  -9.368  1.00 0.00 ? 2   MET A N    3  
ATOM 4381  C CA   . MET A 1 2   ? -18.209 -8.626  -8.595  1.00 0.00 ? 2   MET A CA   3  
ATOM 4382  C C    . MET A 1 2   ? -18.176 -9.054  -7.133  1.00 0.00 ? 2   MET A C    3  
ATOM 4383  O O    . MET A 1 2   ? -17.534 -10.046 -6.781  1.00 0.00 ? 2   MET A O    3  
ATOM 4384  C CB   . MET A 1 2   ? -19.624 -8.815  -9.170  1.00 0.00 ? 2   MET A CB   3  
ATOM 4385  C CG   . MET A 1 2   ? -20.168 -10.236 -9.055  1.00 0.00 ? 2   MET A CG   3  
ATOM 4386  S SD   . MET A 1 2   ? -21.843 -10.387 -9.716  1.00 0.00 ? 2   MET A SD   3  
ATOM 4387  C CE   . MET A 1 2   ? -22.196 -12.110 -9.366  1.00 0.00 ? 2   MET A CE   3  
ATOM 4388  H H    . MET A 1 2   ? -16.880 -10.227 -9.008  1.00 0.00 ? 2   MET A H    3  
ATOM 4389  H HA   . MET A 1 2   ? -17.944 -7.578  -8.650  1.00 0.00 ? 2   MET A HA   3  
ATOM 4390  H HB2  . MET A 1 2   ? -20.301 -8.153  -8.649  1.00 0.00 ? 2   MET A HB2  3  
ATOM 4391  H HB3  . MET A 1 2   ? -19.610 -8.543  -10.216 1.00 0.00 ? 2   MET A HB3  3  
ATOM 4392  H HG2  . MET A 1 2   ? -19.520 -10.903 -9.604  1.00 0.00 ? 2   MET A HG2  3  
ATOM 4393  H HG3  . MET A 1 2   ? -20.179 -10.522 -8.013  1.00 0.00 ? 2   MET A HG3  3  
ATOM 4394  H HE1  . MET A 1 2   ? -22.148 -12.279 -8.301  1.00 0.00 ? 2   MET A HE1  3  
ATOM 4395  H HE2  . MET A 1 2   ? -21.468 -12.735 -9.863  1.00 0.00 ? 2   MET A HE2  3  
ATOM 4396  H HE3  . MET A 1 2   ? -23.185 -12.354 -9.725  1.00 0.00 ? 2   MET A HE3  3  
ATOM 4397  N N    . VAL A 1 3   ? -18.876 -8.304  -6.292  1.00 0.00 ? 3   VAL A N    3  
ATOM 4398  C CA   . VAL A 1 3   ? -18.931 -8.583  -4.864  1.00 0.00 ? 3   VAL A CA   3  
ATOM 4399  C C    . VAL A 1 3   ? -20.361 -8.433  -4.349  1.00 0.00 ? 3   VAL A C    3  
ATOM 4400  O O    . VAL A 1 3   ? -21.103 -7.555  -4.794  1.00 0.00 ? 3   VAL A O    3  
ATOM 4401  C CB   . VAL A 1 3   ? -17.980 -7.646  -4.070  1.00 0.00 ? 3   VAL A CB   3  
ATOM 4402  C CG1  . VAL A 1 3   ? -18.304 -6.176  -4.338  1.00 0.00 ? 3   VAL A CG1  3  
ATOM 4403  C CG2  . VAL A 1 3   ? -18.033 -7.949  -2.574  1.00 0.00 ? 3   VAL A CG2  3  
ATOM 4404  H H    . VAL A 1 3   ? -19.379 -7.539  -6.641  1.00 0.00 ? 3   VAL A H    3  
ATOM 4405  H HA   . VAL A 1 3   ? -18.610 -9.606  -4.709  1.00 0.00 ? 3   VAL A HA   3  
ATOM 4406  H HB   . VAL A 1 3   ? -16.970 -7.830  -4.412  1.00 0.00 ? 3   VAL A HB   3  
ATOM 4407  H HG11 . VAL A 1 3   ? -19.319 -5.966  -4.034  1.00 0.00 ? 3   VAL A HG11 3  
ATOM 4408  H HG12 . VAL A 1 3   ? -18.193 -5.967  -5.393  1.00 0.00 ? 3   VAL A HG12 3  
ATOM 4409  H HG13 . VAL A 1 3   ? -17.624 -5.548  -3.776  1.00 0.00 ? 3   VAL A HG13 3  
ATOM 4410  H HG21 . VAL A 1 3   ? -19.037 -7.791  -2.208  1.00 0.00 ? 3   VAL A HG21 3  
ATOM 4411  H HG22 . VAL A 1 3   ? -17.353 -7.295  -2.047  1.00 0.00 ? 3   VAL A HG22 3  
ATOM 4412  H HG23 . VAL A 1 3   ? -17.746 -8.977  -2.403  1.00 0.00 ? 3   VAL A HG23 3  
ATOM 4413  N N    . SER A 1 4   ? -20.747 -9.322  -3.443  1.00 0.00 ? 4   SER A N    3  
ATOM 4414  C CA   . SER A 1 4   ? -22.059 -9.275  -2.809  1.00 0.00 ? 4   SER A CA   3  
ATOM 4415  C C    . SER A 1 4   ? -21.982 -8.400  -1.555  1.00 0.00 ? 4   SER A C    3  
ATOM 4416  O O    . SER A 1 4   ? -20.934 -8.354  -0.909  1.00 0.00 ? 4   SER A O    3  
ATOM 4417  C CB   . SER A 1 4   ? -22.506 -10.703 -2.451  1.00 0.00 ? 4   SER A CB   3  
ATOM 4418  O OG   . SER A 1 4   ? -23.808 -10.724 -1.891  1.00 0.00 ? 4   SER A OG   3  
ATOM 4419  H H    . SER A 1 4   ? -20.125 -10.030 -3.183  1.00 0.00 ? 4   SER A H    3  
ATOM 4420  H HA   . SER A 1 4   ? -22.763 -8.842  -3.507  1.00 0.00 ? 4   SER A HA   3  
ATOM 4421  H HB2  . SER A 1 4   ? -22.508 -11.310 -3.343  1.00 0.00 ? 4   SER A HB2  3  
ATOM 4422  H HB3  . SER A 1 4   ? -21.814 -11.124 -1.735  1.00 0.00 ? 4   SER A HB3  3  
ATOM 4423  H HG   . SER A 1 4   ? -24.033 -11.629 -1.643  1.00 0.00 ? 4   SER A HG   3  
ATOM 4424  N N    . PRO A 1 5   ? -23.078 -7.692  -1.192  1.00 0.00 ? 5   PRO A N    3  
ATOM 4425  C CA   . PRO A 1 5   ? -23.114 -6.833  0.004   1.00 0.00 ? 5   PRO A CA   3  
ATOM 4426  C C    . PRO A 1 5   ? -22.579 -7.556  1.241   1.00 0.00 ? 5   PRO A C    3  
ATOM 4427  O O    . PRO A 1 5   ? -21.951 -6.946  2.110   1.00 0.00 ? 5   PRO A O    3  
ATOM 4428  C CB   . PRO A 1 5   ? -24.611 -6.488  0.170   1.00 0.00 ? 5   PRO A CB   3  
ATOM 4429  C CG   . PRO A 1 5   ? -25.336 -7.376  -0.792  1.00 0.00 ? 5   PRO A CG   3  
ATOM 4430  C CD   . PRO A 1 5   ? -24.364 -7.662  -1.903  1.00 0.00 ? 5   PRO A CD   3  
ATOM 4431  H HA   . PRO A 1 5   ? -22.545 -5.925  -0.150  1.00 0.00 ? 5   PRO A HA   3  
ATOM 4432  H HB2  . PRO A 1 5   ? -24.921 -6.675  1.190   1.00 0.00 ? 5   PRO A HB2  3  
ATOM 4433  H HB3  . PRO A 1 5   ? -24.768 -5.444  -0.065  1.00 0.00 ? 5   PRO A HB3  3  
ATOM 4434  H HG2  . PRO A 1 5   ? -25.623 -8.295  -0.299  1.00 0.00 ? 5   PRO A HG2  3  
ATOM 4435  H HG3  . PRO A 1 5   ? -26.209 -6.868  -1.177  1.00 0.00 ? 5   PRO A HG3  3  
ATOM 4436  H HD2  . PRO A 1 5   ? -24.580 -8.617  -2.362  1.00 0.00 ? 5   PRO A HD2  3  
ATOM 4437  H HD3  . PRO A 1 5   ? -24.380 -6.872  -2.639  1.00 0.00 ? 5   PRO A HD3  3  
ATOM 4438  N N    . GLU A 1 6   ? -22.815 -8.863  1.293   1.00 0.00 ? 6   GLU A N    3  
ATOM 4439  C CA   . GLU A 1 6   ? -22.332 -9.696  2.387   1.00 0.00 ? 6   GLU A CA   3  
ATOM 4440  C C    . GLU A 1 6   ? -20.801 -9.698  2.412   1.00 0.00 ? 6   GLU A C    3  
ATOM 4441  O O    . GLU A 1 6   ? -20.180 -9.367  3.420   1.00 0.00 ? 6   GLU A O    3  
ATOM 4442  C CB   . GLU A 1 6   ? -22.876 -11.122 2.228   1.00 0.00 ? 6   GLU A CB   3  
ATOM 4443  C CG   . GLU A 1 6   ? -24.399 -11.178 2.124   1.00 0.00 ? 6   GLU A CG   3  
ATOM 4444  C CD   . GLU A 1 6   ? -24.931 -12.589 1.950   1.00 0.00 ? 6   GLU A CD   3  
ATOM 4445  O OE1  . GLU A 1 6   ? -25.152 -13.276 2.970   1.00 0.00 ? 6   GLU A OE1  3  
ATOM 4446  O OE2  . GLU A 1 6   ? -25.133 -13.021 0.794   1.00 0.00 ? 6   GLU A OE2  3  
ATOM 4447  H H    . GLU A 1 6   ? -23.333 -9.278  0.573   1.00 0.00 ? 6   GLU A H    3  
ATOM 4448  H HA   . GLU A 1 6   ? -22.698 -9.278  3.315   1.00 0.00 ? 6   GLU A HA   3  
ATOM 4449  H HB2  . GLU A 1 6   ? -22.457 -11.557 1.331   1.00 0.00 ? 6   GLU A HB2  3  
ATOM 4450  H HB3  . GLU A 1 6   ? -22.570 -11.712 3.080   1.00 0.00 ? 6   GLU A HB3  3  
ATOM 4451  H HG2  . GLU A 1 6   ? -24.822 -10.758 3.026   1.00 0.00 ? 6   GLU A HG2  3  
ATOM 4452  H HG3  . GLU A 1 6   ? -24.709 -10.583 1.276   1.00 0.00 ? 6   GLU A HG3  3  
ATOM 4453  N N    . GLU A 1 7   ? -20.198 -10.040 1.284   1.00 0.00 ? 7   GLU A N    3  
ATOM 4454  C CA   . GLU A 1 7   ? -18.744 -10.042 1.159   1.00 0.00 ? 7   GLU A CA   3  
ATOM 4455  C C    . GLU A 1 7   ? -18.201 -8.619  1.340   1.00 0.00 ? 7   GLU A C    3  
ATOM 4456  O O    . GLU A 1 7   ? -17.088 -8.421  1.824   1.00 0.00 ? 7   GLU A O    3  
ATOM 4457  C CB   . GLU A 1 7   ? -18.342 -10.607 -0.212  1.00 0.00 ? 7   GLU A CB   3  
ATOM 4458  C CG   . GLU A 1 7   ? -16.836 -10.727 -0.432  1.00 0.00 ? 7   GLU A CG   3  
ATOM 4459  C CD   . GLU A 1 7   ? -16.179 -11.777 0.455   1.00 0.00 ? 7   GLU A CD   3  
ATOM 4460  O OE1  . GLU A 1 7   ? -16.484 -12.974 0.290   1.00 0.00 ? 7   GLU A OE1  3  
ATOM 4461  O OE2  . GLU A 1 7   ? -15.331 -11.412 1.298   1.00 0.00 ? 7   GLU A OE2  3  
ATOM 4462  H H    . GLU A 1 7   ? -20.743 -10.291 0.511   1.00 0.00 ? 7   GLU A H    3  
ATOM 4463  H HA   . GLU A 1 7   ? -18.342 -10.676 1.936   1.00 0.00 ? 7   GLU A HA   3  
ATOM 4464  H HB2  . GLU A 1 7   ? -18.775 -11.591 -0.321  1.00 0.00 ? 7   GLU A HB2  3  
ATOM 4465  H HB3  . GLU A 1 7   ? -18.745 -9.964  -0.983  1.00 0.00 ? 7   GLU A HB3  3  
ATOM 4466  H HG2  . GLU A 1 7   ? -16.658 -10.994 -1.465  1.00 0.00 ? 7   GLU A HG2  3  
ATOM 4467  H HG3  . GLU A 1 7   ? -16.381 -9.766  -0.231  1.00 0.00 ? 7   GLU A HG3  3  
ATOM 4468  N N    . ALA A 1 8   ? -19.015 -7.632  0.973   1.00 0.00 ? 8   ALA A N    3  
ATOM 4469  C CA   . ALA A 1 8   ? -18.630 -6.228  1.074   1.00 0.00 ? 8   ALA A CA   3  
ATOM 4470  C C    . ALA A 1 8   ? -18.508 -5.787  2.535   1.00 0.00 ? 8   ALA A C    3  
ATOM 4471  O O    . ALA A 1 8   ? -17.591 -5.043  2.889   1.00 0.00 ? 8   ALA A O    3  
ATOM 4472  C CB   . ALA A 1 8   ? -19.624 -5.351  0.322   1.00 0.00 ? 8   ALA A CB   3  
ATOM 4473  H H    . ALA A 1 8   ? -19.902 -7.858  0.623   1.00 0.00 ? 8   ALA A H    3  
ATOM 4474  H HA   . ALA A 1 8   ? -17.663 -6.117  0.599   1.00 0.00 ? 8   ALA A HA   3  
ATOM 4475  H HB1  . ALA A 1 8   ? -19.298 -4.321  0.357   1.00 0.00 ? 8   ALA A HB1  3  
ATOM 4476  H HB2  . ALA A 1 8   ? -20.599 -5.436  0.780   1.00 0.00 ? 8   ALA A HB2  3  
ATOM 4477  H HB3  . ALA A 1 8   ? -19.683 -5.674  -0.708  1.00 0.00 ? 8   ALA A HB3  3  
ATOM 4478  N N    . VAL A 1 9   ? -19.425 -6.245  3.393   1.00 0.00 ? 9   VAL A N    3  
ATOM 4479  C CA   . VAL A 1 9   ? -19.341 -5.914  4.817   1.00 0.00 ? 9   VAL A CA   3  
ATOM 4480  C C    . VAL A 1 9   ? -18.178 -6.666  5.461   1.00 0.00 ? 9   VAL A C    3  
ATOM 4481  O O    . VAL A 1 9   ? -17.656 -6.255  6.500   1.00 0.00 ? 9   VAL A O    3  
ATOM 4482  C CB   . VAL A 1 9   ? -20.658 -6.194  5.595   1.00 0.00 ? 9   VAL A CB   3  
ATOM 4483  C CG1  . VAL A 1 9   ? -21.822 -5.414  4.990   1.00 0.00 ? 9   VAL A CG1  3  
ATOM 4484  C CG2  . VAL A 1 9   ? -20.974 -7.686  5.653   1.00 0.00 ? 9   VAL A CG2  3  
ATOM 4485  H H    . VAL A 1 9   ? -20.160 -6.806  3.066   1.00 0.00 ? 9   VAL A H    3  
ATOM 4486  H HA   . VAL A 1 9   ? -19.134 -4.852  4.888   1.00 0.00 ? 9   VAL A HA   3  
ATOM 4487  H HB   . VAL A 1 9   ? -20.524 -5.843  6.611   1.00 0.00 ? 9   VAL A HB   3  
ATOM 4488  H HG11 . VAL A 1 9   ? -21.974 -5.726  3.966   1.00 0.00 ? 9   VAL A HG11 3  
ATOM 4489  H HG12 . VAL A 1 9   ? -21.600 -4.357  5.014   1.00 0.00 ? 9   VAL A HG12 3  
ATOM 4490  H HG13 . VAL A 1 9   ? -22.721 -5.604  5.560   1.00 0.00 ? 9   VAL A HG13 3  
ATOM 4491  H HG21 . VAL A 1 9   ? -21.866 -7.844  6.244   1.00 0.00 ? 9   VAL A HG21 3  
ATOM 4492  H HG22 . VAL A 1 9   ? -20.146 -8.214  6.104   1.00 0.00 ? 9   VAL A HG22 3  
ATOM 4493  H HG23 . VAL A 1 9   ? -21.136 -8.060  4.653   1.00 0.00 ? 9   VAL A HG23 3  
ATOM 4494  N N    . LYS A 1 10  ? -17.763 -7.764  4.824   1.00 0.00 ? 10  LYS A N    3  
ATOM 4495  C CA   . LYS A 1 10  ? -16.568 -8.497  5.247   1.00 0.00 ? 10  LYS A CA   3  
ATOM 4496  C C    . LYS A 1 10  ? -15.301 -7.685  4.962   1.00 0.00 ? 10  LYS A C    3  
ATOM 4497  O O    . LYS A 1 10  ? -14.233 -7.974  5.497   1.00 0.00 ? 10  LYS A O    3  
ATOM 4498  C CB   . LYS A 1 10  ? -16.494 -9.873  4.559   1.00 0.00 ? 10  LYS A CB   3  
ATOM 4499  C CG   . LYS A 1 10  ? -17.159 -11.001 5.347   1.00 0.00 ? 10  LYS A CG   3  
ATOM 4500  C CD   . LYS A 1 10  ? -18.628 -10.718 5.643   1.00 0.00 ? 10  LYS A CD   3  
ATOM 4501  C CE   . LYS A 1 10  ? -19.257 -11.819 6.488   1.00 0.00 ? 10  LYS A CE   3  
ATOM 4502  N NZ   . LYS A 1 10  ? -18.591 -11.955 7.811   1.00 0.00 ? 10  LYS A NZ   3  
ATOM 4503  H H    . LYS A 1 10  ? -18.282 -8.095  4.056   1.00 0.00 ? 10  LYS A H    3  
ATOM 4504  H HA   . LYS A 1 10  ? -16.640 -8.647  6.316   1.00 0.00 ? 10  LYS A HA   3  
ATOM 4505  H HB2  . LYS A 1 10  ? -16.979 -9.807  3.595   1.00 0.00 ? 10  LYS A HB2  3  
ATOM 4506  H HB3  . LYS A 1 10  ? -15.456 -10.137 4.408   1.00 0.00 ? 10  LYS A HB3  3  
ATOM 4507  H HG2  . LYS A 1 10  ? -17.088 -11.915 4.773   1.00 0.00 ? 10  LYS A HG2  3  
ATOM 4508  H HG3  . LYS A 1 10  ? -16.630 -11.128 6.282   1.00 0.00 ? 10  LYS A HG3  3  
ATOM 4509  H HD2  . LYS A 1 10  ? -18.704 -9.782  6.178   1.00 0.00 ? 10  LYS A HD2  3  
ATOM 4510  H HD3  . LYS A 1 10  ? -19.165 -10.644 4.709   1.00 0.00 ? 10  LYS A HD3  3  
ATOM 4511  H HE2  . LYS A 1 10  ? -20.300 -11.584 6.645   1.00 0.00 ? 10  LYS A HE2  3  
ATOM 4512  H HE3  . LYS A 1 10  ? -19.178 -12.757 5.957   1.00 0.00 ? 10  LYS A HE3  3  
ATOM 4513  H HZ1  . LYS A 1 10  ? -18.694 -11.076 8.355   1.00 0.00 ? 10  LYS A HZ1  3  
ATOM 4514  H HZ2  . LYS A 1 10  ? -17.577 -12.155 7.685   1.00 0.00 ? 10  LYS A HZ2  3  
ATOM 4515  H HZ3  . LYS A 1 10  ? -19.023 -12.735 8.348   1.00 0.00 ? 10  LYS A HZ3  3  
ATOM 4516  N N    . TRP A 1 11  ? -15.416 -6.669  4.117   1.00 0.00 ? 11  TRP A N    3  
ATOM 4517  C CA   . TRP A 1 11  ? -14.300 -5.760  3.869   1.00 0.00 ? 11  TRP A CA   3  
ATOM 4518  C C    . TRP A 1 11  ? -14.210 -4.733  4.996   1.00 0.00 ? 11  TRP A C    3  
ATOM 4519  O O    . TRP A 1 11  ? -13.180 -4.082  5.181   1.00 0.00 ? 11  TRP A O    3  
ATOM 4520  C CB   . TRP A 1 11  ? -14.458 -5.057  2.512   1.00 0.00 ? 11  TRP A CB   3  
ATOM 4521  C CG   . TRP A 1 11  ? -14.459 -5.998  1.338   1.00 0.00 ? 11  TRP A CG   3  
ATOM 4522  C CD1  . TRP A 1 11  ? -14.301 -7.356  1.369   1.00 0.00 ? 11  TRP A CD1  3  
ATOM 4523  C CD2  . TRP A 1 11  ? -14.618 -5.647  -0.042  1.00 0.00 ? 11  TRP A CD2  3  
ATOM 4524  N NE1  . TRP A 1 11  ? -14.364 -7.869  0.098   1.00 0.00 ? 11  TRP A NE1  3  
ATOM 4525  C CE2  . TRP A 1 11  ? -14.554 -6.839  -0.787  1.00 0.00 ? 11  TRP A CE2  3  
ATOM 4526  C CE3  . TRP A 1 11  ? -14.811 -4.440  -0.721  1.00 0.00 ? 11  TRP A CE3  3  
ATOM 4527  C CZ2  . TRP A 1 11  ? -14.673 -6.859  -2.174  1.00 0.00 ? 11  TRP A CZ2  3  
ATOM 4528  C CZ3  . TRP A 1 11  ? -14.932 -4.461  -2.097  1.00 0.00 ? 11  TRP A CZ3  3  
ATOM 4529  C CH2  . TRP A 1 11  ? -14.862 -5.663  -2.811  1.00 0.00 ? 11  TRP A CH2  3  
ATOM 4530  H H    . TRP A 1 11  ? -16.264 -6.530  3.643   1.00 0.00 ? 11  TRP A H    3  
ATOM 4531  H HA   . TRP A 1 11  ? -13.389 -6.343  3.859   1.00 0.00 ? 11  TRP A HA   3  
ATOM 4532  H HB2  . TRP A 1 11  ? -15.393 -4.515  2.501   1.00 0.00 ? 11  TRP A HB2  3  
ATOM 4533  H HB3  . TRP A 1 11  ? -13.643 -4.357  2.378   1.00 0.00 ? 11  TRP A HB3  3  
ATOM 4534  H HD1  . TRP A 1 11  ? -14.158 -7.931  2.271   1.00 0.00 ? 11  TRP A HD1  3  
ATOM 4535  H HE1  . TRP A 1 11  ? -14.287 -8.816  -0.135  1.00 0.00 ? 11  TRP A HE1  3  
ATOM 4536  H HE3  . TRP A 1 11  ? -14.867 -3.503  -0.187  1.00 0.00 ? 11  TRP A HE3  3  
ATOM 4537  H HZ2  . TRP A 1 11  ? -14.623 -7.780  -2.739  1.00 0.00 ? 11  TRP A HZ2  3  
ATOM 4538  H HZ3  . TRP A 1 11  ? -15.081 -3.538  -2.637  1.00 0.00 ? 11  TRP A HZ3  3  
ATOM 4539  H HH2  . TRP A 1 11  ? -14.959 -5.633  -3.886  1.00 0.00 ? 11  TRP A HH2  3  
ATOM 4540  N N    . GLY A 1 12  ? -15.295 -4.620  5.764   1.00 0.00 ? 12  GLY A N    3  
ATOM 4541  C CA   . GLY A 1 12  ? -15.362 -3.662  6.856   1.00 0.00 ? 12  GLY A CA   3  
ATOM 4542  C C    . GLY A 1 12  ? -15.009 -4.274  8.200   1.00 0.00 ? 12  GLY A C    3  
ATOM 4543  O O    . GLY A 1 12  ? -15.279 -3.681  9.248   1.00 0.00 ? 12  GLY A O    3  
ATOM 4544  H H    . GLY A 1 12  ? -16.064 -5.204  5.587   1.00 0.00 ? 12  GLY A H    3  
ATOM 4545  H HA2  . GLY A 1 12  ? -14.681 -2.848  6.655   1.00 0.00 ? 12  GLY A HA2  3  
ATOM 4546  H HA3  . GLY A 1 12  ? -16.367 -3.268  6.909   1.00 0.00 ? 12  GLY A HA3  3  
ATOM 4547  N N    . GLU A 1 13  ? -14.428 -5.473  8.172   1.00 0.00 ? 13  GLU A N    3  
ATOM 4548  C CA   . GLU A 1 13  ? -13.953 -6.134  9.390   1.00 0.00 ? 13  GLU A CA   3  
ATOM 4549  C C    . GLU A 1 13  ? -12.424 -6.210  9.396   1.00 0.00 ? 13  GLU A C    3  
ATOM 4550  O O    . GLU A 1 13  ? -11.795 -6.225  10.457  1.00 0.00 ? 13  GLU A O    3  
ATOM 4551  C CB   . GLU A 1 13  ? -14.552 -7.547  9.514   1.00 0.00 ? 13  GLU A CB   3  
ATOM 4552  C CG   . GLU A 1 13  ? -14.206 -8.462  8.345   1.00 0.00 ? 13  GLU A CG   3  
ATOM 4553  C CD   . GLU A 1 13  ? -14.717 -9.884  8.512   1.00 0.00 ? 13  GLU A CD   3  
ATOM 4554  O OE1  . GLU A 1 13  ? -15.942 -10.100 8.418   1.00 0.00 ? 13  GLU A OE1  3  
ATOM 4555  O OE2  . GLU A 1 13  ? -13.887 -10.796 8.721   1.00 0.00 ? 13  GLU A OE2  3  
ATOM 4556  H H    . GLU A 1 13  ? -14.327 -5.930  7.313   1.00 0.00 ? 13  GLU A H    3  
ATOM 4557  H HA   . GLU A 1 13  ? -14.272 -5.543  10.238  1.00 0.00 ? 13  GLU A HA   3  
ATOM 4558  H HB2  . GLU A 1 13  ? -14.184 -8.004  10.424  1.00 0.00 ? 13  GLU A HB2  3  
ATOM 4559  H HB3  . GLU A 1 13  ? -15.628 -7.465  9.574   1.00 0.00 ? 13  GLU A HB3  3  
ATOM 4560  H HG2  . GLU A 1 13  ? -14.642 -8.048  7.448   1.00 0.00 ? 13  GLU A HG2  3  
ATOM 4561  H HG3  . GLU A 1 13  ? -13.130 -8.489  8.234   1.00 0.00 ? 13  GLU A HG3  3  
ATOM 4562  N N    . SER A 1 14  ? -11.831 -6.255  8.202   1.00 0.00 ? 14  SER A N    3  
ATOM 4563  C CA   . SER A 1 14  ? -10.385 -6.393  8.068   1.00 0.00 ? 14  SER A CA   3  
ATOM 4564  C C    . SER A 1 14  ? -9.886  -5.770  6.766   1.00 0.00 ? 14  SER A C    3  
ATOM 4565  O O    . SER A 1 14  ? -10.259 -6.211  5.675   1.00 0.00 ? 14  SER A O    3  
ATOM 4566  C CB   . SER A 1 14  ? -9.995  -7.877  8.109   1.00 0.00 ? 14  SER A CB   3  
ATOM 4567  O OG   . SER A 1 14  ? -10.419 -8.488  9.314   1.00 0.00 ? 14  SER A OG   3  
ATOM 4568  H H    . SER A 1 14  ? -12.378 -6.189  7.394   1.00 0.00 ? 14  SER A H    3  
ATOM 4569  H HA   . SER A 1 14  ? -9.919  -5.885  8.901   1.00 0.00 ? 14  SER A HA   3  
ATOM 4570  H HB2  . SER A 1 14  ? -10.457 -8.393  7.279   1.00 0.00 ? 14  SER A HB2  3  
ATOM 4571  H HB3  . SER A 1 14  ? -8.920  -7.968  8.034   1.00 0.00 ? 14  SER A HB3  3  
ATOM 4572  H HG   . SER A 1 14  ? -10.537 -9.434  9.168   1.00 0.00 ? 14  SER A HG   3  
ATOM 4573  N N    . PHE A 1 15  ? -9.042  -4.746  6.889   1.00 0.00 ? 15  PHE A N    3  
ATOM 4574  C CA   . PHE A 1 15  ? -8.353  -4.158  5.737   1.00 0.00 ? 15  PHE A CA   3  
ATOM 4575  C C    . PHE A 1 15  ? -7.566  -5.253  5.019   1.00 0.00 ? 15  PHE A C    3  
ATOM 4576  O O    . PHE A 1 15  ? -7.477  -5.276  3.793   1.00 0.00 ? 15  PHE A O    3  
ATOM 4577  C CB   . PHE A 1 15  ? -7.408  -3.033  6.200   1.00 0.00 ? 15  PHE A CB   3  
ATOM 4578  C CG   . PHE A 1 15  ? -6.798  -2.211  5.081   1.00 0.00 ? 15  PHE A CG   3  
ATOM 4579  C CD1  . PHE A 1 15  ? -5.824  -2.745  4.246   1.00 0.00 ? 15  PHE A CD1  3  
ATOM 4580  C CD2  . PHE A 1 15  ? -7.196  -0.897  4.872   1.00 0.00 ? 15  PHE A CD2  3  
ATOM 4581  C CE1  . PHE A 1 15  ? -5.265  -1.989  3.232   1.00 0.00 ? 15  PHE A CE1  3  
ATOM 4582  C CE2  . PHE A 1 15  ? -6.638  -0.138  3.860   1.00 0.00 ? 15  PHE A CE2  3  
ATOM 4583  C CZ   . PHE A 1 15  ? -5.672  -0.685  3.040   1.00 0.00 ? 15  PHE A CZ   3  
ATOM 4584  H H    . PHE A 1 15  ? -8.886  -4.370  7.780   1.00 0.00 ? 15  PHE A H    3  
ATOM 4585  H HA   . PHE A 1 15  ? -9.099  -3.753  5.065   1.00 0.00 ? 15  PHE A HA   3  
ATOM 4586  H HB2  . PHE A 1 15  ? -7.957  -2.359  6.842   1.00 0.00 ? 15  PHE A HB2  3  
ATOM 4587  H HB3  . PHE A 1 15  ? -6.597  -3.470  6.769   1.00 0.00 ? 15  PHE A HB3  3  
ATOM 4588  H HD1  . PHE A 1 15  ? -5.502  -3.766  4.393   1.00 0.00 ? 15  PHE A HD1  3  
ATOM 4589  H HD2  . PHE A 1 15  ? -7.952  -0.465  5.512   1.00 0.00 ? 15  PHE A HD2  3  
ATOM 4590  H HE1  . PHE A 1 15  ? -4.509  -2.419  2.591   1.00 0.00 ? 15  PHE A HE1  3  
ATOM 4591  H HE2  . PHE A 1 15  ? -6.956  0.884   3.711   1.00 0.00 ? 15  PHE A HE2  3  
ATOM 4592  H HZ   . PHE A 1 15  ? -5.234  -0.094  2.249   1.00 0.00 ? 15  PHE A HZ   3  
ATOM 4593  N N    . ASP A 1 16  ? -7.010  -6.163  5.816   1.00 0.00 ? 16  ASP A N    3  
ATOM 4594  C CA   . ASP A 1 16  ? -6.296  -7.333  5.305   1.00 0.00 ? 16  ASP A CA   3  
ATOM 4595  C C    . ASP A 1 16  ? -7.155  -8.097  4.293   1.00 0.00 ? 16  ASP A C    3  
ATOM 4596  O O    . ASP A 1 16  ? -6.685  -8.472  3.219   1.00 0.00 ? 16  ASP A O    3  
ATOM 4597  C CB   . ASP A 1 16  ? -5.914  -8.249  6.475   1.00 0.00 ? 16  ASP A CB   3  
ATOM 4598  C CG   . ASP A 1 16  ? -5.247  -9.545  6.036   1.00 0.00 ? 16  ASP A CG   3  
ATOM 4599  O OD1  . ASP A 1 16  ? -4.002  -9.567  5.909   1.00 0.00 ? 16  ASP A OD1  3  
ATOM 4600  O OD2  . ASP A 1 16  ? -5.962  -10.553 5.843   1.00 0.00 ? 16  ASP A OD2  3  
ATOM 4601  H H    . ASP A 1 16  ? -7.072  -6.037  6.785   1.00 0.00 ? 16  ASP A H    3  
ATOM 4602  H HA   . ASP A 1 16  ? -5.396  -6.988  4.817   1.00 0.00 ? 16  ASP A HA   3  
ATOM 4603  H HB2  . ASP A 1 16  ? -5.231  -7.719  7.124   1.00 0.00 ? 16  ASP A HB2  3  
ATOM 4604  H HB3  . ASP A 1 16  ? -6.807  -8.495  7.035   1.00 0.00 ? 16  ASP A HB3  3  
ATOM 4605  N N    . LYS A 1 17  ? -8.425  -8.298  4.639   1.00 0.00 ? 17  LYS A N    3  
ATOM 4606  C CA   . LYS A 1 17  ? -9.361  -9.006  3.771   1.00 0.00 ? 17  LYS A CA   3  
ATOM 4607  C C    . LYS A 1 17  ? -9.693  -8.156  2.543   1.00 0.00 ? 17  LYS A C    3  
ATOM 4608  O O    . LYS A 1 17  ? -9.854  -8.679  1.437   1.00 0.00 ? 17  LYS A O    3  
ATOM 4609  C CB   . LYS A 1 17  ? -10.638 -9.372  4.543   1.00 0.00 ? 17  LYS A CB   3  
ATOM 4610  C CG   . LYS A 1 17  ? -11.683 -10.086 3.692   1.00 0.00 ? 17  LYS A CG   3  
ATOM 4611  C CD   . LYS A 1 17  ? -12.887 -10.554 4.508   1.00 0.00 ? 17  LYS A CD   3  
ATOM 4612  C CE   . LYS A 1 17  ? -12.527 -11.652 5.506   1.00 0.00 ? 17  LYS A CE   3  
ATOM 4613  N NZ   . LYS A 1 17  ? -13.730 -12.169 6.217   1.00 0.00 ? 17  LYS A NZ   3  
ATOM 4614  H H    . LYS A 1 17  ? -8.741  -7.959  5.499   1.00 0.00 ? 17  LYS A H    3  
ATOM 4615  H HA   . LYS A 1 17  ? -8.879  -9.916  3.440   1.00 0.00 ? 17  LYS A HA   3  
ATOM 4616  H HB2  . LYS A 1 17  ? -10.371 -10.019 5.369   1.00 0.00 ? 17  LYS A HB2  3  
ATOM 4617  H HB3  . LYS A 1 17  ? -11.080 -8.468  4.938   1.00 0.00 ? 17  LYS A HB3  3  
ATOM 4618  H HG2  . LYS A 1 17  ? -12.027 -9.404  2.929   1.00 0.00 ? 17  LYS A HG2  3  
ATOM 4619  H HG3  . LYS A 1 17  ? -11.222 -10.943 3.225   1.00 0.00 ? 17  LYS A HG3  3  
ATOM 4620  H HD2  . LYS A 1 17  ? -13.290 -9.713  5.052   1.00 0.00 ? 17  LYS A HD2  3  
ATOM 4621  H HD3  . LYS A 1 17  ? -13.639 -10.933 3.829   1.00 0.00 ? 17  LYS A HD3  3  
ATOM 4622  H HE2  . LYS A 1 17  ? -12.058 -12.467 4.975   1.00 0.00 ? 17  LYS A HE2  3  
ATOM 4623  H HE3  . LYS A 1 17  ? -11.835 -11.252 6.234   1.00 0.00 ? 17  LYS A HE3  3  
ATOM 4624  H HZ1  . LYS A 1 17  ? -13.475 -12.997 6.794   1.00 0.00 ? 17  LYS A HZ1  3  
ATOM 4625  H HZ2  . LYS A 1 17  ? -14.458 -12.455 5.531   1.00 0.00 ? 17  LYS A HZ2  3  
ATOM 4626  H HZ3  . LYS A 1 17  ? -14.125 -11.437 6.841   1.00 0.00 ? 17  LYS A HZ3  3  
ATOM 4627  N N    . LEU A 1 18  ? -9.781  -6.843  2.749   1.00 0.00 ? 18  LEU A N    3  
ATOM 4628  C CA   . LEU A 1 18  ? -10.012 -5.899  1.657   1.00 0.00 ? 18  LEU A CA   3  
ATOM 4629  C C    . LEU A 1 18  ? -8.897  -6.017  0.616   1.00 0.00 ? 18  LEU A C    3  
ATOM 4630  O O    . LEU A 1 18  ? -9.154  -6.040  -0.588  1.00 0.00 ? 18  LEU A O    3  
ATOM 4631  C CB   . LEU A 1 18  ? -10.080 -4.464  2.206   1.00 0.00 ? 18  LEU A CB   3  
ATOM 4632  C CG   . LEU A 1 18  ? -10.239 -3.351  1.154   1.00 0.00 ? 18  LEU A CG   3  
ATOM 4633  C CD1  . LEU A 1 18  ? -11.550 -3.508  0.389   1.00 0.00 ? 18  LEU A CD1  3  
ATOM 4634  C CD2  . LEU A 1 18  ? -10.152 -1.972  1.807   1.00 0.00 ? 18  LEU A CD2  3  
ATOM 4635  H H    . LEU A 1 18  ? -9.683  -6.499  3.662   1.00 0.00 ? 18  LEU A H    3  
ATOM 4636  H HA   . LEU A 1 18  ? -10.957 -6.149  1.194   1.00 0.00 ? 18  LEU A HA   3  
ATOM 4637  H HB2  . LEU A 1 18  ? -10.915 -4.405  2.891   1.00 0.00 ? 18  LEU A HB2  3  
ATOM 4638  H HB3  . LEU A 1 18  ? -9.172  -4.273  2.763   1.00 0.00 ? 18  LEU A HB3  3  
ATOM 4639  H HG   . LEU A 1 18  ? -9.432  -3.429  0.439   1.00 0.00 ? 18  LEU A HG   3  
ATOM 4640  H HD11 . LEU A 1 18  ? -11.568 -4.469  -0.103  1.00 0.00 ? 18  LEU A HD11 3  
ATOM 4641  H HD12 . LEU A 1 18  ? -11.632 -2.725  -0.351  1.00 0.00 ? 18  LEU A HD12 3  
ATOM 4642  H HD13 . LEU A 1 18  ? -12.381 -3.440  1.077   1.00 0.00 ? 18  LEU A HD13 3  
ATOM 4643  H HD21 . LEU A 1 18  ? -10.258 -1.207  1.051   1.00 0.00 ? 18  LEU A HD21 3  
ATOM 4644  H HD22 . LEU A 1 18  ? -9.193  -1.863  2.293   1.00 0.00 ? 18  LEU A HD22 3  
ATOM 4645  H HD23 . LEU A 1 18  ? -10.939 -1.866  2.540   1.00 0.00 ? 18  LEU A HD23 3  
ATOM 4646  N N    . LEU A 1 19  ? -7.663  -6.113  1.102   1.00 0.00 ? 19  LEU A N    3  
ATOM 4647  C CA   . LEU A 1 19  ? -6.489  -6.232  0.241   1.00 0.00 ? 19  LEU A CA   3  
ATOM 4648  C C    . LEU A 1 19  ? -6.407  -7.635  -0.366  1.00 0.00 ? 19  LEU A C    3  
ATOM 4649  O O    . LEU A 1 19  ? -5.978  -7.806  -1.509  1.00 0.00 ? 19  LEU A O    3  
ATOM 4650  C CB   . LEU A 1 19  ? -5.218  -5.925  1.050   1.00 0.00 ? 19  LEU A CB   3  
ATOM 4651  C CG   . LEU A 1 19  ? -3.903  -5.923  0.250   1.00 0.00 ? 19  LEU A CG   3  
ATOM 4652  C CD1  . LEU A 1 19  ? -3.931  -4.855  -0.842  1.00 0.00 ? 19  LEU A CD1  3  
ATOM 4653  C CD2  . LEU A 1 19  ? -2.709  -5.714  1.180   1.00 0.00 ? 19  LEU A CD2  3  
ATOM 4654  H H    . LEU A 1 19  ? -7.536  -6.100  2.074   1.00 0.00 ? 19  LEU A H    3  
ATOM 4655  H HA   . LEU A 1 19  ? -6.583  -5.509  -0.555  1.00 0.00 ? 19  LEU A HA   3  
ATOM 4656  H HB2  . LEU A 1 19  ? -5.337  -4.953  1.509   1.00 0.00 ? 19  LEU A HB2  3  
ATOM 4657  H HB3  . LEU A 1 19  ? -5.131  -6.663  1.836   1.00 0.00 ? 19  LEU A HB3  3  
ATOM 4658  H HG   . LEU A 1 19  ? -3.785  -6.883  -0.232  1.00 0.00 ? 19  LEU A HG   3  
ATOM 4659  H HD11 . LEU A 1 19  ? -4.748  -5.055  -1.522  1.00 0.00 ? 19  LEU A HD11 3  
ATOM 4660  H HD12 . LEU A 1 19  ? -2.999  -4.871  -1.389  1.00 0.00 ? 19  LEU A HD12 3  
ATOM 4661  H HD13 . LEU A 1 19  ? -4.068  -3.880  -0.394  1.00 0.00 ? 19  LEU A HD13 3  
ATOM 4662  H HD21 . LEU A 1 19  ? -2.682  -6.506  1.915   1.00 0.00 ? 19  LEU A HD21 3  
ATOM 4663  H HD22 . LEU A 1 19  ? -2.803  -4.762  1.682   1.00 0.00 ? 19  LEU A HD22 3  
ATOM 4664  H HD23 . LEU A 1 19  ? -1.796  -5.728  0.603   1.00 0.00 ? 19  LEU A HD23 3  
ATOM 4665  N N    . SER A 1 20  ? -6.832  -8.633  0.411   1.00 0.00 ? 20  SER A N    3  
ATOM 4666  C CA   . SER A 1 20  ? -6.831  -10.025 -0.039  1.00 0.00 ? 20  SER A CA   3  
ATOM 4667  C C    . SER A 1 20  ? -7.783  -10.207 -1.222  1.00 0.00 ? 20  SER A C    3  
ATOM 4668  O O    . SER A 1 20  ? -7.579  -11.082 -2.069  1.00 0.00 ? 20  SER A O    3  
ATOM 4669  C CB   . SER A 1 20  ? -7.227  -10.955 1.117   1.00 0.00 ? 20  SER A CB   3  
ATOM 4670  O OG   . SER A 1 20  ? -7.158  -12.321 0.732   1.00 0.00 ? 20  SER A OG   3  
ATOM 4671  H H    . SER A 1 20  ? -7.145  -8.427  1.315   1.00 0.00 ? 20  SER A H    3  
ATOM 4672  H HA   . SER A 1 20  ? -5.827  -10.270 -0.358  1.00 0.00 ? 20  SER A HA   3  
ATOM 4673  H HB2  . SER A 1 20  ? -6.557  -10.798 1.950   1.00 0.00 ? 20  SER A HB2  3  
ATOM 4674  H HB3  . SER A 1 20  ? -8.239  -10.734 1.427   1.00 0.00 ? 20  SER A HB3  3  
ATOM 4675  H HG   . SER A 1 20  ? -7.860  -12.511 0.095   1.00 0.00 ? 20  SER A HG   3  
ATOM 4676  N N    . HIS A 1 21  ? -8.825  -9.382  -1.273  1.00 0.00 ? 21  HIS A N    3  
ATOM 4677  C CA   . HIS A 1 21  ? -9.755  -9.391  -2.394  1.00 0.00 ? 21  HIS A CA   3  
ATOM 4678  C C    . HIS A 1 21  ? -9.209  -8.525  -3.520  1.00 0.00 ? 21  HIS A C    3  
ATOM 4679  O O    . HIS A 1 21  ? -9.067  -7.316  -3.357  1.00 0.00 ? 21  HIS A O    3  
ATOM 4680  C CB   . HIS A 1 21  ? -11.144 -8.876  -1.970  1.00 0.00 ? 21  HIS A CB   3  
ATOM 4681  C CG   . HIS A 1 21  ? -12.146 -9.959  -1.714  1.00 0.00 ? 21  HIS A CG   3  
ATOM 4682  N ND1  . HIS A 1 21  ? -13.074 -10.359 -2.655  1.00 0.00 ? 21  HIS A ND1  3  
ATOM 4683  C CD2  . HIS A 1 21  ? -12.383 -10.712 -0.612  1.00 0.00 ? 21  HIS A CD2  3  
ATOM 4684  C CE1  . HIS A 1 21  ? -13.838 -11.302 -2.141  1.00 0.00 ? 21  HIS A CE1  3  
ATOM 4685  N NE2  . HIS A 1 21  ? -13.437 -11.537 -0.905  1.00 0.00 ? 21  HIS A NE2  3  
ATOM 4686  H H    . HIS A 1 21  ? -8.961  -8.736  -0.545  1.00 0.00 ? 21  HIS A H    3  
ATOM 4687  H HA   . HIS A 1 21  ? -9.846  -10.410 -2.747  1.00 0.00 ? 21  HIS A HA   3  
ATOM 4688  H HB2  . HIS A 1 21  ? -11.047 -8.298  -1.063  1.00 0.00 ? 21  HIS A HB2  3  
ATOM 4689  H HB3  . HIS A 1 21  ? -11.542 -8.238  -2.749  1.00 0.00 ? 21  HIS A HB3  3  
ATOM 4690  H HD1  . HIS A 1 21  ? -13.153 -10.013 -3.575  1.00 0.00 ? 21  HIS A HD1  3  
ATOM 4691  H HD2  . HIS A 1 21  ? -11.844 -10.669 0.323   1.00 0.00 ? 21  HIS A HD2  3  
ATOM 4692  H HE1  . HIS A 1 21  ? -14.662 -11.787 -2.643  1.00 0.00 ? 21  HIS A HE1  3  
ATOM 4693  H HE2  . HIS A 1 21  ? -13.913 -12.104 -0.256  1.00 0.00 ? 21  HIS A HE2  3  
ATOM 4694  N N    . ARG A 1 22  ? -8.906  -9.144  -4.656  1.00 0.00 ? 22  ARG A N    3  
ATOM 4695  C CA   . ARG A 1 22  ? -8.447  -8.407  -5.831  1.00 0.00 ? 22  ARG A CA   3  
ATOM 4696  C C    . ARG A 1 22  ? -9.485  -7.345  -6.206  1.00 0.00 ? 22  ARG A C    3  
ATOM 4697  O O    . ARG A 1 22  ? -9.147  -6.274  -6.714  1.00 0.00 ? 22  ARG A O    3  
ATOM 4698  C CB   . ARG A 1 22  ? -8.227  -9.369  -7.005  1.00 0.00 ? 22  ARG A CB   3  
ATOM 4699  C CG   . ARG A 1 22  ? -7.603  -8.723  -8.244  1.00 0.00 ? 22  ARG A CG   3  
ATOM 4700  C CD   . ARG A 1 22  ? -8.203  -9.272  -9.538  1.00 0.00 ? 22  ARG A CD   3  
ATOM 4701  N NE   . ARG A 1 22  ? -9.558  -8.758  -9.764  1.00 0.00 ? 22  ARG A NE   3  
ATOM 4702  C CZ   . ARG A 1 22  ? -10.672 -9.308  -9.273  1.00 0.00 ? 22  ARG A CZ   3  
ATOM 4703  N NH1  . ARG A 1 22  ? -10.627 -10.471 -8.627  1.00 0.00 ? 22  ARG A NH1  3  
ATOM 4704  N NH2  . ARG A 1 22  ? -11.833 -8.702  -9.458  1.00 0.00 ? 22  ARG A NH2  3  
ATOM 4705  H H    . ARG A 1 22  ? -8.988  -10.120 -4.706  1.00 0.00 ? 22  ARG A H    3  
ATOM 4706  H HA   . ARG A 1 22  ? -7.512  -7.922  -5.584  1.00 0.00 ? 22  ARG A HA   3  
ATOM 4707  H HB2  . ARG A 1 22  ? -7.576  -10.167 -6.677  1.00 0.00 ? 22  ARG A HB2  3  
ATOM 4708  H HB3  . ARG A 1 22  ? -9.180  -9.794  -7.284  1.00 0.00 ? 22  ARG A HB3  3  
ATOM 4709  H HG2  . ARG A 1 22  ? -7.772  -7.657  -8.209  1.00 0.00 ? 22  ARG A HG2  3  
ATOM 4710  H HG3  . ARG A 1 22  ? -6.538  -8.917  -8.241  1.00 0.00 ? 22  ARG A HG3  3  
ATOM 4711  H HD2  . ARG A 1 22  ? -7.574  -8.977  -10.367 1.00 0.00 ? 22  ARG A HD2  3  
ATOM 4712  H HD3  . ARG A 1 22  ? -8.238  -10.351 -9.480  1.00 0.00 ? 22  ARG A HD3  3  
ATOM 4713  H HE   . ARG A 1 22  ? -9.636  -7.929  -10.289 1.00 0.00 ? 22  ARG A HE   3  
ATOM 4714  H HH11 . ARG A 1 22  ? -9.753  -10.949 -8.507  1.00 0.00 ? 22  ARG A HH11 3  
ATOM 4715  H HH12 . ARG A 1 22  ? -11.468 -10.875 -8.251  1.00 0.00 ? 22  ARG A HH12 3  
ATOM 4716  H HH21 . ARG A 1 22  ? -11.876 -7.842  -9.975  1.00 0.00 ? 22  ARG A HH21 3  
ATOM 4717  H HH22 . ARG A 1 22  ? -12.673 -9.084  -9.055  1.00 0.00 ? 22  ARG A HH22 3  
ATOM 4718  N N    . ASP A 1 23  ? -10.753 -7.664  -5.934  1.00 0.00 ? 23  ASP A N    3  
ATOM 4719  C CA   . ASP A 1 23  ? -11.862 -6.732  -6.157  1.00 0.00 ? 23  ASP A CA   3  
ATOM 4720  C C    . ASP A 1 23  ? -11.697 -5.521  -5.245  1.00 0.00 ? 23  ASP A C    3  
ATOM 4721  O O    . ASP A 1 23  ? -11.815 -4.372  -5.677  1.00 0.00 ? 23  ASP A O    3  
ATOM 4722  C CB   . ASP A 1 23  ? -13.215 -7.410  -5.861  1.00 0.00 ? 23  ASP A CB   3  
ATOM 4723  C CG   . ASP A 1 23  ? -13.275 -8.854  -6.332  1.00 0.00 ? 23  ASP A CG   3  
ATOM 4724  O OD1  . ASP A 1 23  ? -13.663 -9.104  -7.496  1.00 0.00 ? 23  ASP A OD1  3  
ATOM 4725  O OD2  . ASP A 1 23  ? -12.916 -9.749  -5.535  1.00 0.00 ? 23  ASP A OD2  3  
ATOM 4726  H H    . ASP A 1 23  ? -10.948 -8.555  -5.575  1.00 0.00 ? 23  ASP A H    3  
ATOM 4727  H HA   . ASP A 1 23  ? -11.836 -6.412  -7.189  1.00 0.00 ? 23  ASP A HA   3  
ATOM 4728  H HB2  . ASP A 1 23  ? -13.396 -7.393  -4.794  1.00 0.00 ? 23  ASP A HB2  3  
ATOM 4729  H HB3  . ASP A 1 23  ? -14.000 -6.857  -6.357  1.00 0.00 ? 23  ASP A HB3  3  
ATOM 4730  N N    . GLY A 1 24  ? -11.407 -5.804  -3.975  1.00 0.00 ? 24  GLY A N    3  
ATOM 4731  C CA   . GLY A 1 24  ? -11.205 -4.761  -2.988  1.00 0.00 ? 24  GLY A CA   3  
ATOM 4732  C C    . GLY A 1 24  ? -10.015 -3.893  -3.329  1.00 0.00 ? 24  GLY A C    3  
ATOM 4733  O O    . GLY A 1 24  ? -10.084 -2.670  -3.243  1.00 0.00 ? 24  GLY A O    3  
ATOM 4734  H H    . GLY A 1 24  ? -11.316 -6.739  -3.709  1.00 0.00 ? 24  GLY A H    3  
ATOM 4735  H HA2  . GLY A 1 24  ? -12.091 -4.147  -2.935  1.00 0.00 ? 24  GLY A HA2  3  
ATOM 4736  H HA3  . GLY A 1 24  ? -11.038 -5.219  -2.024  1.00 0.00 ? 24  GLY A HA3  3  
ATOM 4737  N N    . LEU A 1 25  ? -8.925  -4.546  -3.719  1.00 0.00 ? 25  LEU A N    3  
ATOM 4738  C CA   . LEU A 1 25  ? -7.727  -3.866  -4.193  1.00 0.00 ? 25  LEU A CA   3  
ATOM 4739  C C    . LEU A 1 25  ? -8.077  -2.880  -5.303  1.00 0.00 ? 25  LEU A C    3  
ATOM 4740  O O    . LEU A 1 25  ? -7.812  -1.684  -5.198  1.00 0.00 ? 25  LEU A O    3  
ATOM 4741  C CB   . LEU A 1 25  ? -6.725  -4.897  -4.735  1.00 0.00 ? 25  LEU A CB   3  
ATOM 4742  C CG   . LEU A 1 25  ? -5.501  -4.313  -5.468  1.00 0.00 ? 25  LEU A CG   3  
ATOM 4743  C CD1  . LEU A 1 25  ? -4.450  -3.818  -4.480  1.00 0.00 ? 25  LEU A CD1  3  
ATOM 4744  C CD2  . LEU A 1 25  ? -4.919  -5.335  -6.441  1.00 0.00 ? 25  LEU A CD2  3  
ATOM 4745  H H    . LEU A 1 25  ? -8.925  -5.524  -3.677  1.00 0.00 ? 25  LEU A H    3  
ATOM 4746  H HA   . LEU A 1 25  ? -7.282  -3.334  -3.364  1.00 0.00 ? 25  LEU A HA   3  
ATOM 4747  H HB2  . LEU A 1 25  ? -6.373  -5.495  -3.905  1.00 0.00 ? 25  LEU A HB2  3  
ATOM 4748  H HB3  . LEU A 1 25  ? -7.252  -5.546  -5.420  1.00 0.00 ? 25  LEU A HB3  3  
ATOM 4749  H HG   . LEU A 1 25  ? -5.822  -3.460  -6.049  1.00 0.00 ? 25  LEU A HG   3  
ATOM 4750  H HD11 . LEU A 1 25  ? -4.883  -3.062  -3.841  1.00 0.00 ? 25  LEU A HD11 3  
ATOM 4751  H HD12 . LEU A 1 25  ? -3.617  -3.393  -5.021  1.00 0.00 ? 25  LEU A HD12 3  
ATOM 4752  H HD13 . LEU A 1 25  ? -4.101  -4.643  -3.875  1.00 0.00 ? 25  LEU A HD13 3  
ATOM 4753  H HD21 . LEU A 1 25  ? -5.665  -5.581  -7.188  1.00 0.00 ? 25  LEU A HD21 3  
ATOM 4754  H HD22 . LEU A 1 25  ? -4.637  -6.230  -5.904  1.00 0.00 ? 25  LEU A HD22 3  
ATOM 4755  H HD23 . LEU A 1 25  ? -4.050  -4.916  -6.927  1.00 0.00 ? 25  LEU A HD23 3  
ATOM 4756  N N    . GLU A 1 26  ? -8.691  -3.407  -6.356  1.00 0.00 ? 26  GLU A N    3  
ATOM 4757  C CA   . GLU A 1 26  ? -9.014  -2.637  -7.551  1.00 0.00 ? 26  GLU A CA   3  
ATOM 4758  C C    . GLU A 1 26  ? -9.917  -1.445  -7.215  1.00 0.00 ? 26  GLU A C    3  
ATOM 4759  O O    . GLU A 1 26  ? -9.743  -0.344  -7.753  1.00 0.00 ? 26  GLU A O    3  
ATOM 4760  C CB   . GLU A 1 26  ? -9.677  -3.564  -8.581  1.00 0.00 ? 26  GLU A CB   3  
ATOM 4761  C CG   . GLU A 1 26  ? -10.061 -2.890  -9.897  1.00 0.00 ? 26  GLU A CG   3  
ATOM 4762  C CD   . GLU A 1 26  ? -8.871  -2.284  -10.626 1.00 0.00 ? 26  GLU A CD   3  
ATOM 4763  O OE1  . GLU A 1 26  ? -7.921  -3.028  -10.943 1.00 0.00 ? 26  GLU A OE1  3  
ATOM 4764  O OE2  . GLU A 1 26  ? -8.887  -1.065  -10.904 1.00 0.00 ? 26  GLU A OE2  3  
ATOM 4765  H H    . GLU A 1 26  ? -8.943  -4.355  -6.327  1.00 0.00 ? 26  GLU A H    3  
ATOM 4766  H HA   . GLU A 1 26  ? -8.086  -2.265  -7.964  1.00 0.00 ? 26  GLU A HA   3  
ATOM 4767  H HB2  . GLU A 1 26  ? -8.991  -4.373  -8.804  1.00 0.00 ? 26  GLU A HB2  3  
ATOM 4768  H HB3  . GLU A 1 26  ? -10.573 -3.981  -8.142  1.00 0.00 ? 26  GLU A HB3  3  
ATOM 4769  H HG2  . GLU A 1 26  ? -10.518 -3.626  -10.542 1.00 0.00 ? 26  GLU A HG2  3  
ATOM 4770  H HG3  . GLU A 1 26  ? -10.778 -2.106  -9.688  1.00 0.00 ? 26  GLU A HG3  3  
ATOM 4771  N N    . ALA A 1 27  ? -10.868 -1.662  -6.312  1.00 0.00 ? 27  ALA A N    3  
ATOM 4772  C CA   . ALA A 1 27  ? -11.780 -0.604  -5.889  1.00 0.00 ? 27  ALA A CA   3  
ATOM 4773  C C    . ALA A 1 27  ? -11.056 0.430   -5.025  1.00 0.00 ? 27  ALA A C    3  
ATOM 4774  O O    . ALA A 1 27  ? -11.190 1.637   -5.233  1.00 0.00 ? 27  ALA A O    3  
ATOM 4775  C CB   . ALA A 1 27  ? -12.966 -1.197  -5.133  1.00 0.00 ? 27  ALA A CB   3  
ATOM 4776  H H    . ALA A 1 27  ? -10.959 -2.557  -5.920  1.00 0.00 ? 27  ALA A H    3  
ATOM 4777  H HA   . ALA A 1 27  ? -12.159 -0.114  -6.777  1.00 0.00 ? 27  ALA A HA   3  
ATOM 4778  H HB1  . ALA A 1 27  ? -13.657 -0.409  -4.868  1.00 0.00 ? 27  ALA A HB1  3  
ATOM 4779  H HB2  . ALA A 1 27  ? -12.615 -1.683  -4.233  1.00 0.00 ? 27  ALA A HB2  3  
ATOM 4780  H HB3  . ALA A 1 27  ? -13.470 -1.920  -5.759  1.00 0.00 ? 27  ALA A HB3  3  
ATOM 4781  N N    . PHE A 1 28  ? -10.263 -0.060  -4.077  1.00 0.00 ? 28  PHE A N    3  
ATOM 4782  C CA   . PHE A 1 28  ? -9.591  0.797   -3.103  1.00 0.00 ? 28  PHE A CA   3  
ATOM 4783  C C    . PHE A 1 28  ? -8.440  1.570   -3.747  1.00 0.00 ? 28  PHE A C    3  
ATOM 4784  O O    . PHE A 1 28  ? -8.141  2.695   -3.345  1.00 0.00 ? 28  PHE A O    3  
ATOM 4785  C CB   . PHE A 1 28  ? -9.076  -0.042  -1.922  1.00 0.00 ? 28  PHE A CB   3  
ATOM 4786  C CG   . PHE A 1 28  ? -8.477  0.776   -0.802  1.00 0.00 ? 28  PHE A CG   3  
ATOM 4787  C CD1  . PHE A 1 28  ? -9.289  1.522   0.039   1.00 0.00 ? 28  PHE A CD1  3  
ATOM 4788  C CD2  . PHE A 1 28  ? -7.105  0.796   -0.589  1.00 0.00 ? 28  PHE A CD2  3  
ATOM 4789  C CE1  . PHE A 1 28  ? -8.748  2.272   1.067   1.00 0.00 ? 28  PHE A CE1  3  
ATOM 4790  C CE2  . PHE A 1 28  ? -6.558  1.545   0.437   1.00 0.00 ? 28  PHE A CE2  3  
ATOM 4791  C CZ   . PHE A 1 28  ? -7.381  2.284   1.265   1.00 0.00 ? 28  PHE A CZ   3  
ATOM 4792  H H    . PHE A 1 28  ? -10.123 -1.029  -4.032  1.00 0.00 ? 28  PHE A H    3  
ATOM 4793  H HA   . PHE A 1 28  ? -10.318 1.506   -2.735  1.00 0.00 ? 28  PHE A HA   3  
ATOM 4794  H HB2  . PHE A 1 28  ? -9.899  -0.611  -1.511  1.00 0.00 ? 28  PHE A HB2  3  
ATOM 4795  H HB3  . PHE A 1 28  ? -8.320  -0.726  -2.279  1.00 0.00 ? 28  PHE A HB3  3  
ATOM 4796  H HD1  . PHE A 1 28  ? -10.359 1.516   -0.112  1.00 0.00 ? 28  PHE A HD1  3  
ATOM 4797  H HD2  . PHE A 1 28  ? -6.458  0.219   -1.235  1.00 0.00 ? 28  PHE A HD2  3  
ATOM 4798  H HE1  . PHE A 1 28  ? -9.394  2.848   1.713   1.00 0.00 ? 28  PHE A HE1  3  
ATOM 4799  H HE2  . PHE A 1 28  ? -5.489  1.553   0.591   1.00 0.00 ? 28  PHE A HE2  3  
ATOM 4800  H HZ   . PHE A 1 28  ? -6.955  2.870   2.067   1.00 0.00 ? 28  PHE A HZ   3  
ATOM 4801  N N    . THR A 1 29  ? -7.817  0.984   -4.768  1.00 0.00 ? 29  THR A N    3  
ATOM 4802  C CA   . THR A 1 29  ? -6.675  1.615   -5.421  1.00 0.00 ? 29  THR A CA   3  
ATOM 4803  C C    . THR A 1 29  ? -7.192  2.732   -6.312  1.00 0.00 ? 29  THR A C    3  
ATOM 4804  O O    . THR A 1 29  ? -6.620  3.816   -6.374  1.00 0.00 ? 29  THR A O    3  
ATOM 4805  C CB   . THR A 1 29  ? -5.814  0.606   -6.239  1.00 0.00 ? 29  THR A CB   3  
ATOM 4806  O OG1  . THR A 1 29  ? -4.583  1.221   -6.657  1.00 0.00 ? 29  THR A OG1  3  
ATOM 4807  C CG2  . THR A 1 29  ? -6.554  0.090   -7.469  1.00 0.00 ? 29  THR A CG2  3  
ATOM 4808  H H    . THR A 1 29  ? -8.159  0.136   -5.111  1.00 0.00 ? 29  THR A H    3  
ATOM 4809  H HA   . THR A 1 29  ? -6.051  2.049   -4.649  1.00 0.00 ? 29  THR A HA   3  
ATOM 4810  H HB   . THR A 1 29  ? -5.579  -0.237  -5.601  1.00 0.00 ? 29  THR A HB   3  
ATOM 4811  H HG1  . THR A 1 29  ? -3.890  0.547   -6.704  1.00 0.00 ? 29  THR A HG1  3  
ATOM 4812  H HG21 . THR A 1 29  ? -7.470  -0.392  -7.163  1.00 0.00 ? 29  THR A HG21 3  
ATOM 4813  H HG22 . THR A 1 29  ? -5.932  -0.622  -7.993  1.00 0.00 ? 29  THR A HG22 3  
ATOM 4814  H HG23 . THR A 1 29  ? -6.786  0.916   -8.125  1.00 0.00 ? 29  THR A HG23 3  
ATOM 4815  N N    . ARG A 1 30  ? -8.318  2.468   -6.964  1.00 0.00 ? 30  ARG A N    3  
ATOM 4816  C CA   . ARG A 1 30  ? -9.028  3.485   -7.715  1.00 0.00 ? 30  ARG A CA   3  
ATOM 4817  C C    . ARG A 1 30  ? -9.435  4.629   -6.786  1.00 0.00 ? 30  ARG A C    3  
ATOM 4818  O O    . ARG A 1 30  ? -9.353  5.807   -7.149  1.00 0.00 ? 30  ARG A O    3  
ATOM 4819  C CB   . ARG A 1 30  ? -10.266 2.869   -8.380  1.00 0.00 ? 30  ARG A CB   3  
ATOM 4820  C CG   . ARG A 1 30  ? -11.302 3.895   -8.805  1.00 0.00 ? 30  ARG A CG   3  
ATOM 4821  C CD   . ARG A 1 30  ? -12.514 3.254   -9.471  1.00 0.00 ? 30  ARG A CD   3  
ATOM 4822  N NE   . ARG A 1 30  ? -13.473 4.258   -9.934  1.00 0.00 ? 30  ARG A NE   3  
ATOM 4823  C CZ   . ARG A 1 30  ? -14.789 4.064   -10.028 1.00 0.00 ? 30  ARG A CZ   3  
ATOM 4824  N NH1  . ARG A 1 30  ? -15.325 2.887   -9.720  1.00 0.00 ? 30  ARG A NH1  3  
ATOM 4825  N NH2  . ARG A 1 30  ? -15.567 5.047   -10.449 1.00 0.00 ? 30  ARG A NH2  3  
ATOM 4826  H H    . ARG A 1 30  ? -8.681  1.556   -6.937  1.00 0.00 ? 30  ARG A H    3  
ATOM 4827  H HA   . ARG A 1 30  ? -8.364  3.867   -8.480  1.00 0.00 ? 30  ARG A HA   3  
ATOM 4828  H HB2  . ARG A 1 30  ? -9.955  2.316   -9.256  1.00 0.00 ? 30  ARG A HB2  3  
ATOM 4829  H HB3  . ARG A 1 30  ? -10.731 2.186   -7.683  1.00 0.00 ? 30  ARG A HB3  3  
ATOM 4830  H HG2  . ARG A 1 30  ? -11.629 4.422   -7.921  1.00 0.00 ? 30  ARG A HG2  3  
ATOM 4831  H HG3  . ARG A 1 30  ? -10.846 4.593   -9.494  1.00 0.00 ? 30  ARG A HG3  3  
ATOM 4832  H HD2  . ARG A 1 30  ? -12.180 2.671   -10.317 1.00 0.00 ? 30  ARG A HD2  3  
ATOM 4833  H HD3  . ARG A 1 30  ? -13.001 2.606   -8.755  1.00 0.00 ? 30  ARG A HD3  3  
ATOM 4834  H HE   . ARG A 1 30  ? -13.111 5.137   -10.195 1.00 0.00 ? 30  ARG A HE   3  
ATOM 4835  H HH11 . ARG A 1 30  ? -14.744 2.126   -9.414  1.00 0.00 ? 30  ARG A HH11 3  
ATOM 4836  H HH12 . ARG A 1 30  ? -16.320 2.755   -9.794  1.00 0.00 ? 30  ARG A HH12 3  
ATOM 4837  H HH21 . ARG A 1 30  ? -15.167 5.935   -10.704 1.00 0.00 ? 30  ARG A HH21 3  
ATOM 4838  H HH22 . ARG A 1 30  ? -16.562 4.917   -10.508 1.00 0.00 ? 30  ARG A HH22 3  
ATOM 4839  N N    . PHE A 1 31  ? -9.853  4.265   -5.576  1.00 0.00 ? 31  PHE A N    3  
ATOM 4840  C CA   . PHE A 1 31  ? -10.305 5.236   -4.589  1.00 0.00 ? 31  PHE A CA   3  
ATOM 4841  C C    . PHE A 1 31  ? -9.171  6.191   -4.206  1.00 0.00 ? 31  PHE A C    3  
ATOM 4842  O O    . PHE A 1 31  ? -9.323  7.409   -4.293  1.00 0.00 ? 31  PHE A O    3  
ATOM 4843  C CB   . PHE A 1 31  ? -10.849 4.517   -3.347  1.00 0.00 ? 31  PHE A CB   3  
ATOM 4844  C CG   . PHE A 1 31  ? -11.494 5.442   -2.346  1.00 0.00 ? 31  PHE A CG   3  
ATOM 4845  C CD1  . PHE A 1 31  ? -12.734 6.010   -2.608  1.00 0.00 ? 31  PHE A CD1  3  
ATOM 4846  C CD2  . PHE A 1 31  ? -10.864 5.748   -1.147  1.00 0.00 ? 31  PHE A CD2  3  
ATOM 4847  C CE1  . PHE A 1 31  ? -13.330 6.861   -1.700  1.00 0.00 ? 31  PHE A CE1  3  
ATOM 4848  C CE2  . PHE A 1 31  ? -11.457 6.600   -0.235  1.00 0.00 ? 31  PHE A CE2  3  
ATOM 4849  C CZ   . PHE A 1 31  ? -12.691 7.155   -0.513  1.00 0.00 ? 31  PHE A CZ   3  
ATOM 4850  H H    . PHE A 1 31  ? -9.862  3.312   -5.344  1.00 0.00 ? 31  PHE A H    3  
ATOM 4851  H HA   . PHE A 1 31  ? -11.103 5.810   -5.039  1.00 0.00 ? 31  PHE A HA   3  
ATOM 4852  H HB2  . PHE A 1 31  ? -11.591 3.793   -3.656  1.00 0.00 ? 31  PHE A HB2  3  
ATOM 4853  H HB3  . PHE A 1 31  ? -10.036 4.000   -2.854  1.00 0.00 ? 31  PHE A HB3  3  
ATOM 4854  H HD1  . PHE A 1 31  ? -13.236 5.780   -3.538  1.00 0.00 ? 31  PHE A HD1  3  
ATOM 4855  H HD2  . PHE A 1 31  ? -9.899  5.313   -0.929  1.00 0.00 ? 31  PHE A HD2  3  
ATOM 4856  H HE1  . PHE A 1 31  ? -14.294 7.294   -1.917  1.00 0.00 ? 31  PHE A HE1  3  
ATOM 4857  H HE2  . PHE A 1 31  ? -10.956 6.831   0.694   1.00 0.00 ? 31  PHE A HE2  3  
ATOM 4858  H HZ   . PHE A 1 31  ? -13.156 7.822   0.200   1.00 0.00 ? 31  PHE A HZ   3  
ATOM 4859  N N    . LEU A 1 32  ? -8.029  5.640   -3.799  1.00 0.00 ? 32  LEU A N    3  
ATOM 4860  C CA   . LEU A 1 32  ? -6.888  6.467   -3.400  1.00 0.00 ? 32  LEU A CA   3  
ATOM 4861  C C    . LEU A 1 32  ? -6.204  7.103   -4.618  1.00 0.00 ? 32  LEU A C    3  
ATOM 4862  O O    . LEU A 1 32  ? -5.431  8.056   -4.482  1.00 0.00 ? 32  LEU A O    3  
ATOM 4863  C CB   . LEU A 1 32  ? -5.890  5.665   -2.534  1.00 0.00 ? 32  LEU A CB   3  
ATOM 4864  C CG   . LEU A 1 32  ? -5.451  4.287   -3.069  1.00 0.00 ? 32  LEU A CG   3  
ATOM 4865  C CD1  . LEU A 1 32  ? -4.520  4.421   -4.269  1.00 0.00 ? 32  LEU A CD1  3  
ATOM 4866  C CD2  . LEU A 1 32  ? -4.782  3.474   -1.963  1.00 0.00 ? 32  LEU A CD2  3  
ATOM 4867  H H    . LEU A 1 32  ? -7.955  4.661   -3.758  1.00 0.00 ? 32  LEU A H    3  
ATOM 4868  H HA   . LEU A 1 32  ? -7.285  7.271   -2.794  1.00 0.00 ? 32  LEU A HA   3  
ATOM 4869  H HB2  . LEU A 1 32  ? -5.003  6.269   -2.400  1.00 0.00 ? 32  LEU A HB2  3  
ATOM 4870  H HB3  . LEU A 1 32  ? -6.343  5.518   -1.563  1.00 0.00 ? 32  LEU A HB3  3  
ATOM 4871  H HG   . LEU A 1 32  ? -6.326  3.743   -3.394  1.00 0.00 ? 32  LEU A HG   3  
ATOM 4872  H HD11 . LEU A 1 32  ? -4.235  3.438   -4.618  1.00 0.00 ? 32  LEU A HD11 3  
ATOM 4873  H HD12 . LEU A 1 32  ? -3.639  4.969   -3.980  1.00 0.00 ? 32  LEU A HD12 3  
ATOM 4874  H HD13 . LEU A 1 32  ? -5.028  4.949   -5.062  1.00 0.00 ? 32  LEU A HD13 3  
ATOM 4875  H HD21 . LEU A 1 32  ? -3.905  3.996   -1.608  1.00 0.00 ? 32  LEU A HD21 3  
ATOM 4876  H HD22 . LEU A 1 32  ? -4.492  2.508   -2.350  1.00 0.00 ? 32  LEU A HD22 3  
ATOM 4877  H HD23 . LEU A 1 32  ? -5.476  3.338   -1.146  1.00 0.00 ? 32  LEU A HD23 3  
ATOM 4878  N N    . LYS A 1 33  ? -6.500  6.575   -5.808  1.00 0.00 ? 33  LYS A N    3  
ATOM 4879  C CA   . LYS A 1 33  ? -5.989  7.143   -7.056  1.00 0.00 ? 33  LYS A CA   3  
ATOM 4880  C C    . LYS A 1 33  ? -6.571  8.542   -7.274  1.00 0.00 ? 33  LYS A C    3  
ATOM 4881  O O    . LYS A 1 33  ? -5.838  9.503   -7.519  1.00 0.00 ? 33  LYS A O    3  
ATOM 4882  C CB   . LYS A 1 33  ? -6.343  6.238   -8.261  1.00 0.00 ? 33  LYS A CB   3  
ATOM 4883  C CG   . LYS A 1 33  ? -5.139  5.684   -9.031  1.00 0.00 ? 33  LYS A CG   3  
ATOM 4884  C CD   . LYS A 1 33  ? -4.409  4.584   -8.259  1.00 0.00 ? 33  LYS A CD   3  
ATOM 4885  C CE   . LYS A 1 33  ? -3.283  3.963   -9.082  1.00 0.00 ? 33  LYS A CE   3  
ATOM 4886  N NZ   . LYS A 1 33  ? -2.624  2.831   -8.374  1.00 0.00 ? 33  LYS A NZ   3  
ATOM 4887  H H    . LYS A 1 33  ? -7.065  5.775   -5.846  1.00 0.00 ? 33  LYS A H    3  
ATOM 4888  H HA   . LYS A 1 33  ? -4.912  7.219   -6.973  1.00 0.00 ? 33  LYS A HA   3  
ATOM 4889  H HB2  . LYS A 1 33  ? -6.923  5.399   -7.903  1.00 0.00 ? 33  LYS A HB2  3  
ATOM 4890  H HB3  . LYS A 1 33  ? -6.952  6.801   -8.956  1.00 0.00 ? 33  LYS A HB3  3  
ATOM 4891  H HG2  . LYS A 1 33  ? -5.486  5.276   -9.971  1.00 0.00 ? 33  LYS A HG2  3  
ATOM 4892  H HG3  . LYS A 1 33  ? -4.448  6.494   -9.226  1.00 0.00 ? 33  LYS A HG3  3  
ATOM 4893  H HD2  . LYS A 1 33  ? -3.990  5.005   -7.357  1.00 0.00 ? 33  LYS A HD2  3  
ATOM 4894  H HD3  . LYS A 1 33  ? -5.119  3.811   -7.997  1.00 0.00 ? 33  LYS A HD3  3  
ATOM 4895  H HE2  . LYS A 1 33  ? -3.692  3.598   -10.013 1.00 0.00 ? 33  LYS A HE2  3  
ATOM 4896  H HE3  . LYS A 1 33  ? -2.544  4.722   -9.291  1.00 0.00 ? 33  LYS A HE3  3  
ATOM 4897  H HZ1  . LYS A 1 33  ? -1.941  2.366   -9.008  1.00 0.00 ? 33  LYS A HZ1  3  
ATOM 4898  H HZ2  . LYS A 1 33  ? -3.330  2.130   -8.075  1.00 0.00 ? 33  LYS A HZ2  3  
ATOM 4899  H HZ3  . LYS A 1 33  ? -2.112  3.178   -7.535  1.00 0.00 ? 33  LYS A HZ3  3  
ATOM 4900  N N    . THR A 1 34  ? -7.896  8.651   -7.159  1.00 0.00 ? 34  THR A N    3  
ATOM 4901  C CA   . THR A 1 34  ? -8.601  9.897   -7.461  1.00 0.00 ? 34  THR A CA   3  
ATOM 4902  C C    . THR A 1 34  ? -8.285  10.995  -6.438  1.00 0.00 ? 34  THR A C    3  
ATOM 4903  O O    . THR A 1 34  ? -8.505  12.180  -6.702  1.00 0.00 ? 34  THR A O    3  
ATOM 4904  C CB   . THR A 1 34  ? -10.136 9.678   -7.546  1.00 0.00 ? 34  THR A CB   3  
ATOM 4905  O OG1  . THR A 1 34  ? -10.786 10.876  -7.993  1.00 0.00 ? 34  THR A OG1  3  
ATOM 4906  C CG2  . THR A 1 34  ? -10.720 9.259   -6.202  1.00 0.00 ? 34  THR A CG2  3  
ATOM 4907  H H    . THR A 1 34  ? -8.415  7.868   -6.867  1.00 0.00 ? 34  THR A H    3  
ATOM 4908  H HA   . THR A 1 34  ? -8.261  10.232  -8.432  1.00 0.00 ? 34  THR A HA   3  
ATOM 4909  H HB   . THR A 1 34  ? -10.330 8.892   -8.264  1.00 0.00 ? 34  THR A HB   3  
ATOM 4910  H HG1  . THR A 1 34  ? -10.862 10.858  -8.955  1.00 0.00 ? 34  THR A HG1  3  
ATOM 4911  H HG21 . THR A 1 34  ? -10.521 10.024  -5.465  1.00 0.00 ? 34  THR A HG21 3  
ATOM 4912  H HG22 . THR A 1 34  ? -10.269 8.330   -5.886  1.00 0.00 ? 34  THR A HG22 3  
ATOM 4913  H HG23 . THR A 1 34  ? -11.787 9.125   -6.299  1.00 0.00 ? 34  THR A HG23 3  
ATOM 4914  N N    . GLU A 1 35  ? -7.762  10.611  -5.272  1.00 0.00 ? 35  GLU A N    3  
ATOM 4915  C CA   . GLU A 1 35  ? -7.367  11.592  -4.260  1.00 0.00 ? 35  GLU A CA   3  
ATOM 4916  C C    . GLU A 1 35  ? -5.865  11.872  -4.338  1.00 0.00 ? 35  GLU A C    3  
ATOM 4917  O O    . GLU A 1 35  ? -5.304  12.547  -3.472  1.00 0.00 ? 35  GLU A O    3  
ATOM 4918  C CB   . GLU A 1 35  ? -7.768  11.130  -2.850  1.00 0.00 ? 35  GLU A CB   3  
ATOM 4919  C CG   . GLU A 1 35  ? -7.087  9.850   -2.383  1.00 0.00 ? 35  GLU A CG   3  
ATOM 4920  C CD   . GLU A 1 35  ? -7.485  9.459   -0.966  1.00 0.00 ? 35  GLU A CD   3  
ATOM 4921  O OE1  . GLU A 1 35  ? -6.849  9.951   -0.011  1.00 0.00 ? 35  GLU A OE1  3  
ATOM 4922  O OE2  . GLU A 1 35  ? -8.445  8.675   -0.803  1.00 0.00 ? 35  GLU A OE2  3  
ATOM 4923  H H    . GLU A 1 35  ? -7.642  9.655   -5.088  1.00 0.00 ? 35  GLU A H    3  
ATOM 4924  H HA   . GLU A 1 35  ? -7.890  12.515  -4.480  1.00 0.00 ? 35  GLU A HA   3  
ATOM 4925  H HB2  . GLU A 1 35  ? -7.527  11.915  -2.147  1.00 0.00 ? 35  GLU A HB2  3  
ATOM 4926  H HB3  . GLU A 1 35  ? -8.839  10.968  -2.833  1.00 0.00 ? 35  GLU A HB3  3  
ATOM 4927  H HG2  . GLU A 1 35  ? -7.360  9.049   -3.055  1.00 0.00 ? 35  GLU A HG2  3  
ATOM 4928  H HG3  . GLU A 1 35  ? -6.015  9.993   -2.417  1.00 0.00 ? 35  GLU A HG3  3  
ATOM 4929  N N    . PHE A 1 36  ? -5.226  11.345  -5.388  1.00 0.00 ? 36  PHE A N    3  
ATOM 4930  C CA   . PHE A 1 36  ? -3.817  11.624  -5.682  1.00 0.00 ? 36  PHE A CA   3  
ATOM 4931  C C    . PHE A 1 36  ? -2.908  11.234  -4.517  1.00 0.00 ? 36  PHE A C    3  
ATOM 4932  O O    . PHE A 1 36  ? -1.936  11.925  -4.210  1.00 0.00 ? 36  PHE A O    3  
ATOM 4933  C CB   . PHE A 1 36  ? -3.635  13.106  -6.045  1.00 0.00 ? 36  PHE A CB   3  
ATOM 4934  C CG   . PHE A 1 36  ? -4.367  13.509  -7.304  1.00 0.00 ? 36  PHE A CG   3  
ATOM 4935  C CD1  . PHE A 1 36  ? -5.706  13.873  -7.262  1.00 0.00 ? 36  PHE A CD1  3  
ATOM 4936  C CD2  . PHE A 1 36  ? -3.717  13.514  -8.531  1.00 0.00 ? 36  PHE A CD2  3  
ATOM 4937  C CE1  . PHE A 1 36  ? -6.378  14.236  -8.415  1.00 0.00 ? 36  PHE A CE1  3  
ATOM 4938  C CE2  . PHE A 1 36  ? -4.386  13.876  -9.684  1.00 0.00 ? 36  PHE A CE2  3  
ATOM 4939  C CZ   . PHE A 1 36  ? -5.715  14.237  -9.626  1.00 0.00 ? 36  PHE A CZ   3  
ATOM 4940  H H    . PHE A 1 36  ? -5.721  10.748  -5.990  1.00 0.00 ? 36  PHE A H    3  
ATOM 4941  H HA   . PHE A 1 36  ? -3.542  11.024  -6.538  1.00 0.00 ? 36  PHE A HA   3  
ATOM 4942  H HB2  . PHE A 1 36  ? -4.002  13.718  -5.234  1.00 0.00 ? 36  PHE A HB2  3  
ATOM 4943  H HB3  . PHE A 1 36  ? -2.582  13.307  -6.191  1.00 0.00 ? 36  PHE A HB3  3  
ATOM 4944  H HD1  . PHE A 1 36  ? -6.227  13.872  -6.316  1.00 0.00 ? 36  PHE A HD1  3  
ATOM 4945  H HD2  . PHE A 1 36  ? -2.674  13.231  -8.579  1.00 0.00 ? 36  PHE A HD2  3  
ATOM 4946  H HE1  . PHE A 1 36  ? -7.421  14.518  -8.366  1.00 0.00 ? 36  PHE A HE1  3  
ATOM 4947  H HE2  . PHE A 1 36  ? -3.868  13.876  -10.633 1.00 0.00 ? 36  PHE A HE2  3  
ATOM 4948  H HZ   . PHE A 1 36  ? -6.238  14.521  -10.528 1.00 0.00 ? 36  PHE A HZ   3  
ATOM 4949  N N    . SER A 1 37  ? -3.221  10.106  -3.891  1.00 0.00 ? 37  SER A N    3  
ATOM 4950  C CA   . SER A 1 37  ? -2.415  9.569   -2.799  1.00 0.00 ? 37  SER A CA   3  
ATOM 4951  C C    . SER A 1 37  ? -2.005  8.131   -3.132  1.00 0.00 ? 37  SER A C    3  
ATOM 4952  O O    . SER A 1 37  ? -1.853  7.285   -2.249  1.00 0.00 ? 37  SER A O    3  
ATOM 4953  C CB   . SER A 1 37  ? -3.219  9.623   -1.493  1.00 0.00 ? 37  SER A CB   3  
ATOM 4954  O OG   . SER A 1 37  ? -3.668  10.947  -1.234  1.00 0.00 ? 37  SER A OG   3  
ATOM 4955  H H    . SER A 1 37  ? -4.020  9.612   -4.177  1.00 0.00 ? 37  SER A H    3  
ATOM 4956  H HA   . SER A 1 37  ? -1.523  10.174  -2.698  1.00 0.00 ? 37  SER A HA   3  
ATOM 4957  H HB2  . SER A 1 37  ? -4.078  8.973   -1.569  1.00 0.00 ? 37  SER A HB2  3  
ATOM 4958  H HB3  . SER A 1 37  ? -2.595  9.301   -0.672  1.00 0.00 ? 37  SER A HB3  3  
ATOM 4959  H HG   . SER A 1 37  ? -4.140  11.281  -2.008  1.00 0.00 ? 37  SER A HG   3  
ATOM 4960  N N    . GLU A 1 38  ? -1.774  7.893   -4.422  1.00 0.00 ? 38  GLU A N    3  
ATOM 4961  C CA   . GLU A 1 38  ? -1.582  6.541   -4.947  1.00 0.00 ? 38  GLU A CA   3  
ATOM 4962  C C    . GLU A 1 38  ? -0.146  6.039   -4.785  1.00 0.00 ? 38  GLU A C    3  
ATOM 4963  O O    . GLU A 1 38  ? 0.070   4.841   -4.601  1.00 0.00 ? 38  GLU A O    3  
ATOM 4964  C CB   . GLU A 1 38  ? -2.035  6.457   -6.423  1.00 0.00 ? 38  GLU A CB   3  
ATOM 4965  C CG   . GLU A 1 38  ? -1.914  7.757   -7.217  1.00 0.00 ? 38  GLU A CG   3  
ATOM 4966  C CD   . GLU A 1 38  ? -0.497  8.307   -7.278  1.00 0.00 ? 38  GLU A CD   3  
ATOM 4967  O OE1  . GLU A 1 38  ? 0.288   7.855   -8.133  1.00 0.00 ? 38  GLU A OE1  3  
ATOM 4968  O OE2  . GLU A 1 38  ? -0.171  9.207   -6.482  1.00 0.00 ? 38  GLU A OE2  3  
ATOM 4969  H H    . GLU A 1 38  ? -1.703  8.655   -5.034  1.00 0.00 ? 38  GLU A H    3  
ATOM 4970  H HA   . GLU A 1 38  ? -2.218  5.891   -4.367  1.00 0.00 ? 38  GLU A HA   3  
ATOM 4971  H HB2  . GLU A 1 38  ? -1.444  5.703   -6.927  1.00 0.00 ? 38  GLU A HB2  3  
ATOM 4972  H HB3  . GLU A 1 38  ? -3.072  6.148   -6.445  1.00 0.00 ? 38  GLU A HB3  3  
ATOM 4973  H HG2  . GLU A 1 38  ? -2.255  7.578   -8.227  1.00 0.00 ? 38  GLU A HG2  3  
ATOM 4974  H HG3  . GLU A 1 38  ? -2.553  8.501   -6.758  1.00 0.00 ? 38  GLU A HG3  3  
ATOM 4975  N N    . GLU A 1 39  ? 0.832   6.942   -4.819  1.00 0.00 ? 39  GLU A N    3  
ATOM 4976  C CA   . GLU A 1 39  ? 2.238   6.531   -4.735  1.00 0.00 ? 39  GLU A CA   3  
ATOM 4977  C C    . GLU A 1 39  ? 2.500   5.741   -3.451  1.00 0.00 ? 39  GLU A C    3  
ATOM 4978  O O    . GLU A 1 39  ? 3.451   4.965   -3.374  1.00 0.00 ? 39  GLU A O    3  
ATOM 4979  C CB   . GLU A 1 39  ? 3.195   7.734   -4.820  1.00 0.00 ? 39  GLU A CB   3  
ATOM 4980  C CG   . GLU A 1 39  ? 3.078   8.737   -3.674  1.00 0.00 ? 39  GLU A CG   3  
ATOM 4981  C CD   . GLU A 1 39  ? 1.841   9.611   -3.771  1.00 0.00 ? 39  GLU A CD   3  
ATOM 4982  O OE1  . GLU A 1 39  ? 1.848   10.564  -4.579  1.00 0.00 ? 39  GLU A OE1  3  
ATOM 4983  O OE2  . GLU A 1 39  ? 0.862   9.345   -3.050  1.00 0.00 ? 39  GLU A OE2  3  
ATOM 4984  H H    . GLU A 1 39  ? 0.606   7.896   -4.898  1.00 0.00 ? 39  GLU A H    3  
ATOM 4985  H HA   . GLU A 1 39  ? 2.431   5.879   -5.577  1.00 0.00 ? 39  GLU A HA   3  
ATOM 4986  H HB2  . GLU A 1 39  ? 4.211   7.366   -4.838  1.00 0.00 ? 39  GLU A HB2  3  
ATOM 4987  H HB3  . GLU A 1 39  ? 3.004   8.259   -5.747  1.00 0.00 ? 39  GLU A HB3  3  
ATOM 4988  H HG2  . GLU A 1 39  ? 3.047   8.193   -2.741  1.00 0.00 ? 39  GLU A HG2  3  
ATOM 4989  H HG3  . GLU A 1 39  ? 3.952   9.373   -3.683  1.00 0.00 ? 39  GLU A HG3  3  
ATOM 4990  N N    . ASN A 1 40  ? 1.637   5.938   -2.458  1.00 0.00 ? 40  ASN A N    3  
ATOM 4991  C CA   . ASN A 1 40  ? 1.745   5.240   -1.179  1.00 0.00 ? 40  ASN A CA   3  
ATOM 4992  C C    . ASN A 1 40  ? 1.491   3.737   -1.338  1.00 0.00 ? 40  ASN A C    3  
ATOM 4993  O O    . ASN A 1 40  ? 2.289   2.907   -0.881  1.00 0.00 ? 40  ASN A O    3  
ATOM 4994  C CB   . ASN A 1 40  ? 0.764   5.837   -0.156  1.00 0.00 ? 40  ASN A CB   3  
ATOM 4995  C CG   . ASN A 1 40  ? 1.072   7.289   0.171   1.00 0.00 ? 40  ASN A CG   3  
ATOM 4996  O OD1  . ASN A 1 40  ? 1.918   7.582   1.016   1.00 0.00 ? 40  ASN A OD1  3  
ATOM 4997  N ND2  . ASN A 1 40  ? 0.380   8.207   -0.482  1.00 0.00 ? 40  ASN A ND2  3  
ATOM 4998  H H    . ASN A 1 40  ? 0.908   6.580   -2.588  1.00 0.00 ? 40  ASN A H    3  
ATOM 4999  H HA   . ASN A 1 40  ? 2.753   5.381   -0.813  1.00 0.00 ? 40  ASN A HA   3  
ATOM 5000  H HB2  . ASN A 1 40  ? -0.239  5.783   -0.555  1.00 0.00 ? 40  ASN A HB2  3  
ATOM 5001  H HB3  . ASN A 1 40  ? 0.811   5.264   0.759   1.00 0.00 ? 40  ASN A HB3  3  
ATOM 5002  H HD21 . ASN A 1 40  ? -0.288  7.908   -1.137  1.00 0.00 ? 40  ASN A HD21 3  
ATOM 5003  H HD22 . ASN A 1 40  ? 0.562   9.147   -0.288  1.00 0.00 ? 40  ASN A HD22 3  
ATOM 5004  N N    . ILE A 1 41  ? 0.387   3.380   -1.994  1.00 0.00 ? 41  ILE A N    3  
ATOM 5005  C CA   . ILE A 1 41  ? 0.043   1.971   -2.174  1.00 0.00 ? 41  ILE A CA   3  
ATOM 5006  C C    . ILE A 1 41  ? 1.026   1.307   -3.137  1.00 0.00 ? 41  ILE A C    3  
ATOM 5007  O O    . ILE A 1 41  ? 1.470   0.178   -2.903  1.00 0.00 ? 41  ILE A O    3  
ATOM 5008  C CB   . ILE A 1 41  ? -1.421  1.776   -2.664  1.00 0.00 ? 41  ILE A CB   3  
ATOM 5009  C CG1  . ILE A 1 41  ? -1.780  0.278   -2.728  1.00 0.00 ? 41  ILE A CG1  3  
ATOM 5010  C CG2  . ILE A 1 41  ? -1.647  2.443   -4.017  1.00 0.00 ? 41  ILE A CG2  3  
ATOM 5011  C CD1  . ILE A 1 41  ? -3.215  0.005   -3.144  1.00 0.00 ? 41  ILE A CD1  3  
ATOM 5012  H H    . ILE A 1 41  ? -0.198  4.073   -2.368  1.00 0.00 ? 41  ILE A H    3  
ATOM 5013  H HA   . ILE A 1 41  ? 0.137   1.492   -1.206  1.00 0.00 ? 41  ILE A HA   3  
ATOM 5014  H HB   . ILE A 1 41  ? -2.073  2.258   -1.949  1.00 0.00 ? 41  ILE A HB   3  
ATOM 5015  H HG12 . ILE A 1 41  ? -1.134  -0.214  -3.438  1.00 0.00 ? 41  ILE A HG12 3  
ATOM 5016  H HG13 . ILE A 1 41  ? -1.632  -0.162  -1.751  1.00 0.00 ? 41  ILE A HG13 3  
ATOM 5017  H HG21 . ILE A 1 41  ? -0.983  2.009   -4.752  1.00 0.00 ? 41  ILE A HG21 3  
ATOM 5018  H HG22 . ILE A 1 41  ? -1.447  3.501   -3.934  1.00 0.00 ? 41  ILE A HG22 3  
ATOM 5019  H HG23 . ILE A 1 41  ? -2.670  2.295   -4.327  1.00 0.00 ? 41  ILE A HG23 3  
ATOM 5020  H HD11 . ILE A 1 41  ? -3.890  0.493   -2.456  1.00 0.00 ? 41  ILE A HD11 3  
ATOM 5021  H HD12 . ILE A 1 41  ? -3.397  -1.059  -3.131  1.00 0.00 ? 41  ILE A HD12 3  
ATOM 5022  H HD13 . ILE A 1 41  ? -3.382  0.385   -4.143  1.00 0.00 ? 41  ILE A HD13 3  
ATOM 5023  N N    . GLU A 1 42  ? 1.388   2.028   -4.202  1.00 0.00 ? 42  GLU A N    3  
ATOM 5024  C CA   . GLU A 1 42  ? 2.400   1.554   -5.144  1.00 0.00 ? 42  GLU A CA   3  
ATOM 5025  C C    . GLU A 1 42  ? 3.745   1.373   -4.436  1.00 0.00 ? 42  GLU A C    3  
ATOM 5026  O O    . GLU A 1 42  ? 4.537   0.501   -4.798  1.00 0.00 ? 42  GLU A O    3  
ATOM 5027  C CB   . GLU A 1 42  ? 2.554   2.520   -6.337  1.00 0.00 ? 42  GLU A CB   3  
ATOM 5028  C CG   . GLU A 1 42  ? 1.612   2.235   -7.511  1.00 0.00 ? 42  GLU A CG   3  
ATOM 5029  C CD   . GLU A 1 42  ? 0.144   2.473   -7.193  1.00 0.00 ? 42  GLU A CD   3  
ATOM 5030  O OE1  . GLU A 1 42  ? -0.296  3.642   -7.240  1.00 0.00 ? 42  GLU A OE1  3  
ATOM 5031  O OE2  . GLU A 1 42  ? -0.587  1.492   -6.935  1.00 0.00 ? 42  GLU A OE2  3  
ATOM 5032  H H    . GLU A 1 42  ? 0.957   2.897   -4.361  1.00 0.00 ? 42  GLU A H    3  
ATOM 5033  H HA   . GLU A 1 42  ? 2.075   0.592   -5.514  1.00 0.00 ? 42  GLU A HA   3  
ATOM 5034  H HB2  . GLU A 1 42  ? 2.367   3.528   -5.995  1.00 0.00 ? 42  GLU A HB2  3  
ATOM 5035  H HB3  . GLU A 1 42  ? 3.570   2.464   -6.705  1.00 0.00 ? 42  GLU A HB3  3  
ATOM 5036  H HG2  . GLU A 1 42  ? 1.889   2.876   -8.337  1.00 0.00 ? 42  GLU A HG2  3  
ATOM 5037  H HG3  . GLU A 1 42  ? 1.739   1.203   -7.810  1.00 0.00 ? 42  GLU A HG3  3  
ATOM 5038  N N    . PHE A 1 43  ? 3.985   2.194   -3.418  1.00 0.00 ? 43  PHE A N    3  
ATOM 5039  C CA   . PHE A 1 43  ? 5.219   2.134   -2.644  1.00 0.00 ? 43  PHE A CA   3  
ATOM 5040  C C    . PHE A 1 43  ? 5.397   0.770   -1.985  1.00 0.00 ? 43  PHE A C    3  
ATOM 5041  O O    . PHE A 1 43  ? 6.306   0.014   -2.339  1.00 0.00 ? 43  PHE A O    3  
ATOM 5042  C CB   . PHE A 1 43  ? 5.229   3.241   -1.581  1.00 0.00 ? 43  PHE A CB   3  
ATOM 5043  C CG   . PHE A 1 43  ? 6.372   3.155   -0.596  1.00 0.00 ? 43  PHE A CG   3  
ATOM 5044  C CD1  . PHE A 1 43  ? 7.636   3.600   -0.941  1.00 0.00 ? 43  PHE A CD1  3  
ATOM 5045  C CD2  . PHE A 1 43  ? 6.173   2.641   0.678   1.00 0.00 ? 43  PHE A CD2  3  
ATOM 5046  C CE1  . PHE A 1 43  ? 8.679   3.536   -0.038  1.00 0.00 ? 43  PHE A CE1  3  
ATOM 5047  C CE2  . PHE A 1 43  ? 7.212   2.578   1.584   1.00 0.00 ? 43  PHE A CE2  3  
ATOM 5048  C CZ   . PHE A 1 43  ? 8.466   3.026   1.225   1.00 0.00 ? 43  PHE A CZ   3  
ATOM 5049  H H    . PHE A 1 43  ? 3.311   2.867   -3.184  1.00 0.00 ? 43  PHE A H    3  
ATOM 5050  H HA   . PHE A 1 43  ? 6.042   2.300   -3.325  1.00 0.00 ? 43  PHE A HA   3  
ATOM 5051  H HB2  . PHE A 1 43  ? 5.292   4.200   -2.075  1.00 0.00 ? 43  PHE A HB2  3  
ATOM 5052  H HB3  . PHE A 1 43  ? 4.305   3.197   -1.022  1.00 0.00 ? 43  PHE A HB3  3  
ATOM 5053  H HD1  . PHE A 1 43  ? 7.805   4.001   -1.930  1.00 0.00 ? 43  PHE A HD1  3  
ATOM 5054  H HD2  . PHE A 1 43  ? 5.192   2.290   0.961   1.00 0.00 ? 43  PHE A HD2  3  
ATOM 5055  H HE1  . PHE A 1 43  ? 9.660   3.888   -0.320  1.00 0.00 ? 43  PHE A HE1  3  
ATOM 5056  H HE2  . PHE A 1 43  ? 7.043   2.174   2.573   1.00 0.00 ? 43  PHE A HE2  3  
ATOM 5057  H HZ   . PHE A 1 43  ? 9.280   2.981   1.933   1.00 0.00 ? 43  PHE A HZ   3  
ATOM 5058  N N    . TRP A 1 44  ? 4.524   0.441   -1.032  1.00 0.00 ? 44  TRP A N    3  
ATOM 5059  C CA   . TRP A 1 44  ? 4.729   -0.764  -0.233  1.00 0.00 ? 44  TRP A CA   3  
ATOM 5060  C C    . TRP A 1 44  ? 4.388   -2.039  -1.000  1.00 0.00 ? 44  TRP A C    3  
ATOM 5061  O O    . TRP A 1 44  ? 4.830   -3.125  -0.617  1.00 0.00 ? 44  TRP A O    3  
ATOM 5062  C CB   . TRP A 1 44  ? 3.990   -0.701  1.114   1.00 0.00 ? 44  TRP A CB   3  
ATOM 5063  C CG   . TRP A 1 44  ? 2.513   -0.447  1.049   1.00 0.00 ? 44  TRP A CG   3  
ATOM 5064  C CD1  . TRP A 1 44  ? 1.885   0.734   1.305   1.00 0.00 ? 44  TRP A CD1  3  
ATOM 5065  C CD2  . TRP A 1 44  ? 1.477   -1.393  0.745   1.00 0.00 ? 44  TRP A CD2  3  
ATOM 5066  N NE1  . TRP A 1 44  ? 0.531   0.587   1.184   1.00 0.00 ? 44  TRP A NE1  3  
ATOM 5067  C CE2  . TRP A 1 44  ? 0.251   -0.707  0.832   1.00 0.00 ? 44  TRP A CE2  3  
ATOM 5068  C CE3  . TRP A 1 44  ? 1.465   -2.748  0.403   1.00 0.00 ? 44  TRP A CE3  3  
ATOM 5069  C CZ2  . TRP A 1 44  ? -0.970  -1.329  0.592   1.00 0.00 ? 44  TRP A CZ2  3  
ATOM 5070  C CZ3  . TRP A 1 44  ? 0.251   -3.365  0.165   1.00 0.00 ? 44  TRP A CZ3  3  
ATOM 5071  C CH2  . TRP A 1 44  ? -0.952  -2.654  0.260   1.00 0.00 ? 44  TRP A CH2  3  
ATOM 5072  H H    . TRP A 1 44  ? 3.738   1.014   -0.871  1.00 0.00 ? 44  TRP A H    3  
ATOM 5073  H HA   . TRP A 1 44  ? 5.790   -0.802  -0.018  1.00 0.00 ? 44  TRP A HA   3  
ATOM 5074  H HB2  . TRP A 1 44  ? 4.131   -1.638  1.622   1.00 0.00 ? 44  TRP A HB2  3  
ATOM 5075  H HB3  . TRP A 1 44  ? 4.434   0.084   1.712   1.00 0.00 ? 44  TRP A HB3  3  
ATOM 5076  H HD1  . TRP A 1 44  ? 2.396   1.646   1.573   1.00 0.00 ? 44  TRP A HD1  3  
ATOM 5077  H HE1  . TRP A 1 44  ? -0.128  1.296   1.322   1.00 0.00 ? 44  TRP A HE1  3  
ATOM 5078  H HE3  . TRP A 1 44  ? 2.383   -3.313  0.327   1.00 0.00 ? 44  TRP A HE3  3  
ATOM 5079  H HZ2  . TRP A 1 44  ? -1.907  -0.795  0.661   1.00 0.00 ? 44  TRP A HZ2  3  
ATOM 5080  H HZ3  . TRP A 1 44  ? 0.224   -4.412  -0.100  1.00 0.00 ? 44  TRP A HZ3  3  
ATOM 5081  H HH2  . TRP A 1 44  ? -1.877  -3.176  0.065   1.00 0.00 ? 44  TRP A HH2  3  
ATOM 5082  N N    . ILE A 1 45  ? 3.623   -1.931  -2.086  1.00 0.00 ? 45  ILE A N    3  
ATOM 5083  C CA   . ILE A 1 45  ? 3.380   -3.097  -2.932  1.00 0.00 ? 45  ILE A CA   3  
ATOM 5084  C C    . ILE A 1 45  ? 4.649   -3.411  -3.727  1.00 0.00 ? 45  ILE A C    3  
ATOM 5085  O O    . ILE A 1 45  ? 4.963   -4.573  -3.992  1.00 0.00 ? 45  ILE A O    3  
ATOM 5086  C CB   . ILE A 1 45  ? 2.170   -2.914  -3.893  1.00 0.00 ? 45  ILE A CB   3  
ATOM 5087  C CG1  . ILE A 1 45  ? 1.754   -4.269  -4.497  1.00 0.00 ? 45  ILE A CG1  3  
ATOM 5088  C CG2  . ILE A 1 45  ? 2.489   -1.915  -5.002  1.00 0.00 ? 45  ILE A CG2  3  
ATOM 5089  C CD1  . ILE A 1 45  ? 0.543   -4.195  -5.407  1.00 0.00 ? 45  ILE A CD1  3  
ATOM 5090  H H    . ILE A 1 45  ? 3.217   -1.065  -2.315  1.00 0.00 ? 45  ILE A H    3  
ATOM 5091  H HA   . ILE A 1 45  ? 3.169   -3.935  -2.278  1.00 0.00 ? 45  ILE A HA   3  
ATOM 5092  H HB   . ILE A 1 45  ? 1.344   -2.519  -3.318  1.00 0.00 ? 45  ILE A HB   3  
ATOM 5093  H HG12 . ILE A 1 45  ? 2.575   -4.666  -5.077  1.00 0.00 ? 45  ILE A HG12 3  
ATOM 5094  H HG13 . ILE A 1 45  ? 1.524   -4.956  -3.695  1.00 0.00 ? 45  ILE A HG13 3  
ATOM 5095  H HG21 . ILE A 1 45  ? 1.616   -1.770  -5.622  1.00 0.00 ? 45  ILE A HG21 3  
ATOM 5096  H HG22 . ILE A 1 45  ? 3.300   -2.294  -5.607  1.00 0.00 ? 45  ILE A HG22 3  
ATOM 5097  H HG23 . ILE A 1 45  ? 2.780   -0.970  -4.565  1.00 0.00 ? 45  ILE A HG23 3  
ATOM 5098  H HD11 . ILE A 1 45  ? 0.761   -3.551  -6.246  1.00 0.00 ? 45  ILE A HD11 3  
ATOM 5099  H HD12 . ILE A 1 45  ? -0.298  -3.798  -4.857  1.00 0.00 ? 45  ILE A HD12 3  
ATOM 5100  H HD13 . ILE A 1 45  ? 0.302   -5.185  -5.765  1.00 0.00 ? 45  ILE A HD13 3  
ATOM 5101  N N    . ALA A 1 46  ? 5.398   -2.358  -4.073  1.00 0.00 ? 46  ALA A N    3  
ATOM 5102  C CA   . ALA A 1 46  ? 6.695   -2.511  -4.726  1.00 0.00 ? 46  ALA A CA   3  
ATOM 5103  C C    . ALA A 1 46  ? 7.705   -3.096  -3.744  1.00 0.00 ? 46  ALA A C    3  
ATOM 5104  O O    . ALA A 1 46  ? 8.663   -3.764  -4.142  1.00 0.00 ? 46  ALA A O    3  
ATOM 5105  C CB   . ALA A 1 46  ? 7.184   -1.173  -5.271  1.00 0.00 ? 46  ALA A CB   3  
ATOM 5106  H H    . ALA A 1 46  ? 5.064   -1.453  -3.887  1.00 0.00 ? 46  ALA A H    3  
ATOM 5107  H HA   . ALA A 1 46  ? 6.575   -3.194  -5.557  1.00 0.00 ? 46  ALA A HA   3  
ATOM 5108  H HB1  . ALA A 1 46  ? 6.458   -0.780  -5.968  1.00 0.00 ? 46  ALA A HB1  3  
ATOM 5109  H HB2  . ALA A 1 46  ? 8.128   -1.311  -5.778  1.00 0.00 ? 46  ALA A HB2  3  
ATOM 5110  H HB3  . ALA A 1 46  ? 7.313   -0.476  -4.455  1.00 0.00 ? 46  ALA A HB3  3  
ATOM 5111  N N    . CYS A 1 47  ? 7.480   -2.832  -2.459  1.00 0.00 ? 47  CYS A N    3  
ATOM 5112  C CA   . CYS A 1 47  ? 8.293   -3.404  -1.388  1.00 0.00 ? 47  CYS A CA   3  
ATOM 5113  C C    . CYS A 1 47  ? 8.044   -4.908  -1.283  1.00 0.00 ? 47  CYS A C    3  
ATOM 5114  O O    . CYS A 1 47  ? 8.979   -5.698  -1.134  1.00 0.00 ? 47  CYS A O    3  
ATOM 5115  C CB   . CYS A 1 47  ? 7.974   -2.715  -0.055  1.00 0.00 ? 47  CYS A CB   3  
ATOM 5116  S SG   . CYS A 1 47  ? 8.861   -3.388  1.367   1.00 0.00 ? 47  CYS A SG   3  
ATOM 5117  H H    . CYS A 1 47  ? 6.747   -2.224  -2.224  1.00 0.00 ? 47  CYS A H    3  
ATOM 5118  H HA   . CYS A 1 47  ? 9.333   -3.236  -1.633  1.00 0.00 ? 47  CYS A HA   3  
ATOM 5119  H HB2  . CYS A 1 47  ? 8.230   -1.668  -0.130  1.00 0.00 ? 47  CYS A HB2  3  
ATOM 5120  H HB3  . CYS A 1 47  ? 6.916   -2.807  0.147   1.00 0.00 ? 47  CYS A HB3  3  
ATOM 5121  H HG   . CYS A 1 47  ? 8.602   -2.615  2.415   1.00 0.00 ? 47  CYS A HG   3  
ATOM 5122  N N    . GLU A 1 48  ? 6.776   -5.299  -1.373  1.00 0.00 ? 48  GLU A N    3  
ATOM 5123  C CA   . GLU A 1 48  ? 6.408   -6.710  -1.368  1.00 0.00 ? 48  GLU A CA   3  
ATOM 5124  C C    . GLU A 1 48  ? 6.970   -7.387  -2.625  1.00 0.00 ? 48  GLU A C    3  
ATOM 5125  O O    . GLU A 1 48  ? 7.426   -8.531  -2.581  1.00 0.00 ? 48  GLU A O    3  
ATOM 5126  C CB   . GLU A 1 48  ? 4.881   -6.858  -1.292  1.00 0.00 ? 48  GLU A CB   3  
ATOM 5127  C CG   . GLU A 1 48  ? 4.393   -8.288  -1.059  1.00 0.00 ? 48  GLU A CG   3  
ATOM 5128  C CD   . GLU A 1 48  ? 4.761   -8.825  0.317   1.00 0.00 ? 48  GLU A CD   3  
ATOM 5129  O OE1  . GLU A 1 48  ? 4.406   -8.180  1.329   1.00 0.00 ? 48  GLU A OE1  3  
ATOM 5130  O OE2  . GLU A 1 48  ? 5.377   -9.911  0.399   1.00 0.00 ? 48  GLU A OE2  3  
ATOM 5131  H H    . GLU A 1 48  ? 6.070   -4.621  -1.438  1.00 0.00 ? 48  GLU A H    3  
ATOM 5132  H HA   . GLU A 1 48  ? 6.854   -7.167  -0.495  1.00 0.00 ? 48  GLU A HA   3  
ATOM 5133  H HB2  . GLU A 1 48  ? 4.515   -6.245  -0.480  1.00 0.00 ? 48  GLU A HB2  3  
ATOM 5134  H HB3  . GLU A 1 48  ? 4.452   -6.501  -2.211  1.00 0.00 ? 48  GLU A HB3  3  
ATOM 5135  H HG2  . GLU A 1 48  ? 3.317   -8.307  -1.158  1.00 0.00 ? 48  GLU A HG2  3  
ATOM 5136  H HG3  . GLU A 1 48  ? 4.832   -8.929  -1.812  1.00 0.00 ? 48  GLU A HG3  3  
ATOM 5137  N N    . ASP A 1 49  ? 6.957   -6.653  -3.740  1.00 0.00 ? 49  ASP A N    3  
ATOM 5138  C CA   . ASP A 1 49  ? 7.577   -7.118  -4.983  1.00 0.00 ? 49  ASP A CA   3  
ATOM 5139  C C    . ASP A 1 49  ? 9.090   -7.248  -4.807  1.00 0.00 ? 49  ASP A C    3  
ATOM 5140  O O    . ASP A 1 49  ? 9.716   -8.175  -5.327  1.00 0.00 ? 49  ASP A O    3  
ATOM 5141  C CB   . ASP A 1 49  ? 7.270   -6.159  -6.142  1.00 0.00 ? 49  ASP A CB   3  
ATOM 5142  C CG   . ASP A 1 49  ? 8.043   -6.512  -7.409  1.00 0.00 ? 49  ASP A CG   3  
ATOM 5143  O OD1  . ASP A 1 49  ? 7.542   -7.322  -8.216  1.00 0.00 ? 49  ASP A OD1  3  
ATOM 5144  O OD2  . ASP A 1 49  ? 9.168   -5.992  -7.592  1.00 0.00 ? 49  ASP A OD2  3  
ATOM 5145  H H    . ASP A 1 49  ? 6.507   -5.781  -3.729  1.00 0.00 ? 49  ASP A H    3  
ATOM 5146  H HA   . ASP A 1 49  ? 7.168   -8.092  -5.213  1.00 0.00 ? 49  ASP A HA   3  
ATOM 5147  H HB2  . ASP A 1 49  ? 6.211   -6.197  -6.363  1.00 0.00 ? 49  ASP A HB2  3  
ATOM 5148  H HB3  . ASP A 1 49  ? 7.531   -5.151  -5.849  1.00 0.00 ? 49  ASP A HB3  3  
ATOM 5149  N N    . PHE A 1 50  ? 9.668   -6.311  -4.073  1.00 0.00 ? 50  PHE A N    3  
ATOM 5150  C CA   . PHE A 1 50  ? 11.094  -6.328  -3.767  1.00 0.00 ? 50  PHE A CA   3  
ATOM 5151  C C    . PHE A 1 50  ? 11.483  -7.639  -3.092  1.00 0.00 ? 50  PHE A C    3  
ATOM 5152  O O    . PHE A 1 50  ? 12.531  -8.217  -3.387  1.00 0.00 ? 50  PHE A O    3  
ATOM 5153  C CB   . PHE A 1 50  ? 11.450  -5.124  -2.874  1.00 0.00 ? 50  PHE A CB   3  
ATOM 5154  C CG   . PHE A 1 50  ? 12.685  -5.318  -2.028  1.00 0.00 ? 50  PHE A CG   3  
ATOM 5155  C CD1  . PHE A 1 50  ? 13.951  -5.235  -2.587  1.00 0.00 ? 50  PHE A CD1  3  
ATOM 5156  C CD2  . PHE A 1 50  ? 12.572  -5.595  -0.671  1.00 0.00 ? 50  PHE A CD2  3  
ATOM 5157  C CE1  . PHE A 1 50  ? 15.076  -5.423  -1.809  1.00 0.00 ? 50  PHE A CE1  3  
ATOM 5158  C CE2  . PHE A 1 50  ? 13.695  -5.784  0.108   1.00 0.00 ? 50  PHE A CE2  3  
ATOM 5159  C CZ   . PHE A 1 50  ? 14.948  -5.699  -0.462  1.00 0.00 ? 50  PHE A CZ   3  
ATOM 5160  H H    . PHE A 1 50  ? 9.117   -5.580  -3.721  1.00 0.00 ? 50  PHE A H    3  
ATOM 5161  H HA   . PHE A 1 50  ? 11.633  -6.243  -4.700  1.00 0.00 ? 50  PHE A HA   3  
ATOM 5162  H HB2  . PHE A 1 50  ? 11.614  -4.260  -3.501  1.00 0.00 ? 50  PHE A HB2  3  
ATOM 5163  H HB3  . PHE A 1 50  ? 10.619  -4.922  -2.211  1.00 0.00 ? 50  PHE A HB3  3  
ATOM 5164  H HD1  . PHE A 1 50  ? 14.055  -5.019  -3.640  1.00 0.00 ? 50  PHE A HD1  3  
ATOM 5165  H HD2  . PHE A 1 50  ? 11.591  -5.662  -0.224  1.00 0.00 ? 50  PHE A HD2  3  
ATOM 5166  H HE1  . PHE A 1 50  ? 16.059  -5.357  -2.256  1.00 0.00 ? 50  PHE A HE1  3  
ATOM 5167  H HE2  . PHE A 1 50  ? 13.592  -5.998  1.162   1.00 0.00 ? 50  PHE A HE2  3  
ATOM 5168  H HZ   . PHE A 1 50  ? 15.830  -5.848  0.146   1.00 0.00 ? 50  PHE A HZ   3  
ATOM 5169  N N    . LYS A 1 51  ? 10.623  -8.116  -2.203  1.00 0.00 ? 51  LYS A N    3  
ATOM 5170  C CA   . LYS A 1 51  ? 10.937  -9.284  -1.391  1.00 0.00 ? 51  LYS A CA   3  
ATOM 5171  C C    . LYS A 1 51  ? 10.348  -10.578 -1.959  1.00 0.00 ? 51  LYS A C    3  
ATOM 5172  O O    . LYS A 1 51  ? 10.594  -11.653 -1.407  1.00 0.00 ? 51  LYS A O    3  
ATOM 5173  C CB   . LYS A 1 51  ? 10.442  -9.084  0.039   1.00 0.00 ? 51  LYS A CB   3  
ATOM 5174  C CG   . LYS A 1 51  ? 8.942   -8.834  0.146   1.00 0.00 ? 51  LYS A CG   3  
ATOM 5175  C CD   . LYS A 1 51  ? 8.411   -9.127  1.543   1.00 0.00 ? 51  LYS A CD   3  
ATOM 5176  C CE   . LYS A 1 51  ? 8.239   -10.625 1.790   1.00 0.00 ? 51  LYS A CE   3  
ATOM 5177  N NZ   . LYS A 1 51  ? 9.502   -11.392 1.619   1.00 0.00 ? 51  LYS A NZ   3  
ATOM 5178  H H    . LYS A 1 51  ? 9.756   -7.666  -2.085  1.00 0.00 ? 51  LYS A H    3  
ATOM 5179  H HA   . LYS A 1 51  ? 12.013  -9.386  -1.366  1.00 0.00 ? 51  LYS A HA   3  
ATOM 5180  H HB2  . LYS A 1 51  ? 10.683  -9.965  0.616   1.00 0.00 ? 51  LYS A HB2  3  
ATOM 5181  H HB3  . LYS A 1 51  ? 10.958  -8.236  0.469   1.00 0.00 ? 51  LYS A HB3  3  
ATOM 5182  H HG2  . LYS A 1 51  ? 8.745   -7.797  -0.091  1.00 0.00 ? 51  LYS A HG2  3  
ATOM 5183  H HG3  . LYS A 1 51  ? 8.430   -9.466  -0.565  1.00 0.00 ? 51  LYS A HG3  3  
ATOM 5184  H HD2  . LYS A 1 51  ? 9.103   -8.732  2.272   1.00 0.00 ? 51  LYS A HD2  3  
ATOM 5185  H HD3  . LYS A 1 51  ? 7.451   -8.641  1.661   1.00 0.00 ? 51  LYS A HD3  3  
ATOM 5186  H HE2  . LYS A 1 51  ? 7.882   -10.769 2.798   1.00 0.00 ? 51  LYS A HE2  3  
ATOM 5187  H HE3  . LYS A 1 51  ? 7.502   -11.006 1.097   1.00 0.00 ? 51  LYS A HE3  3  
ATOM 5188  H HZ1  . LYS A 1 51  ? 10.254  -10.985 2.209   1.00 0.00 ? 51  LYS A HZ1  3  
ATOM 5189  H HZ2  . LYS A 1 51  ? 9.803   -11.373 0.625   1.00 0.00 ? 51  LYS A HZ2  3  
ATOM 5190  H HZ3  . LYS A 1 51  ? 9.354   -12.383 1.901   1.00 0.00 ? 51  LYS A HZ3  3  
ATOM 5191  N N    . LYS A 1 52  ? 9.551   -10.489 -3.028  1.00 0.00 ? 52  LYS A N    3  
ATOM 5192  C CA   . LYS A 1 52  ? 9.043   -11.703 -3.676  1.00 0.00 ? 52  LYS A CA   3  
ATOM 5193  C C    . LYS A 1 52  ? 10.172  -12.354 -4.467  1.00 0.00 ? 52  LYS A C    3  
ATOM 5194  O O    . LYS A 1 52  ? 10.198  -13.569 -4.660  1.00 0.00 ? 52  LYS A O    3  
ATOM 5195  C CB   . LYS A 1 52  ? 7.839   -11.423 -4.597  1.00 0.00 ? 52  LYS A CB   3  
ATOM 5196  C CG   . LYS A 1 52  ? 8.194   -10.696 -5.893  1.00 0.00 ? 52  LYS A CG   3  
ATOM 5197  C CD   . LYS A 1 52  ? 7.052   -10.734 -6.905  1.00 0.00 ? 52  LYS A CD   3  
ATOM 5198  C CE   . LYS A 1 52  ? 5.789   -10.057 -6.386  1.00 0.00 ? 52  LYS A CE   3  
ATOM 5199  N NZ   . LYS A 1 52  ? 4.692   -10.098 -7.389  1.00 0.00 ? 52  LYS A NZ   3  
ATOM 5200  H H    . LYS A 1 52  ? 9.299   -9.607  -3.377  1.00 0.00 ? 52  LYS A H    3  
ATOM 5201  H HA   . LYS A 1 52  ? 8.734   -12.385 -2.894  1.00 0.00 ? 52  LYS A HA   3  
ATOM 5202  H HB2  . LYS A 1 52  ? 7.375   -12.367 -4.856  1.00 0.00 ? 52  LYS A HB2  3  
ATOM 5203  H HB3  . LYS A 1 52  ? 7.123   -10.816 -4.055  1.00 0.00 ? 52  LYS A HB3  3  
ATOM 5204  H HG2  . LYS A 1 52  ? 8.421   -9.667  -5.665  1.00 0.00 ? 52  LYS A HG2  3  
ATOM 5205  H HG3  . LYS A 1 52  ? 9.063   -11.167 -6.330  1.00 0.00 ? 52  LYS A HG3  3  
ATOM 5206  H HD2  . LYS A 1 52  ? 7.369   -10.230 -7.805  1.00 0.00 ? 52  LYS A HD2  3  
ATOM 5207  H HD3  . LYS A 1 52  ? 6.826   -11.768 -7.135  1.00 0.00 ? 52  LYS A HD3  3  
ATOM 5208  H HE2  . LYS A 1 52  ? 5.461   -10.564 -5.489  1.00 0.00 ? 52  LYS A HE2  3  
ATOM 5209  H HE3  . LYS A 1 52  ? 6.015   -9.027  -6.153  1.00 0.00 ? 52  LYS A HE3  3  
ATOM 5210  H HZ1  . LYS A 1 52  ? 4.456   -11.083 -7.623  1.00 0.00 ? 52  LYS A HZ1  3  
ATOM 5211  H HZ2  . LYS A 1 52  ? 4.985   -9.608  -8.261  1.00 0.00 ? 52  LYS A HZ2  3  
ATOM 5212  H HZ3  . LYS A 1 52  ? 3.842   -9.629  -7.014  1.00 0.00 ? 52  LYS A HZ3  3  
ATOM 5213  N N    . SER A 1 53  ? 11.106  -11.521 -4.918  1.00 0.00 ? 53  SER A N    3  
ATOM 5214  C CA   . SER A 1 53  ? 12.305  -11.990 -5.594  1.00 0.00 ? 53  SER A CA   3  
ATOM 5215  C C    . SER A 1 53  ? 13.272  -12.605 -4.578  1.00 0.00 ? 53  SER A C    3  
ATOM 5216  O O    . SER A 1 53  ? 13.277  -12.219 -3.406  1.00 0.00 ? 53  SER A O    3  
ATOM 5217  C CB   . SER A 1 53  ? 12.954  -10.822 -6.356  1.00 0.00 ? 53  SER A CB   3  
ATOM 5218  O OG   . SER A 1 53  ? 12.729  -9.584  -5.689  1.00 0.00 ? 53  SER A OG   3  
ATOM 5219  H H    . SER A 1 53  ? 10.984  -10.557 -4.788  1.00 0.00 ? 53  SER A H    3  
ATOM 5220  H HA   . SER A 1 53  ? 12.011  -12.754 -6.301  1.00 0.00 ? 53  SER A HA   3  
ATOM 5221  H HB2  . SER A 1 53  ? 14.019  -10.987 -6.432  1.00 0.00 ? 53  SER A HB2  3  
ATOM 5222  H HB3  . SER A 1 53  ? 12.530  -10.762 -7.347  1.00 0.00 ? 53  SER A HB3  3  
ATOM 5223  H HG   . SER A 1 53  ? 13.155  -9.600  -4.822  1.00 0.00 ? 53  SER A HG   3  
ATOM 5224  N N    . LYS A 1 54  ? 14.071  -13.572 -5.018  1.00 0.00 ? 54  LYS A N    3  
ATOM 5225  C CA   . LYS A 1 54  ? 15.006  -14.265 -4.128  1.00 0.00 ? 54  LYS A CA   3  
ATOM 5226  C C    . LYS A 1 54  ? 16.424  -14.279 -4.699  1.00 0.00 ? 54  LYS A C    3  
ATOM 5227  O O    . LYS A 1 54  ? 17.320  -14.911 -4.133  1.00 0.00 ? 54  LYS A O    3  
ATOM 5228  C CB   . LYS A 1 54  ? 14.505  -15.695 -3.836  1.00 0.00 ? 54  LYS A CB   3  
ATOM 5229  C CG   . LYS A 1 54  ? 14.015  -16.478 -5.061  1.00 0.00 ? 54  LYS A CG   3  
ATOM 5230  C CD   . LYS A 1 54  ? 15.128  -16.776 -6.065  1.00 0.00 ? 54  LYS A CD   3  
ATOM 5231  C CE   . LYS A 1 54  ? 14.668  -17.744 -7.148  1.00 0.00 ? 54  LYS A CE   3  
ATOM 5232  N NZ   . LYS A 1 54  ? 14.310  -19.073 -6.583  1.00 0.00 ? 54  LYS A NZ   3  
ATOM 5233  H H    . LYS A 1 54  ? 14.033  -13.830 -5.964  1.00 0.00 ? 54  LYS A H    3  
ATOM 5234  H HA   . LYS A 1 54  ? 15.031  -13.717 -3.194  1.00 0.00 ? 54  LYS A HA   3  
ATOM 5235  H HB2  . LYS A 1 54  ? 15.307  -16.258 -3.379  1.00 0.00 ? 54  LYS A HB2  3  
ATOM 5236  H HB3  . LYS A 1 54  ? 13.687  -15.634 -3.130  1.00 0.00 ? 54  LYS A HB3  3  
ATOM 5237  H HG2  . LYS A 1 54  ? 13.593  -17.414 -4.726  1.00 0.00 ? 54  LYS A HG2  3  
ATOM 5238  H HG3  . LYS A 1 54  ? 13.245  -15.899 -5.554  1.00 0.00 ? 54  LYS A HG3  3  
ATOM 5239  H HD2  . LYS A 1 54  ? 15.437  -15.851 -6.532  1.00 0.00 ? 54  LYS A HD2  3  
ATOM 5240  H HD3  . LYS A 1 54  ? 15.967  -17.212 -5.540  1.00 0.00 ? 54  LYS A HD3  3  
ATOM 5241  H HE2  . LYS A 1 54  ? 13.803  -17.330 -7.646  1.00 0.00 ? 54  LYS A HE2  3  
ATOM 5242  H HE3  . LYS A 1 54  ? 15.467  -17.872 -7.864  1.00 0.00 ? 54  LYS A HE3  3  
ATOM 5243  H HZ1  . LYS A 1 54  ? 13.545  -18.975 -5.888  1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 5244  H HZ2  . LYS A 1 54  ? 15.136  -19.497 -6.112  1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 5245  H HZ3  . LYS A 1 54  ? 13.996  -19.713 -7.339  1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 5246  N N    . GLY A 1 55  ? 16.614  -13.600 -5.827  1.00 0.00 ? 55  GLY A N    3  
ATOM 5247  C CA   . GLY A 1 55  ? 17.939  -13.469 -6.405  1.00 0.00 ? 55  GLY A CA   3  
ATOM 5248  C C    . GLY A 1 55  ? 18.781  -12.471 -5.627  1.00 0.00 ? 55  GLY A C    3  
ATOM 5249  O O    . GLY A 1 55  ? 18.395  -11.308 -5.519  1.00 0.00 ? 55  GLY A O    3  
ATOM 5250  H H    . GLY A 1 55  ? 15.847  -13.181 -6.270  1.00 0.00 ? 55  GLY A H    3  
ATOM 5251  H HA2  . GLY A 1 55  ? 18.428  -14.433 -6.399  1.00 0.00 ? 55  GLY A HA2  3  
ATOM 5252  H HA3  . GLY A 1 55  ? 17.846  -13.128 -7.426  1.00 0.00 ? 55  GLY A HA3  3  
ATOM 5253  N N    . PRO A 1 56  ? 19.934  -12.894 -5.070  1.00 0.00 ? 56  PRO A N    3  
ATOM 5254  C CA   . PRO A 1 56  ? 20.772  -12.035 -4.218  1.00 0.00 ? 56  PRO A CA   3  
ATOM 5255  C C    . PRO A 1 56  ? 21.044  -10.663 -4.844  1.00 0.00 ? 56  PRO A C    3  
ATOM 5256  O O    . PRO A 1 56  ? 20.632  -9.634  -4.306  1.00 0.00 ? 56  PRO A O    3  
ATOM 5257  C CB   . PRO A 1 56  ? 22.070  -12.840 -4.071  1.00 0.00 ? 56  PRO A CB   3  
ATOM 5258  C CG   . PRO A 1 56  ? 21.646  -14.261 -4.229  1.00 0.00 ? 56  PRO A CG   3  
ATOM 5259  C CD   . PRO A 1 56  ? 20.515  -14.245 -5.228  1.00 0.00 ? 56  PRO A CD   3  
ATOM 5260  H HA   . PRO A 1 56  ? 20.322  -11.895 -3.244  1.00 0.00 ? 56  PRO A HA   3  
ATOM 5261  H HB2  . PRO A 1 56  ? 22.774  -12.548 -4.840  1.00 0.00 ? 56  PRO A HB2  3  
ATOM 5262  H HB3  . PRO A 1 56  ? 22.501  -12.663 -3.096  1.00 0.00 ? 56  PRO A HB3  3  
ATOM 5263  H HG2  . PRO A 1 56  ? 22.469  -14.853 -4.602  1.00 0.00 ? 56  PRO A HG2  3  
ATOM 5264  H HG3  . PRO A 1 56  ? 21.303  -14.652 -3.280  1.00 0.00 ? 56  PRO A HG3  3  
ATOM 5265  H HD2  . PRO A 1 56  ? 20.895  -14.387 -6.231  1.00 0.00 ? 56  PRO A HD2  3  
ATOM 5266  H HD3  . PRO A 1 56  ? 19.788  -15.006 -4.988  1.00 0.00 ? 56  PRO A HD3  3  
ATOM 5267  N N    . GLN A 1 57  ? 21.715  -10.657 -5.995  1.00 0.00 ? 57  GLN A N    3  
ATOM 5268  C CA   . GLN A 1 57  ? 22.053  -9.411  -6.686  1.00 0.00 ? 57  GLN A CA   3  
ATOM 5269  C C    . GLN A 1 57  ? 20.784  -8.646  -7.063  1.00 0.00 ? 57  GLN A C    3  
ATOM 5270  O O    . GLN A 1 57  ? 20.754  -7.412  -7.030  1.00 0.00 ? 57  GLN A O    3  
ATOM 5271  C CB   . GLN A 1 57  ? 22.906  -9.682  -7.941  1.00 0.00 ? 57  GLN A CB   3  
ATOM 5272  C CG   . GLN A 1 57  ? 22.179  -10.411 -9.074  1.00 0.00 ? 57  GLN A CG   3  
ATOM 5273  C CD   . GLN A 1 57  ? 21.757  -11.824 -8.702  1.00 0.00 ? 57  GLN A CD   3  
ATOM 5274  O OE1  . GLN A 1 57  ? 20.655  -12.044 -8.203  1.00 0.00 ? 57  GLN A OE1  3  
ATOM 5275  N NE2  . GLN A 1 57  ? 22.634  -12.786 -8.930  1.00 0.00 ? 57  GLN A NE2  3  
ATOM 5276  H H    . GLN A 1 57  ? 21.987  -11.510 -6.389  1.00 0.00 ? 57  GLN A H    3  
ATOM 5277  H HA   . GLN A 1 57  ? 22.626  -8.804  -5.998  1.00 0.00 ? 57  GLN A HA   3  
ATOM 5278  H HB2  . GLN A 1 57  ? 23.260  -8.736  -8.327  1.00 0.00 ? 57  GLN A HB2  3  
ATOM 5279  H HB3  . GLN A 1 57  ? 23.761  -10.277 -7.653  1.00 0.00 ? 57  GLN A HB3  3  
ATOM 5280  H HG2  . GLN A 1 57  ? 21.295  -9.847  -9.338  1.00 0.00 ? 57  GLN A HG2  3  
ATOM 5281  H HG3  . GLN A 1 57  ? 22.837  -10.460 -9.931  1.00 0.00 ? 57  GLN A HG3  3  
ATOM 5282  H HE21 . GLN A 1 57  ? 23.501  -12.542 -9.320  1.00 0.00 ? 57  GLN A HE21 3  
ATOM 5283  H HE22 . GLN A 1 57  ? 22.383  -13.706 -8.697  1.00 0.00 ? 57  GLN A HE22 3  
ATOM 5284  N N    . GLN A 1 58  ? 19.735  -9.396  -7.395  1.00 0.00 ? 58  GLN A N    3  
ATOM 5285  C CA   . GLN A 1 58  ? 18.454  -8.815  -7.779  1.00 0.00 ? 58  GLN A CA   3  
ATOM 5286  C C    . GLN A 1 58  ? 17.895  -7.979  -6.629  1.00 0.00 ? 58  GLN A C    3  
ATOM 5287  O O    . GLN A 1 58  ? 17.378  -6.880  -6.835  1.00 0.00 ? 58  GLN A O    3  
ATOM 5288  C CB   . GLN A 1 58  ? 17.462  -9.927  -8.161  1.00 0.00 ? 58  GLN A CB   3  
ATOM 5289  C CG   . GLN A 1 58  ? 16.163  -9.419  -8.779  1.00 0.00 ? 58  GLN A CG   3  
ATOM 5290  C CD   . GLN A 1 58  ? 16.381  -8.732  -10.117 1.00 0.00 ? 58  GLN A CD   3  
ATOM 5291  O OE1  . GLN A 1 58  ? 17.301  -9.071  -10.862 1.00 0.00 ? 58  GLN A OE1  3  
ATOM 5292  N NE2  . GLN A 1 58  ? 15.533  -7.770  -10.440 1.00 0.00 ? 58  GLN A NE2  3  
ATOM 5293  H H    . GLN A 1 58  ? 19.826  -10.373 -7.376  1.00 0.00 ? 58  GLN A H    3  
ATOM 5294  H HA   . GLN A 1 58  ? 18.620  -8.175  -8.634  1.00 0.00 ? 58  GLN A HA   3  
ATOM 5295  H HB2  . GLN A 1 58  ? 17.938  -10.587 -8.872  1.00 0.00 ? 58  GLN A HB2  3  
ATOM 5296  H HB3  . GLN A 1 58  ? 17.215  -10.494 -7.274  1.00 0.00 ? 58  GLN A HB3  3  
ATOM 5297  H HG2  . GLN A 1 58  ? 15.498  -10.258 -8.927  1.00 0.00 ? 58  GLN A HG2  3  
ATOM 5298  H HG3  . GLN A 1 58  ? 15.705  -8.715  -8.098  1.00 0.00 ? 58  GLN A HG3  3  
ATOM 5299  H HE21 . GLN A 1 58  ? 14.816  -7.553  -9.813  1.00 0.00 ? 58  GLN A HE21 3  
ATOM 5300  H HE22 . GLN A 1 58  ? 15.659  -7.312  -11.299 1.00 0.00 ? 58  GLN A HE22 3  
ATOM 5301  N N    . ILE A 1 59  ? 18.030  -8.504  -5.414  1.00 0.00 ? 59  ILE A N    3  
ATOM 5302  C CA   . ILE A 1 59  ? 17.566  -7.821  -4.212  1.00 0.00 ? 59  ILE A CA   3  
ATOM 5303  C C    . ILE A 1 59  ? 18.251  -6.460  -4.065  1.00 0.00 ? 59  ILE A C    3  
ATOM 5304  O O    . ILE A 1 59  ? 17.610  -5.462  -3.733  1.00 0.00 ? 59  ILE A O    3  
ATOM 5305  C CB   . ILE A 1 59  ? 17.827  -8.685  -2.945  1.00 0.00 ? 59  ILE A CB   3  
ATOM 5306  C CG1  . ILE A 1 59  ? 17.028  -10.000 -3.012  1.00 0.00 ? 59  ILE A CG1  3  
ATOM 5307  C CG2  . ILE A 1 59  ? 17.486  -7.918  -1.668  1.00 0.00 ? 59  ILE A CG2  3  
ATOM 5308  C CD1  . ILE A 1 59  ? 15.526  -9.808  -3.093  1.00 0.00 ? 59  ILE A CD1  3  
ATOM 5309  H H    . ILE A 1 59  ? 18.459  -9.383  -5.324  1.00 0.00 ? 59  ILE A H    3  
ATOM 5310  H HA   . ILE A 1 59  ? 16.498  -7.667  -4.306  1.00 0.00 ? 59  ILE A HA   3  
ATOM 5311  H HB   . ILE A 1 59  ? 18.882  -8.921  -2.916  1.00 0.00 ? 59  ILE A HB   3  
ATOM 5312  H HG12 . ILE A 1 59  ? 17.334  -10.556 -3.886  1.00 0.00 ? 59  ILE A HG12 3  
ATOM 5313  H HG13 . ILE A 1 59  ? 17.240  -10.588 -2.129  1.00 0.00 ? 59  ILE A HG13 3  
ATOM 5314  H HG21 . ILE A 1 59  ? 17.687  -8.540  -0.807  1.00 0.00 ? 59  ILE A HG21 3  
ATOM 5315  H HG22 . ILE A 1 59  ? 16.440  -7.646  -1.676  1.00 0.00 ? 59  ILE A HG22 3  
ATOM 5316  H HG23 . ILE A 1 59  ? 18.089  -7.022  -1.611  1.00 0.00 ? 59  ILE A HG23 3  
ATOM 5317  H HD11 . ILE A 1 59  ? 15.043  -10.773 -3.142  1.00 0.00 ? 59  ILE A HD11 3  
ATOM 5318  H HD12 . ILE A 1 59  ? 15.281  -9.238  -3.977  1.00 0.00 ? 59  ILE A HD12 3  
ATOM 5319  H HD13 . ILE A 1 59  ? 15.181  -9.278  -2.216  1.00 0.00 ? 59  ILE A HD13 3  
ATOM 5320  N N    . HIS A 1 60  ? 19.551  -6.423  -4.349  1.00 0.00 ? 60  HIS A N    3  
ATOM 5321  C CA   . HIS A 1 60  ? 20.338  -5.198  -4.192  1.00 0.00 ? 60  HIS A CA   3  
ATOM 5322  C C    . HIS A 1 60  ? 19.872  -4.107  -5.156  1.00 0.00 ? 60  HIS A C    3  
ATOM 5323  O O    . HIS A 1 60  ? 19.607  -2.975  -4.742  1.00 0.00 ? 60  HIS A O    3  
ATOM 5324  C CB   . HIS A 1 60  ? 21.836  -5.475  -4.400  1.00 0.00 ? 60  HIS A CB   3  
ATOM 5325  C CG   . HIS A 1 60  ? 22.452  -6.303  -3.313  1.00 0.00 ? 60  HIS A CG   3  
ATOM 5326  N ND1  . HIS A 1 60  ? 23.143  -5.763  -2.251  1.00 0.00 ? 60  HIS A ND1  3  
ATOM 5327  C CD2  . HIS A 1 60  ? 22.470  -7.640  -3.122  1.00 0.00 ? 60  HIS A CD2  3  
ATOM 5328  C CE1  . HIS A 1 60  ? 23.555  -6.731  -1.458  1.00 0.00 ? 60  HIS A CE1  3  
ATOM 5329  N NE2  . HIS A 1 60  ? 23.157  -7.882  -1.961  1.00 0.00 ? 60  HIS A NE2  3  
ATOM 5330  H H    . HIS A 1 60  ? 19.988  -7.238  -4.678  1.00 0.00 ? 60  HIS A H    3  
ATOM 5331  H HA   . HIS A 1 60  ? 20.190  -4.845  -3.181  1.00 0.00 ? 60  HIS A HA   3  
ATOM 5332  H HB2  . HIS A 1 60  ? 21.973  -6.000  -5.335  1.00 0.00 ? 60  HIS A HB2  3  
ATOM 5333  H HB3  . HIS A 1 60  ? 22.368  -4.534  -4.443  1.00 0.00 ? 60  HIS A HB3  3  
ATOM 5334  H HD1  . HIS A 1 60  ? 23.321  -4.804  -2.108  1.00 0.00 ? 60  HIS A HD1  3  
ATOM 5335  H HD2  . HIS A 1 60  ? 22.031  -8.383  -3.771  1.00 0.00 ? 60  HIS A HD2  3  
ATOM 5336  H HE1  . HIS A 1 60  ? 24.116  -6.601  -0.545  1.00 0.00 ? 60  HIS A HE1  3  
ATOM 5337  H HE2  . HIS A 1 60  ? 23.119  -8.724  -1.458  1.00 0.00 ? 60  HIS A HE2  3  
ATOM 5338  N N    . LEU A 1 61  ? 19.758  -4.453  -6.437  1.00 0.00 ? 61  LEU A N    3  
ATOM 5339  C CA   . LEU A 1 61  ? 19.419  -3.470  -7.466  1.00 0.00 ? 61  LEU A CA   3  
ATOM 5340  C C    . LEU A 1 61  ? 17.964  -3.010  -7.344  1.00 0.00 ? 61  LEU A C    3  
ATOM 5341  O O    . LEU A 1 61  ? 17.642  -1.861  -7.656  1.00 0.00 ? 61  LEU A O    3  
ATOM 5342  C CB   . LEU A 1 61  ? 19.739  -4.019  -8.875  1.00 0.00 ? 61  LEU A CB   3  
ATOM 5343  C CG   . LEU A 1 61  ? 19.078  -5.359  -9.268  1.00 0.00 ? 61  LEU A CG   3  
ATOM 5344  C CD1  . LEU A 1 61  ? 17.652  -5.148  -9.770  1.00 0.00 ? 61  LEU A CD1  3  
ATOM 5345  C CD2  . LEU A 1 61  ? 19.917  -6.087  -10.321 1.00 0.00 ? 61  LEU A CD2  3  
ATOM 5346  H H    . LEU A 1 61  ? 19.906  -5.389  -6.697  1.00 0.00 ? 61  LEU A H    3  
ATOM 5347  H HA   . LEU A 1 61  ? 20.049  -2.606  -7.293  1.00 0.00 ? 61  LEU A HA   3  
ATOM 5348  H HB2  . LEU A 1 61  ? 19.440  -3.274  -9.600  1.00 0.00 ? 61  LEU A HB2  3  
ATOM 5349  H HB3  . LEU A 1 61  ? 20.811  -4.142  -8.943  1.00 0.00 ? 61  LEU A HB3  3  
ATOM 5350  H HG   . LEU A 1 61  ? 19.026  -5.992  -8.392  1.00 0.00 ? 61  LEU A HG   3  
ATOM 5351  H HD11 . LEU A 1 61  ? 17.221  -6.099  -10.047 1.00 0.00 ? 61  LEU A HD11 3  
ATOM 5352  H HD12 . LEU A 1 61  ? 17.664  -4.495  -10.631 1.00 0.00 ? 61  LEU A HD12 3  
ATOM 5353  H HD13 . LEU A 1 61  ? 17.056  -4.700  -8.988  1.00 0.00 ? 61  LEU A HD13 3  
ATOM 5354  H HD21 . LEU A 1 61  ? 19.447  -7.026  -10.571 1.00 0.00 ? 61  LEU A HD21 3  
ATOM 5355  H HD22 . LEU A 1 61  ? 20.906  -6.274  -9.929  1.00 0.00 ? 61  LEU A HD22 3  
ATOM 5356  H HD23 . LEU A 1 61  ? 19.993  -5.474  -11.209 1.00 0.00 ? 61  LEU A HD23 3  
ATOM 5357  N N    . LYS A 1 62  ? 17.087  -3.894  -6.869  1.00 0.00 ? 62  LYS A N    3  
ATOM 5358  C CA   . LYS A 1 62  ? 15.688  -3.530  -6.650  1.00 0.00 ? 62  LYS A CA   3  
ATOM 5359  C C    . LYS A 1 62  ? 15.565  -2.602  -5.446  1.00 0.00 ? 62  LYS A C    3  
ATOM 5360  O O    . LYS A 1 62  ? 14.820  -1.619  -5.480  1.00 0.00 ? 62  LYS A O    3  
ATOM 5361  C CB   . LYS A 1 62  ? 14.810  -4.779  -6.454  1.00 0.00 ? 62  LYS A CB   3  
ATOM 5362  C CG   . LYS A 1 62  ? 14.729  -5.669  -7.691  1.00 0.00 ? 62  LYS A CG   3  
ATOM 5363  C CD   . LYS A 1 62  ? 13.803  -6.868  -7.488  1.00 0.00 ? 62  LYS A CD   3  
ATOM 5364  C CE   . LYS A 1 62  ? 12.350  -6.447  -7.298  1.00 0.00 ? 62  LYS A CE   3  
ATOM 5365  N NZ   . LYS A 1 62  ? 11.439  -7.620  -7.213  1.00 0.00 ? 62  LYS A NZ   3  
ATOM 5366  H H    . LYS A 1 62  ? 17.386  -4.808  -6.666  1.00 0.00 ? 62  LYS A H    3  
ATOM 5367  H HA   . LYS A 1 62  ? 15.346  -3.000  -7.530  1.00 0.00 ? 62  LYS A HA   3  
ATOM 5368  H HB2  . LYS A 1 62  ? 15.215  -5.363  -5.640  1.00 0.00 ? 62  LYS A HB2  3  
ATOM 5369  H HB3  . LYS A 1 62  ? 13.809  -4.465  -6.195  1.00 0.00 ? 62  LYS A HB3  3  
ATOM 5370  H HG2  . LYS A 1 62  ? 14.358  -5.082  -8.520  1.00 0.00 ? 62  LYS A HG2  3  
ATOM 5371  H HG3  . LYS A 1 62  ? 15.720  -6.030  -7.926  1.00 0.00 ? 62  LYS A HG3  3  
ATOM 5372  H HD2  . LYS A 1 62  ? 13.867  -7.508  -8.354  1.00 0.00 ? 62  LYS A HD2  3  
ATOM 5373  H HD3  . LYS A 1 62  ? 14.127  -7.415  -6.613  1.00 0.00 ? 62  LYS A HD3  3  
ATOM 5374  H HE2  . LYS A 1 62  ? 12.268  -5.875  -6.385  1.00 0.00 ? 62  LYS A HE2  3  
ATOM 5375  H HE3  . LYS A 1 62  ? 12.052  -5.832  -8.135  1.00 0.00 ? 62  LYS A HE3  3  
ATOM 5376  H HZ1  . LYS A 1 62  ? 10.456  -7.300  -7.082  1.00 0.00 ? 62  LYS A HZ1  3  
ATOM 5377  H HZ2  . LYS A 1 62  ? 11.705  -8.227  -6.411  1.00 0.00 ? 62  LYS A HZ2  3  
ATOM 5378  H HZ3  . LYS A 1 62  ? 11.494  -8.178  -8.088  1.00 0.00 ? 62  LYS A HZ3  3  
ATOM 5379  N N    . ALA A 1 63  ? 16.313  -2.914  -4.389  1.00 0.00 ? 63  ALA A N    3  
ATOM 5380  C CA   . ALA A 1 63  ? 16.322  -2.095  -3.178  1.00 0.00 ? 63  ALA A CA   3  
ATOM 5381  C C    . ALA A 1 63  ? 16.805  -0.685  -3.486  1.00 0.00 ? 63  ALA A C    3  
ATOM 5382  O O    . ALA A 1 63  ? 16.215  0.300   -3.038  1.00 0.00 ? 63  ALA A O    3  
ATOM 5383  C CB   . ALA A 1 63  ? 17.208  -2.731  -2.112  1.00 0.00 ? 63  ALA A CB   3  
ATOM 5384  H H    . ALA A 1 63  ? 16.873  -3.719  -4.421  1.00 0.00 ? 63  ALA A H    3  
ATOM 5385  H HA   . ALA A 1 63  ? 15.311  -2.050  -2.796  1.00 0.00 ? 63  ALA A HA   3  
ATOM 5386  H HB1  . ALA A 1 63  ? 16.855  -3.729  -1.895  1.00 0.00 ? 63  ALA A HB1  3  
ATOM 5387  H HB2  . ALA A 1 63  ? 17.173  -2.136  -1.210  1.00 0.00 ? 63  ALA A HB2  3  
ATOM 5388  H HB3  . ALA A 1 63  ? 18.226  -2.780  -2.471  1.00 0.00 ? 63  ALA A HB3  3  
ATOM 5389  N N    . LYS A 1 64  ? 17.879  -0.601  -4.268  1.00 0.00 ? 64  LYS A N    3  
ATOM 5390  C CA   . LYS A 1 64  ? 18.484  0.679   -4.611  1.00 0.00 ? 64  LYS A CA   3  
ATOM 5391  C C    . LYS A 1 64  ? 17.528  1.516   -5.462  1.00 0.00 ? 64  LYS A C    3  
ATOM 5392  O O    . LYS A 1 64  ? 17.396  2.724   -5.258  1.00 0.00 ? 64  LYS A O    3  
ATOM 5393  C CB   . LYS A 1 64  ? 19.813  0.454   -5.346  1.00 0.00 ? 64  LYS A CB   3  
ATOM 5394  C CG   . LYS A 1 64  ? 20.631  1.727   -5.536  1.00 0.00 ? 64  LYS A CG   3  
ATOM 5395  C CD   . LYS A 1 64  ? 22.017  1.434   -6.106  1.00 0.00 ? 64  LYS A CD   3  
ATOM 5396  C CE   . LYS A 1 64  ? 22.880  2.687   -6.146  1.00 0.00 ? 64  LYS A CE   3  
ATOM 5397  N NZ   . LYS A 1 64  ? 24.270  2.397   -6.589  1.00 0.00 ? 64  LYS A NZ   3  
ATOM 5398  H H    . LYS A 1 64  ? 18.276  -1.427  -4.619  1.00 0.00 ? 64  LYS A H    3  
ATOM 5399  H HA   . LYS A 1 64  ? 18.679  1.207   -3.687  1.00 0.00 ? 64  LYS A HA   3  
ATOM 5400  H HB2  . LYS A 1 64  ? 20.407  -0.248  -4.778  1.00 0.00 ? 64  LYS A HB2  3  
ATOM 5401  H HB3  . LYS A 1 64  ? 19.607  0.033   -6.320  1.00 0.00 ? 64  LYS A HB3  3  
ATOM 5402  H HG2  . LYS A 1 64  ? 20.103  2.383   -6.215  1.00 0.00 ? 64  LYS A HG2  3  
ATOM 5403  H HG3  . LYS A 1 64  ? 20.742  2.217   -4.578  1.00 0.00 ? 64  LYS A HG3  3  
ATOM 5404  H HD2  . LYS A 1 64  ? 22.503  0.695   -5.487  1.00 0.00 ? 64  LYS A HD2  3  
ATOM 5405  H HD3  . LYS A 1 64  ? 21.910  1.049   -7.112  1.00 0.00 ? 64  LYS A HD3  3  
ATOM 5406  H HE2  . LYS A 1 64  ? 22.436  3.397   -6.829  1.00 0.00 ? 64  LYS A HE2  3  
ATOM 5407  H HE3  . LYS A 1 64  ? 22.911  3.116   -5.154  1.00 0.00 ? 64  LYS A HE3  3  
ATOM 5408  H HZ1  . LYS A 1 64  ? 24.836  3.267   -6.580  1.00 0.00 ? 64  LYS A HZ1  3  
ATOM 5409  H HZ2  . LYS A 1 64  ? 24.268  2.013   -7.553  1.00 0.00 ? 64  LYS A HZ2  3  
ATOM 5410  H HZ3  . LYS A 1 64  ? 24.715  1.703   -5.951  1.00 0.00 ? 64  LYS A HZ3  3  
ATOM 5411  N N    . ALA A 1 65  ? 16.851  0.860   -6.404  1.00 0.00 ? 65  ALA A N    3  
ATOM 5412  C CA   . ALA A 1 65  ? 15.869  1.526   -7.260  1.00 0.00 ? 65  ALA A CA   3  
ATOM 5413  C C    . ALA A 1 65  ? 14.759  2.152   -6.417  1.00 0.00 ? 65  ALA A C    3  
ATOM 5414  O O    . ALA A 1 65  ? 14.432  3.337   -6.569  1.00 0.00 ? 65  ALA A O    3  
ATOM 5415  C CB   . ALA A 1 65  ? 15.285  0.538   -8.268  1.00 0.00 ? 65  ALA A CB   3  
ATOM 5416  H H    . ALA A 1 65  ? 17.019  -0.099  -6.530  1.00 0.00 ? 65  ALA A H    3  
ATOM 5417  H HA   . ALA A 1 65  ? 16.380  2.307   -7.808  1.00 0.00 ? 65  ALA A HA   3  
ATOM 5418  H HB1  . ALA A 1 65  ? 14.599  1.053   -8.925  1.00 0.00 ? 65  ALA A HB1  3  
ATOM 5419  H HB2  . ALA A 1 65  ? 14.758  -0.246  -7.742  1.00 0.00 ? 65  ALA A HB2  3  
ATOM 5420  H HB3  . ALA A 1 65  ? 16.083  0.104   -8.852  1.00 0.00 ? 65  ALA A HB3  3  
ATOM 5421  N N    . ILE A 1 66  ? 14.192  1.347   -5.518  1.00 0.00 ? 66  ILE A N    3  
ATOM 5422  C CA   . ILE A 1 66  ? 13.133  1.808   -4.624  1.00 0.00 ? 66  ILE A CA   3  
ATOM 5423  C C    . ILE A 1 66  ? 13.653  2.918   -3.714  1.00 0.00 ? 66  ILE A C    3  
ATOM 5424  O O    . ILE A 1 66  ? 12.946  3.886   -3.432  1.00 0.00 ? 66  ILE A O    3  
ATOM 5425  C CB   . ILE A 1 66  ? 12.572  0.647   -3.759  1.00 0.00 ? 66  ILE A CB   3  
ATOM 5426  C CG1  . ILE A 1 66  ? 11.958  -0.441  -4.660  1.00 0.00 ? 66  ILE A CG1  3  
ATOM 5427  C CG2  . ILE A 1 66  ? 11.536  1.160   -2.754  1.00 0.00 ? 66  ILE A CG2  3  
ATOM 5428  C CD1  . ILE A 1 66  ? 11.413  -1.630  -3.900  1.00 0.00 ? 66  ILE A CD1  3  
ATOM 5429  H H    . ILE A 1 66  ? 14.498  0.416   -5.454  1.00 0.00 ? 66  ILE A H    3  
ATOM 5430  H HA   . ILE A 1 66  ? 12.330  2.202   -5.233  1.00 0.00 ? 66  ILE A HA   3  
ATOM 5431  H HB   . ILE A 1 66  ? 13.393  0.217   -3.202  1.00 0.00 ? 66  ILE A HB   3  
ATOM 5432  H HG12 . ILE A 1 66  ? 11.144  -0.014  -5.229  1.00 0.00 ? 66  ILE A HG12 3  
ATOM 5433  H HG13 . ILE A 1 66  ? 12.714  -0.803  -5.343  1.00 0.00 ? 66  ILE A HG13 3  
ATOM 5434  H HG21 . ILE A 1 66  ? 11.993  1.895   -2.105  1.00 0.00 ? 66  ILE A HG21 3  
ATOM 5435  H HG22 . ILE A 1 66  ? 11.171  0.337   -2.157  1.00 0.00 ? 66  ILE A HG22 3  
ATOM 5436  H HG23 . ILE A 1 66  ? 10.710  1.613   -3.283  1.00 0.00 ? 66  ILE A HG23 3  
ATOM 5437  H HD11 . ILE A 1 66  ? 11.018  -2.353  -4.598  1.00 0.00 ? 66  ILE A HD11 3  
ATOM 5438  H HD12 . ILE A 1 66  ? 10.627  -1.304  -3.236  1.00 0.00 ? 66  ILE A HD12 3  
ATOM 5439  H HD13 . ILE A 1 66  ? 12.206  -2.084  -3.323  1.00 0.00 ? 66  ILE A HD13 3  
ATOM 5440  N N    . TYR A 1 67  ? 14.898  2.776   -3.271  1.00 0.00 ? 67  TYR A N    3  
ATOM 5441  C CA   . TYR A 1 67  ? 15.532  3.782   -2.429  1.00 0.00 ? 67  TYR A CA   3  
ATOM 5442  C C    . TYR A 1 67  ? 15.502  5.146   -3.107  1.00 0.00 ? 67  TYR A C    3  
ATOM 5443  O O    . TYR A 1 67  ? 14.890  6.090   -2.601  1.00 0.00 ? 67  TYR A O    3  
ATOM 5444  C CB   . TYR A 1 67  ? 16.980  3.379   -2.099  1.00 0.00 ? 67  TYR A CB   3  
ATOM 5445  C CG   . TYR A 1 67  ? 17.790  4.480   -1.429  1.00 0.00 ? 67  TYR A CG   3  
ATOM 5446  C CD1  . TYR A 1 67  ? 17.479  4.925   -0.147  1.00 0.00 ? 67  TYR A CD1  3  
ATOM 5447  C CD2  . TYR A 1 67  ? 18.862  5.079   -2.086  1.00 0.00 ? 67  TYR A CD2  3  
ATOM 5448  C CE1  . TYR A 1 67  ? 18.209  5.933   0.456   1.00 0.00 ? 67  TYR A CE1  3  
ATOM 5449  C CE2  . TYR A 1 67  ? 19.597  6.085   -1.486  1.00 0.00 ? 67  TYR A CE2  3  
ATOM 5450  C CZ   . TYR A 1 67  ? 19.267  6.510   -0.217  1.00 0.00 ? 67  TYR A CZ   3  
ATOM 5451  O OH   . TYR A 1 67  ? 19.997  7.518   0.380   1.00 0.00 ? 67  TYR A OH   3  
ATOM 5452  H H    . TYR A 1 67  ? 15.402  1.972   -3.515  1.00 0.00 ? 67  TYR A H    3  
ATOM 5453  H HA   . TYR A 1 67  ? 14.970  3.839   -1.511  1.00 0.00 ? 67  TYR A HA   3  
ATOM 5454  H HB2  . TYR A 1 67  ? 16.965  2.528   -1.436  1.00 0.00 ? 67  TYR A HB2  3  
ATOM 5455  H HB3  . TYR A 1 67  ? 17.484  3.103   -3.016  1.00 0.00 ? 67  TYR A HB3  3  
ATOM 5456  H HD1  . TYR A 1 67  ? 16.651  4.472   0.380   1.00 0.00 ? 67  TYR A HD1  3  
ATOM 5457  H HD2  . TYR A 1 67  ? 19.119  4.748   -3.082  1.00 0.00 ? 67  TYR A HD2  3  
ATOM 5458  H HE1  . TYR A 1 67  ? 17.949  6.264   1.452   1.00 0.00 ? 67  TYR A HE1  3  
ATOM 5459  H HE2  . TYR A 1 67  ? 20.427  6.535   -2.014  1.00 0.00 ? 67  TYR A HE2  3  
ATOM 5460  H HH   . TYR A 1 67  ? 20.113  8.243   -0.252  1.00 0.00 ? 67  TYR A HH   3  
ATOM 5461  N N    . GLU A 1 68  ? 16.119  5.213   -4.279  1.00 0.00 ? 68  GLU A N    3  
ATOM 5462  C CA   . GLU A 1 68  ? 16.362  6.474   -4.968  1.00 0.00 ? 68  GLU A CA   3  
ATOM 5463  C C    . GLU A 1 68  ? 15.069  7.138   -5.455  1.00 0.00 ? 68  GLU A C    3  
ATOM 5464  O O    . GLU A 1 68  ? 15.032  8.353   -5.643  1.00 0.00 ? 68  GLU A O    3  
ATOM 5465  C CB   . GLU A 1 68  ? 17.313  6.241   -6.150  1.00 0.00 ? 68  GLU A CB   3  
ATOM 5466  C CG   . GLU A 1 68  ? 18.636  5.587   -5.751  1.00 0.00 ? 68  GLU A CG   3  
ATOM 5467  C CD   . GLU A 1 68  ? 19.571  5.360   -6.929  1.00 0.00 ? 68  GLU A CD   3  
ATOM 5468  O OE1  . GLU A 1 68  ? 19.365  4.386   -7.687  1.00 0.00 ? 68  GLU A OE1  3  
ATOM 5469  O OE2  . GLU A 1 68  ? 20.521  6.155   -7.105  1.00 0.00 ? 68  GLU A OE2  3  
ATOM 5470  H H    . GLU A 1 68  ? 16.422  4.379   -4.701  1.00 0.00 ? 68  GLU A H    3  
ATOM 5471  H HA   . GLU A 1 68  ? 16.845  7.140   -4.267  1.00 0.00 ? 68  GLU A HA   3  
ATOM 5472  H HB2  . GLU A 1 68  ? 16.822  5.601   -6.872  1.00 0.00 ? 68  GLU A HB2  3  
ATOM 5473  H HB3  . GLU A 1 68  ? 17.532  7.192   -6.617  1.00 0.00 ? 68  GLU A HB3  3  
ATOM 5474  H HG2  . GLU A 1 68  ? 19.134  6.223   -5.032  1.00 0.00 ? 68  GLU A HG2  3  
ATOM 5475  H HG3  . GLU A 1 68  ? 18.425  4.631   -5.289  1.00 0.00 ? 68  GLU A HG3  3  
ATOM 5476  N N    . LYS A 1 69  ? 14.013  6.352   -5.671  1.00 0.00 ? 69  LYS A N    3  
ATOM 5477  C CA   . LYS A 1 69  ? 12.766  6.902   -6.220  1.00 0.00 ? 69  LYS A CA   3  
ATOM 5478  C C    . LYS A 1 69  ? 11.663  7.031   -5.165  1.00 0.00 ? 69  LYS A C    3  
ATOM 5479  O O    . LYS A 1 69  ? 10.763  7.864   -5.305  1.00 0.00 ? 69  LYS A O    3  
ATOM 5480  C CB   . LYS A 1 69  ? 12.269  6.037   -7.389  1.00 0.00 ? 69  LYS A CB   3  
ATOM 5481  C CG   . LYS A 1 69  ? 11.004  6.578   -8.059  1.00 0.00 ? 69  LYS A CG   3  
ATOM 5482  C CD   . LYS A 1 69  ? 10.574  5.731   -9.254  1.00 0.00 ? 69  LYS A CD   3  
ATOM 5483  C CE   . LYS A 1 69  ? 9.262   6.231   -9.852  1.00 0.00 ? 69  LYS A CE   3  
ATOM 5484  N NZ   . LYS A 1 69  ? 8.834   5.427   -11.026 1.00 0.00 ? 69  LYS A NZ   3  
ATOM 5485  H H    . LYS A 1 69  ? 14.076  5.392   -5.473  1.00 0.00 ? 69  LYS A H    3  
ATOM 5486  H HA   . LYS A 1 69  ? 12.984  7.891   -6.600  1.00 0.00 ? 69  LYS A HA   3  
ATOM 5487  H HB2  . LYS A 1 69  ? 13.049  5.980   -8.135  1.00 0.00 ? 69  LYS A HB2  3  
ATOM 5488  H HB3  . LYS A 1 69  ? 12.061  5.041   -7.022  1.00 0.00 ? 69  LYS A HB3  3  
ATOM 5489  H HG2  . LYS A 1 69  ? 10.202  6.585   -7.333  1.00 0.00 ? 69  LYS A HG2  3  
ATOM 5490  H HG3  . LYS A 1 69  ? 11.193  7.588   -8.395  1.00 0.00 ? 69  LYS A HG3  3  
ATOM 5491  H HD2  . LYS A 1 69  ? 11.344  5.777   -10.012 1.00 0.00 ? 69  LYS A HD2  3  
ATOM 5492  H HD3  . LYS A 1 69  ? 10.446  4.705   -8.932  1.00 0.00 ? 69  LYS A HD3  3  
ATOM 5493  H HE2  . LYS A 1 69  ? 8.493   6.178   -9.096  1.00 0.00 ? 69  LYS A HE2  3  
ATOM 5494  H HE3  . LYS A 1 69  ? 9.390   7.259   -10.160 1.00 0.00 ? 69  LYS A HE3  3  
ATOM 5495  H HZ1  . LYS A 1 69  ? 7.888   5.727   -11.338 1.00 0.00 ? 69  LYS A HZ1  3  
ATOM 5496  H HZ2  . LYS A 1 69  ? 8.802   4.418   -10.778 1.00 0.00 ? 69  LYS A HZ2  3  
ATOM 5497  H HZ3  . LYS A 1 69  ? 9.502   5.557   -11.812 1.00 0.00 ? 69  LYS A HZ3  3  
ATOM 5498  N N    . PHE A 1 70  ? 11.724  6.218   -4.113  1.00 0.00 ? 70  PHE A N    3  
ATOM 5499  C CA   . PHE A 1 70  ? 10.623  6.143   -3.147  1.00 0.00 ? 70  PHE A CA   3  
ATOM 5500  C C    . PHE A 1 70  ? 11.081  6.402   -1.708  1.00 0.00 ? 70  PHE A C    3  
ATOM 5501  O O    . PHE A 1 70  ? 10.434  7.159   -0.981  1.00 0.00 ? 70  PHE A O    3  
ATOM 5502  C CB   . PHE A 1 70  ? 9.937   4.772   -3.225  1.00 0.00 ? 70  PHE A CB   3  
ATOM 5503  C CG   . PHE A 1 70  ? 9.280   4.477   -4.555  1.00 0.00 ? 70  PHE A CG   3  
ATOM 5504  C CD1  . PHE A 1 70  ? 8.044   5.026   -4.869  1.00 0.00 ? 70  PHE A CD1  3  
ATOM 5505  C CD2  . PHE A 1 70  ? 9.895   3.652   -5.485  1.00 0.00 ? 70  PHE A CD2  3  
ATOM 5506  C CE1  . PHE A 1 70  ? 7.437   4.757   -6.081  1.00 0.00 ? 70  PHE A CE1  3  
ATOM 5507  C CE2  . PHE A 1 70  ? 9.292   3.379   -6.699  1.00 0.00 ? 70  PHE A CE2  3  
ATOM 5508  C CZ   . PHE A 1 70  ? 8.061   3.933   -6.997  1.00 0.00 ? 70  PHE A CZ   3  
ATOM 5509  H H    . PHE A 1 70  ? 12.520  5.665   -3.978  1.00 0.00 ? 70  PHE A H    3  
ATOM 5510  H HA   . PHE A 1 70  ? 9.900   6.904   -3.413  1.00 0.00 ? 70  PHE A HA   3  
ATOM 5511  H HB2  . PHE A 1 70  ? 10.673  4.001   -3.043  1.00 0.00 ? 70  PHE A HB2  3  
ATOM 5512  H HB3  . PHE A 1 70  ? 9.175   4.716   -2.461  1.00 0.00 ? 70  PHE A HB3  3  
ATOM 5513  H HD1  . PHE A 1 70  ? 7.554   5.671   -4.155  1.00 0.00 ? 70  PHE A HD1  3  
ATOM 5514  H HD2  . PHE A 1 70  ? 10.857  3.216   -5.254  1.00 0.00 ? 70  PHE A HD2  3  
ATOM 5515  H HE1  . PHE A 1 70  ? 6.476   5.192   -6.313  1.00 0.00 ? 70  PHE A HE1  3  
ATOM 5516  H HE2  . PHE A 1 70  ? 9.783   2.734   -7.415  1.00 0.00 ? 70  PHE A HE2  3  
ATOM 5517  H HZ   . PHE A 1 70  ? 7.588   3.721   -7.945  1.00 0.00 ? 70  PHE A HZ   3  
ATOM 5518  N N    . ILE A 1 71  ? 12.181  5.775   -1.294  1.00 0.00 ? 71  ILE A N    3  
ATOM 5519  C CA   . ILE A 1 71  ? 12.615  5.849   0.104   1.00 0.00 ? 71  ILE A CA   3  
ATOM 5520  C C    . ILE A 1 71  ? 13.142  7.241   0.430   1.00 0.00 ? 71  ILE A C    3  
ATOM 5521  O O    . ILE A 1 71  ? 12.912  7.767   1.523   1.00 0.00 ? 71  ILE A O    3  
ATOM 5522  C CB   . ILE A 1 71  ? 13.704  4.794   0.431   1.00 0.00 ? 71  ILE A CB   3  
ATOM 5523  C CG1  . ILE A 1 71  ? 13.171  3.370   0.184   1.00 0.00 ? 71  ILE A CG1  3  
ATOM 5524  C CG2  . ILE A 1 71  ? 14.196  4.944   1.871   1.00 0.00 ? 71  ILE A CG2  3  
ATOM 5525  C CD1  . ILE A 1 71  ? 11.994  2.992   1.057   1.00 0.00 ? 71  ILE A CD1  3  
ATOM 5526  H H    . ILE A 1 71  ? 12.723  5.272   -1.940  1.00 0.00 ? 71  ILE A H    3  
ATOM 5527  H HA   . ILE A 1 71  ? 11.752  5.651   0.728   1.00 0.00 ? 71  ILE A HA   3  
ATOM 5528  H HB   . ILE A 1 71  ? 14.544  4.972   -0.224  1.00 0.00 ? 71  ILE A HB   3  
ATOM 5529  H HG12 . ILE A 1 71  ? 12.857  3.285   -0.846  1.00 0.00 ? 71  ILE A HG12 3  
ATOM 5530  H HG13 . ILE A 1 71  ? 13.964  2.660   0.371   1.00 0.00 ? 71  ILE A HG13 3  
ATOM 5531  H HG21 . ILE A 1 71  ? 13.366  4.819   2.552   1.00 0.00 ? 71  ILE A HG21 3  
ATOM 5532  H HG22 . ILE A 1 71  ? 14.628  5.924   2.006   1.00 0.00 ? 71  ILE A HG22 3  
ATOM 5533  H HG23 . ILE A 1 71  ? 14.944  4.191   2.076   1.00 0.00 ? 71  ILE A HG23 3  
ATOM 5534  H HD11 . ILE A 1 71  ? 12.277  3.063   2.098   1.00 0.00 ? 71  ILE A HD11 3  
ATOM 5535  H HD12 . ILE A 1 71  ? 11.693  1.979   0.835   1.00 0.00 ? 71  ILE A HD12 3  
ATOM 5536  H HD13 . ILE A 1 71  ? 11.169  3.663   0.862   1.00 0.00 ? 71  ILE A HD13 3  
ATOM 5537  N N    . GLN A 1 72  ? 13.841  7.833   -0.528  1.00 0.00 ? 72  GLN A N    3  
ATOM 5538  C CA   . GLN A 1 72  ? 14.394  9.168   -0.361  1.00 0.00 ? 72  GLN A CA   3  
ATOM 5539  C C    . GLN A 1 72  ? 13.279  10.212  -0.412  1.00 0.00 ? 72  GLN A C    3  
ATOM 5540  O O    . GLN A 1 72  ? 12.453  10.201  -1.324  1.00 0.00 ? 72  GLN A O    3  
ATOM 5541  C CB   . GLN A 1 72  ? 15.449  9.443   -1.445  1.00 0.00 ? 72  GLN A CB   3  
ATOM 5542  C CG   . GLN A 1 72  ? 16.036  10.854  -1.413  1.00 0.00 ? 72  GLN A CG   3  
ATOM 5543  C CD   . GLN A 1 72  ? 16.766  11.191  -0.116  1.00 0.00 ? 72  GLN A CD   3  
ATOM 5544  O OE1  . GLN A 1 72  ? 16.426  10.700  0.960   1.00 0.00 ? 72  GLN A OE1  3  
ATOM 5545  N NE2  . GLN A 1 72  ? 17.776  12.039  -0.210  1.00 0.00 ? 72  GLN A NE2  3  
ATOM 5546  H H    . GLN A 1 72  ? 13.981  7.365   -1.377  1.00 0.00 ? 72  GLN A H    3  
ATOM 5547  H HA   . GLN A 1 72  ? 14.870  9.212   0.611   1.00 0.00 ? 72  GLN A HA   3  
ATOM 5548  H HB2  . GLN A 1 72  ? 16.262  8.738   -1.323  1.00 0.00 ? 72  GLN A HB2  3  
ATOM 5549  H HB3  . GLN A 1 72  ? 14.996  9.288   -2.417  1.00 0.00 ? 72  GLN A HB3  3  
ATOM 5550  H HG2  . GLN A 1 72  ? 16.732  10.956  -2.233  1.00 0.00 ? 72  GLN A HG2  3  
ATOM 5551  H HG3  . GLN A 1 72  ? 15.228  11.562  -1.545  1.00 0.00 ? 72  GLN A HG3  3  
ATOM 5552  H HE21 . GLN A 1 72  ? 17.999  12.396  -1.094  1.00 0.00 ? 72  GLN A HE21 3  
ATOM 5553  H HE22 . GLN A 1 72  ? 18.260  12.276  0.610   1.00 0.00 ? 72  GLN A HE22 3  
ATOM 5554  N N    . THR A 1 73  ? 13.252  11.096  0.584   1.00 0.00 ? 73  THR A N    3  
ATOM 5555  C CA   . THR A 1 73  ? 12.267  12.170  0.636   1.00 0.00 ? 73  THR A CA   3  
ATOM 5556  C C    . THR A 1 73  ? 12.402  13.067  -0.595  1.00 0.00 ? 73  THR A C    3  
ATOM 5557  O O    . THR A 1 73  ? 11.409  13.442  -1.225  1.00 0.00 ? 73  THR A O    3  
ATOM 5558  C CB   . THR A 1 73  ? 12.439  13.016  1.919   1.00 0.00 ? 73  THR A CB   3  
ATOM 5559  O OG1  . THR A 1 73  ? 12.457  12.154  3.068   1.00 0.00 ? 73  THR A OG1  3  
ATOM 5560  C CG2  . THR A 1 73  ? 11.316  14.041  2.067   1.00 0.00 ? 73  THR A CG2  3  
ATOM 5561  H H    . THR A 1 73  ? 13.908  11.019  1.306   1.00 0.00 ? 73  THR A H    3  
ATOM 5562  H HA   . THR A 1 73  ? 11.281  11.724  0.646   1.00 0.00 ? 73  THR A HA   3  
ATOM 5563  H HB   . THR A 1 73  ? 13.382  13.542  1.863   1.00 0.00 ? 73  THR A HB   3  
ATOM 5564  H HG1  . THR A 1 73  ? 13.193  12.401  3.637   1.00 0.00 ? 73  THR A HG1  3  
ATOM 5565  H HG21 . THR A 1 73  ? 10.366  13.531  2.133   1.00 0.00 ? 73  THR A HG21 3  
ATOM 5566  H HG22 . THR A 1 73  ? 11.311  14.700  1.210   1.00 0.00 ? 73  THR A HG22 3  
ATOM 5567  H HG23 . THR A 1 73  ? 11.474  14.623  2.963   1.00 0.00 ? 73  THR A HG23 3  
ATOM 5568  N N    . ASP A 1 74  ? 13.646  13.394  -0.934  1.00 0.00 ? 74  ASP A N    3  
ATOM 5569  C CA   . ASP A 1 74  ? 13.943  14.158  -2.141  1.00 0.00 ? 74  ASP A CA   3  
ATOM 5570  C C    . ASP A 1 74  ? 13.791  13.248  -3.361  1.00 0.00 ? 74  ASP A C    3  
ATOM 5571  O O    . ASP A 1 74  ? 14.770  12.709  -3.884  1.00 0.00 ? 74  ASP A O    3  
ATOM 5572  C CB   . ASP A 1 74  ? 15.365  14.746  -2.064  1.00 0.00 ? 74  ASP A CB   3  
ATOM 5573  C CG   . ASP A 1 74  ? 15.717  15.616  -3.264  1.00 0.00 ? 74  ASP A CG   3  
ATOM 5574  O OD1  . ASP A 1 74  ? 15.361  16.816  -3.263  1.00 0.00 ? 74  ASP A OD1  3  
ATOM 5575  O OD2  . ASP A 1 74  ? 16.362  15.113  -4.208  1.00 0.00 ? 74  ASP A OD2  3  
ATOM 5576  H H    . ASP A 1 74  ? 14.385  13.111  -0.359  1.00 0.00 ? 74  ASP A H    3  
ATOM 5577  H HA   . ASP A 1 74  ? 13.228  14.966  -2.212  1.00 0.00 ? 74  ASP A HA   3  
ATOM 5578  H HB2  . ASP A 1 74  ? 15.449  15.347  -1.171  1.00 0.00 ? 74  ASP A HB2  3  
ATOM 5579  H HB3  . ASP A 1 74  ? 16.079  13.933  -2.009  1.00 0.00 ? 74  ASP A HB3  3  
ATOM 5580  N N    . ALA A 1 75  ? 12.545  13.041  -3.774  1.00 0.00 ? 75  ALA A N    3  
ATOM 5581  C CA   . ALA A 1 75  ? 12.221  12.124  -4.865  1.00 0.00 ? 75  ALA A CA   3  
ATOM 5582  C C    . ALA A 1 75  ? 11.266  12.783  -5.860  1.00 0.00 ? 75  ALA A C    3  
ATOM 5583  O O    . ALA A 1 75  ? 10.549  13.720  -5.506  1.00 0.00 ? 75  ALA A O    3  
ATOM 5584  C CB   . ALA A 1 75  ? 11.611  10.846  -4.300  1.00 0.00 ? 75  ALA A CB   3  
ATOM 5585  H H    . ALA A 1 75  ? 11.815  13.519  -3.325  1.00 0.00 ? 75  ALA A H    3  
ATOM 5586  H HA   . ALA A 1 75  ? 13.139  11.866  -5.377  1.00 0.00 ? 75  ALA A HA   3  
ATOM 5587  H HB1  . ALA A 1 75  ? 10.694  11.082  -3.780  1.00 0.00 ? 75  ALA A HB1  3  
ATOM 5588  H HB2  . ALA A 1 75  ? 12.307  10.387  -3.612  1.00 0.00 ? 75  ALA A HB2  3  
ATOM 5589  H HB3  . ALA A 1 75  ? 11.399  10.159  -5.107  1.00 0.00 ? 75  ALA A HB3  3  
ATOM 5590  N N    . PRO A 1 76  ? 11.241  12.298  -7.122  1.00 0.00 ? 76  PRO A N    3  
ATOM 5591  C CA   . PRO A 1 76  ? 10.379  12.859  -8.171  1.00 0.00 ? 76  PRO A CA   3  
ATOM 5592  C C    . PRO A 1 76  ? 8.894   12.608  -7.897  1.00 0.00 ? 76  PRO A C    3  
ATOM 5593  O O    . PRO A 1 76  ? 8.033   13.395  -8.298  1.00 0.00 ? 76  PRO A O    3  
ATOM 5594  C CB   . PRO A 1 76  ? 10.825  12.124  -9.453  1.00 0.00 ? 76  PRO A CB   3  
ATOM 5595  C CG   . PRO A 1 76  ? 12.123  11.465  -9.105  1.00 0.00 ? 76  PRO A CG   3  
ATOM 5596  C CD   . PRO A 1 76  ? 12.056  11.179  -7.631  1.00 0.00 ? 76  PRO A CD   3  
ATOM 5597  H HA   . PRO A 1 76  ? 10.543  13.922  -8.287  1.00 0.00 ? 76  PRO A HA   3  
ATOM 5598  H HB2  . PRO A 1 76  ? 10.079  11.393  -9.734  1.00 0.00 ? 76  PRO A HB2  3  
ATOM 5599  H HB3  . PRO A 1 76  ? 10.950  12.837  -10.255 1.00 0.00 ? 76  PRO A HB3  3  
ATOM 5600  H HG2  . PRO A 1 76  ? 12.231  10.545  -9.662  1.00 0.00 ? 76  PRO A HG2  3  
ATOM 5601  H HG3  . PRO A 1 76  ? 12.947  12.133  -9.322  1.00 0.00 ? 76  PRO A HG3  3  
ATOM 5602  H HD2  . PRO A 1 76  ? 11.570  10.230  -7.449  1.00 0.00 ? 76  PRO A HD2  3  
ATOM 5603  H HD3  . PRO A 1 76  ? 13.045  11.189  -7.194  1.00 0.00 ? 76  PRO A HD3  3  
ATOM 5604  N N    . LYS A 1 77  ? 8.605   11.495  -7.224  1.00 0.00 ? 77  LYS A N    3  
ATOM 5605  C CA   . LYS A 1 77  ? 7.229   11.124  -6.891  1.00 0.00 ? 77  LYS A CA   3  
ATOM 5606  C C    . LYS A 1 77  ? 6.963   11.381  -5.407  1.00 0.00 ? 77  LYS A C    3  
ATOM 5607  O O    . LYS A 1 77  ? 5.889   11.857  -5.035  1.00 0.00 ? 77  LYS A O    3  
ATOM 5608  C CB   . LYS A 1 77  ? 6.979   9.640   -7.220  1.00 0.00 ? 77  LYS A CB   3  
ATOM 5609  C CG   . LYS A 1 77  ? 5.505   9.221   -7.170  1.00 0.00 ? 77  LYS A CG   3  
ATOM 5610  C CD   . LYS A 1 77  ? 4.706   9.796   -8.343  1.00 0.00 ? 77  LYS A CD   3  
ATOM 5611  C CE   . LYS A 1 77  ? 3.253   9.315   -8.349  1.00 0.00 ? 77  LYS A CE   3  
ATOM 5612  N NZ   . LYS A 1 77  ? 2.453   9.896   -7.236  1.00 0.00 ? 77  LYS A NZ   3  
ATOM 5613  H H    . LYS A 1 77  ? 9.338   10.911  -6.943  1.00 0.00 ? 77  LYS A H    3  
ATOM 5614  H HA   . LYS A 1 77  ? 6.560   11.737  -7.481  1.00 0.00 ? 77  LYS A HA   3  
ATOM 5615  H HB2  . LYS A 1 77  ? 7.353   9.437   -8.213  1.00 0.00 ? 77  LYS A HB2  3  
ATOM 5616  H HB3  . LYS A 1 77  ? 7.526   9.033   -6.512  1.00 0.00 ? 77  LYS A HB3  3  
ATOM 5617  H HG2  . LYS A 1 77  ? 5.448   8.142   -7.206  1.00 0.00 ? 77  LYS A HG2  3  
ATOM 5618  H HG3  . LYS A 1 77  ? 5.073   9.571   -6.243  1.00 0.00 ? 77  LYS A HG3  3  
ATOM 5619  H HD2  . LYS A 1 77  ? 4.712   10.875  -8.272  1.00 0.00 ? 77  LYS A HD2  3  
ATOM 5620  H HD3  . LYS A 1 77  ? 5.179   9.495   -9.267  1.00 0.00 ? 77  LYS A HD3  3  
ATOM 5621  H HE2  . LYS A 1 77  ? 2.799   9.601   -9.287  1.00 0.00 ? 77  LYS A HE2  3  
ATOM 5622  H HE3  . LYS A 1 77  ? 3.242   8.239   -8.263  1.00 0.00 ? 77  LYS A HE3  3  
ATOM 5623  H HZ1  . LYS A 1 77  ? 1.484   9.510   -7.249  1.00 0.00 ? 77  LYS A HZ1  3  
ATOM 5624  H HZ2  . LYS A 1 77  ? 2.400   10.929  -7.335  1.00 0.00 ? 77  LYS A HZ2  3  
ATOM 5625  H HZ3  . LYS A 1 77  ? 2.888   9.674   -6.319  1.00 0.00 ? 77  LYS A HZ3  3  
ATOM 5626  N N    . GLU A 1 78  ? 7.969   11.075  -4.577  1.00 0.00 ? 78  GLU A N    3  
ATOM 5627  C CA   . GLU A 1 78  ? 7.878   11.201  -3.115  1.00 0.00 ? 78  GLU A CA   3  
ATOM 5628  C C    . GLU A 1 78  ? 6.924   10.163  -2.527  1.00 0.00 ? 78  GLU A C    3  
ATOM 5629  O O    . GLU A 1 78  ? 6.017   9.679   -3.201  1.00 0.00 ? 78  GLU A O    3  
ATOM 5630  C CB   . GLU A 1 78  ? 7.428   12.607  -2.687  1.00 0.00 ? 78  GLU A CB   3  
ATOM 5631  C CG   . GLU A 1 78  ? 8.365   13.727  -3.115  1.00 0.00 ? 78  GLU A CG   3  
ATOM 5632  C CD   . GLU A 1 78  ? 7.882   15.087  -2.640  1.00 0.00 ? 78  GLU A CD   3  
ATOM 5633  O OE1  . GLU A 1 78  ? 6.866   15.580  -3.173  1.00 0.00 ? 78  GLU A OE1  3  
ATOM 5634  O OE2  . GLU A 1 78  ? 8.501   15.660  -1.715  1.00 0.00 ? 78  GLU A OE2  3  
ATOM 5635  H H    . GLU A 1 78  ? 8.804   10.745  -4.962  1.00 0.00 ? 78  GLU A H    3  
ATOM 5636  H HA   . GLU A 1 78  ? 8.866   11.020  -2.718  1.00 0.00 ? 78  GLU A HA   3  
ATOM 5637  H HB2  . GLU A 1 78  ? 6.453   12.803  -3.113  1.00 0.00 ? 78  GLU A HB2  3  
ATOM 5638  H HB3  . GLU A 1 78  ? 7.345   12.630  -1.608  1.00 0.00 ? 78  GLU A HB3  3  
ATOM 5639  H HG2  . GLU A 1 78  ? 9.347   13.539  -2.700  1.00 0.00 ? 78  GLU A HG2  3  
ATOM 5640  H HG3  . GLU A 1 78  ? 8.428   13.737  -4.193  1.00 0.00 ? 78  GLU A HG3  3  
ATOM 5641  N N    . VAL A 1 79  ? 7.151   9.823   -1.261  1.00 0.00 ? 79  VAL A N    3  
ATOM 5642  C CA   . VAL A 1 79  ? 6.277   8.916   -0.519  1.00 0.00 ? 79  VAL A CA   3  
ATOM 5643  C C    . VAL A 1 79  ? 6.113   9.423   0.911   1.00 0.00 ? 79  VAL A C    3  
ATOM 5644  O O    . VAL A 1 79  ? 7.031   10.039  1.465   1.00 0.00 ? 79  VAL A O    3  
ATOM 5645  C CB   . VAL A 1 79  ? 6.832   7.465   -0.489  1.00 0.00 ? 79  VAL A CB   3  
ATOM 5646  C CG1  . VAL A 1 79  ? 5.936   6.551   0.350   1.00 0.00 ? 79  VAL A CG1  3  
ATOM 5647  C CG2  . VAL A 1 79  ? 6.983   6.912   -1.907  1.00 0.00 ? 79  VAL A CG2  3  
ATOM 5648  H H    . VAL A 1 79  ? 7.935   10.193  -0.805  1.00 0.00 ? 79  VAL A H    3  
ATOM 5649  H HA   . VAL A 1 79  ? 5.307   8.906   -1.004  1.00 0.00 ? 79  VAL A HA   3  
ATOM 5650  H HB   . VAL A 1 79  ? 7.812   7.485   -0.030  1.00 0.00 ? 79  VAL A HB   3  
ATOM 5651  H HG11 . VAL A 1 79  ? 5.881   6.928   1.362   1.00 0.00 ? 79  VAL A HG11 3  
ATOM 5652  H HG12 . VAL A 1 79  ? 6.348   5.553   0.363   1.00 0.00 ? 79  VAL A HG12 3  
ATOM 5653  H HG13 . VAL A 1 79  ? 4.943   6.525   -0.077  1.00 0.00 ? 79  VAL A HG13 3  
ATOM 5654  H HG21 . VAL A 1 79  ? 7.371   5.904   -1.865  1.00 0.00 ? 79  VAL A HG21 3  
ATOM 5655  H HG22 . VAL A 1 79  ? 7.665   7.535   -2.467  1.00 0.00 ? 79  VAL A HG22 3  
ATOM 5656  H HG23 . VAL A 1 79  ? 6.019   6.906   -2.396  1.00 0.00 ? 79  VAL A HG23 3  
ATOM 5657  N N    . ASN A 1 80  ? 4.950   9.181   1.499   1.00 0.00 ? 80  ASN A N    3  
ATOM 5658  C CA   . ASN A 1 80  ? 4.679   9.590   2.873   1.00 0.00 ? 80  ASN A CA   3  
ATOM 5659  C C    . ASN A 1 80  ? 5.157   8.510   3.843   1.00 0.00 ? 80  ASN A C    3  
ATOM 5660  O O    . ASN A 1 80  ? 4.408   7.601   4.203   1.00 0.00 ? 80  ASN A O    3  
ATOM 5661  C CB   . ASN A 1 80  ? 3.180   9.866   3.062   1.00 0.00 ? 80  ASN A CB   3  
ATOM 5662  C CG   . ASN A 1 80  ? 2.661   10.987  2.169   1.00 0.00 ? 80  ASN A CG   3  
ATOM 5663  O OD1  . ASN A 1 80  ? 1.521   10.949  1.698   1.00 0.00 ? 80  ASN A OD1  3  
ATOM 5664  N ND2  . ASN A 1 80  ? 3.475   12.008  1.945   1.00 0.00 ? 80  ASN A ND2  3  
ATOM 5665  H H    . ASN A 1 80  ? 4.249   8.709   0.999   1.00 0.00 ? 80  ASN A H    3  
ATOM 5666  H HA   . ASN A 1 80  ? 5.232   10.501  3.066   1.00 0.00 ? 80  ASN A HA   3  
ATOM 5667  H HB2  . ASN A 1 80  ? 2.625   8.969   2.833   1.00 0.00 ? 80  ASN A HB2  3  
ATOM 5668  H HB3  . ASN A 1 80  ? 2.998   10.141  4.092   1.00 0.00 ? 80  ASN A HB3  3  
ATOM 5669  H HD21 . ASN A 1 80  ? 4.365   11.998  2.360   1.00 0.00 ? 80  ASN A HD21 3  
ATOM 5670  H HD22 . ASN A 1 80  ? 3.153   12.738  1.375   1.00 0.00 ? 80  ASN A HD22 3  
ATOM 5671  N N    . LEU A 1 81  ? 6.427   8.597   4.232   1.00 0.00 ? 81  LEU A N    3  
ATOM 5672  C CA   . LEU A 1 81  ? 7.043   7.615   5.119   1.00 0.00 ? 81  LEU A CA   3  
ATOM 5673  C C    . LEU A 1 81  ? 7.859   8.308   6.214   1.00 0.00 ? 81  LEU A C    3  
ATOM 5674  O O    . LEU A 1 81  ? 8.472   9.354   5.977   1.00 0.00 ? 81  LEU A O    3  
ATOM 5675  C CB   . LEU A 1 81  ? 7.934   6.664   4.300   1.00 0.00 ? 81  LEU A CB   3  
ATOM 5676  C CG   . LEU A 1 81  ? 8.848   5.730   5.113   1.00 0.00 ? 81  LEU A CG   3  
ATOM 5677  C CD1  . LEU A 1 81  ? 8.021   4.728   5.911   1.00 0.00 ? 81  LEU A CD1  3  
ATOM 5678  C CD2  . LEU A 1 81  ? 9.839   5.013   4.197   1.00 0.00 ? 81  LEU A CD2  3  
ATOM 5679  H H    . LEU A 1 81  ? 6.971   9.345   3.908   1.00 0.00 ? 81  LEU A H    3  
ATOM 5680  H HA   . LEU A 1 81  ? 6.249   7.042   5.584   1.00 0.00 ? 81  LEU A HA   3  
ATOM 5681  H HB2  . LEU A 1 81  ? 7.283   6.046   3.694   1.00 0.00 ? 81  LEU A HB2  3  
ATOM 5682  H HB3  . LEU A 1 81  ? 8.552   7.259   3.641   1.00 0.00 ? 81  LEU A HB3  3  
ATOM 5683  H HG   . LEU A 1 81  ? 9.416   6.323   5.817   1.00 0.00 ? 81  LEU A HG   3  
ATOM 5684  H HD11 . LEU A 1 81  ? 7.426   4.129   5.236   1.00 0.00 ? 81  LEU A HD11 3  
ATOM 5685  H HD12 . LEU A 1 81  ? 7.370   5.258   6.592   1.00 0.00 ? 81  LEU A HD12 3  
ATOM 5686  H HD13 . LEU A 1 81  ? 8.680   4.085   6.476   1.00 0.00 ? 81  LEU A HD13 3  
ATOM 5687  H HD21 . LEU A 1 81  ? 10.475  4.368   4.787   1.00 0.00 ? 81  LEU A HD21 3  
ATOM 5688  H HD22 . LEU A 1 81  ? 10.450  5.742   3.682   1.00 0.00 ? 81  LEU A HD22 3  
ATOM 5689  H HD23 . LEU A 1 81  ? 9.302   4.420   3.471   1.00 0.00 ? 81  LEU A HD23 3  
ATOM 5690  N N    . ASP A 1 82  ? 7.866   7.700   7.403   1.00 0.00 ? 82  ASP A N    3  
ATOM 5691  C CA   . ASP A 1 82  ? 8.555   8.244   8.579   1.00 0.00 ? 82  ASP A CA   3  
ATOM 5692  C C    . ASP A 1 82  ? 10.038  8.533   8.309   1.00 0.00 ? 82  ASP A C    3  
ATOM 5693  O O    . ASP A 1 82  ? 10.645  7.976   7.386   1.00 0.00 ? 82  ASP A O    3  
ATOM 5694  C CB   . ASP A 1 82  ? 8.413   7.273   9.762   1.00 0.00 ? 82  ASP A CB   3  
ATOM 5695  C CG   . ASP A 1 82  ? 9.301   7.646   10.944  1.00 0.00 ? 82  ASP A CG   3  
ATOM 5696  O OD1  . ASP A 1 82  ? 9.094   8.725   11.532  1.00 0.00 ? 82  ASP A OD1  3  
ATOM 5697  O OD2  . ASP A 1 82  ? 10.234  6.877   11.259  1.00 0.00 ? 82  ASP A OD2  3  
ATOM 5698  H H    . ASP A 1 82  ? 7.387   6.852   7.495   1.00 0.00 ? 82  ASP A H    3  
ATOM 5699  H HA   . ASP A 1 82  ? 8.068   9.173   8.836   1.00 0.00 ? 82  ASP A HA   3  
ATOM 5700  H HB2  . ASP A 1 82  ? 7.386   7.273   10.096  1.00 0.00 ? 82  ASP A HB2  3  
ATOM 5701  H HB3  . ASP A 1 82  ? 8.676   6.275   9.433   1.00 0.00 ? 82  ASP A HB3  3  
ATOM 5702  N N    . PHE A 1 83  ? 10.606  9.405   9.139   1.00 0.00 ? 83  PHE A N    3  
ATOM 5703  C CA   . PHE A 1 83  ? 11.993  9.839   9.013   1.00 0.00 ? 83  PHE A CA   3  
ATOM 5704  C C    . PHE A 1 83  ? 12.950  8.733   9.457   1.00 0.00 ? 83  PHE A C    3  
ATOM 5705  O O    . PHE A 1 83  ? 13.798  8.285   8.684   1.00 0.00 ? 83  PHE A O    3  
ATOM 5706  C CB   . PHE A 1 83  ? 12.226  11.103  9.856   1.00 0.00 ? 83  PHE A CB   3  
ATOM 5707  C CG   . PHE A 1 83  ? 11.296  12.242  9.510   1.00 0.00 ? 83  PHE A CG   3  
ATOM 5708  C CD1  . PHE A 1 83  ? 10.002  12.278  10.017  1.00 0.00 ? 83  PHE A CD1  3  
ATOM 5709  C CD2  . PHE A 1 83  ? 11.712  13.270  8.678   1.00 0.00 ? 83  PHE A CD2  3  
ATOM 5710  C CE1  . PHE A 1 83  ? 9.148   13.317  9.698   1.00 0.00 ? 83  PHE A CE1  3  
ATOM 5711  C CE2  . PHE A 1 83  ? 10.860  14.310  8.358   1.00 0.00 ? 83  PHE A CE2  3  
ATOM 5712  C CZ   . PHE A 1 83  ? 9.577   14.332  8.869   1.00 0.00 ? 83  PHE A CZ   3  
ATOM 5713  H H    . PHE A 1 83  ? 10.068  9.764   9.878   1.00 0.00 ? 83  PHE A H    3  
ATOM 5714  H HA   . PHE A 1 83  ? 12.180  10.069  7.974   1.00 0.00 ? 83  PHE A HA   3  
ATOM 5715  H HB2  . PHE A 1 83  ? 12.082  10.863  10.901  1.00 0.00 ? 83  PHE A HB2  3  
ATOM 5716  H HB3  . PHE A 1 83  ? 13.241  11.444  9.710   1.00 0.00 ? 83  PHE A HB3  3  
ATOM 5717  H HD1  . PHE A 1 83  ? 9.665   11.484  10.667  1.00 0.00 ? 83  PHE A HD1  3  
ATOM 5718  H HD2  . PHE A 1 83  ? 12.714  13.255  8.276   1.00 0.00 ? 83  PHE A HD2  3  
ATOM 5719  H HE1  . PHE A 1 83  ? 8.145   13.334  10.099  1.00 0.00 ? 83  PHE A HE1  3  
ATOM 5720  H HE2  . PHE A 1 83  ? 11.197  15.103  7.707   1.00 0.00 ? 83  PHE A HE2  3  
ATOM 5721  H HZ   . PHE A 1 83  ? 8.910   15.145  8.618   1.00 0.00 ? 83  PHE A HZ   3  
ATOM 5722  N N    . HIS A 1 84  ? 12.790  8.278   10.699  1.00 0.00 ? 84  HIS A N    3  
ATOM 5723  C CA   . HIS A 1 84  ? 13.696  7.283   11.273  1.00 0.00 ? 84  HIS A CA   3  
ATOM 5724  C C    . HIS A 1 84  ? 13.604  5.961   10.519  1.00 0.00 ? 84  HIS A C    3  
ATOM 5725  O O    . HIS A 1 84  ? 14.587  5.227   10.421  1.00 0.00 ? 84  HIS A O    3  
ATOM 5726  C CB   . HIS A 1 84  ? 13.392  7.065   12.759  1.00 0.00 ? 84  HIS A CB   3  
ATOM 5727  C CG   . HIS A 1 84  ? 14.288  6.050   13.409  1.00 0.00 ? 84  HIS A CG   3  
ATOM 5728  N ND1  . HIS A 1 84  ? 15.623  6.279   13.668  1.00 0.00 ? 84  HIS A ND1  3  
ATOM 5729  C CD2  . HIS A 1 84  ? 14.035  4.793   13.845  1.00 0.00 ? 84  HIS A CD2  3  
ATOM 5730  C CE1  . HIS A 1 84  ? 16.151  5.209   14.231  1.00 0.00 ? 84  HIS A CE1  3  
ATOM 5731  N NE2  . HIS A 1 84  ? 15.211  4.293   14.349  1.00 0.00 ? 84  HIS A NE2  3  
ATOM 5732  H H    . HIS A 1 84  ? 12.042  8.611   11.240  1.00 0.00 ? 84  HIS A H    3  
ATOM 5733  H HA   . HIS A 1 84  ? 14.702  7.665   11.177  1.00 0.00 ? 84  HIS A HA   3  
ATOM 5734  H HB2  . HIS A 1 84  ? 13.514  8.001   13.286  1.00 0.00 ? 84  HIS A HB2  3  
ATOM 5735  H HB3  . HIS A 1 84  ? 12.370  6.729   12.869  1.00 0.00 ? 84  HIS A HB3  3  
ATOM 5736  H HD1  . HIS A 1 84  ? 16.117  7.103   13.459  1.00 0.00 ? 84  HIS A HD1  3  
ATOM 5737  H HD2  . HIS A 1 84  ? 13.087  4.277   13.800  1.00 0.00 ? 84  HIS A HD2  3  
ATOM 5738  H HE1  . HIS A 1 84  ? 17.179  5.102   14.545  1.00 0.00 ? 84  HIS A HE1  3  
ATOM 5739  H HE2  . HIS A 1 84  ? 15.367  3.352   14.593  1.00 0.00 ? 84  HIS A HE2  3  
ATOM 5740  N N    . THR A 1 85  ? 12.426  5.666   9.985   1.00 0.00 ? 85  THR A N    3  
ATOM 5741  C CA   . THR A 1 85  ? 12.216  4.440   9.226   1.00 0.00 ? 85  THR A CA   3  
ATOM 5742  C C    . THR A 1 85  ? 13.152  4.386   8.018   1.00 0.00 ? 85  THR A C    3  
ATOM 5743  O O    . THR A 1 85  ? 13.878  3.409   7.826   1.00 0.00 ? 85  THR A O    3  
ATOM 5744  C CB   . THR A 1 85  ? 10.750  4.313   8.751   1.00 0.00 ? 85  THR A CB   3  
ATOM 5745  O OG1  . THR A 1 85  ? 9.862   4.368   9.876   1.00 0.00 ? 85  THR A OG1  3  
ATOM 5746  C CG2  . THR A 1 85  ? 10.528  3.007   7.994   1.00 0.00 ? 85  THR A CG2  3  
ATOM 5747  H H    . THR A 1 85  ? 11.678  6.287   10.111  1.00 0.00 ? 85  THR A H    3  
ATOM 5748  H HA   . THR A 1 85  ? 12.435  3.604   9.878   1.00 0.00 ? 85  THR A HA   3  
ATOM 5749  H HB   . THR A 1 85  ? 10.528  5.139   8.088   1.00 0.00 ? 85  THR A HB   3  
ATOM 5750  H HG1  . THR A 1 85  ? 10.213  4.978   10.537  1.00 0.00 ? 85  THR A HG1  3  
ATOM 5751  H HG21 . THR A 1 85  ? 11.169  2.978   7.125   1.00 0.00 ? 85  THR A HG21 3  
ATOM 5752  H HG22 . THR A 1 85  ? 9.496   2.943   7.681   1.00 0.00 ? 85  THR A HG22 3  
ATOM 5753  H HG23 . THR A 1 85  ? 10.758  2.172   8.640   1.00 0.00 ? 85  THR A HG23 3  
ATOM 5754  N N    . LYS A 1 86  ? 13.153  5.453   7.218   1.00 0.00 ? 86  LYS A N    3  
ATOM 5755  C CA   . LYS A 1 86  ? 14.011  5.509   6.038   1.00 0.00 ? 86  LYS A CA   3  
ATOM 5756  C C    . LYS A 1 86  ? 15.474  5.667   6.454   1.00 0.00 ? 86  LYS A C    3  
ATOM 5757  O O    . LYS A 1 86  ? 16.379  5.272   5.723   1.00 0.00 ? 86  LYS A O    3  
ATOM 5758  C CB   . LYS A 1 86  ? 13.587  6.642   5.091   1.00 0.00 ? 86  LYS A CB   3  
ATOM 5759  C CG   . LYS A 1 86  ? 13.725  8.046   5.676   1.00 0.00 ? 86  LYS A CG   3  
ATOM 5760  C CD   . LYS A 1 86  ? 13.475  9.125   4.624   1.00 0.00 ? 86  LYS A CD   3  
ATOM 5761  C CE   . LYS A 1 86  ? 12.038  9.121   4.110   1.00 0.00 ? 86  LYS A CE   3  
ATOM 5762  N NZ   . LYS A 1 86  ? 11.070  9.587   5.139   1.00 0.00 ? 86  LYS A NZ   3  
ATOM 5763  H H    . LYS A 1 86  ? 12.572  6.216   7.430   1.00 0.00 ? 86  LYS A H    3  
ATOM 5764  H HA   . LYS A 1 86  ? 13.906  4.565   5.519   1.00 0.00 ? 86  LYS A HA   3  
ATOM 5765  H HB2  . LYS A 1 86  ? 14.193  6.589   4.198   1.00 0.00 ? 86  LYS A HB2  3  
ATOM 5766  H HB3  . LYS A 1 86  ? 12.551  6.491   4.817   1.00 0.00 ? 86  LYS A HB3  3  
ATOM 5767  H HG2  . LYS A 1 86  ? 13.008  8.165   6.476   1.00 0.00 ? 86  LYS A HG2  3  
ATOM 5768  H HG3  . LYS A 1 86  ? 14.725  8.165   6.069   1.00 0.00 ? 86  LYS A HG3  3  
ATOM 5769  H HD2  . LYS A 1 86  ? 13.681  10.090  5.061   1.00 0.00 ? 86  LYS A HD2  3  
ATOM 5770  H HD3  . LYS A 1 86  ? 14.145  8.960   3.791   1.00 0.00 ? 86  LYS A HD3  3  
ATOM 5771  H HE2  . LYS A 1 86  ? 11.975  9.776   3.252   1.00 0.00 ? 86  LYS A HE2  3  
ATOM 5772  H HE3  . LYS A 1 86  ? 11.778  8.116   3.812   1.00 0.00 ? 86  LYS A HE3  3  
ATOM 5773  H HZ1  . LYS A 1 86  ? 11.323  10.546  5.455   1.00 0.00 ? 86  LYS A HZ1  3  
ATOM 5774  H HZ2  . LYS A 1 86  ? 11.079  8.950   5.960   1.00 0.00 ? 86  LYS A HZ2  3  
ATOM 5775  H HZ3  . LYS A 1 86  ? 10.107  9.608   4.741   1.00 0.00 ? 86  LYS A HZ3  3  
ATOM 5776  N N    . GLU A 1 87  ? 15.689  6.232   7.640   1.00 0.00 ? 87  GLU A N    3  
ATOM 5777  C CA   . GLU A 1 87  ? 17.031  6.370   8.204   1.00 0.00 ? 87  GLU A CA   3  
ATOM 5778  C C    . GLU A 1 87  ? 17.643  4.990   8.458   1.00 0.00 ? 87  GLU A C    3  
ATOM 5779  O O    . GLU A 1 87  ? 18.823  4.755   8.190   1.00 0.00 ? 87  GLU A O    3  
ATOM 5780  C CB   . GLU A 1 87  ? 16.963  7.184   9.503   1.00 0.00 ? 87  GLU A CB   3  
ATOM 5781  C CG   . GLU A 1 87  ? 18.309  7.393   10.186  1.00 0.00 ? 87  GLU A CG   3  
ATOM 5782  C CD   . GLU A 1 87  ? 18.188  8.211   11.461  1.00 0.00 ? 87  GLU A CD   3  
ATOM 5783  O OE1  . GLU A 1 87  ? 17.833  7.637   12.513  1.00 0.00 ? 87  GLU A OE1  3  
ATOM 5784  O OE2  . GLU A 1 87  ? 18.441  9.435   11.423  1.00 0.00 ? 87  GLU A OE2  3  
ATOM 5785  H H    . GLU A 1 87  ? 14.924  6.572   8.149   1.00 0.00 ? 87  GLU A H    3  
ATOM 5786  H HA   . GLU A 1 87  ? 17.641  6.900   7.484   1.00 0.00 ? 87  GLU A HA   3  
ATOM 5787  H HB2  . GLU A 1 87  ? 16.543  8.155   9.282   1.00 0.00 ? 87  GLU A HB2  3  
ATOM 5788  H HB3  . GLU A 1 87  ? 16.309  6.672   10.197  1.00 0.00 ? 87  GLU A HB3  3  
ATOM 5789  H HG2  . GLU A 1 87  ? 18.729  6.428   10.432  1.00 0.00 ? 87  GLU A HG2  3  
ATOM 5790  H HG3  . GLU A 1 87  ? 18.970  7.909   9.502   1.00 0.00 ? 87  GLU A HG3  3  
ATOM 5791  N N    . VAL A 1 88  ? 16.833  4.071   8.974   1.00 0.00 ? 88  VAL A N    3  
ATOM 5792  C CA   . VAL A 1 88  ? 17.274  2.692   9.157   1.00 0.00 ? 88  VAL A CA   3  
ATOM 5793  C C    . VAL A 1 88  ? 17.569  2.062   7.797   1.00 0.00 ? 88  VAL A C    3  
ATOM 5794  O O    . VAL A 1 88  ? 18.533  1.309   7.636   1.00 0.00 ? 88  VAL A O    3  
ATOM 5795  C CB   . VAL A 1 88  ? 16.213  1.841   9.907   1.00 0.00 ? 88  VAL A CB   3  
ATOM 5796  C CG1  . VAL A 1 88  ? 16.684  0.394   10.069  1.00 0.00 ? 88  VAL A CG1  3  
ATOM 5797  C CG2  . VAL A 1 88  ? 15.887  2.460   11.266  1.00 0.00 ? 88  VAL A CG2  3  
ATOM 5798  H H    . VAL A 1 88  ? 15.923  4.327   9.239   1.00 0.00 ? 88  VAL A H    3  
ATOM 5799  H HA   . VAL A 1 88  ? 18.184  2.705   9.745   1.00 0.00 ? 88  VAL A HA   3  
ATOM 5800  H HB   . VAL A 1 88  ? 15.306  1.834   9.316   1.00 0.00 ? 88  VAL A HB   3  
ATOM 5801  H HG11 . VAL A 1 88  ? 17.605  0.373   10.637  1.00 0.00 ? 88  VAL A HG11 3  
ATOM 5802  H HG12 . VAL A 1 88  ? 16.852  -0.044  9.097   1.00 0.00 ? 88  VAL A HG12 3  
ATOM 5803  H HG13 . VAL A 1 88  ? 15.928  -0.176  10.592  1.00 0.00 ? 88  VAL A HG13 3  
ATOM 5804  H HG21 . VAL A 1 88  ? 16.786  2.507   11.866  1.00 0.00 ? 88  VAL A HG21 3  
ATOM 5805  H HG22 . VAL A 1 88  ? 15.149  1.856   11.772  1.00 0.00 ? 88  VAL A HG22 3  
ATOM 5806  H HG23 . VAL A 1 88  ? 15.499  3.457   11.124  1.00 0.00 ? 88  VAL A HG23 3  
ATOM 5807  N N    . ILE A 1 89  ? 16.741  2.405   6.812   1.00 0.00 ? 89  ILE A N    3  
ATOM 5808  C CA   . ILE A 1 89  ? 16.889  1.884   5.458   1.00 0.00 ? 89  ILE A CA   3  
ATOM 5809  C C    . ILE A 1 89  ? 18.182  2.386   4.808   1.00 0.00 ? 89  ILE A C    3  
ATOM 5810  O O    . ILE A 1 89  ? 18.873  1.622   4.133   1.00 0.00 ? 89  ILE A O    3  
ATOM 5811  C CB   . ILE A 1 89  ? 15.673  2.264   4.574   1.00 0.00 ? 89  ILE A CB   3  
ATOM 5812  C CG1  . ILE A 1 89  ? 14.383  1.658   5.159   1.00 0.00 ? 89  ILE A CG1  3  
ATOM 5813  C CG2  . ILE A 1 89  ? 15.883  1.800   3.132   1.00 0.00 ? 89  ILE A CG2  3  
ATOM 5814  C CD1  . ILE A 1 89  ? 13.123  2.025   4.401   1.00 0.00 ? 89  ILE A CD1  3  
ATOM 5815  H H    . ILE A 1 89  ? 16.006  3.027   7.007   1.00 0.00 ? 89  ILE A H    3  
ATOM 5816  H HA   . ILE A 1 89  ? 16.931  0.804   5.524   1.00 0.00 ? 89  ILE A HA   3  
ATOM 5817  H HB   . ILE A 1 89  ? 15.585  3.341   4.570   1.00 0.00 ? 89  ILE A HB   3  
ATOM 5818  H HG12 . ILE A 1 89  ? 14.464  0.581   5.154   1.00 0.00 ? 89  ILE A HG12 3  
ATOM 5819  H HG13 . ILE A 1 89  ? 14.265  1.997   6.180   1.00 0.00 ? 89  ILE A HG13 3  
ATOM 5820  H HG21 . ILE A 1 89  ? 15.993  0.726   3.110   1.00 0.00 ? 89  ILE A HG21 3  
ATOM 5821  H HG22 . ILE A 1 89  ? 16.773  2.261   2.730   1.00 0.00 ? 89  ILE A HG22 3  
ATOM 5822  H HG23 . ILE A 1 89  ? 15.031  2.088   2.533   1.00 0.00 ? 89  ILE A HG23 3  
ATOM 5823  H HD11 . ILE A 1 89  ? 12.268  1.577   4.884   1.00 0.00 ? 89  ILE A HD11 3  
ATOM 5824  H HD12 . ILE A 1 89  ? 13.193  1.662   3.385   1.00 0.00 ? 89  ILE A HD12 3  
ATOM 5825  H HD13 . ILE A 1 89  ? 13.006  3.101   4.391   1.00 0.00 ? 89  ILE A HD13 3  
ATOM 5826  N N    . THR A 1 90  ? 18.521  3.658   5.025   1.00 0.00 ? 90  THR A N    3  
ATOM 5827  C CA   . THR A 1 90  ? 19.742  4.229   4.458   1.00 0.00 ? 90  THR A CA   3  
ATOM 5828  C C    . THR A 1 90  ? 20.969  3.496   4.992   1.00 0.00 ? 90  THR A C    3  
ATOM 5829  O O    . THR A 1 90  ? 21.945  3.286   4.272   1.00 0.00 ? 90  THR A O    3  
ATOM 5830  C CB   . THR A 1 90  ? 19.867  5.746   4.754   1.00 0.00 ? 90  THR A CB   3  
ATOM 5831  O OG1  . THR A 1 90  ? 19.746  5.984   6.159   1.00 0.00 ? 90  THR A OG1  3  
ATOM 5832  C CG2  . THR A 1 90  ? 18.803  6.548   4.009   1.00 0.00 ? 90  THR A CG2  3  
ATOM 5833  H H    . THR A 1 90  ? 17.943  4.222   5.581   1.00 0.00 ? 90  THR A H    3  
ATOM 5834  H HA   . THR A 1 90  ? 19.699  4.096   3.384   1.00 0.00 ? 90  THR A HA   3  
ATOM 5835  H HB   . THR A 1 90  ? 20.842  6.082   4.425   1.00 0.00 ? 90  THR A HB   3  
ATOM 5836  H HG1  . THR A 1 90  ? 19.724  6.932   6.323   1.00 0.00 ? 90  THR A HG1  3  
ATOM 5837  H HG21 . THR A 1 90  ? 17.820  6.196   4.289   1.00 0.00 ? 90  THR A HG21 3  
ATOM 5838  H HG22 . THR A 1 90  ? 18.939  6.425   2.945   1.00 0.00 ? 90  THR A HG22 3  
ATOM 5839  H HG23 . THR A 1 90  ? 18.895  7.594   4.262   1.00 0.00 ? 90  THR A HG23 3  
ATOM 5840  N N    . ASN A 1 91  ? 20.906  3.095   6.257   1.00 0.00 ? 91  ASN A N    3  
ATOM 5841  C CA   . ASN A 1 91  ? 21.969  2.293   6.868   1.00 0.00 ? 91  ASN A CA   3  
ATOM 5842  C C    . ASN A 1 91  ? 21.930  0.850   6.353   1.00 0.00 ? 91  ASN A C    3  
ATOM 5843  O O    . ASN A 1 91  ? 22.960  0.181   6.273   1.00 0.00 ? 91  ASN A O    3  
ATOM 5844  C CB   . ASN A 1 91  ? 21.847  2.307   8.401   1.00 0.00 ? 91  ASN A CB   3  
ATOM 5845  C CG   . ASN A 1 91  ? 22.329  3.609   9.027   1.00 0.00 ? 91  ASN A CG   3  
ATOM 5846  O OD1  . ASN A 1 91  ? 23.490  3.732   9.420   1.00 0.00 ? 91  ASN A OD1  3  
ATOM 5847  N ND2  . ASN A 1 91  ? 21.448  4.593   9.125   1.00 0.00 ? 91  ASN A ND2  3  
ATOM 5848  H H    . ASN A 1 91  ? 20.129  3.360   6.802   1.00 0.00 ? 91  ASN A H    3  
ATOM 5849  H HA   . ASN A 1 91  ? 22.916  2.733   6.587   1.00 0.00 ? 91  ASN A HA   3  
ATOM 5850  H HB2  . ASN A 1 91  ? 20.811  2.161   8.675   1.00 0.00 ? 91  ASN A HB2  3  
ATOM 5851  H HB3  . ASN A 1 91  ? 22.433  1.495   8.811   1.00 0.00 ? 91  ASN A HB3  3  
ATOM 5852  H HD21 . ASN A 1 91  ? 20.537  4.436   8.796   1.00 0.00 ? 91  ASN A HD21 3  
ATOM 5853  H HD22 . ASN A 1 91  ? 21.742  5.440   9.517   1.00 0.00 ? 91  ASN A HD22 3  
ATOM 5854  N N    . SER A 1 92  ? 20.739  0.381   5.990   1.00 0.00 ? 92  SER A N    3  
ATOM 5855  C CA   . SER A 1 92  ? 20.550  -1.010  5.571   1.00 0.00 ? 92  SER A CA   3  
ATOM 5856  C C    . SER A 1 92  ? 20.623  -1.172  4.048   1.00 0.00 ? 92  SER A C    3  
ATOM 5857  O O    . SER A 1 92  ? 20.548  -2.290  3.538   1.00 0.00 ? 92  SER A O    3  
ATOM 5858  C CB   . SER A 1 92  ? 19.200  -1.520  6.085   1.00 0.00 ? 92  SER A CB   3  
ATOM 5859  O OG   . SER A 1 92  ? 19.131  -1.432  7.501   1.00 0.00 ? 92  SER A OG   3  
ATOM 5860  H H    . SER A 1 92  ? 19.965  0.981   6.008   1.00 0.00 ? 92  SER A H    3  
ATOM 5861  H HA   . SER A 1 92  ? 21.335  -1.602  6.017   1.00 0.00 ? 92  SER A HA   3  
ATOM 5862  H HB2  . SER A 1 92  ? 18.405  -0.924  5.662   1.00 0.00 ? 92  SER A HB2  3  
ATOM 5863  H HB3  . SER A 1 92  ? 19.071  -2.553  5.795   1.00 0.00 ? 92  SER A HB3  3  
ATOM 5864  H HG   . SER A 1 92  ? 19.135  -0.502  7.763   1.00 0.00 ? 92  SER A HG   3  
ATOM 5865  N N    . ILE A 1 93  ? 20.785  -0.066  3.323   1.00 0.00 ? 93  ILE A N    3  
ATOM 5866  C CA   . ILE A 1 93  ? 20.808  -0.104  1.857   1.00 0.00 ? 93  ILE A CA   3  
ATOM 5867  C C    . ILE A 1 93  ? 21.970  -0.965  1.350   1.00 0.00 ? 93  ILE A C    3  
ATOM 5868  O O    . ILE A 1 93  ? 21.896  -1.555  0.270   1.00 0.00 ? 93  ILE A O    3  
ATOM 5869  C CB   . ILE A 1 93  ? 20.903  1.325   1.245   1.00 0.00 ? 93  ILE A CB   3  
ATOM 5870  C CG1  . ILE A 1 93  ? 20.645  1.300   -0.275  1.00 0.00 ? 93  ILE A CG1  3  
ATOM 5871  C CG2  . ILE A 1 93  ? 22.266  1.952   1.542   1.00 0.00 ? 93  ILE A CG2  3  
ATOM 5872  C CD1  . ILE A 1 93  ? 19.291  0.734   -0.660  1.00 0.00 ? 93  ILE A CD1  3  
ATOM 5873  H H    . ILE A 1 93  ? 20.878  0.796   3.782   1.00 0.00 ? 93  ILE A H    3  
ATOM 5874  H HA   . ILE A 1 93  ? 19.878  -0.551  1.528   1.00 0.00 ? 93  ILE A HA   3  
ATOM 5875  H HB   . ILE A 1 93  ? 20.148  1.939   1.718   1.00 0.00 ? 93  ILE A HB   3  
ATOM 5876  H HG12 . ILE A 1 93  ? 20.696  2.309   -0.658  1.00 0.00 ? 93  ILE A HG12 3  
ATOM 5877  H HG13 . ILE A 1 93  ? 21.405  0.702   -0.760  1.00 0.00 ? 93  ILE A HG13 3  
ATOM 5878  H HG21 . ILE A 1 93  ? 23.045  1.361   1.081   1.00 0.00 ? 93  ILE A HG21 3  
ATOM 5879  H HG22 . ILE A 1 93  ? 22.424  1.981   2.611   1.00 0.00 ? 93  ILE A HG22 3  
ATOM 5880  H HG23 . ILE A 1 93  ? 22.295  2.958   1.148   1.00 0.00 ? 93  ILE A HG23 3  
ATOM 5881  H HD11 . ILE A 1 93  ? 18.511  1.325   -0.203  1.00 0.00 ? 93  ILE A HD11 3  
ATOM 5882  H HD12 . ILE A 1 93  ? 19.217  -0.288  -0.319  1.00 0.00 ? 93  ILE A HD12 3  
ATOM 5883  H HD13 . ILE A 1 93  ? 19.182  0.763   -1.734  1.00 0.00 ? 93  ILE A HD13 3  
ATOM 5884  N N    . THR A 1 94  ? 23.032  -1.047  2.149   1.00 0.00 ? 94  THR A N    3  
ATOM 5885  C CA   . THR A 1 94  ? 24.222  -1.808  1.780   1.00 0.00 ? 94  THR A CA   3  
ATOM 5886  C C    . THR A 1 94  ? 24.010  -3.310  2.009   1.00 0.00 ? 94  THR A C    3  
ATOM 5887  O O    . THR A 1 94  ? 24.734  -4.140  1.456   1.00 0.00 ? 94  THR A O    3  
ATOM 5888  C CB   . THR A 1 94  ? 25.458  -1.319  2.577   1.00 0.00 ? 94  THR A CB   3  
ATOM 5889  O OG1  . THR A 1 94  ? 26.654  -1.933  2.073   1.00 0.00 ? 94  THR A OG1  3  
ATOM 5890  C CG2  . THR A 1 94  ? 25.317  -1.623  4.067   1.00 0.00 ? 94  THR A CG2  3  
ATOM 5891  H H    . THR A 1 94  ? 23.016  -0.579  3.010   1.00 0.00 ? 94  THR A H    3  
ATOM 5892  H HA   . THR A 1 94  ? 24.410  -1.640  0.729   1.00 0.00 ? 94  THR A HA   3  
ATOM 5893  H HB   . THR A 1 94  ? 25.541  -0.248  2.454   1.00 0.00 ? 94  THR A HB   3  
ATOM 5894  H HG1  . THR A 1 94  ? 26.624  -2.885  2.242   1.00 0.00 ? 94  THR A HG1  3  
ATOM 5895  H HG21 . THR A 1 94  ? 24.431  -1.139  4.453   1.00 0.00 ? 94  THR A HG21 3  
ATOM 5896  H HG22 . THR A 1 94  ? 26.184  -1.254  4.594   1.00 0.00 ? 94  THR A HG22 3  
ATOM 5897  H HG23 . THR A 1 94  ? 25.237  -2.691  4.213   1.00 0.00 ? 94  THR A HG23 3  
ATOM 5898  N N    . GLN A 1 95  ? 23.007  -3.651  2.820   1.00 0.00 ? 95  GLN A N    3  
ATOM 5899  C CA   . GLN A 1 95  ? 22.691  -5.046  3.138   1.00 0.00 ? 95  GLN A CA   3  
ATOM 5900  C C    . GLN A 1 95  ? 21.175  -5.249  3.185   1.00 0.00 ? 95  GLN A C    3  
ATOM 5901  O O    . GLN A 1 95  ? 20.585  -5.326  4.264   1.00 0.00 ? 95  GLN A O    3  
ATOM 5902  C CB   . GLN A 1 95  ? 23.323  -5.463  4.481   1.00 0.00 ? 95  GLN A CB   3  
ATOM 5903  C CG   . GLN A 1 95  ? 24.840  -5.647  4.436   1.00 0.00 ? 95  GLN A CG   3  
ATOM 5904  C CD   . GLN A 1 95  ? 25.276  -6.812  3.555   1.00 0.00 ? 95  GLN A CD   3  
ATOM 5905  O OE1  . GLN A 1 95  ? 26.351  -6.784  2.954   1.00 0.00 ? 95  GLN A OE1  3  
ATOM 5906  N NE2  . GLN A 1 95  ? 24.454  -7.850  3.478   1.00 0.00 ? 95  GLN A NE2  3  
ATOM 5907  H H    . GLN A 1 95  ? 22.450  -2.944  3.207   1.00 0.00 ? 95  GLN A H    3  
ATOM 5908  H HA   . GLN A 1 95  ? 23.096  -5.668  2.350   1.00 0.00 ? 95  GLN A HA   3  
ATOM 5909  H HB2  . GLN A 1 95  ? 23.101  -4.704  5.219   1.00 0.00 ? 95  GLN A HB2  3  
ATOM 5910  H HB3  . GLN A 1 95  ? 22.880  -6.396  4.799   1.00 0.00 ? 95  GLN A HB3  3  
ATOM 5911  H HG2  . GLN A 1 95  ? 25.289  -4.742  4.052   1.00 0.00 ? 95  GLN A HG2  3  
ATOM 5912  H HG3  . GLN A 1 95  ? 25.197  -5.824  5.440   1.00 0.00 ? 95  GLN A HG3  3  
ATOM 5913  H HE21 . GLN A 1 95  ? 23.616  -7.821  3.985   1.00 0.00 ? 95  GLN A HE21 3  
ATOM 5914  H HE22 . GLN A 1 95  ? 24.720  -8.610  2.918   1.00 0.00 ? 95  GLN A HE22 3  
ATOM 5915  N N    . PRO A 1 96  ? 20.517  -5.303  2.013   1.00 0.00 ? 96  PRO A N    3  
ATOM 5916  C CA   . PRO A 1 96  ? 19.072  -5.528  1.934   1.00 0.00 ? 96  PRO A CA   3  
ATOM 5917  C C    . PRO A 1 96  ? 18.711  -6.990  2.211   1.00 0.00 ? 96  PRO A C    3  
ATOM 5918  O O    . PRO A 1 96  ? 19.442  -7.907  1.822   1.00 0.00 ? 96  PRO A O    3  
ATOM 5919  C CB   . PRO A 1 96  ? 18.733  -5.134  0.491   1.00 0.00 ? 96  PRO A CB   3  
ATOM 5920  C CG   . PRO A 1 96  ? 19.985  -5.402  -0.276  1.00 0.00 ? 96  PRO A CG   3  
ATOM 5921  C CD   . PRO A 1 96  ? 21.126  -5.139  0.676   1.00 0.00 ? 96  PRO A CD   3  
ATOM 5922  H HA   . PRO A 1 96  ? 18.536  -4.889  2.623   1.00 0.00 ? 96  PRO A HA   3  
ATOM 5923  H HB2  . PRO A 1 96  ? 17.908  -5.736  0.129   1.00 0.00 ? 96  PRO A HB2  3  
ATOM 5924  H HB3  . PRO A 1 96  ? 18.462  -4.088  0.453   1.00 0.00 ? 96  PRO A HB3  3  
ATOM 5925  H HG2  . PRO A 1 96  ? 20.001  -6.432  -0.605  1.00 0.00 ? 96  PRO A HG2  3  
ATOM 5926  H HG3  . PRO A 1 96  ? 20.045  -4.737  -1.127  1.00 0.00 ? 96  PRO A HG3  3  
ATOM 5927  H HD2  . PRO A 1 96  ? 21.919  -5.857  0.524   1.00 0.00 ? 96  PRO A HD2  3  
ATOM 5928  H HD3  . PRO A 1 96  ? 21.501  -4.133  0.547   1.00 0.00 ? 96  PRO A HD3  3  
ATOM 5929  N N    . THR A 1 97  ? 17.590  -7.198  2.891   1.00 0.00 ? 97  THR A N    3  
ATOM 5930  C CA   . THR A 1 97  ? 17.131  -8.534  3.254   1.00 0.00 ? 97  THR A CA   3  
ATOM 5931  C C    . THR A 1 97  ? 15.659  -8.699  2.850   1.00 0.00 ? 97  THR A C    3  
ATOM 5932  O O    . THR A 1 97  ? 14.988  -7.716  2.522   1.00 0.00 ? 97  THR A O    3  
ATOM 5933  C CB   . THR A 1 97  ? 17.320  -8.775  4.776   1.00 0.00 ? 97  THR A CB   3  
ATOM 5934  O OG1  . THR A 1 97  ? 18.579  -8.230  5.198   1.00 0.00 ? 97  THR A OG1  3  
ATOM 5935  C CG2  . THR A 1 97  ? 17.289  -10.261 5.128   1.00 0.00 ? 97  THR A CG2  3  
ATOM 5936  H H    . THR A 1 97  ? 17.046  -6.426  3.158   1.00 0.00 ? 97  THR A H    3  
ATOM 5937  H HA   . THR A 1 97  ? 17.727  -9.259  2.712   1.00 0.00 ? 97  THR A HA   3  
ATOM 5938  H HB   . THR A 1 97  ? 16.525  -8.273  5.309   1.00 0.00 ? 97  THR A HB   3  
ATOM 5939  H HG1  . THR A 1 97  ? 18.580  -7.276  5.053   1.00 0.00 ? 97  THR A HG1  3  
ATOM 5940  H HG21 . THR A 1 97  ? 16.299  -10.655 4.956   1.00 0.00 ? 97  THR A HG21 3  
ATOM 5941  H HG22 . THR A 1 97  ? 17.550  -10.390 6.169   1.00 0.00 ? 97  THR A HG22 3  
ATOM 5942  H HG23 . THR A 1 97  ? 18.001  -10.793 4.512   1.00 0.00 ? 97  THR A HG23 3  
ATOM 5943  N N    . LEU A 1 98  ? 15.156  -9.933  2.894   1.00 0.00 ? 98  LEU A N    3  
ATOM 5944  C CA   . LEU A 1 98  ? 13.841  -10.274 2.340   1.00 0.00 ? 98  LEU A CA   3  
ATOM 5945  C C    . LEU A 1 98  ? 12.664  -9.587  3.057   1.00 0.00 ? 98  LEU A C    3  
ATOM 5946  O O    . LEU A 1 98  ? 11.507  -9.859  2.725   1.00 0.00 ? 98  LEU A O    3  
ATOM 5947  C CB   . LEU A 1 98  ? 13.633  -11.802 2.348   1.00 0.00 ? 98  LEU A CB   3  
ATOM 5948  C CG   . LEU A 1 98  ? 14.526  -12.617 1.388   1.00 0.00 ? 98  LEU A CG   3  
ATOM 5949  C CD1  . LEU A 1 98  ? 14.422  -12.087 -0.040  1.00 0.00 ? 98  LEU A CD1  3  
ATOM 5950  C CD2  . LEU A 1 98  ? 15.981  -12.633 1.857   1.00 0.00 ? 98  LEU A CD2  3  
ATOM 5951  H H    . LEU A 1 98  ? 15.689  -10.643 3.303   1.00 0.00 ? 98  LEU A H    3  
ATOM 5952  H HA   . LEU A 1 98  ? 13.838  -9.944  1.311   1.00 0.00 ? 98  LEU A HA   3  
ATOM 5953  H HB2  . LEU A 1 98  ? 13.806  -12.160 3.356   1.00 0.00 ? 98  LEU A HB2  3  
ATOM 5954  H HB3  . LEU A 1 98  ? 12.602  -12.001 2.093   1.00 0.00 ? 98  LEU A HB3  3  
ATOM 5955  H HG   . LEU A 1 98  ? 14.175  -13.640 1.377   1.00 0.00 ? 98  LEU A HG   3  
ATOM 5956  H HD11 . LEU A 1 98  ? 13.394  -12.135 -0.369  1.00 0.00 ? 98  LEU A HD11 3  
ATOM 5957  H HD12 . LEU A 1 98  ? 15.035  -12.690 -0.695  1.00 0.00 ? 98  LEU A HD12 3  
ATOM 5958  H HD13 . LEU A 1 98  ? 14.764  -11.061 -0.073  1.00 0.00 ? 98  LEU A HD13 3  
ATOM 5959  H HD21 . LEU A 1 98  ? 16.368  -11.623 1.876   1.00 0.00 ? 98  LEU A HD21 3  
ATOM 5960  H HD22 . LEU A 1 98  ? 16.572  -13.231 1.178   1.00 0.00 ? 98  LEU A HD22 3  
ATOM 5961  H HD23 . LEU A 1 98  ? 16.036  -13.058 2.848   1.00 0.00 ? 98  LEU A HD23 3  
ATOM 5962  N N    . HIS A 1 99  ? 12.933  -8.716  4.029   1.00 0.00 ? 99  HIS A N    3  
ATOM 5963  C CA   . HIS A 1 99  ? 11.862  -7.938  4.664   1.00 0.00 ? 99  HIS A CA   3  
ATOM 5964  C C    . HIS A 1 99  ? 12.394  -6.657  5.308   1.00 0.00 ? 99  HIS A C    3  
ATOM 5965  O O    . HIS A 1 99  ? 11.718  -6.065  6.140   1.00 0.00 ? 99  HIS A O    3  
ATOM 5966  C CB   . HIS A 1 99  ? 11.113  -8.786  5.716   1.00 0.00 ? 99  HIS A CB   3  
ATOM 5967  C CG   . HIS A 1 99  ? 9.662   -9.017  5.392   1.00 0.00 ? 99  HIS A CG   3  
ATOM 5968  N ND1  . HIS A 1 99  ? 8.813   -8.008  4.979   1.00 0.00 ? 99  HIS A ND1  3  
ATOM 5969  C CD2  . HIS A 1 99  ? 8.917   -10.151 5.387   1.00 0.00 ? 99  HIS A CD2  3  
ATOM 5970  C CE1  . HIS A 1 99  ? 7.615   -8.509  4.736   1.00 0.00 ? 99  HIS A CE1  3  
ATOM 5971  N NE2  . HIS A 1 99  ? 7.652   -9.805  4.978   1.00 0.00 ? 99  HIS A NE2  3  
ATOM 5972  H H    . HIS A 1 99  ? 13.855  -8.612  4.347   1.00 0.00 ? 99  HIS A H    3  
ATOM 5973  H HA   . HIS A 1 99  ? 11.163  -7.655  3.885   1.00 0.00 ? 99  HIS A HA   3  
ATOM 5974  H HB2  . HIS A 1 99  ? 11.590  -9.751  5.797   1.00 0.00 ? 99  HIS A HB2  3  
ATOM 5975  H HB3  . HIS A 1 99  ? 11.161  -8.290  6.677   1.00 0.00 ? 99  HIS A HB3  3  
ATOM 5976  H HD1  . HIS A 1 99  ? 9.050   -7.062  4.893   1.00 0.00 ? 99  HIS A HD1  3  
ATOM 5977  H HD2  . HIS A 1 99  ? 9.256   -11.143 5.658   1.00 0.00 ? 99  HIS A HD2  3  
ATOM 5978  H HE1  . HIS A 1 99  ? 6.761   -7.959  4.361   1.00 0.00 ? 99  HIS A HE1  3  
ATOM 5979  H HE2  . HIS A 1 99  ? 6.876   -10.414 4.931   1.00 0.00 ? 99  HIS A HE2  3  
ATOM 5980  N N    . SER A 1 100 ? 13.577  -6.207  4.895   1.00 0.00 ? 100 SER A N    3  
ATOM 5981  C CA   . SER A 1 100 ? 14.193  -5.010  5.480   1.00 0.00 ? 100 SER A CA   3  
ATOM 5982  C C    . SER A 1 100 ? 13.261  -3.794  5.402   1.00 0.00 ? 100 SER A C    3  
ATOM 5983  O O    . SER A 1 100 ? 13.204  -2.977  6.323   1.00 0.00 ? 100 SER A O    3  
ATOM 5984  C CB   . SER A 1 100 ? 15.508  -4.698  4.761   1.00 0.00 ? 100 SER A CB   3  
ATOM 5985  O OG   . SER A 1 100 ? 16.382  -5.810  4.799   1.00 0.00 ? 100 SER A OG   3  
ATOM 5986  H H    . SER A 1 100 ? 14.055  -6.690  4.187   1.00 0.00 ? 100 SER A H    3  
ATOM 5987  H HA   . SER A 1 100 ? 14.406  -5.222  6.518   1.00 0.00 ? 100 SER A HA   3  
ATOM 5988  H HB2  . SER A 1 100 ? 15.304  -4.453  3.728   1.00 0.00 ? 100 SER A HB2  3  
ATOM 5989  H HB3  . SER A 1 100 ? 15.993  -3.858  5.241   1.00 0.00 ? 100 SER A HB3  3  
ATOM 5990  H HG   . SER A 1 100 ? 16.955  -5.740  5.574   1.00 0.00 ? 100 SER A HG   3  
ATOM 5991  N N    . PHE A 1 101 ? 12.521  -3.694  4.301   1.00 0.00 ? 101 PHE A N    3  
ATOM 5992  C CA   . PHE A 1 101 ? 11.660  -2.540  4.041   1.00 0.00 ? 101 PHE A CA   3  
ATOM 5993  C C    . PHE A 1 101 ? 10.252  -2.749  4.611   1.00 0.00 ? 101 PHE A C    3  
ATOM 5994  O O    . PHE A 1 101 ? 9.318   -2.027  4.252   1.00 0.00 ? 101 PHE A O    3  
ATOM 5995  C CB   . PHE A 1 101 ? 11.582  -2.279  2.526   1.00 0.00 ? 101 PHE A CB   3  
ATOM 5996  C CG   . PHE A 1 101 ? 12.896  -1.874  1.893   1.00 0.00 ? 101 PHE A CG   3  
ATOM 5997  C CD1  . PHE A 1 101 ? 13.960  -2.764  1.827   1.00 0.00 ? 101 PHE A CD1  3  
ATOM 5998  C CD2  . PHE A 1 101 ? 13.059  -0.605  1.355   1.00 0.00 ? 101 PHE A CD2  3  
ATOM 5999  C CE1  . PHE A 1 101 ? 15.157  -2.395  1.241   1.00 0.00 ? 101 PHE A CE1  3  
ATOM 6000  C CE2  . PHE A 1 101 ? 14.254  -0.233  0.768   1.00 0.00 ? 101 PHE A CE2  3  
ATOM 6001  C CZ   . PHE A 1 101 ? 15.304  -1.129  0.711   1.00 0.00 ? 101 PHE A CZ   3  
ATOM 6002  H H    . PHE A 1 101 ? 12.554  -4.418  3.643   1.00 0.00 ? 101 PHE A H    3  
ATOM 6003  H HA   . PHE A 1 101 ? 12.103  -1.677  4.520   1.00 0.00 ? 101 PHE A HA   3  
ATOM 6004  H HB2  . PHE A 1 101 ? 11.244  -3.178  2.032   1.00 0.00 ? 101 PHE A HB2  3  
ATOM 6005  H HB3  . PHE A 1 101 ? 10.867  -1.489  2.343   1.00 0.00 ? 101 PHE A HB3  3  
ATOM 6006  H HD1  . PHE A 1 101 ? 13.848  -3.756  2.242   1.00 0.00 ? 101 PHE A HD1  3  
ATOM 6007  H HD2  . PHE A 1 101 ? 12.241  0.099   1.396   1.00 0.00 ? 101 PHE A HD2  3  
ATOM 6008  H HE1  . PHE A 1 101 ? 15.977  -3.098  1.196   1.00 0.00 ? 101 PHE A HE1  3  
ATOM 6009  H HE2  . PHE A 1 101 ? 14.367  0.759   0.355   1.00 0.00 ? 101 PHE A HE2  3  
ATOM 6010  H HZ   . PHE A 1 101 ? 16.239  -0.839  0.253   1.00 0.00 ? 101 PHE A HZ   3  
ATOM 6011  N N    . ASP A 1 102 ? 10.105  -3.715  5.518   1.00 0.00 ? 102 ASP A N    3  
ATOM 6012  C CA   . ASP A 1 102 ? 8.796   -4.038  6.092   1.00 0.00 ? 102 ASP A CA   3  
ATOM 6013  C C    . ASP A 1 102 ? 8.322   -2.914  7.008   1.00 0.00 ? 102 ASP A C    3  
ATOM 6014  O O    . ASP A 1 102 ? 7.122   -2.661  7.129   1.00 0.00 ? 102 ASP A O    3  
ATOM 6015  C CB   . ASP A 1 102 ? 8.848   -5.357  6.877   1.00 0.00 ? 102 ASP A CB   3  
ATOM 6016  C CG   . ASP A 1 102 ? 9.458   -5.199  8.263   1.00 0.00 ? 102 ASP A CG   3  
ATOM 6017  O OD1  . ASP A 1 102 ? 10.586  -4.676  8.370   1.00 0.00 ? 102 ASP A OD1  3  
ATOM 6018  O OD2  . ASP A 1 102 ? 8.805   -5.597  9.252   1.00 0.00 ? 102 ASP A OD2  3  
ATOM 6019  H H    . ASP A 1 102 ? 10.895  -4.213  5.824   1.00 0.00 ? 102 ASP A H    3  
ATOM 6020  H HA   . ASP A 1 102 ? 8.092   -4.142  5.276   1.00 0.00 ? 102 ASP A HA   3  
ATOM 6021  H HB2  . ASP A 1 102 ? 7.843   -5.742  6.985   1.00 0.00 ? 102 ASP A HB2  3  
ATOM 6022  H HB3  . ASP A 1 102 ? 9.440   -6.073  6.323   1.00 0.00 ? 102 ASP A HB3  3  
ATOM 6023  N N    . ALA A 1 103 ? 9.271   -2.258  7.670   1.00 0.00 ? 103 ALA A N    3  
ATOM 6024  C CA   . ALA A 1 103 ? 8.966   -1.109  8.515   1.00 0.00 ? 103 ALA A CA   3  
ATOM 6025  C C    . ALA A 1 103 ? 8.338   0.000   7.678   1.00 0.00 ? 103 ALA A C    3  
ATOM 6026  O O    . ALA A 1 103 ? 7.340   0.610   8.071   1.00 0.00 ? 103 ALA A O    3  
ATOM 6027  C CB   . ALA A 1 103 ? 10.229  -0.613  9.210   1.00 0.00 ? 103 ALA A CB   3  
ATOM 6028  H H    . ALA A 1 103 ? 10.200  -2.569  7.602   1.00 0.00 ? 103 ALA A H    3  
ATOM 6029  H HA   . ALA A 1 103 ? 8.261   -1.426  9.273   1.00 0.00 ? 103 ALA A HA   3  
ATOM 6030  H HB1  . ALA A 1 103 ? 10.644  -1.406  9.815   1.00 0.00 ? 103 ALA A HB1  3  
ATOM 6031  H HB2  . ALA A 1 103 ? 9.987   0.231   9.841   1.00 0.00 ? 103 ALA A HB2  3  
ATOM 6032  H HB3  . ALA A 1 103 ? 10.954  -0.309  8.469   1.00 0.00 ? 103 ALA A HB3  3  
ATOM 6033  N N    . ALA A 1 104 ? 8.922   0.234   6.505   1.00 0.00 ? 104 ALA A N    3  
ATOM 6034  C CA   . ALA A 1 104 ? 8.404   1.220   5.563   1.00 0.00 ? 104 ALA A CA   3  
ATOM 6035  C C    . ALA A 1 104 ? 7.021   0.801   5.076   1.00 0.00 ? 104 ALA A C    3  
ATOM 6036  O O    . ALA A 1 104 ? 6.100   1.618   4.989   1.00 0.00 ? 104 ALA A O    3  
ATOM 6037  C CB   . ALA A 1 104 ? 9.361   1.383   4.388   1.00 0.00 ? 104 ALA A CB   3  
ATOM 6038  H H    . ALA A 1 104 ? 9.723   -0.275  6.265   1.00 0.00 ? 104 ALA A H    3  
ATOM 6039  H HA   . ALA A 1 104 ? 8.325   2.168   6.076   1.00 0.00 ? 104 ALA A HA   3  
ATOM 6040  H HB1  . ALA A 1 104 ? 10.336  1.673   4.755   1.00 0.00 ? 104 ALA A HB1  3  
ATOM 6041  H HB2  . ALA A 1 104 ? 8.989   2.147   3.720   1.00 0.00 ? 104 ALA A HB2  3  
ATOM 6042  H HB3  . ALA A 1 104 ? 9.445   0.448   3.853   1.00 0.00 ? 104 ALA A HB3  3  
ATOM 6043  N N    . GLN A 1 105 ? 6.893   -0.490  4.783   1.00 0.00 ? 105 GLN A N    3  
ATOM 6044  C CA   . GLN A 1 105 ? 5.630   -1.075  4.350   1.00 0.00 ? 105 GLN A CA   3  
ATOM 6045  C C    . GLN A 1 105 ? 4.543   -0.829  5.395   1.00 0.00 ? 105 GLN A C    3  
ATOM 6046  O O    . GLN A 1 105 ? 3.418   -0.464  5.061   1.00 0.00 ? 105 GLN A O    3  
ATOM 6047  C CB   . GLN A 1 105 ? 5.821   -2.582  4.097   1.00 0.00 ? 105 GLN A CB   3  
ATOM 6048  C CG   . GLN A 1 105 ? 4.553   -3.327  3.687   1.00 0.00 ? 105 GLN A CG   3  
ATOM 6049  C CD   . GLN A 1 105 ? 4.833   -4.748  3.221   1.00 0.00 ? 105 GLN A CD   3  
ATOM 6050  O OE1  . GLN A 1 105 ? 5.769   -5.399  3.688   1.00 0.00 ? 105 GLN A OE1  3  
ATOM 6051  N NE2  . GLN A 1 105 ? 4.032   -5.238  2.285   1.00 0.00 ? 105 GLN A NE2  3  
ATOM 6052  H H    . GLN A 1 105 ? 7.678   -1.071  4.862   1.00 0.00 ? 105 GLN A H    3  
ATOM 6053  H HA   . GLN A 1 105 ? 5.342   -0.595  3.425   1.00 0.00 ? 105 GLN A HA   3  
ATOM 6054  H HB2  . GLN A 1 105 ? 6.551   -2.707  3.310   1.00 0.00 ? 105 GLN A HB2  3  
ATOM 6055  H HB3  . GLN A 1 105 ? 6.205   -3.039  5.000   1.00 0.00 ? 105 GLN A HB3  3  
ATOM 6056  H HG2  . GLN A 1 105 ? 3.887   -3.371  4.539   1.00 0.00 ? 105 GLN A HG2  3  
ATOM 6057  H HG3  . GLN A 1 105 ? 4.071   -2.790  2.889   1.00 0.00 ? 105 GLN A HG3  3  
ATOM 6058  H HE21 . GLN A 1 105 ? 3.310   -4.667  1.948   1.00 0.00 ? 105 GLN A HE21 3  
ATOM 6059  H HE22 . GLN A 1 105 ? 4.196   -6.152  1.964   1.00 0.00 ? 105 GLN A HE22 3  
ATOM 6060  N N    . SER A 1 106 ? 4.909   -1.003  6.661   1.00 0.00 ? 106 SER A N    3  
ATOM 6061  C CA   . SER A 1 106 ? 3.985   -0.816  7.774   1.00 0.00 ? 106 SER A CA   3  
ATOM 6062  C C    . SER A 1 106 ? 3.504   0.633   7.849   1.00 0.00 ? 106 SER A C    3  
ATOM 6063  O O    . SER A 1 106 ? 2.299   0.897   7.853   1.00 0.00 ? 106 SER A O    3  
ATOM 6064  C CB   . SER A 1 106 ? 4.665   -1.218  9.093   1.00 0.00 ? 106 SER A CB   3  
ATOM 6065  O OG   . SER A 1 106 ? 3.790   -1.058  10.198  1.00 0.00 ? 106 SER A OG   3  
ATOM 6066  H H    . SER A 1 106 ? 5.831   -1.270  6.854   1.00 0.00 ? 106 SER A H    3  
ATOM 6067  H HA   . SER A 1 106 ? 3.133   -1.459  7.609   1.00 0.00 ? 106 SER A HA   3  
ATOM 6068  H HB2  . SER A 1 106 ? 4.965   -2.254  9.039   1.00 0.00 ? 106 SER A HB2  3  
ATOM 6069  H HB3  . SER A 1 106 ? 5.538   -0.602  9.249   1.00 0.00 ? 106 SER A HB3  3  
ATOM 6070  H HG   . SER A 1 106 ? 3.824   -1.850  10.748  1.00 0.00 ? 106 SER A HG   3  
ATOM 6071  N N    . ARG A 1 107 ? 4.455   1.570   7.881   1.00 0.00 ? 107 ARG A N    3  
ATOM 6072  C CA   . ARG A 1 107 ? 4.140   2.987   8.075   1.00 0.00 ? 107 ARG A CA   3  
ATOM 6073  C C    . ARG A 1 107 ? 3.173   3.505   7.013   1.00 0.00 ? 107 ARG A C    3  
ATOM 6074  O O    . ARG A 1 107 ? 2.210   4.200   7.327   1.00 0.00 ? 107 ARG A O    3  
ATOM 6075  C CB   . ARG A 1 107 ? 5.416   3.841   8.076   1.00 0.00 ? 107 ARG A CB   3  
ATOM 6076  C CG   . ARG A 1 107 ? 6.393   3.523   9.206   1.00 0.00 ? 107 ARG A CG   3  
ATOM 6077  C CD   . ARG A 1 107 ? 5.704   3.482   10.569  1.00 0.00 ? 107 ARG A CD   3  
ATOM 6078  N NE   . ARG A 1 107 ? 4.855   4.656   10.811  1.00 0.00 ? 107 ARG A NE   3  
ATOM 6079  C CZ   . ARG A 1 107 ? 4.140   4.846   11.921  1.00 0.00 ? 107 ARG A CZ   3  
ATOM 6080  N NH1  . ARG A 1 107 ? 4.228   3.988   12.933  1.00 0.00 ? 107 ARG A NH1  3  
ATOM 6081  N NH2  . ARG A 1 107 ? 3.341   5.903   12.021  1.00 0.00 ? 107 ARG A NH2  3  
ATOM 6082  H H    . ARG A 1 107 ? 5.391   1.300   7.768   1.00 0.00 ? 107 ARG A H    3  
ATOM 6083  H HA   . ARG A 1 107 ? 3.667   3.084   9.038   1.00 0.00 ? 107 ARG A HA   3  
ATOM 6084  H HB2  . ARG A 1 107 ? 5.931   3.695   7.136   1.00 0.00 ? 107 ARG A HB2  3  
ATOM 6085  H HB3  . ARG A 1 107 ? 5.136   4.884   8.159   1.00 0.00 ? 107 ARG A HB3  3  
ATOM 6086  H HG2  . ARG A 1 107 ? 6.847   2.560   9.016   1.00 0.00 ? 107 ARG A HG2  3  
ATOM 6087  H HG3  . ARG A 1 107 ? 7.164   4.282   9.226   1.00 0.00 ? 107 ARG A HG3  3  
ATOM 6088  H HD2  . ARG A 1 107 ? 5.091   2.592   10.622  1.00 0.00 ? 107 ARG A HD2  3  
ATOM 6089  H HD3  . ARG A 1 107 ? 6.464   3.435   11.338  1.00 0.00 ? 107 ARG A HD3  3  
ATOM 6090  H HE   . ARG A 1 107 ? 4.794   5.324   10.093  1.00 0.00 ? 107 ARG A HE   3  
ATOM 6091  H HH11 . ARG A 1 107 ? 4.838   3.192   12.870  1.00 0.00 ? 107 ARG A HH11 3  
ATOM 6092  H HH12 . ARG A 1 107 ? 3.681   4.128   13.763  1.00 0.00 ? 107 ARG A HH12 3  
ATOM 6093  H HH21 . ARG A 1 107 ? 3.278   6.560   11.264  1.00 0.00 ? 107 ARG A HH21 3  
ATOM 6094  H HH22 . ARG A 1 107 ? 2.791   6.044   12.852  1.00 0.00 ? 107 ARG A HH22 3  
ATOM 6095  N N    . VAL A 1 108 ? 3.427   3.153   5.762   1.00 0.00 ? 108 VAL A N    3  
ATOM 6096  C CA   . VAL A 1 108 ? 2.626   3.660   4.653   1.00 0.00 ? 108 VAL A CA   3  
ATOM 6097  C C    . VAL A 1 108 ? 1.280   2.932   4.565   1.00 0.00 ? 108 VAL A C    3  
ATOM 6098  O O    . VAL A 1 108 ? 0.250   3.542   4.266   1.00 0.00 ? 108 VAL A O    3  
ATOM 6099  C CB   . VAL A 1 108 ? 3.396   3.540   3.318   1.00 0.00 ? 108 VAL A CB   3  
ATOM 6100  C CG1  . VAL A 1 108 ? 2.581   4.110   2.163   1.00 0.00 ? 108 VAL A CG1  3  
ATOM 6101  C CG2  . VAL A 1 108 ? 4.750   4.241   3.426   1.00 0.00 ? 108 VAL A CG2  3  
ATOM 6102  H H    . VAL A 1 108 ? 4.166   2.536   5.576   1.00 0.00 ? 108 VAL A H    3  
ATOM 6103  H HA   . VAL A 1 108 ? 2.437   4.710   4.838   1.00 0.00 ? 108 VAL A HA   3  
ATOM 6104  H HB   . VAL A 1 108 ? 3.573   2.491   3.121   1.00 0.00 ? 108 VAL A HB   3  
ATOM 6105  H HG11 . VAL A 1 108 ? 1.651   3.565   2.074   1.00 0.00 ? 108 VAL A HG11 3  
ATOM 6106  H HG12 . VAL A 1 108 ? 3.140   4.014   1.243   1.00 0.00 ? 108 VAL A HG12 3  
ATOM 6107  H HG13 . VAL A 1 108 ? 2.368   5.153   2.348   1.00 0.00 ? 108 VAL A HG13 3  
ATOM 6108  H HG21 . VAL A 1 108 ? 5.336   3.776   4.206   1.00 0.00 ? 108 VAL A HG21 3  
ATOM 6109  H HG22 . VAL A 1 108 ? 4.602   5.284   3.664   1.00 0.00 ? 108 VAL A HG22 3  
ATOM 6110  H HG23 . VAL A 1 108 ? 5.276   4.158   2.485   1.00 0.00 ? 108 VAL A HG23 3  
ATOM 6111  N N    . TYR A 1 109 ? 1.292   1.631   4.844   1.00 0.00 ? 109 TYR A N    3  
ATOM 6112  C CA   . TYR A 1 109 ? 0.068   0.831   4.865   1.00 0.00 ? 109 TYR A CA   3  
ATOM 6113  C C    . TYR A 1 109 ? -0.907  1.366   5.917   1.00 0.00 ? 109 TYR A C    3  
ATOM 6114  O O    . TYR A 1 109 ? -2.071  1.646   5.614   1.00 0.00 ? 109 TYR A O    3  
ATOM 6115  C CB   . TYR A 1 109 ? 0.414   -0.645  5.130   1.00 0.00 ? 109 TYR A CB   3  
ATOM 6116  C CG   . TYR A 1 109 ? -0.725  -1.489  5.694   1.00 0.00 ? 109 TYR A CG   3  
ATOM 6117  C CD1  . TYR A 1 109 ? -1.639  -2.121  4.857   1.00 0.00 ? 109 TYR A CD1  3  
ATOM 6118  C CD2  . TYR A 1 109 ? -0.873  -1.661  7.070   1.00 0.00 ? 109 TYR A CD2  3  
ATOM 6119  C CE1  . TYR A 1 109 ? -2.665  -2.892  5.374   1.00 0.00 ? 109 TYR A CE1  3  
ATOM 6120  C CE2  . TYR A 1 109 ? -1.898  -2.429  7.589   1.00 0.00 ? 109 TYR A CE2  3  
ATOM 6121  C CZ   . TYR A 1 109 ? -2.790  -3.044  6.739   1.00 0.00 ? 109 TYR A CZ   3  
ATOM 6122  O OH   . TYR A 1 109 ? -3.813  -3.810  7.256   1.00 0.00 ? 109 TYR A OH   3  
ATOM 6123  H H    . TYR A 1 109 ? 2.148   1.194   5.044   1.00 0.00 ? 109 TYR A H    3  
ATOM 6124  H HA   . TYR A 1 109 ? -0.395  0.913   3.890   1.00 0.00 ? 109 TYR A HA   3  
ATOM 6125  H HB2  . TYR A 1 109 ? 0.728   -1.100  4.202   1.00 0.00 ? 109 TYR A HB2  3  
ATOM 6126  H HB3  . TYR A 1 109 ? 1.235   -0.687  5.827   1.00 0.00 ? 109 TYR A HB3  3  
ATOM 6127  H HD1  . TYR A 1 109 ? -1.543  -2.004  3.787   1.00 0.00 ? 109 TYR A HD1  3  
ATOM 6128  H HD2  . TYR A 1 109 ? -0.173  -1.178  7.738   1.00 0.00 ? 109 TYR A HD2  3  
ATOM 6129  H HE1  . TYR A 1 109 ? -3.364  -3.376  4.705   1.00 0.00 ? 109 TYR A HE1  3  
ATOM 6130  H HE2  . TYR A 1 109 ? -1.994  -2.546  8.659   1.00 0.00 ? 109 TYR A HE2  3  
ATOM 6131  H HH   . TYR A 1 109 ? -4.235  -3.330  7.983   1.00 0.00 ? 109 TYR A HH   3  
ATOM 6132  N N    . GLN A 1 110 ? -0.420  1.523   7.149   1.00 0.00 ? 110 GLN A N    3  
ATOM 6133  C CA   . GLN A 1 110 ? -1.251  2.000   8.253   1.00 0.00 ? 110 GLN A CA   3  
ATOM 6134  C C    . GLN A 1 110 ? -1.710  3.428   7.990   1.00 0.00 ? 110 GLN A C    3  
ATOM 6135  O O    . GLN A 1 110 ? -2.800  3.834   8.406   1.00 0.00 ? 110 GLN A O    3  
ATOM 6136  C CB   . GLN A 1 110 ? -0.479  1.921   9.587   1.00 0.00 ? 110 GLN A CB   3  
ATOM 6137  C CG   . GLN A 1 110 ? 0.681   2.916   9.726   1.00 0.00 ? 110 GLN A CG   3  
ATOM 6138  C CD   . GLN A 1 110 ? 0.268   4.290   10.250  1.00 0.00 ? 110 GLN A CD   3  
ATOM 6139  O OE1  . GLN A 1 110 ? 0.895   5.299   9.923   1.00 0.00 ? 110 GLN A OE1  3  
ATOM 6140  N NE2  . GLN A 1 110 ? -0.781  4.343   11.060  1.00 0.00 ? 110 GLN A NE2  3  
ATOM 6141  H H    . GLN A 1 110 ? 0.523   1.309   7.317   1.00 0.00 ? 110 GLN A H    3  
ATOM 6142  H HA   . GLN A 1 110 ? -2.121  1.360   8.312   1.00 0.00 ? 110 GLN A HA   3  
ATOM 6143  H HB2  . GLN A 1 110 ? -1.172  2.099   10.397  1.00 0.00 ? 110 GLN A HB2  3  
ATOM 6144  H HB3  . GLN A 1 110 ? -0.080  0.922   9.691   1.00 0.00 ? 110 GLN A HB3  3  
ATOM 6145  H HG2  . GLN A 1 110 ? 1.415   2.504   10.400  1.00 0.00 ? 110 GLN A HG2  3  
ATOM 6146  H HG3  . GLN A 1 110 ? 1.130   3.051   8.748   1.00 0.00 ? 110 GLN A HG3  3  
ATOM 6147  H HE21 . GLN A 1 110 ? -1.240  3.507   11.286  1.00 0.00 ? 110 GLN A HE21 3  
ATOM 6148  H HE22 . GLN A 1 110 ? -1.060  5.222   11.395  1.00 0.00 ? 110 GLN A HE22 3  
ATOM 6149  N N    . LEU A 1 111 ? -0.866  4.176   7.290   1.00 0.00 ? 111 LEU A N    3  
ATOM 6150  C CA   . LEU A 1 111 ? -1.114  5.581   7.012   1.00 0.00 ? 111 LEU A CA   3  
ATOM 6151  C C    . LEU A 1 111 ? -2.335  5.749   6.105   1.00 0.00 ? 111 LEU A C    3  
ATOM 6152  O O    . LEU A 1 111 ? -3.187  6.605   6.351   1.00 0.00 ? 111 LEU A O    3  
ATOM 6153  C CB   . LEU A 1 111 ? 0.135   6.204   6.377   1.00 0.00 ? 111 LEU A CB   3  
ATOM 6154  C CG   . LEU A 1 111 ? 0.101   7.725   6.209   1.00 0.00 ? 111 LEU A CG   3  
ATOM 6155  C CD1  . LEU A 1 111 ? -0.089  8.418   7.558   1.00 0.00 ? 111 LEU A CD1  3  
ATOM 6156  C CD2  . LEU A 1 111 ? 1.370   8.217   5.521   1.00 0.00 ? 111 LEU A CD2  3  
ATOM 6157  H H    . LEU A 1 111 ? -0.038  3.769   6.957   1.00 0.00 ? 111 LEU A H    3  
ATOM 6158  H HA   . LEU A 1 111 ? -1.310  6.074   7.954   1.00 0.00 ? 111 LEU A HA   3  
ATOM 6159  H HB2  . LEU A 1 111 ? 0.988   5.950   6.992   1.00 0.00 ? 111 LEU A HB2  3  
ATOM 6160  H HB3  . LEU A 1 111 ? 0.278   5.760   5.400   1.00 0.00 ? 111 LEU A HB3  3  
ATOM 6161  H HG   . LEU A 1 111 ? -0.735  7.981   5.585   1.00 0.00 ? 111 LEU A HG   3  
ATOM 6162  H HD11 . LEU A 1 111 ? 0.730   8.161   8.215   1.00 0.00 ? 111 LEU A HD11 3  
ATOM 6163  H HD12 . LEU A 1 111 ? -1.020  8.094   8.001   1.00 0.00 ? 111 LEU A HD12 3  
ATOM 6164  H HD13 . LEU A 1 111 ? -0.114  9.488   7.415   1.00 0.00 ? 111 LEU A HD13 3  
ATOM 6165  H HD21 . LEU A 1 111 ? 1.328   9.292   5.411   1.00 0.00 ? 111 LEU A HD21 3  
ATOM 6166  H HD22 . LEU A 1 111 ? 1.452   7.761   4.545   1.00 0.00 ? 111 LEU A HD22 3  
ATOM 6167  H HD23 . LEU A 1 111 ? 2.233   7.950   6.116   1.00 0.00 ? 111 LEU A HD23 3  
ATOM 6168  N N    . MET A 1 112 ? -2.430  4.919   5.064   1.00 0.00 ? 112 MET A N    3  
ATOM 6169  C CA   . MET A 1 112 ? -3.589  4.955   4.171   1.00 0.00 ? 112 MET A CA   3  
ATOM 6170  C C    . MET A 1 112 ? -4.800  4.370   4.884   1.00 0.00 ? 112 MET A C    3  
ATOM 6171  O O    . MET A 1 112 ? -5.933  4.808   4.681   1.00 0.00 ? 112 MET A O    3  
ATOM 6172  C CB   . MET A 1 112 ? -3.336  4.157   2.883   1.00 0.00 ? 112 MET A CB   3  
ATOM 6173  C CG   . MET A 1 112 ? -2.093  4.568   2.109   1.00 0.00 ? 112 MET A CG   3  
ATOM 6174  S SD   . MET A 1 112 ? -1.991  3.752   0.501   1.00 0.00 ? 112 MET A SD   3  
ATOM 6175  C CE   . MET A 1 112 ? -2.408  2.063   0.936   1.00 0.00 ? 112 MET A CE   3  
ATOM 6176  H H    . MET A 1 112 ? -1.712  4.271   4.899   1.00 0.00 ? 112 MET A H    3  
ATOM 6177  H HA   . MET A 1 112 ? -3.790  5.987   3.919   1.00 0.00 ? 112 MET A HA   3  
ATOM 6178  H HB2  . MET A 1 112 ? -3.239  3.112   3.138   1.00 0.00 ? 112 MET A HB2  3  
ATOM 6179  H HB3  . MET A 1 112 ? -4.191  4.275   2.231   1.00 0.00 ? 112 MET A HB3  3  
ATOM 6180  H HG2  . MET A 1 112 ? -2.114  5.638   1.954   1.00 0.00 ? 112 MET A HG2  3  
ATOM 6181  H HG3  . MET A 1 112 ? -1.217  4.306   2.686   1.00 0.00 ? 112 MET A HG3  3  
ATOM 6182  H HE1  . MET A 1 112 ? -3.411  2.029   1.337   1.00 0.00 ? 112 MET A HE1  3  
ATOM 6183  H HE2  . MET A 1 112 ? -1.711  1.698   1.677   1.00 0.00 ? 112 MET A HE2  3  
ATOM 6184  H HE3  . MET A 1 112 ? -2.353  1.441   0.054   1.00 0.00 ? 112 MET A HE3  3  
ATOM 6185  N N    . GLU A 1 113 ? -4.536  3.373   5.720   1.00 0.00 ? 113 GLU A N    3  
ATOM 6186  C CA   . GLU A 1 113 ? -5.574  2.671   6.460   1.00 0.00 ? 113 GLU A CA   3  
ATOM 6187  C C    . GLU A 1 113 ? -6.380  3.652   7.318   1.00 0.00 ? 113 GLU A C    3  
ATOM 6188  O O    . GLU A 1 113 ? -7.568  3.869   7.077   1.00 0.00 ? 113 GLU A O    3  
ATOM 6189  C CB   . GLU A 1 113 ? -4.917  1.569   7.313   1.00 0.00 ? 113 GLU A CB   3  
ATOM 6190  C CG   . GLU A 1 113 ? -5.883  0.610   8.007   1.00 0.00 ? 113 GLU A CG   3  
ATOM 6191  C CD   . GLU A 1 113 ? -6.510  1.181   9.270   1.00 0.00 ? 113 GLU A CD   3  
ATOM 6192  O OE1  . GLU A 1 113 ? -5.758  1.623   10.166  1.00 0.00 ? 113 GLU A OE1  3  
ATOM 6193  O OE2  . GLU A 1 113 ? -7.750  1.158   9.389   1.00 0.00 ? 113 GLU A OE2  3  
ATOM 6194  H H    . GLU A 1 113 ? -3.601  3.099   5.844   1.00 0.00 ? 113 GLU A H    3  
ATOM 6195  H HA   . GLU A 1 113 ? -6.238  2.210   5.741   1.00 0.00 ? 113 GLU A HA   3  
ATOM 6196  H HB2  . GLU A 1 113 ? -4.273  0.983   6.673   1.00 0.00 ? 113 GLU A HB2  3  
ATOM 6197  H HB3  . GLU A 1 113 ? -4.307  2.041   8.072   1.00 0.00 ? 113 GLU A HB3  3  
ATOM 6198  H HG2  . GLU A 1 113 ? -6.674  0.358   7.314   1.00 0.00 ? 113 GLU A HG2  3  
ATOM 6199  H HG3  . GLU A 1 113 ? -5.344  -0.292  8.269   1.00 0.00 ? 113 GLU A HG3  3  
ATOM 6200  N N    . GLN A 1 114 ? -5.706  4.282   8.277   1.00 0.00 ? 114 GLN A N    3  
ATOM 6201  C CA   . GLN A 1 114 ? -6.365  5.163   9.243   1.00 0.00 ? 114 GLN A CA   3  
ATOM 6202  C C    . GLN A 1 114 ? -7.180  6.265   8.557   1.00 0.00 ? 114 GLN A C    3  
ATOM 6203  O O    . GLN A 1 114 ? -8.156  6.767   9.122   1.00 0.00 ? 114 GLN A O    3  
ATOM 6204  C CB   . GLN A 1 114 ? -5.325  5.782   10.193  1.00 0.00 ? 114 GLN A CB   3  
ATOM 6205  C CG   . GLN A 1 114 ? -4.243  6.596   9.486   1.00 0.00 ? 114 GLN A CG   3  
ATOM 6206  C CD   . GLN A 1 114 ? -3.192  7.159   10.438  1.00 0.00 ? 114 GLN A CD   3  
ATOM 6207  O OE1  . GLN A 1 114 ? -2.028  7.315   10.073  1.00 0.00 ? 114 GLN A OE1  3  
ATOM 6208  N NE2  . GLN A 1 114 ? -3.592  7.482   11.659  1.00 0.00 ? 114 GLN A NE2  3  
ATOM 6209  H H    . GLN A 1 114 ? -4.736  4.154   8.337   1.00 0.00 ? 114 GLN A H    3  
ATOM 6210  H HA   . GLN A 1 114 ? -7.042  4.554   9.828   1.00 0.00 ? 114 GLN A HA   3  
ATOM 6211  H HB2  . GLN A 1 114 ? -5.833  6.429   10.894  1.00 0.00 ? 114 GLN A HB2  3  
ATOM 6212  H HB3  . GLN A 1 114 ? -4.842  4.985   10.743  1.00 0.00 ? 114 GLN A HB3  3  
ATOM 6213  H HG2  . GLN A 1 114 ? -3.746  5.962   8.767   1.00 0.00 ? 114 GLN A HG2  3  
ATOM 6214  H HG3  . GLN A 1 114 ? -4.714  7.420   8.969   1.00 0.00 ? 114 GLN A HG3  3  
ATOM 6215  H HE21 . GLN A 1 114 ? -4.535  7.346   11.896  1.00 0.00 ? 114 GLN A HE21 3  
ATOM 6216  H HE22 . GLN A 1 114 ? -2.927  7.847   12.280  1.00 0.00 ? 114 GLN A HE22 3  
ATOM 6217  N N    . ASP A 1 115 ? -6.793  6.626   7.337   1.00 0.00 ? 115 ASP A N    3  
ATOM 6218  C CA   . ASP A 1 115 ? -7.447  7.719   6.616   1.00 0.00 ? 115 ASP A CA   3  
ATOM 6219  C C    . ASP A 1 115 ? -8.389  7.198   5.526   1.00 0.00 ? 115 ASP A C    3  
ATOM 6220  O O    . ASP A 1 115 ? -9.611  7.210   5.689   1.00 0.00 ? 115 ASP A O    3  
ATOM 6221  C CB   . ASP A 1 115 ? -6.397  8.654   6.001   1.00 0.00 ? 115 ASP A CB   3  
ATOM 6222  C CG   . ASP A 1 115 ? -7.027  9.827   5.260   1.00 0.00 ? 115 ASP A CG   3  
ATOM 6223  O OD1  . ASP A 1 115 ? -7.351  10.846  5.913   1.00 0.00 ? 115 ASP A OD1  3  
ATOM 6224  O OD2  . ASP A 1 115 ? -7.204  9.738   4.027   1.00 0.00 ? 115 ASP A OD2  3  
ATOM 6225  H H    . ASP A 1 115 ? -6.055  6.146   6.907   1.00 0.00 ? 115 ASP A H    3  
ATOM 6226  H HA   . ASP A 1 115 ? -8.032  8.282   7.331   1.00 0.00 ? 115 ASP A HA   3  
ATOM 6227  H HB2  . ASP A 1 115 ? -5.766  9.044   6.788   1.00 0.00 ? 115 ASP A HB2  3  
ATOM 6228  H HB3  . ASP A 1 115 ? -5.788  8.094   5.305   1.00 0.00 ? 115 ASP A HB3  3  
ATOM 6229  N N    . SER A 1 116 ? -7.811  6.713   4.433   1.00 0.00 ? 116 SER A N    3  
ATOM 6230  C CA   . SER A 1 116 ? -8.572  6.371   3.231   1.00 0.00 ? 116 SER A CA   3  
ATOM 6231  C C    . SER A 1 116 ? -9.546  5.210   3.480   1.00 0.00 ? 116 SER A C    3  
ATOM 6232  O O    . SER A 1 116 ? -10.631 5.173   2.892   1.00 0.00 ? 116 SER A O    3  
ATOM 6233  C CB   . SER A 1 116 ? -7.606  6.037   2.080   1.00 0.00 ? 116 SER A CB   3  
ATOM 6234  O OG   . SER A 1 116 ? -8.289  5.919   0.840   1.00 0.00 ? 116 SER A OG   3  
ATOM 6235  H H    . SER A 1 116 ? -6.840  6.574   4.431   1.00 0.00 ? 116 SER A H    3  
ATOM 6236  H HA   . SER A 1 116 ? -9.147  7.243   2.955   1.00 0.00 ? 116 SER A HA   3  
ATOM 6237  H HB2  . SER A 1 116 ? -6.870  6.823   1.992   1.00 0.00 ? 116 SER A HB2  3  
ATOM 6238  H HB3  . SER A 1 116 ? -7.107  5.102   2.289   1.00 0.00 ? 116 SER A HB3  3  
ATOM 6239  H HG   . SER A 1 116 ? -8.321  6.784   0.406   1.00 0.00 ? 116 SER A HG   3  
ATOM 6240  N N    . TYR A 1 117 ? -9.183  4.283   4.371   1.00 0.00 ? 117 TYR A N    3  
ATOM 6241  C CA   . TYR A 1 117 ? -10.015 3.103   4.622   1.00 0.00 ? 117 TYR A CA   3  
ATOM 6242  C C    . TYR A 1 117 ? -11.370 3.501   5.209   1.00 0.00 ? 117 TYR A C    3  
ATOM 6243  O O    . TYR A 1 117 ? -12.405 2.950   4.829   1.00 0.00 ? 117 TYR A O    3  
ATOM 6244  C CB   . TYR A 1 117 ? -9.292  2.117   5.549   1.00 0.00 ? 117 TYR A CB   3  
ATOM 6245  C CG   . TYR A 1 117 ? -10.128 0.923   5.973   1.00 0.00 ? 117 TYR A CG   3  
ATOM 6246  C CD1  . TYR A 1 117 ? -10.675 0.055   5.032   1.00 0.00 ? 117 TYR A CD1  3  
ATOM 6247  C CD2  . TYR A 1 117 ? -10.369 0.663   7.319   1.00 0.00 ? 117 TYR A CD2  3  
ATOM 6248  C CE1  . TYR A 1 117 ? -11.435 -1.033  5.421   1.00 0.00 ? 117 TYR A CE1  3  
ATOM 6249  C CE2  . TYR A 1 117 ? -11.125 -0.422  7.713   1.00 0.00 ? 117 TYR A CE2  3  
ATOM 6250  C CZ   . TYR A 1 117 ? -11.655 -1.266  6.762   1.00 0.00 ? 117 TYR A CZ   3  
ATOM 6251  O OH   . TYR A 1 117 ? -12.412 -2.347  7.156   1.00 0.00 ? 117 TYR A OH   3  
ATOM 6252  H H    . TYR A 1 117 ? -8.347  4.400   4.880   1.00 0.00 ? 117 TYR A H    3  
ATOM 6253  H HA   . TYR A 1 117 ? -10.186 2.618   3.668   1.00 0.00 ? 117 TYR A HA   3  
ATOM 6254  H HB2  . TYR A 1 117 ? -8.414  1.738   5.041   1.00 0.00 ? 117 TYR A HB2  3  
ATOM 6255  H HB3  . TYR A 1 117 ? -8.986  2.645   6.445   1.00 0.00 ? 117 TYR A HB3  3  
ATOM 6256  H HD1  . TYR A 1 117 ? -10.500 0.239   3.983   1.00 0.00 ? 117 TYR A HD1  3  
ATOM 6257  H HD2  . TYR A 1 117 ? -9.953  1.325   8.065   1.00 0.00 ? 117 TYR A HD2  3  
ATOM 6258  H HE1  . TYR A 1 117 ? -11.851 -1.695  4.675   1.00 0.00 ? 117 TYR A HE1  3  
ATOM 6259  H HE2  . TYR A 1 117 ? -11.299 -0.605  8.765   1.00 0.00 ? 117 TYR A HE2  3  
ATOM 6260  H HH   . TYR A 1 117 ? -12.311 -3.058  6.513   1.00 0.00 ? 117 TYR A HH   3  
ATOM 6261  N N    . THR A 1 118 ? -11.364 4.468   6.125   1.00 0.00 ? 118 THR A N    3  
ATOM 6262  C CA   . THR A 1 118 ? -12.601 4.942   6.741   1.00 0.00 ? 118 THR A CA   3  
ATOM 6263  C C    . THR A 1 118 ? -13.523 5.534   5.673   1.00 0.00 ? 118 THR A C    3  
ATOM 6264  O O    . THR A 1 118 ? -14.723 5.233   5.614   1.00 0.00 ? 118 THR A O    3  
ATOM 6265  C CB   . THR A 1 118 ? -12.324 5.999   7.838   1.00 0.00 ? 118 THR A CB   3  
ATOM 6266  O OG1  . THR A 1 118 ? -11.693 7.156   7.265   1.00 0.00 ? 118 THR A OG1  3  
ATOM 6267  C CG2  . THR A 1 118 ? -11.432 5.429   8.938   1.00 0.00 ? 118 THR A CG2  3  
ATOM 6268  H H    . THR A 1 118 ? -10.511 4.872   6.387   1.00 0.00 ? 118 THR A H    3  
ATOM 6269  H HA   . THR A 1 118 ? -13.094 4.093   7.199   1.00 0.00 ? 118 THR A HA   3  
ATOM 6270  H HB   . THR A 1 118 ? -13.267 6.296   8.279   1.00 0.00 ? 118 THR A HB   3  
ATOM 6271  H HG1  . THR A 1 118 ? -10.740 7.015   7.219   1.00 0.00 ? 118 THR A HG1  3  
ATOM 6272  H HG21 . THR A 1 118 ? -11.914 4.570   9.385   1.00 0.00 ? 118 THR A HG21 3  
ATOM 6273  H HG22 . THR A 1 118 ? -11.265 6.181   9.695   1.00 0.00 ? 118 THR A HG22 3  
ATOM 6274  H HG23 . THR A 1 118 ? -10.484 5.129   8.515   1.00 0.00 ? 118 THR A HG23 3  
ATOM 6275  N N    . ARG A 1 119 ? -12.939 6.360   4.809   1.00 0.00 ? 119 ARG A N    3  
ATOM 6276  C CA   . ARG A 1 119 ? -13.670 6.949   3.697   1.00 0.00 ? 119 ARG A CA   3  
ATOM 6277  C C    . ARG A 1 119 ? -14.226 5.854   2.796   1.00 0.00 ? 119 ARG A C    3  
ATOM 6278  O O    . ARG A 1 119 ? -15.362 5.936   2.342   1.00 0.00 ? 119 ARG A O    3  
ATOM 6279  C CB   . ARG A 1 119 ? -12.769 7.879   2.880   1.00 0.00 ? 119 ARG A CB   3  
ATOM 6280  C CG   . ARG A 1 119 ? -12.238 9.080   3.654   1.00 0.00 ? 119 ARG A CG   3  
ATOM 6281  C CD   . ARG A 1 119 ? -11.468 10.024  2.741   1.00 0.00 ? 119 ARG A CD   3  
ATOM 6282  N NE   . ARG A 1 119 ? -12.309 10.532  1.651   1.00 0.00 ? 119 ARG A NE   3  
ATOM 6283  C CZ   . ARG A 1 119 ? -11.942 10.581  0.369   1.00 0.00 ? 119 ARG A CZ   3  
ATOM 6284  N NH1  . ARG A 1 119 ? -10.733 10.174  0.000   1.00 0.00 ? 119 ARG A NH1  3  
ATOM 6285  N NH2  . ARG A 1 119 ? -12.787 11.044  -0.544  1.00 0.00 ? 119 ARG A NH2  3  
ATOM 6286  H H    . ARG A 1 119 ? -11.990 6.576   4.927   1.00 0.00 ? 119 ARG A H    3  
ATOM 6287  H HA   . ARG A 1 119 ? -14.493 7.521   4.105   1.00 0.00 ? 119 ARG A HA   3  
ATOM 6288  H HB2  . ARG A 1 119 ? -11.923 7.311   2.517   1.00 0.00 ? 119 ARG A HB2  3  
ATOM 6289  H HB3  . ARG A 1 119 ? -13.331 8.247   2.032   1.00 0.00 ? 119 ARG A HB3  3  
ATOM 6290  H HG2  . ARG A 1 119 ? -13.070 9.614   4.091   1.00 0.00 ? 119 ARG A HG2  3  
ATOM 6291  H HG3  . ARG A 1 119 ? -11.578 8.732   4.438   1.00 0.00 ? 119 ARG A HG3  3  
ATOM 6292  H HD2  . ARG A 1 119 ? -11.110 10.860  3.325   1.00 0.00 ? 119 ARG A HD2  3  
ATOM 6293  H HD3  . ARG A 1 119 ? -10.626 9.494   2.320   1.00 0.00 ? 119 ARG A HD3  3  
ATOM 6294  H HE   . ARG A 1 119 ? -13.206 10.854  1.893   1.00 0.00 ? 119 ARG A HE   3  
ATOM 6295  H HH11 . ARG A 1 119 ? -10.082 9.832   0.685   1.00 0.00 ? 119 ARG A HH11 3  
ATOM 6296  H HH12 . ARG A 1 119 ? -10.467 10.193  -0.965  1.00 0.00 ? 119 ARG A HH12 3  
ATOM 6297  H HH21 . ARG A 1 119 ? -13.702 11.359  -0.273  1.00 0.00 ? 119 ARG A HH21 3  
ATOM 6298  H HH22 . ARG A 1 119 ? -12.517 11.082  -1.511  1.00 0.00 ? 119 ARG A HH22 3  
ATOM 6299  N N    . PHE A 1 120 ? -13.422 4.822   2.555   1.00 0.00 ? 120 PHE A N    3  
ATOM 6300  C CA   . PHE A 1 120 ? -13.838 3.704   1.716   1.00 0.00 ? 120 PHE A CA   3  
ATOM 6301  C C    . PHE A 1 120 ? -15.082 3.032   2.299   1.00 0.00 ? 120 PHE A C    3  
ATOM 6302  O O    . PHE A 1 120 ? -15.945 2.566   1.560   1.00 0.00 ? 120 PHE A O    3  
ATOM 6303  C CB   . PHE A 1 120 ? -12.701 2.685   1.565   1.00 0.00 ? 120 PHE A CB   3  
ATOM 6304  C CG   . PHE A 1 120 ? -13.027 1.549   0.624   1.00 0.00 ? 120 PHE A CG   3  
ATOM 6305  C CD1  . PHE A 1 120 ? -12.922 1.720   -0.750  1.00 0.00 ? 120 PHE A CD1  3  
ATOM 6306  C CD2  . PHE A 1 120 ? -13.440 0.315   1.109   1.00 0.00 ? 120 PHE A CD2  3  
ATOM 6307  C CE1  . PHE A 1 120 ? -13.220 0.686   -1.618  1.00 0.00 ? 120 PHE A CE1  3  
ATOM 6308  C CE2  . PHE A 1 120 ? -13.740 -0.720  0.246   1.00 0.00 ? 120 PHE A CE2  3  
ATOM 6309  C CZ   . PHE A 1 120 ? -13.630 -0.535  -1.120  1.00 0.00 ? 120 PHE A CZ   3  
ATOM 6310  H H    . PHE A 1 120 ? -12.522 4.817   2.947   1.00 0.00 ? 120 PHE A H    3  
ATOM 6311  H HA   . PHE A 1 120 ? -14.085 4.100   0.741   1.00 0.00 ? 120 PHE A HA   3  
ATOM 6312  H HB2  . PHE A 1 120 ? -11.824 3.189   1.186   1.00 0.00 ? 120 PHE A HB2  3  
ATOM 6313  H HB3  . PHE A 1 120 ? -12.474 2.263   2.534   1.00 0.00 ? 120 PHE A HB3  3  
ATOM 6314  H HD1  . PHE A 1 120 ? -12.602 2.676   -1.144  1.00 0.00 ? 120 PHE A HD1  3  
ATOM 6315  H HD2  . PHE A 1 120 ? -13.528 0.168   2.177   1.00 0.00 ? 120 PHE A HD2  3  
ATOM 6316  H HE1  . PHE A 1 120 ? -13.134 0.834   -2.684  1.00 0.00 ? 120 PHE A HE1  3  
ATOM 6317  H HE2  . PHE A 1 120 ? -14.060 -1.675  0.637   1.00 0.00 ? 120 PHE A HE2  3  
ATOM 6318  H HZ   . PHE A 1 120 ? -13.863 -1.345  -1.796  1.00 0.00 ? 120 PHE A HZ   3  
ATOM 6319  N N    . LEU A 1 121 ? -15.174 3.004   3.627   1.00 0.00 ? 121 LEU A N    3  
ATOM 6320  C CA   . LEU A 1 121 ? -16.325 2.411   4.309   1.00 0.00 ? 121 LEU A CA   3  
ATOM 6321  C C    . LEU A 1 121 ? -17.576 3.278   4.138   1.00 0.00 ? 121 LEU A C    3  
ATOM 6322  O O    . LEU A 1 121 ? -18.702 2.782   4.213   1.00 0.00 ? 121 LEU A O    3  
ATOM 6323  C CB   . LEU A 1 121 ? -16.021 2.203   5.802   1.00 0.00 ? 121 LEU A CB   3  
ATOM 6324  C CG   . LEU A 1 121 ? -14.875 1.225   6.107   1.00 0.00 ? 121 LEU A CG   3  
ATOM 6325  C CD1  . LEU A 1 121 ? -14.639 1.118   7.612   1.00 0.00 ? 121 LEU A CD1  3  
ATOM 6326  C CD2  . LEU A 1 121 ? -15.164 -0.151  5.505   1.00 0.00 ? 121 LEU A CD2  3  
ATOM 6327  H H    . LEU A 1 121 ? -14.445 3.387   4.164   1.00 0.00 ? 121 LEU A H    3  
ATOM 6328  H HA   . LEU A 1 121 ? -16.513 1.446   3.856   1.00 0.00 ? 121 LEU A HA   3  
ATOM 6329  H HB2  . LEU A 1 121 ? -15.774 3.164   6.233   1.00 0.00 ? 121 LEU A HB2  3  
ATOM 6330  H HB3  . LEU A 1 121 ? -16.917 1.834   6.281   1.00 0.00 ? 121 LEU A HB3  3  
ATOM 6331  H HG   . LEU A 1 121 ? -13.965 1.599   5.657   1.00 0.00 ? 121 LEU A HG   3  
ATOM 6332  H HD11 . LEU A 1 121 ? -14.383 2.092   8.006   1.00 0.00 ? 121 LEU A HD11 3  
ATOM 6333  H HD12 . LEU A 1 121 ? -13.828 0.431   7.803   1.00 0.00 ? 121 LEU A HD12 3  
ATOM 6334  H HD13 . LEU A 1 121 ? -15.536 0.760   8.095   1.00 0.00 ? 121 LEU A HD13 3  
ATOM 6335  H HD21 . LEU A 1 121 ? -14.348 -0.822  5.731   1.00 0.00 ? 121 LEU A HD21 3  
ATOM 6336  H HD22 . LEU A 1 121 ? -15.265 -0.063  4.432   1.00 0.00 ? 121 LEU A HD22 3  
ATOM 6337  H HD23 . LEU A 1 121 ? -16.080 -0.545  5.922   1.00 0.00 ? 121 LEU A HD23 3  
ATOM 6338  N N    . LYS A 1 122 ? -17.373 4.578   3.925   1.00 0.00 ? 122 LYS A N    3  
ATOM 6339  C CA   . LYS A 1 122 ? -18.487 5.506   3.696   1.00 0.00 ? 122 LYS A CA   3  
ATOM 6340  C C    . LYS A 1 122 ? -18.430 6.112   2.288   1.00 0.00 ? 122 LYS A C    3  
ATOM 6341  O O    . LYS A 1 122 ? -19.014 7.170   2.038   1.00 0.00 ? 122 LYS A O    3  
ATOM 6342  C CB   . LYS A 1 122 ? -18.480 6.625   4.754   1.00 0.00 ? 122 LYS A CB   3  
ATOM 6343  C CG   . LYS A 1 122 ? -18.669 6.132   6.190   1.00 0.00 ? 122 LYS A CG   3  
ATOM 6344  C CD   . LYS A 1 122 ? -19.937 5.290   6.352   1.00 0.00 ? 122 LYS A CD   3  
ATOM 6345  C CE   . LYS A 1 122 ? -21.204 6.056   5.976   1.00 0.00 ? 122 LYS A CE   3  
ATOM 6346  N NZ   . LYS A 1 122 ? -21.459 7.207   6.883   1.00 0.00 ? 122 LYS A NZ   3  
ATOM 6347  H H    . LYS A 1 122 ? -16.453 4.927   3.942   1.00 0.00 ? 122 LYS A H    3  
ATOM 6348  H HA   . LYS A 1 122 ? -19.409 4.948   3.787   1.00 0.00 ? 122 LYS A HA   3  
ATOM 6349  H HB2  . LYS A 1 122 ? -17.535 7.149   4.698   1.00 0.00 ? 122 LYS A HB2  3  
ATOM 6350  H HB3  . LYS A 1 122 ? -19.277 7.322   4.528   1.00 0.00 ? 122 LYS A HB3  3  
ATOM 6351  H HG2  . LYS A 1 122 ? -17.814 5.531   6.467   1.00 0.00 ? 122 LYS A HG2  3  
ATOM 6352  H HG3  . LYS A 1 122 ? -18.731 6.990   6.846   1.00 0.00 ? 122 LYS A HG3  3  
ATOM 6353  H HD2  . LYS A 1 122 ? -19.860 4.418   5.717   1.00 0.00 ? 122 LYS A HD2  3  
ATOM 6354  H HD3  . LYS A 1 122 ? -20.013 4.973   7.384   1.00 0.00 ? 122 LYS A HD3  3  
ATOM 6355  H HE2  . LYS A 1 122 ? -21.103 6.424   4.966   1.00 0.00 ? 122 LYS A HE2  3  
ATOM 6356  H HE3  . LYS A 1 122 ? -22.045 5.379   6.026   1.00 0.00 ? 122 LYS A HE3  3  
ATOM 6357  H HZ1  . LYS A 1 122 ? -20.687 7.902   6.815   1.00 0.00 ? 122 LYS A HZ1  3  
ATOM 6358  H HZ2  . LYS A 1 122 ? -21.527 6.881   7.866   1.00 0.00 ? 122 LYS A HZ2  3  
ATOM 6359  H HZ3  . LYS A 1 122 ? -22.352 7.672   6.625   1.00 0.00 ? 122 LYS A HZ3  3  
ATOM 6360  N N    . SER A 1 123 ? -17.732 5.441   1.376   1.00 0.00 ? 123 SER A N    3  
ATOM 6361  C CA   . SER A 1 123 ? -17.613 5.911   -0.002  1.00 0.00 ? 123 SER A CA   3  
ATOM 6362  C C    . SER A 1 123 ? -18.903 5.650   -0.777  1.00 0.00 ? 123 SER A C    3  
ATOM 6363  O O    . SER A 1 123 ? -19.639 4.704   -0.475  1.00 0.00 ? 123 SER A O    3  
ATOM 6364  C CB   . SER A 1 123 ? -16.441 5.215   -0.704  1.00 0.00 ? 123 SER A CB   3  
ATOM 6365  O OG   . SER A 1 123 ? -16.664 3.815   -0.816  1.00 0.00 ? 123 SER A OG   3  
ATOM 6366  H H    . SER A 1 123 ? -17.268 4.620   1.638   1.00 0.00 ? 123 SER A H    3  
ATOM 6367  H HA   . SER A 1 123 ? -17.426 6.976   0.023   1.00 0.00 ? 123 SER A HA   3  
ATOM 6368  H HB2  . SER A 1 123 ? -16.320 5.625   -1.696  1.00 0.00 ? 123 SER A HB2  3  
ATOM 6369  H HB3  . SER A 1 123 ? -15.535 5.377   -0.138  1.00 0.00 ? 123 SER A HB3  3  
ATOM 6370  H HG   . SER A 1 123 ? -16.238 3.363   -0.079  1.00 0.00 ? 123 SER A HG   3  
ATOM 6371  N N    . ASP A 1 124 ? -19.164 6.480   -1.785  1.00 0.00 ? 124 ASP A N    3  
ATOM 6372  C CA   . ASP A 1 124 ? -20.319 6.295   -2.663  1.00 0.00 ? 124 ASP A CA   3  
ATOM 6373  C C    . ASP A 1 124 ? -20.199 4.957   -3.382  1.00 0.00 ? 124 ASP A C    3  
ATOM 6374  O O    . ASP A 1 124 ? -21.199 4.331   -3.745  1.00 0.00 ? 124 ASP A O    3  
ATOM 6375  C CB   . ASP A 1 124 ? -20.406 7.431   -3.692  1.00 0.00 ? 124 ASP A CB   3  
ATOM 6376  C CG   . ASP A 1 124 ? -20.417 8.807   -3.049  1.00 0.00 ? 124 ASP A CG   3  
ATOM 6377  O OD1  . ASP A 1 124 ? -21.461 9.204   -2.495  1.00 0.00 ? 124 ASP A OD1  3  
ATOM 6378  O OD2  . ASP A 1 124 ? -19.375 9.497   -3.088  1.00 0.00 ? 124 ASP A OD2  3  
ATOM 6379  H H    . ASP A 1 124 ? -18.559 7.233   -1.947  1.00 0.00 ? 124 ASP A H    3  
ATOM 6380  H HA   . ASP A 1 124 ? -21.213 6.293   -2.053  1.00 0.00 ? 124 ASP A HA   3  
ATOM 6381  H HB2  . ASP A 1 124 ? -19.555 7.371   -4.357  1.00 0.00 ? 124 ASP A HB2  3  
ATOM 6382  H HB3  . ASP A 1 124 ? -21.312 7.316   -4.272  1.00 0.00 ? 124 ASP A HB3  3  
ATOM 6383  N N    . ILE A 1 125 ? -18.952 4.538   -3.591  1.00 0.00 ? 125 ILE A N    3  
ATOM 6384  C CA   . ILE A 1 125 ? -18.649 3.230   -4.154  1.00 0.00 ? 125 ILE A CA   3  
ATOM 6385  C C    . ILE A 1 125 ? -19.185 2.126   -3.243  1.00 0.00 ? 125 ILE A C    3  
ATOM 6386  O O    . ILE A 1 125 ? -19.933 1.251   -3.682  1.00 0.00 ? 125 ILE A O    3  
ATOM 6387  C CB   . ILE A 1 125 ? -17.118 3.046   -4.344  1.00 0.00 ? 125 ILE A CB   3  
ATOM 6388  C CG1  . ILE A 1 125 ? -16.566 4.074   -5.349  1.00 0.00 ? 125 ILE A CG1  3  
ATOM 6389  C CG2  . ILE A 1 125 ? -16.785 1.621   -4.783  1.00 0.00 ? 125 ILE A CG2  3  
ATOM 6390  C CD1  . ILE A 1 125 ? -17.163 3.968   -6.738  1.00 0.00 ? 125 ILE A CD1  3  
ATOM 6391  H H    . ILE A 1 125 ? -18.210 5.140   -3.363  1.00 0.00 ? 125 ILE A H    3  
ATOM 6392  H HA   . ILE A 1 125 ? -19.128 3.159   -5.122  1.00 0.00 ? 125 ILE A HA   3  
ATOM 6393  H HB   . ILE A 1 125 ? -16.645 3.211   -3.384  1.00 0.00 ? 125 ILE A HB   3  
ATOM 6394  H HG12 . ILE A 1 125 ? -16.767 5.069   -4.981  1.00 0.00 ? 125 ILE A HG12 3  
ATOM 6395  H HG13 . ILE A 1 125 ? -15.496 3.942   -5.436  1.00 0.00 ? 125 ILE A HG13 3  
ATOM 6396  H HG21 . ILE A 1 125 ? -17.117 0.924   -4.027  1.00 0.00 ? 125 ILE A HG21 3  
ATOM 6397  H HG22 . ILE A 1 125 ? -15.716 1.524   -4.914  1.00 0.00 ? 125 ILE A HG22 3  
ATOM 6398  H HG23 . ILE A 1 125 ? -17.282 1.403   -5.718  1.00 0.00 ? 125 ILE A HG23 3  
ATOM 6399  H HD11 . ILE A 1 125 ? -16.944 2.995   -7.153  1.00 0.00 ? 125 ILE A HD11 3  
ATOM 6400  H HD12 . ILE A 1 125 ? -16.737 4.732   -7.371  1.00 0.00 ? 125 ILE A HD12 3  
ATOM 6401  H HD13 . ILE A 1 125 ? -18.234 4.104   -6.683  1.00 0.00 ? 125 ILE A HD13 3  
ATOM 6402  N N    . TYR A 1 126 ? -18.815 2.190   -1.967  1.00 0.00 ? 126 TYR A N    3  
ATOM 6403  C CA   . TYR A 1 126 ? -19.217 1.177   -0.994  1.00 0.00 ? 126 TYR A CA   3  
ATOM 6404  C C    . TYR A 1 126 ? -20.736 1.157   -0.836  1.00 0.00 ? 126 TYR A C    3  
ATOM 6405  O O    . TYR A 1 126 ? -21.342 0.093   -0.715  1.00 0.00 ? 126 TYR A O    3  
ATOM 6406  C CB   . TYR A 1 126 ? -18.541 1.438   0.357   1.00 0.00 ? 126 TYR A CB   3  
ATOM 6407  C CG   . TYR A 1 126 ? -18.697 0.304   1.354   1.00 0.00 ? 126 TYR A CG   3  
ATOM 6408  C CD1  . TYR A 1 126 ? -18.000 -0.888  1.186   1.00 0.00 ? 126 TYR A CD1  3  
ATOM 6409  C CD2  . TYR A 1 126 ? -19.531 0.424   2.461   1.00 0.00 ? 126 TYR A CD2  3  
ATOM 6410  C CE1  . TYR A 1 126 ? -18.130 -1.924  2.088   1.00 0.00 ? 126 TYR A CE1  3  
ATOM 6411  C CE2  . TYR A 1 126 ? -19.664 -0.607  3.369   1.00 0.00 ? 126 TYR A CE2  3  
ATOM 6412  C CZ   . TYR A 1 126 ? -18.960 -1.779  3.178   1.00 0.00 ? 126 TYR A CZ   3  
ATOM 6413  O OH   . TYR A 1 126 ? -19.090 -2.812  4.078   1.00 0.00 ? 126 TYR A OH   3  
ATOM 6414  H H    . TYR A 1 126 ? -18.252 2.940   -1.669  1.00 0.00 ? 126 TYR A H    3  
ATOM 6415  H HA   . TYR A 1 126 ? -18.895 0.216   -1.368  1.00 0.00 ? 126 TYR A HA   3  
ATOM 6416  H HB2  . TYR A 1 126 ? -17.483 1.592   0.196   1.00 0.00 ? 126 TYR A HB2  3  
ATOM 6417  H HB3  . TYR A 1 126 ? -18.963 2.332   0.797   1.00 0.00 ? 126 TYR A HB3  3  
ATOM 6418  H HD1  . TYR A 1 126 ? -17.348 -1.000  0.331   1.00 0.00 ? 126 TYR A HD1  3  
ATOM 6419  H HD2  . TYR A 1 126 ? -20.081 1.344   2.607   1.00 0.00 ? 126 TYR A HD2  3  
ATOM 6420  H HE1  . TYR A 1 126 ? -17.579 -2.842  1.939   1.00 0.00 ? 126 TYR A HE1  3  
ATOM 6421  H HE2  . TYR A 1 126 ? -20.316 -0.495  4.223   1.00 0.00 ? 126 TYR A HE2  3  
ATOM 6422  H HH   . TYR A 1 126 ? -18.268 -3.318  4.101   1.00 0.00 ? 126 TYR A HH   3  
ATOM 6423  N N    . LEU A 1 127 ? -21.345 2.341   -0.854  1.00 0.00 ? 127 LEU A N    3  
ATOM 6424  C CA   . LEU A 1 127 ? -22.800 2.462   -0.766  1.00 0.00 ? 127 LEU A CA   3  
ATOM 6425  C C    . LEU A 1 127 ? -23.465 1.748   -1.945  1.00 0.00 ? 127 LEU A C    3  
ATOM 6426  O O    . LEU A 1 127 ? -24.551 1.176   -1.810  1.00 0.00 ? 127 LEU A O    3  
ATOM 6427  C CB   . LEU A 1 127 ? -23.213 3.939   -0.733  1.00 0.00 ? 127 LEU A CB   3  
ATOM 6428  C CG   . LEU A 1 127 ? -22.689 4.742   0.472   1.00 0.00 ? 127 LEU A CG   3  
ATOM 6429  C CD1  . LEU A 1 127 ? -23.095 6.210   0.366   1.00 0.00 ? 127 LEU A CD1  3  
ATOM 6430  C CD2  . LEU A 1 127 ? -23.187 4.138   1.787   1.00 0.00 ? 127 LEU A CD2  3  
ATOM 6431  H H    . LEU A 1 127 ? -20.801 3.155   -0.921  1.00 0.00 ? 127 LEU A H    3  
ATOM 6432  H HA   . LEU A 1 127 ? -23.116 1.986   0.152   1.00 0.00 ? 127 LEU A HA   3  
ATOM 6433  H HB2  . LEU A 1 127 ? -22.851 4.411   -1.638  1.00 0.00 ? 127 LEU A HB2  3  
ATOM 6434  H HB3  . LEU A 1 127 ? -24.293 3.991   -0.731  1.00 0.00 ? 127 LEU A HB3  3  
ATOM 6435  H HG   . LEU A 1 127 ? -21.609 4.700   0.476   1.00 0.00 ? 127 LEU A HG   3  
ATOM 6436  H HD11 . LEU A 1 127 ? -24.173 6.290   0.352   1.00 0.00 ? 127 LEU A HD11 3  
ATOM 6437  H HD12 . LEU A 1 127 ? -22.691 6.632   -0.544  1.00 0.00 ? 127 LEU A HD12 3  
ATOM 6438  H HD13 . LEU A 1 127 ? -22.706 6.755   1.215   1.00 0.00 ? 127 LEU A HD13 3  
ATOM 6439  H HD21 . LEU A 1 127 ? -22.802 4.715   2.616   1.00 0.00 ? 127 LEU A HD21 3  
ATOM 6440  H HD22 . LEU A 1 127 ? -22.839 3.118   1.871   1.00 0.00 ? 127 LEU A HD22 3  
ATOM 6441  H HD23 . LEU A 1 127 ? -24.267 4.153   1.809   1.00 0.00 ? 127 LEU A HD23 3  
ATOM 6442  N N    . ASP A 1 128 ? -22.796 1.778   -3.095  1.00 0.00 ? 128 ASP A N    3  
ATOM 6443  C CA   . ASP A 1 128 ? -23.273 1.090   -4.295  1.00 0.00 ? 128 ASP A CA   3  
ATOM 6444  C C    . ASP A 1 128 ? -23.056 -0.416  -4.166  1.00 0.00 ? 128 ASP A C    3  
ATOM 6445  O O    . ASP A 1 128 ? -23.858 -1.217  -4.649  1.00 0.00 ? 128 ASP A O    3  
ATOM 6446  C CB   . ASP A 1 128 ? -22.544 1.628   -5.535  1.00 0.00 ? 128 ASP A CB   3  
ATOM 6447  C CG   . ASP A 1 128 ? -22.903 0.879   -6.810  1.00 0.00 ? 128 ASP A CG   3  
ATOM 6448  O OD1  . ASP A 1 128 ? -23.955 1.182   -7.411  1.00 0.00 ? 128 ASP A OD1  3  
ATOM 6449  O OD2  . ASP A 1 128 ? -22.125 -0.002  -7.233  1.00 0.00 ? 128 ASP A OD2  3  
ATOM 6450  H H    . ASP A 1 128 ? -21.950 2.276   -3.138  1.00 0.00 ? 128 ASP A H    3  
ATOM 6451  H HA   . ASP A 1 128 ? -24.332 1.286   -4.394  1.00 0.00 ? 128 ASP A HA   3  
ATOM 6452  H HB2  . ASP A 1 128 ? -22.800 2.671   -5.667  1.00 0.00 ? 128 ASP A HB2  3  
ATOM 6453  H HB3  . ASP A 1 128 ? -21.476 1.548   -5.377  1.00 0.00 ? 128 ASP A HB3  3  
ATOM 6454  N N    . LEU A 1 129 ? -21.968 -0.793  -3.501  1.00 0.00 ? 129 LEU A N    3  
ATOM 6455  C CA   . LEU A 1 129 ? -21.653 -2.201  -3.268  1.00 0.00 ? 129 LEU A CA   3  
ATOM 6456  C C    . LEU A 1 129 ? -22.616 -2.806  -2.246  1.00 0.00 ? 129 LEU A C    3  
ATOM 6457  O O    . LEU A 1 129 ? -22.747 -4.028  -2.152  1.00 0.00 ? 129 LEU A O    3  
ATOM 6458  C CB   . LEU A 1 129 ? -20.202 -2.359  -2.786  1.00 0.00 ? 129 LEU A CB   3  
ATOM 6459  C CG   . LEU A 1 129 ? -19.124 -1.844  -3.756  1.00 0.00 ? 129 LEU A CG   3  
ATOM 6460  C CD1  . LEU A 1 129 ? -17.726 -2.054  -3.176  1.00 0.00 ? 129 LEU A CD1  3  
ATOM 6461  C CD2  . LEU A 1 129 ? -19.253 -2.519  -5.123  1.00 0.00 ? 129 LEU A CD2  3  
ATOM 6462  H H    . LEU A 1 129 ? -21.356 -0.106  -3.161  1.00 0.00 ? 129 LEU A H    3  
ATOM 6463  H HA   . LEU A 1 129 ? -21.770 -2.725  -4.207  1.00 0.00 ? 129 LEU A HA   3  
ATOM 6464  H HB2  . LEU A 1 129 ? -20.099 -1.827  -1.850  1.00 0.00 ? 129 LEU A HB2  3  
ATOM 6465  H HB3  . LEU A 1 129 ? -20.018 -3.409  -2.604  1.00 0.00 ? 129 LEU A HB3  3  
ATOM 6466  H HG   . LEU A 1 129 ? -19.261 -0.781  -3.898  1.00 0.00 ? 129 LEU A HG   3  
ATOM 6467  H HD11 . LEU A 1 129 ? -17.643 -1.529  -2.236  1.00 0.00 ? 129 LEU A HD11 3  
ATOM 6468  H HD12 . LEU A 1 129 ? -16.988 -1.670  -3.866  1.00 0.00 ? 129 LEU A HD12 3  
ATOM 6469  H HD13 . LEU A 1 129 ? -17.553 -3.109  -3.017  1.00 0.00 ? 129 LEU A HD13 3  
ATOM 6470  H HD21 . LEU A 1 129 ? -20.227 -2.305  -5.540  1.00 0.00 ? 129 LEU A HD21 3  
ATOM 6471  H HD22 . LEU A 1 129 ? -19.136 -3.587  -5.013  1.00 0.00 ? 129 LEU A HD22 3  
ATOM 6472  H HD23 . LEU A 1 129 ? -18.489 -2.140  -5.786  1.00 0.00 ? 129 LEU A HD23 3  
ATOM 6473  N N    . MET A 1 130 ? -23.284 -1.943  -1.485  1.00 0.00 ? 130 MET A N    3  
ATOM 6474  C CA   . MET A 1 130 ? -24.257 -2.382  -0.489  1.00 0.00 ? 130 MET A CA   3  
ATOM 6475  C C    . MET A 1 130 ? -25.565 -2.821  -1.158  1.00 0.00 ? 130 MET A C    3  
ATOM 6476  O O    . MET A 1 130 ? -25.752 -4.002  -1.456  1.00 0.00 ? 130 MET A O    3  
ATOM 6477  C CB   . MET A 1 130 ? -24.531 -1.263  0.533   1.00 0.00 ? 130 MET A CB   3  
ATOM 6478  C CG   . MET A 1 130 ? -23.363 -0.925  1.465   1.00 0.00 ? 130 MET A CG   3  
ATOM 6479  S SD   . MET A 1 130 ? -23.065 -2.181  2.733   1.00 0.00 ? 130 MET A SD   3  
ATOM 6480  C CE   . MET A 1 130 ? -22.087 -3.389  1.838   1.00 0.00 ? 130 MET A CE   3  
ATOM 6481  H H    . MET A 1 130 ? -23.117 -0.984  -1.598  1.00 0.00 ? 130 MET A H    3  
ATOM 6482  H HA   . MET A 1 130 ? -23.836 -3.230  0.030   1.00 0.00 ? 130 MET A HA   3  
ATOM 6483  H HB2  . MET A 1 130 ? -24.794 -0.363  -0.005  1.00 0.00 ? 130 MET A HB2  3  
ATOM 6484  H HB3  . MET A 1 130 ? -25.371 -1.554  1.146   1.00 0.00 ? 130 MET A HB3  3  
ATOM 6485  H HG2  . MET A 1 130 ? -22.466 -0.816  0.873   1.00 0.00 ? 130 MET A HG2  3  
ATOM 6486  H HG3  . MET A 1 130 ? -23.577 0.015   1.957   1.00 0.00 ? 130 MET A HG3  3  
ATOM 6487  H HE1  . MET A 1 130 ? -21.185 -2.921  1.471   1.00 0.00 ? 130 MET A HE1  3  
ATOM 6488  H HE2  . MET A 1 130 ? -22.658 -3.773  1.007   1.00 0.00 ? 130 MET A HE2  3  
ATOM 6489  H HE3  . MET A 1 130 ? -21.825 -4.202  2.500   1.00 0.00 ? 130 MET A HE3  3  
ATOM 6490  N N    . GLU A 1 131 ? -26.450 -1.854  -1.412  1.00 0.00 ? 131 GLU A N    3  
ATOM 6491  C CA   . GLU A 1 131 ? -27.772 -2.119  -1.987  1.00 0.00 ? 131 GLU A CA   3  
ATOM 6492  C C    . GLU A 1 131 ? -28.531 -3.168  -1.170  1.00 0.00 ? 131 GLU A C    3  
ATOM 6493  O O    . GLU A 1 131 ? -29.317 -3.949  -1.712  1.00 0.00 ? 131 GLU A O    3  
ATOM 6494  C CB   . GLU A 1 131 ? -27.652 -2.564  -3.455  1.00 0.00 ? 131 GLU A CB   3  
ATOM 6495  C CG   . GLU A 1 131 ? -27.011 -1.520  -4.363  1.00 0.00 ? 131 GLU A CG   3  
ATOM 6496  C CD   . GLU A 1 131 ? -27.145 -1.859  -5.839  1.00 0.00 ? 131 GLU A CD   3  
ATOM 6497  O OE1  . GLU A 1 131 ? -26.441 -2.773  -6.316  1.00 0.00 ? 131 GLU A OE1  3  
ATOM 6498  O OE2  . GLU A 1 131 ? -27.969 -1.218  -6.531  1.00 0.00 ? 131 GLU A OE2  3  
ATOM 6499  H H    . GLU A 1 131 ? -26.207 -0.925  -1.208  1.00 0.00 ? 131 GLU A H    3  
ATOM 6500  H HA   . GLU A 1 131 ? -28.330 -1.194  -1.951  1.00 0.00 ? 131 GLU A HA   3  
ATOM 6501  H HB2  . GLU A 1 131 ? -27.054 -3.464  -3.498  1.00 0.00 ? 131 GLU A HB2  3  
ATOM 6502  H HB3  . GLU A 1 131 ? -28.641 -2.783  -3.834  1.00 0.00 ? 131 GLU A HB3  3  
ATOM 6503  H HG2  . GLU A 1 131 ? -27.484 -0.564  -4.183  1.00 0.00 ? 131 GLU A HG2  3  
ATOM 6504  H HG3  . GLU A 1 131 ? -25.960 -1.446  -4.118  1.00 0.00 ? 131 GLU A HG3  3  
ATOM 6505  N N    . GLY A 1 132 ? -28.314 -3.160  0.145   1.00 0.00 ? 132 GLY A N    3  
ATOM 6506  C CA   . GLY A 1 132 ? -28.983 -4.105  1.028   1.00 0.00 ? 132 GLY A CA   3  
ATOM 6507  C C    . GLY A 1 132 ? -30.389 -3.658  1.385   1.00 0.00 ? 132 GLY A C    3  
ATOM 6508  O O    . GLY A 1 132 ? -30.767 -3.640  2.558   1.00 0.00 ? 132 GLY A O    3  
ATOM 6509  H H    . GLY A 1 132 ? -27.697 -2.498  0.524   1.00 0.00 ? 132 GLY A H    3  
ATOM 6510  H HA2  . GLY A 1 132 ? -29.035 -5.069  0.541   1.00 0.00 ? 132 GLY A HA2  3  
ATOM 6511  H HA3  . GLY A 1 132 ? -28.406 -4.203  1.936   1.00 0.00 ? 132 GLY A HA3  3  
ATOM 6512  N N    . ARG A 1 133 ? -31.158 -3.304  0.359   1.00 0.00 ? 133 ARG A N    3  
ATOM 6513  C CA   . ARG A 1 133 ? -32.524 -2.815  0.519   1.00 0.00 ? 133 ARG A CA   3  
ATOM 6514  C C    . ARG A 1 133 ? -33.479 -3.970  0.849   1.00 0.00 ? 133 ARG A C    3  
ATOM 6515  O O    . ARG A 1 133 ? -33.710 -4.847  0.012   1.00 0.00 ? 133 ARG A O    3  
ATOM 6516  C CB   . ARG A 1 133 ? -32.962 -2.109  -0.777  1.00 0.00 ? 133 ARG A CB   3  
ATOM 6517  C CG   . ARG A 1 133 ? -34.432 -1.690  -0.825  1.00 0.00 ? 133 ARG A CG   3  
ATOM 6518  C CD   . ARG A 1 133 ? -34.784 -0.657  0.239   1.00 0.00 ? 133 ARG A CD   3  
ATOM 6519  N NE   . ARG A 1 133 ? -36.148 -0.154  0.058   1.00 0.00 ? 133 ARG A NE   3  
ATOM 6520  C CZ   . ARG A 1 133 ? -37.010 0.082   1.050   1.00 0.00 ? 133 ARG A CZ   3  
ATOM 6521  N NH1  . ARG A 1 133 ? -36.660 -0.128  2.314   1.00 0.00 ? 133 ARG A NH1  3  
ATOM 6522  N NH2  . ARG A 1 133 ? -38.227 0.532   0.775   1.00 0.00 ? 133 ARG A NH2  3  
ATOM 6523  H H    . ARG A 1 133 ? -30.794 -3.386  -0.546  1.00 0.00 ? 133 ARG A H    3  
ATOM 6524  H HA   . ARG A 1 133 ? -32.532 -2.101  1.330   1.00 0.00 ? 133 ARG A HA   3  
ATOM 6525  H HB2  . ARG A 1 133 ? -32.359 -1.221  -0.904  1.00 0.00 ? 133 ARG A HB2  3  
ATOM 6526  H HB3  . ARG A 1 133 ? -32.775 -2.773  -1.611  1.00 0.00 ? 133 ARG A HB3  3  
ATOM 6527  H HG2  . ARG A 1 133 ? -34.640 -1.265  -1.798  1.00 0.00 ? 133 ARG A HG2  3  
ATOM 6528  H HG3  . ARG A 1 133 ? -35.049 -2.566  -0.681  1.00 0.00 ? 133 ARG A HG3  3  
ATOM 6529  H HD2  . ARG A 1 133 ? -34.698 -1.116  1.215   1.00 0.00 ? 133 ARG A HD2  3  
ATOM 6530  H HD3  . ARG A 1 133 ? -34.092 0.169   0.167   1.00 0.00 ? 133 ARG A HD3  3  
ATOM 6531  H HE   . ARG A 1 133 ? -36.438 0.017   -0.868  1.00 0.00 ? 133 ARG A HE   3  
ATOM 6532  H HH11 . ARG A 1 133 ? -35.745 -0.468  2.537   1.00 0.00 ? 133 ARG A HH11 3  
ATOM 6533  H HH12 . ARG A 1 133 ? -37.313 0.057   3.054   1.00 0.00 ? 133 ARG A HH12 3  
ATOM 6534  H HH21 . ARG A 1 133 ? -38.502 0.695   -0.176  1.00 0.00 ? 133 ARG A HH21 3  
ATOM 6535  H HH22 . ARG A 1 133 ? -38.880 0.708   1.518   1.00 0.00 ? 133 ARG A HH22 3  
ATOM 6536  N N    . PRO A 1 134 ? -34.031 -4.002  2.076   1.00 0.00 ? 134 PRO A N    3  
ATOM 6537  C CA   . PRO A 1 134 ? -34.999 -5.021  2.480   1.00 0.00 ? 134 PRO A CA   3  
ATOM 6538  C C    . PRO A 1 134 ? -36.430 -4.623  2.110   1.00 0.00 ? 134 PRO A C    3  
ATOM 6539  O O    . PRO A 1 134 ? -36.797 -3.448  2.194   1.00 0.00 ? 134 PRO A O    3  
ATOM 6540  C CB   . PRO A 1 134 ? -34.815 -5.065  3.997   1.00 0.00 ? 134 PRO A CB   3  
ATOM 6541  C CG   . PRO A 1 134 ? -34.468 -3.659  4.371   1.00 0.00 ? 134 PRO A CG   3  
ATOM 6542  C CD   . PRO A 1 134 ? -33.752 -3.056  3.179   1.00 0.00 ? 134 PRO A CD   3  
ATOM 6543  H HA   . PRO A 1 134 ? -34.766 -5.988  2.052   1.00 0.00 ? 134 PRO A HA   3  
ATOM 6544  H HB2  . PRO A 1 134 ? -35.733 -5.392  4.469   1.00 0.00 ? 134 PRO A HB2  3  
ATOM 6545  H HB3  . PRO A 1 134 ? -34.015 -5.748  4.247   1.00 0.00 ? 134 PRO A HB3  3  
ATOM 6546  H HG2  . PRO A 1 134 ? -35.372 -3.104  4.582   1.00 0.00 ? 134 PRO A HG2  3  
ATOM 6547  H HG3  . PRO A 1 134 ? -33.822 -3.659  5.237   1.00 0.00 ? 134 PRO A HG3  3  
ATOM 6548  H HD2  . PRO A 1 134 ? -34.153 -2.077  2.954   1.00 0.00 ? 134 PRO A HD2  3  
ATOM 6549  H HD3  . PRO A 1 134 ? -32.690 -2.991  3.371   1.00 0.00 ? 134 PRO A HD3  3  
ATOM 6550  N N    . SER A 1 1   ? -14.259 -13.227 -10.590 1.00 0.00 ? 1   SER A N    4  
ATOM 6551  C CA   . SER A 1 1   ? -15.331 -13.499 -9.612  1.00 0.00 ? 1   SER A CA   4  
ATOM 6552  C C    . SER A 1 1   ? -16.136 -12.234 -9.326  1.00 0.00 ? 1   SER A C    4  
ATOM 6553  O O    . SER A 1 1   ? -15.931 -11.196 -9.962  1.00 0.00 ? 1   SER A O    4  
ATOM 6554  C CB   . SER A 1 1   ? -14.712 -14.047 -8.316  1.00 0.00 ? 1   SER A CB   4  
ATOM 6555  O OG   . SER A 1 1   ? -13.709 -13.174 -7.808  1.00 0.00 ? 1   SER A OG   4  
ATOM 6556  H H1   . SER A 1 1   ? -13.726 -14.099 -10.790 1.00 0.00 ? 1   SER A H1   4  
ATOM 6557  H H2   . SER A 1 1   ? -13.603 -12.516 -10.211 1.00 0.00 ? 1   SER A H2   4  
ATOM 6558  H H3   . SER A 1 1   ? -14.665 -12.871 -11.473 1.00 0.00 ? 1   SER A H3   4  
ATOM 6559  H HA   . SER A 1 1   ? -15.992 -14.245 -10.032 1.00 0.00 ? 1   SER A HA   4  
ATOM 6560  H HB2  . SER A 1 1   ? -15.483 -14.160 -7.569  1.00 0.00 ? 1   SER A HB2  4  
ATOM 6561  H HB3  . SER A 1 1   ? -14.263 -15.010 -8.515  1.00 0.00 ? 1   SER A HB3  4  
ATOM 6562  H HG   . SER A 1 1   ? -14.127 -12.433 -7.342  1.00 0.00 ? 1   SER A HG   4  
ATOM 6563  N N    . MET A 1 2   ? -17.071 -12.338 -8.387  1.00 0.00 ? 2   MET A N    4  
ATOM 6564  C CA   . MET A 1 2   ? -17.840 -11.195 -7.912  1.00 0.00 ? 2   MET A CA   4  
ATOM 6565  C C    . MET A 1 2   ? -18.246 -11.439 -6.463  1.00 0.00 ? 2   MET A C    4  
ATOM 6566  O O    . MET A 1 2   ? -18.417 -12.587 -6.043  1.00 0.00 ? 2   MET A O    4  
ATOM 6567  C CB   . MET A 1 2   ? -19.071 -10.951 -8.806  1.00 0.00 ? 2   MET A CB   4  
ATOM 6568  C CG   . MET A 1 2   ? -20.097 -12.083 -8.807  1.00 0.00 ? 2   MET A CG   4  
ATOM 6569  S SD   . MET A 1 2   ? -21.081 -12.157 -7.295  1.00 0.00 ? 2   MET A SD   4  
ATOM 6570  C CE   . MET A 1 2   ? -21.916 -10.569 -7.352  1.00 0.00 ? 2   MET A CE   4  
ATOM 6571  H H    . MET A 1 2   ? -17.256 -13.222 -8.000  1.00 0.00 ? 2   MET A H    4  
ATOM 6572  H HA   . MET A 1 2   ? -17.197 -10.325 -7.947  1.00 0.00 ? 2   MET A HA   4  
ATOM 6573  H HB2  . MET A 1 2   ? -19.567 -10.049 -8.475  1.00 0.00 ? 2   MET A HB2  4  
ATOM 6574  H HB3  . MET A 1 2   ? -18.732 -10.804 -9.822  1.00 0.00 ? 2   MET A HB3  4  
ATOM 6575  H HG2  . MET A 1 2   ? -20.766 -11.944 -9.643  1.00 0.00 ? 2   MET A HG2  4  
ATOM 6576  H HG3  . MET A 1 2   ? -19.575 -13.022 -8.924  1.00 0.00 ? 2   MET A HG3  4  
ATOM 6577  H HE1  . MET A 1 2   ? -22.580 -10.482 -6.504  1.00 0.00 ? 2   MET A HE1  4  
ATOM 6578  H HE2  . MET A 1 2   ? -22.488 -10.493 -8.265  1.00 0.00 ? 2   MET A HE2  4  
ATOM 6579  H HE3  . MET A 1 2   ? -21.184 -9.776  -7.318  1.00 0.00 ? 2   MET A HE3  4  
ATOM 6580  N N    . VAL A 1 3   ? -18.376 -10.370 -5.690  1.00 0.00 ? 3   VAL A N    4  
ATOM 6581  C CA   . VAL A 1 3   ? -18.671 -10.489 -4.267  1.00 0.00 ? 3   VAL A CA   4  
ATOM 6582  C C    . VAL A 1 3   ? -20.121 -10.113 -3.962  1.00 0.00 ? 3   VAL A C    4  
ATOM 6583  O O    . VAL A 1 3   ? -20.655 -9.146  -4.515  1.00 0.00 ? 3   VAL A O    4  
ATOM 6584  C CB   . VAL A 1 3   ? -17.711 -9.615  -3.423  1.00 0.00 ? 3   VAL A CB   4  
ATOM 6585  C CG1  . VAL A 1 3   ? -17.804 -8.144  -3.824  1.00 0.00 ? 3   VAL A CG1  4  
ATOM 6586  C CG2  . VAL A 1 3   ? -17.986 -9.793  -1.931  1.00 0.00 ? 3   VAL A CG2  4  
ATOM 6587  H H    . VAL A 1 3   ? -18.275 -9.480  -6.084  1.00 0.00 ? 3   VAL A H    4  
ATOM 6588  H HA   . VAL A 1 3   ? -18.516 -11.522 -3.981  1.00 0.00 ? 3   VAL A HA   4  
ATOM 6589  H HB   . VAL A 1 3   ? -16.700 -9.948  -3.616  1.00 0.00 ? 3   VAL A HB   4  
ATOM 6590  H HG11 . VAL A 1 3   ? -17.571 -8.041  -4.874  1.00 0.00 ? 3   VAL A HG11 4  
ATOM 6591  H HG12 . VAL A 1 3   ? -17.097 -7.569  -3.243  1.00 0.00 ? 3   VAL A HG12 4  
ATOM 6592  H HG13 . VAL A 1 3   ? -18.803 -7.779  -3.636  1.00 0.00 ? 3   VAL A HG13 4  
ATOM 6593  H HG21 . VAL A 1 3   ? -17.293 -9.194  -1.359  1.00 0.00 ? 3   VAL A HG21 4  
ATOM 6594  H HG22 . VAL A 1 3   ? -17.865 -10.833 -1.662  1.00 0.00 ? 3   VAL A HG22 4  
ATOM 6595  H HG23 . VAL A 1 3   ? -18.998 -9.482  -1.708  1.00 0.00 ? 3   VAL A HG23 4  
ATOM 6596  N N    . SER A 1 4   ? -20.752 -10.897 -3.096  1.00 0.00 ? 4   SER A N    4  
ATOM 6597  C CA   . SER A 1 4   ? -22.115 -10.636 -2.650  1.00 0.00 ? 4   SER A CA   4  
ATOM 6598  C C    . SER A 1 4   ? -22.130 -9.502  -1.618  1.00 0.00 ? 4   SER A C    4  
ATOM 6599  O O    . SER A 1 4   ? -21.149 -9.311  -0.891  1.00 0.00 ? 4   SER A O    4  
ATOM 6600  C CB   . SER A 1 4   ? -22.709 -11.917 -2.050  1.00 0.00 ? 4   SER A CB   4  
ATOM 6601  O OG   . SER A 1 4   ? -22.605 -12.994 -2.966  1.00 0.00 ? 4   SER A OG   4  
ATOM 6602  H H    . SER A 1 4   ? -20.287 -11.684 -2.747  1.00 0.00 ? 4   SER A H    4  
ATOM 6603  H HA   . SER A 1 4   ? -22.700 -10.341 -3.510  1.00 0.00 ? 4   SER A HA   4  
ATOM 6604  H HB2  . SER A 1 4   ? -22.174 -12.175 -1.146  1.00 0.00 ? 4   SER A HB2  4  
ATOM 6605  H HB3  . SER A 1 4   ? -23.752 -11.756 -1.817  1.00 0.00 ? 4   SER A HB3  4  
ATOM 6606  H HG   . SER A 1 4   ? -22.902 -12.700 -3.838  1.00 0.00 ? 4   SER A HG   4  
ATOM 6607  N N    . PRO A 1 5   ? -23.244 -8.743  -1.532  1.00 0.00 ? 5   PRO A N    4  
ATOM 6608  C CA   . PRO A 1 5   ? -23.357 -7.589  -0.624  1.00 0.00 ? 5   PRO A CA   4  
ATOM 6609  C C    . PRO A 1 5   ? -23.022 -7.945  0.826   1.00 0.00 ? 5   PRO A C    4  
ATOM 6610  O O    . PRO A 1 5   ? -22.447 -7.134  1.552   1.00 0.00 ? 5   PRO A O    4  
ATOM 6611  C CB   . PRO A 1 5   ? -24.830 -7.154  -0.753  1.00 0.00 ? 5   PRO A CB   4  
ATOM 6612  C CG   . PRO A 1 5   ? -25.521 -8.295  -1.430  1.00 0.00 ? 5   PRO A CG   4  
ATOM 6613  C CD   . PRO A 1 5   ? -24.483 -8.938  -2.305  1.00 0.00 ? 5   PRO A CD   4  
ATOM 6614  H HA   . PRO A 1 5   ? -22.713 -6.780  -0.944  1.00 0.00 ? 5   PRO A HA   4  
ATOM 6615  H HB2  . PRO A 1 5   ? -25.247 -6.967  0.229   1.00 0.00 ? 5   PRO A HB2  4  
ATOM 6616  H HB3  . PRO A 1 5   ? -24.887 -6.251  -1.346  1.00 0.00 ? 5   PRO A HB3  4  
ATOM 6617  H HG2  . PRO A 1 5   ? -25.881 -9.001  -0.691  1.00 0.00 ? 5   PRO A HG2  4  
ATOM 6618  H HG3  . PRO A 1 5   ? -26.343 -7.928  -2.027  1.00 0.00 ? 5   PRO A HG3  4  
ATOM 6619  H HD2  . PRO A 1 5   ? -24.698 -9.990  -2.440  1.00 0.00 ? 5   PRO A HD2  4  
ATOM 6620  H HD3  . PRO A 1 5   ? -24.425 -8.437  -3.261  1.00 0.00 ? 5   PRO A HD3  4  
ATOM 6621  N N    . GLU A 1 6   ? -23.377 -9.163  1.234   1.00 0.00 ? 6   GLU A N    4  
ATOM 6622  C CA   . GLU A 1 6   ? -23.124 -9.624  2.600   1.00 0.00 ? 6   GLU A CA   4  
ATOM 6623  C C    . GLU A 1 6   ? -21.627 -9.618  2.911   1.00 0.00 ? 6   GLU A C    4  
ATOM 6624  O O    . GLU A 1 6   ? -21.191 -9.030  3.900   1.00 0.00 ? 6   GLU A O    4  
ATOM 6625  C CB   . GLU A 1 6   ? -23.699 -11.033 2.808   1.00 0.00 ? 6   GLU A CB   4  
ATOM 6626  C CG   . GLU A 1 6   ? -25.202 -11.126 2.565   1.00 0.00 ? 6   GLU A CG   4  
ATOM 6627  C CD   . GLU A 1 6   ? -25.986 -10.091 3.357   1.00 0.00 ? 6   GLU A CD   4  
ATOM 6628  O OE1  . GLU A 1 6   ? -26.019 -10.186 4.605   1.00 0.00 ? 6   GLU A OE1  4  
ATOM 6629  O OE2  . GLU A 1 6   ? -26.564 -9.174  2.738   1.00 0.00 ? 6   GLU A OE2  4  
ATOM 6630  H H    . GLU A 1 6   ? -23.825 -9.760  0.604   1.00 0.00 ? 6   GLU A H    4  
ATOM 6631  H HA   . GLU A 1 6   ? -23.619 -8.942  3.276   1.00 0.00 ? 6   GLU A HA   4  
ATOM 6632  H HB2  . GLU A 1 6   ? -23.203 -11.717 2.130   1.00 0.00 ? 6   GLU A HB2  4  
ATOM 6633  H HB3  . GLU A 1 6   ? -23.500 -11.345 3.825   1.00 0.00 ? 6   GLU A HB3  4  
ATOM 6634  H HG2  . GLU A 1 6   ? -25.393 -10.975 1.511   1.00 0.00 ? 6   GLU A HG2  4  
ATOM 6635  H HG3  . GLU A 1 6   ? -25.542 -12.112 2.851   1.00 0.00 ? 6   GLU A HG3  4  
ATOM 6636  N N    . GLU A 1 7   ? -20.847 -10.266 2.053   1.00 0.00 ? 7   GLU A N    4  
ATOM 6637  C CA   . GLU A 1 7   ? -19.397 -10.312 2.215   1.00 0.00 ? 7   GLU A CA   4  
ATOM 6638  C C    . GLU A 1 7   ? -18.807 -8.912  2.056   1.00 0.00 ? 7   GLU A C    4  
ATOM 6639  O O    . GLU A 1 7   ? -17.882 -8.535  2.773   1.00 0.00 ? 7   GLU A O    4  
ATOM 6640  C CB   . GLU A 1 7   ? -18.783 -11.280 1.193   1.00 0.00 ? 7   GLU A CB   4  
ATOM 6641  C CG   . GLU A 1 7   ? -17.260 -11.384 1.247   1.00 0.00 ? 7   GLU A CG   4  
ATOM 6642  C CD   . GLU A 1 7   ? -16.737 -11.970 2.552   1.00 0.00 ? 7   GLU A CD   4  
ATOM 6643  O OE1  . GLU A 1 7   ? -17.235 -13.028 2.977   1.00 0.00 ? 7   GLU A OE1  4  
ATOM 6644  O OE2  . GLU A 1 7   ? -15.795 -11.393 3.135   1.00 0.00 ? 7   GLU A OE2  4  
ATOM 6645  H H    . GLU A 1 7   ? -21.257 -10.724 1.291   1.00 0.00 ? 7   GLU A H    4  
ATOM 6646  H HA   . GLU A 1 7   ? -19.185 -10.671 3.215   1.00 0.00 ? 7   GLU A HA   4  
ATOM 6647  H HB2  . GLU A 1 7   ? -19.186 -12.266 1.364   1.00 0.00 ? 7   GLU A HB2  4  
ATOM 6648  H HB3  . GLU A 1 7   ? -19.063 -10.958 0.199   1.00 0.00 ? 7   GLU A HB3  4  
ATOM 6649  H HG2  . GLU A 1 7   ? -16.928 -12.013 0.434   1.00 0.00 ? 7   GLU A HG2  4  
ATOM 6650  H HG3  . GLU A 1 7   ? -16.844 -10.394 1.119   1.00 0.00 ? 7   GLU A HG3  4  
ATOM 6651  N N    . ALA A 1 8   ? -19.371 -8.142  1.127   1.00 0.00 ? 8   ALA A N    4  
ATOM 6652  C CA   . ALA A 1 8   ? -18.906 -6.784  0.857   1.00 0.00 ? 8   ALA A CA   4  
ATOM 6653  C C    . ALA A 1 8   ? -18.999 -5.908  2.107   1.00 0.00 ? 8   ALA A C    4  
ATOM 6654  O O    . ALA A 1 8   ? -18.014 -5.300  2.521   1.00 0.00 ? 8   ALA A O    4  
ATOM 6655  C CB   . ALA A 1 8   ? -19.702 -6.171  -0.290  1.00 0.00 ? 8   ALA A CB   4  
ATOM 6656  H H    . ALA A 1 8   ? -20.124 -8.499  0.610   1.00 0.00 ? 8   ALA A H    4  
ATOM 6657  H HA   . ALA A 1 8   ? -17.870 -6.846  0.550   1.00 0.00 ? 8   ALA A HA   4  
ATOM 6658  H HB1  . ALA A 1 8   ? -19.320 -5.183  -0.510  1.00 0.00 ? 8   ALA A HB1  4  
ATOM 6659  H HB2  . ALA A 1 8   ? -20.743 -6.100  -0.010  1.00 0.00 ? 8   ALA A HB2  4  
ATOM 6660  H HB3  . ALA A 1 8   ? -19.609 -6.795  -1.168  1.00 0.00 ? 8   ALA A HB3  4  
ATOM 6661  N N    . VAL A 1 9   ? -20.185 -5.859  2.714   1.00 0.00 ? 9   VAL A N    4  
ATOM 6662  C CA   . VAL A 1 9   ? -20.399 -5.047  3.915   1.00 0.00 ? 9   VAL A CA   4  
ATOM 6663  C C    . VAL A 1 9   ? -19.600 -5.606  5.090   1.00 0.00 ? 9   VAL A C    4  
ATOM 6664  O O    . VAL A 1 9   ? -19.228 -4.879  6.015   1.00 0.00 ? 9   VAL A O    4  
ATOM 6665  C CB   . VAL A 1 9   ? -21.904 -4.972  4.313   1.00 0.00 ? 9   VAL A CB   4  
ATOM 6666  C CG1  . VAL A 1 9   ? -22.751 -4.414  3.172   1.00 0.00 ? 9   VAL A CG1  4  
ATOM 6667  C CG2  . VAL A 1 9   ? -22.430 -6.337  4.755   1.00 0.00 ? 9   VAL A CG2  4  
ATOM 6668  H H    . VAL A 1 9   ? -20.929 -6.381  2.351   1.00 0.00 ? 9   VAL A H    4  
ATOM 6669  H HA   . VAL A 1 9   ? -20.053 -4.042  3.704   1.00 0.00 ? 9   VAL A HA   4  
ATOM 6670  H HB   . VAL A 1 9   ? -21.992 -4.293  5.151   1.00 0.00 ? 9   VAL A HB   4  
ATOM 6671  H HG11 . VAL A 1 9   ? -22.425 -3.413  2.936   1.00 0.00 ? 9   VAL A HG11 4  
ATOM 6672  H HG12 . VAL A 1 9   ? -23.789 -4.392  3.470   1.00 0.00 ? 9   VAL A HG12 4  
ATOM 6673  H HG13 . VAL A 1 9   ? -22.641 -5.043  2.298   1.00 0.00 ? 9   VAL A HG13 4  
ATOM 6674  H HG21 . VAL A 1 9   ? -21.865 -6.683  5.609   1.00 0.00 ? 9   VAL A HG21 4  
ATOM 6675  H HG22 . VAL A 1 9   ? -22.326 -7.045  3.945   1.00 0.00 ? 9   VAL A HG22 4  
ATOM 6676  H HG23 . VAL A 1 9   ? -23.473 -6.252  5.027   1.00 0.00 ? 9   VAL A HG23 4  
ATOM 6677  N N    . LYS A 1 10  ? -19.320 -6.902  5.028   1.00 0.00 ? 10  LYS A N    4  
ATOM 6678  C CA   . LYS A 1 10  ? -18.648 -7.610  6.109   1.00 0.00 ? 10  LYS A CA   4  
ATOM 6679  C C    . LYS A 1 10  ? -17.146 -7.299  6.133   1.00 0.00 ? 10  LYS A C    4  
ATOM 6680  O O    . LYS A 1 10  ? -16.449 -7.652  7.085   1.00 0.00 ? 10  LYS A O    4  
ATOM 6681  C CB   . LYS A 1 10  ? -18.902 -9.115  5.952   1.00 0.00 ? 10  LYS A CB   4  
ATOM 6682  C CG   . LYS A 1 10  ? -18.392 -9.978  7.102   1.00 0.00 ? 10  LYS A CG   4  
ATOM 6683  C CD   . LYS A 1 10  ? -18.911 -11.410 6.992   1.00 0.00 ? 10  LYS A CD   4  
ATOM 6684  C CE   . LYS A 1 10  ? -18.554 -12.044 5.652   1.00 0.00 ? 10  LYS A CE   4  
ATOM 6685  N NZ   . LYS A 1 10  ? -19.191 -13.374 5.478   1.00 0.00 ? 10  LYS A NZ   4  
ATOM 6686  H H    . LYS A 1 10  ? -19.581 -7.403  4.225   1.00 0.00 ? 10  LYS A H    4  
ATOM 6687  H HA   . LYS A 1 10  ? -19.084 -7.279  7.042   1.00 0.00 ? 10  LYS A HA   4  
ATOM 6688  H HB2  . LYS A 1 10  ? -19.967 -9.275  5.863   1.00 0.00 ? 10  LYS A HB2  4  
ATOM 6689  H HB3  . LYS A 1 10  ? -18.426 -9.451  5.042   1.00 0.00 ? 10  LYS A HB3  4  
ATOM 6690  H HG2  . LYS A 1 10  ? -17.311 -9.991  7.081   1.00 0.00 ? 10  LYS A HG2  4  
ATOM 6691  H HG3  . LYS A 1 10  ? -18.729 -9.554  8.037   1.00 0.00 ? 10  LYS A HG3  4  
ATOM 6692  H HD2  . LYS A 1 10  ? -18.477 -12.003 7.784   1.00 0.00 ? 10  LYS A HD2  4  
ATOM 6693  H HD3  . LYS A 1 10  ? -19.987 -11.401 7.098   1.00 0.00 ? 10  LYS A HD3  4  
ATOM 6694  H HE2  . LYS A 1 10  ? -18.888 -11.394 4.857   1.00 0.00 ? 10  LYS A HE2  4  
ATOM 6695  H HE3  . LYS A 1 10  ? -17.480 -12.159 5.594   1.00 0.00 ? 10  LYS A HE3  4  
ATOM 6696  H HZ1  . LYS A 1 10  ? -18.940 -13.776 4.550   1.00 0.00 ? 10  LYS A HZ1  4  
ATOM 6697  H HZ2  . LYS A 1 10  ? -20.226 -13.281 5.531   1.00 0.00 ? 10  LYS A HZ2  4  
ATOM 6698  H HZ3  . LYS A 1 10  ? -18.876 -14.025 6.224   1.00 0.00 ? 10  LYS A HZ3  4  
ATOM 6699  N N    . TRP A 1 11  ? -16.653 -6.623  5.094   1.00 0.00 ? 11  TRP A N    4  
ATOM 6700  C CA   . TRP A 1 11  ? -15.241 -6.229  5.034   1.00 0.00 ? 11  TRP A CA   4  
ATOM 6701  C C    . TRP A 1 11  ? -14.914 -5.190  6.105   1.00 0.00 ? 11  TRP A C    4  
ATOM 6702  O O    . TRP A 1 11  ? -13.746 -4.996  6.451   1.00 0.00 ? 11  TRP A O    4  
ATOM 6703  C CB   . TRP A 1 11  ? -14.883 -5.678  3.647   1.00 0.00 ? 11  TRP A CB   4  
ATOM 6704  C CG   . TRP A 1 11  ? -14.950 -6.703  2.554   1.00 0.00 ? 11  TRP A CG   4  
ATOM 6705  C CD1  . TRP A 1 11  ? -14.824 -8.056  2.688   1.00 0.00 ? 11  TRP A CD1  4  
ATOM 6706  C CD2  . TRP A 1 11  ? -15.140 -6.456  1.158   1.00 0.00 ? 11  TRP A CD2  4  
ATOM 6707  N NE1  . TRP A 1 11  ? -14.940 -8.664  1.464   1.00 0.00 ? 11  TRP A NE1  4  
ATOM 6708  C CE2  . TRP A 1 11  ? -15.129 -7.704  0.510   1.00 0.00 ? 11  TRP A CE2  4  
ATOM 6709  C CE3  . TRP A 1 11  ? -15.324 -5.301  0.393   1.00 0.00 ? 11  TRP A CE3  4  
ATOM 6710  C CZ2  . TRP A 1 11  ? -15.292 -7.830  -0.864  1.00 0.00 ? 11  TRP A CZ2  4  
ATOM 6711  C CZ3  . TRP A 1 11  ? -15.487 -5.428  -0.974  1.00 0.00 ? 11  TRP A CZ3  4  
ATOM 6712  C CH2  . TRP A 1 11  ? -15.468 -6.686  -1.588  1.00 0.00 ? 11  TRP A CH2  4  
ATOM 6713  H H    . TRP A 1 11  ? -17.246 -6.389  4.346   1.00 0.00 ? 11  TRP A H    4  
ATOM 6714  H HA   . TRP A 1 11  ? -14.646 -7.112  5.222   1.00 0.00 ? 11  TRP A HA   4  
ATOM 6715  H HB2  . TRP A 1 11  ? -15.567 -4.879  3.396   1.00 0.00 ? 11  TRP A HB2  4  
ATOM 6716  H HB3  . TRP A 1 11  ? -13.875 -5.284  3.671   1.00 0.00 ? 11  TRP A HB3  4  
ATOM 6717  H HD1  . TRP A 1 11  ? -14.666 -8.564  3.628   1.00 0.00 ? 11  TRP A HD1  4  
ATOM 6718  H HE1  . TRP A 1 11  ? -14.896 -9.625  1.304   1.00 0.00 ? 11  TRP A HE1  4  
ATOM 6719  H HE3  . TRP A 1 11  ? -15.342 -4.322  0.852   1.00 0.00 ? 11  TRP A HE3  4  
ATOM 6720  H HZ2  . TRP A 1 11  ? -15.280 -8.793  -1.355  1.00 0.00 ? 11  TRP A HZ2  4  
ATOM 6721  H HZ3  . TRP A 1 11  ? -15.629 -4.546  -1.582  1.00 0.00 ? 11  TRP A HZ3  4  
ATOM 6722  H HH2  . TRP A 1 11  ? -15.598 -6.742  -2.659  1.00 0.00 ? 11  TRP A HH2  4  
ATOM 6723  N N    . GLY A 1 12  ? -15.954 -4.546  6.634   1.00 0.00 ? 12  GLY A N    4  
ATOM 6724  C CA   . GLY A 1 12  ? -15.786 -3.495  7.627   1.00 0.00 ? 12  GLY A CA   4  
ATOM 6725  C C    . GLY A 1 12  ? -15.457 -4.036  9.008   1.00 0.00 ? 12  GLY A C    4  
ATOM 6726  O O    . GLY A 1 12  ? -16.210 -3.834  9.966   1.00 0.00 ? 12  GLY A O    4  
ATOM 6727  H H    . GLY A 1 12  ? -16.852 -4.790  6.345   1.00 0.00 ? 12  GLY A H    4  
ATOM 6728  H HA2  . GLY A 1 12  ? -14.988 -2.838  7.310   1.00 0.00 ? 12  GLY A HA2  4  
ATOM 6729  H HA3  . GLY A 1 12  ? -16.702 -2.925  7.684   1.00 0.00 ? 12  GLY A HA3  4  
ATOM 6730  N N    . GLU A 1 13  ? -14.336 -4.735  9.104   1.00 0.00 ? 13  GLU A N    4  
ATOM 6731  C CA   . GLU A 1 13  ? -13.841 -5.255  10.378  1.00 0.00 ? 13  GLU A CA   4  
ATOM 6732  C C    . GLU A 1 13  ? -12.317 -5.351  10.356  1.00 0.00 ? 13  GLU A C    4  
ATOM 6733  O O    . GLU A 1 13  ? -11.646 -5.048  11.348  1.00 0.00 ? 13  GLU A O    4  
ATOM 6734  C CB   . GLU A 1 13  ? -14.448 -6.634  10.690  1.00 0.00 ? 13  GLU A CB   4  
ATOM 6735  C CG   . GLU A 1 13  ? -14.120 -7.711  9.658   1.00 0.00 ? 13  GLU A CG   4  
ATOM 6736  C CD   . GLU A 1 13  ? -14.509 -9.108  10.121  1.00 0.00 ? 13  GLU A CD   4  
ATOM 6737  O OE1  . GLU A 1 13  ? -15.676 -9.506  9.923   1.00 0.00 ? 13  GLU A OE1  4  
ATOM 6738  O OE2  . GLU A 1 13  ? -13.649 -9.810  10.694  1.00 0.00 ? 13  GLU A OE2  4  
ATOM 6739  H H    . GLU A 1 13  ? -13.820 -4.900  8.290   1.00 0.00 ? 13  GLU A H    4  
ATOM 6740  H HA   . GLU A 1 13  ? -14.131 -4.560  11.155  1.00 0.00 ? 13  GLU A HA   4  
ATOM 6741  H HB2  . GLU A 1 13  ? -14.081 -6.965  11.652  1.00 0.00 ? 13  GLU A HB2  4  
ATOM 6742  H HB3  . GLU A 1 13  ? -15.525 -6.535  10.744  1.00 0.00 ? 13  GLU A HB3  4  
ATOM 6743  H HG2  . GLU A 1 13  ? -14.653 -7.489  8.743   1.00 0.00 ? 13  GLU A HG2  4  
ATOM 6744  H HG3  . GLU A 1 13  ? -13.056 -7.693  9.463   1.00 0.00 ? 13  GLU A HG3  4  
ATOM 6745  N N    . SER A 1 14  ? -11.775 -5.766  9.216   1.00 0.00 ? 14  SER A N    4  
ATOM 6746  C CA   . SER A 1 14  ? -10.341 -5.974  9.072   1.00 0.00 ? 14  SER A CA   4  
ATOM 6747  C C    . SER A 1 14  ? -9.868  -5.532  7.688   1.00 0.00 ? 14  SER A C    4  
ATOM 6748  O O    . SER A 1 14  ? -10.389 -5.987  6.664   1.00 0.00 ? 14  SER A O    4  
ATOM 6749  C CB   . SER A 1 14  ? -10.002 -7.452  9.300   1.00 0.00 ? 14  SER A CB   4  
ATOM 6750  O OG   . SER A 1 14  ? -10.340 -7.864  10.615  1.00 0.00 ? 14  SER A OG   4  
ATOM 6751  H H    . SER A 1 14  ? -12.354 -5.937  8.447   1.00 0.00 ? 14  SER A H    4  
ATOM 6752  H HA   . SER A 1 14  ? -9.838  -5.378  9.822   1.00 0.00 ? 14  SER A HA   4  
ATOM 6753  H HB2  . SER A 1 14  ? -10.552 -8.059  8.596   1.00 0.00 ? 14  SER A HB2  4  
ATOM 6754  H HB3  . SER A 1 14  ? -8.943  -7.603  9.152   1.00 0.00 ? 14  SER A HB3  4  
ATOM 6755  H HG   . SER A 1 14  ? -9.552  -8.222  11.043  1.00 0.00 ? 14  SER A HG   4  
ATOM 6756  N N    . PHE A 1 15  ? -8.881  -4.644  7.672   1.00 0.00 ? 15  PHE A N    4  
ATOM 6757  C CA   . PHE A 1 15  ? -8.292  -4.143  6.433   1.00 0.00 ? 15  PHE A CA   4  
ATOM 6758  C C    . PHE A 1 15  ? -7.720  -5.304  5.618   1.00 0.00 ? 15  PHE A C    4  
ATOM 6759  O O    . PHE A 1 15  ? -7.868  -5.360  4.397   1.00 0.00 ? 15  PHE A O    4  
ATOM 6760  C CB   . PHE A 1 15  ? -7.189  -3.129  6.770   1.00 0.00 ? 15  PHE A CB   4  
ATOM 6761  C CG   . PHE A 1 15  ? -6.708  -2.311  5.601   1.00 0.00 ? 15  PHE A CG   4  
ATOM 6762  C CD1  . PHE A 1 15  ? -5.722  -2.789  4.754   1.00 0.00 ? 15  PHE A CD1  4  
ATOM 6763  C CD2  . PHE A 1 15  ? -7.239  -1.056  5.358   1.00 0.00 ? 15  PHE A CD2  4  
ATOM 6764  C CE1  . PHE A 1 15  ? -5.279  -2.030  3.690   1.00 0.00 ? 15  PHE A CE1  4  
ATOM 6765  C CE2  . PHE A 1 15  ? -6.799  -0.294  4.298   1.00 0.00 ? 15  PHE A CE2  4  
ATOM 6766  C CZ   . PHE A 1 15  ? -5.819  -0.782  3.463   1.00 0.00 ? 15  PHE A CZ   4  
ATOM 6767  H H    . PHE A 1 15  ? -8.534  -4.307  8.528   1.00 0.00 ? 15  PHE A H    4  
ATOM 6768  H HA   . PHE A 1 15  ? -9.067  -3.653  5.861   1.00 0.00 ? 15  PHE A HA   4  
ATOM 6769  H HB2  . PHE A 1 15  ? -7.561  -2.444  7.518   1.00 0.00 ? 15  PHE A HB2  4  
ATOM 6770  H HB3  . PHE A 1 15  ? -6.338  -3.659  7.179   1.00 0.00 ? 15  PHE A HB3  4  
ATOM 6771  H HD1  . PHE A 1 15  ? -5.297  -3.768  4.930   1.00 0.00 ? 15  PHE A HD1  4  
ATOM 6772  H HD2  . PHE A 1 15  ? -8.007  -0.673  6.013   1.00 0.00 ? 15  PHE A HD2  4  
ATOM 6773  H HE1  . PHE A 1 15  ? -4.510  -2.414  3.036   1.00 0.00 ? 15  PHE A HE1  4  
ATOM 6774  H HE2  . PHE A 1 15  ? -7.221  0.685   4.124   1.00 0.00 ? 15  PHE A HE2  4  
ATOM 6775  H HZ   . PHE A 1 15  ? -5.472  -0.185  2.632   1.00 0.00 ? 15  PHE A HZ   4  
ATOM 6776  N N    . ASP A 1 16  ? -7.092  -6.244  6.318   1.00 0.00 ? 16  ASP A N    4  
ATOM 6777  C CA   . ASP A 1 16  ? -6.501  -7.421  5.685   1.00 0.00 ? 16  ASP A CA   4  
ATOM 6778  C C    . ASP A 1 16  ? -7.581  -8.296  5.046   1.00 0.00 ? 16  ASP A C    4  
ATOM 6779  O O    . ASP A 1 16  ? -7.327  -8.970  4.048   1.00 0.00 ? 16  ASP A O    4  
ATOM 6780  C CB   . ASP A 1 16  ? -5.692  -8.234  6.706   1.00 0.00 ? 16  ASP A CB   4  
ATOM 6781  C CG   . ASP A 1 16  ? -6.534  -8.707  7.882   1.00 0.00 ? 16  ASP A CG   4  
ATOM 6782  O OD1  . ASP A 1 16  ? -6.842  -7.878  8.762   1.00 0.00 ? 16  ASP A OD1  4  
ATOM 6783  O OD2  . ASP A 1 16  ? -6.891  -9.903  7.937   1.00 0.00 ? 16  ASP A OD2  4  
ATOM 6784  H H    . ASP A 1 16  ? -7.019  -6.145  7.291   1.00 0.00 ? 16  ASP A H    4  
ATOM 6785  H HA   . ASP A 1 16  ? -5.832  -7.075  4.908   1.00 0.00 ? 16  ASP A HA   4  
ATOM 6786  H HB2  . ASP A 1 16  ? -5.267  -9.098  6.216   1.00 0.00 ? 16  ASP A HB2  4  
ATOM 6787  H HB3  . ASP A 1 16  ? -4.888  -7.618  7.088   1.00 0.00 ? 16  ASP A HB3  4  
ATOM 6788  N N    . LYS A 1 17  ? -8.786  -8.274  5.615   1.00 0.00 ? 17  LYS A N    4  
ATOM 6789  C CA   . LYS A 1 17  ? -9.914  -9.017  5.051   1.00 0.00 ? 17  LYS A CA   4  
ATOM 6790  C C    . LYS A 1 17  ? -10.292 -8.432  3.692   1.00 0.00 ? 17  LYS A C    4  
ATOM 6791  O O    . LYS A 1 17  ? -10.630 -9.161  2.754   1.00 0.00 ? 17  LYS A O    4  
ATOM 6792  C CB   . LYS A 1 17  ? -11.121 -8.979  6.002   1.00 0.00 ? 17  LYS A CB   4  
ATOM 6793  C CG   . LYS A 1 17  ? -12.361 -9.692  5.462   1.00 0.00 ? 17  LYS A CG   4  
ATOM 6794  C CD   . LYS A 1 17  ? -13.529 -9.624  6.444   1.00 0.00 ? 17  LYS A CD   4  
ATOM 6795  C CE   . LYS A 1 17  ? -14.800 -10.227 5.858   1.00 0.00 ? 17  LYS A CE   4  
ATOM 6796  N NZ   . LYS A 1 17  ? -14.660 -11.680 5.570   1.00 0.00 ? 17  LYS A NZ   4  
ATOM 6797  H H    . LYS A 1 17  ? -8.919  -7.745  6.429   1.00 0.00 ? 17  LYS A H    4  
ATOM 6798  H HA   . LYS A 1 17  ? -9.602  -10.044 4.916   1.00 0.00 ? 17  LYS A HA   4  
ATOM 6799  H HB2  . LYS A 1 17  ? -10.840 -9.447  6.935   1.00 0.00 ? 17  LYS A HB2  4  
ATOM 6800  H HB3  . LYS A 1 17  ? -11.381 -7.947  6.194   1.00 0.00 ? 17  LYS A HB3  4  
ATOM 6801  H HG2  . LYS A 1 17  ? -12.657 -9.221  4.535   1.00 0.00 ? 17  LYS A HG2  4  
ATOM 6802  H HG3  . LYS A 1 17  ? -12.116 -10.730 5.277   1.00 0.00 ? 17  LYS A HG3  4  
ATOM 6803  H HD2  . LYS A 1 17  ? -13.267 -10.168 7.342   1.00 0.00 ? 17  LYS A HD2  4  
ATOM 6804  H HD3  . LYS A 1 17  ? -13.718 -8.589  6.695   1.00 0.00 ? 17  LYS A HD3  4  
ATOM 6805  H HE2  . LYS A 1 17  ? -15.607 -10.091 6.563   1.00 0.00 ? 17  LYS A HE2  4  
ATOM 6806  H HE3  . LYS A 1 17  ? -15.038 -9.712  4.940   1.00 0.00 ? 17  LYS A HE3  4  
ATOM 6807  H HZ1  . LYS A 1 17  ? -14.680 -12.228 6.455   1.00 0.00 ? 17  LYS A HZ1  4  
ATOM 6808  H HZ2  . LYS A 1 17  ? -13.758 -11.865 5.087   1.00 0.00 ? 17  LYS A HZ2  4  
ATOM 6809  H HZ3  . LYS A 1 17  ? -15.437 -12.000 4.955   1.00 0.00 ? 17  LYS A HZ3  4  
ATOM 6810  N N    . LEU A 1 18  ? -10.218 -7.108  3.600   1.00 0.00 ? 18  LEU A N    4  
ATOM 6811  C CA   . LEU A 1 18  ? -10.472 -6.395  2.351   1.00 0.00 ? 18  LEU A CA   4  
ATOM 6812  C C    . LEU A 1 18  ? -9.486  -6.851  1.270   1.00 0.00 ? 18  LEU A C    4  
ATOM 6813  O O    . LEU A 1 18  ? -9.885  -7.180  0.154   1.00 0.00 ? 18  LEU A O    4  
ATOM 6814  C CB   . LEU A 1 18  ? -10.349 -4.880  2.589   1.00 0.00 ? 18  LEU A CB   4  
ATOM 6815  C CG   . LEU A 1 18  ? -10.646 -3.981  1.377   1.00 0.00 ? 18  LEU A CG   4  
ATOM 6816  C CD1  . LEU A 1 18  ? -12.104 -4.111  0.949   1.00 0.00 ? 18  LEU A CD1  4  
ATOM 6817  C CD2  . LEU A 1 18  ? -10.302 -2.525  1.692   1.00 0.00 ? 18  LEU A CD2  4  
ATOM 6818  H H    . LEU A 1 18  ? -9.987  -6.592  4.405   1.00 0.00 ? 18  LEU A H    4  
ATOM 6819  H HA   . LEU A 1 18  ? -11.480 -6.627  2.027   1.00 0.00 ? 18  LEU A HA   4  
ATOM 6820  H HB2  . LEU A 1 18  ? -11.031 -4.610  3.384   1.00 0.00 ? 18  LEU A HB2  4  
ATOM 6821  H HB3  . LEU A 1 18  ? -9.343  -4.673  2.923   1.00 0.00 ? 18  LEU A HB3  4  
ATOM 6822  H HG   . LEU A 1 18  ? -10.028 -4.296  0.547   1.00 0.00 ? 18  LEU A HG   4  
ATOM 6823  H HD11 . LEU A 1 18  ? -12.289 -3.465  0.102   1.00 0.00 ? 18  LEU A HD11 4  
ATOM 6824  H HD12 . LEU A 1 18  ? -12.749 -3.825  1.766   1.00 0.00 ? 18  LEU A HD12 4  
ATOM 6825  H HD13 . LEU A 1 18  ? -12.309 -5.134  0.670   1.00 0.00 ? 18  LEU A HD13 4  
ATOM 6826  H HD21 . LEU A 1 18  ? -9.250  -2.447  1.931   1.00 0.00 ? 18  LEU A HD21 4  
ATOM 6827  H HD22 . LEU A 1 18  ? -10.887 -2.188  2.536   1.00 0.00 ? 18  LEU A HD22 4  
ATOM 6828  H HD23 . LEU A 1 18  ? -10.522 -1.908  0.833   1.00 0.00 ? 18  LEU A HD23 4  
ATOM 6829  N N    . LEU A 1 19  ? -8.202  -6.891  1.627   1.00 0.00 ? 19  LEU A N    4  
ATOM 6830  C CA   . LEU A 1 19  ? -7.144  -7.310  0.698   1.00 0.00 ? 19  LEU A CA   4  
ATOM 6831  C C    . LEU A 1 19  ? -7.192  -8.818  0.450   1.00 0.00 ? 19  LEU A C    4  
ATOM 6832  O O    . LEU A 1 19  ? -6.740  -9.299  -0.592  1.00 0.00 ? 19  LEU A O    4  
ATOM 6833  C CB   . LEU A 1 19  ? -5.760  -6.898  1.230   1.00 0.00 ? 19  LEU A CB   4  
ATOM 6834  C CG   . LEU A 1 19  ? -5.376  -5.420  1.021   1.00 0.00 ? 19  LEU A CG   4  
ATOM 6835  C CD1  . LEU A 1 19  ? -5.259  -5.095  -0.467  1.00 0.00 ? 19  LEU A CD1  4  
ATOM 6836  C CD2  . LEU A 1 19  ? -6.380  -4.488  1.695   1.00 0.00 ? 19  LEU A CD2  4  
ATOM 6837  H H    . LEU A 1 19  ? -7.956  -6.629  2.541   1.00 0.00 ? 19  LEU A H    4  
ATOM 6838  H HA   . LEU A 1 19  ? -7.319  -6.805  -0.242  1.00 0.00 ? 19  LEU A HA   4  
ATOM 6839  H HB2  . LEU A 1 19  ? -5.728  -7.109  2.291   1.00 0.00 ? 19  LEU A HB2  4  
ATOM 6840  H HB3  . LEU A 1 19  ? -5.013  -7.510  0.743   1.00 0.00 ? 19  LEU A HB3  4  
ATOM 6841  H HG   . LEU A 1 19  ? -4.408  -5.243  1.471   1.00 0.00 ? 19  LEU A HG   4  
ATOM 6842  H HD11 . LEU A 1 19  ? -6.211  -5.258  -0.950  1.00 0.00 ? 19  LEU A HD11 4  
ATOM 6843  H HD12 . LEU A 1 19  ? -4.514  -5.736  -0.917  1.00 0.00 ? 19  LEU A HD12 4  
ATOM 6844  H HD13 . LEU A 1 19  ? -4.963  -4.063  -0.590  1.00 0.00 ? 19  LEU A HD13 4  
ATOM 6845  H HD21 . LEU A 1 19  ? -6.421  -4.707  2.752   1.00 0.00 ? 19  LEU A HD21 4  
ATOM 6846  H HD22 . LEU A 1 19  ? -7.359  -4.632  1.260   1.00 0.00 ? 19  LEU A HD22 4  
ATOM 6847  H HD23 . LEU A 1 19  ? -6.071  -3.462  1.553   1.00 0.00 ? 19  LEU A HD23 4  
ATOM 6848  N N    . SER A 1 20  ? -7.737  -9.559  1.415   1.00 0.00 ? 20  SER A N    4  
ATOM 6849  C CA   . SER A 1 20  ? -7.920  -11.002 1.268   1.00 0.00 ? 20  SER A CA   4  
ATOM 6850  C C    . SER A 1 20  ? -8.825  -11.284 0.068   1.00 0.00 ? 20  SER A C    4  
ATOM 6851  O O    . SER A 1 20  ? -8.722  -12.328 -0.582  1.00 0.00 ? 20  SER A O    4  
ATOM 6852  C CB   . SER A 1 20  ? -8.517  -11.598 2.554   1.00 0.00 ? 20  SER A CB   4  
ATOM 6853  O OG   . SER A 1 20  ? -8.602  -13.010 2.481   1.00 0.00 ? 20  SER A OG   4  
ATOM 6854  H H    . SER A 1 20  ? -8.012  -9.126  2.249   1.00 0.00 ? 20  SER A H    4  
ATOM 6855  H HA   . SER A 1 20  ? -6.951  -11.444 1.088   1.00 0.00 ? 20  SER A HA   4  
ATOM 6856  H HB2  . SER A 1 20  ? -7.891  -11.335 3.394   1.00 0.00 ? 20  SER A HB2  4  
ATOM 6857  H HB3  . SER A 1 20  ? -9.510  -11.198 2.710   1.00 0.00 ? 20  SER A HB3  4  
ATOM 6858  H HG   . SER A 1 20  ? -7.710  -13.382 2.515   1.00 0.00 ? 20  SER A HG   4  
ATOM 6859  N N    . HIS A 1 21  ? -9.693  -10.323 -0.230  1.00 0.00 ? 21  HIS A N    4  
ATOM 6860  C CA   . HIS A 1 21  ? -10.576 -10.390 -1.388  1.00 0.00 ? 21  HIS A CA   4  
ATOM 6861  C C    . HIS A 1 21  ? -10.004 -9.539  -2.514  1.00 0.00 ? 21  HIS A C    4  
ATOM 6862  O O    . HIS A 1 21  ? -9.849  -8.332  -2.358  1.00 0.00 ? 21  HIS A O    4  
ATOM 6863  C CB   . HIS A 1 21  ? -11.979 -9.884  -1.017  1.00 0.00 ? 21  HIS A CB   4  
ATOM 6864  C CG   . HIS A 1 21  ? -12.791 -10.858 -0.214  1.00 0.00 ? 21  HIS A CG   4  
ATOM 6865  N ND1  . HIS A 1 21  ? -13.655 -11.767 -0.786  1.00 0.00 ? 21  HIS A ND1  4  
ATOM 6866  C CD2  . HIS A 1 21  ? -12.890 -11.043 1.123   1.00 0.00 ? 21  HIS A CD2  4  
ATOM 6867  C CE1  . HIS A 1 21  ? -14.246 -12.463 0.162   1.00 0.00 ? 21  HIS A CE1  4  
ATOM 6868  N NE2  . HIS A 1 21  ? -13.799 -12.046 1.330   1.00 0.00 ? 21  HIS A NE2  4  
ATOM 6869  H H    . HIS A 1 21  ? -9.722  -9.522  0.337   1.00 0.00 ? 21  HIS A H    4  
ATOM 6870  H HA   . HIS A 1 21  ? -10.640 -11.420 -1.714  1.00 0.00 ? 21  HIS A HA   4  
ATOM 6871  H HB2  . HIS A 1 21  ? -11.881 -8.981  -0.430  1.00 0.00 ? 21  HIS A HB2  4  
ATOM 6872  H HB3  . HIS A 1 21  ? -12.527 -9.656  -1.917  1.00 0.00 ? 21  HIS A HB3  4  
ATOM 6873  H HD1  . HIS A 1 21  ? -13.796 -11.905 -1.750  1.00 0.00 ? 21  HIS A HD1  4  
ATOM 6874  H HD2  . HIS A 1 21  ? -12.362 -10.494 1.888   1.00 0.00 ? 21  HIS A HD2  4  
ATOM 6875  H HE1  . HIS A 1 21  ? -14.994 -13.226 0.007   1.00 0.00 ? 21  HIS A HE1  4  
ATOM 6876  H HE2  . HIS A 1 21  ? -14.196 -12.279 2.202   1.00 0.00 ? 21  HIS A HE2  4  
ATOM 6877  N N    . ARG A 1 22  ? -9.695  -10.160 -3.646  1.00 0.00 ? 22  ARG A N    4  
ATOM 6878  C CA   . ARG A 1 22  ? -9.148  -9.430  -4.789  1.00 0.00 ? 22  ARG A CA   4  
ATOM 6879  C C    . ARG A 1 22  ? -10.180 -8.433  -5.318  1.00 0.00 ? 22  ARG A C    4  
ATOM 6880  O O    . ARG A 1 22  ? -9.826  -7.401  -5.893  1.00 0.00 ? 22  ARG A O    4  
ATOM 6881  C CB   . ARG A 1 22  ? -8.711  -10.407 -5.888  1.00 0.00 ? 22  ARG A CB   4  
ATOM 6882  C CG   . ARG A 1 22  ? -7.620  -11.376 -5.432  1.00 0.00 ? 22  ARG A CG   4  
ATOM 6883  C CD   . ARG A 1 22  ? -7.138  -12.279 -6.560  1.00 0.00 ? 22  ARG A CD   4  
ATOM 6884  N NE   . ARG A 1 22  ? -6.087  -13.195 -6.111  1.00 0.00 ? 22  ARG A NE   4  
ATOM 6885  C CZ   . ARG A 1 22  ? -5.259  -13.848 -6.927  1.00 0.00 ? 22  ARG A CZ   4  
ATOM 6886  N NH1  . ARG A 1 22  ? -5.341  -13.682 -8.244  1.00 0.00 ? 22  ARG A NH1  4  
ATOM 6887  N NH2  . ARG A 1 22  ? -4.343  -14.664 -6.419  1.00 0.00 ? 22  ARG A NH2  4  
ATOM 6888  H H    . ARG A 1 22  ? -9.848  -11.127 -3.722  1.00 0.00 ? 22  ARG A H    4  
ATOM 6889  H HA   . ARG A 1 22  ? -8.282  -8.880  -4.445  1.00 0.00 ? 22  ARG A HA   4  
ATOM 6890  H HB2  . ARG A 1 22  ? -9.570  -10.983 -6.207  1.00 0.00 ? 22  ARG A HB2  4  
ATOM 6891  H HB3  . ARG A 1 22  ? -8.335  -9.842  -6.731  1.00 0.00 ? 22  ARG A HB3  4  
ATOM 6892  H HG2  . ARG A 1 22  ? -6.779  -10.805 -5.062  1.00 0.00 ? 22  ARG A HG2  4  
ATOM 6893  H HG3  . ARG A 1 22  ? -8.013  -11.992 -4.633  1.00 0.00 ? 22  ARG A HG3  4  
ATOM 6894  H HD2  . ARG A 1 22  ? -7.975  -12.857 -6.926  1.00 0.00 ? 22  ARG A HD2  4  
ATOM 6895  H HD3  . ARG A 1 22  ? -6.750  -11.662 -7.358  1.00 0.00 ? 22  ARG A HD3  4  
ATOM 6896  H HE   . ARG A 1 22  ? -5.998  -13.333 -5.141  1.00 0.00 ? 22  ARG A HE   4  
ATOM 6897  H HH11 . ARG A 1 22  ? -6.031  -13.064 -8.632  1.00 0.00 ? 22  ARG A HH11 4  
ATOM 6898  H HH12 . ARG A 1 22  ? -4.710  -14.165 -8.857  1.00 0.00 ? 22  ARG A HH12 4  
ATOM 6899  H HH21 . ARG A 1 22  ? -4.273  -14.790 -5.424  1.00 0.00 ? 22  ARG A HH21 4  
ATOM 6900  H HH22 . ARG A 1 22  ? -3.719  -15.162 -7.026  1.00 0.00 ? 22  ARG A HH22 4  
ATOM 6901  N N    . ASP A 1 23  ? -11.455 -8.755  -5.106  1.00 0.00 ? 23  ASP A N    4  
ATOM 6902  C CA   . ASP A 1 23  ? -12.555 -7.836  -5.406  1.00 0.00 ? 23  ASP A CA   4  
ATOM 6903  C C    . ASP A 1 23  ? -12.471 -6.611  -4.496  1.00 0.00 ? 23  ASP A C    4  
ATOM 6904  O O    . ASP A 1 23  ? -12.676 -5.478  -4.933  1.00 0.00 ? 23  ASP A O    4  
ATOM 6905  C CB   . ASP A 1 23  ? -13.912 -8.537  -5.217  1.00 0.00 ? 23  ASP A CB   4  
ATOM 6906  C CG   . ASP A 1 23  ? -14.125 -9.687  -6.191  1.00 0.00 ? 23  ASP A CG   4  
ATOM 6907  O OD1  . ASP A 1 23  ? -13.519 -10.764 -5.988  1.00 0.00 ? 23  ASP A OD1  4  
ATOM 6908  O OD2  . ASP A 1 23  ? -14.886 -9.518  -7.165  1.00 0.00 ? 23  ASP A OD2  4  
ATOM 6909  H H    . ASP A 1 23  ? -11.664 -9.642  -4.750  1.00 0.00 ? 23  ASP A H    4  
ATOM 6910  H HA   . ASP A 1 23  ? -12.458 -7.517  -6.436  1.00 0.00 ? 23  ASP A HA   4  
ATOM 6911  H HB2  . ASP A 1 23  ? -13.969 -8.929  -4.211  1.00 0.00 ? 23  ASP A HB2  4  
ATOM 6912  H HB3  . ASP A 1 23  ? -14.707 -7.815  -5.358  1.00 0.00 ? 23  ASP A HB3  4  
ATOM 6913  N N    . GLY A 1 24  ? -12.154 -6.857  -3.227  1.00 0.00 ? 24  GLY A N    4  
ATOM 6914  C CA   . GLY A 1 24  ? -12.008 -5.780  -2.261  1.00 0.00 ? 24  GLY A CA   4  
ATOM 6915  C C    . GLY A 1 24  ? -10.803 -4.916  -2.570  1.00 0.00 ? 24  GLY A C    4  
ATOM 6916  O O    . GLY A 1 24  ? -10.880 -3.687  -2.551  1.00 0.00 ? 24  GLY A O    4  
ATOM 6917  H H    . GLY A 1 24  ? -12.002 -7.781  -2.945  1.00 0.00 ? 24  GLY A H    4  
ATOM 6918  H HA2  . GLY A 1 24  ? -12.900 -5.170  -2.272  1.00 0.00 ? 24  GLY A HA2  4  
ATOM 6919  H HA3  . GLY A 1 24  ? -11.889 -6.207  -1.276  1.00 0.00 ? 24  GLY A HA3  4  
ATOM 6920  N N    . LEU A 1 25  ? -9.689  -5.582  -2.860  1.00 0.00 ? 25  LEU A N    4  
ATOM 6921  C CA   . LEU A 1 25  ? -8.456  -4.923  -3.277  1.00 0.00 ? 25  LEU A CA   4  
ATOM 6922  C C    . LEU A 1 25  ? -8.725  -4.027  -4.484  1.00 0.00 ? 25  LEU A C    4  
ATOM 6923  O O    . LEU A 1 25  ? -8.239  -2.895  -4.553  1.00 0.00 ? 25  LEU A O    4  
ATOM 6924  C CB   . LEU A 1 25  ? -7.391  -5.998  -3.595  1.00 0.00 ? 25  LEU A CB   4  
ATOM 6925  C CG   . LEU A 1 25  ? -6.031  -5.497  -4.140  1.00 0.00 ? 25  LEU A CG   4  
ATOM 6926  C CD1  . LEU A 1 25  ? -4.926  -6.505  -3.821  1.00 0.00 ? 25  LEU A CD1  4  
ATOM 6927  C CD2  . LEU A 1 25  ? -6.095  -5.266  -5.651  1.00 0.00 ? 25  LEU A CD2  4  
ATOM 6928  H H    . LEU A 1 25  ? -9.697  -6.558  -2.783  1.00 0.00 ? 25  LEU A H    4  
ATOM 6929  H HA   . LEU A 1 25  ? -8.110  -4.313  -2.454  1.00 0.00 ? 25  LEU A HA   4  
ATOM 6930  H HB2  . LEU A 1 25  ? -7.202  -6.552  -2.686  1.00 0.00 ? 25  LEU A HB2  4  
ATOM 6931  H HB3  . LEU A 1 25  ? -7.812  -6.681  -4.321  1.00 0.00 ? 25  LEU A HB3  4  
ATOM 6932  H HG   . LEU A 1 25  ? -5.776  -4.560  -3.665  1.00 0.00 ? 25  LEU A HG   4  
ATOM 6933  H HD11 . LEU A 1 25  ? -4.874  -6.657  -2.752  1.00 0.00 ? 25  LEU A HD11 4  
ATOM 6934  H HD12 . LEU A 1 25  ? -3.979  -6.126  -4.174  1.00 0.00 ? 25  LEU A HD12 4  
ATOM 6935  H HD13 . LEU A 1 25  ? -5.140  -7.446  -4.308  1.00 0.00 ? 25  LEU A HD13 4  
ATOM 6936  H HD21 . LEU A 1 25  ? -5.129  -4.939  -6.010  1.00 0.00 ? 25  LEU A HD21 4  
ATOM 6937  H HD22 . LEU A 1 25  ? -6.832  -4.508  -5.871  1.00 0.00 ? 25  LEU A HD22 4  
ATOM 6938  H HD23 . LEU A 1 25  ? -6.369  -6.187  -6.147  1.00 0.00 ? 25  LEU A HD23 4  
ATOM 6939  N N    . GLU A 1 26  ? -9.514  -4.545  -5.423  1.00 0.00 ? 26  GLU A N    4  
ATOM 6940  C CA   . GLU A 1 26  ? -9.887  -3.807  -6.626  1.00 0.00 ? 26  GLU A CA   4  
ATOM 6941  C C    . GLU A 1 26  ? -10.587 -2.504  -6.251  1.00 0.00 ? 26  GLU A C    4  
ATOM 6942  O O    . GLU A 1 26  ? -10.179 -1.420  -6.671  1.00 0.00 ? 26  GLU A O    4  
ATOM 6943  C CB   . GLU A 1 26  ? -10.812 -4.670  -7.496  1.00 0.00 ? 26  GLU A CB   4  
ATOM 6944  C CG   . GLU A 1 26  ? -11.175 -4.044  -8.840  1.00 0.00 ? 26  GLU A CG   4  
ATOM 6945  C CD   . GLU A 1 26  ? -9.979  -3.906  -9.768  1.00 0.00 ? 26  GLU A CD   4  
ATOM 6946  O OE1  . GLU A 1 26  ? -9.303  -4.927  -10.027 1.00 0.00 ? 26  GLU A OE1  4  
ATOM 6947  O OE2  . GLU A 1 26  ? -9.724  -2.787  -10.271 1.00 0.00 ? 26  GLU A OE2  4  
ATOM 6948  H H    . GLU A 1 26  ? -9.855  -5.456  -5.303  1.00 0.00 ? 26  GLU A H    4  
ATOM 6949  H HA   . GLU A 1 26  ? -8.984  -3.583  -7.177  1.00 0.00 ? 26  GLU A HA   4  
ATOM 6950  H HB2  . GLU A 1 26  ? -10.324 -5.616  -7.687  1.00 0.00 ? 26  GLU A HB2  4  
ATOM 6951  H HB3  . GLU A 1 26  ? -11.727 -4.855  -6.952  1.00 0.00 ? 26  GLU A HB3  4  
ATOM 6952  H HG2  . GLU A 1 26  ? -11.915 -4.665  -9.324  1.00 0.00 ? 26  GLU A HG2  4  
ATOM 6953  H HG3  . GLU A 1 26  ? -11.594 -3.064  -8.663  1.00 0.00 ? 26  GLU A HG3  4  
ATOM 6954  N N    . ALA A 1 27  ? -11.631 -2.621  -5.438  1.00 0.00 ? 27  ALA A N    4  
ATOM 6955  C CA   . ALA A 1 27  ? -12.422 -1.469  -5.026  1.00 0.00 ? 27  ALA A CA   4  
ATOM 6956  C C    . ALA A 1 27  ? -11.570 -0.457  -4.259  1.00 0.00 ? 27  ALA A C    4  
ATOM 6957  O O    . ALA A 1 27  ? -11.701 0.755   -4.454  1.00 0.00 ? 27  ALA A O    4  
ATOM 6958  C CB   . ALA A 1 27  ? -13.607 -1.924  -4.181  1.00 0.00 ? 27  ALA A CB   4  
ATOM 6959  H H    . ALA A 1 27  ? -11.875 -3.512  -5.103  1.00 0.00 ? 27  ALA A H    4  
ATOM 6960  H HA   . ALA A 1 27  ? -12.809 -0.995  -5.918  1.00 0.00 ? 27  ALA A HA   4  
ATOM 6961  H HB1  . ALA A 1 27  ? -14.213 -1.069  -3.919  1.00 0.00 ? 27  ALA A HB1  4  
ATOM 6962  H HB2  . ALA A 1 27  ? -13.246 -2.399  -3.280  1.00 0.00 ? 27  ALA A HB2  4  
ATOM 6963  H HB3  . ALA A 1 27  ? -14.204 -2.627  -4.744  1.00 0.00 ? 27  ALA A HB3  4  
ATOM 6964  N N    . PHE A 1 28  ? -10.685 -0.962  -3.400  1.00 0.00 ? 28  PHE A N    4  
ATOM 6965  C CA   . PHE A 1 28  ? -9.861  -0.103  -2.558  1.00 0.00 ? 28  PHE A CA   4  
ATOM 6966  C C    . PHE A 1 28  ? -8.844  0.674   -3.390  1.00 0.00 ? 28  PHE A C    4  
ATOM 6967  O O    . PHE A 1 28  ? -8.719  1.889   -3.241  1.00 0.00 ? 28  PHE A O    4  
ATOM 6968  C CB   . PHE A 1 28  ? -9.139  -0.920  -1.478  1.00 0.00 ? 28  PHE A CB   4  
ATOM 6969  C CG   . PHE A 1 28  ? -8.301  -0.069  -0.552  1.00 0.00 ? 28  PHE A CG   4  
ATOM 6970  C CD1  . PHE A 1 28  ? -8.905  0.767   0.376   1.00 0.00 ? 28  PHE A CD1  4  
ATOM 6971  C CD2  . PHE A 1 28  ? -6.913  -0.092  -0.623  1.00 0.00 ? 28  PHE A CD2  4  
ATOM 6972  C CE1  . PHE A 1 28  ? -8.146  1.558   1.217   1.00 0.00 ? 28  PHE A CE1  4  
ATOM 6973  C CE2  . PHE A 1 28  ? -6.151  0.698   0.214   1.00 0.00 ? 28  PHE A CE2  4  
ATOM 6974  C CZ   . PHE A 1 28  ? -6.767  1.524   1.135   1.00 0.00 ? 28  PHE A CZ   4  
ATOM 6975  H H    . PHE A 1 28  ? -10.584 -1.936  -3.333  1.00 0.00 ? 28  PHE A H    4  
ATOM 6976  H HA   . PHE A 1 28  ? -10.519 0.605   -2.074  1.00 0.00 ? 28  PHE A HA   4  
ATOM 6977  H HB2  . PHE A 1 28  ? -9.872  -1.441  -0.879  1.00 0.00 ? 28  PHE A HB2  4  
ATOM 6978  H HB3  . PHE A 1 28  ? -8.490  -1.643  -1.951  1.00 0.00 ? 28  PHE A HB3  4  
ATOM 6979  H HD1  . PHE A 1 28  ? -9.983  0.795   0.443   1.00 0.00 ? 28  PHE A HD1  4  
ATOM 6980  H HD2  . PHE A 1 28  ? -6.430  -0.737  -1.343  1.00 0.00 ? 28  PHE A HD2  4  
ATOM 6981  H HE1  . PHE A 1 28  ? -8.629  2.204   1.937   1.00 0.00 ? 28  PHE A HE1  4  
ATOM 6982  H HE2  . PHE A 1 28  ? -5.073  0.671   0.149   1.00 0.00 ? 28  PHE A HE2  4  
ATOM 6983  H HZ   . PHE A 1 28  ? -6.171  2.143   1.790   1.00 0.00 ? 28  PHE A HZ   4  
ATOM 6984  N N    . THR A 1 29  ? -8.125  -0.023  -4.271  1.00 0.00 ? 29  THR A N    4  
ATOM 6985  C CA   . THR A 1 29  ? -7.086  0.614   -5.078  1.00 0.00 ? 29  THR A CA   4  
ATOM 6986  C C    . THR A 1 29  ? -7.696  1.700   -5.971  1.00 0.00 ? 29  THR A C    4  
ATOM 6987  O O    . THR A 1 29  ? -7.083  2.743   -6.201  1.00 0.00 ? 29  THR A O    4  
ATOM 6988  C CB   . THR A 1 29  ? -6.296  -0.415  -5.935  1.00 0.00 ? 29  THR A CB   4  
ATOM 6989  O OG1  . THR A 1 29  ? -5.164  0.215   -6.551  1.00 0.00 ? 29  THR A OG1  4  
ATOM 6990  C CG2  . THR A 1 29  ? -7.169  -1.046  -7.015  1.00 0.00 ? 29  THR A CG2  4  
ATOM 6991  H H    . THR A 1 29  ? -8.301  -0.982  -4.384  1.00 0.00 ? 29  THR A H    4  
ATOM 6992  H HA   . THR A 1 29  ? -6.390  1.085   -4.395  1.00 0.00 ? 29  THR A HA   4  
ATOM 6993  H HB   . THR A 1 29  ? -5.940  -1.200  -5.281  1.00 0.00 ? 29  THR A HB   4  
ATOM 6994  H HG1  . THR A 1 29  ? -4.610  -0.453  -6.963  1.00 0.00 ? 29  THR A HG1  4  
ATOM 6995  H HG21 . THR A 1 29  ? -8.001  -1.561  -6.554  1.00 0.00 ? 29  THR A HG21 4  
ATOM 6996  H HG22 . THR A 1 29  ? -6.584  -1.753  -7.587  1.00 0.00 ? 29  THR A HG22 4  
ATOM 6997  H HG23 . THR A 1 29  ? -7.545  -0.277  -7.674  1.00 0.00 ? 29  THR A HG23 4  
ATOM 6998  N N    . ARG A 1 30  ? -8.924  1.460   -6.437  1.00 0.00 ? 30  ARG A N    4  
ATOM 6999  C CA   . ARG A 1 30  ? -9.650  2.441   -7.244  1.00 0.00 ? 30  ARG A CA   4  
ATOM 7000  C C    . ARG A 1 30  ? -9.832  3.740   -6.463  1.00 0.00 ? 30  ARG A C    4  
ATOM 7001  O O    . ARG A 1 30  ? -9.481  4.823   -6.940  1.00 0.00 ? 30  ARG A O    4  
ATOM 7002  C CB   . ARG A 1 30  ? -11.016 1.882   -7.670  1.00 0.00 ? 30  ARG A CB   4  
ATOM 7003  C CG   . ARG A 1 30  ? -10.923 0.741   -8.679  1.00 0.00 ? 30  ARG A CG   4  
ATOM 7004  C CD   . ARG A 1 30  ? -10.279 1.201   -9.978  1.00 0.00 ? 30  ARG A CD   4  
ATOM 7005  N NE   . ARG A 1 30  ? -10.144 0.111   -10.949 1.00 0.00 ? 30  ARG A NE   4  
ATOM 7006  C CZ   . ARG A 1 30  ? -9.978  0.299   -12.262 1.00 0.00 ? 30  ARG A CZ   4  
ATOM 7007  N NH1  . ARG A 1 30  ? -9.911  1.530   -12.755 1.00 0.00 ? 30  ARG A NH1  4  
ATOM 7008  N NH2  . ARG A 1 30  ? -9.870  -0.744  -13.075 1.00 0.00 ? 30  ARG A NH2  4  
ATOM 7009  H H    . ARG A 1 30  ? -9.354  0.602   -6.230  1.00 0.00 ? 30  ARG A H    4  
ATOM 7010  H HA   . ARG A 1 30  ? -9.061  2.645   -8.126  1.00 0.00 ? 30  ARG A HA   4  
ATOM 7011  H HB2  . ARG A 1 30  ? -11.533 1.516   -6.793  1.00 0.00 ? 30  ARG A HB2  4  
ATOM 7012  H HB3  . ARG A 1 30  ? -11.599 2.679   -8.112  1.00 0.00 ? 30  ARG A HB3  4  
ATOM 7013  H HG2  . ARG A 1 30  ? -10.329 -0.055  -8.255  1.00 0.00 ? 30  ARG A HG2  4  
ATOM 7014  H HG3  . ARG A 1 30  ? -11.920 0.377   -8.889  1.00 0.00 ? 30  ARG A HG3  4  
ATOM 7015  H HD2  . ARG A 1 30  ? -10.891 1.980   -10.409 1.00 0.00 ? 30  ARG A HD2  4  
ATOM 7016  H HD3  . ARG A 1 30  ? -9.297  1.598   -9.759  1.00 0.00 ? 30  ARG A HD3  4  
ATOM 7017  H HE   . ARG A 1 30  ? -10.179 -0.813  -10.600 1.00 0.00 ? 30  ARG A HE   4  
ATOM 7018  H HH11 . ARG A 1 30  ? -9.986  2.326   -12.144 1.00 0.00 ? 30  ARG A HH11 4  
ATOM 7019  H HH12 . ARG A 1 30  ? -9.781  1.676   -13.741 1.00 0.00 ? 30  ARG A HH12 4  
ATOM 7020  H HH21 . ARG A 1 30  ? -9.908  -1.677  -12.708 1.00 0.00 ? 30  ARG A HH21 4  
ATOM 7021  H HH22 . ARG A 1 30  ? -9.764  -0.605  -14.065 1.00 0.00 ? 30  ARG A HH22 4  
ATOM 7022  N N    . PHE A 1 31  ? -10.361 3.620   -5.248  1.00 0.00 ? 31  PHE A N    4  
ATOM 7023  C CA   . PHE A 1 31  ? -10.571 4.776   -4.387  1.00 0.00 ? 31  PHE A CA   4  
ATOM 7024  C C    . PHE A 1 31  ? -9.237  5.416   -4.009  1.00 0.00 ? 31  PHE A C    4  
ATOM 7025  O O    . PHE A 1 31  ? -9.096  6.638   -4.023  1.00 0.00 ? 31  PHE A O    4  
ATOM 7026  C CB   . PHE A 1 31  ? -11.346 4.383   -3.120  1.00 0.00 ? 31  PHE A CB   4  
ATOM 7027  C CG   . PHE A 1 31  ? -11.447 5.498   -2.107  1.00 0.00 ? 31  PHE A CG   4  
ATOM 7028  C CD1  . PHE A 1 31  ? -12.206 6.629   -2.374  1.00 0.00 ? 31  PHE A CD1  4  
ATOM 7029  C CD2  . PHE A 1 31  ? -10.769 5.424   -0.897  1.00 0.00 ? 31  PHE A CD2  4  
ATOM 7030  C CE1  . PHE A 1 31  ? -12.290 7.657   -1.457  1.00 0.00 ? 31  PHE A CE1  4  
ATOM 7031  C CE2  . PHE A 1 31  ? -10.850 6.451   0.024   1.00 0.00 ? 31  PHE A CE2  4  
ATOM 7032  C CZ   . PHE A 1 31  ? -11.612 7.568   -0.257  1.00 0.00 ? 31  PHE A CZ   4  
ATOM 7033  H H    . PHE A 1 31  ? -10.614 2.728   -4.922  1.00 0.00 ? 31  PHE A H    4  
ATOM 7034  H HA   . PHE A 1 31  ? -11.155 5.498   -4.944  1.00 0.00 ? 31  PHE A HA   4  
ATOM 7035  H HB2  . PHE A 1 31  ? -12.351 4.092   -3.394  1.00 0.00 ? 31  PHE A HB2  4  
ATOM 7036  H HB3  . PHE A 1 31  ? -10.852 3.543   -2.648  1.00 0.00 ? 31  PHE A HB3  4  
ATOM 7037  H HD1  . PHE A 1 31  ? -12.739 6.701   -3.312  1.00 0.00 ? 31  PHE A HD1  4  
ATOM 7038  H HD2  . PHE A 1 31  ? -10.172 4.550   -0.677  1.00 0.00 ? 31  PHE A HD2  4  
ATOM 7039  H HE1  . PHE A 1 31  ? -12.887 8.531   -1.677  1.00 0.00 ? 31  PHE A HE1  4  
ATOM 7040  H HE2  . PHE A 1 31  ? -10.317 6.380   0.962   1.00 0.00 ? 31  PHE A HE2  4  
ATOM 7041  H HZ   . PHE A 1 31  ? -11.677 8.372   0.461   1.00 0.00 ? 31  PHE A HZ   4  
ATOM 7042  N N    . LEU A 1 32  ? -8.255  4.584   -3.694  1.00 0.00 ? 32  LEU A N    4  
ATOM 7043  C CA   . LEU A 1 32  ? -6.961  5.071   -3.234  1.00 0.00 ? 32  LEU A CA   4  
ATOM 7044  C C    . LEU A 1 32  ? -6.250  5.845   -4.348  1.00 0.00 ? 32  LEU A C    4  
ATOM 7045  O O    . LEU A 1 32  ? -5.448  6.742   -4.079  1.00 0.00 ? 32  LEU A O    4  
ATOM 7046  C CB   . LEU A 1 32  ? -6.094  3.902   -2.740  1.00 0.00 ? 32  LEU A CB   4  
ATOM 7047  C CG   . LEU A 1 32  ? -4.969  4.293   -1.770  1.00 0.00 ? 32  LEU A CG   4  
ATOM 7048  C CD1  . LEU A 1 32  ? -5.546  4.875   -0.481  1.00 0.00 ? 32  LEU A CD1  4  
ATOM 7049  C CD2  . LEU A 1 32  ? -4.073  3.097   -1.467  1.00 0.00 ? 32  LEU A CD2  4  
ATOM 7050  H H    . LEU A 1 32  ? -8.402  3.619   -3.771  1.00 0.00 ? 32  LEU A H    4  
ATOM 7051  H HA   . LEU A 1 32  ? -7.141  5.745   -2.407  1.00 0.00 ? 32  LEU A HA   4  
ATOM 7052  H HB2  . LEU A 1 32  ? -6.738  3.186   -2.245  1.00 0.00 ? 32  LEU A HB2  4  
ATOM 7053  H HB3  . LEU A 1 32  ? -5.648  3.421   -3.600  1.00 0.00 ? 32  LEU A HB3  4  
ATOM 7054  H HG   . LEU A 1 32  ? -4.359  5.057   -2.229  1.00 0.00 ? 32  LEU A HG   4  
ATOM 7055  H HD11 . LEU A 1 32  ? -6.186  4.143   -0.006  1.00 0.00 ? 32  LEU A HD11 4  
ATOM 7056  H HD12 . LEU A 1 32  ? -6.123  5.759   -0.713  1.00 0.00 ? 32  LEU A HD12 4  
ATOM 7057  H HD13 . LEU A 1 32  ? -4.741  5.138   0.189   1.00 0.00 ? 32  LEU A HD13 4  
ATOM 7058  H HD21 . LEU A 1 32  ? -3.288  3.395   -0.788  1.00 0.00 ? 32  LEU A HD21 4  
ATOM 7059  H HD22 . LEU A 1 32  ? -3.633  2.737   -2.385  1.00 0.00 ? 32  LEU A HD22 4  
ATOM 7060  H HD23 . LEU A 1 32  ? -4.658  2.307   -1.016  1.00 0.00 ? 32  LEU A HD23 4  
ATOM 7061  N N    . LYS A 1 33  ? -6.555  5.500   -5.602  1.00 0.00 ? 33  LYS A N    4  
ATOM 7062  C CA   . LYS A 1 33  ? -5.988  6.209   -6.749  1.00 0.00 ? 33  LYS A CA   4  
ATOM 7063  C C    . LYS A 1 33  ? -6.653  7.573   -6.936  1.00 0.00 ? 33  LYS A C    4  
ATOM 7064  O O    . LYS A 1 33  ? -5.967  8.569   -7.173  1.00 0.00 ? 33  LYS A O    4  
ATOM 7065  C CB   . LYS A 1 33  ? -6.096  5.376   -8.038  1.00 0.00 ? 33  LYS A CB   4  
ATOM 7066  C CG   . LYS A 1 33  ? -5.068  4.250   -8.124  1.00 0.00 ? 33  LYS A CG   4  
ATOM 7067  C CD   . LYS A 1 33  ? -5.030  3.606   -9.508  1.00 0.00 ? 33  LYS A CD   4  
ATOM 7068  C CE   . LYS A 1 33  ? -3.847  2.651   -9.659  1.00 0.00 ? 33  LYS A CE   4  
ATOM 7069  N NZ   . LYS A 1 33  ? -2.538  3.342   -9.468  1.00 0.00 ? 33  LYS A NZ   4  
ATOM 7070  H H    . LYS A 1 33  ? -7.171  4.751   -5.758  1.00 0.00 ? 33  LYS A H    4  
ATOM 7071  H HA   . LYS A 1 33  ? -4.940  6.374   -6.535  1.00 0.00 ? 33  LYS A HA   4  
ATOM 7072  H HB2  . LYS A 1 33  ? -7.085  4.940   -8.091  1.00 0.00 ? 33  LYS A HB2  4  
ATOM 7073  H HB3  . LYS A 1 33  ? -5.956  6.029   -8.889  1.00 0.00 ? 33  LYS A HB3  4  
ATOM 7074  H HG2  . LYS A 1 33  ? -4.090  4.654   -7.903  1.00 0.00 ? 33  LYS A HG2  4  
ATOM 7075  H HG3  . LYS A 1 33  ? -5.316  3.494   -7.391  1.00 0.00 ? 33  LYS A HG3  4  
ATOM 7076  H HD2  . LYS A 1 33  ? -5.946  3.054   -9.662  1.00 0.00 ? 33  LYS A HD2  4  
ATOM 7077  H HD3  . LYS A 1 33  ? -4.949  4.384   -10.255 1.00 0.00 ? 33  LYS A HD3  4  
ATOM 7078  H HE2  . LYS A 1 33  ? -3.936  1.864   -8.924  1.00 0.00 ? 33  LYS A HE2  4  
ATOM 7079  H HE3  . LYS A 1 33  ? -3.873  2.219   -10.650 1.00 0.00 ? 33  LYS A HE3  4  
ATOM 7080  H HZ1  . LYS A 1 33  ? -1.757  2.723   -9.763  1.00 0.00 ? 33  LYS A HZ1  4  
ATOM 7081  H HZ2  . LYS A 1 33  ? -2.402  3.586   -8.466  1.00 0.00 ? 33  LYS A HZ2  4  
ATOM 7082  H HZ3  . LYS A 1 33  ? -2.505  4.219   -10.027 1.00 0.00 ? 33  LYS A HZ3  4  
ATOM 7083  N N    . THR A 1 34  ? -7.980  7.630   -6.825  1.00 0.00 ? 34  THR A N    4  
ATOM 7084  C CA   . THR A 1 34  ? -8.689  8.908   -6.937  1.00 0.00 ? 34  THR A CA   4  
ATOM 7085  C C    . THR A 1 34  ? -8.425  9.769   -5.698  1.00 0.00 ? 34  THR A C    4  
ATOM 7086  O O    . THR A 1 34  ? -8.629  10.985  -5.716  1.00 0.00 ? 34  THR A O    4  
ATOM 7087  C CB   . THR A 1 34  ? -10.217 8.726   -7.153  1.00 0.00 ? 34  THR A CB   4  
ATOM 7088  O OG1  . THR A 1 34  ? -10.839 10.000  -7.379  1.00 0.00 ? 34  THR A OG1  4  
ATOM 7089  C CG2  . THR A 1 34  ? -10.879 8.050   -5.960  1.00 0.00 ? 34  THR A CG2  4  
ATOM 7090  H H    . THR A 1 34  ? -8.491  6.805   -6.670  1.00 0.00 ? 34  THR A H    4  
ATOM 7091  H HA   . THR A 1 34  ? -8.289  9.424   -7.801  1.00 0.00 ? 34  THR A HA   4  
ATOM 7092  H HB   . THR A 1 34  ? -10.367 8.105   -8.026  1.00 0.00 ? 34  THR A HB   4  
ATOM 7093  H HG1  . THR A 1 34  ? -10.515 10.635  -6.729  1.00 0.00 ? 34  THR A HG1  4  
ATOM 7094  H HG21 . THR A 1 34  ? -11.937 7.937   -6.150  1.00 0.00 ? 34  THR A HG21 4  
ATOM 7095  H HG22 . THR A 1 34  ? -10.734 8.653   -5.075  1.00 0.00 ? 34  THR A HG22 4  
ATOM 7096  H HG23 . THR A 1 34  ? -10.437 7.076   -5.806  1.00 0.00 ? 34  THR A HG23 4  
ATOM 7097  N N    . GLU A 1 35  ? -7.959  9.123   -4.629  1.00 0.00 ? 35  GLU A N    4  
ATOM 7098  C CA   . GLU A 1 35  ? -7.547  9.814   -3.408  1.00 0.00 ? 35  GLU A CA   4  
ATOM 7099  C C    . GLU A 1 35  ? -6.043  10.125  -3.473  1.00 0.00 ? 35  GLU A C    4  
ATOM 7100  O O    . GLU A 1 35  ? -5.417  10.466  -2.469  1.00 0.00 ? 35  GLU A O    4  
ATOM 7101  C CB   . GLU A 1 35  ? -7.877  8.933   -2.191  1.00 0.00 ? 35  GLU A CB   4  
ATOM 7102  C CG   . GLU A 1 35  ? -7.720  9.628   -0.841  1.00 0.00 ? 35  GLU A CG   4  
ATOM 7103  C CD   . GLU A 1 35  ? -8.591  10.870  -0.714  1.00 0.00 ? 35  GLU A CD   4  
ATOM 7104  O OE1  . GLU A 1 35  ? -9.822  10.729  -0.543  1.00 0.00 ? 35  GLU A OE1  4  
ATOM 7105  O OE2  . GLU A 1 35  ? -8.047  11.994  -0.767  1.00 0.00 ? 35  GLU A OE2  4  
ATOM 7106  H H    . GLU A 1 35  ? -7.903  8.144   -4.655  1.00 0.00 ? 35  GLU A H    4  
ATOM 7107  H HA   . GLU A 1 35  ? -8.097  10.744  -3.338  1.00 0.00 ? 35  GLU A HA   4  
ATOM 7108  H HB2  . GLU A 1 35  ? -8.901  8.596   -2.276  1.00 0.00 ? 35  GLU A HB2  4  
ATOM 7109  H HB3  . GLU A 1 35  ? -7.227  8.068   -2.203  1.00 0.00 ? 35  GLU A HB3  4  
ATOM 7110  H HG2  . GLU A 1 35  ? -7.993  8.934   -0.059  1.00 0.00 ? 35  GLU A HG2  4  
ATOM 7111  H HG3  . GLU A 1 35  ? -6.684  9.913   -0.717  1.00 0.00 ? 35  GLU A HG3  4  
ATOM 7112  N N    . PHE A 1 36  ? -5.479  9.983   -4.683  1.00 0.00 ? 36  PHE A N    4  
ATOM 7113  C CA   . PHE A 1 36  ? -4.060  10.264  -4.979  1.00 0.00 ? 36  PHE A CA   4  
ATOM 7114  C C    . PHE A 1 36  ? -3.103  9.655   -3.945  1.00 0.00 ? 36  PHE A C    4  
ATOM 7115  O O    . PHE A 1 36  ? -1.953  10.080  -3.824  1.00 0.00 ? 36  PHE A O    4  
ATOM 7116  C CB   . PHE A 1 36  ? -3.802  11.782  -5.161  1.00 0.00 ? 36  PHE A CB   4  
ATOM 7117  C CG   . PHE A 1 36  ? -4.156  12.655  -3.975  1.00 0.00 ? 36  PHE A CG   4  
ATOM 7118  C CD1  . PHE A 1 36  ? -3.270  12.813  -2.918  1.00 0.00 ? 36  PHE A CD1  4  
ATOM 7119  C CD2  . PHE A 1 36  ? -5.375  13.320  -3.923  1.00 0.00 ? 36  PHE A CD2  4  
ATOM 7120  C CE1  . PHE A 1 36  ? -3.593  13.610  -1.837  1.00 0.00 ? 36  PHE A CE1  4  
ATOM 7121  C CE2  . PHE A 1 36  ? -5.701  14.117  -2.843  1.00 0.00 ? 36  PHE A CE2  4  
ATOM 7122  C CZ   . PHE A 1 36  ? -4.809  14.262  -1.799  1.00 0.00 ? 36  PHE A CZ   4  
ATOM 7123  H H    . PHE A 1 36  ? -6.043  9.670   -5.416  1.00 0.00 ? 36  PHE A H    4  
ATOM 7124  H HA   . PHE A 1 36  ? -3.853  9.782   -5.925  1.00 0.00 ? 36  PHE A HA   4  
ATOM 7125  H HB2  . PHE A 1 36  ? -2.754  11.934  -5.373  1.00 0.00 ? 36  PHE A HB2  4  
ATOM 7126  H HB3  . PHE A 1 36  ? -4.378  12.130  -6.009  1.00 0.00 ? 36  PHE A HB3  4  
ATOM 7127  H HD1  . PHE A 1 36  ? -2.316  12.304  -2.943  1.00 0.00 ? 36  PHE A HD1  4  
ATOM 7128  H HD2  . PHE A 1 36  ? -6.076  13.208  -4.738  1.00 0.00 ? 36  PHE A HD2  4  
ATOM 7129  H HE1  . PHE A 1 36  ? -2.894  13.722  -1.020  1.00 0.00 ? 36  PHE A HE1  4  
ATOM 7130  H HE2  . PHE A 1 36  ? -6.652  14.629  -2.816  1.00 0.00 ? 36  PHE A HE2  4  
ATOM 7131  H HZ   . PHE A 1 36  ? -5.063  14.885  -0.954  1.00 0.00 ? 36  PHE A HZ   4  
ATOM 7132  N N    . SER A 1 37  ? -3.563  8.623   -3.243  1.00 0.00 ? 37  SER A N    4  
ATOM 7133  C CA   . SER A 1 37  ? -2.749  7.937   -2.241  1.00 0.00 ? 37  SER A CA   4  
ATOM 7134  C C    . SER A 1 37  ? -2.333  6.555   -2.755  1.00 0.00 ? 37  SER A C    4  
ATOM 7135  O O    . SER A 1 37  ? -1.918  5.686   -1.983  1.00 0.00 ? 37  SER A O    4  
ATOM 7136  C CB   . SER A 1 37  ? -3.539  7.809   -0.932  1.00 0.00 ? 37  SER A CB   4  
ATOM 7137  O OG   . SER A 1 37  ? -3.991  9.076   -0.481  1.00 0.00 ? 37  SER A OG   4  
ATOM 7138  H H    . SER A 1 37  ? -4.477  8.309   -3.403  1.00 0.00 ? 37  SER A H    4  
ATOM 7139  H HA   . SER A 1 37  ? -1.860  8.527   -2.062  1.00 0.00 ? 37  SER A HA   4  
ATOM 7140  H HB2  . SER A 1 37  ? -4.398  7.173   -1.091  1.00 0.00 ? 37  SER A HB2  4  
ATOM 7141  H HB3  . SER A 1 37  ? -2.906  7.375   -0.171  1.00 0.00 ? 37  SER A HB3  4  
ATOM 7142  H HG   . SER A 1 37  ? -4.191  9.637   -1.241  1.00 0.00 ? 37  SER A HG   4  
ATOM 7143  N N    . GLU A 1 38  ? -2.427  6.373   -4.075  1.00 0.00 ? 38  GLU A N    4  
ATOM 7144  C CA   . GLU A 1 38  ? -2.102  5.097   -4.723  1.00 0.00 ? 38  GLU A CA   4  
ATOM 7145  C C    . GLU A 1 38  ? -0.697  4.617   -4.360  1.00 0.00 ? 38  GLU A C    4  
ATOM 7146  O O    . GLU A 1 38  ? -0.381  3.433   -4.500  1.00 0.00 ? 38  GLU A O    4  
ATOM 7147  C CB   . GLU A 1 38  ? -2.232  5.222   -6.246  1.00 0.00 ? 38  GLU A CB   4  
ATOM 7148  C CG   . GLU A 1 38  ? -1.386  6.336   -6.861  1.00 0.00 ? 38  GLU A CG   4  
ATOM 7149  C CD   . GLU A 1 38  ? -1.341  6.273   -8.384  1.00 0.00 ? 38  GLU A CD   4  
ATOM 7150  O OE1  . GLU A 1 38  ? -2.402  6.049   -9.009  1.00 0.00 ? 38  GLU A OE1  4  
ATOM 7151  O OE2  . GLU A 1 38  ? -0.245  6.428   -8.962  1.00 0.00 ? 38  GLU A OE2  4  
ATOM 7152  H H    . GLU A 1 38  ? -2.730  7.120   -4.631  1.00 0.00 ? 38  GLU A H    4  
ATOM 7153  H HA   . GLU A 1 38  ? -2.815  4.363   -4.374  1.00 0.00 ? 38  GLU A HA   4  
ATOM 7154  H HB2  . GLU A 1 38  ? -1.938  4.284   -6.697  1.00 0.00 ? 38  GLU A HB2  4  
ATOM 7155  H HB3  . GLU A 1 38  ? -3.268  5.414   -6.487  1.00 0.00 ? 38  GLU A HB3  4  
ATOM 7156  H HG2  . GLU A 1 38  ? -1.801  7.290   -6.568  1.00 0.00 ? 38  GLU A HG2  4  
ATOM 7157  H HG3  . GLU A 1 38  ? -0.376  6.255   -6.480  1.00 0.00 ? 38  GLU A HG3  4  
ATOM 7158  N N    . GLU A 1 39  ? 0.135   5.545   -3.900  1.00 0.00 ? 39  GLU A N    4  
ATOM 7159  C CA   . GLU A 1 39  ? 1.486   5.231   -3.451  1.00 0.00 ? 39  GLU A CA   4  
ATOM 7160  C C    . GLU A 1 39  ? 1.476   4.062   -2.471  1.00 0.00 ? 39  GLU A C    4  
ATOM 7161  O O    . GLU A 1 39  ? 2.223   3.110   -2.641  1.00 0.00 ? 39  GLU A O    4  
ATOM 7162  C CB   . GLU A 1 39  ? 2.121   6.490   -2.816  1.00 0.00 ? 39  GLU A CB   4  
ATOM 7163  C CG   . GLU A 1 39  ? 3.405   6.253   -2.008  1.00 0.00 ? 39  GLU A CG   4  
ATOM 7164  C CD   . GLU A 1 39  ? 3.147   6.027   -0.515  1.00 0.00 ? 39  GLU A CD   4  
ATOM 7165  O OE1  . GLU A 1 39  ? 2.847   7.012   0.200   1.00 0.00 ? 39  GLU A OE1  4  
ATOM 7166  O OE2  . GLU A 1 39  ? 3.246   4.872   -0.050  1.00 0.00 ? 39  GLU A OE2  4  
ATOM 7167  H H    . GLU A 1 39  ? -0.169  6.474   -3.862  1.00 0.00 ? 39  GLU A H    4  
ATOM 7168  H HA   . GLU A 1 39  ? 2.062   4.945   -4.323  1.00 0.00 ? 39  GLU A HA   4  
ATOM 7169  H HB2  . GLU A 1 39  ? 2.355   7.189   -3.608  1.00 0.00 ? 39  GLU A HB2  4  
ATOM 7170  H HB3  . GLU A 1 39  ? 1.392   6.949   -2.163  1.00 0.00 ? 39  GLU A HB3  4  
ATOM 7171  H HG2  . GLU A 1 39  ? 3.910   5.384   -2.407  1.00 0.00 ? 39  GLU A HG2  4  
ATOM 7172  H HG3  . GLU A 1 39  ? 4.047   7.115   -2.118  1.00 0.00 ? 39  GLU A HG3  4  
ATOM 7173  N N    . ASN A 1 40  ? 0.589   4.122   -1.483  1.00 0.00 ? 40  ASN A N    4  
ATOM 7174  C CA   . ASN A 1 40  ? 0.560   3.139   -0.395  1.00 0.00 ? 40  ASN A CA   4  
ATOM 7175  C C    . ASN A 1 40  ? 0.390   1.710   -0.921  1.00 0.00 ? 40  ASN A C    4  
ATOM 7176  O O    . ASN A 1 40  ? 1.263   0.845   -0.727  1.00 0.00 ? 40  ASN A O    4  
ATOM 7177  C CB   . ASN A 1 40  ? -0.575  3.471   0.585   1.00 0.00 ? 40  ASN A CB   4  
ATOM 7178  C CG   . ASN A 1 40  ? -0.507  4.894   1.128   1.00 0.00 ? 40  ASN A CG   4  
ATOM 7179  O OD1  . ASN A 1 40  ? -1.534  5.494   1.444   1.00 0.00 ? 40  ASN A OD1  4  
ATOM 7180  N ND2  . ASN A 1 40  ? 0.691   5.446   1.241   1.00 0.00 ? 40  ASN A ND2  4  
ATOM 7181  H H    . ASN A 1 40  ? -0.065  4.855   -1.480  1.00 0.00 ? 40  ASN A H    4  
ATOM 7182  H HA   . ASN A 1 40  ? 1.502   3.204   0.130   1.00 0.00 ? 40  ASN A HA   4  
ATOM 7183  H HB2  . ASN A 1 40  ? -1.523  3.347   0.081   1.00 0.00 ? 40  ASN A HB2  4  
ATOM 7184  H HB3  . ASN A 1 40  ? -0.529  2.785   1.421   1.00 0.00 ? 40  ASN A HB3  4  
ATOM 7185  H HD21 . ASN A 1 40  ? 1.480   4.922   0.971   1.00 0.00 ? 40  ASN A HD21 4  
ATOM 7186  H HD22 . ASN A 1 40  ? 0.746   6.363   1.576   1.00 0.00 ? 40  ASN A HD22 4  
ATOM 7187  N N    . ILE A 1 41  ? -0.736  1.476   -1.597  1.00 0.00 ? 41  ILE A N    4  
ATOM 7188  C CA   . ILE A 1 41  ? -1.072  0.152   -2.116  1.00 0.00 ? 41  ILE A CA   4  
ATOM 7189  C C    . ILE A 1 41  ? 0.046   -0.362  -3.030  1.00 0.00 ? 41  ILE A C    4  
ATOM 7190  O O    . ILE A 1 41  ? 0.519   -1.487  -2.873  1.00 0.00 ? 41  ILE A O    4  
ATOM 7191  C CB   . ILE A 1 41  ? -2.439  0.171   -2.876  1.00 0.00 ? 41  ILE A CB   4  
ATOM 7192  C CG1  . ILE A 1 41  ? -2.820  -1.231  -3.390  1.00 0.00 ? 41  ILE A CG1  4  
ATOM 7193  C CG2  . ILE A 1 41  ? -2.425  1.175   -4.027  1.00 0.00 ? 41  ILE A CG2  4  
ATOM 7194  C CD1  . ILE A 1 41  ? -3.206  -2.205  -2.297  1.00 0.00 ? 41  ILE A CD1  4  
ATOM 7195  H H    . ILE A 1 41  ? -1.352  2.219   -1.758  1.00 0.00 ? 41  ILE A H    4  
ATOM 7196  H HA   . ILE A 1 41  ? -1.165  -0.518  -1.269  1.00 0.00 ? 41  ILE A HA   4  
ATOM 7197  H HB   . ILE A 1 41  ? -3.196  0.497   -2.174  1.00 0.00 ? 41  ILE A HB   4  
ATOM 7198  H HG12 . ILE A 1 41  ? -3.661  -1.147  -4.062  1.00 0.00 ? 41  ILE A HG12 4  
ATOM 7199  H HG13 . ILE A 1 41  ? -1.981  -1.652  -3.926  1.00 0.00 ? 41  ILE A HG13 4  
ATOM 7200  H HG21 . ILE A 1 41  ? -3.388  1.176   -4.518  1.00 0.00 ? 41  ILE A HG21 4  
ATOM 7201  H HG22 . ILE A 1 41  ? -1.661  0.899   -4.737  1.00 0.00 ? 41  ILE A HG22 4  
ATOM 7202  H HG23 . ILE A 1 41  ? -2.218  2.163   -3.642  1.00 0.00 ? 41  ILE A HG23 4  
ATOM 7203  H HD11 . ILE A 1 41  ? -2.378  -2.330  -1.614  1.00 0.00 ? 41  ILE A HD11 4  
ATOM 7204  H HD12 . ILE A 1 41  ? -3.455  -3.159  -2.737  1.00 0.00 ? 41  ILE A HD12 4  
ATOM 7205  H HD13 . ILE A 1 41  ? -4.063  -1.824  -1.759  1.00 0.00 ? 41  ILE A HD13 4  
ATOM 7206  N N    . GLU A 1 42  ? 0.504   0.497   -3.938  1.00 0.00 ? 42  GLU A N    4  
ATOM 7207  C CA   . GLU A 1 42  ? 1.512   0.117   -4.925  1.00 0.00 ? 42  GLU A CA   4  
ATOM 7208  C C    . GLU A 1 42  ? 2.913   0.104   -4.315  1.00 0.00 ? 42  GLU A C    4  
ATOM 7209  O O    . GLU A 1 42  ? 3.856   -0.410  -4.924  1.00 0.00 ? 42  GLU A O    4  
ATOM 7210  C CB   . GLU A 1 42  ? 1.444   1.058   -6.138  1.00 0.00 ? 42  GLU A CB   4  
ATOM 7211  C CG   . GLU A 1 42  ? 0.114   0.970   -6.877  1.00 0.00 ? 42  GLU A CG   4  
ATOM 7212  C CD   . GLU A 1 42  ? 0.016   1.900   -8.076  1.00 0.00 ? 42  GLU A CD   4  
ATOM 7213  O OE1  . GLU A 1 42  ? -0.389  3.066   -7.904  1.00 0.00 ? 42  GLU A OE1  4  
ATOM 7214  O OE2  . GLU A 1 42  ? 0.319   1.461   -9.206  1.00 0.00 ? 42  GLU A OE2  4  
ATOM 7215  H H    . GLU A 1 42  ? 0.162   1.417   -3.940  1.00 0.00 ? 42  GLU A H    4  
ATOM 7216  H HA   . GLU A 1 42  ? 1.280   -0.887  -5.258  1.00 0.00 ? 42  GLU A HA   4  
ATOM 7217  H HB2  . GLU A 1 42  ? 1.581   2.078   -5.802  1.00 0.00 ? 42  GLU A HB2  4  
ATOM 7218  H HB3  . GLU A 1 42  ? 2.235   0.804   -6.829  1.00 0.00 ? 42  GLU A HB3  4  
ATOM 7219  H HG2  . GLU A 1 42  ? -0.015  -0.042  -7.219  1.00 0.00 ? 42  GLU A HG2  4  
ATOM 7220  H HG3  . GLU A 1 42  ? -0.679  1.209   -6.187  1.00 0.00 ? 42  GLU A HG3  4  
ATOM 7221  N N    . PHE A 1 43  ? 3.043   0.656   -3.108  1.00 0.00 ? 43  PHE A N    4  
ATOM 7222  C CA   . PHE A 1 43  ? 4.318   0.662   -2.399  1.00 0.00 ? 43  PHE A CA   4  
ATOM 7223  C C    . PHE A 1 43  ? 4.667   -0.739  -1.930  1.00 0.00 ? 43  PHE A C    4  
ATOM 7224  O O    . PHE A 1 43  ? 5.636   -1.334  -2.409  1.00 0.00 ? 43  PHE A O    4  
ATOM 7225  C CB   . PHE A 1 43  ? 4.297   1.623   -1.200  1.00 0.00 ? 43  PHE A CB   4  
ATOM 7226  C CG   . PHE A 1 43  ? 5.567   1.593   -0.385  1.00 0.00 ? 43  PHE A CG   4  
ATOM 7227  C CD1  . PHE A 1 43  ? 6.743   2.122   -0.895  1.00 0.00 ? 43  PHE A CD1  4  
ATOM 7228  C CD2  . PHE A 1 43  ? 5.589   1.025   0.883   1.00 0.00 ? 43  PHE A CD2  4  
ATOM 7229  C CE1  . PHE A 1 43  ? 7.912   2.089   -0.159  1.00 0.00 ? 43  PHE A CE1  4  
ATOM 7230  C CE2  . PHE A 1 43  ? 6.755   0.988   1.621   1.00 0.00 ? 43  PHE A CE2  4  
ATOM 7231  C CZ   . PHE A 1 43  ? 7.918   1.521   1.099   1.00 0.00 ? 43  PHE A CZ   4  
ATOM 7232  H H    . PHE A 1 43  ? 2.263   1.078   -2.689  1.00 0.00 ? 43  PHE A H    4  
ATOM 7233  H HA   . PHE A 1 43  ? 5.079   0.992   -3.095  1.00 0.00 ? 43  PHE A HA   4  
ATOM 7234  H HB2  . PHE A 1 43  ? 4.155   2.634   -1.559  1.00 0.00 ? 43  PHE A HB2  4  
ATOM 7235  H HB3  . PHE A 1 43  ? 3.473   1.363   -0.550  1.00 0.00 ? 43  PHE A HB3  4  
ATOM 7236  H HD1  . PHE A 1 43  ? 6.740   2.568   -1.881  1.00 0.00 ? 43  PHE A HD1  4  
ATOM 7237  H HD2  . PHE A 1 43  ? 4.680   0.608   1.292   1.00 0.00 ? 43  PHE A HD2  4  
ATOM 7238  H HE1  . PHE A 1 43  ? 8.820   2.506   -0.569  1.00 0.00 ? 43  PHE A HE1  4  
ATOM 7239  H HE2  . PHE A 1 43  ? 6.758   0.542   2.605   1.00 0.00 ? 43  PHE A HE2  4  
ATOM 7240  H HZ   . PHE A 1 43  ? 8.832   1.493   1.675   1.00 0.00 ? 43  PHE A HZ   4  
ATOM 7241  N N    . TRP A 1 44  ? 3.876   -1.286  -1.004  1.00 0.00 ? 44  TRP A N    4  
ATOM 7242  C CA   . TRP A 1 44  ? 4.200   -2.606  -0.466  1.00 0.00 ? 44  TRP A CA   4  
ATOM 7243  C C    . TRP A 1 44  ? 3.909   -3.711  -1.481  1.00 0.00 ? 44  TRP A C    4  
ATOM 7244  O O    . TRP A 1 44  ? 4.461   -4.809  -1.386  1.00 0.00 ? 44  TRP A O    4  
ATOM 7245  C CB   . TRP A 1 44  ? 3.547   -2.878  0.901   1.00 0.00 ? 44  TRP A CB   4  
ATOM 7246  C CG   . TRP A 1 44  ? 2.120   -2.439  1.065   1.00 0.00 ? 44  TRP A CG   4  
ATOM 7247  C CD1  . TRP A 1 44  ? 1.689   -1.284  1.654   1.00 0.00 ? 44  TRP A CD1  4  
ATOM 7248  C CD2  . TRP A 1 44  ? 0.942   -3.159  0.685   1.00 0.00 ? 44  TRP A CD2  4  
ATOM 7249  N NE1  . TRP A 1 44  ? 0.320   -1.245  1.671   1.00 0.00 ? 44  TRP A NE1  4  
ATOM 7250  C CE2  . TRP A 1 44  ? -0.165  -2.380  1.075   1.00 0.00 ? 44  TRP A CE2  4  
ATOM 7251  C CE3  . TRP A 1 44  ? 0.715   -4.385  0.054   1.00 0.00 ? 44  TRP A CE3  4  
ATOM 7252  C CZ2  . TRP A 1 44  ? -1.475  -2.789  0.854   1.00 0.00 ? 44  TRP A CZ2  4  
ATOM 7253  C CZ3  . TRP A 1 44  ? -0.587  -4.788  -0.167  1.00 0.00 ? 44  TRP A CZ3  4  
ATOM 7254  C CH2  . TRP A 1 44  ? -1.668  -3.993  0.232   1.00 0.00 ? 44  TRP A CH2  4  
ATOM 7255  H H    . TRP A 1 44  ? 3.071   -0.802  -0.693  1.00 0.00 ? 44  TRP A H    4  
ATOM 7256  H HA   . TRP A 1 44  ? 5.274   -2.604  -0.315  1.00 0.00 ? 44  TRP A HA   4  
ATOM 7257  H HB2  . TRP A 1 44  ? 3.578   -3.939  1.093   1.00 0.00 ? 44  TRP A HB2  4  
ATOM 7258  H HB3  . TRP A 1 44  ? 4.132   -2.378  1.663   1.00 0.00 ? 44  TRP A HB3  4  
ATOM 7259  H HD1  . TRP A 1 44  ? 2.345   -0.524  2.055   1.00 0.00 ? 44  TRP A HD1  4  
ATOM 7260  H HE1  . TRP A 1 44  ? -0.221  -0.520  2.045   1.00 0.00 ? 44  TRP A HE1  4  
ATOM 7261  H HE3  . TRP A 1 44  ? 1.537   -5.013  -0.262  1.00 0.00 ? 44  TRP A HE3  4  
ATOM 7262  H HZ2  . TRP A 1 44  ? -2.319  -2.188  1.155   1.00 0.00 ? 44  TRP A HZ2  4  
ATOM 7263  H HZ3  . TRP A 1 44  ? -0.782  -5.731  -0.655  1.00 0.00 ? 44  TRP A HZ3  4  
ATOM 7264  H HH2  . TRP A 1 44  ? -2.670  -4.348  0.040   1.00 0.00 ? 44  TRP A HH2  4  
ATOM 7265  N N    . ILE A 1 45  ? 3.074   -3.412  -2.476  1.00 0.00 ? 45  ILE A N    4  
ATOM 7266  C CA   . ILE A 1 45  ? 2.936   -4.296  -3.634  1.00 0.00 ? 45  ILE A CA   4  
ATOM 7267  C C    . ILE A 1 45  ? 4.289   -4.423  -4.343  1.00 0.00 ? 45  ILE A C    4  
ATOM 7268  O O    . ILE A 1 45  ? 4.707   -5.522  -4.725  1.00 0.00 ? 45  ILE A O    4  
ATOM 7269  C CB   . ILE A 1 45  ? 1.848   -3.782  -4.622  1.00 0.00 ? 45  ILE A CB   4  
ATOM 7270  C CG1  . ILE A 1 45  ? 0.446   -4.191  -4.130  1.00 0.00 ? 45  ILE A CG1  4  
ATOM 7271  C CG2  . ILE A 1 45  ? 2.089   -4.278  -6.051  1.00 0.00 ? 45  ILE A CG2  4  
ATOM 7272  C CD1  . ILE A 1 45  ? -0.682  -3.746  -5.040  1.00 0.00 ? 45  ILE A CD1  4  
ATOM 7273  H H    . ILE A 1 45  ? 2.534   -2.592  -2.428  1.00 0.00 ? 45  ILE A H    4  
ATOM 7274  H HA   . ILE A 1 45  ? 2.640   -5.273  -3.271  1.00 0.00 ? 45  ILE A HA   4  
ATOM 7275  H HB   . ILE A 1 45  ? 1.903   -2.703  -4.640  1.00 0.00 ? 45  ILE A HB   4  
ATOM 7276  H HG12 . ILE A 1 45  ? 0.397   -5.268  -4.050  1.00 0.00 ? 45  ILE A HG12 4  
ATOM 7277  H HG13 . ILE A 1 45  ? 0.274   -3.757  -3.155  1.00 0.00 ? 45  ILE A HG13 4  
ATOM 7278  H HG21 . ILE A 1 45  ? 3.059   -3.940  -6.390  1.00 0.00 ? 45  ILE A HG21 4  
ATOM 7279  H HG22 . ILE A 1 45  ? 1.325   -3.880  -6.705  1.00 0.00 ? 45  ILE A HG22 4  
ATOM 7280  H HG23 . ILE A 1 45  ? 2.056   -5.357  -6.072  1.00 0.00 ? 45  ILE A HG23 4  
ATOM 7281  H HD11 . ILE A 1 45  ? -0.554  -4.188  -6.017  1.00 0.00 ? 45  ILE A HD11 4  
ATOM 7282  H HD12 . ILE A 1 45  ? -0.672  -2.669  -5.128  1.00 0.00 ? 45  ILE A HD12 4  
ATOM 7283  H HD13 . ILE A 1 45  ? -1.626  -4.064  -4.623  1.00 0.00 ? 45  ILE A HD13 4  
ATOM 7284  N N    . ALA A 1 46  ? 4.982   -3.291  -4.481  1.00 0.00 ? 46  ALA A N    4  
ATOM 7285  C CA   . ALA A 1 46  ? 6.299   -3.258  -5.114  1.00 0.00 ? 46  ALA A CA   4  
ATOM 7286  C C    . ALA A 1 46  ? 7.359   -3.875  -4.201  1.00 0.00 ? 46  ALA A C    4  
ATOM 7287  O O    . ALA A 1 46  ? 8.357   -4.421  -4.678  1.00 0.00 ? 46  ALA A O    4  
ATOM 7288  C CB   . ALA A 1 46  ? 6.685   -1.828  -5.472  1.00 0.00 ? 46  ALA A CB   4  
ATOM 7289  H H    . ALA A 1 46  ? 4.595   -2.452  -4.145  1.00 0.00 ? 46  ALA A H    4  
ATOM 7290  H HA   . ALA A 1 46  ? 6.246   -3.833  -6.028  1.00 0.00 ? 46  ALA A HA   4  
ATOM 7291  H HB1  . ALA A 1 46  ? 5.941   -1.409  -6.135  1.00 0.00 ? 46  ALA A HB1  4  
ATOM 7292  H HB2  . ALA A 1 46  ? 7.646   -1.825  -5.965  1.00 0.00 ? 46  ALA A HB2  4  
ATOM 7293  H HB3  . ALA A 1 46  ? 6.741   -1.231  -4.573  1.00 0.00 ? 46  ALA A HB3  4  
ATOM 7294  N N    . CYS A 1 47  ? 7.135   -3.785  -2.891  1.00 0.00 ? 47  CYS A N    4  
ATOM 7295  C CA   . CYS A 1 47  ? 8.061   -4.348  -1.909  1.00 0.00 ? 47  CYS A CA   4  
ATOM 7296  C C    . CYS A 1 47  ? 8.096   -5.873  -2.008  1.00 0.00 ? 47  CYS A C    4  
ATOM 7297  O O    . CYS A 1 47  ? 9.150   -6.492  -1.854  1.00 0.00 ? 47  CYS A O    4  
ATOM 7298  C CB   . CYS A 1 47  ? 7.670   -3.913  -0.494  1.00 0.00 ? 47  CYS A CB   4  
ATOM 7299  S SG   . CYS A 1 47  ? 7.708   -2.122  -0.247  1.00 0.00 ? 47  CYS A SG   4  
ATOM 7300  H H    . CYS A 1 47  ? 6.329   -3.323  -2.577  1.00 0.00 ? 47  CYS A H    4  
ATOM 7301  H HA   . CYS A 1 47  ? 9.048   -3.965  -2.132  1.00 0.00 ? 47  CYS A HA   4  
ATOM 7302  H HB2  . CYS A 1 47  ? 6.667   -4.250  -0.282  1.00 0.00 ? 47  CYS A HB2  4  
ATOM 7303  H HB3  . CYS A 1 47  ? 8.353   -4.358  0.217   1.00 0.00 ? 47  CYS A HB3  4  
ATOM 7304  H HG   . CYS A 1 47  ? 7.256   -1.549  -1.352  1.00 0.00 ? 47  CYS A HG   4  
ATOM 7305  N N    . GLU A 1 48  ? 6.942   -6.477  -2.274  1.00 0.00 ? 48  GLU A N    4  
ATOM 7306  C CA   . GLU A 1 48  ? 6.865   -7.923  -2.446  1.00 0.00 ? 48  GLU A CA   4  
ATOM 7307  C C    . GLU A 1 48  ? 7.367   -8.333  -3.830  1.00 0.00 ? 48  GLU A C    4  
ATOM 7308  O O    . GLU A 1 48  ? 7.850   -9.454  -4.015  1.00 0.00 ? 48  GLU A O    4  
ATOM 7309  C CB   . GLU A 1 48  ? 5.439   -8.425  -2.194  1.00 0.00 ? 48  GLU A CB   4  
ATOM 7310  C CG   . GLU A 1 48  ? 5.002   -8.281  -0.736  1.00 0.00 ? 48  GLU A CG   4  
ATOM 7311  C CD   . GLU A 1 48  ? 5.877   -9.081  0.228   1.00 0.00 ? 48  GLU A CD   4  
ATOM 7312  O OE1  . GLU A 1 48  ? 6.945   -8.573  0.644   1.00 0.00 ? 48  GLU A OE1  4  
ATOM 7313  O OE2  . GLU A 1 48  ? 5.503   -10.227 0.564   1.00 0.00 ? 48  GLU A OE2  4  
ATOM 7314  H H    . GLU A 1 48  ? 6.122   -5.939  -2.338  1.00 0.00 ? 48  GLU A H    4  
ATOM 7315  H HA   . GLU A 1 48  ? 7.520   -8.369  -1.708  1.00 0.00 ? 48  GLU A HA   4  
ATOM 7316  H HB2  . GLU A 1 48  ? 4.754   -7.862  -2.814  1.00 0.00 ? 48  GLU A HB2  4  
ATOM 7317  H HB3  . GLU A 1 48  ? 5.380   -9.470  -2.465  1.00 0.00 ? 48  GLU A HB3  4  
ATOM 7318  H HG2  . GLU A 1 48  ? 5.053   -7.235  -0.461  1.00 0.00 ? 48  GLU A HG2  4  
ATOM 7319  H HG3  . GLU A 1 48  ? 3.980   -8.623  -0.644  1.00 0.00 ? 48  GLU A HG3  4  
ATOM 7320  N N    . ASP A 1 49  ? 7.257   -7.425  -4.800  1.00 0.00 ? 49  ASP A N    4  
ATOM 7321  C CA   . ASP A 1 49  ? 7.902   -7.619  -6.102  1.00 0.00 ? 49  ASP A CA   4  
ATOM 7322  C C    . ASP A 1 49  ? 9.412   -7.649  -5.914  1.00 0.00 ? 49  ASP A C    4  
ATOM 7323  O O    . ASP A 1 49  ? 10.125  -8.435  -6.541  1.00 0.00 ? 49  ASP A O    4  
ATOM 7324  C CB   . ASP A 1 49  ? 7.519   -6.505  -7.086  1.00 0.00 ? 49  ASP A CB   4  
ATOM 7325  C CG   . ASP A 1 49  ? 8.359   -6.535  -8.361  1.00 0.00 ? 49  ASP A CG   4  
ATOM 7326  O OD1  . ASP A 1 49  ? 8.144   -7.428  -9.208  1.00 0.00 ? 49  ASP A OD1  4  
ATOM 7327  O OD2  . ASP A 1 49  ? 9.248   -5.672  -8.518  1.00 0.00 ? 49  ASP A OD2  4  
ATOM 7328  H H    . ASP A 1 49  ? 6.726   -6.614  -4.641  1.00 0.00 ? 49  ASP A H    4  
ATOM 7329  H HA   . ASP A 1 49  ? 7.580   -8.573  -6.496  1.00 0.00 ? 49  ASP A HA   4  
ATOM 7330  H HB2  . ASP A 1 49  ? 6.479   -6.618  -7.357  1.00 0.00 ? 49  ASP A HB2  4  
ATOM 7331  H HB3  . ASP A 1 49  ? 7.656   -5.546  -6.606  1.00 0.00 ? 49  ASP A HB3  4  
ATOM 7332  N N    . PHE A 1 50  ? 9.876   -6.780  -5.030  1.00 0.00 ? 50  PHE A N    4  
ATOM 7333  C CA   . PHE A 1 50  ? 11.273  -6.723  -4.631  1.00 0.00 ? 50  PHE A CA   4  
ATOM 7334  C C    . PHE A 1 50  ? 11.684  -8.046  -3.981  1.00 0.00 ? 50  PHE A C    4  
ATOM 7335  O O    . PHE A 1 50  ? 12.730  -8.608  -4.299  1.00 0.00 ? 50  PHE A O    4  
ATOM 7336  C CB   . PHE A 1 50  ? 11.458  -5.547  -3.657  1.00 0.00 ? 50  PHE A CB   4  
ATOM 7337  C CG   . PHE A 1 50  ? 12.847  -5.387  -3.097  1.00 0.00 ? 50  PHE A CG   4  
ATOM 7338  C CD1  . PHE A 1 50  ? 13.838  -4.763  -3.834  1.00 0.00 ? 50  PHE A CD1  4  
ATOM 7339  C CD2  . PHE A 1 50  ? 13.156  -5.847  -1.824  1.00 0.00 ? 50  PHE A CD2  4  
ATOM 7340  C CE1  . PHE A 1 50  ? 15.105  -4.602  -3.318  1.00 0.00 ? 50  PHE A CE1  4  
ATOM 7341  C CE2  . PHE A 1 50  ? 14.423  -5.686  -1.303  1.00 0.00 ? 50  PHE A CE2  4  
ATOM 7342  C CZ   . PHE A 1 50  ? 15.399  -5.063  -2.050  1.00 0.00 ? 50  PHE A CZ   4  
ATOM 7343  H H    . PHE A 1 50  ? 9.249   -6.141  -4.627  1.00 0.00 ? 50  PHE A H    4  
ATOM 7344  H HA   . PHE A 1 50  ? 11.872  -6.555  -5.513  1.00 0.00 ? 50  PHE A HA   4  
ATOM 7345  H HB2  . PHE A 1 50  ? 11.206  -4.629  -4.168  1.00 0.00 ? 50  PHE A HB2  4  
ATOM 7346  H HB3  . PHE A 1 50  ? 10.778  -5.676  -2.825  1.00 0.00 ? 50  PHE A HB3  4  
ATOM 7347  H HD1  . PHE A 1 50  ? 13.611  -4.401  -4.827  1.00 0.00 ? 50  PHE A HD1  4  
ATOM 7348  H HD2  . PHE A 1 50  ? 12.393  -6.337  -1.237  1.00 0.00 ? 50  PHE A HD2  4  
ATOM 7349  H HE1  . PHE A 1 50  ? 15.869  -4.113  -3.905  1.00 0.00 ? 50  PHE A HE1  4  
ATOM 7350  H HE2  . PHE A 1 50  ? 14.652  -6.047  -0.309  1.00 0.00 ? 50  PHE A HE2  4  
ATOM 7351  H HZ   . PHE A 1 50  ? 16.392  -4.933  -1.645  1.00 0.00 ? 50  PHE A HZ   4  
ATOM 7352  N N    . LYS A 1 51  ? 10.819  -8.548  -3.100  1.00 0.00 ? 51  LYS A N    4  
ATOM 7353  C CA   . LYS A 1 51  ? 11.083  -9.780  -2.357  1.00 0.00 ? 51  LYS A CA   4  
ATOM 7354  C C    . LYS A 1 51  ? 11.313  -10.972 -3.293  1.00 0.00 ? 51  LYS A C    4  
ATOM 7355  O O    . LYS A 1 51  ? 12.168  -11.820 -3.033  1.00 0.00 ? 51  LYS A O    4  
ATOM 7356  C CB   . LYS A 1 51  ? 9.913   -10.092 -1.409  1.00 0.00 ? 51  LYS A CB   4  
ATOM 7357  C CG   . LYS A 1 51  ? 10.188  -11.251 -0.451  1.00 0.00 ? 51  LYS A CG   4  
ATOM 7358  C CD   . LYS A 1 51  ? 8.950   -11.654 0.349   1.00 0.00 ? 51  LYS A CD   4  
ATOM 7359  C CE   . LYS A 1 51  ? 7.869   -12.263 -0.539  1.00 0.00 ? 51  LYS A CE   4  
ATOM 7360  N NZ   . LYS A 1 51  ? 8.325   -13.518 -1.200  1.00 0.00 ? 51  LYS A NZ   4  
ATOM 7361  H H    . LYS A 1 51  ? 9.981   -8.066  -2.934  1.00 0.00 ? 51  LYS A H    4  
ATOM 7362  H HA   . LYS A 1 51  ? 11.975  -9.625  -1.770  1.00 0.00 ? 51  LYS A HA   4  
ATOM 7363  H HB2  . LYS A 1 51  ? 9.700   -9.210  -0.819  1.00 0.00 ? 51  LYS A HB2  4  
ATOM 7364  H HB3  . LYS A 1 51  ? 9.040   -10.336 -1.998  1.00 0.00 ? 51  LYS A HB3  4  
ATOM 7365  H HG2  . LYS A 1 51  ? 10.522  -12.104 -1.025  1.00 0.00 ? 51  LYS A HG2  4  
ATOM 7366  H HG3  . LYS A 1 51  ? 10.970  -10.957 0.237   1.00 0.00 ? 51  LYS A HG3  4  
ATOM 7367  H HD2  . LYS A 1 51  ? 9.238   -12.380 1.097   1.00 0.00 ? 51  LYS A HD2  4  
ATOM 7368  H HD3  . LYS A 1 51  ? 8.551   -10.776 0.840   1.00 0.00 ? 51  LYS A HD3  4  
ATOM 7369  H HE2  . LYS A 1 51  ? 7.003   -12.484 0.069   1.00 0.00 ? 51  LYS A HE2  4  
ATOM 7370  H HE3  . LYS A 1 51  ? 7.596   -11.545 -1.300  1.00 0.00 ? 51  LYS A HE3  4  
ATOM 7371  H HZ1  . LYS A 1 51  ? 7.558   -13.919 -1.779  1.00 0.00 ? 51  LYS A HZ1  4  
ATOM 7372  H HZ2  . LYS A 1 51  ? 8.600   -14.221 -0.487  1.00 0.00 ? 51  LYS A HZ2  4  
ATOM 7373  H HZ3  . LYS A 1 51  ? 9.141   -13.329 -1.814  1.00 0.00 ? 51  LYS A HZ3  4  
ATOM 7374  N N    . LYS A 1 52  ? 10.542  -11.041 -4.379  1.00 0.00 ? 52  LYS A N    4  
ATOM 7375  C CA   . LYS A 1 52  ? 10.628  -12.178 -5.300  1.00 0.00 ? 52  LYS A CA   4  
ATOM 7376  C C    . LYS A 1 52  ? 11.761  -11.999 -6.314  1.00 0.00 ? 52  LYS A C    4  
ATOM 7377  O O    . LYS A 1 52  ? 11.978  -12.853 -7.173  1.00 0.00 ? 52  LYS A O    4  
ATOM 7378  C CB   . LYS A 1 52  ? 9.281   -12.419 -6.009  1.00 0.00 ? 52  LYS A CB   4  
ATOM 7379  C CG   . LYS A 1 52  ? 8.770   -11.246 -6.843  1.00 0.00 ? 52  LYS A CG   4  
ATOM 7380  C CD   . LYS A 1 52  ? 7.376   -11.529 -7.409  1.00 0.00 ? 52  LYS A CD   4  
ATOM 7381  C CE   . LYS A 1 52  ? 6.813   -10.342 -8.188  1.00 0.00 ? 52  LYS A CE   4  
ATOM 7382  N NZ   . LYS A 1 52  ? 7.597   -10.048 -9.416  1.00 0.00 ? 52  LYS A NZ   4  
ATOM 7383  H H    . LYS A 1 52  ? 9.907   -10.316 -4.564  1.00 0.00 ? 52  LYS A H    4  
ATOM 7384  H HA   . LYS A 1 52  ? 10.856  -13.054 -4.704  1.00 0.00 ? 52  LYS A HA   4  
ATOM 7385  H HB2  . LYS A 1 52  ? 9.385   -13.275 -6.665  1.00 0.00 ? 52  LYS A HB2  4  
ATOM 7386  H HB3  . LYS A 1 52  ? 8.535   -12.646 -5.254  1.00 0.00 ? 52  LYS A HB3  4  
ATOM 7387  H HG2  . LYS A 1 52  ? 8.721   -10.365 -6.218  1.00 0.00 ? 52  LYS A HG2  4  
ATOM 7388  H HG3  . LYS A 1 52  ? 9.455   -11.071 -7.662  1.00 0.00 ? 52  LYS A HG3  4  
ATOM 7389  H HD2  . LYS A 1 52  ? 7.434   -12.381 -8.072  1.00 0.00 ? 52  LYS A HD2  4  
ATOM 7390  H HD3  . LYS A 1 52  ? 6.706   -11.758 -6.591  1.00 0.00 ? 52  LYS A HD3  4  
ATOM 7391  H HE2  . LYS A 1 52  ? 5.796   -10.566 -8.472  1.00 0.00 ? 52  LYS A HE2  4  
ATOM 7392  H HE3  . LYS A 1 52  ? 6.821   -9.472  -7.549  1.00 0.00 ? 52  LYS A HE3  4  
ATOM 7393  H HZ1  . LYS A 1 52  ? 7.229   -9.191  -9.880  1.00 0.00 ? 52  LYS A HZ1  4  
ATOM 7394  H HZ2  . LYS A 1 52  ? 7.531   -10.843 -10.085 1.00 0.00 ? 52  LYS A HZ2  4  
ATOM 7395  H HZ3  . LYS A 1 52  ? 8.596   -9.896  -9.181  1.00 0.00 ? 52  LYS A HZ3  4  
ATOM 7396  N N    . SER A 1 53  ? 12.496  -10.896 -6.195  1.00 0.00 ? 53  SER A N    4  
ATOM 7397  C CA   . SER A 1 53  ? 13.670  -10.648 -7.030  1.00 0.00 ? 53  SER A CA   4  
ATOM 7398  C C    . SER A 1 53  ? 14.928  -10.916 -6.208  1.00 0.00 ? 53  SER A C    4  
ATOM 7399  O O    . SER A 1 53  ? 15.835  -10.091 -6.126  1.00 0.00 ? 53  SER A O    4  
ATOM 7400  C CB   . SER A 1 53  ? 13.647  -9.208  -7.541  1.00 0.00 ? 53  SER A CB   4  
ATOM 7401  O OG   . SER A 1 53  ? 12.392  -8.896  -8.130  1.00 0.00 ? 53  SER A OG   4  
ATOM 7402  H H    . SER A 1 53  ? 12.251  -10.232 -5.515  1.00 0.00 ? 53  SER A H    4  
ATOM 7403  H HA   . SER A 1 53  ? 13.646  -11.333 -7.867  1.00 0.00 ? 53  SER A HA   4  
ATOM 7404  H HB2  . SER A 1 53  ? 13.822  -8.533  -6.716  1.00 0.00 ? 53  SER A HB2  4  
ATOM 7405  H HB3  . SER A 1 53  ? 14.422  -9.080  -8.282  1.00 0.00 ? 53  SER A HB3  4  
ATOM 7406  H HG   . SER A 1 53  ? 11.692  -9.067  -7.489  1.00 0.00 ? 53  SER A HG   4  
ATOM 7407  N N    . LYS A 1 54  ? 14.970  -12.118 -5.650  1.00 0.00 ? 54  LYS A N    4  
ATOM 7408  C CA   . LYS A 1 54  ? 15.935  -12.505 -4.615  1.00 0.00 ? 54  LYS A CA   4  
ATOM 7409  C C    . LYS A 1 54  ? 17.397  -12.467 -5.085  1.00 0.00 ? 54  LYS A C    4  
ATOM 7410  O O    . LYS A 1 54  ? 18.304  -12.712 -4.285  1.00 0.00 ? 54  LYS A O    4  
ATOM 7411  C CB   . LYS A 1 54  ? 15.592  -13.912 -4.095  1.00 0.00 ? 54  LYS A CB   4  
ATOM 7412  C CG   . LYS A 1 54  ? 16.011  -15.060 -5.019  1.00 0.00 ? 54  LYS A CG   4  
ATOM 7413  C CD   . LYS A 1 54  ? 15.371  -14.992 -6.405  1.00 0.00 ? 54  LYS A CD   4  
ATOM 7414  C CE   . LYS A 1 54  ? 15.870  -16.123 -7.301  1.00 0.00 ? 54  LYS A CE   4  
ATOM 7415  N NZ   . LYS A 1 54  ? 15.271  -16.072 -8.660  1.00 0.00 ? 54  LYS A NZ   4  
ATOM 7416  H H    . LYS A 1 54  ? 14.310  -12.777 -5.940  1.00 0.00 ? 54  LYS A H    4  
ATOM 7417  H HA   . LYS A 1 54  ? 15.825  -11.808 -3.797  1.00 0.00 ? 54  LYS A HA   4  
ATOM 7418  H HB2  . LYS A 1 54  ? 16.082  -14.055 -3.141  1.00 0.00 ? 54  LYS A HB2  4  
ATOM 7419  H HB3  . LYS A 1 54  ? 14.522  -13.974 -3.944  1.00 0.00 ? 54  LYS A HB3  4  
ATOM 7420  H HG2  . LYS A 1 54  ? 17.085  -15.043 -5.132  1.00 0.00 ? 54  LYS A HG2  4  
ATOM 7421  H HG3  . LYS A 1 54  ? 15.720  -15.986 -4.555  1.00 0.00 ? 54  LYS A HG3  4  
ATOM 7422  H HD2  . LYS A 1 54  ? 14.298  -15.072 -6.304  1.00 0.00 ? 54  LYS A HD2  4  
ATOM 7423  H HD3  . LYS A 1 54  ? 15.621  -14.045 -6.863  1.00 0.00 ? 54  LYS A HD3  4  
ATOM 7424  H HE2  . LYS A 1 54  ? 16.945  -16.046 -7.392  1.00 0.00 ? 54  LYS A HE2  4  
ATOM 7425  H HE3  . LYS A 1 54  ? 15.617  -17.068 -6.842  1.00 0.00 ? 54  LYS A HE3  4  
ATOM 7426  H HZ1  . LYS A 1 54  ? 14.250  -16.262 -8.614  1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 7427  H HZ2  . LYS A 1 54  ? 15.714  -16.785 -9.272  1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 7428  H HZ3  . LYS A 1 54  ? 15.421  -15.134 -9.084  1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 7429  N N    . GLY A 1 55  ? 17.628  -12.193 -6.367  1.00 0.00 ? 55  GLY A N    4  
ATOM 7430  C CA   . GLY A 1 55  ? 18.991  -12.089 -6.867  1.00 0.00 ? 55  GLY A CA   4  
ATOM 7431  C C    . GLY A 1 55  ? 19.749  -10.969 -6.172  1.00 0.00 ? 55  GLY A C    4  
ATOM 7432  O O    . GLY A 1 55  ? 19.373  -9.812  -6.310  1.00 0.00 ? 55  GLY A O    4  
ATOM 7433  H H    . GLY A 1 55  ? 16.875  -12.041 -6.969  1.00 0.00 ? 55  GLY A H    4  
ATOM 7434  H HA2  . GLY A 1 55  ? 19.502  -13.026 -6.699  1.00 0.00 ? 55  GLY A HA2  4  
ATOM 7435  H HA3  . GLY A 1 55  ? 18.962  -11.889 -7.928  1.00 0.00 ? 55  GLY A HA3  4  
ATOM 7436  N N    . PRO A 1 56  ? 20.826  -11.282 -5.414  1.00 0.00 ? 56  PRO A N    4  
ATOM 7437  C CA   . PRO A 1 56  ? 21.554  -10.299 -4.594  1.00 0.00 ? 56  PRO A CA   4  
ATOM 7438  C C    . PRO A 1 56  ? 21.821  -8.980  -5.330  1.00 0.00 ? 56  PRO A C    4  
ATOM 7439  O O    . PRO A 1 56  ? 21.566  -7.896  -4.796  1.00 0.00 ? 56  PRO A O    4  
ATOM 7440  C CB   . PRO A 1 56  ? 22.876  -11.017 -4.239  1.00 0.00 ? 56  PRO A CB   4  
ATOM 7441  C CG   . PRO A 1 56  ? 22.867  -12.302 -5.009  1.00 0.00 ? 56  PRO A CG   4  
ATOM 7442  C CD   . PRO A 1 56  ? 21.423  -12.618 -5.288  1.00 0.00 ? 56  PRO A CD   4  
ATOM 7443  H HA   . PRO A 1 56  ? 21.011  -10.084 -3.684  1.00 0.00 ? 56  PRO A HA   4  
ATOM 7444  H HB2  . PRO A 1 56  ? 23.718  -10.399 -4.520  1.00 0.00 ? 56  PRO A HB2  4  
ATOM 7445  H HB3  . PRO A 1 56  ? 22.908  -11.202 -3.174  1.00 0.00 ? 56  PRO A HB3  4  
ATOM 7446  H HG2  . PRO A 1 56  ? 23.407  -12.179 -5.937  1.00 0.00 ? 56  PRO A HG2  4  
ATOM 7447  H HG3  . PRO A 1 56  ? 23.315  -13.089 -4.419  1.00 0.00 ? 56  PRO A HG3  4  
ATOM 7448  H HD2  . PRO A 1 56  ? 21.328  -13.180 -6.209  1.00 0.00 ? 56  PRO A HD2  4  
ATOM 7449  H HD3  . PRO A 1 56  ? 20.985  -13.161 -4.463  1.00 0.00 ? 56  PRO A HD3  4  
ATOM 7450  N N    . GLN A 1 57  ? 22.315  -9.080  -6.561  1.00 0.00 ? 57  GLN A N    4  
ATOM 7451  C CA   . GLN A 1 57  ? 22.586  -7.897  -7.377  1.00 0.00 ? 57  GLN A CA   4  
ATOM 7452  C C    . GLN A 1 57  ? 21.281  -7.153  -7.662  1.00 0.00 ? 57  GLN A C    4  
ATOM 7453  O O    . GLN A 1 57  ? 21.170  -5.948  -7.420  1.00 0.00 ? 57  GLN A O    4  
ATOM 7454  C CB   . GLN A 1 57  ? 23.266  -8.305  -8.694  1.00 0.00 ? 57  GLN A CB   4  
ATOM 7455  C CG   . GLN A 1 57  ? 24.591  -9.037  -8.502  1.00 0.00 ? 57  GLN A CG   4  
ATOM 7456  C CD   . GLN A 1 57  ? 25.181  -9.537  -9.811  1.00 0.00 ? 57  GLN A CD   4  
ATOM 7457  O OE1  . GLN A 1 57  ? 24.899  -10.657 -10.247 1.00 0.00 ? 57  GLN A OE1  4  
ATOM 7458  N NE2  . GLN A 1 57  ? 26.010  -8.722  -10.441 1.00 0.00 ? 57  GLN A NE2  4  
ATOM 7459  H H    . GLN A 1 57  ? 22.492  -9.968  -6.935  1.00 0.00 ? 57  GLN A H    4  
ATOM 7460  H HA   . GLN A 1 57  ? 23.249  -7.248  -6.820  1.00 0.00 ? 57  GLN A HA   4  
ATOM 7461  H HB2  . GLN A 1 57  ? 22.597  -8.954  -9.243  1.00 0.00 ? 57  GLN A HB2  4  
ATOM 7462  H HB3  . GLN A 1 57  ? 23.451  -7.416  -9.281  1.00 0.00 ? 57  GLN A HB3  4  
ATOM 7463  H HG2  . GLN A 1 57  ? 25.297  -8.362  -8.041  1.00 0.00 ? 57  GLN A HG2  4  
ATOM 7464  H HG3  . GLN A 1 57  ? 24.429  -9.885  -7.850  1.00 0.00 ? 57  GLN A HG3  4  
ATOM 7465  H HE21 . GLN A 1 57  ? 26.202  -7.850  -10.033 1.00 0.00 ? 57  GLN A HE21 4  
ATOM 7466  H HE22 . GLN A 1 57  ? 26.397  -9.020  -11.290 1.00 0.00 ? 57  GLN A HE22 4  
ATOM 7467  N N    . GLN A 1 58  ? 20.289  -7.905  -8.140  1.00 0.00 ? 58  GLN A N    4  
ATOM 7468  C CA   . GLN A 1 58  ? 18.971  -7.364  -8.472  1.00 0.00 ? 58  GLN A CA   4  
ATOM 7469  C C    . GLN A 1 58  ? 18.360  -6.652  -7.261  1.00 0.00 ? 58  GLN A C    4  
ATOM 7470  O O    . GLN A 1 58  ? 17.723  -5.605  -7.398  1.00 0.00 ? 58  GLN A O    4  
ATOM 7471  C CB   . GLN A 1 58  ? 18.057  -8.509  -8.952  1.00 0.00 ? 58  GLN A CB   4  
ATOM 7472  C CG   . GLN A 1 58  ? 16.669  -8.072  -9.420  1.00 0.00 ? 58  GLN A CG   4  
ATOM 7473  C CD   . GLN A 1 58  ? 16.700  -7.089  -10.586 1.00 0.00 ? 58  GLN A CD   4  
ATOM 7474  O OE1  . GLN A 1 58  ? 15.814  -6.246  -10.725 1.00 0.00 ? 58  GLN A OE1  4  
ATOM 7475  N NE2  . GLN A 1 58  ? 17.707  -7.195  -11.442 1.00 0.00 ? 58  GLN A NE2  4  
ATOM 7476  H H    . GLN A 1 58  ? 20.448  -8.865  -8.267  1.00 0.00 ? 58  GLN A H    4  
ATOM 7477  H HA   . GLN A 1 58  ? 19.096  -6.651  -9.274  1.00 0.00 ? 58  GLN A HA   4  
ATOM 7478  H HB2  . GLN A 1 58  ? 18.541  -9.013  -9.775  1.00 0.00 ? 58  GLN A HB2  4  
ATOM 7479  H HB3  . GLN A 1 58  ? 17.932  -9.213  -8.141  1.00 0.00 ? 58  GLN A HB3  4  
ATOM 7480  H HG2  . GLN A 1 58  ? 16.122  -8.951  -9.734  1.00 0.00 ? 58  GLN A HG2  4  
ATOM 7481  H HG3  . GLN A 1 58  ? 16.151  -7.615  -8.588  1.00 0.00 ? 58  GLN A HG3  4  
ATOM 7482  H HE21 . GLN A 1 58  ? 18.379  -7.896  -11.292 1.00 0.00 ? 58  GLN A HE21 4  
ATOM 7483  H HE22 . GLN A 1 58  ? 17.743  -6.566  -12.194 1.00 0.00 ? 58  GLN A HE22 4  
ATOM 7484  N N    . ILE A 1 59  ? 18.589  -7.220  -6.079  1.00 0.00 ? 59  ILE A N    4  
ATOM 7485  C CA   . ILE A 1 59  ? 18.114  -6.647  -4.823  1.00 0.00 ? 59  ILE A CA   4  
ATOM 7486  C C    . ILE A 1 59  ? 18.651  -5.227  -4.639  1.00 0.00 ? 59  ILE A C    4  
ATOM 7487  O O    . ILE A 1 59  ? 17.885  -4.287  -4.431  1.00 0.00 ? 59  ILE A O    4  
ATOM 7488  C CB   . ILE A 1 59  ? 18.535  -7.535  -3.615  1.00 0.00 ? 59  ILE A CB   4  
ATOM 7489  C CG1  . ILE A 1 59  ? 17.742  -8.855  -3.606  1.00 0.00 ? 59  ILE A CG1  4  
ATOM 7490  C CG2  . ILE A 1 59  ? 18.361  -6.795  -2.289  1.00 0.00 ? 59  ILE A CG2  4  
ATOM 7491  C CD1  . ILE A 1 59  ? 16.253  -8.678  -3.382  1.00 0.00 ? 59  ILE A CD1  4  
ATOM 7492  H H    . ILE A 1 59  ? 19.094  -8.056  -6.051  1.00 0.00 ? 59  ILE A H    4  
ATOM 7493  H HA   . ILE A 1 59  ? 17.033  -6.610  -4.860  1.00 0.00 ? 59  ILE A HA   4  
ATOM 7494  H HB   . ILE A 1 59  ? 19.585  -7.764  -3.725  1.00 0.00 ? 59  ILE A HB   4  
ATOM 7495  H HG12 . ILE A 1 59  ? 17.873  -9.351  -4.556  1.00 0.00 ? 59  ILE A HG12 4  
ATOM 7496  H HG13 . ILE A 1 59  ? 18.122  -9.493  -2.819  1.00 0.00 ? 59  ILE A HG13 4  
ATOM 7497  H HG21 . ILE A 1 59  ? 18.659  -7.439  -1.474  1.00 0.00 ? 59  ILE A HG21 4  
ATOM 7498  H HG22 . ILE A 1 59  ? 17.325  -6.515  -2.163  1.00 0.00 ? 59  ILE A HG22 4  
ATOM 7499  H HG23 . ILE A 1 59  ? 18.975  -5.907  -2.287  1.00 0.00 ? 59  ILE A HG23 4  
ATOM 7500  H HD11 . ILE A 1 59  ? 15.839  -8.062  -4.167  1.00 0.00 ? 59  ILE A HD11 4  
ATOM 7501  H HD12 . ILE A 1 59  ? 16.085  -8.203  -2.426  1.00 0.00 ? 59  ILE A HD12 4  
ATOM 7502  H HD13 . ILE A 1 59  ? 15.770  -9.644  -3.393  1.00 0.00 ? 59  ILE A HD13 4  
ATOM 7503  N N    . HIS A 1 60  ? 19.968  -5.070  -4.746  1.00 0.00 ? 60  HIS A N    4  
ATOM 7504  C CA   . HIS A 1 60  ? 20.603  -3.764  -4.548  1.00 0.00 ? 60  HIS A CA   4  
ATOM 7505  C C    . HIS A 1 60  ? 20.132  -2.769  -5.607  1.00 0.00 ? 60  HIS A C    4  
ATOM 7506  O O    . HIS A 1 60  ? 19.944  -1.585  -5.320  1.00 0.00 ? 60  HIS A O    4  
ATOM 7507  C CB   . HIS A 1 60  ? 22.135  -3.888  -4.571  1.00 0.00 ? 60  HIS A CB   4  
ATOM 7508  C CG   . HIS A 1 60  ? 22.694  -4.592  -3.369  1.00 0.00 ? 60  HIS A CG   4  
ATOM 7509  N ND1  . HIS A 1 60  ? 23.725  -4.088  -2.599  1.00 0.00 ? 60  HIS A ND1  4  
ATOM 7510  C CD2  . HIS A 1 60  ? 22.350  -5.771  -2.802  1.00 0.00 ? 60  HIS A CD2  4  
ATOM 7511  C CE1  . HIS A 1 60  ? 23.983  -4.927  -1.613  1.00 0.00 ? 60  HIS A CE1  4  
ATOM 7512  N NE2  . HIS A 1 60  ? 23.163  -5.952  -1.713  1.00 0.00 ? 60  HIS A NE2  4  
ATOM 7513  H H    . HIS A 1 60  ? 20.523  -5.848  -4.976  1.00 0.00 ? 60  HIS A H    4  
ATOM 7514  H HA   . HIS A 1 60  ? 20.297  -3.398  -3.576  1.00 0.00 ? 60  HIS A HA   4  
ATOM 7515  H HB2  . HIS A 1 60  ? 22.433  -4.442  -5.449  1.00 0.00 ? 60  HIS A HB2  4  
ATOM 7516  H HB3  . HIS A 1 60  ? 22.571  -2.900  -4.611  1.00 0.00 ? 60  HIS A HB3  4  
ATOM 7517  H HD1  . HIS A 1 60  ? 24.205  -3.243  -2.756  1.00 0.00 ? 60  HIS A HD1  4  
ATOM 7518  H HD2  . HIS A 1 60  ? 21.578  -6.444  -3.148  1.00 0.00 ? 60  HIS A HD2  4  
ATOM 7519  H HE1  . HIS A 1 60  ? 24.737  -4.793  -0.851  1.00 0.00 ? 60  HIS A HE1  4  
ATOM 7520  H HE2  . HIS A 1 60  ? 23.188  -6.757  -1.147  1.00 0.00 ? 60  HIS A HE2  4  
ATOM 7521  N N    . LEU A 1 61  ? 19.925  -3.265  -6.824  1.00 0.00 ? 61  LEU A N    4  
ATOM 7522  C CA   . LEU A 1 61  ? 19.479  -2.431  -7.939  1.00 0.00 ? 61  LEU A CA   4  
ATOM 7523  C C    . LEU A 1 61  ? 18.074  -1.880  -7.682  1.00 0.00 ? 61  LEU A C    4  
ATOM 7524  O O    . LEU A 1 61  ? 17.837  -0.673  -7.799  1.00 0.00 ? 61  LEU A O    4  
ATOM 7525  C CB   . LEU A 1 61  ? 19.501  -3.239  -9.244  1.00 0.00 ? 61  LEU A CB   4  
ATOM 7526  C CG   . LEU A 1 61  ? 20.880  -3.790  -9.648  1.00 0.00 ? 61  LEU A CG   4  
ATOM 7527  C CD1  . LEU A 1 61  ? 20.770  -4.670  -10.891 1.00 0.00 ? 61  LEU A CD1  4  
ATOM 7528  C CD2  . LEU A 1 61  ? 21.874  -2.651  -9.879  1.00 0.00 ? 61  LEU A CD2  4  
ATOM 7529  H H    . LEU A 1 61  ? 20.078  -4.223  -6.979  1.00 0.00 ? 61  LEU A H    4  
ATOM 7530  H HA   . LEU A 1 61  ? 20.166  -1.602  -8.028  1.00 0.00 ? 61  LEU A HA   4  
ATOM 7531  H HB2  . LEU A 1 61  ? 18.819  -4.073  -9.137  1.00 0.00 ? 61  LEU A HB2  4  
ATOM 7532  H HB3  . LEU A 1 61  ? 19.142  -2.606  -10.044 1.00 0.00 ? 61  LEU A HB3  4  
ATOM 7533  H HG   . LEU A 1 61  ? 21.262  -4.405  -8.841  1.00 0.00 ? 61  LEU A HG   4  
ATOM 7534  H HD11 . LEU A 1 61  ? 21.747  -5.052  -11.151 1.00 0.00 ? 61  LEU A HD11 4  
ATOM 7535  H HD12 . LEU A 1 61  ? 20.381  -4.087  -11.715 1.00 0.00 ? 61  LEU A HD12 4  
ATOM 7536  H HD13 . LEU A 1 61  ? 20.103  -5.496  -10.690 1.00 0.00 ? 61  LEU A HD13 4  
ATOM 7537  H HD21 . LEU A 1 61  ? 22.836  -3.061  -10.152 1.00 0.00 ? 61  LEU A HD21 4  
ATOM 7538  H HD22 . LEU A 1 61  ? 21.977  -2.071  -8.973  1.00 0.00 ? 61  LEU A HD22 4  
ATOM 7539  H HD23 . LEU A 1 61  ? 21.517  -2.012  -10.675 1.00 0.00 ? 61  LEU A HD23 4  
ATOM 7540  N N    . LYS A 1 62  ? 17.151  -2.768  -7.324  1.00 0.00 ? 62  LYS A N    4  
ATOM 7541  C CA   . LYS A 1 62  ? 15.762  -2.380  -7.086  1.00 0.00 ? 62  LYS A CA   4  
ATOM 7542  C C    . LYS A 1 62  ? 15.641  -1.546  -5.815  1.00 0.00 ? 62  LYS A C    4  
ATOM 7543  O O    . LYS A 1 62  ? 14.844  -0.612  -5.753  1.00 0.00 ? 62  LYS A O    4  
ATOM 7544  C CB   . LYS A 1 62  ? 14.866  -3.620  -6.991  1.00 0.00 ? 62  LYS A CB   4  
ATOM 7545  C CG   . LYS A 1 62  ? 14.830  -4.452  -8.268  1.00 0.00 ? 62  LYS A CG   4  
ATOM 7546  C CD   . LYS A 1 62  ? 13.994  -5.720  -8.101  1.00 0.00 ? 62  LYS A CD   4  
ATOM 7547  C CE   . LYS A 1 62  ? 12.519  -5.415  -7.862  1.00 0.00 ? 62  LYS A CE   4  
ATOM 7548  N NZ   . LYS A 1 62  ? 11.891  -4.719  -9.018  1.00 0.00 ? 62  LYS A NZ   4  
ATOM 7549  H H    . LYS A 1 62  ? 17.410  -3.708  -7.213  1.00 0.00 ? 62  LYS A H    4  
ATOM 7550  H HA   . LYS A 1 62  ? 15.439  -1.779  -7.926  1.00 0.00 ? 62  LYS A HA   4  
ATOM 7551  H HB2  . LYS A 1 62  ? 15.225  -4.249  -6.188  1.00 0.00 ? 62  LYS A HB2  4  
ATOM 7552  H HB3  . LYS A 1 62  ? 13.857  -3.304  -6.764  1.00 0.00 ? 62  LYS A HB3  4  
ATOM 7553  H HG2  . LYS A 1 62  ? 14.406  -3.855  -9.063  1.00 0.00 ? 62  LYS A HG2  4  
ATOM 7554  H HG3  . LYS A 1 62  ? 15.842  -4.731  -8.530  1.00 0.00 ? 62  LYS A HG3  4  
ATOM 7555  H HD2  . LYS A 1 62  ? 14.083  -6.316  -8.998  1.00 0.00 ? 62  LYS A HD2  4  
ATOM 7556  H HD3  . LYS A 1 62  ? 14.376  -6.283  -7.259  1.00 0.00 ? 62  LYS A HD3  4  
ATOM 7557  H HE2  . LYS A 1 62  ? 11.995  -6.345  -7.692  1.00 0.00 ? 62  LYS A HE2  4  
ATOM 7558  H HE3  . LYS A 1 62  ? 12.429  -4.790  -6.984  1.00 0.00 ? 62  LYS A HE3  4  
ATOM 7559  H HZ1  . LYS A 1 62  ? 12.280  -3.758  -9.115  1.00 0.00 ? 62  LYS A HZ1  4  
ATOM 7560  H HZ2  . LYS A 1 62  ? 10.862  -4.652  -8.882  1.00 0.00 ? 62  LYS A HZ2  4  
ATOM 7561  H HZ3  . LYS A 1 62  ? 12.077  -5.243  -9.898  1.00 0.00 ? 62  LYS A HZ3  4  
ATOM 7562  N N    . ALA A 1 63  ? 16.440  -1.887  -4.808  1.00 0.00 ? 63  ALA A N    4  
ATOM 7563  C CA   . ALA A 1 63  ? 16.431  -1.164  -3.539  1.00 0.00 ? 63  ALA A CA   4  
ATOM 7564  C C    . ALA A 1 63  ? 16.808  0.299   -3.750  1.00 0.00 ? 63  ALA A C    4  
ATOM 7565  O O    . ALA A 1 63  ? 16.125  1.203   -3.268  1.00 0.00 ? 63  ALA A O    4  
ATOM 7566  C CB   . ALA A 1 63  ? 17.385  -1.819  -2.546  1.00 0.00 ? 63  ALA A CB   4  
ATOM 7567  H H    . ALA A 1 63  ? 17.051  -2.647  -4.920  1.00 0.00 ? 63  ALA A H    4  
ATOM 7568  H HA   . ALA A 1 63  ? 15.430  -1.216  -3.131  1.00 0.00 ? 63  ALA A HA   4  
ATOM 7569  H HB1  . ALA A 1 63  ? 18.395  -1.770  -2.927  1.00 0.00 ? 63  ALA A HB1  4  
ATOM 7570  H HB2  . ALA A 1 63  ? 17.104  -2.853  -2.406  1.00 0.00 ? 63  ALA A HB2  4  
ATOM 7571  H HB3  . ALA A 1 63  ? 17.332  -1.303  -1.598  1.00 0.00 ? 63  ALA A HB3  4  
ATOM 7572  N N    . LYS A 1 64  ? 17.892  0.519   -4.490  1.00 0.00 ? 64  LYS A N    4  
ATOM 7573  C CA   . LYS A 1 64  ? 18.380  1.869   -4.762  1.00 0.00 ? 64  LYS A CA   4  
ATOM 7574  C C    . LYS A 1 64  ? 17.399  2.612   -5.672  1.00 0.00 ? 64  LYS A C    4  
ATOM 7575  O O    . LYS A 1 64  ? 17.267  3.838   -5.599  1.00 0.00 ? 64  LYS A O    4  
ATOM 7576  C CB   . LYS A 1 64  ? 19.781  1.798   -5.393  1.00 0.00 ? 64  LYS A CB   4  
ATOM 7577  C CG   . LYS A 1 64  ? 20.505  3.141   -5.494  1.00 0.00 ? 64  LYS A CG   4  
ATOM 7578  C CD   . LYS A 1 64  ? 20.530  3.883   -4.153  1.00 0.00 ? 64  LYS A CD   4  
ATOM 7579  C CE   . LYS A 1 64  ? 21.616  4.956   -4.108  1.00 0.00 ? 64  LYS A CE   4  
ATOM 7580  N NZ   . LYS A 1 64  ? 21.647  5.789   -5.342  1.00 0.00 ? 64  LYS A NZ   4  
ATOM 7581  H H    . LYS A 1 64  ? 18.378  -0.247  -4.864  1.00 0.00 ? 64  LYS A H    4  
ATOM 7582  H HA   . LYS A 1 64  ? 18.444  2.393   -3.819  1.00 0.00 ? 64  LYS A HA   4  
ATOM 7583  H HB2  . LYS A 1 64  ? 20.392  1.134   -4.799  1.00 0.00 ? 64  LYS A HB2  4  
ATOM 7584  H HB3  . LYS A 1 64  ? 19.692  1.386   -6.389  1.00 0.00 ? 64  LYS A HB3  4  
ATOM 7585  H HG2  . LYS A 1 64  ? 21.523  2.963   -5.815  1.00 0.00 ? 64  LYS A HG2  4  
ATOM 7586  H HG3  . LYS A 1 64  ? 20.001  3.756   -6.227  1.00 0.00 ? 64  LYS A HG3  4  
ATOM 7587  H HD2  . LYS A 1 64  ? 19.572  4.355   -3.997  1.00 0.00 ? 64  LYS A HD2  4  
ATOM 7588  H HD3  . LYS A 1 64  ? 20.712  3.170   -3.360  1.00 0.00 ? 64  LYS A HD3  4  
ATOM 7589  H HE2  . LYS A 1 64  ? 21.432  5.600   -3.260  1.00 0.00 ? 64  LYS A HE2  4  
ATOM 7590  H HE3  . LYS A 1 64  ? 22.575  4.474   -3.988  1.00 0.00 ? 64  LYS A HE3  4  
ATOM 7591  H HZ1  . LYS A 1 64  ? 21.981  5.221   -6.148  1.00 0.00 ? 64  LYS A HZ1  4  
ATOM 7592  H HZ2  . LYS A 1 64  ? 22.288  6.597   -5.214  1.00 0.00 ? 64  LYS A HZ2  4  
ATOM 7593  H HZ3  . LYS A 1 64  ? 20.696  6.148   -5.555  1.00 0.00 ? 64  LYS A HZ3  4  
ATOM 7594  N N    . ALA A 1 65  ? 16.702  1.857   -6.516  1.00 0.00 ? 65  ALA A N    4  
ATOM 7595  C CA   . ALA A 1 65  ? 15.668  2.418   -7.378  1.00 0.00 ? 65  ALA A CA   4  
ATOM 7596  C C    . ALA A 1 65  ? 14.507  2.937   -6.534  1.00 0.00 ? 65  ALA A C    4  
ATOM 7597  O O    . ALA A 1 65  ? 14.218  4.133   -6.532  1.00 0.00 ? 65  ALA A O    4  
ATOM 7598  C CB   . ALA A 1 65  ? 15.182  1.375   -8.382  1.00 0.00 ? 65  ALA A CB   4  
ATOM 7599  H H    . ALA A 1 65  ? 16.890  0.895   -6.564  1.00 0.00 ? 65  ALA A H    4  
ATOM 7600  H HA   . ALA A 1 65  ? 16.101  3.244   -7.928  1.00 0.00 ? 65  ALA A HA   4  
ATOM 7601  H HB1  . ALA A 1 65  ? 16.018  1.024   -8.969  1.00 0.00 ? 65  ALA A HB1  4  
ATOM 7602  H HB2  . ALA A 1 65  ? 14.445  1.820   -9.036  1.00 0.00 ? 65  ALA A HB2  4  
ATOM 7603  H HB3  . ALA A 1 65  ? 14.739  0.542   -7.854  1.00 0.00 ? 65  ALA A HB3  4  
ATOM 7604  N N    . ILE A 1 66  ? 13.874  2.027   -5.791  1.00 0.00 ? 66  ILE A N    4  
ATOM 7605  C CA   . ILE A 1 66  ? 12.747  2.366   -4.923  1.00 0.00 ? 66  ILE A CA   4  
ATOM 7606  C C    . ILE A 1 66  ? 13.135  3.478   -3.948  1.00 0.00 ? 66  ILE A C    4  
ATOM 7607  O O    . ILE A 1 66  ? 12.310  4.318   -3.585  1.00 0.00 ? 66  ILE A O    4  
ATOM 7608  C CB   . ILE A 1 66  ? 12.252  1.125   -4.126  1.00 0.00 ? 66  ILE A CB   4  
ATOM 7609  C CG1  . ILE A 1 66  ? 11.798  0.014   -5.091  1.00 0.00 ? 66  ILE A CG1  4  
ATOM 7610  C CG2  . ILE A 1 66  ? 11.119  1.504   -3.168  1.00 0.00 ? 66  ILE A CG2  4  
ATOM 7611  C CD1  . ILE A 1 66  ? 11.351  -1.260  -4.399  1.00 0.00 ? 66  ILE A CD1  4  
ATOM 7612  H H    . ILE A 1 66  ? 14.177  1.095   -5.829  1.00 0.00 ? 66  ILE A H    4  
ATOM 7613  H HA   . ILE A 1 66  ? 11.937  2.716   -5.549  1.00 0.00 ? 66  ILE A HA   4  
ATOM 7614  H HB   . ILE A 1 66  ? 13.078  0.757   -3.534  1.00 0.00 ? 66  ILE A HB   4  
ATOM 7615  H HG12 . ILE A 1 66  ? 10.969  0.374   -5.682  1.00 0.00 ? 66  ILE A HG12 4  
ATOM 7616  H HG13 . ILE A 1 66  ? 12.617  -0.239  -5.750  1.00 0.00 ? 66  ILE A HG13 4  
ATOM 7617  H HG21 . ILE A 1 66  ? 10.803  0.630   -2.616  1.00 0.00 ? 66  ILE A HG21 4  
ATOM 7618  H HG22 . ILE A 1 66  ? 10.283  1.895   -3.731  1.00 0.00 ? 66  ILE A HG22 4  
ATOM 7619  H HG23 . ILE A 1 66  ? 11.467  2.258   -2.475  1.00 0.00 ? 66  ILE A HG23 4  
ATOM 7620  H HD11 . ILE A 1 66  ? 11.057  -1.989  -5.141  1.00 0.00 ? 66  ILE A HD11 4  
ATOM 7621  H HD12 . ILE A 1 66  ? 10.510  -1.047  -3.755  1.00 0.00 ? 66  ILE A HD12 4  
ATOM 7622  H HD13 . ILE A 1 66  ? 12.164  -1.657  -3.809  1.00 0.00 ? 66  ILE A HD13 4  
ATOM 7623  N N    . TYR A 1 67  ? 14.402  3.480   -3.542  1.00 0.00 ? 67  TYR A N    4  
ATOM 7624  C CA   . TYR A 1 67  ? 14.930  4.506   -2.650  1.00 0.00 ? 67  TYR A CA   4  
ATOM 7625  C C    . TYR A 1 67  ? 14.678  5.902   -3.228  1.00 0.00 ? 67  TYR A C    4  
ATOM 7626  O O    . TYR A 1 67  ? 13.879  6.668   -2.691  1.00 0.00 ? 67  TYR A O    4  
ATOM 7627  C CB   . TYR A 1 67  ? 16.435  4.278   -2.423  1.00 0.00 ? 67  TYR A CB   4  
ATOM 7628  C CG   . TYR A 1 67  ? 17.081  5.240   -1.440  1.00 0.00 ? 67  TYR A CG   4  
ATOM 7629  C CD1  . TYR A 1 67  ? 17.008  5.020   -0.068  1.00 0.00 ? 67  TYR A CD1  4  
ATOM 7630  C CD2  . TYR A 1 67  ? 17.775  6.363   -1.883  1.00 0.00 ? 67  TYR A CD2  4  
ATOM 7631  C CE1  . TYR A 1 67  ? 17.604  5.889   0.827   1.00 0.00 ? 67  TYR A CE1  4  
ATOM 7632  C CE2  . TYR A 1 67  ? 18.372  7.236   -0.994  1.00 0.00 ? 67  TYR A CE2  4  
ATOM 7633  C CZ   . TYR A 1 67  ? 18.285  6.994   0.360   1.00 0.00 ? 67  TYR A CZ   4  
ATOM 7634  O OH   . TYR A 1 67  ? 18.879  7.861   1.250   1.00 0.00 ? 67  TYR A OH   4  
ATOM 7635  H H    . TYR A 1 67  ? 15.000  2.763   -3.849  1.00 0.00 ? 67  TYR A H    4  
ATOM 7636  H HA   . TYR A 1 67  ? 14.416  4.420   -1.704  1.00 0.00 ? 67  TYR A HA   4  
ATOM 7637  H HB2  . TYR A 1 67  ? 16.584  3.275   -2.048  1.00 0.00 ? 67  TYR A HB2  4  
ATOM 7638  H HB3  . TYR A 1 67  ? 16.948  4.374   -3.370  1.00 0.00 ? 67  TYR A HB3  4  
ATOM 7639  H HD1  . TYR A 1 67  ? 16.474  4.155   0.299   1.00 0.00 ? 67  TYR A HD1  4  
ATOM 7640  H HD2  . TYR A 1 67  ? 17.842  6.551   -2.944  1.00 0.00 ? 67  TYR A HD2  4  
ATOM 7641  H HE1  . TYR A 1 67  ? 17.535  5.699   1.887   1.00 0.00 ? 67  TYR A HE1  4  
ATOM 7642  H HE2  . TYR A 1 67  ? 18.904  8.102   -1.361  1.00 0.00 ? 67  TYR A HE2  4  
ATOM 7643  H HH   . TYR A 1 67  ? 18.549  8.757   1.091   1.00 0.00 ? 67  TYR A HH   4  
ATOM 7644  N N    . GLU A 1 68  ? 15.325  6.197   -4.353  1.00 0.00 ? 68  GLU A N    4  
ATOM 7645  C CA   . GLU A 1 68  ? 15.268  7.530   -4.962  1.00 0.00 ? 68  GLU A CA   4  
ATOM 7646  C C    . GLU A 1 68  ? 13.945  7.766   -5.699  1.00 0.00 ? 68  GLU A C    4  
ATOM 7647  O O    . GLU A 1 68  ? 13.629  8.897   -6.080  1.00 0.00 ? 68  GLU A O    4  
ATOM 7648  C CB   . GLU A 1 68  ? 16.447  7.703   -5.928  1.00 0.00 ? 68  GLU A CB   4  
ATOM 7649  C CG   . GLU A 1 68  ? 17.806  7.539   -5.256  1.00 0.00 ? 68  GLU A CG   4  
ATOM 7650  C CD   . GLU A 1 68  ? 18.963  7.554   -6.239  1.00 0.00 ? 68  GLU A CD   4  
ATOM 7651  O OE1  . GLU A 1 68  ? 19.482  8.644   -6.545  1.00 0.00 ? 68  GLU A OE1  4  
ATOM 7652  O OE2  . GLU A 1 68  ? 19.370  6.467   -6.701  1.00 0.00 ? 68  GLU A OE2  4  
ATOM 7653  H H    . GLU A 1 68  ? 15.859  5.497   -4.792  1.00 0.00 ? 68  GLU A H    4  
ATOM 7654  H HA   . GLU A 1 68  ? 15.357  8.260   -4.171  1.00 0.00 ? 68  GLU A HA   4  
ATOM 7655  H HB2  . GLU A 1 68  ? 16.364  6.968   -6.715  1.00 0.00 ? 68  GLU A HB2  4  
ATOM 7656  H HB3  . GLU A 1 68  ? 16.401  8.692   -6.364  1.00 0.00 ? 68  GLU A HB3  4  
ATOM 7657  H HG2  . GLU A 1 68  ? 17.943  8.345   -4.549  1.00 0.00 ? 68  GLU A HG2  4  
ATOM 7658  H HG3  . GLU A 1 68  ? 17.817  6.597   -4.724  1.00 0.00 ? 68  GLU A HG3  4  
ATOM 7659  N N    . LYS A 1 69  ? 13.181  6.698   -5.902  1.00 0.00 ? 69  LYS A N    4  
ATOM 7660  C CA   . LYS A 1 69  ? 11.916  6.780   -6.632  1.00 0.00 ? 69  LYS A CA   4  
ATOM 7661  C C    . LYS A 1 69  ? 10.739  7.002   -5.679  1.00 0.00 ? 69  LYS A C    4  
ATOM 7662  O O    . LYS A 1 69  ? 9.765   7.673   -6.032  1.00 0.00 ? 69  LYS A O    4  
ATOM 7663  C CB   . LYS A 1 69  ? 11.696  5.491   -7.441  1.00 0.00 ? 69  LYS A CB   4  
ATOM 7664  C CG   . LYS A 1 69  ? 10.480  5.519   -8.368  1.00 0.00 ? 69  LYS A CG   4  
ATOM 7665  C CD   . LYS A 1 69  ? 10.670  6.490   -9.531  1.00 0.00 ? 69  LYS A CD   4  
ATOM 7666  C CE   . LYS A 1 69  ? 9.518   6.416   -10.531 1.00 0.00 ? 69  LYS A CE   4  
ATOM 7667  N NZ   . LYS A 1 69  ? 9.786   7.224   -11.752 1.00 0.00 ? 69  LYS A NZ   4  
ATOM 7668  H H    . LYS A 1 69  ? 13.480  5.829   -5.562  1.00 0.00 ? 69  LYS A H    4  
ATOM 7669  H HA   . LYS A 1 69  ? 11.977  7.617   -7.316  1.00 0.00 ? 69  LYS A HA   4  
ATOM 7670  H HB2  . LYS A 1 69  ? 12.574  5.308   -8.044  1.00 0.00 ? 69  LYS A HB2  4  
ATOM 7671  H HB3  . LYS A 1 69  ? 11.574  4.668   -6.750  1.00 0.00 ? 69  LYS A HB3  4  
ATOM 7672  H HG2  . LYS A 1 69  ? 10.322  4.526   -8.766  1.00 0.00 ? 69  LYS A HG2  4  
ATOM 7673  H HG3  . LYS A 1 69  ? 9.612   5.820   -7.796  1.00 0.00 ? 69  LYS A HG3  4  
ATOM 7674  H HD2  . LYS A 1 69  ? 10.729  7.497   -9.143  1.00 0.00 ? 69  LYS A HD2  4  
ATOM 7675  H HD3  . LYS A 1 69  ? 11.592  6.248   -10.042 1.00 0.00 ? 69  LYS A HD3  4  
ATOM 7676  H HE2  . LYS A 1 69  ? 9.371   5.385   -10.822 1.00 0.00 ? 69  LYS A HE2  4  
ATOM 7677  H HE3  . LYS A 1 69  ? 8.620   6.786   -10.058 1.00 0.00 ? 69  LYS A HE3  4  
ATOM 7678  H HZ1  . LYS A 1 69  ? 9.813   8.237   -11.517 1.00 0.00 ? 69  LYS A HZ1  4  
ATOM 7679  H HZ2  . LYS A 1 69  ? 9.043   7.066   -12.460 1.00 0.00 ? 69  LYS A HZ2  4  
ATOM 7680  H HZ3  . LYS A 1 69  ? 10.704  6.955   -12.164 1.00 0.00 ? 69  LYS A HZ3  4  
ATOM 7681  N N    . PHE A 1 70  ? 10.840  6.443   -4.472  1.00 0.00 ? 70  PHE A N    4  
ATOM 7682  C CA   . PHE A 1 70  ? 9.724   6.448   -3.519  1.00 0.00 ? 70  PHE A CA   4  
ATOM 7683  C C    . PHE A 1 70  ? 10.167  6.860   -2.110  1.00 0.00 ? 70  PHE A C    4  
ATOM 7684  O O    . PHE A 1 70  ? 9.547   7.722   -1.486  1.00 0.00 ? 70  PHE A O    4  
ATOM 7685  C CB   . PHE A 1 70  ? 9.072   5.055   -3.456  1.00 0.00 ? 70  PHE A CB   4  
ATOM 7686  C CG   . PHE A 1 70  ? 8.435   4.602   -4.749  1.00 0.00 ? 70  PHE A CG   4  
ATOM 7687  C CD1  . PHE A 1 70  ? 7.256   5.183   -5.197  1.00 0.00 ? 70  PHE A CD1  4  
ATOM 7688  C CD2  . PHE A 1 70  ? 9.004   3.588   -5.507  1.00 0.00 ? 70  PHE A CD2  4  
ATOM 7689  C CE1  . PHE A 1 70  ? 6.662   4.765   -6.373  1.00 0.00 ? 70  PHE A CE1  4  
ATOM 7690  C CE2  . PHE A 1 70  ? 8.414   3.168   -6.684  1.00 0.00 ? 70  PHE A CE2  4  
ATOM 7691  C CZ   . PHE A 1 70  ? 7.242   3.756   -7.117  1.00 0.00 ? 70  PHE A CZ   4  
ATOM 7692  H H    . PHE A 1 70  ? 11.685  6.021   -4.213  1.00 0.00 ? 70  PHE A H    4  
ATOM 7693  H HA   . PHE A 1 70  ? 8.988   7.158   -3.870  1.00 0.00 ? 70  PHE A HA   4  
ATOM 7694  H HB2  . PHE A 1 70  ? 9.825   4.328   -3.187  1.00 0.00 ? 70  PHE A HB2  4  
ATOM 7695  H HB3  . PHE A 1 70  ? 8.306   5.061   -2.695  1.00 0.00 ? 70  PHE A HB3  4  
ATOM 7696  H HD1  . PHE A 1 70  ? 6.801   5.974   -4.619  1.00 0.00 ? 70  PHE A HD1  4  
ATOM 7697  H HD2  . PHE A 1 70  ? 9.921   3.124   -5.170  1.00 0.00 ? 70  PHE A HD2  4  
ATOM 7698  H HE1  . PHE A 1 70  ? 5.746   5.226   -6.710  1.00 0.00 ? 70  PHE A HE1  4  
ATOM 7699  H HE2  . PHE A 1 70  ? 8.868   2.379   -7.265  1.00 0.00 ? 70  PHE A HE2  4  
ATOM 7700  H HZ   . PHE A 1 70  ? 6.780   3.427   -8.036  1.00 0.00 ? 70  PHE A HZ   4  
ATOM 7701  N N    . ILE A 1 71  ? 11.238  6.237   -1.613  1.00 0.00 ? 71  ILE A N    4  
ATOM 7702  C CA   . ILE A 1 71  ? 11.650  6.407   -0.214  1.00 0.00 ? 71  ILE A CA   4  
ATOM 7703  C C    . ILE A 1 71  ? 12.140  7.830   0.045   1.00 0.00 ? 71  ILE A C    4  
ATOM 7704  O O    . ILE A 1 71  ? 12.042  8.345   1.164   1.00 0.00 ? 71  ILE A O    4  
ATOM 7705  C CB   . ILE A 1 71  ? 12.759  5.392   0.176   1.00 0.00 ? 71  ILE A CB   4  
ATOM 7706  C CG1  . ILE A 1 71  ? 12.263  3.950   -0.035  1.00 0.00 ? 71  ILE A CG1  4  
ATOM 7707  C CG2  . ILE A 1 71  ? 13.214  5.597   1.624   1.00 0.00 ? 71  ILE A CG2  4  
ATOM 7708  C CD1  . ILE A 1 71  ? 11.060  3.580   0.812   1.00 0.00 ? 71  ILE A CD1  4  
ATOM 7709  H H    . ILE A 1 71  ? 11.778  5.670   -2.203  1.00 0.00 ? 71  ILE A H    4  
ATOM 7710  H HA   . ILE A 1 71  ? 10.785  6.221   0.410   1.00 0.00 ? 71  ILE A HA   4  
ATOM 7711  H HB   . ILE A 1 71  ? 13.611  5.566   -0.468  1.00 0.00 ? 71  ILE A HB   4  
ATOM 7712  H HG12 . ILE A 1 71  ? 11.989  3.817   -1.072  1.00 0.00 ? 71  ILE A HG12 4  
ATOM 7713  H HG13 . ILE A 1 71  ? 13.063  3.263   0.208   1.00 0.00 ? 71  ILE A HG13 4  
ATOM 7714  H HG21 . ILE A 1 71  ? 13.611  6.595   1.741   1.00 0.00 ? 71  ILE A HG21 4  
ATOM 7715  H HG22 . ILE A 1 71  ? 13.981  4.875   1.867   1.00 0.00 ? 71  ILE A HG22 4  
ATOM 7716  H HG23 . ILE A 1 71  ? 12.372  5.465   2.290   1.00 0.00 ? 71  ILE A HG23 4  
ATOM 7717  H HD11 . ILE A 1 71  ? 10.758  2.568   0.588   1.00 0.00 ? 71  ILE A HD11 4  
ATOM 7718  H HD12 . ILE A 1 71  ? 10.244  4.254   0.595   1.00 0.00 ? 71  ILE A HD12 4  
ATOM 7719  H HD13 . ILE A 1 71  ? 11.319  3.654   1.858   1.00 0.00 ? 71  ILE A HD13 4  
ATOM 7720  N N    . GLN A 1 72  ? 12.665  8.458   -1.000  1.00 0.00 ? 72  GLN A N    4  
ATOM 7721  C CA   . GLN A 1 72  ? 13.149  9.828   -0.915  1.00 0.00 ? 72  GLN A CA   4  
ATOM 7722  C C    . GLN A 1 72  ? 11.972  10.770  -0.640  1.00 0.00 ? 72  GLN A C    4  
ATOM 7723  O O    . GLN A 1 72  ? 10.983  10.756  -1.371  1.00 0.00 ? 72  GLN A O    4  
ATOM 7724  C CB   . GLN A 1 72  ? 13.855  10.224  -2.228  1.00 0.00 ? 72  GLN A CB   4  
ATOM 7725  C CG   . GLN A 1 72  ? 15.208  10.899  -2.037  1.00 0.00 ? 72  GLN A CG   4  
ATOM 7726  C CD   . GLN A 1 72  ? 15.154  12.068  -1.071  1.00 0.00 ? 72  GLN A CD   4  
ATOM 7727  O OE1  . GLN A 1 72  ? 15.344  11.901  0.135   1.00 0.00 ? 72  GLN A OE1  4  
ATOM 7728  N NE2  . GLN A 1 72  ? 14.885  13.256  -1.591  1.00 0.00 ? 72  GLN A NE2  4  
ATOM 7729  H H    . GLN A 1 72  ? 12.721  7.986   -1.858  1.00 0.00 ? 72  GLN A H    4  
ATOM 7730  H HA   . GLN A 1 72  ? 13.852  9.885   -0.095  1.00 0.00 ? 72  GLN A HA   4  
ATOM 7731  H HB2  . GLN A 1 72  ? 14.011  9.332   -2.823  1.00 0.00 ? 72  GLN A HB2  4  
ATOM 7732  H HB3  . GLN A 1 72  ? 13.215  10.903  -2.781  1.00 0.00 ? 72  GLN A HB3  4  
ATOM 7733  H HG2  . GLN A 1 72  ? 15.910  10.172  -1.656  1.00 0.00 ? 72  GLN A HG2  4  
ATOM 7734  H HG3  . GLN A 1 72  ? 15.552  11.260  -2.996  1.00 0.00 ? 72  GLN A HG3  4  
ATOM 7735  H HE21 . GLN A 1 72  ? 14.736  13.315  -2.561  1.00 0.00 ? 72  GLN A HE21 4  
ATOM 7736  H HE22 . GLN A 1 72  ? 14.854  14.029  -0.986  1.00 0.00 ? 72  GLN A HE22 4  
ATOM 7737  N N    . THR A 1 73  ? 12.080  11.578  0.414   1.00 0.00 ? 73  THR A N    4  
ATOM 7738  C CA   . THR A 1 73  ? 11.019  12.520  0.766   1.00 0.00 ? 73  THR A CA   4  
ATOM 7739  C C    . THR A 1 73  ? 10.746  13.478  -0.399  1.00 0.00 ? 73  THR A C    4  
ATOM 7740  O O    . THR A 1 73  ? 9.624   13.957  -0.585  1.00 0.00 ? 73  THR A O    4  
ATOM 7741  C CB   . THR A 1 73  ? 11.384  13.315  2.041   1.00 0.00 ? 73  THR A CB   4  
ATOM 7742  O OG1  . THR A 1 73  ? 11.774  12.401  3.079   1.00 0.00 ? 73  THR A OG1  4  
ATOM 7743  C CG2  . THR A 1 73  ? 10.208  14.160  2.525   1.00 0.00 ? 73  THR A CG2  4  
ATOM 7744  H H    . THR A 1 73  ? 12.889  11.541  0.965   1.00 0.00 ? 73  THR A H    4  
ATOM 7745  H HA   . THR A 1 73  ? 10.122  11.949  0.965   1.00 0.00 ? 73  THR A HA   4  
ATOM 7746  H HB   . THR A 1 73  ? 12.215  13.970  1.816   1.00 0.00 ? 73  THR A HB   4  
ATOM 7747  H HG1  . THR A 1 73  ? 12.729  12.457  3.208   1.00 0.00 ? 73  THR A HG1  4  
ATOM 7748  H HG21 . THR A 1 73  ? 9.370   13.516  2.753   1.00 0.00 ? 73  THR A HG21 4  
ATOM 7749  H HG22 . THR A 1 73  ? 9.924   14.860  1.753   1.00 0.00 ? 73  THR A HG22 4  
ATOM 7750  H HG23 . THR A 1 73  ? 10.498  14.703  3.413   1.00 0.00 ? 73  THR A HG23 4  
ATOM 7751  N N    . ASP A 1 74  ? 11.787  13.749  -1.183  1.00 0.00 ? 74  ASP A N    4  
ATOM 7752  C CA   . ASP A 1 74  ? 11.641  14.479  -2.440  1.00 0.00 ? 74  ASP A CA   4  
ATOM 7753  C C    . ASP A 1 74  ? 11.872  13.521  -3.604  1.00 0.00 ? 74  ASP A C    4  
ATOM 7754  O O    . ASP A 1 74  ? 13.014  13.271  -4.006  1.00 0.00 ? 74  ASP A O    4  
ATOM 7755  C CB   . ASP A 1 74  ? 12.613  15.668  -2.518  1.00 0.00 ? 74  ASP A CB   4  
ATOM 7756  C CG   . ASP A 1 74  ? 12.308  16.745  -1.485  1.00 0.00 ? 74  ASP A CG   4  
ATOM 7757  O OD1  . ASP A 1 74  ? 11.253  17.401  -1.596  1.00 0.00 ? 74  ASP A OD1  4  
ATOM 7758  O OD2  . ASP A 1 74  ? 13.119  16.937  -0.552  1.00 0.00 ? 74  ASP A OD2  4  
ATOM 7759  H H    . ASP A 1 74  ? 12.680  13.446  -0.910  1.00 0.00 ? 74  ASP A H    4  
ATOM 7760  H HA   . ASP A 1 74  ? 10.626  14.851  -2.495  1.00 0.00 ? 74  ASP A HA   4  
ATOM 7761  H HB2  . ASP A 1 74  ? 13.622  15.312  -2.357  1.00 0.00 ? 74  ASP A HB2  4  
ATOM 7762  H HB3  . ASP A 1 74  ? 12.550  16.112  -3.503  1.00 0.00 ? 74  ASP A HB3  4  
ATOM 7763  N N    . ALA A 1 75  ? 10.778  12.964  -4.110  1.00 0.00 ? 75  ALA A N    4  
ATOM 7764  C CA   . ALA A 1 75  ? 10.815  11.964  -5.172  1.00 0.00 ? 75  ALA A CA   4  
ATOM 7765  C C    . ALA A 1 75  ? 9.520   12.022  -5.985  1.00 0.00 ? 75  ALA A C    4  
ATOM 7766  O O    . ALA A 1 75  ? 8.547   12.633  -5.538  1.00 0.00 ? 75  ALA A O    4  
ATOM 7767  C CB   . ALA A 1 75  ? 11.004  10.574  -4.565  1.00 0.00 ? 75  ALA A CB   4  
ATOM 7768  H H    . ALA A 1 75  ? 9.907   13.235  -3.757  1.00 0.00 ? 75  ALA A H    4  
ATOM 7769  H HA   . ALA A 1 75  ? 11.655  12.176  -5.821  1.00 0.00 ? 75  ALA A HA   4  
ATOM 7770  H HB1  . ALA A 1 75  ? 10.168  10.346  -3.920  1.00 0.00 ? 75  ALA A HB1  4  
ATOM 7771  H HB2  . ALA A 1 75  ? 11.918  10.555  -3.989  1.00 0.00 ? 75  ALA A HB2  4  
ATOM 7772  H HB3  . ALA A 1 75  ? 11.063  9.840   -5.354  1.00 0.00 ? 75  ALA A HB3  4  
ATOM 7773  N N    . PRO A 1 76  ? 9.485   11.400  -7.190  1.00 0.00 ? 76  PRO A N    4  
ATOM 7774  C CA   . PRO A 1 76  ? 8.279   11.371  -8.034  1.00 0.00 ? 76  PRO A CA   4  
ATOM 7775  C C    . PRO A 1 76  ? 7.023   11.002  -7.240  1.00 0.00 ? 76  PRO A C    4  
ATOM 7776  O O    . PRO A 1 76  ? 5.973   11.639  -7.379  1.00 0.00 ? 76  PRO A O    4  
ATOM 7777  C CB   . PRO A 1 76  ? 8.610   10.295  -9.074  1.00 0.00 ? 76  PRO A CB   4  
ATOM 7778  C CG   . PRO A 1 76  ? 10.095  10.357  -9.206  1.00 0.00 ? 76  PRO A CG   4  
ATOM 7779  C CD   . PRO A 1 76  ? 10.616  10.689  -7.831  1.00 0.00 ? 76  PRO A CD   4  
ATOM 7780  H HA   . PRO A 1 76  ? 8.123   12.321  -8.529  1.00 0.00 ? 76  PRO A HA   4  
ATOM 7781  H HB2  . PRO A 1 76  ? 8.283   9.326   -8.719  1.00 0.00 ? 76  PRO A HB2  4  
ATOM 7782  H HB3  . PRO A 1 76  ? 8.119   10.526  -10.010 1.00 0.00 ? 76  PRO A HB3  4  
ATOM 7783  H HG2  . PRO A 1 76  ? 10.476  9.400   -9.536  1.00 0.00 ? 76  PRO A HG2  4  
ATOM 7784  H HG3  . PRO A 1 76  ? 10.370  11.133  -9.909  1.00 0.00 ? 76  PRO A HG3  4  
ATOM 7785  H HD2  . PRO A 1 76  ? 10.857  9.784   -7.289  1.00 0.00 ? 76  PRO A HD2  4  
ATOM 7786  H HD3  . PRO A 1 76  ? 11.484  11.330  -7.897  1.00 0.00 ? 76  PRO A HD3  4  
ATOM 7787  N N    . LYS A 1 77  ? 7.141   9.973   -6.404  1.00 0.00 ? 77  LYS A N    4  
ATOM 7788  C CA   . LYS A 1 77  ? 6.073   9.586   -5.488  1.00 0.00 ? 77  LYS A CA   4  
ATOM 7789  C C    . LYS A 1 77  ? 6.642   9.420   -4.084  1.00 0.00 ? 77  LYS A C    4  
ATOM 7790  O O    . LYS A 1 77  ? 7.113   8.344   -3.713  1.00 0.00 ? 77  LYS A O    4  
ATOM 7791  C CB   . LYS A 1 77  ? 5.382   8.293   -5.949  1.00 0.00 ? 77  LYS A CB   4  
ATOM 7792  C CG   . LYS A 1 77  ? 4.647   8.427   -7.282  1.00 0.00 ? 77  LYS A CG   4  
ATOM 7793  C CD   . LYS A 1 77  ? 3.886   7.153   -7.643  1.00 0.00 ? 77  LYS A CD   4  
ATOM 7794  C CE   . LYS A 1 77  ? 3.161   7.284   -8.978  1.00 0.00 ? 77  LYS A CE   4  
ATOM 7795  N NZ   . LYS A 1 77  ? 2.405   6.051   -9.321  1.00 0.00 ? 77  LYS A NZ   4  
ATOM 7796  H H    . LYS A 1 77  ? 7.977   9.458   -6.399  1.00 0.00 ? 77  LYS A H    4  
ATOM 7797  H HA   . LYS A 1 77  ? 5.343   10.387  -5.468  1.00 0.00 ? 77  LYS A HA   4  
ATOM 7798  H HB2  . LYS A 1 77  ? 6.127   7.517   -6.051  1.00 0.00 ? 77  LYS A HB2  4  
ATOM 7799  H HB3  . LYS A 1 77  ? 4.666   7.993   -5.197  1.00 0.00 ? 77  LYS A HB3  4  
ATOM 7800  H HG2  . LYS A 1 77  ? 3.944   9.246   -7.214  1.00 0.00 ? 77  LYS A HG2  4  
ATOM 7801  H HG3  . LYS A 1 77  ? 5.369   8.637   -8.060  1.00 0.00 ? 77  LYS A HG3  4  
ATOM 7802  H HD2  . LYS A 1 77  ? 4.586   6.332   -7.707  1.00 0.00 ? 77  LYS A HD2  4  
ATOM 7803  H HD3  . LYS A 1 77  ? 3.160   6.947   -6.867  1.00 0.00 ? 77  LYS A HD3  4  
ATOM 7804  H HE2  . LYS A 1 77  ? 2.468   8.112   -8.921  1.00 0.00 ? 77  LYS A HE2  4  
ATOM 7805  H HE3  . LYS A 1 77  ? 3.888   7.477   -9.754  1.00 0.00 ? 77  LYS A HE3  4  
ATOM 7806  H HZ1  . LYS A 1 77  ? 2.067   6.100   -10.303 1.00 0.00 ? 77  LYS A HZ1  4  
ATOM 7807  H HZ2  . LYS A 1 77  ? 1.582   5.946   -8.688  1.00 0.00 ? 77  LYS A HZ2  4  
ATOM 7808  H HZ3  . LYS A 1 77  ? 3.013   5.217   -9.214  1.00 0.00 ? 77  LYS A HZ3  4  
ATOM 7809  N N    . GLU A 1 78  ? 6.634   10.511  -3.328  1.00 0.00 ? 78  GLU A N    4  
ATOM 7810  C CA   . GLU A 1 78  ? 7.161   10.515  -1.971  1.00 0.00 ? 78  GLU A CA   4  
ATOM 7811  C C    . GLU A 1 78  ? 6.273   9.677   -1.051  1.00 0.00 ? 78  GLU A C    4  
ATOM 7812  O O    . GLU A 1 78  ? 5.092   9.979   -0.859  1.00 0.00 ? 78  GLU A O    4  
ATOM 7813  C CB   . GLU A 1 78  ? 7.295   11.956  -1.431  1.00 0.00 ? 78  GLU A CB   4  
ATOM 7814  C CG   . GLU A 1 78  ? 5.989   12.762  -1.375  1.00 0.00 ? 78  GLU A CG   4  
ATOM 7815  C CD   . GLU A 1 78  ? 5.550   13.308  -2.728  1.00 0.00 ? 78  GLU A CD   4  
ATOM 7816  O OE1  . GLU A 1 78  ? 5.960   14.435  -3.079  1.00 0.00 ? 78  GLU A OE1  4  
ATOM 7817  O OE2  . GLU A 1 78  ? 4.792   12.623  -3.448  1.00 0.00 ? 78  GLU A OE2  4  
ATOM 7818  H H    . GLU A 1 78  ? 6.256   11.334  -3.690  1.00 0.00 ? 78  GLU A H    4  
ATOM 7819  H HA   . GLU A 1 78  ? 8.144   10.065  -2.001  1.00 0.00 ? 78  GLU A HA   4  
ATOM 7820  H HB2  . GLU A 1 78  ? 7.700   11.912  -0.430  1.00 0.00 ? 78  GLU A HB2  4  
ATOM 7821  H HB3  . GLU A 1 78  ? 7.993   12.492  -2.060  1.00 0.00 ? 78  GLU A HB3  4  
ATOM 7822  H HG2  . GLU A 1 78  ? 5.205   12.126  -0.992  1.00 0.00 ? 78  GLU A HG2  4  
ATOM 7823  H HG3  . GLU A 1 78  ? 6.128   13.595  -0.697  1.00 0.00 ? 78  GLU A HG3  4  
ATOM 7824  N N    . VAL A 1 79  ? 6.842   8.610   -0.502  1.00 0.00 ? 79  VAL A N    4  
ATOM 7825  C CA   . VAL A 1 79  ? 6.114   7.741   0.412   1.00 0.00 ? 79  VAL A CA   4  
ATOM 7826  C C    . VAL A 1 79  ? 5.840   8.458   1.732   1.00 0.00 ? 79  VAL A C    4  
ATOM 7827  O O    . VAL A 1 79  ? 6.705   9.157   2.267   1.00 0.00 ? 79  VAL A O    4  
ATOM 7828  C CB   . VAL A 1 79  ? 6.887   6.424   0.684   1.00 0.00 ? 79  VAL A CB   4  
ATOM 7829  C CG1  . VAL A 1 79  ? 6.136   5.537   1.675   1.00 0.00 ? 79  VAL A CG1  4  
ATOM 7830  C CG2  . VAL A 1 79  ? 7.137   5.674   -0.620  1.00 0.00 ? 79  VAL A CG2  4  
ATOM 7831  H H    . VAL A 1 79  ? 7.774   8.398   -0.725  1.00 0.00 ? 79  VAL A H    4  
ATOM 7832  H HA   . VAL A 1 79  ? 5.169   7.490   -0.052  1.00 0.00 ? 79  VAL A HA   4  
ATOM 7833  H HB   . VAL A 1 79  ? 7.846   6.675   1.117   1.00 0.00 ? 79  VAL A HB   4  
ATOM 7834  H HG11 . VAL A 1 79  ? 5.164   5.286   1.272   1.00 0.00 ? 79  VAL A HG11 4  
ATOM 7835  H HG12 . VAL A 1 79  ? 6.012   6.062   2.610   1.00 0.00 ? 79  VAL A HG12 4  
ATOM 7836  H HG13 . VAL A 1 79  ? 6.698   4.629   1.846   1.00 0.00 ? 79  VAL A HG13 4  
ATOM 7837  H HG21 . VAL A 1 79  ? 6.192   5.396   -1.066  1.00 0.00 ? 79  VAL A HG21 4  
ATOM 7838  H HG22 . VAL A 1 79  ? 7.716   4.782   -0.419  1.00 0.00 ? 79  VAL A HG22 4  
ATOM 7839  H HG23 . VAL A 1 79  ? 7.684   6.309   -1.302  1.00 0.00 ? 79  VAL A HG23 4  
ATOM 7840  N N    . ASN A 1 80  ? 4.636   8.269   2.259   1.00 0.00 ? 80  ASN A N    4  
ATOM 7841  C CA   . ASN A 1 80  ? 4.220   8.886   3.523   1.00 0.00 ? 80  ASN A CA   4  
ATOM 7842  C C    . ASN A 1 80  ? 4.781   8.117   4.725   1.00 0.00 ? 80  ASN A C    4  
ATOM 7843  O O    . ASN A 1 80  ? 4.187   8.107   5.805   1.00 0.00 ? 80  ASN A O    4  
ATOM 7844  C CB   . ASN A 1 80  ? 2.683   8.945   3.597   1.00 0.00 ? 80  ASN A CB   4  
ATOM 7845  C CG   . ASN A 1 80  ? 2.086   9.903   2.579   1.00 0.00 ? 80  ASN A CG   4  
ATOM 7846  O OD1  . ASN A 1 80  ? 1.894   11.087  2.864   1.00 0.00 ? 80  ASN A OD1  4  
ATOM 7847  N ND2  . ASN A 1 80  ? 1.803   9.407   1.384   1.00 0.00 ? 80  ASN A ND2  4  
ATOM 7848  H H    . ASN A 1 80  ? 3.998   7.693   1.778   1.00 0.00 ? 80  ASN A H    4  
ATOM 7849  H HA   . ASN A 1 80  ? 4.610   9.895   3.546   1.00 0.00 ? 80  ASN A HA   4  
ATOM 7850  H HB2  . ASN A 1 80  ? 2.282   7.958   3.414   1.00 0.00 ? 80  ASN A HB2  4  
ATOM 7851  H HB3  . ASN A 1 80  ? 2.388   9.270   4.584   1.00 0.00 ? 80  ASN A HB3  4  
ATOM 7852  H HD21 . ASN A 1 80  ? 1.994   8.455   1.215   1.00 0.00 ? 80  ASN A HD21 4  
ATOM 7853  H HD22 . ASN A 1 80  ? 1.420   10.007  0.710   1.00 0.00 ? 80  ASN A HD22 4  
ATOM 7854  N N    . LEU A 1 81  ? 5.950   7.514   4.538   1.00 0.00 ? 81  LEU A N    4  
ATOM 7855  C CA   . LEU A 1 81  ? 6.576   6.671   5.549   1.00 0.00 ? 81  LEU A CA   4  
ATOM 7856  C C    . LEU A 1 81  ? 7.185   7.502   6.681   1.00 0.00 ? 81  LEU A C    4  
ATOM 7857  O O    . LEU A 1 81  ? 7.683   8.608   6.459   1.00 0.00 ? 81  LEU A O    4  
ATOM 7858  C CB   . LEU A 1 81  ? 7.646   5.792   4.884   1.00 0.00 ? 81  LEU A CB   4  
ATOM 7859  C CG   . LEU A 1 81  ? 8.558   5.007   5.832   1.00 0.00 ? 81  LEU A CG   4  
ATOM 7860  C CD1  . LEU A 1 81  ? 7.764   3.936   6.566   1.00 0.00 ? 81  LEU A CD1  4  
ATOM 7861  C CD2  . LEU A 1 81  ? 9.730   4.396   5.068   1.00 0.00 ? 81  LEU A CD2  4  
ATOM 7862  H H    . LEU A 1 81  ? 6.418   7.654   3.691   1.00 0.00 ? 81  LEU A H    4  
ATOM 7863  H HA   . LEU A 1 81  ? 5.809   6.029   5.964   1.00 0.00 ? 81  LEU A HA   4  
ATOM 7864  H HB2  . LEU A 1 81  ? 7.133   5.075   4.255   1.00 0.00 ? 81  LEU A HB2  4  
ATOM 7865  H HB3  . LEU A 1 81  ? 8.262   6.421   4.256   1.00 0.00 ? 81  LEU A HB3  4  
ATOM 7866  H HG   . LEU A 1 81  ? 8.962   5.683   6.574   1.00 0.00 ? 81  LEU A HG   4  
ATOM 7867  H HD11 . LEU A 1 81  ? 7.331   3.251   5.850   1.00 0.00 ? 81  LEU A HD11 4  
ATOM 7868  H HD12 . LEU A 1 81  ? 6.977   4.402   7.139   1.00 0.00 ? 81  LEU A HD12 4  
ATOM 7869  H HD13 . LEU A 1 81  ? 8.418   3.393   7.233   1.00 0.00 ? 81  LEU A HD13 4  
ATOM 7870  H HD21 . LEU A 1 81  ? 10.300  5.183   4.597   1.00 0.00 ? 81  LEU A HD21 4  
ATOM 7871  H HD22 . LEU A 1 81  ? 9.357   3.721   4.312   1.00 0.00 ? 81  LEU A HD22 4  
ATOM 7872  H HD23 . LEU A 1 81  ? 10.366  3.855   5.753   1.00 0.00 ? 81  LEU A HD23 4  
ATOM 7873  N N    . ASP A 1 82  ? 7.132   6.942   7.890   1.00 0.00 ? 82  ASP A N    4  
ATOM 7874  C CA   . ASP A 1 82  ? 7.688   7.567   9.092   1.00 0.00 ? 82  ASP A CA   4  
ATOM 7875  C C    . ASP A 1 82  ? 9.155   7.970   8.905   1.00 0.00 ? 82  ASP A C    4  
ATOM 7876  O O    . ASP A 1 82  ? 9.925   7.281   8.226   1.00 0.00 ? 82  ASP A O    4  
ATOM 7877  C CB   . ASP A 1 82  ? 7.547   6.607   10.284  1.00 0.00 ? 82  ASP A CB   4  
ATOM 7878  C CG   . ASP A 1 82  ? 8.454   6.973   11.449  1.00 0.00 ? 82  ASP A CG   4  
ATOM 7879  O OD1  . ASP A 1 82  ? 8.302   8.077   12.006  1.00 0.00 ? 82  ASP A OD1  4  
ATOM 7880  O OD2  . ASP A 1 82  ? 9.341   6.162   11.793  1.00 0.00 ? 82  ASP A OD2  4  
ATOM 7881  H H    . ASP A 1 82  ? 6.696   6.072   7.979   1.00 0.00 ? 82  ASP A H    4  
ATOM 7882  H HA   . ASP A 1 82  ? 7.109   8.457   9.296   1.00 0.00 ? 82  ASP A HA   4  
ATOM 7883  H HB2  . ASP A 1 82  ? 6.525   6.625   10.632  1.00 0.00 ? 82  ASP A HB2  4  
ATOM 7884  H HB3  . ASP A 1 82  ? 7.791   5.604   9.959   1.00 0.00 ? 82  ASP A HB3  4  
ATOM 7885  N N    . PHE A 1 83  ? 9.531   9.079   9.543   1.00 0.00 ? 83  PHE A N    4  
ATOM 7886  C CA   . PHE A 1 83  ? 10.869  9.650   9.413   1.00 0.00 ? 83  PHE A CA   4  
ATOM 7887  C C    . PHE A 1 83  ? 11.930  8.731   10.025  1.00 0.00 ? 83  PHE A C    4  
ATOM 7888  O O    . PHE A 1 83  ? 13.018  8.571   9.470   1.00 0.00 ? 83  PHE A O    4  
ATOM 7889  C CB   . PHE A 1 83  ? 10.924  11.049  10.058  1.00 0.00 ? 83  PHE A CB   4  
ATOM 7890  C CG   . PHE A 1 83  ? 10.449  11.099  11.493  1.00 0.00 ? 83  PHE A CG   4  
ATOM 7891  C CD1  . PHE A 1 83  ? 11.334  10.896  12.545  1.00 0.00 ? 83  PHE A CD1  4  
ATOM 7892  C CD2  . PHE A 1 83  ? 9.116   11.357  11.790  1.00 0.00 ? 83  PHE A CD2  4  
ATOM 7893  C CE1  . PHE A 1 83  ? 10.900  10.950  13.856  1.00 0.00 ? 83  PHE A CE1  4  
ATOM 7894  C CE2  . PHE A 1 83  ? 8.679   11.412  13.100  1.00 0.00 ? 83  PHE A CE2  4  
ATOM 7895  C CZ   . PHE A 1 83  ? 9.572   11.207  14.135  1.00 0.00 ? 83  PHE A CZ   4  
ATOM 7896  H H    . PHE A 1 83  ? 8.883   9.522   10.133  1.00 0.00 ? 83  PHE A H    4  
ATOM 7897  H HA   . PHE A 1 83  ? 11.076  9.751   8.356   1.00 0.00 ? 83  PHE A HA   4  
ATOM 7898  H HB2  . PHE A 1 83  ? 11.943  11.407  10.036  1.00 0.00 ? 83  PHE A HB2  4  
ATOM 7899  H HB3  . PHE A 1 83  ? 10.306  11.723  9.481   1.00 0.00 ? 83  PHE A HB3  4  
ATOM 7900  H HD1  . PHE A 1 83  ? 12.374  10.694  12.331  1.00 0.00 ? 83  PHE A HD1  4  
ATOM 7901  H HD2  . PHE A 1 83  ? 8.415   11.516  10.983  1.00 0.00 ? 83  PHE A HD2  4  
ATOM 7902  H HE1  . PHE A 1 83  ? 11.599  10.790  14.664  1.00 0.00 ? 83  PHE A HE1  4  
ATOM 7903  H HE2  . PHE A 1 83  ? 7.639   11.614  13.314  1.00 0.00 ? 83  PHE A HE2  4  
ATOM 7904  H HZ   . PHE A 1 83  ? 9.231   11.251  15.160  1.00 0.00 ? 83  PHE A HZ   4  
ATOM 7905  N N    . HIS A 1 84  ? 11.603  8.111   11.155  1.00 0.00 ? 84  HIS A N    4  
ATOM 7906  C CA   . HIS A 1 84  ? 12.542  7.214   11.828  1.00 0.00 ? 84  HIS A CA   4  
ATOM 7907  C C    . HIS A 1 84  ? 12.743  5.944   11.008  1.00 0.00 ? 84  HIS A C    4  
ATOM 7908  O O    . HIS A 1 84  ? 13.840  5.386   10.967  1.00 0.00 ? 84  HIS A O    4  
ATOM 7909  C CB   . HIS A 1 84  ? 12.051  6.862   13.241  1.00 0.00 ? 84  HIS A CB   4  
ATOM 7910  C CG   . HIS A 1 84  ? 12.886  5.818   13.926  1.00 0.00 ? 84  HIS A CG   4  
ATOM 7911  N ND1  . HIS A 1 84  ? 14.093  6.090   14.531  1.00 0.00 ? 84  HIS A ND1  4  
ATOM 7912  C CD2  . HIS A 1 84  ? 12.683  4.487   14.089  1.00 0.00 ? 84  HIS A CD2  4  
ATOM 7913  C CE1  . HIS A 1 84  ? 14.594  4.978   15.034  1.00 0.00 ? 84  HIS A CE1  4  
ATOM 7914  N NE2  . HIS A 1 84  ? 13.758  3.991   14.780  1.00 0.00 ? 84  HIS A NE2  4  
ATOM 7915  H H    . HIS A 1 84  ? 10.710  8.253   11.541  1.00 0.00 ? 84  HIS A H    4  
ATOM 7916  H HA   . HIS A 1 84  ? 13.491  7.729   11.905  1.00 0.00 ? 84  HIS A HA   4  
ATOM 7917  H HB2  . HIS A 1 84  ? 12.064  7.752   13.853  1.00 0.00 ? 84  HIS A HB2  4  
ATOM 7918  H HB3  . HIS A 1 84  ? 11.037  6.491   13.181  1.00 0.00 ? 84  HIS A HB3  4  
ATOM 7919  H HD1  . HIS A 1 84  ? 14.520  6.975   14.589  1.00 0.00 ? 84  HIS A HD1  4  
ATOM 7920  H HD2  . HIS A 1 84  ? 11.831  3.922   13.736  1.00 0.00 ? 84  HIS A HD2  4  
ATOM 7921  H HE1  . HIS A 1 84  ? 15.534  4.890   15.560  1.00 0.00 ? 84  HIS A HE1  4  
ATOM 7922  H HE2  . HIS A 1 84  ? 13.962  3.036   14.902  1.00 0.00 ? 84  HIS A HE2  4  
ATOM 7923  N N    . THR A 1 85  ? 11.680  5.495   10.349  1.00 0.00 ? 85  THR A N    4  
ATOM 7924  C CA   . THR A 1 85  ? 11.745  4.287   9.540   1.00 0.00 ? 85  THR A CA   4  
ATOM 7925  C C    . THR A 1 85  ? 12.587  4.521   8.283   1.00 0.00 ? 85  THR A C    4  
ATOM 7926  O O    . THR A 1 85  ? 13.450  3.705   7.945   1.00 0.00 ? 85  THR A O    4  
ATOM 7927  C CB   . THR A 1 85  ? 10.337  3.797   9.138   1.00 0.00 ? 85  THR A CB   4  
ATOM 7928  O OG1  . THR A 1 85  ? 9.492   3.731   10.295  1.00 0.00 ? 85  THR A OG1  4  
ATOM 7929  C CG2  . THR A 1 85  ? 10.402  2.418   8.482   1.00 0.00 ? 85  THR A CG2  4  
ATOM 7930  H H    . THR A 1 85  ? 10.833  5.989   10.413  1.00 0.00 ? 85  THR A H    4  
ATOM 7931  H HA   . THR A 1 85  ? 12.215  3.514   10.136  1.00 0.00 ? 85  THR A HA   4  
ATOM 7932  H HB   . THR A 1 85  ? 9.912   4.496   8.433   1.00 0.00 ? 85  THR A HB   4  
ATOM 7933  H HG1  . THR A 1 85  ? 9.777   4.386   10.945  1.00 0.00 ? 85  THR A HG1  4  
ATOM 7934  H HG21 . THR A 1 85  ? 10.827  1.707   9.176   1.00 0.00 ? 85  THR A HG21 4  
ATOM 7935  H HG22 . THR A 1 85  ? 11.017  2.468   7.597   1.00 0.00 ? 85  THR A HG22 4  
ATOM 7936  H HG23 . THR A 1 85  ? 9.405   2.103   8.208   1.00 0.00 ? 85  THR A HG23 4  
ATOM 7937  N N    . LYS A 1 86  ? 12.351  5.647   7.600   1.00 0.00 ? 86  LYS A N    4  
ATOM 7938  C CA   . LYS A 1 86  ? 13.117  5.976   6.397   1.00 0.00 ? 86  LYS A CA   4  
ATOM 7939  C C    . LYS A 1 86  ? 14.583  6.196   6.759   1.00 0.00 ? 86  LYS A C    4  
ATOM 7940  O O    . LYS A 1 86  ? 15.477  5.908   5.964   1.00 0.00 ? 86  LYS A O    4  
ATOM 7941  C CB   . LYS A 1 86  ? 12.544  7.212   5.673   1.00 0.00 ? 86  LYS A CB   4  
ATOM 7942  C CG   . LYS A 1 86  ? 12.684  8.521   6.448   1.00 0.00 ? 86  LYS A CG   4  
ATOM 7943  C CD   . LYS A 1 86  ? 12.204  9.730   5.640   1.00 0.00 ? 86  LYS A CD   4  
ATOM 7944  C CE   . LYS A 1 86  ? 10.729  9.624   5.262   1.00 0.00 ? 86  LYS A CE   4  
ATOM 7945  N NZ   . LYS A 1 86  ? 10.251  10.842  4.554   1.00 0.00 ? 86  LYS A NZ   4  
ATOM 7946  H H    . LYS A 1 86  ? 11.654  6.266   7.913   1.00 0.00 ? 86  LYS A H    4  
ATOM 7947  H HA   . LYS A 1 86  ? 13.055  5.124   5.730   1.00 0.00 ? 86  LYS A HA   4  
ATOM 7948  H HB2  . LYS A 1 86  ? 13.055  7.326   4.726   1.00 0.00 ? 86  LYS A HB2  4  
ATOM 7949  H HB3  . LYS A 1 86  ? 11.494  7.043   5.483   1.00 0.00 ? 86  LYS A HB3  4  
ATOM 7950  H HG2  . LYS A 1 86  ? 12.099  8.453   7.354   1.00 0.00 ? 86  LYS A HG2  4  
ATOM 7951  H HG3  . LYS A 1 86  ? 13.725  8.664   6.706   1.00 0.00 ? 86  LYS A HG3  4  
ATOM 7952  H HD2  . LYS A 1 86  ? 12.344  10.623  6.233   1.00 0.00 ? 86  LYS A HD2  4  
ATOM 7953  H HD3  . LYS A 1 86  ? 12.795  9.804   4.737   1.00 0.00 ? 86  LYS A HD3  4  
ATOM 7954  H HE2  . LYS A 1 86  ? 10.593  8.770   4.614   1.00 0.00 ? 86  LYS A HE2  4  
ATOM 7955  H HE3  . LYS A 1 86  ? 10.146  9.489   6.162   1.00 0.00 ? 86  LYS A HE3  4  
ATOM 7956  H HZ1  . LYS A 1 86  ? 9.269   10.712  4.241   1.00 0.00 ? 86  LYS A HZ1  4  
ATOM 7957  H HZ2  . LYS A 1 86  ? 10.844  11.038  3.723   1.00 0.00 ? 86  LYS A HZ2  4  
ATOM 7958  H HZ3  . LYS A 1 86  ? 10.290  11.663  5.191   1.00 0.00 ? 86  LYS A HZ3  4  
ATOM 7959  N N    . GLU A 1 87  ? 14.820  6.691   7.976   1.00 0.00 ? 87  GLU A N    4  
ATOM 7960  C CA   . GLU A 1 87  ? 16.177  6.878   8.486   1.00 0.00 ? 87  GLU A CA   4  
ATOM 7961  C C    . GLU A 1 87  ? 16.925  5.545   8.497   1.00 0.00 ? 87  GLU A C    4  
ATOM 7962  O O    . GLU A 1 87  ? 18.063  5.452   8.035   1.00 0.00 ? 87  GLU A O    4  
ATOM 7963  C CB   . GLU A 1 87  ? 16.146  7.477   9.903   1.00 0.00 ? 87  GLU A CB   4  
ATOM 7964  C CG   . GLU A 1 87  ? 17.528  7.719   10.509  1.00 0.00 ? 87  GLU A CG   4  
ATOM 7965  C CD   . GLU A 1 87  ? 18.309  8.820   9.800   1.00 0.00 ? 87  GLU A CD   4  
ATOM 7966  O OE1  . GLU A 1 87  ? 18.733  8.614   8.645   1.00 0.00 ? 87  GLU A OE1  4  
ATOM 7967  O OE2  . GLU A 1 87  ? 18.501  9.901   10.395  1.00 0.00 ? 87  GLU A OE2  4  
ATOM 7968  H H    . GLU A 1 87  ? 14.062  6.948   8.542   1.00 0.00 ? 87  GLU A H    4  
ATOM 7969  H HA   . GLU A 1 87  ? 16.690  7.563   7.823   1.00 0.00 ? 87  GLU A HA   4  
ATOM 7970  H HB2  . GLU A 1 87  ? 15.621  8.422   9.868   1.00 0.00 ? 87  GLU A HB2  4  
ATOM 7971  H HB3  . GLU A 1 87  ? 15.606  6.802   10.551  1.00 0.00 ? 87  GLU A HB3  4  
ATOM 7972  H HG2  . GLU A 1 87  ? 17.406  7.995   11.548  1.00 0.00 ? 87  GLU A HG2  4  
ATOM 7973  H HG3  . GLU A 1 87  ? 18.097  6.801   10.453  1.00 0.00 ? 87  GLU A HG3  4  
ATOM 7974  N N    . VAL A 1 88  ? 16.275  4.509   9.021   1.00 0.00 ? 88  VAL A N    4  
ATOM 7975  C CA   . VAL A 1 88  ? 16.863  3.172   9.045   1.00 0.00 ? 88  VAL A CA   4  
ATOM 7976  C C    . VAL A 1 88  ? 17.187  2.709   7.622   1.00 0.00 ? 88  VAL A C    4  
ATOM 7977  O O    . VAL A 1 88  ? 18.263  2.159   7.360   1.00 0.00 ? 88  VAL A O    4  
ATOM 7978  C CB   . VAL A 1 88  ? 15.918  2.145   9.726   1.00 0.00 ? 88  VAL A CB   4  
ATOM 7979  C CG1  . VAL A 1 88  ? 16.542  0.750   9.740   1.00 0.00 ? 88  VAL A CG1  4  
ATOM 7980  C CG2  . VAL A 1 88  ? 15.562  2.598   11.143  1.00 0.00 ? 88  VAL A CG2  4  
ATOM 7981  H H    . VAL A 1 88  ? 15.380  4.648   9.400   1.00 0.00 ? 88  VAL A H    4  
ATOM 7982  H HA   . VAL A 1 88  ? 17.780  3.223   9.616   1.00 0.00 ? 88  VAL A HA   4  
ATOM 7983  H HB   . VAL A 1 88  ? 15.002  2.098   9.151   1.00 0.00 ? 88  VAL A HB   4  
ATOM 7984  H HG11 . VAL A 1 88  ? 17.472  0.774   10.291  1.00 0.00 ? 88  VAL A HG11 4  
ATOM 7985  H HG12 . VAL A 1 88  ? 16.736  0.429   8.726   1.00 0.00 ? 88  VAL A HG12 4  
ATOM 7986  H HG13 . VAL A 1 88  ? 15.864  0.053   10.212  1.00 0.00 ? 88  VAL A HG13 4  
ATOM 7987  H HG21 . VAL A 1 88  ? 15.073  3.561   11.102  1.00 0.00 ? 88  VAL A HG21 4  
ATOM 7988  H HG22 . VAL A 1 88  ? 16.463  2.678   11.734  1.00 0.00 ? 88  VAL A HG22 4  
ATOM 7989  H HG23 . VAL A 1 88  ? 14.898  1.876   11.597  1.00 0.00 ? 88  VAL A HG23 4  
ATOM 7990  N N    . ILE A 1 89  ? 16.254  2.962   6.707   1.00 0.00 ? 89  ILE A N    4  
ATOM 7991  C CA   . ILE A 1 89  ? 16.413  2.572   5.310   1.00 0.00 ? 89  ILE A CA   4  
ATOM 7992  C C    . ILE A 1 89  ? 17.621  3.265   4.677   1.00 0.00 ? 89  ILE A C    4  
ATOM 7993  O O    . ILE A 1 89  ? 18.439  2.617   4.032   1.00 0.00 ? 89  ILE A O    4  
ATOM 7994  C CB   . ILE A 1 89  ? 15.139  2.890   4.480   1.00 0.00 ? 89  ILE A CB   4  
ATOM 7995  C CG1  . ILE A 1 89  ? 13.929  2.122   5.041   1.00 0.00 ? 89  ILE A CG1  4  
ATOM 7996  C CG2  . ILE A 1 89  ? 15.356  2.552   3.002   1.00 0.00 ? 89  ILE A CG2  4  
ATOM 7997  C CD1  . ILE A 1 89  ? 12.636  2.383   4.294   1.00 0.00 ? 89  ILE A CD1  4  
ATOM 7998  H H    . ILE A 1 89  ? 15.436  3.429   6.981   1.00 0.00 ? 89  ILE A H    4  
ATOM 7999  H HA   . ILE A 1 89  ? 16.574  1.502   5.282   1.00 0.00 ? 89  ILE A HA   4  
ATOM 8000  H HB   . ILE A 1 89  ? 14.946  3.951   4.554   1.00 0.00 ? 89  ILE A HB   4  
ATOM 8001  H HG12 . ILE A 1 89  ? 14.126  1.061   4.994   1.00 0.00 ? 89  ILE A HG12 4  
ATOM 8002  H HG13 . ILE A 1 89  ? 13.776  2.407   6.073   1.00 0.00 ? 89  ILE A HG13 4  
ATOM 8003  H HG21 . ILE A 1 89  ? 16.184  3.128   2.615   1.00 0.00 ? 89  ILE A HG21 4  
ATOM 8004  H HG22 . ILE A 1 89  ? 14.462  2.788   2.441   1.00 0.00 ? 89  ILE A HG22 4  
ATOM 8005  H HG23 . ILE A 1 89  ? 15.574  1.498   2.901   1.00 0.00 ? 89  ILE A HG23 4  
ATOM 8006  H HD11 . ILE A 1 89  ? 11.837  1.815   4.748   1.00 0.00 ? 89  ILE A HD11 4  
ATOM 8007  H HD12 . ILE A 1 89  ? 12.750  2.082   3.261   1.00 0.00 ? 89  ILE A HD12 4  
ATOM 8008  H HD13 . ILE A 1 89  ? 12.400  3.435   4.338   1.00 0.00 ? 89  ILE A HD13 4  
ATOM 8009  N N    . THR A 1 90  ? 17.745  4.574   4.888   1.00 0.00 ? 90  THR A N    4  
ATOM 8010  C CA   . THR A 1 90  ? 18.830  5.349   4.286   1.00 0.00 ? 90  THR A CA   4  
ATOM 8011  C C    . THR A 1 90  ? 20.193  4.823   4.741   1.00 0.00 ? 90  THR A C    4  
ATOM 8012  O O    . THR A 1 90  ? 21.117  4.671   3.939   1.00 0.00 ? 90  THR A O    4  
ATOM 8013  C CB   . THR A 1 90  ? 18.722  6.857   4.629   1.00 0.00 ? 90  THR A CB   4  
ATOM 8014  O OG1  . THR A 1 90  ? 18.787  7.046   6.050   1.00 0.00 ? 90  THR A OG1  4  
ATOM 8015  C CG2  . THR A 1 90  ? 17.423  7.454   4.096   1.00 0.00 ? 90  THR A CG2  4  
ATOM 8016  H H    . THR A 1 90  ? 17.096  5.030   5.464   1.00 0.00 ? 90  THR A H    4  
ATOM 8017  H HA   . THR A 1 90  ? 18.757  5.241   3.211   1.00 0.00 ? 90  THR A HA   4  
ATOM 8018  H HB   . THR A 1 90  ? 19.553  7.377   4.170   1.00 0.00 ? 90  THR A HB   4  
ATOM 8019  H HG1  . THR A 1 90  ? 17.980  7.473   6.358   1.00 0.00 ? 90  THR A HG1  4  
ATOM 8020  H HG21 . THR A 1 90  ? 17.393  7.350   3.019   1.00 0.00 ? 90  THR A HG21 4  
ATOM 8021  H HG22 . THR A 1 90  ? 17.374  8.501   4.355   1.00 0.00 ? 90  THR A HG22 4  
ATOM 8022  H HG23 . THR A 1 90  ? 16.581  6.936   4.530   1.00 0.00 ? 90  THR A HG23 4  
ATOM 8023  N N    . ASN A 1 91  ? 20.299  4.520   6.033   1.00 0.00 ? 91  ASN A N    4  
ATOM 8024  C CA   . ASN A 1 91  ? 21.564  4.078   6.625   1.00 0.00 ? 91  ASN A CA   4  
ATOM 8025  C C    . ASN A 1 91  ? 21.797  2.579   6.434   1.00 0.00 ? 91  ASN A C    4  
ATOM 8026  O O    . ASN A 1 91  ? 22.873  2.071   6.765   1.00 0.00 ? 91  ASN A O    4  
ATOM 8027  C CB   . ASN A 1 91  ? 21.610  4.427   8.122   1.00 0.00 ? 91  ASN A CB   4  
ATOM 8028  C CG   . ASN A 1 91  ? 21.722  5.924   8.375   1.00 0.00 ? 91  ASN A CG   4  
ATOM 8029  O OD1  . ASN A 1 91  ? 22.824  6.471   8.461   1.00 0.00 ? 91  ASN A OD1  4  
ATOM 8030  N ND2  . ASN A 1 91  ? 20.591  6.596   8.494   1.00 0.00 ? 91  ASN A ND2  4  
ATOM 8031  H H    . ASN A 1 91  ? 19.507  4.605   6.605   1.00 0.00 ? 91  ASN A H    4  
ATOM 8032  H HA   . ASN A 1 91  ? 22.362  4.610   6.125   1.00 0.00 ? 91  ASN A HA   4  
ATOM 8033  H HB2  . ASN A 1 91  ? 20.709  4.066   8.597   1.00 0.00 ? 91  ASN A HB2  4  
ATOM 8034  H HB3  . ASN A 1 91  ? 22.465  3.941   8.574   1.00 0.00 ? 91  ASN A HB3  4  
ATOM 8035  H HD21 . ASN A 1 91  ? 19.746  6.105   8.415   1.00 0.00 ? 91  ASN A HD21 4  
ATOM 8036  H HD22 . ASN A 1 91  ? 20.636  7.563   8.655   1.00 0.00 ? 91  ASN A HD22 4  
ATOM 8037  N N    . SER A 1 92  ? 20.800  1.866   5.910   1.00 0.00 ? 92  SER A N    4  
ATOM 8038  C CA   . SER A 1 92  ? 20.929  0.424   5.681   1.00 0.00 ? 92  SER A CA   4  
ATOM 8039  C C    . SER A 1 92  ? 20.658  0.048   4.220   1.00 0.00 ? 92  SER A C    4  
ATOM 8040  O O    . SER A 1 92  ? 20.639  -1.136  3.874   1.00 0.00 ? 92  SER A O    4  
ATOM 8041  C CB   . SER A 1 92  ? 19.975  -0.334  6.607   1.00 0.00 ? 92  SER A CB   4  
ATOM 8042  O OG   . SER A 1 92  ? 20.199  0.024   7.963   1.00 0.00 ? 92  SER A OG   4  
ATOM 8043  H H    . SER A 1 92  ? 19.949  2.311   5.698   1.00 0.00 ? 92  SER A H    4  
ATOM 8044  H HA   . SER A 1 92  ? 21.944  0.138   5.922   1.00 0.00 ? 92  SER A HA   4  
ATOM 8045  H HB2  . SER A 1 92  ? 18.954  -0.093  6.351   1.00 0.00 ? 92  SER A HB2  4  
ATOM 8046  H HB3  . SER A 1 92  ? 20.133  -1.398  6.498   1.00 0.00 ? 92  SER A HB3  4  
ATOM 8047  H HG   . SER A 1 92  ? 19.619  0.759   8.194   1.00 0.00 ? 92  SER A HG   4  
ATOM 8048  N N    . ILE A 1 93  ? 20.478  1.051   3.361   1.00 0.00 ? 93  ILE A N    4  
ATOM 8049  C CA   . ILE A 1 93  ? 20.170  0.811   1.947   1.00 0.00 ? 93  ILE A CA   4  
ATOM 8050  C C    . ILE A 1 93  ? 21.365  0.169   1.241   1.00 0.00 ? 93  ILE A C    4  
ATOM 8051  O O    . ILE A 1 93  ? 21.217  -0.473  0.199   1.00 0.00 ? 93  ILE A O    4  
ATOM 8052  C CB   . ILE A 1 93  ? 19.763  2.124   1.211   1.00 0.00 ? 93  ILE A CB   4  
ATOM 8053  C CG1  . ILE A 1 93  ? 19.180  1.822   -0.182  1.00 0.00 ? 93  ILE A CG1  4  
ATOM 8054  C CG2  . ILE A 1 93  ? 20.946  3.081   1.096   1.00 0.00 ? 93  ILE A CG2  4  
ATOM 8055  C CD1  . ILE A 1 93  ? 17.890  1.030   -0.146  1.00 0.00 ? 93  ILE A CD1  4  
ATOM 8056  H H    . ILE A 1 93  ? 20.550  1.975   3.684   1.00 0.00 ? 93  ILE A H    4  
ATOM 8057  H HA   . ILE A 1 93  ? 19.334  0.126   1.904   1.00 0.00 ? 93  ILE A HA   4  
ATOM 8058  H HB   . ILE A 1 93  ? 19.004  2.612   1.805   1.00 0.00 ? 93  ILE A HB   4  
ATOM 8059  H HG12 . ILE A 1 93  ? 18.978  2.752   -0.692  1.00 0.00 ? 93  ILE A HG12 4  
ATOM 8060  H HG13 . ILE A 1 93  ? 19.902  1.255   -0.755  1.00 0.00 ? 93  ILE A HG13 4  
ATOM 8061  H HG21 . ILE A 1 93  ? 21.307  3.328   2.084   1.00 0.00 ? 93  ILE A HG21 4  
ATOM 8062  H HG22 . ILE A 1 93  ? 20.632  3.985   0.594   1.00 0.00 ? 93  ILE A HG22 4  
ATOM 8063  H HG23 . ILE A 1 93  ? 21.740  2.613   0.531   1.00 0.00 ? 93  ILE A HG23 4  
ATOM 8064  H HD11 . ILE A 1 93  ? 18.063  0.081   0.342   1.00 0.00 ? 93  ILE A HD11 4  
ATOM 8065  H HD12 . ILE A 1 93  ? 17.545  0.858   -1.155  1.00 0.00 ? 93  ILE A HD12 4  
ATOM 8066  H HD13 . ILE A 1 93  ? 17.143  1.584   0.401   1.00 0.00 ? 93  ILE A HD13 4  
ATOM 8067  N N    . THR A 1 94  ? 22.545  0.345   1.832   1.00 0.00 ? 94  THR A N    4  
ATOM 8068  C CA   . THR A 1 94  ? 23.778  -0.235  1.308   1.00 0.00 ? 94  THR A CA   4  
ATOM 8069  C C    . THR A 1 94  ? 23.678  -1.764  1.221   1.00 0.00 ? 94  THR A C    4  
ATOM 8070  O O    . THR A 1 94  ? 24.183  -2.378  0.275   1.00 0.00 ? 94  THR A O    4  
ATOM 8071  C CB   . THR A 1 94  ? 24.996  0.165   2.185   1.00 0.00 ? 94  THR A CB   4  
ATOM 8072  O OG1  . THR A 1 94  ? 26.203  -0.392  1.650   1.00 0.00 ? 94  THR A OG1  4  
ATOM 8073  C CG2  . THR A 1 94  ? 24.820  -0.289  3.632   1.00 0.00 ? 94  THR A CG2  4  
ATOM 8074  H H    . THR A 1 94  ? 22.590  0.896   2.642   1.00 0.00 ? 94  THR A H    4  
ATOM 8075  H HA   . THR A 1 94  ? 23.933  0.161   0.313   1.00 0.00 ? 94  THR A HA   4  
ATOM 8076  H HB   . THR A 1 94  ? 25.080  1.243   2.174   1.00 0.00 ? 94  THR A HB   4  
ATOM 8077  H HG1  . THR A 1 94  ? 26.506  0.155   0.917   1.00 0.00 ? 94  THR A HG1  4  
ATOM 8078  H HG21 . THR A 1 94  ? 24.717  -1.365  3.663   1.00 0.00 ? 94  THR A HG21 4  
ATOM 8079  H HG22 . THR A 1 94  ? 23.934  0.168   4.049   1.00 0.00 ? 94  THR A HG22 4  
ATOM 8080  H HG23 . THR A 1 94  ? 25.683  0.006   4.211   1.00 0.00 ? 94  THR A HG23 4  
ATOM 8081  N N    . GLN A 1 95  ? 23.007  -2.372  2.201   1.00 0.00 ? 95  GLN A N    4  
ATOM 8082  C CA   . GLN A 1 95  ? 22.846  -3.824  2.250   1.00 0.00 ? 95  GLN A CA   4  
ATOM 8083  C C    . GLN A 1 95  ? 21.445  -4.184  2.743   1.00 0.00 ? 95  GLN A C    4  
ATOM 8084  O O    . GLN A 1 95  ? 21.231  -4.409  3.936   1.00 0.00 ? 95  GLN A O    4  
ATOM 8085  C CB   . GLN A 1 95  ? 23.913  -4.468  3.156   1.00 0.00 ? 95  GLN A CB   4  
ATOM 8086  C CG   . GLN A 1 95  ? 25.347  -4.247  2.681   1.00 0.00 ? 95  GLN A CG   4  
ATOM 8087  C CD   . GLN A 1 95  ? 26.373  -4.921  3.574   1.00 0.00 ? 95  GLN A CD   4  
ATOM 8088  O OE1  . GLN A 1 95  ? 26.162  -5.086  4.776   1.00 0.00 ? 95  GLN A OE1  4  
ATOM 8089  N NE2  . GLN A 1 95  ? 27.496  -5.312  2.993   1.00 0.00 ? 95  GLN A NE2  4  
ATOM 8090  H H    . GLN A 1 95  ? 22.593  -1.826  2.903   1.00 0.00 ? 95  GLN A H    4  
ATOM 8091  H HA   . GLN A 1 95  ? 22.966  -4.206  1.246   1.00 0.00 ? 95  GLN A HA   4  
ATOM 8092  H HB2  . GLN A 1 95  ? 23.820  -4.055  4.150   1.00 0.00 ? 95  GLN A HB2  4  
ATOM 8093  H HB3  . GLN A 1 95  ? 23.732  -5.533  3.203   1.00 0.00 ? 95  GLN A HB3  4  
ATOM 8094  H HG2  . GLN A 1 95  ? 25.449  -4.643  1.681   1.00 0.00 ? 95  GLN A HG2  4  
ATOM 8095  H HG3  . GLN A 1 95  ? 25.548  -3.185  2.667   1.00 0.00 ? 95  GLN A HG3  4  
ATOM 8096  H HE21 . GLN A 1 95  ? 27.602  -5.147  2.034   1.00 0.00 ? 95  GLN A HE21 4  
ATOM 8097  H HE22 . GLN A 1 95  ? 28.176  -5.754  3.547   1.00 0.00 ? 95  GLN A HE22 4  
ATOM 8098  N N    . PRO A 1 96  ? 20.461  -4.199  1.828   1.00 0.00 ? 96  PRO A N    4  
ATOM 8099  C CA   . PRO A 1 96  ? 19.079  -4.552  2.158   1.00 0.00 ? 96  PRO A CA   4  
ATOM 8100  C C    . PRO A 1 96  ? 18.863  -6.068  2.211   1.00 0.00 ? 96  PRO A C    4  
ATOM 8101  O O    . PRO A 1 96  ? 19.623  -6.838  1.614   1.00 0.00 ? 96  PRO A O    4  
ATOM 8102  C CB   . PRO A 1 96  ? 18.289  -3.924  1.006   1.00 0.00 ? 96  PRO A CB   4  
ATOM 8103  C CG   . PRO A 1 96  ? 19.217  -3.988  -0.162  1.00 0.00 ? 96  PRO A CG   4  
ATOM 8104  C CD   . PRO A 1 96  ? 20.616  -3.857  0.397   1.00 0.00 ? 96  PRO A CD   4  
ATOM 8105  H HA   . PRO A 1 96  ? 18.770  -4.111  3.096   1.00 0.00 ? 96  PRO A HA   4  
ATOM 8106  H HB2  . PRO A 1 96  ? 17.385  -4.491  0.829   1.00 0.00 ? 96  PRO A HB2  4  
ATOM 8107  H HB3  . PRO A 1 96  ? 18.034  -2.903  1.253   1.00 0.00 ? 96  PRO A HB3  4  
ATOM 8108  H HG2  . PRO A 1 96  ? 19.104  -4.935  -0.670  1.00 0.00 ? 96  PRO A HG2  4  
ATOM 8109  H HG3  . PRO A 1 96  ? 19.009  -3.174  -0.841  1.00 0.00 ? 96  PRO A HG3  4  
ATOM 8110  H HD2  . PRO A 1 96  ? 21.284  -4.552  -0.093  1.00 0.00 ? 96  PRO A HD2  4  
ATOM 8111  H HD3  . PRO A 1 96  ? 20.977  -2.844  0.280   1.00 0.00 ? 96  PRO A HD3  4  
ATOM 8112  N N    . THR A 1 97  ? 17.836  -6.487  2.945   1.00 0.00 ? 97  THR A N    4  
ATOM 8113  C CA   . THR A 1 97  ? 17.462  -7.893  3.032   1.00 0.00 ? 97  THR A CA   4  
ATOM 8114  C C    . THR A 1 97  ? 16.513  -8.270  1.888   1.00 0.00 ? 97  THR A C    4  
ATOM 8115  O O    . THR A 1 97  ? 16.284  -7.461  0.983   1.00 0.00 ? 97  THR A O    4  
ATOM 8116  C CB   . THR A 1 97  ? 16.796  -8.192  4.396   1.00 0.00 ? 97  THR A CB   4  
ATOM 8117  O OG1  . THR A 1 97  ? 15.656  -7.340  4.588   1.00 0.00 ? 97  THR A OG1  4  
ATOM 8118  C CG2  . THR A 1 97  ? 17.782  -7.987  5.543   1.00 0.00 ? 97  THR A CG2  4  
ATOM 8119  H H    . THR A 1 97  ? 17.317  -5.832  3.451   1.00 0.00 ? 97  THR A H    4  
ATOM 8120  H HA   . THR A 1 97  ? 18.361  -8.491  2.953   1.00 0.00 ? 97  THR A HA   4  
ATOM 8121  H HB   . THR A 1 97  ? 16.470  -9.222  4.404   1.00 0.00 ? 97  THR A HB   4  
ATOM 8122  H HG1  . THR A 1 97  ? 15.118  -7.687  5.310   1.00 0.00 ? 97  THR A HG1  4  
ATOM 8123  H HG21 . THR A 1 97  ? 18.108  -6.957  5.559   1.00 0.00 ? 97  THR A HG21 4  
ATOM 8124  H HG22 . THR A 1 97  ? 18.638  -8.633  5.403   1.00 0.00 ? 97  THR A HG22 4  
ATOM 8125  H HG23 . THR A 1 97  ? 17.300  -8.228  6.480   1.00 0.00 ? 97  THR A HG23 4  
ATOM 8126  N N    . LEU A 1 98  ? 15.957  -9.488  1.943   1.00 0.00 ? 98  LEU A N    4  
ATOM 8127  C CA   . LEU A 1 98  ? 15.071  -9.999  0.891   1.00 0.00 ? 98  LEU A CA   4  
ATOM 8128  C C    . LEU A 1 98  ? 13.960  -8.994  0.579   1.00 0.00 ? 98  LEU A C    4  
ATOM 8129  O O    . LEU A 1 98  ? 13.555  -8.829  -0.570  1.00 0.00 ? 98  LEU A O    4  
ATOM 8130  C CB   . LEU A 1 98  ? 14.467  -11.346 1.319   1.00 0.00 ? 98  LEU A CB   4  
ATOM 8131  C CG   . LEU A 1 98  ? 13.672  -12.090 0.234   1.00 0.00 ? 98  LEU A CG   4  
ATOM 8132  C CD1  . LEU A 1 98  ? 14.568  -12.439 -0.950  1.00 0.00 ? 98  LEU A CD1  4  
ATOM 8133  C CD2  . LEU A 1 98  ? 13.020  -13.346 0.807   1.00 0.00 ? 98  LEU A CD2  4  
ATOM 8134  H H    . LEU A 1 98  ? 16.147  -10.062 2.717   1.00 0.00 ? 98  LEU A H    4  
ATOM 8135  H HA   . LEU A 1 98  ? 15.667  -10.149 0.001   1.00 0.00 ? 98  LEU A HA   4  
ATOM 8136  H HB2  . LEU A 1 98  ? 15.273  -11.987 1.650   1.00 0.00 ? 98  LEU A HB2  4  
ATOM 8137  H HB3  . LEU A 1 98  ? 13.809  -11.169 2.158   1.00 0.00 ? 98  LEU A HB3  4  
ATOM 8138  H HG   . LEU A 1 98  ? 12.885  -11.444 -0.128  1.00 0.00 ? 98  LEU A HG   4  
ATOM 8139  H HD11 . LEU A 1 98  ? 13.989  -12.961 -1.698  1.00 0.00 ? 98  LEU A HD11 4  
ATOM 8140  H HD12 . LEU A 1 98  ? 15.380  -13.070 -0.618  1.00 0.00 ? 98  LEU A HD12 4  
ATOM 8141  H HD13 . LEU A 1 98  ? 14.971  -11.533 -1.378  1.00 0.00 ? 98  LEU A HD13 4  
ATOM 8142  H HD21 . LEU A 1 98  ? 12.350  -13.071 1.608   1.00 0.00 ? 98  LEU A HD21 4  
ATOM 8143  H HD22 . LEU A 1 98  ? 13.783  -14.009 1.187   1.00 0.00 ? 98  LEU A HD22 4  
ATOM 8144  H HD23 . LEU A 1 98  ? 12.462  -13.847 0.030   1.00 0.00 ? 98  LEU A HD23 4  
ATOM 8145  N N    . HIS A 1 99  ? 13.469  -8.331  1.622   1.00 0.00 ? 99  HIS A N    4  
ATOM 8146  C CA   . HIS A 1 99  ? 12.552  -7.207  1.467   1.00 0.00 ? 99  HIS A CA   4  
ATOM 8147  C C    . HIS A 1 99  ? 12.699  -6.261  2.655   1.00 0.00 ? 99  HIS A C    4  
ATOM 8148  O O    . HIS A 1 99  ? 11.885  -6.254  3.578   1.00 0.00 ? 99  HIS A O    4  
ATOM 8149  C CB   . HIS A 1 99  ? 11.087  -7.662  1.259   1.00 0.00 ? 99  HIS A CB   4  
ATOM 8150  C CG   . HIS A 1 99  ? 10.475  -8.460  2.380   1.00 0.00 ? 99  HIS A CG   4  
ATOM 8151  N ND1  . HIS A 1 99  ? 9.114   -8.660  2.494   1.00 0.00 ? 99  HIS A ND1  4  
ATOM 8152  C CD2  . HIS A 1 99  ? 11.034  -9.119  3.425   1.00 0.00 ? 99  HIS A CD2  4  
ATOM 8153  C CE1  . HIS A 1 99  ? 8.865   -9.398  3.558   1.00 0.00 ? 99  HIS A CE1  4  
ATOM 8154  N NE2  . HIS A 1 99  ? 10.012  -9.689  4.139   1.00 0.00 ? 99  HIS A NE2  4  
ATOM 8155  H H    . HIS A 1 99  ? 13.747  -8.597  2.524   1.00 0.00 ? 99  HIS A H    4  
ATOM 8156  H HA   . HIS A 1 99  ? 12.867  -6.667  0.582   1.00 0.00 ? 99  HIS A HA   4  
ATOM 8157  H HB2  . HIS A 1 99  ? 10.470  -6.787  1.116   1.00 0.00 ? 99  HIS A HB2  4  
ATOM 8158  H HB3  . HIS A 1 99  ? 11.040  -8.266  0.363   1.00 0.00 ? 99  HIS A HB3  4  
ATOM 8159  H HD1  . HIS A 1 99  ? 8.425   -8.322  1.872   1.00 0.00 ? 99  HIS A HD1  4  
ATOM 8160  H HD2  . HIS A 1 99  ? 12.089  -9.182  3.653   1.00 0.00 ? 99  HIS A HD2  4  
ATOM 8161  H HE1  . HIS A 1 99  ? 7.888   -9.711  3.896   1.00 0.00 ? 99  HIS A HE1  4  
ATOM 8162  H HE2  . HIS A 1 99  ? 10.122  -10.335 4.875   1.00 0.00 ? 99  HIS A HE2  4  
ATOM 8163  N N    . SER A 1 100 ? 13.775  -5.477  2.625   1.00 0.00 ? 100 SER A N    4  
ATOM 8164  C CA   . SER A 1 100 ? 14.120  -4.563  3.717   1.00 0.00 ? 100 SER A CA   4  
ATOM 8165  C C    . SER A 1 100 ? 13.001  -3.555  3.978   1.00 0.00 ? 100 SER A C    4  
ATOM 8166  O O    . SER A 1 100 ? 12.928  -2.959  5.055   1.00 0.00 ? 100 SER A O    4  
ATOM 8167  C CB   . SER A 1 100 ? 15.427  -3.824  3.390   1.00 0.00 ? 100 SER A CB   4  
ATOM 8168  O OG   . SER A 1 100 ? 15.923  -3.117  4.516   1.00 0.00 ? 100 SER A OG   4  
ATOM 8169  H H    . SER A 1 100 ? 14.370  -5.528  1.846   1.00 0.00 ? 100 SER A H    4  
ATOM 8170  H HA   . SER A 1 100 ? 14.269  -5.157  4.609   1.00 0.00 ? 100 SER A HA   4  
ATOM 8171  H HB2  . SER A 1 100 ? 16.173  -4.539  3.076   1.00 0.00 ? 100 SER A HB2  4  
ATOM 8172  H HB3  . SER A 1 100 ? 15.250  -3.121  2.589   1.00 0.00 ? 100 SER A HB3  4  
ATOM 8173  H HG   . SER A 1 100 ? 15.185  -2.809  5.054   1.00 0.00 ? 100 SER A HG   4  
ATOM 8174  N N    . PHE A 1 101 ? 12.126  -3.381  2.995   1.00 0.00 ? 101 PHE A N    4  
ATOM 8175  C CA   . PHE A 1 101 ? 11.011  -2.443  3.102   1.00 0.00 ? 101 PHE A CA   4  
ATOM 8176  C C    . PHE A 1 101 ? 9.889   -3.026  3.964   1.00 0.00 ? 101 PHE A C    4  
ATOM 8177  O O    . PHE A 1 101 ? 8.823   -2.433  4.080   1.00 0.00 ? 101 PHE A O    4  
ATOM 8178  C CB   . PHE A 1 101 ? 10.490  -2.094  1.702   1.00 0.00 ? 101 PHE A CB   4  
ATOM 8179  C CG   . PHE A 1 101 ? 11.560  -1.552  0.783   1.00 0.00 ? 101 PHE A CG   4  
ATOM 8180  C CD1  . PHE A 1 101 ? 11.981  -0.233  0.885   1.00 0.00 ? 101 PHE A CD1  4  
ATOM 8181  C CD2  . PHE A 1 101 ? 12.152  -2.364  -0.178  1.00 0.00 ? 101 PHE A CD2  4  
ATOM 8182  C CE1  . PHE A 1 101 ? 12.966  0.264   0.051   1.00 0.00 ? 101 PHE A CE1  4  
ATOM 8183  C CE2  . PHE A 1 101 ? 13.138  -1.871  -1.014  1.00 0.00 ? 101 PHE A CE2  4  
ATOM 8184  C CZ   . PHE A 1 101 ? 13.545  -0.555  -0.898  1.00 0.00 ? 101 PHE A CZ   4  
ATOM 8185  H H    . PHE A 1 101 ? 12.229  -3.897  2.171   1.00 0.00 ? 101 PHE A H    4  
ATOM 8186  H HA   . PHE A 1 101 ? 11.378  -1.541  3.574   1.00 0.00 ? 101 PHE A HA   4  
ATOM 8187  H HB2  . PHE A 1 101 ? 10.074  -2.984  1.247   1.00 0.00 ? 101 PHE A HB2  4  
ATOM 8188  H HB3  . PHE A 1 101 ? 9.713   -1.347  1.789   1.00 0.00 ? 101 PHE A HB3  4  
ATOM 8189  H HD1  . PHE A 1 101 ? 11.531  0.412   1.628   1.00 0.00 ? 101 PHE A HD1  4  
ATOM 8190  H HD2  . PHE A 1 101 ? 11.836  -3.395  -0.271  1.00 0.00 ? 101 PHE A HD2  4  
ATOM 8191  H HE1  . PHE A 1 101 ? 13.283  1.293   0.142   1.00 0.00 ? 101 PHE A HE1  4  
ATOM 8192  H HE2  . PHE A 1 101 ? 13.590  -2.514  -1.756  1.00 0.00 ? 101 PHE A HE2  4  
ATOM 8193  H HZ   . PHE A 1 101 ? 14.315  -0.168  -1.552  1.00 0.00 ? 101 PHE A HZ   4  
ATOM 8194  N N    . ASP A 1 102 ? 10.149  -4.188  4.564   1.00 0.00 ? 102 ASP A N    4  
ATOM 8195  C CA   . ASP A 1 102 ? 9.198   -4.853  5.464   1.00 0.00 ? 102 ASP A CA   4  
ATOM 8196  C C    . ASP A 1 102 ? 8.714   -3.895  6.558   1.00 0.00 ? 102 ASP A C    4  
ATOM 8197  O O    . ASP A 1 102 ? 7.508   -3.737  6.780   1.00 0.00 ? 102 ASP A O    4  
ATOM 8198  C CB   . ASP A 1 102 ? 9.869   -6.083  6.097   1.00 0.00 ? 102 ASP A CB   4  
ATOM 8199  C CG   . ASP A 1 102 ? 8.989   -6.800  7.116   1.00 0.00 ? 102 ASP A CG   4  
ATOM 8200  O OD1  . ASP A 1 102 ? 9.011   -6.411  8.303   1.00 0.00 ? 102 ASP A OD1  4  
ATOM 8201  O OD2  . ASP A 1 102 ? 8.296   -7.770  6.738   1.00 0.00 ? 102 ASP A OD2  4  
ATOM 8202  H H    . ASP A 1 102 ? 11.008  -4.622  4.392   1.00 0.00 ? 102 ASP A H    4  
ATOM 8203  H HA   . ASP A 1 102 ? 8.351   -5.175  4.876   1.00 0.00 ? 102 ASP A HA   4  
ATOM 8204  H HB2  . ASP A 1 102 ? 10.124  -6.784  5.315   1.00 0.00 ? 102 ASP A HB2  4  
ATOM 8205  H HB3  . ASP A 1 102 ? 10.780  -5.770  6.593   1.00 0.00 ? 102 ASP A HB3  4  
ATOM 8206  N N    . ALA A 1 103 ? 9.666   -3.250  7.230   1.00 0.00 ? 103 ALA A N    4  
ATOM 8207  C CA   . ALA A 1 103 ? 9.353   -2.293  8.290   1.00 0.00 ? 103 ALA A CA   4  
ATOM 8208  C C    . ALA A 1 103 ? 8.532   -1.131  7.737   1.00 0.00 ? 103 ALA A C    4  
ATOM 8209  O O    . ALA A 1 103 ? 7.555   -0.693  8.353   1.00 0.00 ? 103 ALA A O    4  
ATOM 8210  C CB   . ALA A 1 103 ? 10.635  -1.783  8.942   1.00 0.00 ? 103 ALA A CB   4  
ATOM 8211  H H    . ALA A 1 103 ? 10.603  -3.429  7.012   1.00 0.00 ? 103 ALA A H    4  
ATOM 8212  H HA   . ALA A 1 103 ? 8.771   -2.809  9.045   1.00 0.00 ? 103 ALA A HA   4  
ATOM 8213  H HB1  . ALA A 1 103 ? 10.389  -1.108  9.751   1.00 0.00 ? 103 ALA A HB1  4  
ATOM 8214  H HB2  . ALA A 1 103 ? 11.233  -1.259  8.208   1.00 0.00 ? 103 ALA A HB2  4  
ATOM 8215  H HB3  . ALA A 1 103 ? 11.198  -2.618  9.333   1.00 0.00 ? 103 ALA A HB3  4  
ATOM 8216  N N    . ALA A 1 104 ? 8.931   -0.654  6.561   1.00 0.00 ? 104 ALA A N    4  
ATOM 8217  C CA   . ALA A 1 104 ? 8.239   0.441   5.890   1.00 0.00 ? 104 ALA A CA   4  
ATOM 8218  C C    . ALA A 1 104 ? 6.797   0.054   5.578   1.00 0.00 ? 104 ALA A C    4  
ATOM 8219  O O    . ALA A 1 104 ? 5.872   0.840   5.787   1.00 0.00 ? 104 ALA A O    4  
ATOM 8220  C CB   . ALA A 1 104 ? 8.978   0.835   4.616   1.00 0.00 ? 104 ALA A CB   4  
ATOM 8221  H H    . ALA A 1 104 ? 9.711   -1.057  6.128   1.00 0.00 ? 104 ALA A H    4  
ATOM 8222  H HA   . ALA A 1 104 ? 8.237   1.294   6.557   1.00 0.00 ? 104 ALA A HA   4  
ATOM 8223  H HB1  . ALA A 1 104 ? 8.996   -0.003  3.933   1.00 0.00 ? 104 ALA A HB1  4  
ATOM 8224  H HB2  . ALA A 1 104 ? 9.990   1.122   4.858   1.00 0.00 ? 104 ALA A HB2  4  
ATOM 8225  H HB3  . ALA A 1 104 ? 8.471   1.667   4.148   1.00 0.00 ? 104 ALA A HB3  4  
ATOM 8226  N N    . GLN A 1 105 ? 6.626   -1.173  5.094   1.00 0.00 ? 105 GLN A N    4  
ATOM 8227  C CA   . GLN A 1 105 ? 5.312   -1.728  4.784   1.00 0.00 ? 105 GLN A CA   4  
ATOM 8228  C C    . GLN A 1 105 ? 4.399   -1.639  5.999   1.00 0.00 ? 105 GLN A C    4  
ATOM 8229  O O    . GLN A 1 105 ? 3.242   -1.239  5.890   1.00 0.00 ? 105 GLN A O    4  
ATOM 8230  C CB   . GLN A 1 105 ? 5.463   -3.190  4.333   1.00 0.00 ? 105 GLN A CB   4  
ATOM 8231  C CG   . GLN A 1 105 ? 4.146   -3.956  4.227   1.00 0.00 ? 105 GLN A CG   4  
ATOM 8232  C CD   . GLN A 1 105 ? 4.334   -5.374  3.712   1.00 0.00 ? 105 GLN A CD   4  
ATOM 8233  O OE1  . GLN A 1 105 ? 4.272   -5.624  2.513   1.00 0.00 ? 105 GLN A OE1  4  
ATOM 8234  N NE2  . GLN A 1 105 ? 4.577   -6.306  4.619   1.00 0.00 ? 105 GLN A NE2  4  
ATOM 8235  H H    . GLN A 1 105 ? 7.415   -1.730  4.941   1.00 0.00 ? 105 GLN A H    4  
ATOM 8236  H HA   . GLN A 1 105 ? 4.886   -1.150  3.977   1.00 0.00 ? 105 GLN A HA   4  
ATOM 8237  H HB2  . GLN A 1 105 ? 5.941   -3.206  3.364   1.00 0.00 ? 105 GLN A HB2  4  
ATOM 8238  H HB3  . GLN A 1 105 ? 6.097   -3.707  5.041   1.00 0.00 ? 105 GLN A HB3  4  
ATOM 8239  H HG2  . GLN A 1 105 ? 3.692   -4.005  5.208   1.00 0.00 ? 105 GLN A HG2  4  
ATOM 8240  H HG3  . GLN A 1 105 ? 3.487   -3.426  3.553   1.00 0.00 ? 105 GLN A HG3  4  
ATOM 8241  H HE21 . GLN A 1 105 ? 4.621   -6.039  5.560   1.00 0.00 ? 105 GLN A HE21 4  
ATOM 8242  H HE22 . GLN A 1 105 ? 4.705   -7.226  4.309   1.00 0.00 ? 105 GLN A HE22 4  
ATOM 8243  N N    . SER A 1 106 ? 4.942   -1.996  7.159   1.00 0.00 ? 106 SER A N    4  
ATOM 8244  C CA   . SER A 1 106 ? 4.192   -1.957  8.409   1.00 0.00 ? 106 SER A CA   4  
ATOM 8245  C C    . SER A 1 106 ? 3.647   -0.549  8.664   1.00 0.00 ? 106 SER A C    4  
ATOM 8246  O O    . SER A 1 106 ? 2.467   -0.378  8.975   1.00 0.00 ? 106 SER A O    4  
ATOM 8247  C CB   . SER A 1 106 ? 5.085   -2.401  9.569   1.00 0.00 ? 106 SER A CB   4  
ATOM 8248  O OG   . SER A 1 106 ? 5.634   -3.693  9.334   1.00 0.00 ? 106 SER A OG   4  
ATOM 8249  H H    . SER A 1 106 ? 5.877   -2.292  7.172   1.00 0.00 ? 106 SER A H    4  
ATOM 8250  H HA   . SER A 1 106 ? 3.362   -2.645  8.319   1.00 0.00 ? 106 SER A HA   4  
ATOM 8251  H HB2  . SER A 1 106 ? 5.898   -1.699  9.684   1.00 0.00 ? 106 SER A HB2  4  
ATOM 8252  H HB3  . SER A 1 106 ? 4.504   -2.431  10.478  1.00 0.00 ? 106 SER A HB3  4  
ATOM 8253  H HG   . SER A 1 106 ? 6.179   -3.675  8.537   1.00 0.00 ? 106 SER A HG   4  
ATOM 8254  N N    . ARG A 1 107 ? 4.514   0.455   8.508   1.00 0.00 ? 107 ARG A N    4  
ATOM 8255  C CA   . ARG A 1 107 ? 4.116   1.851   8.691   1.00 0.00 ? 107 ARG A CA   4  
ATOM 8256  C C    . ARG A 1 107 ? 3.056   2.245   7.665   1.00 0.00 ? 107 ARG A C    4  
ATOM 8257  O O    . ARG A 1 107 ? 1.916   2.535   8.022   1.00 0.00 ? 107 ARG A O    4  
ATOM 8258  C CB   . ARG A 1 107 ? 5.325   2.799   8.583   1.00 0.00 ? 107 ARG A CB   4  
ATOM 8259  C CG   . ARG A 1 107 ? 6.173   2.917   9.851   1.00 0.00 ? 107 ARG A CG   4  
ATOM 8260  C CD   . ARG A 1 107 ? 6.846   1.605   10.235  1.00 0.00 ? 107 ARG A CD   4  
ATOM 8261  N NE   . ARG A 1 107 ? 7.803   1.785   11.325  1.00 0.00 ? 107 ARG A NE   4  
ATOM 8262  C CZ   . ARG A 1 107 ? 8.460   0.793   11.924  1.00 0.00 ? 107 ARG A CZ   4  
ATOM 8263  N NH1  . ARG A 1 107 ? 8.273   -0.465  11.545  1.00 0.00 ? 107 ARG A NH1  4  
ATOM 8264  N NH2  . ARG A 1 107 ? 9.315   1.067   12.898  1.00 0.00 ? 107 ARG A NH2  4  
ATOM 8265  H H    . ARG A 1 107 ? 5.440   0.250   8.250   1.00 0.00 ? 107 ARG A H    4  
ATOM 8266  H HA   . ARG A 1 107 ? 3.691   1.947   9.676   1.00 0.00 ? 107 ARG A HA   4  
ATOM 8267  H HB2  . ARG A 1 107 ? 5.964   2.450   7.785   1.00 0.00 ? 107 ARG A HB2  4  
ATOM 8268  H HB3  . ARG A 1 107 ? 4.968   3.788   8.328   1.00 0.00 ? 107 ARG A HB3  4  
ATOM 8269  H HG2  . ARG A 1 107 ? 6.941   3.661   9.688   1.00 0.00 ? 107 ARG A HG2  4  
ATOM 8270  H HG3  . ARG A 1 107 ? 5.536   3.235   10.666  1.00 0.00 ? 107 ARG A HG3  4  
ATOM 8271  H HD2  . ARG A 1 107 ? 6.087   0.900   10.544  1.00 0.00 ? 107 ARG A HD2  4  
ATOM 8272  H HD3  . ARG A 1 107 ? 7.368   1.214   9.371   1.00 0.00 ? 107 ARG A HD3  4  
ATOM 8273  H HE   . ARG A 1 107 ? 7.974   2.709   11.623  1.00 0.00 ? 107 ARG A HE   4  
ATOM 8274  H HH11 . ARG A 1 107 ? 7.635   -0.680  10.807  1.00 0.00 ? 107 ARG A HH11 4  
ATOM 8275  H HH12 . ARG A 1 107 ? 8.781   -1.208  11.996  1.00 0.00 ? 107 ARG A HH12 4  
ATOM 8276  H HH21 . ARG A 1 107 ? 9.470   2.021   13.182  1.00 0.00 ? 107 ARG A HH21 4  
ATOM 8277  H HH22 . ARG A 1 107 ? 9.804   0.325   13.366  1.00 0.00 ? 107 ARG A HH22 4  
ATOM 8278  N N    . VAL A 1 108 ? 3.443   2.219   6.393   1.00 0.00 ? 108 VAL A N    4  
ATOM 8279  C CA   . VAL A 1 108 ? 2.580   2.671   5.300   1.00 0.00 ? 108 VAL A CA   4  
ATOM 8280  C C    . VAL A 1 108 ? 1.197   2.019   5.373   1.00 0.00 ? 108 VAL A C    4  
ATOM 8281  O O    . VAL A 1 108 ? 0.177   2.688   5.190   1.00 0.00 ? 108 VAL A O    4  
ATOM 8282  C CB   . VAL A 1 108 ? 3.226   2.373   3.923   1.00 0.00 ? 108 VAL A CB   4  
ATOM 8283  C CG1  . VAL A 1 108 ? 2.322   2.822   2.778   1.00 0.00 ? 108 VAL A CG1  4  
ATOM 8284  C CG2  . VAL A 1 108 ? 4.597   3.043   3.823   1.00 0.00 ? 108 VAL A CG2  4  
ATOM 8285  H H    . VAL A 1 108 ? 4.336   1.880   6.178   1.00 0.00 ? 108 VAL A H    4  
ATOM 8286  H HA   . VAL A 1 108 ? 2.465   3.743   5.392   1.00 0.00 ? 108 VAL A HA   4  
ATOM 8287  H HB   . VAL A 1 108 ? 3.368   1.304   3.840   1.00 0.00 ? 108 VAL A HB   4  
ATOM 8288  H HG11 . VAL A 1 108 ? 2.804   2.612   1.833   1.00 0.00 ? 108 VAL A HG11 4  
ATOM 8289  H HG12 . VAL A 1 108 ? 2.136   3.883   2.857   1.00 0.00 ? 108 VAL A HG12 4  
ATOM 8290  H HG13 . VAL A 1 108 ? 1.383   2.289   2.828   1.00 0.00 ? 108 VAL A HG13 4  
ATOM 8291  H HG21 . VAL A 1 108 ? 4.486   4.113   3.935   1.00 0.00 ? 108 VAL A HG21 4  
ATOM 8292  H HG22 . VAL A 1 108 ? 5.036   2.827   2.860   1.00 0.00 ? 108 VAL A HG22 4  
ATOM 8293  H HG23 . VAL A 1 108 ? 5.242   2.665   4.605   1.00 0.00 ? 108 VAL A HG23 4  
ATOM 8294  N N    . TYR A 1 109 ? 1.174   0.722   5.665   1.00 0.00 ? 109 TYR A N    4  
ATOM 8295  C CA   . TYR A 1 109 ? -0.075  -0.028  5.786   1.00 0.00 ? 109 TYR A CA   4  
ATOM 8296  C C    . TYR A 1 109 ? -0.996  0.599   6.839   1.00 0.00 ? 109 TYR A C    4  
ATOM 8297  O O    . TYR A 1 109 ? -2.109  1.021   6.525   1.00 0.00 ? 109 TYR A O    4  
ATOM 8298  C CB   . TYR A 1 109 ? 0.227   -1.500  6.123   1.00 0.00 ? 109 TYR A CB   4  
ATOM 8299  C CG   . TYR A 1 109 ? -0.980  -2.319  6.559   1.00 0.00 ? 109 TYR A CG   4  
ATOM 8300  C CD1  . TYR A 1 109 ? -1.353  -2.386  7.900   1.00 0.00 ? 109 TYR A CD1  4  
ATOM 8301  C CD2  . TYR A 1 109 ? -1.747  -3.025  5.635   1.00 0.00 ? 109 TYR A CD2  4  
ATOM 8302  C CE1  . TYR A 1 109 ? -2.446  -3.123  8.304   1.00 0.00 ? 109 TYR A CE1  4  
ATOM 8303  C CE2  . TYR A 1 109 ? -2.844  -3.765  6.035   1.00 0.00 ? 109 TYR A CE2  4  
ATOM 8304  C CZ   . TYR A 1 109 ? -3.189  -3.811  7.371   1.00 0.00 ? 109 TYR A CZ   4  
ATOM 8305  O OH   . TYR A 1 109 ? -4.288  -4.539  7.774   1.00 0.00 ? 109 TYR A OH   4  
ATOM 8306  H H    . TYR A 1 109 ? 2.023   0.253   5.805   1.00 0.00 ? 109 TYR A H    4  
ATOM 8307  H HA   . TYR A 1 109 ? -0.570  0.012   4.829   1.00 0.00 ? 109 TYR A HA   4  
ATOM 8308  H HB2  . TYR A 1 109 ? 0.648   -1.978  5.249   1.00 0.00 ? 109 TYR A HB2  4  
ATOM 8309  H HB3  . TYR A 1 109 ? 0.957   -1.531  6.915   1.00 0.00 ? 109 TYR A HB3  4  
ATOM 8310  H HD1  . TYR A 1 109 ? -0.769  -1.846  8.633   1.00 0.00 ? 109 TYR A HD1  4  
ATOM 8311  H HD2  . TYR A 1 109 ? -1.477  -2.989  4.589   1.00 0.00 ? 109 TYR A HD2  4  
ATOM 8312  H HE1  . TYR A 1 109 ? -2.715  -3.159  9.350   1.00 0.00 ? 109 TYR A HE1  4  
ATOM 8313  H HE2  . TYR A 1 109 ? -3.426  -4.305  5.303   1.00 0.00 ? 109 TYR A HE2  4  
ATOM 8314  H HH   . TYR A 1 109 ? -4.892  -3.956  8.252   1.00 0.00 ? 109 TYR A HH   4  
ATOM 8315  N N    . GLN A 1 110 ? -0.519  0.681   8.081   1.00 0.00 ? 110 GLN A N    4  
ATOM 8316  C CA   . GLN A 1 110 ? -1.353  1.159   9.187   1.00 0.00 ? 110 GLN A CA   4  
ATOM 8317  C C    . GLN A 1 110 ? -1.615  2.662   9.081   1.00 0.00 ? 110 GLN A C    4  
ATOM 8318  O O    . GLN A 1 110 ? -2.576  3.173   9.660   1.00 0.00 ? 110 GLN A O    4  
ATOM 8319  C CB   . GLN A 1 110 ? -0.717  0.813   10.542  1.00 0.00 ? 110 GLN A CB   4  
ATOM 8320  C CG   . GLN A 1 110 ? 0.655   1.436   10.773  1.00 0.00 ? 110 GLN A CG   4  
ATOM 8321  C CD   . GLN A 1 110 ? 1.256   1.065   12.121  1.00 0.00 ? 110 GLN A CD   4  
ATOM 8322  O OE1  . GLN A 1 110 ? 2.016   1.835   12.706  1.00 0.00 ? 110 GLN A OE1  4  
ATOM 8323  N NE2  . GLN A 1 110 ? 0.929   -0.119  12.623  1.00 0.00 ? 110 GLN A NE2  4  
ATOM 8324  H H    . GLN A 1 110 ? 0.412   0.424   8.257   1.00 0.00 ? 110 GLN A H    4  
ATOM 8325  H HA   . GLN A 1 110 ? -2.304  0.647   9.115   1.00 0.00 ? 110 GLN A HA   4  
ATOM 8326  H HB2  . GLN A 1 110 ? -1.377  1.150   11.331  1.00 0.00 ? 110 GLN A HB2  4  
ATOM 8327  H HB3  . GLN A 1 110 ? -0.615  -0.262  10.612  1.00 0.00 ? 110 GLN A HB3  4  
ATOM 8328  H HG2  . GLN A 1 110 ? 1.325   1.097   9.996   1.00 0.00 ? 110 GLN A HG2  4  
ATOM 8329  H HG3  . GLN A 1 110 ? 0.562   2.513   10.719  1.00 0.00 ? 110 GLN A HG3  4  
ATOM 8330  H HE21 . GLN A 1 110 ? 0.328   -0.694  12.105  1.00 0.00 ? 110 GLN A HE21 4  
ATOM 8331  H HE22 . GLN A 1 110 ? 1.289   -0.365  13.500  1.00 0.00 ? 110 GLN A HE22 4  
ATOM 8332  N N    . LEU A 1 111 ? -0.769  3.368   8.332   1.00 0.00 ? 111 LEU A N    4  
ATOM 8333  C CA   . LEU A 1 111 ? -0.938  4.806   8.138   1.00 0.00 ? 111 LEU A CA   4  
ATOM 8334  C C    . LEU A 1 111 ? -2.164  5.102   7.275   1.00 0.00 ? 111 LEU A C    4  
ATOM 8335  O O    . LEU A 1 111 ? -2.920  6.029   7.564   1.00 0.00 ? 111 LEU A O    4  
ATOM 8336  C CB   . LEU A 1 111 ? 0.323   5.431   7.517   1.00 0.00 ? 111 LEU A CB   4  
ATOM 8337  C CG   . LEU A 1 111 ? 1.545   5.502   8.449   1.00 0.00 ? 111 LEU A CG   4  
ATOM 8338  C CD1  . LEU A 1 111 ? 2.756   6.065   7.713   1.00 0.00 ? 111 LEU A CD1  4  
ATOM 8339  C CD2  . LEU A 1 111 ? 1.230   6.334   9.693   1.00 0.00 ? 111 LEU A CD2  4  
ATOM 8340  H H    . LEU A 1 111 ? -0.014  2.910   7.904   1.00 0.00 ? 111 LEU A H    4  
ATOM 8341  H HA   . LEU A 1 111 ? -1.096  5.247   9.114   1.00 0.00 ? 111 LEU A HA   4  
ATOM 8342  H HB2  . LEU A 1 111 ? 0.594   4.848   6.645   1.00 0.00 ? 111 LEU A HB2  4  
ATOM 8343  H HB3  . LEU A 1 111 ? 0.085   6.435   7.195   1.00 0.00 ? 111 LEU A HB3  4  
ATOM 8344  H HG   . LEU A 1 111 ? 1.796   4.503   8.775   1.00 0.00 ? 111 LEU A HG   4  
ATOM 8345  H HD11 . LEU A 1 111 ? 3.603   6.096   8.383   1.00 0.00 ? 111 LEU A HD11 4  
ATOM 8346  H HD12 . LEU A 1 111 ? 2.537   7.063   7.362   1.00 0.00 ? 111 LEU A HD12 4  
ATOM 8347  H HD13 . LEU A 1 111 ? 2.991   5.432   6.870   1.00 0.00 ? 111 LEU A HD13 4  
ATOM 8348  H HD21 . LEU A 1 111 ? 2.100   6.370   10.333  1.00 0.00 ? 111 LEU A HD21 4  
ATOM 8349  H HD22 . LEU A 1 111 ? 0.408   5.883   10.232  1.00 0.00 ? 111 LEU A HD22 4  
ATOM 8350  H HD23 . LEU A 1 111 ? 0.959   7.339   9.401   1.00 0.00 ? 111 LEU A HD23 4  
ATOM 8351  N N    . MET A 1 112 ? -2.372  4.309   6.225   1.00 0.00 ? 112 MET A N    4  
ATOM 8352  C CA   . MET A 1 112 ? -3.531  4.501   5.356   1.00 0.00 ? 112 MET A CA   4  
ATOM 8353  C C    . MET A 1 112 ? -4.709  3.658   5.831   1.00 0.00 ? 112 MET A C    4  
ATOM 8354  O O    . MET A 1 112 ? -5.838  3.856   5.386   1.00 0.00 ? 112 MET A O    4  
ATOM 8355  C CB   . MET A 1 112 ? -3.188  4.223   3.880   1.00 0.00 ? 112 MET A CB   4  
ATOM 8356  C CG   . MET A 1 112 ? -2.531  2.877   3.601   1.00 0.00 ? 112 MET A CG   4  
ATOM 8357  S SD   . MET A 1 112 ? -3.661  1.482   3.729   1.00 0.00 ? 112 MET A SD   4  
ATOM 8358  C CE   . MET A 1 112 ? -2.663  0.190   2.990   1.00 0.00 ? 112 MET A CE   4  
ATOM 8359  H H    . MET A 1 112 ? -1.740  3.581   6.033   1.00 0.00 ? 112 MET A H    4  
ATOM 8360  H HA   . MET A 1 112 ? -3.821  5.541   5.442   1.00 0.00 ? 112 MET A HA   4  
ATOM 8361  H HB2  . MET A 1 112 ? -4.098  4.271   3.301   1.00 0.00 ? 112 MET A HB2  4  
ATOM 8362  H HB3  . MET A 1 112 ? -2.520  4.998   3.533   1.00 0.00 ? 112 MET A HB3  4  
ATOM 8363  H HG2  . MET A 1 112 ? -2.125  2.893   2.601   1.00 0.00 ? 112 MET A HG2  4  
ATOM 8364  H HG3  . MET A 1 112 ? -1.726  2.734   4.308   1.00 0.00 ? 112 MET A HG3  4  
ATOM 8365  H HE1  . MET A 1 112 ? -1.733  0.100   3.528   1.00 0.00 ? 112 MET A HE1  4  
ATOM 8366  H HE2  . MET A 1 112 ? -2.459  0.438   1.959   1.00 0.00 ? 112 MET A HE2  4  
ATOM 8367  H HE3  . MET A 1 112 ? -3.197  -0.748  3.035   1.00 0.00 ? 112 MET A HE3  4  
ATOM 8368  N N    . GLU A 1 113 ? -4.457  2.731   6.751   1.00 0.00 ? 113 GLU A N    4  
ATOM 8369  C CA   . GLU A 1 113 ? -5.540  1.995   7.394   1.00 0.00 ? 113 GLU A CA   4  
ATOM 8370  C C    . GLU A 1 113 ? -6.345  2.946   8.285   1.00 0.00 ? 113 GLU A C    4  
ATOM 8371  O O    . GLU A 1 113 ? -7.548  3.124   8.101   1.00 0.00 ? 113 GLU A O    4  
ATOM 8372  C CB   . GLU A 1 113 ? -4.996  0.821   8.228   1.00 0.00 ? 113 GLU A CB   4  
ATOM 8373  C CG   . GLU A 1 113 ? -6.085  0.002   8.922   1.00 0.00 ? 113 GLU A CG   4  
ATOM 8374  C CD   . GLU A 1 113 ? -5.534  -1.102  9.817   1.00 0.00 ? 113 GLU A CD   4  
ATOM 8375  O OE1  . GLU A 1 113 ? -5.118  -0.796  10.953  1.00 0.00 ? 113 GLU A OE1  4  
ATOM 8376  O OE2  . GLU A 1 113 ? -5.528  -2.281  9.394   1.00 0.00 ? 113 GLU A OE2  4  
ATOM 8377  H H    . GLU A 1 113 ? -3.528  2.529   6.988   1.00 0.00 ? 113 GLU A H    4  
ATOM 8378  H HA   . GLU A 1 113 ? -6.187  1.609   6.618   1.00 0.00 ? 113 GLU A HA   4  
ATOM 8379  H HB2  . GLU A 1 113 ? -4.436  0.162   7.579   1.00 0.00 ? 113 GLU A HB2  4  
ATOM 8380  H HB3  . GLU A 1 113 ? -4.331  1.212   8.986   1.00 0.00 ? 113 GLU A HB3  4  
ATOM 8381  H HG2  . GLU A 1 113 ? -6.685  0.667   9.528   1.00 0.00 ? 113 GLU A HG2  4  
ATOM 8382  H HG3  . GLU A 1 113 ? -6.715  -0.447  8.163   1.00 0.00 ? 113 GLU A HG3  4  
ATOM 8383  N N    . GLN A 1 114 ? -5.655  3.590   9.221   1.00 0.00 ? 114 GLN A N    4  
ATOM 8384  C CA   . GLN A 1 114 ? -6.295  4.470   10.203  1.00 0.00 ? 114 GLN A CA   4  
ATOM 8385  C C    . GLN A 1 114 ? -7.074  5.612   9.538   1.00 0.00 ? 114 GLN A C    4  
ATOM 8386  O O    . GLN A 1 114 ? -7.987  6.180   10.143  1.00 0.00 ? 114 GLN A O    4  
ATOM 8387  C CB   . GLN A 1 114 ? -5.237  5.036   11.161  1.00 0.00 ? 114 GLN A CB   4  
ATOM 8388  C CG   . GLN A 1 114 ? -4.144  5.839   10.465  1.00 0.00 ? 114 GLN A CG   4  
ATOM 8389  C CD   . GLN A 1 114 ? -3.035  6.263   11.409  1.00 0.00 ? 114 GLN A CD   4  
ATOM 8390  O OE1  . GLN A 1 114 ? -3.088  7.333   12.013  1.00 0.00 ? 114 GLN A OE1  4  
ATOM 8391  N NE2  . GLN A 1 114 ? -2.022  5.422   11.547  1.00 0.00 ? 114 GLN A NE2  4  
ATOM 8392  H H    . GLN A 1 114 ? -4.682  3.467   9.257   1.00 0.00 ? 114 GLN A H    4  
ATOM 8393  H HA   . GLN A 1 114 ? -6.990  3.870   10.773  1.00 0.00 ? 114 GLN A HA   4  
ATOM 8394  H HB2  . GLN A 1 114 ? -5.725  5.677   11.883  1.00 0.00 ? 114 GLN A HB2  4  
ATOM 8395  H HB3  . GLN A 1 114 ? -4.770  4.214   11.687  1.00 0.00 ? 114 GLN A HB3  4  
ATOM 8396  H HG2  . GLN A 1 114 ? -3.714  5.234   9.679   1.00 0.00 ? 114 GLN A HG2  4  
ATOM 8397  H HG3  . GLN A 1 114 ? -4.587  6.726   10.031  1.00 0.00 ? 114 GLN A HG3  4  
ATOM 8398  H HE21 . GLN A 1 114 ? -2.047  4.581   11.039  1.00 0.00 ? 114 GLN A HE21 4  
ATOM 8399  H HE22 . GLN A 1 114 ? -1.290  5.671   12.152  1.00 0.00 ? 114 GLN A HE22 4  
ATOM 8400  N N    . ASP A 1 115 ? -6.715  5.950   8.302   1.00 0.00 ? 115 ASP A N    4  
ATOM 8401  C CA   . ASP A 1 115 ? -7.389  7.026   7.569   1.00 0.00 ? 115 ASP A CA   4  
ATOM 8402  C C    . ASP A 1 115 ? -8.204  6.470   6.403   1.00 0.00 ? 115 ASP A C    4  
ATOM 8403  O O    . ASP A 1 115 ? -9.436  6.462   6.437   1.00 0.00 ? 115 ASP A O    4  
ATOM 8404  C CB   . ASP A 1 115 ? -6.367  8.052   7.044   1.00 0.00 ? 115 ASP A CB   4  
ATOM 8405  C CG   . ASP A 1 115 ? -7.008  9.171   6.223   1.00 0.00 ? 115 ASP A CG   4  
ATOM 8406  O OD1  . ASP A 1 115 ? -7.176  9.000   4.995   1.00 0.00 ? 115 ASP A OD1  4  
ATOM 8407  O OD2  . ASP A 1 115 ? -7.333  10.234  6.798   1.00 0.00 ? 115 ASP A OD2  4  
ATOM 8408  H H    . ASP A 1 115 ? -5.982  5.465   7.871   1.00 0.00 ? 115 ASP A H    4  
ATOM 8409  H HA   . ASP A 1 115 ? -8.061  7.526   8.254   1.00 0.00 ? 115 ASP A HA   4  
ATOM 8410  H HB2  . ASP A 1 115 ? -5.853  8.497   7.885   1.00 0.00 ? 115 ASP A HB2  4  
ATOM 8411  H HB3  . ASP A 1 115 ? -5.644  7.542   6.422   1.00 0.00 ? 115 ASP A HB3  4  
ATOM 8412  N N    . SER A 1 116 ? -7.503  5.968   5.393   1.00 0.00 ? 116 SER A N    4  
ATOM 8413  C CA   . SER A 1 116 ? -8.113  5.620   4.114   1.00 0.00 ? 116 SER A CA   4  
ATOM 8414  C C    . SER A 1 116 ? -9.038  4.398   4.205   1.00 0.00 ? 116 SER A C    4  
ATOM 8415  O O    . SER A 1 116 ? -9.868  4.194   3.321   1.00 0.00 ? 116 SER A O    4  
ATOM 8416  C CB   . SER A 1 116 ? -7.021  5.403   3.063   1.00 0.00 ? 116 SER A CB   4  
ATOM 8417  O OG   . SER A 1 116 ? -6.172  6.541   2.978   1.00 0.00 ? 116 SER A OG   4  
ATOM 8418  H H    . SER A 1 116 ? -6.541  5.823   5.509   1.00 0.00 ? 116 SER A H    4  
ATOM 8419  H HA   . SER A 1 116 ? -8.711  6.468   3.807   1.00 0.00 ? 116 SER A HA   4  
ATOM 8420  H HB2  . SER A 1 116 ? -6.426  4.542   3.333   1.00 0.00 ? 116 SER A HB2  4  
ATOM 8421  H HB3  . SER A 1 116 ? -7.477  5.235   2.095   1.00 0.00 ? 116 SER A HB3  4  
ATOM 8422  H HG   . SER A 1 116 ? -6.503  7.234   3.568   1.00 0.00 ? 116 SER A HG   4  
ATOM 8423  N N    . TYR A 1 117 ? -8.914  3.592   5.263   1.00 0.00 ? 117 TYR A N    4  
ATOM 8424  C CA   . TYR A 1 117 ? -9.796  2.431   5.436   1.00 0.00 ? 117 TYR A CA   4  
ATOM 8425  C C    . TYR A 1 117 ? -11.223 2.885   5.727   1.00 0.00 ? 117 TYR A C    4  
ATOM 8426  O O    . TYR A 1 117 ? -12.144 2.590   4.967   1.00 0.00 ? 117 TYR A O    4  
ATOM 8427  C CB   . TYR A 1 117 ? -9.290  1.519   6.559   1.00 0.00 ? 117 TYR A CB   4  
ATOM 8428  C CG   . TYR A 1 117 ? -10.163 0.304   6.834   1.00 0.00 ? 117 TYR A CG   4  
ATOM 8429  C CD1  . TYR A 1 117 ? -10.604 -0.516  5.798   1.00 0.00 ? 117 TYR A CD1  4  
ATOM 8430  C CD2  . TYR A 1 117 ? -10.538 -0.026  8.134   1.00 0.00 ? 117 TYR A CD2  4  
ATOM 8431  C CE1  . TYR A 1 117 ? -11.392 -1.623  6.050   1.00 0.00 ? 117 TYR A CE1  4  
ATOM 8432  C CE2  . TYR A 1 117 ? -11.323 -1.133  8.391   1.00 0.00 ? 117 TYR A CE2  4  
ATOM 8433  C CZ   . TYR A 1 117 ? -11.747 -1.928  7.349   1.00 0.00 ? 117 TYR A CZ   4  
ATOM 8434  O OH   . TYR A 1 117 ? -12.529 -3.030  7.603   1.00 0.00 ? 117 TYR A OH   4  
ATOM 8435  H H    . TYR A 1 117 ? -8.220  3.778   5.936   1.00 0.00 ? 117 TYR A H    4  
ATOM 8436  H HA   . TYR A 1 117 ? -9.793  1.875   4.507   1.00 0.00 ? 117 TYR A HA   4  
ATOM 8437  H HB2  . TYR A 1 117 ? -8.301  1.158   6.297   1.00 0.00 ? 117 TYR A HB2  4  
ATOM 8438  H HB3  . TYR A 1 117 ? -9.226  2.098   7.475   1.00 0.00 ? 117 TYR A HB3  4  
ATOM 8439  H HD1  . TYR A 1 117 ? -10.325 -0.276  4.781   1.00 0.00 ? 117 TYR A HD1  4  
ATOM 8440  H HD2  . TYR A 1 117 ? -10.206 0.597   8.952   1.00 0.00 ? 117 TYR A HD2  4  
ATOM 8441  H HE1  . TYR A 1 117 ? -11.723 -2.247  5.232   1.00 0.00 ? 117 TYR A HE1  4  
ATOM 8442  H HE2  . TYR A 1 117 ? -11.604 -1.371  9.408   1.00 0.00 ? 117 TYR A HE2  4  
ATOM 8443  H HH   . TYR A 1 117 ? -12.324 -3.724  6.968   1.00 0.00 ? 117 TYR A HH   4  
ATOM 8444  N N    . THR A 1 118 ? -11.398 3.617   6.823   1.00 0.00 ? 118 THR A N    4  
ATOM 8445  C CA   . THR A 1 118 ? -12.707 4.142   7.195   1.00 0.00 ? 118 THR A CA   4  
ATOM 8446  C C    . THR A 1 118 ? -13.185 5.157   6.157   1.00 0.00 ? 118 THR A C    4  
ATOM 8447  O O    . THR A 1 118 ? -14.378 5.255   5.858   1.00 0.00 ? 118 THR A O    4  
ATOM 8448  C CB   . THR A 1 118 ? -12.655 4.786   8.597   1.00 0.00 ? 118 THR A CB   4  
ATOM 8449  O OG1  . THR A 1 118 ? -11.532 5.673   8.679   1.00 0.00 ? 118 THR A OG1  4  
ATOM 8450  C CG2  . THR A 1 118 ? -12.543 3.723   9.684   1.00 0.00 ? 118 THR A CG2  4  
ATOM 8451  H H    . THR A 1 118 ? -10.625 3.821   7.392   1.00 0.00 ? 118 THR A H    4  
ATOM 8452  H HA   . THR A 1 118 ? -13.405 3.313   7.223   1.00 0.00 ? 118 THR A HA   4  
ATOM 8453  H HB   . THR A 1 118 ? -13.562 5.351   8.758   1.00 0.00 ? 118 THR A HB   4  
ATOM 8454  H HG1  . THR A 1 118 ? -11.589 6.186   9.492   1.00 0.00 ? 118 THR A HG1  4  
ATOM 8455  H HG21 . THR A 1 118 ? -11.643 3.144   9.533   1.00 0.00 ? 118 THR A HG21 4  
ATOM 8456  H HG22 . THR A 1 118 ? -13.402 3.068   9.642   1.00 0.00 ? 118 THR A HG22 4  
ATOM 8457  H HG23 . THR A 1 118 ? -12.502 4.200   10.653  1.00 0.00 ? 118 THR A HG23 4  
ATOM 8458  N N    . ARG A 1 119 ? -12.225 5.892   5.609   1.00 0.00 ? 119 ARG A N    4  
ATOM 8459  C CA   . ARG A 1 119 ? -12.466 6.811   4.501   1.00 0.00 ? 119 ARG A CA   4  
ATOM 8460  C C    . ARG A 1 119 ? -13.119 6.053   3.342   1.00 0.00 ? 119 ARG A C    4  
ATOM 8461  O O    . ARG A 1 119 ? -14.123 6.490   2.769   1.00 0.00 ? 119 ARG A O    4  
ATOM 8462  C CB   . ARG A 1 119 ? -11.120 7.404   4.077   1.00 0.00 ? 119 ARG A CB   4  
ATOM 8463  C CG   . ARG A 1 119 ? -11.190 8.635   3.188   1.00 0.00 ? 119 ARG A CG   4  
ATOM 8464  C CD   . ARG A 1 119 ? -9.785  9.135   2.864   1.00 0.00 ? 119 ARG A CD   4  
ATOM 8465  N NE   . ARG A 1 119 ? -9.790  10.452  2.228   1.00 0.00 ? 119 ARG A NE   4  
ATOM 8466  C CZ   . ARG A 1 119 ? -9.102  11.502  2.685   1.00 0.00 ? 119 ARG A CZ   4  
ATOM 8467  N NH1  . ARG A 1 119 ? -8.333  11.382  3.764   1.00 0.00 ? 119 ARG A NH1  4  
ATOM 8468  N NH2  . ARG A 1 119 ? -9.164  12.663  2.045   1.00 0.00 ? 119 ARG A NH2  4  
ATOM 8469  H H    . ARG A 1 119 ? -11.316 5.825   5.975   1.00 0.00 ? 119 ARG A H    4  
ATOM 8470  H HA   . ARG A 1 119 ? -13.123 7.599   4.841   1.00 0.00 ? 119 ARG A HA   4  
ATOM 8471  H HB2  . ARG A 1 119 ? -10.573 7.674   4.967   1.00 0.00 ? 119 ARG A HB2  4  
ATOM 8472  H HB3  . ARG A 1 119 ? -10.560 6.641   3.549   1.00 0.00 ? 119 ARG A HB3  4  
ATOM 8473  H HG2  . ARG A 1 119 ? -11.701 8.382   2.270   1.00 0.00 ? 119 ARG A HG2  4  
ATOM 8474  H HG3  . ARG A 1 119 ? -11.732 9.413   3.705   1.00 0.00 ? 119 ARG A HG3  4  
ATOM 8475  H HD2  . ARG A 1 119 ? -9.217  9.191   3.784   1.00 0.00 ? 119 ARG A HD2  4  
ATOM 8476  H HD3  . ARG A 1 119 ? -9.312  8.429   2.198   1.00 0.00 ? 119 ARG A HD3  4  
ATOM 8477  H HE   . ARG A 1 119 ? -10.326 10.555  1.408   1.00 0.00 ? 119 ARG A HE   4  
ATOM 8478  H HH11 . ARG A 1 119 ? -8.261  10.499  4.243   1.00 0.00 ? 119 ARG A HH11 4  
ATOM 8479  H HH12 . ARG A 1 119 ? -7.813  12.170  4.102   1.00 0.00 ? 119 ARG A HH12 4  
ATOM 8480  H HH21 . ARG A 1 119 ? -9.720  12.753  1.215   1.00 0.00 ? 119 ARG A HH21 4  
ATOM 8481  H HH22 . ARG A 1 119 ? -8.653  13.457  2.389   1.00 0.00 ? 119 ARG A HH22 4  
ATOM 8482  N N    . PHE A 1 120 ? -12.548 4.894   3.030   1.00 0.00 ? 120 PHE A N    4  
ATOM 8483  C CA   . PHE A 1 120 ? -13.073 4.023   1.988   1.00 0.00 ? 120 PHE A CA   4  
ATOM 8484  C C    . PHE A 1 120 ? -14.445 3.487   2.386   1.00 0.00 ? 120 PHE A C    4  
ATOM 8485  O O    . PHE A 1 120 ? -15.358 3.445   1.568   1.00 0.00 ? 120 PHE A O    4  
ATOM 8486  C CB   . PHE A 1 120 ? -12.096 2.866   1.722   1.00 0.00 ? 120 PHE A CB   4  
ATOM 8487  C CG   . PHE A 1 120 ? -12.589 1.852   0.716   1.00 0.00 ? 120 PHE A CG   4  
ATOM 8488  C CD1  . PHE A 1 120 ? -12.870 2.226   -0.590  1.00 0.00 ? 120 PHE A CD1  4  
ATOM 8489  C CD2  . PHE A 1 120 ? -12.765 0.522   1.078   1.00 0.00 ? 120 PHE A CD2  4  
ATOM 8490  C CE1  . PHE A 1 120 ? -13.317 1.299   -1.511  1.00 0.00 ? 120 PHE A CE1  4  
ATOM 8491  C CE2  . PHE A 1 120 ? -13.211 -0.408  0.159   1.00 0.00 ? 120 PHE A CE2  4  
ATOM 8492  C CZ   . PHE A 1 120 ? -13.488 -0.020  -1.136  1.00 0.00 ? 120 PHE A CZ   4  
ATOM 8493  H H    . PHE A 1 120 ? -11.748 4.613   3.520   1.00 0.00 ? 120 PHE A H    4  
ATOM 8494  H HA   . PHE A 1 120 ? -13.175 4.612   1.087   1.00 0.00 ? 120 PHE A HA   4  
ATOM 8495  H HB2  . PHE A 1 120 ? -11.166 3.271   1.352   1.00 0.00 ? 120 PHE A HB2  4  
ATOM 8496  H HB3  . PHE A 1 120 ? -11.905 2.349   2.654   1.00 0.00 ? 120 PHE A HB3  4  
ATOM 8497  H HD1  . PHE A 1 120 ? -12.738 3.258   -0.887  1.00 0.00 ? 120 PHE A HD1  4  
ATOM 8498  H HD2  . PHE A 1 120 ? -12.548 0.214   2.091   1.00 0.00 ? 120 PHE A HD2  4  
ATOM 8499  H HE1  . PHE A 1 120 ? -13.533 1.604   -2.524  1.00 0.00 ? 120 PHE A HE1  4  
ATOM 8500  H HE2  . PHE A 1 120 ? -13.343 -1.438  0.454   1.00 0.00 ? 120 PHE A HE2  4  
ATOM 8501  H HZ   . PHE A 1 120 ? -13.838 -0.746  -1.855  1.00 0.00 ? 120 PHE A HZ   4  
ATOM 8502  N N    . LEU A 1 121 ? -14.594 3.110   3.652   1.00 0.00 ? 121 LEU A N    4  
ATOM 8503  C CA   . LEU A 1 121 ? -15.859 2.568   4.153   1.00 0.00 ? 121 LEU A CA   4  
ATOM 8504  C C    . LEU A 1 121 ? -17.006 3.561   3.950   1.00 0.00 ? 121 LEU A C    4  
ATOM 8505  O O    . LEU A 1 121 ? -18.169 3.167   3.865   1.00 0.00 ? 121 LEU A O    4  
ATOM 8506  C CB   . LEU A 1 121 ? -15.743 2.196   5.641   1.00 0.00 ? 121 LEU A CB   4  
ATOM 8507  C CG   . LEU A 1 121 ? -14.732 1.082   5.968   1.00 0.00 ? 121 LEU A CG   4  
ATOM 8508  C CD1  . LEU A 1 121 ? -14.696 0.808   7.469   1.00 0.00 ? 121 LEU A CD1  4  
ATOM 8509  C CD2  . LEU A 1 121 ? -15.057 -0.196  5.193   1.00 0.00 ? 121 LEU A CD2  4  
ATOM 8510  H H    . LEU A 1 121 ? -13.834 3.191   4.265   1.00 0.00 ? 121 LEU A H    4  
ATOM 8511  H HA   . LEU A 1 121 ? -16.076 1.673   3.586   1.00 0.00 ? 121 LEU A HA   4  
ATOM 8512  H HB2  . LEU A 1 121 ? -15.457 3.084   6.190   1.00 0.00 ? 121 LEU A HB2  4  
ATOM 8513  H HB3  . LEU A 1 121 ? -16.717 1.881   5.989   1.00 0.00 ? 121 LEU A HB3  4  
ATOM 8514  H HG   . LEU A 1 121 ? -13.746 1.407   5.671   1.00 0.00 ? 121 LEU A HG   4  
ATOM 8515  H HD11 . LEU A 1 121 ? -13.973 0.032   7.677   1.00 0.00 ? 121 LEU A HD11 4  
ATOM 8516  H HD12 . LEU A 1 121 ? -15.673 0.488   7.805   1.00 0.00 ? 121 LEU A HD12 4  
ATOM 8517  H HD13 . LEU A 1 121 ? -14.413 1.711   7.993   1.00 0.00 ? 121 LEU A HD13 4  
ATOM 8518  H HD21 . LEU A 1 121 ? -15.013 0.004   4.132   1.00 0.00 ? 121 LEU A HD21 4  
ATOM 8519  H HD22 . LEU A 1 121 ? -16.049 -0.537  5.453   1.00 0.00 ? 121 LEU A HD22 4  
ATOM 8520  H HD23 . LEU A 1 121 ? -14.336 -0.961  5.444   1.00 0.00 ? 121 LEU A HD23 4  
ATOM 8521  N N    . LYS A 1 122 ? -16.676 4.852   3.883   1.00 0.00 ? 122 LYS A N    4  
ATOM 8522  C CA   . LYS A 1 122 ? -17.682 5.897   3.671   1.00 0.00 ? 122 LYS A CA   4  
ATOM 8523  C C    . LYS A 1 122 ? -17.509 6.595   2.321   1.00 0.00 ? 122 LYS A C    4  
ATOM 8524  O O    . LYS A 1 122 ? -18.177 7.594   2.045   1.00 0.00 ? 122 LYS A O    4  
ATOM 8525  C CB   . LYS A 1 122 ? -17.660 6.913   4.831   1.00 0.00 ? 122 LYS A CB   4  
ATOM 8526  C CG   . LYS A 1 122 ? -18.715 6.636   5.903   1.00 0.00 ? 122 LYS A CG   4  
ATOM 8527  C CD   . LYS A 1 122 ? -18.575 5.237   6.509   1.00 0.00 ? 122 LYS A CD   4  
ATOM 8528  C CE   . LYS A 1 122 ? -19.805 4.843   7.319   1.00 0.00 ? 122 LYS A CE   4  
ATOM 8529  N NZ   . LYS A 1 122 ? -19.674 3.483   7.910   1.00 0.00 ? 122 LYS A NZ   4  
ATOM 8530  H H    . LYS A 1 122 ? -15.734 5.111   3.992   1.00 0.00 ? 122 LYS A H    4  
ATOM 8531  H HA   . LYS A 1 122 ? -18.649 5.412   3.664   1.00 0.00 ? 122 LYS A HA   4  
ATOM 8532  H HB2  . LYS A 1 122 ? -16.685 6.891   5.298   1.00 0.00 ? 122 LYS A HB2  4  
ATOM 8533  H HB3  . LYS A 1 122 ? -17.833 7.905   4.436   1.00 0.00 ? 122 LYS A HB3  4  
ATOM 8534  H HG2  . LYS A 1 122 ? -18.611 7.369   6.691   1.00 0.00 ? 122 LYS A HG2  4  
ATOM 8535  H HG3  . LYS A 1 122 ? -19.697 6.729   5.455   1.00 0.00 ? 122 LYS A HG3  4  
ATOM 8536  H HD2  . LYS A 1 122 ? -18.443 4.520   5.713   1.00 0.00 ? 122 LYS A HD2  4  
ATOM 8537  H HD3  . LYS A 1 122 ? -17.708 5.219   7.156   1.00 0.00 ? 122 LYS A HD3  4  
ATOM 8538  H HE2  . LYS A 1 122 ? -19.942 5.559   8.116   1.00 0.00 ? 122 LYS A HE2  4  
ATOM 8539  H HE3  . LYS A 1 122 ? -20.669 4.861   6.668   1.00 0.00 ? 122 LYS A HE3  4  
ATOM 8540  H HZ1  . LYS A 1 122 ? -19.528 2.777   7.160   1.00 0.00 ? 122 LYS A HZ1  4  
ATOM 8541  H HZ2  . LYS A 1 122 ? -20.537 3.236   8.434   1.00 0.00 ? 122 LYS A HZ2  4  
ATOM 8542  H HZ3  . LYS A 1 122 ? -18.866 3.450   8.562   1.00 0.00 ? 122 LYS A HZ3  4  
ATOM 8543  N N    . SER A 1 123 ? -16.617 6.075   1.480   1.00 0.00 ? 123 SER A N    4  
ATOM 8544  C CA   . SER A 1 123 ? -16.511 6.549   0.102   1.00 0.00 ? 123 SER A CA   4  
ATOM 8545  C C    . SER A 1 123 ? -17.754 6.119   -0.677  1.00 0.00 ? 123 SER A C    4  
ATOM 8546  O O    . SER A 1 123 ? -18.239 4.998   -0.495  1.00 0.00 ? 123 SER A O    4  
ATOM 8547  C CB   . SER A 1 123 ? -15.260 5.982   -0.577  1.00 0.00 ? 123 SER A CB   4  
ATOM 8548  O OG   . SER A 1 123 ? -15.391 4.589   -0.817  1.00 0.00 ? 123 SER A OG   4  
ATOM 8549  H H    . SER A 1 123 ? -16.008 5.376   1.797   1.00 0.00 ? 123 SER A H    4  
ATOM 8550  H HA   . SER A 1 123 ? -16.454 7.628   0.119   1.00 0.00 ? 123 SER A HA   4  
ATOM 8551  H HB2  . SER A 1 123 ? -15.106 6.483   -1.522  1.00 0.00 ? 123 SER A HB2  4  
ATOM 8552  H HB3  . SER A 1 123 ? -14.401 6.145   0.059   1.00 0.00 ? 123 SER A HB3  4  
ATOM 8553  H HG   . SER A 1 123 ? -15.773 4.166   -0.040  1.00 0.00 ? 123 SER A HG   4  
ATOM 8554  N N    . ASP A 1 124 ? -18.256 6.994   -1.546  1.00 0.00 ? 124 ASP A N    4  
ATOM 8555  C CA   . ASP A 1 124 ? -19.453 6.696   -2.338  1.00 0.00 ? 124 ASP A CA   4  
ATOM 8556  C C    . ASP A 1 124 ? -19.299 5.391   -3.117  1.00 0.00 ? 124 ASP A C    4  
ATOM 8557  O O    . ASP A 1 124 ? -20.272 4.665   -3.308  1.00 0.00 ? 124 ASP A O    4  
ATOM 8558  C CB   . ASP A 1 124 ? -19.768 7.843   -3.309  1.00 0.00 ? 124 ASP A CB   4  
ATOM 8559  C CG   . ASP A 1 124 ? -20.147 9.131   -2.595  1.00 0.00 ? 124 ASP A CG   4  
ATOM 8560  O OD1  . ASP A 1 124 ? -21.349 9.333   -2.315  1.00 0.00 ? 124 ASP A OD1  4  
ATOM 8561  O OD2  . ASP A 1 124 ? -19.240 9.942   -2.310  1.00 0.00 ? 124 ASP A OD2  4  
ATOM 8562  H H    . ASP A 1 124 ? -17.824 7.870   -1.648  1.00 0.00 ? 124 ASP A H    4  
ATOM 8563  H HA   . ASP A 1 124 ? -20.280 6.589   -1.651  1.00 0.00 ? 124 ASP A HA   4  
ATOM 8564  H HB2  . ASP A 1 124 ? -18.899 8.034   -3.924  1.00 0.00 ? 124 ASP A HB2  4  
ATOM 8565  H HB3  . ASP A 1 124 ? -20.591 7.548   -3.947  1.00 0.00 ? 124 ASP A HB3  4  
ATOM 8566  N N    . ILE A 1 125 ? -18.075 5.088   -3.556  1.00 0.00 ? 125 ILE A N    4  
ATOM 8567  C CA   . ILE A 1 125 ? -17.829 3.875   -4.338  1.00 0.00 ? 125 ILE A CA   4  
ATOM 8568  C C    . ILE A 1 125 ? -18.064 2.618   -3.487  1.00 0.00 ? 125 ILE A C    4  
ATOM 8569  O O    . ILE A 1 125 ? -18.654 1.639   -3.956  1.00 0.00 ? 125 ILE A O    4  
ATOM 8570  C CB   . ILE A 1 125 ? -16.400 3.858   -4.960  1.00 0.00 ? 125 ILE A CB   4  
ATOM 8571  C CG1  . ILE A 1 125 ? -16.226 2.646   -5.895  1.00 0.00 ? 125 ILE A CG1  4  
ATOM 8572  C CG2  . ILE A 1 125 ? -15.316 3.863   -3.882  1.00 0.00 ? 125 ILE A CG2  4  
ATOM 8573  C CD1  . ILE A 1 125 ? -17.152 2.661   -7.097  1.00 0.00 ? 125 ILE A CD1  4  
ATOM 8574  H H    . ILE A 1 125 ? -17.331 5.690   -3.353  1.00 0.00 ? 125 ILE A H    4  
ATOM 8575  H HA   . ILE A 1 125 ? -18.544 3.869   -5.152  1.00 0.00 ? 125 ILE A HA   4  
ATOM 8576  H HB   . ILE A 1 125 ? -16.284 4.761   -5.541  1.00 0.00 ? 125 ILE A HB   4  
ATOM 8577  H HG12 . ILE A 1 125 ? -15.211 2.626   -6.266  1.00 0.00 ? 125 ILE A HG12 4  
ATOM 8578  H HG13 . ILE A 1 125 ? -16.418 1.738   -5.340  1.00 0.00 ? 125 ILE A HG13 4  
ATOM 8579  H HG21 . ILE A 1 125 ? -15.418 2.985   -3.261  1.00 0.00 ? 125 ILE A HG21 4  
ATOM 8580  H HG22 . ILE A 1 125 ? -15.415 4.749   -3.273  1.00 0.00 ? 125 ILE A HG22 4  
ATOM 8581  H HG23 . ILE A 1 125 ? -14.340 3.858   -4.353  1.00 0.00 ? 125 ILE A HG23 4  
ATOM 8582  H HD11 . ILE A 1 125 ? -16.962 1.791   -7.707  1.00 0.00 ? 125 ILE A HD11 4  
ATOM 8583  H HD12 . ILE A 1 125 ? -16.974 3.553   -7.679  1.00 0.00 ? 125 ILE A HD12 4  
ATOM 8584  H HD13 . ILE A 1 125 ? -18.179 2.649   -6.763  1.00 0.00 ? 125 ILE A HD13 4  
ATOM 8585  N N    . TYR A 1 126 ? -17.626 2.650   -2.229  1.00 0.00 ? 126 TYR A N    4  
ATOM 8586  C CA   . TYR A 1 126 ? -17.871 1.536   -1.316  1.00 0.00 ? 126 TYR A CA   4  
ATOM 8587  C C    . TYR A 1 126 ? -19.343 1.507   -0.918  1.00 0.00 ? 126 TYR A C    4  
ATOM 8588  O O    . TYR A 1 126 ? -19.971 0.447   -0.892  1.00 0.00 ? 126 TYR A O    4  
ATOM 8589  C CB   . TYR A 1 126 ? -16.986 1.649   -0.071  1.00 0.00 ? 126 TYR A CB   4  
ATOM 8590  C CG   . TYR A 1 126 ? -17.177 0.527   0.939   1.00 0.00 ? 126 TYR A CG   4  
ATOM 8591  C CD1  . TYR A 1 126 ? -16.526 -0.693  0.786   1.00 0.00 ? 126 TYR A CD1  4  
ATOM 8592  C CD2  . TYR A 1 126 ? -18.004 0.690   2.048   1.00 0.00 ? 126 TYR A CD2  4  
ATOM 8593  C CE1  . TYR A 1 126 ? -16.692 -1.713  1.706   1.00 0.00 ? 126 TYR A CE1  4  
ATOM 8594  C CE2  . TYR A 1 126 ? -18.173 -0.324  2.970   1.00 0.00 ? 126 TYR A CE2  4  
ATOM 8595  C CZ   . TYR A 1 126 ? -17.516 -1.523  2.795   1.00 0.00 ? 126 TYR A CZ   4  
ATOM 8596  O OH   . TYR A 1 126 ? -17.682 -2.535  3.714   1.00 0.00 ? 126 TYR A OH   4  
ATOM 8597  H H    . TYR A 1 126 ? -17.130 3.437   -1.909  1.00 0.00 ? 126 TYR A H    4  
ATOM 8598  H HA   . TYR A 1 126 ? -17.632 0.618   -1.837  1.00 0.00 ? 126 TYR A HA   4  
ATOM 8599  H HB2  . TYR A 1 126 ? -15.950 1.644   -0.378  1.00 0.00 ? 126 TYR A HB2  4  
ATOM 8600  H HB3  . TYR A 1 126 ? -17.198 2.586   0.426   1.00 0.00 ? 126 TYR A HB3  4  
ATOM 8601  H HD1  . TYR A 1 126 ? -15.881 -0.841  -0.068  1.00 0.00 ? 126 TYR A HD1  4  
ATOM 8602  H HD2  . TYR A 1 126 ? -18.520 1.630   2.184   1.00 0.00 ? 126 TYR A HD2  4  
ATOM 8603  H HE1  . TYR A 1 126 ? -16.175 -2.652  1.567   1.00 0.00 ? 126 TYR A HE1  4  
ATOM 8604  H HE2  . TYR A 1 126 ? -18.819 -0.177  3.825   1.00 0.00 ? 126 TYR A HE2  4  
ATOM 8605  H HH   . TYR A 1 126 ? -18.620 -2.667  3.875   1.00 0.00 ? 126 TYR A HH   4  
ATOM 8606  N N    . LEU A 1 127 ? -19.891 2.686   -0.624  1.00 0.00 ? 127 LEU A N    4  
ATOM 8607  C CA   . LEU A 1 127 ? -21.305 2.817   -0.282  1.00 0.00 ? 127 LEU A CA   4  
ATOM 8608  C C    . LEU A 1 127 ? -22.175 2.372   -1.456  1.00 0.00 ? 127 LEU A C    4  
ATOM 8609  O O    . LEU A 1 127 ? -23.327 1.979   -1.276  1.00 0.00 ? 127 LEU A O    4  
ATOM 8610  C CB   . LEU A 1 127 ? -21.637 4.261   0.128   1.00 0.00 ? 127 LEU A CB   4  
ATOM 8611  C CG   . LEU A 1 127 ? -20.936 4.758   1.404   1.00 0.00 ? 127 LEU A CG   4  
ATOM 8612  C CD1  . LEU A 1 127 ? -21.315 6.208   1.700   1.00 0.00 ? 127 LEU A CD1  4  
ATOM 8613  C CD2  . LEU A 1 127 ? -21.270 3.856   2.594   1.00 0.00 ? 127 LEU A CD2  4  
ATOM 8614  H H    . LEU A 1 127 ? -19.328 3.490   -0.638  1.00 0.00 ? 127 LEU A H    4  
ATOM 8615  H HA   . LEU A 1 127 ? -21.501 2.162   0.557   1.00 0.00 ? 127 LEU A HA   4  
ATOM 8616  H HB2  . LEU A 1 127 ? -21.362 4.916   -0.686  1.00 0.00 ? 127 LEU A HB2  4  
ATOM 8617  H HB3  . LEU A 1 127 ? -22.705 4.334   0.279   1.00 0.00 ? 127 LEU A HB3  4  
ATOM 8618  H HG   . LEU A 1 127 ? -19.866 4.724   1.252   1.00 0.00 ? 127 LEU A HG   4  
ATOM 8619  H HD11 . LEU A 1 127 ? -20.805 6.539   2.592   1.00 0.00 ? 127 LEU A HD11 4  
ATOM 8620  H HD12 . LEU A 1 127 ? -22.384 6.280   1.851   1.00 0.00 ? 127 LEU A HD12 4  
ATOM 8621  H HD13 . LEU A 1 127 ? -21.028 6.832   0.868   1.00 0.00 ? 127 LEU A HD13 4  
ATOM 8622  H HD21 . LEU A 1 127 ? -20.935 2.851   2.389   1.00 0.00 ? 127 LEU A HD21 4  
ATOM 8623  H HD22 . LEU A 1 127 ? -22.338 3.852   2.758   1.00 0.00 ? 127 LEU A HD22 4  
ATOM 8624  H HD23 . LEU A 1 127 ? -20.773 4.228   3.480   1.00 0.00 ? 127 LEU A HD23 4  
ATOM 8625  N N    . ASP A 1 128 ? -21.611 2.430   -2.657  1.00 0.00 ? 128 ASP A N    4  
ATOM 8626  C CA   . ASP A 1 128 ? -22.270 1.899   -3.845  1.00 0.00 ? 128 ASP A CA   4  
ATOM 8627  C C    . ASP A 1 128 ? -22.343 0.378   -3.769  1.00 0.00 ? 128 ASP A C    4  
ATOM 8628  O O    . ASP A 1 128 ? -23.378 -0.220  -4.066  1.00 0.00 ? 128 ASP A O    4  
ATOM 8629  C CB   . ASP A 1 128 ? -21.534 2.330   -5.121  1.00 0.00 ? 128 ASP A CB   4  
ATOM 8630  C CG   . ASP A 1 128 ? -22.140 1.719   -6.374  1.00 0.00 ? 128 ASP A CG   4  
ATOM 8631  O OD1  . ASP A 1 128 ? -23.337 1.958   -6.638  1.00 0.00 ? 128 ASP A OD1  4  
ATOM 8632  O OD2  . ASP A 1 128 ? -21.427 0.989   -7.098  1.00 0.00 ? 128 ASP A OD2  4  
ATOM 8633  H H    . ASP A 1 128 ? -20.732 2.856   -2.750  1.00 0.00 ? 128 ASP A H    4  
ATOM 8634  H HA   . ASP A 1 128 ? -23.278 2.296   -3.870  1.00 0.00 ? 128 ASP A HA   4  
ATOM 8635  H HB2  . ASP A 1 128 ? -21.580 3.406   -5.208  1.00 0.00 ? 128 ASP A HB2  4  
ATOM 8636  H HB3  . ASP A 1 128 ? -20.500 2.024   -5.051  1.00 0.00 ? 128 ASP A HB3  4  
ATOM 8637  N N    . LEU A 1 129 ? -21.242 -0.242  -3.353  1.00 0.00 ? 129 LEU A N    4  
ATOM 8638  C CA   . LEU A 1 129 ? -21.205 -1.692  -3.160  1.00 0.00 ? 129 LEU A CA   4  
ATOM 8639  C C    . LEU A 1 129 ? -22.212 -2.109  -2.086  1.00 0.00 ? 129 LEU A C    4  
ATOM 8640  O O    . LEU A 1 129 ? -22.742 -3.221  -2.112  1.00 0.00 ? 129 LEU A O    4  
ATOM 8641  C CB   . LEU A 1 129 ? -19.795 -2.156  -2.755  1.00 0.00 ? 129 LEU A CB   4  
ATOM 8642  C CG   . LEU A 1 129 ? -18.671 -1.809  -3.746  1.00 0.00 ? 129 LEU A CG   4  
ATOM 8643  C CD1  . LEU A 1 129 ? -17.309 -2.212  -3.182  1.00 0.00 ? 129 LEU A CD1  4  
ATOM 8644  C CD2  . LEU A 1 129 ? -18.915 -2.483  -5.096  1.00 0.00 ? 129 LEU A CD2  4  
ATOM 8645  H H    . LEU A 1 129 ? -20.431 0.288   -3.179  1.00 0.00 ? 129 LEU A H    4  
ATOM 8646  H HA   . LEU A 1 129 ? -21.478 -2.161  -4.095  1.00 0.00 ? 129 LEU A HA   4  
ATOM 8647  H HB2  . LEU A 1 129 ? -19.555 -1.715  -1.797  1.00 0.00 ? 129 LEU A HB2  4  
ATOM 8648  H HB3  . LEU A 1 129 ? -19.817 -3.231  -2.636  1.00 0.00 ? 129 LEU A HB3  4  
ATOM 8649  H HG   . LEU A 1 129 ? -18.659 -0.740  -3.904  1.00 0.00 ? 129 LEU A HG   4  
ATOM 8650  H HD11 . LEU A 1 129 ? -17.133 -1.689  -2.254  1.00 0.00 ? 129 LEU A HD11 4  
ATOM 8651  H HD12 . LEU A 1 129 ? -16.535 -1.956  -3.890  1.00 0.00 ? 129 LEU A HD12 4  
ATOM 8652  H HD13 . LEU A 1 129 ? -17.292 -3.278  -3.004  1.00 0.00 ? 129 LEU A HD13 4  
ATOM 8653  H HD21 . LEU A 1 129 ? -19.857 -2.145  -5.504  1.00 0.00 ? 129 LEU A HD21 4  
ATOM 8654  H HD22 . LEU A 1 129 ? -18.942 -3.555  -4.967  1.00 0.00 ? 129 LEU A HD22 4  
ATOM 8655  H HD23 . LEU A 1 129 ? -18.117 -2.224  -5.778  1.00 0.00 ? 129 LEU A HD23 4  
ATOM 8656  N N    . MET A 1 130 ? -22.464 -1.205  -1.140  1.00 0.00 ? 130 MET A N    4  
ATOM 8657  C CA   . MET A 1 130 ? -23.397 -1.467  -0.043  1.00 0.00 ? 130 MET A CA   4  
ATOM 8658  C C    . MET A 1 130 ? -24.843 -1.286  -0.514  1.00 0.00 ? 130 MET A C    4  
ATOM 8659  O O    . MET A 1 130 ? -25.627 -2.238  -0.579  1.00 0.00 ? 130 MET A O    4  
ATOM 8660  C CB   . MET A 1 130 ? -23.143 -0.505  1.135   1.00 0.00 ? 130 MET A CB   4  
ATOM 8661  C CG   . MET A 1 130 ? -21.687 -0.371  1.584   1.00 0.00 ? 130 MET A CG   4  
ATOM 8662  S SD   . MET A 1 130 ? -21.005 -1.862  2.340   1.00 0.00 ? 130 MET A SD   4  
ATOM 8663  C CE   . MET A 1 130 ? -20.412 -2.767  0.908   1.00 0.00 ? 130 MET A CE   4  
ATOM 8664  H H    . MET A 1 130 ? -22.006 -0.338  -1.180  1.00 0.00 ? 130 MET A H    4  
ATOM 8665  H HA   . MET A 1 130 ? -23.254 -2.486  0.291   1.00 0.00 ? 130 MET A HA   4  
ATOM 8666  H HB2  . MET A 1 130 ? -23.491 0.479   0.855   1.00 0.00 ? 130 MET A HB2  4  
ATOM 8667  H HB3  . MET A 1 130 ? -23.723 -0.844  1.984   1.00 0.00 ? 130 MET A HB3  4  
ATOM 8668  H HG2  . MET A 1 130 ? -21.086 -0.122  0.725   1.00 0.00 ? 130 MET A HG2  4  
ATOM 8669  H HG3  . MET A 1 130 ? -21.624 0.436   2.302   1.00 0.00 ? 130 MET A HG3  4  
ATOM 8670  H HE1  . MET A 1 130 ? -19.933 -3.679  1.231   1.00 0.00 ? 130 MET A HE1  4  
ATOM 8671  H HE2  . MET A 1 130 ? -19.701 -2.160  0.368   1.00 0.00 ? 130 MET A HE2  4  
ATOM 8672  H HE3  . MET A 1 130 ? -21.244 -3.007  0.264   1.00 0.00 ? 130 MET A HE3  4  
ATOM 8673  N N    . GLU A 1 131 ? -25.164 -0.045  -0.861  1.00 0.00 ? 131 GLU A N    4  
ATOM 8674  C CA   . GLU A 1 131 ? -26.535 0.394   -1.111  1.00 0.00 ? 131 GLU A CA   4  
ATOM 8675  C C    . GLU A 1 131 ? -26.825 0.561   -2.605  1.00 0.00 ? 131 GLU A C    4  
ATOM 8676  O O    . GLU A 1 131 ? -27.935 0.290   -3.064  1.00 0.00 ? 131 GLU A O    4  
ATOM 8677  C CB   . GLU A 1 131 ? -26.748 1.730   -0.382  1.00 0.00 ? 131 GLU A CB   4  
ATOM 8678  C CG   . GLU A 1 131 ? -28.094 2.398   -0.636  1.00 0.00 ? 131 GLU A CG   4  
ATOM 8679  C CD   . GLU A 1 131 ? -28.176 3.768   0.019   1.00 0.00 ? 131 GLU A CD   4  
ATOM 8680  O OE1  . GLU A 1 131 ? -27.718 4.757   -0.597  1.00 0.00 ? 131 GLU A OE1  4  
ATOM 8681  O OE2  . GLU A 1 131 ? -28.669 3.862   1.162   1.00 0.00 ? 131 GLU A OE2  4  
ATOM 8682  H H    . GLU A 1 131 ? -24.445 0.609   -0.955  1.00 0.00 ? 131 GLU A H    4  
ATOM 8683  H HA   . GLU A 1 131 ? -27.211 -0.341  -0.699  1.00 0.00 ? 131 GLU A HA   4  
ATOM 8684  H HB2  . GLU A 1 131 ? -26.657 1.558   0.681   1.00 0.00 ? 131 GLU A HB2  4  
ATOM 8685  H HB3  . GLU A 1 131 ? -25.969 2.415   -0.689  1.00 0.00 ? 131 GLU A HB3  4  
ATOM 8686  H HG2  . GLU A 1 131 ? -28.237 2.509   -1.703  1.00 0.00 ? 131 GLU A HG2  4  
ATOM 8687  H HG3  . GLU A 1 131 ? -28.877 1.771   -0.233  1.00 0.00 ? 131 GLU A HG3  4  
ATOM 8688  N N    . GLY A 1 132 ? -25.822 0.996   -3.356  1.00 0.00 ? 132 GLY A N    4  
ATOM 8689  C CA   . GLY A 1 132 ? -26.031 1.363   -4.748  1.00 0.00 ? 132 GLY A CA   4  
ATOM 8690  C C    . GLY A 1 132 ? -26.236 2.859   -4.879  1.00 0.00 ? 132 GLY A C    4  
ATOM 8691  O O    . GLY A 1 132 ? -27.372 3.348   -4.846  1.00 0.00 ? 132 GLY A O    4  
ATOM 8692  H H    . GLY A 1 132 ? -24.928 1.068   -2.967  1.00 0.00 ? 132 GLY A H    4  
ATOM 8693  H HA2  . GLY A 1 132 ? -25.165 1.071   -5.324  1.00 0.00 ? 132 GLY A HA2  4  
ATOM 8694  H HA3  . GLY A 1 132 ? -26.902 0.852   -5.130  1.00 0.00 ? 132 GLY A HA3  4  
ATOM 8695  N N    . ARG A 1 133 ? -25.137 3.589   -5.026  1.00 0.00 ? 133 ARG A N    4  
ATOM 8696  C CA   . ARG A 1 133 ? -25.160 5.045   -4.943  1.00 0.00 ? 133 ARG A CA   4  
ATOM 8697  C C    . ARG A 1 133 ? -24.117 5.665   -5.878  1.00 0.00 ? 133 ARG A C    4  
ATOM 8698  O O    . ARG A 1 133 ? -22.951 5.266   -5.860  1.00 0.00 ? 133 ARG A O    4  
ATOM 8699  C CB   . ARG A 1 133 ? -24.880 5.470   -3.494  1.00 0.00 ? 133 ARG A CB   4  
ATOM 8700  C CG   . ARG A 1 133 ? -24.948 6.973   -3.253  1.00 0.00 ? 133 ARG A CG   4  
ATOM 8701  C CD   . ARG A 1 133 ? -24.582 7.321   -1.816  1.00 0.00 ? 133 ARG A CD   4  
ATOM 8702  N NE   . ARG A 1 133 ? -25.423 6.611   -0.849  1.00 0.00 ? 133 ARG A NE   4  
ATOM 8703  C CZ   . ARG A 1 133 ? -25.273 6.684   0.474   1.00 0.00 ? 133 ARG A CZ   4  
ATOM 8704  N NH1  . ARG A 1 133 ? -24.333 7.451   1.010   1.00 0.00 ? 133 ARG A NH1  4  
ATOM 8705  N NH2  . ARG A 1 133 ? -26.079 5.995   1.266   1.00 0.00 ? 133 ARG A NH2  4  
ATOM 8706  H H    . ARG A 1 133 ? -24.286 3.138   -5.219  1.00 0.00 ? 133 ARG A H    4  
ATOM 8707  H HA   . ARG A 1 133 ? -26.146 5.385   -5.229  1.00 0.00 ? 133 ARG A HA   4  
ATOM 8708  H HB2  . ARG A 1 133 ? -25.603 4.993   -2.850  1.00 0.00 ? 133 ARG A HB2  4  
ATOM 8709  H HB3  . ARG A 1 133 ? -23.891 5.127   -3.220  1.00 0.00 ? 133 ARG A HB3  4  
ATOM 8710  H HG2  . ARG A 1 133 ? -24.257 7.469   -3.921  1.00 0.00 ? 133 ARG A HG2  4  
ATOM 8711  H HG3  . ARG A 1 133 ? -25.954 7.317   -3.455  1.00 0.00 ? 133 ARG A HG3  4  
ATOM 8712  H HD2  . ARG A 1 133 ? -23.548 7.054   -1.645  1.00 0.00 ? 133 ARG A HD2  4  
ATOM 8713  H HD3  . ARG A 1 133 ? -24.705 8.386   -1.674  1.00 0.00 ? 133 ARG A HD3  4  
ATOM 8714  H HE   . ARG A 1 133 ? -26.141 6.040   -1.211  1.00 0.00 ? 133 ARG A HE   4  
ATOM 8715  H HH11 . ARG A 1 133 ? -23.717 7.990   0.424   1.00 0.00 ? 133 ARG A HH11 4  
ATOM 8716  H HH12 . ARG A 1 133 ? -24.231 7.493   2.008   1.00 0.00 ? 133 ARG A HH12 4  
ATOM 8717  H HH21 . ARG A 1 133 ? -26.801 5.414   0.871   1.00 0.00 ? 133 ARG A HH21 4  
ATOM 8718  H HH22 . ARG A 1 133 ? -25.975 6.053   2.265   1.00 0.00 ? 133 ARG A HH22 4  
ATOM 8719  N N    . PRO A 1 134 ? -24.526 6.635   -6.720  1.00 0.00 ? 134 PRO A N    4  
ATOM 8720  C CA   . PRO A 1 134 ? -23.600 7.393   -7.569  1.00 0.00 ? 134 PRO A CA   4  
ATOM 8721  C C    . PRO A 1 134 ? -22.743 8.361   -6.748  1.00 0.00 ? 134 PRO A C    4  
ATOM 8722  O O    . PRO A 1 134 ? -23.018 8.592   -5.565  1.00 0.00 ? 134 PRO A O    4  
ATOM 8723  C CB   . PRO A 1 134 ? -24.525 8.167   -8.535  1.00 0.00 ? 134 PRO A CB   4  
ATOM 8724  C CG   . PRO A 1 134 ? -25.887 7.575   -8.343  1.00 0.00 ? 134 PRO A CG   4  
ATOM 8725  C CD   . PRO A 1 134 ? -25.917 7.059   -6.932  1.00 0.00 ? 134 PRO A CD   4  
ATOM 8726  H HA   . PRO A 1 134 ? -22.954 6.733   -8.131  1.00 0.00 ? 134 PRO A HA   4  
ATOM 8727  H HB2  . PRO A 1 134 ? -24.516 9.220   -8.286  1.00 0.00 ? 134 PRO A HB2  4  
ATOM 8728  H HB3  . PRO A 1 134 ? -24.179 8.033   -9.549  1.00 0.00 ? 134 PRO A HB3  4  
ATOM 8729  H HG2  . PRO A 1 134 ? -26.643 8.335   -8.482  1.00 0.00 ? 134 PRO A HG2  4  
ATOM 8730  H HG3  . PRO A 1 134 ? -26.038 6.764   -9.042  1.00 0.00 ? 134 PRO A HG3  4  
ATOM 8731  H HD2  . PRO A 1 134 ? -26.193 7.846   -6.242  1.00 0.00 ? 134 PRO A HD2  4  
ATOM 8732  H HD3  . PRO A 1 134 ? -26.596 6.223   -6.845  1.00 0.00 ? 134 PRO A HD3  4  
ATOM 8733  N N    . SER A 1 1   ? -16.300 -4.999  -10.345 1.00 0.00 ? 1   SER A N    5  
ATOM 8734  C CA   . SER A 1 1   ? -17.093 -6.241  -10.435 1.00 0.00 ? 1   SER A CA   5  
ATOM 8735  C C    . SER A 1 1   ? -18.198 -6.224  -9.381  1.00 0.00 ? 1   SER A C    5  
ATOM 8736  O O    . SER A 1 1   ? -18.052 -5.588  -8.335  1.00 0.00 ? 1   SER A O    5  
ATOM 8737  C CB   . SER A 1 1   ? -16.170 -7.451  -10.243 1.00 0.00 ? 1   SER A CB   5  
ATOM 8738  O OG   . SER A 1 1   ? -15.064 -7.388  -11.134 1.00 0.00 ? 1   SER A OG   5  
ATOM 8739  H H1   . SER A 1 1   ? -15.874 -4.918  -9.401  1.00 0.00 ? 1   SER A H1   5  
ATOM 8740  H H2   . SER A 1 1   ? -16.911 -4.176  -10.508 1.00 0.00 ? 1   SER A H2   5  
ATOM 8741  H H3   . SER A 1 1   ? -15.543 -5.007  -11.058 1.00 0.00 ? 1   SER A H3   5  
ATOM 8742  H HA   . SER A 1 1   ? -17.544 -6.287  -11.417 1.00 0.00 ? 1   SER A HA   5  
ATOM 8743  H HB2  . SER A 1 1   ? -15.799 -7.465  -9.227  1.00 0.00 ? 1   SER A HB2  5  
ATOM 8744  H HB3  . SER A 1 1   ? -16.721 -8.359  -10.438 1.00 0.00 ? 1   SER A HB3  5  
ATOM 8745  H HG   . SER A 1 1   ? -14.530 -8.188  -11.043 1.00 0.00 ? 1   SER A HG   5  
ATOM 8746  N N    . MET A 1 2   ? -19.308 -6.907  -9.659  1.00 0.00 ? 2   MET A N    5  
ATOM 8747  C CA   . MET A 1 2   ? -20.455 -6.904  -8.751  1.00 0.00 ? 2   MET A CA   5  
ATOM 8748  C C    . MET A 1 2   ? -20.219 -7.819  -7.546  1.00 0.00 ? 2   MET A C    5  
ATOM 8749  O O    . MET A 1 2   ? -20.825 -8.890  -7.425  1.00 0.00 ? 2   MET A O    5  
ATOM 8750  C CB   . MET A 1 2   ? -21.748 -7.297  -9.491  1.00 0.00 ? 2   MET A CB   5  
ATOM 8751  C CG   . MET A 1 2   ? -21.680 -8.637  -10.216 1.00 0.00 ? 2   MET A CG   5  
ATOM 8752  S SD   . MET A 1 2   ? -23.260 -9.119  -10.948 1.00 0.00 ? 2   MET A SD   5  
ATOM 8753  C CE   . MET A 1 2   ? -23.602 -7.697  -11.984 1.00 0.00 ? 2   MET A CE   5  
ATOM 8754  H H    . MET A 1 2   ? -19.356 -7.425  -10.494 1.00 0.00 ? 2   MET A H    5  
ATOM 8755  H HA   . MET A 1 2   ? -20.570 -5.891  -8.383  1.00 0.00 ? 2   MET A HA   5  
ATOM 8756  H HB2  . MET A 1 2   ? -22.559 -7.343  -8.777  1.00 0.00 ? 2   MET A HB2  5  
ATOM 8757  H HB3  . MET A 1 2   ? -21.974 -6.531  -10.220 1.00 0.00 ? 2   MET A HB3  5  
ATOM 8758  H HG2  . MET A 1 2   ? -20.942 -8.571  -11.002 1.00 0.00 ? 2   MET A HG2  5  
ATOM 8759  H HG3  . MET A 1 2   ? -21.380 -9.400  -9.511  1.00 0.00 ? 2   MET A HG3  5  
ATOM 8760  H HE1  . MET A 1 2   ? -22.800 -7.568  -12.697 1.00 0.00 ? 2   MET A HE1  5  
ATOM 8761  H HE2  . MET A 1 2   ? -23.682 -6.813  -11.369 1.00 0.00 ? 2   MET A HE2  5  
ATOM 8762  H HE3  . MET A 1 2   ? -24.529 -7.855  -12.514 1.00 0.00 ? 2   MET A HE3  5  
ATOM 8763  N N    . VAL A 1 3   ? -19.322 -7.397  -6.660  1.00 0.00 ? 3   VAL A N    5  
ATOM 8764  C CA   . VAL A 1 3   ? -19.068 -8.121  -5.422  1.00 0.00 ? 3   VAL A CA   5  
ATOM 8765  C C    . VAL A 1 3   ? -20.333 -8.149  -4.566  1.00 0.00 ? 3   VAL A C    5  
ATOM 8766  O O    . VAL A 1 3   ? -20.907 -7.103  -4.254  1.00 0.00 ? 3   VAL A O    5  
ATOM 8767  C CB   . VAL A 1 3   ? -17.897 -7.501  -4.613  1.00 0.00 ? 3   VAL A CB   5  
ATOM 8768  C CG1  . VAL A 1 3   ? -18.098 -5.997  -4.420  1.00 0.00 ? 3   VAL A CG1  5  
ATOM 8769  C CG2  . VAL A 1 3   ? -17.742 -8.205  -3.265  1.00 0.00 ? 3   VAL A CG2  5  
ATOM 8770  H H    . VAL A 1 3   ? -18.819 -6.575  -6.845  1.00 0.00 ? 3   VAL A H    5  
ATOM 8771  H HA   . VAL A 1 3   ? -18.799 -9.138  -5.683  1.00 0.00 ? 3   VAL A HA   5  
ATOM 8772  H HB   . VAL A 1 3   ? -16.980 -7.647  -5.173  1.00 0.00 ? 3   VAL A HB   5  
ATOM 8773  H HG11 . VAL A 1 3   ? -19.011 -5.821  -3.869  1.00 0.00 ? 3   VAL A HG11 5  
ATOM 8774  H HG12 . VAL A 1 3   ? -18.163 -5.513  -5.383  1.00 0.00 ? 3   VAL A HG12 5  
ATOM 8775  H HG13 . VAL A 1 3   ? -17.262 -5.587  -3.870  1.00 0.00 ? 3   VAL A HG13 5  
ATOM 8776  H HG21 . VAL A 1 3   ? -16.918 -7.767  -2.721  1.00 0.00 ? 3   VAL A HG21 5  
ATOM 8777  H HG22 . VAL A 1 3   ? -17.550 -9.256  -3.425  1.00 0.00 ? 3   VAL A HG22 5  
ATOM 8778  H HG23 . VAL A 1 3   ? -18.652 -8.090  -2.691  1.00 0.00 ? 3   VAL A HG23 5  
ATOM 8779  N N    . SER A 1 4   ? -20.782 -9.347  -4.220  1.00 0.00 ? 4   SER A N    5  
ATOM 8780  C CA   . SER A 1 4   ? -21.970 -9.511  -3.398  1.00 0.00 ? 4   SER A CA   5  
ATOM 8781  C C    . SER A 1 4   ? -21.752 -8.869  -2.022  1.00 0.00 ? 4   SER A C    5  
ATOM 8782  O O    . SER A 1 4   ? -20.683 -9.028  -1.426  1.00 0.00 ? 4   SER A O    5  
ATOM 8783  C CB   . SER A 1 4   ? -22.295 -11.002 -3.260  1.00 0.00 ? 4   SER A CB   5  
ATOM 8784  O OG   . SER A 1 4   ? -22.374 -11.621 -4.538  1.00 0.00 ? 4   SER A OG   5  
ATOM 8785  H H    . SER A 1 4   ? -20.300 -10.143 -4.523  1.00 0.00 ? 4   SER A H    5  
ATOM 8786  H HA   . SER A 1 4   ? -22.791 -9.016  -3.897  1.00 0.00 ? 4   SER A HA   5  
ATOM 8787  H HB2  . SER A 1 4   ? -21.519 -11.489 -2.687  1.00 0.00 ? 4   SER A HB2  5  
ATOM 8788  H HB3  . SER A 1 4   ? -23.242 -11.121 -2.758  1.00 0.00 ? 4   SER A HB3  5  
ATOM 8789  H HG   . SER A 1 4   ? -23.154 -12.192 -4.566  1.00 0.00 ? 4   SER A HG   5  
ATOM 8790  N N    . PRO A 1 5   ? -22.757 -8.123  -1.504  1.00 0.00 ? 5   PRO A N    5  
ATOM 8791  C CA   . PRO A 1 5   ? -22.658 -7.424  -0.215  1.00 0.00 ? 5   PRO A CA   5  
ATOM 8792  C C    . PRO A 1 5   ? -22.156 -8.335  0.907   1.00 0.00 ? 5   PRO A C    5  
ATOM 8793  O O    . PRO A 1 5   ? -21.557 -7.866  1.874   1.00 0.00 ? 5   PRO A O    5  
ATOM 8794  C CB   . PRO A 1 5   ? -24.096 -6.940  0.064   1.00 0.00 ? 5   PRO A CB   5  
ATOM 8795  C CG   . PRO A 1 5   ? -24.956 -7.615  -0.957  1.00 0.00 ? 5   PRO A CG   5  
ATOM 8796  C CD   . PRO A 1 5   ? -24.066 -7.892  -2.134  1.00 0.00 ? 5   PRO A CD   5  
ATOM 8797  H HA   . PRO A 1 5   ? -21.999 -6.570  -0.290  1.00 0.00 ? 5   PRO A HA   5  
ATOM 8798  H HB2  . PRO A 1 5   ? -24.389 -7.216  1.068   1.00 0.00 ? 5   PRO A HB2  5  
ATOM 8799  H HB3  . PRO A 1 5   ? -24.140 -5.863  -0.039  1.00 0.00 ? 5   PRO A HB3  5  
ATOM 8800  H HG2  . PRO A 1 5   ? -25.347 -8.541  -0.556  1.00 0.00 ? 5   PRO A HG2  5  
ATOM 8801  H HG3  . PRO A 1 5   ? -25.768 -6.962  -1.246  1.00 0.00 ? 5   PRO A HG3  5  
ATOM 8802  H HD2  . PRO A 1 5   ? -24.402 -8.771  -2.668  1.00 0.00 ? 5   PRO A HD2  5  
ATOM 8803  H HD3  . PRO A 1 5   ? -24.029 -7.038  -2.796  1.00 0.00 ? 5   PRO A HD3  5  
ATOM 8804  N N    . GLU A 1 6   ? -22.403 -9.636  0.764   1.00 0.00 ? 6   GLU A N    5  
ATOM 8805  C CA   . GLU A 1 6   ? -21.911 -10.629 1.715   1.00 0.00 ? 6   GLU A CA   5  
ATOM 8806  C C    . GLU A 1 6   ? -20.380 -10.565 1.802   1.00 0.00 ? 6   GLU A C    5  
ATOM 8807  O O    . GLU A 1 6   ? -19.817 -10.329 2.870   1.00 0.00 ? 6   GLU A O    5  
ATOM 8808  C CB   . GLU A 1 6   ? -22.377 -12.028 1.287   1.00 0.00 ? 6   GLU A CB   5  
ATOM 8809  C CG   . GLU A 1 6   ? -22.129 -13.120 2.321   1.00 0.00 ? 6   GLU A CG   5  
ATOM 8810  C CD   . GLU A 1 6   ? -22.682 -14.471 1.886   1.00 0.00 ? 6   GLU A CD   5  
ATOM 8811  O OE1  . GLU A 1 6   ? -23.922 -14.637 1.868   1.00 0.00 ? 6   GLU A OE1  5  
ATOM 8812  O OE2  . GLU A 1 6   ? -21.885 -15.374 1.561   1.00 0.00 ? 6   GLU A OE2  5  
ATOM 8813  H H    . GLU A 1 6   ? -22.938 -9.936  -0.002  1.00 0.00 ? 6   GLU A H    5  
ATOM 8814  H HA   . GLU A 1 6   ? -22.329 -10.397 2.685   1.00 0.00 ? 6   GLU A HA   5  
ATOM 8815  H HB2  . GLU A 1 6   ? -23.439 -11.991 1.087   1.00 0.00 ? 6   GLU A HB2  5  
ATOM 8816  H HB3  . GLU A 1 6   ? -21.862 -12.302 0.376   1.00 0.00 ? 6   GLU A HB3  5  
ATOM 8817  H HG2  . GLU A 1 6   ? -21.064 -13.213 2.481   1.00 0.00 ? 6   GLU A HG2  5  
ATOM 8818  H HG3  . GLU A 1 6   ? -22.605 -12.834 3.250   1.00 0.00 ? 6   GLU A HG3  5  
ATOM 8819  N N    . GLU A 1 7   ? -19.715 -10.753 0.667   1.00 0.00 ? 7   GLU A N    5  
ATOM 8820  C CA   . GLU A 1 7   ? -18.258 -10.629 0.590   1.00 0.00 ? 7   GLU A CA   5  
ATOM 8821  C C    . GLU A 1 7   ? -17.824 -9.221  1.012   1.00 0.00 ? 7   GLU A C    5  
ATOM 8822  O O    . GLU A 1 7   ? -16.801 -9.039  1.673   1.00 0.00 ? 7   GLU A O    5  
ATOM 8823  C CB   . GLU A 1 7   ? -17.786 -10.913 -0.844  1.00 0.00 ? 7   GLU A CB   5  
ATOM 8824  C CG   . GLU A 1 7   ? -16.269 -10.918 -1.023  1.00 0.00 ? 7   GLU A CG   5  
ATOM 8825  C CD   . GLU A 1 7   ? -15.597 -12.101 -0.346  1.00 0.00 ? 7   GLU A CD   5  
ATOM 8826  O OE1  . GLU A 1 7   ? -15.654 -13.218 -0.903  1.00 0.00 ? 7   GLU A OE1  5  
ATOM 8827  O OE2  . GLU A 1 7   ? -15.002 -11.925 0.736   1.00 0.00 ? 7   GLU A OE2  5  
ATOM 8828  H H    . GLU A 1 7   ? -20.213 -10.988 -0.142  1.00 0.00 ? 7   GLU A H    5  
ATOM 8829  H HA   . GLU A 1 7   ? -17.820 -11.353 1.264   1.00 0.00 ? 7   GLU A HA   5  
ATOM 8830  H HB2  . GLU A 1 7   ? -18.162 -11.881 -1.147  1.00 0.00 ? 7   GLU A HB2  5  
ATOM 8831  H HB3  . GLU A 1 7   ? -18.201 -10.161 -1.501  1.00 0.00 ? 7   GLU A HB3  5  
ATOM 8832  H HG2  . GLU A 1 7   ? -16.046 -10.953 -2.080  1.00 0.00 ? 7   GLU A HG2  5  
ATOM 8833  H HG3  . GLU A 1 7   ? -15.869 -10.003 -0.606  1.00 0.00 ? 7   GLU A HG3  5  
ATOM 8834  N N    . ALA A 1 8   ? -18.631 -8.230  0.635   1.00 0.00 ? 8   ALA A N    5  
ATOM 8835  C CA   . ALA A 1 8   ? -18.326 -6.832  0.918   1.00 0.00 ? 8   ALA A CA   5  
ATOM 8836  C C    . ALA A 1 8   ? -18.271 -6.559  2.424   1.00 0.00 ? 8   ALA A C    5  
ATOM 8837  O O    . ALA A 1 8   ? -17.407 -5.816  2.890   1.00 0.00 ? 8   ALA A O    5  
ATOM 8838  C CB   . ALA A 1 8   ? -19.337 -5.920  0.231   1.00 0.00 ? 8   ALA A CB   5  
ATOM 8839  H H    . ALA A 1 8   ? -19.453 -8.450  0.146   1.00 0.00 ? 8   ALA A H    5  
ATOM 8840  H HA   . ALA A 1 8   ? -17.352 -6.620  0.496   1.00 0.00 ? 8   ALA A HA   5  
ATOM 8841  H HB1  . ALA A 1 8   ? -19.353 -6.130  -0.828  1.00 0.00 ? 8   ALA A HB1  5  
ATOM 8842  H HB2  . ALA A 1 8   ? -19.060 -4.888  0.387   1.00 0.00 ? 8   ALA A HB2  5  
ATOM 8843  H HB3  . ALA A 1 8   ? -20.321 -6.093  0.646   1.00 0.00 ? 8   ALA A HB3  5  
ATOM 8844  N N    . VAL A 1 9   ? -19.182 -7.163  3.194   1.00 0.00 ? 9   VAL A N    5  
ATOM 8845  C CA   . VAL A 1 9   ? -19.166 -6.985  4.648   1.00 0.00 ? 9   VAL A CA   5  
ATOM 8846  C C    . VAL A 1 9   ? -17.988 -7.739  5.260   1.00 0.00 ? 9   VAL A C    5  
ATOM 8847  O O    . VAL A 1 9   ? -17.484 -7.362  6.319   1.00 0.00 ? 9   VAL A O    5  
ATOM 8848  C CB   . VAL A 1 9   ? -20.487 -7.422  5.346   1.00 0.00 ? 9   VAL A CB   5  
ATOM 8849  C CG1  . VAL A 1 9   ? -21.680 -6.646  4.795   1.00 0.00 ? 9   VAL A CG1  5  
ATOM 8850  C CG2  . VAL A 1 9   ? -20.716 -8.925  5.230   1.00 0.00 ? 9   VAL A CG2  5  
ATOM 8851  H H    . VAL A 1 9   ? -19.865 -7.736  2.782   1.00 0.00 ? 9   VAL A H    5  
ATOM 8852  H HA   . VAL A 1 9   ? -19.024 -5.928  4.839   1.00 0.00 ? 9   VAL A HA   5  
ATOM 8853  H HB   . VAL A 1 9   ? -20.397 -7.180  6.398   1.00 0.00 ? 9   VAL A HB   5  
ATOM 8854  H HG11 . VAL A 1 9   ? -22.580 -6.953  5.310   1.00 0.00 ? 9   VAL A HG11 5  
ATOM 8855  H HG12 . VAL A 1 9   ? -21.786 -6.845  3.738   1.00 0.00 ? 9   VAL A HG12 5  
ATOM 8856  H HG13 . VAL A 1 9   ? -21.524 -5.587  4.946   1.00 0.00 ? 9   VAL A HG13 5  
ATOM 8857  H HG21 . VAL A 1 9   ? -20.831 -9.193  4.191   1.00 0.00 ? 9   VAL A HG21 5  
ATOM 8858  H HG22 . VAL A 1 9   ? -21.611 -9.196  5.771   1.00 0.00 ? 9   VAL A HG22 5  
ATOM 8859  H HG23 . VAL A 1 9   ? -19.871 -9.454  5.647   1.00 0.00 ? 9   VAL A HG23 5  
ATOM 8860  N N    . LYS A 1 10  ? -17.543 -8.801  4.583   1.00 0.00 ? 10  LYS A N    5  
ATOM 8861  C CA   . LYS A 1 10  ? -16.350 -9.532  5.011   1.00 0.00 ? 10  LYS A CA   5  
ATOM 8862  C C    . LYS A 1 10  ? -15.136 -8.606  4.931   1.00 0.00 ? 10  LYS A C    5  
ATOM 8863  O O    . LYS A 1 10  ? -14.258 -8.631  5.790   1.00 0.00 ? 10  LYS A O    5  
ATOM 8864  C CB   . LYS A 1 10  ? -16.118 -10.781 4.141   1.00 0.00 ? 10  LYS A CB   5  
ATOM 8865  C CG   . LYS A 1 10  ? -17.342 -11.685 3.998   1.00 0.00 ? 10  LYS A CG   5  
ATOM 8866  C CD   . LYS A 1 10  ? -17.881 -12.160 5.346   1.00 0.00 ? 10  LYS A CD   5  
ATOM 8867  C CE   . LYS A 1 10  ? -16.896 -13.074 6.059   1.00 0.00 ? 10  LYS A CE   5  
ATOM 8868  N NZ   . LYS A 1 10  ? -16.637 -14.321 5.294   1.00 0.00 ? 10  LYS A NZ   5  
ATOM 8869  H H    . LYS A 1 10  ? -18.032 -9.102  3.784   1.00 0.00 ? 10  LYS A H    5  
ATOM 8870  H HA   . LYS A 1 10  ? -16.493 -9.834  6.040   1.00 0.00 ? 10  LYS A HA   5  
ATOM 8871  H HB2  . LYS A 1 10  ? -15.821 -10.464 3.151   1.00 0.00 ? 10  LYS A HB2  5  
ATOM 8872  H HB3  . LYS A 1 10  ? -15.315 -11.363 4.574   1.00 0.00 ? 10  LYS A HB3  5  
ATOM 8873  H HG2  . LYS A 1 10  ? -18.119 -11.136 3.490   1.00 0.00 ? 10  LYS A HG2  5  
ATOM 8874  H HG3  . LYS A 1 10  ? -17.071 -12.549 3.405   1.00 0.00 ? 10  LYS A HG3  5  
ATOM 8875  H HD2  . LYS A 1 10  ? -18.074 -11.300 5.970   1.00 0.00 ? 10  LYS A HD2  5  
ATOM 8876  H HD3  . LYS A 1 10  ? -18.804 -12.699 5.182   1.00 0.00 ? 10  LYS A HD3  5  
ATOM 8877  H HE2  . LYS A 1 10  ? -15.964 -12.545 6.185   1.00 0.00 ? 10  LYS A HE2  5  
ATOM 8878  H HE3  . LYS A 1 10  ? -17.299 -13.333 7.027   1.00 0.00 ? 10  LYS A HE3  5  
ATOM 8879  H HZ1  . LYS A 1 10  ? -16.152 -14.102 4.403   1.00 0.00 ? 10  LYS A HZ1  5  
ATOM 8880  H HZ2  . LYS A 1 10  ? -17.533 -14.802 5.075   1.00 0.00 ? 10  LYS A HZ2  5  
ATOM 8881  H HZ3  . LYS A 1 10  ? -16.042 -14.968 5.850   1.00 0.00 ? 10  LYS A HZ3  5  
ATOM 8882  N N    . TRP A 1 11  ? -15.112 -7.773  3.892   1.00 0.00 ? 11  TRP A N    5  
ATOM 8883  C CA   . TRP A 1 11  ? -14.062 -6.771  3.720   1.00 0.00 ? 11  TRP A CA   5  
ATOM 8884  C C    . TRP A 1 11  ? -14.063 -5.784  4.887   1.00 0.00 ? 11  TRP A C    5  
ATOM 8885  O O    . TRP A 1 11  ? -13.019 -5.246  5.269   1.00 0.00 ? 11  TRP A O    5  
ATOM 8886  C CB   . TRP A 1 11  ? -14.261 -6.013  2.400   1.00 0.00 ? 11  TRP A CB   5  
ATOM 8887  C CG   . TRP A 1 11  ? -14.086 -6.861  1.175   1.00 0.00 ? 11  TRP A CG   5  
ATOM 8888  C CD1  . TRP A 1 11  ? -13.560 -8.120  1.112   1.00 0.00 ? 11  TRP A CD1  5  
ATOM 8889  C CD2  . TRP A 1 11  ? -14.418 -6.496  -0.171  1.00 0.00 ? 11  TRP A CD2  5  
ATOM 8890  N NE1  . TRP A 1 11  ? -13.541 -8.556  -0.188  1.00 0.00 ? 11  TRP A NE1  5  
ATOM 8891  C CE2  . TRP A 1 11  ? -14.063 -7.578  -0.995  1.00 0.00 ? 11  TRP A CE2  5  
ATOM 8892  C CE3  . TRP A 1 11  ? -14.980 -5.357  -0.755  1.00 0.00 ? 11  TRP A CE3  5  
ATOM 8893  C CZ2  . TRP A 1 11  ? -14.248 -7.554  -2.374  1.00 0.00 ? 11  TRP A CZ2  5  
ATOM 8894  C CZ3  . TRP A 1 11  ? -15.164 -5.334  -2.125  1.00 0.00 ? 11  TRP A CZ3  5  
ATOM 8895  C CH2  . TRP A 1 11  ? -14.798 -6.426  -2.921  1.00 0.00 ? 11  TRP A CH2  5  
ATOM 8896  H H    . TRP A 1 11  ? -15.821 -7.840  3.214   1.00 0.00 ? 11  TRP A H    5  
ATOM 8897  H HA   . TRP A 1 11  ? -13.109 -7.283  3.695   1.00 0.00 ? 11  TRP A HA   5  
ATOM 8898  H HB2  . TRP A 1 11  ? -15.260 -5.603  2.376   1.00 0.00 ? 11  TRP A HB2  5  
ATOM 8899  H HB3  . TRP A 1 11  ? -13.546 -5.204  2.347   1.00 0.00 ? 11  TRP A HB3  5  
ATOM 8900  H HD1  . TRP A 1 11  ? -13.209 -8.678  1.968   1.00 0.00 ? 11  TRP A HD1  5  
ATOM 8901  H HE1  . TRP A 1 11  ? -13.208 -9.429  -0.488  1.00 0.00 ? 11  TRP A HE1  5  
ATOM 8902  H HE3  . TRP A 1 11  ? -15.269 -4.506  -0.155  1.00 0.00 ? 11  TRP A HE3  5  
ATOM 8903  H HZ2  . TRP A 1 11  ? -13.972 -8.388  -3.003  1.00 0.00 ? 11  TRP A HZ2  5  
ATOM 8904  H HZ3  . TRP A 1 11  ? -15.592 -4.460  -2.597  1.00 0.00 ? 11  TRP A HZ3  5  
ATOM 8905  H HH2  . TRP A 1 11  ? -14.958 -6.365  -3.988  1.00 0.00 ? 11  TRP A HH2  5  
ATOM 8906  N N    . GLY A 1 12  ? -15.242 -5.575  5.462   1.00 0.00 ? 12  GLY A N    5  
ATOM 8907  C CA   . GLY A 1 12  ? -15.406 -4.605  6.529   1.00 0.00 ? 12  GLY A CA   5  
ATOM 8908  C C    . GLY A 1 12  ? -14.838 -5.062  7.864   1.00 0.00 ? 12  GLY A C    5  
ATOM 8909  O O    . GLY A 1 12  ? -15.039 -4.395  8.882   1.00 0.00 ? 12  GLY A O    5  
ATOM 8910  H H    . GLY A 1 12  ? -16.019 -6.087  5.153   1.00 0.00 ? 12  GLY A H    5  
ATOM 8911  H HA2  . GLY A 1 12  ? -14.916 -3.685  6.241   1.00 0.00 ? 12  GLY A HA2  5  
ATOM 8912  H HA3  . GLY A 1 12  ? -16.461 -4.407  6.654   1.00 0.00 ? 12  GLY A HA3  5  
ATOM 8913  N N    . GLU A 1 13  ? -14.144 -6.201  7.880   1.00 0.00 ? 13  GLU A N    5  
ATOM 8914  C CA   . GLU A 1 13  ? -13.493 -6.682  9.100   1.00 0.00 ? 13  GLU A CA   5  
ATOM 8915  C C    . GLU A 1 13  ? -12.048 -7.107  8.827   1.00 0.00 ? 13  GLU A C    5  
ATOM 8916  O O    . GLU A 1 13  ? -11.399 -7.717  9.682   1.00 0.00 ? 13  GLU A O    5  
ATOM 8917  C CB   . GLU A 1 13  ? -14.317 -7.819  9.742   1.00 0.00 ? 13  GLU A CB   5  
ATOM 8918  C CG   . GLU A 1 13  ? -14.576 -9.034  8.847   1.00 0.00 ? 13  GLU A CG   5  
ATOM 8919  C CD   . GLU A 1 13  ? -13.484 -10.090 8.929   1.00 0.00 ? 13  GLU A CD   5  
ATOM 8920  O OE1  . GLU A 1 13  ? -13.424 -10.812 9.949   1.00 0.00 ? 13  GLU A OE1  5  
ATOM 8921  O OE2  . GLU A 1 13  ? -12.690 -10.223 7.978   1.00 0.00 ? 13  GLU A OE2  5  
ATOM 8922  H H    . GLU A 1 13  ? -14.079 -6.737  7.061   1.00 0.00 ? 13  GLU A H    5  
ATOM 8923  H HA   . GLU A 1 13  ? -13.462 -5.851  9.795   1.00 0.00 ? 13  GLU A HA   5  
ATOM 8924  H HB2  . GLU A 1 13  ? -13.801 -8.160  10.628  1.00 0.00 ? 13  GLU A HB2  5  
ATOM 8925  H HB3  . GLU A 1 13  ? -15.275 -7.414  10.040  1.00 0.00 ? 13  GLU A HB3  5  
ATOM 8926  H HG2  . GLU A 1 13  ? -15.510 -9.488  9.144   1.00 0.00 ? 13  GLU A HG2  5  
ATOM 8927  H HG3  . GLU A 1 13  ? -14.658 -8.697  7.822   1.00 0.00 ? 13  GLU A HG3  5  
ATOM 8928  N N    . SER A 1 14  ? -11.541 -6.754  7.644   1.00 0.00 ? 14  SER A N    5  
ATOM 8929  C CA   . SER A 1 14  ? -10.153 -7.037  7.282   1.00 0.00 ? 14  SER A CA   5  
ATOM 8930  C C    . SER A 1 14  ? -9.769  -6.338  5.976   1.00 0.00 ? 14  SER A C    5  
ATOM 8931  O O    . SER A 1 14  ? -10.094 -6.814  4.881   1.00 0.00 ? 14  SER A O    5  
ATOM 8932  C CB   . SER A 1 14  ? -9.921  -8.549  7.160   1.00 0.00 ? 14  SER A CB   5  
ATOM 8933  O OG   . SER A 1 14  ? -8.586  -8.841  6.773   1.00 0.00 ? 14  SER A OG   5  
ATOM 8934  H H    . SER A 1 14  ? -12.115 -6.293  6.997   1.00 0.00 ? 14  SER A H    5  
ATOM 8935  H HA   . SER A 1 14  ? -9.524  -6.653  8.075   1.00 0.00 ? 14  SER A HA   5  
ATOM 8936  H HB2  . SER A 1 14  ? -10.112 -9.019  8.113   1.00 0.00 ? 14  SER A HB2  5  
ATOM 8937  H HB3  . SER A 1 14  ? -10.593 -8.958  6.418   1.00 0.00 ? 14  SER A HB3  5  
ATOM 8938  H HG   . SER A 1 14  ? -8.209  -9.484  7.386   1.00 0.00 ? 14  SER A HG   5  
ATOM 8939  N N    . PHE A 1 15  ? -9.067  -5.209  6.099   1.00 0.00 ? 15  PHE A N    5  
ATOM 8940  C CA   . PHE A 1 15  ? -8.565  -4.475  4.936   1.00 0.00 ? 15  PHE A CA   5  
ATOM 8941  C C    . PHE A 1 15  ? -7.719  -5.392  4.053   1.00 0.00 ? 15  PHE A C    5  
ATOM 8942  O O    . PHE A 1 15  ? -7.654  -5.217  2.834   1.00 0.00 ? 15  PHE A O    5  
ATOM 8943  C CB   . PHE A 1 15  ? -7.738  -3.259  5.390   1.00 0.00 ? 15  PHE A CB   5  
ATOM 8944  C CG   . PHE A 1 15  ? -7.083  -2.496  4.260   1.00 0.00 ? 15  PHE A CG   5  
ATOM 8945  C CD1  . PHE A 1 15  ? -7.843  -1.969  3.228   1.00 0.00 ? 15  PHE A CD1  5  
ATOM 8946  C CD2  . PHE A 1 15  ? -5.708  -2.306  4.235   1.00 0.00 ? 15  PHE A CD2  5  
ATOM 8947  C CE1  . PHE A 1 15  ? -7.249  -1.272  2.195   1.00 0.00 ? 15  PHE A CE1  5  
ATOM 8948  C CE2  . PHE A 1 15  ? -5.110  -1.608  3.202   1.00 0.00 ? 15  PHE A CE2  5  
ATOM 8949  C CZ   . PHE A 1 15  ? -5.882  -1.091  2.182   1.00 0.00 ? 15  PHE A CZ   5  
ATOM 8950  H H    . PHE A 1 15  ? -8.879  -4.860  6.998   1.00 0.00 ? 15  PHE A H    5  
ATOM 8951  H HA   . PHE A 1 15  ? -9.419  -4.131  4.367   1.00 0.00 ? 15  PHE A HA   5  
ATOM 8952  H HB2  . PHE A 1 15  ? -8.385  -2.573  5.918   1.00 0.00 ? 15  PHE A HB2  5  
ATOM 8953  H HB3  . PHE A 1 15  ? -6.961  -3.595  6.063   1.00 0.00 ? 15  PHE A HB3  5  
ATOM 8954  H HD1  . PHE A 1 15  ? -8.912  -2.107  3.237   1.00 0.00 ? 15  PHE A HD1  5  
ATOM 8955  H HD2  . PHE A 1 15  ? -5.101  -2.709  5.033   1.00 0.00 ? 15  PHE A HD2  5  
ATOM 8956  H HE1  . PHE A 1 15  ? -7.854  -0.868  1.396   1.00 0.00 ? 15  PHE A HE1  5  
ATOM 8957  H HE2  . PHE A 1 15  ? -4.037  -1.467  3.193   1.00 0.00 ? 15  PHE A HE2  5  
ATOM 8958  H HZ   . PHE A 1 15  ? -5.415  -0.545  1.374   1.00 0.00 ? 15  PHE A HZ   5  
ATOM 8959  N N    . ASP A 1 16  ? -7.094  -6.381  4.687   1.00 0.00 ? 16  ASP A N    5  
ATOM 8960  C CA   . ASP A 1 16  ? -6.244  -7.335  3.988   1.00 0.00 ? 16  ASP A CA   5  
ATOM 8961  C C    . ASP A 1 16  ? -7.018  -8.052  2.887   1.00 0.00 ? 16  ASP A C    5  
ATOM 8962  O O    . ASP A 1 16  ? -6.594  -8.062  1.733   1.00 0.00 ? 16  ASP A O    5  
ATOM 8963  C CB   . ASP A 1 16  ? -5.667  -8.363  4.971   1.00 0.00 ? 16  ASP A CB   5  
ATOM 8964  C CG   . ASP A 1 16  ? -4.729  -9.358  4.298   1.00 0.00 ? 16  ASP A CG   5  
ATOM 8965  O OD1  . ASP A 1 16  ? -3.518  -9.065  4.193   1.00 0.00 ? 16  ASP A OD1  5  
ATOM 8966  O OD2  . ASP A 1 16  ? -5.191  -10.441 3.882   1.00 0.00 ? 16  ASP A OD2  5  
ATOM 8967  H H    . ASP A 1 16  ? -7.210  -6.471  5.654   1.00 0.00 ? 16  ASP A H    5  
ATOM 8968  H HA   . ASP A 1 16  ? -5.428  -6.784  3.539   1.00 0.00 ? 16  ASP A HA   5  
ATOM 8969  H HB2  . ASP A 1 16  ? -5.117  -7.843  5.743   1.00 0.00 ? 16  ASP A HB2  5  
ATOM 8970  H HB3  . ASP A 1 16  ? -6.480  -8.912  5.428   1.00 0.00 ? 16  ASP A HB3  5  
ATOM 8971  N N    . LYS A 1 17  ? -8.172  -8.622  3.237   1.00 0.00 ? 17  LYS A N    5  
ATOM 8972  C CA   . LYS A 1 17  ? -8.934  -9.429  2.281   1.00 0.00 ? 17  LYS A CA   5  
ATOM 8973  C C    . LYS A 1 17  ? -9.623  -8.536  1.258   1.00 0.00 ? 17  LYS A C    5  
ATOM 8974  O O    . LYS A 1 17  ? -9.855  -8.951  0.120   1.00 0.00 ? 17  LYS A O    5  
ATOM 8975  C CB   . LYS A 1 17  ? -9.952  -10.329 2.994   1.00 0.00 ? 17  LYS A CB   5  
ATOM 8976  C CG   . LYS A 1 17  ? -11.021 -9.579  3.778   1.00 0.00 ? 17  LYS A CG   5  
ATOM 8977  C CD   . LYS A 1 17  ? -11.973 -10.535 4.491   1.00 0.00 ? 17  LYS A CD   5  
ATOM 8978  C CE   . LYS A 1 17  ? -11.227 -11.493 5.418   1.00 0.00 ? 17  LYS A CE   5  
ATOM 8979  N NZ   . LYS A 1 17  ? -12.152 -12.351 6.198   1.00 0.00 ? 17  LYS A NZ   5  
ATOM 8980  H H    . LYS A 1 17  ? -8.527  -8.478  4.144   1.00 0.00 ? 17  LYS A H    5  
ATOM 8981  H HA   . LYS A 1 17  ? -8.228  -10.059 1.756   1.00 0.00 ? 17  LYS A HA   5  
ATOM 8982  H HB2  . LYS A 1 17  ? -10.448 -10.942 2.254   1.00 0.00 ? 17  LYS A HB2  5  
ATOM 8983  H HB3  . LYS A 1 17  ? -9.420  -10.974 3.678   1.00 0.00 ? 17  LYS A HB3  5  
ATOM 8984  H HG2  . LYS A 1 17  ? -10.541 -8.949  4.514   1.00 0.00 ? 17  LYS A HG2  5  
ATOM 8985  H HG3  . LYS A 1 17  ? -11.590 -8.963  3.095   1.00 0.00 ? 17  LYS A HG3  5  
ATOM 8986  H HD2  . LYS A 1 17  ? -12.674 -9.959  5.077   1.00 0.00 ? 17  LYS A HD2  5  
ATOM 8987  H HD3  . LYS A 1 17  ? -12.511 -11.111 3.750   1.00 0.00 ? 17  LYS A HD3  5  
ATOM 8988  H HE2  . LYS A 1 17  ? -10.585 -12.126 4.821   1.00 0.00 ? 17  LYS A HE2  5  
ATOM 8989  H HE3  . LYS A 1 17  ? -10.623 -10.915 6.103   1.00 0.00 ? 17  LYS A HE3  5  
ATOM 8990  H HZ1  . LYS A 1 17  ? -12.820 -12.831 5.563   1.00 0.00 ? 17  LYS A HZ1  5  
ATOM 8991  H HZ2  . LYS A 1 17  ? -12.689 -11.774 6.879   1.00 0.00 ? 17  LYS A HZ2  5  
ATOM 8992  H HZ3  . LYS A 1 17  ? -11.616 -13.073 6.727   1.00 0.00 ? 17  LYS A HZ3  5  
ATOM 8993  N N    . LEU A 1 18  ? -9.939  -7.309  1.670   1.00 0.00 ? 18  LEU A N    5  
ATOM 8994  C CA   . LEU A 1 18  ? -10.483 -6.303  0.760   1.00 0.00 ? 18  LEU A CA   5  
ATOM 8995  C C    . LEU A 1 18  ? -9.525  -6.080  -0.404  1.00 0.00 ? 18  LEU A C    5  
ATOM 8996  O O    . LEU A 1 18  ? -9.911  -6.158  -1.570  1.00 0.00 ? 18  LEU A O    5  
ATOM 8997  C CB   . LEU A 1 18  ? -10.724 -4.976  1.509   1.00 0.00 ? 18  LEU A CB   5  
ATOM 8998  C CG   . LEU A 1 18  ? -10.919 -3.723  0.628   1.00 0.00 ? 18  LEU A CG   5  
ATOM 8999  C CD1  . LEU A 1 18  ? -12.098 -3.885  -0.324  1.00 0.00 ? 18  LEU A CD1  5  
ATOM 9000  C CD2  . LEU A 1 18  ? -11.103 -2.478  1.493   1.00 0.00 ? 18  LEU A CD2  5  
ATOM 9001  H H    . LEU A 1 18  ? -9.799  -7.074  2.613   1.00 0.00 ? 18  LEU A H    5  
ATOM 9002  H HA   . LEU A 1 18  ? -11.424 -6.671  0.376   1.00 0.00 ? 18  LEU A HA   5  
ATOM 9003  H HB2  . LEU A 1 18  ? -11.604 -5.095  2.127   1.00 0.00 ? 18  LEU A HB2  5  
ATOM 9004  H HB3  . LEU A 1 18  ? -9.877  -4.801  2.159   1.00 0.00 ? 18  LEU A HB3  5  
ATOM 9005  H HG   . LEU A 1 18  ? -10.033 -3.578  0.026   1.00 0.00 ? 18  LEU A HG   5  
ATOM 9006  H HD11 . LEU A 1 18  ? -11.933 -4.742  -0.960  1.00 0.00 ? 18  LEU A HD11 5  
ATOM 9007  H HD12 . LEU A 1 18  ? -12.195 -2.999  -0.935  1.00 0.00 ? 18  LEU A HD12 5  
ATOM 9008  H HD13 . LEU A 1 18  ? -13.006 -4.030  0.246   1.00 0.00 ? 18  LEU A HD13 5  
ATOM 9009  H HD21 . LEU A 1 18  ? -11.214 -1.610  0.861   1.00 0.00 ? 18  LEU A HD21 5  
ATOM 9010  H HD22 . LEU A 1 18  ? -10.241 -2.351  2.126   1.00 0.00 ? 18  LEU A HD22 5  
ATOM 9011  H HD23 . LEU A 1 18  ? -11.987 -2.590  2.108   1.00 0.00 ? 18  LEU A HD23 5  
ATOM 9012  N N    . LEU A 1 19  ? -8.268  -5.832  -0.069  1.00 0.00 ? 19  LEU A N    5  
ATOM 9013  C CA   . LEU A 1 19  ? -7.260  -5.504  -1.065  1.00 0.00 ? 19  LEU A CA   5  
ATOM 9014  C C    . LEU A 1 19  ? -6.695  -6.774  -1.706  1.00 0.00 ? 19  LEU A C    5  
ATOM 9015  O O    . LEU A 1 19  ? -6.166  -6.738  -2.818  1.00 0.00 ? 19  LEU A O    5  
ATOM 9016  C CB   . LEU A 1 19  ? -6.147  -4.674  -0.413  1.00 0.00 ? 19  LEU A CB   5  
ATOM 9017  C CG   . LEU A 1 19  ? -5.244  -3.911  -1.389  1.00 0.00 ? 19  LEU A CG   5  
ATOM 9018  C CD1  . LEU A 1 19  ? -6.079  -2.988  -2.273  1.00 0.00 ? 19  LEU A CD1  5  
ATOM 9019  C CD2  . LEU A 1 19  ? -4.185  -3.119  -0.631  1.00 0.00 ? 19  LEU A CD2  5  
ATOM 9020  H H    . LEU A 1 19  ? -8.009  -5.869  0.877   1.00 0.00 ? 19  LEU A H    5  
ATOM 9021  H HA   . LEU A 1 19  ? -7.735  -4.909  -1.834  1.00 0.00 ? 19  LEU A HA   5  
ATOM 9022  H HB2  . LEU A 1 19  ? -6.606  -3.958  0.255   1.00 0.00 ? 19  LEU A HB2  5  
ATOM 9023  H HB3  . LEU A 1 19  ? -5.525  -5.338  0.173   1.00 0.00 ? 19  LEU A HB3  5  
ATOM 9024  H HG   . LEU A 1 19  ? -4.739  -4.619  -2.031  1.00 0.00 ? 19  LEU A HG   5  
ATOM 9025  H HD11 . LEU A 1 19  ? -6.600  -2.268  -1.657  1.00 0.00 ? 19  LEU A HD11 5  
ATOM 9026  H HD12 . LEU A 1 19  ? -6.799  -3.572  -2.828  1.00 0.00 ? 19  LEU A HD12 5  
ATOM 9027  H HD13 . LEU A 1 19  ? -5.434  -2.469  -2.965  1.00 0.00 ? 19  LEU A HD13 5  
ATOM 9028  H HD21 . LEU A 1 19  ? -3.588  -3.795  -0.035  1.00 0.00 ? 19  LEU A HD21 5  
ATOM 9029  H HD22 . LEU A 1 19  ? -4.664  -2.396  0.015   1.00 0.00 ? 19  LEU A HD22 5  
ATOM 9030  H HD23 . LEU A 1 19  ? -3.546  -2.604  -1.334  1.00 0.00 ? 19  LEU A HD23 5  
ATOM 9031  N N    . SER A 1 20  ? -6.818  -7.892  -0.995  1.00 0.00 ? 20  SER A N    5  
ATOM 9032  C CA   . SER A 1 20  ? -6.360  -9.186  -1.496  1.00 0.00 ? 20  SER A CA   5  
ATOM 9033  C C    . SER A 1 20  ? -7.349  -9.736  -2.527  1.00 0.00 ? 20  SER A C    5  
ATOM 9034  O O    . SER A 1 20  ? -6.978  -10.522 -3.404  1.00 0.00 ? 20  SER A O    5  
ATOM 9035  C CB   . SER A 1 20  ? -6.190  -10.174 -0.331  1.00 0.00 ? 20  SER A CB   5  
ATOM 9036  O OG   . SER A 1 20  ? -5.584  -11.387 -0.751  1.00 0.00 ? 20  SER A OG   5  
ATOM 9037  H H    . SER A 1 20  ? -7.219  -7.845  -0.105  1.00 0.00 ? 20  SER A H    5  
ATOM 9038  H HA   . SER A 1 20  ? -5.402  -9.038  -1.976  1.00 0.00 ? 20  SER A HA   5  
ATOM 9039  H HB2  . SER A 1 20  ? -5.567  -9.725  0.430   1.00 0.00 ? 20  SER A HB2  5  
ATOM 9040  H HB3  . SER A 1 20  ? -7.160  -10.401 0.090   1.00 0.00 ? 20  SER A HB3  5  
ATOM 9041  H HG   . SER A 1 20  ? -4.853  -11.599 -0.156  1.00 0.00 ? 20  SER A HG   5  
ATOM 9042  N N    . HIS A 1 21  ? -8.611  -9.314  -2.421  1.00 0.00 ? 21  HIS A N    5  
ATOM 9043  C CA   . HIS A 1 21  ? -9.637  -9.731  -3.371  1.00 0.00 ? 21  HIS A CA   5  
ATOM 9044  C C    . HIS A 1 21  ? -9.405  -9.001  -4.691  1.00 0.00 ? 21  HIS A C    5  
ATOM 9045  O O    . HIS A 1 21  ? -9.414  -7.779  -4.721  1.00 0.00 ? 21  HIS A O    5  
ATOM 9046  C CB   . HIS A 1 21  ? -11.050 -9.429  -2.825  1.00 0.00 ? 21  HIS A CB   5  
ATOM 9047  C CG   . HIS A 1 21  ? -12.075 -10.472 -3.176  1.00 0.00 ? 21  HIS A CG   5  
ATOM 9048  N ND1  . HIS A 1 21  ? -13.183 -10.219 -3.958  1.00 0.00 ? 21  HIS A ND1  5  
ATOM 9049  C CD2  . HIS A 1 21  ? -12.166 -11.778 -2.821  1.00 0.00 ? 21  HIS A CD2  5  
ATOM 9050  C CE1  . HIS A 1 21  ? -13.908 -11.316 -4.064  1.00 0.00 ? 21  HIS A CE1  5  
ATOM 9051  N NE2  . HIS A 1 21  ? -13.312 -12.276 -3.386  1.00 0.00 ? 21  HIS A NE2  5  
ATOM 9052  H H    . HIS A 1 21  ? -8.853  -8.701  -1.695  1.00 0.00 ? 21  HIS A H    5  
ATOM 9053  H HA   . HIS A 1 21  ? -9.533  -10.795 -3.529  1.00 0.00 ? 21  HIS A HA   5  
ATOM 9054  H HB2  . HIS A 1 21  ? -11.012 -9.360  -1.750  1.00 0.00 ? 21  HIS A HB2  5  
ATOM 9055  H HB3  . HIS A 1 21  ? -11.390 -8.483  -3.224  1.00 0.00 ? 21  HIS A HB3  5  
ATOM 9056  H HD1  . HIS A 1 21  ? -13.401 -9.361  -4.388  1.00 0.00 ? 21  HIS A HD1  5  
ATOM 9057  H HD2  . HIS A 1 21  ? -11.464 -12.326 -2.207  1.00 0.00 ? 21  HIS A HD2  5  
ATOM 9058  H HE1  . HIS A 1 21  ? -14.832 -11.411 -4.613  1.00 0.00 ? 21  HIS A HE1  5  
ATOM 9059  H HE2  . HIS A 1 21  ? -13.663 -13.183 -3.262  1.00 0.00 ? 21  HIS A HE2  5  
ATOM 9060  N N    . ARG A 1 22  ? -9.197  -9.760  -5.762  1.00 0.00 ? 22  ARG A N    5  
ATOM 9061  C CA   . ARG A 1 22  ? -8.826  -9.214  -7.078  1.00 0.00 ? 22  ARG A CA   5  
ATOM 9062  C C    . ARG A 1 22  ? -9.638  -7.962  -7.447  1.00 0.00 ? 22  ARG A C    5  
ATOM 9063  O O    . ARG A 1 22  ? -9.075  -6.892  -7.704  1.00 0.00 ? 22  ARG A O    5  
ATOM 9064  C CB   . ARG A 1 22  ? -9.008  -10.304 -8.145  1.00 0.00 ? 22  ARG A CB   5  
ATOM 9065  C CG   . ARG A 1 22  ? -8.128  -11.534 -7.915  1.00 0.00 ? 22  ARG A CG   5  
ATOM 9066  C CD   . ARG A 1 22  ? -8.566  -12.720 -8.766  1.00 0.00 ? 22  ARG A CD   5  
ATOM 9067  N NE   . ARG A 1 22  ? -8.525  -12.423 -10.198 1.00 0.00 ? 22  ARG A NE   5  
ATOM 9068  C CZ   . ARG A 1 22  ? -9.368  -12.939 -11.094 1.00 0.00 ? 22  ARG A CZ   5  
ATOM 9069  N NH1  . ARG A 1 22  ? -10.350 -13.745 -10.705 1.00 0.00 ? 22  ARG A NH1  5  
ATOM 9070  N NH2  . ARG A 1 22  ? -9.231  -12.639 -12.376 1.00 0.00 ? 22  ARG A NH2  5  
ATOM 9071  H H    . ARG A 1 22  ? -9.289  -10.731 -5.668  1.00 0.00 ? 22  ARG A H    5  
ATOM 9072  H HA   . ARG A 1 22  ? -7.779  -8.945  -7.034  1.00 0.00 ? 22  ARG A HA   5  
ATOM 9073  H HB2  . ARG A 1 22  ? -10.043 -10.620 -8.147  1.00 0.00 ? 22  ARG A HB2  5  
ATOM 9074  H HB3  . ARG A 1 22  ? -8.766  -9.891  -9.115  1.00 0.00 ? 22  ARG A HB3  5  
ATOM 9075  H HG2  . ARG A 1 22  ? -7.107  -11.285 -8.166  1.00 0.00 ? 22  ARG A HG2  5  
ATOM 9076  H HG3  . ARG A 1 22  ? -8.182  -11.813 -6.871  1.00 0.00 ? 22  ARG A HG3  5  
ATOM 9077  H HD2  . ARG A 1 22  ? -7.908  -13.554 -8.564  1.00 0.00 ? 22  ARG A HD2  5  
ATOM 9078  H HD3  . ARG A 1 22  ? -9.577  -12.990 -8.490  1.00 0.00 ? 22  ARG A HD3  5  
ATOM 9079  H HE   . ARG A 1 22  ? -7.820  -11.809 -10.511 1.00 0.00 ? 22  ARG A HE   5  
ATOM 9080  H HH11 . ARG A 1 22  ? -10.463 -13.972 -9.734  1.00 0.00 ? 22  ARG A HH11 5  
ATOM 9081  H HH12 . ARG A 1 22  ? -10.987 -14.130 -11.378 1.00 0.00 ? 22  ARG A HH12 5  
ATOM 9082  H HH21 . ARG A 1 22  ? -8.491  -12.026 -12.676 1.00 0.00 ? 22  ARG A HH21 5  
ATOM 9083  H HH22 . ARG A 1 22  ? -9.861  -13.025 -13.053 1.00 0.00 ? 22  ARG A HH22 5  
ATOM 9084  N N    . ASP A 1 23  ? -10.958 -8.094  -7.453  1.00 0.00 ? 23  ASP A N    5  
ATOM 9085  C CA   . ASP A 1 23  ? -11.835 -6.983  -7.822  1.00 0.00 ? 23  ASP A CA   5  
ATOM 9086  C C    . ASP A 1 23  ? -11.858 -5.929  -6.714  1.00 0.00 ? 23  ASP A C    5  
ATOM 9087  O O    . ASP A 1 23  ? -12.101 -4.747  -6.971  1.00 0.00 ? 23  ASP A O    5  
ATOM 9088  C CB   . ASP A 1 23  ? -13.253 -7.491  -8.098  1.00 0.00 ? 23  ASP A CB   5  
ATOM 9089  C CG   . ASP A 1 23  ? -13.964 -7.945  -6.836  1.00 0.00 ? 23  ASP A CG   5  
ATOM 9090  O OD1  . ASP A 1 23  ? -13.509 -8.932  -6.226  1.00 0.00 ? 23  ASP A OD1  5  
ATOM 9091  O OD2  . ASP A 1 23  ? -14.969 -7.313  -6.454  1.00 0.00 ? 23  ASP A OD2  5  
ATOM 9092  H H    . ASP A 1 23  ? -11.355 -8.954  -7.199  1.00 0.00 ? 23  ASP A H    5  
ATOM 9093  H HA   . ASP A 1 23  ? -11.440 -6.533  -8.724  1.00 0.00 ? 23  ASP A HA   5  
ATOM 9094  H HB2  . ASP A 1 23  ? -13.830 -6.699  -8.554  1.00 0.00 ? 23  ASP A HB2  5  
ATOM 9095  H HB3  . ASP A 1 23  ? -13.202 -8.328  -8.781  1.00 0.00 ? 23  ASP A HB3  5  
ATOM 9096  N N    . GLY A 1 24  ? -11.600 -6.371  -5.483  1.00 0.00 ? 24  GLY A N    5  
ATOM 9097  C CA   . GLY A 1 24  ? -11.513 -5.459  -4.352  1.00 0.00 ? 24  GLY A CA   5  
ATOM 9098  C C    . GLY A 1 24  ? -10.295 -4.561  -4.458  1.00 0.00 ? 24  GLY A C    5  
ATOM 9099  O O    . GLY A 1 24  ? -10.329 -3.396  -4.064  1.00 0.00 ? 24  GLY A O    5  
ATOM 9100  H H    . GLY A 1 24  ? -11.461 -7.328  -5.343  1.00 0.00 ? 24  GLY A H    5  
ATOM 9101  H HA2  . GLY A 1 24  ? -12.405 -4.849  -4.315  1.00 0.00 ? 24  GLY A HA2  5  
ATOM 9102  H HA3  . GLY A 1 24  ? -11.444 -6.036  -3.441  1.00 0.00 ? 24  GLY A HA3  5  
ATOM 9103  N N    . LEU A 1 25  ? -9.221  -5.121  -5.009  1.00 0.00 ? 25  LEU A N    5  
ATOM 9104  C CA   . LEU A 1 25  ? -8.000  -4.381  -5.301  1.00 0.00 ? 25  LEU A CA   5  
ATOM 9105  C C    . LEU A 1 25  ? -8.318  -3.226  -6.239  1.00 0.00 ? 25  LEU A C    5  
ATOM 9106  O O    . LEU A 1 25  ? -8.023  -2.062  -5.953  1.00 0.00 ? 25  LEU A O    5  
ATOM 9107  C CB   . LEU A 1 25  ? -6.980  -5.317  -5.970  1.00 0.00 ? 25  LEU A CB   5  
ATOM 9108  C CG   . LEU A 1 25  ? -5.703  -4.644  -6.510  1.00 0.00 ? 25  LEU A CG   5  
ATOM 9109  C CD1  . LEU A 1 25  ? -4.657  -4.486  -5.411  1.00 0.00 ? 25  LEU A CD1  5  
ATOM 9110  C CD2  . LEU A 1 25  ? -5.148  -5.424  -7.702  1.00 0.00 ? 25  LEU A CD2  5  
ATOM 9111  H H    . LEU A 1 25  ? -9.255  -6.071  -5.232  1.00 0.00 ? 25  LEU A H    5  
ATOM 9112  H HA   . LEU A 1 25  ? -7.594  -4.000  -4.376  1.00 0.00 ? 25  LEU A HA   5  
ATOM 9113  H HB2  . LEU A 1 25  ? -6.691  -6.067  -5.248  1.00 0.00 ? 25  LEU A HB2  5  
ATOM 9114  H HB3  . LEU A 1 25  ? -7.475  -5.814  -6.794  1.00 0.00 ? 25  LEU A HB3  5  
ATOM 9115  H HG   . LEU A 1 25  ? -5.956  -3.652  -6.860  1.00 0.00 ? 25  LEU A HG   5  
ATOM 9116  H HD11 . LEU A 1 25  ? -4.398  -5.457  -5.015  1.00 0.00 ? 25  LEU A HD11 5  
ATOM 9117  H HD12 . LEU A 1 25  ? -5.057  -3.870  -4.620  1.00 0.00 ? 25  LEU A HD12 5  
ATOM 9118  H HD13 . LEU A 1 25  ? -3.773  -4.016  -5.818  1.00 0.00 ? 25  LEU A HD13 5  
ATOM 9119  H HD21 . LEU A 1 25  ? -4.919  -6.437  -7.401  1.00 0.00 ? 25  LEU A HD21 5  
ATOM 9120  H HD22 . LEU A 1 25  ? -4.249  -4.944  -8.063  1.00 0.00 ? 25  LEU A HD22 5  
ATOM 9121  H HD23 . LEU A 1 25  ? -5.887  -5.443  -8.494  1.00 0.00 ? 25  LEU A HD23 5  
ATOM 9122  N N    . GLU A 1 26  ? -8.937  -3.576  -7.361  1.00 0.00 ? 26  GLU A N    5  
ATOM 9123  C CA   . GLU A 1 26  ? -9.309  -2.607  -8.383  1.00 0.00 ? 26  GLU A CA   5  
ATOM 9124  C C    . GLU A 1 26  ? -10.299 -1.580  -7.814  1.00 0.00 ? 26  GLU A C    5  
ATOM 9125  O O    . GLU A 1 26  ? -10.262 -0.401  -8.169  1.00 0.00 ? 26  GLU A O    5  
ATOM 9126  C CB   . GLU A 1 26  ? -9.914  -3.343  -9.588  1.00 0.00 ? 26  GLU A CB   5  
ATOM 9127  C CG   . GLU A 1 26  ? -10.160 -2.461  -10.812 1.00 0.00 ? 26  GLU A CG   5  
ATOM 9128  C CD   . GLU A 1 26  ? -8.872  -2.003  -11.484 1.00 0.00 ? 26  GLU A CD   5  
ATOM 9129  O OE1  . GLU A 1 26  ? -8.320  -2.768  -12.307 1.00 0.00 ? 26  GLU A OE1  5  
ATOM 9130  O OE2  . GLU A 1 26  ? -8.416  -0.875  -11.215 1.00 0.00 ? 26  GLU A OE2  5  
ATOM 9131  H H    . GLU A 1 26  ? -9.151  -4.527  -7.507  1.00 0.00 ? 26  GLU A H    5  
ATOM 9132  H HA   . GLU A 1 26  ? -8.411  -2.093  -8.697  1.00 0.00 ? 26  GLU A HA   5  
ATOM 9133  H HB2  . GLU A 1 26  ? -9.236  -4.139  -9.876  1.00 0.00 ? 26  GLU A HB2  5  
ATOM 9134  H HB3  . GLU A 1 26  ? -10.856 -3.782  -9.291  1.00 0.00 ? 26  GLU A HB3  5  
ATOM 9135  H HG2  . GLU A 1 26  ? -10.743 -3.022  -11.531 1.00 0.00 ? 26  GLU A HG2  5  
ATOM 9136  H HG3  . GLU A 1 26  ? -10.722 -1.590  -10.505 1.00 0.00 ? 26  GLU A HG3  5  
ATOM 9137  N N    . ALA A 1 27  ? -11.166 -2.035  -6.909  1.00 0.00 ? 27  ALA A N    5  
ATOM 9138  C CA   . ALA A 1 27  ? -12.155 -1.164  -6.274  1.00 0.00 ? 27  ALA A CA   5  
ATOM 9139  C C    . ALA A 1 27  ? -11.482 -0.148  -5.346  1.00 0.00 ? 27  ALA A C    5  
ATOM 9140  O O    . ALA A 1 27  ? -11.707 1.064   -5.456  1.00 0.00 ? 27  ALA A O    5  
ATOM 9141  C CB   . ALA A 1 27  ? -13.176 -1.997  -5.502  1.00 0.00 ? 27  ALA A CB   5  
ATOM 9142  H H    . ALA A 1 27  ? -11.142 -2.985  -6.666  1.00 0.00 ? 27  ALA A H    5  
ATOM 9143  H HA   . ALA A 1 27  ? -12.679 -0.630  -7.054  1.00 0.00 ? 27  ALA A HA   5  
ATOM 9144  H HB1  . ALA A 1 27  ? -13.648 -2.702  -6.171  1.00 0.00 ? 27  ALA A HB1  5  
ATOM 9145  H HB2  . ALA A 1 27  ? -13.928 -1.348  -5.077  1.00 0.00 ? 27  ALA A HB2  5  
ATOM 9146  H HB3  . ALA A 1 27  ? -12.679 -2.536  -4.706  1.00 0.00 ? 27  ALA A HB3  5  
ATOM 9147  N N    . PHE A 1 28  ? -10.643 -0.640  -4.439  1.00 0.00 ? 28  PHE A N    5  
ATOM 9148  C CA   . PHE A 1 28  ? -9.980  0.222   -3.468  1.00 0.00 ? 28  PHE A CA   5  
ATOM 9149  C C    . PHE A 1 28  ? -9.032  1.192   -4.168  1.00 0.00 ? 28  PHE A C    5  
ATOM 9150  O O    . PHE A 1 28  ? -8.945  2.362   -3.791  1.00 0.00 ? 28  PHE A O    5  
ATOM 9151  C CB   . PHE A 1 28  ? -9.213  -0.597  -2.418  1.00 0.00 ? 28  PHE A CB   5  
ATOM 9152  C CG   . PHE A 1 28  ? -8.529  0.263   -1.379  1.00 0.00 ? 28  PHE A CG   5  
ATOM 9153  C CD1  . PHE A 1 28  ? -9.263  0.856   -0.358  1.00 0.00 ? 28  PHE A CD1  5  
ATOM 9154  C CD2  . PHE A 1 28  ? -7.160  0.498   -1.434  1.00 0.00 ? 28  PHE A CD2  5  
ATOM 9155  C CE1  . PHE A 1 28  ? -8.645  1.658   0.584   1.00 0.00 ? 28  PHE A CE1  5  
ATOM 9156  C CE2  . PHE A 1 28  ? -6.540  1.302   -0.496  1.00 0.00 ? 28  PHE A CE2  5  
ATOM 9157  C CZ   . PHE A 1 28  ? -7.282  1.882   0.515   1.00 0.00 ? 28  PHE A CZ   5  
ATOM 9158  H H    . PHE A 1 28  ? -10.466 -1.603  -4.423  1.00 0.00 ? 28  PHE A H    5  
ATOM 9159  H HA   . PHE A 1 28  ? -10.747 0.796   -2.967  1.00 0.00 ? 28  PHE A HA   5  
ATOM 9160  H HB2  . PHE A 1 28  ? -9.905  -1.254  -1.909  1.00 0.00 ? 28  PHE A HB2  5  
ATOM 9161  H HB3  . PHE A 1 28  ? -8.459  -1.194  -2.913  1.00 0.00 ? 28  PHE A HB3  5  
ATOM 9162  H HD1  . PHE A 1 28  ? -10.327 0.682   -0.300  1.00 0.00 ? 28  PHE A HD1  5  
ATOM 9163  H HD2  . PHE A 1 28  ? -6.575  0.044   -2.223  1.00 0.00 ? 28  PHE A HD2  5  
ATOM 9164  H HE1  . PHE A 1 28  ? -9.228  2.110   1.374   1.00 0.00 ? 28  PHE A HE1  5  
ATOM 9165  H HE2  . PHE A 1 28  ? -5.475  1.476   -0.551  1.00 0.00 ? 28  PHE A HE2  5  
ATOM 9166  H HZ   . PHE A 1 28  ? -6.800  2.511   1.250   1.00 0.00 ? 28  PHE A HZ   5  
ATOM 9167  N N    . THR A 1 29  ? -8.327  0.712   -5.192  1.00 0.00 ? 29  THR A N    5  
ATOM 9168  C CA   . THR A 1 29  ? -7.389  1.561   -5.913  1.00 0.00 ? 29  THR A CA   5  
ATOM 9169  C C    . THR A 1 29  ? -8.146  2.697   -6.614  1.00 0.00 ? 29  THR A C    5  
ATOM 9170  O O    . THR A 1 29  ? -7.639  3.811   -6.716  1.00 0.00 ? 29  THR A O    5  
ATOM 9171  C CB   . THR A 1 29  ? -6.519  0.759   -6.923  1.00 0.00 ? 29  THR A CB   5  
ATOM 9172  O OG1  . THR A 1 29  ? -5.339  1.506   -7.256  1.00 0.00 ? 29  THR A OG1  5  
ATOM 9173  C CG2  . THR A 1 29  ? -7.280  0.435   -8.204  1.00 0.00 ? 29  THR A CG2  5  
ATOM 9174  H H    . THR A 1 29  ? -8.439  -0.223  -5.459  1.00 0.00 ? 29  THR A H    5  
ATOM 9175  H HA   . THR A 1 29  ? -6.725  2.000   -5.178  1.00 0.00 ? 29  THR A HA   5  
ATOM 9176  H HB   . THR A 1 29  ? -6.220  -0.170  -6.456  1.00 0.00 ? 29  THR A HB   5  
ATOM 9177  H HG1  . THR A 1 29  ? -4.563  1.051   -6.910  1.00 0.00 ? 29  THR A HG1  5  
ATOM 9178  H HG21 . THR A 1 29  ? -7.573  1.352   -8.694  1.00 0.00 ? 29  THR A HG21 5  
ATOM 9179  H HG22 . THR A 1 29  ? -8.160  -0.141  -7.965  1.00 0.00 ? 29  THR A HG22 5  
ATOM 9180  H HG23 . THR A 1 29  ? -6.646  -0.138  -8.866  1.00 0.00 ? 29  THR A HG23 5  
ATOM 9181  N N    . ARG A 1 30  ? -9.380  2.417   -7.063  1.00 0.00 ? 30  ARG A N    5  
ATOM 9182  C CA   . ARG A 1 30  ? -10.264 3.466   -7.591  1.00 0.00 ? 30  ARG A CA   5  
ATOM 9183  C C    . ARG A 1 30  ? -10.369 4.601   -6.580  1.00 0.00 ? 30  ARG A C    5  
ATOM 9184  O O    . ARG A 1 30  ? -10.161 5.774   -6.908  1.00 0.00 ? 30  ARG A O    5  
ATOM 9185  C CB   . ARG A 1 30  ? -11.679 2.921   -7.868  1.00 0.00 ? 30  ARG A CB   5  
ATOM 9186  C CG   . ARG A 1 30  ? -11.817 2.065   -9.122  1.00 0.00 ? 30  ARG A CG   5  
ATOM 9187  C CD   . ARG A 1 30  ? -11.667 2.889   -10.396 1.00 0.00 ? 30  ARG A CD   5  
ATOM 9188  N NE   . ARG A 1 30  ? -12.200 2.186   -11.563 1.00 0.00 ? 30  ARG A NE   5  
ATOM 9189  C CZ   . ARG A 1 30  ? -11.538 1.264   -12.262 1.00 0.00 ? 30  ARG A CZ   5  
ATOM 9190  N NH1  . ARG A 1 30  ? -10.297 0.929   -11.931 1.00 0.00 ? 30  ARG A NH1  5  
ATOM 9191  N NH2  . ARG A 1 30  ? -12.131 0.679   -13.292 1.00 0.00 ? 30  ARG A NH2  5  
ATOM 9192  H H    . ARG A 1 30  ? -9.701  1.490   -7.035  1.00 0.00 ? 30  ARG A H    5  
ATOM 9193  H HA   . ARG A 1 30  ? -9.834  3.842   -8.508  1.00 0.00 ? 30  ARG A HA   5  
ATOM 9194  H HB2  . ARG A 1 30  ? -11.987 2.322   -7.024  1.00 0.00 ? 30  ARG A HB2  5  
ATOM 9195  H HB3  . ARG A 1 30  ? -12.359 3.758   -7.959  1.00 0.00 ? 30  ARG A HB3  5  
ATOM 9196  H HG2  . ARG A 1 30  ? -11.052 1.301   -9.107  1.00 0.00 ? 30  ARG A HG2  5  
ATOM 9197  H HG3  . ARG A 1 30  ? -12.791 1.596   -9.120  1.00 0.00 ? 30  ARG A HG3  5  
ATOM 9198  H HD2  . ARG A 1 30  ? -12.203 3.820   -10.274 1.00 0.00 ? 30  ARG A HD2  5  
ATOM 9199  H HD3  . ARG A 1 30  ? -10.619 3.098   -10.558 1.00 0.00 ? 30  ARG A HD3  5  
ATOM 9200  H HE   . ARG A 1 30  ? -13.119 2.412   -11.839 1.00 0.00 ? 30  ARG A HE   5  
ATOM 9201  H HH11 . ARG A 1 30  ? -9.846  1.371   -11.155 1.00 0.00 ? 30  ARG A HH11 5  
ATOM 9202  H HH12 . ARG A 1 30  ? -9.808  0.221   -12.445 1.00 0.00 ? 30  ARG A HH12 5  
ATOM 9203  H HH21 . ARG A 1 30  ? -13.073 0.930   -13.537 1.00 0.00 ? 30  ARG A HH21 5  
ATOM 9204  H HH22 . ARG A 1 30  ? -11.646 -0.013  -13.835 1.00 0.00 ? 30  ARG A HH22 5  
ATOM 9205  N N    . PHE A 1 31  ? -10.683 4.225   -5.344  1.00 0.00 ? 31  PHE A N    5  
ATOM 9206  C CA   . PHE A 1 31  ? -10.864 5.184   -4.258  1.00 0.00 ? 31  PHE A CA   5  
ATOM 9207  C C    . PHE A 1 31  ? -9.551  5.912   -3.948  1.00 0.00 ? 31  PHE A C    5  
ATOM 9208  O O    . PHE A 1 31  ? -9.515  7.139   -3.848  1.00 0.00 ? 31  PHE A O    5  
ATOM 9209  C CB   . PHE A 1 31  ? -11.386 4.456   -3.010  1.00 0.00 ? 31  PHE A CB   5  
ATOM 9210  C CG   . PHE A 1 31  ? -11.755 5.369   -1.864  1.00 0.00 ? 31  PHE A CG   5  
ATOM 9211  C CD1  . PHE A 1 31  ? -12.890 6.166   -1.935  1.00 0.00 ? 31  PHE A CD1  5  
ATOM 9212  C CD2  . PHE A 1 31  ? -10.974 5.426   -0.716  1.00 0.00 ? 31  PHE A CD2  5  
ATOM 9213  C CE1  . PHE A 1 31  ? -13.237 6.999   -0.887  1.00 0.00 ? 31  PHE A CE1  5  
ATOM 9214  C CE2  . PHE A 1 31  ? -11.320 6.257   0.333   1.00 0.00 ? 31  PHE A CE2  5  
ATOM 9215  C CZ   . PHE A 1 31  ? -12.451 7.044   0.247   1.00 0.00 ? 31  PHE A CZ   5  
ATOM 9216  H H    . PHE A 1 31  ? -10.800 3.264   -5.156  1.00 0.00 ? 31  PHE A H    5  
ATOM 9217  H HA   . PHE A 1 31  ? -11.600 5.910   -4.577  1.00 0.00 ? 31  PHE A HA   5  
ATOM 9218  H HB2  . PHE A 1 31  ? -12.269 3.892   -3.277  1.00 0.00 ? 31  PHE A HB2  5  
ATOM 9219  H HB3  . PHE A 1 31  ? -10.626 3.770   -2.660  1.00 0.00 ? 31  PHE A HB3  5  
ATOM 9220  H HD1  . PHE A 1 31  ? -13.506 6.134   -2.821  1.00 0.00 ? 31  PHE A HD1  5  
ATOM 9221  H HD2  . PHE A 1 31  ? -10.088 4.813   -0.645  1.00 0.00 ? 31  PHE A HD2  5  
ATOM 9222  H HE1  . PHE A 1 31  ? -14.123 7.614   -0.955  1.00 0.00 ? 31  PHE A HE1  5  
ATOM 9223  H HE2  . PHE A 1 31  ? -10.703 6.292   1.221   1.00 0.00 ? 31  PHE A HE2  5  
ATOM 9224  H HZ   . PHE A 1 31  ? -12.722 7.694   1.066   1.00 0.00 ? 31  PHE A HZ   5  
ATOM 9225  N N    . LEU A 1 32  ? -8.470  5.150   -3.838  1.00 0.00 ? 32  LEU A N    5  
ATOM 9226  C CA   . LEU A 1 32  ? -7.173  5.702   -3.452  1.00 0.00 ? 32  LEU A CA   5  
ATOM 9227  C C    . LEU A 1 32  ? -6.580  6.573   -4.568  1.00 0.00 ? 32  LEU A C    5  
ATOM 9228  O O    . LEU A 1 32  ? -5.739  7.440   -4.310  1.00 0.00 ? 32  LEU A O    5  
ATOM 9229  C CB   . LEU A 1 32  ? -6.205  4.568   -3.090  1.00 0.00 ? 32  LEU A CB   5  
ATOM 9230  C CG   . LEU A 1 32  ? -4.909  5.001   -2.385  1.00 0.00 ? 32  LEU A CG   5  
ATOM 9231  C CD1  . LEU A 1 32  ? -5.214  5.631   -1.027  1.00 0.00 ? 32  LEU A CD1  5  
ATOM 9232  C CD2  . LEU A 1 32  ? -3.963  3.816   -2.227  1.00 0.00 ? 32  LEU A CD2  5  
ATOM 9233  H H    . LEU A 1 32  ? -8.546  4.189   -4.011  1.00 0.00 ? 32  LEU A H    5  
ATOM 9234  H HA   . LEU A 1 32  ? -7.326  6.319   -2.579  1.00 0.00 ? 32  LEU A HA   5  
ATOM 9235  H HB2  . LEU A 1 32  ? -6.727  3.882   -2.442  1.00 0.00 ? 32  LEU A HB2  5  
ATOM 9236  H HB3  . LEU A 1 32  ? -5.939  4.046   -3.998  1.00 0.00 ? 32  LEU A HB3  5  
ATOM 9237  H HG   . LEU A 1 32  ? -4.411  5.746   -2.991  1.00 0.00 ? 32  LEU A HG   5  
ATOM 9238  H HD11 . LEU A 1 32  ? -4.290  5.924   -0.550  1.00 0.00 ? 32  LEU A HD11 5  
ATOM 9239  H HD12 . LEU A 1 32  ? -5.730  4.916   -0.402  1.00 0.00 ? 32  LEU A HD12 5  
ATOM 9240  H HD13 . LEU A 1 32  ? -5.837  6.502   -1.166  1.00 0.00 ? 32  LEU A HD13 5  
ATOM 9241  H HD21 . LEU A 1 32  ? -4.438  3.047   -1.634  1.00 0.00 ? 32  LEU A HD21 5  
ATOM 9242  H HD22 . LEU A 1 32  ? -3.058  4.140   -1.737  1.00 0.00 ? 32  LEU A HD22 5  
ATOM 9243  H HD23 . LEU A 1 32  ? -3.720  3.418   -3.202  1.00 0.00 ? 32  LEU A HD23 5  
ATOM 9244  N N    . LYS A 1 33  ? -7.010  6.337   -5.805  1.00 0.00 ? 33  LYS A N    5  
ATOM 9245  C CA   . LYS A 1 33  ? -6.537  7.128   -6.944  1.00 0.00 ? 33  LYS A CA   5  
ATOM 9246  C C    . LYS A 1 33  ? -7.374  8.398   -7.114  1.00 0.00 ? 33  LYS A C    5  
ATOM 9247  O O    . LYS A 1 33  ? -6.848  9.443   -7.505  1.00 0.00 ? 33  LYS A O    5  
ATOM 9248  C CB   . LYS A 1 33  ? -6.557  6.304   -8.245  1.00 0.00 ? 33  LYS A CB   5  
ATOM 9249  C CG   . LYS A 1 33  ? -5.530  5.168   -8.291  1.00 0.00 ? 33  LYS A CG   5  
ATOM 9250  C CD   . LYS A 1 33  ? -5.533  4.465   -9.650  1.00 0.00 ? 33  LYS A CD   5  
ATOM 9251  C CE   . LYS A 1 33  ? -4.609  3.247   -9.681  1.00 0.00 ? 33  LYS A CE   5  
ATOM 9252  N NZ   . LYS A 1 33  ? -3.200  3.588   -9.343  1.00 0.00 ? 33  LYS A NZ   5  
ATOM 9253  H H    . LYS A 1 33  ? -7.653  5.610   -5.959  1.00 0.00 ? 33  LYS A H    5  
ATOM 9254  H HA   . LYS A 1 33  ? -5.516  7.418   -6.736  1.00 0.00 ? 33  LYS A HA   5  
ATOM 9255  H HB2  . LYS A 1 33  ? -7.541  5.873   -8.366  1.00 0.00 ? 33  LYS A HB2  5  
ATOM 9256  H HB3  . LYS A 1 33  ? -6.363  6.966   -9.078  1.00 0.00 ? 33  LYS A HB3  5  
ATOM 9257  H HG2  . LYS A 1 33  ? -4.546  5.576   -8.109  1.00 0.00 ? 33  LYS A HG2  5  
ATOM 9258  H HG3  . LYS A 1 33  ? -5.770  4.447   -7.521  1.00 0.00 ? 33  LYS A HG3  5  
ATOM 9259  H HD2  . LYS A 1 33  ? -6.540  4.139   -9.872  1.00 0.00 ? 33  LYS A HD2  5  
ATOM 9260  H HD3  . LYS A 1 33  ? -5.209  5.168   -10.406 1.00 0.00 ? 33  LYS A HD3  5  
ATOM 9261  H HE2  . LYS A 1 33  ? -4.969  2.520   -8.970  1.00 0.00 ? 33  LYS A HE2  5  
ATOM 9262  H HE3  . LYS A 1 33  ? -4.636  2.816   -10.672 1.00 0.00 ? 33  LYS A HE3  5  
ATOM 9263  H HZ1  . LYS A 1 33  ? -3.105  3.761   -8.323  1.00 0.00 ? 33  LYS A HZ1  5  
ATOM 9264  H HZ2  . LYS A 1 33  ? -2.904  4.443   -9.855  1.00 0.00 ? 33  LYS A HZ2  5  
ATOM 9265  H HZ3  . LYS A 1 33  ? -2.566  2.804   -9.607  1.00 0.00 ? 33  LYS A HZ3  5  
ATOM 9266  N N    . THR A 1 34  ? -8.672  8.322   -6.808  1.00 0.00 ? 34  THR A N    5  
ATOM 9267  C CA   . THR A 1 34  ? -9.558  9.477   -6.977  1.00 0.00 ? 34  THR A CA   5  
ATOM 9268  C C    . THR A 1 34  ? -9.277  10.539  -5.913  1.00 0.00 ? 34  THR A C    5  
ATOM 9269  O O    . THR A 1 34  ? -9.591  11.713  -6.106  1.00 0.00 ? 34  THR A O    5  
ATOM 9270  C CB   . THR A 1 34  ? -11.060 9.087   -6.954  1.00 0.00 ? 34  THR A CB   5  
ATOM 9271  O OG1  . THR A 1 34  ? -11.865 10.211  -7.347  1.00 0.00 ? 34  THR A OG1  5  
ATOM 9272  C CG2  . THR A 1 34  ? -11.503 8.616   -5.573  1.00 0.00 ? 34  THR A CG2  5  
ATOM 9273  H H    . THR A 1 34  ? -9.039  7.478   -6.464  1.00 0.00 ? 34  THR A H    5  
ATOM 9274  H HA   . THR A 1 34  ? -9.342  9.907   -7.947  1.00 0.00 ? 34  THR A HA   5  
ATOM 9275  H HB   . THR A 1 34  ? -11.218 8.282   -7.659  1.00 0.00 ? 34  THR A HB   5  
ATOM 9276  H HG1  . THR A 1 34  ? -11.450 11.027  -7.032  1.00 0.00 ? 34  THR A HG1  5  
ATOM 9277  H HG21 . THR A 1 34  ? -12.549 8.343   -5.602  1.00 0.00 ? 34  THR A HG21 5  
ATOM 9278  H HG22 . THR A 1 34  ? -11.360 9.410   -4.855  1.00 0.00 ? 34  THR A HG22 5  
ATOM 9279  H HG23 . THR A 1 34  ? -10.917 7.757   -5.280  1.00 0.00 ? 34  THR A HG23 5  
ATOM 9280  N N    . GLU A 1 35  ? -8.692  10.119  -4.789  1.00 0.00 ? 35  GLU A N    5  
ATOM 9281  C CA   . GLU A 1 35  ? -8.257  11.055  -3.752  1.00 0.00 ? 35  GLU A CA   5  
ATOM 9282  C C    . GLU A 1 35  ? -6.830  11.525  -4.036  1.00 0.00 ? 35  GLU A C    5  
ATOM 9283  O O    . GLU A 1 35  ? -6.223  12.234  -3.230  1.00 0.00 ? 35  GLU A O    5  
ATOM 9284  C CB   . GLU A 1 35  ? -8.346  10.411  -2.363  1.00 0.00 ? 35  GLU A CB   5  
ATOM 9285  C CG   . GLU A 1 35  ? -7.479  9.171   -2.191  1.00 0.00 ? 35  GLU A CG   5  
ATOM 9286  C CD   . GLU A 1 35  ? -7.592  8.578   -0.799  1.00 0.00 ? 35  GLU A CD   5  
ATOM 9287  O OE1  . GLU A 1 35  ? -8.621  7.947   -0.501  1.00 0.00 ? 35  GLU A OE1  5  
ATOM 9288  O OE2  . GLU A 1 35  ? -6.660  8.752   0.014   1.00 0.00 ? 35  GLU A OE2  5  
ATOM 9289  H H    . GLU A 1 35  ? -8.562  9.157   -4.648  1.00 0.00 ? 35  GLU A H    5  
ATOM 9290  H HA   . GLU A 1 35  ? -8.915  11.915  -3.783  1.00 0.00 ? 35  GLU A HA   5  
ATOM 9291  H HB2  . GLU A 1 35  ? -8.043  11.140  -1.624  1.00 0.00 ? 35  GLU A HB2  5  
ATOM 9292  H HB3  . GLU A 1 35  ? -9.374  10.133  -2.176  1.00 0.00 ? 35  GLU A HB3  5  
ATOM 9293  H HG2  . GLU A 1 35  ? -7.789  8.426   -2.911  1.00 0.00 ? 35  GLU A HG2  5  
ATOM 9294  H HG3  . GLU A 1 35  ? -6.447  9.438   -2.375  1.00 0.00 ? 35  GLU A HG3  5  
ATOM 9295  N N    . PHE A 1 36  ? -6.305  11.099  -5.186  1.00 0.00 ? 36  PHE A N    5  
ATOM 9296  C CA   . PHE A 1 36  ? -5.004  11.545  -5.687  1.00 0.00 ? 36  PHE A CA   5  
ATOM 9297  C C    . PHE A 1 36  ? -3.852  11.015  -4.821  1.00 0.00 ? 36  PHE A C    5  
ATOM 9298  O O    . PHE A 1 36  ? -2.778  11.612  -4.768  1.00 0.00 ? 36  PHE A O    5  
ATOM 9299  C CB   . PHE A 1 36  ? -4.977  13.087  -5.779  1.00 0.00 ? 36  PHE A CB   5  
ATOM 9300  C CG   . PHE A 1 36  ? -3.831  13.648  -6.591  1.00 0.00 ? 36  PHE A CG   5  
ATOM 9301  C CD1  . PHE A 1 36  ? -3.775  13.452  -7.964  1.00 0.00 ? 36  PHE A CD1  5  
ATOM 9302  C CD2  . PHE A 1 36  ? -2.816  14.379  -5.984  1.00 0.00 ? 36  PHE A CD2  5  
ATOM 9303  C CE1  . PHE A 1 36  ? -2.733  13.968  -8.712  1.00 0.00 ? 36  PHE A CE1  5  
ATOM 9304  C CE2  . PHE A 1 36  ? -1.773  14.895  -6.729  1.00 0.00 ? 36  PHE A CE2  5  
ATOM 9305  C CZ   . PHE A 1 36  ? -1.732  14.690  -8.093  1.00 0.00 ? 36  PHE A CZ   5  
ATOM 9306  H H    . PHE A 1 36  ? -6.817  10.463  -5.725  1.00 0.00 ? 36  PHE A H    5  
ATOM 9307  H HA   . PHE A 1 36  ? -4.891  11.140  -6.682  1.00 0.00 ? 36  PHE A HA   5  
ATOM 9308  H HB2  . PHE A 1 36  ? -5.898  13.426  -6.234  1.00 0.00 ? 36  PHE A HB2  5  
ATOM 9309  H HB3  . PHE A 1 36  ? -4.913  13.497  -4.779  1.00 0.00 ? 36  PHE A HB3  5  
ATOM 9310  H HD1  . PHE A 1 36  ? -4.559  12.887  -8.452  1.00 0.00 ? 36  PHE A HD1  5  
ATOM 9311  H HD2  . PHE A 1 36  ? -2.846  14.541  -4.915  1.00 0.00 ? 36  PHE A HD2  5  
ATOM 9312  H HE1  . PHE A 1 36  ? -2.702  13.806  -9.780  1.00 0.00 ? 36  PHE A HE1  5  
ATOM 9313  H HE2  . PHE A 1 36  ? -0.990  15.460  -6.244  1.00 0.00 ? 36  PHE A HE2  5  
ATOM 9314  H HZ   . PHE A 1 36  ? -0.917  15.093  -8.678  1.00 0.00 ? 36  PHE A HZ   5  
ATOM 9315  N N    . SER A 1 37  ? -4.062  9.873   -4.160  1.00 0.00 ? 37  SER A N    5  
ATOM 9316  C CA   . SER A 1 37  ? -3.000  9.252   -3.377  1.00 0.00 ? 37  SER A CA   5  
ATOM 9317  C C    . SER A 1 37  ? -2.232  8.246   -4.240  1.00 0.00 ? 37  SER A C    5  
ATOM 9318  O O    . SER A 1 37  ? -1.155  8.563   -4.737  1.00 0.00 ? 37  SER A O    5  
ATOM 9319  C CB   . SER A 1 37  ? -3.579  8.587   -2.127  1.00 0.00 ? 37  SER A CB   5  
ATOM 9320  O OG   . SER A 1 37  ? -4.271  9.529   -1.325  1.00 0.00 ? 37  SER A OG   5  
ATOM 9321  H H    . SER A 1 37  ? -4.942  9.439   -4.203  1.00 0.00 ? 37  SER A H    5  
ATOM 9322  H HA   . SER A 1 37  ? -2.315  10.033  -3.070  1.00 0.00 ? 37  SER A HA   5  
ATOM 9323  H HB2  . SER A 1 37  ? -4.268  7.810   -2.422  1.00 0.00 ? 37  SER A HB2  5  
ATOM 9324  H HB3  . SER A 1 37  ? -2.778  8.155   -1.543  1.00 0.00 ? 37  SER A HB3  5  
ATOM 9325  H HG   . SER A 1 37  ? -4.984  9.082   -0.848  1.00 0.00 ? 37  SER A HG   5  
ATOM 9326  N N    . GLU A 1 38  ? -2.811  7.050   -4.435  1.00 0.00 ? 38  GLU A N    5  
ATOM 9327  C CA   . GLU A 1 38  ? -2.243  6.011   -5.315  1.00 0.00 ? 38  GLU A CA   5  
ATOM 9328  C C    . GLU A 1 38  ? -0.921  5.427   -4.780  1.00 0.00 ? 38  GLU A C    5  
ATOM 9329  O O    . GLU A 1 38  ? -0.846  4.234   -4.447  1.00 0.00 ? 38  GLU A O    5  
ATOM 9330  C CB   . GLU A 1 38  ? -2.037  6.565   -6.736  1.00 0.00 ? 38  GLU A CB   5  
ATOM 9331  C CG   . GLU A 1 38  ? -1.366  5.581   -7.684  1.00 0.00 ? 38  GLU A CG   5  
ATOM 9332  C CD   . GLU A 1 38  ? -1.212  6.122   -9.093  1.00 0.00 ? 38  GLU A CD   5  
ATOM 9333  O OE1  . GLU A 1 38  ? -2.216  6.151   -9.833  1.00 0.00 ? 38  GLU A OE1  5  
ATOM 9334  O OE2  . GLU A 1 38  ? -0.086  6.505   -9.471  1.00 0.00 ? 38  GLU A OE2  5  
ATOM 9335  H H    . GLU A 1 38  ? -3.659  6.863   -3.983  1.00 0.00 ? 38  GLU A H    5  
ATOM 9336  H HA   . GLU A 1 38  ? -2.967  5.209   -5.367  1.00 0.00 ? 38  GLU A HA   5  
ATOM 9337  H HB2  . GLU A 1 38  ? -3.000  6.832   -7.150  1.00 0.00 ? 38  GLU A HB2  5  
ATOM 9338  H HB3  . GLU A 1 38  ? -1.422  7.452   -6.678  1.00 0.00 ? 38  GLU A HB3  5  
ATOM 9339  H HG2  . GLU A 1 38  ? -0.385  5.342   -7.297  1.00 0.00 ? 38  GLU A HG2  5  
ATOM 9340  H HG3  . GLU A 1 38  ? -1.961  4.679   -7.725  1.00 0.00 ? 38  GLU A HG3  5  
ATOM 9341  N N    . GLU A 1 39  ? 0.104   6.279   -4.709  1.00 0.00 ? 39  GLU A N    5  
ATOM 9342  C CA   . GLU A 1 39  ? 1.465   5.890   -4.333  1.00 0.00 ? 39  GLU A CA   5  
ATOM 9343  C C    . GLU A 1 39  ? 1.503   4.860   -3.207  1.00 0.00 ? 39  GLU A C    5  
ATOM 9344  O O    . GLU A 1 39  ? 2.317   3.952   -3.236  1.00 0.00 ? 39  GLU A O    5  
ATOM 9345  C CB   . GLU A 1 39  ? 2.265   7.132   -3.914  1.00 0.00 ? 39  GLU A CB   5  
ATOM 9346  C CG   . GLU A 1 39  ? 1.614   7.930   -2.787  1.00 0.00 ? 39  GLU A CG   5  
ATOM 9347  C CD   . GLU A 1 39  ? 2.498   9.055   -2.272  1.00 0.00 ? 39  GLU A CD   5  
ATOM 9348  O OE1  . GLU A 1 39  ? 2.506   10.142  -2.886  1.00 0.00 ? 39  GLU A OE1  5  
ATOM 9349  O OE2  . GLU A 1 39  ? 3.186   8.854   -1.251  1.00 0.00 ? 39  GLU A OE2  5  
ATOM 9350  H H    . GLU A 1 39  ? -0.057  7.216   -4.932  1.00 0.00 ? 39  GLU A H    5  
ATOM 9351  H HA   . GLU A 1 39  ? 1.934   5.461   -5.207  1.00 0.00 ? 39  GLU A HA   5  
ATOM 9352  H HB2  . GLU A 1 39  ? 3.249   6.821   -3.587  1.00 0.00 ? 39  GLU A HB2  5  
ATOM 9353  H HB3  . GLU A 1 39  ? 2.372   7.781   -4.771  1.00 0.00 ? 39  GLU A HB3  5  
ATOM 9354  H HG2  . GLU A 1 39  ? 0.690   8.356   -3.153  1.00 0.00 ? 39  GLU A HG2  5  
ATOM 9355  H HG3  . GLU A 1 39  ? 1.394   7.258   -1.968  1.00 0.00 ? 39  GLU A HG3  5  
ATOM 9356  N N    . ASN A 1 40  ? 0.613   5.009   -2.230  1.00 0.00 ? 40  ASN A N    5  
ATOM 9357  C CA   . ASN A 1 40  ? 0.586   4.135   -1.055  1.00 0.00 ? 40  ASN A CA   5  
ATOM 9358  C C    . ASN A 1 40  ? 0.597   2.650   -1.446  1.00 0.00 ? 40  ASN A C    5  
ATOM 9359  O O    . ASN A 1 40  ? 1.591   1.938   -1.230  1.00 0.00 ? 40  ASN A O    5  
ATOM 9360  C CB   . ASN A 1 40  ? -0.648  4.436   -0.188  1.00 0.00 ? 40  ASN A CB   5  
ATOM 9361  C CG   . ASN A 1 40  ? -0.621  5.829   0.423   1.00 0.00 ? 40  ASN A CG   5  
ATOM 9362  O OD1  . ASN A 1 40  ? -0.100  6.030   1.517   1.00 0.00 ? 40  ASN A OD1  5  
ATOM 9363  N ND2  . ASN A 1 40  ? -1.197  6.799   -0.277  1.00 0.00 ? 40  ASN A ND2  5  
ATOM 9364  H H    . ASN A 1 40  ? -0.037  5.734   -2.298  1.00 0.00 ? 40  ASN A H    5  
ATOM 9365  H HA   . ASN A 1 40  ? 1.474   4.342   -0.477  1.00 0.00 ? 40  ASN A HA   5  
ATOM 9366  H HB2  . ASN A 1 40  ? -1.536  4.350   -0.796  1.00 0.00 ? 40  ASN A HB2  5  
ATOM 9367  H HB3  . ASN A 1 40  ? -0.701  3.714   0.616   1.00 0.00 ? 40  ASN A HB3  5  
ATOM 9368  H HD21 . ASN A 1 40  ? -1.605  6.571   -1.134  1.00 0.00 ? 40  ASN A HD21 5  
ATOM 9369  H HD22 . ASN A 1 40  ? -1.190  7.705   0.099   1.00 0.00 ? 40  ASN A HD22 5  
ATOM 9370  N N    . ILE A 1 41  ? -0.506  2.195   -2.038  1.00 0.00 ? 41  ILE A N    5  
ATOM 9371  C CA   . ILE A 1 41  ? -0.667  0.789   -2.393  1.00 0.00 ? 41  ILE A CA   5  
ATOM 9372  C C    . ILE A 1 41  ? 0.395   0.358   -3.405  1.00 0.00 ? 41  ILE A C    5  
ATOM 9373  O O    . ILE A 1 41  ? 1.008   -0.700  -3.256  1.00 0.00 ? 41  ILE A O    5  
ATOM 9374  C CB   . ILE A 1 41  ? -2.082  0.502   -2.963  1.00 0.00 ? 41  ILE A CB   5  
ATOM 9375  C CG1  . ILE A 1 41  ? -2.236  -0.989  -3.314  1.00 0.00 ? 41  ILE A CG1  5  
ATOM 9376  C CG2  . ILE A 1 41  ? -2.371  1.379   -4.177  1.00 0.00 ? 41  ILE A CG2  5  
ATOM 9377  C CD1  . ILE A 1 41  ? -3.511  -1.312  -4.063  1.00 0.00 ? 41  ILE A CD1  5  
ATOM 9378  H H    . ILE A 1 41  ? -1.227  2.824   -2.247  1.00 0.00 ? 41  ILE A H    5  
ATOM 9379  H HA   . ILE A 1 41  ? -0.541  0.206   -1.489  1.00 0.00 ? 41  ILE A HA   5  
ATOM 9380  H HB   . ILE A 1 41  ? -2.804  0.753   -2.198  1.00 0.00 ? 41  ILE A HB   5  
ATOM 9381  H HG12 . ILE A 1 41  ? -1.405  -1.298  -3.928  1.00 0.00 ? 41  ILE A HG12 5  
ATOM 9382  H HG13 . ILE A 1 41  ? -2.233  -1.569  -2.401  1.00 0.00 ? 41  ILE A HG13 5  
ATOM 9383  H HG21 . ILE A 1 41  ? -2.262  2.419   -3.905  1.00 0.00 ? 41  ILE A HG21 5  
ATOM 9384  H HG22 . ILE A 1 41  ? -3.381  1.202   -4.520  1.00 0.00 ? 41  ILE A HG22 5  
ATOM 9385  H HG23 . ILE A 1 41  ? -1.676  1.139   -4.968  1.00 0.00 ? 41  ILE A HG23 5  
ATOM 9386  H HD11 . ILE A 1 41  ? -3.568  -2.376  -4.234  1.00 0.00 ? 41  ILE A HD11 5  
ATOM 9387  H HD12 . ILE A 1 41  ? -3.512  -0.795  -5.012  1.00 0.00 ? 41  ILE A HD12 5  
ATOM 9388  H HD13 . ILE A 1 41  ? -4.362  -0.994  -3.479  1.00 0.00 ? 41  ILE A HD13 5  
ATOM 9389  N N    . GLU A 1 42  ? 0.625   1.198   -4.417  1.00 0.00 ? 42  GLU A N    5  
ATOM 9390  C CA   . GLU A 1 42  ? 1.603   0.887   -5.460  1.00 0.00 ? 42  GLU A CA   5  
ATOM 9391  C C    . GLU A 1 42  ? 3.018   0.777   -4.875  1.00 0.00 ? 42  GLU A C    5  
ATOM 9392  O O    . GLU A 1 42  ? 3.841   -0.014  -5.349  1.00 0.00 ? 42  GLU A O    5  
ATOM 9393  C CB   . GLU A 1 42  ? 1.553   1.942   -6.585  1.00 0.00 ? 42  GLU A CB   5  
ATOM 9394  C CG   . GLU A 1 42  ? 0.639   1.576   -7.762  1.00 0.00 ? 42  GLU A CG   5  
ATOM 9395  C CD   . GLU A 1 42  ? -0.841  1.469   -7.400  1.00 0.00 ? 42  GLU A CD   5  
ATOM 9396  O OE1  . GLU A 1 42  ? -1.548  2.500   -7.446  1.00 0.00 ? 42  GLU A OE1  5  
ATOM 9397  O OE2  . GLU A 1 42  ? -1.308  0.348   -7.107  1.00 0.00 ? 42  GLU A OE2  5  
ATOM 9398  H H    . GLU A 1 42  ? 0.129   2.049   -4.461  1.00 0.00 ? 42  GLU A H    5  
ATOM 9399  H HA   . GLU A 1 42  ? 1.333   -0.075  -5.876  1.00 0.00 ? 42  GLU A HA   5  
ATOM 9400  H HB2  . GLU A 1 42  ? 1.205   2.877   -6.169  1.00 0.00 ? 42  GLU A HB2  5  
ATOM 9401  H HB3  . GLU A 1 42  ? 2.552   2.086   -6.972  1.00 0.00 ? 42  GLU A HB3  5  
ATOM 9402  H HG2  . GLU A 1 42  ? 0.747   2.331   -8.527  1.00 0.00 ? 42  GLU A HG2  5  
ATOM 9403  H HG3  . GLU A 1 42  ? 0.965   0.624   -8.162  1.00 0.00 ? 42  GLU A HG3  5  
ATOM 9404  N N    . PHE A 1 43  ? 3.283   1.548   -3.825  1.00 0.00 ? 43  PHE A N    5  
ATOM 9405  C CA   . PHE A 1 43  ? 4.605   1.589   -3.206  1.00 0.00 ? 43  PHE A CA   5  
ATOM 9406  C C    . PHE A 1 43  ? 4.964   0.250   -2.576  1.00 0.00 ? 43  PHE A C    5  
ATOM 9407  O O    . PHE A 1 43  ? 5.884   -0.435  -3.036  1.00 0.00 ? 43  PHE A O    5  
ATOM 9408  C CB   . PHE A 1 43  ? 4.680   2.701   -2.147  1.00 0.00 ? 43  PHE A CB   5  
ATOM 9409  C CG   . PHE A 1 43  ? 5.937   2.667   -1.308  1.00 0.00 ? 43  PHE A CG   5  
ATOM 9410  C CD1  . PHE A 1 43  ? 7.162   3.041   -1.844  1.00 0.00 ? 43  PHE A CD1  5  
ATOM 9411  C CD2  . PHE A 1 43  ? 5.891   2.256   0.019   1.00 0.00 ? 43  PHE A CD2  5  
ATOM 9412  C CE1  . PHE A 1 43  ? 8.310   3.005   -1.075  1.00 0.00 ? 43  PHE A CE1  5  
ATOM 9413  C CE2  . PHE A 1 43  ? 7.036   2.219   0.790   1.00 0.00 ? 43  PHE A CE2  5  
ATOM 9414  C CZ   . PHE A 1 43  ? 8.246   2.593   0.243   1.00 0.00 ? 43  PHE A CZ   5  
ATOM 9415  H H    . PHE A 1 43  ? 2.567   2.102   -3.450  1.00 0.00 ? 43  PHE A H    5  
ATOM 9416  H HA   . PHE A 1 43  ? 5.323   1.805   -3.986  1.00 0.00 ? 43  PHE A HA   5  
ATOM 9417  H HB2  . PHE A 1 43  ? 4.639   3.662   -2.643  1.00 0.00 ? 43  PHE A HB2  5  
ATOM 9418  H HB3  . PHE A 1 43  ? 3.831   2.612   -1.484  1.00 0.00 ? 43  PHE A HB3  5  
ATOM 9419  H HD1  . PHE A 1 43  ? 7.214   3.364   -2.874  1.00 0.00 ? 43  PHE A HD1  5  
ATOM 9420  H HD2  . PHE A 1 43  ? 4.945   1.961   0.450   1.00 0.00 ? 43  PHE A HD2  5  
ATOM 9421  H HE1  . PHE A 1 43  ? 9.257   3.298   -1.504  1.00 0.00 ? 43  PHE A HE1  5  
ATOM 9422  H HE2  . PHE A 1 43  ? 6.986   1.898   1.821   1.00 0.00 ? 43  PHE A HE2  5  
ATOM 9423  H HZ   . PHE A 1 43  ? 9.142   2.565   0.845   1.00 0.00 ? 43  PHE A HZ   5  
ATOM 9424  N N    . TRP A 1 44  ? 4.244   -0.136  -1.524  1.00 0.00 ? 44  TRP A N    5  
ATOM 9425  C CA   . TRP A 1 44  ? 4.646   -1.319  -0.766  1.00 0.00 ? 44  TRP A CA   5  
ATOM 9426  C C    . TRP A 1 44  ? 4.402   -2.604  -1.550  1.00 0.00 ? 44  TRP A C    5  
ATOM 9427  O O    . TRP A 1 44  ? 5.071   -3.604  -1.306  1.00 0.00 ? 44  TRP A O    5  
ATOM 9428  C CB   . TRP A 1 44  ? 4.004   -1.379  0.632   1.00 0.00 ? 44  TRP A CB   5  
ATOM 9429  C CG   . TRP A 1 44  ? 2.506   -1.289  0.668   1.00 0.00 ? 44  TRP A CG   5  
ATOM 9430  C CD1  . TRP A 1 44  ? 1.771   -0.209  1.054   1.00 0.00 ? 44  TRP A CD1  5  
ATOM 9431  C CD2  . TRP A 1 44  ? 1.562   -2.320  0.340   1.00 0.00 ? 44  TRP A CD2  5  
ATOM 9432  N NE1  . TRP A 1 44  ? 0.434   -0.497  0.985   1.00 0.00 ? 44  TRP A NE1  5  
ATOM 9433  C CE2  . TRP A 1 44  ? 0.279   -1.786  0.544   1.00 0.00 ? 44  TRP A CE2  5  
ATOM 9434  C CE3  . TRP A 1 44  ? 1.678   -3.638  -0.113  1.00 0.00 ? 44  TRP A CE3  5  
ATOM 9435  C CZ2  . TRP A 1 44  ? -0.878  -2.523  0.314   1.00 0.00 ? 44  TRP A CZ2  5  
ATOM 9436  C CZ3  . TRP A 1 44  ? 0.527   -4.367  -0.341  1.00 0.00 ? 44  TRP A CZ3  5  
ATOM 9437  C CH2  . TRP A 1 44  ? -0.736  -3.809  -0.128  1.00 0.00 ? 44  TRP A CH2  5  
ATOM 9438  H H    . TRP A 1 44  ? 3.439   0.372   -1.263  1.00 0.00 ? 44  TRP A H    5  
ATOM 9439  H HA   . TRP A 1 44  ? 5.717   -1.236  -0.627  1.00 0.00 ? 44  TRP A HA   5  
ATOM 9440  H HB2  . TRP A 1 44  ? 4.281   -2.311  1.101   1.00 0.00 ? 44  TRP A HB2  5  
ATOM 9441  H HB3  . TRP A 1 44  ? 4.398   -0.565  1.227   1.00 0.00 ? 44  TRP A HB3  5  
ATOM 9442  H HD1  . TRP A 1 44  ? 2.194   0.733   1.371   1.00 0.00 ? 44  TRP A HD1  5  
ATOM 9443  H HE1  . TRP A 1 44  ? -0.289  0.121   1.211   1.00 0.00 ? 44  TRP A HE1  5  
ATOM 9444  H HE3  . TRP A 1 44  ? 2.647   -4.087  -0.283  1.00 0.00 ? 44  TRP A HE3  5  
ATOM 9445  H HZ2  . TRP A 1 44  ? -1.861  -2.106  0.473   1.00 0.00 ? 44  TRP A HZ2  5  
ATOM 9446  H HZ3  . TRP A 1 44  ? 0.597   -5.384  -0.695  1.00 0.00 ? 44  TRP A HZ3  5  
ATOM 9447  H HH2  . TRP A 1 44  ? -1.610  -4.417  -0.319  1.00 0.00 ? 44  TRP A HH2  5  
ATOM 9448  N N    . ILE A 1 45  ? 3.474   -2.587  -2.509  1.00 0.00 ? 45  ILE A N    5  
ATOM 9449  C CA   . ILE A 1 45  ? 3.245   -3.774  -3.333  1.00 0.00 ? 45  ILE A CA   5  
ATOM 9450  C C    . ILE A 1 45  ? 4.473   -4.038  -4.204  1.00 0.00 ? 45  ILE A C    5  
ATOM 9451  O O    . ILE A 1 45  ? 4.858   -5.190  -4.427  1.00 0.00 ? 45  ILE A O    5  
ATOM 9452  C CB   . ILE A 1 45  ? 1.968   -3.664  -4.213  1.00 0.00 ? 45  ILE A CB   5  
ATOM 9453  C CG1  . ILE A 1 45  ? 1.574   -5.050  -4.752  1.00 0.00 ? 45  ILE A CG1  5  
ATOM 9454  C CG2  . ILE A 1 45  ? 2.174   -2.683  -5.366  1.00 0.00 ? 45  ILE A CG2  5  
ATOM 9455  C CD1  . ILE A 1 45  ? 0.269   -5.064  -5.518  1.00 0.00 ? 45  ILE A CD1  5  
ATOM 9456  H H    . ILE A 1 45  ? 2.940   -1.776  -2.660  1.00 0.00 ? 45  ILE A H    5  
ATOM 9457  H HA   . ILE A 1 45  ? 3.117   -4.613  -2.660  1.00 0.00 ? 45  ILE A HA   5  
ATOM 9458  H HB   . ILE A 1 45  ? 1.166   -3.287  -3.595  1.00 0.00 ? 45  ILE A HB   5  
ATOM 9459  H HG12 . ILE A 1 45  ? 2.348   -5.407  -5.417  1.00 0.00 ? 45  ILE A HG12 5  
ATOM 9460  H HG13 . ILE A 1 45  ? 1.478   -5.739  -3.924  1.00 0.00 ? 45  ILE A HG13 5  
ATOM 9461  H HG21 . ILE A 1 45  ? 2.436   -1.712  -4.970  1.00 0.00 ? 45  ILE A HG21 5  
ATOM 9462  H HG22 . ILE A 1 45  ? 1.262   -2.601  -5.939  1.00 0.00 ? 45  ILE A HG22 5  
ATOM 9463  H HG23 . ILE A 1 45  ? 2.969   -3.036  -6.006  1.00 0.00 ? 45  ILE A HG23 5  
ATOM 9464  H HD11 . ILE A 1 45  ? 0.063   -6.067  -5.860  1.00 0.00 ? 45  ILE A HD11 5  
ATOM 9465  H HD12 . ILE A 1 45  ? 0.344   -4.403  -6.369  1.00 0.00 ? 45  ILE A HD12 5  
ATOM 9466  H HD13 . ILE A 1 45  ? -0.532  -4.731  -4.873  1.00 0.00 ? 45  ILE A HD13 5  
ATOM 9467  N N    . ALA A 1 46  ? 5.109   -2.959  -4.669  1.00 0.00 ? 46  ALA A N    5  
ATOM 9468  C CA   . ALA A 1 46  ? 6.369   -3.066  -5.396  1.00 0.00 ? 46  ALA A CA   5  
ATOM 9469  C C    . ALA A 1 46  ? 7.464   -3.588  -4.465  1.00 0.00 ? 46  ALA A C    5  
ATOM 9470  O O    . ALA A 1 46  ? 8.369   -4.317  -4.885  1.00 0.00 ? 46  ALA A O    5  
ATOM 9471  C CB   . ALA A 1 46  ? 6.760   -1.715  -5.987  1.00 0.00 ? 46  ALA A CB   5  
ATOM 9472  H H    . ALA A 1 46  ? 4.713   -2.067  -4.525  1.00 0.00 ? 46  ALA A H    5  
ATOM 9473  H HA   . ALA A 1 46  ? 6.231   -3.767  -6.208  1.00 0.00 ? 46  ALA A HA   5  
ATOM 9474  H HB1  . ALA A 1 46  ? 7.675   -1.818  -6.554  1.00 0.00 ? 46  ALA A HB1  5  
ATOM 9475  H HB2  . ALA A 1 46  ? 6.908   -1.001  -5.191  1.00 0.00 ? 46  ALA A HB2  5  
ATOM 9476  H HB3  . ALA A 1 46  ? 5.971   -1.366  -6.639  1.00 0.00 ? 46  ALA A HB3  5  
ATOM 9477  N N    . CYS A 1 47  ? 7.361   -3.214  -3.192  1.00 0.00 ? 47  CYS A N    5  
ATOM 9478  C CA   . CYS A 1 47  ? 8.294   -3.681  -2.172  1.00 0.00 ? 47  CYS A CA   5  
ATOM 9479  C C    . CYS A 1 47  ? 8.070   -5.166  -1.886  1.00 0.00 ? 47  CYS A C    5  
ATOM 9480  O O    . CYS A 1 47  ? 9.003   -5.884  -1.520  1.00 0.00 ? 47  CYS A O    5  
ATOM 9481  C CB   . CYS A 1 47  ? 8.141   -2.856  -0.889  1.00 0.00 ? 47  CYS A CB   5  
ATOM 9482  S SG   . CYS A 1 47  ? 8.419   -1.083  -1.119  1.00 0.00 ? 47  CYS A SG   5  
ATOM 9483  H H    . CYS A 1 47  ? 6.638   -2.604  -2.932  1.00 0.00 ? 47  CYS A H    5  
ATOM 9484  H HA   . CYS A 1 47  ? 9.296   -3.550  -2.557  1.00 0.00 ? 47  CYS A HA   5  
ATOM 9485  H HB2  . CYS A 1 47  ? 7.141   -2.983  -0.501  1.00 0.00 ? 47  CYS A HB2  5  
ATOM 9486  H HB3  . CYS A 1 47  ? 8.854   -3.206  -0.154  1.00 0.00 ? 47  CYS A HB3  5  
ATOM 9487  H HG   . CYS A 1 47  ? 7.601   -0.662  -2.076  1.00 0.00 ? 47  CYS A HG   5  
ATOM 9488  N N    . GLU A 1 48  ? 6.832   -5.630  -2.064  1.00 0.00 ? 48  GLU A N    5  
ATOM 9489  C CA   . GLU A 1 48  ? 6.521   -7.044  -1.879  1.00 0.00 ? 48  GLU A CA   5  
ATOM 9490  C C    . GLU A 1 48  ? 7.083   -7.868  -3.027  1.00 0.00 ? 48  GLU A C    5  
ATOM 9491  O O    . GLU A 1 48  ? 7.454   -9.025  -2.841  1.00 0.00 ? 48  GLU A O    5  
ATOM 9492  C CB   . GLU A 1 48  ? 5.014   -7.284  -1.728  1.00 0.00 ? 48  GLU A CB   5  
ATOM 9493  C CG   . GLU A 1 48  ? 4.401   -6.539  -0.553  1.00 0.00 ? 48  GLU A CG   5  
ATOM 9494  C CD   . GLU A 1 48  ? 5.186   -6.751  0.729   1.00 0.00 ? 48  GLU A CD   5  
ATOM 9495  O OE1  . GLU A 1 48  ? 5.170   -7.881  1.265   1.00 0.00 ? 48  GLU A OE1  5  
ATOM 9496  O OE2  . GLU A 1 48  ? 5.827   -5.793  1.214   1.00 0.00 ? 48  GLU A OE2  5  
ATOM 9497  H H    . GLU A 1 48  ? 6.115   -5.007  -2.310  1.00 0.00 ? 48  GLU A H    5  
ATOM 9498  H HA   . GLU A 1 48  ? 7.011   -7.361  -0.968  1.00 0.00 ? 48  GLU A HA   5  
ATOM 9499  H HB2  . GLU A 1 48  ? 4.512   -6.972  -2.634  1.00 0.00 ? 48  GLU A HB2  5  
ATOM 9500  H HB3  . GLU A 1 48  ? 4.846   -8.343  -1.576  1.00 0.00 ? 48  GLU A HB3  5  
ATOM 9501  H HG2  . GLU A 1 48  ? 4.378   -5.483  -0.781  1.00 0.00 ? 48  GLU A HG2  5  
ATOM 9502  H HG3  . GLU A 1 48  ? 3.390   -6.894  -0.404  1.00 0.00 ? 48  GLU A HG3  5  
ATOM 9503  N N    . ASP A 1 49  ? 7.159   -7.276  -4.214  1.00 0.00 ? 49  ASP A N    5  
ATOM 9504  C CA   . ASP A 1 49  ? 7.840   -7.929  -5.328  1.00 0.00 ? 49  ASP A CA   5  
ATOM 9505  C C    . ASP A 1 49  ? 9.304   -8.151  -4.958  1.00 0.00 ? 49  ASP A C    5  
ATOM 9506  O O    . ASP A 1 49  ? 9.874   -9.214  -5.211  1.00 0.00 ? 49  ASP A O    5  
ATOM 9507  C CB   . ASP A 1 49  ? 7.741   -7.102  -6.614  1.00 0.00 ? 49  ASP A CB   5  
ATOM 9508  C CG   . ASP A 1 49  ? 8.514   -7.741  -7.759  1.00 0.00 ? 49  ASP A CG   5  
ATOM 9509  O OD1  . ASP A 1 49  ? 8.049   -8.774  -8.292  1.00 0.00 ? 49  ASP A OD1  5  
ATOM 9510  O OD2  . ASP A 1 49  ? 9.599   -7.228  -8.117  1.00 0.00 ? 49  ASP A OD2  5  
ATOM 9511  H H    . ASP A 1 49  ? 6.746   -6.394  -4.343  1.00 0.00 ? 49  ASP A H    5  
ATOM 9512  H HA   . ASP A 1 49  ? 7.370   -8.893  -5.485  1.00 0.00 ? 49  ASP A HA   5  
ATOM 9513  H HB2  . ASP A 1 49  ? 6.702   -7.020  -6.903  1.00 0.00 ? 49  ASP A HB2  5  
ATOM 9514  H HB3  . ASP A 1 49  ? 8.140   -6.114  -6.434  1.00 0.00 ? 49  ASP A HB3  5  
ATOM 9515  N N    . PHE A 1 50  ? 9.889   -7.133  -4.335  1.00 0.00 ? 50  PHE A N    5  
ATOM 9516  C CA   . PHE A 1 50  ? 11.244  -7.218  -3.797  1.00 0.00 ? 50  PHE A CA   5  
ATOM 9517  C C    . PHE A 1 50  ? 11.303  -8.270  -2.689  1.00 0.00 ? 50  PHE A C    5  
ATOM 9518  O O    . PHE A 1 50  ? 12.292  -8.989  -2.551  1.00 0.00 ? 50  PHE A O    5  
ATOM 9519  C CB   . PHE A 1 50  ? 11.676  -5.839  -3.268  1.00 0.00 ? 50  PHE A CB   5  
ATOM 9520  C CG   . PHE A 1 50  ? 12.970  -5.840  -2.490  1.00 0.00 ? 50  PHE A CG   5  
ATOM 9521  C CD1  . PHE A 1 50  ? 14.190  -5.842  -3.146  1.00 0.00 ? 50  PHE A CD1  5  
ATOM 9522  C CD2  . PHE A 1 50  ? 12.962  -5.837  -1.099  1.00 0.00 ? 50  PHE A CD2  5  
ATOM 9523  C CE1  . PHE A 1 50  ? 15.374  -5.841  -2.435  1.00 0.00 ? 50  PHE A CE1  5  
ATOM 9524  C CE2  . PHE A 1 50  ? 14.144  -5.836  -0.386  1.00 0.00 ? 50  PHE A CE2  5  
ATOM 9525  C CZ   . PHE A 1 50  ? 15.351  -5.839  -1.054  1.00 0.00 ? 50  PHE A CZ   5  
ATOM 9526  H H    . PHE A 1 50  ? 9.392   -6.294  -4.232  1.00 0.00 ? 50  PHE A H    5  
ATOM 9527  H HA   . PHE A 1 50  ? 11.902  -7.519  -4.598  1.00 0.00 ? 50  PHE A HA   5  
ATOM 9528  H HB2  . PHE A 1 50  ? 11.796  -5.167  -4.106  1.00 0.00 ? 50  PHE A HB2  5  
ATOM 9529  H HB3  . PHE A 1 50  ? 10.898  -5.454  -2.623  1.00 0.00 ? 50  PHE A HB3  5  
ATOM 9530  H HD1  . PHE A 1 50  ? 14.212  -5.843  -4.227  1.00 0.00 ? 50  PHE A HD1  5  
ATOM 9531  H HD2  . PHE A 1 50  ? 12.016  -5.836  -0.575  1.00 0.00 ? 50  PHE A HD2  5  
ATOM 9532  H HE1  . PHE A 1 50  ? 16.318  -5.842  -2.960  1.00 0.00 ? 50  PHE A HE1  5  
ATOM 9533  H HE2  . PHE A 1 50  ? 14.125  -5.834  0.695   1.00 0.00 ? 50  PHE A HE2  5  
ATOM 9534  H HZ   . PHE A 1 50  ? 16.278  -5.839  -0.498  1.00 0.00 ? 50  PHE A HZ   5  
ATOM 9535  N N    . LYS A 1 51  ? 10.223  -8.358  -1.923  1.00 0.00 ? 51  LYS A N    5  
ATOM 9536  C CA   . LYS A 1 51  ? 10.099  -9.338  -0.844  1.00 0.00 ? 51  LYS A CA   5  
ATOM 9537  C C    . LYS A 1 51  ? 10.229  -10.756 -1.408  1.00 0.00 ? 51  LYS A C    5  
ATOM 9538  O O    . LYS A 1 51  ? 10.685  -11.676 -0.723  1.00 0.00 ? 51  LYS A O    5  
ATOM 9539  C CB   . LYS A 1 51  ? 8.734   -9.173  -0.150  1.00 0.00 ? 51  LYS A CB   5  
ATOM 9540  C CG   . LYS A 1 51  ? 8.700   -9.633  1.302   1.00 0.00 ? 51  LYS A CG   5  
ATOM 9541  C CD   . LYS A 1 51  ? 9.438   -8.659  2.216   1.00 0.00 ? 51  LYS A CD   5  
ATOM 9542  C CE   . LYS A 1 51  ? 8.794   -7.274  2.213   1.00 0.00 ? 51  LYS A CE   5  
ATOM 9543  N NZ   . LYS A 1 51  ? 7.376   -7.314  2.660   1.00 0.00 ? 51  LYS A NZ   5  
ATOM 9544  H H    . LYS A 1 51  ? 9.481   -7.740  -2.083  1.00 0.00 ? 51  LYS A H    5  
ATOM 9545  H HA   . LYS A 1 51  ? 10.891  -9.162  -0.131  1.00 0.00 ? 51  LYS A HA   5  
ATOM 9546  H HB2  . LYS A 1 51  ? 8.456   -8.129  -0.176  1.00 0.00 ? 51  LYS A HB2  5  
ATOM 9547  H HB3  . LYS A 1 51  ? 7.993   -9.739  -0.699  1.00 0.00 ? 51  LYS A HB3  5  
ATOM 9548  H HG2  . LYS A 1 51  ? 7.671   -9.704  1.624   1.00 0.00 ? 51  LYS A HG2  5  
ATOM 9549  H HG3  . LYS A 1 51  ? 9.168   -10.605 1.374   1.00 0.00 ? 51  LYS A HG3  5  
ATOM 9550  H HD2  . LYS A 1 51  ? 9.423   -9.047  3.223   1.00 0.00 ? 51  LYS A HD2  5  
ATOM 9551  H HD3  . LYS A 1 51  ? 10.462  -8.571  1.880   1.00 0.00 ? 51  LYS A HD3  5  
ATOM 9552  H HE2  . LYS A 1 51  ? 9.351   -6.630  2.879   1.00 0.00 ? 51  LYS A HE2  5  
ATOM 9553  H HE3  . LYS A 1 51  ? 8.835   -6.870  1.211   1.00 0.00 ? 51  LYS A HE3  5  
ATOM 9554  H HZ1  . LYS A 1 51  ? 7.315   -7.603  3.656   1.00 0.00 ? 51  LYS A HZ1  5  
ATOM 9555  H HZ2  . LYS A 1 51  ? 6.836   -7.991  2.084   1.00 0.00 ? 51  LYS A HZ2  5  
ATOM 9556  H HZ3  . LYS A 1 51  ? 6.937   -6.376  2.552   1.00 0.00 ? 51  LYS A HZ3  5  
ATOM 9557  N N    . LYS A 1 52  ? 9.819   -10.913 -2.668  1.00 0.00 ? 52  LYS A N    5  
ATOM 9558  C CA   . LYS A 1 52  ? 9.854   -12.206 -3.354  1.00 0.00 ? 52  LYS A CA   5  
ATOM 9559  C C    . LYS A 1 52  ? 11.207  -12.437 -4.023  1.00 0.00 ? 52  LYS A C    5  
ATOM 9560  O O    . LYS A 1 52  ? 11.567  -13.574 -4.342  1.00 0.00 ? 52  LYS A O    5  
ATOM 9561  C CB   . LYS A 1 52  ? 8.753   -12.271 -4.423  1.00 0.00 ? 52  LYS A CB   5  
ATOM 9562  C CG   . LYS A 1 52  ? 7.367   -11.905 -3.908  1.00 0.00 ? 52  LYS A CG   5  
ATOM 9563  C CD   . LYS A 1 52  ? 6.277   -12.074 -4.973  1.00 0.00 ? 52  LYS A CD   5  
ATOM 9564  C CE   . LYS A 1 52  ? 6.372   -11.041 -6.100  1.00 0.00 ? 52  LYS A CE   5  
ATOM 9565  N NZ   . LYS A 1 52  ? 7.580   -11.212 -6.957  1.00 0.00 ? 52  LYS A NZ   5  
ATOM 9566  H H    . LYS A 1 52  ? 9.471   -10.133 -3.149  1.00 0.00 ? 52  LYS A H    5  
ATOM 9567  H HA   . LYS A 1 52  ? 9.683   -12.984 -2.623  1.00 0.00 ? 52  LYS A HA   5  
ATOM 9568  H HB2  . LYS A 1 52  ? 9.005   -11.586 -5.225  1.00 0.00 ? 52  LYS A HB2  5  
ATOM 9569  H HB3  . LYS A 1 52  ? 8.712   -13.279 -4.820  1.00 0.00 ? 52  LYS A HB3  5  
ATOM 9570  H HG2  . LYS A 1 52  ? 7.134   -12.537 -3.066  1.00 0.00 ? 52  LYS A HG2  5  
ATOM 9571  H HG3  . LYS A 1 52  ? 7.380   -10.874 -3.583  1.00 0.00 ? 52  LYS A HG3  5  
ATOM 9572  H HD2  . LYS A 1 52  ? 6.361   -13.060 -5.403  1.00 0.00 ? 52  LYS A HD2  5  
ATOM 9573  H HD3  . LYS A 1 52  ? 5.313   -11.974 -4.495  1.00 0.00 ? 52  LYS A HD3  5  
ATOM 9574  H HE2  . LYS A 1 52  ? 5.495   -11.131 -6.723  1.00 0.00 ? 52  LYS A HE2  5  
ATOM 9575  H HE3  . LYS A 1 52  ? 6.390   -10.054 -5.662  1.00 0.00 ? 52  LYS A HE3  5  
ATOM 9576  H HZ1  . LYS A 1 52  ? 7.604   -12.170 -7.362  1.00 0.00 ? 52  LYS A HZ1  5  
ATOM 9577  H HZ2  . LYS A 1 52  ? 8.447   -11.064 -6.402  1.00 0.00 ? 52  LYS A HZ2  5  
ATOM 9578  H HZ3  . LYS A 1 52  ? 7.566   -10.521 -7.738  1.00 0.00 ? 52  LYS A HZ3  5  
ATOM 9579  N N    . SER A 1 53  ? 11.945  -11.354 -4.239  1.00 0.00 ? 53  SER A N    5  
ATOM 9580  C CA   . SER A 1 53  ? 13.191  -11.406 -4.987  1.00 0.00 ? 53  SER A CA   5  
ATOM 9581  C C    . SER A 1 53  ? 14.298  -12.063 -4.166  1.00 0.00 ? 53  SER A C    5  
ATOM 9582  O O    . SER A 1 53  ? 15.107  -11.389 -3.525  1.00 0.00 ? 53  SER A O    5  
ATOM 9583  C CB   . SER A 1 53  ? 13.590  -9.995  -5.422  1.00 0.00 ? 53  SER A CB   5  
ATOM 9584  O OG   . SER A 1 53  ? 12.520  -9.368  -6.118  1.00 0.00 ? 53  SER A OG   5  
ATOM 9585  H H    . SER A 1 53  ? 11.653  -10.496 -3.869  1.00 0.00 ? 53  SER A H    5  
ATOM 9586  H HA   . SER A 1 53  ? 13.018  -12.005 -5.872  1.00 0.00 ? 53  SER A HA   5  
ATOM 9587  H HB2  . SER A 1 53  ? 13.834  -9.403  -4.551  1.00 0.00 ? 53  SER A HB2  5  
ATOM 9588  H HB3  . SER A 1 53  ? 14.449  -10.046 -6.077  1.00 0.00 ? 53  SER A HB3  5  
ATOM 9589  H HG   . SER A 1 53  ? 11.723  -9.911  -6.033  1.00 0.00 ? 53  SER A HG   5  
ATOM 9590  N N    . LYS A 1 54  ? 14.302  -13.390 -4.169  1.00 0.00 ? 54  LYS A N    5  
ATOM 9591  C CA   . LYS A 1 54  ? 15.317  -14.159 -3.462  1.00 0.00 ? 54  LYS A CA   5  
ATOM 9592  C C    . LYS A 1 54  ? 16.644  -14.148 -4.231  1.00 0.00 ? 54  LYS A C    5  
ATOM 9593  O O    . LYS A 1 54  ? 16.799  -14.806 -5.261  1.00 0.00 ? 54  LYS A O    5  
ATOM 9594  C CB   . LYS A 1 54  ? 14.815  -15.595 -3.164  1.00 0.00 ? 54  LYS A CB   5  
ATOM 9595  C CG   . LYS A 1 54  ? 13.871  -16.204 -4.213  1.00 0.00 ? 54  LYS A CG   5  
ATOM 9596  C CD   . LYS A 1 54  ? 14.591  -16.673 -5.477  1.00 0.00 ? 54  LYS A CD   5  
ATOM 9597  C CE   . LYS A 1 54  ? 15.648  -17.732 -5.174  1.00 0.00 ? 54  LYS A CE   5  
ATOM 9598  N NZ   . LYS A 1 54  ? 15.073  -18.926 -4.501  1.00 0.00 ? 54  LYS A NZ   5  
ATOM 9599  H H    . LYS A 1 54  ? 13.595  -13.861 -4.656  1.00 0.00 ? 54  LYS A H    5  
ATOM 9600  H HA   . LYS A 1 54  ? 15.482  -13.658 -2.515  1.00 0.00 ? 54  LYS A HA   5  
ATOM 9601  H HB2  . LYS A 1 54  ? 15.671  -16.247 -3.069  1.00 0.00 ? 54  LYS A HB2  5  
ATOM 9602  H HB3  . LYS A 1 54  ? 14.291  -15.581 -2.217  1.00 0.00 ? 54  LYS A HB3  5  
ATOM 9603  H HG2  . LYS A 1 54  ? 13.365  -17.053 -3.773  1.00 0.00 ? 54  LYS A HG2  5  
ATOM 9604  H HG3  . LYS A 1 54  ? 13.136  -15.460 -4.487  1.00 0.00 ? 54  LYS A HG3  5  
ATOM 9605  H HD2  . LYS A 1 54  ? 13.865  -17.092 -6.158  1.00 0.00 ? 54  LYS A HD2  5  
ATOM 9606  H HD3  . LYS A 1 54  ? 15.069  -15.823 -5.942  1.00 0.00 ? 54  LYS A HD3  5  
ATOM 9607  H HE2  . LYS A 1 54  ? 16.103  -18.040 -6.103  1.00 0.00 ? 54  LYS A HE2  5  
ATOM 9608  H HE3  . LYS A 1 54  ? 16.403  -17.296 -4.534  1.00 0.00 ? 54  LYS A HE3  5  
ATOM 9609  H HZ1  . LYS A 1 54  ? 14.640  -18.654 -3.596  1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 9610  H HZ2  . LYS A 1 54  ? 15.819  -19.626 -4.315  1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 9611  H HZ3  . LYS A 1 54  ? 14.345  -19.364 -5.102  1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 9612  N N    . GLY A 1 55  ? 17.579  -13.350 -3.738  1.00 0.00 ? 55  GLY A N    5  
ATOM 9613  C CA   . GLY A 1 55  ? 18.892  -13.251 -4.345  1.00 0.00 ? 55  GLY A CA   5  
ATOM 9614  C C    . GLY A 1 55  ? 19.708  -12.152 -3.694  1.00 0.00 ? 55  GLY A C    5  
ATOM 9615  O O    . GLY A 1 55  ? 19.301  -10.991 -3.724  1.00 0.00 ? 55  GLY A O    5  
ATOM 9616  H H    . GLY A 1 55  ? 17.371  -12.804 -2.951  1.00 0.00 ? 55  GLY A H    5  
ATOM 9617  H HA2  . GLY A 1 55  ? 19.404  -14.196 -4.234  1.00 0.00 ? 55  GLY A HA2  5  
ATOM 9618  H HA3  . GLY A 1 55  ? 18.781  -13.030 -5.397  1.00 0.00 ? 55  GLY A HA3  5  
ATOM 9619  N N    . PRO A 1 56  ? 20.870  -12.481 -3.097  1.00 0.00 ? 56  PRO A N    5  
ATOM 9620  C CA   . PRO A 1 56  ? 21.675  -11.514 -2.337  1.00 0.00 ? 56  PRO A CA   5  
ATOM 9621  C C    . PRO A 1 56  ? 22.030  -10.276 -3.163  1.00 0.00 ? 56  PRO A C    5  
ATOM 9622  O O    . PRO A 1 56  ? 21.874  -9.142  -2.700  1.00 0.00 ? 56  PRO A O    5  
ATOM 9623  C CB   . PRO A 1 56  ? 22.941  -12.308 -1.952  1.00 0.00 ? 56  PRO A CB   5  
ATOM 9624  C CG   . PRO A 1 56  ? 22.948  -13.495 -2.859  1.00 0.00 ? 56  PRO A CG   5  
ATOM 9625  C CD   . PRO A 1 56  ? 21.504  -13.811 -3.126  1.00 0.00 ? 56  PRO A CD   5  
ATOM 9626  H HA   . PRO A 1 56  ? 21.160  -11.203 -1.439  1.00 0.00 ? 56  PRO A HA   5  
ATOM 9627  H HB2  . PRO A 1 56  ? 23.819  -11.693 -2.096  1.00 0.00 ? 56  PRO A HB2  5  
ATOM 9628  H HB3  . PRO A 1 56  ? 22.876  -12.607 -0.915  1.00 0.00 ? 56  PRO A HB3  5  
ATOM 9629  H HG2  . PRO A 1 56  ? 23.457  -13.251 -3.783  1.00 0.00 ? 56  PRO A HG2  5  
ATOM 9630  H HG3  . PRO A 1 56  ? 23.432  -14.330 -2.372  1.00 0.00 ? 56  PRO A HG3  5  
ATOM 9631  H HD2  . PRO A 1 56  ? 21.387  -14.275 -4.096  1.00 0.00 ? 56  PRO A HD2  5  
ATOM 9632  H HD3  . PRO A 1 56  ? 21.101  -14.446 -2.349  1.00 0.00 ? 56  PRO A HD3  5  
ATOM 9633  N N    . GLN A 1 57  ? 22.487  -10.497 -4.390  1.00 0.00 ? 57  GLN A N    5  
ATOM 9634  C CA   . GLN A 1 57  ? 22.855  -9.402  -5.279  1.00 0.00 ? 57  GLN A CA   5  
ATOM 9635  C C    . GLN A 1 57  ? 21.610  -8.610  -5.685  1.00 0.00 ? 57  GLN A C    5  
ATOM 9636  O O    . GLN A 1 57  ? 21.663  -7.386  -5.831  1.00 0.00 ? 57  GLN A O    5  
ATOM 9637  C CB   . GLN A 1 57  ? 23.609  -9.920  -6.525  1.00 0.00 ? 57  GLN A CB   5  
ATOM 9638  C CG   . GLN A 1 57  ? 22.735  -10.495 -7.647  1.00 0.00 ? 57  GLN A CG   5  
ATOM 9639  C CD   . GLN A 1 57  ? 22.068  -11.827 -7.320  1.00 0.00 ? 57  GLN A CD   5  
ATOM 9640  O OE1  . GLN A 1 57  ? 21.726  -12.115 -6.177  1.00 0.00 ? 57  GLN A OE1  5  
ATOM 9641  N NE2  . GLN A 1 57  ? 21.872  -12.651 -8.337  1.00 0.00 ? 57  GLN A NE2  5  
ATOM 9642  H H    . GLN A 1 57  ? 22.576  -11.421 -4.704  1.00 0.00 ? 57  GLN A H    5  
ATOM 9643  H HA   . GLN A 1 57  ? 23.512  -8.743  -4.726  1.00 0.00 ? 57  GLN A HA   5  
ATOM 9644  H HB2  . GLN A 1 57  ? 24.180  -9.101  -6.942  1.00 0.00 ? 57  GLN A HB2  5  
ATOM 9645  H HB3  . GLN A 1 57  ? 24.300  -10.691 -6.210  1.00 0.00 ? 57  GLN A HB3  5  
ATOM 9646  H HG2  . GLN A 1 57  ? 21.959  -9.782  -7.874  1.00 0.00 ? 57  GLN A HG2  5  
ATOM 9647  H HG3  . GLN A 1 57  ? 23.355  -10.629 -8.523  1.00 0.00 ? 57  GLN A HG3  5  
ATOM 9648  H HE21 . GLN A 1 57  ? 22.167  -12.363 -9.229  1.00 0.00 ? 57  GLN A HE21 5  
ATOM 9649  H HE22 . GLN A 1 57  ? 21.442  -13.515 -8.160  1.00 0.00 ? 57  GLN A HE22 5  
ATOM 9650  N N    . GLN A 1 58  ? 20.483  -9.315  -5.832  1.00 0.00 ? 58  GLN A N    5  
ATOM 9651  C CA   . GLN A 1 58  ? 19.219  -8.679  -6.199  1.00 0.00 ? 58  GLN A CA   5  
ATOM 9652  C C    . GLN A 1 58  ? 18.796  -7.708  -5.104  1.00 0.00 ? 58  GLN A C    5  
ATOM 9653  O O    . GLN A 1 58  ? 18.326  -6.604  -5.382  1.00 0.00 ? 58  GLN A O    5  
ATOM 9654  C CB   . GLN A 1 58  ? 18.106  -9.720  -6.413  1.00 0.00 ? 58  GLN A CB   5  
ATOM 9655  C CG   . GLN A 1 58  ? 18.452  -10.825 -7.408  1.00 0.00 ? 58  GLN A CG   5  
ATOM 9656  C CD   . GLN A 1 58  ? 18.902  -10.301 -8.765  1.00 0.00 ? 58  GLN A CD   5  
ATOM 9657  O OE1  . GLN A 1 58  ? 18.502  -9.223  -9.202  1.00 0.00 ? 58  GLN A OE1  5  
ATOM 9658  N NE2  . GLN A 1 58  ? 19.734  -11.072 -9.446  1.00 0.00 ? 58  GLN A NE2  5  
ATOM 9659  H H    . GLN A 1 58  ? 20.504  -10.284 -5.676  1.00 0.00 ? 58  GLN A H    5  
ATOM 9660  H HA   . GLN A 1 58  ? 19.373  -8.129  -7.117  1.00 0.00 ? 58  GLN A HA   5  
ATOM 9661  H HB2  . GLN A 1 58  ? 17.880  -10.186 -5.464  1.00 0.00 ? 58  GLN A HB2  5  
ATOM 9662  H HB3  . GLN A 1 58  ? 17.219  -9.212  -6.769  1.00 0.00 ? 58  GLN A HB3  5  
ATOM 9663  H HG2  . GLN A 1 58  ? 19.248  -11.425 -6.990  1.00 0.00 ? 58  GLN A HG2  5  
ATOM 9664  H HG3  . GLN A 1 58  ? 17.577  -11.445 -7.550  1.00 0.00 ? 58  GLN A HG3  5  
ATOM 9665  H HE21 . GLN A 1 58  ? 20.010  -11.925 -9.043  1.00 0.00 ? 58  GLN A HE21 5  
ATOM 9666  H HE22 . GLN A 1 58  ? 20.038  -10.763 -10.325 1.00 0.00 ? 58  GLN A HE22 5  
ATOM 9667  N N    . ILE A 1 59  ? 18.989  -8.133  -3.858  1.00 0.00 ? 59  ILE A N    5  
ATOM 9668  C CA   . ILE A 1 59  ? 18.632  -7.329  -2.694  1.00 0.00 ? 59  ILE A CA   5  
ATOM 9669  C C    . ILE A 1 59  ? 19.288  -5.952  -2.761  1.00 0.00 ? 59  ILE A C    5  
ATOM 9670  O O    . ILE A 1 59  ? 18.651  -4.940  -2.477  1.00 0.00 ? 59  ILE A O    5  
ATOM 9671  C CB   . ILE A 1 59  ? 19.039  -8.035  -1.371  1.00 0.00 ? 59  ILE A CB   5  
ATOM 9672  C CG1  . ILE A 1 59  ? 18.311  -9.386  -1.234  1.00 0.00 ? 59  ILE A CG1  5  
ATOM 9673  C CG2  . ILE A 1 59  ? 18.752  -7.145  -0.162  1.00 0.00 ? 59  ILE A CG2  5  
ATOM 9674  C CD1  . ILE A 1 59  ? 16.800  -9.276  -1.250  1.00 0.00 ? 59  ILE A CD1  5  
ATOM 9675  H H    . ILE A 1 59  ? 19.381  -9.023  -3.717  1.00 0.00 ? 59  ILE A H    5  
ATOM 9676  H HA   . ILE A 1 59  ? 17.558  -7.205  -2.696  1.00 0.00 ? 59  ILE A HA   5  
ATOM 9677  H HB   . ILE A 1 59  ? 20.104  -8.216  -1.404  1.00 0.00 ? 59  ILE A HB   5  
ATOM 9678  H HG12 . ILE A 1 59  ? 18.602  -10.027 -2.053  1.00 0.00 ? 59  ILE A HG12 5  
ATOM 9679  H HG13 . ILE A 1 59  ? 18.600  -9.852  -0.303  1.00 0.00 ? 59  ILE A HG13 5  
ATOM 9680  H HG21 . ILE A 1 59  ? 19.025  -7.666  0.745   1.00 0.00 ? 59  ILE A HG21 5  
ATOM 9681  H HG22 . ILE A 1 59  ? 17.699  -6.902  -0.133  1.00 0.00 ? 59  ILE A HG22 5  
ATOM 9682  H HG23 . ILE A 1 59  ? 19.329  -6.235  -0.240  1.00 0.00 ? 59  ILE A HG23 5  
ATOM 9683  H HD11 . ILE A 1 59  ? 16.474  -8.661  -0.424  1.00 0.00 ? 59  ILE A HD11 5  
ATOM 9684  H HD12 . ILE A 1 59  ? 16.367  -10.261 -1.159  1.00 0.00 ? 59  ILE A HD12 5  
ATOM 9685  H HD13 . ILE A 1 59  ? 16.480  -8.828  -2.179  1.00 0.00 ? 59  ILE A HD13 5  
ATOM 9686  N N    . HIS A 1 60  ? 20.552  -5.918  -3.166  1.00 0.00 ? 60  HIS A N    5  
ATOM 9687  C CA   . HIS A 1 60  ? 21.299  -4.663  -3.233  1.00 0.00 ? 60  HIS A CA   5  
ATOM 9688  C C    . HIS A 1 60  ? 20.742  -3.746  -4.321  1.00 0.00 ? 60  HIS A C    5  
ATOM 9689  O O    . HIS A 1 60  ? 20.343  -2.612  -4.044  1.00 0.00 ? 60  HIS A O    5  
ATOM 9690  C CB   . HIS A 1 60  ? 22.792  -4.923  -3.484  1.00 0.00 ? 60  HIS A CB   5  
ATOM 9691  C CG   . HIS A 1 60  ? 23.519  -5.491  -2.301  1.00 0.00 ? 60  HIS A CG   5  
ATOM 9692  N ND1  . HIS A 1 60  ? 24.485  -4.795  -1.602  1.00 0.00 ? 60  HIS A ND1  5  
ATOM 9693  C CD2  . HIS A 1 60  ? 23.415  -6.694  -1.693  1.00 0.00 ? 60  HIS A CD2  5  
ATOM 9694  C CE1  . HIS A 1 60  ? 24.943  -5.549  -0.621  1.00 0.00 ? 60  HIS A CE1  5  
ATOM 9695  N NE2  . HIS A 1 60  ? 24.310  -6.707  -0.654  1.00 0.00 ? 60  HIS A NE2  5  
ATOM 9696  H H    . HIS A 1 60  ? 20.987  -6.752  -3.441  1.00 0.00 ? 60  HIS A H    5  
ATOM 9697  H HA   . HIS A 1 60  ? 21.189  -4.166  -2.277  1.00 0.00 ? 60  HIS A HA   5  
ATOM 9698  H HB2  . HIS A 1 60  ? 22.895  -5.623  -4.301  1.00 0.00 ? 60  HIS A HB2  5  
ATOM 9699  H HB3  . HIS A 1 60  ? 23.274  -3.993  -3.754  1.00 0.00 ? 60  HIS A HB3  5  
ATOM 9700  H HD1  . HIS A 1 60  ? 24.801  -3.885  -1.807  1.00 0.00 ? 60  HIS A HD1  5  
ATOM 9701  H HD2  . HIS A 1 60  ? 22.747  -7.496  -1.974  1.00 0.00 ? 60  HIS A HD2  5  
ATOM 9702  H HE1  . HIS A 1 60  ? 25.701  -5.263  0.093   1.00 0.00 ? 60  HIS A HE1  5  
ATOM 9703  H HE2  . HIS A 1 60  ? 24.581  -7.507  -0.148  1.00 0.00 ? 60  HIS A HE2  5  
ATOM 9704  N N    . LEU A 1 61  ? 20.687  -4.250  -5.549  1.00 0.00 ? 61  LEU A N    5  
ATOM 9705  C CA   . LEU A 1 61  ? 20.355  -3.415  -6.702  1.00 0.00 ? 61  LEU A CA   5  
ATOM 9706  C C    . LEU A 1 61  ? 18.866  -3.035  -6.745  1.00 0.00 ? 61  LEU A C    5  
ATOM 9707  O O    . LEU A 1 61  ? 18.525  -1.924  -7.162  1.00 0.00 ? 61  LEU A O    5  
ATOM 9708  C CB   . LEU A 1 61  ? 20.818  -4.093  -8.011  1.00 0.00 ? 61  LEU A CB   5  
ATOM 9709  C CG   . LEU A 1 61  ? 20.347  -5.545  -8.245  1.00 0.00 ? 61  LEU A CG   5  
ATOM 9710  C CD1  . LEU A 1 61  ? 18.952  -5.588  -8.862  1.00 0.00 ? 61  LEU A CD1  5  
ATOM 9711  C CD2  . LEU A 1 61  ? 21.343  -6.302  -9.122  1.00 0.00 ? 61  LEU A CD2  5  
ATOM 9712  H H    . LEU A 1 61  ? 20.877  -5.205  -5.686  1.00 0.00 ? 61  LEU A H    5  
ATOM 9713  H HA   . LEU A 1 61  ? 20.919  -2.497  -6.591  1.00 0.00 ? 61  LEU A HA   5  
ATOM 9714  H HB2  . LEU A 1 61  ? 20.476  -3.489  -8.841  1.00 0.00 ? 61  LEU A HB2  5  
ATOM 9715  H HB3  . LEU A 1 61  ? 21.900  -4.086  -8.018  1.00 0.00 ? 61  LEU A HB3  5  
ATOM 9716  H HG   . LEU A 1 61  ? 20.299  -6.054  -7.291  1.00 0.00 ? 61  LEU A HG   5  
ATOM 9717  H HD11 . LEU A 1 61  ? 18.961  -5.082  -9.817  1.00 0.00 ? 61  LEU A HD11 5  
ATOM 9718  H HD12 . LEU A 1 61  ? 18.251  -5.098  -8.203  1.00 0.00 ? 61  LEU A HD12 5  
ATOM 9719  H HD13 . LEU A 1 61  ? 18.650  -6.616  -9.003  1.00 0.00 ? 61  LEU A HD13 5  
ATOM 9720  H HD21 . LEU A 1 61  ? 21.430  -5.811  -10.081 1.00 0.00 ? 61  LEU A HD21 5  
ATOM 9721  H HD22 . LEU A 1 61  ? 20.999  -7.315  -9.268  1.00 0.00 ? 61  LEU A HD22 5  
ATOM 9722  H HD23 . LEU A 1 61  ? 22.310  -6.320  -8.638  1.00 0.00 ? 61  LEU A HD23 5  
ATOM 9723  N N    . LYS A 1 62  ? 17.980  -3.931  -6.302  1.00 0.00 ? 62  LYS A N    5  
ATOM 9724  C CA   . LYS A 1 62  ? 16.543  -3.633  -6.303  1.00 0.00 ? 62  LYS A CA   5  
ATOM 9725  C C    . LYS A 1 62  ? 16.188  -2.685  -5.159  1.00 0.00 ? 62  LYS A C    5  
ATOM 9726  O O    . LYS A 1 62  ? 15.390  -1.762  -5.336  1.00 0.00 ? 62  LYS A O    5  
ATOM 9727  C CB   . LYS A 1 62  ? 15.693  -4.915  -6.219  1.00 0.00 ? 62  LYS A CB   5  
ATOM 9728  C CG   . LYS A 1 62  ? 15.854  -5.840  -7.425  1.00 0.00 ? 62  LYS A CG   5  
ATOM 9729  C CD   . LYS A 1 62  ? 14.793  -6.941  -7.469  1.00 0.00 ? 62  LYS A CD   5  
ATOM 9730  C CE   . LYS A 1 62  ? 13.396  -6.383  -7.746  1.00 0.00 ? 62  LYS A CE   5  
ATOM 9731  N NZ   . LYS A 1 62  ? 12.396  -7.467  -7.957  1.00 0.00 ? 62  LYS A NZ   5  
ATOM 9732  H H    . LYS A 1 62  ? 18.294  -4.797  -5.970  1.00 0.00 ? 62  LYS A H    5  
ATOM 9733  H HA   . LYS A 1 62  ? 16.317  -3.133  -7.236  1.00 0.00 ? 62  LYS A HA   5  
ATOM 9734  H HB2  . LYS A 1 62  ? 15.975  -5.463  -5.330  1.00 0.00 ? 62  LYS A HB2  5  
ATOM 9735  H HB3  . LYS A 1 62  ? 14.650  -4.637  -6.142  1.00 0.00 ? 62  LYS A HB3  5  
ATOM 9736  H HG2  . LYS A 1 62  ? 15.780  -5.251  -8.328  1.00 0.00 ? 62  LYS A HG2  5  
ATOM 9737  H HG3  . LYS A 1 62  ? 16.832  -6.300  -7.378  1.00 0.00 ? 62  LYS A HG3  5  
ATOM 9738  H HD2  . LYS A 1 62  ? 15.050  -7.640  -8.251  1.00 0.00 ? 62  LYS A HD2  5  
ATOM 9739  H HD3  . LYS A 1 62  ? 14.782  -7.454  -6.517  1.00 0.00 ? 62  LYS A HD3  5  
ATOM 9740  H HE2  . LYS A 1 62  ? 13.086  -5.782  -6.905  1.00 0.00 ? 62  LYS A HE2  5  
ATOM 9741  H HE3  . LYS A 1 62  ? 13.435  -5.765  -8.633  1.00 0.00 ? 62  LYS A HE3  5  
ATOM 9742  H HZ1  . LYS A 1 62  ? 12.677  -8.060  -8.767  1.00 0.00 ? 62  LYS A HZ1  5  
ATOM 9743  H HZ2  . LYS A 1 62  ? 11.457  -7.062  -8.148  1.00 0.00 ? 62  LYS A HZ2  5  
ATOM 9744  H HZ3  . LYS A 1 62  ? 12.333  -8.064  -7.112  1.00 0.00 ? 62  LYS A HZ3  5  
ATOM 9745  N N    . ALA A 1 63  ? 16.787  -2.906  -3.989  1.00 0.00 ? 63  ALA A N    5  
ATOM 9746  C CA   . ALA A 1 63  ? 16.565  -2.027  -2.841  1.00 0.00 ? 63  ALA A CA   5  
ATOM 9747  C C    . ALA A 1 63  ? 17.090  -0.629  -3.139  1.00 0.00 ? 63  ALA A C    5  
ATOM 9748  O O    . ALA A 1 63  ? 16.448  0.370   -2.813  1.00 0.00 ? 63  ALA A O    5  
ATOM 9749  C CB   . ALA A 1 63  ? 17.228  -2.585  -1.589  1.00 0.00 ? 63  ALA A CB   5  
ATOM 9750  H H    . ALA A 1 63  ? 17.391  -3.675  -3.895  1.00 0.00 ? 63  ALA A H    5  
ATOM 9751  H HA   . ALA A 1 63  ? 15.498  -1.974  -2.665  1.00 0.00 ? 63  ALA A HA   5  
ATOM 9752  H HB1  . ALA A 1 63  ? 18.298  -2.641  -1.739  1.00 0.00 ? 63  ALA A HB1  5  
ATOM 9753  H HB2  . ALA A 1 63  ? 16.843  -3.575  -1.387  1.00 0.00 ? 63  ALA A HB2  5  
ATOM 9754  H HB3  . ALA A 1 63  ? 17.015  -1.940  -0.749  1.00 0.00 ? 63  ALA A HB3  5  
ATOM 9755  N N    . LYS A 1 64  ? 18.261  -0.574  -3.771  1.00 0.00 ? 64  LYS A N    5  
ATOM 9756  C CA   . LYS A 1 64  ? 18.869  0.689   -4.178  1.00 0.00 ? 64  LYS A CA   5  
ATOM 9757  C C    . LYS A 1 64  ? 17.943  1.422   -5.149  1.00 0.00 ? 64  LYS A C    5  
ATOM 9758  O O    . LYS A 1 64  ? 17.757  2.639   -5.054  1.00 0.00 ? 64  LYS A O    5  
ATOM 9759  C CB   . LYS A 1 64  ? 20.234  0.425   -4.835  1.00 0.00 ? 64  LYS A CB   5  
ATOM 9760  C CG   . LYS A 1 64  ? 21.030  1.686   -5.165  1.00 0.00 ? 64  LYS A CG   5  
ATOM 9761  C CD   . LYS A 1 64  ? 21.482  2.436   -3.908  1.00 0.00 ? 64  LYS A CD   5  
ATOM 9762  C CE   . LYS A 1 64  ? 22.365  1.572   -3.009  1.00 0.00 ? 64  LYS A CE   5  
ATOM 9763  N NZ   . LYS A 1 64  ? 22.977  2.361   -1.906  1.00 0.00 ? 64  LYS A NZ   5  
ATOM 9764  H H    . LYS A 1 64  ? 18.733  -1.412  -3.967  1.00 0.00 ? 64  LYS A H    5  
ATOM 9765  H HA   . LYS A 1 64  ? 19.009  1.296   -3.294  1.00 0.00 ? 64  LYS A HA   5  
ATOM 9766  H HB2  . LYS A 1 64  ? 20.828  -0.182  -4.166  1.00 0.00 ? 64  LYS A HB2  5  
ATOM 9767  H HB3  . LYS A 1 64  ? 20.077  -0.125  -5.754  1.00 0.00 ? 64  LYS A HB3  5  
ATOM 9768  H HG2  . LYS A 1 64  ? 21.904  1.410   -5.738  1.00 0.00 ? 64  LYS A HG2  5  
ATOM 9769  H HG3  . LYS A 1 64  ? 20.408  2.343   -5.759  1.00 0.00 ? 64  LYS A HG3  5  
ATOM 9770  H HD2  . LYS A 1 64  ? 22.041  3.311   -4.206  1.00 0.00 ? 64  LYS A HD2  5  
ATOM 9771  H HD3  . LYS A 1 64  ? 20.608  2.742   -3.350  1.00 0.00 ? 64  LYS A HD3  5  
ATOM 9772  H HE2  . LYS A 1 64  ? 21.764  0.783   -2.580  1.00 0.00 ? 64  LYS A HE2  5  
ATOM 9773  H HE3  . LYS A 1 64  ? 23.154  1.136   -3.607  1.00 0.00 ? 64  LYS A HE3  5  
ATOM 9774  H HZ1  . LYS A 1 64  ? 23.399  1.727   -1.197  1.00 0.00 ? 64  LYS A HZ1  5  
ATOM 9775  H HZ2  . LYS A 1 64  ? 22.262  2.956   -1.443  1.00 0.00 ? 64  LYS A HZ2  5  
ATOM 9776  H HZ3  . LYS A 1 64  ? 23.725  2.977   -2.283  1.00 0.00 ? 64  LYS A HZ3  5  
ATOM 9777  N N    . ALA A 1 65  ? 17.352  0.659   -6.066  1.00 0.00 ? 65  ALA A N    5  
ATOM 9778  C CA   . ALA A 1 65  ? 16.426  1.201   -7.054  1.00 0.00 ? 65  ALA A CA   5  
ATOM 9779  C C    . ALA A 1 65  ? 15.207  1.830   -6.374  1.00 0.00 ? 65  ALA A C    5  
ATOM 9780  O O    . ALA A 1 65  ? 14.830  2.964   -6.677  1.00 0.00 ? 65  ALA A O    5  
ATOM 9781  C CB   . ALA A 1 65  ? 15.995  0.106   -8.025  1.00 0.00 ? 65  ALA A CB   5  
ATOM 9782  H H    . ALA A 1 65  ? 17.550  -0.300  -6.081  1.00 0.00 ? 65  ALA A H    5  
ATOM 9783  H HA   . ALA A 1 65  ? 16.946  1.965   -7.617  1.00 0.00 ? 65  ALA A HA   5  
ATOM 9784  H HB1  . ALA A 1 65  ? 16.870  -0.321  -8.495  1.00 0.00 ? 65  ALA A HB1  5  
ATOM 9785  H HB2  . ALA A 1 65  ? 15.350  0.526   -8.783  1.00 0.00 ? 65  ALA A HB2  5  
ATOM 9786  H HB3  . ALA A 1 65  ? 15.464  -0.666  -7.487  1.00 0.00 ? 65  ALA A HB3  5  
ATOM 9787  N N    . ILE A 1 66  ? 14.600  1.085   -5.450  1.00 0.00 ? 66  ILE A N    5  
ATOM 9788  C CA   . ILE A 1 66  ? 13.443  1.576   -4.699  1.00 0.00 ? 66  ILE A CA   5  
ATOM 9789  C C    . ILE A 1 66  ? 13.844  2.761   -3.819  1.00 0.00 ? 66  ILE A C    5  
ATOM 9790  O O    . ILE A 1 66  ? 13.080  3.714   -3.642  1.00 0.00 ? 66  ILE A O    5  
ATOM 9791  C CB   . ILE A 1 66  ? 12.828  0.457   -3.815  1.00 0.00 ? 66  ILE A CB   5  
ATOM 9792  C CG1  . ILE A 1 66  ? 12.367  -0.726  -4.687  1.00 0.00 ? 66  ILE A CG1  5  
ATOM 9793  C CG2  . ILE A 1 66  ? 11.664  0.999   -2.979  1.00 0.00 ? 66  ILE A CG2  5  
ATOM 9794  C CD1  . ILE A 1 66  ? 11.790  -1.885  -3.897  1.00 0.00 ? 66  ILE A CD1  5  
ATOM 9795  H H    . ILE A 1 66  ? 14.937  0.181   -5.270  1.00 0.00 ? 66  ILE A H    5  
ATOM 9796  H HA   . ILE A 1 66  ? 12.694  1.902   -5.410  1.00 0.00 ? 66  ILE A HA   5  
ATOM 9797  H HB   . ILE A 1 66  ? 13.594  0.110   -3.134  1.00 0.00 ? 66  ILE A HB   5  
ATOM 9798  H HG12 . ILE A 1 66  ? 11.605  -0.387  -5.374  1.00 0.00 ? 66  ILE A HG12 5  
ATOM 9799  H HG13 . ILE A 1 66  ? 13.210  -1.099  -5.253  1.00 0.00 ? 66  ILE A HG13 5  
ATOM 9800  H HG21 . ILE A 1 66  ? 11.252  0.203   -2.372  1.00 0.00 ? 66  ILE A HG21 5  
ATOM 9801  H HG22 . ILE A 1 66  ? 10.896  1.383   -3.634  1.00 0.00 ? 66  ILE A HG22 5  
ATOM 9802  H HG23 . ILE A 1 66  ? 12.017  1.793   -2.336  1.00 0.00 ? 66  ILE A HG23 5  
ATOM 9803  H HD11 . ILE A 1 66  ? 12.529  -2.251  -3.200  1.00 0.00 ? 66  ILE A HD11 5  
ATOM 9804  H HD12 . ILE A 1 66  ? 11.512  -2.679  -4.574  1.00 0.00 ? 66  ILE A HD12 5  
ATOM 9805  H HD13 . ILE A 1 66  ? 10.916  -1.553  -3.356  1.00 0.00 ? 66  ILE A HD13 5  
ATOM 9806  N N    . TYR A 1 67  ? 15.060  2.697   -3.291  1.00 0.00 ? 67  TYR A N    5  
ATOM 9807  C CA   . TYR A 1 67  ? 15.589  3.733   -2.414  1.00 0.00 ? 67  TYR A CA   5  
ATOM 9808  C C    . TYR A 1 67  ? 15.585  5.091   -3.112  1.00 0.00 ? 67  TYR A C    5  
ATOM 9809  O O    . TYR A 1 67  ? 14.869  6.008   -2.703  1.00 0.00 ? 67  TYR A O    5  
ATOM 9810  C CB   . TYR A 1 67  ? 17.012  3.360   -1.967  1.00 0.00 ? 67  TYR A CB   5  
ATOM 9811  C CG   . TYR A 1 67  ? 17.688  4.388   -1.074  1.00 0.00 ? 67  TYR A CG   5  
ATOM 9812  C CD1  . TYR A 1 67  ? 17.236  4.621   0.220   1.00 0.00 ? 67  TYR A CD1  5  
ATOM 9813  C CD2  . TYR A 1 67  ? 18.786  5.118   -1.524  1.00 0.00 ? 67  TYR A CD2  5  
ATOM 9814  C CE1  . TYR A 1 67  ? 17.855  5.548   1.036   1.00 0.00 ? 67  TYR A CE1  5  
ATOM 9815  C CE2  . TYR A 1 67  ? 19.411  6.044   -0.712  1.00 0.00 ? 67  TYR A CE2  5  
ATOM 9816  C CZ   . TYR A 1 67  ? 18.942  6.257   0.566   1.00 0.00 ? 67  TYR A CZ   5  
ATOM 9817  O OH   . TYR A 1 67  ? 19.564  7.177   1.379   1.00 0.00 ? 67  TYR A OH   5  
ATOM 9818  H H    . TYR A 1 67  ? 15.623  1.922   -3.501  1.00 0.00 ? 67  TYR A H    5  
ATOM 9819  H HA   . TYR A 1 67  ? 14.952  3.786   -1.543  1.00 0.00 ? 67  TYR A HA   5  
ATOM 9820  H HB2  . TYR A 1 67  ? 16.972  2.428   -1.420  1.00 0.00 ? 67  TYR A HB2  5  
ATOM 9821  H HB3  . TYR A 1 67  ? 17.627  3.223   -2.845  1.00 0.00 ? 67  TYR A HB3  5  
ATOM 9822  H HD1  . TYR A 1 67  ? 16.385  4.066   0.588   1.00 0.00 ? 67  TYR A HD1  5  
ATOM 9823  H HD2  . TYR A 1 67  ? 19.153  4.950   -2.528  1.00 0.00 ? 67  TYR A HD2  5  
ATOM 9824  H HE1  . TYR A 1 67  ? 17.488  5.715   2.039   1.00 0.00 ? 67  TYR A HE1  5  
ATOM 9825  H HE2  . TYR A 1 67  ? 20.261  6.600   -1.082  1.00 0.00 ? 67  TYR A HE2  5  
ATOM 9826  H HH   . TYR A 1 67  ? 19.869  7.921   0.851   1.00 0.00 ? 67  TYR A HH   5  
ATOM 9827  N N    . GLU A 1 68  ? 16.353  5.193   -4.188  1.00 0.00 ? 68  GLU A N    5  
ATOM 9828  C CA   . GLU A 1 68  ? 16.558  6.464   -4.878  1.00 0.00 ? 68  GLU A CA   5  
ATOM 9829  C C    . GLU A 1 68  ? 15.287  6.943   -5.582  1.00 0.00 ? 68  GLU A C    5  
ATOM 9830  O O    . GLU A 1 68  ? 15.077  8.148   -5.736  1.00 0.00 ? 68  GLU A O    5  
ATOM 9831  C CB   . GLU A 1 68  ? 17.702  6.334   -5.896  1.00 0.00 ? 68  GLU A CB   5  
ATOM 9832  C CG   . GLU A 1 68  ? 19.015  5.854   -5.286  1.00 0.00 ? 68  GLU A CG   5  
ATOM 9833  C CD   . GLU A 1 68  ? 20.160  5.840   -6.287  1.00 0.00 ? 68  GLU A CD   5  
ATOM 9834  O OE1  . GLU A 1 68  ? 20.319  4.833   -7.013  1.00 0.00 ? 68  GLU A OE1  5  
ATOM 9835  O OE2  . GLU A 1 68  ? 20.910  6.837   -6.356  1.00 0.00 ? 68  GLU A OE2  5  
ATOM 9836  H H    . GLU A 1 68  ? 16.798  4.387   -4.533  1.00 0.00 ? 68  GLU A H    5  
ATOM 9837  H HA   . GLU A 1 68  ? 16.839  7.199   -4.136  1.00 0.00 ? 68  GLU A HA   5  
ATOM 9838  H HB2  . GLU A 1 68  ? 17.407  5.631   -6.663  1.00 0.00 ? 68  GLU A HB2  5  
ATOM 9839  H HB3  . GLU A 1 68  ? 17.874  7.299   -6.353  1.00 0.00 ? 68  GLU A HB3  5  
ATOM 9840  H HG2  . GLU A 1 68  ? 19.277  6.509   -4.468  1.00 0.00 ? 68  GLU A HG2  5  
ATOM 9841  H HG3  . GLU A 1 68  ? 18.875  4.849   -4.906  1.00 0.00 ? 68  GLU A HG3  5  
ATOM 9842  N N    . LYS A 1 69  ? 14.439  6.006   -6.005  1.00 0.00 ? 69  LYS A N    5  
ATOM 9843  C CA   . LYS A 1 69  ? 13.276  6.346   -6.826  1.00 0.00 ? 69  LYS A CA   5  
ATOM 9844  C C    . LYS A 1 69  ? 12.007  6.537   -5.987  1.00 0.00 ? 69  LYS A C    5  
ATOM 9845  O O    . LYS A 1 69  ? 11.033  7.136   -6.459  1.00 0.00 ? 69  LYS A O    5  
ATOM 9846  C CB   . LYS A 1 69  ? 13.054  5.267   -7.898  1.00 0.00 ? 69  LYS A CB   5  
ATOM 9847  C CG   . LYS A 1 69  ? 11.947  5.595   -8.900  1.00 0.00 ? 69  LYS A CG   5  
ATOM 9848  C CD   . LYS A 1 69  ? 11.908  4.584   -10.045 1.00 0.00 ? 69  LYS A CD   5  
ATOM 9849  C CE   . LYS A 1 69  ? 10.830  4.915   -11.071 1.00 0.00 ? 69  LYS A CE   5  
ATOM 9850  N NZ   . LYS A 1 69  ? 9.459   4.770   -10.516 1.00 0.00 ? 69  LYS A NZ   5  
ATOM 9851  H H    . LYS A 1 69  ? 14.604  5.068   -5.769  1.00 0.00 ? 69  LYS A H    5  
ATOM 9852  H HA   . LYS A 1 69  ? 13.492  7.281   -7.327  1.00 0.00 ? 69  LYS A HA   5  
ATOM 9853  H HB2  . LYS A 1 69  ? 13.975  5.129   -8.446  1.00 0.00 ? 69  LYS A HB2  5  
ATOM 9854  H HB3  . LYS A 1 69  ? 12.800  4.337   -7.407  1.00 0.00 ? 69  LYS A HB3  5  
ATOM 9855  H HG2  . LYS A 1 69  ? 10.994  5.580   -8.388  1.00 0.00 ? 69  LYS A HG2  5  
ATOM 9856  H HG3  . LYS A 1 69  ? 12.122  6.580   -9.307  1.00 0.00 ? 69  LYS A HG3  5  
ATOM 9857  H HD2  . LYS A 1 69  ? 12.869  4.582   -10.540 1.00 0.00 ? 69  LYS A HD2  5  
ATOM 9858  H HD3  . LYS A 1 69  ? 11.713  3.603   -9.637  1.00 0.00 ? 69  LYS A HD3  5  
ATOM 9859  H HE2  . LYS A 1 69  ? 10.965  5.933   -11.404 1.00 0.00 ? 69  LYS A HE2  5  
ATOM 9860  H HE3  . LYS A 1 69  ? 10.938  4.246   -11.915 1.00 0.00 ? 69  LYS A HE3  5  
ATOM 9861  H HZ1  . LYS A 1 69  ? 9.314   3.796   -10.178 1.00 0.00 ? 69  LYS A HZ1  5  
ATOM 9862  H HZ2  . LYS A 1 69  ? 8.753   4.975   -11.254 1.00 0.00 ? 69  LYS A HZ2  5  
ATOM 9863  H HZ3  . LYS A 1 69  ? 9.318   5.427   -9.727  1.00 0.00 ? 69  LYS A HZ3  5  
ATOM 9864  N N    . PHE A 1 70  ? 12.007  6.049   -4.748  1.00 0.00 ? 70  PHE A N    5  
ATOM 9865  C CA   . PHE A 1 70  ? 10.812  6.135   -3.900  1.00 0.00 ? 70  PHE A CA   5  
ATOM 9866  C C    . PHE A 1 70  ? 11.135  6.630   -2.491  1.00 0.00 ? 70  PHE A C    5  
ATOM 9867  O O    . PHE A 1 70  ? 10.511  7.575   -2.000  1.00 0.00 ? 70  PHE A O    5  
ATOM 9868  C CB   . PHE A 1 70  ? 10.114  4.768   -3.811  1.00 0.00 ? 70  PHE A CB   5  
ATOM 9869  C CG   . PHE A 1 70  ? 9.582   4.252   -5.128  1.00 0.00 ? 70  PHE A CG   5  
ATOM 9870  C CD1  . PHE A 1 70  ? 8.355   4.682   -5.611  1.00 0.00 ? 70  PHE A CD1  5  
ATOM 9871  C CD2  . PHE A 1 70  ? 10.307  3.337   -5.878  1.00 0.00 ? 70  PHE A CD2  5  
ATOM 9872  C CE1  . PHE A 1 70  ? 7.863   4.210   -6.814  1.00 0.00 ? 70  PHE A CE1  5  
ATOM 9873  C CE2  . PHE A 1 70  ? 9.819   2.862   -7.081  1.00 0.00 ? 70  PHE A CE2  5  
ATOM 9874  C CZ   . PHE A 1 70  ? 8.595   3.300   -7.549  1.00 0.00 ? 70  PHE A CZ   5  
ATOM 9875  H H    . PHE A 1 70  ? 12.818  5.621   -4.398  1.00 0.00 ? 70  PHE A H    5  
ATOM 9876  H HA   . PHE A 1 70  ? 10.135  6.841   -4.359  1.00 0.00 ? 70  PHE A HA   5  
ATOM 9877  H HB2  . PHE A 1 70  ? 10.817  4.039   -3.430  1.00 0.00 ? 70  PHE A HB2  5  
ATOM 9878  H HB3  . PHE A 1 70  ? 9.282   4.841   -3.123  1.00 0.00 ? 70  PHE A HB3  5  
ATOM 9879  H HD1  . PHE A 1 70  ? 7.779   5.394   -5.039  1.00 0.00 ? 70  PHE A HD1  5  
ATOM 9880  H HD2  . PHE A 1 70  ? 11.265  2.993   -5.514  1.00 0.00 ? 70  PHE A HD2  5  
ATOM 9881  H HE1  . PHE A 1 70  ? 6.905   4.554   -7.178  1.00 0.00 ? 70  PHE A HE1  5  
ATOM 9882  H HE2  . PHE A 1 70  ? 10.394  2.149   -7.654  1.00 0.00 ? 70  PHE A HE2  5  
ATOM 9883  H HZ   . PHE A 1 70  ? 8.213   2.929   -8.488  1.00 0.00 ? 70  PHE A HZ   5  
ATOM 9884  N N    . ILE A 1 71  ? 12.102  5.987   -1.841  1.00 0.00 ? 71  ILE A N    5  
ATOM 9885  C CA   . ILE A 1 71  ? 12.390  6.249   -0.430  1.00 0.00 ? 71  ILE A CA   5  
ATOM 9886  C C    . ILE A 1 71  ? 12.946  7.659   -0.226  1.00 0.00 ? 71  ILE A C    5  
ATOM 9887  O O    . ILE A 1 71  ? 12.531  8.379   0.691   1.00 0.00 ? 71  ILE A O    5  
ATOM 9888  C CB   . ILE A 1 71  ? 13.398  5.215   0.140   1.00 0.00 ? 71  ILE A CB   5  
ATOM 9889  C CG1  . ILE A 1 71  ? 12.858  3.781   -0.015  1.00 0.00 ? 71  ILE A CG1  5  
ATOM 9890  C CG2  . ILE A 1 71  ? 13.719  5.512   1.606   1.00 0.00 ? 71  ILE A CG2  5  
ATOM 9891  C CD1  . ILE A 1 71  ? 11.564  3.526   0.729   1.00 0.00 ? 71  ILE A CD1  5  
ATOM 9892  H H    . ILE A 1 71  ? 12.645  5.326   -2.325  1.00 0.00 ? 71  ILE A H    5  
ATOM 9893  H HA   . ILE A 1 71  ? 11.463  6.156   0.121   1.00 0.00 ? 71  ILE A HA   5  
ATOM 9894  H HB   . ILE A 1 71  ? 14.317  5.303   -0.424  1.00 0.00 ? 71  ILE A HB   5  
ATOM 9895  H HG12 . ILE A 1 71  ? 12.681  3.581   -1.062  1.00 0.00 ? 71  ILE A HG12 5  
ATOM 9896  H HG13 . ILE A 1 71  ? 13.596  3.083   0.357   1.00 0.00 ? 71  ILE A HG13 5  
ATOM 9897  H HG21 . ILE A 1 71  ? 14.430  4.786   1.973   1.00 0.00 ? 71  ILE A HG21 5  
ATOM 9898  H HG22 . ILE A 1 71  ? 12.815  5.460   2.194   1.00 0.00 ? 71  ILE A HG22 5  
ATOM 9899  H HG23 . ILE A 1 71  ? 14.144  6.503   1.689   1.00 0.00 ? 71  ILE A HG23 5  
ATOM 9900  H HD11 . ILE A 1 71  ? 11.711  3.706   1.784   1.00 0.00 ? 71  ILE A HD11 5  
ATOM 9901  H HD12 . ILE A 1 71  ? 11.259  2.500   0.580   1.00 0.00 ? 71  ILE A HD12 5  
ATOM 9902  H HD13 . ILE A 1 71  ? 10.795  4.187   0.355   1.00 0.00 ? 71  ILE A HD13 5  
ATOM 9903  N N    . GLN A 1 72  ? 13.869  8.048   -1.095  1.00 0.00 ? 72  GLN A N    5  
ATOM 9904  C CA   . GLN A 1 72  ? 14.574  9.317   -0.963  1.00 0.00 ? 72  GLN A CA   5  
ATOM 9905  C C    . GLN A 1 72  ? 13.650  10.492  -1.295  1.00 0.00 ? 72  GLN A C    5  
ATOM 9906  O O    . GLN A 1 72  ? 12.796  10.390  -2.172  1.00 0.00 ? 72  GLN A O    5  
ATOM 9907  C CB   . GLN A 1 72  ? 15.807  9.318   -1.884  1.00 0.00 ? 72  GLN A CB   5  
ATOM 9908  C CG   . GLN A 1 72  ? 16.629  10.598  -1.816  1.00 0.00 ? 72  GLN A CG   5  
ATOM 9909  C CD   . GLN A 1 72  ? 17.160  10.878  -0.421  1.00 0.00 ? 72  GLN A CD   5  
ATOM 9910  O OE1  . GLN A 1 72  ? 16.492  11.517  0.392   1.00 0.00 ? 72  GLN A OE1  5  
ATOM 9911  N NE2  . GLN A 1 72  ? 18.365  10.410  -0.134  1.00 0.00 ? 72  GLN A NE2  5  
ATOM 9912  H H    . GLN A 1 72  ? 14.070  7.473   -1.863  1.00 0.00 ? 72  GLN A H    5  
ATOM 9913  H HA   . GLN A 1 72  ? 14.902  9.410   0.063   1.00 0.00 ? 72  GLN A HA   5  
ATOM 9914  H HB2  . GLN A 1 72  ? 16.448  8.491   -1.606  1.00 0.00 ? 72  GLN A HB2  5  
ATOM 9915  H HB3  . GLN A 1 72  ? 15.480  9.180   -2.906  1.00 0.00 ? 72  GLN A HB3  5  
ATOM 9916  H HG2  . GLN A 1 72  ? 17.466  10.512  -2.495  1.00 0.00 ? 72  GLN A HG2  5  
ATOM 9917  H HG3  . GLN A 1 72  ? 16.003  11.425  -2.123  1.00 0.00 ? 72  GLN A HG3  5  
ATOM 9918  H HE21 . GLN A 1 72  ? 18.848  9.915   -0.828  1.00 0.00 ? 72  GLN A HE21 5  
ATOM 9919  H HE22 . GLN A 1 72  ? 18.730  10.586  0.761   1.00 0.00 ? 72  GLN A HE22 5  
ATOM 9920  N N    . THR A 1 73  ? 13.839  11.608  -0.592  1.00 0.00 ? 73  THR A N    5  
ATOM 9921  C CA   . THR A 1 73  ? 13.049  12.822  -0.811  1.00 0.00 ? 73  THR A CA   5  
ATOM 9922  C C    . THR A 1 73  ? 13.667  13.667  -1.941  1.00 0.00 ? 73  THR A C    5  
ATOM 9923  O O    . THR A 1 73  ? 13.525  14.894  -1.993  1.00 0.00 ? 73  THR A O    5  
ATOM 9924  C CB   . THR A 1 73  ? 12.955  13.636  0.503   1.00 0.00 ? 73  THR A CB   5  
ATOM 9925  O OG1  . THR A 1 73  ? 12.594  12.755  1.581   1.00 0.00 ? 73  THR A OG1  5  
ATOM 9926  C CG2  . THR A 1 73  ? 11.916  14.755  0.404   1.00 0.00 ? 73  THR A CG2  5  
ATOM 9927  H H    . THR A 1 73  ? 14.529  11.618  0.105   1.00 0.00 ? 73  THR A H    5  
ATOM 9928  H HA   . THR A 1 73  ? 12.049  12.524  -1.103  1.00 0.00 ? 73  THR A HA   5  
ATOM 9929  H HB   . THR A 1 73  ? 13.922  14.074  0.715   1.00 0.00 ? 73  THR A HB   5  
ATOM 9930  H HG1  . THR A 1 73  ? 11.757  13.043  1.962   1.00 0.00 ? 73  THR A HG1  5  
ATOM 9931  H HG21 . THR A 1 73  ? 11.857  15.279  1.347   1.00 0.00 ? 73  THR A HG21 5  
ATOM 9932  H HG22 . THR A 1 73  ? 10.950  14.333  0.167   1.00 0.00 ? 73  THR A HG22 5  
ATOM 9933  H HG23 . THR A 1 73  ? 12.204  15.449  -0.374  1.00 0.00 ? 73  THR A HG23 5  
ATOM 9934  N N    . ASP A 1 74  ? 14.357  12.982  -2.850  1.00 0.00 ? 74  ASP A N    5  
ATOM 9935  C CA   . ASP A 1 74  ? 14.910  13.586  -4.063  1.00 0.00 ? 74  ASP A CA   5  
ATOM 9936  C C    . ASP A 1 74  ? 14.472  12.746  -5.258  1.00 0.00 ? 74  ASP A C    5  
ATOM 9937  O O    . ASP A 1 74  ? 15.070  12.801  -6.337  1.00 0.00 ? 74  ASP A O    5  
ATOM 9938  C CB   . ASP A 1 74  ? 16.448  13.644  -4.002  1.00 0.00 ? 74  ASP A CB   5  
ATOM 9939  C CG   . ASP A 1 74  ? 16.975  14.569  -2.914  1.00 0.00 ? 74  ASP A CG   5  
ATOM 9940  O OD1  . ASP A 1 74  ? 17.098  15.786  -3.167  1.00 0.00 ? 74  ASP A OD1  5  
ATOM 9941  O OD2  . ASP A 1 74  ? 17.282  14.085  -1.804  1.00 0.00 ? 74  ASP A OD2  5  
ATOM 9942  H H    . ASP A 1 74  ? 14.494  12.027  -2.704  1.00 0.00 ? 74  ASP A H    5  
ATOM 9943  H HA   . ASP A 1 74  ? 14.510  14.586  -4.166  1.00 0.00 ? 74  ASP A HA   5  
ATOM 9944  H HB2  . ASP A 1 74  ? 16.830  12.650  -3.816  1.00 0.00 ? 74  ASP A HB2  5  
ATOM 9945  H HB3  . ASP A 1 74  ? 16.825  13.990  -4.957  1.00 0.00 ? 74  ASP A HB3  5  
ATOM 9946  N N    . ALA A 1 75  ? 13.403  11.986  -5.048  1.00 0.00 ? 75  ALA A N    5  
ATOM 9947  C CA   . ALA A 1 75  ? 12.943  10.979  -5.995  1.00 0.00 ? 75  ALA A CA   5  
ATOM 9948  C C    . ALA A 1 75  ? 12.017  11.577  -7.057  1.00 0.00 ? 75  ALA A C    5  
ATOM 9949  O O    . ALA A 1 75  ? 11.430  12.642  -6.855  1.00 0.00 ? 75  ALA A O    5  
ATOM 9950  C CB   . ALA A 1 75  ? 12.226  9.869   -5.233  1.00 0.00 ? 75  ALA A CB   5  
ATOM 9951  H H    . ALA A 1 75  ? 12.883  12.122  -4.224  1.00 0.00 ? 75  ALA A H    5  
ATOM 9952  H HA   . ALA A 1 75  ? 13.809  10.548  -6.480  1.00 0.00 ? 75  ALA A HA   5  
ATOM 9953  H HB1  . ALA A 1 75  ? 11.915  9.097   -5.922  1.00 0.00 ? 75  ALA A HB1  5  
ATOM 9954  H HB2  . ALA A 1 75  ? 11.358  10.275  -4.733  1.00 0.00 ? 75  ALA A HB2  5  
ATOM 9955  H HB3  . ALA A 1 75  ? 12.896  9.445   -4.499  1.00 0.00 ? 75  ALA A HB3  5  
ATOM 9956  N N    . PRO A 1 76  ? 11.865  10.888  -8.208  1.00 0.00 ? 76  PRO A N    5  
ATOM 9957  C CA   . PRO A 1 76  ? 10.963  11.316  -9.280  1.00 0.00 ? 76  PRO A CA   5  
ATOM 9958  C C    . PRO A 1 76  ? 9.530   10.822  -9.055  1.00 0.00 ? 76  PRO A C    5  
ATOM 9959  O O    . PRO A 1 76  ? 8.687   10.889  -9.954  1.00 0.00 ? 76  PRO A O    5  
ATOM 9960  C CB   . PRO A 1 76  ? 11.586  10.656  -10.513 1.00 0.00 ? 76  PRO A CB   5  
ATOM 9961  C CG   . PRO A 1 76  ? 12.163  9.379   -10.000 1.00 0.00 ? 76  PRO A CG   5  
ATOM 9962  C CD   . PRO A 1 76  ? 12.576  9.640   -8.567  1.00 0.00 ? 76  PRO A CD   5  
ATOM 9963  H HA   . PRO A 1 76  ? 10.962  12.391  -9.399  1.00 0.00 ? 76  PRO A HA   5  
ATOM 9964  H HB2  . PRO A 1 76  ? 10.825  10.481  -11.261 1.00 0.00 ? 76  PRO A HB2  5  
ATOM 9965  H HB3  . PRO A 1 76  ? 12.353  11.299  -10.918 1.00 0.00 ? 76  PRO A HB3  5  
ATOM 9966  H HG2  . PRO A 1 76  ? 11.416  8.597   -10.038 1.00 0.00 ? 76  PRO A HG2  5  
ATOM 9967  H HG3  . PRO A 1 76  ? 13.023  9.100   -10.593 1.00 0.00 ? 76  PRO A HG3  5  
ATOM 9968  H HD2  . PRO A 1 76  ? 12.262  8.825   -7.930  1.00 0.00 ? 76  PRO A HD2  5  
ATOM 9969  H HD3  . PRO A 1 76  ? 13.647  9.776   -8.499  1.00 0.00 ? 76  PRO A HD3  5  
ATOM 9970  N N    . LYS A 1 77  ? 9.269   10.313  -7.851  1.00 0.00 ? 77  LYS A N    5  
ATOM 9971  C CA   . LYS A 1 77  ? 7.937   9.833   -7.478  1.00 0.00 ? 77  LYS A CA   5  
ATOM 9972  C C    . LYS A 1 77  ? 7.499   10.463  -6.159  1.00 0.00 ? 77  LYS A C    5  
ATOM 9973  O O    . LYS A 1 77  ? 6.359   10.906  -6.027  1.00 0.00 ? 77  LYS A O    5  
ATOM 9974  C CB   . LYS A 1 77  ? 7.928   8.302   -7.356  1.00 0.00 ? 77  LYS A CB   5  
ATOM 9975  C CG   . LYS A 1 77  ? 6.547   7.683   -7.088  1.00 0.00 ? 77  LYS A CG   5  
ATOM 9976  C CD   . LYS A 1 77  ? 5.690   7.560   -8.356  1.00 0.00 ? 77  LYS A CD   5  
ATOM 9977  C CE   . LYS A 1 77  ? 5.016   8.872   -8.766  1.00 0.00 ? 77  LYS A CE   5  
ATOM 9978  N NZ   . LYS A 1 77  ? 3.977   9.301   -7.791  1.00 0.00 ? 77  LYS A NZ   5  
ATOM 9979  H H    . LYS A 1 77  ? 9.991   10.264  -7.194  1.00 0.00 ? 77  LYS A H    5  
ATOM 9980  H HA   . LYS A 1 77  ? 7.244   10.130  -8.252  1.00 0.00 ? 77  LYS A HA   5  
ATOM 9981  H HB2  . LYS A 1 77  ? 8.311   7.880   -8.275  1.00 0.00 ? 77  LYS A HB2  5  
ATOM 9982  H HB3  . LYS A 1 77  ? 8.586   8.016   -6.545  1.00 0.00 ? 77  LYS A HB3  5  
ATOM 9983  H HG2  . LYS A 1 77  ? 6.685   6.696   -6.672  1.00 0.00 ? 77  LYS A HG2  5  
ATOM 9984  H HG3  . LYS A 1 77  ? 6.023   8.300   -6.371  1.00 0.00 ? 77  LYS A HG3  5  
ATOM 9985  H HD2  . LYS A 1 77  ? 6.320   7.230   -9.170  1.00 0.00 ? 77  LYS A HD2  5  
ATOM 9986  H HD3  . LYS A 1 77  ? 4.923   6.816   -8.182  1.00 0.00 ? 77  LYS A HD3  5  
ATOM 9987  H HE2  . LYS A 1 77  ? 5.767   9.643   -8.837  1.00 0.00 ? 77  LYS A HE2  5  
ATOM 9988  H HE3  . LYS A 1 77  ? 4.553   8.736   -9.733  1.00 0.00 ? 77  LYS A HE3  5  
ATOM 9989  H HZ1  . LYS A 1 77  ? 3.317   8.518   -7.602  1.00 0.00 ? 77  LYS A HZ1  5  
ATOM 9990  H HZ2  . LYS A 1 77  ? 3.436   10.103  -8.176  1.00 0.00 ? 77  LYS A HZ2  5  
ATOM 9991  H HZ3  . LYS A 1 77  ? 4.415   9.595   -6.894  1.00 0.00 ? 77  LYS A HZ3  5  
ATOM 9992  N N    . GLU A 1 78  ? 8.424   10.494  -5.194  1.00 0.00 ? 78  GLU A N    5  
ATOM 9993  C CA   . GLU A 1 78  ? 8.178   11.085  -3.878  1.00 0.00 ? 78  GLU A CA   5  
ATOM 9994  C C    . GLU A 1 78  ? 7.100   10.319  -3.110  1.00 0.00 ? 78  GLU A C    5  
ATOM 9995  O O    . GLU A 1 78  ? 5.905   10.524  -3.328  1.00 0.00 ? 78  GLU A O    5  
ATOM 9996  C CB   . GLU A 1 78  ? 7.777   12.564  -4.010  1.00 0.00 ? 78  GLU A CB   5  
ATOM 9997  C CG   . GLU A 1 78  ? 8.890   13.461  -4.530  1.00 0.00 ? 78  GLU A CG   5  
ATOM 9998  C CD   . GLU A 1 78  ? 10.053  13.565  -3.559  1.00 0.00 ? 78  GLU A CD   5  
ATOM 9999  O OE1  . GLU A 1 78  ? 9.891   14.215  -2.507  1.00 0.00 ? 78  GLU A OE1  5  
ATOM 10000 O OE2  . GLU A 1 78  ? 11.132  13.018  -3.849  1.00 0.00 ? 78  GLU A OE2  5  
ATOM 10001 H H    . GLU A 1 78  ? 9.300   10.102  -5.372  1.00 0.00 ? 78  GLU A H    5  
ATOM 10002 H HA   . GLU A 1 78  ? 9.102   11.027  -3.321  1.00 0.00 ? 78  GLU A HA   5  
ATOM 10003 H HB2  . GLU A 1 78  ? 6.938   12.638  -4.687  1.00 0.00 ? 78  GLU A HB2  5  
ATOM 10004 H HB3  . GLU A 1 78  ? 7.473   12.932  -3.038  1.00 0.00 ? 78  GLU A HB3  5  
ATOM 10005 H HG2  . GLU A 1 78  ? 9.250   13.060  -5.468  1.00 0.00 ? 78  GLU A HG2  5  
ATOM 10006 H HG3  . GLU A 1 78  ? 8.489   14.451  -4.697  1.00 0.00 ? 78  GLU A HG3  5  
ATOM 10007 N N    . VAL A 1 79  ? 7.529   9.425   -2.223  1.00 0.00 ? 79  VAL A N    5  
ATOM 10008 C CA   . VAL A 1 79  ? 6.602   8.672   -1.382  1.00 0.00 ? 79  VAL A CA   5  
ATOM 10009 C C    . VAL A 1 79  ? 6.554   9.272   0.021   1.00 0.00 ? 79  VAL A C    5  
ATOM 10010 O O    . VAL A 1 79  ? 7.595   9.559   0.624   1.00 0.00 ? 79  VAL A O    5  
ATOM 10011 C CB   . VAL A 1 79  ? 6.998   7.176   -1.297  1.00 0.00 ? 79  VAL A CB   5  
ATOM 10012 C CG1  . VAL A 1 79  ? 6.011   6.395   -0.428  1.00 0.00 ? 79  VAL A CG1  5  
ATOM 10013 C CG2  . VAL A 1 79  ? 7.086   6.571   -2.698  1.00 0.00 ? 79  VAL A CG2  5  
ATOM 10014 H H    . VAL A 1 79  ? 8.491   9.267   -2.129  1.00 0.00 ? 79  VAL A H    5  
ATOM 10015 H HA   . VAL A 1 79  ? 5.616   8.738   -1.826  1.00 0.00 ? 79  VAL A HA   5  
ATOM 10016 H HB   . VAL A 1 79  ? 7.976   7.109   -0.839  1.00 0.00 ? 79  VAL A HB   5  
ATOM 10017 H HG11 . VAL A 1 79  ? 5.017   6.473   -0.846  1.00 0.00 ? 79  VAL A HG11 5  
ATOM 10018 H HG12 . VAL A 1 79  ? 6.011   6.801   0.575   1.00 0.00 ? 79  VAL A HG12 5  
ATOM 10019 H HG13 . VAL A 1 79  ? 6.305   5.356   -0.392  1.00 0.00 ? 79  VAL A HG13 5  
ATOM 10020 H HG21 . VAL A 1 79  ? 7.821   7.110   -3.278  1.00 0.00 ? 79  VAL A HG21 5  
ATOM 10021 H HG22 . VAL A 1 79  ? 6.123   6.642   -3.184  1.00 0.00 ? 79  VAL A HG22 5  
ATOM 10022 H HG23 . VAL A 1 79  ? 7.377   5.533   -2.626  1.00 0.00 ? 79  VAL A HG23 5  
ATOM 10023 N N    . ASN A 1 80  ? 5.340   9.438   0.541   1.00 0.00 ? 80  ASN A N    5  
ATOM 10024 C CA   . ASN A 1 80  ? 5.111   10.074  1.840   1.00 0.00 ? 80  ASN A CA   5  
ATOM 10025 C C    . ASN A 1 80  ? 5.282   9.078   2.992   1.00 0.00 ? 80  ASN A C    5  
ATOM 10026 O O    . ASN A 1 80  ? 4.683   9.242   4.059   1.00 0.00 ? 80  ASN A O    5  
ATOM 10027 C CB   . ASN A 1 80  ? 3.703   10.690  1.880   1.00 0.00 ? 80  ASN A CB   5  
ATOM 10028 C CG   . ASN A 1 80  ? 3.556   11.883  0.947   1.00 0.00 ? 80  ASN A CG   5  
ATOM 10029 O OD1  . ASN A 1 80  ? 3.775   13.030  1.344   1.00 0.00 ? 80  ASN A OD1  5  
ATOM 10030 N ND2  . ASN A 1 80  ? 3.193   11.626  -0.301  1.00 0.00 ? 80  ASN A ND2  5  
ATOM 10031 H H    . ASN A 1 80  ? 4.563   9.119   0.030   1.00 0.00 ? 80  ASN A H    5  
ATOM 10032 H HA   . ASN A 1 80  ? 5.840   10.863  1.957   1.00 0.00 ? 80  ASN A HA   5  
ATOM 10033 H HB2  . ASN A 1 80  ? 2.980   9.941   1.595   1.00 0.00 ? 80  ASN A HB2  5  
ATOM 10034 H HB3  . ASN A 1 80  ? 3.490   11.018  2.889   1.00 0.00 ? 80  ASN A HB3  5  
ATOM 10035 H HD21 . ASN A 1 80  ? 3.037   10.688  -0.559  1.00 0.00 ? 80  ASN A HD21 5  
ATOM 10036 H HD22 . ASN A 1 80  ? 3.097   12.376  -0.922  1.00 0.00 ? 80  ASN A HD22 5  
ATOM 10037 N N    . LEU A 1 81  ? 6.104   8.054   2.773   1.00 0.00 ? 81  LEU A N    5  
ATOM 10038 C CA   . LEU A 1 81  ? 6.446   7.091   3.819   1.00 0.00 ? 81  LEU A CA   5  
ATOM 10039 C C    . LEU A 1 81  ? 7.063   7.804   5.025   1.00 0.00 ? 81  LEU A C    5  
ATOM 10040 O O    . LEU A 1 81  ? 7.815   8.770   4.862   1.00 0.00 ? 81  LEU A O    5  
ATOM 10041 C CB   . LEU A 1 81  ? 7.406   6.025   3.254   1.00 0.00 ? 81  LEU A CB   5  
ATOM 10042 C CG   . LEU A 1 81  ? 8.285   5.273   4.272   1.00 0.00 ? 81  LEU A CG   5  
ATOM 10043 C CD1  . LEU A 1 81  ? 7.449   4.311   5.105   1.00 0.00 ? 81  LEU A CD1  5  
ATOM 10044 C CD2  . LEU A 1 81  ? 9.414   4.529   3.564   1.00 0.00 ? 81  LEU A CD2  5  
ATOM 10045 H H    . LEU A 1 81  ? 6.495   7.948   1.886   1.00 0.00 ? 81  LEU A H    5  
ATOM 10046 H HA   . LEU A 1 81  ? 5.529   6.607   4.132   1.00 0.00 ? 81  LEU A HA   5  
ATOM 10047 H HB2  . LEU A 1 81  ? 6.803   5.287   2.741   1.00 0.00 ? 81  LEU A HB2  5  
ATOM 10048 H HB3  . LEU A 1 81  ? 8.054   6.501   2.531   1.00 0.00 ? 81  LEU A HB3  5  
ATOM 10049 H HG   . LEU A 1 81  ? 8.732   5.990   4.947   1.00 0.00 ? 81  LEU A HG   5  
ATOM 10050 H HD11 . LEU A 1 81  ? 6.682   4.862   5.630   1.00 0.00 ? 81  LEU A HD11 5  
ATOM 10051 H HD12 . LEU A 1 81  ? 8.084   3.811   5.822   1.00 0.00 ? 81  LEU A HD12 5  
ATOM 10052 H HD13 . LEU A 1 81  ? 6.989   3.578   4.460   1.00 0.00 ? 81  LEU A HD13 5  
ATOM 10053 H HD21 . LEU A 1 81  ? 8.997   3.815   2.867   1.00 0.00 ? 81  LEU A HD21 5  
ATOM 10054 H HD22 . LEU A 1 81  ? 10.018  4.009   4.293   1.00 0.00 ? 81  LEU A HD22 5  
ATOM 10055 H HD23 . LEU A 1 81  ? 10.031  5.237   3.027   1.00 0.00 ? 81  LEU A HD23 5  
ATOM 10056 N N    . ASP A 1 82  ? 6.737   7.307   6.222   1.00 0.00 ? 82  ASP A N    5  
ATOM 10057 C CA   . ASP A 1 82  ? 7.165   7.916   7.484   1.00 0.00 ? 82  ASP A CA   5  
ATOM 10058 C C    . ASP A 1 82  ? 8.657   8.266   7.467   1.00 0.00 ? 82  ASP A C    5  
ATOM 10059 O O    . ASP A 1 82  ? 9.504   7.424   7.143   1.00 0.00 ? 82  ASP A O    5  
ATOM 10060 C CB   . ASP A 1 82  ? 6.847   6.961   8.644   1.00 0.00 ? 82  ASP A CB   5  
ATOM 10061 C CG   . ASP A 1 82  ? 7.350   7.463   9.989   1.00 0.00 ? 82  ASP A CG   5  
ATOM 10062 O OD1  . ASP A 1 82  ? 6.698   8.347   10.584  1.00 0.00 ? 82  ASP A OD1  5  
ATOM 10063 O OD2  . ASP A 1 82  ? 8.382   6.946   10.470  1.00 0.00 ? 82  ASP A OD2  5  
ATOM 10064 H H    . ASP A 1 82  ? 6.190   6.496   6.259   1.00 0.00 ? 82  ASP A H    5  
ATOM 10065 H HA   . ASP A 1 82  ? 6.597   8.826   7.619   1.00 0.00 ? 82  ASP A HA   5  
ATOM 10066 H HB2  . ASP A 1 82  ? 5.776   6.832   8.710   1.00 0.00 ? 82  ASP A HB2  5  
ATOM 10067 H HB3  . ASP A 1 82  ? 7.302   6.001   8.443   1.00 0.00 ? 82  ASP A HB3  5  
ATOM 10068 N N    . PHE A 1 83  ? 8.964   9.516   7.818   1.00 0.00 ? 83  PHE A N    5  
ATOM 10069 C CA   . PHE A 1 83  ? 10.328  10.042  7.753   1.00 0.00 ? 83  PHE A CA   5  
ATOM 10070 C C    . PHE A 1 83  ? 11.277  9.226   8.629   1.00 0.00 ? 83  PHE A C    5  
ATOM 10071 O O    . PHE A 1 83  ? 12.372  8.857   8.198   1.00 0.00 ? 83  PHE A O    5  
ATOM 10072 C CB   . PHE A 1 83  ? 10.344  11.520  8.175   1.00 0.00 ? 83  PHE A CB   5  
ATOM 10073 C CG   . PHE A 1 83  ? 11.708  12.164  8.105   1.00 0.00 ? 83  PHE A CG   5  
ATOM 10074 C CD1  . PHE A 1 83  ? 12.265  12.512  6.881   1.00 0.00 ? 83  PHE A CD1  5  
ATOM 10075 C CD2  . PHE A 1 83  ? 12.433  12.428  9.262   1.00 0.00 ? 83  PHE A CD2  5  
ATOM 10076 C CE1  . PHE A 1 83  ? 13.512  13.105  6.812   1.00 0.00 ? 83  PHE A CE1  5  
ATOM 10077 C CE2  . PHE A 1 83  ? 13.680  13.021  9.196   1.00 0.00 ? 83  PHE A CE2  5  
ATOM 10078 C CZ   . PHE A 1 83  ? 14.220  13.359  7.971   1.00 0.00 ? 83  PHE A CZ   5  
ATOM 10079 H H    . PHE A 1 83  ? 8.244   10.106  8.136   1.00 0.00 ? 83  PHE A H    5  
ATOM 10080 H HA   . PHE A 1 83  ? 10.658  9.971   6.725   1.00 0.00 ? 83  PHE A HA   5  
ATOM 10081 H HB2  . PHE A 1 83  ? 9.681   12.077  7.527   1.00 0.00 ? 83  PHE A HB2  5  
ATOM 10082 H HB3  . PHE A 1 83  ? 9.987   11.599  9.193   1.00 0.00 ? 83  PHE A HB3  5  
ATOM 10083 H HD1  . PHE A 1 83  ? 11.713  12.313  5.973   1.00 0.00 ? 83  PHE A HD1  5  
ATOM 10084 H HD2  . PHE A 1 83  ? 12.014  12.164  10.222  1.00 0.00 ? 83  PHE A HD2  5  
ATOM 10085 H HE1  . PHE A 1 83  ? 13.932  13.370  5.853   1.00 0.00 ? 83  PHE A HE1  5  
ATOM 10086 H HE2  . PHE A 1 83  ? 14.232  13.219  10.105  1.00 0.00 ? 83  PHE A HE2  5  
ATOM 10087 H HZ   . PHE A 1 83  ? 15.196  13.824  7.919   1.00 0.00 ? 83  PHE A HZ   5  
ATOM 10088 N N    . HIS A 1 84  ? 10.845  8.933   9.852   1.00 0.00 ? 84  HIS A N    5  
ATOM 10089 C CA   . HIS A 1 84  ? 11.656  8.151   10.786  1.00 0.00 ? 84  HIS A CA   5  
ATOM 10090 C C    . HIS A 1 84  ? 11.941  6.757   10.226  1.00 0.00 ? 84  HIS A C    5  
ATOM 10091 O O    . HIS A 1 84  ? 12.980  6.159   10.519  1.00 0.00 ? 84  HIS A O    5  
ATOM 10092 C CB   . HIS A 1 84  ? 10.959  8.043   12.149  1.00 0.00 ? 84  HIS A CB   5  
ATOM 10093 C CG   . HIS A 1 84  ? 11.584  7.042   13.075  1.00 0.00 ? 84  HIS A CG   5  
ATOM 10094 N ND1  . HIS A 1 84  ? 12.869  7.156   13.560  1.00 0.00 ? 84  HIS A ND1  5  
ATOM 10095 C CD2  . HIS A 1 84  ? 11.092  5.891   13.595  1.00 0.00 ? 84  HIS A CD2  5  
ATOM 10096 C CE1  . HIS A 1 84  ? 13.139  6.120   14.332  1.00 0.00 ? 84  HIS A CE1  5  
ATOM 10097 N NE2  . HIS A 1 84  ? 12.078  5.335   14.371  1.00 0.00 ? 84  HIS A NE2  5  
ATOM 10098 H H    . HIS A 1 84  ? 9.958   9.248   10.134  1.00 0.00 ? 84  HIS A H    5  
ATOM 10099 H HA   . HIS A 1 84  ? 12.597  8.670   10.915  1.00 0.00 ? 84  HIS A HA   5  
ATOM 10100 H HB2  . HIS A 1 84  ? 10.987  9.007   12.636  1.00 0.00 ? 84  HIS A HB2  5  
ATOM 10101 H HB3  . HIS A 1 84  ? 9.926   7.756   11.996  1.00 0.00 ? 84  HIS A HB3  5  
ATOM 10102 H HD1  . HIS A 1 84  ? 13.501  7.882   13.355  1.00 0.00 ? 84  HIS A HD1  5  
ATOM 10103 H HD2  . HIS A 1 84  ? 10.104  5.486   13.430  1.00 0.00 ? 84  HIS A HD2  5  
ATOM 10104 H HE1  . HIS A 1 84  ? 14.071  5.943   14.848  1.00 0.00 ? 84  HIS A HE1  5  
ATOM 10105 H HE2  . HIS A 1 84  ? 12.084  4.403   14.687  1.00 0.00 ? 84  HIS A HE2  5  
ATOM 10106 N N    . THR A 1 85  ? 11.023  6.248   9.415   1.00 0.00 ? 85  THR A N    5  
ATOM 10107 C CA   . THR A 1 85  ? 11.192  4.937   8.804   1.00 0.00 ? 85  THR A CA   5  
ATOM 10108 C C    . THR A 1 85  ? 12.275  4.977   7.729   1.00 0.00 ? 85  THR A C    5  
ATOM 10109 O O    . THR A 1 85  ? 13.184  4.145   7.723   1.00 0.00 ? 85  THR A O    5  
ATOM 10110 C CB   . THR A 1 85  ? 9.874   4.435   8.189   1.00 0.00 ? 85  THR A CB   5  
ATOM 10111 O OG1  . THR A 1 85  ? 8.837   4.509   9.170   1.00 0.00 ? 85  THR A OG1  5  
ATOM 10112 C CG2  . THR A 1 85  ? 10.008  2.996   7.686   1.00 0.00 ? 85  THR A CG2  5  
ATOM 10113 H H    . THR A 1 85  ? 10.208  6.767   9.225   1.00 0.00 ? 85  THR A H    5  
ATOM 10114 H HA   . THR A 1 85  ? 11.490  4.244   9.580   1.00 0.00 ? 85  THR A HA   5  
ATOM 10115 H HB   . THR A 1 85  ? 9.612   5.071   7.355   1.00 0.00 ? 85  THR A HB   5  
ATOM 10116 H HG1  . THR A 1 85  ? 9.072   5.166   9.838   1.00 0.00 ? 85  THR A HG1  5  
ATOM 10117 H HG21 . THR A 1 85  ? 10.268  2.348   8.510   1.00 0.00 ? 85  THR A HG21 5  
ATOM 10118 H HG22 . THR A 1 85  ? 10.780  2.947   6.933   1.00 0.00 ? 85  THR A HG22 5  
ATOM 10119 H HG23 . THR A 1 85  ? 9.069   2.673   7.257   1.00 0.00 ? 85  THR A HG23 5  
ATOM 10120 N N    . LYS A 1 86  ? 12.188  5.957   6.826   1.00 0.00 ? 86  LYS A N    5  
ATOM 10121 C CA   . LYS A 1 86  ? 13.179  6.083   5.761   1.00 0.00 ? 86  LYS A CA   5  
ATOM 10122 C C    . LYS A 1 86  ? 14.539  6.456   6.351   1.00 0.00 ? 86  LYS A C    5  
ATOM 10123 O O    . LYS A 1 86  ? 15.579  6.193   5.750   1.00 0.00 ? 86  LYS A O    5  
ATOM 10124 C CB   . LYS A 1 86  ? 12.738  7.092   4.685   1.00 0.00 ? 86  LYS A CB   5  
ATOM 10125 C CG   . LYS A 1 86  ? 12.541  8.520   5.178   1.00 0.00 ? 86  LYS A CG   5  
ATOM 10126 C CD   . LYS A 1 86  ? 12.201  9.468   4.026   1.00 0.00 ? 86  LYS A CD   5  
ATOM 10127 C CE   . LYS A 1 86  ? 10.894  9.085   3.329   1.00 0.00 ? 86  LYS A CE   5  
ATOM 10128 N NZ   . LYS A 1 86  ? 10.681  9.865   2.078   1.00 0.00 ? 86  LYS A NZ   5  
ATOM 10129 H H    . LYS A 1 86  ? 11.452  6.606   6.885   1.00 0.00 ? 86  LYS A H    5  
ATOM 10130 H HA   . LYS A 1 86  ? 13.274  5.109   5.299   1.00 0.00 ? 86  LYS A HA   5  
ATOM 10131 H HB2  . LYS A 1 86  ? 13.486  7.110   3.904   1.00 0.00 ? 86  LYS A HB2  5  
ATOM 10132 H HB3  . LYS A 1 86  ? 11.804  6.750   4.261   1.00 0.00 ? 86  LYS A HB3  5  
ATOM 10133 H HG2  . LYS A 1 86  ? 11.733  8.537   5.897   1.00 0.00 ? 86  LYS A HG2  5  
ATOM 10134 H HG3  . LYS A 1 86  ? 13.452  8.858   5.652   1.00 0.00 ? 86  LYS A HG3  5  
ATOM 10135 H HD2  . LYS A 1 86  ? 12.105  10.473  4.416   1.00 0.00 ? 86  LYS A HD2  5  
ATOM 10136 H HD3  . LYS A 1 86  ? 13.005  9.441   3.303   1.00 0.00 ? 86  LYS A HD3  5  
ATOM 10137 H HE2  . LYS A 1 86  ? 10.924  8.033   3.082   1.00 0.00 ? 86  LYS A HE2  5  
ATOM 10138 H HE3  . LYS A 1 86  ? 10.070  9.272   4.003   1.00 0.00 ? 86  LYS A HE3  5  
ATOM 10139 H HZ1  . LYS A 1 86  ? 9.737   9.667   1.688   1.00 0.00 ? 86  LYS A HZ1  5  
ATOM 10140 H HZ2  . LYS A 1 86  ? 11.397  9.608   1.367   1.00 0.00 ? 86  LYS A HZ2  5  
ATOM 10141 H HZ3  . LYS A 1 86  ? 10.757  10.884  2.273   1.00 0.00 ? 86  LYS A HZ3  5  
ATOM 10142 N N    . GLU A 1 87  ? 14.515  7.053   7.541   1.00 0.00 ? 87  GLU A N    5  
ATOM 10143 C CA   . GLU A 1 87  ? 15.729  7.298   8.314   1.00 0.00 ? 87  GLU A CA   5  
ATOM 10144 C C    . GLU A 1 87  ? 16.440  5.968   8.581   1.00 0.00 ? 87  GLU A C    5  
ATOM 10145 O O    . GLU A 1 87  ? 17.618  5.802   8.261   1.00 0.00 ? 87  GLU A O    5  
ATOM 10146 C CB   . GLU A 1 87  ? 15.372  8.002   9.635   1.00 0.00 ? 87  GLU A CB   5  
ATOM 10147 C CG   . GLU A 1 87  ? 16.548  8.211   10.584  1.00 0.00 ? 87  GLU A CG   5  
ATOM 10148 C CD   . GLU A 1 87  ? 16.129  8.876   11.888  1.00 0.00 ? 87  GLU A CD   5  
ATOM 10149 O OE1  . GLU A 1 87  ? 15.421  8.228   12.691  1.00 0.00 ? 87  GLU A OE1  5  
ATOM 10150 O OE2  . GLU A 1 87  ? 16.495  10.052  12.113  1.00 0.00 ? 87  GLU A OE2  5  
ATOM 10151 H H    . GLU A 1 87  ? 13.652  7.343   7.909   1.00 0.00 ? 87  GLU A H    5  
ATOM 10152 H HA   . GLU A 1 87  ? 16.377  7.938   7.731   1.00 0.00 ? 87  GLU A HA   5  
ATOM 10153 H HB2  . GLU A 1 87  ? 14.949  8.970   9.406   1.00 0.00 ? 87  GLU A HB2  5  
ATOM 10154 H HB3  . GLU A 1 87  ? 14.626  7.413   10.148  1.00 0.00 ? 87  GLU A HB3  5  
ATOM 10155 H HG2  . GLU A 1 87  ? 16.988  7.250   10.812  1.00 0.00 ? 87  GLU A HG2  5  
ATOM 10156 H HG3  . GLU A 1 87  ? 17.283  8.834   10.095  1.00 0.00 ? 87  GLU A HG3  5  
ATOM 10157 N N    . VAL A 1 88  ? 15.699  5.014   9.134   1.00 0.00 ? 88  VAL A N    5  
ATOM 10158 C CA   . VAL A 1 88  ? 16.227  3.672   9.376   1.00 0.00 ? 88  VAL A CA   5  
ATOM 10159 C C    . VAL A 1 88  ? 16.692  3.037   8.060   1.00 0.00 ? 88  VAL A C    5  
ATOM 10160 O O    . VAL A 1 88  ? 17.749  2.398   7.998   1.00 0.00 ? 88  VAL A O    5  
ATOM 10161 C CB   . VAL A 1 88  ? 15.166  2.757   10.041  1.00 0.00 ? 88  VAL A CB   5  
ATOM 10162 C CG1  . VAL A 1 88  ? 15.728  1.357   10.300  1.00 0.00 ? 88  VAL A CG1  5  
ATOM 10163 C CG2  . VAL A 1 88  ? 14.646  3.381   11.336  1.00 0.00 ? 88  VAL A CG2  5  
ATOM 10164 H H    . VAL A 1 88  ? 14.772  5.217   9.393   1.00 0.00 ? 88  VAL A H    5  
ATOM 10165 H HA   . VAL A 1 88  ? 17.072  3.760   10.043  1.00 0.00 ? 88  VAL A HA   5  
ATOM 10166 H HB   . VAL A 1 88  ? 14.331  2.659   9.359   1.00 0.00 ? 88  VAL A HB   5  
ATOM 10167 H HG11 . VAL A 1 88  ? 16.040  0.914   9.365   1.00 0.00 ? 88  VAL A HG11 5  
ATOM 10168 H HG12 . VAL A 1 88  ? 14.967  0.739   10.752  1.00 0.00 ? 88  VAL A HG12 5  
ATOM 10169 H HG13 . VAL A 1 88  ? 16.578  1.426   10.966  1.00 0.00 ? 88  VAL A HG13 5  
ATOM 10170 H HG21 . VAL A 1 88  ? 13.905  2.732   11.779  1.00 0.00 ? 88  VAL A HG21 5  
ATOM 10171 H HG22 . VAL A 1 88  ? 14.198  4.341   11.121  1.00 0.00 ? 88  VAL A HG22 5  
ATOM 10172 H HG23 . VAL A 1 88  ? 15.466  3.516   12.028  1.00 0.00 ? 88  VAL A HG23 5  
ATOM 10173 N N    . ILE A 1 89  ? 15.900  3.238   7.008   1.00 0.00 ? 89  ILE A N    5  
ATOM 10174 C CA   . ILE A 1 89  ? 16.208  2.686   5.692   1.00 0.00 ? 89  ILE A CA   5  
ATOM 10175 C C    . ILE A 1 89  ? 17.546  3.212   5.170   1.00 0.00 ? 89  ILE A C    5  
ATOM 10176 O O    . ILE A 1 89  ? 18.356  2.440   4.663   1.00 0.00 ? 89  ILE A O    5  
ATOM 10177 C CB   . ILE A 1 89  ? 15.083  2.987   4.667   1.00 0.00 ? 89  ILE A CB   5  
ATOM 10178 C CG1  . ILE A 1 89  ? 13.771  2.314   5.111   1.00 0.00 ? 89  ILE A CG1  5  
ATOM 10179 C CG2  . ILE A 1 89  ? 15.484  2.525   3.262   1.00 0.00 ? 89  ILE A CG2  5  
ATOM 10180 C CD1  . ILE A 1 89  ? 12.603  2.565   4.179   1.00 0.00 ? 89  ILE A CD1  5  
ATOM 10181 H H    . ILE A 1 89  ? 15.084  3.770   7.123   1.00 0.00 ? 89  ILE A H    5  
ATOM 10182 H HA   . ILE A 1 89  ? 16.282  1.610   5.800   1.00 0.00 ? 89  ILE A HA   5  
ATOM 10183 H HB   . ILE A 1 89  ? 14.935  4.058   4.636   1.00 0.00 ? 89  ILE A HB   5  
ATOM 10184 H HG12 . ILE A 1 89  ? 13.921  1.246   5.169   1.00 0.00 ? 89  ILE A HG12 5  
ATOM 10185 H HG13 . ILE A 1 89  ? 13.498  2.685   6.089   1.00 0.00 ? 89  ILE A HG13 5  
ATOM 10186 H HG21 . ILE A 1 89  ? 14.683  2.738   2.567   1.00 0.00 ? 89  ILE A HG21 5  
ATOM 10187 H HG22 . ILE A 1 89  ? 15.678  1.462   3.270   1.00 0.00 ? 89  ILE A HG22 5  
ATOM 10188 H HG23 . ILE A 1 89  ? 16.377  3.050   2.949   1.00 0.00 ? 89  ILE A HG23 5  
ATOM 10189 H HD11 . ILE A 1 89  ? 11.722  2.072   4.566   1.00 0.00 ? 89  ILE A HD11 5  
ATOM 10190 H HD12 . ILE A 1 89  ? 12.832  2.172   3.199   1.00 0.00 ? 89  ILE A HD12 5  
ATOM 10191 H HD13 . ILE A 1 89  ? 12.419  3.627   4.110   1.00 0.00 ? 89  ILE A HD13 5  
ATOM 10192 N N    . THR A 1 90  ? 17.794  4.515   5.316   1.00 0.00 ? 90  THR A N    5  
ATOM 10193 C CA   . THR A 1 90  ? 19.060  5.102   4.867   1.00 0.00 ? 90  THR A CA   5  
ATOM 10194 C C    . THR A 1 90  ? 20.229  4.481   5.632   1.00 0.00 ? 90  THR A C    5  
ATOM 10195 O O    . THR A 1 90  ? 21.329  4.331   5.103   1.00 0.00 ? 90  THR A O    5  
ATOM 10196 C CB   . THR A 1 90  ? 19.092  6.642   5.046   1.00 0.00 ? 90  THR A CB   5  
ATOM 10197 O OG1  . THR A 1 90  ? 18.924  6.982   6.426   1.00 0.00 ? 90  THR A OG1  5  
ATOM 10198 C CG2  . THR A 1 90  ? 18.006  7.322   4.218   1.00 0.00 ? 90  THR A CG2  5  
ATOM 10199 H H    . THR A 1 90  ? 17.120  5.089   5.736   1.00 0.00 ? 90  THR A H    5  
ATOM 10200 H HA   . THR A 1 90  ? 19.175  4.878   3.815   1.00 0.00 ? 90  THR A HA   5  
ATOM 10201 H HB   . THR A 1 90  ? 20.056  7.007   4.714   1.00 0.00 ? 90  THR A HB   5  
ATOM 10202 H HG1  . THR A 1 90  ? 17.987  6.987   6.644   1.00 0.00 ? 90  THR A HG1  5  
ATOM 10203 H HG21 . THR A 1 90  ? 18.158  7.101   3.171   1.00 0.00 ? 90  THR A HG21 5  
ATOM 10204 H HG22 . THR A 1 90  ? 18.052  8.391   4.370   1.00 0.00 ? 90  THR A HG22 5  
ATOM 10205 H HG23 . THR A 1 90  ? 17.037  6.957   4.525   1.00 0.00 ? 90  THR A HG23 5  
ATOM 10206 N N    . ASN A 1 91  ? 19.973  4.104   6.883   1.00 0.00 ? 91  ASN A N    5  
ATOM 10207 C CA   . ASN A 1 91  ? 20.992  3.479   7.726   1.00 0.00 ? 91  ASN A CA   5  
ATOM 10208 C C    . ASN A 1 91  ? 21.148  1.991   7.396   1.00 0.00 ? 91  ASN A C    5  
ATOM 10209 O O    . ASN A 1 91  ? 22.148  1.370   7.763   1.00 0.00 ? 91  ASN A O    5  
ATOM 10210 C CB   . ASN A 1 91  ? 20.644  3.650   9.215   1.00 0.00 ? 91  ASN A CB   5  
ATOM 10211 C CG   . ASN A 1 91  ? 20.811  5.077   9.726   1.00 0.00 ? 91  ASN A CG   5  
ATOM 10212 O OD1  . ASN A 1 91  ? 21.169  5.287   10.886  1.00 0.00 ? 91  ASN A OD1  5  
ATOM 10213 N ND2  . ASN A 1 91  ? 20.528  6.067   8.887   1.00 0.00 ? 91  ASN A ND2  5  
ATOM 10214 H H    . ASN A 1 91  ? 19.074  4.258   7.253   1.00 0.00 ? 91  ASN A H    5  
ATOM 10215 H HA   . ASN A 1 91  ? 21.933  3.976   7.529   1.00 0.00 ? 91  ASN A HA   5  
ATOM 10216 H HB2  . ASN A 1 91  ? 19.616  3.358   9.371   1.00 0.00 ? 91  ASN A HB2  5  
ATOM 10217 H HB3  . ASN A 1 91  ? 21.284  3.004   9.802   1.00 0.00 ? 91  ASN A HB3  5  
ATOM 10218 H HD21 . ASN A 1 91  ? 20.224  5.843   7.983   1.00 0.00 ? 91  ASN A HD21 5  
ATOM 10219 H HD22 . ASN A 1 91  ? 20.640  6.988   9.206   1.00 0.00 ? 91  ASN A HD22 5  
ATOM 10220 N N    . SER A 1 92  ? 20.164  1.420   6.704   1.00 0.00 ? 92  SER A N    5  
ATOM 10221 C CA   . SER A 1 92  ? 20.173  -0.014  6.390   1.00 0.00 ? 92  SER A CA   5  
ATOM 10222 C C    . SER A 1 92  ? 20.435  -0.278  4.901   1.00 0.00 ? 92  SER A C    5  
ATOM 10223 O O    . SER A 1 92  ? 20.751  -1.404  4.517   1.00 0.00 ? 92  SER A O    5  
ATOM 10224 C CB   . SER A 1 92  ? 18.829  -0.637  6.794   1.00 0.00 ? 92  SER A CB   5  
ATOM 10225 O OG   . SER A 1 92  ? 18.526  -0.371  8.158   1.00 0.00 ? 92  SER A OG   5  
ATOM 10226 H H    . SER A 1 92  ? 19.406  1.969   6.407   1.00 0.00 ? 92  SER A H    5  
ATOM 10227 H HA   . SER A 1 92  ? 20.959  -0.480  6.967   1.00 0.00 ? 92  SER A HA   5  
ATOM 10228 H HB2  . SER A 1 92  ? 18.042  -0.225  6.180   1.00 0.00 ? 92  SER A HB2  5  
ATOM 10229 H HB3  . SER A 1 92  ? 18.872  -1.708  6.651   1.00 0.00 ? 92  SER A HB3  5  
ATOM 10230 H HG   . SER A 1 92  ? 18.411  0.581   8.279   1.00 0.00 ? 92  SER A HG   5  
ATOM 10231 N N    . ILE A 1 93  ? 20.323  0.761   4.075   1.00 0.00 ? 93  ILE A N    5  
ATOM 10232 C CA   . ILE A 1 93  ? 20.356  0.603   2.615   1.00 0.00 ? 93  ILE A CA   5  
ATOM 10233 C C    . ILE A 1 93  ? 21.711  0.084   2.117   1.00 0.00 ? 93  ILE A C    5  
ATOM 10234 O O    . ILE A 1 93  ? 21.797  -0.474  1.021   1.00 0.00 ? 93  ILE A O    5  
ATOM 10235 C CB   . ILE A 1 93  ? 20.004  1.932   1.891   1.00 0.00 ? 93  ILE A CB   5  
ATOM 10236 C CG1  . ILE A 1 93  ? 19.828  1.704   0.378   1.00 0.00 ? 93  ILE A CG1  5  
ATOM 10237 C CG2  . ILE A 1 93  ? 21.068  2.996   2.155   1.00 0.00 ? 93  ILE A CG2  5  
ATOM 10238 C CD1  . ILE A 1 93  ? 18.724  0.723   0.030   1.00 0.00 ? 93  ILE A CD1  5  
ATOM 10239 H H    . ILE A 1 93  ? 20.208  1.658   4.452   1.00 0.00 ? 93  ILE A H    5  
ATOM 10240 H HA   . ILE A 1 93  ? 19.599  -0.124  2.356   1.00 0.00 ? 93  ILE A HA   5  
ATOM 10241 H HB   . ILE A 1 93  ? 19.071  2.293   2.299   1.00 0.00 ? 93  ILE A HB   5  
ATOM 10242 H HG12 . ILE A 1 93  ? 19.591  2.645   -0.098  1.00 0.00 ? 93  ILE A HG12 5  
ATOM 10243 H HG13 . ILE A 1 93  ? 20.752  1.323   -0.035  1.00 0.00 ? 93  ILE A HG13 5  
ATOM 10244 H HG21 . ILE A 1 93  ? 22.021  2.658   1.774   1.00 0.00 ? 93  ILE A HG21 5  
ATOM 10245 H HG22 . ILE A 1 93  ? 21.148  3.171   3.218   1.00 0.00 ? 93  ILE A HG22 5  
ATOM 10246 H HG23 . ILE A 1 93  ? 20.789  3.916   1.660   1.00 0.00 ? 93  ILE A HG23 5  
ATOM 10247 H HD11 . ILE A 1 93  ? 18.657  0.623   -1.044  1.00 0.00 ? 93  ILE A HD11 5  
ATOM 10248 H HD12 . ILE A 1 93  ? 17.783  1.089   0.417   1.00 0.00 ? 93  ILE A HD12 5  
ATOM 10249 H HD13 . ILE A 1 93  ? 18.945  -0.239  0.468   1.00 0.00 ? 93  ILE A HD13 5  
ATOM 10250 N N    . THR A 1 94  ? 22.760  0.266   2.918   1.00 0.00 ? 94  THR A N    5  
ATOM 10251 C CA   . THR A 1 94  ? 24.087  -0.233  2.564   1.00 0.00 ? 94  THR A CA   5  
ATOM 10252 C C    . THR A 1 94  ? 24.041  -1.747  2.322   1.00 0.00 ? 94  THR A C    5  
ATOM 10253 O O    . THR A 1 94  ? 24.582  -2.249  1.334   1.00 0.00 ? 94  THR A O    5  
ATOM 10254 C CB   . THR A 1 94  ? 25.136  0.105   3.660   1.00 0.00 ? 94  THR A CB   5  
ATOM 10255 O OG1  . THR A 1 94  ? 26.422  -0.415  3.298   1.00 0.00 ? 94  THR A OG1  5  
ATOM 10256 C CG2  . THR A 1 94  ? 24.728  -0.446  5.026   1.00 0.00 ? 94  THR A CG2  5  
ATOM 10257 H H    . THR A 1 94  ? 22.639  0.752   3.762   1.00 0.00 ? 94  THR A H    5  
ATOM 10258 H HA   . THR A 1 94  ? 24.387  0.256   1.647   1.00 0.00 ? 94  THR A HA   5  
ATOM 10259 H HB   . THR A 1 94  ? 25.210  1.182   3.737   1.00 0.00 ? 94  THR A HB   5  
ATOM 10260 H HG1  . THR A 1 94  ? 26.786  0.107   2.570   1.00 0.00 ? 94  THR A HG1  5  
ATOM 10261 H HG21 . THR A 1 94  ? 24.651  -1.523  4.972   1.00 0.00 ? 94  THR A HG21 5  
ATOM 10262 H HG22 . THR A 1 94  ? 23.771  -0.032  5.312   1.00 0.00 ? 94  THR A HG22 5  
ATOM 10263 H HG23 . THR A 1 94  ? 25.472  -0.176  5.762   1.00 0.00 ? 94  THR A HG23 5  
ATOM 10264 N N    . GLN A 1 95  ? 23.360  -2.458  3.220   1.00 0.00 ? 95  GLN A N    5  
ATOM 10265 C CA   . GLN A 1 95  ? 23.188  -3.904  3.121   1.00 0.00 ? 95  GLN A CA   5  
ATOM 10266 C C    . GLN A 1 95  ? 21.853  -4.293  3.757   1.00 0.00 ? 95  GLN A C    5  
ATOM 10267 O O    . GLN A 1 95  ? 21.800  -4.691  4.928   1.00 0.00 ? 95  GLN A O    5  
ATOM 10268 C CB   . GLN A 1 95  ? 24.355  -4.651  3.799   1.00 0.00 ? 95  GLN A CB   5  
ATOM 10269 C CG   . GLN A 1 95  ? 25.699  -4.473  3.094   1.00 0.00 ? 95  GLN A CG   5  
ATOM 10270 C CD   . GLN A 1 95  ? 26.847  -5.146  3.823   1.00 0.00 ? 95  GLN A CD   5  
ATOM 10271 O OE1  . GLN A 1 95  ? 27.500  -4.538  4.672   1.00 0.00 ? 95  GLN A OE1  5  
ATOM 10272 N NE2  . GLN A 1 95  ? 27.105  -6.402  3.498   1.00 0.00 ? 95  GLN A NE2  5  
ATOM 10273 H H    . GLN A 1 95  ? 22.940  -1.989  3.971   1.00 0.00 ? 95  GLN A H    5  
ATOM 10274 H HA   . GLN A 1 95  ? 23.161  -4.166  2.072   1.00 0.00 ? 95  GLN A HA   5  
ATOM 10275 H HB2  . GLN A 1 95  ? 24.456  -4.291  4.814   1.00 0.00 ? 95  GLN A HB2  5  
ATOM 10276 H HB3  . GLN A 1 95  ? 24.125  -5.707  3.825   1.00 0.00 ? 95  GLN A HB3  5  
ATOM 10277 H HG2  . GLN A 1 95  ? 25.627  -4.895  2.101   1.00 0.00 ? 95  GLN A HG2  5  
ATOM 10278 H HG3  . GLN A 1 95  ? 25.911  -3.416  3.016   1.00 0.00 ? 95  GLN A HG3  5  
ATOM 10279 H HE21 . GLN A 1 95  ? 26.547  -6.826  2.810   1.00 0.00 ? 95  GLN A HE21 5  
ATOM 10280 H HE22 . GLN A 1 95  ? 27.847  -6.857  3.949   1.00 0.00 ? 95  GLN A HE22 5  
ATOM 10281 N N    . PRO A 1 96  ? 20.748  -4.127  3.004   1.00 0.00 ? 96  PRO A N    5  
ATOM 10282 C CA   . PRO A 1 96  ? 19.391  -4.383  3.505   1.00 0.00 ? 96  PRO A CA   5  
ATOM 10283 C C    . PRO A 1 96  ? 19.072  -5.879  3.603   1.00 0.00 ? 96  PRO A C    5  
ATOM 10284 O O    . PRO A 1 96  ? 19.973  -6.720  3.619   1.00 0.00 ? 96  PRO A O    5  
ATOM 10285 C CB   . PRO A 1 96  ? 18.501  -3.688  2.464   1.00 0.00 ? 96  PRO A CB   5  
ATOM 10286 C CG   . PRO A 1 96  ? 19.286  -3.742  1.197   1.00 0.00 ? 96  PRO A CG   5  
ATOM 10287 C CD   . PRO A 1 96  ? 20.738  -3.665  1.598   1.00 0.00 ? 96  PRO A CD   5  
ATOM 10288 H HA   . PRO A 1 96  ? 19.239  -3.926  4.473   1.00 0.00 ? 96  PRO A HA   5  
ATOM 10289 H HB2  . PRO A 1 96  ? 17.562  -4.216  2.373   1.00 0.00 ? 96  PRO A HB2  5  
ATOM 10290 H HB3  . PRO A 1 96  ? 18.316  -2.667  2.770   1.00 0.00 ? 96  PRO A HB3  5  
ATOM 10291 H HG2  . PRO A 1 96  ? 19.087  -4.671  0.682   1.00 0.00 ? 96  PRO A HG2  5  
ATOM 10292 H HG3  . PRO A 1 96  ? 19.026  -2.903  0.568   1.00 0.00 ? 96  PRO A HG3  5  
ATOM 10293 H HD2  . PRO A 1 96  ? 21.336  -4.316  0.976   1.00 0.00 ? 96  PRO A HD2  5  
ATOM 10294 H HD3  . PRO A 1 96  ? 21.097  -2.647  1.526   1.00 0.00 ? 96  PRO A HD3  5  
ATOM 10295 N N    . THR A 1 97  ? 17.784  -6.199  3.677   1.00 0.00 ? 97  THR A N    5  
ATOM 10296 C CA   . THR A 1 97  ? 17.330  -7.574  3.856   1.00 0.00 ? 97  THR A CA   5  
ATOM 10297 C C    . THR A 1 97  ? 15.934  -7.741  3.242   1.00 0.00 ? 97  THR A C    5  
ATOM 10298 O O    . THR A 1 97  ? 15.267  -6.743  2.950   1.00 0.00 ? 97  THR A O    5  
ATOM 10299 C CB   . THR A 1 97  ? 17.298  -7.935  5.365   1.00 0.00 ? 97  THR A CB   5  
ATOM 10300 O OG1  . THR A 1 97  ? 18.519  -7.505  5.990   1.00 0.00 ? 97  THR A OG1  5  
ATOM 10301 C CG2  . THR A 1 97  ? 17.127  -9.435  5.588   1.00 0.00 ? 97  THR A CG2  5  
ATOM 10302 H H    . THR A 1 97  ? 17.114  -5.490  3.601   1.00 0.00 ? 97  THR A H    5  
ATOM 10303 H HA   . THR A 1 97  ? 18.024  -8.234  3.352   1.00 0.00 ? 97  THR A HA   5  
ATOM 10304 H HB   . THR A 1 97  ? 16.467  -7.419  5.827   1.00 0.00 ? 97  THR A HB   5  
ATOM 10305 H HG1  . THR A 1 97  ? 19.265  -7.733  5.419   1.00 0.00 ? 97  THR A HG1  5  
ATOM 10306 H HG21 . THR A 1 97  ? 17.933  -9.968  5.103   1.00 0.00 ? 97  THR A HG21 5  
ATOM 10307 H HG22 . THR A 1 97  ? 16.183  -9.757  5.172   1.00 0.00 ? 97  THR A HG22 5  
ATOM 10308 H HG23 . THR A 1 97  ? 17.143  -9.646  6.647   1.00 0.00 ? 97  THR A HG23 5  
ATOM 10309 N N    . LEU A 1 98  ? 15.500  -8.991  3.059   1.00 0.00 ? 98  LEU A N    5  
ATOM 10310 C CA   . LEU A 1 98  ? 14.204  -9.297  2.439   1.00 0.00 ? 98  LEU A CA   5  
ATOM 10311 C C    . LEU A 1 98  ? 13.080  -8.449  3.041   1.00 0.00 ? 98  LEU A C    5  
ATOM 10312 O O    . LEU A 1 98  ? 12.440  -7.662  2.342   1.00 0.00 ? 98  LEU A O    5  
ATOM 10313 C CB   . LEU A 1 98  ? 13.864  -10.796 2.597   1.00 0.00 ? 98  LEU A CB   5  
ATOM 10314 C CG   . LEU A 1 98  ? 14.658  -11.782 1.712   1.00 0.00 ? 98  LEU A CG   5  
ATOM 10315 C CD1  . LEU A 1 98  ? 14.444  -11.480 0.230   1.00 0.00 ? 98  LEU A CD1  5  
ATOM 10316 C CD2  . LEU A 1 98  ? 16.147  -11.774 2.060   1.00 0.00 ? 98  LEU A CD2  5  
ATOM 10317 H H    . LEU A 1 98  ? 16.068  -9.733  3.349   1.00 0.00 ? 98  LEU A H    5  
ATOM 10318 H HA   . LEU A 1 98  ? 14.284  -9.069  1.386   1.00 0.00 ? 98  LEU A HA   5  
ATOM 10319 H HB2  . LEU A 1 98  ? 14.028  -11.070 3.631   1.00 0.00 ? 98  LEU A HB2  5  
ATOM 10320 H HB3  . LEU A 1 98  ? 12.812  -10.926 2.378   1.00 0.00 ? 98  LEU A HB3  5  
ATOM 10321 H HG   . LEU A 1 98  ? 14.286  -12.782 1.892   1.00 0.00 ? 98  LEU A HG   5  
ATOM 10322 H HD11 . LEU A 1 98  ? 13.395  -11.572 -0.009  1.00 0.00 ? 98  LEU A HD11 5  
ATOM 10323 H HD12 . LEU A 1 98  ? 15.011  -12.183 -0.365  1.00 0.00 ? 98  LEU A HD12 5  
ATOM 10324 H HD13 . LEU A 1 98  ? 14.776  -10.476 0.013   1.00 0.00 ? 98  LEU A HD13 5  
ATOM 10325 H HD21 . LEU A 1 98  ? 16.665  -12.499 1.448   1.00 0.00 ? 98  LEU A HD21 5  
ATOM 10326 H HD22 . LEU A 1 98  ? 16.276  -12.026 3.102   1.00 0.00 ? 98  LEU A HD22 5  
ATOM 10327 H HD23 . LEU A 1 98  ? 16.557  -10.790 1.874   1.00 0.00 ? 98  LEU A HD23 5  
ATOM 10328 N N    . HIS A 1 99  ? 12.858  -8.595  4.344   1.00 0.00 ? 99  HIS A N    5  
ATOM 10329 C CA   . HIS A 1 99  ? 11.771  -7.888  5.026   1.00 0.00 ? 99  HIS A CA   5  
ATOM 10330 C C    . HIS A 1 99  ? 12.263  -6.592  5.671   1.00 0.00 ? 99  HIS A C    5  
ATOM 10331 O O    . HIS A 1 99  ? 11.643  -6.086  6.603   1.00 0.00 ? 99  HIS A O    5  
ATOM 10332 C CB   . HIS A 1 99  ? 11.104  -8.799  6.074   1.00 0.00 ? 99  HIS A CB   5  
ATOM 10333 C CG   . HIS A 1 99  ? 10.311  -9.922  5.468   1.00 0.00 ? 99  HIS A CG   5  
ATOM 10334 N ND1  . HIS A 1 99  ? 8.944   -9.864  5.271   1.00 0.00 ? 99  HIS A ND1  5  
ATOM 10335 C CD2  . HIS A 1 99  ? 10.708  -11.117 4.972   1.00 0.00 ? 99  HIS A CD2  5  
ATOM 10336 C CE1  . HIS A 1 99  ? 8.541   -10.972 4.676   1.00 0.00 ? 99  HIS A CE1  5  
ATOM 10337 N NE2  . HIS A 1 99  ? 9.590   -11.749 4.484   1.00 0.00 ? 99  HIS A NE2  5  
ATOM 10338 H H    . HIS A 1 99  ? 13.443  -9.189  4.866   1.00 0.00 ? 99  HIS A H    5  
ATOM 10339 H HA   . HIS A 1 99  ? 11.032  -7.630  4.280   1.00 0.00 ? 99  HIS A HA   5  
ATOM 10340 H HB2  . HIS A 1 99  ? 11.866  -9.233  6.707   1.00 0.00 ? 99  HIS A HB2  5  
ATOM 10341 H HB3  . HIS A 1 99  ? 10.433  -8.209  6.683   1.00 0.00 ? 99  HIS A HB3  5  
ATOM 10342 H HD1  . HIS A 1 99  ? 8.350   -9.132  5.556   1.00 0.00 ? 99  HIS A HD1  5  
ATOM 10343 H HD2  . HIS A 1 99  ? 11.718  -11.503 4.962   1.00 0.00 ? 99  HIS A HD2  5  
ATOM 10344 H HE1  . HIS A 1 99  ? 7.526   -11.187 4.360   1.00 0.00 ? 99  HIS A HE1  5  
ATOM 10345 H HE2  . HIS A 1 99  ? 9.606   -12.528 3.882   1.00 0.00 ? 99  HIS A HE2  5  
ATOM 10346 N N    . SER A 1 100 ? 13.353  -6.036  5.149   1.00 0.00 ? 100 SER A N    5  
ATOM 10347 C CA   . SER A 1 100 ? 13.866  -4.755  5.636   1.00 0.00 ? 100 SER A CA   5  
ATOM 10348 C C    . SER A 1 100 ? 12.868  -3.642  5.311   1.00 0.00 ? 100 SER A C    5  
ATOM 10349 O O    . SER A 1 100 ? 12.612  -2.755  6.126   1.00 0.00 ? 100 SER A O    5  
ATOM 10350 C CB   . SER A 1 100 ? 15.233  -4.457  5.004   1.00 0.00 ? 100 SER A CB   5  
ATOM 10351 O OG   . SER A 1 100 ? 15.780  -3.236  5.472   1.00 0.00 ? 100 SER A OG   5  
ATOM 10352 H H    . SER A 1 100 ? 13.821  -6.490  4.416   1.00 0.00 ? 100 SER A H    5  
ATOM 10353 H HA   . SER A 1 100 ? 13.979  -4.825  6.710   1.00 0.00 ? 100 SER A HA   5  
ATOM 10354 H HB2  . SER A 1 100 ? 15.920  -5.253  5.247   1.00 0.00 ? 100 SER A HB2  5  
ATOM 10355 H HB3  . SER A 1 100 ? 15.124  -4.397  3.929   1.00 0.00 ? 100 SER A HB3  5  
ATOM 10356 H HG   . SER A 1 100 ? 15.471  -3.067  6.372   1.00 0.00 ? 100 SER A HG   5  
ATOM 10357 N N    . PHE A 1 101 ? 12.286  -3.717  4.115   1.00 0.00 ? 101 PHE A N    5  
ATOM 10358 C CA   . PHE A 1 101 ? 11.296  -2.736  3.671   1.00 0.00 ? 101 PHE A CA   5  
ATOM 10359 C C    . PHE A 1 101 ? 9.888   -3.146  4.106   1.00 0.00 ? 101 PHE A C    5  
ATOM 10360 O O    . PHE A 1 101 ? 8.903   -2.507  3.736   1.00 0.00 ? 101 PHE A O    5  
ATOM 10361 C CB   . PHE A 1 101 ? 11.360  -2.568  2.146   1.00 0.00 ? 101 PHE A CB   5  
ATOM 10362 C CG   . PHE A 1 101 ? 12.648  -1.946  1.664   1.00 0.00 ? 101 PHE A CG   5  
ATOM 10363 C CD1  . PHE A 1 101 ? 13.793  -2.716  1.503   1.00 0.00 ? 101 PHE A CD1  5  
ATOM 10364 C CD2  . PHE A 1 101 ? 12.716  -0.589  1.376   1.00 0.00 ? 101 PHE A CD2  5  
ATOM 10365 C CE1  . PHE A 1 101 ? 14.973  -2.146  1.068   1.00 0.00 ? 101 PHE A CE1  5  
ATOM 10366 C CE2  . PHE A 1 101 ? 13.896  -0.015  0.939   1.00 0.00 ? 101 PHE A CE2  5  
ATOM 10367 C CZ   . PHE A 1 101 ? 15.025  -0.795  0.785   1.00 0.00 ? 101 PHE A CZ   5  
ATOM 10368 H H    . PHE A 1 101 ? 12.533  -4.448  3.514   1.00 0.00 ? 101 PHE A H    5  
ATOM 10369 H HA   . PHE A 1 101 ? 11.537  -1.790  4.136   1.00 0.00 ? 101 PHE A HA   5  
ATOM 10370 H HB2  . PHE A 1 101 ? 11.262  -3.538  1.679   1.00 0.00 ? 101 PHE A HB2  5  
ATOM 10371 H HB3  . PHE A 1 101 ? 10.542  -1.937  1.824   1.00 0.00 ? 101 PHE A HB3  5  
ATOM 10372 H HD1  . PHE A 1 101 ? 13.756  -3.774  1.723   1.00 0.00 ? 101 PHE A HD1  5  
ATOM 10373 H HD2  . PHE A 1 101 ? 11.834  0.025   1.495   1.00 0.00 ? 101 PHE A HD2  5  
ATOM 10374 H HE1  . PHE A 1 101 ? 15.857  -2.758  0.949   1.00 0.00 ? 101 PHE A HE1  5  
ATOM 10375 H HE2  . PHE A 1 101 ? 13.935  1.041   0.717   1.00 0.00 ? 101 PHE A HE2  5  
ATOM 10376 H HZ   . PHE A 1 101 ? 15.948  -0.349  0.444   1.00 0.00 ? 101 PHE A HZ   5  
ATOM 10377 N N    . ASP A 1 102 ? 9.802   -4.203  4.910   1.00 0.00 ? 102 ASP A N    5  
ATOM 10378 C CA   . ASP A 1 102 ? 8.517   -4.672  5.426   1.00 0.00 ? 102 ASP A CA   5  
ATOM 10379 C C    . ASP A 1 102 ? 7.992   -3.670  6.446   1.00 0.00 ? 102 ASP A C    5  
ATOM 10380 O O    . ASP A 1 102 ? 6.785   -3.448  6.564   1.00 0.00 ? 102 ASP A O    5  
ATOM 10381 C CB   . ASP A 1 102 ? 8.667   -6.056  6.068   1.00 0.00 ? 102 ASP A CB   5  
ATOM 10382 C CG   . ASP A 1 102 ? 7.339   -6.777  6.240   1.00 0.00 ? 102 ASP A CG   5  
ATOM 10383 O OD1  . ASP A 1 102 ? 6.622   -6.504  7.224   1.00 0.00 ? 102 ASP A OD1  5  
ATOM 10384 O OD2  . ASP A 1 102 ? 7.021   -7.641  5.394   1.00 0.00 ? 102 ASP A OD2  5  
ATOM 10385 H H    . ASP A 1 102 ? 10.622  -4.667  5.177   1.00 0.00 ? 102 ASP A H    5  
ATOM 10386 H HA   . ASP A 1 102 ? 7.825   -4.733  4.595   1.00 0.00 ? 102 ASP A HA   5  
ATOM 10387 H HB2  . ASP A 1 102 ? 9.307   -6.666  5.445   1.00 0.00 ? 102 ASP A HB2  5  
ATOM 10388 H HB3  . ASP A 1 102 ? 9.128   -5.947  7.041   1.00 0.00 ? 102 ASP A HB3  5  
ATOM 10389 N N    . ALA A 1 103 ? 8.923   -3.057  7.178   1.00 0.00 ? 103 ALA A N    5  
ATOM 10390 C CA   . ALA A 1 103 ? 8.592   -1.976  8.096   1.00 0.00 ? 103 ALA A CA   5  
ATOM 10391 C C    . ALA A 1 103 ? 8.001   -0.805  7.317   1.00 0.00 ? 103 ALA A C    5  
ATOM 10392 O O    . ALA A 1 103 ? 7.007   -0.207  7.731   1.00 0.00 ? 103 ALA A O    5  
ATOM 10393 C CB   . ALA A 1 103 ? 9.830   -1.537  8.876   1.00 0.00 ? 103 ALA A CB   5  
ATOM 10394 H H    . ALA A 1 103 ? 9.856   -3.348  7.101   1.00 0.00 ? 103 ALA A H    5  
ATOM 10395 H HA   . ALA A 1 103 ? 7.856   -2.344  8.800   1.00 0.00 ? 103 ALA A HA   5  
ATOM 10396 H HB1  . ALA A 1 103 ? 10.233  -2.380  9.420   1.00 0.00 ? 103 ALA A HB1  5  
ATOM 10397 H HB2  . ALA A 1 103 ? 9.560   -0.756  9.574   1.00 0.00 ? 103 ALA A HB2  5  
ATOM 10398 H HB3  . ALA A 1 103 ? 10.577  -1.164  8.190   1.00 0.00 ? 103 ALA A HB3  5  
ATOM 10399 N N    . ALA A 1 104 ? 8.611   -0.504  6.169   1.00 0.00 ? 104 ALA A N    5  
ATOM 10400 C CA   . ALA A 1 104 ? 8.121   0.548   5.282   1.00 0.00 ? 104 ALA A CA   5  
ATOM 10401 C C    . ALA A 1 104 ? 6.691   0.240   4.844   1.00 0.00 ? 104 ALA A C    5  
ATOM 10402 O O    . ALA A 1 104 ? 5.840   1.135   4.790   1.00 0.00 ? 104 ALA A O    5  
ATOM 10403 C CB   . ALA A 1 104 ? 9.037   0.698   4.072   1.00 0.00 ? 104 ALA A CB   5  
ATOM 10404 H H    . ALA A 1 104 ? 9.411   -1.007  5.912   1.00 0.00 ? 104 ALA A H    5  
ATOM 10405 H HA   . ALA A 1 104 ? 8.128   1.480   5.832   1.00 0.00 ? 104 ALA A HA   5  
ATOM 10406 H HB1  . ALA A 1 104 ? 9.045   -0.224  3.508   1.00 0.00 ? 104 ALA A HB1  5  
ATOM 10407 H HB2  . ALA A 1 104 ? 10.040  0.923   4.406   1.00 0.00 ? 104 ALA A HB2  5  
ATOM 10408 H HB3  . ALA A 1 104 ? 8.679   1.501   3.444   1.00 0.00 ? 104 ALA A HB3  5  
ATOM 10409 N N    . GLN A 1 105 ? 6.437   -1.037  4.545   1.00 0.00 ? 105 GLN A N    5  
ATOM 10410 C CA   . GLN A 1 105 ? 5.090   -1.505  4.231   1.00 0.00 ? 105 GLN A CA   5  
ATOM 10411 C C    . GLN A 1 105 ? 4.129   -1.102  5.339   1.00 0.00 ? 105 GLN A C    5  
ATOM 10412 O O    . GLN A 1 105 ? 3.115   -0.464  5.086   1.00 0.00 ? 105 GLN A O    5  
ATOM 10413 C CB   . GLN A 1 105 ? 5.056   -3.032  4.069   1.00 0.00 ? 105 GLN A CB   5  
ATOM 10414 C CG   . GLN A 1 105 ? 3.643   -3.599  3.923   1.00 0.00 ? 105 GLN A CG   5  
ATOM 10415 C CD   . GLN A 1 105 ? 3.579   -5.103  4.136   1.00 0.00 ? 105 GLN A CD   5  
ATOM 10416 O OE1  . GLN A 1 105 ? 3.389   -5.577  5.256   1.00 0.00 ? 105 GLN A OE1  5  
ATOM 10417 N NE2  . GLN A 1 105 ? 3.744   -5.859  3.070   1.00 0.00 ? 105 GLN A NE2  5  
ATOM 10418 H H    . GLN A 1 105 ? 7.178   -1.679  4.534   1.00 0.00 ? 105 GLN A H    5  
ATOM 10419 H HA   . GLN A 1 105 ? 4.779   -1.039  3.306   1.00 0.00 ? 105 GLN A HA   5  
ATOM 10420 H HB2  . GLN A 1 105 ? 5.626   -3.300  3.189   1.00 0.00 ? 105 GLN A HB2  5  
ATOM 10421 H HB3  . GLN A 1 105 ? 5.516   -3.483  4.935   1.00 0.00 ? 105 GLN A HB3  5  
ATOM 10422 H HG2  . GLN A 1 105 ? 3.001   -3.125  4.651   1.00 0.00 ? 105 GLN A HG2  5  
ATOM 10423 H HG3  . GLN A 1 105 ? 3.281   -3.374  2.928   1.00 0.00 ? 105 GLN A HG3  5  
ATOM 10424 H HE21 . GLN A 1 105 ? 3.899   -5.416  2.208   1.00 0.00 ? 105 GLN A HE21 5  
ATOM 10425 H HE22 . GLN A 1 105 ? 3.708   -6.832  3.179   1.00 0.00 ? 105 GLN A HE22 5  
ATOM 10426 N N    . SER A 1 106 ? 4.474   -1.472  6.570   1.00 0.00 ? 106 SER A N    5  
ATOM 10427 C CA   . SER A 1 106 ? 3.634   -1.201  7.733   1.00 0.00 ? 106 SER A CA   5  
ATOM 10428 C C    . SER A 1 106 ? 3.242   0.277   7.802   1.00 0.00 ? 106 SER A C    5  
ATOM 10429 O O    . SER A 1 106 ? 2.078   0.604   8.020   1.00 0.00 ? 106 SER A O    5  
ATOM 10430 C CB   . SER A 1 106 ? 4.361   -1.619  9.021   1.00 0.00 ? 106 SER A CB   5  
ATOM 10431 O OG   . SER A 1 106 ? 3.589   -1.323  10.178  1.00 0.00 ? 106 SER A OG   5  
ATOM 10432 H H    . SER A 1 106 ? 5.324   -1.949  6.701   1.00 0.00 ? 106 SER A H    5  
ATOM 10433 H HA   . SER A 1 106 ? 2.735   -1.793  7.632   1.00 0.00 ? 106 SER A HA   5  
ATOM 10434 H HB2  . SER A 1 106 ? 4.549   -2.682  8.995   1.00 0.00 ? 106 SER A HB2  5  
ATOM 10435 H HB3  . SER A 1 106 ? 5.302   -1.090  9.087   1.00 0.00 ? 106 SER A HB3  5  
ATOM 10436 H HG   . SER A 1 106 ? 2.778   -1.850  10.166  1.00 0.00 ? 106 SER A HG   5  
ATOM 10437 N N    . ARG A 1 107 ? 4.215   1.162   7.582   1.00 0.00 ? 107 ARG A N    5  
ATOM 10438 C CA   . ARG A 1 107 ? 3.996   2.606   7.714   1.00 0.00 ? 107 ARG A CA   5  
ATOM 10439 C C    . ARG A 1 107 ? 2.961   3.099   6.705   1.00 0.00 ? 107 ARG A C    5  
ATOM 10440 O O    . ARG A 1 107 ? 1.997   3.777   7.066   1.00 0.00 ? 107 ARG A O    5  
ATOM 10441 C CB   . ARG A 1 107 ? 5.313   3.367   7.526   1.00 0.00 ? 107 ARG A CB   5  
ATOM 10442 C CG   . ARG A 1 107 ? 6.490   2.740   8.264   1.00 0.00 ? 107 ARG A CG   5  
ATOM 10443 C CD   . ARG A 1 107 ? 6.281   2.681   9.776   1.00 0.00 ? 107 ARG A CD   5  
ATOM 10444 N NE   . ARG A 1 107 ? 6.585   3.952   10.437  1.00 0.00 ? 107 ARG A NE   5  
ATOM 10445 C CZ   . ARG A 1 107 ? 6.361   4.195   11.730  1.00 0.00 ? 107 ARG A CZ   5  
ATOM 10446 N NH1  . ARG A 1 107 ? 5.744   3.287   12.481  1.00 0.00 ? 107 ARG A NH1  5  
ATOM 10447 N NH2  . ARG A 1 107 ? 6.753   5.343   12.268  1.00 0.00 ? 107 ARG A NH2  5  
ATOM 10448 H H    . ARG A 1 107 ? 5.104   0.833   7.321   1.00 0.00 ? 107 ARG A H    5  
ATOM 10449 H HA   . ARG A 1 107 ? 3.627   2.797   8.704   1.00 0.00 ? 107 ARG A HA   5  
ATOM 10450 H HB2  . ARG A 1 107 ? 5.553   3.395   6.473   1.00 0.00 ? 107 ARG A HB2  5  
ATOM 10451 H HB3  . ARG A 1 107 ? 5.188   4.381   7.884   1.00 0.00 ? 107 ARG A HB3  5  
ATOM 10452 H HG2  . ARG A 1 107 ? 6.632   1.735   7.897   1.00 0.00 ? 107 ARG A HG2  5  
ATOM 10453 H HG3  . ARG A 1 107 ? 7.377   3.323   8.057   1.00 0.00 ? 107 ARG A HG3  5  
ATOM 10454 H HD2  . ARG A 1 107 ? 5.252   2.420   9.978   1.00 0.00 ? 107 ARG A HD2  5  
ATOM 10455 H HD3  . ARG A 1 107 ? 6.927   1.917   10.179  1.00 0.00 ? 107 ARG A HD3  5  
ATOM 10456 H HE   . ARG A 1 107 ? 7.020   4.646   9.893   1.00 0.00 ? 107 ARG A HE   5  
ATOM 10457 H HH11 . ARG A 1 107 ? 5.445   2.416   12.079  1.00 0.00 ? 107 ARG A HH11 5  
ATOM 10458 H HH12 . ARG A 1 107 ? 5.575   3.468   13.455  1.00 0.00 ? 107 ARG A HH12 5  
ATOM 10459 H HH21 . ARG A 1 107 ? 7.221   6.033   11.706  1.00 0.00 ? 107 ARG A HH21 5  
ATOM 10460 H HH22 . ARG A 1 107 ? 6.585   5.531   13.243  1.00 0.00 ? 107 ARG A HH22 5  
ATOM 10461 N N    . VAL A 1 108 ? 3.164   2.742   5.448   1.00 0.00 ? 108 VAL A N    5  
ATOM 10462 C CA   . VAL A 1 108 ? 2.286   3.178   4.368   1.00 0.00 ? 108 VAL A CA   5  
ATOM 10463 C C    . VAL A 1 108 ? 0.929   2.473   4.448   1.00 0.00 ? 108 VAL A C    5  
ATOM 10464 O O    . VAL A 1 108 ? -0.125  3.093   4.281   1.00 0.00 ? 108 VAL A O    5  
ATOM 10465 C CB   . VAL A 1 108 ? 2.939   2.905   2.993   1.00 0.00 ? 108 VAL A CB   5  
ATOM 10466 C CG1  . VAL A 1 108 ? 2.001   3.290   1.858   1.00 0.00 ? 108 VAL A CG1  5  
ATOM 10467 C CG2  . VAL A 1 108 ? 4.270   3.647   2.875   1.00 0.00 ? 108 VAL A CG2  5  
ATOM 10468 H H    . VAL A 1 108 ? 3.926   2.160   5.234   1.00 0.00 ? 108 VAL A H    5  
ATOM 10469 H HA   . VAL A 1 108 ? 2.136   4.246   4.468   1.00 0.00 ? 108 VAL A HA   5  
ATOM 10470 H HB   . VAL A 1 108 ? 3.139   1.843   2.918   1.00 0.00 ? 108 VAL A HB   5  
ATOM 10471 H HG11 . VAL A 1 108 ? 1.100   2.693   1.912   1.00 0.00 ? 108 VAL A HG11 5  
ATOM 10472 H HG12 . VAL A 1 108 ? 2.491   3.114   0.910   1.00 0.00 ? 108 VAL A HG12 5  
ATOM 10473 H HG13 . VAL A 1 108 ? 1.745   4.336   1.939   1.00 0.00 ? 108 VAL A HG13 5  
ATOM 10474 H HG21 . VAL A 1 108 ? 4.708   3.448   1.908   1.00 0.00 ? 108 VAL A HG21 5  
ATOM 10475 H HG22 . VAL A 1 108 ? 4.943   3.309   3.650   1.00 0.00 ? 108 VAL A HG22 5  
ATOM 10476 H HG23 . VAL A 1 108 ? 4.103   4.709   2.983   1.00 0.00 ? 108 VAL A HG23 5  
ATOM 10477 N N    . TYR A 1 109 ? 0.976   1.178   4.720   1.00 0.00 ? 109 TYR A N    5  
ATOM 10478 C CA   . TYR A 1 109 ? -0.219  0.351   4.842   1.00 0.00 ? 109 TYR A CA   5  
ATOM 10479 C C    . TYR A 1 109 ? -1.140  0.898   5.931   1.00 0.00 ? 109 TYR A C    5  
ATOM 10480 O O    . TYR A 1 109 ? -2.317  1.161   5.679   1.00 0.00 ? 109 TYR A O    5  
ATOM 10481 C CB   . TYR A 1 109 ? 0.196   -1.099  5.148   1.00 0.00 ? 109 TYR A CB   5  
ATOM 10482 C CG   . TYR A 1 109 ? -0.949  -2.059  5.431   1.00 0.00 ? 109 TYR A CG   5  
ATOM 10483 C CD1  . TYR A 1 109 ? -1.561  -2.770  4.403   1.00 0.00 ? 109 TYR A CD1  5  
ATOM 10484 C CD2  . TYR A 1 109 ? -1.398  -2.271  6.731   1.00 0.00 ? 109 TYR A CD2  5  
ATOM 10485 C CE1  . TYR A 1 109 ? -2.584  -3.662  4.665   1.00 0.00 ? 109 TYR A CE1  5  
ATOM 10486 C CE2  . TYR A 1 109 ? -2.422  -3.156  6.997   1.00 0.00 ? 109 TYR A CE2  5  
ATOM 10487 C CZ   . TYR A 1 109 ? -3.012  -3.851  5.963   1.00 0.00 ? 109 TYR A CZ   5  
ATOM 10488 O OH   . TYR A 1 109 ? -4.028  -4.744  6.227   1.00 0.00 ? 109 TYR A OH   5  
ATOM 10489 H H    . TYR A 1 109 ? 1.849   0.761   4.848   1.00 0.00 ? 109 TYR A H    5  
ATOM 10490 H HA   . TYR A 1 109 ? -0.740  0.375   3.895   1.00 0.00 ? 109 TYR A HA   5  
ATOM 10491 H HB2  . TYR A 1 109 ? 0.745   -1.487  4.302   1.00 0.00 ? 109 TYR A HB2  5  
ATOM 10492 H HB3  . TYR A 1 109 ? 0.848   -1.097  6.008   1.00 0.00 ? 109 TYR A HB3  5  
ATOM 10493 H HD1  . TYR A 1 109 ? -1.225  -2.618  3.386   1.00 0.00 ? 109 TYR A HD1  5  
ATOM 10494 H HD2  . TYR A 1 109 ? -0.936  -1.725  7.542   1.00 0.00 ? 109 TYR A HD2  5  
ATOM 10495 H HE1  . TYR A 1 109 ? -3.046  -4.205  3.853   1.00 0.00 ? 109 TYR A HE1  5  
ATOM 10496 H HE2  . TYR A 1 109 ? -2.757  -3.303  8.014   1.00 0.00 ? 109 TYR A HE2  5  
ATOM 10497 H HH   . TYR A 1 109 ? -4.623  -4.361  6.884   1.00 0.00 ? 109 TYR A HH   5  
ATOM 10498 N N    . GLN A 1 110 ? -0.593  1.096   7.133   1.00 0.00 ? 110 GLN A N    5  
ATOM 10499 C CA   . GLN A 1 110 ? -1.380  1.595   8.258   1.00 0.00 ? 110 GLN A CA   5  
ATOM 10500 C C    . GLN A 1 110 ? -1.860  3.014   7.975   1.00 0.00 ? 110 GLN A C    5  
ATOM 10501 O O    . GLN A 1 110 ? -2.939  3.410   8.414   1.00 0.00 ? 110 GLN A O    5  
ATOM 10502 C CB   . GLN A 1 110 ? -0.570  1.548   9.571   1.00 0.00 ? 110 GLN A CB   5  
ATOM 10503 C CG   . GLN A 1 110 ? 0.566   2.575   9.667   1.00 0.00 ? 110 GLN A CG   5  
ATOM 10504 C CD   . GLN A 1 110 ? 0.251   3.741   10.598  1.00 0.00 ? 110 GLN A CD   5  
ATOM 10505 O OE1  . GLN A 1 110 ? 0.545   3.694   11.791  1.00 0.00 ? 110 GLN A OE1  5  
ATOM 10506 N NE2  . GLN A 1 110 ? -0.346  4.793   10.061  1.00 0.00 ? 110 GLN A NE2  5  
ATOM 10507 H H    . GLN A 1 110 ? 0.359   0.901   7.263   1.00 0.00 ? 110 GLN A H    5  
ATOM 10508 H HA   . GLN A 1 110 ? -2.244  0.955   8.360   1.00 0.00 ? 110 GLN A HA   5  
ATOM 10509 H HB2  . GLN A 1 110 ? -1.247  1.713   10.398  1.00 0.00 ? 110 GLN A HB2  5  
ATOM 10510 H HB3  . GLN A 1 110 ? -0.141  0.560   9.669   1.00 0.00 ? 110 GLN A HB3  5  
ATOM 10511 H HG2  . GLN A 1 110 ? 1.452   2.078   10.035  1.00 0.00 ? 110 GLN A HG2  5  
ATOM 10512 H HG3  . GLN A 1 110 ? 0.767   2.968   8.678   1.00 0.00 ? 110 GLN A HG3  5  
ATOM 10513 H HE21 . GLN A 1 110 ? -0.550  4.771   9.106   1.00 0.00 ? 110 GLN A HE21 5  
ATOM 10514 H HE22 . GLN A 1 110 ? -0.561  5.548   10.646  1.00 0.00 ? 110 GLN A HE22 5  
ATOM 10515 N N    . LEU A 1 111 ? -1.049  3.771   7.229   1.00 0.00 ? 111 LEU A N    5  
ATOM 10516 C CA   . LEU A 1 111 ? -1.376  5.150   6.878   1.00 0.00 ? 111 LEU A CA   5  
ATOM 10517 C C    . LEU A 1 111 ? -2.652  5.202   6.044   1.00 0.00 ? 111 LEU A C    5  
ATOM 10518 O O    . LEU A 1 111 ? -3.657  5.767   6.470   1.00 0.00 ? 111 LEU A O    5  
ATOM 10519 C CB   . LEU A 1 111 ? -0.211  5.802   6.117   1.00 0.00 ? 111 LEU A CB   5  
ATOM 10520 C CG   . LEU A 1 111 ? -0.419  7.274   5.718   1.00 0.00 ? 111 LEU A CG   5  
ATOM 10521 C CD1  . LEU A 1 111 ? -0.619  8.149   6.955   1.00 0.00 ? 111 LEU A CD1  5  
ATOM 10522 C CD2  . LEU A 1 111 ? 0.756   7.777   4.879   1.00 0.00 ? 111 LEU A CD2  5  
ATOM 10523 H H    . LEU A 1 111 ? -0.206  3.386   6.905   1.00 0.00 ? 111 LEU A H    5  
ATOM 10524 H HA   . LEU A 1 111 ? -1.541  5.693   7.799   1.00 0.00 ? 111 LEU A HA   5  
ATOM 10525 H HB2  . LEU A 1 111 ? 0.674   5.740   6.737   1.00 0.00 ? 111 LEU A HB2  5  
ATOM 10526 H HB3  . LEU A 1 111 ? -0.036  5.229   5.217   1.00 0.00 ? 111 LEU A HB3  5  
ATOM 10527 H HG   . LEU A 1 111 ? -1.313  7.350   5.115   1.00 0.00 ? 111 LEU A HG   5  
ATOM 10528 H HD11 . LEU A 1 111 ? 0.247   8.074   7.597   1.00 0.00 ? 111 LEU A HD11 5  
ATOM 10529 H HD12 . LEU A 1 111 ? -1.496  7.818   7.493   1.00 0.00 ? 111 LEU A HD12 5  
ATOM 10530 H HD13 . LEU A 1 111 ? -0.754  9.177   6.652   1.00 0.00 ? 111 LEU A HD13 5  
ATOM 10531 H HD21 . LEU A 1 111 ? 0.854   7.168   3.992   1.00 0.00 ? 111 LEU A HD21 5  
ATOM 10532 H HD22 . LEU A 1 111 ? 1.667   7.718   5.457   1.00 0.00 ? 111 LEU A HD22 5  
ATOM 10533 H HD23 . LEU A 1 111 ? 0.580   8.803   4.590   1.00 0.00 ? 111 LEU A HD23 5  
ATOM 10534 N N    . MET A 1 112 ? -2.622  4.584   4.866   1.00 0.00 ? 112 MET A N    5  
ATOM 10535 C CA   . MET A 1 112 ? -3.780  4.604   3.978   1.00 0.00 ? 112 MET A CA   5  
ATOM 10536 C C    . MET A 1 112 ? -4.930  3.804   4.584   1.00 0.00 ? 112 MET A C    5  
ATOM 10537 O O    . MET A 1 112 ? -6.086  4.007   4.235   1.00 0.00 ? 112 MET A O    5  
ATOM 10538 C CB   . MET A 1 112 ? -3.428  4.074   2.579   1.00 0.00 ? 112 MET A CB   5  
ATOM 10539 C CG   . MET A 1 112 ? -3.151  2.580   2.515   1.00 0.00 ? 112 MET A CG   5  
ATOM 10540 S SD   . MET A 1 112 ? -2.822  2.021   0.832   1.00 0.00 ? 112 MET A SD   5  
ATOM 10541 C CE   . MET A 1 112 ? -2.694  0.259   1.091   1.00 0.00 ? 112 MET A CE   5  
ATOM 10542 H H    . MET A 1 112 ? -1.806  4.108   4.590   1.00 0.00 ? 112 MET A H    5  
ATOM 10543 H HA   . MET A 1 112 ? -4.096  5.634   3.887   1.00 0.00 ? 112 MET A HA   5  
ATOM 10544 H HB2  . MET A 1 112 ? -4.249  4.289   1.910   1.00 0.00 ? 112 MET A HB2  5  
ATOM 10545 H HB3  . MET A 1 112 ? -2.547  4.595   2.224   1.00 0.00 ? 112 MET A HB3  5  
ATOM 10546 H HG2  . MET A 1 112 ? -2.290  2.357   3.128   1.00 0.00 ? 112 MET A HG2  5  
ATOM 10547 H HG3  . MET A 1 112 ? -4.012  2.047   2.894   1.00 0.00 ? 112 MET A HG3  5  
ATOM 10548 H HE1  . MET A 1 112 ? -2.539  -0.235  0.144   1.00 0.00 ? 112 MET A HE1  5  
ATOM 10549 H HE2  . MET A 1 112 ? -3.604  -0.108  1.545   1.00 0.00 ? 112 MET A HE2  5  
ATOM 10550 H HE3  . MET A 1 112 ? -1.857  0.053   1.744   1.00 0.00 ? 112 MET A HE3  5  
ATOM 10551 N N    . GLU A 1 113 ? -4.619  2.898   5.503   1.00 0.00 ? 113 GLU A N    5  
ATOM 10552 C CA   . GLU A 1 113 ? -5.659  2.169   6.217   1.00 0.00 ? 113 GLU A CA   5  
ATOM 10553 C C    . GLU A 1 113 ? -6.480  3.150   7.060   1.00 0.00 ? 113 GLU A C    5  
ATOM 10554 O O    . GLU A 1 113 ? -7.696  3.273   6.892   1.00 0.00 ? 113 GLU A O    5  
ATOM 10555 C CB   . GLU A 1 113 ? -5.046  1.062   7.091   1.00 0.00 ? 113 GLU A CB   5  
ATOM 10556 C CG   . GLU A 1 113 ? -6.074  0.212   7.836   1.00 0.00 ? 113 GLU A CG   5  
ATOM 10557 C CD   . GLU A 1 113 ? -5.449  -0.972  8.564   1.00 0.00 ? 113 GLU A CD   5  
ATOM 10558 O OE1  . GLU A 1 113 ? -4.705  -0.751  9.545   1.00 0.00 ? 113 GLU A OE1  5  
ATOM 10559 O OE2  . GLU A 1 113 ? -5.694  -2.129  8.158   1.00 0.00 ? 113 GLU A OE2  5  
ATOM 10560 H H    . GLU A 1 113 ? -3.676  2.712   5.701   1.00 0.00 ? 113 GLU A H    5  
ATOM 10561 H HA   . GLU A 1 113 ? -6.311  1.718   5.479   1.00 0.00 ? 113 GLU A HA   5  
ATOM 10562 H HB2  . GLU A 1 113 ? -4.462  0.407   6.460   1.00 0.00 ? 113 GLU A HB2  5  
ATOM 10563 H HB3  . GLU A 1 113 ? -4.389  1.517   7.821   1.00 0.00 ? 113 GLU A HB3  5  
ATOM 10564 H HG2  . GLU A 1 113 ? -6.576  0.835   8.564   1.00 0.00 ? 113 GLU A HG2  5  
ATOM 10565 H HG3  . GLU A 1 113 ? -6.800  -0.159  7.125   1.00 0.00 ? 113 GLU A HG3  5  
ATOM 10566 N N    . GLN A 1 114 ? -5.793  3.898   7.918   1.00 0.00 ? 114 GLN A N    5  
ATOM 10567 C CA   . GLN A 1 114 ? -6.449  4.833   8.833   1.00 0.00 ? 114 GLN A CA   5  
ATOM 10568 C C    . GLN A 1 114 ? -6.880  6.122   8.118   1.00 0.00 ? 114 GLN A C    5  
ATOM 10569 O O    . GLN A 1 114 ? -7.718  6.870   8.630   1.00 0.00 ? 114 GLN A O    5  
ATOM 10570 C CB   . GLN A 1 114 ? -5.511  5.177   9.998   1.00 0.00 ? 114 GLN A CB   5  
ATOM 10571 C CG   . GLN A 1 114 ? -4.237  5.892   9.560   1.00 0.00 ? 114 GLN A CG   5  
ATOM 10572 C CD   . GLN A 1 114 ? -3.347  6.310   10.716  1.00 0.00 ? 114 GLN A CD   5  
ATOM 10573 O OE1  . GLN A 1 114 ? -3.305  5.659   11.759  1.00 0.00 ? 114 GLN A OE1  5  
ATOM 10574 N NE2  . GLN A 1 114 ? -2.640  7.413   10.541  1.00 0.00 ? 114 GLN A NE2  5  
ATOM 10575 H H    . GLN A 1 114 ? -4.815  3.821   7.937   1.00 0.00 ? 114 GLN A H    5  
ATOM 10576 H HA   . GLN A 1 114 ? -7.329  4.345   9.227   1.00 0.00 ? 114 GLN A HA   5  
ATOM 10577 H HB2  . GLN A 1 114 ? -6.038  5.814   10.695  1.00 0.00 ? 114 GLN A HB2  5  
ATOM 10578 H HB3  . GLN A 1 114 ? -5.231  4.262   10.502  1.00 0.00 ? 114 GLN A HB3  5  
ATOM 10579 H HG2  . GLN A 1 114 ? -3.673  5.234   8.916   1.00 0.00 ? 114 GLN A HG2  5  
ATOM 10580 H HG3  . GLN A 1 114 ? -4.514  6.778   9.003   1.00 0.00 ? 114 GLN A HG3  5  
ATOM 10581 H HE21 . GLN A 1 114 ? -2.732  7.892   9.684   1.00 0.00 ? 114 GLN A HE21 5  
ATOM 10582 H HE22 . GLN A 1 114 ? -2.062  7.716   11.270  1.00 0.00 ? 114 GLN A HE22 5  
ATOM 10583 N N    . ASP A 1 115 ? -6.303  6.393   6.947   1.00 0.00 ? 115 ASP A N    5  
ATOM 10584 C CA   . ASP A 1 115 ? -6.576  7.644   6.225   1.00 0.00 ? 115 ASP A CA   5  
ATOM 10585 C C    . ASP A 1 115 ? -7.289  7.410   4.889   1.00 0.00 ? 115 ASP A C    5  
ATOM 10586 O O    . ASP A 1 115 ? -7.529  8.360   4.141   1.00 0.00 ? 115 ASP A O    5  
ATOM 10587 C CB   . ASP A 1 115 ? -5.272  8.436   5.998   1.00 0.00 ? 115 ASP A CB   5  
ATOM 10588 C CG   . ASP A 1 115 ? -4.833  9.226   7.227   1.00 0.00 ? 115 ASP A CG   5  
ATOM 10589 O OD1  . ASP A 1 115 ? -5.293  10.380  7.393   1.00 0.00 ? 115 ASP A OD1  5  
ATOM 10590 O OD2  . ASP A 1 115 ? -4.036  8.707   8.039   1.00 0.00 ? 115 ASP A OD2  5  
ATOM 10591 H H    . ASP A 1 115 ? -5.662  5.752   6.570   1.00 0.00 ? 115 ASP A H    5  
ATOM 10592 H HA   . ASP A 1 115 ? -7.230  8.239   6.847   1.00 0.00 ? 115 ASP A HA   5  
ATOM 10593 H HB2  . ASP A 1 115 ? -4.482  7.748   5.734   1.00 0.00 ? 115 ASP A HB2  5  
ATOM 10594 H HB3  . ASP A 1 115 ? -5.418  9.131   5.180   1.00 0.00 ? 115 ASP A HB3  5  
ATOM 10595 N N    . SER A 1 116 ? -7.640  6.164   4.583   1.00 0.00 ? 116 SER A N    5  
ATOM 10596 C CA   . SER A 1 116 ? -8.369  5.865   3.347   1.00 0.00 ? 116 SER A CA   5  
ATOM 10597 C C    . SER A 1 116 ? -9.331  4.687   3.535   1.00 0.00 ? 116 SER A C    5  
ATOM 10598 O O    . SER A 1 116 ? -10.471 4.755   3.095   1.00 0.00 ? 116 SER A O    5  
ATOM 10599 C CB   . SER A 1 116 ? -7.394  5.599   2.183   1.00 0.00 ? 116 SER A CB   5  
ATOM 10600 O OG   . SER A 1 116 ? -8.081  5.406   0.957   1.00 0.00 ? 116 SER A OG   5  
ATOM 10601 H H    . SER A 1 116 ? -7.401  5.433   5.188   1.00 0.00 ? 116 SER A H    5  
ATOM 10602 H HA   . SER A 1 116 ? -8.959  6.741   3.103   1.00 0.00 ? 116 SER A HA   5  
ATOM 10603 H HB2  . SER A 1 116 ? -6.728  6.443   2.075   1.00 0.00 ? 116 SER A HB2  5  
ATOM 10604 H HB3  . SER A 1 116 ? -6.814  4.713   2.399   1.00 0.00 ? 116 SER A HB3  5  
ATOM 10605 H HG   . SER A 1 116 ? -8.242  6.262   0.537   1.00 0.00 ? 116 SER A HG   5  
ATOM 10606 N N    . TYR A 1 117 ? -8.887  3.618   4.208   1.00 0.00 ? 117 TYR A N    5  
ATOM 10607 C CA   . TYR A 1 117 ? -9.747  2.446   4.429   1.00 0.00 ? 117 TYR A CA   5  
ATOM 10608 C C    . TYR A 1 117 ? -10.923 2.806   5.337   1.00 0.00 ? 117 TYR A C    5  
ATOM 10609 O O    . TYR A 1 117 ? -12.055 2.375   5.108   1.00 0.00 ? 117 TYR A O    5  
ATOM 10610 C CB   . TYR A 1 117 ? -8.939  1.274   5.017   1.00 0.00 ? 117 TYR A CB   5  
ATOM 10611 C CG   . TYR A 1 117 ? -9.785  0.107   5.508   1.00 0.00 ? 117 TYR A CG   5  
ATOM 10612 C CD1  . TYR A 1 117 ? -10.620 -0.594  4.642   1.00 0.00 ? 117 TYR A CD1  5  
ATOM 10613 C CD2  . TYR A 1 117 ? -9.745  -0.292  6.842   1.00 0.00 ? 117 TYR A CD2  5  
ATOM 10614 C CE1  . TYR A 1 117 ? -11.387 -1.654  5.091   1.00 0.00 ? 117 TYR A CE1  5  
ATOM 10615 C CE2  . TYR A 1 117 ? -10.509 -1.350  7.295   1.00 0.00 ? 117 TYR A CE2  5  
ATOM 10616 C CZ   . TYR A 1 117 ? -11.327 -2.029  6.417   1.00 0.00 ? 117 TYR A CZ   5  
ATOM 10617 O OH   . TYR A 1 117 ? -12.090 -3.082  6.871   1.00 0.00 ? 117 TYR A OH   5  
ATOM 10618 H H    . TYR A 1 117 ? -7.972  3.615   4.564   1.00 0.00 ? 117 TYR A H    5  
ATOM 10619 H HA   . TYR A 1 117 ? -10.140 2.147   3.466   1.00 0.00 ? 117 TYR A HA   5  
ATOM 10620 H HB2  . TYR A 1 117 ? -8.269  0.894   4.254   1.00 0.00 ? 117 TYR A HB2  5  
ATOM 10621 H HB3  . TYR A 1 117 ? -8.354  1.639   5.855   1.00 0.00 ? 117 TYR A HB3  5  
ATOM 10622 H HD1  . TYR A 1 117 ? -10.665 -0.300  3.603   1.00 0.00 ? 117 TYR A HD1  5  
ATOM 10623 H HD2  . TYR A 1 117 ? -9.103  0.239   7.530   1.00 0.00 ? 117 TYR A HD2  5  
ATOM 10624 H HE1  . TYR A 1 117 ? -12.027 -2.186  4.403   1.00 0.00 ? 117 TYR A HE1  5  
ATOM 10625 H HE2  . TYR A 1 117 ? -10.463 -1.642  8.334   1.00 0.00 ? 117 TYR A HE2  5  
ATOM 10626 H HH   . TYR A 1 117 ? -12.157 -3.752  6.179   1.00 0.00 ? 117 TYR A HH   5  
ATOM 10627 N N    . THR A 1 118 ? -10.649 3.606   6.358   1.00 0.00 ? 118 THR A N    5  
ATOM 10628 C CA   . THR A 1 118 ? -11.692 4.121   7.239   1.00 0.00 ? 118 THR A CA   5  
ATOM 10629 C C    . THR A 1 118 ? -12.744 4.877   6.421   1.00 0.00 ? 118 THR A C    5  
ATOM 10630 O O    . THR A 1 118 ? -13.944 4.570   6.462   1.00 0.00 ? 118 THR A O    5  
ATOM 10631 C CB   . THR A 1 118 ? -11.077 5.063   8.298   1.00 0.00 ? 118 THR A CB   5  
ATOM 10632 O OG1  . THR A 1 118 ? -10.258 6.047   7.646   1.00 0.00 ? 118 THR A OG1  5  
ATOM 10633 C CG2  . THR A 1 118 ? -10.230 4.286   9.303   1.00 0.00 ? 118 THR A CG2  5  
ATOM 10634 H H    . THR A 1 118 ? -9.717  3.859   6.529   1.00 0.00 ? 118 THR A H    5  
ATOM 10635 H HA   . THR A 1 118 ? -12.160 3.286   7.742   1.00 0.00 ? 118 THR A HA   5  
ATOM 10636 H HB   . THR A 1 118 ? -11.875 5.562   8.828   1.00 0.00 ? 118 THR A HB   5  
ATOM 10637 H HG1  . THR A 1 118 ? -9.691  6.476   8.300   1.00 0.00 ? 118 THR A HG1  5  
ATOM 10638 H HG21 . THR A 1 118 ? -10.847 3.561   9.813   1.00 0.00 ? 118 THR A HG21 5  
ATOM 10639 H HG22 . THR A 1 118 ? -9.810  4.971   10.026  1.00 0.00 ? 118 THR A HG22 5  
ATOM 10640 H HG23 . THR A 1 118 ? -9.429  3.778   8.785   1.00 0.00 ? 118 THR A HG23 5  
ATOM 10641 N N    . ARG A 1 119 ? -12.264 5.854   5.660   1.00 0.00 ? 119 ARG A N    5  
ATOM 10642 C CA   . ARG A 1 119 ? -13.103 6.635   4.757   1.00 0.00 ? 119 ARG A CA   5  
ATOM 10643 C C    . ARG A 1 119 ? -13.803 5.729   3.744   1.00 0.00 ? 119 ARG A C    5  
ATOM 10644 O O    . ARG A 1 119 ? -14.944 5.977   3.364   1.00 0.00 ? 119 ARG A O    5  
ATOM 10645 C CB   . ARG A 1 119 ? -12.249 7.676   4.026   1.00 0.00 ? 119 ARG A CB   5  
ATOM 10646 C CG   . ARG A 1 119 ? -11.734 8.803   4.920   1.00 0.00 ? 119 ARG A CG   5  
ATOM 10647 C CD   . ARG A 1 119 ? -10.662 9.627   4.213   1.00 0.00 ? 119 ARG A CD   5  
ATOM 10648 N NE   . ARG A 1 119 ? -11.018 9.901   2.820   1.00 0.00 ? 119 ARG A NE   5  
ATOM 10649 C CZ   . ARG A 1 119 ? -10.266 9.553   1.775   1.00 0.00 ? 119 ARG A CZ   5  
ATOM 10650 N NH1  . ARG A 1 119 ? -9.069  9.007   1.962   1.00 0.00 ? 119 ARG A NH1  5  
ATOM 10651 N NH2  . ARG A 1 119 ? -10.704 9.766   0.543   1.00 0.00 ? 119 ARG A NH2  5  
ATOM 10652 H H    . ARG A 1 119 ? -11.307 6.062   5.714   1.00 0.00 ? 119 ARG A H    5  
ATOM 10653 H HA   . ARG A 1 119 ? -13.852 7.143   5.351   1.00 0.00 ? 119 ARG A HA   5  
ATOM 10654 H HB2  . ARG A 1 119 ? -11.395 7.177   3.587   1.00 0.00 ? 119 ARG A HB2  5  
ATOM 10655 H HB3  . ARG A 1 119 ? -12.840 8.117   3.234   1.00 0.00 ? 119 ARG A HB3  5  
ATOM 10656 H HG2  . ARG A 1 119 ? -12.559 9.451   5.179   1.00 0.00 ? 119 ARG A HG2  5  
ATOM 10657 H HG3  . ARG A 1 119 ? -11.312 8.375   5.820   1.00 0.00 ? 119 ARG A HG3  5  
ATOM 10658 H HD2  . ARG A 1 119 ? -10.542 10.566  4.735   1.00 0.00 ? 119 ARG A HD2  5  
ATOM 10659 H HD3  . ARG A 1 119 ? -9.728  9.081   4.239   1.00 0.00 ? 119 ARG A HD3  5  
ATOM 10660 H HE   . ARG A 1 119 ? -11.884 10.343  2.654   1.00 0.00 ? 119 ARG A HE   5  
ATOM 10661 H HH11 . ARG A 1 119 ? -8.722  8.856   2.888   1.00 0.00 ? 119 ARG A HH11 5  
ATOM 10662 H HH12 . ARG A 1 119 ? -8.512  8.731   1.169   1.00 0.00 ? 119 ARG A HH12 5  
ATOM 10663 H HH21 . ARG A 1 119 ? -11.602 10.191  0.393   1.00 0.00 ? 119 ARG A HH21 5  
ATOM 10664 H HH22 . ARG A 1 119 ? -10.142 9.490   -0.243  1.00 0.00 ? 119 ARG A HH22 5  
ATOM 10665 N N    . PHE A 1 120 ? -13.111 4.675   3.320   1.00 0.00 ? 120 PHE A N    5  
ATOM 10666 C CA   . PHE A 1 120 ? -13.658 3.723   2.361   1.00 0.00 ? 120 PHE A CA   5  
ATOM 10667 C C    . PHE A 1 120 ? -14.908 3.074   2.936   1.00 0.00 ? 120 PHE A C    5  
ATOM 10668 O O    . PHE A 1 120 ? -15.926 2.977   2.264   1.00 0.00 ? 120 PHE A O    5  
ATOM 10669 C CB   . PHE A 1 120 ? -12.613 2.658   1.995   1.00 0.00 ? 120 PHE A CB   5  
ATOM 10670 C CG   . PHE A 1 120 ? -13.087 1.664   0.959   1.00 0.00 ? 120 PHE A CG   5  
ATOM 10671 C CD1  . PHE A 1 120 ? -13.015 1.966   -0.395  1.00 0.00 ? 120 PHE A CD1  5  
ATOM 10672 C CD2  . PHE A 1 120 ? -13.605 0.432   1.338   1.00 0.00 ? 120 PHE A CD2  5  
ATOM 10673 C CE1  . PHE A 1 120 ? -13.447 1.062   -1.347  1.00 0.00 ? 120 PHE A CE1  5  
ATOM 10674 C CE2  . PHE A 1 120 ? -14.040 -0.475  0.388   1.00 0.00 ? 120 PHE A CE2  5  
ATOM 10675 C CZ   . PHE A 1 120 ? -13.959 -0.160  -0.955  1.00 0.00 ? 120 PHE A CZ   5  
ATOM 10676 H H    . PHE A 1 120 ? -12.206 4.532   3.664   1.00 0.00 ? 120 PHE A H    5  
ATOM 10677 H HA   . PHE A 1 120 ? -13.930 4.272   1.468   1.00 0.00 ? 120 PHE A HA   5  
ATOM 10678 H HB2  . PHE A 1 120 ? -11.732 3.149   1.606   1.00 0.00 ? 120 PHE A HB2  5  
ATOM 10679 H HB3  . PHE A 1 120 ? -12.342 2.109   2.888   1.00 0.00 ? 120 PHE A HB3  5  
ATOM 10680 H HD1  . PHE A 1 120 ? -12.613 2.922   -0.704  1.00 0.00 ? 120 PHE A HD1  5  
ATOM 10681 H HD2  . PHE A 1 120 ? -13.669 0.182   2.388   1.00 0.00 ? 120 PHE A HD2  5  
ATOM 10682 H HE1  . PHE A 1 120 ? -13.384 1.310   -2.396  1.00 0.00 ? 120 PHE A HE1  5  
ATOM 10683 H HE2  . PHE A 1 120 ? -14.439 -1.430  0.696   1.00 0.00 ? 120 PHE A HE2  5  
ATOM 10684 H HZ   . PHE A 1 120 ? -14.297 -0.867  -1.698  1.00 0.00 ? 120 PHE A HZ   5  
ATOM 10685 N N    . LEU A 1 121 ? -14.834 2.661   4.196   1.00 0.00 ? 121 LEU A N    5  
ATOM 10686 C CA   . LEU A 1 121 ? -15.981 2.061   4.876   1.00 0.00 ? 121 LEU A CA   5  
ATOM 10687 C C    . LEU A 1 121 ? -17.118 3.074   5.001   1.00 0.00 ? 121 LEU A C    5  
ATOM 10688 O O    . LEU A 1 121 ? -18.285 2.703   5.143   1.00 0.00 ? 121 LEU A O    5  
ATOM 10689 C CB   . LEU A 1 121 ? -15.580 1.543   6.266   1.00 0.00 ? 121 LEU A CB   5  
ATOM 10690 C CG   . LEU A 1 121 ? -14.501 0.444   6.273   1.00 0.00 ? 121 LEU A CG   5  
ATOM 10691 C CD1  . LEU A 1 121 ? -14.189 0.001   7.701   1.00 0.00 ? 121 LEU A CD1  5  
ATOM 10692 C CD2  . LEU A 1 121 ? -14.933 -0.748  5.417   1.00 0.00 ? 121 LEU A CD2  5  
ATOM 10693 H H    . LEU A 1 121 ? -13.985 2.759   4.682   1.00 0.00 ? 121 LEU A H    5  
ATOM 10694 H HA   . LEU A 1 121 ? -16.322 1.229   4.276   1.00 0.00 ? 121 LEU A HA   5  
ATOM 10695 H HB2  . LEU A 1 121 ? -15.217 2.380   6.848   1.00 0.00 ? 121 LEU A HB2  5  
ATOM 10696 H HB3  . LEU A 1 121 ? -16.465 1.150   6.748   1.00 0.00 ? 121 LEU A HB3  5  
ATOM 10697 H HG   . LEU A 1 121 ? -13.592 0.846   5.848   1.00 0.00 ? 121 LEU A HG   5  
ATOM 10698 H HD11 . LEU A 1 121 ? -15.082 -0.399  8.162   1.00 0.00 ? 121 LEU A HD11 5  
ATOM 10699 H HD12 . LEU A 1 121 ? -13.838 0.847   8.274   1.00 0.00 ? 121 LEU A HD12 5  
ATOM 10700 H HD13 . LEU A 1 121 ? -13.422 -0.760  7.683   1.00 0.00 ? 121 LEU A HD13 5  
ATOM 10701 H HD21 . LEU A 1 121 ? -14.168 -1.510  5.450   1.00 0.00 ? 121 LEU A HD21 5  
ATOM 10702 H HD22 . LEU A 1 121 ? -15.075 -0.427  4.396   1.00 0.00 ? 121 LEU A HD22 5  
ATOM 10703 H HD23 . LEU A 1 121 ? -15.860 -1.152  5.799   1.00 0.00 ? 121 LEU A HD23 5  
ATOM 10704 N N    . LYS A 1 122 ? -16.768 4.357   4.960   1.00 0.00 ? 122 LYS A N    5  
ATOM 10705 C CA   . LYS A 1 122 ? -17.759 5.429   5.048   1.00 0.00 ? 122 LYS A CA   5  
ATOM 10706 C C    . LYS A 1 122 ? -18.079 6.037   3.679   1.00 0.00 ? 122 LYS A C    5  
ATOM 10707 O O    . LYS A 1 122 ? -18.883 6.965   3.590   1.00 0.00 ? 122 LYS A O    5  
ATOM 10708 C CB   . LYS A 1 122 ? -17.262 6.533   5.990   1.00 0.00 ? 122 LYS A CB   5  
ATOM 10709 C CG   . LYS A 1 122 ? -16.922 6.048   7.396   1.00 0.00 ? 122 LYS A CG   5  
ATOM 10710 C CD   . LYS A 1 122 ? -18.094 5.326   8.062   1.00 0.00 ? 122 LYS A CD   5  
ATOM 10711 C CE   . LYS A 1 122 ? -19.346 6.194   8.129   1.00 0.00 ? 122 LYS A CE   5  
ATOM 10712 N NZ   . LYS A 1 122 ? -20.446 5.518   8.866   1.00 0.00 ? 122 LYS A NZ   5  
ATOM 10713 H H    . LYS A 1 122 ? -15.813 4.590   4.896   1.00 0.00 ? 122 LYS A H    5  
ATOM 10714 H HA   . LYS A 1 122 ? -18.668 5.010   5.458   1.00 0.00 ? 122 LYS A HA   5  
ATOM 10715 H HB2  . LYS A 1 122 ? -16.374 6.978   5.564   1.00 0.00 ? 122 LYS A HB2  5  
ATOM 10716 H HB3  . LYS A 1 122 ? -18.028 7.293   6.071   1.00 0.00 ? 122 LYS A HB3  5  
ATOM 10717 H HG2  . LYS A 1 122 ? -16.086 5.366   7.336   1.00 0.00 ? 122 LYS A HG2  5  
ATOM 10718 H HG3  . LYS A 1 122 ? -16.646 6.900   8.002   1.00 0.00 ? 122 LYS A HG3  5  
ATOM 10719 H HD2  . LYS A 1 122 ? -18.321 4.433   7.498   1.00 0.00 ? 122 LYS A HD2  5  
ATOM 10720 H HD3  . LYS A 1 122 ? -17.807 5.050   9.068   1.00 0.00 ? 122 LYS A HD3  5  
ATOM 10721 H HE2  . LYS A 1 122 ? -19.106 7.119   8.629   1.00 0.00 ? 122 LYS A HE2  5  
ATOM 10722 H HE3  . LYS A 1 122 ? -19.680 6.405   7.120   1.00 0.00 ? 122 LYS A HE3  5  
ATOM 10723 H HZ1  . LYS A 1 122 ? -21.270 6.150   8.942   1.00 0.00 ? 122 LYS A HZ1  5  
ATOM 10724 H HZ2  . LYS A 1 122 ? -20.132 5.265   9.826   1.00 0.00 ? 122 LYS A HZ2  5  
ATOM 10725 H HZ3  . LYS A 1 122 ? -20.730 4.651   8.368   1.00 0.00 ? 122 LYS A HZ3  5  
ATOM 10726 N N    . SER A 1 123 ? -17.456 5.528   2.617   1.00 0.00 ? 123 SER A N    5  
ATOM 10727 C CA   . SER A 1 123 ? -17.649 6.094   1.284   1.00 0.00 ? 123 SER A CA   5  
ATOM 10728 C C    . SER A 1 123 ? -18.995 5.663   0.710   1.00 0.00 ? 123 SER A C    5  
ATOM 10729 O O    . SER A 1 123 ? -19.465 4.551   0.974   1.00 0.00 ? 123 SER A O    5  
ATOM 10730 C CB   . SER A 1 123 ? -16.519 5.663   0.337   1.00 0.00 ? 123 SER A CB   5  
ATOM 10731 O OG   . SER A 1 123 ? -16.609 4.284   0.013   1.00 0.00 ? 123 SER A OG   5  
ATOM 10732 H H    . SER A 1 123 ? -16.855 4.761   2.730   1.00 0.00 ? 123 SER A H    5  
ATOM 10733 H HA   . SER A 1 123 ? -17.637 7.172   1.377   1.00 0.00 ? 123 SER A HA   5  
ATOM 10734 H HB2  . SER A 1 123 ? -16.580 6.236   -0.577  1.00 0.00 ? 123 SER A HB2  5  
ATOM 10735 H HB3  . SER A 1 123 ? -15.566 5.847   0.811   1.00 0.00 ? 123 SER A HB3  5  
ATOM 10736 H HG   . SER A 1 123 ? -16.097 3.775   0.644   1.00 0.00 ? 123 SER A HG   5  
ATOM 10737 N N    . ASP A 1 124 ? -19.604 6.541   -0.084  1.00 0.00 ? 124 ASP A N    5  
ATOM 10738 C CA   . ASP A 1 124 ? -20.853 6.218   -0.773  1.00 0.00 ? 124 ASP A CA   5  
ATOM 10739 C C    . ASP A 1 124 ? -20.644 4.992   -1.657  1.00 0.00 ? 124 ASP A C    5  
ATOM 10740 O O    . ASP A 1 124 ? -21.557 4.195   -1.867  1.00 0.00 ? 124 ASP A O    5  
ATOM 10741 C CB   . ASP A 1 124 ? -21.327 7.409   -1.616  1.00 0.00 ? 124 ASP A CB   5  
ATOM 10742 C CG   . ASP A 1 124 ? -22.618 7.117   -2.370  1.00 0.00 ? 124 ASP A CG   5  
ATOM 10743 O OD1  . ASP A 1 124 ? -23.710 7.275   -1.779  1.00 0.00 ? 124 ASP A OD1  5  
ATOM 10744 O OD2  . ASP A 1 124 ? -22.550 6.743   -3.561  1.00 0.00 ? 124 ASP A OD2  5  
ATOM 10745 H H    . ASP A 1 124 ? -19.201 7.424   -0.216  1.00 0.00 ? 124 ASP A H    5  
ATOM 10746 H HA   . ASP A 1 124 ? -21.600 5.991   -0.023  1.00 0.00 ? 124 ASP A HA   5  
ATOM 10747 H HB2  . ASP A 1 124 ? -21.496 8.256   -0.967  1.00 0.00 ? 124 ASP A HB2  5  
ATOM 10748 H HB3  . ASP A 1 124 ? -20.560 7.661   -2.334  1.00 0.00 ? 124 ASP A HB3  5  
ATOM 10749 N N    . ILE A 1 125 ? -19.416 4.856   -2.155  1.00 0.00 ? 125 ILE A N    5  
ATOM 10750 C CA   . ILE A 1 125 ? -19.008 3.698   -2.943  1.00 0.00 ? 125 ILE A CA   5  
ATOM 10751 C C    . ILE A 1 125 ? -19.234 2.404   -2.157  1.00 0.00 ? 125 ILE A C    5  
ATOM 10752 O O    . ILE A 1 125 ? -19.831 1.452   -2.664  1.00 0.00 ? 125 ILE A O    5  
ATOM 10753 C CB   . ILE A 1 125 ? -17.512 3.807   -3.351  1.00 0.00 ? 125 ILE A CB   5  
ATOM 10754 C CG1  . ILE A 1 125 ? -17.289 5.030   -4.261  1.00 0.00 ? 125 ILE A CG1  5  
ATOM 10755 C CG2  . ILE A 1 125 ? -17.027 2.526   -4.031  1.00 0.00 ? 125 ILE A CG2  5  
ATOM 10756 C CD1  . ILE A 1 125 ? -18.080 4.996   -5.556  1.00 0.00 ? 125 ILE A CD1  5  
ATOM 10757 H H    . ILE A 1 125 ? -18.763 5.568   -1.987  1.00 0.00 ? 125 ILE A H    5  
ATOM 10758 H HA   . ILE A 1 125 ? -19.608 3.674   -3.843  1.00 0.00 ? 125 ILE A HA   5  
ATOM 10759 H HB   . ILE A 1 125 ? -16.932 3.938   -2.447  1.00 0.00 ? 125 ILE A HB   5  
ATOM 10760 H HG12 . ILE A 1 125 ? -17.575 5.923   -3.726  1.00 0.00 ? 125 ILE A HG12 5  
ATOM 10761 H HG13 . ILE A 1 125 ? -16.239 5.095   -4.514  1.00 0.00 ? 125 ILE A HG13 5  
ATOM 10762 H HG21 . ILE A 1 125 ? -17.627 2.330   -4.907  1.00 0.00 ? 125 ILE A HG21 5  
ATOM 10763 H HG22 . ILE A 1 125 ? -17.112 1.699   -3.343  1.00 0.00 ? 125 ILE A HG22 5  
ATOM 10764 H HG23 . ILE A 1 125 ? -15.992 2.644   -4.324  1.00 0.00 ? 125 ILE A HG23 5  
ATOM 10765 H HD11 . ILE A 1 125 ? -17.871 5.890   -6.126  1.00 0.00 ? 125 ILE A HD11 5  
ATOM 10766 H HD12 . ILE A 1 125 ? -19.135 4.950   -5.335  1.00 0.00 ? 125 ILE A HD12 5  
ATOM 10767 H HD13 . ILE A 1 125 ? -17.794 4.128   -6.132  1.00 0.00 ? 125 ILE A HD13 5  
ATOM 10768 N N    . TYR A 1 126 ? -18.768 2.383   -0.911  1.00 0.00 ? 126 TYR A N    5  
ATOM 10769 C CA   . TYR A 1 126 ? -18.904 1.203   -0.059  1.00 0.00 ? 126 TYR A CA   5  
ATOM 10770 C C    . TYR A 1 126 ? -20.372 0.944   0.268   1.00 0.00 ? 126 TYR A C    5  
ATOM 10771 O O    . TYR A 1 126 ? -20.835 -0.195  0.217   1.00 0.00 ? 126 TYR A O    5  
ATOM 10772 C CB   . TYR A 1 126 ? -18.095 1.380   1.229   1.00 0.00 ? 126 TYR A CB   5  
ATOM 10773 C CG   . TYR A 1 126 ? -18.152 0.190   2.175   1.00 0.00 ? 126 TYR A CG   5  
ATOM 10774 C CD1  . TYR A 1 126 ? -17.421 -0.969  1.917   1.00 0.00 ? 126 TYR A CD1  5  
ATOM 10775 C CD2  . TYR A 1 126 ? -18.933 0.225   3.327   1.00 0.00 ? 126 TYR A CD2  5  
ATOM 10776 C CE1  . TYR A 1 126 ? -17.472 -2.053  2.777   1.00 0.00 ? 126 TYR A CE1  5  
ATOM 10777 C CE2  . TYR A 1 126 ? -18.985 -0.852  4.190   1.00 0.00 ? 126 TYR A CE2  5  
ATOM 10778 C CZ   . TYR A 1 126 ? -18.256 -1.987  3.913   1.00 0.00 ? 126 TYR A CZ   5  
ATOM 10779 O OH   . TYR A 1 126 ? -18.310 -3.059  4.776   1.00 0.00 ? 126 TYR A OH   5  
ATOM 10780 H H    . TYR A 1 126 ? -18.326 3.185   -0.553  1.00 0.00 ? 126 TYR A H    5  
ATOM 10781 H HA   . TYR A 1 126 ? -18.513 0.355   -0.605  1.00 0.00 ? 126 TYR A HA   5  
ATOM 10782 H HB2  . TYR A 1 126 ? -17.058 1.545   0.971   1.00 0.00 ? 126 TYR A HB2  5  
ATOM 10783 H HB3  . TYR A 1 126 ? -18.465 2.247   1.761   1.00 0.00 ? 126 TYR A HB3  5  
ATOM 10784 H HD1  . TYR A 1 126 ? -16.809 -1.018  1.029   1.00 0.00 ? 126 TYR A HD1  5  
ATOM 10785 H HD2  . TYR A 1 126 ? -19.507 1.115   3.544   1.00 0.00 ? 126 TYR A HD2  5  
ATOM 10786 H HE1  . TYR A 1 126 ? -16.898 -2.943  2.558   1.00 0.00 ? 126 TYR A HE1  5  
ATOM 10787 H HE2  . TYR A 1 126 ? -19.599 -0.801  5.077   1.00 0.00 ? 126 TYR A HE2  5  
ATOM 10788 H HH   . TYR A 1 126 ? -19.231 -3.298  4.928   1.00 0.00 ? 126 TYR A HH   5  
ATOM 10789 N N    . LEU A 1 127 ? -21.102 2.007   0.596   1.00 0.00 ? 127 LEU A N    5  
ATOM 10790 C CA   . LEU A 1 127 ? -22.529 1.897   0.891   1.00 0.00 ? 127 LEU A CA   5  
ATOM 10791 C C    . LEU A 1 127 ? -23.290 1.390   -0.336  1.00 0.00 ? 127 LEU A C    5  
ATOM 10792 O O    . LEU A 1 127 ? -24.259 0.634   -0.210  1.00 0.00 ? 127 LEU A O    5  
ATOM 10793 C CB   . LEU A 1 127 ? -23.097 3.243   1.386   1.00 0.00 ? 127 LEU A CB   5  
ATOM 10794 C CG   . LEU A 1 127 ? -22.884 3.546   2.882   1.00 0.00 ? 127 LEU A CG   5  
ATOM 10795 C CD1  . LEU A 1 127 ? -23.562 2.488   3.751   1.00 0.00 ? 127 LEU A CD1  5  
ATOM 10796 C CD2  . LEU A 1 127 ? -21.397 3.652   3.220   1.00 0.00 ? 127 LEU A CD2  5  
ATOM 10797 H H    . LEU A 1 127 ? -20.669 2.889   0.640   1.00 0.00 ? 127 LEU A H    5  
ATOM 10798 H HA   . LEU A 1 127 ? -22.638 1.165   1.681   1.00 0.00 ? 127 LEU A HA   5  
ATOM 10799 H HB2  . LEU A 1 127 ? -22.634 4.036   0.815   1.00 0.00 ? 127 LEU A HB2  5  
ATOM 10800 H HB3  . LEU A 1 127 ? -24.161 3.258   1.188   1.00 0.00 ? 127 LEU A HB3  5  
ATOM 10801 H HG   . LEU A 1 127 ? -23.343 4.497   3.114   1.00 0.00 ? 127 LEU A HG   5  
ATOM 10802 H HD11 . LEU A 1 127 ? -24.620 2.466   3.530   1.00 0.00 ? 127 LEU A HD11 5  
ATOM 10803 H HD12 . LEU A 1 127 ? -23.419 2.730   4.793   1.00 0.00 ? 127 LEU A HD12 5  
ATOM 10804 H HD13 . LEU A 1 127 ? -23.131 1.517   3.544   1.00 0.00 ? 127 LEU A HD13 5  
ATOM 10805 H HD21 . LEU A 1 127 ? -21.279 3.863   4.273   1.00 0.00 ? 127 LEU A HD21 5  
ATOM 10806 H HD22 . LEU A 1 127 ? -20.954 4.451   2.644   1.00 0.00 ? 127 LEU A HD22 5  
ATOM 10807 H HD23 . LEU A 1 127 ? -20.902 2.720   2.980   1.00 0.00 ? 127 LEU A HD23 5  
ATOM 10808 N N    . ASP A 1 128 ? -22.822 1.787   -1.518  1.00 0.00 ? 128 ASP A N    5  
ATOM 10809 C CA   . ASP A 1 128 ? -23.377 1.300   -2.781  1.00 0.00 ? 128 ASP A CA   5  
ATOM 10810 C C    . ASP A 1 128 ? -23.137 -0.202  -2.914  1.00 0.00 ? 128 ASP A C    5  
ATOM 10811 O O    . ASP A 1 128 ? -23.968 -0.933  -3.454  1.00 0.00 ? 128 ASP A O    5  
ATOM 10812 C CB   . ASP A 1 128 ? -22.745 2.046   -3.971  1.00 0.00 ? 128 ASP A CB   5  
ATOM 10813 C CG   . ASP A 1 128 ? -23.226 1.535   -5.326  1.00 0.00 ? 128 ASP A CG   5  
ATOM 10814 O OD1  . ASP A 1 128 ? -24.313 1.953   -5.777  1.00 0.00 ? 128 ASP A OD1  5  
ATOM 10815 O OD2  . ASP A 1 128 ? -22.512 0.720   -5.954  1.00 0.00 ? 128 ASP A OD2  5  
ATOM 10816 H H    . ASP A 1 128 ? -22.083 2.429   -1.542  1.00 0.00 ? 128 ASP A H    5  
ATOM 10817 H HA   . ASP A 1 128 ? -24.444 1.486   -2.772  1.00 0.00 ? 128 ASP A HA   5  
ATOM 10818 H HB2  . ASP A 1 128 ? -22.990 3.096   -3.897  1.00 0.00 ? 128 ASP A HB2  5  
ATOM 10819 H HB3  . ASP A 1 128 ? -21.670 1.934   -3.923  1.00 0.00 ? 128 ASP A HB3  5  
ATOM 10820 N N    . LEU A 1 129 ? -21.991 -0.655  -2.410  1.00 0.00 ? 129 LEU A N    5  
ATOM 10821 C CA   . LEU A 1 129 ? -21.648 -2.079  -2.412  1.00 0.00 ? 129 LEU A CA   5  
ATOM 10822 C C    . LEU A 1 129 ? -22.415 -2.825  -1.319  1.00 0.00 ? 129 LEU A C    5  
ATOM 10823 O O    . LEU A 1 129 ? -22.642 -4.033  -1.422  1.00 0.00 ? 129 LEU A O    5  
ATOM 10824 C CB   . LEU A 1 129 ? -20.134 -2.270  -2.217  1.00 0.00 ? 129 LEU A CB   5  
ATOM 10825 C CG   . LEU A 1 129 ? -19.248 -1.673  -3.324  1.00 0.00 ? 129 LEU A CG   5  
ATOM 10826 C CD1  . LEU A 1 129 ? -17.768 -1.865  -2.995  1.00 0.00 ? 129 LEU A CD1  5  
ATOM 10827 C CD2  . LEU A 1 129 ? -19.584 -2.289  -4.682  1.00 0.00 ? 129 LEU A CD2  5  
ATOM 10828 H H    . LEU A 1 129 ? -21.351 -0.012  -2.034  1.00 0.00 ? 129 LEU A H    5  
ATOM 10829 H HA   . LEU A 1 129 ? -21.931 -2.486  -3.372  1.00 0.00 ? 129 LEU A HA   5  
ATOM 10830 H HB2  . LEU A 1 129 ? -19.855 -1.815  -1.276  1.00 0.00 ? 129 LEU A HB2  5  
ATOM 10831 H HB3  . LEU A 1 129 ? -19.931 -3.330  -2.157  1.00 0.00 ? 129 LEU A HB3  5  
ATOM 10832 H HG   . LEU A 1 129 ? -19.435 -0.610  -3.386  1.00 0.00 ? 129 LEU A HG   5  
ATOM 10833 H HD11 . LEU A 1 129 ? -17.543 -1.387  -2.052  1.00 0.00 ? 129 LEU A HD11 5  
ATOM 10834 H HD12 . LEU A 1 129 ? -17.165 -1.420  -3.774  1.00 0.00 ? 129 LEU A HD12 5  
ATOM 10835 H HD13 . LEU A 1 129 ? -17.543 -2.921  -2.926  1.00 0.00 ? 129 LEU A HD13 5  
ATOM 10836 H HD21 . LEU A 1 129 ? -19.434 -3.360  -4.644  1.00 0.00 ? 129 LEU A HD21 5  
ATOM 10837 H HD22 . LEU A 1 129 ? -18.942 -1.863  -5.440  1.00 0.00 ? 129 LEU A HD22 5  
ATOM 10838 H HD23 . LEU A 1 129 ? -20.615 -2.079  -4.928  1.00 0.00 ? 129 LEU A HD23 5  
ATOM 10839 N N    . MET A 1 130 ? -22.801 -2.100  -0.269  1.00 0.00 ? 130 MET A N    5  
ATOM 10840 C CA   . MET A 1 130 ? -23.575 -2.681  0.830   1.00 0.00 ? 130 MET A CA   5  
ATOM 10841 C C    . MET A 1 130 ? -24.998 -2.986  0.373   1.00 0.00 ? 130 MET A C    5  
ATOM 10842 O O    . MET A 1 130 ? -25.546 -4.042  0.687   1.00 0.00 ? 130 MET A O    5  
ATOM 10843 C CB   . MET A 1 130 ? -23.615 -1.728  2.039   1.00 0.00 ? 130 MET A CB   5  
ATOM 10844 C CG   . MET A 1 130 ? -22.265 -1.466  2.712   1.00 0.00 ? 130 MET A CG   5  
ATOM 10845 S SD   . MET A 1 130 ? -21.674 -2.840  3.734   1.00 0.00 ? 130 MET A SD   5  
ATOM 10846 C CE   . MET A 1 130 ? -21.058 -3.984  2.501   1.00 0.00 ? 130 MET A CE   5  
ATOM 10847 H H    . MET A 1 130 ? -22.558 -1.152  -0.234  1.00 0.00 ? 130 MET A H    5  
ATOM 10848 H HA   . MET A 1 130 ? -23.097 -3.605  1.124   1.00 0.00 ? 130 MET A HA   5  
ATOM 10849 H HB2  . MET A 1 130 ? -24.014 -0.778  1.713   1.00 0.00 ? 130 MET A HB2  5  
ATOM 10850 H HB3  . MET A 1 130 ? -24.282 -2.143  2.782   1.00 0.00 ? 130 MET A HB3  5  
ATOM 10851 H HG2  . MET A 1 130 ? -21.530 -1.270  1.945   1.00 0.00 ? 130 MET A HG2  5  
ATOM 10852 H HG3  . MET A 1 130 ? -22.359 -0.590  3.339   1.00 0.00 ? 130 MET A HG3  5  
ATOM 10853 H HE1  . MET A 1 130 ? -20.631 -4.846  2.992   1.00 0.00 ? 130 MET A HE1  5  
ATOM 10854 H HE2  . MET A 1 130 ? -20.300 -3.499  1.903   1.00 0.00 ? 130 MET A HE2  5  
ATOM 10855 H HE3  . MET A 1 130 ? -21.871 -4.300  1.864   1.00 0.00 ? 130 MET A HE3  5  
ATOM 10856 N N    . GLU A 1 131 ? -25.589 -2.033  -0.355  1.00 0.00 ? 131 GLU A N    5  
ATOM 10857 C CA   . GLU A 1 131 ? -26.953 -2.163  -0.882  1.00 0.00 ? 131 GLU A CA   5  
ATOM 10858 C C    . GLU A 1 131 ? -27.965 -2.403  0.245   1.00 0.00 ? 131 GLU A C    5  
ATOM 10859 O O    . GLU A 1 131 ? -29.099 -2.823  0.000   1.00 0.00 ? 131 GLU A O    5  
ATOM 10860 C CB   . GLU A 1 131 ? -27.028 -3.301  -1.917  1.00 0.00 ? 131 GLU A CB   5  
ATOM 10861 C CG   . GLU A 1 131 ? -25.978 -3.200  -3.018  1.00 0.00 ? 131 GLU A CG   5  
ATOM 10862 C CD   . GLU A 1 131 ? -26.241 -4.149  -4.178  1.00 0.00 ? 131 GLU A CD   5  
ATOM 10863 O OE1  . GLU A 1 131 ? -25.906 -5.349  -4.073  1.00 0.00 ? 131 GLU A OE1  5  
ATOM 10864 O OE2  . GLU A 1 131 ? -26.793 -3.695  -5.203  1.00 0.00 ? 131 GLU A OE2  5  
ATOM 10865 H H    . GLU A 1 131 ? -25.085 -1.213  -0.553  1.00 0.00 ? 131 GLU A H    5  
ATOM 10866 H HA   . GLU A 1 131 ? -27.201 -1.232  -1.371  1.00 0.00 ? 131 GLU A HA   5  
ATOM 10867 H HB2  . GLU A 1 131 ? -26.896 -4.244  -1.408  1.00 0.00 ? 131 GLU A HB2  5  
ATOM 10868 H HB3  . GLU A 1 131 ? -28.007 -3.286  -2.380  1.00 0.00 ? 131 GLU A HB3  5  
ATOM 10869 H HG2  . GLU A 1 131 ? -25.967 -2.188  -3.396  1.00 0.00 ? 131 GLU A HG2  5  
ATOM 10870 H HG3  . GLU A 1 131 ? -25.010 -3.431  -2.596  1.00 0.00 ? 131 GLU A HG3  5  
ATOM 10871 N N    . GLY A 1 132 ? -27.559 -2.094  1.475   1.00 0.00 ? 132 GLY A N    5  
ATOM 10872 C CA   . GLY A 1 132 ? -28.388 -2.367  2.640   1.00 0.00 ? 132 GLY A CA   5  
ATOM 10873 C C    . GLY A 1 132 ? -29.346 -1.236  2.973   1.00 0.00 ? 132 GLY A C    5  
ATOM 10874 O O    . GLY A 1 132 ? -30.022 -1.283  4.000   1.00 0.00 ? 132 GLY A O    5  
ATOM 10875 H H    . GLY A 1 132 ? -26.683 -1.678  1.594   1.00 0.00 ? 132 GLY A H    5  
ATOM 10876 H HA2  . GLY A 1 132 ? -28.963 -3.266  2.461   1.00 0.00 ? 132 GLY A HA2  5  
ATOM 10877 H HA3  . GLY A 1 132 ? -27.742 -2.535  3.490   1.00 0.00 ? 132 GLY A HA3  5  
ATOM 10878 N N    . ARG A 1 133 ? -29.402 -0.227  2.097   1.00 0.00 ? 133 ARG A N    5  
ATOM 10879 C CA   . ARG A 1 133 ? -30.275 0.938   2.282   1.00 0.00 ? 133 ARG A CA   5  
ATOM 10880 C C    . ARG A 1 133 ? -29.929 1.686   3.579   1.00 0.00 ? 133 ARG A C    5  
ATOM 10881 O O    . ARG A 1 133 ? -30.445 1.362   4.650   1.00 0.00 ? 133 ARG A O    5  
ATOM 10882 C CB   . ARG A 1 133 ? -31.756 0.518   2.277   1.00 0.00 ? 133 ARG A CB   5  
ATOM 10883 C CG   . ARG A 1 133 ? -32.180 -0.224  1.010   1.00 0.00 ? 133 ARG A CG   5  
ATOM 10884 C CD   . ARG A 1 133 ? -33.648 -0.635  1.056   1.00 0.00 ? 133 ARG A CD   5  
ATOM 10885 N NE   . ARG A 1 133 ? -34.045 -1.387  -0.138  1.00 0.00 ? 133 ARG A NE   5  
ATOM 10886 C CZ   . ARG A 1 133 ? -34.869 -0.925  -1.083  1.00 0.00 ? 133 ARG A CZ   5  
ATOM 10887 N NH1  . ARG A 1 133 ? -35.359 0.306   -1.004  1.00 0.00 ? 133 ARG A NH1  5  
ATOM 10888 N NH2  . ARG A 1 133 ? -35.190 -1.696  -2.114  1.00 0.00 ? 133 ARG A NH2  5  
ATOM 10889 H H    . ARG A 1 133 ? -28.841 -0.271  1.297   1.00 0.00 ? 133 ARG A H    5  
ATOM 10890 H HA   . ARG A 1 133 ? -30.103 1.605   1.448   1.00 0.00 ? 133 ARG A HA   5  
ATOM 10891 H HB2  . ARG A 1 133 ? -31.936 -0.129  3.125   1.00 0.00 ? 133 ARG A HB2  5  
ATOM 10892 H HB3  . ARG A 1 133 ? -32.370 1.402   2.375   1.00 0.00 ? 133 ARG A HB3  5  
ATOM 10893 H HG2  . ARG A 1 133 ? -32.025 0.422   0.158   1.00 0.00 ? 133 ARG A HG2  5  
ATOM 10894 H HG3  . ARG A 1 133 ? -31.570 -1.110  0.905   1.00 0.00 ? 133 ARG A HG3  5  
ATOM 10895 H HD2  . ARG A 1 133 ? -33.807 -1.256  1.927   1.00 0.00 ? 133 ARG A HD2  5  
ATOM 10896 H HD3  . ARG A 1 133 ? -34.257 0.255   1.134   1.00 0.00 ? 133 ARG A HD3  5  
ATOM 10897 H HE   . ARG A 1 133 ? -33.680 -2.296  -0.238  1.00 0.00 ? 133 ARG A HE   5  
ATOM 10898 H HH11 . ARG A 1 133 ? -35.115 0.900   -0.233  1.00 0.00 ? 133 ARG A HH11 5  
ATOM 10899 H HH12 . ARG A 1 133 ? -35.970 0.652   -1.721  1.00 0.00 ? 133 ARG A HH12 5  
ATOM 10900 H HH21 . ARG A 1 133 ? -34.813 -2.628  -2.183  1.00 0.00 ? 133 ARG A HH21 5  
ATOM 10901 H HH22 . ARG A 1 133 ? -35.804 -1.352  -2.832  1.00 0.00 ? 133 ARG A HH22 5  
ATOM 10902 N N    . PRO A 1 134 ? -29.032 2.689   3.496   1.00 0.00 ? 134 PRO A N    5  
ATOM 10903 C CA   . PRO A 1 134 ? -28.564 3.441   4.671   1.00 0.00 ? 134 PRO A CA   5  
ATOM 10904 C C    . PRO A 1 134 ? -29.710 4.023   5.505   1.00 0.00 ? 134 PRO A C    5  
ATOM 10905 O O    . PRO A 1 134 ? -30.451 4.892   5.039   1.00 0.00 ? 134 PRO A O    5  
ATOM 10906 C CB   . PRO A 1 134 ? -27.712 4.565   4.062   1.00 0.00 ? 134 PRO A CB   5  
ATOM 10907 C CG   . PRO A 1 134 ? -27.266 4.026   2.745   1.00 0.00 ? 134 PRO A CG   5  
ATOM 10908 C CD   . PRO A 1 134 ? -28.401 3.168   2.249   1.00 0.00 ? 134 PRO A CD   5  
ATOM 10909 H HA   . PRO A 1 134 ? -27.942 2.823   5.305   1.00 0.00 ? 134 PRO A HA   5  
ATOM 10910 H HB2  . PRO A 1 134 ? -28.314 5.457   3.941   1.00 0.00 ? 134 PRO A HB2  5  
ATOM 10911 H HB3  . PRO A 1 134 ? -26.873 4.778   4.708   1.00 0.00 ? 134 PRO A HB3  5  
ATOM 10912 H HG2  . PRO A 1 134 ? -27.076 4.839   2.057   1.00 0.00 ? 134 PRO A HG2  5  
ATOM 10913 H HG3  . PRO A 1 134 ? -26.374 3.429   2.875   1.00 0.00 ? 134 PRO A HG3  5  
ATOM 10914 H HD2  . PRO A 1 134 ? -29.095 3.755   1.664   1.00 0.00 ? 134 PRO A HD2  5  
ATOM 10915 H HD3  . PRO A 1 134 ? -28.023 2.339   1.665   1.00 0.00 ? 134 PRO A HD3  5  
ATOM 10916 N N    . SER A 1 1   ? -21.299 -13.935 -10.068 1.00 0.00 ? 1   SER A N    6  
ATOM 10917 C CA   . SER A 1 1   ? -20.157 -13.599 -10.943 1.00 0.00 ? 1   SER A CA   6  
ATOM 10918 C C    . SER A 1 1   ? -19.074 -12.859 -10.153 1.00 0.00 ? 1   SER A C    6  
ATOM 10919 O O    . SER A 1 1   ? -17.920 -13.291 -10.117 1.00 0.00 ? 1   SER A O    6  
ATOM 10920 C CB   . SER A 1 1   ? -20.643 -12.754 -12.126 1.00 0.00 ? 1   SER A CB   6  
ATOM 10921 O OG   . SER A 1 1   ? -21.613 -13.455 -12.890 1.00 0.00 ? 1   SER A OG   6  
ATOM 10922 H H1   . SER A 1 1   ? -21.723 -13.070 -9.685  1.00 0.00 ? 1   SER A H1   6  
ATOM 10923 H H2   . SER A 1 1   ? -20.980 -14.531 -9.278  1.00 0.00 ? 1   SER A H2   6  
ATOM 10924 H H3   . SER A 1 1   ? -22.021 -14.453 -10.607 1.00 0.00 ? 1   SER A H3   6  
ATOM 10925 H HA   . SER A 1 1   ? -19.741 -14.525 -11.317 1.00 0.00 ? 1   SER A HA   6  
ATOM 10926 H HB2  . SER A 1 1   ? -21.086 -11.841 -11.759 1.00 0.00 ? 1   SER A HB2  6  
ATOM 10927 H HB3  . SER A 1 1   ? -19.804 -12.516 -12.765 1.00 0.00 ? 1   SER A HB3  6  
ATOM 10928 H HG   . SER A 1 1   ? -22.461 -12.993 -12.838 1.00 0.00 ? 1   SER A HG   6  
ATOM 10929 N N    . MET A 1 2   ? -19.447 -11.751 -9.514  1.00 0.00 ? 2   MET A N    6  
ATOM 10930 C CA   . MET A 1 2   ? -18.516 -10.987 -8.679  1.00 0.00 ? 2   MET A CA   6  
ATOM 10931 C C    . MET A 1 2   ? -18.909 -11.117 -7.206  1.00 0.00 ? 2   MET A C    6  
ATOM 10932 O O    . MET A 1 2   ? -19.756 -11.945 -6.854  1.00 0.00 ? 2   MET A O    6  
ATOM 10933 C CB   . MET A 1 2   ? -18.503 -9.506  -9.096  1.00 0.00 ? 2   MET A CB   6  
ATOM 10934 C CG   . MET A 1 2   ? -18.080 -9.269  -10.542 1.00 0.00 ? 2   MET A CG   6  
ATOM 10935 S SD   . MET A 1 2   ? -16.417 -9.875  -10.897 1.00 0.00 ? 2   MET A SD   6  
ATOM 10936 C CE   . MET A 1 2   ? -16.258 -9.440  -12.630 1.00 0.00 ? 2   MET A CE   6  
ATOM 10937 H H    . MET A 1 2   ? -20.375 -11.436 -9.598  1.00 0.00 ? 2   MET A H    6  
ATOM 10938 H HA   . MET A 1 2   ? -17.524 -11.400 -8.812  1.00 0.00 ? 2   MET A HA   6  
ATOM 10939 H HB2  . MET A 1 2   ? -19.497 -9.101  -8.966  1.00 0.00 ? 2   MET A HB2  6  
ATOM 10940 H HB3  . MET A 1 2   ? -17.820 -8.969  -8.452  1.00 0.00 ? 2   MET A HB3  6  
ATOM 10941 H HG2  . MET A 1 2   ? -18.777 -9.776  -11.194 1.00 0.00 ? 2   MET A HG2  6  
ATOM 10942 H HG3  . MET A 1 2   ? -18.111 -8.208  -10.743 1.00 0.00 ? 2   MET A HG3  6  
ATOM 10943 H HE1  . MET A 1 2   ? -16.367 -8.373  -12.745 1.00 0.00 ? 2   MET A HE1  6  
ATOM 10944 H HE2  . MET A 1 2   ? -17.023 -9.945  -13.202 1.00 0.00 ? 2   MET A HE2  6  
ATOM 10945 H HE3  . MET A 1 2   ? -15.284 -9.742  -12.988 1.00 0.00 ? 2   MET A HE3  6  
ATOM 10946 N N    . VAL A 1 3   ? -18.278 -10.315 -6.352  1.00 0.00 ? 3   VAL A N    6  
ATOM 10947 C CA   . VAL A 1 3   ? -18.585 -10.305 -4.923  1.00 0.00 ? 3   VAL A CA   6  
ATOM 10948 C C    . VAL A 1 3   ? -20.042 -9.899  -4.670  1.00 0.00 ? 3   VAL A C    6  
ATOM 10949 O O    . VAL A 1 3   ? -20.592 -9.044  -5.368  1.00 0.00 ? 3   VAL A O    6  
ATOM 10950 C CB   . VAL A 1 3   ? -17.641 -9.345  -4.156  1.00 0.00 ? 3   VAL A CB   6  
ATOM 10951 C CG1  . VAL A 1 3   ? -17.777 -7.911  -4.669  1.00 0.00 ? 3   VAL A CG1  6  
ATOM 10952 C CG2  . VAL A 1 3   ? -17.901 -9.411  -2.652  1.00 0.00 ? 3   VAL A CG2  6  
ATOM 10953 H H    . VAL A 1 3   ? -17.576 -9.718  -6.689  1.00 0.00 ? 3   VAL A H    6  
ATOM 10954 H HA   . VAL A 1 3   ? -18.428 -11.308 -4.543  1.00 0.00 ? 3   VAL A HA   6  
ATOM 10955 H HB   . VAL A 1 3   ? -16.622 -9.664  -4.334  1.00 0.00 ? 3   VAL A HB   6  
ATOM 10956 H HG11 . VAL A 1 3   ? -17.544 -7.881  -5.724  1.00 0.00 ? 3   VAL A HG11 6  
ATOM 10957 H HG12 . VAL A 1 3   ? -17.093 -7.269  -4.133  1.00 0.00 ? 3   VAL A HG12 6  
ATOM 10958 H HG13 . VAL A 1 3   ? -18.790 -7.564  -4.515  1.00 0.00 ? 3   VAL A HG13 6  
ATOM 10959 H HG21 . VAL A 1 3   ? -17.731 -10.417 -2.299  1.00 0.00 ? 3   VAL A HG21 6  
ATOM 10960 H HG22 . VAL A 1 3   ? -18.924 -9.126  -2.448  1.00 0.00 ? 3   VAL A HG22 6  
ATOM 10961 H HG23 . VAL A 1 3   ? -17.234 -8.734  -2.139  1.00 0.00 ? 3   VAL A HG23 6  
ATOM 10962 N N    . SER A 1 4   ? -20.664 -10.534 -3.681  1.00 0.00 ? 4   SER A N    6  
ATOM 10963 C CA   . SER A 1 4   ? -22.030 -10.210 -3.284  1.00 0.00 ? 4   SER A CA   6  
ATOM 10964 C C    . SER A 1 4   ? -22.018 -9.157  -2.168  1.00 0.00 ? 4   SER A C    6  
ATOM 10965 O O    . SER A 1 4   ? -21.091 -9.128  -1.358  1.00 0.00 ? 4   SER A O    6  
ATOM 10966 C CB   . SER A 1 4   ? -22.741 -11.483 -2.816  1.00 0.00 ? 4   SER A CB   6  
ATOM 10967 O OG   . SER A 1 4   ? -22.672 -12.492 -3.813  1.00 0.00 ? 4   SER A OG   6  
ATOM 10968 H H    . SER A 1 4   ? -20.188 -11.247 -3.202  1.00 0.00 ? 4   SER A H    6  
ATOM 10969 H HA   . SER A 1 4   ? -22.548 -9.809  -4.143  1.00 0.00 ? 4   SER A HA   6  
ATOM 10970 H HB2  . SER A 1 4   ? -22.269 -11.852 -1.916  1.00 0.00 ? 4   SER A HB2  6  
ATOM 10971 H HB3  . SER A 1 4   ? -23.781 -11.264 -2.614  1.00 0.00 ? 4   SER A HB3  6  
ATOM 10972 H HG   . SER A 1 4   ? -22.206 -12.144 -4.585  1.00 0.00 ? 4   SER A HG   6  
ATOM 10973 N N    . PRO A 1 5   ? -23.050 -8.285  -2.104  1.00 0.00 ? 5   PRO A N    6  
ATOM 10974 C CA   . PRO A 1 5   ? -23.116 -7.188  -1.123  1.00 0.00 ? 5   PRO A CA   6  
ATOM 10975 C C    . PRO A 1 5   ? -22.861 -7.654  0.315   1.00 0.00 ? 5   PRO A C    6  
ATOM 10976 O O    . PRO A 1 5   ? -22.236 -6.943  1.101   1.00 0.00 ? 5   PRO A O    6  
ATOM 10977 C CB   . PRO A 1 5   ? -24.548 -6.633  -1.274  1.00 0.00 ? 5   PRO A CB   6  
ATOM 10978 C CG   . PRO A 1 5   ? -25.276 -7.624  -2.125  1.00 0.00 ? 5   PRO A CG   6  
ATOM 10979 C CD   . PRO A 1 5   ? -24.231 -8.286  -2.981  1.00 0.00 ? 5   PRO A CD   6  
ATOM 10980 H HA   . PRO A 1 5   ? -22.404 -6.411  -1.368  1.00 0.00 ? 5   PRO A HA   6  
ATOM 10981 H HB2  . PRO A 1 5   ? -25.007 -6.537  -0.300  1.00 0.00 ? 5   PRO A HB2  6  
ATOM 10982 H HB3  . PRO A 1 5   ? -24.509 -5.662  -1.750  1.00 0.00 ? 5   PRO A HB3  6  
ATOM 10983 H HG2  . PRO A 1 5   ? -25.767 -8.357  -1.498  1.00 0.00 ? 5   PRO A HG2  6  
ATOM 10984 H HG3  . PRO A 1 5   ? -26.002 -7.115  -2.744  1.00 0.00 ? 5   PRO A HG3  6  
ATOM 10985 H HD2  . PRO A 1 5   ? -24.530 -9.294  -3.234  1.00 0.00 ? 5   PRO A HD2  6  
ATOM 10986 H HD3  . PRO A 1 5   ? -24.049 -7.707  -3.875  1.00 0.00 ? 5   PRO A HD3  6  
ATOM 10987 N N    . GLU A 1 6   ? -23.340 -8.850  0.649   1.00 0.00 ? 6   GLU A N    6  
ATOM 10988 C CA   . GLU A 1 6   ? -23.158 -9.406  1.991   1.00 0.00 ? 6   GLU A CA   6  
ATOM 10989 C C    . GLU A 1 6   ? -21.670 -9.675  2.251   1.00 0.00 ? 6   GLU A C    6  
ATOM 10990 O O    . GLU A 1 6   ? -21.146 -9.397  3.328   1.00 0.00 ? 6   GLU A O    6  
ATOM 10991 C CB   . GLU A 1 6   ? -23.987 -10.696 2.139   1.00 0.00 ? 6   GLU A CB   6  
ATOM 10992 C CG   . GLU A 1 6   ? -24.463 -10.994 3.560   1.00 0.00 ? 6   GLU A CG   6  
ATOM 10993 C CD   . GLU A 1 6   ? -23.338 -11.303 4.532   1.00 0.00 ? 6   GLU A CD   6  
ATOM 10994 O OE1  . GLU A 1 6   ? -22.777 -12.419 4.461   1.00 0.00 ? 6   GLU A OE1  6  
ATOM 10995 O OE2  . GLU A 1 6   ? -23.024 -10.449 5.383   1.00 0.00 ? 6   GLU A OE2  6  
ATOM 10996 H H    . GLU A 1 6   ? -23.834 -9.371  -0.021  1.00 0.00 ? 6   GLU A H    6  
ATOM 10997 H HA   . GLU A 1 6   ? -23.512 -8.673  2.705   1.00 0.00 ? 6   GLU A HA   6  
ATOM 10998 H HB2  . GLU A 1 6   ? -24.860 -10.616 1.508   1.00 0.00 ? 6   GLU A HB2  6  
ATOM 10999 H HB3  . GLU A 1 6   ? -23.393 -11.534 1.799   1.00 0.00 ? 6   GLU A HB3  6  
ATOM 11000 H HG2  . GLU A 1 6   ? -25.008 -10.136 3.927   1.00 0.00 ? 6   GLU A HG2  6  
ATOM 11001 H HG3  . GLU A 1 6   ? -25.131 -11.845 3.527   1.00 0.00 ? 6   GLU A HG3  6  
ATOM 11002 N N    . GLU A 1 7   ? -20.986 -10.194 1.242   1.00 0.00 ? 7   GLU A N    6  
ATOM 11003 C CA   . GLU A 1 7   ? -19.557 -10.460 1.354   1.00 0.00 ? 7   GLU A CA   6  
ATOM 11004 C C    . GLU A 1 7   ? -18.808 -9.124  1.404   1.00 0.00 ? 7   GLU A C    6  
ATOM 11005 O O    . GLU A 1 7   ? -17.769 -8.997  2.046   1.00 0.00 ? 7   GLU A O    6  
ATOM 11006 C CB   . GLU A 1 7   ? -19.091 -11.322 0.165   1.00 0.00 ? 7   GLU A CB   6  
ATOM 11007 C CG   . GLU A 1 7   ? -17.932 -12.271 0.473   1.00 0.00 ? 7   GLU A CG   6  
ATOM 11008 C CD   . GLU A 1 7   ? -16.631 -11.565 0.820   1.00 0.00 ? 7   GLU A CD   6  
ATOM 11009 O OE1  . GLU A 1 7   ? -16.118 -10.810 -0.031  1.00 0.00 ? 7   GLU A OE1  6  
ATOM 11010 O OE2  . GLU A 1 7   ? -16.098 -11.795 1.931   1.00 0.00 ? 7   GLU A OE2  6  
ATOM 11011 H H    . GLU A 1 7   ? -21.446 -10.389 0.402   1.00 0.00 ? 7   GLU A H    6  
ATOM 11012 H HA   . GLU A 1 7   ? -19.385 -10.996 2.277   1.00 0.00 ? 7   GLU A HA   6  
ATOM 11013 H HB2  . GLU A 1 7   ? -19.924 -11.918 -0.177  1.00 0.00 ? 7   GLU A HB2  6  
ATOM 11014 H HB3  . GLU A 1 7   ? -18.783 -10.668 -0.640  1.00 0.00 ? 7   GLU A HB3  6  
ATOM 11015 H HG2  . GLU A 1 7   ? -18.216 -12.898 1.306   1.00 0.00 ? 7   GLU A HG2  6  
ATOM 11016 H HG3  . GLU A 1 7   ? -17.763 -12.895 -0.394  1.00 0.00 ? 7   GLU A HG3  6  
ATOM 11017 N N    . ALA A 1 8   ? -19.381 -8.115  0.746   1.00 0.00 ? 8   ALA A N    6  
ATOM 11018 C CA   . ALA A 1 8   ? -18.804 -6.776  0.731   1.00 0.00 ? 8   ALA A CA   6  
ATOM 11019 C C    . ALA A 1 8   ? -18.852 -6.140  2.124   1.00 0.00 ? 8   ALA A C    6  
ATOM 11020 O O    . ALA A 1 8   ? -17.867 -5.553  2.577   1.00 0.00 ? 8   ALA A O    6  
ATOM 11021 C CB   . ALA A 1 8   ? -19.519 -5.900  -0.293  1.00 0.00 ? 8   ALA A CB   6  
ATOM 11022 H H    . ALA A 1 8   ? -20.211 -8.280  0.254   1.00 0.00 ? 8   ALA A H    6  
ATOM 11023 H HA   . ALA A 1 8   ? -17.769 -6.867  0.427   1.00 0.00 ? 8   ALA A HA   6  
ATOM 11024 H HB1  . ALA A 1 8   ? -19.465 -6.367  -1.267  1.00 0.00 ? 8   ALA A HB1  6  
ATOM 11025 H HB2  . ALA A 1 8   ? -19.047 -4.928  -0.337  1.00 0.00 ? 8   ALA A HB2  6  
ATOM 11026 H HB3  . ALA A 1 8   ? -20.554 -5.783  -0.008  1.00 0.00 ? 8   ALA A HB3  6  
ATOM 11027 N N    . VAL A 1 9   ? -19.993 -6.265  2.812   1.00 0.00 ? 9   VAL A N    6  
ATOM 11028 C CA   . VAL A 1 9   ? -20.131 -5.699  4.159   1.00 0.00 ? 9   VAL A CA   6  
ATOM 11029 C C    . VAL A 1 9   ? -19.206 -6.421  5.137   1.00 0.00 ? 9   VAL A C    6  
ATOM 11030 O O    . VAL A 1 9   ? -18.790 -5.855  6.154   1.00 0.00 ? 9   VAL A O    6  
ATOM 11031 C CB   . VAL A 1 9   ? -21.591 -5.742  4.697   1.00 0.00 ? 9   VAL A CB   6  
ATOM 11032 C CG1  . VAL A 1 9   ? -22.549 -5.054  3.730   1.00 0.00 ? 9   VAL A CG1  6  
ATOM 11033 C CG2  . VAL A 1 9   ? -22.042 -7.171  4.988   1.00 0.00 ? 9   VAL A CG2  6  
ATOM 11034 H H    . VAL A 1 9   ? -20.751 -6.744  2.408   1.00 0.00 ? 9   VAL A H    6  
ATOM 11035 H HA   . VAL A 1 9   ? -19.825 -4.662  4.106   1.00 0.00 ? 9   VAL A HA   6  
ATOM 11036 H HB   . VAL A 1 9   ? -21.615 -5.191  5.629   1.00 0.00 ? 9   VAL A HB   6  
ATOM 11037 H HG11 . VAL A 1 9   ? -23.558 -5.120  4.112   1.00 0.00 ? 9   VAL A HG11 6  
ATOM 11038 H HG12 . VAL A 1 9   ? -22.498 -5.537  2.765   1.00 0.00 ? 9   VAL A HG12 6  
ATOM 11039 H HG13 . VAL A 1 9   ? -22.272 -4.016  3.626   1.00 0.00 ? 9   VAL A HG13 6  
ATOM 11040 H HG21 . VAL A 1 9   ? -22.034 -7.746  4.074   1.00 0.00 ? 9   VAL A HG21 6  
ATOM 11041 H HG22 . VAL A 1 9   ? -23.043 -7.159  5.396   1.00 0.00 ? 9   VAL A HG22 6  
ATOM 11042 H HG23 . VAL A 1 9   ? -21.370 -7.625  5.704   1.00 0.00 ? 9   VAL A HG23 6  
ATOM 11043 N N    . LYS A 1 10  ? -18.885 -7.676  4.818   1.00 0.00 ? 10  LYS A N    6  
ATOM 11044 C CA   . LYS A 1 10  ? -17.927 -8.452  5.601   1.00 0.00 ? 10  LYS A CA   6  
ATOM 11045 C C    . LYS A 1 10  ? -16.571 -7.745  5.665   1.00 0.00 ? 10  LYS A C    6  
ATOM 11046 O O    . LYS A 1 10  ? -15.880 -7.810  6.681   1.00 0.00 ? 10  LYS A O    6  
ATOM 11047 C CB   . LYS A 1 10  ? -17.758 -9.861  5.012   1.00 0.00 ? 10  LYS A CB   6  
ATOM 11048 C CG   . LYS A 1 10  ? -18.903 -10.822 5.327   1.00 0.00 ? 10  LYS A CG   6  
ATOM 11049 C CD   . LYS A 1 10  ? -18.956 -11.168 6.815   1.00 0.00 ? 10  LYS A CD   6  
ATOM 11050 C CE   . LYS A 1 10  ? -19.968 -12.271 7.113   1.00 0.00 ? 10  LYS A CE   6  
ATOM 11051 N NZ   . LYS A 1 10  ? -21.353 -11.877 6.747   1.00 0.00 ? 10  LYS A NZ   6  
ATOM 11052 H H    . LYS A 1 10  ? -19.315 -8.095  4.038   1.00 0.00 ? 10  LYS A H    6  
ATOM 11053 H HA   . LYS A 1 10  ? -18.317 -8.537  6.605   1.00 0.00 ? 10  LYS A HA   6  
ATOM 11054 H HB2  . LYS A 1 10  ? -17.676 -9.780  3.939   1.00 0.00 ? 10  LYS A HB2  6  
ATOM 11055 H HB3  . LYS A 1 10  ? -16.843 -10.292 5.396   1.00 0.00 ? 10  LYS A HB3  6  
ATOM 11056 H HG2  . LYS A 1 10  ? -19.838 -10.360 5.042   1.00 0.00 ? 10  LYS A HG2  6  
ATOM 11057 H HG3  . LYS A 1 10  ? -18.764 -11.733 4.760   1.00 0.00 ? 10  LYS A HG3  6  
ATOM 11058 H HD2  . LYS A 1 10  ? -17.977 -11.500 7.132   1.00 0.00 ? 10  LYS A HD2  6  
ATOM 11059 H HD3  . LYS A 1 10  ? -19.231 -10.280 7.370   1.00 0.00 ? 10  LYS A HD3  6  
ATOM 11060 H HE2  . LYS A 1 10  ? -19.698 -13.155 6.552   1.00 0.00 ? 10  LYS A HE2  6  
ATOM 11061 H HE3  . LYS A 1 10  ? -19.936 -12.495 8.170   1.00 0.00 ? 10  LYS A HE3  6  
ATOM 11062 H HZ1  . LYS A 1 10  ? -21.602 -10.972 7.195   1.00 0.00 ? 10  LYS A HZ1  6  
ATOM 11063 H HZ2  . LYS A 1 10  ? -22.029 -12.598 7.064   1.00 0.00 ? 10  LYS A HZ2  6  
ATOM 11064 H HZ3  . LYS A 1 10  ? -21.441 -11.770 5.714   1.00 0.00 ? 10  LYS A HZ3  6  
ATOM 11065 N N    . TRP A 1 11  ? -16.202 -7.060  4.581   1.00 0.00 ? 11  TRP A N    6  
ATOM 11066 C CA   . TRP A 1 11  ? -14.919 -6.355  4.510   1.00 0.00 ? 11  TRP A CA   6  
ATOM 11067 C C    . TRP A 1 11  ? -14.818 -5.293  5.604   1.00 0.00 ? 11  TRP A C    6  
ATOM 11068 O O    . TRP A 1 11  ? -13.738 -5.033  6.134   1.00 0.00 ? 11  TRP A O    6  
ATOM 11069 C CB   . TRP A 1 11  ? -14.736 -5.676  3.143   1.00 0.00 ? 11  TRP A CB   6  
ATOM 11070 C CG   . TRP A 1 11  ? -14.847 -6.600  1.964   1.00 0.00 ? 11  TRP A CG   6  
ATOM 11071 C CD1  . TRP A 1 11  ? -14.724 -7.959  1.961   1.00 0.00 ? 11  TRP A CD1  6  
ATOM 11072 C CD2  . TRP A 1 11  ? -15.092 -6.216  0.605   1.00 0.00 ? 11  TRP A CD2  6  
ATOM 11073 N NE1  . TRP A 1 11  ? -14.888 -8.441  0.688   1.00 0.00 ? 11  TRP A NE1  6  
ATOM 11074 C CE2  . TRP A 1 11  ? -15.112 -7.393  -0.163  1.00 0.00 ? 11  TRP A CE2  6  
ATOM 11075 C CE3  . TRP A 1 11  ? -15.301 -4.991  -0.036  1.00 0.00 ? 11  TRP A CE3  6  
ATOM 11076 C CZ2  . TRP A 1 11  ? -15.331 -7.381  -1.537  1.00 0.00 ? 11  TRP A CZ2  6  
ATOM 11077 C CZ3  . TRP A 1 11  ? -15.517 -4.981  -1.400  1.00 0.00 ? 11  TRP A CZ3  6  
ATOM 11078 C CH2  . TRP A 1 11  ? -15.531 -6.169  -2.138  1.00 0.00 ? 11  TRP A CH2  6  
ATOM 11079 H H    . TRP A 1 11  ? -16.807 -7.029  3.807   1.00 0.00 ? 11  TRP A H    6  
ATOM 11080 H HA   . TRP A 1 11  ? -14.129 -7.083  4.651   1.00 0.00 ? 11  TRP A HA   6  
ATOM 11081 H HB2  . TRP A 1 11  ? -15.490 -4.912  3.030   1.00 0.00 ? 11  TRP A HB2  6  
ATOM 11082 H HB3  . TRP A 1 11  ? -13.760 -5.213  3.109   1.00 0.00 ? 11  TRP A HB3  6  
ATOM 11083 H HD1  . TRP A 1 11  ? -14.532 -8.555  2.840   1.00 0.00 ? 11  TRP A HD1  6  
ATOM 11084 H HE1  . TRP A 1 11  ? -14.858 -9.389  0.429   1.00 0.00 ? 11  TRP A HE1  6  
ATOM 11085 H HE3  . TRP A 1 11  ? -15.294 -4.064  0.519   1.00 0.00 ? 11  TRP A HE3  6  
ATOM 11086 H HZ2  . TRP A 1 11  ? -15.346 -8.291  -2.121  1.00 0.00 ? 11  TRP A HZ2  6  
ATOM 11087 H HZ3  . TRP A 1 11  ? -15.679 -4.043  -1.912  1.00 0.00 ? 11  TRP A HZ3  6  
ATOM 11088 H HH2  . TRP A 1 11  ? -15.703 -6.116  -3.203  1.00 0.00 ? 11  TRP A HH2  6  
ATOM 11089 N N    . GLY A 1 12  ? -15.965 -4.710  5.950   1.00 0.00 ? 12  GLY A N    6  
ATOM 11090 C CA   . GLY A 1 12  ? -16.004 -3.565  6.848   1.00 0.00 ? 12  GLY A CA   6  
ATOM 11091 C C    . GLY A 1 12  ? -15.539 -3.860  8.266   1.00 0.00 ? 12  GLY A C    6  
ATOM 11092 O O    . GLY A 1 12  ? -15.486 -2.952  9.096   1.00 0.00 ? 12  GLY A O    6  
ATOM 11093 H H    . GLY A 1 12  ? -16.805 -5.066  5.588   1.00 0.00 ? 12  GLY A H    6  
ATOM 11094 H HA2  . GLY A 1 12  ? -15.378 -2.786  6.439   1.00 0.00 ? 12  GLY A HA2  6  
ATOM 11095 H HA3  . GLY A 1 12  ? -17.020 -3.200  6.889   1.00 0.00 ? 12  GLY A HA3  6  
ATOM 11096 N N    . GLU A 1 13  ? -15.212 -5.117  8.561   1.00 0.00 ? 13  GLU A N    6  
ATOM 11097 C CA   . GLU A 1 13  ? -14.743 -5.484  9.897   1.00 0.00 ? 13  GLU A CA   6  
ATOM 11098 C C    . GLU A 1 13  ? -13.218 -5.397  9.983   1.00 0.00 ? 13  GLU A C    6  
ATOM 11099 O O    . GLU A 1 13  ? -12.665 -5.050  11.029  1.00 0.00 ? 13  GLU A O    6  
ATOM 11100 C CB   . GLU A 1 13  ? -15.219 -6.896  10.279  1.00 0.00 ? 13  GLU A CB   6  
ATOM 11101 C CG   . GLU A 1 13  ? -14.592 -8.016  9.456   1.00 0.00 ? 13  GLU A CG   6  
ATOM 11102 C CD   . GLU A 1 13  ? -15.125 -9.390  9.832   1.00 0.00 ? 13  GLU A CD   6  
ATOM 11103 O OE1  . GLU A 1 13  ? -14.608 -9.991  10.796  1.00 0.00 ? 13  GLU A OE1  6  
ATOM 11104 O OE2  . GLU A 1 13  ? -16.066 -9.873  9.164   1.00 0.00 ? 13  GLU A OE2  6  
ATOM 11105 H H    . GLU A 1 13  ? -15.287 -5.808  7.870   1.00 0.00 ? 13  GLU A H    6  
ATOM 11106 H HA   . GLU A 1 13  ? -15.165 -4.775  10.599  1.00 0.00 ? 13  GLU A HA   6  
ATOM 11107 H HB2  . GLU A 1 13  ? -14.985 -7.072  11.320  1.00 0.00 ? 13  GLU A HB2  6  
ATOM 11108 H HB3  . GLU A 1 13  ? -16.292 -6.944  10.153  1.00 0.00 ? 13  GLU A HB3  6  
ATOM 11109 H HG2  . GLU A 1 13  ? -14.801 -7.837  8.411   1.00 0.00 ? 13  GLU A HG2  6  
ATOM 11110 H HG3  . GLU A 1 13  ? -13.522 -8.004  9.612   1.00 0.00 ? 13  GLU A HG3  6  
ATOM 11111 N N    . SER A 1 14  ? -12.544 -5.684  8.870   1.00 0.00 ? 14  SER A N    6  
ATOM 11112 C CA   . SER A 1 14  ? -11.086 -5.745  8.846   1.00 0.00 ? 14  SER A CA   6  
ATOM 11113 C C    . SER A 1 14  ? -10.544 -5.364  7.469   1.00 0.00 ? 14  SER A C    6  
ATOM 11114 O O    . SER A 1 14  ? -10.891 -5.985  6.460   1.00 0.00 ? 14  SER A O    6  
ATOM 11115 C CB   . SER A 1 14  ? -10.608 -7.159  9.216   1.00 0.00 ? 14  SER A CB   6  
ATOM 11116 O OG   . SER A 1 14  ? -11.044 -7.535  10.513  1.00 0.00 ? 14  SER A OG   6  
ATOM 11117 H H    . SER A 1 14  ? -13.039 -5.839  8.037   1.00 0.00 ? 14  SER A H    6  
ATOM 11118 H HA   . SER A 1 14  ? -10.707 -5.045  9.577   1.00 0.00 ? 14  SER A HA   6  
ATOM 11119 H HB2  . SER A 1 14  ? -11.001 -7.869  8.503   1.00 0.00 ? 14  SER A HB2  6  
ATOM 11120 H HB3  . SER A 1 14  ? -9.527  -7.190  9.192   1.00 0.00 ? 14  SER A HB3  6  
ATOM 11121 H HG   . SER A 1 14  ? -10.791 -8.453  10.681  1.00 0.00 ? 14  SER A HG   6  
ATOM 11122 N N    . PHE A 1 15  ? -9.674  -4.356  7.443   1.00 0.00 ? 15  PHE A N    6  
ATOM 11123 C CA   . PHE A 1 15  ? -9.011  -3.922  6.214   1.00 0.00 ? 15  PHE A CA   6  
ATOM 11124 C C    . PHE A 1 15  ? -8.215  -5.080  5.613   1.00 0.00 ? 15  PHE A C    6  
ATOM 11125 O O    . PHE A 1 15  ? -8.091  -5.203  4.393   1.00 0.00 ? 15  PHE A O    6  
ATOM 11126 C CB   . PHE A 1 15  ? -8.098  -2.720  6.515   1.00 0.00 ? 15  PHE A CB   6  
ATOM 11127 C CG   . PHE A 1 15  ? -7.283  -2.232  5.340   1.00 0.00 ? 15  PHE A CG   6  
ATOM 11128 C CD1  . PHE A 1 15  ? -7.865  -2.048  4.094   1.00 0.00 ? 15  PHE A CD1  6  
ATOM 11129 C CD2  . PHE A 1 15  ? -5.932  -1.946  5.489   1.00 0.00 ? 15  PHE A CD2  6  
ATOM 11130 C CE1  . PHE A 1 15  ? -7.118  -1.593  3.025   1.00 0.00 ? 15  PHE A CE1  6  
ATOM 11131 C CE2  . PHE A 1 15  ? -5.183  -1.491  4.423   1.00 0.00 ? 15  PHE A CE2  6  
ATOM 11132 C CZ   . PHE A 1 15  ? -5.776  -1.315  3.190   1.00 0.00 ? 15  PHE A CZ   6  
ATOM 11133 H H    . PHE A 1 15  ? -9.465  -3.894  8.278   1.00 0.00 ? 15  PHE A H    6  
ATOM 11134 H HA   . PHE A 1 15  ? -9.777  -3.619  5.512   1.00 0.00 ? 15  PHE A HA   6  
ATOM 11135 H HB2  . PHE A 1 15  ? -8.709  -1.894  6.853   1.00 0.00 ? 15  PHE A HB2  6  
ATOM 11136 H HB3  . PHE A 1 15  ? -7.414  -2.994  7.306   1.00 0.00 ? 15  PHE A HB3  6  
ATOM 11137 H HD1  . PHE A 1 15  ? -8.915  -2.266  3.962   1.00 0.00 ? 15  PHE A HD1  6  
ATOM 11138 H HD2  . PHE A 1 15  ? -5.465  -2.082  6.454   1.00 0.00 ? 15  PHE A HD2  6  
ATOM 11139 H HE1  . PHE A 1 15  ? -7.584  -1.455  2.059   1.00 0.00 ? 15  PHE A HE1  6  
ATOM 11140 H HE2  . PHE A 1 15  ? -4.132  -1.273  4.553   1.00 0.00 ? 15  PHE A HE2  6  
ATOM 11141 H HZ   . PHE A 1 15  ? -5.189  -0.958  2.355   1.00 0.00 ? 15  PHE A HZ   6  
ATOM 11142 N N    . ASP A 1 16  ? -7.695  -5.937  6.489   1.00 0.00 ? 16  ASP A N    6  
ATOM 11143 C CA   . ASP A 1 16  ? -6.995  -7.150  6.071   1.00 0.00 ? 16  ASP A CA   6  
ATOM 11144 C C    . ASP A 1 16  ? -7.871  -7.993  5.140   1.00 0.00 ? 16  ASP A C    6  
ATOM 11145 O O    . ASP A 1 16  ? -7.405  -8.485  4.108   1.00 0.00 ? 16  ASP A O    6  
ATOM 11146 C CB   . ASP A 1 16  ? -6.588  -7.979  7.299   1.00 0.00 ? 16  ASP A CB   6  
ATOM 11147 C CG   . ASP A 1 16  ? -5.887  -9.276  6.924   1.00 0.00 ? 16  ASP A CG   6  
ATOM 11148 O OD1  . ASP A 1 16  ? -4.713  -9.222  6.505   1.00 0.00 ? 16  ASP A OD1  6  
ATOM 11149 O OD2  . ASP A 1 16  ? -6.500  -10.356 7.054   1.00 0.00 ? 16  ASP A OD2  6  
ATOM 11150 H H    . ASP A 1 16  ? -7.771  -5.736  7.447   1.00 0.00 ? 16  ASP A H    6  
ATOM 11151 H HA   . ASP A 1 16  ? -6.103  -6.851  5.538   1.00 0.00 ? 16  ASP A HA   6  
ATOM 11152 H HB2  . ASP A 1 16  ? -5.917  -7.394  7.913   1.00 0.00 ? 16  ASP A HB2  6  
ATOM 11153 H HB3  . ASP A 1 16  ? -7.472  -8.217  7.874   1.00 0.00 ? 16  ASP A HB3  6  
ATOM 11154 N N    . LYS A 1 17  ? -9.147  -8.132  5.502   1.00 0.00 ? 17  LYS A N    6  
ATOM 11155 C CA   . LYS A 1 17  ? -10.101 -8.894  4.697   1.00 0.00 ? 17  LYS A CA   6  
ATOM 11156 C C    . LYS A 1 17  ? -10.364 -8.183  3.371   1.00 0.00 ? 17  LYS A C    6  
ATOM 11157 O O    . LYS A 1 17  ? -10.416 -8.816  2.311   1.00 0.00 ? 17  LYS A O    6  
ATOM 11158 C CB   . LYS A 1 17  ? -11.422 -9.098  5.456   1.00 0.00 ? 17  LYS A CB   6  
ATOM 11159 C CG   . LYS A 1 17  ? -12.514 -9.745  4.607   1.00 0.00 ? 17  LYS A CG   6  
ATOM 11160 C CD   . LYS A 1 17  ? -13.807 -9.974  5.385   1.00 0.00 ? 17  LYS A CD   6  
ATOM 11161 C CE   . LYS A 1 17  ? -13.630 -10.982 6.514   1.00 0.00 ? 17  LYS A CE   6  
ATOM 11162 N NZ   . LYS A 1 17  ? -14.924 -11.315 7.168   1.00 0.00 ? 17  LYS A NZ   6  
ATOM 11163 H H    . LYS A 1 17  ? -9.456  -7.702  6.325   1.00 0.00 ? 17  LYS A H    6  
ATOM 11164 H HA   . LYS A 1 17  ? -9.662  -9.861  4.490   1.00 0.00 ? 17  LYS A HA   6  
ATOM 11165 H HB2  . LYS A 1 17  ? -11.237 -9.730  6.315   1.00 0.00 ? 17  LYS A HB2  6  
ATOM 11166 H HB3  . LYS A 1 17  ? -11.780 -8.138  5.798   1.00 0.00 ? 17  LYS A HB3  6  
ATOM 11167 H HG2  . LYS A 1 17  ? -12.727 -9.097  3.769   1.00 0.00 ? 17  LYS A HG2  6  
ATOM 11168 H HG3  . LYS A 1 17  ? -12.152 -10.695 4.240   1.00 0.00 ? 17  LYS A HG3  6  
ATOM 11169 H HD2  . LYS A 1 17  ? -14.132 -9.035  5.808   1.00 0.00 ? 17  LYS A HD2  6  
ATOM 11170 H HD3  . LYS A 1 17  ? -14.563 -10.339 4.704   1.00 0.00 ? 17  LYS A HD3  6  
ATOM 11171 H HE2  . LYS A 1 17  ? -13.201 -11.887 6.108   1.00 0.00 ? 17  LYS A HE2  6  
ATOM 11172 H HE3  . LYS A 1 17  ? -12.960 -10.567 7.252   1.00 0.00 ? 17  LYS A HE3  6  
ATOM 11173 H HZ1  . LYS A 1 17  ? -14.770 -11.991 7.943   1.00 0.00 ? 17  LYS A HZ1  6  
ATOM 11174 H HZ2  . LYS A 1 17  ? -15.574 -11.744 6.477   1.00 0.00 ? 17  LYS A HZ2  6  
ATOM 11175 H HZ3  . LYS A 1 17  ? -15.365 -10.458 7.557   1.00 0.00 ? 17  LYS A HZ3  6  
ATOM 11176 N N    . LEU A 1 18  ? -10.519 -6.862  3.442   1.00 0.00 ? 18  LEU A N    6  
ATOM 11177 C CA   . LEU A 1 18  ? -10.717 -6.035  2.253   1.00 0.00 ? 18  LEU A CA   6  
ATOM 11178 C C    . LEU A 1 18  ? -9.590  -6.277  1.249   1.00 0.00 ? 18  LEU A C    6  
ATOM 11179 O O    . LEU A 1 18  ? -9.817  -6.342  0.040   1.00 0.00 ? 18  LEU A O    6  
ATOM 11180 C CB   . LEU A 1 18  ? -10.773 -4.548  2.648   1.00 0.00 ? 18  LEU A CB   6  
ATOM 11181 C CG   . LEU A 1 18  ? -10.925 -3.550  1.485   1.00 0.00 ? 18  LEU A CG   6  
ATOM 11182 C CD1  . LEU A 1 18  ? -12.233 -3.780  0.736   1.00 0.00 ? 18  LEU A CD1  6  
ATOM 11183 C CD2  . LEU A 1 18  ? -10.843 -2.113  1.990   1.00 0.00 ? 18  LEU A CD2  6  
ATOM 11184 H H    . LEU A 1 18  ? -10.501 -6.430  4.324   1.00 0.00 ? 18  LEU A H    6  
ATOM 11185 H HA   . LEU A 1 18  ? -11.659 -6.318  1.802   1.00 0.00 ? 18  LEU A HA   6  
ATOM 11186 H HB2  . LEU A 1 18  ? -11.606 -4.410  3.324   1.00 0.00 ? 18  LEU A HB2  6  
ATOM 11187 H HB3  . LEU A 1 18  ? -9.862  -4.308  3.180   1.00 0.00 ? 18  LEU A HB3  6  
ATOM 11188 H HG   . LEU A 1 18  ? -10.115 -3.701  0.784   1.00 0.00 ? 18  LEU A HG   6  
ATOM 11189 H HD11 . LEU A 1 18  ? -12.257 -4.789  0.351   1.00 0.00 ? 18  LEU A HD11 6  
ATOM 11190 H HD12 . LEU A 1 18  ? -12.305 -3.082  -0.086  1.00 0.00 ? 18  LEU A HD12 6  
ATOM 11191 H HD13 . LEU A 1 18  ? -13.066 -3.632  1.408   1.00 0.00 ? 18  LEU A HD13 6  
ATOM 11192 H HD21 . LEU A 1 18  ? -11.630 -1.936  2.710   1.00 0.00 ? 18  LEU A HD21 6  
ATOM 11193 H HD22 . LEU A 1 18  ? -10.957 -1.431  1.159   1.00 0.00 ? 18  LEU A HD22 6  
ATOM 11194 H HD23 . LEU A 1 18  ? -9.883  -1.950  2.459   1.00 0.00 ? 18  LEU A HD23 6  
ATOM 11195 N N    . LEU A 1 19  ? -8.380  -6.430  1.774   1.00 0.00 ? 19  LEU A N    6  
ATOM 11196 C CA   . LEU A 1 19  ? -7.199  -6.681  0.955   1.00 0.00 ? 19  LEU A CA   6  
ATOM 11197 C C    . LEU A 1 19  ? -7.179  -8.128  0.447   1.00 0.00 ? 19  LEU A C    6  
ATOM 11198 O O    . LEU A 1 19  ? -6.627  -8.415  -0.615  1.00 0.00 ? 19  LEU A O    6  
ATOM 11199 C CB   . LEU A 1 19  ? -5.932  -6.389  1.774   1.00 0.00 ? 19  LEU A CB   6  
ATOM 11200 C CG   . LEU A 1 19  ? -4.604  -6.522  1.013   1.00 0.00 ? 19  LEU A CG   6  
ATOM 11201 C CD1  . LEU A 1 19  ? -4.539  -5.521  -0.139  1.00 0.00 ? 19  LEU A CD1  6  
ATOM 11202 C CD2  . LEU A 1 19  ? -3.421  -6.338  1.964   1.00 0.00 ? 19  LEU A CD2  6  
ATOM 11203 H H    . LEU A 1 19  ? -8.275  -6.361  2.747   1.00 0.00 ? 19  LEU A H    6  
ATOM 11204 H HA   . LEU A 1 19  ? -7.231  -6.012  0.107   1.00 0.00 ? 19  LEU A HA   6  
ATOM 11205 H HB2  . LEU A 1 19  ? -6.004  -5.380  2.156   1.00 0.00 ? 19  LEU A HB2  6  
ATOM 11206 H HB3  . LEU A 1 19  ? -5.909  -7.069  2.615   1.00 0.00 ? 19  LEU A HB3  6  
ATOM 11207 H HG   . LEU A 1 19  ? -4.538  -7.515  0.591   1.00 0.00 ? 19  LEU A HG   6  
ATOM 11208 H HD11 . LEU A 1 19  ? -5.359  -5.701  -0.819  1.00 0.00 ? 19  LEU A HD11 6  
ATOM 11209 H HD12 . LEU A 1 19  ? -3.604  -5.638  -0.668  1.00 0.00 ? 19  LEU A HD12 6  
ATOM 11210 H HD13 . LEU A 1 19  ? -4.608  -4.516  0.250   1.00 0.00 ? 19  LEU A HD13 6  
ATOM 11211 H HD21 . LEU A 1 19  ? -3.465  -7.087  2.742   1.00 0.00 ? 19  LEU A HD21 6  
ATOM 11212 H HD22 . LEU A 1 19  ? -3.462  -5.355  2.409   1.00 0.00 ? 19  LEU A HD22 6  
ATOM 11213 H HD23 . LEU A 1 19  ? -2.497  -6.446  1.415   1.00 0.00 ? 19  LEU A HD23 6  
ATOM 11214 N N    . SER A 1 20  ? -7.790  -9.031  1.214   1.00 0.00 ? 20  SER A N    6  
ATOM 11215 C CA   . SER A 1 20  ? -7.797  -10.456 0.875   1.00 0.00 ? 20  SER A CA   6  
ATOM 11216 C C    . SER A 1 20  ? -8.633  -10.724 -0.378  1.00 0.00 ? 20  SER A C    6  
ATOM 11217 O O    . SER A 1 20  ? -8.293  -11.588 -1.194  1.00 0.00 ? 20  SER A O    6  
ATOM 11218 C CB   . SER A 1 20  ? -8.334  -11.280 2.053   1.00 0.00 ? 20  SER A CB   6  
ATOM 11219 O OG   . SER A 1 20  ? -7.573  -11.042 3.226   1.00 0.00 ? 20  SER A OG   6  
ATOM 11220 H H    . SER A 1 20  ? -8.254  -8.732  2.022   1.00 0.00 ? 20  SER A H    6  
ATOM 11221 H HA   . SER A 1 20  ? -6.775  -10.754 0.679   1.00 0.00 ? 20  SER A HA   6  
ATOM 11222 H HB2  . SER A 1 20  ? -9.361  -11.006 2.245   1.00 0.00 ? 20  SER A HB2  6  
ATOM 11223 H HB3  . SER A 1 20  ? -8.279  -12.332 1.812   1.00 0.00 ? 20  SER A HB3  6  
ATOM 11224 H HG   . SER A 1 20  ? -7.200  -10.154 3.190   1.00 0.00 ? 20  SER A HG   6  
ATOM 11225 N N    . HIS A 1 21  ? -9.727  -9.981  -0.529  1.00 0.00 ? 21  HIS A N    6  
ATOM 11226 C CA   . HIS A 1 21  ? -10.602 -10.140 -1.686  1.00 0.00 ? 21  HIS A CA   6  
ATOM 11227 C C    . HIS A 1 21  ? -10.097 -9.274  -2.833  1.00 0.00 ? 21  HIS A C    6  
ATOM 11228 O O    . HIS A 1 21  ? -9.988  -8.058  -2.692  1.00 0.00 ? 21  HIS A O    6  
ATOM 11229 C CB   . HIS A 1 21  ? -12.058 -9.774  -1.335  1.00 0.00 ? 21  HIS A CB   6  
ATOM 11230 C CG   . HIS A 1 21  ? -13.005 -10.934 -1.426  1.00 0.00 ? 21  HIS A CG   6  
ATOM 11231 N ND1  . HIS A 1 21  ? -13.755 -11.214 -2.550  1.00 0.00 ? 21  HIS A ND1  6  
ATOM 11232 C CD2  . HIS A 1 21  ? -13.324 -11.892 -0.523  1.00 0.00 ? 21  HIS A CD2  6  
ATOM 11233 C CE1  . HIS A 1 21  ? -14.490 -12.286 -2.333  1.00 0.00 ? 21  HIS A CE1  6  
ATOM 11234 N NE2  . HIS A 1 21  ? -14.247 -12.721 -1.110  1.00 0.00 ? 21  HIS A NE2  6  
ATOM 11235 H H    . HIS A 1 21  ? -9.939  -9.295  0.142   1.00 0.00 ? 21  HIS A H    6  
ATOM 11236 H HA   . HIS A 1 21  ? -10.562 -11.177 -1.993  1.00 0.00 ? 21  HIS A HA   6  
ATOM 11237 H HB2  . HIS A 1 21  ? -12.095 -9.394  -0.324  1.00 0.00 ? 21  HIS A HB2  6  
ATOM 11238 H HB3  . HIS A 1 21  ? -12.409 -9.005  -2.011  1.00 0.00 ? 21  HIS A HB3  6  
ATOM 11239 H HD1  . HIS A 1 21  ? -13.745 -10.704 -3.391  1.00 0.00 ? 21  HIS A HD1  6  
ATOM 11240 H HD2  . HIS A 1 21  ? -12.931 -11.983 0.479   1.00 0.00 ? 21  HIS A HD2  6  
ATOM 11241 H HE1  . HIS A 1 21  ? -15.176 -12.732 -3.037  1.00 0.00 ? 21  HIS A HE1  6  
ATOM 11242 H HE2  . HIS A 1 21  ? -14.825 -13.346 -0.620  1.00 0.00 ? 21  HIS A HE2  6  
ATOM 11243 N N    . ARG A 1 22  ? -9.796  -9.907  -3.965  1.00 0.00 ? 22  ARG A N    6  
ATOM 11244 C CA   . ARG A 1 22  ? -9.297  -9.197  -5.142  1.00 0.00 ? 22  ARG A CA   6  
ATOM 11245 C C    . ARG A 1 22  ? -10.299 -8.128  -5.581  1.00 0.00 ? 22  ARG A C    6  
ATOM 11246 O O    . ARG A 1 22  ? -9.928  -7.111  -6.173  1.00 0.00 ? 22  ARG A O    6  
ATOM 11247 C CB   . ARG A 1 22  ? -9.027  -10.183 -6.290  1.00 0.00 ? 22  ARG A CB   6  
ATOM 11248 C CG   . ARG A 1 22  ? -10.282 -10.852 -6.846  1.00 0.00 ? 22  ARG A CG   6  
ATOM 11249 C CD   . ARG A 1 22  ? -9.947  -11.840 -7.955  1.00 0.00 ? 22  ARG A CD   6  
ATOM 11250 N NE   . ARG A 1 22  ? -9.136  -11.225 -9.009  1.00 0.00 ? 22  ARG A NE   6  
ATOM 11251 C CZ   . ARG A 1 22  ? -8.481  -11.913 -9.944  1.00 0.00 ? 22  ARG A CZ   6  
ATOM 11252 N NH1  . ARG A 1 22  ? -8.601  -13.233 -10.020 1.00 0.00 ? 22  ARG A NH1  6  
ATOM 11253 N NH2  . ARG A 1 22  ? -7.715  -11.278 -10.820 1.00 0.00 ? 22  ARG A NH2  6  
ATOM 11254 H H    . ARG A 1 22  ? -9.911  -10.880 -4.010  1.00 0.00 ? 22  ARG A H    6  
ATOM 11255 H HA   . ARG A 1 22  ? -8.370  -8.712  -4.868  1.00 0.00 ? 22  ARG A HA   6  
ATOM 11256 H HB2  . ARG A 1 22  ? -8.541  -9.651  -7.097  1.00 0.00 ? 22  ARG A HB2  6  
ATOM 11257 H HB3  . ARG A 1 22  ? -8.359  -10.955 -5.933  1.00 0.00 ? 22  ARG A HB3  6  
ATOM 11258 H HG2  . ARG A 1 22  ? -10.782 -11.379 -6.046  1.00 0.00 ? 22  ARG A HG2  6  
ATOM 11259 H HG3  . ARG A 1 22  ? -10.938 -10.089 -7.241  1.00 0.00 ? 22  ARG A HG3  6  
ATOM 11260 H HD2  . ARG A 1 22  ? -9.402  -12.672 -7.530  1.00 0.00 ? 22  ARG A HD2  6  
ATOM 11261 H HD3  . ARG A 1 22  ? -10.870 -12.201 -8.389  1.00 0.00 ? 22  ARG A HD3  6  
ATOM 11262 H HE   . ARG A 1 22  ? -9.060  -10.244 -9.002  1.00 0.00 ? 22  ARG A HE   6  
ATOM 11263 H HH11 . ARG A 1 22  ? -9.191  -13.727 -9.374  1.00 0.00 ? 22  ARG A HH11 6  
ATOM 11264 H HH12 . ARG A 1 22  ? -8.095  -13.744 -10.721 1.00 0.00 ? 22  ARG A HH12 6  
ATOM 11265 H HH21 . ARG A 1 22  ? -7.622  -10.280 -10.781 1.00 0.00 ? 22  ARG A HH21 6  
ATOM 11266 H HH22 . ARG A 1 22  ? -7.221  -11.798 -11.525 1.00 0.00 ? 22  ARG A HH22 6  
ATOM 11267 N N    . ASP A 1 23  ? -11.572 -8.383  -5.285  1.00 0.00 ? 23  ASP A N    6  
ATOM 11268 C CA   . ASP A 1 23  ? -12.642 -7.417  -5.524  1.00 0.00 ? 23  ASP A CA   6  
ATOM 11269 C C    . ASP A 1 23  ? -12.384 -6.161  -4.696  1.00 0.00 ? 23  ASP A C    6  
ATOM 11270 O O    . ASP A 1 23  ? -12.412 -5.040  -5.208  1.00 0.00 ? 23  ASP A O    6  
ATOM 11271 C CB   . ASP A 1 23  ? -14.004 -8.018  -5.133  1.00 0.00 ? 23  ASP A CB   6  
ATOM 11272 C CG   . ASP A 1 23  ? -14.243 -9.394  -5.737  1.00 0.00 ? 23  ASP A CG   6  
ATOM 11273 O OD1  . ASP A 1 23  ? -13.598 -10.364 -5.271  1.00 0.00 ? 23  ASP A OD1  6  
ATOM 11274 O OD2  . ASP A 1 23  ? -15.075 -9.516  -6.663  1.00 0.00 ? 23  ASP A OD2  6  
ATOM 11275 H H    . ASP A 1 23  ? -11.804 -9.257  -4.904  1.00 0.00 ? 23  ASP A H    6  
ATOM 11276 H HA   . ASP A 1 23  ? -12.647 -7.162  -6.576  1.00 0.00 ? 23  ASP A HA   6  
ATOM 11277 H HB2  . ASP A 1 23  ? -14.054 -8.107  -4.056  1.00 0.00 ? 23  ASP A HB2  6  
ATOM 11278 H HB3  . ASP A 1 23  ? -14.791 -7.353  -5.466  1.00 0.00 ? 23  ASP A HB3  6  
ATOM 11279 N N    . GLY A 1 24  ? -12.115 -6.380  -3.407  1.00 0.00 ? 24  GLY A N    6  
ATOM 11280 C CA   . GLY A 1 24  ? -11.836 -5.289  -2.493  1.00 0.00 ? 24  GLY A CA   6  
ATOM 11281 C C    . GLY A 1 24  ? -10.574 -4.545  -2.875  1.00 0.00 ? 24  GLY A C    6  
ATOM 11282 O O    . GLY A 1 24  ? -10.551 -3.315  -2.885  1.00 0.00 ? 24  GLY A O    6  
ATOM 11283 H H    . GLY A 1 24  ? -12.090 -7.299  -3.078  1.00 0.00 ? 24  GLY A H    6  
ATOM 11284 H HA2  . GLY A 1 24  ? -12.669 -4.604  -2.494  1.00 0.00 ? 24  GLY A HA2  6  
ATOM 11285 H HA3  . GLY A 1 24  ? -11.715 -5.691  -1.497  1.00 0.00 ? 24  GLY A HA3  6  
ATOM 11286 N N    . LEU A 1 25  ? -9.532  -5.307  -3.202  1.00 0.00 ? 25  LEU A N    6  
ATOM 11287 C CA   . LEU A 1 25  ? -8.253  -4.758  -3.651  1.00 0.00 ? 25  LEU A CA   6  
ATOM 11288 C C    . LEU A 1 25  ? -8.458  -3.713  -4.746  1.00 0.00 ? 25  LEU A C    6  
ATOM 11289 O O    . LEU A 1 25  ? -8.090  -2.547  -4.589  1.00 0.00 ? 25  LEU A O    6  
ATOM 11290 C CB   . LEU A 1 25  ? -7.366  -5.887  -4.196  1.00 0.00 ? 25  LEU A CB   6  
ATOM 11291 C CG   . LEU A 1 25  ? -6.063  -5.435  -4.883  1.00 0.00 ? 25  LEU A CG   6  
ATOM 11292 C CD1  . LEU A 1 25  ? -5.001  -5.049  -3.855  1.00 0.00 ? 25  LEU A CD1  6  
ATOM 11293 C CD2  . LEU A 1 25  ? -5.556  -6.515  -5.836  1.00 0.00 ? 25  LEU A CD2  6  
ATOM 11294 H H    . LEU A 1 25  ? -9.626  -6.280  -3.133  1.00 0.00 ? 25  LEU A H    6  
ATOM 11295 H HA   . LEU A 1 25  ? -7.766  -4.297  -2.803  1.00 0.00 ? 25  LEU A HA   6  
ATOM 11296 H HB2  . LEU A 1 25  ? -7.108  -6.542  -3.373  1.00 0.00 ? 25  LEU A HB2  6  
ATOM 11297 H HB3  . LEU A 1 25  ? -7.945  -6.454  -4.911  1.00 0.00 ? 25  LEU A HB3  6  
ATOM 11298 H HG   . LEU A 1 25  ? -6.273  -4.552  -5.473  1.00 0.00 ? 25  LEU A HG   6  
ATOM 11299 H HD11 . LEU A 1 25  ? -4.104  -4.729  -4.365  1.00 0.00 ? 25  LEU A HD11 6  
ATOM 11300 H HD12 . LEU A 1 25  ? -4.774  -5.903  -3.230  1.00 0.00 ? 25  LEU A HD12 6  
ATOM 11301 H HD13 . LEU A 1 25  ? -5.372  -4.243  -3.238  1.00 0.00 ? 25  LEU A HD13 6  
ATOM 11302 H HD21 . LEU A 1 25  ? -5.389  -7.432  -5.291  1.00 0.00 ? 25  LEU A HD21 6  
ATOM 11303 H HD22 . LEU A 1 25  ? -4.631  -6.190  -6.291  1.00 0.00 ? 25  LEU A HD22 6  
ATOM 11304 H HD23 . LEU A 1 25  ? -6.295  -6.683  -6.609  1.00 0.00 ? 25  LEU A HD23 6  
ATOM 11305 N N    . GLU A 1 26  ? -9.055  -4.151  -5.850  1.00 0.00 ? 26  GLU A N    6  
ATOM 11306 C CA   . GLU A 1 26  ? -9.248  -3.304  -7.021  1.00 0.00 ? 26  GLU A CA   6  
ATOM 11307 C C    . GLU A 1 26  ? -10.074 -2.066  -6.668  1.00 0.00 ? 26  GLU A C    6  
ATOM 11308 O O    . GLU A 1 26  ? -9.676  -0.939  -6.963  1.00 0.00 ? 26  GLU A O    6  
ATOM 11309 C CB   . GLU A 1 26  ? -9.928  -4.113  -8.132  1.00 0.00 ? 26  GLU A CB   6  
ATOM 11310 C CG   . GLU A 1 26  ? -10.160 -3.335  -9.426  1.00 0.00 ? 26  GLU A CG   6  
ATOM 11311 C CD   . GLU A 1 26  ? -8.867  -2.958  -10.137 1.00 0.00 ? 26  GLU A CD   6  
ATOM 11312 O OE1  . GLU A 1 26  ? -8.271  -3.838  -10.795 1.00 0.00 ? 26  GLU A OE1  6  
ATOM 11313 O OE2  . GLU A 1 26  ? -8.453  -1.781  -10.068 1.00 0.00 ? 26  GLU A OE2  6  
ATOM 11314 H H    . GLU A 1 26  ? -9.379  -5.077  -5.877  1.00 0.00 ? 26  GLU A H    6  
ATOM 11315 H HA   . GLU A 1 26  ? -8.273  -2.987  -7.363  1.00 0.00 ? 26  GLU A HA   6  
ATOM 11316 H HB2  . GLU A 1 26  ? -9.306  -4.972  -8.359  1.00 0.00 ? 26  GLU A HB2  6  
ATOM 11317 H HB3  . GLU A 1 26  ? -10.884 -4.464  -7.771  1.00 0.00 ? 26  GLU A HB3  6  
ATOM 11318 H HG2  . GLU A 1 26  ? -10.753 -3.944  -10.093 1.00 0.00 ? 26  GLU A HG2  6  
ATOM 11319 H HG3  . GLU A 1 26  ? -10.705 -2.430  -9.193  1.00 0.00 ? 26  GLU A HG3  6  
ATOM 11320 N N    . ALA A 1 27  ? -11.208 -2.283  -6.008  1.00 0.00 ? 27  ALA A N    6  
ATOM 11321 C CA   . ALA A 1 27  ? -12.101 -1.188  -5.627  1.00 0.00 ? 27  ALA A CA   6  
ATOM 11322 C C    . ALA A 1 27  ? -11.394 -0.198  -4.698  1.00 0.00 ? 27  ALA A C    6  
ATOM 11323 O O    . ALA A 1 27  ? -11.618 1.015   -4.770  1.00 0.00 ? 27  ALA A O    6  
ATOM 11324 C CB   . ALA A 1 27  ? -13.355 -1.742  -4.960  1.00 0.00 ? 27  ALA A CB   6  
ATOM 11325 H H    . ALA A 1 27  ? -11.453 -3.203  -5.768  1.00 0.00 ? 27  ALA A H    6  
ATOM 11326 H HA   . ALA A 1 27  ? -12.398 -0.672  -6.531  1.00 0.00 ? 27  ALA A HA   6  
ATOM 11327 H HB1  . ALA A 1 27  ? -14.024 -0.929  -4.716  1.00 0.00 ? 27  ALA A HB1  6  
ATOM 11328 H HB2  . ALA A 1 27  ? -13.082 -2.267  -4.056  1.00 0.00 ? 27  ALA A HB2  6  
ATOM 11329 H HB3  . ALA A 1 27  ? -13.852 -2.426  -5.635  1.00 0.00 ? 27  ALA A HB3  6  
ATOM 11330 N N    . PHE A 1 28  ? -10.522 -0.726  -3.843  1.00 0.00 ? 28  PHE A N    6  
ATOM 11331 C CA   . PHE A 1 28  ? -9.825  0.081   -2.846  1.00 0.00 ? 28  PHE A CA   6  
ATOM 11332 C C    . PHE A 1 28  ? -8.722  0.909   -3.493  1.00 0.00 ? 28  PHE A C    6  
ATOM 11333 O O    . PHE A 1 28  ? -8.611  2.115   -3.247  1.00 0.00 ? 28  PHE A O    6  
ATOM 11334 C CB   . PHE A 1 28  ? -9.237  -0.810  -1.743  1.00 0.00 ? 28  PHE A CB   6  
ATOM 11335 C CG   . PHE A 1 28  ? -8.478  -0.042  -0.688  1.00 0.00 ? 28  PHE A CG   6  
ATOM 11336 C CD1  . PHE A 1 28  ? -9.155  0.640   0.312   1.00 0.00 ? 28  PHE A CD1  6  
ATOM 11337 C CD2  . PHE A 1 28  ? -7.089  0.000   -0.701  1.00 0.00 ? 28  PHE A CD2  6  
ATOM 11338 C CE1  . PHE A 1 28  ? -8.465  1.348   1.276   1.00 0.00 ? 28  PHE A CE1  6  
ATOM 11339 C CE2  . PHE A 1 28  ? -6.397  0.708   0.262   1.00 0.00 ? 28  PHE A CE2  6  
ATOM 11340 C CZ   . PHE A 1 28  ? -7.084  1.382   1.251   1.00 0.00 ? 28  PHE A CZ   6  
ATOM 11341 H H    . PHE A 1 28  ? -10.334 -1.687  -3.893  1.00 0.00 ? 28  PHE A H    6  
ATOM 11342 H HA   . PHE A 1 28  ? -10.548 0.753   -2.402  1.00 0.00 ? 28  PHE A HA   6  
ATOM 11343 H HB2  . PHE A 1 28  ? -10.040 -1.343  -1.252  1.00 0.00 ? 28  PHE A HB2  6  
ATOM 11344 H HB3  . PHE A 1 28  ? -8.560  -1.526  -2.189  1.00 0.00 ? 28  PHE A HB3  6  
ATOM 11345 H HD1  . PHE A 1 28  ? -10.236 0.615   0.335   1.00 0.00 ? 28  PHE A HD1  6  
ATOM 11346 H HD2  . PHE A 1 28  ? -6.549  -0.526  -1.474  1.00 0.00 ? 28  PHE A HD2  6  
ATOM 11347 H HE1  . PHE A 1 28  ? -9.005  1.876   2.049   1.00 0.00 ? 28  PHE A HE1  6  
ATOM 11348 H HE2  . PHE A 1 28  ? -5.316  0.733   0.241   1.00 0.00 ? 28  PHE A HE2  6  
ATOM 11349 H HZ   . PHE A 1 28  ? -6.544  1.935   2.005   1.00 0.00 ? 28  PHE A HZ   6  
ATOM 11350 N N    . THR A 1 29  ? -7.927  0.273   -4.350  1.00 0.00 ? 29  THR A N    6  
ATOM 11351 C CA   . THR A 1 29  ? -6.795  0.946   -4.959  1.00 0.00 ? 29  THR A CA   6  
ATOM 11352 C C    . THR A 1 29  ? -7.330  1.960   -5.950  1.00 0.00 ? 29  THR A C    6  
ATOM 11353 O O    . THR A 1 29  ? -6.724  2.997   -6.191  1.00 0.00 ? 29  THR A O    6  
ATOM 11354 C CB   . THR A 1 29  ? -5.818  -0.040  -5.658  1.00 0.00 ? 29  THR A CB   6  
ATOM 11355 O OG1  . THR A 1 29  ? -4.661  0.663   -6.136  1.00 0.00 ? 29  THR A OG1  6  
ATOM 11356 C CG2  . THR A 1 29  ? -6.485  -0.761  -6.826  1.00 0.00 ? 29  THR A CG2  6  
ATOM 11357 H H    . THR A 1 29  ? -8.138  -0.646  -4.616  1.00 0.00 ? 29  THR A H    6  
ATOM 11358 H HA   . THR A 1 29  ? -6.256  1.471   -4.179  1.00 0.00 ? 29  THR A HA   6  
ATOM 11359 H HB   . THR A 1 29  ? -5.501  -0.780  -4.935  1.00 0.00 ? 29  THR A HB   6  
ATOM 11360 H HG1  . THR A 1 29  ? -3.869  0.318   -5.705  1.00 0.00 ? 29  THR A HG1  6  
ATOM 11361 H HG21 . THR A 1 29  ? -6.813  -0.036  -7.555  1.00 0.00 ? 29  THR A HG21 6  
ATOM 11362 H HG22 . THR A 1 29  ? -7.336  -1.322  -6.466  1.00 0.00 ? 29  THR A HG22 6  
ATOM 11363 H HG23 . THR A 1 29  ? -5.777  -1.436  -7.284  1.00 0.00 ? 29  THR A HG23 6  
ATOM 11364 N N    . ARG A 1 30  ? -8.511  1.663   -6.481  1.00 0.00 ? 30  ARG A N    6  
ATOM 11365 C CA   . ARG A 1 30  ? -9.184  2.550   -7.408  1.00 0.00 ? 30  ARG A CA   6  
ATOM 11366 C C    . ARG A 1 30  ? -9.491  3.881   -6.723  1.00 0.00 ? 30  ARG A C    6  
ATOM 11367 O O    . ARG A 1 30  ? -9.106  4.945   -7.211  1.00 0.00 ? 30  ARG A O    6  
ATOM 11368 C CB   . ARG A 1 30  ? -10.482 1.901   -7.919  1.00 0.00 ? 30  ARG A CB   6  
ATOM 11369 C CG   . ARG A 1 30  ? -10.812 2.268   -9.356  1.00 0.00 ? 30  ARG A CG   6  
ATOM 11370 C CD   . ARG A 1 30  ? -10.988 3.778   -9.532  1.00 0.00 ? 30  ARG A CD   6  
ATOM 11371 N NE   . ARG A 1 30  ? -11.200 4.171   -10.925 1.00 0.00 ? 30  ARG A NE   6  
ATOM 11372 C CZ   . ARG A 1 30  ? -11.139 5.435   -11.362 1.00 0.00 ? 30  ARG A CZ   6  
ATOM 11373 N NH1  . ARG A 1 30  ? -10.899 6.434   -10.513 1.00 0.00 ? 30  ARG A NH1  6  
ATOM 11374 N NH2  . ARG A 1 30  ? -11.321 5.704   -12.647 1.00 0.00 ? 30  ARG A NH2  6  
ATOM 11375 H H    . ARG A 1 30  ? -8.938  0.811   -6.245  1.00 0.00 ? 30  ARG A H    6  
ATOM 11376 H HA   . ARG A 1 30  ? -8.520  2.728   -8.243  1.00 0.00 ? 30  ARG A HA   6  
ATOM 11377 H HB2  . ARG A 1 30  ? -10.381 0.825   -7.861  1.00 0.00 ? 30  ARG A HB2  6  
ATOM 11378 H HB3  . ARG A 1 30  ? -11.307 2.207   -7.289  1.00 0.00 ? 30  ARG A HB3  6  
ATOM 11379 H HG2  . ARG A 1 30  ? -9.998  1.927   -9.973  1.00 0.00 ? 30  ARG A HG2  6  
ATOM 11380 H HG3  . ARG A 1 30  ? -11.725 1.766   -9.650  1.00 0.00 ? 30  ARG A HG3  6  
ATOM 11381 H HD2  . ARG A 1 30  ? -11.840 4.098   -8.951  1.00 0.00 ? 30  ARG A HD2  6  
ATOM 11382 H HD3  . ARG A 1 30  ? -10.100 4.274   -9.163  1.00 0.00 ? 30  ARG A HD3  6  
ATOM 11383 H HE   . ARG A 1 30  ? -11.394 3.451   -11.573 1.00 0.00 ? 30  ARG A HE   6  
ATOM 11384 H HH11 . ARG A 1 30  ? -10.760 6.249   -9.536  1.00 0.00 ? 30  ARG A HH11 6  
ATOM 11385 H HH12 . ARG A 1 30  ? -10.854 7.381   -10.848 1.00 0.00 ? 30  ARG A HH12 6  
ATOM 11386 H HH21 . ARG A 1 30  ? -11.502 4.962   -13.298 1.00 0.00 ? 30  ARG A HH21 6  
ATOM 11387 H HH22 . ARG A 1 30  ? -11.275 6.649   -12.975 1.00 0.00 ? 30  ARG A HH22 6  
ATOM 11388 N N    . PHE A 1 31  ? -10.181 3.809   -5.587  1.00 0.00 ? 31  PHE A N    6  
ATOM 11389 C CA   . PHE A 1 31  ? -10.563 5.002   -4.834  1.00 0.00 ? 31  PHE A CA   6  
ATOM 11390 C C    . PHE A 1 31  ? -9.328  5.820   -4.457  1.00 0.00 ? 31  PHE A C    6  
ATOM 11391 O O    . PHE A 1 31  ? -9.362  7.049   -4.431  1.00 0.00 ? 31  PHE A O    6  
ATOM 11392 C CB   . PHE A 1 31  ? -11.351 4.609   -3.574  1.00 0.00 ? 31  PHE A CB   6  
ATOM 11393 C CG   . PHE A 1 31  ? -11.765 5.787   -2.727  1.00 0.00 ? 31  PHE A CG   6  
ATOM 11394 C CD1  . PHE A 1 31  ? -12.785 6.633   -3.143  1.00 0.00 ? 31  PHE A CD1  6  
ATOM 11395 C CD2  . PHE A 1 31  ? -11.126 6.058   -1.524  1.00 0.00 ? 31  PHE A CD2  6  
ATOM 11396 C CE1  . PHE A 1 31  ? -13.160 7.719   -2.375  1.00 0.00 ? 31  PHE A CE1  6  
ATOM 11397 C CE2  . PHE A 1 31  ? -11.496 7.144   -0.756  1.00 0.00 ? 31  PHE A CE2  6  
ATOM 11398 C CZ   . PHE A 1 31  ? -12.515 7.975   -1.181  1.00 0.00 ? 31  PHE A CZ   6  
ATOM 11399 H H    . PHE A 1 31  ? -10.438 2.925   -5.241  1.00 0.00 ? 31  PHE A H    6  
ATOM 11400 H HA   . PHE A 1 31  ? -11.198 5.603   -5.471  1.00 0.00 ? 31  PHE A HA   6  
ATOM 11401 H HB2  . PHE A 1 31  ? -12.247 4.080   -3.867  1.00 0.00 ? 31  PHE A HB2  6  
ATOM 11402 H HB3  . PHE A 1 31  ? -10.742 3.955   -2.965  1.00 0.00 ? 31  PHE A HB3  6  
ATOM 11403 H HD1  . PHE A 1 31  ? -13.292 6.435   -4.076  1.00 0.00 ? 31  PHE A HD1  6  
ATOM 11404 H HD2  . PHE A 1 31  ? -10.330 5.408   -1.189  1.00 0.00 ? 31  PHE A HD2  6  
ATOM 11405 H HE1  . PHE A 1 31  ? -13.957 8.369   -2.709  1.00 0.00 ? 31  PHE A HE1  6  
ATOM 11406 H HE2  . PHE A 1 31  ? -10.990 7.342   0.178   1.00 0.00 ? 31  PHE A HE2  6  
ATOM 11407 H HZ   . PHE A 1 31  ? -12.805 8.825   -0.581  1.00 0.00 ? 31  PHE A HZ   6  
ATOM 11408 N N    . LEU A 1 32  ? -8.234  5.121   -4.197  1.00 0.00 ? 32  LEU A N    6  
ATOM 11409 C CA   . LEU A 1 32  ? -6.986  5.752   -3.787  1.00 0.00 ? 32  LEU A CA   6  
ATOM 11410 C C    . LEU A 1 32  ? -6.298  6.432   -4.978  1.00 0.00 ? 32  LEU A C    6  
ATOM 11411 O O    . LEU A 1 32  ? -5.848  7.576   -4.880  1.00 0.00 ? 32  LEU A O    6  
ATOM 11412 C CB   . LEU A 1 32  ? -6.071  4.694   -3.178  1.00 0.00 ? 32  LEU A CB   6  
ATOM 11413 C CG   . LEU A 1 32  ? -4.817  5.223   -2.471  1.00 0.00 ? 32  LEU A CG   6  
ATOM 11414 C CD1  . LEU A 1 32  ? -5.194  6.184   -1.344  1.00 0.00 ? 32  LEU A CD1  6  
ATOM 11415 C CD2  . LEU A 1 32  ? -3.982  4.062   -1.933  1.00 0.00 ? 32  LEU A CD2  6  
ATOM 11416 H H    . LEU A 1 32  ? -8.267  4.142   -4.274  1.00 0.00 ? 32  LEU A H    6  
ATOM 11417 H HA   . LEU A 1 32  ? -7.214  6.497   -3.038  1.00 0.00 ? 32  LEU A HA   6  
ATOM 11418 H HB2  . LEU A 1 32  ? -6.647  4.121   -2.465  1.00 0.00 ? 32  LEU A HB2  6  
ATOM 11419 H HB3  . LEU A 1 32  ? -5.762  4.037   -3.975  1.00 0.00 ? 32  LEU A HB3  6  
ATOM 11420 H HG   . LEU A 1 32  ? -4.211  5.766   -3.184  1.00 0.00 ? 32  LEU A HG   6  
ATOM 11421 H HD11 . LEU A 1 32  ? -5.815  5.674   -0.622  1.00 0.00 ? 32  LEU A HD11 6  
ATOM 11422 H HD12 . LEU A 1 32  ? -5.735  7.025   -1.753  1.00 0.00 ? 32  LEU A HD12 6  
ATOM 11423 H HD13 . LEU A 1 32  ? -4.296  6.540   -0.858  1.00 0.00 ? 32  LEU A HD13 6  
ATOM 11424 H HD21 . LEU A 1 32  ? -3.694  3.417   -2.749  1.00 0.00 ? 32  LEU A HD21 6  
ATOM 11425 H HD22 . LEU A 1 32  ? -4.563  3.499   -1.217  1.00 0.00 ? 32  LEU A HD22 6  
ATOM 11426 H HD23 . LEU A 1 32  ? -3.095  4.449   -1.452  1.00 0.00 ? 32  LEU A HD23 6  
ATOM 11427 N N    . LYS A 1 33  ? -6.228  5.721   -6.105  1.00 0.00 ? 33  LYS A N    6  
ATOM 11428 C CA   . LYS A 1 33  ? -5.652  6.270   -7.335  1.00 0.00 ? 33  LYS A CA   6  
ATOM 11429 C C    . LYS A 1 33  ? -6.448  7.492   -7.784  1.00 0.00 ? 33  LYS A C    6  
ATOM 11430 O O    . LYS A 1 33  ? -5.932  8.372   -8.474  1.00 0.00 ? 33  LYS A O    6  
ATOM 11431 C CB   . LYS A 1 33  ? -5.645  5.219   -8.458  1.00 0.00 ? 33  LYS A CB   6  
ATOM 11432 C CG   . LYS A 1 33  ? -4.774  3.997   -8.171  1.00 0.00 ? 33  LYS A CG   6  
ATOM 11433 C CD   . LYS A 1 33  ? -4.763  3.026   -9.350  1.00 0.00 ? 33  LYS A CD   6  
ATOM 11434 C CE   . LYS A 1 33  ? -3.988  1.750   -9.034  1.00 0.00 ? 33  LYS A CE   6  
ATOM 11435 N NZ   . LYS A 1 33  ? -2.589  2.025   -8.616  1.00 0.00 ? 33  LYS A NZ   6  
ATOM 11436 H H    . LYS A 1 33  ? -6.571  4.804   -6.109  1.00 0.00 ? 33  LYS A H    6  
ATOM 11437 H HA   . LYS A 1 33  ? -4.636  6.571   -7.125  1.00 0.00 ? 33  LYS A HA   6  
ATOM 11438 H HB2  . LYS A 1 33  ? -6.658  4.879   -8.622  1.00 0.00 ? 33  LYS A HB2  6  
ATOM 11439 H HB3  . LYS A 1 33  ? -5.284  5.684   -9.366  1.00 0.00 ? 33  LYS A HB3  6  
ATOM 11440 H HG2  . LYS A 1 33  ? -3.762  4.326   -7.980  1.00 0.00 ? 33  LYS A HG2  6  
ATOM 11441 H HG3  . LYS A 1 33  ? -5.158  3.489   -7.299  1.00 0.00 ? 33  LYS A HG3  6  
ATOM 11442 H HD2  . LYS A 1 33  ? -5.781  2.761   -9.596  1.00 0.00 ? 33  LYS A HD2  6  
ATOM 11443 H HD3  . LYS A 1 33  ? -4.302  3.514   -10.200 1.00 0.00 ? 33  LYS A HD3  6  
ATOM 11444 H HE2  . LYS A 1 33  ? -4.493  1.226   -8.236  1.00 0.00 ? 33  LYS A HE2  6  
ATOM 11445 H HE3  . LYS A 1 33  ? -3.973  1.127   -9.916  1.00 0.00 ? 33  LYS A HE3  6  
ATOM 11446 H HZ1  . LYS A 1 33  ? -2.568  2.400   -7.643  1.00 0.00 ? 33  LYS A HZ1  6  
ATOM 11447 H HZ2  . LYS A 1 33  ? -2.150  2.724   -9.247  1.00 0.00 ? 33  LYS A HZ2  6  
ATOM 11448 H HZ3  . LYS A 1 33  ? -2.028  1.149   -8.643  1.00 0.00 ? 33  LYS A HZ3  6  
ATOM 11449 N N    . THR A 1 34  ? -7.711  7.530   -7.380  1.00 0.00 ? 34  THR A N    6  
ATOM 11450 C CA   . THR A 1 34  ? -8.596  8.644   -7.676  1.00 0.00 ? 34  THR A CA   6  
ATOM 11451 C C    . THR A 1 34  ? -8.062  9.955   -7.076  1.00 0.00 ? 34  THR A C    6  
ATOM 11452 O O    . THR A 1 34  ? -8.206  11.028  -7.674  1.00 0.00 ? 34  THR A O    6  
ATOM 11453 C CB   . THR A 1 34  ? -10.015 8.344   -7.144  1.00 0.00 ? 34  THR A CB   6  
ATOM 11454 O OG1  . THR A 1 34  ? -10.531 7.160   -7.780  1.00 0.00 ? 34  THR A OG1  6  
ATOM 11455 C CG2  . THR A 1 34  ? -10.962 9.506   -7.382  1.00 0.00 ? 34  THR A CG2  6  
ATOM 11456 H H    . THR A 1 34  ? -8.062  6.772   -6.865  1.00 0.00 ? 34  THR A H    6  
ATOM 11457 H HA   . THR A 1 34  ? -8.652  8.747   -8.752  1.00 0.00 ? 34  THR A HA   6  
ATOM 11458 H HB   . THR A 1 34  ? -9.950  8.165   -6.080  1.00 0.00 ? 34  THR A HB   6  
ATOM 11459 H HG1  . THR A 1 34  ? -10.304 6.393   -7.249  1.00 0.00 ? 34  THR A HG1  6  
ATOM 11460 H HG21 . THR A 1 34  ? -10.586 10.383  -6.877  1.00 0.00 ? 34  THR A HG21 6  
ATOM 11461 H HG22 . THR A 1 34  ? -11.937 9.257   -6.992  1.00 0.00 ? 34  THR A HG22 6  
ATOM 11462 H HG23 . THR A 1 34  ? -11.035 9.701   -8.441  1.00 0.00 ? 34  THR A HG23 6  
ATOM 11463 N N    . GLU A 1 35  ? -7.435  9.866   -5.899  1.00 0.00 ? 35  GLU A N    6  
ATOM 11464 C CA   . GLU A 1 35  ? -6.821  11.035  -5.262  1.00 0.00 ? 35  GLU A CA   6  
ATOM 11465 C C    . GLU A 1 35  ? -5.303  11.021  -5.466  1.00 0.00 ? 35  GLU A C    6  
ATOM 11466 O O    . GLU A 1 35  ? -4.574  11.803  -4.855  1.00 0.00 ? 35  GLU A O    6  
ATOM 11467 C CB   . GLU A 1 35  ? -7.169  11.092  -3.766  1.00 0.00 ? 35  GLU A CB   6  
ATOM 11468 C CG   . GLU A 1 35  ? -6.694  9.890   -2.956  1.00 0.00 ? 35  GLU A CG   6  
ATOM 11469 C CD   . GLU A 1 35  ? -6.944  10.070  -1.466  1.00 0.00 ? 35  GLU A CD   6  
ATOM 11470 O OE1  . GLU A 1 35  ? -6.085  10.674  -0.787  1.00 0.00 ? 35  GLU A OE1  6  
ATOM 11471 O OE2  . GLU A 1 35  ? -8.008  9.633   -0.975  1.00 0.00 ? 35  GLU A OE2  6  
ATOM 11472 H H    . GLU A 1 35  ? -7.380  8.995   -5.450  1.00 0.00 ? 35  GLU A H    6  
ATOM 11473 H HA   . GLU A 1 35  ? -7.218  11.920  -5.744  1.00 0.00 ? 35  GLU A HA   6  
ATOM 11474 H HB2  . GLU A 1 35  ? -6.725  11.981  -3.341  1.00 0.00 ? 35  GLU A HB2  6  
ATOM 11475 H HB3  . GLU A 1 35  ? -8.243  11.161  -3.666  1.00 0.00 ? 35  GLU A HB3  6  
ATOM 11476 H HG2  . GLU A 1 35  ? -7.223  9.009   -3.296  1.00 0.00 ? 35  GLU A HG2  6  
ATOM 11477 H HG3  . GLU A 1 35  ? -5.633  9.756   -3.118  1.00 0.00 ? 35  GLU A HG3  6  
ATOM 11478 N N    . PHE A 1 36  ? -4.847  10.106  -6.327  1.00 0.00 ? 36  PHE A N    6  
ATOM 11479 C CA   . PHE A 1 36  ? -3.444  10.021  -6.752  1.00 0.00 ? 36  PHE A CA   6  
ATOM 11480 C C    . PHE A 1 36  ? -2.505  9.631   -5.606  1.00 0.00 ? 36  PHE A C    6  
ATOM 11481 O O    . PHE A 1 36  ? -1.284  9.631   -5.771  1.00 0.00 ? 36  PHE A O    6  
ATOM 11482 C CB   . PHE A 1 36  ? -2.985  11.346  -7.388  1.00 0.00 ? 36  PHE A CB   6  
ATOM 11483 C CG   . PHE A 1 36  ? -3.800  11.754  -8.593  1.00 0.00 ? 36  PHE A CG   6  
ATOM 11484 C CD1  . PHE A 1 36  ? -3.627  11.116  -9.814  1.00 0.00 ? 36  PHE A CD1  6  
ATOM 11485 C CD2  . PHE A 1 36  ? -4.741  12.773  -8.504  1.00 0.00 ? 36  PHE A CD2  6  
ATOM 11486 C CE1  . PHE A 1 36  ? -4.373  11.485  -10.916 1.00 0.00 ? 36  PHE A CE1  6  
ATOM 11487 C CE2  . PHE A 1 36  ? -5.489  13.143  -9.604  1.00 0.00 ? 36  PHE A CE2  6  
ATOM 11488 C CZ   . PHE A 1 36  ? -5.306  12.499  -10.813 1.00 0.00 ? 36  PHE A CZ   6  
ATOM 11489 H H    . PHE A 1 36  ? -5.483  9.462   -6.699  1.00 0.00 ? 36  PHE A H    6  
ATOM 11490 H HA   . PHE A 1 36  ? -3.388  9.247   -7.504  1.00 0.00 ? 36  PHE A HA   6  
ATOM 11491 H HB2  . PHE A 1 36  ? -3.058  12.134  -6.652  1.00 0.00 ? 36  PHE A HB2  6  
ATOM 11492 H HB3  . PHE A 1 36  ? -1.953  11.249  -7.699  1.00 0.00 ? 36  PHE A HB3  6  
ATOM 11493 H HD1  . PHE A 1 36  ? -2.899  10.321  -9.900  1.00 0.00 ? 36  PHE A HD1  6  
ATOM 11494 H HD2  . PHE A 1 36  ? -4.886  13.280  -7.560  1.00 0.00 ? 36  PHE A HD2  6  
ATOM 11495 H HE1  . PHE A 1 36  ? -4.228  10.980  -11.861 1.00 0.00 ? 36  PHE A HE1  6  
ATOM 11496 H HE2  . PHE A 1 36  ? -6.218  13.936  -9.521  1.00 0.00 ? 36  PHE A HE2  6  
ATOM 11497 H HZ   . PHE A 1 36  ? -5.889  12.788  -11.675 1.00 0.00 ? 36  PHE A HZ   6  
ATOM 11498 N N    . SER A 1 37  ? -3.065  9.262   -4.460  1.00 0.00 ? 37  SER A N    6  
ATOM 11499 C CA   . SER A 1 37  ? -2.259  8.892   -3.298  1.00 0.00 ? 37  SER A CA   6  
ATOM 11500 C C    . SER A 1 37  ? -2.029  7.382   -3.289  1.00 0.00 ? 37  SER A C    6  
ATOM 11501 O O    . SER A 1 37  ? -2.102  6.734   -2.249  1.00 0.00 ? 37  SER A O    6  
ATOM 11502 C CB   . SER A 1 37  ? -2.960  9.343   -2.007  1.00 0.00 ? 37  SER A CB   6  
ATOM 11503 O OG   . SER A 1 37  ? -2.124  9.171   -0.869  1.00 0.00 ? 37  SER A OG   6  
ATOM 11504 H H    . SER A 1 37  ? -4.042  9.222   -4.394  1.00 0.00 ? 37  SER A H    6  
ATOM 11505 H HA   . SER A 1 37  ? -1.303  9.391   -3.376  1.00 0.00 ? 37  SER A HA   6  
ATOM 11506 H HB2  . SER A 1 37  ? -3.218  10.388  -2.088  1.00 0.00 ? 37  SER A HB2  6  
ATOM 11507 H HB3  . SER A 1 37  ? -3.861  8.763   -1.866  1.00 0.00 ? 37  SER A HB3  6  
ATOM 11508 H HG   . SER A 1 37  ? -1.511  8.437   -1.026  1.00 0.00 ? 37  SER A HG   6  
ATOM 11509 N N    . GLU A 1 38  ? -1.721  6.836   -4.458  1.00 0.00 ? 38  GLU A N    6  
ATOM 11510 C CA   . GLU A 1 38  ? -1.584  5.392   -4.629  1.00 0.00 ? 38  GLU A CA   6  
ATOM 11511 C C    . GLU A 1 38  ? -0.170  4.912   -4.289  1.00 0.00 ? 38  GLU A C    6  
ATOM 11512 O O    . GLU A 1 38  ? 0.130   3.721   -4.389  1.00 0.00 ? 38  GLU A O    6  
ATOM 11513 C CB   . GLU A 1 38  ? -1.952  5.012   -6.071  1.00 0.00 ? 38  GLU A CB   6  
ATOM 11514 C CG   . GLU A 1 38  ? -1.126  5.732   -7.135  1.00 0.00 ? 38  GLU A CG   6  
ATOM 11515 C CD   . GLU A 1 38  ? -1.604  5.435   -8.549  1.00 0.00 ? 38  GLU A CD   6  
ATOM 11516 O OE1  . GLU A 1 38  ? -1.263  4.359   -9.087  1.00 0.00 ? 38  GLU A OE1  6  
ATOM 11517 O OE2  . GLU A 1 38  ? -2.333  6.269   -9.127  1.00 0.00 ? 38  GLU A OE2  6  
ATOM 11518 H H    . GLU A 1 38  ? -1.573  7.421   -5.229  1.00 0.00 ? 38  GLU A H    6  
ATOM 11519 H HA   . GLU A 1 38  ? -2.280  4.911   -3.956  1.00 0.00 ? 38  GLU A HA   6  
ATOM 11520 H HB2  . GLU A 1 38  ? -1.814  3.948   -6.196  1.00 0.00 ? 38  GLU A HB2  6  
ATOM 11521 H HB3  . GLU A 1 38  ? -2.994  5.