data_2PO5
# 
_entry.id   2PO5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PO5         
RCSB  RCSB042594   
WWPDB D_1000042594 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1HRK . unspecified 
PDB 2PNJ . unspecified 
PDB 2PO7 . unspecified 
# 
_pdbx_database_status.entry_id                        2PO5 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dailey, H.A.'            1 
'Wu, C.-K.'               2 
'Horanyi, P.'             3 
'Medlock, A.E.'           4 
'Najahi-Missaoui, A.E.W.' 5 
'Burden, A.'              6 
'Dailey, T.A.'            7 
'Rose, J.P.'              8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Altered orientation of active site residues in variants of human ferrochelatase. Evidence for a hydrogen bond network involved in catalysis
;
Biochemistry         46   7973 7979 2007 BICHAW US 0006-2960 0033 ? 17567154 10.1021/bi700151f               
1       'The 2.0 A structure of human ferrochelatase, the terminal enzyme of heme biosynthesis' Nat.Struct.Biol.     8    156  160 
2001 NSBIEW US 1072-8368 2024 ? 11175906 10.1038/84152                   
2       
'Human Ferrochelatase: Crystallization, Characterization of the [2Fe-2S] Cluster and Determination that the Enzyme is a Homodimer' 
Biochim.Biophys.Acta 1435 191  197  1999 BBACAQ NE 0006-3002 0113 ? 10561552 '10.1016/S0167-4838(99)00196-X' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dailey, H.A.'        1  
primary 'Wu, C.-K.'           2  
primary 'Horanyi, P.'         3  
primary 'Medlock, A.E.'       4  
primary 'Najahi-Missaoui, W.' 5  
primary 'Burden, A.E.'        6  
primary 'Dailey, T.A.'        7  
primary 'Rose, J.P.'          8  
1       'Wu, C.K.'            9  
1       'Dailey, H.A.'        10 
1       'Rose, J.P.'          11 
1       'Burden, A.'          12 
1       'Sellers, V.M.'       13 
1       'Wang, B.-C.'         14 
2       'Burden, A.E.'        15 
2       'Wu, C.-K.'           16 
2       'Dailey, T.A.'        17 
2       'Busch, J.L.H.'       18 
2       'Dhawan, I.K.'        19 
2       'Rose, J.P.'          20 
2       'Wang, B.C.'          21 
2       'Dailey, H.A.'        22 
# 
_cell.entry_id           2PO5 
_cell.length_a           93.420 
_cell.length_b           87.730 
_cell.length_c           109.580 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2PO5 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ferrochelatase, mitochondrial' 41099.344 2   4.99.1.1 'R115L, H263C' 'Mature Protein' ? 
2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'    175.820   2   ?        ?              ?                ? 
3 non-polymer syn 'CHOLIC ACID'                   408.571   6   ?        ?              ?                ? 
4 water       nat water                           18.015    308 ?        ?              ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protoheme ferro-lyase; Heme synthetase' 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.4.99.1.1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMV
KLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTI
DRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSACSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSK
VGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADL
VHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMV
KLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTI
DRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSACSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSK
VGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADL
VHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   LYS n 
1 3   PRO n 
1 4   LYS n 
1 5   THR n 
1 6   GLY n 
1 7   ILE n 
1 8   LEU n 
1 9   MET n 
1 10  LEU n 
1 11  ASN n 
1 12  MET n 
1 13  GLY n 
1 14  GLY n 
1 15  PRO n 
1 16  GLU n 
1 17  THR n 
1 18  LEU n 
1 19  GLY n 
1 20  ASP n 
1 21  VAL n 
1 22  HIS n 
1 23  ASP n 
1 24  PHE n 
1 25  LEU n 
1 26  LEU n 
1 27  ARG n 
1 28  LEU n 
1 29  PHE n 
1 30  LEU n 
1 31  ASP n 
1 32  ARG n 
1 33  ASP n 
1 34  LEU n 
1 35  MET n 
1 36  THR n 
1 37  LEU n 
1 38  PRO n 
1 39  ILE n 
1 40  GLN n 
1 41  ASN n 
1 42  LYS n 
1 43  LEU n 
1 44  ALA n 
1 45  PRO n 
1 46  PHE n 
1 47  ILE n 
1 48  ALA n 
1 49  LYS n 
1 50  ARG n 
1 51  LEU n 
1 52  THR n 
1 53  PRO n 
1 54  LYS n 
1 55  ILE n 
1 56  GLN n 
1 57  GLU n 
1 58  GLN n 
1 59  TYR n 
1 60  ARG n 
1 61  ARG n 
1 62  ILE n 
1 63  GLY n 
1 64  GLY n 
1 65  GLY n 
1 66  SER n 
1 67  PRO n 
1 68  ILE n 
1 69  LYS n 
1 70  ILE n 
1 71  TRP n 
1 72  THR n 
1 73  SER n 
1 74  LYS n 
1 75  GLN n 
1 76  GLY n 
1 77  GLU n 
1 78  GLY n 
1 79  MET n 
1 80  VAL n 
1 81  LYS n 
1 82  LEU n 
1 83  LEU n 
1 84  ASP n 
1 85  GLU n 
1 86  LEU n 
1 87  SER n 
1 88  PRO n 
1 89  ASN n 
1 90  THR n 
1 91  ALA n 
1 92  PRO n 
1 93  HIS n 
1 94  LYS n 
1 95  TYR n 
1 96  TYR n 
1 97  ILE n 
1 98  GLY n 
1 99  PHE n 
1 100 ARG n 
1 101 TYR n 
1 102 VAL n 
1 103 HIS n 
1 104 PRO n 
1 105 LEU n 
1 106 THR n 
1 107 GLU n 
1 108 GLU n 
1 109 ALA n 
1 110 ILE n 
1 111 GLU n 
1 112 GLU n 
1 113 MET n 
1 114 GLU n 
1 115 ARG n 
1 116 ASP n 
1 117 GLY n 
1 118 LEU n 
1 119 GLU n 
1 120 ARG n 
1 121 ALA n 
1 122 ILE n 
1 123 ALA n 
1 124 PHE n 
1 125 THR n 
1 126 GLN n 
1 127 TYR n 
1 128 PRO n 
1 129 GLN n 
1 130 TYR n 
1 131 SER n 
1 132 CYS n 
1 133 SER n 
1 134 THR n 
1 135 THR n 
1 136 GLY n 
1 137 SER n 
1 138 SER n 
1 139 LEU n 
1 140 ASN n 
1 141 ALA n 
1 142 ILE n 
1 143 TYR n 
1 144 ARG n 
1 145 TYR n 
1 146 TYR n 
1 147 ASN n 
1 148 GLN n 
1 149 VAL n 
1 150 GLY n 
1 151 ARG n 
1 152 LYS n 
1 153 PRO n 
1 154 THR n 
1 155 MET n 
1 156 LYS n 
1 157 TRP n 
1 158 SER n 
1 159 THR n 
1 160 ILE n 
1 161 ASP n 
1 162 ARG n 
1 163 TRP n 
1 164 PRO n 
1 165 THR n 
1 166 HIS n 
1 167 HIS n 
1 168 LEU n 
1 169 LEU n 
1 170 ILE n 
1 171 GLN n 
1 172 CYS n 
1 173 PHE n 
1 174 ALA n 
1 175 ASP n 
1 176 HIS n 
1 177 ILE n 
1 178 LEU n 
1 179 LYS n 
1 180 GLU n 
1 181 LEU n 
1 182 ASP n 
1 183 HIS n 
1 184 PHE n 
1 185 PRO n 
1 186 LEU n 
1 187 GLU n 
1 188 LYS n 
1 189 ARG n 
1 190 SER n 
1 191 GLU n 
1 192 VAL n 
1 193 VAL n 
1 194 ILE n 
1 195 LEU n 
1 196 PHE n 
1 197 SER n 
1 198 ALA n 
1 199 CYS n 
1 200 SER n 
1 201 LEU n 
1 202 PRO n 
1 203 MET n 
1 204 SER n 
1 205 VAL n 
1 206 VAL n 
1 207 ASN n 
1 208 ARG n 
1 209 GLY n 
1 210 ASP n 
1 211 PRO n 
1 212 TYR n 
1 213 PRO n 
1 214 GLN n 
1 215 GLU n 
1 216 VAL n 
1 217 SER n 
1 218 ALA n 
1 219 THR n 
1 220 VAL n 
1 221 GLN n 
1 222 LYS n 
1 223 VAL n 
1 224 MET n 
1 225 GLU n 
1 226 ARG n 
1 227 LEU n 
1 228 GLU n 
1 229 TYR n 
1 230 CYS n 
1 231 ASN n 
1 232 PRO n 
1 233 TYR n 
1 234 ARG n 
1 235 LEU n 
1 236 VAL n 
1 237 TRP n 
1 238 GLN n 
1 239 SER n 
1 240 LYS n 
1 241 VAL n 
1 242 GLY n 
1 243 PRO n 
1 244 MET n 
1 245 PRO n 
1 246 TRP n 
1 247 LEU n 
1 248 GLY n 
1 249 PRO n 
1 250 GLN n 
1 251 THR n 
1 252 ASP n 
1 253 GLU n 
1 254 SER n 
1 255 ILE n 
1 256 LYS n 
1 257 GLY n 
1 258 LEU n 
1 259 CYS n 
1 260 GLU n 
1 261 ARG n 
1 262 GLY n 
1 263 ARG n 
1 264 LYS n 
1 265 ASN n 
1 266 ILE n 
1 267 LEU n 
1 268 LEU n 
1 269 VAL n 
1 270 PRO n 
1 271 ILE n 
1 272 ALA n 
1 273 PHE n 
1 274 THR n 
1 275 SER n 
1 276 ASP n 
1 277 HIS n 
1 278 ILE n 
1 279 GLU n 
1 280 THR n 
1 281 LEU n 
1 282 TYR n 
1 283 GLU n 
1 284 LEU n 
1 285 ASP n 
1 286 ILE n 
1 287 GLU n 
1 288 TYR n 
1 289 SER n 
1 290 GLN n 
1 291 VAL n 
1 292 LEU n 
1 293 ALA n 
1 294 LYS n 
1 295 GLU n 
1 296 CYS n 
1 297 GLY n 
1 298 VAL n 
1 299 GLU n 
1 300 ASN n 
1 301 ILE n 
1 302 ARG n 
1 303 ARG n 
1 304 ALA n 
1 305 GLU n 
1 306 SER n 
1 307 LEU n 
1 308 ASN n 
1 309 GLY n 
1 310 ASN n 
1 311 PRO n 
1 312 LEU n 
1 313 PHE n 
1 314 SER n 
1 315 LYS n 
1 316 ALA n 
1 317 LEU n 
1 318 ALA n 
1 319 ASP n 
1 320 LEU n 
1 321 VAL n 
1 322 HIS n 
1 323 SER n 
1 324 HIS n 
1 325 ILE n 
1 326 GLN n 
1 327 SER n 
1 328 ASN n 
1 329 GLU n 
1 330 LEU n 
1 331 CYS n 
1 332 SER n 
1 333 LYS n 
1 334 GLN n 
1 335 LEU n 
1 336 THR n 
1 337 LEU n 
1 338 SER n 
1 339 CYS n 
1 340 PRO n 
1 341 LEU n 
1 342 CYS n 
1 343 VAL n 
1 344 ASN n 
1 345 PRO n 
1 346 VAL n 
1 347 CYS n 
1 348 ARG n 
1 349 GLU n 
1 350 THR n 
1 351 LYS n 
1 352 SER n 
1 353 PHE n 
1 354 PHE n 
1 355 THR n 
1 356 SER n 
1 357 GLN n 
1 358 GLN n 
1 359 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 FECH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               JM109 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PHDTF20 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HEMH_HUMAN 
_struct_ref.pdbx_db_accession          P22830 
_struct_ref.pdbx_align_begin           65 
_struct_ref.pdbx_seq_one_letter_code   
;RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMV
KLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTI
DRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSK
VGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADL
VHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2PO5 A 1 ? 359 ? P22830 65 ? 423 ? 65 423 
2 1 2PO5 B 1 ? 359 ? P22830 65 ? 423 ? 65 423 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2PO5 LEU A 51  ? UNP P22830 ARG 115 ENGINEERED 115 1 
1 2PO5 CYS A 199 ? UNP P22830 HIS 263 ENGINEERED 263 2 
2 2PO5 LEU B 51  ? UNP P22830 ARG 115 ENGINEERED 115 3 
2 2PO5 CYS B 199 ? UNP P22830 HIS 263 ENGINEERED 263 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'     133.103 
CHD non-polymer         . 'CHOLIC ACID'                ? 'C24 H40 O5'     408.571 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'   121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2'         175.820 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                        ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2PO5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.73 
_exptl_crystal.density_percent_sol   54.94 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    
;CRYSTALS WERE GROWN BY HANGING DROP VAPOR DIFFUSION USING 2 MICROLITER DROPS CONTAINING EQUAL VOLUMES OF PROTEIN SOLUTION (50 MG/ML IN 50 MM TRIS MOPS, 0.1M KCL, 1% NA- CHOLATE, 250 MM IMIDAZOLE, PH 8.1) AND PRECIPITANT SOLUTION (0.1 M HEPES PH 7.5, 0.2 M AMMONIUM SULFATE, 34% PEG 400, 0.1 M SODIUM PHOSPHATE)., pH 7.50, VAPOR DIFFUSION, HANGING DROP, temperature 291K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2001-06-25 
_diffrn_detector.details                'RIGAKU BLUE CONFOCAL' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'RIGAKU BLUE CONFOCAL Optics' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     2PO5 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   45450 
_reflns.number_all                   45450 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.065 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 2PO5 
_refine.ls_number_reflns_obs                     44652 
_refine.ls_number_reflns_all                     44652 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.90 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_R_factor_obs                          0.209 
_refine.ls_R_factor_all                          0.209 
_refine.ls_R_factor_R_work                       0.209 
_refine.ls_R_factor_R_free                       0.24 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.80 
_refine.ls_number_reflns_R_free                  2247 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            7.947 
_refine.aniso_B[2][2]                            1.87 
_refine.aniso_B[3][3]                            -9.534 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.38 
_refine.solvent_model_param_bsol                 36.33 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'DIFFERENCE FOURIER' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5702 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         182 
_refine_hist.number_atoms_solvent             308 
_refine_hist.number_atoms_total               6192 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        19.90 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.211 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   2 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.242 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.272 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:PROTEIN_REP.PARAM ? 'X-RAY DIFFRACTION' 
2 WATER_REP.PARA               ? 'X-RAY DIFFRACTION' 
3 CHLOATE.PAR                  ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2PO5 
_struct.title                     'Crystal structure of human ferrochelatase mutant with His 263 replaced by Cys' 
_struct.pdbx_descriptor           'Ferrochelatase, mitochondrial (E.C.4.99.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PO5 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            
;FERROCHELATASE; H263C; FE2S2 CLUSTER; HEME BIOSYNTHESIS; PROTOHEME; FERRO-LYASE; MATURE LENGTH; PROTEOLYTICALLY PROCESSED MITOCHONDRIAL INNER MEMBRANE PROTEIN, LYASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 17  ? GLY A 19  ? THR A 81  GLY A 83  5 ? 3  
HELX_P HELX_P2  2  ASP A 20  ? LEU A 30  ? ASP A 84  LEU A 94  1 ? 11 
HELX_P HELX_P3  3  ILE A 39  ? ILE A 62  ? ILE A 103 ILE A 126 1 ? 24 
HELX_P HELX_P4  4  PRO A 67  ? SER A 87  ? PRO A 131 SER A 151 1 ? 21 
HELX_P HELX_P5  5  PRO A 88  ? ALA A 91  ? PRO A 152 ALA A 155 5 ? 4  
HELX_P HELX_P6  6  LEU A 105 ? ASP A 116 ? LEU A 169 ASP A 180 1 ? 12 
HELX_P HELX_P7  7  THR A 134 ? GLY A 150 ? THR A 198 GLY A 214 1 ? 17 
HELX_P HELX_P8  8  HIS A 166 ? ASP A 182 ? HIS A 230 ASP A 246 1 ? 17 
HELX_P HELX_P9  9  HIS A 183 ? PHE A 184 ? HIS A 247 PHE A 248 5 ? 2  
HELX_P HELX_P10 10 PRO A 185 ? VAL A 192 ? PRO A 249 VAL A 256 5 ? 8  
HELX_P HELX_P11 11 PRO A 202 ? ASN A 207 ? PRO A 266 ASN A 271 1 ? 6  
HELX_P HELX_P12 12 PRO A 211 ? LEU A 227 ? PRO A 275 LEU A 291 1 ? 17 
HELX_P HELX_P13 13 GLN A 250 ? ARG A 261 ? GLN A 314 ARG A 325 1 ? 12 
HELX_P HELX_P14 14 HIS A 277 ? TYR A 282 ? HIS A 341 TYR A 346 1 ? 6  
HELX_P HELX_P15 15 GLN A 290 ? GLY A 297 ? GLN A 354 GLY A 361 1 ? 8  
HELX_P HELX_P16 16 ASN A 310 ? ASN A 328 ? ASN A 374 ASN A 392 1 ? 19 
HELX_P HELX_P17 17 SER A 332 ? LEU A 337 ? SER A 396 LEU A 401 5 ? 6  
HELX_P HELX_P18 18 PRO A 345 ? SER A 356 ? PRO A 409 SER A 420 1 ? 12 
HELX_P HELX_P19 19 THR B 17  ? GLY B 19  ? THR B 81  GLY B 83  5 ? 3  
HELX_P HELX_P20 20 ASP B 20  ? LEU B 30  ? ASP B 84  LEU B 94  1 ? 11 
HELX_P HELX_P21 21 ILE B 39  ? ILE B 62  ? ILE B 103 ILE B 126 1 ? 24 
HELX_P HELX_P22 22 PRO B 67  ? SER B 87  ? PRO B 131 SER B 151 1 ? 21 
HELX_P HELX_P23 23 PRO B 88  ? ALA B 91  ? PRO B 152 ALA B 155 5 ? 4  
HELX_P HELX_P24 24 LEU B 105 ? ASP B 116 ? LEU B 169 ASP B 180 1 ? 12 
HELX_P HELX_P25 25 THR B 134 ? GLY B 150 ? THR B 198 GLY B 214 1 ? 17 
HELX_P HELX_P26 26 HIS B 166 ? ASP B 182 ? HIS B 230 ASP B 246 1 ? 17 
HELX_P HELX_P27 27 HIS B 183 ? PHE B 184 ? HIS B 247 PHE B 248 5 ? 2  
HELX_P HELX_P28 28 PRO B 185 ? VAL B 192 ? PRO B 249 VAL B 256 5 ? 8  
HELX_P HELX_P29 29 PRO B 202 ? ASN B 207 ? PRO B 266 ASN B 271 1 ? 6  
HELX_P HELX_P30 30 PRO B 211 ? LEU B 227 ? PRO B 275 LEU B 291 1 ? 17 
HELX_P HELX_P31 31 GLN B 250 ? ARG B 261 ? GLN B 314 ARG B 325 1 ? 12 
HELX_P HELX_P32 32 HIS B 277 ? TYR B 282 ? HIS B 341 TYR B 346 1 ? 6  
HELX_P HELX_P33 33 GLN B 290 ? GLY B 297 ? GLN B 354 GLY B 361 1 ? 8  
HELX_P HELX_P34 34 ASN B 310 ? ASN B 328 ? ASN B 374 ASN B 392 1 ? 19 
HELX_P HELX_P35 35 SER B 332 ? LEU B 337 ? SER B 396 LEU B 401 5 ? 6  
HELX_P HELX_P36 36 PRO B 345 ? SER B 356 ? PRO B 409 SER B 420 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 132 SG ? ? ? 1_555 C FES . FE2 ? ? A CYS 196 A FES 499 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc2 metalc ? ? A CYS 339 SG ? ? ? 1_555 C FES . FE2 ? ? A CYS 403 A FES 499 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc3 metalc ? ? A CYS 342 SG ? ? ? 1_555 C FES . FE1 ? ? A CYS 406 A FES 499 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc4 metalc ? ? A CYS 347 SG ? ? ? 1_555 C FES . FE1 ? ? A CYS 411 A FES 499 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc5 metalc ? ? B CYS 132 SG ? ? ? 1_555 G FES . FE1 ? ? B CYS 196 B FES 999 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc6 metalc ? ? B CYS 339 SG ? ? ? 1_555 G FES . FE1 ? ? B CYS 403 B FES 999 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc7 metalc ? ? B CYS 342 SG ? ? ? 1_555 G FES . FE2 ? ? B CYS 406 B FES 999 1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc8 metalc ? ? B CYS 347 SG ? ? ? 1_555 G FES . FE2 ? ? B CYS 411 B FES 999 1_555 ? ? ? ? ? ? ? 2.416 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 91  A . ? ALA 155 A PRO 92  A ? PRO 156 A 1 -0.03 
2 HIS 103 A . ? HIS 167 A PRO 104 A ? PRO 168 A 1 -0.40 
3 GLY 248 A . ? GLY 312 A PRO 249 A ? PRO 313 A 1 -0.05 
4 ALA 91  B . ? ALA 155 B PRO 92  B ? PRO 156 B 1 -0.20 
5 HIS 103 B . ? HIS 167 B PRO 104 B ? PRO 168 B 1 -0.33 
6 GLY 248 B . ? GLY 312 B PRO 249 B ? PRO 313 B 1 -0.10 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
C 1 2 ? parallel 
C 2 3 ? parallel 
C 3 4 ? parallel 
D 1 2 ? parallel 
D 2 3 ? parallel 
D 3 4 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 93  ? PHE A 99  ? HIS A 157 PHE A 163 
A 2 THR A 5   ? ASN A 11  ? THR A 69  ASN A 75  
A 3 ARG A 120 ? THR A 125 ? ARG A 184 THR A 189 
A 4 LYS A 156 ? ILE A 160 ? LYS A 220 ILE A 224 
B 1 TYR A 233 ? GLN A 238 ? TYR A 297 GLN A 302 
B 2 VAL A 193 ? CYS A 199 ? VAL A 257 CYS A 263 
B 3 ASN A 265 ? PRO A 270 ? ASN A 329 PRO A 334 
B 4 ASN A 300 ? ARG A 303 ? ASN A 364 ARG A 367 
C 1 HIS B 93  ? PHE B 99  ? HIS B 157 PHE B 163 
C 2 THR B 5   ? ASN B 11  ? THR B 69  ASN B 75  
C 3 ARG B 120 ? THR B 125 ? ARG B 184 THR B 189 
C 4 LYS B 156 ? ILE B 160 ? LYS B 220 ILE B 224 
D 1 TYR B 233 ? GLN B 238 ? TYR B 297 GLN B 302 
D 2 VAL B 193 ? CYS B 199 ? VAL B 257 CYS B 263 
D 3 ASN B 265 ? VAL B 269 ? ASN B 329 VAL B 333 
D 4 ASN B 300 ? ARG B 303 ? ASN B 364 ARG B 367 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 96  ? O TYR A 160 N MET A 9   ? N MET A 73  
A 2 3 N GLY A 6   ? N GLY A 70  O ARG A 120 ? O ARG A 184 
A 3 4 N ALA A 123 ? N ALA A 187 O SER A 158 ? O SER A 222 
B 1 2 O VAL A 236 ? O VAL A 300 N PHE A 196 ? N PHE A 260 
B 2 3 N SER A 197 ? N SER A 261 O VAL A 269 ? O VAL A 333 
B 3 4 N LEU A 268 ? N LEU A 332 O ARG A 302 ? O ARG A 366 
C 1 2 O TYR B 96  ? O TYR B 160 N MET B 9   ? N MET B 73  
C 2 3 N GLY B 6   ? N GLY B 70  O ARG B 120 ? O ARG B 184 
C 3 4 N ALA B 123 ? N ALA B 187 O SER B 158 ? O SER B 222 
D 1 2 O VAL B 236 ? O VAL B 300 N PHE B 196 ? N PHE B 260 
D 2 3 N LEU B 195 ? N LEU B 259 O LEU B 267 ? O LEU B 331 
D 3 4 N LEU B 268 ? N LEU B 332 O ARG B 302 ? O ARG B 366 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FES A 499' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FES B 999' 
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CHD A 501' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CHD A 502' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CHD A 503' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CHD B 501' 
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CHD B 502' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CHD B 503' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  CYS A 132 ? CYS A 196 . ? 1_555 ? 
2  AC1 6  ARG A 208 ? ARG A 272 . ? 1_555 ? 
3  AC1 6  CYS A 339 ? CYS A 403 . ? 1_555 ? 
4  AC1 6  CYS A 342 ? CYS A 406 . ? 1_555 ? 
5  AC1 6  CYS A 347 ? CYS A 411 . ? 1_555 ? 
6  AC1 6  HOH K .   ? HOH A 516 . ? 1_555 ? 
7  AC2 5  CYS B 132 ? CYS B 196 . ? 1_555 ? 
8  AC2 5  ARG B 208 ? ARG B 272 . ? 1_555 ? 
9  AC2 5  CYS B 339 ? CYS B 403 . ? 1_555 ? 
10 AC2 5  CYS B 342 ? CYS B 406 . ? 1_555 ? 
11 AC2 5  CYS B 347 ? CYS B 411 . ? 1_555 ? 
12 AC3 15 MET A 12  ? MET A 76  . ? 1_555 ? 
13 AC3 15 LEU A 28  ? LEU A 92  . ? 1_555 ? 
14 AC3 15 PHE A 29  ? PHE A 93  . ? 1_555 ? 
15 AC3 15 LEU A 34  ? LEU A 98  . ? 1_555 ? 
16 AC3 15 MET A 35  ? MET A 99  . ? 1_555 ? 
17 AC3 15 SER A 133 ? SER A 197 . ? 1_555 ? 
18 AC3 15 LEU A 201 ? LEU A 265 . ? 1_555 ? 
19 AC3 15 PRO A 202 ? PRO A 266 . ? 1_555 ? 
20 AC3 15 VAL A 205 ? VAL A 269 . ? 1_555 ? 
21 AC3 15 VAL A 241 ? VAL A 305 . ? 1_555 ? 
22 AC3 15 TRP A 246 ? TRP A 310 . ? 1_555 ? 
23 AC3 15 CHD E .   ? CHD A 502 . ? 1_555 ? 
24 AC3 15 HOH K .   ? HOH A 616 . ? 1_555 ? 
25 AC3 15 HOH K .   ? HOH A 654 . ? 1_555 ? 
26 AC3 15 HOH K .   ? HOH A 660 . ? 1_555 ? 
27 AC4 8  MET A 35  ? MET A 99  . ? 1_555 ? 
28 AC4 8  ARG A 50  ? ARG A 114 . ? 1_555 ? 
29 AC4 8  LEU A 51  ? LEU A 115 . ? 1_555 ? 
30 AC4 8  PRO A 202 ? PRO A 266 . ? 1_555 ? 
31 AC4 8  VAL A 241 ? VAL A 305 . ? 1_555 ? 
32 AC4 8  MET A 244 ? MET A 308 . ? 1_555 ? 
33 AC4 8  CHD D .   ? CHD A 501 . ? 1_555 ? 
34 AC4 8  CHD F .   ? CHD A 503 . ? 1_555 ? 
35 AC5 3  CHD E .   ? CHD A 502 . ? 1_555 ? 
36 AC5 3  LEU B 43  ? LEU B 107 . ? 3_554 ? 
37 AC5 3  PHE B 46  ? PHE B 110 . ? 3_554 ? 
38 AC6 10 LEU B 28  ? LEU B 92  . ? 1_555 ? 
39 AC6 10 PHE B 29  ? PHE B 93  . ? 1_555 ? 
40 AC6 10 LEU B 34  ? LEU B 98  . ? 1_555 ? 
41 AC6 10 MET B 35  ? MET B 99  . ? 1_555 ? 
42 AC6 10 SER B 133 ? SER B 197 . ? 1_555 ? 
43 AC6 10 LEU B 201 ? LEU B 265 . ? 1_555 ? 
44 AC6 10 VAL B 205 ? VAL B 269 . ? 1_555 ? 
45 AC6 10 VAL B 241 ? VAL B 305 . ? 1_555 ? 
46 AC6 10 TRP B 246 ? TRP B 310 . ? 1_555 ? 
47 AC6 10 CHD I .   ? CHD B 502 . ? 1_555 ? 
48 AC7 6  ARG B 50  ? ARG B 114 . ? 1_555 ? 
49 AC7 6  PRO B 202 ? PRO B 266 . ? 1_555 ? 
50 AC7 6  GLY B 242 ? GLY B 306 . ? 1_555 ? 
51 AC7 6  MET B 244 ? MET B 308 . ? 1_555 ? 
52 AC7 6  CHD H .   ? CHD B 501 . ? 1_555 ? 
53 AC7 6  CHD J .   ? CHD B 503 . ? 1_555 ? 
54 AC8 4  PHE A 46  ? PHE A 110 . ? 3_544 ? 
55 AC8 4  LEU B 37  ? LEU B 101 . ? 1_555 ? 
56 AC8 4  PRO B 38  ? PRO B 102 . ? 1_555 ? 
57 AC8 4  CHD I .   ? CHD B 502 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2PO5 
_atom_sites.fract_transf_matrix[1][1]   0.010704 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011399 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009126 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ARG A 1 1   ? -3.204  39.629  22.770  1.00 43.05 ? 65   ARG A N   1 
ATOM   2    C  CA  . ARG A 1 1   ? -4.305  39.686  21.764  1.00 43.44 ? 65   ARG A CA  1 
ATOM   3    C  C   . ARG A 1 1   ? -3.773  39.407  20.359  1.00 42.86 ? 65   ARG A C   1 
ATOM   4    O  O   . ARG A 1 1   ? -4.294  38.544  19.655  1.00 43.72 ? 65   ARG A O   1 
ATOM   5    C  CB  . ARG A 1 1   ? -4.992  41.060  21.808  1.00 43.37 ? 65   ARG A CB  1 
ATOM   6    N  N   . LYS A 1 2   ? -2.740  40.136  19.952  1.00 41.62 ? 66   LYS A N   1 
ATOM   7    C  CA  . LYS A 1 2   ? -2.155  39.939  18.628  1.00 40.00 ? 66   LYS A CA  1 
ATOM   8    C  C   . LYS A 1 2   ? -1.648  38.504  18.502  1.00 38.36 ? 66   LYS A C   1 
ATOM   9    O  O   . LYS A 1 2   ? -1.006  37.982  19.412  1.00 37.04 ? 66   LYS A O   1 
ATOM   10   C  CB  . LYS A 1 2   ? -1.008  40.923  18.405  1.00 40.23 ? 66   LYS A CB  1 
ATOM   11   N  N   . PRO A 1 3   ? -1.926  37.851  17.363  1.00 37.06 ? 67   PRO A N   1 
ATOM   12   C  CA  . PRO A 1 3   ? -1.497  36.468  17.122  1.00 35.82 ? 67   PRO A CA  1 
ATOM   13   C  C   . PRO A 1 3   ? 0.017   36.263  17.161  1.00 34.18 ? 67   PRO A C   1 
ATOM   14   O  O   . PRO A 1 3   ? 0.781   37.053  16.610  1.00 35.10 ? 67   PRO A O   1 
ATOM   15   C  CB  . PRO A 1 3   ? -2.091  36.162  15.749  1.00 36.28 ? 67   PRO A CB  1 
ATOM   16   C  CG  . PRO A 1 3   ? -2.047  37.502  15.074  1.00 37.02 ? 67   PRO A CG  1 
ATOM   17   C  CD  . PRO A 1 3   ? -2.562  38.416  16.160  1.00 36.45 ? 67   PRO A CD  1 
ATOM   18   N  N   . LYS A 1 4   ? 0.441   35.189  17.815  1.00 32.16 ? 68   LYS A N   1 
ATOM   19   C  CA  . LYS A 1 4   ? 1.855   34.871  17.931  1.00 31.23 ? 68   LYS A CA  1 
ATOM   20   C  C   . LYS A 1 4   ? 2.244   33.680  17.055  1.00 29.72 ? 68   LYS A C   1 
ATOM   21   O  O   . LYS A 1 4   ? 3.243   33.722  16.341  1.00 28.42 ? 68   LYS A O   1 
ATOM   22   C  CB  . LYS A 1 4   ? 2.194   34.558  19.388  1.00 33.46 ? 68   LYS A CB  1 
ATOM   23   C  CG  . LYS A 1 4   ? 3.648   34.181  19.609  1.00 36.16 ? 68   LYS A CG  1 
ATOM   24   C  CD  . LYS A 1 4   ? 3.906   33.773  21.049  1.00 37.49 ? 68   LYS A CD  1 
ATOM   25   C  CE  . LYS A 1 4   ? 3.693   34.930  22.013  1.00 39.29 ? 68   LYS A CE  1 
ATOM   26   N  NZ  . LYS A 1 4   ? 4.038   34.538  23.413  1.00 41.58 ? 68   LYS A NZ  1 
ATOM   27   N  N   . THR A 1 5   ? 1.442   32.622  17.121  1.00 28.29 ? 69   THR A N   1 
ATOM   28   C  CA  . THR A 1 5   ? 1.689   31.403  16.363  1.00 26.21 ? 69   THR A CA  1 
ATOM   29   C  C   . THR A 1 5   ? 0.592   31.159  15.334  1.00 25.41 ? 69   THR A C   1 
ATOM   30   O  O   . THR A 1 5   ? -0.587  31.036  15.679  1.00 24.52 ? 69   THR A O   1 
ATOM   31   C  CB  . THR A 1 5   ? 1.754   30.180  17.302  1.00 26.27 ? 69   THR A CB  1 
ATOM   32   O  OG1 . THR A 1 5   ? 2.800   30.372  18.261  1.00 25.66 ? 69   THR A OG1 1 
ATOM   33   C  CG2 . THR A 1 5   ? 2.018   28.904  16.514  1.00 25.72 ? 69   THR A CG2 1 
ATOM   34   N  N   . GLY A 1 6   ? 0.985   31.094  14.070  1.00 23.22 ? 70   GLY A N   1 
ATOM   35   C  CA  . GLY A 1 6   ? 0.019   30.853  13.017  1.00 22.20 ? 70   GLY A CA  1 
ATOM   36   C  C   . GLY A 1 6   ? 0.129   29.435  12.490  1.00 21.42 ? 70   GLY A C   1 
ATOM   37   O  O   . GLY A 1 6   ? 1.228   28.905  12.314  1.00 22.09 ? 70   GLY A O   1 
ATOM   38   N  N   . ILE A 1 7   ? -1.016  28.807  12.261  1.00 19.84 ? 71   ILE A N   1 
ATOM   39   C  CA  . ILE A 1 7   ? -1.052  27.454  11.734  1.00 18.84 ? 71   ILE A CA  1 
ATOM   40   C  C   . ILE A 1 7   ? -1.731  27.525  10.368  1.00 18.35 ? 71   ILE A C   1 
ATOM   41   O  O   . ILE A 1 7   ? -2.937  27.770  10.272  1.00 17.84 ? 71   ILE A O   1 
ATOM   42   C  CB  . ILE A 1 7   ? -1.847  26.496  12.662  1.00 20.03 ? 71   ILE A CB  1 
ATOM   43   C  CG1 . ILE A 1 7   ? -1.212  26.448  14.055  1.00 22.30 ? 71   ILE A CG1 1 
ATOM   44   C  CG2 . ILE A 1 7   ? -1.857  25.096  12.081  1.00 19.25 ? 71   ILE A CG2 1 
ATOM   45   C  CD1 . ILE A 1 7   ? -1.564  27.624  14.945  1.00 24.05 ? 71   ILE A CD1 1 
ATOM   46   N  N   . LEU A 1 8   ? -0.937  27.347  9.318   1.00 17.02 ? 72   LEU A N   1 
ATOM   47   C  CA  . LEU A 1 8   ? -1.430  27.384  7.951   1.00 17.80 ? 72   LEU A CA  1 
ATOM   48   C  C   . LEU A 1 8   ? -1.939  26.001  7.553   1.00 17.17 ? 72   LEU A C   1 
ATOM   49   O  O   . LEU A 1 8   ? -1.154  25.075  7.360   1.00 16.48 ? 72   LEU A O   1 
ATOM   50   C  CB  . LEU A 1 8   ? -0.306  27.811  7.002   1.00 16.90 ? 72   LEU A CB  1 
ATOM   51   C  CG  . LEU A 1 8   ? -0.668  27.860  5.521   1.00 15.94 ? 72   LEU A CG  1 
ATOM   52   C  CD1 . LEU A 1 8   ? -1.746  28.914  5.296   1.00 15.36 ? 72   LEU A CD1 1 
ATOM   53   C  CD2 . LEU A 1 8   ? 0.577   28.168  4.704   1.00 16.44 ? 72   LEU A CD2 1 
ATOM   54   N  N   . MET A 1 9   ? -3.256  25.867  7.440   1.00 17.51 ? 73   MET A N   1 
ATOM   55   C  CA  . MET A 1 9   ? -3.859  24.590  7.077   1.00 17.60 ? 73   MET A CA  1 
ATOM   56   C  C   . MET A 1 9   ? -3.874  24.445  5.558   1.00 18.28 ? 73   MET A C   1 
ATOM   57   O  O   . MET A 1 9   ? -4.588  25.159  4.851   1.00 18.87 ? 73   MET A O   1 
ATOM   58   C  CB  . MET A 1 9   ? -5.264  24.508  7.662   1.00 18.27 ? 73   MET A CB  1 
ATOM   59   C  CG  . MET A 1 9   ? -5.271  24.627  9.187   1.00 22.71 ? 73   MET A CG  1 
ATOM   60   S  SD  . MET A 1 9   ? -6.936  24.604  9.891   1.00 29.58 ? 73   MET A SD  1 
ATOM   61   C  CE  . MET A 1 9   ? -7.306  22.828  9.779   1.00 21.98 ? 73   MET A CE  1 
ATOM   62   N  N   . LEU A 1 10  ? -3.063  23.512  5.072   1.00 17.57 ? 74   LEU A N   1 
ATOM   63   C  CA  . LEU A 1 10  ? -2.913  23.268  3.646   1.00 18.23 ? 74   LEU A CA  1 
ATOM   64   C  C   . LEU A 1 10  ? -3.811  22.179  3.096   1.00 19.04 ? 74   LEU A C   1 
ATOM   65   O  O   . LEU A 1 10  ? -3.855  21.056  3.608   1.00 18.59 ? 74   LEU A O   1 
ATOM   66   C  CB  . LEU A 1 10  ? -1.455  22.920  3.344   1.00 15.25 ? 74   LEU A CB  1 
ATOM   67   C  CG  . LEU A 1 10  ? -0.467  23.997  3.801   1.00 17.32 ? 74   LEU A CG  1 
ATOM   68   C  CD1 . LEU A 1 10  ? 0.947   23.429  3.841   1.00 16.95 ? 74   LEU A CD1 1 
ATOM   69   C  CD2 . LEU A 1 10  ? -0.562  25.193  2.864   1.00 15.35 ? 74   LEU A CD2 1 
ATOM   70   N  N   . ASN A 1 11  ? -4.513  22.518  2.026   1.00 20.42 ? 75   ASN A N   1 
ATOM   71   C  CA  . ASN A 1 11  ? -5.404  21.577  1.383   1.00 21.78 ? 75   ASN A CA  1 
ATOM   72   C  C   . ASN A 1 11  ? -5.570  22.035  -0.059  1.00 21.06 ? 75   ASN A C   1 
ATOM   73   O  O   . ASN A 1 11  ? -5.349  23.202  -0.373  1.00 17.99 ? 75   ASN A O   1 
ATOM   74   C  CB  . ASN A 1 11  ? -6.750  21.559  2.115   1.00 25.17 ? 75   ASN A CB  1 
ATOM   75   C  CG  . ASN A 1 11  ? -7.652  20.437  1.650   1.00 28.31 ? 75   ASN A CG  1 
ATOM   76   O  OD1 . ASN A 1 11  ? -8.160  20.457  0.529   1.00 32.43 ? 75   ASN A OD1 1 
ATOM   77   N  ND2 . ASN A 1 11  ? -7.855  19.447  2.510   1.00 29.50 ? 75   ASN A ND2 1 
ATOM   78   N  N   . MET A 1 12  ? -5.935  21.110  -0.935  1.00 22.49 ? 76   MET A N   1 
ATOM   79   C  CA  . MET A 1 12  ? -6.130  21.429  -2.343  1.00 25.09 ? 76   MET A CA  1 
ATOM   80   C  C   . MET A 1 12  ? -7.213  22.489  -2.476  1.00 23.51 ? 76   MET A C   1 
ATOM   81   O  O   . MET A 1 12  ? -7.094  23.427  -3.267  1.00 22.22 ? 76   MET A O   1 
ATOM   82   C  CB  . MET A 1 12  ? -6.547  20.175  -3.115  1.00 26.69 ? 76   MET A CB  1 
ATOM   83   C  CG  . MET A 1 12  ? -7.115  20.453  -4.492  1.00 35.37 ? 76   MET A CG  1 
ATOM   84   S  SD  . MET A 1 12  ? -7.746  18.971  -5.337  1.00 38.75 ? 76   MET A SD  1 
ATOM   85   C  CE  . MET A 1 12  ? -6.277  18.526  -6.297  1.00 42.07 ? 76   MET A CE  1 
ATOM   86   N  N   . GLY A 1 13  ? -8.259  22.336  -1.675  1.00 22.33 ? 77   GLY A N   1 
ATOM   87   C  CA  . GLY A 1 13  ? -9.365  23.263  -1.722  1.00 24.50 ? 77   GLY A CA  1 
ATOM   88   C  C   . GLY A 1 13  ? -10.365 22.788  -2.760  1.00 23.92 ? 77   GLY A C   1 
ATOM   89   O  O   . GLY A 1 13  ? -10.127 21.808  -3.462  1.00 24.51 ? 77   GLY A O   1 
ATOM   90   N  N   . GLY A 1 14  ? -11.490 23.480  -2.854  1.00 24.24 ? 78   GLY A N   1 
ATOM   91   C  CA  . GLY A 1 14  ? -12.506 23.101  -3.815  1.00 25.33 ? 78   GLY A CA  1 
ATOM   92   C  C   . GLY A 1 14  ? -13.401 24.293  -4.060  1.00 25.15 ? 78   GLY A C   1 
ATOM   93   O  O   . GLY A 1 14  ? -13.532 25.141  -3.185  1.00 25.62 ? 78   GLY A O   1 
ATOM   94   N  N   . PRO A 1 15  ? -14.026 24.395  -5.240  1.00 25.27 ? 79   PRO A N   1 
ATOM   95   C  CA  . PRO A 1 15  ? -14.908 25.529  -5.540  1.00 24.68 ? 79   PRO A CA  1 
ATOM   96   C  C   . PRO A 1 15  ? -16.085 25.638  -4.569  1.00 24.31 ? 79   PRO A C   1 
ATOM   97   O  O   . PRO A 1 15  ? -16.776 24.656  -4.315  1.00 23.50 ? 79   PRO A O   1 
ATOM   98   C  CB  . PRO A 1 15  ? -15.354 25.243  -6.972  1.00 24.13 ? 79   PRO A CB  1 
ATOM   99   C  CG  . PRO A 1 15  ? -15.324 23.742  -7.040  1.00 24.89 ? 79   PRO A CG  1 
ATOM   100  C  CD  . PRO A 1 15  ? -14.046 23.403  -6.330  1.00 24.54 ? 79   PRO A CD  1 
ATOM   101  N  N   . GLU A 1 16  ? -16.299 26.833  -4.023  1.00 24.97 ? 80   GLU A N   1 
ATOM   102  C  CA  . GLU A 1 16  ? -17.396 27.072  -3.086  1.00 25.99 ? 80   GLU A CA  1 
ATOM   103  C  C   . GLU A 1 16  ? -18.738 27.158  -3.806  1.00 24.37 ? 80   GLU A C   1 
ATOM   104  O  O   . GLU A 1 16  ? -19.774 26.804  -3.249  1.00 24.63 ? 80   GLU A O   1 
ATOM   105  C  CB  . GLU A 1 16  ? -17.165 28.364  -2.295  1.00 28.24 ? 80   GLU A CB  1 
ATOM   106  C  CG  . GLU A 1 16  ? -16.122 28.255  -1.186  1.00 35.37 ? 80   GLU A CG  1 
ATOM   107  C  CD  . GLU A 1 16  ? -15.970 29.548  -0.381  1.00 39.15 ? 80   GLU A CD  1 
ATOM   108  O  OE1 . GLU A 1 16  ? -16.969 30.012  0.221   1.00 41.03 ? 80   GLU A OE1 1 
ATOM   109  O  OE2 . GLU A 1 16  ? -14.847 30.101  -0.351  1.00 41.30 ? 80   GLU A OE2 1 
ATOM   110  N  N   . THR A 1 17  ? -18.714 27.646  -5.040  1.00 23.54 ? 81   THR A N   1 
ATOM   111  C  CA  . THR A 1 17  ? -19.922 27.777  -5.847  1.00 23.88 ? 81   THR A CA  1 
ATOM   112  C  C   . THR A 1 17  ? -19.577 27.321  -7.256  1.00 23.44 ? 81   THR A C   1 
ATOM   113  O  O   . THR A 1 17  ? -18.398 27.225  -7.606  1.00 23.11 ? 81   THR A O   1 
ATOM   114  C  CB  . THR A 1 17  ? -20.412 29.246  -5.915  1.00 24.12 ? 81   THR A CB  1 
ATOM   115  O  OG1 . THR A 1 17  ? -19.460 30.039  -6.639  1.00 25.41 ? 81   THR A OG1 1 
ATOM   116  C  CG2 . THR A 1 17  ? -20.570 29.820  -4.518  1.00 25.64 ? 81   THR A CG2 1 
ATOM   117  N  N   . LEU A 1 18  ? -20.599 27.050  -8.062  1.00 22.87 ? 82   LEU A N   1 
ATOM   118  C  CA  . LEU A 1 18  ? -20.389 26.606  -9.437  1.00 23.15 ? 82   LEU A CA  1 
ATOM   119  C  C   . LEU A 1 18  ? -19.550 27.626  -10.202 1.00 22.83 ? 82   LEU A C   1 
ATOM   120  O  O   . LEU A 1 18  ? -18.772 27.274  -11.094 1.00 22.07 ? 82   LEU A O   1 
ATOM   121  C  CB  . LEU A 1 18  ? -21.735 26.410  -10.144 1.00 24.51 ? 82   LEU A CB  1 
ATOM   122  C  CG  . LEU A 1 18  ? -22.766 25.506  -9.460  1.00 25.42 ? 82   LEU A CG  1 
ATOM   123  C  CD1 . LEU A 1 18  ? -23.973 25.334  -10.386 1.00 25.08 ? 82   LEU A CD1 1 
ATOM   124  C  CD2 . LEU A 1 18  ? -22.151 24.154  -9.141  1.00 24.14 ? 82   LEU A CD2 1 
ATOM   125  N  N   . GLY A 1 19  ? -19.709 28.894  -9.840  1.00 23.56 ? 83   GLY A N   1 
ATOM   126  C  CA  . GLY A 1 19  ? -18.961 29.944  -10.499 1.00 23.49 ? 83   GLY A CA  1 
ATOM   127  C  C   . GLY A 1 19  ? -17.459 29.865  -10.277 1.00 23.16 ? 83   GLY A C   1 
ATOM   128  O  O   . GLY A 1 19  ? -16.695 30.351  -11.110 1.00 24.03 ? 83   GLY A O   1 
ATOM   129  N  N   . ASP A 1 20  ? -17.034 29.255  -9.171  1.00 21.21 ? 84   ASP A N   1 
ATOM   130  C  CA  . ASP A 1 20  ? -15.606 29.140  -8.847  1.00 22.42 ? 84   ASP A CA  1 
ATOM   131  C  C   . ASP A 1 20  ? -14.898 27.986  -9.564  1.00 22.35 ? 84   ASP A C   1 
ATOM   132  O  O   . ASP A 1 20  ? -13.670 27.877  -9.518  1.00 22.56 ? 84   ASP A O   1 
ATOM   133  C  CB  . ASP A 1 20  ? -15.411 28.959  -7.335  1.00 23.91 ? 84   ASP A CB  1 
ATOM   134  C  CG  . ASP A 1 20  ? -15.868 30.165  -6.529  1.00 28.63 ? 84   ASP A CG  1 
ATOM   135  O  OD1 . ASP A 1 20  ? -15.306 31.267  -6.724  1.00 29.86 ? 84   ASP A OD1 1 
ATOM   136  O  OD2 . ASP A 1 20  ? -16.788 30.010  -5.690  1.00 29.88 ? 84   ASP A OD2 1 
ATOM   137  N  N   . VAL A 1 21  ? -15.673 27.131  -10.219 1.00 21.14 ? 85   VAL A N   1 
ATOM   138  C  CA  . VAL A 1 21  ? -15.134 25.977  -10.924 1.00 21.55 ? 85   VAL A CA  1 
ATOM   139  C  C   . VAL A 1 21  ? -14.077 26.283  -11.985 1.00 20.74 ? 85   VAL A C   1 
ATOM   140  O  O   . VAL A 1 21  ? -13.014 25.664  -12.002 1.00 22.26 ? 85   VAL A O   1 
ATOM   141  C  CB  . VAL A 1 21  ? -16.270 25.170  -11.587 1.00 20.00 ? 85   VAL A CB  1 
ATOM   142  C  CG1 . VAL A 1 21  ? -15.692 24.133  -12.530 1.00 20.06 ? 85   VAL A CG1 1 
ATOM   143  C  CG2 . VAL A 1 21  ? -17.112 24.498  -10.517 1.00 19.83 ? 85   VAL A CG2 1 
ATOM   144  N  N   . HIS A 1 22  ? -14.370 27.225  -12.873 1.00 20.80 ? 86   HIS A N   1 
ATOM   145  C  CA  . HIS A 1 22  ? -13.437 27.576  -13.934 1.00 22.25 ? 86   HIS A CA  1 
ATOM   146  C  C   . HIS A 1 22  ? -12.033 27.957  -13.457 1.00 23.52 ? 86   HIS A C   1 
ATOM   147  O  O   . HIS A 1 22  ? -11.043 27.466  -14.004 1.00 23.75 ? 86   HIS A O   1 
ATOM   148  C  CB  . HIS A 1 22  ? -14.004 28.706  -14.792 1.00 23.54 ? 86   HIS A CB  1 
ATOM   149  C  CG  . HIS A 1 22  ? -13.076 29.149  -15.878 1.00 27.68 ? 86   HIS A CG  1 
ATOM   150  N  ND1 . HIS A 1 22  ? -11.968 29.932  -15.636 1.00 29.17 ? 86   HIS A ND1 1 
ATOM   151  C  CD2 . HIS A 1 22  ? -13.049 28.857  -17.200 1.00 26.96 ? 86   HIS A CD2 1 
ATOM   152  C  CE1 . HIS A 1 22  ? -11.297 30.102  -16.760 1.00 29.79 ? 86   HIS A CE1 1 
ATOM   153  N  NE2 . HIS A 1 22  ? -11.932 29.459  -17.724 1.00 29.08 ? 86   HIS A NE2 1 
ATOM   154  N  N   . ASP A 1 23  ? -11.937 28.825  -12.450 1.00 23.40 ? 87   ASP A N   1 
ATOM   155  C  CA  . ASP A 1 23  ? -10.627 29.234  -11.951 1.00 26.18 ? 87   ASP A CA  1 
ATOM   156  C  C   . ASP A 1 23  ? -9.948  28.102  -11.199 1.00 25.54 ? 87   ASP A C   1 
ATOM   157  O  O   . ASP A 1 23  ? -8.728  27.956  -11.245 1.00 24.01 ? 87   ASP A O   1 
ATOM   158  C  CB  . ASP A 1 23  ? -10.734 30.469  -11.053 1.00 28.30 ? 87   ASP A CB  1 
ATOM   159  C  CG  . ASP A 1 23  ? -11.064 31.728  -11.834 1.00 32.30 ? 87   ASP A CG  1 
ATOM   160  O  OD1 . ASP A 1 23  ? -10.670 31.814  -13.019 1.00 36.07 ? 87   ASP A OD1 1 
ATOM   161  O  OD2 . ASP A 1 23  ? -11.704 32.637  -11.264 1.00 33.70 ? 87   ASP A OD2 1 
ATOM   162  N  N   . PHE A 1 24  ? -10.748 27.308  -10.499 1.00 25.10 ? 88   PHE A N   1 
ATOM   163  C  CA  . PHE A 1 24  ? -10.234 26.164  -9.765  1.00 23.84 ? 88   PHE A CA  1 
ATOM   164  C  C   . PHE A 1 24  ? -9.461  25.305  -10.766 1.00 24.33 ? 88   PHE A C   1 
ATOM   165  O  O   . PHE A 1 24  ? -8.278  25.002  -10.572 1.00 23.28 ? 88   PHE A O   1 
ATOM   166  C  CB  . PHE A 1 24  ? -11.403 25.377  -9.175  1.00 24.63 ? 88   PHE A CB  1 
ATOM   167  C  CG  . PHE A 1 24  ? -11.039 24.005  -8.693  1.00 25.74 ? 88   PHE A CG  1 
ATOM   168  C  CD1 . PHE A 1 24  ? -10.063 23.830  -7.716  1.00 25.33 ? 88   PHE A CD1 1 
ATOM   169  C  CD2 . PHE A 1 24  ? -11.687 22.884  -9.208  1.00 25.34 ? 88   PHE A CD2 1 
ATOM   170  C  CE1 . PHE A 1 24  ? -9.739  22.556  -7.256  1.00 27.71 ? 88   PHE A CE1 1 
ATOM   171  C  CE2 . PHE A 1 24  ? -11.375 21.610  -8.760  1.00 27.36 ? 88   PHE A CE2 1 
ATOM   172  C  CZ  . PHE A 1 24  ? -10.397 21.442  -7.779  1.00 26.57 ? 88   PHE A CZ  1 
ATOM   173  N  N   . LEU A 1 25  ? -10.132 24.941  -11.854 1.00 23.60 ? 89   LEU A N   1 
ATOM   174  C  CA  . LEU A 1 25  ? -9.513  24.117  -12.880 1.00 23.82 ? 89   LEU A CA  1 
ATOM   175  C  C   . LEU A 1 25  ? -8.294  24.786  -13.500 1.00 23.39 ? 89   LEU A C   1 
ATOM   176  O  O   . LEU A 1 25  ? -7.254  24.152  -13.666 1.00 24.69 ? 89   LEU A O   1 
ATOM   177  C  CB  . LEU A 1 25  ? -10.538 23.772  -13.963 1.00 22.13 ? 89   LEU A CB  1 
ATOM   178  C  CG  . LEU A 1 25  ? -11.698 22.909  -13.455 1.00 21.94 ? 89   LEU A CG  1 
ATOM   179  C  CD1 . LEU A 1 25  ? -12.721 22.712  -14.555 1.00 22.89 ? 89   LEU A CD1 1 
ATOM   180  C  CD2 . LEU A 1 25  ? -11.169 21.568  -12.964 1.00 22.49 ? 89   LEU A CD2 1 
ATOM   181  N  N   . LEU A 1 26  ? -8.424  26.068  -13.827 1.00 23.51 ? 90   LEU A N   1 
ATOM   182  C  CA  . LEU A 1 26  ? -7.337  26.821  -14.432 1.00 24.03 ? 90   LEU A CA  1 
ATOM   183  C  C   . LEU A 1 26  ? -6.067  26.782  -13.582 1.00 24.08 ? 90   LEU A C   1 
ATOM   184  O  O   . LEU A 1 26  ? -4.998  26.449  -14.086 1.00 23.86 ? 90   LEU A O   1 
ATOM   185  C  CB  . LEU A 1 26  ? -7.760  28.275  -14.661 1.00 23.23 ? 90   LEU A CB  1 
ATOM   186  C  CG  . LEU A 1 26  ? -6.686  29.210  -15.223 1.00 25.29 ? 90   LEU A CG  1 
ATOM   187  C  CD1 . LEU A 1 26  ? -6.282  28.760  -16.629 1.00 25.97 ? 90   LEU A CD1 1 
ATOM   188  C  CD2 . LEU A 1 26  ? -7.218  30.629  -15.264 1.00 25.21 ? 90   LEU A CD2 1 
ATOM   189  N  N   . ARG A 1 27  ? -6.176  27.124  -12.299 1.00 24.20 ? 91   ARG A N   1 
ATOM   190  C  CA  . ARG A 1 27  ? -5.002  27.112  -11.423 1.00 25.59 ? 91   ARG A CA  1 
ATOM   191  C  C   . ARG A 1 27  ? -4.409  25.713  -11.334 1.00 25.80 ? 91   ARG A C   1 
ATOM   192  O  O   . ARG A 1 27  ? -3.199  25.541  -11.213 1.00 25.03 ? 91   ARG A O   1 
ATOM   193  C  CB  . ARG A 1 27  ? -5.362  27.585  -10.013 1.00 24.62 ? 91   ARG A CB  1 
ATOM   194  C  CG  . ARG A 1 27  ? -5.802  29.028  -9.918  1.00 24.72 ? 91   ARG A CG  1 
ATOM   195  C  CD  . ARG A 1 27  ? -5.883  29.480  -8.464  1.00 25.06 ? 91   ARG A CD  1 
ATOM   196  N  NE  . ARG A 1 27  ? -6.442  30.821  -8.353  1.00 26.21 ? 91   ARG A NE  1 
ATOM   197  C  CZ  . ARG A 1 27  ? -7.745  31.088  -8.324  1.00 27.65 ? 91   ARG A CZ  1 
ATOM   198  N  NH1 . ARG A 1 27  ? -8.634  30.101  -8.388  1.00 26.98 ? 91   ARG A NH1 1 
ATOM   199  N  NH2 . ARG A 1 27  ? -8.159  32.347  -8.253  1.00 27.54 ? 91   ARG A NH2 1 
ATOM   200  N  N   . LEU A 1 28  ? -5.280  24.716  -11.404 1.00 27.55 ? 92   LEU A N   1 
ATOM   201  C  CA  . LEU A 1 28  ? -4.873  23.328  -11.316 1.00 29.19 ? 92   LEU A CA  1 
ATOM   202  C  C   . LEU A 1 28  ? -4.075  22.862  -12.538 1.00 29.28 ? 92   LEU A C   1 
ATOM   203  O  O   . LEU A 1 28  ? -3.088  22.129  -12.409 1.00 29.02 ? 92   LEU A O   1 
ATOM   204  C  CB  . LEU A 1 28  ? -6.115  22.464  -11.115 1.00 30.37 ? 92   LEU A CB  1 
ATOM   205  C  CG  . LEU A 1 28  ? -5.878  21.031  -10.661 1.00 33.52 ? 92   LEU A CG  1 
ATOM   206  C  CD1 . LEU A 1 28  ? -7.118  20.518  -9.950  1.00 33.54 ? 92   LEU A CD1 1 
ATOM   207  C  CD2 . LEU A 1 28  ? -5.519  20.171  -11.862 1.00 36.11 ? 92   LEU A CD2 1 
ATOM   208  N  N   . PHE A 1 29  ? -4.485  23.286  -13.726 1.00 28.58 ? 93   PHE A N   1 
ATOM   209  C  CA  . PHE A 1 29  ? -3.762  22.875  -14.918 1.00 29.36 ? 93   PHE A CA  1 
ATOM   210  C  C   . PHE A 1 29  ? -2.521  23.720  -15.175 1.00 30.06 ? 93   PHE A C   1 
ATOM   211  O  O   . PHE A 1 29  ? -1.737  23.420  -16.073 1.00 30.04 ? 93   PHE A O   1 
ATOM   212  C  CB  . PHE A 1 29  ? -4.692  22.878  -16.130 1.00 28.81 ? 93   PHE A CB  1 
ATOM   213  C  CG  . PHE A 1 29  ? -5.731  21.799  -16.079 1.00 28.63 ? 93   PHE A CG  1 
ATOM   214  C  CD1 . PHE A 1 29  ? -7.071  22.108  -15.899 1.00 28.74 ? 93   PHE A CD1 1 
ATOM   215  C  CD2 . PHE A 1 29  ? -5.361  20.463  -16.167 1.00 31.12 ? 93   PHE A CD2 1 
ATOM   216  C  CE1 . PHE A 1 29  ? -8.027  21.099  -15.804 1.00 28.46 ? 93   PHE A CE1 1 
ATOM   217  C  CE2 . PHE A 1 29  ? -6.313  19.447  -16.072 1.00 31.35 ? 93   PHE A CE2 1 
ATOM   218  C  CZ  . PHE A 1 29  ? -7.645  19.769  -15.890 1.00 30.43 ? 93   PHE A CZ  1 
ATOM   219  N  N   . LEU A 1 30  ? -2.336  24.762  -14.368 1.00 30.09 ? 94   LEU A N   1 
ATOM   220  C  CA  . LEU A 1 30  ? -1.170  25.633  -14.494 1.00 31.58 ? 94   LEU A CA  1 
ATOM   221  C  C   . LEU A 1 30  ? -0.046  25.194  -13.553 1.00 32.42 ? 94   LEU A C   1 
ATOM   222  O  O   . LEU A 1 30  ? 1.083   25.679  -13.654 1.00 34.06 ? 94   LEU A O   1 
ATOM   223  C  CB  . LEU A 1 30  ? -1.549  27.079  -14.166 1.00 31.18 ? 94   LEU A CB  1 
ATOM   224  C  CG  . LEU A 1 30  ? -2.415  27.866  -15.149 1.00 31.01 ? 94   LEU A CG  1 
ATOM   225  C  CD1 . LEU A 1 30  ? -2.753  29.223  -14.547 1.00 31.02 ? 94   LEU A CD1 1 
ATOM   226  C  CD2 . LEU A 1 30  ? -1.673  28.040  -16.463 1.00 32.67 ? 94   LEU A CD2 1 
ATOM   227  N  N   . ASP A 1 31  ? -0.358  24.279  -12.640 1.00 33.56 ? 95   ASP A N   1 
ATOM   228  C  CA  . ASP A 1 31  ? 0.614   23.800  -11.659 1.00 34.40 ? 95   ASP A CA  1 
ATOM   229  C  C   . ASP A 1 31  ? 1.592   22.787  -12.234 1.00 35.24 ? 95   ASP A C   1 
ATOM   230  O  O   . ASP A 1 31  ? 1.214   21.668  -12.587 1.00 34.51 ? 95   ASP A O   1 
ATOM   231  C  CB  . ASP A 1 31  ? -0.113  23.184  -10.458 1.00 34.93 ? 95   ASP A CB  1 
ATOM   232  C  CG  . ASP A 1 31  ? 0.822   22.889  -9.290  1.00 36.45 ? 95   ASP A CG  1 
ATOM   233  O  OD1 . ASP A 1 31  ? 0.335   22.371  -8.260  1.00 36.67 ? 95   ASP A OD1 1 
ATOM   234  O  OD2 . ASP A 1 31  ? 2.037   23.178  -9.396  1.00 35.43 ? 95   ASP A OD2 1 
ATOM   235  N  N   . ARG A 1 32  ? 2.856   23.185  -12.310 1.00 36.66 ? 96   ARG A N   1 
ATOM   236  C  CA  . ARG A 1 32  ? 3.912   22.324  -12.833 1.00 38.58 ? 96   ARG A CA  1 
ATOM   237  C  C   . ARG A 1 32  ? 4.153   21.120  -11.914 1.00 38.70 ? 96   ARG A C   1 
ATOM   238  O  O   . ARG A 1 32  ? 4.464   20.029  -12.387 1.00 38.68 ? 96   ARG A O   1 
ATOM   239  C  CB  . ARG A 1 32  ? 5.211   23.121  -12.972 1.00 40.84 ? 96   ARG A CB  1 
ATOM   240  C  CG  . ARG A 1 32  ? 5.085   24.435  -13.733 1.00 43.10 ? 96   ARG A CG  1 
ATOM   241  C  CD  . ARG A 1 32  ? 4.916   24.241  -15.228 1.00 44.64 ? 96   ARG A CD  1 
ATOM   242  N  NE  . ARG A 1 32  ? 3.000   24.817  -15.782 1.00 44.82 ? 96   ARG A NE  1 
ATOM   243  N  N   . ASP A 1 33  ? 4.015   21.319  -10.605 1.00 38.88 ? 97   ASP A N   1 
ATOM   244  C  CA  . ASP A 1 33  ? 4.226   20.235  -9.642  1.00 39.36 ? 97   ASP A CA  1 
ATOM   245  C  C   . ASP A 1 33  ? 3.190   19.135  -9.808  1.00 39.66 ? 97   ASP A C   1 
ATOM   246  O  O   . ASP A 1 33  ? 3.319   18.058  -9.227  1.00 40.12 ? 97   ASP A O   1 
ATOM   247  C  CB  . ASP A 1 33  ? 4.145   20.747  -8.198  1.00 40.45 ? 97   ASP A CB  1 
ATOM   248  C  CG  . ASP A 1 33  ? 5.143   21.848  -7.903  1.00 41.47 ? 97   ASP A CG  1 
ATOM   249  O  OD1 . ASP A 1 33  ? 6.310   21.731  -8.329  1.00 43.01 ? 97   ASP A OD1 1 
ATOM   250  O  OD2 . ASP A 1 33  ? 4.759   22.827  -7.228  1.00 43.61 ? 97   ASP A OD2 1 
ATOM   251  N  N   . LEU A 1 34  ? 2.160   19.407  -10.600 1.00 39.44 ? 98   LEU A N   1 
ATOM   252  C  CA  . LEU A 1 34  ? 1.092   18.439  -10.812 1.00 38.76 ? 98   LEU A CA  1 
ATOM   253  C  C   . LEU A 1 34  ? 1.139   17.842  -12.218 1.00 39.04 ? 98   LEU A C   1 
ATOM   254  O  O   . LEU A 1 34  ? 0.880   16.654  -12.409 1.00 38.90 ? 98   LEU A O   1 
ATOM   255  C  CB  . LEU A 1 34  ? -0.260  19.117  -10.562 1.00 38.85 ? 98   LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 34  ? -1.521  18.259  -10.463 1.00 39.48 ? 98   LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 34  ? -1.337  17.196  -9.386  1.00 39.02 ? 98   LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 34  ? -2.716  19.148  -10.130 1.00 36.98 ? 98   LEU A CD2 1 
ATOM   259  N  N   . MET A 1 35  ? 1.481   18.661  -13.204 1.00 39.09 ? 99   MET A N   1 
ATOM   260  C  CA  . MET A 1 35  ? 1.541   18.176  -14.573 1.00 39.24 ? 99   MET A CA  1 
ATOM   261  C  C   . MET A 1 35  ? 2.226   19.158  -15.504 1.00 39.68 ? 99   MET A C   1 
ATOM   262  O  O   . MET A 1 35  ? 2.099   20.372  -15.351 1.00 39.39 ? 99   MET A O   1 
ATOM   263  C  CB  . MET A 1 35  ? 0.130   17.901  -15.101 1.00 38.78 ? 99   MET A CB  1 
ATOM   264  C  CG  . MET A 1 35  ? -0.736  19.146  -15.211 1.00 38.67 ? 99   MET A CG  1 
ATOM   265  S  SD  . MET A 1 35  ? -2.400  18.817  -15.839 1.00 40.70 ? 99   MET A SD  1 
ATOM   266  C  CE  . MET A 1 35  ? -3.225  18.313  -14.338 1.00 38.69 ? 99   MET A CE  1 
ATOM   267  N  N   . THR A 1 36  ? 2.957   18.618  -16.470 1.00 39.99 ? 100  THR A N   1 
ATOM   268  C  CA  . THR A 1 36  ? 3.643   19.433  -17.459 1.00 40.09 ? 100  THR A CA  1 
ATOM   269  C  C   . THR A 1 36  ? 2.917   19.175  -18.768 1.00 40.19 ? 100  THR A C   1 
ATOM   270  O  O   . THR A 1 36  ? 2.647   18.028  -19.118 1.00 40.25 ? 100  THR A O   1 
ATOM   271  C  CB  . THR A 1 36  ? 5.130   19.035  -17.594 1.00 40.74 ? 100  THR A CB  1 
ATOM   272  O  OG1 . THR A 1 36  ? 5.234   17.617  -17.777 1.00 41.93 ? 100  THR A OG1 1 
ATOM   273  C  CG2 . THR A 1 36  ? 5.908   19.442  -16.342 1.00 40.21 ? 100  THR A CG2 1 
ATOM   274  N  N   . LEU A 1 37  ? 2.580   20.244  -19.479 1.00 39.70 ? 101  LEU A N   1 
ATOM   275  C  CA  . LEU A 1 37  ? 1.865   20.117  -20.742 1.00 40.19 ? 101  LEU A CA  1 
ATOM   276  C  C   . LEU A 1 37  ? 2.458   21.077  -21.763 1.00 41.08 ? 101  LEU A C   1 
ATOM   277  O  O   . LEU A 1 37  ? 2.954   22.147  -21.405 1.00 40.62 ? 101  LEU A O   1 
ATOM   278  C  CB  . LEU A 1 37  ? 0.387   20.461  -20.542 1.00 39.27 ? 101  LEU A CB  1 
ATOM   279  C  CG  . LEU A 1 37  ? -0.275  19.995  -19.242 1.00 38.84 ? 101  LEU A CG  1 
ATOM   280  C  CD1 . LEU A 1 37  ? -1.655  20.627  -19.125 1.00 37.81 ? 101  LEU A CD1 1 
ATOM   281  C  CD2 . LEU A 1 37  ? -0.366  18.475  -19.212 1.00 37.85 ? 101  LEU A CD2 1 
ATOM   282  N  N   . PRO A 1 38  ? 2.425   20.703  -23.052 1.00 41.58 ? 102  PRO A N   1 
ATOM   283  C  CA  . PRO A 1 38  ? 2.975   21.595  -24.076 1.00 41.85 ? 102  PRO A CA  1 
ATOM   284  C  C   . PRO A 1 38  ? 2.187   22.900  -24.025 1.00 41.90 ? 102  PRO A C   1 
ATOM   285  O  O   . PRO A 1 38  ? 1.003   22.885  -23.692 1.00 41.89 ? 102  PRO A O   1 
ATOM   286  C  CB  . PRO A 1 38  ? 2.732   20.821  -25.369 1.00 42.66 ? 102  PRO A CB  1 
ATOM   287  C  CG  . PRO A 1 38  ? 2.826   19.387  -24.919 1.00 42.06 ? 102  PRO A CG  1 
ATOM   288  C  CD  . PRO A 1 38  ? 2.028   19.410  -23.637 1.00 41.53 ? 102  PRO A CD  1 
ATOM   289  N  N   . ILE A 1 39  ? 2.838   24.017  -24.345 1.00 42.07 ? 103  ILE A N   1 
ATOM   290  C  CA  . ILE A 1 39  ? 2.183   25.326  -24.322 1.00 42.55 ? 103  ILE A CA  1 
ATOM   291  C  C   . ILE A 1 39  ? 1.164   25.375  -23.182 1.00 41.63 ? 103  ILE A C   1 
ATOM   292  O  O   . ILE A 1 39  ? 0.021   25.801  -23.362 1.00 40.02 ? 103  ILE A O   1 
ATOM   293  C  CB  . ILE A 1 39  ? 1.463   25.624  -25.670 1.00 43.61 ? 103  ILE A CB  1 
ATOM   294  C  CG1 . ILE A 1 39  ? 0.404   24.557  -25.957 1.00 44.46 ? 103  ILE A CG1 1 
ATOM   295  C  CG2 . ILE A 1 39  ? 2.480   25.661  -26.806 1.00 44.21 ? 103  ILE A CG2 1 
ATOM   296  C  CD1 . ILE A 1 39  ? -0.463  24.852  -27.162 1.00 45.76 ? 103  ILE A CD1 1 
ATOM   297  N  N   . GLN A 1 40  ? 1.602   24.939  -22.005 1.00 41.84 ? 104  GLN A N   1 
ATOM   298  C  CA  . GLN A 1 40  ? 0.745   24.884  -20.826 1.00 42.37 ? 104  GLN A CA  1 
ATOM   299  C  C   . GLN A 1 40  ? -0.031  26.164  -20.532 1.00 42.39 ? 104  GLN A C   1 
ATOM   300  O  O   . GLN A 1 40  ? -1.231  26.111  -20.260 1.00 41.59 ? 104  GLN A O   1 
ATOM   301  C  CB  . GLN A 1 40  ? 1.570   24.487  -19.597 1.00 42.15 ? 104  GLN A CB  1 
ATOM   302  C  CG  . GLN A 1 40  ? 0.822   23.562  -18.640 1.00 41.97 ? 104  GLN A CG  1 
ATOM   303  C  CD  . GLN A 1 40  ? 1.680   23.090  -17.486 1.00 42.55 ? 104  GLN A CD  1 
ATOM   304  O  OE1 . GLN A 1 40  ? 2.823   22.665  -17.677 1.00 42.96 ? 104  GLN A OE1 1 
ATOM   305  N  NE2 . GLN A 1 40  ? 1.130   23.148  -16.278 1.00 41.20 ? 104  GLN A NE2 1 
ATOM   306  N  N   . ASN A 1 41  ? 0.642   27.309  -20.593 1.00 42.48 ? 105  ASN A N   1 
ATOM   307  C  CA  . ASN A 1 41  ? -0.014  28.582  -20.314 1.00 42.24 ? 105  ASN A CA  1 
ATOM   308  C  C   . ASN A 1 41  ? -1.148  28.915  -21.272 1.00 42.16 ? 105  ASN A C   1 
ATOM   309  O  O   . ASN A 1 41  ? -1.996  29.748  -20.962 1.00 41.62 ? 105  ASN A O   1 
ATOM   310  C  CB  . ASN A 1 41  ? 1.008   29.720  -20.308 1.00 43.52 ? 105  ASN A CB  1 
ATOM   311  C  CG  . ASN A 1 41  ? 1.955   29.641  -19.126 1.00 44.41 ? 105  ASN A CG  1 
ATOM   312  O  OD1 . ASN A 1 41  ? 1.524   29.650  -17.970 1.00 44.14 ? 105  ASN A OD1 1 
ATOM   313  N  ND2 . ASN A 1 41  ? 3.253   29.560  -19.407 1.00 45.66 ? 105  ASN A ND2 1 
ATOM   314  N  N   . LYS A 1 42  ? -1.165  28.270  -22.435 1.00 41.75 ? 106  LYS A N   1 
ATOM   315  C  CA  . LYS A 1 42  ? -2.220  28.503  -23.417 1.00 41.42 ? 106  LYS A CA  1 
ATOM   316  C  C   . LYS A 1 42  ? -3.255  27.385  -23.341 1.00 40.65 ? 106  LYS A C   1 
ATOM   317  O  O   . LYS A 1 42  ? -4.459  27.632  -23.449 1.00 41.05 ? 106  LYS A O   1 
ATOM   318  C  CB  . LYS A 1 42  ? -1.636  28.569  -24.832 1.00 43.03 ? 106  LYS A CB  1 
ATOM   319  C  CG  . LYS A 1 42  ? -0.690  29.736  -25.059 1.00 43.95 ? 106  LYS A CG  1 
ATOM   320  C  CD  . LYS A 1 42  ? -0.221  29.788  -26.506 1.00 45.74 ? 106  LYS A CD  1 
ATOM   321  C  CE  . LYS A 1 42  ? 0.721   30.964  -26.746 1.00 45.78 ? 106  LYS A CE  1 
ATOM   322  N  NZ  . LYS A 1 42  ? 1.958   30.864  -25.918 1.00 46.01 ? 106  LYS A NZ  1 
ATOM   323  N  N   . LEU A 1 43  ? -2.780  26.157  -23.157 1.00 38.91 ? 107  LEU A N   1 
ATOM   324  C  CA  . LEU A 1 43  ? -3.665  25.004  -23.055 1.00 38.36 ? 107  LEU A CA  1 
ATOM   325  C  C   . LEU A 1 43  ? -4.507  25.021  -21.782 1.00 37.95 ? 107  LEU A C   1 
ATOM   326  O  O   . LEU A 1 43  ? -5.727  24.855  -21.837 1.00 37.82 ? 107  LEU A O   1 
ATOM   327  C  CB  . LEU A 1 43  ? -2.859  23.704  -23.099 1.00 39.89 ? 107  LEU A CB  1 
ATOM   328  C  CG  . LEU A 1 43  ? -2.539  23.154  -24.487 1.00 41.53 ? 107  LEU A CG  1 
ATOM   329  C  CD1 . LEU A 1 43  ? -1.681  21.899  -24.365 1.00 41.91 ? 107  LEU A CD1 1 
ATOM   330  C  CD2 . LEU A 1 43  ? -3.842  22.846  -25.214 1.00 41.40 ? 107  LEU A CD2 1 
ATOM   331  N  N   . ALA A 1 44  ? -3.848  25.221  -20.643 1.00 36.54 ? 108  ALA A N   1 
ATOM   332  C  CA  . ALA A 1 44  ? -4.522  25.240  -19.347 1.00 35.26 ? 108  ALA A CA  1 
ATOM   333  C  C   . ALA A 1 44  ? -5.861  25.967  -19.372 1.00 34.19 ? 108  ALA A C   1 
ATOM   334  O  O   . ALA A 1 44  ? -6.896  25.372  -19.083 1.00 32.90 ? 108  ALA A O   1 
ATOM   335  C  CB  . ALA A 1 44  ? -3.609  25.851  -18.281 1.00 35.26 ? 108  ALA A CB  1 
ATOM   336  N  N   . PRO A 1 45  ? -5.865  27.266  -19.712 1.00 33.83 ? 109  PRO A N   1 
ATOM   337  C  CA  . PRO A 1 45  ? -7.160  27.950  -19.730 1.00 33.88 ? 109  PRO A CA  1 
ATOM   338  C  C   . PRO A 1 45  ? -8.176  27.258  -20.627 1.00 34.04 ? 109  PRO A C   1 
ATOM   339  O  O   . PRO A 1 45  ? -9.365  27.212  -20.314 1.00 34.07 ? 109  PRO A O   1 
ATOM   340  C  CB  . PRO A 1 45  ? -6.807  29.368  -20.195 1.00 34.17 ? 109  PRO A CB  1 
ATOM   341  C  CG  . PRO A 1 45  ? -5.486  29.206  -20.904 1.00 32.95 ? 109  PRO A CG  1 
ATOM   342  C  CD  . PRO A 1 45  ? -4.773  28.187  -20.071 1.00 32.90 ? 109  PRO A CD  1 
ATOM   343  N  N   . PHE A 1 46  ? -7.702  26.705  -21.737 1.00 35.44 ? 110  PHE A N   1 
ATOM   344  C  CA  . PHE A 1 46  ? -8.579  26.009  -22.666 1.00 35.52 ? 110  PHE A CA  1 
ATOM   345  C  C   . PHE A 1 46  ? -9.165  24.743  -22.064 1.00 34.43 ? 110  PHE A C   1 
ATOM   346  O  O   . PHE A 1 46  ? -10.373 24.518  -22.129 1.00 34.26 ? 110  PHE A O   1 
ATOM   347  C  CB  . PHE A 1 46  ? -7.832  25.625  -23.938 1.00 37.88 ? 110  PHE A CB  1 
ATOM   348  C  CG  . PHE A 1 46  ? -8.559  24.609  -24.762 1.00 39.15 ? 110  PHE A CG  1 
ATOM   349  C  CD1 . PHE A 1 46  ? -9.763  24.930  -25.381 1.00 40.16 ? 110  PHE A CD1 1 
ATOM   350  C  CD2 . PHE A 1 46  ? -8.074  23.312  -24.870 1.00 40.85 ? 110  PHE A CD2 1 
ATOM   351  C  CE1 . PHE A 1 46  ? -10.475 23.974  -26.090 1.00 41.09 ? 110  PHE A CE1 1 
ATOM   352  C  CE2 . PHE A 1 46  ? -8.781  22.346  -25.578 1.00 42.12 ? 110  PHE A CE2 1 
ATOM   353  C  CZ  . PHE A 1 46  ? -9.983  22.680  -26.187 1.00 42.38 ? 110  PHE A CZ  1 
ATOM   354  N  N   . ILE A 1 47  ? -8.307  23.901  -21.502 1.00 32.74 ? 111  ILE A N   1 
ATOM   355  C  CA  . ILE A 1 47  ? -8.779  22.661  -20.906 1.00 32.82 ? 111  ILE A CA  1 
ATOM   356  C  C   . ILE A 1 47  ? -9.750  22.960  -19.762 1.00 32.24 ? 111  ILE A C   1 
ATOM   357  O  O   . ILE A 1 47  ? -10.708 22.223  -19.542 1.00 32.02 ? 111  ILE A O   1 
ATOM   358  C  CB  . ILE A 1 47  ? -7.607  21.812  -20.377 1.00 32.87 ? 111  ILE A CB  1 
ATOM   359  C  CG1 . ILE A 1 47  ? -6.613  21.541  -21.512 1.00 33.10 ? 111  ILE A CG1 1 
ATOM   360  C  CG2 . ILE A 1 47  ? -8.133  20.502  -19.803 1.00 32.26 ? 111  ILE A CG2 1 
ATOM   361  C  CD1 . ILE A 1 47  ? -5.423  20.686  -21.108 1.00 33.59 ? 111  ILE A CD1 1 
ATOM   362  N  N   . ALA A 1 48  ? -9.503  24.051  -19.046 1.00 31.24 ? 112  ALA A N   1 
ATOM   363  C  CA  . ALA A 1 48  ? -10.362 24.439  -17.937 1.00 30.90 ? 112  ALA A CA  1 
ATOM   364  C  C   . ALA A 1 48  ? -11.745 24.806  -18.459 1.00 31.56 ? 112  ALA A C   1 
ATOM   365  O  O   . ALA A 1 48  ? -12.760 24.382  -17.911 1.00 28.85 ? 112  ALA A O   1 
ATOM   366  C  CB  . ALA A 1 48  ? -9.755  25.618  -17.187 1.00 29.62 ? 112  ALA A CB  1 
ATOM   367  N  N   . LYS A 1 49  ? -11.779 25.592  -19.530 1.00 32.50 ? 113  LYS A N   1 
ATOM   368  C  CA  . LYS A 1 49  ? -13.044 26.014  -20.111 1.00 33.01 ? 113  LYS A CA  1 
ATOM   369  C  C   . LYS A 1 49  ? -13.890 24.831  -20.570 1.00 32.46 ? 113  LYS A C   1 
ATOM   370  O  O   . LYS A 1 49  ? -15.106 24.825  -20.380 1.00 32.73 ? 113  LYS A O   1 
ATOM   371  C  CB  . LYS A 1 49  ? -12.792 26.961  -21.277 1.00 34.50 ? 113  LYS A CB  1 
ATOM   372  N  N   . ARG A 1 50  ? -13.260 23.821  -21.161 1.00 32.54 ? 114  ARG A N   1 
ATOM   373  C  CA  . ARG A 1 50  ? -14.026 22.683  -21.643 1.00 33.30 ? 114  ARG A CA  1 
ATOM   374  C  C   . ARG A 1 50  ? -14.454 21.699  -20.566 1.00 31.92 ? 114  ARG A C   1 
ATOM   375  O  O   . ARG A 1 50  ? -15.455 21.005  -20.727 1.00 33.08 ? 114  ARG A O   1 
ATOM   376  C  CB  . ARG A 1 50  ? -13.272 21.949  -22.761 1.00 36.41 ? 114  ARG A CB  1 
ATOM   377  C  CG  . ARG A 1 50  ? -11.925 21.361  -22.390 1.00 39.65 ? 114  ARG A CG  1 
ATOM   378  C  CD  . ARG A 1 50  ? -11.864 19.891  -22.801 1.00 44.15 ? 114  ARG A CD  1 
ATOM   379  N  NE  . ARG A 1 50  ? -12.444 19.667  -24.124 1.00 47.50 ? 114  ARG A NE  1 
ATOM   380  C  CZ  . ARG A 1 50  ? -12.637 18.467  -24.669 1.00 48.90 ? 114  ARG A CZ  1 
ATOM   381  N  NH1 . ARG A 1 50  ? -12.291 17.368  -24.010 1.00 48.73 ? 114  ARG A NH1 1 
ATOM   382  N  NH2 . ARG A 1 50  ? -13.191 18.365  -25.869 1.00 48.89 ? 114  ARG A NH2 1 
ATOM   383  N  N   . LEU A 1 51  ? -13.713 21.636  -19.466 1.00 30.26 ? 115  LEU A N   1 
ATOM   384  C  CA  . LEU A 1 51  ? -14.073 20.724  -18.388 1.00 29.21 ? 115  LEU A CA  1 
ATOM   385  C  C   . LEU A 1 51  ? -15.067 21.366  -17.432 1.00 27.49 ? 115  LEU A C   1 
ATOM   386  O  O   . LEU A 1 51  ? -15.797 20.671  -16.740 1.00 26.87 ? 115  LEU A O   1 
ATOM   387  C  CB  . LEU A 1 51  ? -12.832 20.302  -17.598 1.00 30.17 ? 115  LEU A CB  1 
ATOM   388  C  CG  . LEU A 1 51  ? -11.876 19.312  -18.256 1.00 30.81 ? 115  LEU A CG  1 
ATOM   389  C  CD1 . LEU A 1 51  ? -10.629 19.151  -17.390 1.00 31.63 ? 115  LEU A CD1 1 
ATOM   390  C  CD2 . LEU A 1 51  ? -12.584 17.982  -18.449 1.00 31.98 ? 115  LEU A CD2 1 
ATOM   391  N  N   . THR A 1 52  ? -15.088 22.694  -17.408 1.00 26.56 ? 116  THR A N   1 
ATOM   392  C  CA  . THR A 1 52  ? -15.957 23.453  -16.517 1.00 26.20 ? 116  THR A CA  1 
ATOM   393  C  C   . THR A 1 52  ? -17.408 22.996  -16.444 1.00 26.30 ? 116  THR A C   1 
ATOM   394  O  O   . THR A 1 52  ? -17.917 22.734  -15.356 1.00 25.65 ? 116  THR A O   1 
ATOM   395  C  CB  . THR A 1 52  ? -15.904 24.965  -16.861 1.00 26.20 ? 116  THR A CB  1 
ATOM   396  O  OG1 . THR A 1 52  ? -14.606 25.468  -16.536 1.00 27.48 ? 116  THR A OG1 1 
ATOM   397  C  CG2 . THR A 1 52  ? -16.942 25.757  -16.065 1.00 25.81 ? 116  THR A CG2 1 
ATOM   398  N  N   . PRO A 1 53  ? -18.093 22.888  -17.595 1.00 26.62 ? 117  PRO A N   1 
ATOM   399  C  CA  . PRO A 1 53  ? -19.493 22.455  -17.583 1.00 26.71 ? 117  PRO A CA  1 
ATOM   400  C  C   . PRO A 1 53  ? -19.704 21.110  -16.892 1.00 27.14 ? 117  PRO A C   1 
ATOM   401  O  O   . PRO A 1 53  ? -20.606 20.960  -16.072 1.00 26.84 ? 117  PRO A O   1 
ATOM   402  C  CB  . PRO A 1 53  ? -19.848 22.403  -19.069 1.00 27.34 ? 117  PRO A CB  1 
ATOM   403  C  CG  . PRO A 1 53  ? -18.951 23.468  -19.666 1.00 26.96 ? 117  PRO A CG  1 
ATOM   404  C  CD  . PRO A 1 53  ? -17.648 23.176  -18.970 1.00 26.12 ? 117  PRO A CD  1 
ATOM   405  N  N   . LYS A 1 54  ? -18.863 20.137  -17.224 1.00 27.23 ? 118  LYS A N   1 
ATOM   406  C  CA  . LYS A 1 54  ? -18.971 18.804  -16.647 1.00 27.34 ? 118  LYS A CA  1 
ATOM   407  C  C   . LYS A 1 54  ? -18.714 18.807  -15.144 1.00 26.35 ? 118  LYS A C   1 
ATOM   408  O  O   . LYS A 1 54  ? -19.388 18.108  -14.392 1.00 27.95 ? 118  LYS A O   1 
ATOM   409  C  CB  . LYS A 1 54  ? -17.997 17.854  -17.343 1.00 28.11 ? 118  LYS A CB  1 
ATOM   410  N  N   . ILE A 1 55  ? -17.738 19.594  -14.708 1.00 25.21 ? 119  ILE A N   1 
ATOM   411  C  CA  . ILE A 1 55  ? -17.410 19.659  -13.293 1.00 24.22 ? 119  ILE A CA  1 
ATOM   412  C  C   . ILE A 1 55  ? -18.462 20.455  -12.514 1.00 22.50 ? 119  ILE A C   1 
ATOM   413  O  O   . ILE A 1 55  ? -18.779 20.110  -11.380 1.00 20.37 ? 119  ILE A O   1 
ATOM   414  C  CB  . ILE A 1 55  ? -16.008 20.276  -13.078 1.00 23.11 ? 119  ILE A CB  1 
ATOM   415  C  CG1 . ILE A 1 55  ? -14.965 19.483  -13.878 1.00 26.46 ? 119  ILE A CG1 1 
ATOM   416  C  CG2 . ILE A 1 55  ? -15.647 20.260  -11.602 1.00 22.83 ? 119  ILE A CG2 1 
ATOM   417  C  CD1 . ILE A 1 55  ? -14.852 18.018  -13.481 1.00 27.08 ? 119  ILE A CD1 1 
ATOM   418  N  N   . GLN A 1 56  ? -18.999 21.513  -13.117 1.00 21.83 ? 120  GLN A N   1 
ATOM   419  C  CA  . GLN A 1 56  ? -20.029 22.314  -12.450 1.00 23.14 ? 120  GLN A CA  1 
ATOM   420  C  C   . GLN A 1 56  ? -21.235 21.422  -12.206 1.00 23.29 ? 120  GLN A C   1 
ATOM   421  O  O   . GLN A 1 56  ? -21.904 21.526  -11.178 1.00 21.36 ? 120  GLN A O   1 
ATOM   422  C  CB  . GLN A 1 56  ? -20.468 23.496  -13.319 1.00 22.79 ? 120  GLN A CB  1 
ATOM   423  C  CG  . GLN A 1 56  ? -19.456 24.617  -13.454 1.00 23.30 ? 120  GLN A CG  1 
ATOM   424  C  CD  . GLN A 1 56  ? -20.009 25.771  -14.274 1.00 23.45 ? 120  GLN A CD  1 
ATOM   425  O  OE1 . GLN A 1 56  ? -20.618 25.560  -15.324 1.00 23.29 ? 120  GLN A OE1 1 
ATOM   426  N  NE2 . GLN A 1 56  ? -19.795 26.991  -13.806 1.00 23.05 ? 120  GLN A NE2 1 
ATOM   427  N  N   . GLU A 1 57  ? -21.494 20.541  -13.170 1.00 23.94 ? 121  GLU A N   1 
ATOM   428  C  CA  . GLU A 1 57  ? -22.605 19.604  -13.094 1.00 24.53 ? 121  GLU A CA  1 
ATOM   429  C  C   . GLU A 1 57  ? -22.405 18.661  -11.910 1.00 23.93 ? 121  GLU A C   1 
ATOM   430  O  O   . GLU A 1 57  ? -23.349 18.361  -11.185 1.00 24.81 ? 121  GLU A O   1 
ATOM   431  C  CB  . GLU A 1 57  ? -22.702 18.813  -14.404 1.00 26.07 ? 121  GLU A CB  1 
ATOM   432  C  CG  . GLU A 1 57  ? -23.746 17.707  -14.430 1.00 29.40 ? 121  GLU A CG  1 
ATOM   433  C  CD  . GLU A 1 57  ? -25.147 18.196  -14.113 1.00 32.28 ? 121  GLU A CD  1 
ATOM   434  O  OE1 . GLU A 1 57  ? -25.471 19.359  -14.439 1.00 33.33 ? 121  GLU A OE1 1 
ATOM   435  O  OE2 . GLU A 1 57  ? -25.933 17.406  -13.551 1.00 33.81 ? 121  GLU A OE2 1 
ATOM   436  N  N   . GLN A 1 58  ? -21.176 18.194  -11.714 1.00 23.35 ? 122  GLN A N   1 
ATOM   437  C  CA  . GLN A 1 58  ? -20.891 17.311  -10.591 1.00 22.33 ? 122  GLN A CA  1 
ATOM   438  C  C   . GLN A 1 58  ? -21.158 18.048  -9.277  1.00 20.22 ? 122  GLN A C   1 
ATOM   439  O  O   . GLN A 1 58  ? -21.727 17.485  -8.348  1.00 19.75 ? 122  GLN A O   1 
ATOM   440  C  CB  . GLN A 1 58  ? -19.434 16.834  -10.631 1.00 22.66 ? 122  GLN A CB  1 
ATOM   441  C  CG  . GLN A 1 58  ? -19.197 15.615  -11.518 1.00 24.88 ? 122  GLN A CG  1 
ATOM   442  C  CD  . GLN A 1 58  ? -17.734 15.172  -11.531 1.00 26.48 ? 122  GLN A CD  1 
ATOM   443  O  OE1 . GLN A 1 58  ? -17.036 15.262  -10.523 1.00 27.10 ? 122  GLN A OE1 1 
ATOM   444  N  NE2 . GLN A 1 58  ? -17.275 14.676  -12.672 1.00 27.19 ? 122  GLN A NE2 1 
ATOM   445  N  N   . TYR A 1 59  ? -20.748 19.308  -9.195  1.00 19.10 ? 123  TYR A N   1 
ATOM   446  C  CA  . TYR A 1 59  ? -20.986 20.063  -7.974  1.00 19.75 ? 123  TYR A CA  1 
ATOM   447  C  C   . TYR A 1 59  ? -22.457 20.389  -7.779  1.00 18.02 ? 123  TYR A C   1 
ATOM   448  O  O   . TYR A 1 59  ? -22.926 20.459  -6.652  1.00 18.52 ? 123  TYR A O   1 
ATOM   449  C  CB  . TYR A 1 59  ? -20.142 21.338  -7.942  1.00 19.32 ? 123  TYR A CB  1 
ATOM   450  C  CG  . TYR A 1 59  ? -18.718 21.052  -7.546  1.00 19.94 ? 123  TYR A CG  1 
ATOM   451  C  CD1 . TYR A 1 59  ? -17.752 20.765  -8.506  1.00 20.33 ? 123  TYR A CD1 1 
ATOM   452  C  CD2 . TYR A 1 59  ? -18.350 21.001  -6.201  1.00 20.03 ? 123  TYR A CD2 1 
ATOM   453  C  CE1 . TYR A 1 59  ? -16.451 20.430  -8.140  1.00 21.14 ? 123  TYR A CE1 1 
ATOM   454  C  CE2 . TYR A 1 59  ? -17.050 20.665  -5.824  1.00 21.14 ? 123  TYR A CE2 1 
ATOM   455  C  CZ  . TYR A 1 59  ? -16.109 20.383  -6.799  1.00 21.72 ? 123  TYR A CZ  1 
ATOM   456  O  OH  . TYR A 1 59  ? -14.823 20.067  -6.438  1.00 22.72 ? 123  TYR A OH  1 
ATOM   457  N  N   . ARG A 1 60  ? -23.185 20.592  -8.873  1.00 17.42 ? 124  ARG A N   1 
ATOM   458  C  CA  . ARG A 1 60  ? -24.608 20.866  -8.757  1.00 17.57 ? 124  ARG A CA  1 
ATOM   459  C  C   . ARG A 1 60  ? -25.258 19.635  -8.131  1.00 17.12 ? 124  ARG A C   1 
ATOM   460  O  O   . ARG A 1 60  ? -26.107 19.763  -7.263  1.00 17.93 ? 124  ARG A O   1 
ATOM   461  C  CB  . ARG A 1 60  ? -25.241 21.132  -10.129 1.00 17.50 ? 124  ARG A CB  1 
ATOM   462  C  CG  . ARG A 1 60  ? -26.733 21.495  -10.056 1.00 18.42 ? 124  ARG A CG  1 
ATOM   463  C  CD  . ARG A 1 60  ? -27.342 21.713  -11.444 1.00 18.27 ? 124  ARG A CD  1 
ATOM   464  N  NE  . ARG A 1 60  ? -27.411 20.471  -12.209 1.00 20.95 ? 124  ARG A NE  1 
ATOM   465  C  CZ  . ARG A 1 60  ? -28.227 19.460  -11.923 1.00 20.06 ? 124  ARG A CZ  1 
ATOM   466  N  NH1 . ARG A 1 60  ? -29.055 19.539  -10.891 1.00 19.00 ? 124  ARG A NH1 1 
ATOM   467  N  NH2 . ARG A 1 60  ? -28.211 18.364  -12.666 1.00 22.46 ? 124  ARG A NH2 1 
ATOM   468  N  N   . ARG A 1 61  ? -24.841 18.445  -8.565  1.00 17.90 ? 125  ARG A N   1 
ATOM   469  C  CA  . ARG A 1 61  ? -25.407 17.194  -8.046  1.00 17.71 ? 125  ARG A CA  1 
ATOM   470  C  C   . ARG A 1 61  ? -25.223 16.981  -6.542  1.00 17.16 ? 125  ARG A C   1 
ATOM   471  O  O   . ARG A 1 61  ? -25.935 16.182  -5.946  1.00 15.76 ? 125  ARG A O   1 
ATOM   472  C  CB  . ARG A 1 61  ? -24.840 15.982  -8.796  1.00 17.79 ? 125  ARG A CB  1 
ATOM   473  C  CG  . ARG A 1 61  ? -25.254 15.894  -10.267 1.00 19.11 ? 125  ARG A CG  1 
ATOM   474  C  CD  . ARG A 1 61  ? -26.764 15.782  -10.429 1.00 20.53 ? 125  ARG A CD  1 
ATOM   475  N  NE  . ARG A 1 61  ? -27.313 14.613  -9.745  1.00 22.05 ? 125  ARG A NE  1 
ATOM   476  C  CZ  . ARG A 1 61  ? -27.093 13.353  -10.110 1.00 21.81 ? 125  ARG A CZ  1 
ATOM   477  N  NH1 . ARG A 1 61  ? -26.329 13.082  -11.165 1.00 23.52 ? 125  ARG A NH1 1 
ATOM   478  N  NH2 . ARG A 1 61  ? -27.633 12.360  -9.417  1.00 22.25 ? 125  ARG A NH2 1 
ATOM   479  N  N   . ILE A 1 62  ? -24.270 17.679  -5.927  1.00 18.67 ? 126  ILE A N   1 
ATOM   480  C  CA  . ILE A 1 62  ? -24.077 17.528  -4.489  1.00 19.95 ? 126  ILE A CA  1 
ATOM   481  C  C   . ILE A 1 62  ? -24.563 18.740  -3.692  1.00 20.49 ? 126  ILE A C   1 
ATOM   482  O  O   . ILE A 1 62  ? -24.337 18.817  -2.485  1.00 21.86 ? 126  ILE A O   1 
ATOM   483  C  CB  . ILE A 1 62  ? -22.594 17.279  -4.107  1.00 21.11 ? 126  ILE A CB  1 
ATOM   484  C  CG1 . ILE A 1 62  ? -21.730 18.473  -4.526  1.00 20.98 ? 126  ILE A CG1 1 
ATOM   485  C  CG2 . ILE A 1 62  ? -22.104 15.983  -4.736  1.00 22.71 ? 126  ILE A CG2 1 
ATOM   486  C  CD1 . ILE A 1 62  ? -20.398 18.542  -3.792  1.00 19.08 ? 126  ILE A CD1 1 
ATOM   487  N  N   . GLY A 1 63  ? -25.218 19.693  -4.349  1.00 20.00 ? 127  GLY A N   1 
ATOM   488  C  CA  . GLY A 1 63  ? -25.705 20.845  -3.606  1.00 19.68 ? 127  GLY A CA  1 
ATOM   489  C  C   . GLY A 1 63  ? -25.266 22.224  -4.071  1.00 20.54 ? 127  GLY A C   1 
ATOM   490  O  O   . GLY A 1 63  ? -25.730 23.229  -3.526  1.00 20.58 ? 127  GLY A O   1 
ATOM   491  N  N   . GLY A 1 64  ? -24.370 22.287  -5.058  1.00 20.36 ? 128  GLY A N   1 
ATOM   492  C  CA  . GLY A 1 64  ? -23.936 23.579  -5.564  1.00 20.49 ? 128  GLY A CA  1 
ATOM   493  C  C   . GLY A 1 64  ? -22.538 24.053  -5.212  1.00 20.46 ? 128  GLY A C   1 
ATOM   494  O  O   . GLY A 1 64  ? -22.160 25.164  -5.586  1.00 21.44 ? 128  GLY A O   1 
ATOM   495  N  N   . GLY A 1 65  ? -21.768 23.231  -4.501  1.00 21.09 ? 129  GLY A N   1 
ATOM   496  C  CA  . GLY A 1 65  ? -20.419 23.626  -4.136  1.00 21.45 ? 129  GLY A CA  1 
ATOM   497  C  C   . GLY A 1 65  ? -19.771 22.736  -3.086  1.00 22.05 ? 129  GLY A C   1 
ATOM   498  O  O   . GLY A 1 65  ? -20.433 21.921  -2.451  1.00 23.32 ? 129  GLY A O   1 
ATOM   499  N  N   . SER A 1 66  ? -18.465 22.895  -2.905  1.00 22.00 ? 130  SER A N   1 
ATOM   500  C  CA  . SER A 1 66  ? -17.724 22.102  -1.931  1.00 22.04 ? 130  SER A CA  1 
ATOM   501  C  C   . SER A 1 66  ? -17.837 22.671  -0.520  1.00 19.04 ? 130  SER A C   1 
ATOM   502  O  O   . SER A 1 66  ? -17.879 23.881  -0.331  1.00 19.19 ? 130  SER A O   1 
ATOM   503  C  CB  . SER A 1 66  ? -16.248 22.029  -2.325  1.00 23.19 ? 130  SER A CB  1 
ATOM   504  O  OG  . SER A 1 66  ? -15.492 21.374  -1.319  1.00 25.33 ? 130  SER A OG  1 
ATOM   505  N  N   . PRO A 1 67  ? -17.909 21.794  0.489   1.00 18.90 ? 131  PRO A N   1 
ATOM   506  C  CA  . PRO A 1 67  ? -18.014 22.234  1.882   1.00 17.88 ? 131  PRO A CA  1 
ATOM   507  C  C   . PRO A 1 67  ? -16.648 22.303  2.568   1.00 17.53 ? 131  PRO A C   1 
ATOM   508  O  O   . PRO A 1 67  ? -16.558 22.625  3.750   1.00 18.09 ? 131  PRO A O   1 
ATOM   509  C  CB  . PRO A 1 67  ? -18.910 21.170  2.500   1.00 17.62 ? 131  PRO A CB  1 
ATOM   510  C  CG  . PRO A 1 67  ? -18.430 19.926  1.805   1.00 18.43 ? 131  PRO A CG  1 
ATOM   511  C  CD  . PRO A 1 67  ? -18.276 20.369  0.360   1.00 18.22 ? 131  PRO A CD  1 
ATOM   512  N  N   . ILE A 1 68  ? -15.590 22.014  1.819   1.00 18.68 ? 132  ILE A N   1 
ATOM   513  C  CA  . ILE A 1 68  ? -14.233 22.008  2.367   1.00 20.30 ? 132  ILE A CA  1 
ATOM   514  C  C   . ILE A 1 68  ? -13.874 23.208  3.249   1.00 19.38 ? 132  ILE A C   1 
ATOM   515  O  O   . ILE A 1 68  ? -13.342 23.030  4.343   1.00 17.95 ? 132  ILE A O   1 
ATOM   516  C  CB  . ILE A 1 68  ? -13.165 21.887  1.240   1.00 22.80 ? 132  ILE A CB  1 
ATOM   517  C  CG1 . ILE A 1 68  ? -13.421 20.633  0.404   1.00 27.44 ? 132  ILE A CG1 1 
ATOM   518  C  CG2 . ILE A 1 68  ? -11.772 21.765  1.851   1.00 25.54 ? 132  ILE A CG2 1 
ATOM   519  C  CD1 . ILE A 1 68  ? -12.513 20.505  -0.825  1.00 29.85 ? 132  ILE A CD1 1 
ATOM   520  N  N   . LYS A 1 69  ? -14.157 24.422  2.785   1.00 19.51 ? 133  LYS A N   1 
ATOM   521  C  CA  . LYS A 1 69  ? -13.822 25.602  3.573   1.00 21.67 ? 133  LYS A CA  1 
ATOM   522  C  C   . LYS A 1 69  ? -14.580 25.658  4.898   1.00 22.29 ? 133  LYS A C   1 
ATOM   523  O  O   . LYS A 1 69  ? -14.015 26.008  5.936   1.00 22.69 ? 133  LYS A O   1 
ATOM   524  C  CB  . LYS A 1 69  ? -14.078 26.887  2.778   1.00 22.85 ? 133  LYS A CB  1 
ATOM   525  C  CG  . LYS A 1 69  ? -13.683 28.137  3.563   1.00 28.02 ? 133  LYS A CG  1 
ATOM   526  C  CD  . LYS A 1 69  ? -13.766 29.411  2.738   1.00 29.86 ? 133  LYS A CD  1 
ATOM   527  C  CE  . LYS A 1 69  ? -13.276 30.602  3.552   1.00 32.58 ? 133  LYS A CE  1 
ATOM   528  N  NZ  . LYS A 1 69  ? -13.288 31.874  2.777   1.00 33.95 ? 133  LYS A NZ  1 
ATOM   529  N  N   . ILE A 1 70  ? -15.862 25.319  4.861   1.00 21.22 ? 134  ILE A N   1 
ATOM   530  C  CA  . ILE A 1 70  ? -16.680 25.319  6.069   1.00 21.91 ? 134  ILE A CA  1 
ATOM   531  C  C   . ILE A 1 70  ? -16.118 24.336  7.100   1.00 20.93 ? 134  ILE A C   1 
ATOM   532  O  O   . ILE A 1 70  ? -15.940 24.677  8.265   1.00 18.66 ? 134  ILE A O   1 
ATOM   533  C  CB  . ILE A 1 70  ? -18.119 24.914  5.749   1.00 23.53 ? 134  ILE A CB  1 
ATOM   534  C  CG1 . ILE A 1 70  ? -18.753 25.959  4.836   1.00 26.93 ? 134  ILE A CG1 1 
ATOM   535  C  CG2 . ILE A 1 70  ? -18.911 24.767  7.032   1.00 26.41 ? 134  ILE A CG2 1 
ATOM   536  C  CD1 . ILE A 1 70  ? -20.097 25.538  4.278   1.00 30.29 ? 134  ILE A CD1 1 
ATOM   537  N  N   . TRP A 1 71  ? -15.847 23.111  6.662   1.00 18.94 ? 135  TRP A N   1 
ATOM   538  C  CA  . TRP A 1 71  ? -15.305 22.097  7.554   1.00 18.56 ? 135  TRP A CA  1 
ATOM   539  C  C   . TRP A 1 71  ? -13.889 22.447  8.020   1.00 16.77 ? 135  TRP A C   1 
ATOM   540  O  O   . TRP A 1 71  ? -13.557 22.235  9.181   1.00 15.94 ? 135  TRP A O   1 
ATOM   541  C  CB  . TRP A 1 71  ? -15.326 20.726  6.867   1.00 18.74 ? 135  TRP A CB  1 
ATOM   542  C  CG  . TRP A 1 71  ? -16.716 20.115  6.779   1.00 18.91 ? 135  TRP A CG  1 
ATOM   543  C  CD1 . TRP A 1 71  ? -17.335 19.651  5.660   1.00 20.14 ? 135  TRP A CD1 1 
ATOM   544  C  CD2 . TRP A 1 71  ? -17.644 19.926  7.859   1.00 20.35 ? 135  TRP A CD2 1 
ATOM   545  N  NE1 . TRP A 1 71  ? -18.592 19.189  5.969   1.00 22.15 ? 135  TRP A NE1 1 
ATOM   546  C  CE2 . TRP A 1 71  ? -18.807 19.344  7.312   1.00 21.74 ? 135  TRP A CE2 1 
ATOM   547  C  CE3 . TRP A 1 71  ? -17.604 20.192  9.235   1.00 22.60 ? 135  TRP A CE3 1 
ATOM   548  C  CZ2 . TRP A 1 71  ? -19.927 19.021  8.090   1.00 22.57 ? 135  TRP A CZ2 1 
ATOM   549  C  CZ3 . TRP A 1 71  ? -18.721 19.870  10.013  1.00 23.26 ? 135  TRP A CZ3 1 
ATOM   550  C  CH2 . TRP A 1 71  ? -19.865 19.290  9.434   1.00 22.19 ? 135  TRP A CH2 1 
ATOM   551  N  N   . THR A 1 72  ? -13.064 22.989  7.124   1.00 17.87 ? 136  THR A N   1 
ATOM   552  C  CA  . THR A 1 72  ? -11.695 23.367  7.486   1.00 19.15 ? 136  THR A CA  1 
ATOM   553  C  C   . THR A 1 72  ? -11.729 24.472  8.545   1.00 19.68 ? 136  THR A C   1 
ATOM   554  O  O   . THR A 1 72  ? -10.971 24.434  9.519   1.00 19.08 ? 136  THR A O   1 
ATOM   555  C  CB  . THR A 1 72  ? -10.879 23.883  6.261   1.00 16.49 ? 136  THR A CB  1 
ATOM   556  O  OG1 . THR A 1 72  ? -10.778 22.852  5.273   1.00 20.20 ? 136  THR A OG1 1 
ATOM   557  C  CG2 . THR A 1 72  ? -9.470  24.267  6.684   1.00 17.70 ? 136  THR A CG2 1 
ATOM   558  N  N   . SER A 1 73  ? -12.612 25.450  8.344   1.00 19.96 ? 137  SER A N   1 
ATOM   559  C  CA  . SER A 1 73  ? -12.763 26.566  9.276   1.00 21.47 ? 137  SER A CA  1 
ATOM   560  C  C   . SER A 1 73  ? -13.169 26.087  10.659  1.00 21.67 ? 137  SER A C   1 
ATOM   561  O  O   . SER A 1 73  ? -12.625 26.543  11.663  1.00 21.31 ? 137  SER A O   1 
ATOM   562  C  CB  . SER A 1 73  ? -13.817 27.560  8.767   1.00 22.63 ? 137  SER A CB  1 
ATOM   563  O  OG  . SER A 1 73  ? -13.365 28.238  7.607   1.00 25.46 ? 137  SER A OG  1 
ATOM   564  N  N   . LYS A 1 74  ? -14.126 25.165  10.706  1.00 21.35 ? 138  LYS A N   1 
ATOM   565  C  CA  . LYS A 1 74  ? -14.608 24.641  11.976  1.00 23.23 ? 138  LYS A CA  1 
ATOM   566  C  C   . LYS A 1 74  ? -13.541 23.818  12.690  1.00 23.18 ? 138  LYS A C   1 
ATOM   567  O  O   . LYS A 1 74  ? -13.415 23.878  13.915  1.00 22.36 ? 138  LYS A O   1 
ATOM   568  C  CB  . LYS A 1 74  ? -15.862 23.790  11.761  1.00 24.78 ? 138  LYS A CB  1 
ATOM   569  C  CG  . LYS A 1 74  ? -16.469 23.280  13.057  1.00 30.80 ? 138  LYS A CG  1 
ATOM   570  C  CD  . LYS A 1 74  ? -17.691 22.404  12.814  1.00 35.72 ? 138  LYS A CD  1 
ATOM   571  C  CE  . LYS A 1 74  ? -18.207 21.826  14.129  1.00 38.85 ? 138  LYS A CE  1 
ATOM   572  N  NZ  . LYS A 1 74  ? -19.387 20.928  13.937  1.00 41.56 ? 138  LYS A NZ  1 
ATOM   573  N  N   . GLN A 1 75  ? -12.774 23.048  11.924  1.00 23.39 ? 139  GLN A N   1 
ATOM   574  C  CA  . GLN A 1 75  ? -11.718 22.233  12.506  1.00 21.86 ? 139  GLN A CA  1 
ATOM   575  C  C   . GLN A 1 75  ? -10.606 23.143  13.010  1.00 21.88 ? 139  GLN A C   1 
ATOM   576  O  O   . GLN A 1 75  ? -10.058 22.926  14.084  1.00 21.72 ? 139  GLN A O   1 
ATOM   577  C  CB  . GLN A 1 75  ? -11.164 21.258  11.466  1.00 21.90 ? 139  GLN A CB  1 
ATOM   578  C  CG  . GLN A 1 75  ? -12.198 20.266  10.948  1.00 22.93 ? 139  GLN A CG  1 
ATOM   579  C  CD  . GLN A 1 75  ? -11.708 19.484  9.745   1.00 23.61 ? 139  GLN A CD  1 
ATOM   580  O  OE1 . GLN A 1 75  ? -10.874 19.966  8.979   1.00 24.44 ? 139  GLN A OE1 1 
ATOM   581  N  NE2 . GLN A 1 75  ? -12.245 18.279  9.559   1.00 23.97 ? 139  GLN A NE2 1 
ATOM   582  N  N   . GLY A 1 76  ? -10.286 24.168  12.227  1.00 21.68 ? 140  GLY A N   1 
ATOM   583  C  CA  . GLY A 1 76  ? -9.237  25.094  12.606  1.00 22.30 ? 140  GLY A CA  1 
ATOM   584  C  C   . GLY A 1 76  ? -9.579  25.854  13.870  1.00 21.83 ? 140  GLY A C   1 
ATOM   585  O  O   . GLY A 1 76  ? -8.747  25.989  14.767  1.00 20.25 ? 140  GLY A O   1 
ATOM   586  N  N   . GLU A 1 77  ? -10.811 26.347  13.939  1.00 23.60 ? 141  GLU A N   1 
ATOM   587  C  CA  . GLU A 1 77  ? -11.282 27.096  15.098  1.00 24.89 ? 141  GLU A CA  1 
ATOM   588  C  C   . GLU A 1 77  ? -11.254 26.218  16.339  1.00 24.28 ? 141  GLU A C   1 
ATOM   589  O  O   . GLU A 1 77  ? -10.872 26.665  17.424  1.00 23.38 ? 141  GLU A O   1 
ATOM   590  C  CB  . GLU A 1 77  ? -12.704 27.610  14.844  1.00 29.60 ? 141  GLU A CB  1 
ATOM   591  C  CG  . GLU A 1 77  ? -12.757 28.807  13.905  1.00 35.27 ? 141  GLU A CG  1 
ATOM   592  C  CD  . GLU A 1 77  ? -14.137 29.045  13.311  1.00 40.24 ? 141  GLU A CD  1 
ATOM   593  O  OE1 . GLU A 1 77  ? -15.145 28.863  14.036  1.00 40.83 ? 141  GLU A OE1 1 
ATOM   594  O  OE2 . GLU A 1 77  ? -14.210 29.429  12.120  1.00 41.39 ? 141  GLU A OE2 1 
ATOM   595  N  N   . GLY A 1 78  ? -11.656 24.962  16.176  1.00 23.29 ? 142  GLY A N   1 
ATOM   596  C  CA  . GLY A 1 78  ? -11.655 24.048  17.299  1.00 21.89 ? 142  GLY A CA  1 
ATOM   597  C  C   . GLY A 1 78  ? -10.227 23.791  17.737  1.00 22.09 ? 142  GLY A C   1 
ATOM   598  O  O   . GLY A 1 78  ? -9.930  23.726  18.930  1.00 19.76 ? 142  GLY A O   1 
ATOM   599  N  N   . MET A 1 79  ? -9.341  23.646  16.757  1.00 20.94 ? 143  MET A N   1 
ATOM   600  C  CA  . MET A 1 79  ? -7.930  23.400  17.016  1.00 21.26 ? 143  MET A CA  1 
ATOM   601  C  C   . MET A 1 79  ? -7.342  24.547  17.838  1.00 21.51 ? 143  MET A C   1 
ATOM   602  O  O   . MET A 1 79  ? -6.702  24.323  18.864  1.00 21.06 ? 143  MET A O   1 
ATOM   603  C  CB  . MET A 1 79  ? -7.176  23.272  15.687  1.00 19.49 ? 143  MET A CB  1 
ATOM   604  C  CG  . MET A 1 79  ? -5.657  23.257  15.822  1.00 22.58 ? 143  MET A CG  1 
ATOM   605  S  SD  . MET A 1 79  ? -4.803  23.214  14.233  1.00 24.29 ? 143  MET A SD  1 
ATOM   606  C  CE  . MET A 1 79  ? -5.076  24.861  13.664  1.00 25.94 ? 143  MET A CE  1 
ATOM   607  N  N   . VAL A 1 80  ? -7.569  25.775  17.375  1.00 22.88 ? 144  VAL A N   1 
ATOM   608  C  CA  . VAL A 1 80  ? -7.059  26.968  18.045  1.00 23.85 ? 144  VAL A CA  1 
ATOM   609  C  C   . VAL A 1 80  ? -7.554  27.086  19.480  1.00 24.62 ? 144  VAL A C   1 
ATOM   610  O  O   . VAL A 1 80  ? -6.781  27.405  20.379  1.00 26.61 ? 144  VAL A O   1 
ATOM   611  C  CB  . VAL A 1 80  ? -7.438  28.253  17.257  1.00 22.61 ? 144  VAL A CB  1 
ATOM   612  C  CG1 . VAL A 1 80  ? -7.234  29.491  18.119  1.00 23.96 ? 144  VAL A CG1 1 
ATOM   613  C  CG2 . VAL A 1 80  ? -6.583  28.350  16.003  1.00 19.03 ? 144  VAL A CG2 1 
ATOM   614  N  N   . LYS A 1 81  ? -8.837  26.821  19.694  1.00 25.45 ? 145  LYS A N   1 
ATOM   615  C  CA  . LYS A 1 81  ? -9.402  26.907  21.032  1.00 26.74 ? 145  LYS A CA  1 
ATOM   616  C  C   . LYS A 1 81  ? -8.598  26.023  21.975  1.00 25.37 ? 145  LYS A C   1 
ATOM   617  O  O   . LYS A 1 81  ? -8.258  26.437  23.082  1.00 26.26 ? 145  LYS A O   1 
ATOM   618  C  CB  . LYS A 1 81  ? -10.868 26.461  21.034  1.00 28.57 ? 145  LYS A CB  1 
ATOM   619  C  CG  . LYS A 1 81  ? -11.632 26.895  22.278  1.00 33.68 ? 145  LYS A CG  1 
ATOM   620  C  CD  . LYS A 1 81  ? -13.009 26.240  22.384  1.00 37.04 ? 145  LYS A CD  1 
ATOM   621  C  CE  . LYS A 1 81  ? -12.928 24.822  22.961  1.00 38.89 ? 145  LYS A CE  1 
ATOM   622  N  NZ  . LYS A 1 81  ? -12.173 23.863  22.096  1.00 41.83 ? 145  LYS A NZ  1 
ATOM   623  N  N   . LEU A 1 82  ? -8.290  24.809  21.529  1.00 24.58 ? 146  LEU A N   1 
ATOM   624  C  CA  . LEU A 1 82  ? -7.520  23.866  22.336  1.00 26.14 ? 146  LEU A CA  1 
ATOM   625  C  C   . LEU A 1 82  ? -6.061  24.281  22.495  1.00 25.16 ? 146  LEU A C   1 
ATOM   626  O  O   . LEU A 1 82  ? -5.518  24.226  23.596  1.00 25.43 ? 146  LEU A O   1 
ATOM   627  C  CB  . LEU A 1 82  ? -7.575  22.461  21.726  1.00 25.69 ? 146  LEU A CB  1 
ATOM   628  C  CG  . LEU A 1 82  ? -8.942  21.775  21.677  1.00 28.25 ? 146  LEU A CG  1 
ATOM   629  C  CD1 . LEU A 1 82  ? -8.830  20.464  20.909  1.00 27.73 ? 146  LEU A CD1 1 
ATOM   630  C  CD2 . LEU A 1 82  ? -9.451  21.537  23.103  1.00 27.72 ? 146  LEU A CD2 1 
ATOM   631  N  N   . LEU A 1 83  ? -5.426  24.693  21.400  1.00 25.08 ? 147  LEU A N   1 
ATOM   632  C  CA  . LEU A 1 83  ? -4.023  25.096  21.459  1.00 26.80 ? 147  LEU A CA  1 
ATOM   633  C  C   . LEU A 1 83  ? -3.751  26.210  22.461  1.00 28.11 ? 147  LEU A C   1 
ATOM   634  O  O   . LEU A 1 83  ? -2.740  26.184  23.161  1.00 27.85 ? 147  LEU A O   1 
ATOM   635  C  CB  . LEU A 1 83  ? -3.524  25.513  20.075  1.00 26.07 ? 147  LEU A CB  1 
ATOM   636  C  CG  . LEU A 1 83  ? -3.157  24.350  19.147  1.00 25.65 ? 147  LEU A CG  1 
ATOM   637  C  CD1 . LEU A 1 83  ? -2.745  24.889  17.784  1.00 26.30 ? 147  LEU A CD1 1 
ATOM   638  C  CD2 . LEU A 1 83  ? -2.028  23.540  19.764  1.00 24.11 ? 147  LEU A CD2 1 
ATOM   639  N  N   . ASP A 1 84  ? -4.648  27.187  22.531  1.00 29.39 ? 148  ASP A N   1 
ATOM   640  C  CA  . ASP A 1 84  ? -4.477  28.289  23.466  1.00 31.53 ? 148  ASP A CA  1 
ATOM   641  C  C   . ASP A 1 84  ? -4.380  27.778  24.902  1.00 32.33 ? 148  ASP A C   1 
ATOM   642  O  O   . ASP A 1 84  ? -3.690  28.371  25.729  1.00 33.21 ? 148  ASP A O   1 
ATOM   643  C  CB  . ASP A 1 84  ? -5.631  29.292  23.340  1.00 31.78 ? 148  ASP A CB  1 
ATOM   644  C  CG  . ASP A 1 84  ? -5.506  30.174  22.107  1.00 32.97 ? 148  ASP A CG  1 
ATOM   645  O  OD1 . ASP A 1 84  ? -4.441  30.141  21.457  1.00 32.83 ? 148  ASP A OD1 1 
ATOM   646  O  OD2 . ASP A 1 84  ? -6.466  30.909  21.790  1.00 34.35 ? 148  ASP A OD2 1 
ATOM   647  N  N   . GLU A 1 85  ? -5.058  26.672  25.191  1.00 32.53 ? 149  GLU A N   1 
ATOM   648  C  CA  . GLU A 1 85  ? -5.029  26.093  26.528  1.00 33.65 ? 149  GLU A CA  1 
ATOM   649  C  C   . GLU A 1 85  ? -3.881  25.093  26.669  1.00 33.31 ? 149  GLU A C   1 
ATOM   650  O  O   . GLU A 1 85  ? -3.269  24.990  27.730  1.00 34.31 ? 149  GLU A O   1 
ATOM   651  C  CB  . GLU A 1 85  ? -6.361  25.402  26.836  1.00 35.54 ? 149  GLU A CB  1 
ATOM   652  C  CG  . GLU A 1 85  ? -7.582  26.284  26.630  1.00 38.82 ? 149  GLU A CG  1 
ATOM   653  C  CD  . GLU A 1 85  ? -7.573  27.536  27.497  1.00 42.73 ? 149  GLU A CD  1 
ATOM   654  O  OE1 . GLU A 1 85  ? -8.385  28.449  27.224  1.00 43.55 ? 149  GLU A OE1 1 
ATOM   655  O  OE2 . GLU A 1 85  ? -6.765  27.609  28.452  1.00 43.82 ? 149  GLU A OE2 1 
ATOM   656  N  N   . LEU A 1 86  ? -3.592  24.364  25.595  1.00 32.86 ? 150  LEU A N   1 
ATOM   657  C  CA  . LEU A 1 86  ? -2.512  23.380  25.594  1.00 32.17 ? 150  LEU A CA  1 
ATOM   658  C  C   . LEU A 1 86  ? -1.124  24.003  25.660  1.00 31.82 ? 150  LEU A C   1 
ATOM   659  O  O   . LEU A 1 86  ? -0.264  23.536  26.407  1.00 32.41 ? 150  LEU A O   1 
ATOM   660  C  CB  . LEU A 1 86  ? -2.578  22.506  24.339  1.00 31.56 ? 150  LEU A CB  1 
ATOM   661  C  CG  . LEU A 1 86  ? -3.496  21.285  24.304  1.00 31.57 ? 150  LEU A CG  1 
ATOM   662  C  CD1 . LEU A 1 86  ? -3.496  20.698  22.901  1.00 30.34 ? 150  LEU A CD1 1 
ATOM   663  C  CD2 . LEU A 1 86  ? -3.016  20.249  25.313  1.00 31.78 ? 150  LEU A CD2 1 
ATOM   664  N  N   . SER A 1 87  ? -0.904  25.052  24.873  1.00 31.67 ? 151  SER A N   1 
ATOM   665  C  CA  . SER A 1 87  ? 0.401   25.697  24.828  1.00 31.83 ? 151  SER A CA  1 
ATOM   666  C  C   . SER A 1 87  ? 0.343   27.207  25.068  1.00 32.13 ? 151  SER A C   1 
ATOM   667  O  O   . SER A 1 87  ? 0.492   28.004  24.138  1.00 31.22 ? 151  SER A O   1 
ATOM   668  C  CB  . SER A 1 87  ? 1.061   25.399  23.477  1.00 31.46 ? 151  SER A CB  1 
ATOM   669  O  OG  . SER A 1 87  ? 2.355   25.972  23.385  1.00 34.40 ? 151  SER A OG  1 
ATOM   670  N  N   . PRO A 1 88  ? 0.145   27.618  26.331  1.00 32.57 ? 152  PRO A N   1 
ATOM   671  C  CA  . PRO A 1 88  ? 0.067   29.034  26.704  1.00 33.11 ? 152  PRO A CA  1 
ATOM   672  C  C   . PRO A 1 88  ? 1.296   29.808  26.237  1.00 34.02 ? 152  PRO A C   1 
ATOM   673  O  O   . PRO A 1 88  ? 1.197   30.963  25.826  1.00 33.39 ? 152  PRO A O   1 
ATOM   674  C  CB  . PRO A 1 88  ? -0.025  28.988  28.230  1.00 34.12 ? 152  PRO A CB  1 
ATOM   675  C  CG  . PRO A 1 88  ? -0.659  27.653  28.507  1.00 33.58 ? 152  PRO A CG  1 
ATOM   676  C  CD  . PRO A 1 88  ? 0.055   26.757  27.524  1.00 33.59 ? 152  PRO A CD  1 
ATOM   677  N  N   . ASN A 1 89  ? 2.453   29.158  26.301  1.00 34.73 ? 153  ASN A N   1 
ATOM   678  C  CA  . ASN A 1 89  ? 3.708   29.783  25.896  1.00 36.19 ? 153  ASN A CA  1 
ATOM   679  C  C   . ASN A 1 89  ? 3.736   30.229  24.438  1.00 35.58 ? 153  ASN A C   1 
ATOM   680  O  O   . ASN A 1 89  ? 4.448   31.170  24.092  1.00 35.44 ? 153  ASN A O   1 
ATOM   681  C  CB  . ASN A 1 89  ? 4.882   28.834  26.163  1.00 39.19 ? 153  ASN A CB  1 
ATOM   682  C  CG  . ASN A 1 89  ? 5.157   28.649  27.647  1.00 42.53 ? 153  ASN A CG  1 
ATOM   683  O  OD1 . ASN A 1 89  ? 5.394   29.618  28.369  1.00 43.79 ? 153  ASN A OD1 1 
ATOM   684  N  ND2 . ASN A 1 89  ? 5.129   27.400  28.108  1.00 44.29 ? 153  ASN A ND2 1 
ATOM   685  N  N   . THR A 1 90  ? 2.971   29.561  23.581  1.00 34.86 ? 154  THR A N   1 
ATOM   686  C  CA  . THR A 1 90  ? 2.953   29.933  22.171  1.00 34.17 ? 154  THR A CA  1 
ATOM   687  C  C   . THR A 1 90  ? 1.649   30.605  21.748  1.00 33.47 ? 154  THR A C   1 
ATOM   688  O  O   . THR A 1 90  ? 1.401   30.809  20.561  1.00 34.05 ? 154  THR A O   1 
ATOM   689  C  CB  . THR A 1 90  ? 3.216   28.707  21.258  1.00 35.31 ? 154  THR A CB  1 
ATOM   690  O  OG1 . THR A 1 90  ? 2.225   27.697  21.493  1.00 35.92 ? 154  THR A OG1 1 
ATOM   691  C  CG2 . THR A 1 90  ? 4.599   28.132  21.533  1.00 36.27 ? 154  THR A CG2 1 
ATOM   692  N  N   . ALA A 1 91  ? 0.819   30.957  22.722  1.00 33.04 ? 155  ALA A N   1 
ATOM   693  C  CA  . ALA A 1 91  ? -0.449  31.613  22.433  1.00 32.34 ? 155  ALA A CA  1 
ATOM   694  C  C   . ALA A 1 91  ? -0.260  33.127  22.298  1.00 31.89 ? 155  ALA A C   1 
ATOM   695  O  O   . ALA A 1 91  ? 0.740   33.683  22.753  1.00 32.08 ? 155  ALA A O   1 
ATOM   696  C  CB  . ALA A 1 91  ? -1.462  31.304  23.535  1.00 33.25 ? 155  ALA A CB  1 
ATOM   697  N  N   . PRO A 1 92  ? -1.220  33.810  21.658  1.00 31.24 ? 156  PRO A N   1 
ATOM   698  C  CA  . PRO A 1 92  ? -2.425  33.201  21.086  1.00 30.87 ? 156  PRO A CA  1 
ATOM   699  C  C   . PRO A 1 92  ? -2.151  32.562  19.731  1.00 29.46 ? 156  PRO A C   1 
ATOM   700  O  O   . PRO A 1 92  ? -1.251  32.986  19.003  1.00 28.92 ? 156  PRO A O   1 
ATOM   701  C  CB  . PRO A 1 92  ? -3.390  34.378  20.991  1.00 31.54 ? 156  PRO A CB  1 
ATOM   702  C  CG  . PRO A 1 92  ? -2.476  35.512  20.666  1.00 33.29 ? 156  PRO A CG  1 
ATOM   703  C  CD  . PRO A 1 92  ? -1.293  35.281  21.590  1.00 32.05 ? 156  PRO A CD  1 
ATOM   704  N  N   . HIS A 1 93  ? -2.920  31.534  19.396  1.00 27.52 ? 157  HIS A N   1 
ATOM   705  C  CA  . HIS A 1 93  ? -2.736  30.871  18.115  1.00 27.31 ? 157  HIS A CA  1 
ATOM   706  C  C   . HIS A 1 93  ? -3.807  31.319  17.142  1.00 27.16 ? 157  HIS A C   1 
ATOM   707  O  O   . HIS A 1 93  ? -4.917  31.654  17.540  1.00 29.20 ? 157  HIS A O   1 
ATOM   708  C  CB  . HIS A 1 93  ? -2.802  29.358  18.278  1.00 24.64 ? 157  HIS A CB  1 
ATOM   709  C  CG  . HIS A 1 93  ? -1.815  28.816  19.261  1.00 23.85 ? 157  HIS A CG  1 
ATOM   710  N  ND1 . HIS A 1 93  ? -1.996  28.907  20.623  1.00 23.79 ? 157  HIS A ND1 1 
ATOM   711  C  CD2 . HIS A 1 93  ? -0.628  28.191  19.079  1.00 23.84 ? 157  HIS A CD2 1 
ATOM   712  C  CE1 . HIS A 1 93  ? -0.963  28.361  21.239  1.00 23.99 ? 157  HIS A CE1 1 
ATOM   713  N  NE2 . HIS A 1 93  ? -0.119  27.919  20.325  1.00 24.81 ? 157  HIS A NE2 1 
ATOM   714  N  N   . LYS A 1 94  ? -3.467  31.321  15.862  1.00 26.43 ? 158  LYS A N   1 
ATOM   715  C  CA  . LYS A 1 94  ? -4.410  31.711  14.832  1.00 24.51 ? 158  LYS A CA  1 
ATOM   716  C  C   . LYS A 1 94  ? -4.246  30.762  13.650  1.00 23.53 ? 158  LYS A C   1 
ATOM   717  O  O   . LYS A 1 94  ? -3.124  30.435  13.253  1.00 24.39 ? 158  LYS A O   1 
ATOM   718  C  CB  . LYS A 1 94  ? -4.147  33.154  14.394  1.00 23.77 ? 158  LYS A CB  1 
ATOM   719  C  CG  . LYS A 1 94  ? -5.203  33.709  13.464  1.00 25.19 ? 158  LYS A CG  1 
ATOM   720  C  CD  . LYS A 1 94  ? -4.861  35.115  12.985  1.00 27.58 ? 158  LYS A CD  1 
ATOM   721  C  CE  . LYS A 1 94  ? -5.862  35.580  11.937  1.00 27.35 ? 158  LYS A CE  1 
ATOM   722  N  NZ  . LYS A 1 94  ? -5.510  36.906  11.357  1.00 32.10 ? 158  LYS A NZ  1 
ATOM   723  N  N   . TYR A 1 95  ? -5.362  30.306  13.095  1.00 20.79 ? 159  TYR A N   1 
ATOM   724  C  CA  . TYR A 1 95  ? -5.308  29.402  11.959  1.00 19.20 ? 159  TYR A CA  1 
ATOM   725  C  C   . TYR A 1 95  ? -5.558  30.188  10.686  1.00 19.02 ? 159  TYR A C   1 
ATOM   726  O  O   . TYR A 1 95  ? -6.309  31.164  10.685  1.00 19.45 ? 159  TYR A O   1 
ATOM   727  C  CB  . TYR A 1 95  ? -6.359  28.287  12.096  1.00 18.58 ? 159  TYR A CB  1 
ATOM   728  C  CG  . TYR A 1 95  ? -7.765  28.671  11.657  1.00 19.97 ? 159  TYR A CG  1 
ATOM   729  C  CD1 . TYR A 1 95  ? -8.149  28.587  10.313  1.00 19.29 ? 159  TYR A CD1 1 
ATOM   730  C  CD2 . TYR A 1 95  ? -8.709  29.119  12.581  1.00 18.31 ? 159  TYR A CD2 1 
ATOM   731  C  CE1 . TYR A 1 95  ? -9.440  28.938  9.904   1.00 21.84 ? 159  TYR A CE1 1 
ATOM   732  C  CE2 . TYR A 1 95  ? -10.002 29.475  12.185  1.00 20.08 ? 159  TYR A CE2 1 
ATOM   733  C  CZ  . TYR A 1 95  ? -10.361 29.383  10.845  1.00 21.61 ? 159  TYR A CZ  1 
ATOM   734  O  OH  . TYR A 1 95  ? -11.628 29.742  10.447  1.00 24.14 ? 159  TYR A OH  1 
ATOM   735  N  N   . TYR A 1 96  ? -4.914  29.761  9.609   1.00 18.34 ? 160  TYR A N   1 
ATOM   736  C  CA  . TYR A 1 96  ? -5.078  30.384  8.309   1.00 18.75 ? 160  TYR A CA  1 
ATOM   737  C  C   . TYR A 1 96  ? -5.335  29.259  7.329   1.00 18.24 ? 160  TYR A C   1 
ATOM   738  O  O   . TYR A 1 96  ? -4.749  28.184  7.440   1.00 20.03 ? 160  TYR A O   1 
ATOM   739  C  CB  . TYR A 1 96  ? -3.814  31.143  7.881   1.00 19.93 ? 160  TYR A CB  1 
ATOM   740  C  CG  . TYR A 1 96  ? -3.393  32.236  8.834   1.00 21.50 ? 160  TYR A CG  1 
ATOM   741  C  CD1 . TYR A 1 96  ? -2.805  31.925  10.057  1.00 19.99 ? 160  TYR A CD1 1 
ATOM   742  C  CD2 . TYR A 1 96  ? -3.567  33.584  8.508   1.00 21.35 ? 160  TYR A CD2 1 
ATOM   743  C  CE1 . TYR A 1 96  ? -2.398  32.918  10.930  1.00 22.12 ? 160  TYR A CE1 1 
ATOM   744  C  CE2 . TYR A 1 96  ? -3.159  34.593  9.379   1.00 22.89 ? 160  TYR A CE2 1 
ATOM   745  C  CZ  . TYR A 1 96  ? -2.571  34.246  10.592  1.00 22.44 ? 160  TYR A CZ  1 
ATOM   746  O  OH  . TYR A 1 96  ? -2.128  35.217  11.460  1.00 24.85 ? 160  TYR A OH  1 
ATOM   747  N  N   . ILE A 1 97  ? -6.216  29.505  6.375   1.00 18.61 ? 161  ILE A N   1 
ATOM   748  C  CA  . ILE A 1 97  ? -6.533  28.509  5.375   1.00 17.83 ? 161  ILE A CA  1 
ATOM   749  C  C   . ILE A 1 97  ? -5.759  28.821  4.102   1.00 17.86 ? 161  ILE A C   1 
ATOM   750  O  O   . ILE A 1 97  ? -5.860  29.914  3.549   1.00 18.50 ? 161  ILE A O   1 
ATOM   751  C  CB  . ILE A 1 97  ? -8.040  28.493  5.084   1.00 19.22 ? 161  ILE A CB  1 
ATOM   752  C  CG1 . ILE A 1 97  ? -8.792  28.024  6.334   1.00 19.37 ? 161  ILE A CG1 1 
ATOM   753  C  CG2 . ILE A 1 97  ? -8.334  27.611  3.883   1.00 14.66 ? 161  ILE A CG2 1 
ATOM   754  C  CD1 . ILE A 1 97  ? -10.300 27.986  6.164   1.00 19.87 ? 161  ILE A CD1 1 
ATOM   755  N  N   . GLY A 1 98  ? -4.969  27.853  3.660   1.00 17.79 ? 162  GLY A N   1 
ATOM   756  C  CA  . GLY A 1 98  ? -4.187  28.025  2.457   1.00 17.58 ? 162  GLY A CA  1 
ATOM   757  C  C   . GLY A 1 98  ? -4.567  26.953  1.457   1.00 18.94 ? 162  GLY A C   1 
ATOM   758  O  O   . GLY A 1 98  ? -3.996  25.858  1.463   1.00 19.49 ? 162  GLY A O   1 
ATOM   759  N  N   . PHE A 1 99  ? -5.557  27.254  0.619   1.00 20.17 ? 163  PHE A N   1 
ATOM   760  C  CA  . PHE A 1 99  ? -5.989  26.311  -0.400  1.00 20.73 ? 163  PHE A CA  1 
ATOM   761  C  C   . PHE A 1 99  ? -5.063  26.494  -1.586  1.00 21.52 ? 163  PHE A C   1 
ATOM   762  O  O   . PHE A 1 99  ? -4.691  27.611  -1.938  1.00 23.90 ? 163  PHE A O   1 
ATOM   763  C  CB  . PHE A 1 99  ? -7.439  26.573  -0.814  1.00 19.11 ? 163  PHE A CB  1 
ATOM   764  C  CG  . PHE A 1 99  ? -8.452  26.124  0.205   1.00 18.96 ? 163  PHE A CG  1 
ATOM   765  C  CD1 . PHE A 1 99  ? -9.689  26.745  0.287   1.00 18.28 ? 163  PHE A CD1 1 
ATOM   766  C  CD2 . PHE A 1 99  ? -8.177  25.061  1.066   1.00 20.09 ? 163  PHE A CD2 1 
ATOM   767  C  CE1 . PHE A 1 99  ? -10.642 26.318  1.209   1.00 20.67 ? 163  PHE A CE1 1 
ATOM   768  C  CE2 . PHE A 1 99  ? -9.125  24.625  1.994   1.00 19.33 ? 163  PHE A CE2 1 
ATOM   769  C  CZ  . PHE A 1 99  ? -10.357 25.254  2.065   1.00 19.55 ? 163  PHE A CZ  1 
ATOM   770  N  N   . ARG A 1 100 ? -4.685  25.380  -2.191  1.00 20.79 ? 164  ARG A N   1 
ATOM   771  C  CA  . ARG A 1 100 ? -3.787  25.396  -3.326  1.00 20.50 ? 164  ARG A CA  1 
ATOM   772  C  C   . ARG A 1 100 ? -4.396  25.983  -4.591  1.00 20.84 ? 164  ARG A C   1 
ATOM   773  O  O   . ARG A 1 100 ? -3.747  26.762  -5.275  1.00 20.81 ? 164  ARG A O   1 
ATOM   774  C  CB  . ARG A 1 100 ? -3.319  23.970  -3.631  1.00 20.83 ? 164  ARG A CB  1 
ATOM   775  C  CG  . ARG A 1 100 ? -2.187  23.884  -4.633  1.00 23.50 ? 164  ARG A CG  1 
ATOM   776  C  CD  . ARG A 1 100 ? -0.866  24.266  -3.998  1.00 23.93 ? 164  ARG A CD  1 
ATOM   777  N  NE  . ARG A 1 100 ? 0.238   24.197  -4.952  1.00 27.28 ? 164  ARG A NE  1 
ATOM   778  C  CZ  . ARG A 1 100 ? 0.487   25.110  -5.886  1.00 28.47 ? 164  ARG A CZ  1 
ATOM   779  N  NH1 . ARG A 1 100 ? -0.284  26.183  -6.001  1.00 28.98 ? 164  ARG A NH1 1 
ATOM   780  N  NH2 . ARG A 1 100 ? 1.505   24.939  -6.717  1.00 30.08 ? 164  ARG A NH2 1 
ATOM   781  N  N   . TYR A 1 101 ? -5.643  25.624  -4.895  1.00 20.13 ? 165  TYR A N   1 
ATOM   782  C  CA  . TYR A 1 101 ? -6.262  26.071  -6.140  1.00 20.83 ? 165  TYR A CA  1 
ATOM   783  C  C   . TYR A 1 101 ? -7.487  26.986  -6.104  1.00 20.99 ? 165  TYR A C   1 
ATOM   784  O  O   . TYR A 1 101 ? -8.033  27.320  -7.158  1.00 21.38 ? 165  TYR A O   1 
ATOM   785  C  CB  . TYR A 1 101 ? -6.571  24.845  -7.003  1.00 20.74 ? 165  TYR A CB  1 
ATOM   786  C  CG  . TYR A 1 101 ? -5.371  23.937  -7.190  1.00 22.52 ? 165  TYR A CG  1 
ATOM   787  C  CD1 . TYR A 1 101 ? -5.340  22.660  -6.627  1.00 24.03 ? 165  TYR A CD1 1 
ATOM   788  C  CD2 . TYR A 1 101 ? -4.257  24.366  -7.902  1.00 22.78 ? 165  TYR A CD2 1 
ATOM   789  C  CE1 . TYR A 1 101 ? -4.224  21.834  -6.771  1.00 22.38 ? 165  TYR A CE1 1 
ATOM   790  C  CE2 . TYR A 1 101 ? -3.138  23.554  -8.049  1.00 24.19 ? 165  TYR A CE2 1 
ATOM   791  C  CZ  . TYR A 1 101 ? -3.127  22.292  -7.482  1.00 23.84 ? 165  TYR A CZ  1 
ATOM   792  O  OH  . TYR A 1 101 ? -2.016  21.499  -7.623  1.00 23.87 ? 165  TYR A OH  1 
ATOM   793  N  N   . VAL A 1 102 ? -7.927  27.374  -4.913  1.00 20.68 ? 166  VAL A N   1 
ATOM   794  C  CA  . VAL A 1 102 ? -9.053  28.292  -4.784  1.00 21.86 ? 166  VAL A CA  1 
ATOM   795  C  C   . VAL A 1 102 ? -8.774  29.239  -3.621  1.00 23.36 ? 166  VAL A C   1 
ATOM   796  O  O   . VAL A 1 102 ? -7.890  28.978  -2.806  1.00 22.27 ? 166  VAL A O   1 
ATOM   797  C  CB  . VAL A 1 102 ? -10.396 27.552  -4.530  1.00 20.91 ? 166  VAL A CB  1 
ATOM   798  C  CG1 . VAL A 1 102 ? -10.775 26.727  -5.755  1.00 21.13 ? 166  VAL A CG1 1 
ATOM   799  C  CG2 . VAL A 1 102 ? -10.292 26.673  -3.299  1.00 21.63 ? 166  VAL A CG2 1 
ATOM   800  N  N   . HIS A 1 103 ? -9.515  30.341  -3.557  1.00 23.66 ? 167  HIS A N   1 
ATOM   801  C  CA  . HIS A 1 103 ? -9.353  31.313  -2.483  1.00 25.13 ? 167  HIS A CA  1 
ATOM   802  C  C   . HIS A 1 103 ? -9.872  30.726  -1.172  1.00 25.40 ? 167  HIS A C   1 
ATOM   803  O  O   . HIS A 1 103 ? -10.867 30.003  -1.159  1.00 27.60 ? 167  HIS A O   1 
ATOM   804  C  CB  . HIS A 1 103 ? -10.135 32.593  -2.806  1.00 28.54 ? 167  HIS A CB  1 
ATOM   805  C  CG  . HIS A 1 103 ? -9.574  33.377  -3.952  1.00 29.75 ? 167  HIS A CG  1 
ATOM   806  N  ND1 . HIS A 1 103 ? -8.360  34.027  -3.888  1.00 31.81 ? 167  HIS A ND1 1 
ATOM   807  C  CD2 . HIS A 1 103 ? -10.066 33.623  -5.191  1.00 31.82 ? 167  HIS A CD2 1 
ATOM   808  C  CE1 . HIS A 1 103 ? -8.128  34.640  -5.036  1.00 31.71 ? 167  HIS A CE1 1 
ATOM   809  N  NE2 . HIS A 1 103 ? -9.147  34.410  -5.844  1.00 32.11 ? 167  HIS A NE2 1 
ATOM   810  N  N   . PRO A 1 104 ? -9.179  30.989  -0.054  1.00 25.88 ? 168  PRO A N   1 
ATOM   811  C  CA  . PRO A 1 104 ? -7.953  31.787  0.036   1.00 24.10 ? 168  PRO A CA  1 
ATOM   812  C  C   . PRO A 1 104 ? -6.750  30.958  -0.404  1.00 23.84 ? 168  PRO A C   1 
ATOM   813  O  O   . PRO A 1 104 ? -6.496  29.872  0.126   1.00 23.68 ? 168  PRO A O   1 
ATOM   814  C  CB  . PRO A 1 104 ? -7.894  32.156  1.517   1.00 24.43 ? 168  PRO A CB  1 
ATOM   815  C  CG  . PRO A 1 104 ? -8.479  30.957  2.172   1.00 24.54 ? 168  PRO A CG  1 
ATOM   816  C  CD  . PRO A 1 104 ? -9.679  30.651  1.292   1.00 24.79 ? 168  PRO A CD  1 
ATOM   817  N  N   . LEU A 1 105 ? -6.019  31.468  -1.385  1.00 23.35 ? 169  LEU A N   1 
ATOM   818  C  CA  . LEU A 1 105 ? -4.849  30.777  -1.898  1.00 23.14 ? 169  LEU A CA  1 
ATOM   819  C  C   . LEU A 1 105 ? -3.725  30.717  -0.868  1.00 23.20 ? 169  LEU A C   1 
ATOM   820  O  O   . LEU A 1 105 ? -3.685  31.507  0.076   1.00 22.25 ? 169  LEU A O   1 
ATOM   821  C  CB  . LEU A 1 105 ? -4.358  31.470  -3.163  1.00 23.58 ? 169  LEU A CB  1 
ATOM   822  C  CG  . LEU A 1 105 ? -5.347  31.406  -4.324  1.00 22.86 ? 169  LEU A CG  1 
ATOM   823  C  CD1 . LEU A 1 105 ? -4.942  32.409  -5.393  1.00 24.40 ? 169  LEU A CD1 1 
ATOM   824  C  CD2 . LEU A 1 105 ? -5.391  29.987  -4.878  1.00 21.97 ? 169  LEU A CD2 1 
ATOM   825  N  N   . THR A 1 106 ? -2.821  29.765  -1.054  1.00 22.60 ? 170  THR A N   1 
ATOM   826  C  CA  . THR A 1 106 ? -1.695  29.596  -0.151  1.00 24.14 ? 170  THR A CA  1 
ATOM   827  C  C   . THR A 1 106 ? -0.939  30.915  -0.020  1.00 24.22 ? 170  THR A C   1 
ATOM   828  O  O   . THR A 1 106 ? -0.579  31.331  1.079   1.00 24.37 ? 170  THR A O   1 
ATOM   829  C  CB  . THR A 1 106 ? -0.731  28.525  -0.681  1.00 23.97 ? 170  THR A CB  1 
ATOM   830  O  OG1 . THR A 1 106 ? -1.475  27.351  -1.034  1.00 24.35 ? 170  THR A OG1 1 
ATOM   831  C  CG2 . THR A 1 106 ? 0.298   28.166  0.378   1.00 23.27 ? 170  THR A CG2 1 
ATOM   832  N  N   . GLU A 1 107 ? -0.712  31.566  -1.157  1.00 24.42 ? 171  GLU A N   1 
ATOM   833  C  CA  . GLU A 1 107 ? 0.001   32.838  -1.210  1.00 25.71 ? 171  GLU A CA  1 
ATOM   834  C  C   . GLU A 1 107 ? -0.693  33.944  -0.416  1.00 25.53 ? 171  GLU A C   1 
ATOM   835  O  O   . GLU A 1 107 ? -0.038  34.726  0.279   1.00 26.02 ? 171  GLU A O   1 
ATOM   836  C  CB  . GLU A 1 107 ? 0.154   33.286  -2.664  1.00 26.80 ? 171  GLU A CB  1 
ATOM   837  C  CG  . GLU A 1 107 ? 0.908   32.301  -3.558  1.00 30.32 ? 171  GLU A CG  1 
ATOM   838  C  CD  . GLU A 1 107 ? 0.155   30.997  -3.802  1.00 29.81 ? 171  GLU A CD  1 
ATOM   839  O  OE1 . GLU A 1 107 ? -1.057  30.932  -3.511  1.00 31.94 ? 171  GLU A OE1 1 
ATOM   840  O  OE2 . GLU A 1 107 ? 0.779   30.036  -4.302  1.00 30.93 ? 171  GLU A OE2 1 
ATOM   841  N  N   . GLU A 1 108 ? -2.016  34.008  -0.520  1.00 24.49 ? 172  GLU A N   1 
ATOM   842  C  CA  . GLU A 1 108 ? -2.782  35.024  0.185   1.00 25.10 ? 172  GLU A CA  1 
ATOM   843  C  C   . GLU A 1 108 ? -2.683  34.795  1.686   1.00 25.48 ? 172  GLU A C   1 
ATOM   844  O  O   . GLU A 1 108 ? -2.546  35.739  2.462   1.00 25.26 ? 172  GLU A O   1 
ATOM   845  C  CB  . GLU A 1 108 ? -4.246  34.989  -0.268  1.00 24.98 ? 172  GLU A CB  1 
ATOM   846  C  CG  . GLU A 1 108 ? -4.393  35.158  -1.773  1.00 28.31 ? 172  GLU A CG  1 
ATOM   847  C  CD  . GLU A 1 108 ? -5.834  35.085  -2.248  1.00 31.05 ? 172  GLU A CD  1 
ATOM   848  O  OE1 . GLU A 1 108 ? -6.547  34.127  -1.873  1.00 30.62 ? 172  GLU A OE1 1 
ATOM   849  O  OE2 . GLU A 1 108 ? -6.251  35.987  -3.008  1.00 32.45 ? 172  GLU A OE2 1 
ATOM   850  N  N   . ALA A 1 109 ? -2.738  33.533  2.090   1.00 25.12 ? 173  ALA A N   1 
ATOM   851  C  CA  . ALA A 1 109 ? -2.641  33.196  3.497   1.00 24.36 ? 173  ALA A CA  1 
ATOM   852  C  C   . ALA A 1 109 ? -1.282  33.618  4.052   1.00 23.60 ? 173  ALA A C   1 
ATOM   853  O  O   . ALA A 1 109 ? -1.202  34.195  5.133   1.00 23.45 ? 173  ALA A O   1 
ATOM   854  C  CB  . ALA A 1 109 ? -2.843  31.706  3.689   1.00 26.22 ? 173  ALA A CB  1 
ATOM   855  N  N   . ILE A 1 110 ? -0.217  33.330  3.313   1.00 23.07 ? 174  ILE A N   1 
ATOM   856  C  CA  . ILE A 1 110 ? 1.132   33.691  3.759   1.00 24.85 ? 174  ILE A CA  1 
ATOM   857  C  C   . ILE A 1 110 ? 1.262   35.202  3.879   1.00 25.63 ? 174  ILE A C   1 
ATOM   858  O  O   . ILE A 1 110 ? 1.834   35.716  4.840   1.00 26.34 ? 174  ILE A O   1 
ATOM   859  C  CB  . ILE A 1 110 ? 2.214   33.185  2.777   1.00 25.26 ? 174  ILE A CB  1 
ATOM   860  C  CG1 . ILE A 1 110 ? 2.242   31.658  2.769   1.00 26.78 ? 174  ILE A CG1 1 
ATOM   861  C  CG2 . ILE A 1 110 ? 3.579   33.715  3.185   1.00 26.76 ? 174  ILE A CG2 1 
ATOM   862  C  CD1 . ILE A 1 110 ? 3.243   31.071  1.788   1.00 27.66 ? 174  ILE A CD1 1 
ATOM   863  N  N   . GLU A 1 111 ? 0.733   35.908  2.890   1.00 27.68 ? 175  GLU A N   1 
ATOM   864  C  CA  . GLU A 1 111 ? 0.777   37.363  2.880   1.00 30.32 ? 175  GLU A CA  1 
ATOM   865  C  C   . GLU A 1 111 ? 0.100   37.867  4.154   1.00 29.66 ? 175  GLU A C   1 
ATOM   866  O  O   . GLU A 1 111 ? 0.594   38.786  4.811   1.00 29.78 ? 175  GLU A O   1 
ATOM   867  C  CB  . GLU A 1 111 ? 0.059   37.886  1.631   1.00 34.06 ? 175  GLU A CB  1 
ATOM   868  C  CG  . GLU A 1 111 ? 0.297   39.352  1.310   1.00 40.61 ? 175  GLU A CG  1 
ATOM   869  C  CD  . GLU A 1 111 ? -0.144  39.713  -0.105  1.00 45.77 ? 175  GLU A CD  1 
ATOM   870  O  OE1 . GLU A 1 111 ? 0.408   39.139  -1.072  1.00 48.93 ? 175  GLU A OE1 1 
ATOM   871  O  OE2 . GLU A 1 111 ? -1.043  40.569  -0.255  1.00 48.44 ? 175  GLU A OE2 1 
ATOM   872  N  N   . GLU A 1 112 ? -1.015  37.238  4.518   1.00 29.20 ? 176  GLU A N   1 
ATOM   873  C  CA  . GLU A 1 112 ? -1.755  37.626  5.716   1.00 29.10 ? 176  GLU A CA  1 
ATOM   874  C  C   . GLU A 1 112 ? -1.002  37.254  6.994   1.00 27.10 ? 176  GLU A C   1 
ATOM   875  O  O   . GLU A 1 112 ? -1.047  37.983  7.980   1.00 25.22 ? 176  GLU A O   1 
ATOM   876  C  CB  . GLU A 1 112 ? -3.140  36.967  5.736   1.00 30.63 ? 176  GLU A CB  1 
ATOM   877  C  CG  . GLU A 1 112 ? -4.134  37.675  6.657   1.00 36.36 ? 176  GLU A CG  1 
ATOM   878  C  CD  . GLU A 1 112 ? -5.349  36.823  7.016   1.00 38.69 ? 176  GLU A CD  1 
ATOM   879  O  OE1 . GLU A 1 112 ? -5.945  36.198  6.113   1.00 40.66 ? 176  GLU A OE1 1 
ATOM   880  O  OE2 . GLU A 1 112 ? -5.716  36.789  8.209   1.00 41.50 ? 176  GLU A OE2 1 
ATOM   881  N  N   . MET A 1 113 ? -0.317  36.116  6.984   1.00 25.89 ? 177  MET A N   1 
ATOM   882  C  CA  . MET A 1 113 ? 0.432   35.699  8.163   1.00 27.77 ? 177  MET A CA  1 
ATOM   883  C  C   . MET A 1 113 ? 1.578   36.674  8.422   1.00 28.38 ? 177  MET A C   1 
ATOM   884  O  O   . MET A 1 113 ? 1.840   37.038  9.562   1.00 29.00 ? 177  MET A O   1 
ATOM   885  C  CB  . MET A 1 113 ? 0.981   34.282  7.983   1.00 25.43 ? 177  MET A CB  1 
ATOM   886  C  CG  . MET A 1 113 ? -0.098  33.215  7.868   1.00 24.69 ? 177  MET A CG  1 
ATOM   887  S  SD  . MET A 1 113 ? 0.582   31.606  7.443   1.00 22.88 ? 177  MET A SD  1 
ATOM   888  C  CE  . MET A 1 113 ? 1.073   31.001  9.056   1.00 22.06 ? 177  MET A CE  1 
ATOM   889  N  N   . GLU A 1 114 ? 2.259   37.091  7.362   1.00 30.17 ? 178  GLU A N   1 
ATOM   890  C  CA  . GLU A 1 114 ? 3.358   38.034  7.514   1.00 34.58 ? 178  GLU A CA  1 
ATOM   891  C  C   . GLU A 1 114 ? 2.835   39.381  8.026   1.00 35.35 ? 178  GLU A C   1 
ATOM   892  O  O   . GLU A 1 114 ? 3.440   39.980  8.914   1.00 35.67 ? 178  GLU A O   1 
ATOM   893  C  CB  . GLU A 1 114 ? 4.099   38.206  6.182   1.00 35.41 ? 178  GLU A CB  1 
ATOM   894  C  CG  . GLU A 1 114 ? 4.881   36.961  5.759   1.00 39.10 ? 178  GLU A CG  1 
ATOM   895  C  CD  . GLU A 1 114 ? 6.387   37.091  5.968   1.00 41.92 ? 178  GLU A CD  1 
ATOM   896  O  OE1 . GLU A 1 114 ? 7.072   36.047  6.064   1.00 41.41 ? 178  GLU A OE1 1 
ATOM   897  O  OE2 . GLU A 1 114 ? 6.895   38.234  6.020   1.00 43.79 ? 178  GLU A OE2 1 
ATOM   898  N  N   . ARG A 1 115 ? 1.706   39.840  7.485   1.00 37.82 ? 179  ARG A N   1 
ATOM   899  C  CA  . ARG A 1 115 ? 1.114   41.111  7.911   1.00 38.69 ? 179  ARG A CA  1 
ATOM   900  C  C   . ARG A 1 115 ? 0.681   41.084  9.371   1.00 38.09 ? 179  ARG A C   1 
ATOM   901  O  O   . ARG A 1 115 ? 0.627   42.128  10.017  1.00 39.45 ? 179  ARG A O   1 
ATOM   902  C  CB  . ARG A 1 115 ? -0.100  41.486  7.050   1.00 39.90 ? 179  ARG A CB  1 
ATOM   903  C  CG  . ARG A 1 115 ? 0.199   41.706  5.577   1.00 42.45 ? 179  ARG A CG  1 
ATOM   904  C  CD  . ARG A 1 115 ? -0.803  42.680  4.963   1.00 44.74 ? 179  ARG A CD  1 
ATOM   905  N  NE  . ARG A 1 115 ? -2.188  42.324  5.271   1.00 47.86 ? 179  ARG A NE  1 
ATOM   906  C  CZ  . ARG A 1 115 ? -2.841  41.293  4.739   1.00 49.63 ? 179  ARG A CZ  1 
ATOM   907  N  NH1 . ARG A 1 115 ? -2.240  40.500  3.857   1.00 49.83 ? 179  ARG A NH1 1 
ATOM   908  N  NH2 . ARG A 1 115 ? -4.098  41.049  5.094   1.00 49.18 ? 179  ARG A NH2 1 
ATOM   909  N  N   . ASP A 1 116 ? 0.351   39.903  9.888   1.00 37.51 ? 180  ASP A N   1 
ATOM   910  C  CA  . ASP A 1 116 ? -0.062  39.794  11.285  1.00 37.01 ? 180  ASP A CA  1 
ATOM   911  C  C   . ASP A 1 116 ? 1.164   39.784  12.194  1.00 35.88 ? 180  ASP A C   1 
ATOM   912  O  O   . ASP A 1 116 ? 1.042   39.803  13.418  1.00 35.13 ? 180  ASP A O   1 
ATOM   913  C  CB  . ASP A 1 116 ? -0.889  38.525  11.531  1.00 38.47 ? 180  ASP A CB  1 
ATOM   914  C  CG  . ASP A 1 116 ? -2.284  38.602  10.930  1.00 40.92 ? 180  ASP A CG  1 
ATOM   915  O  OD1 . ASP A 1 116 ? -2.925  39.669  11.036  1.00 43.57 ? 180  ASP A OD1 1 
ATOM   916  O  OD2 . ASP A 1 116 ? -2.753  37.590  10.365  1.00 43.25 ? 180  ASP A OD2 1 
ATOM   917  N  N   . GLY A 1 117 ? 2.346   39.745  11.587  1.00 35.22 ? 181  GLY A N   1 
ATOM   918  C  CA  . GLY A 1 117 ? 3.575   39.750  12.361  1.00 34.99 ? 181  GLY A CA  1 
ATOM   919  C  C   . GLY A 1 117 ? 3.729   38.595  13.332  1.00 34.64 ? 181  GLY A C   1 
ATOM   920  O  O   . GLY A 1 117 ? 4.052   38.791  14.504  1.00 35.39 ? 181  GLY A O   1 
ATOM   921  N  N   . LEU A 1 118 ? 3.505   37.383  12.842  1.00 34.04 ? 182  LEU A N   1 
ATOM   922  C  CA  . LEU A 1 118 ? 3.628   36.189  13.665  1.00 32.29 ? 182  LEU A CA  1 
ATOM   923  C  C   . LEU A 1 118 ? 5.093   35.899  13.943  1.00 32.85 ? 182  LEU A C   1 
ATOM   924  O  O   . LEU A 1 118 ? 5.967   36.321  13.185  1.00 31.93 ? 182  LEU A O   1 
ATOM   925  C  CB  . LEU A 1 118 ? 3.042   34.983  12.930  1.00 31.20 ? 182  LEU A CB  1 
ATOM   926  C  CG  . LEU A 1 118 ? 1.590   35.050  12.473  1.00 29.30 ? 182  LEU A CG  1 
ATOM   927  C  CD1 . LEU A 1 118 ? 1.320   33.909  11.499  1.00 29.27 ? 182  LEU A CD1 1 
ATOM   928  C  CD2 . LEU A 1 118 ? 0.672   34.975  13.683  1.00 28.84 ? 182  LEU A CD2 1 
ATOM   929  N  N   . GLU A 1 119 ? 5.349   35.169  15.027  1.00 34.02 ? 183  GLU A N   1 
ATOM   930  C  CA  . GLU A 1 119 ? 6.703   34.762  15.388  1.00 34.83 ? 183  GLU A CA  1 
ATOM   931  C  C   . GLU A 1 119 ? 6.910   33.345  14.835  1.00 34.06 ? 183  GLU A C   1 
ATOM   932  O  O   . GLU A 1 119 ? 7.985   33.010  14.333  1.00 33.54 ? 183  GLU A O   1 
ATOM   933  C  CB  . GLU A 1 119 ? 6.882   34.720  16.909  1.00 36.14 ? 183  GLU A CB  1 
ATOM   934  C  CG  . GLU A 1 119 ? 6.739   36.052  17.621  1.00 40.37 ? 183  GLU A CG  1 
ATOM   935  C  CD  . GLU A 1 119 ? 7.101   35.953  19.096  1.00 43.14 ? 183  GLU A CD  1 
ATOM   936  O  OE1 . GLU A 1 119 ? 8.256   35.575  19.399  1.00 44.03 ? 183  GLU A OE1 1 
ATOM   937  O  OE2 . GLU A 1 119 ? 6.234   36.252  19.950  1.00 44.32 ? 183  GLU A OE2 1 
ATOM   938  N  N   . ARG A 1 120 ? 5.857   32.533  14.945  1.00 32.19 ? 184  ARG A N   1 
ATOM   939  C  CA  . ARG A 1 120 ? 5.847   31.141  14.497  1.00 32.24 ? 184  ARG A CA  1 
ATOM   940  C  C   . ARG A 1 120 ? 4.875   30.891  13.339  1.00 30.41 ? 184  ARG A C   1 
ATOM   941  O  O   . ARG A 1 120 ? 3.747   31.390  13.340  1.00 31.06 ? 184  ARG A O   1 
ATOM   942  C  CB  . ARG A 1 120 ? 5.427   30.224  15.650  1.00 35.27 ? 184  ARG A CB  1 
ATOM   943  C  CG  . ARG A 1 120 ? 6.523   29.787  16.598  1.00 38.12 ? 184  ARG A CG  1 
ATOM   944  C  CD  . ARG A 1 120 ? 6.742   28.298  16.446  1.00 40.30 ? 184  ARG A CD  1 
ATOM   945  N  NE  . ARG A 1 120 ? 7.038   27.991  15.052  1.00 42.36 ? 184  ARG A NE  1 
ATOM   946  C  CZ  . ARG A 1 120 ? 7.222   26.771  14.560  1.00 41.91 ? 184  ARG A CZ  1 
ATOM   947  N  NH1 . ARG A 1 120 ? 7.139   25.701  15.351  1.00 40.54 ? 184  ARG A NH1 1 
ATOM   948  N  NH2 . ARG A 1 120 ? 7.498   26.630  13.268  1.00 39.01 ? 184  ARG A NH2 1 
ATOM   949  N  N   . ALA A 1 121 ? 5.314   30.097  12.368  1.00 27.43 ? 185  ALA A N   1 
ATOM   950  C  CA  . ALA A 1 121 ? 4.486   29.729  11.224  1.00 25.13 ? 185  ALA A CA  1 
ATOM   951  C  C   . ALA A 1 121 ? 4.653   28.227  11.001  1.00 23.60 ? 185  ALA A C   1 
ATOM   952  O  O   . ALA A 1 121 ? 5.759   27.741  10.768  1.00 21.81 ? 185  ALA A O   1 
ATOM   953  C  CB  . ALA A 1 121 ? 4.911   30.500  9.979   1.00 27.13 ? 185  ALA A CB  1 
ATOM   954  N  N   . ILE A 1 122 ? 3.548   27.496  11.094  1.00 21.08 ? 186  ILE A N   1 
ATOM   955  C  CA  . ILE A 1 122 ? 3.568   26.053  10.914  1.00 18.90 ? 186  ILE A CA  1 
ATOM   956  C  C   . ILE A 1 122 ? 2.727   25.651  9.708   1.00 18.21 ? 186  ILE A C   1 
ATOM   957  O  O   . ILE A 1 122 ? 1.518   25.889  9.678   1.00 18.15 ? 186  ILE A O   1 
ATOM   958  C  CB  . ILE A 1 122 ? 3.009   25.335  12.164  1.00 19.17 ? 186  ILE A CB  1 
ATOM   959  C  CG1 . ILE A 1 122 ? 3.870   25.665  13.384  1.00 18.85 ? 186  ILE A CG1 1 
ATOM   960  C  CG2 . ILE A 1 122 ? 2.971   23.827  11.934  1.00 19.72 ? 186  ILE A CG2 1 
ATOM   961  C  CD1 . ILE A 1 122 ? 3.224   25.255  14.705  1.00 19.74 ? 186  ILE A CD1 1 
ATOM   962  N  N   . ALA A 1 123 ? 3.381   25.062  8.710   1.00 16.91 ? 187  ALA A N   1 
ATOM   963  C  CA  . ALA A 1 123 ? 2.703   24.589  7.506   1.00 16.90 ? 187  ALA A CA  1 
ATOM   964  C  C   . ALA A 1 123 ? 2.102   23.236  7.890   1.00 16.42 ? 187  ALA A C   1 
ATOM   965  O  O   . ALA A 1 123 ? 2.799   22.227  7.923   1.00 16.06 ? 187  ALA A O   1 
ATOM   966  C  CB  . ALA A 1 123 ? 3.712   24.427  6.364   1.00 15.81 ? 187  ALA A CB  1 
ATOM   967  N  N   . PHE A 1 124 ? 0.810   23.228  8.193   1.00 16.41 ? 188  PHE A N   1 
ATOM   968  C  CA  . PHE A 1 124 ? 0.125   22.013  8.631   1.00 16.08 ? 188  PHE A CA  1 
ATOM   969  C  C   . PHE A 1 124 ? -0.735  21.411  7.536   1.00 15.70 ? 188  PHE A C   1 
ATOM   970  O  O   . PHE A 1 124 ? -1.882  21.813  7.356   1.00 16.29 ? 188  PHE A O   1 
ATOM   971  C  CB  . PHE A 1 124 ? -0.752  22.337  9.850   1.00 14.86 ? 188  PHE A CB  1 
ATOM   972  C  CG  . PHE A 1 124 ? -1.293  21.124  10.568  1.00 14.36 ? 188  PHE A CG  1 
ATOM   973  C  CD1 . PHE A 1 124 ? -2.097  21.278  11.688  1.00 14.31 ? 188  PHE A CD1 1 
ATOM   974  C  CD2 . PHE A 1 124 ? -0.981  19.837  10.147  1.00 15.04 ? 188  PHE A CD2 1 
ATOM   975  C  CE1 . PHE A 1 124 ? -2.580  20.171  12.379  1.00 14.40 ? 188  PHE A CE1 1 
ATOM   976  C  CE2 . PHE A 1 124 ? -1.460  18.726  10.830  1.00 14.89 ? 188  PHE A CE2 1 
ATOM   977  C  CZ  . PHE A 1 124 ? -2.261  18.893  11.950  1.00 14.86 ? 188  PHE A CZ  1 
ATOM   978  N  N   . THR A 1 125 ? -0.188  20.440  6.813   1.00 16.36 ? 189  THR A N   1 
ATOM   979  C  CA  . THR A 1 125 ? -0.946  19.804  5.744   1.00 16.72 ? 189  THR A CA  1 
ATOM   980  C  C   . THR A 1 125 ? -2.170  19.088  6.313   1.00 17.52 ? 189  THR A C   1 
ATOM   981  O  O   . THR A 1 125 ? -2.125  18.527  7.410   1.00 16.43 ? 189  THR A O   1 
ATOM   982  C  CB  . THR A 1 125 ? -0.089  18.774  4.962   1.00 16.26 ? 189  THR A CB  1 
ATOM   983  O  OG1 . THR A 1 125 ? -0.835  18.295  3.835   1.00 17.16 ? 189  THR A OG1 1 
ATOM   984  C  CG2 . THR A 1 125 ? 0.294   17.592  5.854   1.00 14.20 ? 189  THR A CG2 1 
ATOM   985  N  N   . GLN A 1 126 ? -3.262  19.118  5.563   1.00 16.51 ? 190  GLN A N   1 
ATOM   986  C  CA  . GLN A 1 126 ? -4.475  18.462  5.991   1.00 16.69 ? 190  GLN A CA  1 
ATOM   987  C  C   . GLN A 1 126 ? -4.608  17.097  5.312   1.00 17.63 ? 190  GLN A C   1 
ATOM   988  O  O   . GLN A 1 126 ? -5.659  16.459  5.359   1.00 17.53 ? 190  GLN A O   1 
ATOM   989  C  CB  . GLN A 1 126 ? -5.685  19.365  5.718   1.00 17.25 ? 190  GLN A CB  1 
ATOM   990  C  CG  . GLN A 1 126 ? -5.671  20.634  6.571   1.00 20.32 ? 190  GLN A CG  1 
ATOM   991  C  CD  . GLN A 1 126 ? -5.500  20.336  8.062   1.00 22.70 ? 190  GLN A CD  1 
ATOM   992  O  OE1 . GLN A 1 126 ? -6.355  19.705  8.681   1.00 22.95 ? 190  GLN A OE1 1 
ATOM   993  N  NE2 . GLN A 1 126 ? -4.382  20.783  8.639   1.00 22.48 ? 190  GLN A NE2 1 
ATOM   994  N  N   . TYR A 1 127 ? -3.526  16.659  4.677   1.00 18.27 ? 191  TYR A N   1 
ATOM   995  C  CA  . TYR A 1 127 ? -3.474  15.339  4.052   1.00 19.16 ? 191  TYR A CA  1 
ATOM   996  C  C   . TYR A 1 127 ? -2.650  14.503  5.025   1.00 17.71 ? 191  TYR A C   1 
ATOM   997  O  O   . TYR A 1 127 ? -1.452  14.723  5.165   1.00 16.88 ? 191  TYR A O   1 
ATOM   998  C  CB  . TYR A 1 127 ? -2.736  15.367  2.710   1.00 22.08 ? 191  TYR A CB  1 
ATOM   999  C  CG  . TYR A 1 127 ? -3.387  16.211  1.655   1.00 26.39 ? 191  TYR A CG  1 
ATOM   1000 C  CD1 . TYR A 1 127 ? -2.992  17.530  1.448   1.00 27.23 ? 191  TYR A CD1 1 
ATOM   1001 C  CD2 . TYR A 1 127 ? -4.405  15.692  0.859   1.00 29.03 ? 191  TYR A CD2 1 
ATOM   1002 C  CE1 . TYR A 1 127 ? -3.594  18.310  0.472   1.00 29.67 ? 191  TYR A CE1 1 
ATOM   1003 C  CE2 . TYR A 1 127 ? -5.012  16.461  -0.116  1.00 31.01 ? 191  TYR A CE2 1 
ATOM   1004 C  CZ  . TYR A 1 127 ? -4.604  17.766  -0.306  1.00 30.02 ? 191  TYR A CZ  1 
ATOM   1005 O  OH  . TYR A 1 127 ? -5.212  18.526  -1.272  1.00 32.62 ? 191  TYR A OH  1 
ATOM   1006 N  N   . PRO A 1 128 ? -3.280  13.543  5.714   1.00 18.59 ? 192  PRO A N   1 
ATOM   1007 C  CA  . PRO A 1 128 ? -2.548  12.703  6.669   1.00 18.49 ? 192  PRO A CA  1 
ATOM   1008 C  C   . PRO A 1 128 ? -1.407  11.925  6.020   1.00 17.37 ? 192  PRO A C   1 
ATOM   1009 O  O   . PRO A 1 128 ? -0.352  11.730  6.631   1.00 17.08 ? 192  PRO A O   1 
ATOM   1010 C  CB  . PRO A 1 128 ? -3.636  11.782  7.227   1.00 17.29 ? 192  PRO A CB  1 
ATOM   1011 C  CG  . PRO A 1 128 ? -4.860  12.625  7.137   1.00 18.07 ? 192  PRO A CG  1 
ATOM   1012 C  CD  . PRO A 1 128 ? -4.722  13.249  5.763   1.00 18.52 ? 192  PRO A CD  1 
ATOM   1013 N  N   . GLN A 1 129 ? -1.615  11.472  4.787   1.00 16.67 ? 193  GLN A N   1 
ATOM   1014 C  CA  . GLN A 1 129 ? -0.572  10.726  4.096   1.00 16.40 ? 193  GLN A CA  1 
ATOM   1015 C  C   . GLN A 1 129 ? 0.021   11.572  2.971   1.00 15.64 ? 193  GLN A C   1 
ATOM   1016 O  O   . GLN A 1 129 ? -0.689  12.131  2.127   1.00 13.65 ? 193  GLN A O   1 
ATOM   1017 C  CB  . GLN A 1 129 ? -1.092  9.368   3.588   1.00 16.25 ? 193  GLN A CB  1 
ATOM   1018 C  CG  . GLN A 1 129 ? -2.446  9.393   2.938   1.00 21.25 ? 193  GLN A CG  1 
ATOM   1019 C  CD  . GLN A 1 129 ? -3.595  9.312   3.926   1.00 18.51 ? 193  GLN A CD  1 
ATOM   1020 O  OE1 . GLN A 1 129 ? -4.585  10.002  3.767   1.00 18.74 ? 193  GLN A OE1 1 
ATOM   1021 N  NE2 . GLN A 1 129 ? -3.476  8.455   4.933   1.00 17.87 ? 193  GLN A NE2 1 
ATOM   1022 N  N   . TYR A 1 130 ? 1.343   11.667  2.997   1.00 11.55 ? 194  TYR A N   1 
ATOM   1023 C  CA  . TYR A 1 130 ? 2.100   12.483  2.067   1.00 14.15 ? 194  TYR A CA  1 
ATOM   1024 C  C   . TYR A 1 130 ? 2.163   12.048  0.612   1.00 15.21 ? 194  TYR A C   1 
ATOM   1025 O  O   . TYR A 1 130 ? 2.446   10.894  0.287   1.00 15.33 ? 194  TYR A O   1 
ATOM   1026 C  CB  . TYR A 1 130 ? 3.531   12.630  2.591   1.00 13.96 ? 194  TYR A CB  1 
ATOM   1027 C  CG  . TYR A 1 130 ? 4.387   13.618  1.836   1.00 14.79 ? 194  TYR A CG  1 
ATOM   1028 C  CD1 . TYR A 1 130 ? 4.598   14.905  2.333   1.00 15.51 ? 194  TYR A CD1 1 
ATOM   1029 C  CD2 . TYR A 1 130 ? 4.978   13.276  0.616   1.00 14.51 ? 194  TYR A CD2 1 
ATOM   1030 C  CE1 . TYR A 1 130 ? 5.373   15.827  1.639   1.00 14.65 ? 194  TYR A CE1 1 
ATOM   1031 C  CE2 . TYR A 1 130 ? 5.756   14.197  -0.089  1.00 14.53 ? 194  TYR A CE2 1 
ATOM   1032 C  CZ  . TYR A 1 130 ? 5.946   15.470  0.431   1.00 16.55 ? 194  TYR A CZ  1 
ATOM   1033 O  OH  . TYR A 1 130 ? 6.698   16.395  -0.259  1.00 20.65 ? 194  TYR A OH  1 
ATOM   1034 N  N   . SER A 1 131 ? 1.907   13.003  -0.267  1.00 14.92 ? 195  SER A N   1 
ATOM   1035 C  CA  . SER A 1 131 ? 2.024   12.756  -1.692  1.00 15.74 ? 195  SER A CA  1 
ATOM   1036 C  C   . SER A 1 131 ? 2.700   13.994  -2.247  1.00 14.80 ? 195  SER A C   1 
ATOM   1037 O  O   . SER A 1 131 ? 2.404   15.111  -1.824  1.00 13.28 ? 195  SER A O   1 
ATOM   1038 C  CB  . SER A 1 131 ? 0.667   12.583  -2.361  1.00 16.65 ? 195  SER A CB  1 
ATOM   1039 O  OG  . SER A 1 131 ? 0.872   12.293  -3.728  1.00 19.51 ? 195  SER A OG  1 
ATOM   1040 N  N   . CYS A 1 132 ? 3.611   13.804  -3.186  1.00 16.32 ? 196  CYS A N   1 
ATOM   1041 C  CA  . CYS A 1 132 ? 4.291   14.942  -3.763  1.00 19.45 ? 196  CYS A CA  1 
ATOM   1042 C  C   . CYS A 1 132 ? 3.298   15.817  -4.532  1.00 18.98 ? 196  CYS A C   1 
ATOM   1043 O  O   . CYS A 1 132 ? 3.523   17.013  -4.707  1.00 19.00 ? 196  CYS A O   1 
ATOM   1044 C  CB  . CYS A 1 132 ? 5.423   14.454  -4.664  1.00 20.75 ? 196  CYS A CB  1 
ATOM   1045 S  SG  . CYS A 1 132 ? 6.606   13.415  -3.760  1.00 23.43 ? 196  CYS A SG  1 
ATOM   1046 N  N   . SER A 1 133 ? 2.184   15.228  -4.954  1.00 19.04 ? 197  SER A N   1 
ATOM   1047 C  CA  . SER A 1 133 ? 1.174   15.975  -5.694  1.00 21.25 ? 197  SER A CA  1 
ATOM   1048 C  C   . SER A 1 133 ? 0.202   16.748  -4.798  1.00 19.12 ? 197  SER A C   1 
ATOM   1049 O  O   . SER A 1 133 ? -0.499  17.646  -5.260  1.00 20.61 ? 197  SER A O   1 
ATOM   1050 C  CB  . SER A 1 133 ? 0.382   15.035  -6.606  1.00 22.93 ? 197  SER A CB  1 
ATOM   1051 O  OG  . SER A 1 133 ? -0.263  14.012  -5.865  1.00 27.02 ? 197  SER A OG  1 
ATOM   1052 N  N   . THR A 1 134 ? 0.154   16.403  -3.518  1.00 19.01 ? 198  THR A N   1 
ATOM   1053 C  CA  . THR A 1 134 ? -0.747  17.088  -2.598  1.00 18.33 ? 198  THR A CA  1 
ATOM   1054 C  C   . THR A 1 134 ? 0.046   17.940  -1.612  1.00 17.25 ? 198  THR A C   1 
ATOM   1055 O  O   . THR A 1 134 ? 0.211   19.142  -1.820  1.00 17.10 ? 198  THR A O   1 
ATOM   1056 C  CB  . THR A 1 134 ? -1.642  16.082  -1.824  1.00 16.65 ? 198  THR A CB  1 
ATOM   1057 O  OG1 . THR A 1 134 ? -0.826  15.076  -1.214  1.00 17.72 ? 198  THR A OG1 1 
ATOM   1058 C  CG2 . THR A 1 134 ? -2.641  15.418  -2.766  1.00 16.07 ? 198  THR A CG2 1 
ATOM   1059 N  N   . THR A 1 135 ? 0.541   17.317  -0.547  1.00 17.24 ? 199  THR A N   1 
ATOM   1060 C  CA  . THR A 1 135 ? 1.322   18.035  0.450   1.00 17.50 ? 199  THR A CA  1 
ATOM   1061 C  C   . THR A 1 135 ? 2.566   18.663  -0.193  1.00 17.37 ? 199  THR A C   1 
ATOM   1062 O  O   . THR A 1 135 ? 2.871   19.823  0.041   1.00 16.24 ? 199  THR A O   1 
ATOM   1063 C  CB  . THR A 1 135 ? 1.777   17.093  1.587   1.00 18.46 ? 199  THR A CB  1 
ATOM   1064 O  OG1 . THR A 1 135 ? 0.628   16.565  2.261   1.00 19.22 ? 199  THR A OG1 1 
ATOM   1065 C  CG2 . THR A 1 135 ? 2.652   17.843  2.585   1.00 16.70 ? 199  THR A CG2 1 
ATOM   1066 N  N   . GLY A 1 136 ? 3.278   17.885  -1.002  1.00 17.52 ? 200  GLY A N   1 
ATOM   1067 C  CA  . GLY A 1 136 ? 4.474   18.394  -1.653  1.00 19.83 ? 200  GLY A CA  1 
ATOM   1068 C  C   . GLY A 1 136 ? 4.236   19.679  -2.428  1.00 21.08 ? 200  GLY A C   1 
ATOM   1069 O  O   . GLY A 1 136 ? 5.017   20.623  -2.331  1.00 19.04 ? 200  GLY A O   1 
ATOM   1070 N  N   . SER A 1 137 ? 3.149   19.711  -3.196  1.00 21.39 ? 201  SER A N   1 
ATOM   1071 C  CA  . SER A 1 137 ? 2.798   20.879  -3.993  1.00 21.60 ? 201  SER A CA  1 
ATOM   1072 C  C   . SER A 1 137 ? 2.510   22.097  -3.109  1.00 21.82 ? 201  SER A C   1 
ATOM   1073 O  O   . SER A 1 137 ? 2.895   23.220  -3.435  1.00 20.92 ? 201  SER A O   1 
ATOM   1074 C  CB  . SER A 1 137 ? 1.575   20.568  -4.857  1.00 22.24 ? 201  SER A CB  1 
ATOM   1075 O  OG  . SER A 1 137 ? 1.141   21.727  -5.538  1.00 23.33 ? 201  SER A OG  1 
ATOM   1076 N  N   . SER A 1 138 ? 1.826   21.869  -1.993  1.00 20.88 ? 202  SER A N   1 
ATOM   1077 C  CA  . SER A 1 138 ? 1.509   22.952  -1.074  1.00 20.77 ? 202  SER A CA  1 
ATOM   1078 C  C   . SER A 1 138 ? 2.781   23.487  -0.437  1.00 19.06 ? 202  SER A C   1 
ATOM   1079 O  O   . SER A 1 138 ? 2.925   24.690  -0.243  1.00 20.84 ? 202  SER A O   1 
ATOM   1080 C  CB  . SER A 1 138 ? 0.547   22.472  0.018   1.00 21.14 ? 202  SER A CB  1 
ATOM   1081 O  OG  . SER A 1 138 ? -0.771  22.380  -0.488  1.00 26.07 ? 202  SER A OG  1 
ATOM   1082 N  N   . LEU A 1 139 ? 3.703   22.591  -0.107  1.00 17.52 ? 203  LEU A N   1 
ATOM   1083 C  CA  . LEU A 1 139 ? 4.957   23.018  0.494   1.00 17.34 ? 203  LEU A CA  1 
ATOM   1084 C  C   . LEU A 1 139 ? 5.783   23.801  -0.533  1.00 16.91 ? 203  LEU A C   1 
ATOM   1085 O  O   . LEU A 1 139 ? 6.411   24.805  -0.196  1.00 15.99 ? 203  LEU A O   1 
ATOM   1086 C  CB  . LEU A 1 139 ? 5.736   21.810  1.021   1.00 16.53 ? 203  LEU A CB  1 
ATOM   1087 C  CG  . LEU A 1 139 ? 5.064   21.038  2.167   1.00 17.23 ? 203  LEU A CG  1 
ATOM   1088 C  CD1 . LEU A 1 139 ? 5.995   19.927  2.646   1.00 18.21 ? 203  LEU A CD1 1 
ATOM   1089 C  CD2 . LEU A 1 139 ? 4.740   21.973  3.318   1.00 16.21 ? 203  LEU A CD2 1 
ATOM   1090 N  N   . ASN A 1 140 ? 5.770   23.345  -1.783  1.00 16.95 ? 204  ASN A N   1 
ATOM   1091 C  CA  . ASN A 1 140 ? 6.493   24.033  -2.845  1.00 19.14 ? 204  ASN A CA  1 
ATOM   1092 C  C   . ASN A 1 140 ? 5.941   25.445  -3.024  1.00 20.84 ? 204  ASN A C   1 
ATOM   1093 O  O   . ASN A 1 140 ? 6.690   26.383  -3.303  1.00 22.58 ? 204  ASN A O   1 
ATOM   1094 C  CB  . ASN A 1 140 ? 6.375   23.281  -4.180  1.00 17.87 ? 204  ASN A CB  1 
ATOM   1095 C  CG  . ASN A 1 140 ? 7.117   21.960  -4.176  1.00 17.64 ? 204  ASN A CG  1 
ATOM   1096 O  OD1 . ASN A 1 140 ? 8.028   21.759  -3.385  1.00 16.10 ? 204  ASN A OD1 1 
ATOM   1097 N  ND2 . ASN A 1 140 ? 6.737   21.059  -5.073  1.00 19.36 ? 204  ASN A ND2 1 
ATOM   1098 N  N   . ALA A 1 141 ? 4.631   25.593  -2.860  1.00 20.62 ? 205  ALA A N   1 
ATOM   1099 C  CA  . ALA A 1 141 ? 3.987   26.893  -3.013  1.00 20.68 ? 205  ALA A CA  1 
ATOM   1100 C  C   . ALA A 1 141 ? 4.539   27.901  -2.011  1.00 20.54 ? 205  ALA A C   1 
ATOM   1101 O  O   . ALA A 1 141 ? 4.721   29.072  -2.337  1.00 21.21 ? 205  ALA A O   1 
ATOM   1102 C  CB  . ALA A 1 141 ? 2.473   26.755  -2.838  1.00 19.03 ? 205  ALA A CB  1 
ATOM   1103 N  N   . ILE A 1 142 ? 4.807   27.441  -0.792  1.00 20.22 ? 206  ILE A N   1 
ATOM   1104 C  CA  . ILE A 1 142 ? 5.333   28.311  0.247   1.00 20.20 ? 206  ILE A CA  1 
ATOM   1105 C  C   . ILE A 1 142 ? 6.741   28.758  -0.120  1.00 21.67 ? 206  ILE A C   1 
ATOM   1106 O  O   . ILE A 1 142 ? 7.062   29.944  -0.052  1.00 22.60 ? 206  ILE A O   1 
ATOM   1107 C  CB  . ILE A 1 142 ? 5.370   27.594  1.608   1.00 19.26 ? 206  ILE A CB  1 
ATOM   1108 C  CG1 . ILE A 1 142 ? 3.955   27.167  2.006   1.00 18.67 ? 206  ILE A CG1 1 
ATOM   1109 C  CG2 . ILE A 1 142 ? 5.983   28.503  2.652   1.00 18.96 ? 206  ILE A CG2 1 
ATOM   1110 C  CD1 . ILE A 1 142 ? 3.879   26.398  3.316   1.00 14.62 ? 206  ILE A CD1 1 
ATOM   1111 N  N   . TYR A 1 143 ? 7.581   27.806  -0.511  1.00 22.17 ? 207  TYR A N   1 
ATOM   1112 C  CA  . TYR A 1 143 ? 8.947   28.130  -0.902  1.00 24.13 ? 207  TYR A CA  1 
ATOM   1113 C  C   . TYR A 1 143 ? 8.940   29.102  -2.084  1.00 25.64 ? 207  TYR A C   1 
ATOM   1114 O  O   . TYR A 1 143 ? 9.619   30.132  -2.056  1.00 24.26 ? 207  TYR A O   1 
ATOM   1115 C  CB  . TYR A 1 143 ? 9.707   26.861  -1.291  1.00 25.15 ? 207  TYR A CB  1 
ATOM   1116 C  CG  . TYR A 1 143 ? 10.937  27.145  -2.122  1.00 27.54 ? 207  TYR A CG  1 
ATOM   1117 C  CD1 . TYR A 1 143 ? 12.087  27.686  -1.545  1.00 27.67 ? 207  TYR A CD1 1 
ATOM   1118 C  CD2 . TYR A 1 143 ? 10.922  26.942  -3.501  1.00 27.83 ? 207  TYR A CD2 1 
ATOM   1119 C  CE1 . TYR A 1 143 ? 13.190  28.024  -2.329  1.00 28.46 ? 207  TYR A CE1 1 
ATOM   1120 C  CE2 . TYR A 1 143 ? 12.010  27.275  -4.289  1.00 29.57 ? 207  TYR A CE2 1 
ATOM   1121 C  CZ  . TYR A 1 143 ? 13.137  27.816  -3.701  1.00 29.49 ? 207  TYR A CZ  1 
ATOM   1122 O  OH  . TYR A 1 143 ? 14.200  28.167  -4.497  1.00 33.00 ? 207  TYR A OH  1 
ATOM   1123 N  N   . ARG A 1 144 ? 8.171   28.768  -3.119  1.00 26.81 ? 208  ARG A N   1 
ATOM   1124 C  CA  . ARG A 1 144 ? 8.078   29.608  -4.308  1.00 28.91 ? 208  ARG A CA  1 
ATOM   1125 C  C   . ARG A 1 144 ? 7.553   31.003  -4.000  1.00 28.83 ? 208  ARG A C   1 
ATOM   1126 O  O   . ARG A 1 144 ? 7.950   31.972  -4.644  1.00 28.58 ? 208  ARG A O   1 
ATOM   1127 C  CB  . ARG A 1 144 ? 7.171   28.971  -5.364  1.00 31.03 ? 208  ARG A CB  1 
ATOM   1128 C  CG  . ARG A 1 144 ? 7.787   27.820  -6.136  1.00 34.24 ? 208  ARG A CG  1 
ATOM   1129 C  CD  . ARG A 1 144 ? 7.158   27.742  -7.517  1.00 37.71 ? 208  ARG A CD  1 
ATOM   1130 N  NE  . ARG A 1 144 ? 7.654   26.618  -8.304  1.00 40.87 ? 208  ARG A NE  1 
ATOM   1131 C  CZ  . ARG A 1 144 ? 7.245   25.362  -8.155  1.00 41.84 ? 208  ARG A CZ  1 
ATOM   1132 N  NH1 . ARG A 1 144 ? 6.328   25.067  -7.246  1.00 42.70 ? 208  ARG A NH1 1 
ATOM   1133 N  NH2 . ARG A 1 144 ? 7.753   24.404  -8.919  1.00 42.26 ? 208  ARG A NH2 1 
ATOM   1134 N  N   . TYR A 1 145 ? 6.650   31.107  -3.031  1.00 28.53 ? 209  TYR A N   1 
ATOM   1135 C  CA  . TYR A 1 145 ? 6.096   32.405  -2.674  1.00 28.46 ? 209  TYR A CA  1 
ATOM   1136 C  C   . TYR A 1 145 ? 7.202   33.372  -2.264  1.00 29.40 ? 209  TYR A C   1 
ATOM   1137 O  O   . TYR A 1 145 ? 7.269   34.501  -2.747  1.00 29.80 ? 209  TYR A O   1 
ATOM   1138 C  CB  . TYR A 1 145 ? 5.105   32.281  -1.524  1.00 28.02 ? 209  TYR A CB  1 
ATOM   1139 C  CG  . TYR A 1 145 ? 4.716   33.624  -0.965  1.00 28.22 ? 209  TYR A CG  1 
ATOM   1140 C  CD1 . TYR A 1 145 ? 3.832   34.456  -1.650  1.00 29.42 ? 209  TYR A CD1 1 
ATOM   1141 C  CD2 . TYR A 1 145 ? 5.287   34.097  0.213   1.00 27.63 ? 209  TYR A CD2 1 
ATOM   1142 C  CE1 . TYR A 1 145 ? 3.529   35.731  -1.175  1.00 31.70 ? 209  TYR A CE1 1 
ATOM   1143 C  CE2 . TYR A 1 145 ? 4.994   35.369  0.694   1.00 29.32 ? 209  TYR A CE2 1 
ATOM   1144 C  CZ  . TYR A 1 145 ? 4.117   36.179  -0.005  1.00 30.98 ? 209  TYR A CZ  1 
ATOM   1145 O  OH  . TYR A 1 145 ? 3.838   37.443  0.459   1.00 34.59 ? 209  TYR A OH  1 
ATOM   1146 N  N   . TYR A 1 146 ? 8.063   32.931  -1.357  1.00 30.15 ? 210  TYR A N   1 
ATOM   1147 C  CA  . TYR A 1 146 ? 9.146   33.778  -0.901  1.00 31.45 ? 210  TYR A CA  1 
ATOM   1148 C  C   . TYR A 1 146 ? 10.173  34.000  -1.996  1.00 34.38 ? 210  TYR A C   1 
ATOM   1149 O  O   . TYR A 1 146 ? 10.693  35.104  -2.157  1.00 35.17 ? 210  TYR A O   1 
ATOM   1150 C  CB  . TYR A 1 146 ? 9.806   33.165  0.329   1.00 27.53 ? 210  TYR A CB  1 
ATOM   1151 C  CG  . TYR A 1 146 ? 8.943   33.289  1.557   1.00 25.30 ? 210  TYR A CG  1 
ATOM   1152 C  CD1 . TYR A 1 146 ? 8.269   32.186  2.084   1.00 20.99 ? 210  TYR A CD1 1 
ATOM   1153 C  CD2 . TYR A 1 146 ? 8.778   34.523  2.180   1.00 23.41 ? 210  TYR A CD2 1 
ATOM   1154 C  CE1 . TYR A 1 146 ? 7.454   32.316  3.205   1.00 19.74 ? 210  TYR A CE1 1 
ATOM   1155 C  CE2 . TYR A 1 146 ? 7.967   34.663  3.297   1.00 22.67 ? 210  TYR A CE2 1 
ATOM   1156 C  CZ  . TYR A 1 146 ? 7.311   33.559  3.807   1.00 20.50 ? 210  TYR A CZ  1 
ATOM   1157 O  OH  . TYR A 1 146 ? 6.542   33.707  4.932   1.00 19.78 ? 210  TYR A OH  1 
ATOM   1158 N  N   . ASN A 1 147 ? 10.446  32.949  -2.759  1.00 37.90 ? 211  ASN A N   1 
ATOM   1159 C  CA  . ASN A 1 147 ? 11.414  33.023  -3.841  1.00 41.64 ? 211  ASN A CA  1 
ATOM   1160 C  C   . ASN A 1 147 ? 10.930  33.988  -4.919  1.00 43.27 ? 211  ASN A C   1 
ATOM   1161 O  O   . ASN A 1 147 ? 11.730  34.690  -5.534  1.00 44.18 ? 211  ASN A O   1 
ATOM   1162 C  CB  . ASN A 1 147 ? 11.641  31.625  -4.423  1.00 43.85 ? 211  ASN A CB  1 
ATOM   1163 C  CG  . ASN A 1 147 ? 12.870  31.549  -5.307  1.00 45.43 ? 211  ASN A CG  1 
ATOM   1164 O  OD1 . ASN A 1 147 ? 12.829  31.898  -6.487  1.00 46.71 ? 211  ASN A OD1 1 
ATOM   1165 N  ND2 . ASN A 1 147 ? 13.978  31.099  -4.733  1.00 47.04 ? 211  ASN A ND2 1 
ATOM   1166 N  N   . GLN A 1 148 ? 9.619   34.040  -5.135  1.00 44.31 ? 212  GLN A N   1 
ATOM   1167 C  CA  . GLN A 1 148 ? 9.063   34.933  -6.147  1.00 45.23 ? 212  GLN A CA  1 
ATOM   1168 C  C   . GLN A 1 148 ? 8.908   36.362  -5.633  1.00 44.74 ? 212  GLN A C   1 
ATOM   1169 O  O   . GLN A 1 148 ? 9.104   37.317  -6.384  1.00 45.58 ? 212  GLN A O   1 
ATOM   1170 C  CB  . GLN A 1 148 ? 7.698   34.432  -6.634  1.00 46.98 ? 212  GLN A CB  1 
ATOM   1171 C  CG  . GLN A 1 148 ? 6.576   34.584  -5.611  1.00 49.93 ? 212  GLN A CG  1 
ATOM   1172 C  CD  . GLN A 1 148 ? 5.186   34.511  -6.232  1.00 52.21 ? 212  GLN A CD  1 
ATOM   1173 O  OE1 . GLN A 1 148 ? 4.172   34.591  -5.527  1.00 51.02 ? 212  GLN A OE1 1 
ATOM   1174 N  NE2 . GLN A 1 148 ? 5.132   34.368  -7.557  1.00 52.34 ? 212  GLN A NE2 1 
ATOM   1175 N  N   . VAL A 1 149 ? 8.550   36.514  -4.362  1.00 43.74 ? 213  VAL A N   1 
ATOM   1176 C  CA  . VAL A 1 149 ? 8.371   37.845  -3.789  1.00 42.43 ? 213  VAL A CA  1 
ATOM   1177 C  C   . VAL A 1 149 ? 9.729   38.481  -3.524  1.00 43.50 ? 213  VAL A C   1 
ATOM   1178 O  O   . VAL A 1 149 ? 9.821   39.652  -3.152  1.00 43.70 ? 213  VAL A O   1 
ATOM   1179 C  CB  . VAL A 1 149 ? 7.571   37.791  -2.470  1.00 40.94 ? 213  VAL A CB  1 
ATOM   1180 C  CG1 . VAL A 1 149 ? 8.451   37.299  -1.343  1.00 39.59 ? 213  VAL A CG1 1 
ATOM   1181 C  CG2 . VAL A 1 149 ? 7.000   39.155  -2.154  1.00 40.54 ? 213  VAL A CG2 1 
ATOM   1182 N  N   . GLY A 1 150 ? 10.782  37.690  -3.714  1.00 43.51 ? 214  GLY A N   1 
ATOM   1183 C  CA  . GLY A 1 150 ? 12.132  38.176  -3.509  1.00 43.19 ? 214  GLY A CA  1 
ATOM   1184 C  C   . GLY A 1 150 ? 12.408  38.766  -2.139  1.00 42.99 ? 214  GLY A C   1 
ATOM   1185 O  O   . GLY A 1 150 ? 12.703  39.955  -2.019  1.00 43.67 ? 214  GLY A O   1 
ATOM   1186 N  N   . ARG A 1 151 ? 12.314  37.936  -1.107  1.00 42.59 ? 215  ARG A N   1 
ATOM   1187 C  CA  . ARG A 1 151 ? 12.572  38.365  0.264   1.00 42.47 ? 215  ARG A CA  1 
ATOM   1188 C  C   . ARG A 1 151 ? 12.347  37.204  1.225   1.00 41.75 ? 215  ARG A C   1 
ATOM   1189 O  O   . ARG A 1 151 ? 11.426  36.406  1.051   1.00 41.48 ? 215  ARG A O   1 
ATOM   1190 C  CB  . ARG A 1 151 ? 11.676  39.552  0.641   1.00 44.41 ? 215  ARG A CB  1 
ATOM   1191 C  CG  . ARG A 1 151 ? 10.192  39.311  0.436   1.00 46.88 ? 215  ARG A CG  1 
ATOM   1192 C  CD  . ARG A 1 151 ? 9.369   40.550  0.770   1.00 49.90 ? 215  ARG A CD  1 
ATOM   1193 N  NE  . ARG A 1 151 ? 7.948   40.342  0.496   1.00 51.39 ? 215  ARG A NE  1 
ATOM   1194 C  CZ  . ARG A 1 151 ? 7.004   41.259  0.681   1.00 51.89 ? 215  ARG A CZ  1 
ATOM   1195 N  NH1 . ARG A 1 151 ? 7.321   42.460  1.146   1.00 52.90 ? 215  ARG A NH1 1 
ATOM   1196 N  NH2 . ARG A 1 151 ? 5.740   40.976  0.394   1.00 51.78 ? 215  ARG A NH2 1 
ATOM   1197 N  N   . LYS A 1 152 ? 13.199  37.110  2.238   1.00 39.94 ? 216  LYS A N   1 
ATOM   1198 C  CA  . LYS A 1 152 ? 13.098  36.037  3.212   1.00 39.01 ? 216  LYS A CA  1 
ATOM   1199 C  C   . LYS A 1 152 ? 11.875  36.192  4.105   1.00 37.88 ? 216  LYS A C   1 
ATOM   1200 O  O   . LYS A 1 152 ? 11.302  37.277  4.208   1.00 38.16 ? 216  LYS A O   1 
ATOM   1201 C  CB  . LYS A 1 152 ? 14.367  35.995  4.063   1.00 40.21 ? 216  LYS A CB  1 
ATOM   1202 C  CG  . LYS A 1 152 ? 15.639  35.810  3.241   1.00 43.21 ? 216  LYS A CG  1 
ATOM   1203 C  CD  . LYS A 1 152 ? 15.594  34.529  2.399   1.00 44.30 ? 216  LYS A CD  1 
ATOM   1204 C  CE  . LYS A 1 152 ? 16.840  34.398  1.529   1.00 44.09 ? 216  LYS A CE  1 
ATOM   1205 N  NZ  . LYS A 1 152 ? 16.865  33.126  0.754   1.00 45.21 ? 216  LYS A NZ  1 
ATOM   1206 N  N   . PRO A 1 153 ? 11.449  35.094  4.752   1.00 36.44 ? 217  PRO A N   1 
ATOM   1207 C  CA  . PRO A 1 153 ? 10.284  35.115  5.644   1.00 35.33 ? 217  PRO A CA  1 
ATOM   1208 C  C   . PRO A 1 153 ? 10.606  35.904  6.906   1.00 35.40 ? 217  PRO A C   1 
ATOM   1209 O  O   . PRO A 1 153 ? 11.764  35.984  7.313   1.00 34.72 ? 217  PRO A O   1 
ATOM   1210 C  CB  . PRO A 1 153 ? 10.053  33.634  5.952   1.00 34.82 ? 217  PRO A CB  1 
ATOM   1211 C  CG  . PRO A 1 153 ? 10.651  32.927  4.772   1.00 35.03 ? 217  PRO A CG  1 
ATOM   1212 C  CD  . PRO A 1 153 ? 11.911  33.712  4.535   1.00 35.50 ? 217  PRO A CD  1 
ATOM   1213 N  N   . THR A 1 154 ? 9.582   36.472  7.532   1.00 35.24 ? 218  THR A N   1 
ATOM   1214 C  CA  . THR A 1 154 ? 9.780   37.242  8.752   1.00 34.48 ? 218  THR A CA  1 
ATOM   1215 C  C   . THR A 1 154 ? 9.385   36.428  9.984   1.00 34.16 ? 218  THR A C   1 
ATOM   1216 O  O   . THR A 1 154 ? 9.499   36.899  11.114  1.00 34.12 ? 218  THR A O   1 
ATOM   1217 C  CB  . THR A 1 154 ? 8.957   38.542  8.721   1.00 35.07 ? 218  THR A CB  1 
ATOM   1218 O  OG1 . THR A 1 154 ? 7.569   38.225  8.572   1.00 35.16 ? 218  THR A OG1 1 
ATOM   1219 C  CG2 . THR A 1 154 ? 9.396   39.423  7.553   1.00 33.93 ? 218  THR A CG2 1 
ATOM   1220 N  N   . MET A 1 155 ? 8.930   35.199  9.757   1.00 33.56 ? 219  MET A N   1 
ATOM   1221 C  CA  . MET A 1 155 ? 8.518   34.311  10.844  1.00 32.44 ? 219  MET A CA  1 
ATOM   1222 C  C   . MET A 1 155 ? 9.308   33.013  10.748  1.00 30.63 ? 219  MET A C   1 
ATOM   1223 O  O   . MET A 1 155 ? 9.750   32.632  9.667   1.00 28.49 ? 219  MET A O   1 
ATOM   1224 C  CB  . MET A 1 155 ? 7.029   33.977  10.719  1.00 33.30 ? 219  MET A CB  1 
ATOM   1225 C  CG  . MET A 1 155 ? 6.234   34.960  9.872   1.00 34.91 ? 219  MET A CG  1 
ATOM   1226 S  SD  . MET A 1 155 ? 4.613   34.316  9.390   1.00 37.69 ? 219  MET A SD  1 
ATOM   1227 C  CE  . MET A 1 155 ? 5.011   33.621  7.787   1.00 34.97 ? 219  MET A CE  1 
ATOM   1228 N  N   . LYS A 1 156 ? 9.477   32.332  11.875  1.00 30.25 ? 220  LYS A N   1 
ATOM   1229 C  CA  . LYS A 1 156 ? 10.190  31.059  11.888  1.00 30.58 ? 220  LYS A CA  1 
ATOM   1230 C  C   . LYS A 1 156 ? 9.224   29.984  11.383  1.00 29.13 ? 220  LYS A C   1 
ATOM   1231 O  O   . LYS A 1 156 ? 8.196   29.720  12.008  1.00 30.79 ? 220  LYS A O   1 
ATOM   1232 C  CB  . LYS A 1 156 ? 10.649  30.722  13.309  1.00 31.83 ? 220  LYS A CB  1 
ATOM   1233 C  CG  . LYS A 1 156 ? 11.586  31.766  13.918  1.00 36.32 ? 220  LYS A CG  1 
ATOM   1234 C  CD  . LYS A 1 156 ? 11.858  31.494  15.394  1.00 39.14 ? 220  LYS A CD  1 
ATOM   1235 C  CE  . LYS A 1 156 ? 10.586  31.644  16.237  1.00 41.60 ? 220  LYS A CE  1 
ATOM   1236 N  NZ  . LYS A 1 156 ? 10.831  31.401  17.691  1.00 41.10 ? 220  LYS A NZ  1 
ATOM   1237 N  N   . TRP A 1 157 ? 9.554   29.377  10.249  1.00 25.96 ? 221  TRP A N   1 
ATOM   1238 C  CA  . TRP A 1 157 ? 8.711   28.342  9.658   1.00 23.23 ? 221  TRP A CA  1 
ATOM   1239 C  C   . TRP A 1 157 ? 9.084   26.918  10.053  1.00 21.11 ? 221  TRP A C   1 
ATOM   1240 O  O   . TRP A 1 157 ? 10.207  26.640  10.469  1.00 21.28 ? 221  TRP A O   1 
ATOM   1241 C  CB  . TRP A 1 157 ? 8.759   28.412  8.128   1.00 21.90 ? 221  TRP A CB  1 
ATOM   1242 C  CG  . TRP A 1 157 ? 7.860   29.426  7.490   1.00 22.43 ? 221  TRP A CG  1 
ATOM   1243 C  CD1 . TRP A 1 157 ? 8.193   30.690  7.096   1.00 21.46 ? 221  TRP A CD1 1 
ATOM   1244 C  CD2 . TRP A 1 157 ? 6.486   29.239  7.124   1.00 21.33 ? 221  TRP A CD2 1 
ATOM   1245 N  NE1 . TRP A 1 157 ? 7.113   31.301  6.501   1.00 21.98 ? 221  TRP A NE1 1 
ATOM   1246 C  CE2 . TRP A 1 157 ? 6.053   30.432  6.506   1.00 21.76 ? 221  TRP A CE2 1 
ATOM   1247 C  CE3 . TRP A 1 157 ? 5.581   28.177  7.257   1.00 20.11 ? 221  TRP A CE3 1 
ATOM   1248 C  CZ2 . TRP A 1 157 ? 4.747   30.595  6.018   1.00 21.77 ? 221  TRP A CZ2 1 
ATOM   1249 C  CZ3 . TRP A 1 157 ? 4.285   28.339  6.775   1.00 21.01 ? 221  TRP A CZ3 1 
ATOM   1250 C  CH2 . TRP A 1 157 ? 3.882   29.542  6.161   1.00 21.55 ? 221  TRP A CH2 1 
ATOM   1251 N  N   . SER A 1 158 ? 8.119   26.020  9.890   1.00 18.81 ? 222  SER A N   1 
ATOM   1252 C  CA  . SER A 1 158 ? 8.305   24.603  10.149  1.00 19.22 ? 222  SER A CA  1 
ATOM   1253 C  C   . SER A 1 158 ? 7.086   23.910  9.558   1.00 19.27 ? 222  SER A C   1 
ATOM   1254 O  O   . SER A 1 158 ? 6.100   24.567  9.197   1.00 17.25 ? 222  SER A O   1 
ATOM   1255 C  CB  . SER A 1 158 ? 8.408   24.308  11.649  1.00 19.80 ? 222  SER A CB  1 
ATOM   1256 O  OG  . SER A 1 158 ? 7.151   24.428  12.281  1.00 21.78 ? 222  SER A OG  1 
ATOM   1257 N  N   . THR A 1 159 ? 7.143   22.591  9.436   1.00 18.26 ? 223  THR A N   1 
ATOM   1258 C  CA  . THR A 1 159 ? 6.003   21.898  8.874   1.00 18.95 ? 223  THR A CA  1 
ATOM   1259 C  C   . THR A 1 159 ? 5.674   20.565  9.499   1.00 18.74 ? 223  THR A C   1 
ATOM   1260 O  O   . THR A 1 159 ? 6.531   19.884  10.062  1.00 18.98 ? 223  THR A O   1 
ATOM   1261 C  CB  . THR A 1 159 ? 6.164   21.675  7.339   1.00 21.32 ? 223  THR A CB  1 
ATOM   1262 O  OG1 . THR A 1 159 ? 5.046   20.922  6.846   1.00 19.52 ? 223  THR A OG1 1 
ATOM   1263 C  CG2 . THR A 1 159 ? 7.450   20.921  7.026   1.00 17.84 ? 223  THR A CG2 1 
ATOM   1264 N  N   . ILE A 1 160 ? 4.392   20.237  9.420   1.00 18.60 ? 224  ILE A N   1 
ATOM   1265 C  CA  . ILE A 1 160 ? 3.859   18.965  9.869   1.00 18.86 ? 224  ILE A CA  1 
ATOM   1266 C  C   . ILE A 1 160 ? 3.440   18.461  8.493   1.00 19.77 ? 224  ILE A C   1 
ATOM   1267 O  O   . ILE A 1 160 ? 2.314   18.679  8.055   1.00 20.23 ? 224  ILE A O   1 
ATOM   1268 C  CB  . ILE A 1 160 ? 2.627   19.150  10.776  1.00 19.33 ? 224  ILE A CB  1 
ATOM   1269 C  CG1 . ILE A 1 160 ? 3.045   19.852  12.071  1.00 18.93 ? 224  ILE A CG1 1 
ATOM   1270 C  CG2 . ILE A 1 160 ? 1.997   17.796  11.081  1.00 16.39 ? 224  ILE A CG2 1 
ATOM   1271 C  CD1 . ILE A 1 160 ? 1.907   20.095  13.049  1.00 19.39 ? 224  ILE A CD1 1 
ATOM   1272 N  N   . ASP A 1 161 ? 4.387   17.831  7.803   1.00 19.23 ? 225  ASP A N   1 
ATOM   1273 C  CA  . ASP A 1 161 ? 4.187   17.344  6.446   1.00 19.17 ? 225  ASP A CA  1 
ATOM   1274 C  C   . ASP A 1 161 ? 3.452   16.020  6.290   1.00 18.52 ? 225  ASP A C   1 
ATOM   1275 O  O   . ASP A 1 161 ? 3.106   15.643  5.174   1.00 17.41 ? 225  ASP A O   1 
ATOM   1276 C  CB  . ASP A 1 161 ? 5.540   17.251  5.736   1.00 18.69 ? 225  ASP A CB  1 
ATOM   1277 C  CG  . ASP A 1 161 ? 6.529   16.398  6.496   1.00 18.35 ? 225  ASP A CG  1 
ATOM   1278 O  OD1 . ASP A 1 161 ? 6.907   16.788  7.626   1.00 18.83 ? 225  ASP A OD1 1 
ATOM   1279 O  OD2 . ASP A 1 161 ? 6.918   15.333  5.968   1.00 20.64 ? 225  ASP A OD2 1 
ATOM   1280 N  N   . ARG A 1 162 ? 3.238   15.306  7.390   1.00 17.39 ? 226  ARG A N   1 
ATOM   1281 C  CA  . ARG A 1 162 ? 2.515   14.040  7.331   1.00 16.53 ? 226  ARG A CA  1 
ATOM   1282 C  C   . ARG A 1 162 ? 2.178   13.523  8.721   1.00 15.67 ? 226  ARG A C   1 
ATOM   1283 O  O   . ARG A 1 162 ? 2.855   13.840  9.687   1.00 16.50 ? 226  ARG A O   1 
ATOM   1284 C  CB  . ARG A 1 162 ? 3.318   12.988  6.550   1.00 14.77 ? 226  ARG A CB  1 
ATOM   1285 C  CG  . ARG A 1 162 ? 4.525   12.416  7.268   1.00 15.43 ? 226  ARG A CG  1 
ATOM   1286 C  CD  . ARG A 1 162 ? 5.419   11.694  6.265   1.00 14.49 ? 226  ARG A CD  1 
ATOM   1287 N  NE  . ARG A 1 162 ? 6.105   12.669  5.433   1.00 17.70 ? 226  ARG A NE  1 
ATOM   1288 C  CZ  . ARG A 1 162 ? 6.655   12.424  4.251   1.00 15.81 ? 226  ARG A CZ  1 
ATOM   1289 N  NH1 . ARG A 1 162 ? 6.612   11.212  3.713   1.00 16.90 ? 226  ARG A NH1 1 
ATOM   1290 N  NH2 . ARG A 1 162 ? 7.256   13.410  3.607   1.00 17.13 ? 226  ARG A NH2 1 
ATOM   1291 N  N   . TRP A 1 163 ? 1.121   12.723  8.810   1.00 15.19 ? 227  TRP A N   1 
ATOM   1292 C  CA  . TRP A 1 163 ? 0.679   12.165  10.083  1.00 14.91 ? 227  TRP A CA  1 
ATOM   1293 C  C   . TRP A 1 163 ? -0.304  11.036  9.812   1.00 14.87 ? 227  TRP A C   1 
ATOM   1294 O  O   . TRP A 1 163 ? -1.421  11.026  10.328  1.00 15.24 ? 227  TRP A O   1 
ATOM   1295 C  CB  . TRP A 1 163 ? 0.015   13.254  10.933  1.00 14.69 ? 227  TRP A CB  1 
ATOM   1296 C  CG  . TRP A 1 163 ? -0.922  14.163  10.177  1.00 13.54 ? 227  TRP A CG  1 
ATOM   1297 C  CD1 . TRP A 1 163 ? -0.580  15.126  9.269   1.00 12.97 ? 227  TRP A CD1 1 
ATOM   1298 C  CD2 . TRP A 1 163 ? -2.344  14.258  10.343  1.00 13.61 ? 227  TRP A CD2 1 
ATOM   1299 N  NE1 . TRP A 1 163 ? -1.697  15.819  8.870   1.00 14.98 ? 227  TRP A NE1 1 
ATOM   1300 C  CE2 . TRP A 1 163 ? -2.793  15.307  9.514   1.00 12.62 ? 227  TRP A CE2 1 
ATOM   1301 C  CE3 . TRP A 1 163 ? -3.282  13.558  11.116  1.00 13.84 ? 227  TRP A CE3 1 
ATOM   1302 C  CZ2 . TRP A 1 163 ? -4.141  15.676  9.436   1.00 12.20 ? 227  TRP A CZ2 1 
ATOM   1303 C  CZ3 . TRP A 1 163 ? -4.625  13.926  11.036  1.00 13.14 ? 227  TRP A CZ3 1 
ATOM   1304 C  CH2 . TRP A 1 163 ? -5.036  14.975  10.202  1.00 12.41 ? 227  TRP A CH2 1 
ATOM   1305 N  N   . PRO A 1 164 ? 0.131   10.041  9.027   1.00 14.06 ? 228  PRO A N   1 
ATOM   1306 C  CA  . PRO A 1 164 ? -0.677  8.885   8.647   1.00 12.89 ? 228  PRO A CA  1 
ATOM   1307 C  C   . PRO A 1 164 ? -1.160  7.974   9.767   1.00 14.57 ? 228  PRO A C   1 
ATOM   1308 O  O   . PRO A 1 164 ? -2.175  7.288   9.614   1.00 14.75 ? 228  PRO A O   1 
ATOM   1309 C  CB  . PRO A 1 164 ? 0.226   8.154   7.663   1.00 11.98 ? 228  PRO A CB  1 
ATOM   1310 C  CG  . PRO A 1 164 ? 1.589   8.364   8.271   1.00 11.65 ? 228  PRO A CG  1 
ATOM   1311 C  CD  . PRO A 1 164 ? 1.549   9.834   8.661   1.00 11.92 ? 228  PRO A CD  1 
ATOM   1312 N  N   . THR A 1 165 ? -0.451  7.951   10.889  1.00 13.90 ? 229  THR A N   1 
ATOM   1313 C  CA  . THR A 1 165 ? -0.875  7.071   11.963  1.00 16.11 ? 229  THR A CA  1 
ATOM   1314 C  C   . THR A 1 165 ? -1.128  7.733   13.314  1.00 17.95 ? 229  THR A C   1 
ATOM   1315 O  O   . THR A 1 165 ? -1.076  7.062   14.343  1.00 18.23 ? 229  THR A O   1 
ATOM   1316 C  CB  . THR A 1 165 ? 0.139   5.911   12.158  1.00 16.29 ? 229  THR A CB  1 
ATOM   1317 O  OG1 . THR A 1 165 ? 1.423   6.445   12.498  1.00 16.44 ? 229  THR A OG1 1 
ATOM   1318 C  CG2 . THR A 1 165 ? 0.266   5.091   10.876  1.00 14.36 ? 229  THR A CG2 1 
ATOM   1319 N  N   . HIS A 1 166 ? -1.403  9.034   13.333  1.00 18.21 ? 230  HIS A N   1 
ATOM   1320 C  CA  . HIS A 1 166 ? -1.662  9.683   14.617  1.00 19.60 ? 230  HIS A CA  1 
ATOM   1321 C  C   . HIS A 1 166 ? -2.802  8.931   15.298  1.00 19.22 ? 230  HIS A C   1 
ATOM   1322 O  O   . HIS A 1 166 ? -3.874  8.745   14.717  1.00 17.60 ? 230  HIS A O   1 
ATOM   1323 C  CB  . HIS A 1 166 ? -2.025  11.157  14.452  1.00 18.01 ? 230  HIS A CB  1 
ATOM   1324 C  CG  . HIS A 1 166 ? -2.086  11.891  15.752  1.00 20.48 ? 230  HIS A CG  1 
ATOM   1325 N  ND1 . HIS A 1 166 ? -3.207  11.894  16.553  1.00 22.01 ? 230  HIS A ND1 1 
ATOM   1326 C  CD2 . HIS A 1 166 ? -1.133  12.566  16.436  1.00 20.28 ? 230  HIS A CD2 1 
ATOM   1327 C  CE1 . HIS A 1 166 ? -2.941  12.537  17.676  1.00 21.42 ? 230  HIS A CE1 1 
ATOM   1328 N  NE2 . HIS A 1 166 ? -1.689  12.955  17.629  1.00 20.77 ? 230  HIS A NE2 1 
ATOM   1329 N  N   . HIS A 1 167 ? -2.564  8.503   16.532  1.00 20.05 ? 231  HIS A N   1 
ATOM   1330 C  CA  . HIS A 1 167 ? -3.547  7.708   17.253  1.00 22.16 ? 231  HIS A CA  1 
ATOM   1331 C  C   . HIS A 1 167 ? -4.962  8.262   17.347  1.00 21.46 ? 231  HIS A C   1 
ATOM   1332 O  O   . HIS A 1 167 ? -5.907  7.488   17.395  1.00 19.19 ? 231  HIS A O   1 
ATOM   1333 C  CB  . HIS A 1 167 ? -3.024  7.346   18.649  1.00 25.06 ? 231  HIS A CB  1 
ATOM   1334 C  CG  . HIS A 1 167 ? -3.232  8.410   19.675  1.00 29.43 ? 231  HIS A CG  1 
ATOM   1335 N  ND1 . HIS A 1 167 ? -2.559  9.612   19.651  1.00 32.32 ? 231  HIS A ND1 1 
ATOM   1336 C  CD2 . HIS A 1 167 ? -4.027  8.443   20.771  1.00 30.46 ? 231  HIS A CD2 1 
ATOM   1337 C  CE1 . HIS A 1 167 ? -2.929  10.340  20.690  1.00 33.72 ? 231  HIS A CE1 1 
ATOM   1338 N  NE2 . HIS A 1 167 ? -3.819  9.654   21.385  1.00 33.03 ? 231  HIS A NE2 1 
ATOM   1339 N  N   . LEU A 1 168 ? -5.123  9.583   17.366  1.00 21.70 ? 232  LEU A N   1 
ATOM   1340 C  CA  . LEU A 1 168 ? -6.467  10.146  17.440  1.00 21.49 ? 232  LEU A CA  1 
ATOM   1341 C  C   . LEU A 1 168 ? -7.111  10.152  16.057  1.00 21.59 ? 232  LEU A C   1 
ATOM   1342 O  O   . LEU A 1 168 ? -8.334  10.072  15.936  1.00 21.65 ? 232  LEU A O   1 
ATOM   1343 C  CB  . LEU A 1 168 ? -6.443  11.552  18.048  1.00 20.96 ? 232  LEU A CB  1 
ATOM   1344 C  CG  . LEU A 1 168 ? -6.131  11.566  19.555  1.00 23.89 ? 232  LEU A CG  1 
ATOM   1345 C  CD1 . LEU A 1 168 ? -6.081  12.999  20.068  1.00 23.30 ? 232  LEU A CD1 1 
ATOM   1346 C  CD2 . LEU A 1 168 ? -7.191  10.772  20.309  1.00 22.88 ? 232  LEU A CD2 1 
ATOM   1347 N  N   . LEU A 1 169 ? -6.291  10.243  15.013  1.00 19.84 ? 233  LEU A N   1 
ATOM   1348 C  CA  . LEU A 1 169 ? -6.819  10.194  13.654  1.00 18.36 ? 233  LEU A CA  1 
ATOM   1349 C  C   . LEU A 1 169 ? -7.394  8.794   13.454  1.00 18.06 ? 233  LEU A C   1 
ATOM   1350 O  O   . LEU A 1 169 ? -8.499  8.631   12.942  1.00 15.70 ? 233  LEU A O   1 
ATOM   1351 C  CB  . LEU A 1 169 ? -5.715  10.423  12.618  1.00 17.46 ? 233  LEU A CB  1 
ATOM   1352 C  CG  . LEU A 1 169 ? -6.118  10.118  11.167  1.00 15.45 ? 233  LEU A CG  1 
ATOM   1353 C  CD1 . LEU A 1 169 ? -7.134  11.152  10.689  1.00 15.53 ? 233  LEU A CD1 1 
ATOM   1354 C  CD2 . LEU A 1 169 ? -4.888  10.136  10.270  1.00 12.15 ? 233  LEU A CD2 1 
ATOM   1355 N  N   . ILE A 1 170 ? -6.629  7.787   13.870  1.00 18.40 ? 234  ILE A N   1 
ATOM   1356 C  CA  . ILE A 1 170 ? -7.054  6.398   13.741  1.00 19.18 ? 234  ILE A CA  1 
ATOM   1357 C  C   . ILE A 1 170 ? -8.338  6.141   14.534  1.00 20.58 ? 234  ILE A C   1 
ATOM   1358 O  O   . ILE A 1 170 ? -9.247  5.464   14.053  1.00 19.21 ? 234  ILE A O   1 
ATOM   1359 C  CB  . ILE A 1 170 ? -5.943  5.434   14.217  1.00 19.48 ? 234  ILE A CB  1 
ATOM   1360 C  CG1 . ILE A 1 170 ? -4.677  5.672   13.390  1.00 20.83 ? 234  ILE A CG1 1 
ATOM   1361 C  CG2 . ILE A 1 170 ? -6.389  3.981   14.060  1.00 19.32 ? 234  ILE A CG2 1 
ATOM   1362 C  CD1 . ILE A 1 170 ? -4.904  5.589   11.879  1.00 17.26 ? 234  ILE A CD1 1 
ATOM   1363 N  N   . GLN A 1 171 ? -8.414  6.699   15.739  1.00 20.07 ? 235  GLN A N   1 
ATOM   1364 C  CA  . GLN A 1 171 ? -9.593  6.526   16.582  1.00 22.12 ? 235  GLN A CA  1 
ATOM   1365 C  C   . GLN A 1 171 ? -10.828 7.152   15.936  1.00 20.86 ? 235  GLN A C   1 
ATOM   1366 O  O   . GLN A 1 171 ? -11.926 6.602   16.020  1.00 20.55 ? 235  GLN A O   1 
ATOM   1367 C  CB  . GLN A 1 171 ? -9.357  7.143   17.965  1.00 23.78 ? 235  GLN A CB  1 
ATOM   1368 C  CG  . GLN A 1 171 ? -10.391 6.723   18.996  1.00 28.22 ? 235  GLN A CG  1 
ATOM   1369 C  CD  . GLN A 1 171 ? -10.076 7.243   20.384  1.00 32.07 ? 235  GLN A CD  1 
ATOM   1370 O  OE1 . GLN A 1 171 ? -8.935  7.158   20.849  1.00 33.39 ? 235  GLN A OE1 1 
ATOM   1371 N  NE2 . GLN A 1 171 ? -11.090 7.775   21.061  1.00 34.59 ? 235  GLN A NE2 1 
ATOM   1372 N  N   . CYS A 1 172 ? -10.654 8.305   15.298  1.00 19.69 ? 236  CYS A N   1 
ATOM   1373 C  CA  . CYS A 1 172 ? -11.777 8.959   14.629  1.00 21.78 ? 236  CYS A CA  1 
ATOM   1374 C  C   . CYS A 1 172 ? -12.304 8.058   13.519  1.00 20.80 ? 236  CYS A C   1 
ATOM   1375 O  O   . CYS A 1 172 ? -13.513 7.870   13.388  1.00 20.24 ? 236  CYS A O   1 
ATOM   1376 C  CB  . CYS A 1 172 ? -11.358 10.307  14.039  1.00 22.35 ? 236  CYS A CB  1 
ATOM   1377 S  SG  . CYS A 1 172 ? -11.132 11.606  15.275  1.00 30.97 ? 236  CYS A SG  1 
ATOM   1378 N  N   . PHE A 1 173 ? -11.398 7.502   12.722  1.00 18.91 ? 237  PHE A N   1 
ATOM   1379 C  CA  . PHE A 1 173 ? -11.805 6.610   11.644  1.00 19.18 ? 237  PHE A CA  1 
ATOM   1380 C  C   . PHE A 1 173 ? -12.486 5.360   12.201  1.00 18.18 ? 237  PHE A C   1 
ATOM   1381 O  O   . PHE A 1 173 ? -13.547 4.969   11.729  1.00 17.10 ? 237  PHE A O   1 
ATOM   1382 C  CB  . PHE A 1 173 ? -10.598 6.207   10.791  1.00 18.62 ? 237  PHE A CB  1 
ATOM   1383 C  CG  . PHE A 1 173 ? -10.254 7.201   9.721   1.00 19.19 ? 237  PHE A CG  1 
ATOM   1384 C  CD1 . PHE A 1 173 ? -8.947  7.654   9.567   1.00 19.36 ? 237  PHE A CD1 1 
ATOM   1385 C  CD2 . PHE A 1 173 ? -11.230 7.660   8.842   1.00 19.99 ? 237  PHE A CD2 1 
ATOM   1386 C  CE1 . PHE A 1 173 ? -8.617  8.549   8.551   1.00 18.62 ? 237  PHE A CE1 1 
ATOM   1387 C  CE2 . PHE A 1 173 ? -10.911 8.557   7.823   1.00 21.49 ? 237  PHE A CE2 1 
ATOM   1388 C  CZ  . PHE A 1 173 ? -9.601  9.001   7.678   1.00 19.45 ? 237  PHE A CZ  1 
ATOM   1389 N  N   . ALA A 1 174 ? -11.879 4.741   13.208  1.00 18.88 ? 238  ALA A N   1 
ATOM   1390 C  CA  . ALA A 1 174 ? -12.453 3.539   13.813  1.00 19.66 ? 238  ALA A CA  1 
ATOM   1391 C  C   . ALA A 1 174 ? -13.857 3.810   14.365  1.00 19.66 ? 238  ALA A C   1 
ATOM   1392 O  O   . ALA A 1 174 ? -14.777 3.029   14.133  1.00 19.88 ? 238  ALA A O   1 
ATOM   1393 C  CB  . ALA A 1 174 ? -11.548 3.023   14.913  1.00 18.00 ? 238  ALA A CB  1 
ATOM   1394 N  N   . ASP A 1 175 ? -14.016 4.920   15.082  1.00 19.93 ? 239  ASP A N   1 
ATOM   1395 C  CA  . ASP A 1 175 ? -15.316 5.283   15.650  1.00 20.78 ? 239  ASP A CA  1 
ATOM   1396 C  C   . ASP A 1 175 ? -16.366 5.458   14.557  1.00 19.94 ? 239  ASP A C   1 
ATOM   1397 O  O   . ASP A 1 175 ? -17.489 4.983   14.691  1.00 20.54 ? 239  ASP A O   1 
ATOM   1398 C  CB  . ASP A 1 175 ? -15.221 6.587   16.462  1.00 21.36 ? 239  ASP A CB  1 
ATOM   1399 C  CG  . ASP A 1 175 ? -14.540 6.397   17.816  1.00 26.78 ? 239  ASP A CG  1 
ATOM   1400 O  OD1 . ASP A 1 175 ? -14.287 7.414   18.503  1.00 27.58 ? 239  ASP A OD1 1 
ATOM   1401 O  OD2 . ASP A 1 175 ? -14.266 5.238   18.203  1.00 28.87 ? 239  ASP A OD2 1 
ATOM   1402 N  N   . HIS A 1 176 ? -16.006 6.150   13.481  1.00 19.19 ? 240  HIS A N   1 
ATOM   1403 C  CA  . HIS A 1 176 ? -16.945 6.375   12.390  1.00 19.54 ? 240  HIS A CA  1 
ATOM   1404 C  C   . HIS A 1 176 ? -17.315 5.077   11.680  1.00 18.04 ? 240  HIS A C   1 
ATOM   1405 O  O   . HIS A 1 176 ? -18.451 4.903   11.246  1.00 15.95 ? 240  HIS A O   1 
ATOM   1406 C  CB  . HIS A 1 176 ? -16.374 7.390   11.400  1.00 19.67 ? 240  HIS A CB  1 
ATOM   1407 C  CG  . HIS A 1 176 ? -16.570 8.815   11.822  1.00 22.45 ? 240  HIS A CG  1 
ATOM   1408 N  ND1 . HIS A 1 176 ? -16.703 9.189   13.142  1.00 24.99 ? 240  HIS A ND1 1 
ATOM   1409 C  CD2 . HIS A 1 176 ? -16.643 9.958   11.100  1.00 23.06 ? 240  HIS A CD2 1 
ATOM   1410 C  CE1 . HIS A 1 176 ? -16.853 10.500  13.214  1.00 23.27 ? 240  HIS A CE1 1 
ATOM   1411 N  NE2 . HIS A 1 176 ? -16.820 10.990  11.988  1.00 23.69 ? 240  HIS A NE2 1 
ATOM   1412 N  N   . ILE A 1 177 ? -16.360 4.164   11.576  1.00 18.44 ? 241  ILE A N   1 
ATOM   1413 C  CA  . ILE A 1 177 ? -16.617 2.884   10.936  1.00 18.25 ? 241  ILE A CA  1 
ATOM   1414 C  C   . ILE A 1 177 ? -17.600 2.080   11.794  1.00 19.32 ? 241  ILE A C   1 
ATOM   1415 O  O   . ILE A 1 177 ? -18.580 1.543   11.287  1.00 18.50 ? 241  ILE A O   1 
ATOM   1416 C  CB  . ILE A 1 177 ? -15.308 2.095   10.756  1.00 16.91 ? 241  ILE A CB  1 
ATOM   1417 C  CG1 . ILE A 1 177 ? -14.479 2.748   9.645   1.00 17.05 ? 241  ILE A CG1 1 
ATOM   1418 C  CG2 . ILE A 1 177 ? -15.601 0.627   10.468  1.00 15.03 ? 241  ILE A CG2 1 
ATOM   1419 C  CD1 . ILE A 1 177 ? -13.052 2.267   9.583   1.00 12.91 ? 241  ILE A CD1 1 
ATOM   1420 N  N   . LEU A 1 178 ? -17.339 2.017   13.096  1.00 20.42 ? 242  LEU A N   1 
ATOM   1421 C  CA  . LEU A 1 178 ? -18.208 1.281   14.004  1.00 22.06 ? 242  LEU A CA  1 
ATOM   1422 C  C   . LEU A 1 178 ? -19.635 1.829   14.017  1.00 23.55 ? 242  LEU A C   1 
ATOM   1423 O  O   . LEU A 1 178 ? -20.592 1.058   13.961  1.00 22.59 ? 242  LEU A O   1 
ATOM   1424 C  CB  . LEU A 1 178 ? -17.633 1.293   15.426  1.00 21.51 ? 242  LEU A CB  1 
ATOM   1425 C  CG  . LEU A 1 178 ? -16.409 0.406   15.693  1.00 21.98 ? 242  LEU A CG  1 
ATOM   1426 C  CD1 . LEU A 1 178 ? -15.774 0.788   17.032  1.00 22.76 ? 242  LEU A CD1 1 
ATOM   1427 C  CD2 . LEU A 1 178 ? -16.829 -1.061  15.690  1.00 19.91 ? 242  LEU A CD2 1 
ATOM   1428 N  N   . LYS A 1 179 ? -19.800 3.147   14.078  1.00 23.17 ? 243  LYS A N   1 
ATOM   1429 C  CA  . LYS A 1 179 ? -21.163 3.668   14.104  1.00 25.32 ? 243  LYS A CA  1 
ATOM   1430 C  C   . LYS A 1 179 ? -21.875 3.409   12.783  1.00 26.68 ? 243  LYS A C   1 
ATOM   1431 O  O   . LYS A 1 179 ? -23.095 3.233   12.756  1.00 26.94 ? 243  LYS A O   1 
ATOM   1432 C  CB  . LYS A 1 179 ? -21.198 5.160   14.463  1.00 24.17 ? 243  LYS A CB  1 
ATOM   1433 C  CG  . LYS A 1 179 ? -20.923 6.147   13.351  1.00 27.38 ? 243  LYS A CG  1 
ATOM   1434 C  CD  . LYS A 1 179 ? -21.020 7.584   13.899  1.00 31.62 ? 243  LYS A CD  1 
ATOM   1435 C  CE  . LYS A 1 179 ? -20.666 8.646   12.850  1.00 32.60 ? 243  LYS A CE  1 
ATOM   1436 N  NZ  . LYS A 1 179 ? -21.594 8.648   11.675  1.00 34.60 ? 243  LYS A NZ  1 
ATOM   1437 N  N   . GLU A 1 180 ? -21.123 3.358   11.686  1.00 26.85 ? 244  GLU A N   1 
ATOM   1438 C  CA  . GLU A 1 180 ? -21.750 3.088   10.406  1.00 27.33 ? 244  GLU A CA  1 
ATOM   1439 C  C   . GLU A 1 180 ? -22.138 1.606   10.312  1.00 27.64 ? 244  GLU A C   1 
ATOM   1440 O  O   . GLU A 1 180 ? -23.170 1.270   9.739   1.00 26.55 ? 244  GLU A O   1 
ATOM   1441 C  CB  . GLU A 1 180 ? -20.828 3.470   9.251   1.00 27.40 ? 244  GLU A CB  1 
ATOM   1442 C  CG  . GLU A 1 180 ? -21.599 3.722   7.970   1.00 28.28 ? 244  GLU A CG  1 
ATOM   1443 C  CD  . GLU A 1 180 ? -22.635 4.845   8.118   1.00 30.19 ? 244  GLU A CD  1 
ATOM   1444 O  OE1 . GLU A 1 180 ? -23.682 4.781   7.436   1.00 30.71 ? 244  GLU A OE1 1 
ATOM   1445 O  OE2 . GLU A 1 180 ? -22.404 5.799   8.898   1.00 27.64 ? 244  GLU A OE2 1 
ATOM   1446 N  N   . LEU A 1 181 ? -21.315 0.724   10.879  1.00 28.88 ? 245  LEU A N   1 
ATOM   1447 C  CA  . LEU A 1 181 ? -21.620 -0.710  10.864  1.00 29.01 ? 245  LEU A CA  1 
ATOM   1448 C  C   . LEU A 1 181 ? -22.920 -0.951  11.623  1.00 29.10 ? 245  LEU A C   1 
ATOM   1449 O  O   . LEU A 1 181 ? -23.679 -1.859  11.288  1.00 29.55 ? 245  LEU A O   1 
ATOM   1450 C  CB  . LEU A 1 181 ? -20.484 -1.525  11.503  1.00 28.25 ? 245  LEU A CB  1 
ATOM   1451 C  CG  . LEU A 1 181 ? -19.219 -1.701  10.652  1.00 30.06 ? 245  LEU A CG  1 
ATOM   1452 C  CD1 . LEU A 1 181 ? -18.135 -2.396  11.456  1.00 28.01 ? 245  LEU A CD1 1 
ATOM   1453 C  CD2 . LEU A 1 181 ? -19.552 -2.508  9.404   1.00 29.38 ? 245  LEU A CD2 1 
ATOM   1454 N  N   . ASP A 1 182 ? -23.167 -0.131  12.644  1.00 29.56 ? 246  ASP A N   1 
ATOM   1455 C  CA  . ASP A 1 182 ? -24.387 -0.226  13.444  1.00 29.88 ? 246  ASP A CA  1 
ATOM   1456 C  C   . ASP A 1 182 ? -25.600 0.144   12.598  1.00 29.73 ? 246  ASP A C   1 
ATOM   1457 O  O   . ASP A 1 182 ? -26.740 -0.136  12.972  1.00 29.18 ? 246  ASP A O   1 
ATOM   1458 C  CB  . ASP A 1 182 ? -24.319 0.719   14.644  1.00 33.25 ? 246  ASP A CB  1 
ATOM   1459 C  CG  . ASP A 1 182 ? -23.353 0.246   15.711  1.00 37.02 ? 246  ASP A CG  1 
ATOM   1460 O  OD1 . ASP A 1 182 ? -23.143 0.996   16.691  1.00 39.76 ? 246  ASP A OD1 1 
ATOM   1461 O  OD2 . ASP A 1 182 ? -22.807 -0.870  15.578  1.00 40.88 ? 246  ASP A OD2 1 
ATOM   1462 N  N   . HIS A 1 183 ? -25.353 0.777   11.457  1.00 28.67 ? 247  HIS A N   1 
ATOM   1463 C  CA  . HIS A 1 183 ? -26.434 1.174   10.568  1.00 29.73 ? 247  HIS A CA  1 
ATOM   1464 C  C   . HIS A 1 183 ? -26.846 0.084   9.586   1.00 28.15 ? 247  HIS A C   1 
ATOM   1465 O  O   . HIS A 1 183 ? -27.867 0.210   8.909   1.00 26.58 ? 247  HIS A O   1 
ATOM   1466 C  CB  . HIS A 1 183 ? -26.065 2.452   9.817   1.00 31.67 ? 247  HIS A CB  1 
ATOM   1467 C  CG  . HIS A 1 183 ? -26.063 3.674   10.681  1.00 35.64 ? 247  HIS A CG  1 
ATOM   1468 N  ND1 . HIS A 1 183 ? -27.108 3.988   11.525  1.00 37.16 ? 247  HIS A ND1 1 
ATOM   1469 C  CD2 . HIS A 1 183 ? -25.157 4.671   10.818  1.00 37.19 ? 247  HIS A CD2 1 
ATOM   1470 C  CE1 . HIS A 1 183 ? -26.846 5.126   12.144  1.00 38.40 ? 247  HIS A CE1 1 
ATOM   1471 N  NE2 . HIS A 1 183 ? -25.668 5.561   11.733  1.00 39.28 ? 247  HIS A NE2 1 
ATOM   1472 N  N   . PHE A 1 184 ? -26.053 -0.980  9.499   1.00 26.82 ? 248  PHE A N   1 
ATOM   1473 C  CA  . PHE A 1 184 ? -26.395 -2.092  8.619   1.00 26.18 ? 248  PHE A CA  1 
ATOM   1474 C  C   . PHE A 1 184 ? -27.391 -2.974  9.362   1.00 27.05 ? 248  PHE A C   1 
ATOM   1475 O  O   . PHE A 1 184 ? -27.464 -2.940  10.590  1.00 25.59 ? 248  PHE A O   1 
ATOM   1476 C  CB  . PHE A 1 184 ? -25.174 -2.960  8.303   1.00 24.03 ? 248  PHE A CB  1 
ATOM   1477 C  CG  . PHE A 1 184 ? -24.291 -2.420  7.224   1.00 22.48 ? 248  PHE A CG  1 
ATOM   1478 C  CD1 . PHE A 1 184 ? -23.373 -1.415  7.494   1.00 20.45 ? 248  PHE A CD1 1 
ATOM   1479 C  CD2 . PHE A 1 184 ? -24.351 -2.949  5.937   1.00 21.92 ? 248  PHE A CD2 1 
ATOM   1480 C  CE1 . PHE A 1 184 ? -22.519 -0.945  6.501   1.00 22.48 ? 248  PHE A CE1 1 
ATOM   1481 C  CE2 . PHE A 1 184 ? -23.502 -2.487  4.936   1.00 22.55 ? 248  PHE A CE2 1 
ATOM   1482 C  CZ  . PHE A 1 184 ? -22.580 -1.479  5.220   1.00 21.43 ? 248  PHE A CZ  1 
ATOM   1483 N  N   . PRO A 1 185 ? -28.176 -3.775  8.627   1.00 28.24 ? 249  PRO A N   1 
ATOM   1484 C  CA  . PRO A 1 185 ? -29.129 -4.646  9.320   1.00 30.21 ? 249  PRO A CA  1 
ATOM   1485 C  C   . PRO A 1 185 ? -28.296 -5.590  10.190  1.00 30.15 ? 249  PRO A C   1 
ATOM   1486 O  O   . PRO A 1 185 ? -27.233 -6.043  9.766   1.00 29.45 ? 249  PRO A O   1 
ATOM   1487 C  CB  . PRO A 1 185 ? -29.821 -5.380  8.174   1.00 29.28 ? 249  PRO A CB  1 
ATOM   1488 C  CG  . PRO A 1 185 ? -29.795 -4.365  7.069   1.00 30.12 ? 249  PRO A CG  1 
ATOM   1489 C  CD  . PRO A 1 185 ? -28.385 -3.816  7.170   1.00 28.68 ? 249  PRO A CD  1 
ATOM   1490 N  N   . LEU A 1 186 ? -28.769 -5.869  11.400  1.00 32.08 ? 250  LEU A N   1 
ATOM   1491 C  CA  . LEU A 1 186 ? -28.053 -6.745  12.328  1.00 34.23 ? 250  LEU A CA  1 
ATOM   1492 C  C   . LEU A 1 186 ? -27.603 -8.063  11.692  1.00 33.89 ? 250  LEU A C   1 
ATOM   1493 O  O   . LEU A 1 186 ? -26.501 -8.540  11.957  1.00 33.56 ? 250  LEU A O   1 
ATOM   1494 C  CB  . LEU A 1 186 ? -28.929 -7.058  13.547  1.00 36.45 ? 250  LEU A CB  1 
ATOM   1495 C  CG  . LEU A 1 186 ? -29.507 -5.878  14.337  1.00 41.15 ? 250  LEU A CG  1 
ATOM   1496 C  CD1 . LEU A 1 186 ? -30.628 -5.204  13.532  1.00 41.33 ? 250  LEU A CD1 1 
ATOM   1497 C  CD2 . LEU A 1 186 ? -30.045 -6.377  15.676  1.00 40.51 ? 250  LEU A CD2 1 
ATOM   1498 N  N   . GLU A 1 187 ? -28.463 -8.642  10.857  1.00 33.37 ? 251  GLU A N   1 
ATOM   1499 C  CA  . GLU A 1 187 ? -28.177 -9.912  10.192  1.00 34.32 ? 251  GLU A CA  1 
ATOM   1500 C  C   . GLU A 1 187 ? -26.984 -9.845  9.243   1.00 33.28 ? 251  GLU A C   1 
ATOM   1501 O  O   . GLU A 1 187 ? -26.343 -10.862 8.974   1.00 32.97 ? 251  GLU A O   1 
ATOM   1502 C  CB  . GLU A 1 187 ? -29.382 -10.385 9.368   1.00 37.61 ? 251  GLU A CB  1 
ATOM   1503 C  CG  . GLU A 1 187 ? -30.752 -10.131 9.967   1.00 42.71 ? 251  GLU A CG  1 
ATOM   1504 C  CD  . GLU A 1 187 ? -31.254 -8.715  9.720   1.00 44.55 ? 251  GLU A CD  1 
ATOM   1505 O  OE1 . GLU A 1 187 ? -30.866 -7.795  10.476  1.00 44.52 ? 251  GLU A OE1 1 
ATOM   1506 O  OE2 . GLU A 1 187 ? -32.037 -8.526  8.761   1.00 45.17 ? 251  GLU A OE2 1 
ATOM   1507 N  N   . LYS A 1 188 ? -26.696 -8.655  8.729   1.00 31.53 ? 252  LYS A N   1 
ATOM   1508 C  CA  . LYS A 1 188 ? -25.611 -8.489  7.769   1.00 31.75 ? 252  LYS A CA  1 
ATOM   1509 C  C   . LYS A 1 188 ? -24.314 -7.910  8.316   1.00 29.97 ? 252  LYS A C   1 
ATOM   1510 O  O   . LYS A 1 188 ? -23.300 -7.903  7.621   1.00 29.73 ? 252  LYS A O   1 
ATOM   1511 C  CB  . LYS A 1 188 ? -26.101 -7.633  6.599   1.00 31.69 ? 252  LYS A CB  1 
ATOM   1512 N  N   . ARG A 1 189 ? -24.338 -7.439  9.556   1.00 29.52 ? 253  ARG A N   1 
ATOM   1513 C  CA  . ARG A 1 189 ? -23.159 -6.828  10.158  1.00 30.43 ? 253  ARG A CA  1 
ATOM   1514 C  C   . ARG A 1 189 ? -21.847 -7.584  9.953   1.00 29.14 ? 253  ARG A C   1 
ATOM   1515 O  O   . ARG A 1 189 ? -20.858 -7.001  9.511   1.00 29.40 ? 253  ARG A O   1 
ATOM   1516 C  CB  . ARG A 1 189 ? -23.385 -6.593  11.655  1.00 31.93 ? 253  ARG A CB  1 
ATOM   1517 C  CG  . ARG A 1 189 ? -22.271 -5.774  12.303  1.00 35.19 ? 253  ARG A CG  1 
ATOM   1518 C  CD  . ARG A 1 189 ? -22.723 -5.124  13.603  1.00 38.94 ? 253  ARG A CD  1 
ATOM   1519 N  NE  . ARG A 1 189 ? -21.752 -4.140  14.080  1.00 41.31 ? 253  ARG A NE  1 
ATOM   1520 C  CZ  . ARG A 1 189 ? -20.536 -4.445  14.520  1.00 43.01 ? 253  ARG A CZ  1 
ATOM   1521 N  NH1 . ARG A 1 189 ? -20.141 -5.713  14.550  1.00 44.82 ? 253  ARG A NH1 1 
ATOM   1522 N  NH2 . ARG A 1 189 ? -19.710 -3.485  14.918  1.00 42.55 ? 253  ARG A NH2 1 
ATOM   1523 N  N   . SER A 1 190 ? -21.842 -8.874  10.274  1.00 27.91 ? 254  SER A N   1 
ATOM   1524 C  CA  . SER A 1 190 ? -20.649 -9.703  10.138  1.00 27.84 ? 254  SER A CA  1 
ATOM   1525 C  C   . SER A 1 190 ? -20.250 -10.019 8.697   1.00 27.31 ? 254  SER A C   1 
ATOM   1526 O  O   . SER A 1 190 ? -19.103 -10.376 8.435   1.00 27.50 ? 254  SER A O   1 
ATOM   1527 C  CB  . SER A 1 190 ? -20.832 -11.016 10.907  1.00 28.28 ? 254  SER A CB  1 
ATOM   1528 O  OG  . SER A 1 190 ? -20.887 -10.779 12.305  1.00 31.68 ? 254  SER A OG  1 
ATOM   1529 N  N   . GLU A 1 191 ? -21.192 -9.884  7.769   1.00 25.46 ? 255  GLU A N   1 
ATOM   1530 C  CA  . GLU A 1 191 ? -20.930 -10.170 6.361   1.00 24.57 ? 255  GLU A CA  1 
ATOM   1531 C  C   . GLU A 1 191 ? -20.347 -8.971  5.610   1.00 21.20 ? 255  GLU A C   1 
ATOM   1532 O  O   . GLU A 1 191 ? -19.794 -9.117  4.526   1.00 20.34 ? 255  GLU A O   1 
ATOM   1533 C  CB  . GLU A 1 191 ? -22.233 -10.643 5.686   1.00 27.57 ? 255  GLU A CB  1 
ATOM   1534 C  CG  . GLU A 1 191 ? -22.278 -10.496 4.166   1.00 31.93 ? 255  GLU A CG  1 
ATOM   1535 C  CD  . GLU A 1 191 ? -21.241 -11.349 3.447   1.00 35.72 ? 255  GLU A CD  1 
ATOM   1536 O  OE1 . GLU A 1 191 ? -21.059 -11.160 2.218   1.00 33.93 ? 255  GLU A OE1 1 
ATOM   1537 O  OE2 . GLU A 1 191 ? -20.611 -12.206 4.110   1.00 37.92 ? 255  GLU A OE2 1 
ATOM   1538 N  N   . VAL A 1 192 ? -20.468 -7.788  6.196   1.00 18.16 ? 256  VAL A N   1 
ATOM   1539 C  CA  . VAL A 1 192 ? -19.965 -6.569  5.575   1.00 18.04 ? 256  VAL A CA  1 
ATOM   1540 C  C   . VAL A 1 192 ? -18.457 -6.583  5.279   1.00 17.42 ? 256  VAL A C   1 
ATOM   1541 O  O   . VAL A 1 192 ? -17.653 -6.994  6.112   1.00 17.76 ? 256  VAL A O   1 
ATOM   1542 C  CB  . VAL A 1 192 ? -20.278 -5.338  6.465   1.00 17.38 ? 256  VAL A CB  1 
ATOM   1543 C  CG1 . VAL A 1 192 ? -19.582 -4.094  5.917   1.00 16.96 ? 256  VAL A CG1 1 
ATOM   1544 C  CG2 . VAL A 1 192 ? -21.780 -5.114  6.523   1.00 18.16 ? 256  VAL A CG2 1 
ATOM   1545 N  N   . VAL A 1 193 ? -18.090 -6.139  4.081   1.00 18.67 ? 257  VAL A N   1 
ATOM   1546 C  CA  . VAL A 1 193 ? -16.688 -6.053  3.685   1.00 20.60 ? 257  VAL A CA  1 
ATOM   1547 C  C   . VAL A 1 193 ? -16.309 -4.569  3.654   1.00 20.00 ? 257  VAL A C   1 
ATOM   1548 O  O   . VAL A 1 193 ? -17.009 -3.744  3.062   1.00 18.21 ? 257  VAL A O   1 
ATOM   1549 C  CB  . VAL A 1 193 ? -16.441 -6.686  2.290   1.00 22.18 ? 257  VAL A CB  1 
ATOM   1550 C  CG1 . VAL A 1 193 ? -16.715 -8.171  2.345   1.00 24.46 ? 257  VAL A CG1 1 
ATOM   1551 C  CG2 . VAL A 1 193 ? -17.326 -6.042  1.252   1.00 25.60 ? 257  VAL A CG2 1 
ATOM   1552 N  N   . ILE A 1 194 ? -15.208 -4.220  4.303   1.00 18.41 ? 258  ILE A N   1 
ATOM   1553 C  CA  . ILE A 1 194 ? -14.799 -2.826  4.334   1.00 17.10 ? 258  ILE A CA  1 
ATOM   1554 C  C   . ILE A 1 194 ? -13.863 -2.462  3.188   1.00 17.38 ? 258  ILE A C   1 
ATOM   1555 O  O   . ILE A 1 194 ? -12.776 -3.020  3.057   1.00 18.02 ? 258  ILE A O   1 
ATOM   1556 C  CB  . ILE A 1 194 ? -14.106 -2.477  5.677   1.00 18.21 ? 258  ILE A CB  1 
ATOM   1557 C  CG1 . ILE A 1 194 ? -15.020 -2.838  6.854   1.00 17.62 ? 258  ILE A CG1 1 
ATOM   1558 C  CG2 . ILE A 1 194 ? -13.775 -0.995  5.715   1.00 16.35 ? 258  ILE A CG2 1 
ATOM   1559 C  CD1 . ILE A 1 194 ? -14.349 -2.732  8.217   1.00 15.67 ? 258  ILE A CD1 1 
ATOM   1560 N  N   . LEU A 1 195 ? -14.301 -1.541  2.340   1.00 16.16 ? 259  LEU A N   1 
ATOM   1561 C  CA  . LEU A 1 195 ? -13.461 -1.087  1.247   1.00 17.33 ? 259  LEU A CA  1 
ATOM   1562 C  C   . LEU A 1 195 ? -12.890 0.267   1.634   1.00 17.27 ? 259  LEU A C   1 
ATOM   1563 O  O   . LEU A 1 195 ? -13.620 1.262   1.692   1.00 16.74 ? 259  LEU A O   1 
ATOM   1564 C  CB  . LEU A 1 195 ? -14.247 -0.933  -0.060  1.00 16.59 ? 259  LEU A CB  1 
ATOM   1565 C  CG  . LEU A 1 195 ? -14.619 -2.176  -0.867  1.00 18.39 ? 259  LEU A CG  1 
ATOM   1566 C  CD1 . LEU A 1 195 ? -15.287 -1.736  -2.171  1.00 16.55 ? 259  LEU A CD1 1 
ATOM   1567 C  CD2 . LEU A 1 195 ? -13.362 -3.001  -1.165  1.00 17.87 ? 259  LEU A CD2 1 
ATOM   1568 N  N   . PHE A 1 196 ? -11.601 0.294   1.951   1.00 13.99 ? 260  PHE A N   1 
ATOM   1569 C  CA  . PHE A 1 196 ? -10.962 1.557   2.274   1.00 15.63 ? 260  PHE A CA  1 
ATOM   1570 C  C   . PHE A 1 196 ? -10.672 2.150   0.907   1.00 15.72 ? 260  PHE A C   1 
ATOM   1571 O  O   . PHE A 1 196 ? -10.016 1.522   0.075   1.00 17.18 ? 260  PHE A O   1 
ATOM   1572 C  CB  . PHE A 1 196 ? -9.661  1.348   3.059   1.00 12.89 ? 260  PHE A CB  1 
ATOM   1573 C  CG  . PHE A 1 196 ? -9.880  0.936   4.477   1.00 12.15 ? 260  PHE A CG  1 
ATOM   1574 C  CD1 . PHE A 1 196 ? -9.974  -0.406  4.821   1.00 11.06 ? 260  PHE A CD1 1 
ATOM   1575 C  CD2 . PHE A 1 196 ? -10.036 1.894   5.472   1.00 12.85 ? 260  PHE A CD2 1 
ATOM   1576 C  CE1 . PHE A 1 196 ? -10.223 -0.789  6.134   1.00 12.79 ? 260  PHE A CE1 1 
ATOM   1577 C  CE2 . PHE A 1 196 ? -10.286 1.519   6.795   1.00 14.35 ? 260  PHE A CE2 1 
ATOM   1578 C  CZ  . PHE A 1 196 ? -10.380 0.177   7.125   1.00 12.30 ? 260  PHE A CZ  1 
ATOM   1579 N  N   . SER A 1 197 ? -11.179 3.349   0.668   1.00 16.02 ? 261  SER A N   1 
ATOM   1580 C  CA  . SER A 1 197 ? -10.992 3.987   -0.619  1.00 18.27 ? 261  SER A CA  1 
ATOM   1581 C  C   . SER A 1 197 ? -10.162 5.264   -0.534  1.00 17.90 ? 261  SER A C   1 
ATOM   1582 O  O   . SER A 1 197 ? -10.529 6.218   0.151   1.00 18.07 ? 261  SER A O   1 
ATOM   1583 C  CB  . SER A 1 197 ? -12.366 4.284   -1.234  1.00 18.75 ? 261  SER A CB  1 
ATOM   1584 O  OG  . SER A 1 197 ? -12.254 4.680   -2.586  1.00 17.83 ? 261  SER A OG  1 
ATOM   1585 N  N   . ALA A 1 198 ? -9.042  5.280   -1.244  1.00 17.84 ? 262  ALA A N   1 
ATOM   1586 C  CA  . ALA A 1 198 ? -8.177  6.447   -1.256  1.00 17.88 ? 262  ALA A CA  1 
ATOM   1587 C  C   . ALA A 1 198 ? -8.017  6.919   -2.689  1.00 18.23 ? 262  ALA A C   1 
ATOM   1588 O  O   . ALA A 1 198 ? -8.263  6.171   -3.631  1.00 16.64 ? 262  ALA A O   1 
ATOM   1589 C  CB  . ALA A 1 198 ? -6.815  6.104   -0.655  1.00 16.39 ? 262  ALA A CB  1 
ATOM   1590 N  N   . CYS A 1 199 ? -7.616  8.169   -2.857  1.00 20.76 ? 263  CYS A N   1 
ATOM   1591 C  CA  . CYS A 1 199 ? -7.422  8.695   -4.192  1.00 22.06 ? 263  CYS A CA  1 
ATOM   1592 C  C   . CYS A 1 199 ? -6.241  7.989   -4.843  1.00 22.29 ? 263  CYS A C   1 
ATOM   1593 O  O   . CYS A 1 199 ? -5.165  7.873   -4.253  1.00 20.68 ? 263  CYS A O   1 
ATOM   1594 C  CB  . CYS A 1 199 ? -7.184  10.206  -4.139  1.00 25.19 ? 263  CYS A CB  1 
ATOM   1595 S  SG  . CYS A 1 199 ? -8.721  11.159  -4.093  1.00 33.43 ? 263  CYS A SG  1 
ATOM   1596 N  N   . SER A 1 200 ? -6.466  7.500   -6.057  1.00 19.84 ? 264  SER A N   1 
ATOM   1597 C  CA  . SER A 1 200 ? -5.447  6.801   -6.817  1.00 18.98 ? 264  SER A CA  1 
ATOM   1598 C  C   . SER A 1 200 ? -4.409  7.759   -7.387  1.00 18.73 ? 264  SER A C   1 
ATOM   1599 O  O   . SER A 1 200 ? -4.577  8.976   -7.347  1.00 17.49 ? 264  SER A O   1 
ATOM   1600 C  CB  . SER A 1 200 ? -6.091  6.029   -7.963  1.00 18.97 ? 264  SER A CB  1 
ATOM   1601 O  OG  . SER A 1 200 ? -5.106  5.374   -8.740  1.00 21.23 ? 264  SER A OG  1 
ATOM   1602 N  N   . LEU A 1 201 ? -3.329  7.196   -7.913  1.00 17.62 ? 265  LEU A N   1 
ATOM   1603 C  CA  . LEU A 1 201 ? -2.274  7.992   -8.513  1.00 17.67 ? 265  LEU A CA  1 
ATOM   1604 C  C   . LEU A 1 201 ? -1.851  7.335   -9.805  1.00 16.96 ? 265  LEU A C   1 
ATOM   1605 O  O   . LEU A 1 201 ? -2.005  6.130   -9.977  1.00 15.82 ? 265  LEU A O   1 
ATOM   1606 C  CB  . LEU A 1 201 ? -1.052  8.075   -7.599  1.00 20.30 ? 265  LEU A CB  1 
ATOM   1607 C  CG  . LEU A 1 201 ? -1.152  8.822   -6.271  1.00 23.28 ? 265  LEU A CG  1 
ATOM   1608 C  CD1 . LEU A 1 201 ? 0.159   8.669   -5.505  1.00 22.20 ? 265  LEU A CD1 1 
ATOM   1609 C  CD2 . LEU A 1 201 ? -1.459  10.290  -6.534  1.00 23.61 ? 265  LEU A CD2 1 
ATOM   1610 N  N   . PRO A 1 202 ? -1.326  8.127   -10.746 1.00 17.63 ? 266  PRO A N   1 
ATOM   1611 C  CA  . PRO A 1 202 ? -0.888  7.536   -12.007 1.00 17.40 ? 266  PRO A CA  1 
ATOM   1612 C  C   . PRO A 1 202 ? 0.312   6.647   -11.671 1.00 17.87 ? 266  PRO A C   1 
ATOM   1613 O  O   . PRO A 1 202 ? 1.085   6.965   -10.768 1.00 17.99 ? 266  PRO A O   1 
ATOM   1614 C  CB  . PRO A 1 202 ? -0.482  8.753   -12.833 1.00 17.72 ? 266  PRO A CB  1 
ATOM   1615 C  CG  . PRO A 1 202 ? -1.360  9.852   -12.276 1.00 18.44 ? 266  PRO A CG  1 
ATOM   1616 C  CD  . PRO A 1 202 ? -1.272  9.599   -10.799 1.00 16.84 ? 266  PRO A CD  1 
ATOM   1617 N  N   . MET A 1 203 ? 0.468   5.533   -12.369 1.00 17.19 ? 267  MET A N   1 
ATOM   1618 C  CA  . MET A 1 203 ? 1.604   4.672   -12.087 1.00 18.98 ? 267  MET A CA  1 
ATOM   1619 C  C   . MET A 1 203 ? 2.925   5.389   -12.323 1.00 18.91 ? 267  MET A C   1 
ATOM   1620 O  O   . MET A 1 203 ? 3.918   5.086   -11.662 1.00 19.18 ? 267  MET A O   1 
ATOM   1621 C  CB  . MET A 1 203 ? 1.534   3.392   -12.915 1.00 18.35 ? 267  MET A CB  1 
ATOM   1622 C  CG  . MET A 1 203 ? 0.473   2.413   -12.403 1.00 19.84 ? 267  MET A CG  1 
ATOM   1623 S  SD  . MET A 1 203 ? 0.625   2.061   -10.613 1.00 22.00 ? 267  MET A SD  1 
ATOM   1624 C  CE  . MET A 1 203 ? 2.211   1.165   -10.540 1.00 18.89 ? 267  MET A CE  1 
ATOM   1625 N  N   . SER A 1 204 ? 2.943   6.352   -13.240 1.00 19.19 ? 268  SER A N   1 
ATOM   1626 C  CA  . SER A 1 204 ? 4.176   7.086   -13.502 1.00 19.75 ? 268  SER A CA  1 
ATOM   1627 C  C   . SER A 1 204 ? 4.627   7.798   -12.231 1.00 19.46 ? 268  SER A C   1 
ATOM   1628 O  O   . SER A 1 204 ? 5.827   7.926   -11.978 1.00 20.74 ? 268  SER A O   1 
ATOM   1629 C  CB  . SER A 1 204 ? 3.996   8.102   -14.646 1.00 21.11 ? 268  SER A CB  1 
ATOM   1630 O  OG  . SER A 1 204 ? 3.017   9.079   -14.351 1.00 21.71 ? 268  SER A OG  1 
ATOM   1631 N  N   . VAL A 1 205 ? 3.670   8.248   -11.426 1.00 17.56 ? 269  VAL A N   1 
ATOM   1632 C  CA  . VAL A 1 205 ? 4.002   8.928   -10.180 1.00 16.24 ? 269  VAL A CA  1 
ATOM   1633 C  C   . VAL A 1 205 ? 4.418   7.907   -9.116  1.00 16.23 ? 269  VAL A C   1 
ATOM   1634 O  O   . VAL A 1 205 ? 5.413   8.097   -8.412  1.00 14.21 ? 269  VAL A O   1 
ATOM   1635 C  CB  . VAL A 1 205 ? 2.808   9.751   -9.651  1.00 18.17 ? 269  VAL A CB  1 
ATOM   1636 C  CG1 . VAL A 1 205 ? 3.110   10.268  -8.261  1.00 16.94 ? 269  VAL A CG1 1 
ATOM   1637 C  CG2 . VAL A 1 205 ? 2.522   10.915  -10.592 1.00 18.57 ? 269  VAL A CG2 1 
ATOM   1638 N  N   . VAL A 1 206 ? 3.650   6.831   -9.002  1.00 14.65 ? 270  VAL A N   1 
ATOM   1639 C  CA  . VAL A 1 206 ? 3.947   5.782   -8.037  1.00 15.10 ? 270  VAL A CA  1 
ATOM   1640 C  C   . VAL A 1 206 ? 5.362   5.248   -8.275  1.00 14.48 ? 270  VAL A C   1 
ATOM   1641 O  O   . VAL A 1 206 ? 6.131   5.047   -7.333  1.00 12.48 ? 270  VAL A O   1 
ATOM   1642 C  CB  . VAL A 1 206 ? 2.959   4.595   -8.176  1.00 15.63 ? 270  VAL A CB  1 
ATOM   1643 C  CG1 . VAL A 1 206 ? 3.415   3.431   -7.307  1.00 15.97 ? 270  VAL A CG1 1 
ATOM   1644 C  CG2 . VAL A 1 206 ? 1.558   5.030   -7.792  1.00 14.38 ? 270  VAL A CG2 1 
ATOM   1645 N  N   . ASN A 1 207 ? 5.688   5.022   -9.543  1.00 14.13 ? 271  ASN A N   1 
ATOM   1646 C  CA  . ASN A 1 207 ? 6.985   4.488   -9.913  1.00 17.29 ? 271  ASN A CA  1 
ATOM   1647 C  C   . ASN A 1 207 ? 8.181   5.407   -9.706  1.00 18.10 ? 271  ASN A C   1 
ATOM   1648 O  O   . ASN A 1 207 ? 9.318   4.951   -9.815  1.00 17.82 ? 271  ASN A O   1 
ATOM   1649 C  CB  . ASN A 1 207 ? 6.961   3.979   -11.364 1.00 17.87 ? 271  ASN A CB  1 
ATOM   1650 C  CG  . ASN A 1 207 ? 6.089   2.750   -11.527 1.00 18.10 ? 271  ASN A CG  1 
ATOM   1651 O  OD1 . ASN A 1 207 ? 5.970   1.946   -10.603 1.00 20.22 ? 271  ASN A OD1 1 
ATOM   1652 N  ND2 . ASN A 1 207 ? 5.481   2.591   -12.698 1.00 18.93 ? 271  ASN A ND2 1 
ATOM   1653 N  N   . ARG A 1 208 ? 7.960   6.687   -9.416  1.00 18.42 ? 272  ARG A N   1 
ATOM   1654 C  CA  . ARG A 1 208 ? 9.114   7.539   -9.191  1.00 20.93 ? 272  ARG A CA  1 
ATOM   1655 C  C   . ARG A 1 208 ? 9.499   7.543   -7.720  1.00 19.90 ? 272  ARG A C   1 
ATOM   1656 O  O   . ARG A 1 208 ? 10.554  8.064   -7.346  1.00 20.74 ? 272  ARG A O   1 
ATOM   1657 C  CB  . ARG A 1 208 ? 8.904   8.971   -9.717  1.00 23.15 ? 272  ARG A CB  1 
ATOM   1658 C  CG  . ARG A 1 208 ? 7.767   9.794   -9.148  1.00 28.56 ? 272  ARG A CG  1 
ATOM   1659 C  CD  . ARG A 1 208 ? 7.909   11.223  -9.689  1.00 31.66 ? 272  ARG A CD  1 
ATOM   1660 N  NE  . ARG A 1 208 ? 6.691   12.031  -9.629  1.00 36.54 ? 272  ARG A NE  1 
ATOM   1661 C  CZ  . ARG A 1 208 ? 6.025   12.322  -8.514  1.00 39.88 ? 272  ARG A CZ  1 
ATOM   1662 N  NH1 . ARG A 1 208 ? 6.444   11.866  -7.332  1.00 41.99 ? 272  ARG A NH1 1 
ATOM   1663 N  NH2 . ARG A 1 208 ? 4.943   13.088  -8.578  1.00 40.03 ? 272  ARG A NH2 1 
ATOM   1664 N  N   . GLY A 1 209 ? 8.648   6.935   -6.897  1.00 18.07 ? 273  GLY A N   1 
ATOM   1665 C  CA  . GLY A 1 209 ? 8.926   6.848   -5.473  1.00 18.34 ? 273  GLY A CA  1 
ATOM   1666 C  C   . GLY A 1 209 ? 7.971   7.554   -4.524  1.00 17.56 ? 273  GLY A C   1 
ATOM   1667 O  O   . GLY A 1 209 ? 8.316   7.769   -3.360  1.00 17.12 ? 273  GLY A O   1 
ATOM   1668 N  N   . ASP A 1 210 ? 6.778   7.908   -4.999  1.00 16.32 ? 274  ASP A N   1 
ATOM   1669 C  CA  . ASP A 1 210 ? 5.819   8.599   -4.155  1.00 16.29 ? 274  ASP A CA  1 
ATOM   1670 C  C   . ASP A 1 210 ? 5.503   7.815   -2.876  1.00 15.17 ? 274  ASP A C   1 
ATOM   1671 O  O   . ASP A 1 210 ? 5.128   6.648   -2.931  1.00 15.20 ? 274  ASP A O   1 
ATOM   1672 C  CB  . ASP A 1 210 ? 4.531   8.876   -4.931  1.00 17.93 ? 274  ASP A CB  1 
ATOM   1673 C  CG  . ASP A 1 210 ? 3.755   10.057  -4.358  1.00 20.78 ? 274  ASP A CG  1 
ATOM   1674 O  OD1 . ASP A 1 210 ? 3.037   9.875   -3.352  1.00 18.45 ? 274  ASP A OD1 1 
ATOM   1675 O  OD2 . ASP A 1 210 ? 3.884   11.176  -4.908  1.00 23.99 ? 274  ASP A OD2 1 
ATOM   1676 N  N   . PRO A 1 211 ? 5.656   8.462   -1.707  1.00 15.82 ? 275  PRO A N   1 
ATOM   1677 C  CA  . PRO A 1 211 ? 5.420   7.925   -0.357  1.00 16.10 ? 275  PRO A CA  1 
ATOM   1678 C  C   . PRO A 1 211 ? 3.950   7.552   -0.065  1.00 14.21 ? 275  PRO A C   1 
ATOM   1679 O  O   . PRO A 1 211 ? 3.664   6.699   0.771   1.00 14.33 ? 275  PRO A O   1 
ATOM   1680 C  CB  . PRO A 1 211 ? 5.863   9.072   0.556   1.00 14.08 ? 275  PRO A CB  1 
ATOM   1681 C  CG  . PRO A 1 211 ? 6.744   9.920   -0.297  1.00 17.49 ? 275  PRO A CG  1 
ATOM   1682 C  CD  . PRO A 1 211 ? 6.082   9.871   -1.629  1.00 14.95 ? 275  PRO A CD  1 
ATOM   1683 N  N   . TYR A 1 212 ? 3.039   8.209   -0.764  1.00 14.85 ? 276  TYR A N   1 
ATOM   1684 C  CA  . TYR A 1 212 ? 1.601   8.040   -0.581  1.00 14.32 ? 276  TYR A CA  1 
ATOM   1685 C  C   . TYR A 1 212 ? 1.036   6.623   -0.378  1.00 12.91 ? 276  TYR A C   1 
ATOM   1686 O  O   . TYR A 1 212 ? 0.477   6.335   0.673   1.00 12.86 ? 276  TYR A O   1 
ATOM   1687 C  CB  . TYR A 1 212 ? 0.880   8.747   -1.734  1.00 12.70 ? 276  TYR A CB  1 
ATOM   1688 C  CG  . TYR A 1 212 ? -0.630  8.772   -1.630  1.00 14.47 ? 276  TYR A CG  1 
ATOM   1689 C  CD1 . TYR A 1 212 ? -1.279  9.561   -0.679  1.00 13.92 ? 276  TYR A CD1 1 
ATOM   1690 C  CD2 . TYR A 1 212 ? -1.411  8.031   -2.511  1.00 14.49 ? 276  TYR A CD2 1 
ATOM   1691 C  CE1 . TYR A 1 212 ? -2.675  9.612   -0.616  1.00 13.11 ? 276  TYR A CE1 1 
ATOM   1692 C  CE2 . TYR A 1 212 ? -2.796  8.075   -2.458  1.00 13.73 ? 276  TYR A CE2 1 
ATOM   1693 C  CZ  . TYR A 1 212 ? -3.420  8.860   -1.518  1.00 11.36 ? 276  TYR A CZ  1 
ATOM   1694 O  OH  . TYR A 1 212 ? -4.789  8.886   -1.487  1.00 16.54 ? 276  TYR A OH  1 
ATOM   1695 N  N   . PRO A 1 213 ? 1.185   5.722   -1.366  1.00 13.44 ? 277  PRO A N   1 
ATOM   1696 C  CA  . PRO A 1 213 ? 0.654   4.359   -1.222  1.00 14.32 ? 277  PRO A CA  1 
ATOM   1697 C  C   . PRO A 1 213 ? 1.007   3.675   0.096   1.00 14.29 ? 277  PRO A C   1 
ATOM   1698 O  O   . PRO A 1 213 ? 0.133   3.148   0.793   1.00 13.44 ? 277  PRO A O   1 
ATOM   1699 C  CB  . PRO A 1 213 ? 1.251   3.620   -2.421  1.00 15.05 ? 277  PRO A CB  1 
ATOM   1700 C  CG  . PRO A 1 213 ? 1.417   4.715   -3.439  1.00 17.17 ? 277  PRO A CG  1 
ATOM   1701 C  CD  . PRO A 1 213 ? 1.964   5.848   -2.613  1.00 12.40 ? 277  PRO A CD  1 
ATOM   1702 N  N   . GLN A 1 214 ? 2.289   3.693   0.442   1.00 11.17 ? 278  GLN A N   1 
ATOM   1703 C  CA  . GLN A 1 214 ? 2.740   3.062   1.670   1.00 11.66 ? 278  GLN A CA  1 
ATOM   1704 C  C   . GLN A 1 214 ? 2.143   3.708   2.923   1.00 12.47 ? 278  GLN A C   1 
ATOM   1705 O  O   . GLN A 1 214 ? 1.808   3.011   3.879   1.00 10.59 ? 278  GLN A O   1 
ATOM   1706 C  CB  . GLN A 1 214 ? 4.270   3.075   1.724   1.00 9.98  ? 278  GLN A CB  1 
ATOM   1707 C  CG  . GLN A 1 214 ? 4.871   2.308   2.885   1.00 11.88 ? 278  GLN A CG  1 
ATOM   1708 C  CD  . GLN A 1 214 ? 4.837   3.091   4.182   1.00 14.00 ? 278  GLN A CD  1 
ATOM   1709 O  OE1 . GLN A 1 214 ? 5.031   4.306   4.186   1.00 14.98 ? 278  GLN A OE1 1 
ATOM   1710 N  NE2 . GLN A 1 214 ? 4.601   2.399   5.291   1.00 11.35 ? 278  GLN A NE2 1 
ATOM   1711 N  N   . GLU A 1 215 ? 1.994   5.029   2.922   1.00 12.39 ? 279  GLU A N   1 
ATOM   1712 C  CA  . GLU A 1 215 ? 1.429   5.694   4.087   1.00 14.01 ? 279  GLU A CA  1 
ATOM   1713 C  C   . GLU A 1 215 ? -0.058  5.423   4.246   1.00 12.81 ? 279  GLU A C   1 
ATOM   1714 O  O   . GLU A 1 215 ? -0.529  5.210   5.361   1.00 12.81 ? 279  GLU A O   1 
ATOM   1715 C  CB  . GLU A 1 215 ? 1.699   7.201   4.038   1.00 15.25 ? 279  GLU A CB  1 
ATOM   1716 C  CG  . GLU A 1 215 ? 3.177   7.520   4.192   1.00 17.87 ? 279  GLU A CG  1 
ATOM   1717 C  CD  . GLU A 1 215 ? 3.442   8.977   4.496   1.00 23.23 ? 279  GLU A CD  1 
ATOM   1718 O  OE1 . GLU A 1 215 ? 4.631   9.361   4.504   1.00 27.62 ? 279  GLU A OE1 1 
ATOM   1719 O  OE2 . GLU A 1 215 ? 2.475   9.739   4.731   1.00 24.07 ? 279  GLU A OE2 1 
ATOM   1720 N  N   . VAL A 1 216 ? -0.795  5.429   3.137   1.00 12.24 ? 280  VAL A N   1 
ATOM   1721 C  CA  . VAL A 1 216 ? -2.226  5.151   3.182   1.00 9.96  ? 280  VAL A CA  1 
ATOM   1722 C  C   . VAL A 1 216 ? -2.402  3.745   3.727   1.00 10.64 ? 280  VAL A C   1 
ATOM   1723 O  O   . VAL A 1 216 ? -3.288  3.488   4.530   1.00 12.29 ? 280  VAL A O   1 
ATOM   1724 C  CB  . VAL A 1 216 ? -2.877  5.216   1.774   1.00 10.40 ? 280  VAL A CB  1 
ATOM   1725 C  CG1 . VAL A 1 216 ? -4.354  4.779   1.857   1.00 10.94 ? 280  VAL A CG1 1 
ATOM   1726 C  CG2 . VAL A 1 216 ? -2.798  6.640   1.227   1.00 7.49  ? 280  VAL A CG2 1 
ATOM   1727 N  N   . SER A 1 217 ? -1.547  2.838   3.273   1.00 10.70 ? 281  SER A N   1 
ATOM   1728 C  CA  . SER A 1 217 ? -1.594  1.457   3.724   1.00 12.04 ? 281  SER A CA  1 
ATOM   1729 C  C   . SER A 1 217 ? -1.368  1.381   5.224   1.00 13.76 ? 281  SER A C   1 
ATOM   1730 O  O   . SER A 1 217 ? -1.972  0.557   5.909   1.00 14.25 ? 281  SER A O   1 
ATOM   1731 C  CB  . SER A 1 217 ? -0.537  0.629   3.005   1.00 10.80 ? 281  SER A CB  1 
ATOM   1732 O  OG  . SER A 1 217 ? -0.845  0.501   1.632   1.00 9.89  ? 281  SER A OG  1 
ATOM   1733 N  N   . ALA A 1 218 ? -0.493  2.245   5.726   1.00 14.05 ? 282  ALA A N   1 
ATOM   1734 C  CA  . ALA A 1 218 ? -0.191  2.287   7.149   1.00 13.14 ? 282  ALA A CA  1 
ATOM   1735 C  C   . ALA A 1 218 ? -1.441  2.678   7.929   1.00 13.44 ? 282  ALA A C   1 
ATOM   1736 O  O   . ALA A 1 218 ? -1.770  2.051   8.933   1.00 12.56 ? 282  ALA A O   1 
ATOM   1737 C  CB  . ALA A 1 218 ? 0.928   3.291   7.422   1.00 14.47 ? 282  ALA A CB  1 
ATOM   1738 N  N   . THR A 1 219 ? -2.128  3.719   7.462   1.00 11.37 ? 283  THR A N   1 
ATOM   1739 C  CA  . THR A 1 219 ? -3.343  4.185   8.119   1.00 12.32 ? 283  THR A CA  1 
ATOM   1740 C  C   . THR A 1 219 ? -4.379  3.056   8.185   1.00 12.66 ? 283  THR A C   1 
ATOM   1741 O  O   . THR A 1 219 ? -4.984  2.823   9.229   1.00 13.22 ? 283  THR A O   1 
ATOM   1742 C  CB  . THR A 1 219 ? -3.978  5.383   7.361   1.00 12.67 ? 283  THR A CB  1 
ATOM   1743 O  OG1 . THR A 1 219 ? -2.993  6.400   7.142   1.00 13.06 ? 283  THR A OG1 1 
ATOM   1744 C  CG2 . THR A 1 219 ? -5.125  5.984   8.176   1.00 11.46 ? 283  THR A CG2 1 
ATOM   1745 N  N   . VAL A 1 220 ? -4.575  2.358   7.066   1.00 12.93 ? 284  VAL A N   1 
ATOM   1746 C  CA  . VAL A 1 220 ? -5.543  1.262   7.012   1.00 13.57 ? 284  VAL A CA  1 
ATOM   1747 C  C   . VAL A 1 220 ? -5.208  0.177   8.036   1.00 14.62 ? 284  VAL A C   1 
ATOM   1748 O  O   . VAL A 1 220 ? -6.081  -0.293  8.778   1.00 12.10 ? 284  VAL A O   1 
ATOM   1749 C  CB  . VAL A 1 220 ? -5.605  0.638   5.587   1.00 12.29 ? 284  VAL A CB  1 
ATOM   1750 C  CG1 . VAL A 1 220 ? -6.485  -0.612  5.589   1.00 11.95 ? 284  VAL A CG1 1 
ATOM   1751 C  CG2 . VAL A 1 220 ? -6.163  1.656   4.598   1.00 12.16 ? 284  VAL A CG2 1 
ATOM   1752 N  N   . GLN A 1 221 ? -3.941  -0.212  8.090   1.00 14.79 ? 285  GLN A N   1 
ATOM   1753 C  CA  . GLN A 1 221 ? -3.534  -1.237  9.038   1.00 16.89 ? 285  GLN A CA  1 
ATOM   1754 C  C   . GLN A 1 221 ? -3.856  -0.780  10.461  1.00 17.87 ? 285  GLN A C   1 
ATOM   1755 O  O   . GLN A 1 221 ? -4.389  -1.555  11.253  1.00 17.71 ? 285  GLN A O   1 
ATOM   1756 C  CB  . GLN A 1 221 ? -2.036  -1.530  8.902   1.00 17.99 ? 285  GLN A CB  1 
ATOM   1757 C  CG  . GLN A 1 221 ? -1.579  -2.805  9.604   1.00 21.70 ? 285  GLN A CG  1 
ATOM   1758 C  CD  . GLN A 1 221 ? -2.215  -4.053  9.016   1.00 25.03 ? 285  GLN A CD  1 
ATOM   1759 O  OE1 . GLN A 1 221 ? -2.333  -4.190  7.800   1.00 28.15 ? 285  GLN A OE1 1 
ATOM   1760 N  NE2 . GLN A 1 221 ? -2.620  -4.976  9.879   1.00 27.72 ? 285  GLN A NE2 1 
ATOM   1761 N  N   . LYS A 1 222 ? -3.548  0.478   10.779  1.00 17.43 ? 286  LYS A N   1 
ATOM   1762 C  CA  . LYS A 1 222 ? -3.812  1.018   12.115  1.00 19.60 ? 286  LYS A CA  1 
ATOM   1763 C  C   . LYS A 1 222 ? -5.300  1.016   12.466  1.00 17.53 ? 286  LYS A C   1 
ATOM   1764 O  O   . LYS A 1 222 ? -5.681  0.672   13.579  1.00 16.05 ? 286  LYS A O   1 
ATOM   1765 C  CB  . LYS A 1 222 ? -3.270  2.449   12.245  1.00 22.55 ? 286  LYS A CB  1 
ATOM   1766 C  CG  . LYS A 1 222 ? -1.850  2.565   12.793  1.00 27.58 ? 286  LYS A CG  1 
ATOM   1767 C  CD  . LYS A 1 222 ? -1.768  2.007   14.210  1.00 32.17 ? 286  LYS A CD  1 
ATOM   1768 C  CE  . LYS A 1 222 ? -0.490  2.430   14.923  1.00 34.37 ? 286  LYS A CE  1 
ATOM   1769 N  NZ  . LYS A 1 222 ? -0.497  3.890   15.270  1.00 36.37 ? 286  LYS A NZ  1 
ATOM   1770 N  N   . VAL A 1 223 ? -6.136  1.415   11.518  1.00 16.54 ? 287  VAL A N   1 
ATOM   1771 C  CA  . VAL A 1 223 ? -7.576  1.435   11.751  1.00 15.23 ? 287  VAL A CA  1 
ATOM   1772 C  C   . VAL A 1 223 ? -8.095  0.016   11.995  1.00 15.87 ? 287  VAL A C   1 
ATOM   1773 O  O   . VAL A 1 223 ? -8.840  -0.222  12.943  1.00 13.69 ? 287  VAL A O   1 
ATOM   1774 C  CB  . VAL A 1 223 ? -8.332  2.044   10.552  1.00 15.63 ? 287  VAL A CB  1 
ATOM   1775 C  CG1 . VAL A 1 223 ? -9.836  1.830   10.713  1.00 14.50 ? 287  VAL A CG1 1 
ATOM   1776 C  CG2 . VAL A 1 223 ? -8.021  3.527   10.449  1.00 14.87 ? 287  VAL A CG2 1 
ATOM   1777 N  N   . MET A 1 224 ? -7.690  -0.922  11.144  1.00 15.44 ? 288  MET A N   1 
ATOM   1778 C  CA  . MET A 1 224 ? -8.134  -2.300  11.280  1.00 16.17 ? 288  MET A CA  1 
ATOM   1779 C  C   . MET A 1 224 ? -7.684  -2.963  12.579  1.00 18.58 ? 288  MET A C   1 
ATOM   1780 O  O   . MET A 1 224 ? -8.415  -3.778  13.146  1.00 17.03 ? 288  MET A O   1 
ATOM   1781 C  CB  . MET A 1 224 ? -7.681  -3.130  10.076  1.00 16.57 ? 288  MET A CB  1 
ATOM   1782 C  CG  . MET A 1 224 ? -8.431  -2.786  8.800   1.00 17.51 ? 288  MET A CG  1 
ATOM   1783 S  SD  . MET A 1 224 ? -10.224 -2.703  9.064   1.00 19.48 ? 288  MET A SD  1 
ATOM   1784 C  CE  . MET A 1 224 ? -10.573 -4.346  9.727   1.00 20.57 ? 288  MET A CE  1 
ATOM   1785 N  N   . GLU A 1 225 ? -6.489  -2.618  13.050  1.00 20.43 ? 289  GLU A N   1 
ATOM   1786 C  CA  . GLU A 1 225 ? -5.990  -3.185  14.297  1.00 22.77 ? 289  GLU A CA  1 
ATOM   1787 C  C   . GLU A 1 225 ? -6.832  -2.671  15.463  1.00 22.13 ? 289  GLU A C   1 
ATOM   1788 O  O   . GLU A 1 225 ? -7.112  -3.402  16.416  1.00 20.52 ? 289  GLU A O   1 
ATOM   1789 C  CB  . GLU A 1 225 ? -4.514  -2.822  14.500  1.00 25.59 ? 289  GLU A CB  1 
ATOM   1790 C  CG  . GLU A 1 225 ? -3.575  -3.638  13.616  1.00 34.14 ? 289  GLU A CG  1 
ATOM   1791 C  CD  . GLU A 1 225 ? -2.104  -3.305  13.815  1.00 38.39 ? 289  GLU A CD  1 
ATOM   1792 O  OE1 . GLU A 1 225 ? -1.672  -3.167  14.982  1.00 40.88 ? 289  GLU A OE1 1 
ATOM   1793 O  OE2 . GLU A 1 225 ? -1.379  -3.197  12.799  1.00 40.60 ? 289  GLU A OE2 1 
ATOM   1794 N  N   . ARG A 1 226 ? -7.251  -1.414  15.379  1.00 21.00 ? 290  ARG A N   1 
ATOM   1795 C  CA  . ARG A 1 226 ? -8.066  -0.834  16.435  1.00 23.35 ? 290  ARG A CA  1 
ATOM   1796 C  C   . ARG A 1 226 ? -9.460  -1.454  16.414  1.00 23.23 ? 290  ARG A C   1 
ATOM   1797 O  O   . ARG A 1 226 ? -10.123 -1.530  17.444  1.00 23.73 ? 290  ARG A O   1 
ATOM   1798 C  CB  . ARG A 1 226 ? -8.169  0.687   16.282  1.00 24.71 ? 290  ARG A CB  1 
ATOM   1799 C  CG  . ARG A 1 226 ? -8.865  1.347   17.462  1.00 29.26 ? 290  ARG A CG  1 
ATOM   1800 C  CD  . ARG A 1 226 ? -8.485  2.807   17.608  1.00 33.82 ? 290  ARG A CD  1 
ATOM   1801 N  NE  . ARG A 1 226 ? -8.782  3.296   18.954  1.00 37.02 ? 290  ARG A NE  1 
ATOM   1802 C  CZ  . ARG A 1 226 ? -10.007 3.445   19.443  1.00 38.21 ? 290  ARG A CZ  1 
ATOM   1803 N  NH1 . ARG A 1 226 ? -11.065 3.148   18.695  1.00 41.01 ? 290  ARG A NH1 1 
ATOM   1804 N  NH2 . ARG A 1 226 ? -10.176 3.885   20.682  1.00 37.72 ? 290  ARG A NH2 1 
ATOM   1805 N  N   . LEU A 1 227 ? -9.898  -1.899  15.238  1.00 22.65 ? 291  LEU A N   1 
ATOM   1806 C  CA  . LEU A 1 227 ? -11.207 -2.534  15.104  1.00 22.04 ? 291  LEU A CA  1 
ATOM   1807 C  C   . LEU A 1 227 ? -11.076 -4.032  15.392  1.00 22.22 ? 291  LEU A C   1 
ATOM   1808 O  O   . LEU A 1 227 ? -12.049 -4.776  15.323  1.00 22.60 ? 291  LEU A O   1 
ATOM   1809 C  CB  . LEU A 1 227 ? -11.755 -2.325  13.687  1.00 21.64 ? 291  LEU A CB  1 
ATOM   1810 C  CG  . LEU A 1 227 ? -12.131 -0.890  13.299  1.00 20.72 ? 291  LEU A CG  1 
ATOM   1811 C  CD1 . LEU A 1 227 ? -12.372 -0.812  11.800  1.00 18.59 ? 291  LEU A CD1 1 
ATOM   1812 C  CD2 . LEU A 1 227 ? -13.368 -0.455  14.064  1.00 19.70 ? 291  LEU A CD2 1 
ATOM   1813 N  N   . GLU A 1 228 ? -9.860  -4.464  15.713  1.00 23.32 ? 292  GLU A N   1 
ATOM   1814 C  CA  . GLU A 1 228 ? -9.584  -5.867  16.010  1.00 25.13 ? 292  GLU A CA  1 
ATOM   1815 C  C   . GLU A 1 228 ? -10.003 -6.774  14.849  1.00 24.32 ? 292  GLU A C   1 
ATOM   1816 O  O   . GLU A 1 228 ? -10.488 -7.893  15.046  1.00 25.16 ? 292  GLU A O   1 
ATOM   1817 C  CB  . GLU A 1 228 ? -10.274 -6.278  17.329  1.00 27.79 ? 292  GLU A CB  1 
ATOM   1818 C  CG  . GLU A 1 228 ? -9.746  -5.496  18.546  1.00 33.03 ? 292  GLU A CG  1 
ATOM   1819 C  CD  . GLU A 1 228 ? -10.374 -5.903  19.881  1.00 36.93 ? 292  GLU A CD  1 
ATOM   1820 O  OE1 . GLU A 1 228 ? -10.201 -7.066  20.309  1.00 38.86 ? 292  GLU A OE1 1 
ATOM   1821 O  OE2 . GLU A 1 228 ? -11.038 -5.051  20.514  1.00 39.20 ? 292  GLU A OE2 1 
ATOM   1822 N  N   . TYR A 1 229 ? -9.807  -6.274  13.635  1.00 21.33 ? 293  TYR A N   1 
ATOM   1823 C  CA  . TYR A 1 229 ? -10.127 -7.019  12.428  1.00 22.67 ? 293  TYR A CA  1 
ATOM   1824 C  C   . TYR A 1 229 ? -11.528 -7.621  12.465  1.00 22.36 ? 293  TYR A C   1 
ATOM   1825 O  O   . TYR A 1 229 ? -11.713 -8.775  12.094  1.00 21.11 ? 293  TYR A O   1 
ATOM   1826 C  CB  . TYR A 1 229 ? -9.097  -8.131  12.243  1.00 23.76 ? 293  TYR A CB  1 
ATOM   1827 C  CG  . TYR A 1 229 ? -7.681  -7.617  12.206  1.00 26.67 ? 293  TYR A CG  1 
ATOM   1828 C  CD1 . TYR A 1 229 ? -7.148  -7.087  11.035  1.00 26.92 ? 293  TYR A CD1 1 
ATOM   1829 C  CD2 . TYR A 1 229 ? -6.884  -7.619  13.357  1.00 27.43 ? 293  TYR A CD2 1 
ATOM   1830 C  CE1 . TYR A 1 229 ? -5.861  -6.570  11.004  1.00 29.60 ? 293  TYR A CE1 1 
ATOM   1831 C  CE2 . TYR A 1 229 ? -5.592  -7.101  13.336  1.00 28.67 ? 293  TYR A CE2 1 
ATOM   1832 C  CZ  . TYR A 1 229 ? -5.090  -6.578  12.152  1.00 30.18 ? 293  TYR A CZ  1 
ATOM   1833 O  OH  . TYR A 1 229 ? -3.822  -6.054  12.106  1.00 31.86 ? 293  TYR A OH  1 
ATOM   1834 N  N   . CYS A 1 230 ? -12.511 -6.838  12.901  1.00 22.23 ? 294  CYS A N   1 
ATOM   1835 C  CA  . CYS A 1 230 ? -13.881 -7.334  12.996  1.00 21.67 ? 294  CYS A CA  1 
ATOM   1836 C  C   . CYS A 1 230 ? -14.453 -7.770  11.653  1.00 21.02 ? 294  CYS A C   1 
ATOM   1837 O  O   . CYS A 1 230 ? -15.270 -8.688  11.593  1.00 22.40 ? 294  CYS A O   1 
ATOM   1838 C  CB  . CYS A 1 230 ? -14.792 -6.278  13.648  1.00 21.81 ? 294  CYS A CB  1 
ATOM   1839 S  SG  . CYS A 1 230 ? -14.824 -4.649  12.845  1.00 25.32 ? 294  CYS A SG  1 
ATOM   1840 N  N   . ASN A 1 231 ? -14.020 -7.117  10.578  1.00 18.86 ? 295  ASN A N   1 
ATOM   1841 C  CA  . ASN A 1 231 ? -14.490 -7.453  9.238   1.00 17.30 ? 295  ASN A CA  1 
ATOM   1842 C  C   . ASN A 1 231 ? -13.338 -7.523  8.247   1.00 16.82 ? 295  ASN A C   1 
ATOM   1843 O  O   . ASN A 1 231 ? -12.279 -6.937  8.471   1.00 17.41 ? 295  ASN A O   1 
ATOM   1844 C  CB  . ASN A 1 231 ? -15.495 -6.411  8.726   1.00 17.10 ? 295  ASN A CB  1 
ATOM   1845 C  CG  . ASN A 1 231 ? -16.794 -6.416  9.504   1.00 17.43 ? 295  ASN A CG  1 
ATOM   1846 O  OD1 . ASN A 1 231 ? -16.863 -5.922  10.629  1.00 16.30 ? 295  ASN A OD1 1 
ATOM   1847 N  ND2 . ASN A 1 231 ? -17.834 -6.985  8.906   1.00 16.51 ? 295  ASN A ND2 1 
ATOM   1848 N  N   . PRO A 1 232 ? -13.529 -8.259  7.142   1.00 14.91 ? 296  PRO A N   1 
ATOM   1849 C  CA  . PRO A 1 232 ? -12.478 -8.370  6.128   1.00 13.94 ? 296  PRO A CA  1 
ATOM   1850 C  C   . PRO A 1 232 ? -12.433 -7.033  5.402   1.00 15.77 ? 296  PRO A C   1 
ATOM   1851 O  O   . PRO A 1 232 ? -13.421 -6.288  5.407   1.00 16.56 ? 296  PRO A O   1 
ATOM   1852 C  CB  . PRO A 1 232 ? -12.975 -9.493  5.237   1.00 12.96 ? 296  PRO A CB  1 
ATOM   1853 C  CG  . PRO A 1 232 ? -14.467 -9.350  5.322   1.00 11.95 ? 296  PRO A CG  1 
ATOM   1854 C  CD  . PRO A 1 232 ? -14.683 -9.110  6.801   1.00 12.00 ? 296  PRO A CD  1 
ATOM   1855 N  N   . TYR A 1 233 ? -11.309 -6.732  4.767   1.00 15.28 ? 297  TYR A N   1 
ATOM   1856 C  CA  . TYR A 1 233 ? -11.174 -5.459  4.085   1.00 16.01 ? 297  TYR A CA  1 
ATOM   1857 C  C   . TYR A 1 233 ? -10.227 -5.525  2.910   1.00 16.34 ? 297  TYR A C   1 
ATOM   1858 O  O   . TYR A 1 233 ? -9.533  -6.518  2.684   1.00 18.54 ? 297  TYR A O   1 
ATOM   1859 C  CB  . TYR A 1 233 ? -10.663 -4.403  5.070   1.00 14.57 ? 297  TYR A CB  1 
ATOM   1860 C  CG  . TYR A 1 233 ? -9.217  -4.615  5.468   1.00 15.79 ? 297  TYR A CG  1 
ATOM   1861 C  CD1 . TYR A 1 233 ? -8.178  -4.106  4.686   1.00 18.70 ? 297  TYR A CD1 1 
ATOM   1862 C  CD2 . TYR A 1 233 ? -8.884  -5.378  6.592   1.00 16.40 ? 297  TYR A CD2 1 
ATOM   1863 C  CE1 . TYR A 1 233 ? -6.840  -4.354  5.005   1.00 21.03 ? 297  TYR A CE1 1 
ATOM   1864 C  CE2 . TYR A 1 233 ? -7.550  -5.634  6.923   1.00 20.24 ? 297  TYR A CE2 1 
ATOM   1865 C  CZ  . TYR A 1 233 ? -6.532  -5.120  6.122   1.00 20.71 ? 297  TYR A CZ  1 
ATOM   1866 O  OH  . TYR A 1 233 ? -5.211  -5.389  6.413   1.00 24.62 ? 297  TYR A OH  1 
ATOM   1867 N  N   . ARG A 1 234 ? -10.187 -4.428  2.176   1.00 18.86 ? 298  ARG A N   1 
ATOM   1868 C  CA  . ARG A 1 234 ? -9.310  -4.310  1.030   1.00 18.77 ? 298  ARG A CA  1 
ATOM   1869 C  C   . ARG A 1 234 ? -9.112  -2.814  0.835   1.00 17.67 ? 298  ARG A C   1 
ATOM   1870 O  O   . ARG A 1 234 ? -10.030 -2.023  1.073   1.00 15.82 ? 298  ARG A O   1 
ATOM   1871 C  CB  . ARG A 1 234 ? -9.981  -4.934  -0.198  1.00 21.37 ? 298  ARG A CB  1 
ATOM   1872 C  CG  . ARG A 1 234 ? -9.058  -5.284  -1.348  1.00 24.01 ? 298  ARG A CG  1 
ATOM   1873 C  CD  . ARG A 1 234 ? -8.145  -6.493  -1.065  1.00 24.11 ? 298  ARG A CD  1 
ATOM   1874 N  NE  . ARG A 1 234 ? -8.725  -7.423  -0.111  1.00 24.46 ? 298  ARG A NE  1 
ATOM   1875 C  CZ  . ARG A 1 234 ? -8.625  -8.745  -0.186  1.00 23.43 ? 298  ARG A CZ  1 
ATOM   1876 N  NH1 . ARG A 1 234 ? -7.969  -9.318  -1.182  1.00 24.00 ? 298  ARG A NH1 1 
ATOM   1877 N  NH2 . ARG A 1 234 ? -9.180  -9.496  0.753   1.00 23.16 ? 298  ARG A NH2 1 
ATOM   1878 N  N   . LEU A 1 235 ? -7.903  -2.425  0.448   1.00 16.11 ? 299  LEU A N   1 
ATOM   1879 C  CA  . LEU A 1 235 ? -7.608  -1.025  0.181   1.00 15.46 ? 299  LEU A CA  1 
ATOM   1880 C  C   . LEU A 1 235 ? -7.683  -0.844  -1.331  1.00 14.71 ? 299  LEU A C   1 
ATOM   1881 O  O   . LEU A 1 235 ? -6.907  -1.453  -2.071  1.00 15.64 ? 299  LEU A O   1 
ATOM   1882 C  CB  . LEU A 1 235 ? -6.208  -0.665  0.684   1.00 13.80 ? 299  LEU A CB  1 
ATOM   1883 C  CG  . LEU A 1 235 ? -5.645  0.683   0.240   1.00 14.85 ? 299  LEU A CG  1 
ATOM   1884 C  CD1 . LEU A 1 235 ? -6.599  1.815   0.616   1.00 12.18 ? 299  LEU A CD1 1 
ATOM   1885 C  CD2 . LEU A 1 235 ? -4.271  0.877   0.886   1.00 11.46 ? 299  LEU A CD2 1 
ATOM   1886 N  N   . VAL A 1 236 ? -8.629  -0.023  -1.779  1.00 13.96 ? 300  VAL A N   1 
ATOM   1887 C  CA  . VAL A 1 236 ? -8.824  0.243   -3.196  1.00 14.31 ? 300  VAL A CA  1 
ATOM   1888 C  C   . VAL A 1 236 ? -8.671  1.730   -3.499  1.00 14.68 ? 300  VAL A C   1 
ATOM   1889 O  O   . VAL A 1 236 ? -8.718  2.562   -2.595  1.00 14.40 ? 300  VAL A O   1 
ATOM   1890 C  CB  . VAL A 1 236 ? -10.201 -0.268  -3.674  1.00 15.52 ? 300  VAL A CB  1 
ATOM   1891 C  CG1 . VAL A 1 236 ? -10.259 -1.775  -3.499  1.00 17.53 ? 300  VAL A CG1 1 
ATOM   1892 C  CG2 . VAL A 1 236 ? -11.317 0.391   -2.894  1.00 15.32 ? 300  VAL A CG2 1 
ATOM   1893 N  N   . TRP A 1 237 ? -8.499  2.061   -4.775  1.00 14.54 ? 301  TRP A N   1 
ATOM   1894 C  CA  . TRP A 1 237 ? -8.268  3.444   -5.175  1.00 15.36 ? 301  TRP A CA  1 
ATOM   1895 C  C   . TRP A 1 237 ? -9.318  4.006   -6.125  1.00 15.60 ? 301  TRP A C   1 
ATOM   1896 O  O   . TRP A 1 237 ? -9.790  3.325   -7.039  1.00 15.75 ? 301  TRP A O   1 
ATOM   1897 C  CB  . TRP A 1 237 ? -6.867  3.536   -5.790  1.00 13.77 ? 301  TRP A CB  1 
ATOM   1898 C  CG  . TRP A 1 237 ? -5.869  2.725   -5.001  1.00 12.77 ? 301  TRP A CG  1 
ATOM   1899 C  CD1 . TRP A 1 237 ? -5.670  1.375   -5.076  1.00 12.15 ? 301  TRP A CD1 1 
ATOM   1900 C  CD2 . TRP A 1 237 ? -5.006  3.197   -3.956  1.00 11.77 ? 301  TRP A CD2 1 
ATOM   1901 N  NE1 . TRP A 1 237 ? -4.740  0.976   -4.141  1.00 11.83 ? 301  TRP A NE1 1 
ATOM   1902 C  CE2 . TRP A 1 237 ? -4.317  2.074   -3.442  1.00 11.48 ? 301  TRP A CE2 1 
ATOM   1903 C  CE3 . TRP A 1 237 ? -4.751  4.454   -3.402  1.00 12.05 ? 301  TRP A CE3 1 
ATOM   1904 C  CZ2 . TRP A 1 237 ? -3.389  2.174   -2.404  1.00 9.82  ? 301  TRP A CZ2 1 
ATOM   1905 C  CZ3 . TRP A 1 237 ? -3.819  4.549   -2.358  1.00 9.83  ? 301  TRP A CZ3 1 
ATOM   1906 C  CH2 . TRP A 1 237 ? -3.155  3.415   -1.879  1.00 8.89  ? 301  TRP A CH2 1 
ATOM   1907 N  N   . GLN A 1 238 ? -9.674  5.265   -5.910  1.00 17.06 ? 302  GLN A N   1 
ATOM   1908 C  CA  . GLN A 1 238 ? -10.694 5.907   -6.724  1.00 19.15 ? 302  GLN A CA  1 
ATOM   1909 C  C   . GLN A 1 238 ? -10.169 7.139   -7.450  1.00 21.30 ? 302  GLN A C   1 
ATOM   1910 O  O   . GLN A 1 238 ? -9.028  7.569   -7.241  1.00 19.78 ? 302  GLN A O   1 
ATOM   1911 C  CB  . GLN A 1 238 ? -11.864 6.330   -5.830  1.00 18.80 ? 302  GLN A CB  1 
ATOM   1912 C  CG  . GLN A 1 238 ? -11.510 7.476   -4.888  1.00 19.76 ? 302  GLN A CG  1 
ATOM   1913 C  CD  . GLN A 1 238 ? -12.632 7.823   -3.922  1.00 22.48 ? 302  GLN A CD  1 
ATOM   1914 O  OE1 . GLN A 1 238 ? -12.885 7.098   -2.958  1.00 23.77 ? 302  GLN A OE1 1 
ATOM   1915 N  NE2 . GLN A 1 238 ? -13.315 8.935   -4.182  1.00 21.64 ? 302  GLN A NE2 1 
ATOM   1916 N  N   . SER A 1 239 ? -11.029 7.693   -8.303  1.00 22.04 ? 303  SER A N   1 
ATOM   1917 C  CA  . SER A 1 239 ? -10.744 8.914   -9.049  1.00 24.70 ? 303  SER A CA  1 
ATOM   1918 C  C   . SER A 1 239 ? -9.769  8.809   -10.214 1.00 24.69 ? 303  SER A C   1 
ATOM   1919 O  O   . SER A 1 239 ? -9.204  9.812   -10.643 1.00 24.97 ? 303  SER A O   1 
ATOM   1920 C  CB  . SER A 1 239 ? -10.277 10.012  -8.081  1.00 25.03 ? 303  SER A CB  1 
ATOM   1921 O  OG  . SER A 1 239 ? -11.259 10.260  -7.082  1.00 28.56 ? 303  SER A OG  1 
ATOM   1922 N  N   . LYS A 1 240 ? -9.565  7.609   -10.735 1.00 26.18 ? 304  LYS A N   1 
ATOM   1923 C  CA  . LYS A 1 240 ? -8.680  7.471   -11.876 1.00 28.28 ? 304  LYS A CA  1 
ATOM   1924 C  C   . LYS A 1 240 ? -9.313  8.215   -13.048 1.00 30.35 ? 304  LYS A C   1 
ATOM   1925 O  O   . LYS A 1 240 ? -10.522 8.130   -13.265 1.00 30.47 ? 304  LYS A O   1 
ATOM   1926 C  CB  . LYS A 1 240 ? -8.509  6.009   -12.276 1.00 28.20 ? 304  LYS A CB  1 
ATOM   1927 C  CG  . LYS A 1 240 ? -7.793  5.867   -13.605 1.00 30.39 ? 304  LYS A CG  1 
ATOM   1928 C  CD  . LYS A 1 240 ? -7.975  4.505   -14.241 1.00 31.21 ? 304  LYS A CD  1 
ATOM   1929 C  CE  . LYS A 1 240 ? -7.316  4.492   -15.616 1.00 32.90 ? 304  LYS A CE  1 
ATOM   1930 N  NZ  . LYS A 1 240 ? -7.498  3.203   -16.334 1.00 33.09 ? 304  LYS A NZ  1 
ATOM   1931 N  N   . VAL A 1 241 ? -8.495  8.943   -13.797 1.00 32.88 ? 305  VAL A N   1 
ATOM   1932 C  CA  . VAL A 1 241 ? -8.982  9.668   -14.962 1.00 34.28 ? 305  VAL A CA  1 
ATOM   1933 C  C   . VAL A 1 241 ? -8.000  9.525   -16.120 1.00 35.00 ? 305  VAL A C   1 
ATOM   1934 O  O   . VAL A 1 241 ? -6.782  9.556   -15.926 1.00 35.83 ? 305  VAL A O   1 
ATOM   1935 C  CB  . VAL A 1 241 ? -9.179  11.170  -14.659 1.00 35.14 ? 305  VAL A CB  1 
ATOM   1936 C  CG1 . VAL A 1 241 ? -7.860  11.804  -14.251 1.00 35.11 ? 305  VAL A CG1 1 
ATOM   1937 C  CG2 . VAL A 1 241 ? -9.750  11.870  -15.881 1.00 36.37 ? 305  VAL A CG2 1 
ATOM   1938 N  N   . GLY A 1 242 ? -8.529  9.354   -17.326 1.00 34.89 ? 306  GLY A N   1 
ATOM   1939 C  CA  . GLY A 1 242 ? -7.662  9.226   -18.482 1.00 35.93 ? 306  GLY A CA  1 
ATOM   1940 C  C   . GLY A 1 242 ? -7.395  7.797   -18.922 1.00 35.76 ? 306  GLY A C   1 
ATOM   1941 O  O   . GLY A 1 242 ? -7.886  6.850   -18.309 1.00 36.52 ? 306  GLY A O   1 
ATOM   1942 N  N   . PRO A 1 243 ? -6.610  7.617   -19.996 1.00 35.53 ? 307  PRO A N   1 
ATOM   1943 C  CA  . PRO A 1 243 ? -6.253  6.312   -20.559 1.00 35.10 ? 307  PRO A CA  1 
ATOM   1944 C  C   . PRO A 1 243 ? -4.998  5.675   -19.959 1.00 34.57 ? 307  PRO A C   1 
ATOM   1945 O  O   . PRO A 1 243 ? -4.765  4.479   -20.123 1.00 34.73 ? 307  PRO A O   1 
ATOM   1946 C  CB  . PRO A 1 243 ? -6.061  6.636   -22.031 1.00 34.95 ? 307  PRO A CB  1 
ATOM   1947 C  CG  . PRO A 1 243 ? -5.363  7.964   -21.951 1.00 34.88 ? 307  PRO A CG  1 
ATOM   1948 C  CD  . PRO A 1 243 ? -6.176  8.705   -20.895 1.00 34.96 ? 307  PRO A CD  1 
ATOM   1949 N  N   . MET A 1 244 ? -4.189  6.475   -19.274 1.00 33.61 ? 308  MET A N   1 
ATOM   1950 C  CA  . MET A 1 244 ? -2.952  5.973   -18.687 1.00 31.48 ? 308  MET A CA  1 
ATOM   1951 C  C   . MET A 1 244 ? -3.186  5.041   -17.506 1.00 28.75 ? 308  MET A C   1 
ATOM   1952 O  O   . MET A 1 244 ? -4.250  5.052   -16.903 1.00 27.90 ? 308  MET A O   1 
ATOM   1953 C  CB  . MET A 1 244 ? -2.075  7.148   -18.260 1.00 35.05 ? 308  MET A CB  1 
ATOM   1954 C  CG  . MET A 1 244 ? -1.750  8.097   -19.403 1.00 37.82 ? 308  MET A CG  1 
ATOM   1955 S  SD  . MET A 1 244 ? -0.980  7.232   -20.784 1.00 41.92 ? 308  MET A SD  1 
ATOM   1956 C  CE  . MET A 1 244 ? 0.741   7.238   -20.262 1.00 39.73 ? 308  MET A CE  1 
ATOM   1957 N  N   . PRO A 1 245 ? -2.187  4.210   -17.170 1.00 27.21 ? 309  PRO A N   1 
ATOM   1958 C  CA  . PRO A 1 245 ? -2.317  3.279   -16.046 1.00 25.11 ? 309  PRO A CA  1 
ATOM   1959 C  C   . PRO A 1 245 ? -2.192  3.987   -14.701 1.00 22.74 ? 309  PRO A C   1 
ATOM   1960 O  O   . PRO A 1 245 ? -1.298  4.812   -14.500 1.00 22.62 ? 309  PRO A O   1 
ATOM   1961 C  CB  . PRO A 1 245 ? -1.169  2.292   -16.265 1.00 26.24 ? 309  PRO A CB  1 
ATOM   1962 C  CG  . PRO A 1 245 ? -0.853  2.419   -17.733 1.00 26.85 ? 309  PRO A CG  1 
ATOM   1963 C  CD  . PRO A 1 245 ? -0.988  3.897   -17.963 1.00 27.11 ? 309  PRO A CD  1 
ATOM   1964 N  N   . TRP A 1 246 ? -3.107  3.664   -13.794 1.00 20.73 ? 310  TRP A N   1 
ATOM   1965 C  CA  . TRP A 1 246 ? -3.116  4.223   -12.448 1.00 19.70 ? 310  TRP A CA  1 
ATOM   1966 C  C   . TRP A 1 246 ? -3.033  3.056   -11.477 1.00 19.15 ? 310  TRP A C   1 
ATOM   1967 O  O   . TRP A 1 246 ? -3.232  1.898   -11.861 1.00 17.01 ? 310  TRP A O   1 
ATOM   1968 C  CB  . TRP A 1 246 ? -4.410  4.990   -12.177 1.00 19.53 ? 310  TRP A CB  1 
ATOM   1969 C  CG  . TRP A 1 246 ? -4.515  6.316   -12.869 1.00 19.64 ? 310  TRP A CG  1 
ATOM   1970 C  CD1 . TRP A 1 246 ? -4.436  6.552   -14.214 1.00 19.50 ? 310  TRP A CD1 1 
ATOM   1971 C  CD2 . TRP A 1 246 ? -4.790  7.581   -12.256 1.00 18.45 ? 310  TRP A CD2 1 
ATOM   1972 N  NE1 . TRP A 1 246 ? -4.649  7.883   -14.474 1.00 19.73 ? 310  TRP A NE1 1 
ATOM   1973 C  CE2 . TRP A 1 246 ? -4.870  8.539   -13.293 1.00 20.28 ? 310  TRP A CE2 1 
ATOM   1974 C  CE3 . TRP A 1 246 ? -4.980  7.998   -10.933 1.00 18.53 ? 310  TRP A CE3 1 
ATOM   1975 C  CZ2 . TRP A 1 246 ? -5.134  9.893   -13.048 1.00 19.97 ? 310  TRP A CZ2 1 
ATOM   1976 C  CZ3 . TRP A 1 246 ? -5.243  9.344   -10.688 1.00 21.30 ? 310  TRP A CZ3 1 
ATOM   1977 C  CH2 . TRP A 1 246 ? -5.317  10.276  -11.746 1.00 19.88 ? 310  TRP A CH2 1 
ATOM   1978 N  N   . LEU A 1 247 ? -2.742  3.362   -10.221 1.00 16.73 ? 311  LEU A N   1 
ATOM   1979 C  CA  . LEU A 1 247 ? -2.659  2.331   -9.206  1.00 16.96 ? 311  LEU A CA  1 
ATOM   1980 C  C   . LEU A 1 247 ? -4.060  1.809   -8.919  1.00 16.07 ? 311  LEU A C   1 
ATOM   1981 O  O   . LEU A 1 247 ? -4.981  2.584   -8.674  1.00 15.51 ? 311  LEU A O   1 
ATOM   1982 C  CB  . LEU A 1 247 ? -2.050  2.888   -7.916  1.00 16.19 ? 311  LEU A CB  1 
ATOM   1983 C  CG  . LEU A 1 247 ? -1.991  1.891   -6.750  1.00 14.44 ? 311  LEU A CG  1 
ATOM   1984 C  CD1 . LEU A 1 247 ? -1.193  0.653   -7.161  1.00 13.38 ? 311  LEU A CD1 1 
ATOM   1985 C  CD2 . LEU A 1 247 ? -1.357  2.564   -5.537  1.00 11.74 ? 311  LEU A CD2 1 
ATOM   1986 N  N   . GLY A 1 248 ? -4.214  0.494   -8.956  1.00 15.49 ? 312  GLY A N   1 
ATOM   1987 C  CA  . GLY A 1 248 ? -5.504  -0.102  -8.678  1.00 15.91 ? 312  GLY A CA  1 
ATOM   1988 C  C   . GLY A 1 248 ? -5.376  -1.059  -7.509  1.00 16.80 ? 312  GLY A C   1 
ATOM   1989 O  O   . GLY A 1 248 ? -4.339  -1.078  -6.842  1.00 17.27 ? 312  GLY A O   1 
ATOM   1990 N  N   . PRO A 1 249 ? -6.400  -1.874  -7.231  1.00 16.88 ? 313  PRO A N   1 
ATOM   1991 C  CA  . PRO A 1 249 ? -7.678  -1.959  -7.942  1.00 17.29 ? 313  PRO A CA  1 
ATOM   1992 C  C   . PRO A 1 249 ? -8.516  -0.697  -7.790  1.00 17.62 ? 313  PRO A C   1 
ATOM   1993 O  O   . PRO A 1 249 ? -8.403  0.021   -6.799  1.00 16.62 ? 313  PRO A O   1 
ATOM   1994 C  CB  . PRO A 1 249 ? -8.343  -3.173  -7.300  1.00 15.82 ? 313  PRO A CB  1 
ATOM   1995 C  CG  . PRO A 1 249 ? -7.848  -3.104  -5.901  1.00 17.81 ? 313  PRO A CG  1 
ATOM   1996 C  CD  . PRO A 1 249 ? -6.388  -2.780  -6.070  1.00 16.31 ? 313  PRO A CD  1 
ATOM   1997 N  N   . GLN A 1 250 ? -9.342  -0.423  -8.790  1.00 19.84 ? 314  GLN A N   1 
ATOM   1998 C  CA  . GLN A 1 250 ? -10.211 0.744   -8.763  1.00 21.17 ? 314  GLN A CA  1 
ATOM   1999 C  C   . GLN A 1 250 ? -11.362 0.447   -7.816  1.00 19.81 ? 314  GLN A C   1 
ATOM   2000 O  O   . GLN A 1 250 ? -11.783 -0.699  -7.682  1.00 18.69 ? 314  GLN A O   1 
ATOM   2001 C  CB  . GLN A 1 250 ? -10.757 1.040   -10.159 1.00 24.01 ? 314  GLN A CB  1 
ATOM   2002 C  CG  . GLN A 1 250 ? -9.701  1.455   -11.174 1.00 29.24 ? 314  GLN A CG  1 
ATOM   2003 C  CD  . GLN A 1 250 ? -10.261 1.556   -12.587 1.00 33.55 ? 314  GLN A CD  1 
ATOM   2004 O  OE1 . GLN A 1 250 ? -11.212 2.302   -12.845 1.00 36.97 ? 314  GLN A OE1 1 
ATOM   2005 N  NE2 . GLN A 1 250 ? -9.674  0.801   -13.509 1.00 33.73 ? 314  GLN A NE2 1 
ATOM   2006 N  N   . THR A 1 251 ? -11.864 1.483   -7.163  1.00 18.38 ? 315  THR A N   1 
ATOM   2007 C  CA  . THR A 1 251 ? -12.968 1.333   -6.226  1.00 18.77 ? 315  THR A CA  1 
ATOM   2008 C  C   . THR A 1 251 ? -14.260 0.883   -6.915  1.00 18.30 ? 315  THR A C   1 
ATOM   2009 O  O   . THR A 1 251 ? -14.961 0.009   -6.407  1.00 17.46 ? 315  THR A O   1 
ATOM   2010 C  CB  . THR A 1 251 ? -13.202 2.655   -5.475  1.00 17.87 ? 315  THR A CB  1 
ATOM   2011 O  OG1 . THR A 1 251 ? -12.010 2.991   -4.758  1.00 15.90 ? 315  THR A OG1 1 
ATOM   2012 C  CG2 . THR A 1 251 ? -14.368 2.539   -4.494  1.00 17.01 ? 315  THR A CG2 1 
ATOM   2013 N  N   . ASP A 1 252 ? -14.575 1.466   -8.068  1.00 20.18 ? 316  ASP A N   1 
ATOM   2014 C  CA  . ASP A 1 252 ? -15.793 1.083   -8.783  1.00 22.85 ? 316  ASP A CA  1 
ATOM   2015 C  C   . ASP A 1 252 ? -15.731 -0.370  -9.255  1.00 22.27 ? 316  ASP A C   1 
ATOM   2016 O  O   . ASP A 1 252 ? -16.680 -1.127  -9.075  1.00 23.53 ? 316  ASP A O   1 
ATOM   2017 C  CB  . ASP A 1 252 ? -16.054 2.032   -9.969  1.00 24.81 ? 316  ASP A CB  1 
ATOM   2018 C  CG  . ASP A 1 252 ? -14.892 2.095   -10.954 1.00 27.22 ? 316  ASP A CG  1 
ATOM   2019 O  OD1 . ASP A 1 252 ? -15.007 2.845   -11.948 1.00 30.52 ? 316  ASP A OD1 1 
ATOM   2020 O  OD2 . ASP A 1 252 ? -13.869 1.408   -10.745 1.00 27.99 ? 316  ASP A OD2 1 
ATOM   2021 N  N   . GLU A 1 253 ? -14.607 -0.767  -9.843  1.00 23.07 ? 317  GLU A N   1 
ATOM   2022 C  CA  . GLU A 1 253 ? -14.449 -2.141  -10.308 1.00 23.26 ? 317  GLU A CA  1 
ATOM   2023 C  C   . GLU A 1 253 ? -14.510 -3.123  -9.142  1.00 21.50 ? 317  GLU A C   1 
ATOM   2024 O  O   . GLU A 1 253 ? -15.042 -4.227  -9.282  1.00 19.92 ? 317  GLU A O   1 
ATOM   2025 C  CB  . GLU A 1 253 ? -13.124 -2.310  -11.060 1.00 27.28 ? 317  GLU A CB  1 
ATOM   2026 C  CG  . GLU A 1 253 ? -13.032 -1.474  -12.323 1.00 33.99 ? 317  GLU A CG  1 
ATOM   2027 C  CD  . GLU A 1 253 ? -11.947 -1.953  -13.271 1.00 39.18 ? 317  GLU A CD  1 
ATOM   2028 O  OE1 . GLU A 1 253 ? -10.783 -2.096  -12.831 1.00 41.88 ? 317  GLU A OE1 1 
ATOM   2029 O  OE2 . GLU A 1 253 ? -12.262 -2.183  -14.462 1.00 41.13 ? 317  GLU A OE2 1 
ATOM   2030 N  N   . SER A 1 254 ? -13.972 -2.723  -7.990  1.00 20.86 ? 318  SER A N   1 
ATOM   2031 C  CA  . SER A 1 254 ? -13.988 -3.584  -6.808  1.00 19.48 ? 318  SER A CA  1 
ATOM   2032 C  C   . SER A 1 254 ? -15.410 -3.789  -6.295  1.00 18.57 ? 318  SER A C   1 
ATOM   2033 O  O   . SER A 1 254 ? -15.796 -4.896  -5.923  1.00 20.07 ? 318  SER A O   1 
ATOM   2034 C  CB  . SER A 1 254 ? -13.123 -2.986  -5.703  1.00 17.27 ? 318  SER A CB  1 
ATOM   2035 O  OG  . SER A 1 254 ? -11.769 -2.962  -6.105  1.00 20.67 ? 318  SER A OG  1 
ATOM   2036 N  N   . ILE A 1 255 ? -16.183 -2.714  -6.269  1.00 18.34 ? 319  ILE A N   1 
ATOM   2037 C  CA  . ILE A 1 255 ? -17.568 -2.783  -5.816  1.00 18.72 ? 319  ILE A CA  1 
ATOM   2038 C  C   . ILE A 1 255 ? -18.331 -3.739  -6.729  1.00 18.71 ? 319  ILE A C   1 
ATOM   2039 O  O   . ILE A 1 255 ? -19.057 -4.610  -6.264  1.00 19.13 ? 319  ILE A O   1 
ATOM   2040 C  CB  . ILE A 1 255 ? -18.225 -1.385  -5.861  1.00 17.45 ? 319  ILE A CB  1 
ATOM   2041 C  CG1 . ILE A 1 255 ? -17.550 -0.482  -4.821  1.00 16.92 ? 319  ILE A CG1 1 
ATOM   2042 C  CG2 . ILE A 1 255 ? -19.736 -1.498  -5.640  1.00 18.48 ? 319  ILE A CG2 1 
ATOM   2043 C  CD1 . ILE A 1 255 ? -17.976 0.981   -4.871  1.00 15.49 ? 319  ILE A CD1 1 
ATOM   2044 N  N   . LYS A 1 256 ? -18.141 -3.572  -8.032  1.00 19.55 ? 320  LYS A N   1 
ATOM   2045 C  CA  . LYS A 1 256 ? -18.792 -4.412  -9.028  1.00 21.51 ? 320  LYS A CA  1 
ATOM   2046 C  C   . LYS A 1 256 ? -18.285 -5.846  -8.910  1.00 21.57 ? 320  LYS A C   1 
ATOM   2047 O  O   . LYS A 1 256 ? -19.058 -6.797  -9.004  1.00 20.13 ? 320  LYS A O   1 
ATOM   2048 C  CB  . LYS A 1 256 ? -18.499 -3.860  -10.425 1.00 23.98 ? 320  LYS A CB  1 
ATOM   2049 C  CG  . LYS A 1 256 ? -19.080 -4.653  -11.589 1.00 28.74 ? 320  LYS A CG  1 
ATOM   2050 C  CD  . LYS A 1 256 ? -18.818 -3.906  -12.899 1.00 31.22 ? 320  LYS A CD  1 
ATOM   2051 C  CE  . LYS A 1 256 ? -19.396 -4.624  -14.107 1.00 35.53 ? 320  LYS A CE  1 
ATOM   2052 N  NZ  . LYS A 1 256 ? -19.255 -3.786  -15.347 1.00 36.85 ? 320  LYS A NZ  1 
ATOM   2053 N  N   . GLY A 1 257 ? -16.979 -5.990  -8.703  1.00 20.60 ? 321  GLY A N   1 
ATOM   2054 C  CA  . GLY A 1 257 ? -16.395 -7.309  -8.568  1.00 19.86 ? 321  GLY A CA  1 
ATOM   2055 C  C   . GLY A 1 257 ? -16.935 -8.030  -7.345  1.00 19.02 ? 321  GLY A C   1 
ATOM   2056 O  O   . GLY A 1 257 ? -17.278 -9.207  -7.424  1.00 19.00 ? 321  GLY A O   1 
ATOM   2057 N  N   . LEU A 1 258 ? -17.010 -7.325  -6.219  1.00 18.36 ? 322  LEU A N   1 
ATOM   2058 C  CA  . LEU A 1 258 ? -17.521 -7.906  -4.981  1.00 19.80 ? 322  LEU A CA  1 
ATOM   2059 C  C   . LEU A 1 258 ? -18.960 -8.406  -5.140  1.00 21.38 ? 322  LEU A C   1 
ATOM   2060 O  O   . LEU A 1 258 ? -19.287 -9.506  -4.707  1.00 21.76 ? 322  LEU A O   1 
ATOM   2061 C  CB  . LEU A 1 258 ? -17.459 -6.885  -3.840  1.00 18.06 ? 322  LEU A CB  1 
ATOM   2062 C  CG  . LEU A 1 258 ? -16.087 -6.599  -3.219  1.00 18.94 ? 322  LEU A CG  1 
ATOM   2063 C  CD1 . LEU A 1 258 ? -16.182 -5.398  -2.292  1.00 18.22 ? 322  LEU A CD1 1 
ATOM   2064 C  CD2 . LEU A 1 258 ? -15.596 -7.830  -2.458  1.00 14.75 ? 322  LEU A CD2 1 
ATOM   2065 N  N   . CYS A 1 259 ? -19.813 -7.600  -5.762  1.00 23.55 ? 323  CYS A N   1 
ATOM   2066 C  CA  . CYS A 1 259 ? -21.204 -7.994  -5.956  1.00 26.28 ? 323  CYS A CA  1 
ATOM   2067 C  C   . CYS A 1 259 ? -21.336 -9.263  -6.779  1.00 26.23 ? 323  CYS A C   1 
ATOM   2068 O  O   . CYS A 1 259 ? -22.026 -10.196 -6.380  1.00 26.93 ? 323  CYS A O   1 
ATOM   2069 C  CB  . CYS A 1 259 ? -21.992 -6.870  -6.623  1.00 28.05 ? 323  CYS A CB  1 
ATOM   2070 S  SG  . CYS A 1 259 ? -22.235 -5.452  -5.543  1.00 35.44 ? 323  CYS A SG  1 
ATOM   2071 N  N   . GLU A 1 260 ? -20.669 -9.301  -7.924  1.00 25.52 ? 324  GLU A N   1 
ATOM   2072 C  CA  . GLU A 1 260 ? -20.728 -10.474 -8.786  1.00 28.10 ? 324  GLU A CA  1 
ATOM   2073 C  C   . GLU A 1 260 ? -20.221 -11.737 -8.087  1.00 28.14 ? 324  GLU A C   1 
ATOM   2074 O  O   . GLU A 1 260 ? -20.480 -12.849 -8.544  1.00 28.61 ? 324  GLU A O   1 
ATOM   2075 C  CB  . GLU A 1 260 ? -19.922 -10.226 -10.062 1.00 29.08 ? 324  GLU A CB  1 
ATOM   2076 C  CG  . GLU A 1 260 ? -20.282 -8.914  -10.741 1.00 34.69 ? 324  GLU A CG  1 
ATOM   2077 C  CD  . GLU A 1 260 ? -19.774 -8.813  -12.166 1.00 37.06 ? 324  GLU A CD  1 
ATOM   2078 O  OE1 . GLU A 1 260 ? -18.590 -9.138  -12.410 1.00 38.25 ? 324  GLU A OE1 1 
ATOM   2079 O  OE2 . GLU A 1 260 ? -20.564 -8.395  -13.042 1.00 38.79 ? 324  GLU A OE2 1 
ATOM   2080 N  N   . ARG A 1 261 ? -19.501 -11.568 -6.981  1.00 27.28 ? 325  ARG A N   1 
ATOM   2081 C  CA  . ARG A 1 261 ? -18.972 -12.714 -6.251  1.00 26.73 ? 325  ARG A CA  1 
ATOM   2082 C  C   . ARG A 1 261 ? -19.722 -12.986 -4.953  1.00 26.16 ? 325  ARG A C   1 
ATOM   2083 O  O   . ARG A 1 261 ? -19.245 -13.722 -4.091  1.00 27.84 ? 325  ARG A O   1 
ATOM   2084 C  CB  . ARG A 1 261 ? -17.474 -12.523 -5.997  1.00 25.78 ? 325  ARG A CB  1 
ATOM   2085 C  CG  . ARG A 1 261 ? -16.676 -12.540 -7.293  1.00 24.99 ? 325  ARG A CG  1 
ATOM   2086 C  CD  . ARG A 1 261 ? -15.262 -11.997 -7.144  1.00 24.90 ? 325  ARG A CD  1 
ATOM   2087 N  NE  . ARG A 1 261 ? -14.547 -12.035 -8.423  1.00 24.62 ? 325  ARG A NE  1 
ATOM   2088 C  CZ  . ARG A 1 261 ? -14.869 -11.302 -9.490  1.00 25.29 ? 325  ARG A CZ  1 
ATOM   2089 N  NH1 . ARG A 1 261 ? -15.894 -10.460 -9.442  1.00 27.19 ? 325  ARG A NH1 1 
ATOM   2090 N  NH2 . ARG A 1 261 ? -14.180 -11.428 -10.618 1.00 21.53 ? 325  ARG A NH2 1 
ATOM   2091 N  N   . GLY A 1 262 ? -20.903 -12.388 -4.822  1.00 26.34 ? 326  GLY A N   1 
ATOM   2092 C  CA  . GLY A 1 262 ? -21.721 -12.618 -3.642  1.00 25.51 ? 326  GLY A CA  1 
ATOM   2093 C  C   . GLY A 1 262 ? -21.500 -11.767 -2.401  1.00 25.59 ? 326  GLY A C   1 
ATOM   2094 O  O   . GLY A 1 262 ? -22.154 -11.998 -1.379  1.00 25.34 ? 326  GLY A O   1 
ATOM   2095 N  N   . ARG A 1 263 ? -20.581 -10.806 -2.460  1.00 24.25 ? 327  ARG A N   1 
ATOM   2096 C  CA  . ARG A 1 263 ? -20.340 -9.936  -1.312  1.00 23.58 ? 327  ARG A CA  1 
ATOM   2097 C  C   . ARG A 1 263 ? -21.119 -8.650  -1.594  1.00 24.38 ? 327  ARG A C   1 
ATOM   2098 O  O   . ARG A 1 263 ? -20.589 -7.686  -2.158  1.00 23.72 ? 327  ARG A O   1 
ATOM   2099 C  CB  . ARG A 1 263 ? -18.837 -9.656  -1.154  1.00 21.68 ? 327  ARG A CB  1 
ATOM   2100 C  CG  . ARG A 1 263 ? -17.950 -10.908 -1.170  1.00 22.54 ? 327  ARG A CG  1 
ATOM   2101 C  CD  . ARG A 1 263 ? -18.471 -12.018 -0.254  1.00 22.00 ? 327  ARG A CD  1 
ATOM   2102 N  NE  . ARG A 1 263 ? -18.498 -11.629 1.156   1.00 22.88 ? 327  ARG A NE  1 
ATOM   2103 C  CZ  . ARG A 1 263 ? -17.539 -11.906 2.037   1.00 23.50 ? 327  ARG A CZ  1 
ATOM   2104 N  NH1 . ARG A 1 263 ? -16.461 -12.584 1.666   1.00 24.17 ? 327  ARG A NH1 1 
ATOM   2105 N  NH2 . ARG A 1 263 ? -17.659 -11.506 3.296   1.00 22.93 ? 327  ARG A NH2 1 
ATOM   2106 N  N   . LYS A 1 264 ? -22.385 -8.642  -1.191  1.00 25.30 ? 328  LYS A N   1 
ATOM   2107 C  CA  . LYS A 1 264 ? -23.265 -7.510  -1.458  1.00 27.01 ? 328  LYS A CA  1 
ATOM   2108 C  C   . LYS A 1 264 ? -23.521 -6.532  -0.317  1.00 25.37 ? 328  LYS A C   1 
ATOM   2109 O  O   . LYS A 1 264 ? -24.430 -5.707  -0.393  1.00 26.83 ? 328  LYS A O   1 
ATOM   2110 C  CB  . LYS A 1 264 ? -24.596 -8.035  -1.998  1.00 28.40 ? 328  LYS A CB  1 
ATOM   2111 C  CG  . LYS A 1 264 ? -24.445 -8.845  -3.281  1.00 33.40 ? 328  LYS A CG  1 
ATOM   2112 C  CD  . LYS A 1 264 ? -25.764 -9.483  -3.698  1.00 35.61 ? 328  LYS A CD  1 
ATOM   2113 C  CE  . LYS A 1 264 ? -25.603 -10.339 -4.941  1.00 36.89 ? 328  LYS A CE  1 
ATOM   2114 N  NZ  . LYS A 1 264 ? -25.185 -9.536  -6.124  1.00 40.45 ? 328  LYS A NZ  1 
ATOM   2115 N  N   . ASN A 1 265 ? -22.727 -6.624  0.740   1.00 22.63 ? 329  ASN A N   1 
ATOM   2116 C  CA  . ASN A 1 265 ? -22.860 -5.708  1.863   1.00 21.21 ? 329  ASN A CA  1 
ATOM   2117 C  C   . ASN A 1 265 ? -21.485 -5.072  2.014   1.00 20.02 ? 329  ASN A C   1 
ATOM   2118 O  O   . ASN A 1 265 ? -20.528 -5.701  2.466   1.00 17.71 ? 329  ASN A O   1 
ATOM   2119 C  CB  . ASN A 1 265 ? -23.303 -6.462  3.114   1.00 21.16 ? 329  ASN A CB  1 
ATOM   2120 C  CG  . ASN A 1 265 ? -24.714 -7.035  2.969   1.00 24.09 ? 329  ASN A CG  1 
ATOM   2121 O  OD1 . ASN A 1 265 ? -24.897 -8.186  2.557   1.00 23.49 ? 329  ASN A OD1 1 
ATOM   2122 N  ND2 . ASN A 1 265 ? -25.715 -6.220  3.282   1.00 20.10 ? 329  ASN A ND2 1 
ATOM   2123 N  N   . ILE A 1 266 ? -21.408 -3.813  1.602   1.00 20.37 ? 330  ILE A N   1 
ATOM   2124 C  CA  . ILE A 1 266 ? -20.161 -3.067  1.578   1.00 18.91 ? 330  ILE A CA  1 
ATOM   2125 C  C   . ILE A 1 266 ? -20.183 -1.780  2.386   1.00 19.36 ? 330  ILE A C   1 
ATOM   2126 O  O   . ILE A 1 266 ? -21.183 -1.057  2.411   1.00 18.51 ? 330  ILE A O   1 
ATOM   2127 C  CB  . ILE A 1 266 ? -19.814 -2.715  0.105   1.00 17.59 ? 330  ILE A CB  1 
ATOM   2128 C  CG1 . ILE A 1 266 ? -19.807 -3.991  -0.736  1.00 17.33 ? 330  ILE A CG1 1 
ATOM   2129 C  CG2 . ILE A 1 266 ? -18.494 -1.969  0.019   1.00 17.30 ? 330  ILE A CG2 1 
ATOM   2130 C  CD1 . ILE A 1 266 ? -19.748 -3.743  -2.226  1.00 18.91 ? 330  ILE A CD1 1 
ATOM   2131 N  N   . LEU A 1 267 ? -19.060 -1.500  3.037   1.00 18.68 ? 331  LEU A N   1 
ATOM   2132 C  CA  . LEU A 1 267 ? -18.895 -0.288  3.822   1.00 17.09 ? 331  LEU A CA  1 
ATOM   2133 C  C   . LEU A 1 267 ? -17.698 0.458   3.239   1.00 17.45 ? 331  LEU A C   1 
ATOM   2134 O  O   . LEU A 1 267 ? -16.559 0.017   3.377   1.00 17.54 ? 331  LEU A O   1 
ATOM   2135 C  CB  . LEU A 1 267 ? -18.635 -0.618  5.293   1.00 18.24 ? 331  LEU A CB  1 
ATOM   2136 C  CG  . LEU A 1 267 ? -18.237 0.583   6.167   1.00 20.70 ? 331  LEU A CG  1 
ATOM   2137 C  CD1 . LEU A 1 267 ? -19.288 1.676   6.064   1.00 20.79 ? 331  LEU A CD1 1 
ATOM   2138 C  CD2 . LEU A 1 267 ? -18.088 0.142   7.611   1.00 20.51 ? 331  LEU A CD2 1 
ATOM   2139 N  N   . LEU A 1 268 ? -17.964 1.571   2.563   1.00 18.02 ? 332  LEU A N   1 
ATOM   2140 C  CA  . LEU A 1 268 ? -16.902 2.369   1.972   1.00 18.36 ? 332  LEU A CA  1 
ATOM   2141 C  C   . LEU A 1 268 ? -16.310 3.290   3.034   1.00 17.99 ? 332  LEU A C   1 
ATOM   2142 O  O   . LEU A 1 268 ? -17.035 3.851   3.853   1.00 16.34 ? 332  LEU A O   1 
ATOM   2143 C  CB  . LEU A 1 268 ? -17.450 3.202   0.808   1.00 17.37 ? 332  LEU A CB  1 
ATOM   2144 C  CG  . LEU A 1 268 ? -18.030 2.408   -0.368  1.00 20.40 ? 332  LEU A CG  1 
ATOM   2145 C  CD1 . LEU A 1 268 ? -18.729 3.347   -1.337  1.00 19.34 ? 332  LEU A CD1 1 
ATOM   2146 C  CD2 . LEU A 1 268 ? -16.912 1.646   -1.069  1.00 18.94 ? 332  LEU A CD2 1 
ATOM   2147 N  N   . VAL A 1 269 ? -14.990 3.437   3.021   1.00 17.69 ? 333  VAL A N   1 
ATOM   2148 C  CA  . VAL A 1 269 ? -14.325 4.304   3.979   1.00 17.42 ? 333  VAL A CA  1 
ATOM   2149 C  C   . VAL A 1 269 ? -13.335 5.248   3.295   1.00 18.39 ? 333  VAL A C   1 
ATOM   2150 O  O   . VAL A 1 269 ? -12.324 4.805   2.744   1.00 19.11 ? 333  VAL A O   1 
ATOM   2151 C  CB  . VAL A 1 269 ? -13.574 3.474   5.066   1.00 15.95 ? 333  VAL A CB  1 
ATOM   2152 C  CG1 . VAL A 1 269 ? -12.908 4.414   6.086   1.00 14.70 ? 333  VAL A CG1 1 
ATOM   2153 C  CG2 . VAL A 1 269 ? -14.549 2.549   5.783   1.00 16.28 ? 333  VAL A CG2 1 
ATOM   2154 N  N   . PRO A 1 270 ? -13.622 6.566   3.311   1.00 17.91 ? 334  PRO A N   1 
ATOM   2155 C  CA  . PRO A 1 270 ? -12.749 7.578   2.698   1.00 18.26 ? 334  PRO A CA  1 
ATOM   2156 C  C   . PRO A 1 270 ? -11.551 7.760   3.627   1.00 17.90 ? 334  PRO A C   1 
ATOM   2157 O  O   . PRO A 1 270 ? -11.494 8.697   4.417   1.00 20.27 ? 334  PRO A O   1 
ATOM   2158 C  CB  . PRO A 1 270 ? -13.644 8.814   2.638   1.00 16.15 ? 334  PRO A CB  1 
ATOM   2159 C  CG  . PRO A 1 270 ? -14.485 8.670   3.875   1.00 18.20 ? 334  PRO A CG  1 
ATOM   2160 C  CD  . PRO A 1 270 ? -14.832 7.188   3.882   1.00 17.28 ? 334  PRO A CD  1 
ATOM   2161 N  N   . ILE A 1 271 ? -10.590 6.856   3.501   1.00 17.65 ? 335  ILE A N   1 
ATOM   2162 C  CA  . ILE A 1 271 ? -9.416  6.821   4.364   1.00 16.70 ? 335  ILE A CA  1 
ATOM   2163 C  C   . ILE A 1 271 ? -8.331  7.886   4.180   1.00 17.51 ? 335  ILE A C   1 
ATOM   2164 O  O   . ILE A 1 271 ? -7.460  8.027   5.032   1.00 16.60 ? 335  ILE A O   1 
ATOM   2165 C  CB  . ILE A 1 271 ? -8.769  5.416   4.271   1.00 15.85 ? 335  ILE A CB  1 
ATOM   2166 C  CG1 . ILE A 1 271 ? -7.869  5.161   5.475   1.00 15.95 ? 335  ILE A CG1 1 
ATOM   2167 C  CG2 . ILE A 1 271 ? -7.989  5.291   2.958   1.00 14.99 ? 335  ILE A CG2 1 
ATOM   2168 C  CD1 . ILE A 1 271 ? -8.603  5.207   6.804   1.00 18.10 ? 335  ILE A CD1 1 
ATOM   2169 N  N   . ALA A 1 272 ? -8.374  8.637   3.088   1.00 19.10 ? 336  ALA A N   1 
ATOM   2170 C  CA  . ALA A 1 272 ? -7.348  9.646   2.847   1.00 21.18 ? 336  ALA A CA  1 
ATOM   2171 C  C   . ALA A 1 272 ? -7.845  11.083  2.950   1.00 22.38 ? 336  ALA A C   1 
ATOM   2172 O  O   . ALA A 1 272 ? -7.116  12.014  2.629   1.00 23.74 ? 336  ALA A O   1 
ATOM   2173 C  CB  . ALA A 1 272 ? -6.704  9.413   1.472   1.00 22.97 ? 336  ALA A CB  1 
ATOM   2174 N  N   . PHE A 1 273 ? -9.080  11.258  3.402   1.00 23.43 ? 337  PHE A N   1 
ATOM   2175 C  CA  . PHE A 1 273 ? -9.668  12.584  3.547   1.00 24.10 ? 337  PHE A CA  1 
ATOM   2176 C  C   . PHE A 1 273 ? -10.105 12.819  4.981   1.00 23.13 ? 337  PHE A C   1 
ATOM   2177 O  O   . PHE A 1 273 ? -10.461 11.883  5.684   1.00 22.66 ? 337  PHE A O   1 
ATOM   2178 C  CB  . PHE A 1 273 ? -10.872 12.721  2.616   1.00 27.14 ? 337  PHE A CB  1 
ATOM   2179 C  CG  . PHE A 1 273 ? -10.506 12.756  1.166   1.00 32.18 ? 337  PHE A CG  1 
ATOM   2180 C  CD1 . PHE A 1 273 ? -11.345 12.195  0.211   1.00 34.06 ? 337  PHE A CD1 1 
ATOM   2181 C  CD2 . PHE A 1 273 ? -9.326  13.365  0.749   1.00 33.83 ? 337  PHE A CD2 1 
ATOM   2182 C  CE1 . PHE A 1 273 ? -11.016 12.239  -1.137  1.00 35.64 ? 337  PHE A CE1 1 
ATOM   2183 C  CE2 . PHE A 1 273 ? -8.988  13.414  -0.601  1.00 35.72 ? 337  PHE A CE2 1 
ATOM   2184 C  CZ  . PHE A 1 273 ? -9.836  12.850  -1.544  1.00 35.80 ? 337  PHE A CZ  1 
ATOM   2185 N  N   . THR A 1 274 ? -10.083 14.074  5.409   1.00 24.10 ? 338  THR A N   1 
ATOM   2186 C  CA  . THR A 1 274 ? -10.474 14.430  6.769   1.00 23.81 ? 338  THR A CA  1 
ATOM   2187 C  C   . THR A 1 274 ? -11.828 15.128  6.771   1.00 24.39 ? 338  THR A C   1 
ATOM   2188 O  O   . THR A 1 274 ? -12.398 15.409  7.834   1.00 23.90 ? 338  THR A O   1 
ATOM   2189 C  CB  . THR A 1 274 ? -9.431  15.358  7.419   1.00 24.60 ? 338  THR A CB  1 
ATOM   2190 O  OG1 . THR A 1 274 ? -9.133  16.437  6.525   1.00 26.39 ? 338  THR A OG1 1 
ATOM   2191 C  CG2 . THR A 1 274 ? -8.147  14.585  7.728   1.00 25.17 ? 338  THR A CG2 1 
ATOM   2192 N  N   . SER A 1 275 ? -12.334 15.417  5.576   1.00 24.10 ? 339  SER A N   1 
ATOM   2193 C  CA  . SER A 1 275 ? -13.631 16.061  5.449   1.00 24.53 ? 339  SER A CA  1 
ATOM   2194 C  C   . SER A 1 275 ? -14.262 15.723  4.099   1.00 24.19 ? 339  SER A C   1 
ATOM   2195 O  O   . SER A 1 275 ? -13.630 15.122  3.230   1.00 23.50 ? 339  SER A O   1 
ATOM   2196 C  CB  . SER A 1 275 ? -13.499 17.580  5.596   1.00 25.02 ? 339  SER A CB  1 
ATOM   2197 O  OG  . SER A 1 275 ? -13.348 18.204  4.330   1.00 26.40 ? 339  SER A OG  1 
ATOM   2198 N  N   . ASP A 1 276 ? -15.512 16.120  3.923   1.00 23.90 ? 340  ASP A N   1 
ATOM   2199 C  CA  . ASP A 1 276 ? -16.199 15.839  2.676   1.00 23.65 ? 340  ASP A CA  1 
ATOM   2200 C  C   . ASP A 1 276 ? -15.762 16.704  1.520   1.00 23.01 ? 340  ASP A C   1 
ATOM   2201 O  O   . ASP A 1 276 ? -15.380 17.856  1.690   1.00 23.27 ? 340  ASP A O   1 
ATOM   2202 C  CB  . ASP A 1 276 ? -17.709 16.004  2.838   1.00 23.08 ? 340  ASP A CB  1 
ATOM   2203 C  CG  . ASP A 1 276 ? -18.338 14.862  3.583   1.00 25.62 ? 340  ASP A CG  1 
ATOM   2204 O  OD1 . ASP A 1 276 ? -18.007 13.699  3.271   1.00 28.29 ? 340  ASP A OD1 1 
ATOM   2205 O  OD2 . ASP A 1 276 ? -19.173 15.127  4.469   1.00 26.79 ? 340  ASP A OD2 1 
ATOM   2206 N  N   . HIS A 1 277 ? -15.821 16.119  0.337   1.00 23.37 ? 341  HIS A N   1 
ATOM   2207 C  CA  . HIS A 1 277 ? -15.513 16.821  -0.889  1.00 24.97 ? 341  HIS A CA  1 
ATOM   2208 C  C   . HIS A 1 277 ? -16.227 16.087  -2.004  1.00 22.72 ? 341  HIS A C   1 
ATOM   2209 O  O   . HIS A 1 277 ? -16.962 15.131  -1.760  1.00 20.49 ? 341  HIS A O   1 
ATOM   2210 C  CB  . HIS A 1 277 ? -14.017 16.867  -1.202  1.00 30.09 ? 341  HIS A CB  1 
ATOM   2211 C  CG  . HIS A 1 277 ? -13.688 17.810  -2.324  1.00 38.38 ? 341  HIS A CG  1 
ATOM   2212 N  ND1 . HIS A 1 277 ? -12.531 17.723  -3.070  1.00 40.59 ? 341  HIS A ND1 1 
ATOM   2213 C  CD2 . HIS A 1 277 ? -14.385 18.858  -2.833  1.00 37.71 ? 341  HIS A CD2 1 
ATOM   2214 C  CE1 . HIS A 1 277 ? -12.531 18.675  -3.989  1.00 40.84 ? 341  HIS A CE1 1 
ATOM   2215 N  NE2 . HIS A 1 277 ? -13.645 19.376  -3.865  1.00 39.40 ? 341  HIS A NE2 1 
ATOM   2216 N  N   . ILE A 1 278 ? -15.996 16.538  -3.228  1.00 21.42 ? 342  ILE A N   1 
ATOM   2217 C  CA  . ILE A 1 278 ? -16.612 15.951  -4.400  1.00 23.17 ? 342  ILE A CA  1 
ATOM   2218 C  C   . ILE A 1 278 ? -16.318 14.447  -4.509  1.00 22.98 ? 342  ILE A C   1 
ATOM   2219 O  O   . ILE A 1 278 ? -17.167 13.683  -4.963  1.00 22.85 ? 342  ILE A O   1 
ATOM   2220 C  CB  . ILE A 1 278 ? -16.135 16.690  -5.678  1.00 22.86 ? 342  ILE A CB  1 
ATOM   2221 C  CG1 . ILE A 1 278 ? -17.061 16.362  -6.848  1.00 23.25 ? 342  ILE A CG1 1 
ATOM   2222 C  CG2 . ILE A 1 278 ? -14.693 16.326  -5.990  1.00 23.11 ? 342  ILE A CG2 1 
ATOM   2223 C  CD1 . ILE A 1 278 ? -18.452 16.980  -6.702  1.00 22.07 ? 342  ILE A CD1 1 
ATOM   2224 N  N   . GLU A 1 279 ? -15.127 14.023  -4.084  1.00 22.24 ? 343  GLU A N   1 
ATOM   2225 C  CA  . GLU A 1 279 ? -14.759 12.608  -4.142  1.00 24.58 ? 343  GLU A CA  1 
ATOM   2226 C  C   . GLU A 1 279 ? -15.630 11.719  -3.255  1.00 24.03 ? 343  GLU A C   1 
ATOM   2227 O  O   . GLU A 1 279 ? -15.868 10.560  -3.582  1.00 23.64 ? 343  GLU A O   1 
ATOM   2228 C  CB  . GLU A 1 279 ? -13.292 12.405  -3.746  1.00 26.94 ? 343  GLU A CB  1 
ATOM   2229 C  CG  . GLU A 1 279 ? -12.269 12.753  -4.823  1.00 32.53 ? 343  GLU A CG  1 
ATOM   2230 C  CD  . GLU A 1 279 ? -12.309 14.209  -5.237  1.00 35.88 ? 343  GLU A CD  1 
ATOM   2231 O  OE1 . GLU A 1 279 ? -12.313 15.084  -4.344  1.00 36.39 ? 343  GLU A OE1 1 
ATOM   2232 O  OE2 . GLU A 1 279 ? -12.326 14.480  -6.460  1.00 39.68 ? 343  GLU A OE2 1 
ATOM   2233 N  N   . THR A 1 280 ? -16.096 12.251  -2.129  1.00 23.75 ? 344  THR A N   1 
ATOM   2234 C  CA  . THR A 1 280 ? -16.935 11.467  -1.235  1.00 23.19 ? 344  THR A CA  1 
ATOM   2235 C  C   . THR A 1 280 ? -18.417 11.737  -1.467  1.00 23.78 ? 344  THR A C   1 
ATOM   2236 O  O   . THR A 1 280 ? -19.206 10.802  -1.585  1.00 23.35 ? 344  THR A O   1 
ATOM   2237 C  CB  . THR A 1 280 ? -16.621 11.746  0.260   1.00 23.28 ? 344  THR A CB  1 
ATOM   2238 O  OG1 . THR A 1 280 ? -16.967 13.097  0.586   1.00 25.23 ? 344  THR A OG1 1 
ATOM   2239 C  CG2 . THR A 1 280 ? -15.145 11.518  0.551   1.00 23.17 ? 344  THR A CG2 1 
ATOM   2240 N  N   . LEU A 1 281 ? -18.790 13.013  -1.542  1.00 22.99 ? 345  LEU A N   1 
ATOM   2241 C  CA  . LEU A 1 281 ? -20.192 13.382  -1.737  1.00 23.79 ? 345  LEU A CA  1 
ATOM   2242 C  C   . LEU A 1 281 ? -20.716 13.023  -3.119  1.00 23.33 ? 345  LEU A C   1 
ATOM   2243 O  O   . LEU A 1 281 ? -21.903 12.736  -3.281  1.00 22.45 ? 345  LEU A O   1 
ATOM   2244 C  CB  . LEU A 1 281 ? -20.396 14.881  -1.482  1.00 23.08 ? 345  LEU A CB  1 
ATOM   2245 C  CG  . LEU A 1 281 ? -20.062 15.373  -0.072  1.00 25.04 ? 345  LEU A CG  1 
ATOM   2246 C  CD1 . LEU A 1 281 ? -20.363 16.862  0.027   1.00 25.51 ? 345  LEU A CD1 1 
ATOM   2247 C  CD2 . LEU A 1 281 ? -20.870 14.595  0.956   1.00 26.70 ? 345  LEU A CD2 1 
ATOM   2248 N  N   . TYR A 1 282 ? -19.842 13.034  -4.121  1.00 22.11 ? 346  TYR A N   1 
ATOM   2249 C  CA  . TYR A 1 282 ? -20.283 12.692  -5.461  1.00 20.97 ? 346  TYR A CA  1 
ATOM   2250 C  C   . TYR A 1 282 ? -19.816 11.323  -5.946  1.00 21.29 ? 346  TYR A C   1 
ATOM   2251 O  O   . TYR A 1 282 ? -20.632 10.440  -6.199  1.00 21.30 ? 346  TYR A O   1 
ATOM   2252 C  CB  . TYR A 1 282 ? -19.836 13.748  -6.466  1.00 21.19 ? 346  TYR A CB  1 
ATOM   2253 C  CG  . TYR A 1 282 ? -20.262 13.425  -7.876  1.00 20.95 ? 346  TYR A CG  1 
ATOM   2254 C  CD1 . TYR A 1 282 ? -21.582 13.612  -8.288  1.00 22.09 ? 346  TYR A CD1 1 
ATOM   2255 C  CD2 . TYR A 1 282 ? -19.351 12.908  -8.796  1.00 22.16 ? 346  TYR A CD2 1 
ATOM   2256 C  CE1 . TYR A 1 282 ? -21.984 13.294  -9.588  1.00 21.31 ? 346  TYR A CE1 1 
ATOM   2257 C  CE2 . TYR A 1 282 ? -19.741 12.585  -10.091 1.00 21.33 ? 346  TYR A CE2 1 
ATOM   2258 C  CZ  . TYR A 1 282 ? -21.055 12.782  -10.483 1.00 22.39 ? 346  TYR A CZ  1 
ATOM   2259 O  OH  . TYR A 1 282 ? -21.430 12.481  -11.775 1.00 24.18 ? 346  TYR A OH  1 
ATOM   2260 N  N   . GLU A 1 283 ? -18.507 11.140  -6.076  1.00 21.75 ? 347  GLU A N   1 
ATOM   2261 C  CA  . GLU A 1 283 ? -17.992 9.870   -6.579  1.00 23.83 ? 347  GLU A CA  1 
ATOM   2262 C  C   . GLU A 1 283 ? -18.452 8.665   -5.754  1.00 22.79 ? 347  GLU A C   1 
ATOM   2263 O  O   . GLU A 1 283 ? -19.084 7.753   -6.287  1.00 21.53 ? 347  GLU A O   1 
ATOM   2264 C  CB  . GLU A 1 283 ? -16.462 9.900   -6.667  1.00 25.32 ? 347  GLU A CB  1 
ATOM   2265 C  CG  . GLU A 1 283 ? -15.908 8.964   -7.727  1.00 28.30 ? 347  GLU A CG  1 
ATOM   2266 C  CD  . GLU A 1 283 ? -14.390 8.999   -7.824  1.00 31.20 ? 347  GLU A CD  1 
ATOM   2267 O  OE1 . GLU A 1 283 ? -13.801 10.093  -7.685  1.00 32.81 ? 347  GLU A OE1 1 
ATOM   2268 O  OE2 . GLU A 1 283 ? -13.786 7.933   -8.058  1.00 30.48 ? 347  GLU A OE2 1 
ATOM   2269 N  N   . LEU A 1 284 ? -18.162 8.667   -4.457  1.00 21.13 ? 348  LEU A N   1 
ATOM   2270 C  CA  . LEU A 1 284 ? -18.556 7.550   -3.604  1.00 22.44 ? 348  LEU A CA  1 
ATOM   2271 C  C   . LEU A 1 284 ? -20.050 7.444   -3.279  1.00 22.80 ? 348  LEU A C   1 
ATOM   2272 O  O   . LEU A 1 284 ? -20.618 6.356   -3.369  1.00 23.21 ? 348  LEU A O   1 
ATOM   2273 C  CB  . LEU A 1 284 ? -17.762 7.571   -2.293  1.00 21.69 ? 348  LEU A CB  1 
ATOM   2274 C  CG  . LEU A 1 284 ? -16.260 7.273   -2.366  1.00 20.34 ? 348  LEU A CG  1 
ATOM   2275 C  CD1 . LEU A 1 284 ? -15.670 7.318   -0.969  1.00 20.50 ? 348  LEU A CD1 1 
ATOM   2276 C  CD2 . LEU A 1 284 ? -16.031 5.898   -2.983  1.00 21.82 ? 348  LEU A CD2 1 
ATOM   2277 N  N   . ASP A 1 285 ? -20.682 8.556   -2.902  1.00 24.45 ? 349  ASP A N   1 
ATOM   2278 C  CA  . ASP A 1 285 ? -22.102 8.547   -2.537  1.00 24.75 ? 349  ASP A CA  1 
ATOM   2279 C  C   . ASP A 1 285 ? -23.099 8.414   -3.685  1.00 24.58 ? 349  ASP A C   1 
ATOM   2280 O  O   . ASP A 1 285 ? -24.093 7.698   -3.566  1.00 25.59 ? 349  ASP A O   1 
ATOM   2281 C  CB  . ASP A 1 285 ? -22.464 9.801   -1.727  1.00 26.63 ? 349  ASP A CB  1 
ATOM   2282 C  CG  . ASP A 1 285 ? -21.766 9.855   -0.378  1.00 27.78 ? 349  ASP A CG  1 
ATOM   2283 O  OD1 . ASP A 1 285 ? -21.271 8.808   0.089   1.00 28.98 ? 349  ASP A OD1 1 
ATOM   2284 O  OD2 . ASP A 1 285 ? -21.720 10.947  0.223   1.00 30.38 ? 349  ASP A OD2 1 
ATOM   2285 N  N   . ILE A 1 286 ? -22.847 9.103   -4.789  1.00 23.83 ? 350  ILE A N   1 
ATOM   2286 C  CA  . ILE A 1 286 ? -23.768 9.053   -5.918  1.00 23.70 ? 350  ILE A CA  1 
ATOM   2287 C  C   . ILE A 1 286 ? -23.333 8.105   -7.032  1.00 22.76 ? 350  ILE A C   1 
ATOM   2288 O  O   . ILE A 1 286 ? -24.038 7.152   -7.353  1.00 24.04 ? 350  ILE A O   1 
ATOM   2289 C  CB  . ILE A 1 286 ? -23.992 10.472  -6.511  1.00 21.86 ? 350  ILE A CB  1 
ATOM   2290 C  CG1 . ILE A 1 286 ? -24.580 11.394  -5.435  1.00 24.13 ? 350  ILE A CG1 1 
ATOM   2291 C  CG2 . ILE A 1 286 ? -24.944 10.404  -7.701  1.00 22.11 ? 350  ILE A CG2 1 
ATOM   2292 C  CD1 . ILE A 1 286 ? -24.797 12.834  -5.889  1.00 22.74 ? 350  ILE A CD1 1 
ATOM   2293 N  N   . GLU A 1 287 ? -22.169 8.368   -7.610  1.00 23.36 ? 351  GLU A N   1 
ATOM   2294 C  CA  . GLU A 1 287 ? -21.646 7.559   -8.705  1.00 25.93 ? 351  GLU A CA  1 
ATOM   2295 C  C   . GLU A 1 287 ? -21.563 6.066   -8.365  1.00 26.06 ? 351  GLU A C   1 
ATOM   2296 O  O   . GLU A 1 287 ? -22.068 5.227   -9.113  1.00 25.28 ? 351  GLU A O   1 
ATOM   2297 C  CB  . GLU A 1 287 ? -20.266 8.086   -9.107  1.00 28.02 ? 351  GLU A CB  1 
ATOM   2298 C  CG  . GLU A 1 287 ? -19.868 7.810   -10.547 1.00 34.00 ? 351  GLU A CG  1 
ATOM   2299 C  CD  . GLU A 1 287 ? -18.498 8.387   -10.897 1.00 37.42 ? 351  GLU A CD  1 
ATOM   2300 O  OE1 . GLU A 1 287 ? -18.238 9.563   -10.558 1.00 38.08 ? 351  GLU A OE1 1 
ATOM   2301 O  OE2 . GLU A 1 287 ? -17.685 7.666   -11.521 1.00 39.52 ? 351  GLU A OE2 1 
ATOM   2302 N  N   . TYR A 1 288 ? -20.950 5.736   -7.231  1.00 25.54 ? 352  TYR A N   1 
ATOM   2303 C  CA  . TYR A 1 288 ? -20.799 4.337   -6.839  1.00 26.60 ? 352  TYR A CA  1 
ATOM   2304 C  C   . TYR A 1 288 ? -21.912 3.758   -5.969  1.00 27.41 ? 352  TYR A C   1 
ATOM   2305 O  O   . TYR A 1 288 ? -22.384 2.651   -6.227  1.00 27.35 ? 352  TYR A O   1 
ATOM   2306 C  CB  . TYR A 1 288 ? -19.465 4.119   -6.115  1.00 23.57 ? 352  TYR A CB  1 
ATOM   2307 C  CG  . TYR A 1 288 ? -18.243 4.581   -6.879  1.00 23.94 ? 352  TYR A CG  1 
ATOM   2308 C  CD1 . TYR A 1 288 ? -18.251 4.677   -8.272  1.00 24.41 ? 352  TYR A CD1 1 
ATOM   2309 C  CD2 . TYR A 1 288 ? -17.069 4.910   -6.206  1.00 22.90 ? 352  TYR A CD2 1 
ATOM   2310 C  CE1 . TYR A 1 288 ? -17.112 5.099   -8.973  1.00 23.98 ? 352  TYR A CE1 1 
ATOM   2311 C  CE2 . TYR A 1 288 ? -15.933 5.327   -6.895  1.00 23.06 ? 352  TYR A CE2 1 
ATOM   2312 C  CZ  . TYR A 1 288 ? -15.963 5.421   -8.274  1.00 23.43 ? 352  TYR A CZ  1 
ATOM   2313 O  OH  . TYR A 1 288 ? -14.838 5.854   -8.943  1.00 28.33 ? 352  TYR A OH  1 
ATOM   2314 N  N   . SER A 1 289 ? -22.329 4.497   -4.944  1.00 28.57 ? 353  SER A N   1 
ATOM   2315 C  CA  . SER A 1 289 ? -23.359 4.015   -4.024  1.00 29.23 ? 353  SER A CA  1 
ATOM   2316 C  C   . SER A 1 289 ? -24.796 4.072   -4.517  1.00 29.61 ? 353  SER A C   1 
ATOM   2317 O  O   . SER A 1 289 ? -25.630 3.290   -4.071  1.00 31.79 ? 353  SER A O   1 
ATOM   2318 C  CB  . SER A 1 289 ? -23.260 4.754   -2.687  1.00 28.54 ? 353  SER A CB  1 
ATOM   2319 O  OG  . SER A 1 289 ? -22.062 4.411   -2.015  1.00 30.59 ? 353  SER A OG  1 
ATOM   2320 N  N   . GLN A 1 290 ? -25.105 4.998   -5.415  1.00 31.04 ? 354  GLN A N   1 
ATOM   2321 C  CA  . GLN A 1 290 ? -26.468 5.080   -5.927  1.00 32.19 ? 354  GLN A CA  1 
ATOM   2322 C  C   . GLN A 1 290 ? -26.584 4.408   -7.283  1.00 31.35 ? 354  GLN A C   1 
ATOM   2323 O  O   . GLN A 1 290 ? -27.331 3.448   -7.438  1.00 31.09 ? 354  GLN A O   1 
ATOM   2324 C  CB  . GLN A 1 290 ? -26.925 6.536   -6.035  1.00 32.86 ? 354  GLN A CB  1 
ATOM   2325 C  CG  . GLN A 1 290 ? -27.079 7.229   -4.693  1.00 35.27 ? 354  GLN A CG  1 
ATOM   2326 C  CD  . GLN A 1 290 ? -27.604 8.646   -4.826  1.00 37.02 ? 354  GLN A CD  1 
ATOM   2327 O  OE1 . GLN A 1 290 ? -27.767 9.352   -3.831  1.00 36.93 ? 354  GLN A OE1 1 
ATOM   2328 N  NE2 . GLN A 1 290 ? -27.876 9.069   -6.058  1.00 38.04 ? 354  GLN A NE2 1 
ATOM   2329 N  N   . VAL A 1 291 ? -25.828 4.901   -8.257  1.00 30.93 ? 355  VAL A N   1 
ATOM   2330 C  CA  . VAL A 1 291 ? -25.874 4.359   -9.606  1.00 31.96 ? 355  VAL A CA  1 
ATOM   2331 C  C   . VAL A 1 291 ? -25.236 2.981   -9.761  1.00 32.95 ? 355  VAL A C   1 
ATOM   2332 O  O   . VAL A 1 291 ? -25.940 1.989   -9.948  1.00 32.93 ? 355  VAL A O   1 
ATOM   2333 C  CB  . VAL A 1 291 ? -25.218 5.333   -10.603 1.00 34.02 ? 355  VAL A CB  1 
ATOM   2334 C  CG1 . VAL A 1 291 ? -25.348 4.796   -12.026 1.00 32.41 ? 355  VAL A CG1 1 
ATOM   2335 C  CG2 . VAL A 1 291 ? -25.879 6.706   -10.487 1.00 34.44 ? 355  VAL A CG2 1 
ATOM   2336 N  N   . LEU A 1 292 ? -23.911 2.916   -9.687  1.00 33.13 ? 356  LEU A N   1 
ATOM   2337 C  CA  . LEU A 1 292 ? -23.208 1.642   -9.838  1.00 33.48 ? 356  LEU A CA  1 
ATOM   2338 C  C   . LEU A 1 292 ? -23.801 0.555   -8.950  1.00 33.61 ? 356  LEU A C   1 
ATOM   2339 O  O   . LEU A 1 292 ? -24.074 -0.553  -9.415  1.00 32.23 ? 356  LEU A O   1 
ATOM   2340 C  CB  . LEU A 1 292 ? -21.717 1.805   -9.515  1.00 33.42 ? 356  LEU A CB  1 
ATOM   2341 C  CG  . LEU A 1 292 ? -20.850 0.550   -9.683  1.00 34.91 ? 356  LEU A CG  1 
ATOM   2342 C  CD1 . LEU A 1 292 ? -20.916 0.068   -11.136 1.00 34.26 ? 356  LEU A CD1 1 
ATOM   2343 C  CD2 . LEU A 1 292 ? -19.407 0.859   -9.289  1.00 33.74 ? 356  LEU A CD2 1 
ATOM   2344 N  N   . ALA A 1 293 ? -23.999 0.879   -7.675  1.00 34.43 ? 357  ALA A N   1 
ATOM   2345 C  CA  . ALA A 1 293 ? -24.549 -0.068  -6.711  1.00 35.53 ? 357  ALA A CA  1 
ATOM   2346 C  C   . ALA A 1 293 ? -25.876 -0.675  -7.163  1.00 36.30 ? 357  ALA A C   1 
ATOM   2347 O  O   . ALA A 1 293 ? -26.107 -1.873  -6.992  1.00 36.25 ? 357  ALA A O   1 
ATOM   2348 C  CB  . ALA A 1 293 ? -24.724 0.612   -5.356  1.00 36.03 ? 357  ALA A CB  1 
ATOM   2349 N  N   . LYS A 1 294 ? -26.744 0.154   -7.733  1.00 37.56 ? 358  LYS A N   1 
ATOM   2350 C  CA  . LYS A 1 294 ? -28.042 -0.311  -8.206  1.00 37.95 ? 358  LYS A CA  1 
ATOM   2351 C  C   . LYS A 1 294 ? -27.865 -1.268  -9.376  1.00 37.95 ? 358  LYS A C   1 
ATOM   2352 O  O   . LYS A 1 294 ? -28.429 -2.360  -9.386  1.00 39.66 ? 358  LYS A O   1 
ATOM   2353 C  CB  . LYS A 1 294 ? -28.906 0.876   -8.626  1.00 39.42 ? 358  LYS A CB  1 
ATOM   2354 N  N   . GLU A 1 295 ? -27.074 -0.854  -10.358 1.00 36.59 ? 359  GLU A N   1 
ATOM   2355 C  CA  . GLU A 1 295 ? -26.823 -1.673  -11.533 1.00 36.50 ? 359  GLU A CA  1 
ATOM   2356 C  C   . GLU A 1 295 ? -26.205 -3.022  -11.183 1.00 36.61 ? 359  GLU A C   1 
ATOM   2357 O  O   . GLU A 1 295 ? -26.318 -3.977  -11.948 1.00 36.20 ? 359  GLU A O   1 
ATOM   2358 C  CB  . GLU A 1 295 ? -25.913 -0.926  -12.496 1.00 36.68 ? 359  GLU A CB  1 
ATOM   2359 N  N   . CYS A 1 296 ? -25.555 -3.104  -10.026 1.00 36.51 ? 360  CYS A N   1 
ATOM   2360 C  CA  . CYS A 1 296 ? -24.904 -4.343  -9.611  1.00 36.89 ? 360  CYS A CA  1 
ATOM   2361 C  C   . CYS A 1 296 ? -25.718 -5.234  -8.690  1.00 35.94 ? 360  CYS A C   1 
ATOM   2362 O  O   . CYS A 1 296 ? -25.370 -6.389  -8.483  1.00 34.90 ? 360  CYS A O   1 
ATOM   2363 C  CB  . CYS A 1 296 ? -23.563 -4.034  -8.946  1.00 38.12 ? 360  CYS A CB  1 
ATOM   2364 S  SG  . CYS A 1 296 ? -22.342 -3.383  -10.085 1.00 41.43 ? 360  CYS A SG  1 
ATOM   2365 N  N   . GLY A 1 297 ? -26.794 -4.700  -8.132  1.00 36.04 ? 361  GLY A N   1 
ATOM   2366 C  CA  . GLY A 1 297 ? -27.612 -5.498  -7.243  1.00 34.69 ? 361  GLY A CA  1 
ATOM   2367 C  C   . GLY A 1 297 ? -27.063 -5.623  -5.831  1.00 34.00 ? 361  GLY A C   1 
ATOM   2368 O  O   . GLY A 1 297 ? -27.176 -6.683  -5.212  1.00 33.75 ? 361  GLY A O   1 
ATOM   2369 N  N   . VAL A 1 298 ? -26.462 -4.551  -5.318  1.00 32.92 ? 362  VAL A N   1 
ATOM   2370 C  CA  . VAL A 1 298 ? -25.932 -4.567  -3.959  1.00 31.84 ? 362  VAL A CA  1 
ATOM   2371 C  C   . VAL A 1 298 ? -27.120 -4.649  -3.004  1.00 30.61 ? 362  VAL A C   1 
ATOM   2372 O  O   . VAL A 1 298 ? -28.212 -4.187  -3.332  1.00 29.79 ? 362  VAL A O   1 
ATOM   2373 C  CB  . VAL A 1 298 ? -25.138 -3.275  -3.647  1.00 33.16 ? 362  VAL A CB  1 
ATOM   2374 C  CG1 . VAL A 1 298 ? -26.057 -2.066  -3.746  1.00 32.55 ? 362  VAL A CG1 1 
ATOM   2375 C  CG2 . VAL A 1 298 ? -24.526 -3.356  -2.250  1.00 32.32 ? 362  VAL A CG2 1 
ATOM   2376 N  N   . GLU A 1 299 ? -26.912 -5.246  -1.834  1.00 31.05 ? 363  GLU A N   1 
ATOM   2377 C  CA  . GLU A 1 299 ? -27.968 -5.371  -0.833  1.00 30.78 ? 363  GLU A CA  1 
ATOM   2378 C  C   . GLU A 1 299 ? -27.914 -4.174  0.121   1.00 30.08 ? 363  GLU A C   1 
ATOM   2379 O  O   . GLU A 1 299 ? -28.942 -3.618  0.502   1.00 30.71 ? 363  GLU A O   1 
ATOM   2380 C  CB  . GLU A 1 299 ? -27.799 -6.670  -0.035  1.00 34.17 ? 363  GLU A CB  1 
ATOM   2381 C  CG  . GLU A 1 299 ? -27.918 -7.948  -0.861  1.00 38.85 ? 363  GLU A CG  1 
ATOM   2382 C  CD  . GLU A 1 299 ? -27.750 -9.215  -0.026  1.00 41.21 ? 363  GLU A CD  1 
ATOM   2383 O  OE1 . GLU A 1 299 ? -27.802 -10.325 -0.602  1.00 44.11 ? 363  GLU A OE1 1 
ATOM   2384 O  OE2 . GLU A 1 299 ? -27.568 -9.104  1.206   1.00 41.45 ? 363  GLU A OE2 1 
ATOM   2385 N  N   . ASN A 1 300 ? -26.701 -3.791  0.502   1.00 27.24 ? 364  ASN A N   1 
ATOM   2386 C  CA  . ASN A 1 300 ? -26.474 -2.666  1.403   1.00 24.04 ? 364  ASN A CA  1 
ATOM   2387 C  C   . ASN A 1 300 ? -25.086 -2.085  1.182   1.00 21.64 ? 364  ASN A C   1 
ATOM   2388 O  O   . ASN A 1 300 ? -24.084 -2.800  1.273   1.00 17.96 ? 364  ASN A O   1 
ATOM   2389 C  CB  . ASN A 1 300 ? -26.556 -3.101  2.873   1.00 25.60 ? 364  ASN A CB  1 
ATOM   2390 C  CG  . ASN A 1 300 ? -27.966 -3.389  3.331   1.00 27.56 ? 364  ASN A CG  1 
ATOM   2391 O  OD1 . ASN A 1 300 ? -28.313 -4.532  3.636   1.00 28.04 ? 364  ASN A OD1 1 
ATOM   2392 N  ND2 . ASN A 1 300 ? -28.787 -2.353  3.390   1.00 29.75 ? 364  ASN A ND2 1 
ATOM   2393 N  N   . ILE A 1 301 ? -25.027 -0.796  0.872   1.00 20.03 ? 365  ILE A N   1 
ATOM   2394 C  CA  . ILE A 1 301 ? -23.750 -0.124  0.716   1.00 18.54 ? 365  ILE A CA  1 
ATOM   2395 C  C   . ILE A 1 301 ? -23.850 1.188   1.478   1.00 20.34 ? 365  ILE A C   1 
ATOM   2396 O  O   . ILE A 1 301 ? -24.768 1.986   1.262   1.00 20.41 ? 365  ILE A O   1 
ATOM   2397 C  CB  . ILE A 1 301 ? -23.371 0.127   -0.767  1.00 18.35 ? 365  ILE A CB  1 
ATOM   2398 C  CG1 . ILE A 1 301 ? -21.947 0.701   -0.827  1.00 15.50 ? 365  ILE A CG1 1 
ATOM   2399 C  CG2 . ILE A 1 301 ? -24.355 1.085   -1.439  1.00 15.87 ? 365  ILE A CG2 1 
ATOM   2400 C  CD1 . ILE A 1 301 ? -21.324 0.640   -2.212  1.00 16.01 ? 365  ILE A CD1 1 
ATOM   2401 N  N   . ARG A 1 302 ? -22.932 1.384   2.416   1.00 20.55 ? 366  ARG A N   1 
ATOM   2402 C  CA  . ARG A 1 302 ? -22.923 2.595   3.219   1.00 20.00 ? 366  ARG A CA  1 
ATOM   2403 C  C   . ARG A 1 302 ? -21.517 3.167   3.222   1.00 20.72 ? 366  ARG A C   1 
ATOM   2404 O  O   . ARG A 1 302 ? -20.561 2.506   2.808   1.00 21.00 ? 366  ARG A O   1 
ATOM   2405 C  CB  . ARG A 1 302 ? -23.365 2.291   4.650   1.00 19.02 ? 366  ARG A CB  1 
ATOM   2406 C  CG  . ARG A 1 302 ? -24.752 1.660   4.752   1.00 22.74 ? 366  ARG A CG  1 
ATOM   2407 C  CD  . ARG A 1 302 ? -25.187 1.500   6.205   1.00 23.58 ? 366  ARG A CD  1 
ATOM   2408 N  NE  . ARG A 1 302 ? -25.533 2.783   6.813   1.00 27.54 ? 366  ARG A NE  1 
ATOM   2409 C  CZ  . ARG A 1 302 ? -26.706 3.393   6.658   1.00 28.92 ? 366  ARG A CZ  1 
ATOM   2410 N  NH1 . ARG A 1 302 ? -27.657 2.832   5.921   1.00 29.27 ? 366  ARG A NH1 1 
ATOM   2411 N  NH2 . ARG A 1 302 ? -26.924 4.572   7.226   1.00 27.48 ? 366  ARG A NH2 1 
ATOM   2412 N  N   . ARG A 1 303 ? -21.394 4.406   3.669   1.00 20.70 ? 367  ARG A N   1 
ATOM   2413 C  CA  . ARG A 1 303 ? -20.096 5.043   3.729   1.00 21.56 ? 367  ARG A CA  1 
ATOM   2414 C  C   . ARG A 1 303 ? -19.908 5.652   5.095   1.00 21.16 ? 367  ARG A C   1 
ATOM   2415 O  O   . ARG A 1 303 ? -20.791 6.349   5.601   1.00 20.83 ? 367  ARG A O   1 
ATOM   2416 C  CB  . ARG A 1 303 ? -19.963 6.141   2.675   1.00 21.58 ? 367  ARG A CB  1 
ATOM   2417 C  CG  . ARG A 1 303 ? -18.655 6.921   2.817   1.00 25.04 ? 367  ARG A CG  1 
ATOM   2418 C  CD  . ARG A 1 303 ? -18.473 7.937   1.716   1.00 24.64 ? 367  ARG A CD  1 
ATOM   2419 N  NE  . ARG A 1 303 ? -19.440 9.028   1.787   1.00 26.00 ? 367  ARG A NE  1 
ATOM   2420 C  CZ  . ARG A 1 303 ? -19.392 10.012  2.677   1.00 26.98 ? 367  ARG A CZ  1 
ATOM   2421 N  NH1 . ARG A 1 303 ? -18.423 10.041  3.585   1.00 27.78 ? 367  ARG A NH1 1 
ATOM   2422 N  NH2 . ARG A 1 303 ? -20.292 10.986  2.639   1.00 26.67 ? 367  ARG A NH2 1 
ATOM   2423 N  N   . ALA A 1 304 ? -18.762 5.375   5.698   1.00 19.54 ? 368  ALA A N   1 
ATOM   2424 C  CA  . ALA A 1 304 ? -18.458 5.931   7.001   1.00 19.88 ? 368  ALA A CA  1 
ATOM   2425 C  C   . ALA A 1 304 ? -18.488 7.454   6.857   1.00 21.04 ? 368  ALA A C   1 
ATOM   2426 O  O   . ALA A 1 304 ? -18.048 8.004   5.837   1.00 20.28 ? 368  ALA A O   1 
ATOM   2427 C  CB  . ALA A 1 304 ? -17.087 5.476   7.450   1.00 18.79 ? 368  ALA A CB  1 
ATOM   2428 N  N   . GLU A 1 305 ? -19.021 8.128   7.867   1.00 21.14 ? 369  GLU A N   1 
ATOM   2429 C  CA  . GLU A 1 305 ? -19.094 9.580   7.849   1.00 23.66 ? 369  GLU A CA  1 
ATOM   2430 C  C   . GLU A 1 305 ? -17.681 10.149  7.816   1.00 22.38 ? 369  GLU A C   1 
ATOM   2431 O  O   . GLU A 1 305 ? -16.771 9.584   8.423   1.00 21.30 ? 369  GLU A O   1 
ATOM   2432 C  CB  . GLU A 1 305 ? -19.814 10.078  9.102   1.00 26.91 ? 369  GLU A CB  1 
ATOM   2433 C  CG  . GLU A 1 305 ? -19.932 11.592  9.210   1.00 32.83 ? 369  GLU A CG  1 
ATOM   2434 C  CD  . GLU A 1 305 ? -20.725 12.029  10.434  1.00 36.47 ? 369  GLU A CD  1 
ATOM   2435 O  OE1 . GLU A 1 305 ? -21.025 13.236  10.547  1.00 40.18 ? 369  GLU A OE1 1 
ATOM   2436 O  OE2 . GLU A 1 305 ? -21.046 11.169  11.286  1.00 38.13 ? 369  GLU A OE2 1 
ATOM   2437 N  N   . SER A 1 306 ? -17.486 11.242  7.084   1.00 21.26 ? 370  SER A N   1 
ATOM   2438 C  CA  . SER A 1 306 ? -16.169 11.872  7.037   1.00 22.16 ? 370  SER A CA  1 
ATOM   2439 C  C   . SER A 1 306 ? -15.936 12.502  8.409   1.00 23.44 ? 370  SER A C   1 
ATOM   2440 O  O   . SER A 1 306 ? -16.893 12.840  9.114   1.00 22.86 ? 370  SER A O   1 
ATOM   2441 C  CB  . SER A 1 306 ? -16.120 12.944  5.947   1.00 23.35 ? 370  SER A CB  1 
ATOM   2442 O  OG  . SER A 1 306 ? -16.304 12.366  4.666   1.00 24.39 ? 370  SER A OG  1 
ATOM   2443 N  N   . LEU A 1 307 ? -14.675 12.663  8.790   1.00 23.73 ? 371  LEU A N   1 
ATOM   2444 C  CA  . LEU A 1 307 ? -14.358 13.223  10.098  1.00 25.61 ? 371  LEU A CA  1 
ATOM   2445 C  C   . LEU A 1 307 ? -15.037 14.568  10.375  1.00 25.56 ? 371  LEU A C   1 
ATOM   2446 O  O   . LEU A 1 307 ? -15.530 14.804  11.481  1.00 24.95 ? 371  LEU A O   1 
ATOM   2447 C  CB  . LEU A 1 307 ? -12.839 13.323  10.252  1.00 24.64 ? 371  LEU A CB  1 
ATOM   2448 C  CG  . LEU A 1 307 ? -12.142 12.000  9.895   1.00 26.32 ? 371  LEU A CG  1 
ATOM   2449 C  CD1 . LEU A 1 307 ? -10.710 12.020  10.385  1.00 24.06 ? 371  LEU A CD1 1 
ATOM   2450 C  CD2 . LEU A 1 307 ? -12.889 10.832  10.524  1.00 25.29 ? 371  LEU A CD2 1 
ATOM   2451 N  N   . ASN A 1 308 ? -15.071 15.432  9.367   1.00 25.37 ? 372  ASN A N   1 
ATOM   2452 C  CA  . ASN A 1 308 ? -15.700 16.749  9.464   1.00 26.97 ? 372  ASN A CA  1 
ATOM   2453 C  C   . ASN A 1 308 ? -15.616 17.461  10.819  1.00 27.58 ? 372  ASN A C   1 
ATOM   2454 O  O   . ASN A 1 308 ? -14.549 17.912  11.220  1.00 27.33 ? 372  ASN A O   1 
ATOM   2455 C  CB  . ASN A 1 308 ? -17.169 16.661  9.035   1.00 26.68 ? 372  ASN A CB  1 
ATOM   2456 C  CG  . ASN A 1 308 ? -17.334 16.163  7.607   1.00 27.61 ? 372  ASN A CG  1 
ATOM   2457 O  OD1 . ASN A 1 308 ? -16.480 16.395  6.750   1.00 26.17 ? 372  ASN A OD1 1 
ATOM   2458 N  ND2 . ASN A 1 308 ? -18.448 15.492  7.343   1.00 27.33 ? 372  ASN A ND2 1 
ATOM   2459 N  N   . GLY A 1 309 ? -16.747 17.557  11.514  1.00 29.17 ? 373  GLY A N   1 
ATOM   2460 C  CA  . GLY A 1 309 ? -16.785 18.245  12.797  1.00 29.50 ? 373  GLY A CA  1 
ATOM   2461 C  C   . GLY A 1 309 ? -16.613 17.440  14.078  1.00 30.55 ? 373  GLY A C   1 
ATOM   2462 O  O   . GLY A 1 309 ? -16.890 17.947  15.164  1.00 31.41 ? 373  GLY A O   1 
ATOM   2463 N  N   . ASN A 1 310 ? -16.162 16.195  13.971  1.00 30.24 ? 374  ASN A N   1 
ATOM   2464 C  CA  . ASN A 1 310 ? -15.950 15.366  15.153  1.00 28.95 ? 374  ASN A CA  1 
ATOM   2465 C  C   . ASN A 1 310 ? -14.979 16.095  16.090  1.00 28.22 ? 374  ASN A C   1 
ATOM   2466 O  O   . ASN A 1 310 ? -13.845 16.389  15.714  1.00 28.31 ? 374  ASN A O   1 
ATOM   2467 C  CB  . ASN A 1 310 ? -15.374 14.008  14.738  1.00 30.44 ? 374  ASN A CB  1 
ATOM   2468 C  CG  . ASN A 1 310 ? -15.270 13.029  15.900  1.00 31.90 ? 374  ASN A CG  1 
ATOM   2469 O  OD1 . ASN A 1 310 ? -15.181 11.818  15.697  1.00 33.81 ? 374  ASN A OD1 1 
ATOM   2470 N  ND2 . ASN A 1 310 ? -15.273 13.549  17.119  1.00 33.92 ? 374  ASN A ND2 1 
ATOM   2471 N  N   . PRO A 1 311 ? -15.417 16.399  17.323  1.00 27.72 ? 375  PRO A N   1 
ATOM   2472 C  CA  . PRO A 1 311 ? -14.566 17.101  18.292  1.00 25.65 ? 375  PRO A CA  1 
ATOM   2473 C  C   . PRO A 1 311 ? -13.231 16.395  18.517  1.00 25.13 ? 375  PRO A C   1 
ATOM   2474 O  O   . PRO A 1 311 ? -12.222 17.028  18.826  1.00 22.91 ? 375  PRO A O   1 
ATOM   2475 C  CB  . PRO A 1 311 ? -15.432 17.135  19.552  1.00 26.55 ? 375  PRO A CB  1 
ATOM   2476 C  CG  . PRO A 1 311 ? -16.825 17.180  18.992  1.00 27.22 ? 375  PRO A CG  1 
ATOM   2477 C  CD  . PRO A 1 311 ? -16.754 16.146  17.892  1.00 27.06 ? 375  PRO A CD  1 
ATOM   2478 N  N   . LEU A 1 312 ? -13.236 15.077  18.365  1.00 23.24 ? 376  LEU A N   1 
ATOM   2479 C  CA  . LEU A 1 312 ? -12.024 14.293  18.540  1.00 23.00 ? 376  LEU A CA  1 
ATOM   2480 C  C   . LEU A 1 312 ? -10.988 14.638  17.465  1.00 22.08 ? 376  LEU A C   1 
ATOM   2481 O  O   . LEU A 1 312 ? -9.785  14.604  17.715  1.00 20.68 ? 376  LEU A O   1 
ATOM   2482 C  CB  . LEU A 1 312 ? -12.362 12.804  18.488  1.00 25.37 ? 376  LEU A CB  1 
ATOM   2483 C  CG  . LEU A 1 312 ? -11.219 11.860  18.854  1.00 28.63 ? 376  LEU A CG  1 
ATOM   2484 C  CD1 . LEU A 1 312 ? -10.646 12.260  20.210  1.00 28.77 ? 376  LEU A CD1 1 
ATOM   2485 C  CD2 . LEU A 1 312 ? -11.735 10.422  18.887  1.00 30.28 ? 376  LEU A CD2 1 
ATOM   2486 N  N   . PHE A 1 313 ? -11.452 14.980  16.269  1.00 21.77 ? 377  PHE A N   1 
ATOM   2487 C  CA  . PHE A 1 313 ? -10.532 15.332  15.192  1.00 22.31 ? 377  PHE A CA  1 
ATOM   2488 C  C   . PHE A 1 313 ? -9.822  16.661  15.474  1.00 22.76 ? 377  PHE A C   1 
ATOM   2489 O  O   . PHE A 1 313 ? -8.612  16.791  15.249  1.00 20.59 ? 377  PHE A O   1 
ATOM   2490 C  CB  . PHE A 1 313 ? -11.274 15.413  13.857  1.00 22.57 ? 377  PHE A CB  1 
ATOM   2491 C  CG  . PHE A 1 313 ? -10.381 15.727  12.701  1.00 22.96 ? 377  PHE A CG  1 
ATOM   2492 C  CD1 . PHE A 1 313 ? -10.517 16.920  12.006  1.00 23.33 ? 377  PHE A CD1 1 
ATOM   2493 C  CD2 . PHE A 1 313 ? -9.381  14.836  12.320  1.00 22.39 ? 377  PHE A CD2 1 
ATOM   2494 C  CE1 . PHE A 1 313 ? -9.667  17.226  10.944  1.00 23.21 ? 377  PHE A CE1 1 
ATOM   2495 C  CE2 . PHE A 1 313 ? -8.526  15.132  11.262  1.00 22.48 ? 377  PHE A CE2 1 
ATOM   2496 C  CZ  . PHE A 1 313 ? -8.670  16.329  10.574  1.00 22.10 ? 377  PHE A CZ  1 
ATOM   2497 N  N   . SER A 1 314 ? -10.575 17.650  15.948  1.00 21.96 ? 378  SER A N   1 
ATOM   2498 C  CA  . SER A 1 314 ? -9.988  18.944  16.283  1.00 24.39 ? 378  SER A CA  1 
ATOM   2499 C  C   . SER A 1 314 ? -8.941  18.699  17.358  1.00 21.82 ? 378  SER A C   1 
ATOM   2500 O  O   . SER A 1 314 ? -7.883  19.325  17.362  1.00 20.77 ? 378  SER A O   1 
ATOM   2501 C  CB  . SER A 1 314 ? -11.054 19.910  16.806  1.00 26.01 ? 378  SER A CB  1 
ATOM   2502 O  OG  . SER A 1 314 ? -11.905 20.330  15.759  1.00 31.48 ? 378  SER A OG  1 
ATOM   2503 N  N   . LYS A 1 315 ? -9.244  17.777  18.266  1.00 21.49 ? 379  LYS A N   1 
ATOM   2504 C  CA  . LYS A 1 315 ? -8.308  17.429  19.326  1.00 21.96 ? 379  LYS A CA  1 
ATOM   2505 C  C   . LYS A 1 315 ? -7.059  16.813  18.700  1.00 22.35 ? 379  LYS A C   1 
ATOM   2506 O  O   . LYS A 1 315 ? -5.939  17.069  19.147  1.00 23.73 ? 379  LYS A O   1 
ATOM   2507 C  CB  . LYS A 1 315 ? -8.935  16.434  20.306  1.00 23.16 ? 379  LYS A CB  1 
ATOM   2508 C  CG  . LYS A 1 315 ? -7.977  15.998  21.414  1.00 26.10 ? 379  LYS A CG  1 
ATOM   2509 C  CD  . LYS A 1 315 ? -8.632  15.055  22.406  1.00 28.78 ? 379  LYS A CD  1 
ATOM   2510 C  CE  . LYS A 1 315 ? -7.668  14.707  23.533  1.00 31.68 ? 379  LYS A CE  1 
ATOM   2511 N  NZ  . LYS A 1 315 ? -8.321  13.897  24.600  1.00 33.16 ? 379  LYS A NZ  1 
ATOM   2512 N  N   . ALA A 1 316 ? -7.251  16.003  17.661  1.00 20.97 ? 380  ALA A N   1 
ATOM   2513 C  CA  . ALA A 1 316 ? -6.124  15.374  16.989  1.00 19.63 ? 380  ALA A CA  1 
ATOM   2514 C  C   . ALA A 1 316 ? -5.226  16.456  16.396  1.00 18.42 ? 380  ALA A C   1 
ATOM   2515 O  O   . ALA A 1 316 ? -4.008  16.423  16.550  1.00 16.42 ? 380  ALA A O   1 
ATOM   2516 C  CB  . ALA A 1 316 ? -6.620  14.427  15.885  1.00 19.35 ? 380  ALA A CB  1 
ATOM   2517 N  N   . LEU A 1 317 ? -5.836  17.422  15.716  1.00 18.27 ? 381  LEU A N   1 
ATOM   2518 C  CA  . LEU A 1 317 ? -5.081  18.510  15.107  1.00 17.21 ? 381  LEU A CA  1 
ATOM   2519 C  C   . LEU A 1 317 ? -4.276  19.270  16.161  1.00 17.80 ? 381  LEU A C   1 
ATOM   2520 O  O   . LEU A 1 317 ? -3.096  19.570  15.962  1.00 16.87 ? 381  LEU A O   1 
ATOM   2521 C  CB  . LEU A 1 317 ? -6.029  19.479  14.393  1.00 15.52 ? 381  LEU A CB  1 
ATOM   2522 C  CG  . LEU A 1 317 ? -6.787  18.998  13.147  1.00 16.53 ? 381  LEU A CG  1 
ATOM   2523 C  CD1 . LEU A 1 317 ? -7.747  20.092  12.699  1.00 15.83 ? 381  LEU A CD1 1 
ATOM   2524 C  CD2 . LEU A 1 317 ? -5.819  18.661  12.022  1.00 12.59 ? 381  LEU A CD2 1 
ATOM   2525 N  N   . ALA A 1 318 ? -4.922  19.582  17.280  1.00 17.95 ? 382  ALA A N   1 
ATOM   2526 C  CA  . ALA A 1 318 ? -4.267  20.320  18.356  1.00 18.17 ? 382  ALA A CA  1 
ATOM   2527 C  C   . ALA A 1 318 ? -3.109  19.530  18.953  1.00 18.66 ? 382  ALA A C   1 
ATOM   2528 O  O   . ALA A 1 318 ? -2.051  20.083  19.216  1.00 17.35 ? 382  ALA A O   1 
ATOM   2529 C  CB  . ALA A 1 318 ? -5.280  20.674  19.443  1.00 18.77 ? 382  ALA A CB  1 
ATOM   2530 N  N   . ASP A 1 319 ? -3.303  18.233  19.160  1.00 20.41 ? 383  ASP A N   1 
ATOM   2531 C  CA  . ASP A 1 319 ? -2.243  17.408  19.725  1.00 22.00 ? 383  ASP A CA  1 
ATOM   2532 C  C   . ASP A 1 319 ? -1.029  17.371  18.807  1.00 21.30 ? 383  ASP A C   1 
ATOM   2533 O  O   . ASP A 1 319 ? 0.108   17.446  19.271  1.00 20.88 ? 383  ASP A O   1 
ATOM   2534 C  CB  . ASP A 1 319 ? -2.736  15.983  19.967  1.00 24.74 ? 383  ASP A CB  1 
ATOM   2535 C  CG  . ASP A 1 319 ? -1.671  15.105  20.596  1.00 30.38 ? 383  ASP A CG  1 
ATOM   2536 O  OD1 . ASP A 1 319 ? -1.268  15.394  21.749  1.00 33.15 ? 383  ASP A OD1 1 
ATOM   2537 O  OD2 . ASP A 1 319 ? -1.228  14.134  19.940  1.00 32.40 ? 383  ASP A OD2 1 
ATOM   2538 N  N   . LEU A 1 320 ? -1.271  17.250  17.504  1.00 20.74 ? 384  LEU A N   1 
ATOM   2539 C  CA  . LEU A 1 320 ? -0.180  17.212  16.533  1.00 20.49 ? 384  LEU A CA  1 
ATOM   2540 C  C   . LEU A 1 320 ? 0.632   18.501  16.574  1.00 18.84 ? 384  LEU A C   1 
ATOM   2541 O  O   . LEU A 1 320 ? 1.860   18.469  16.636  1.00 18.03 ? 384  LEU A O   1 
ATOM   2542 C  CB  . LEU A 1 320 ? -0.723  16.996  15.115  1.00 18.82 ? 384  LEU A CB  1 
ATOM   2543 C  CG  . LEU A 1 320 ? -0.988  15.548  14.688  1.00 21.99 ? 384  LEU A CG  1 
ATOM   2544 C  CD1 . LEU A 1 320 ? -1.906  15.533  13.487  1.00 19.48 ? 384  LEU A CD1 1 
ATOM   2545 C  CD2 . LEU A 1 320 ? 0.336   14.843  14.371  1.00 22.43 ? 384  LEU A CD2 1 
ATOM   2546 N  N   . VAL A 1 321 ? -0.060  19.637  16.525  1.00 17.89 ? 385  VAL A N   1 
ATOM   2547 C  CA  . VAL A 1 321 ? 0.615   20.926  16.557  1.00 18.15 ? 385  VAL A CA  1 
ATOM   2548 C  C   . VAL A 1 321 ? 1.400   21.065  17.858  1.00 19.96 ? 385  VAL A C   1 
ATOM   2549 O  O   . VAL A 1 321 ? 2.566   21.461  17.852  1.00 19.26 ? 385  VAL A O   1 
ATOM   2550 C  CB  . VAL A 1 321 ? -0.389  22.094  16.462  1.00 19.48 ? 385  VAL A CB  1 
ATOM   2551 C  CG1 . VAL A 1 321 ? 0.351   23.418  16.576  1.00 18.63 ? 385  VAL A CG1 1 
ATOM   2552 C  CG2 . VAL A 1 321 ? -1.162  22.024  15.146  1.00 18.13 ? 385  VAL A CG2 1 
ATOM   2553 N  N   . HIS A 1 322 ? 0.756   20.723  18.969  1.00 19.85 ? 386  HIS A N   1 
ATOM   2554 C  CA  . HIS A 1 322 ? 1.384   20.816  20.279  1.00 22.71 ? 386  HIS A CA  1 
ATOM   2555 C  C   . HIS A 1 322 ? 2.667   19.994  20.352  1.00 23.63 ? 386  HIS A C   1 
ATOM   2556 O  O   . HIS A 1 322 ? 3.707   20.493  20.774  1.00 22.61 ? 386  HIS A O   1 
ATOM   2557 C  CB  . HIS A 1 322 ? 0.420   20.340  21.365  1.00 23.64 ? 386  HIS A CB  1 
ATOM   2558 C  CG  . HIS A 1 322 ? 0.932   20.553  22.755  1.00 27.44 ? 386  HIS A CG  1 
ATOM   2559 N  ND1 . HIS A 1 322 ? 0.752   19.633  23.765  1.00 28.76 ? 386  HIS A ND1 1 
ATOM   2560 C  CD2 . HIS A 1 322 ? 1.605   21.592  23.306  1.00 26.82 ? 386  HIS A CD2 1 
ATOM   2561 C  CE1 . HIS A 1 322 ? 1.293   20.096  24.878  1.00 29.92 ? 386  HIS A CE1 1 
ATOM   2562 N  NE2 . HIS A 1 322 ? 1.817   21.282  24.627  1.00 27.58 ? 386  HIS A NE2 1 
ATOM   2563 N  N   . SER A 1 323 ? 2.583   18.733  19.940  1.00 23.54 ? 387  SER A N   1 
ATOM   2564 C  CA  . SER A 1 323 ? 3.733   17.836  19.957  1.00 24.35 ? 387  SER A CA  1 
ATOM   2565 C  C   . SER A 1 323 ? 4.842   18.336  19.039  1.00 23.21 ? 387  SER A C   1 
ATOM   2566 O  O   . SER A 1 323 ? 6.023   18.180  19.337  1.00 23.08 ? 387  SER A O   1 
ATOM   2567 C  CB  . SER A 1 323 ? 3.309   16.432  19.520  1.00 25.69 ? 387  SER A CB  1 
ATOM   2568 O  OG  . SER A 1 323 ? 2.269   15.945  20.351  1.00 32.59 ? 387  SER A OG  1 
ATOM   2569 N  N   . HIS A 1 324 ? 4.450   18.927  17.917  1.00 21.87 ? 388  HIS A N   1 
ATOM   2570 C  CA  . HIS A 1 324 ? 5.399   19.462  16.944  1.00 20.69 ? 388  HIS A CA  1 
ATOM   2571 C  C   . HIS A 1 324 ? 6.163   20.635  17.564  1.00 22.34 ? 388  HIS A C   1 
ATOM   2572 O  O   . HIS A 1 324 ? 7.384   20.757  17.404  1.00 20.00 ? 388  HIS A O   1 
ATOM   2573 C  CB  . HIS A 1 324 ? 4.629   19.902  15.692  1.00 18.80 ? 388  HIS A CB  1 
ATOM   2574 C  CG  . HIS A 1 324 ? 5.469   20.575  14.651  1.00 19.25 ? 388  HIS A CG  1 
ATOM   2575 N  ND1 . HIS A 1 324 ? 5.572   21.947  14.550  1.00 17.24 ? 388  HIS A ND1 1 
ATOM   2576 C  CD2 . HIS A 1 324 ? 6.220   20.067  13.646  1.00 15.85 ? 388  HIS A CD2 1 
ATOM   2577 C  CE1 . HIS A 1 324 ? 6.346   22.252  13.525  1.00 15.41 ? 388  HIS A CE1 1 
ATOM   2578 N  NE2 . HIS A 1 324 ? 6.754   21.130  12.959  1.00 16.53 ? 388  HIS A NE2 1 
ATOM   2579 N  N   . ILE A 1 325 ? 5.436   21.490  18.281  1.00 23.64 ? 389  ILE A N   1 
ATOM   2580 C  CA  . ILE A 1 325 ? 6.039   22.647  18.934  1.00 26.57 ? 389  ILE A CA  1 
ATOM   2581 C  C   . ILE A 1 325 ? 6.990   22.226  20.059  1.00 28.16 ? 389  ILE A C   1 
ATOM   2582 O  O   . ILE A 1 325 ? 8.096   22.747  20.173  1.00 27.63 ? 389  ILE A O   1 
ATOM   2583 C  CB  . ILE A 1 325 ? 4.950   23.587  19.507  1.00 26.65 ? 389  ILE A CB  1 
ATOM   2584 C  CG1 . ILE A 1 325 ? 4.210   24.274  18.357  1.00 25.20 ? 389  ILE A CG1 1 
ATOM   2585 C  CG2 . ILE A 1 325 ? 5.576   24.621  20.436  1.00 27.74 ? 389  ILE A CG2 1 
ATOM   2586 C  CD1 . ILE A 1 325 ? 2.982   25.053  18.795  1.00 25.80 ? 389  ILE A CD1 1 
ATOM   2587 N  N   . GLN A 1 326 ? 6.566   21.270  20.876  1.00 30.62 ? 390  GLN A N   1 
ATOM   2588 C  CA  . GLN A 1 326 ? 7.392   20.800  21.982  1.00 33.94 ? 390  GLN A CA  1 
ATOM   2589 C  C   . GLN A 1 326 ? 8.639   20.020  21.558  1.00 34.07 ? 390  GLN A C   1 
ATOM   2590 O  O   . GLN A 1 326 ? 9.602   19.922  22.317  1.00 34.37 ? 390  GLN A O   1 
ATOM   2591 C  CB  . GLN A 1 326 ? 6.554   19.939  22.927  1.00 36.29 ? 390  GLN A CB  1 
ATOM   2592 C  CG  . GLN A 1 326 ? 5.530   20.724  23.735  1.00 41.09 ? 390  GLN A CG  1 
ATOM   2593 C  CD  . GLN A 1 326 ? 4.771   19.855  24.731  1.00 44.30 ? 390  GLN A CD  1 
ATOM   2594 O  OE1 . GLN A 1 326 ? 4.085   20.367  25.621  1.00 46.03 ? 390  GLN A OE1 1 
ATOM   2595 N  NE2 . GLN A 1 326 ? 4.886   18.535  24.581  1.00 45.31 ? 390  GLN A NE2 1 
ATOM   2596 N  N   . SER A 1 327 ? 8.626   19.474  20.346  1.00 33.79 ? 391  SER A N   1 
ATOM   2597 C  CA  . SER A 1 327 ? 9.754   18.692  19.854  1.00 33.59 ? 391  SER A CA  1 
ATOM   2598 C  C   . SER A 1 327 ? 10.767  19.516  19.060  1.00 33.67 ? 391  SER A C   1 
ATOM   2599 O  O   . SER A 1 327 ? 11.860  19.041  18.762  1.00 33.85 ? 391  SER A O   1 
ATOM   2600 C  CB  . SER A 1 327 ? 9.247   17.554  18.967  1.00 32.62 ? 391  SER A CB  1 
ATOM   2601 O  OG  . SER A 1 327 ? 8.799   18.054  17.716  1.00 31.05 ? 391  SER A OG  1 
ATOM   2602 N  N   . ASN A 1 328 ? 10.398  20.744  18.718  1.00 34.20 ? 392  ASN A N   1 
ATOM   2603 C  CA  . ASN A 1 328 ? 11.262  21.618  17.928  1.00 35.89 ? 392  ASN A CA  1 
ATOM   2604 C  C   . ASN A 1 328 ? 11.493  21.066  16.523  1.00 35.56 ? 392  ASN A C   1 
ATOM   2605 O  O   . ASN A 1 328 ? 12.450  21.444  15.845  1.00 36.82 ? 392  ASN A O   1 
ATOM   2606 C  CB  . ASN A 1 328 ? 12.613  21.834  18.618  1.00 37.68 ? 392  ASN A CB  1 
ATOM   2607 C  CG  . ASN A 1 328 ? 12.533  22.836  19.749  1.00 38.75 ? 392  ASN A CG  1 
ATOM   2608 O  OD1 . ASN A 1 328 ? 12.059  22.523  20.842  1.00 40.54 ? 392  ASN A OD1 1 
ATOM   2609 N  ND2 . ASN A 1 328 ? 12.982  24.057  19.486  1.00 39.06 ? 392  ASN A ND2 1 
ATOM   2610 N  N   . GLU A 1 329 ? 10.615  20.167  16.096  1.00 33.95 ? 393  GLU A N   1 
ATOM   2611 C  CA  . GLU A 1 329 ? 10.705  19.581  14.764  1.00 33.62 ? 393  GLU A CA  1 
ATOM   2612 C  C   . GLU A 1 329 ? 10.544  20.659  13.693  1.00 29.94 ? 393  GLU A C   1 
ATOM   2613 O  O   . GLU A 1 329 ? 9.701   21.547  13.816  1.00 29.20 ? 393  GLU A O   1 
ATOM   2614 C  CB  . GLU A 1 329 ? 9.600   18.534  14.569  1.00 35.41 ? 393  GLU A CB  1 
ATOM   2615 C  CG  . GLU A 1 329 ? 9.287   18.230  13.102  1.00 40.35 ? 393  GLU A CG  1 
ATOM   2616 C  CD  . GLU A 1 329 ? 7.886   17.655  12.890  1.00 43.16 ? 393  GLU A CD  1 
ATOM   2617 O  OE1 . GLU A 1 329 ? 7.476   17.492  11.715  1.00 42.48 ? 393  GLU A OE1 1 
ATOM   2618 O  OE2 . GLU A 1 329 ? 7.193   17.371  13.894  1.00 44.22 ? 393  GLU A OE2 1 
ATOM   2619 N  N   . LEU A 1 330 ? 11.357  20.581  12.646  1.00 27.15 ? 394  LEU A N   1 
ATOM   2620 C  CA  . LEU A 1 330 ? 11.245  21.528  11.549  1.00 24.75 ? 394  LEU A CA  1 
ATOM   2621 C  C   . LEU A 1 330 ? 10.417  20.851  10.454  1.00 23.49 ? 394  LEU A C   1 
ATOM   2622 O  O   . LEU A 1 330 ? 9.726   21.512  9.682   1.00 22.06 ? 394  LEU A O   1 
ATOM   2623 C  CB  . LEU A 1 330 ? 12.631  21.909  11.031  1.00 25.04 ? 394  LEU A CB  1 
ATOM   2624 C  CG  . LEU A 1 330 ? 13.437  22.794  11.994  1.00 26.80 ? 394  LEU A CG  1 
ATOM   2625 C  CD1 . LEU A 1 330 ? 14.851  22.963  11.476  1.00 25.16 ? 394  LEU A CD1 1 
ATOM   2626 C  CD2 . LEU A 1 330 ? 12.756  24.156  12.143  1.00 24.98 ? 394  LEU A CD2 1 
ATOM   2627 N  N   . CYS A 1 331 ? 10.488  19.523  10.423  1.00 22.41 ? 395  CYS A N   1 
ATOM   2628 C  CA  . CYS A 1 331 ? 9.764   18.689  9.463   1.00 23.18 ? 395  CYS A CA  1 
ATOM   2629 C  C   . CYS A 1 331 ? 10.030  17.229  9.816   1.00 22.33 ? 395  CYS A C   1 
ATOM   2630 O  O   . CYS A 1 331 ? 10.863  16.936  10.676  1.00 22.11 ? 395  CYS A O   1 
ATOM   2631 C  CB  . CYS A 1 331 ? 10.246  18.952  8.036   1.00 22.60 ? 395  CYS A CB  1 
ATOM   2632 S  SG  . CYS A 1 331 ? 11.972  18.482  7.752   1.00 25.23 ? 395  CYS A SG  1 
ATOM   2633 N  N   . SER A 1 332 ? 9.327   16.313  9.157   1.00 21.72 ? 396  SER A N   1 
ATOM   2634 C  CA  . SER A 1 332 ? 9.523   14.895  9.422   1.00 19.94 ? 396  SER A CA  1 
ATOM   2635 C  C   . SER A 1 332 ? 10.837  14.459  8.805   1.00 19.16 ? 396  SER A C   1 
ATOM   2636 O  O   . SER A 1 332 ? 11.361  15.121  7.901   1.00 19.44 ? 396  SER A O   1 
ATOM   2637 C  CB  . SER A 1 332 ? 8.399   14.059  8.806   1.00 19.60 ? 396  SER A CB  1 
ATOM   2638 O  OG  . SER A 1 332 ? 8.505   14.028  7.387   1.00 19.83 ? 396  SER A OG  1 
ATOM   2639 N  N   . LYS A 1 333 ? 11.360  13.341  9.291   1.00 18.00 ? 397  LYS A N   1 
ATOM   2640 C  CA  . LYS A 1 333 ? 12.598  12.796  8.769   1.00 19.05 ? 397  LYS A CA  1 
ATOM   2641 C  C   . LYS A 1 333 ? 12.358  12.439  7.305   1.00 18.41 ? 397  LYS A C   1 
ATOM   2642 O  O   . LYS A 1 333 ? 13.240  12.599  6.463   1.00 17.98 ? 397  LYS A O   1 
ATOM   2643 C  CB  . LYS A 1 333 ? 12.989  11.539  9.555   1.00 18.30 ? 397  LYS A CB  1 
ATOM   2644 C  CG  . LYS A 1 333 ? 14.255  10.857  9.071   1.00 17.55 ? 397  LYS A CG  1 
ATOM   2645 C  CD  . LYS A 1 333 ? 15.479  11.731  9.296   1.00 18.30 ? 397  LYS A CD  1 
ATOM   2646 C  CE  . LYS A 1 333 ? 15.759  11.935  10.790  1.00 19.97 ? 397  LYS A CE  1 
ATOM   2647 N  NZ  . LYS A 1 333 ? 17.046  12.679  10.998  1.00 22.88 ? 397  LYS A NZ  1 
ATOM   2648 N  N   . GLN A 1 334 ? 11.146  11.974  7.014   1.00 16.99 ? 398  GLN A N   1 
ATOM   2649 C  CA  . GLN A 1 334 ? 10.767  11.571  5.666   1.00 17.42 ? 398  GLN A CA  1 
ATOM   2650 C  C   . GLN A 1 334 ? 10.873  12.673  4.633   1.00 17.21 ? 398  GLN A C   1 
ATOM   2651 O  O   . GLN A 1 334 ? 11.160  12.397  3.473   1.00 15.05 ? 398  GLN A O   1 
ATOM   2652 C  CB  . GLN A 1 334 ? 9.340   11.003  5.650   1.00 18.65 ? 398  GLN A CB  1 
ATOM   2653 C  CG  . GLN A 1 334 ? 9.245   9.587   6.196   1.00 16.37 ? 398  GLN A CG  1 
ATOM   2654 C  CD  . GLN A 1 334 ? 10.069  8.622   5.379   1.00 17.59 ? 398  GLN A CD  1 
ATOM   2655 O  OE1 . GLN A 1 334 ? 9.592   8.058   4.394   1.00 19.58 ? 398  GLN A OE1 1 
ATOM   2656 N  NE2 . GLN A 1 334 ? 11.324  8.446   5.765   1.00 17.35 ? 398  GLN A NE2 1 
ATOM   2657 N  N   . LEU A 1 335 ? 10.651  13.919  5.042   1.00 17.19 ? 399  LEU A N   1 
ATOM   2658 C  CA  . LEU A 1 335 ? 10.727  15.019  4.090   1.00 19.51 ? 399  LEU A CA  1 
ATOM   2659 C  C   . LEU A 1 335 ? 12.165  15.279  3.647   1.00 19.46 ? 399  LEU A C   1 
ATOM   2660 O  O   . LEU A 1 335 ? 12.386  15.896  2.602   1.00 22.00 ? 399  LEU A O   1 
ATOM   2661 C  CB  . LEU A 1 335 ? 10.150  16.303  4.690   1.00 20.01 ? 399  LEU A CB  1 
ATOM   2662 C  CG  . LEU A 1 335 ? 9.905   17.437  3.690   1.00 19.42 ? 399  LEU A CG  1 
ATOM   2663 C  CD1 . LEU A 1 335 ? 8.699   17.084  2.822   1.00 18.33 ? 399  LEU A CD1 1 
ATOM   2664 C  CD2 . LEU A 1 335 ? 9.650   18.746  4.428   1.00 18.47 ? 399  LEU A CD2 1 
ATOM   2665 N  N   . THR A 1 336 ? 13.136  14.812  4.434   1.00 18.67 ? 400  THR A N   1 
ATOM   2666 C  CA  . THR A 1 336 ? 14.545  15.025  4.098   1.00 18.70 ? 400  THR A CA  1 
ATOM   2667 C  C   . THR A 1 336 ? 14.997  14.097  2.980   1.00 18.77 ? 400  THR A C   1 
ATOM   2668 O  O   . THR A 1 336 ? 16.133  14.175  2.517   1.00 19.12 ? 400  THR A O   1 
ATOM   2669 C  CB  . THR A 1 336 ? 15.475  14.823  5.325   1.00 17.87 ? 400  THR A CB  1 
ATOM   2670 O  OG1 . THR A 1 336 ? 15.398  13.463  5.775   1.00 17.52 ? 400  THR A OG1 1 
ATOM   2671 C  CG2 . THR A 1 336 ? 15.068  15.759  6.457   1.00 14.67 ? 400  THR A CG2 1 
ATOM   2672 N  N   . LEU A 1 337 ? 14.101  13.216  2.550   1.00 17.78 ? 401  LEU A N   1 
ATOM   2673 C  CA  . LEU A 1 337 ? 14.408  12.295  1.468   1.00 17.52 ? 401  LEU A CA  1 
ATOM   2674 C  C   . LEU A 1 337 ? 13.444  12.490  0.305   1.00 18.81 ? 401  LEU A C   1 
ATOM   2675 O  O   . LEU A 1 337 ? 12.242  12.224  0.418   1.00 18.32 ? 401  LEU A O   1 
ATOM   2676 C  CB  . LEU A 1 337 ? 14.326  10.843  1.944   1.00 18.83 ? 401  LEU A CB  1 
ATOM   2677 C  CG  . LEU A 1 337 ? 14.410  9.811   0.816   1.00 16.04 ? 401  LEU A CG  1 
ATOM   2678 C  CD1 . LEU A 1 337 ? 15.705  10.007  0.035   1.00 16.08 ? 401  LEU A CD1 1 
ATOM   2679 C  CD2 . LEU A 1 337 ? 14.343  8.399   1.398   1.00 17.50 ? 401  LEU A CD2 1 
ATOM   2680 N  N   . SER A 1 338 ? 13.976  12.961  -0.814  1.00 18.84 ? 402  SER A N   1 
ATOM   2681 C  CA  . SER A 1 338 ? 13.164  13.171  -2.000  1.00 19.99 ? 402  SER A CA  1 
ATOM   2682 C  C   . SER A 1 338 ? 12.973  11.842  -2.725  1.00 19.46 ? 402  SER A C   1 
ATOM   2683 O  O   . SER A 1 338 ? 13.744  10.899  -2.526  1.00 18.92 ? 402  SER A O   1 
ATOM   2684 C  CB  . SER A 1 338 ? 13.845  14.179  -2.925  1.00 20.76 ? 402  SER A CB  1 
ATOM   2685 O  OG  . SER A 1 338 ? 13.890  15.456  -2.313  1.00 23.67 ? 402  SER A OG  1 
ATOM   2686 N  N   . CYS A 1 339 ? 11.943  11.759  -3.560  1.00 19.19 ? 403  CYS A N   1 
ATOM   2687 C  CA  . CYS A 1 339 ? 11.703  10.533  -4.305  1.00 20.06 ? 403  CYS A CA  1 
ATOM   2688 C  C   . CYS A 1 339 ? 12.988  10.139  -5.043  1.00 19.85 ? 403  CYS A C   1 
ATOM   2689 O  O   . CYS A 1 339 ? 13.682  10.989  -5.604  1.00 18.81 ? 403  CYS A O   1 
ATOM   2690 C  CB  . CYS A 1 339 ? 10.565  10.734  -5.301  1.00 18.87 ? 403  CYS A CB  1 
ATOM   2691 S  SG  . CYS A 1 339 ? 8.983   11.068  -4.513  1.00 21.07 ? 403  CYS A SG  1 
ATOM   2692 N  N   . PRO A 1 340 ? 13.319  8.842   -5.045  1.00 19.58 ? 404  PRO A N   1 
ATOM   2693 C  CA  . PRO A 1 340 ? 14.529  8.359   -5.717  1.00 18.77 ? 404  PRO A CA  1 
ATOM   2694 C  C   . PRO A 1 340 ? 14.616  8.810   -7.171  1.00 18.73 ? 404  PRO A C   1 
ATOM   2695 O  O   . PRO A 1 340 ? 15.708  9.033   -7.692  1.00 16.43 ? 404  PRO A O   1 
ATOM   2696 C  CB  . PRO A 1 340 ? 14.417  6.843   -5.585  1.00 16.19 ? 404  PRO A CB  1 
ATOM   2697 C  CG  . PRO A 1 340 ? 13.679  6.682   -4.289  1.00 21.46 ? 404  PRO A CG  1 
ATOM   2698 C  CD  . PRO A 1 340 ? 12.593  7.729   -4.410  1.00 19.74 ? 404  PRO A CD  1 
ATOM   2699 N  N   . LEU A 1 341 ? 13.457  8.960   -7.810  1.00 18.26 ? 405  LEU A N   1 
ATOM   2700 C  CA  . LEU A 1 341 ? 13.401  9.372   -9.203  1.00 20.17 ? 405  LEU A CA  1 
ATOM   2701 C  C   . LEU A 1 341 ? 12.742  10.730  -9.417  1.00 20.51 ? 405  LEU A C   1 
ATOM   2702 O  O   . LEU A 1 341 ? 12.168  10.988  -10.482 1.00 20.22 ? 405  LEU A O   1 
ATOM   2703 C  CB  . LEU A 1 341 ? 12.673  8.305   -10.028 1.00 21.93 ? 405  LEU A CB  1 
ATOM   2704 C  CG  . LEU A 1 341 ? 13.431  6.976   -10.127 1.00 25.41 ? 405  LEU A CG  1 
ATOM   2705 C  CD1 . LEU A 1 341 ? 12.575  5.930   -10.811 1.00 26.01 ? 405  LEU A CD1 1 
ATOM   2706 C  CD2 . LEU A 1 341 ? 14.735  7.193   -10.898 1.00 25.41 ? 405  LEU A CD2 1 
ATOM   2707 N  N   . CYS A 1 342 ? 12.814  11.596  -8.410  1.00 21.58 ? 406  CYS A N   1 
ATOM   2708 C  CA  . CYS A 1 342 ? 12.238  12.927  -8.531  1.00 24.09 ? 406  CYS A CA  1 
ATOM   2709 C  C   . CYS A 1 342 ? 12.939  13.670  -9.662  1.00 25.51 ? 406  CYS A C   1 
ATOM   2710 O  O   . CYS A 1 342 ? 14.167  13.609  -9.780  1.00 24.68 ? 406  CYS A O   1 
ATOM   2711 C  CB  . CYS A 1 342 ? 12.424  13.714  -7.233  1.00 25.33 ? 406  CYS A CB  1 
ATOM   2712 S  SG  . CYS A 1 342 ? 12.042  15.488  -7.370  1.00 23.48 ? 406  CYS A SG  1 
ATOM   2713 N  N   . VAL A 1 343 ? 12.159  14.362  -10.491 1.00 27.33 ? 407  VAL A N   1 
ATOM   2714 C  CA  . VAL A 1 343 ? 12.713  15.142  -11.598 1.00 29.77 ? 407  VAL A CA  1 
ATOM   2715 C  C   . VAL A 1 343 ? 12.322  16.613  -11.464 1.00 29.83 ? 407  VAL A C   1 
ATOM   2716 O  O   . VAL A 1 343 ? 12.523  17.407  -12.381 1.00 32.63 ? 407  VAL A O   1 
ATOM   2717 C  CB  . VAL A 1 343 ? 12.214  14.640  -12.965 1.00 30.13 ? 407  VAL A CB  1 
ATOM   2718 C  CG1 . VAL A 1 343 ? 12.764  13.247  -13.243 1.00 30.45 ? 407  VAL A CG1 1 
ATOM   2719 C  CG2 . VAL A 1 343 ? 10.698  14.650  -12.994 1.00 29.47 ? 407  VAL A CG2 1 
ATOM   2720 N  N   . ASN A 1 344 ? 11.759  16.967  -10.316 1.00 29.26 ? 408  ASN A N   1 
ATOM   2721 C  CA  . ASN A 1 344 ? 11.341  18.338  -10.055 1.00 27.53 ? 408  ASN A CA  1 
ATOM   2722 C  C   . ASN A 1 344 ? 12.409  18.993  -9.174  1.00 26.06 ? 408  ASN A C   1 
ATOM   2723 O  O   . ASN A 1 344 ? 12.532  18.666  -7.995  1.00 25.56 ? 408  ASN A O   1 
ATOM   2724 C  CB  . ASN A 1 344 ? 9.996   18.335  -9.328  1.00 26.82 ? 408  ASN A CB  1 
ATOM   2725 C  CG  . ASN A 1 344 ? 9.364   19.708  -9.262  1.00 25.32 ? 408  ASN A CG  1 
ATOM   2726 O  OD1 . ASN A 1 344 ? 10.052  20.727  -9.340  1.00 25.30 ? 408  ASN A OD1 1 
ATOM   2727 N  ND2 . ASN A 1 344 ? 8.048   19.743  -9.102  1.00 24.14 ? 408  ASN A ND2 1 
ATOM   2728 N  N   . PRO A 1 345 ? 13.186  19.932  -9.735  1.00 26.01 ? 409  PRO A N   1 
ATOM   2729 C  CA  . PRO A 1 345 ? 14.245  20.617  -8.980  1.00 25.22 ? 409  PRO A CA  1 
ATOM   2730 C  C   . PRO A 1 345 ? 13.786  21.428  -7.773  1.00 24.52 ? 409  PRO A C   1 
ATOM   2731 O  O   . PRO A 1 345 ? 14.570  21.689  -6.866  1.00 23.50 ? 409  PRO A O   1 
ATOM   2732 C  CB  . PRO A 1 345 ? 14.913  21.495  -10.037 1.00 26.77 ? 409  PRO A CB  1 
ATOM   2733 C  CG  . PRO A 1 345 ? 13.767  21.839  -10.951 1.00 27.43 ? 409  PRO A CG  1 
ATOM   2734 C  CD  . PRO A 1 345 ? 13.060  20.497  -11.093 1.00 25.67 ? 409  PRO A CD  1 
ATOM   2735 N  N   . VAL A 1 346 ? 12.521  21.829  -7.753  1.00 23.52 ? 410  VAL A N   1 
ATOM   2736 C  CA  . VAL A 1 346 ? 12.027  22.618  -6.636  1.00 23.19 ? 410  VAL A CA  1 
ATOM   2737 C  C   . VAL A 1 346 ? 11.886  21.788  -5.354  1.00 22.73 ? 410  VAL A C   1 
ATOM   2738 O  O   . VAL A 1 346 ? 11.952  22.331  -4.250  1.00 22.36 ? 410  VAL A O   1 
ATOM   2739 C  CB  . VAL A 1 346 ? 10.661  23.268  -6.960  1.00 22.60 ? 410  VAL A CB  1 
ATOM   2740 C  CG1 . VAL A 1 346 ? 9.549   22.231  -6.883  1.00 24.14 ? 410  VAL A CG1 1 
ATOM   2741 C  CG2 . VAL A 1 346 ? 10.388  24.397  -5.989  1.00 24.43 ? 410  VAL A CG2 1 
ATOM   2742 N  N   . CYS A 1 347 ? 11.710  20.477  -5.502  1.00 22.65 ? 411  CYS A N   1 
ATOM   2743 C  CA  . CYS A 1 347 ? 11.544  19.597  -4.345  1.00 22.62 ? 411  CYS A CA  1 
ATOM   2744 C  C   . CYS A 1 347 ? 12.710  19.694  -3.366  1.00 21.96 ? 411  CYS A C   1 
ATOM   2745 O  O   . CYS A 1 347 ? 12.505  19.823  -2.159  1.00 20.65 ? 411  CYS A O   1 
ATOM   2746 C  CB  . CYS A 1 347 ? 11.357  18.143  -4.801  1.00 22.80 ? 411  CYS A CB  1 
ATOM   2747 S  SG  . CYS A 1 347 ? 9.810   17.843  -5.715  1.00 26.87 ? 411  CYS A SG  1 
ATOM   2748 N  N   . ARG A 1 348 ? 13.930  19.636  -3.885  1.00 22.73 ? 412  ARG A N   1 
ATOM   2749 C  CA  . ARG A 1 348 ? 15.111  19.731  -3.040  1.00 24.57 ? 412  ARG A CA  1 
ATOM   2750 C  C   . ARG A 1 348 ? 15.187  21.112  -2.397  1.00 24.53 ? 412  ARG A C   1 
ATOM   2751 O  O   . ARG A 1 348 ? 15.583  21.244  -1.244  1.00 24.20 ? 412  ARG A O   1 
ATOM   2752 C  CB  . ARG A 1 348 ? 16.380  19.488  -3.856  1.00 27.38 ? 412  ARG A CB  1 
ATOM   2753 C  CG  . ARG A 1 348 ? 17.647  19.569  -3.022  1.00 31.66 ? 412  ARG A CG  1 
ATOM   2754 C  CD  . ARG A 1 348 ? 18.887  19.500  -3.885  1.00 35.07 ? 412  ARG A CD  1 
ATOM   2755 N  NE  . ARG A 1 348 ? 19.001  20.646  -4.789  1.00 39.46 ? 412  ARG A NE  1 
ATOM   2756 C  CZ  . ARG A 1 348 ? 19.167  21.908  -4.394  1.00 40.60 ? 412  ARG A CZ  1 
ATOM   2757 N  NH1 . ARG A 1 348 ? 19.239  22.205  -3.102  1.00 40.27 ? 412  ARG A NH1 1 
ATOM   2758 N  NH2 . ARG A 1 348 ? 19.272  22.876  -5.297  1.00 42.27 ? 412  ARG A NH2 1 
ATOM   2759 N  N   . GLU A 1 349 ? 14.810  22.139  -3.152  1.00 24.33 ? 413  GLU A N   1 
ATOM   2760 C  CA  . GLU A 1 349 ? 14.833  23.509  -2.641  1.00 25.30 ? 413  GLU A CA  1 
ATOM   2761 C  C   . GLU A 1 349 ? 13.802  23.689  -1.524  1.00 24.11 ? 413  GLU A C   1 
ATOM   2762 O  O   . GLU A 1 349 ? 14.071  24.334  -0.512  1.00 22.88 ? 413  GLU A O   1 
ATOM   2763 C  CB  . GLU A 1 349 ? 14.549  24.494  -3.778  1.00 27.75 ? 413  GLU A CB  1 
ATOM   2764 C  CG  . GLU A 1 349 ? 15.667  24.575  -4.806  1.00 32.26 ? 413  GLU A CG  1 
ATOM   2765 C  CD  . GLU A 1 349 ? 15.234  25.243  -6.102  1.00 37.58 ? 413  GLU A CD  1 
ATOM   2766 O  OE1 . GLU A 1 349 ? 14.684  26.367  -6.050  1.00 39.92 ? 413  GLU A OE1 1 
ATOM   2767 O  OE2 . GLU A 1 349 ? 15.451  24.641  -7.179  1.00 39.87 ? 413  GLU A OE2 1 
ATOM   2768 N  N   . THR A 1 350 ? 12.621  23.107  -1.719  1.00 23.06 ? 414  THR A N   1 
ATOM   2769 C  CA  . THR A 1 350 ? 11.550  23.187  -0.737  1.00 22.88 ? 414  THR A CA  1 
ATOM   2770 C  C   . THR A 1 350 ? 11.967  22.469  0.556   1.00 23.42 ? 414  THR A C   1 
ATOM   2771 O  O   . THR A 1 350 ? 11.739  22.968  1.659   1.00 20.73 ? 414  THR A O   1 
ATOM   2772 C  CB  . THR A 1 350 ? 10.264  22.556  -1.304  1.00 23.34 ? 414  THR A CB  1 
ATOM   2773 O  OG1 . THR A 1 350 ? 9.853   23.293  -2.465  1.00 22.74 ? 414  THR A OG1 1 
ATOM   2774 C  CG2 . THR A 1 350 ? 9.150   22.577  -0.268  1.00 21.79 ? 414  THR A CG2 1 
ATOM   2775 N  N   . LYS A 1 351 ? 12.585  21.301  0.403   1.00 23.46 ? 415  LYS A N   1 
ATOM   2776 C  CA  . LYS A 1 351 ? 13.060  20.524  1.537   1.00 24.53 ? 415  LYS A CA  1 
ATOM   2777 C  C   . LYS A 1 351 ? 14.047  21.366  2.345   1.00 23.49 ? 415  LYS A C   1 
ATOM   2778 O  O   . LYS A 1 351 ? 13.930  21.480  3.565   1.00 23.11 ? 415  LYS A O   1 
ATOM   2779 C  CB  . LYS A 1 351 ? 13.755  19.247  1.044   1.00 27.48 ? 415  LYS A CB  1 
ATOM   2780 C  CG  . LYS A 1 351 ? 14.501  18.482  2.128   1.00 30.13 ? 415  LYS A CG  1 
ATOM   2781 C  CD  . LYS A 1 351 ? 15.189  17.236  1.584   1.00 34.77 ? 415  LYS A CD  1 
ATOM   2782 C  CE  . LYS A 1 351 ? 16.454  17.559  0.798   1.00 34.94 ? 415  LYS A CE  1 
ATOM   2783 N  NZ  . LYS A 1 351 ? 16.186  18.393  -0.405  1.00 37.88 ? 415  LYS A NZ  1 
ATOM   2784 N  N   . SER A 1 352 ? 15.014  21.954  1.649   1.00 21.71 ? 416  SER A N   1 
ATOM   2785 C  CA  . SER A 1 352 ? 16.027  22.787  2.285   1.00 23.14 ? 416  SER A CA  1 
ATOM   2786 C  C   . SER A 1 352 ? 15.397  23.981  2.971   1.00 21.68 ? 416  SER A C   1 
ATOM   2787 O  O   . SER A 1 352 ? 15.848  24.397  4.032   1.00 23.65 ? 416  SER A O   1 
ATOM   2788 C  CB  . SER A 1 352 ? 17.043  23.276  1.253   1.00 22.99 ? 416  SER A CB  1 
ATOM   2789 O  OG  . SER A 1 352 ? 17.650  22.173  0.605   1.00 30.99 ? 416  SER A OG  1 
ATOM   2790 N  N   . PHE A 1 353 ? 14.353  24.533  2.364   1.00 21.04 ? 417  PHE A N   1 
ATOM   2791 C  CA  . PHE A 1 353 ? 13.682  25.677  2.950   1.00 20.21 ? 417  PHE A CA  1 
ATOM   2792 C  C   . PHE A 1 353 ? 13.274  25.365  4.381   1.00 19.65 ? 417  PHE A C   1 
ATOM   2793 O  O   . PHE A 1 353 ? 13.504  26.162  5.288   1.00 19.71 ? 417  PHE A O   1 
ATOM   2794 C  CB  . PHE A 1 353 ? 12.434  26.049  2.145   1.00 22.17 ? 417  PHE A CB  1 
ATOM   2795 C  CG  . PHE A 1 353 ? 11.690  27.232  2.699   1.00 22.05 ? 417  PHE A CG  1 
ATOM   2796 C  CD1 . PHE A 1 353 ? 12.199  28.521  2.553   1.00 22.70 ? 417  PHE A CD1 1 
ATOM   2797 C  CD2 . PHE A 1 353 ? 10.491  27.058  3.384   1.00 21.50 ? 417  PHE A CD2 1 
ATOM   2798 C  CE1 . PHE A 1 353 ? 11.523  29.620  3.084   1.00 21.70 ? 417  PHE A CE1 1 
ATOM   2799 C  CE2 . PHE A 1 353 ? 9.803   28.150  3.921   1.00 19.83 ? 417  PHE A CE2 1 
ATOM   2800 C  CZ  . PHE A 1 353 ? 10.322  29.434  3.770   1.00 20.87 ? 417  PHE A CZ  1 
ATOM   2801 N  N   . PHE A 1 354 ? 12.675  24.198  4.592   1.00 18.31 ? 418  PHE A N   1 
ATOM   2802 C  CA  . PHE A 1 354 ? 12.238  23.849  5.935   1.00 18.58 ? 418  PHE A CA  1 
ATOM   2803 C  C   . PHE A 1 354 ? 13.318  23.285  6.849   1.00 17.99 ? 418  PHE A C   1 
ATOM   2804 O  O   . PHE A 1 354 ? 13.318  23.574  8.040   1.00 19.47 ? 418  PHE A O   1 
ATOM   2805 C  CB  . PHE A 1 354 ? 11.041  22.891  5.879   1.00 18.12 ? 418  PHE A CB  1 
ATOM   2806 C  CG  . PHE A 1 354 ? 9.789   23.528  5.338   1.00 18.19 ? 418  PHE A CG  1 
ATOM   2807 C  CD1 . PHE A 1 354 ? 9.452   23.406  3.995   1.00 16.73 ? 418  PHE A CD1 1 
ATOM   2808 C  CD2 . PHE A 1 354 ? 8.977   24.300  6.165   1.00 18.60 ? 418  PHE A CD2 1 
ATOM   2809 C  CE1 . PHE A 1 354 ? 8.330   24.043  3.483   1.00 19.32 ? 418  PHE A CE1 1 
ATOM   2810 C  CE2 . PHE A 1 354 ? 7.851   24.944  5.662   1.00 19.18 ? 418  PHE A CE2 1 
ATOM   2811 C  CZ  . PHE A 1 354 ? 7.526   24.816  4.321   1.00 18.52 ? 418  PHE A CZ  1 
ATOM   2812 N  N   . THR A 1 355 ? 14.243  22.499  6.308   1.00 17.12 ? 419  THR A N   1 
ATOM   2813 C  CA  . THR A 1 355 ? 15.290  21.924  7.143   1.00 19.82 ? 419  THR A CA  1 
ATOM   2814 C  C   . THR A 1 355 ? 16.321  22.957  7.589   1.00 19.42 ? 419  THR A C   1 
ATOM   2815 O  O   . THR A 1 355 ? 17.031  22.739  8.563   1.00 20.33 ? 419  THR A O   1 
ATOM   2816 C  CB  . THR A 1 355 ? 16.028  20.779  6.417   1.00 19.36 ? 419  THR A CB  1 
ATOM   2817 O  OG1 . THR A 1 355 ? 16.712  21.297  5.270   1.00 19.04 ? 419  THR A OG1 1 
ATOM   2818 C  CG2 . THR A 1 355 ? 15.041  19.710  5.969   1.00 18.83 ? 419  THR A CG2 1 
ATOM   2819 N  N   . SER A 1 356 ? 16.380  24.088  6.893   1.00 20.76 ? 420  SER A N   1 
ATOM   2820 C  CA  . SER A 1 356 ? 17.346  25.140  7.205   1.00 22.43 ? 420  SER A CA  1 
ATOM   2821 C  C   . SER A 1 356 ? 16.818  26.282  8.065   1.00 22.30 ? 420  SER A C   1 
ATOM   2822 O  O   . SER A 1 356 ? 17.581  27.171  8.446   1.00 19.38 ? 420  SER A O   1 
ATOM   2823 C  CB  . SER A 1 356 ? 17.901  25.729  5.911   1.00 22.34 ? 420  SER A CB  1 
ATOM   2824 O  OG  . SER A 1 356 ? 18.483  24.717  5.110   1.00 24.27 ? 420  SER A OG  1 
ATOM   2825 N  N   . GLN A 1 357 ? 15.524  26.262  8.365   1.00 24.09 ? 421  GLN A N   1 
ATOM   2826 C  CA  . GLN A 1 357 ? 14.915  27.317  9.169   1.00 28.08 ? 421  GLN A CA  1 
ATOM   2827 C  C   . GLN A 1 357 ? 15.654  27.623  10.465  1.00 30.54 ? 421  GLN A C   1 
ATOM   2828 O  O   . GLN A 1 357 ? 16.112  26.718  11.171  1.00 29.71 ? 421  GLN A O   1 
ATOM   2829 C  CB  . GLN A 1 357 ? 13.462  26.961  9.487   1.00 28.24 ? 421  GLN A CB  1 
ATOM   2830 C  CG  . GLN A 1 357 ? 12.568  26.984  8.262   1.00 28.86 ? 421  GLN A CG  1 
ATOM   2831 C  CD  . GLN A 1 357 ? 12.404  28.387  7.701   1.00 28.67 ? 421  GLN A CD  1 
ATOM   2832 O  OE1 . GLN A 1 357 ? 12.516  28.604  6.494   1.00 28.48 ? 421  GLN A OE1 1 
ATOM   2833 N  NE2 . GLN A 1 357 ? 12.130  29.346  8.579   1.00 29.21 ? 421  GLN A NE2 1 
ATOM   2834 N  N   . GLN A 1 358 ? 15.772  28.910  10.769  1.00 34.07 ? 422  GLN A N   1 
ATOM   2835 C  CA  . GLN A 1 358 ? 16.438  29.338  11.988  1.00 38.60 ? 422  GLN A CA  1 
ATOM   2836 C  C   . GLN A 1 358 ? 15.601  28.932  13.196  1.00 41.13 ? 422  GLN A C   1 
ATOM   2837 O  O   . GLN A 1 358 ? 14.378  28.795  13.103  1.00 40.09 ? 422  GLN A O   1 
ATOM   2838 C  CB  . GLN A 1 358 ? 16.641  30.856  11.987  1.00 38.88 ? 422  GLN A CB  1 
ATOM   2839 C  CG  . GLN A 1 358 ? 17.310  31.379  13.251  1.00 40.13 ? 422  GLN A CG  1 
ATOM   2840 C  CD  . GLN A 1 358 ? 17.557  32.874  13.209  1.00 41.07 ? 422  GLN A CD  1 
ATOM   2841 O  OE1 . GLN A 1 358 ? 16.625  33.664  13.051  1.00 41.06 ? 422  GLN A OE1 1 
ATOM   2842 N  NE2 . GLN A 1 358 ? 18.818  33.270  13.352  1.00 41.59 ? 422  GLN A NE2 1 
ATOM   2843 N  N   . LEU A 1 359 ? 16.274  28.744  14.326  1.00 44.41 ? 423  LEU A N   1 
ATOM   2844 C  CA  . LEU A 1 359 ? 15.626  28.348  15.572  1.00 47.63 ? 423  LEU A CA  1 
ATOM   2845 C  C   . LEU A 1 359 ? 14.980  26.981  15.382  1.00 48.44 ? 423  LEU A C   1 
ATOM   2846 O  O   . LEU A 1 359 ? 15.551  25.991  15.890  1.00 49.03 ? 423  LEU A O   1 
ATOM   2847 C  CB  . LEU A 1 359 ? 14.564  29.385  15.975  1.00 48.72 ? 423  LEU A CB  1 
ATOM   2848 C  CG  . LEU A 1 359 ? 13.998  29.394  17.405  1.00 50.93 ? 423  LEU A CG  1 
ATOM   2849 C  CD1 . LEU A 1 359 ? 13.244  28.103  17.691  1.00 50.24 ? 423  LEU A CD1 1 
ATOM   2850 C  CD2 . LEU A 1 359 ? 15.137  29.592  18.404  1.00 51.49 ? 423  LEU A CD2 1 
ATOM   2851 O  OXT . LEU A 1 359 ? 13.924  26.916  14.716  1.00 50.21 ? 423  LEU A OXT 1 
ATOM   2852 N  N   . ARG B 1 1   ? 5.328   -39.455 22.877  1.00 43.15 ? 65   ARG B N   1 
ATOM   2853 C  CA  . ARG B 1 1   ? 6.362   -39.632 21.814  1.00 42.86 ? 65   ARG B CA  1 
ATOM   2854 C  C   . ARG B 1 1   ? 5.767   -39.447 20.417  1.00 42.03 ? 65   ARG B C   1 
ATOM   2855 O  O   . ARG B 1 1   ? 6.348   -38.769 19.570  1.00 42.68 ? 65   ARG B O   1 
ATOM   2856 C  CB  . ARG B 1 1   ? 7.005   -41.018 21.932  1.00 42.96 ? 65   ARG B CB  1 
ATOM   2857 N  N   . LYS B 1 2   ? 4.610   -40.052 20.172  1.00 40.79 ? 66   LYS B N   1 
ATOM   2858 C  CA  . LYS B 1 2   ? 3.970   -39.927 18.869  1.00 39.44 ? 66   LYS B CA  1 
ATOM   2859 C  C   . LYS B 1 2   ? 3.534   -38.482 18.644  1.00 37.75 ? 66   LYS B C   1 
ATOM   2860 O  O   . LYS B 1 2   ? 2.913   -37.866 19.513  1.00 37.47 ? 66   LYS B O   1 
ATOM   2861 C  CB  . LYS B 1 2   ? 2.767   -40.861 18.776  1.00 39.65 ? 66   LYS B CB  1 
ATOM   2862 N  N   . PRO B 1 3   ? 3.851   -37.924 17.465  1.00 36.35 ? 67   PRO B N   1 
ATOM   2863 C  CA  . PRO B 1 3   ? 3.481   -36.543 17.145  1.00 35.02 ? 67   PRO B CA  1 
ATOM   2864 C  C   . PRO B 1 3   ? 1.973   -36.309 17.237  1.00 33.73 ? 67   PRO B C   1 
ATOM   2865 O  O   . PRO B 1 3   ? 1.178   -37.083 16.706  1.00 34.89 ? 67   PRO B O   1 
ATOM   2866 C  CB  . PRO B 1 3   ? 4.024   -36.366 15.729  1.00 35.44 ? 67   PRO B CB  1 
ATOM   2867 C  CG  . PRO B 1 3   ? 3.897   -37.748 15.157  1.00 35.38 ? 67   PRO B CG  1 
ATOM   2868 C  CD  . PRO B 1 3   ? 4.415   -38.602 16.285  1.00 35.44 ? 67   PRO B CD  1 
ATOM   2869 N  N   . LYS B 1 4   ? 1.593   -35.235 17.920  1.00 31.43 ? 68   LYS B N   1 
ATOM   2870 C  CA  . LYS B 1 4   ? 0.192   -34.887 18.106  1.00 31.16 ? 68   LYS B CA  1 
ATOM   2871 C  C   . LYS B 1 4   ? -0.225  -33.704 17.226  1.00 29.39 ? 68   LYS B C   1 
ATOM   2872 O  O   . LYS B 1 4   ? -1.245  -33.758 16.535  1.00 26.68 ? 68   LYS B O   1 
ATOM   2873 C  CB  . LYS B 1 4   ? -0.049  -34.548 19.577  1.00 33.06 ? 68   LYS B CB  1 
ATOM   2874 C  CG  . LYS B 1 4   ? -1.499  -34.302 19.947  1.00 35.50 ? 68   LYS B CG  1 
ATOM   2875 C  CD  . LYS B 1 4   ? -1.640  -34.101 21.446  1.00 37.40 ? 68   LYS B CD  1 
ATOM   2876 C  CE  . LYS B 1 4   ? -3.094  -33.905 21.845  1.00 41.16 ? 68   LYS B CE  1 
ATOM   2877 N  NZ  . LYS B 1 4   ? -3.241  -33.747 23.321  1.00 42.12 ? 68   LYS B NZ  1 
ATOM   2878 N  N   . THR B 1 5   ? 0.573   -32.641 17.267  1.00 27.98 ? 69   THR B N   1 
ATOM   2879 C  CA  . THR B 1 5   ? 0.312   -31.433 16.497  1.00 27.77 ? 69   THR B CA  1 
ATOM   2880 C  C   . THR B 1 5   ? 1.391   -31.207 15.439  1.00 26.05 ? 69   THR B C   1 
ATOM   2881 O  O   . THR B 1 5   ? 2.580   -31.141 15.751  1.00 25.95 ? 69   THR B O   1 
ATOM   2882 C  CB  . THR B 1 5   ? 0.262   -30.191 17.413  1.00 28.13 ? 69   THR B CB  1 
ATOM   2883 O  OG1 . THR B 1 5   ? -0.820  -30.324 18.341  1.00 29.73 ? 69   THR B OG1 1 
ATOM   2884 C  CG2 . THR B 1 5   ? 0.062   -28.920 16.593  1.00 29.44 ? 69   THR B CG2 1 
ATOM   2885 N  N   . GLY B 1 6   ? 0.967   -31.097 14.186  1.00 24.65 ? 70   GLY B N   1 
ATOM   2886 C  CA  . GLY B 1 6   ? 1.911   -30.865 13.112  1.00 23.15 ? 70   GLY B CA  1 
ATOM   2887 C  C   . GLY B 1 6   ? 1.832   -29.433 12.611  1.00 22.26 ? 70   GLY B C   1 
ATOM   2888 O  O   . GLY B 1 6   ? 0.743   -28.861 12.502  1.00 22.51 ? 70   GLY B O   1 
ATOM   2889 N  N   . ILE B 1 7   ? 2.988   -28.842 12.328  1.00 19.92 ? 71   ILE B N   1 
ATOM   2890 C  CA  . ILE B 1 7   ? 3.045   -27.482 11.818  1.00 17.81 ? 71   ILE B CA  1 
ATOM   2891 C  C   . ILE B 1 7   ? 3.681   -27.541 10.436  1.00 16.84 ? 71   ILE B C   1 
ATOM   2892 O  O   . ILE B 1 7   ? 4.884   -27.793 10.299  1.00 15.88 ? 71   ILE B O   1 
ATOM   2893 C  CB  . ILE B 1 7   ? 3.886   -26.543 12.722  1.00 19.17 ? 71   ILE B CB  1 
ATOM   2894 C  CG1 . ILE B 1 7   ? 3.286   -26.456 14.128  1.00 20.20 ? 71   ILE B CG1 1 
ATOM   2895 C  CG2 . ILE B 1 7   ? 3.916   -25.149 12.130  1.00 19.03 ? 71   ILE B CG2 1 
ATOM   2896 C  CD1 . ILE B 1 7   ? 3.755   -27.539 15.070  1.00 22.41 ? 71   ILE B CD1 1 
ATOM   2897 N  N   . LEU B 1 8   ? 2.855   -27.337 9.416   1.00 14.74 ? 72   LEU B N   1 
ATOM   2898 C  CA  . LEU B 1 8   ? 3.302   -27.356 8.037   1.00 14.53 ? 72   LEU B CA  1 
ATOM   2899 C  C   . LEU B 1 8   ? 3.825   -25.970 7.667   1.00 14.54 ? 72   LEU B C   1 
ATOM   2900 O  O   . LEU B 1 8   ? 3.051   -25.022 7.537   1.00 13.50 ? 72   LEU B O   1 
ATOM   2901 C  CB  . LEU B 1 8   ? 2.136   -27.739 7.116   1.00 13.59 ? 72   LEU B CB  1 
ATOM   2902 C  CG  . LEU B 1 8   ? 2.461   -27.861 5.628   1.00 14.67 ? 72   LEU B CG  1 
ATOM   2903 C  CD1 . LEU B 1 8   ? 3.589   -28.869 5.447   1.00 13.65 ? 72   LEU B CD1 1 
ATOM   2904 C  CD2 . LEU B 1 8   ? 1.214   -28.282 4.852   1.00 13.98 ? 72   LEU B CD2 1 
ATOM   2905 N  N   . MET B 1 9   ? 5.141   -25.851 7.516   1.00 15.68 ? 73   MET B N   1 
ATOM   2906 C  CA  . MET B 1 9   ? 5.737   -24.569 7.167   1.00 17.52 ? 73   MET B CA  1 
ATOM   2907 C  C   . MET B 1 9   ? 5.724   -24.452 5.653   1.00 17.21 ? 73   MET B C   1 
ATOM   2908 O  O   . MET B 1 9   ? 6.378   -25.227 4.953   1.00 17.63 ? 73   MET B O   1 
ATOM   2909 C  CB  . MET B 1 9   ? 7.156   -24.487 7.720   1.00 17.99 ? 73   MET B CB  1 
ATOM   2910 C  CG  . MET B 1 9   ? 7.210   -24.675 9.227   1.00 22.94 ? 73   MET B CG  1 
ATOM   2911 S  SD  . MET B 1 9   ? 8.893   -24.604 9.857   1.00 26.81 ? 73   MET B SD  1 
ATOM   2912 C  CE  . MET B 1 9   ? 9.150   -22.812 9.871   1.00 22.94 ? 73   MET B CE  1 
ATOM   2913 N  N   . LEU B 1 10  ? 4.953   -23.487 5.160   1.00 16.89 ? 74   LEU B N   1 
ATOM   2914 C  CA  . LEU B 1 10  ? 4.794   -23.267 3.728   1.00 17.29 ? 74   LEU B CA  1 
ATOM   2915 C  C   . LEU B 1 10  ? 5.691   -22.187 3.146   1.00 18.03 ? 74   LEU B C   1 
ATOM   2916 O  O   . LEU B 1 10  ? 5.764   -21.059 3.650   1.00 18.01 ? 74   LEU B O   1 
ATOM   2917 C  CB  . LEU B 1 10  ? 3.336   -22.925 3.427   1.00 15.45 ? 74   LEU B CB  1 
ATOM   2918 C  CG  . LEU B 1 10  ? 2.347   -23.999 3.878   1.00 15.63 ? 74   LEU B CG  1 
ATOM   2919 C  CD1 . LEU B 1 10  ? 0.956   -23.399 3.979   1.00 14.98 ? 74   LEU B CD1 1 
ATOM   2920 C  CD2 . LEU B 1 10  ? 2.388   -25.166 2.900   1.00 13.64 ? 74   LEU B CD2 1 
ATOM   2921 N  N   . ASN B 1 11  ? 6.359   -22.540 2.058   1.00 19.01 ? 75   ASN B N   1 
ATOM   2922 C  CA  . ASN B 1 11  ? 7.245   -21.613 1.391   1.00 20.84 ? 75   ASN B CA  1 
ATOM   2923 C  C   . ASN B 1 11  ? 7.414   -22.051 -0.060  1.00 20.42 ? 75   ASN B C   1 
ATOM   2924 O  O   . ASN B 1 11  ? 7.173   -23.206 -0.401  1.00 18.10 ? 75   ASN B O   1 
ATOM   2925 C  CB  . ASN B 1 11  ? 8.591   -21.582 2.124   1.00 23.56 ? 75   ASN B CB  1 
ATOM   2926 C  CG  . ASN B 1 11  ? 9.487   -20.477 1.638   1.00 27.90 ? 75   ASN B CG  1 
ATOM   2927 O  OD1 . ASN B 1 11  ? 10.163  -20.613 0.614   1.00 32.48 ? 75   ASN B OD1 1 
ATOM   2928 N  ND2 . ASN B 1 11  ? 9.491   -19.361 2.360   1.00 26.70 ? 75   ASN B ND2 1 
ATOM   2929 N  N   . MET B 1 12  ? 7.806   -21.122 -0.916  1.00 21.59 ? 76   MET B N   1 
ATOM   2930 C  CA  . MET B 1 12  ? 7.993   -21.427 -2.327  1.00 23.49 ? 76   MET B CA  1 
ATOM   2931 C  C   . MET B 1 12  ? 9.052   -22.506 -2.476  1.00 22.69 ? 76   MET B C   1 
ATOM   2932 O  O   . MET B 1 12  ? 8.886   -23.454 -3.244  1.00 21.68 ? 76   MET B O   1 
ATOM   2933 C  CB  . MET B 1 12  ? 8.436   -20.173 -3.077  1.00 26.37 ? 76   MET B CB  1 
ATOM   2934 C  CG  . MET B 1 12  ? 8.686   -20.381 -4.551  1.00 34.82 ? 76   MET B CG  1 
ATOM   2935 S  SD  . MET B 1 12  ? 9.350   -18.899 -5.338  1.00 40.63 ? 76   MET B SD  1 
ATOM   2936 C  CE  . MET B 1 12  ? 7.804   -18.025 -5.741  1.00 41.24 ? 76   MET B CE  1 
ATOM   2937 N  N   . GLY B 1 13  ? 10.130  -22.356 -1.715  1.00 20.54 ? 77   GLY B N   1 
ATOM   2938 C  CA  . GLY B 1 13  ? 11.220  -23.301 -1.777  1.00 22.41 ? 77   GLY B CA  1 
ATOM   2939 C  C   . GLY B 1 13  ? 12.225  -22.853 -2.820  1.00 22.35 ? 77   GLY B C   1 
ATOM   2940 O  O   . GLY B 1 13  ? 11.978  -21.912 -3.570  1.00 22.88 ? 77   GLY B O   1 
ATOM   2941 N  N   . GLY B 1 14  ? 13.364  -23.525 -2.870  1.00 23.01 ? 78   GLY B N   1 
ATOM   2942 C  CA  . GLY B 1 14  ? 14.382  -23.168 -3.836  1.00 23.27 ? 78   GLY B CA  1 
ATOM   2943 C  C   . GLY B 1 14  ? 15.229  -24.385 -4.114  1.00 22.90 ? 78   GLY B C   1 
ATOM   2944 O  O   . GLY B 1 14  ? 15.320  -25.266 -3.268  1.00 23.41 ? 78   GLY B O   1 
ATOM   2945 N  N   . PRO B 1 15  ? 15.865  -24.467 -5.290  1.00 23.27 ? 79   PRO B N   1 
ATOM   2946 C  CA  . PRO B 1 15  ? 16.705  -25.619 -5.634  1.00 23.47 ? 79   PRO B CA  1 
ATOM   2947 C  C   . PRO B 1 15  ? 17.919  -25.713 -4.719  1.00 23.56 ? 79   PRO B C   1 
ATOM   2948 O  O   . PRO B 1 15  ? 18.644  -24.737 -4.560  1.00 22.51 ? 79   PRO B O   1 
ATOM   2949 C  CB  . PRO B 1 15  ? 17.086  -25.339 -7.084  1.00 22.24 ? 79   PRO B CB  1 
ATOM   2950 C  CG  . PRO B 1 15  ? 17.151  -23.843 -7.119  1.00 23.09 ? 79   PRO B CG  1 
ATOM   2951 C  CD  . PRO B 1 15  ? 15.932  -23.430 -6.335  1.00 22.57 ? 79   PRO B CD  1 
ATOM   2952 N  N   . GLU B 1 16  ? 18.129  -26.880 -4.113  1.00 24.53 ? 80   GLU B N   1 
ATOM   2953 C  CA  . GLU B 1 16  ? 19.265  -27.084 -3.211  1.00 25.86 ? 80   GLU B CA  1 
ATOM   2954 C  C   . GLU B 1 16  ? 20.599  -27.190 -3.958  1.00 24.41 ? 80   GLU B C   1 
ATOM   2955 O  O   . GLU B 1 16  ? 21.642  -26.812 -3.429  1.00 24.15 ? 80   GLU B O   1 
ATOM   2956 C  CB  . GLU B 1 16  ? 19.049  -28.332 -2.343  1.00 28.91 ? 80   GLU B CB  1 
ATOM   2957 C  CG  . GLU B 1 16  ? 17.830  -28.236 -1.420  1.00 35.39 ? 80   GLU B CG  1 
ATOM   2958 C  CD  . GLU B 1 16  ? 17.794  -29.327 -0.349  1.00 39.21 ? 80   GLU B CD  1 
ATOM   2959 O  OE1 . GLU B 1 16  ? 18.579  -29.237 0.622   1.00 41.24 ? 80   GLU B OE1 1 
ATOM   2960 O  OE2 . GLU B 1 16  ? 16.986  -30.276 -0.479  1.00 40.95 ? 80   GLU B OE2 1 
ATOM   2961 N  N   . THR B 1 17  ? 20.560  -27.717 -5.176  1.00 22.95 ? 81   THR B N   1 
ATOM   2962 C  CA  . THR B 1 17  ? 21.751  -27.845 -6.010  1.00 22.88 ? 81   THR B CA  1 
ATOM   2963 C  C   . THR B 1 17  ? 21.371  -27.350 -7.398  1.00 22.66 ? 81   THR B C   1 
ATOM   2964 O  O   . THR B 1 17  ? 20.186  -27.156 -7.691  1.00 20.93 ? 81   THR B O   1 
ATOM   2965 C  CB  . THR B 1 17  ? 22.235  -29.316 -6.138  1.00 24.62 ? 81   THR B CB  1 
ATOM   2966 O  OG1 . THR B 1 17  ? 21.209  -30.109 -6.754  1.00 25.43 ? 81   THR B OG1 1 
ATOM   2967 C  CG2 . THR B 1 17  ? 22.584  -29.892 -4.775  1.00 25.43 ? 81   THR B CG2 1 
ATOM   2968 N  N   . LEU B 1 18  ? 22.369  -27.150 -8.251  1.00 22.44 ? 82   LEU B N   1 
ATOM   2969 C  CA  . LEU B 1 18  ? 22.126  -26.676 -9.607  1.00 22.98 ? 82   LEU B CA  1 
ATOM   2970 C  C   . LEU B 1 18  ? 21.295  -27.694 -10.384 1.00 23.27 ? 82   LEU B C   1 
ATOM   2971 O  O   . LEU B 1 18  ? 20.550  -27.335 -11.298 1.00 22.57 ? 82   LEU B O   1 
ATOM   2972 C  CB  . LEU B 1 18  ? 23.454  -26.432 -10.333 1.00 23.68 ? 82   LEU B CB  1 
ATOM   2973 C  CG  . LEU B 1 18  ? 24.462  -25.485 -9.673  1.00 25.51 ? 82   LEU B CG  1 
ATOM   2974 C  CD1 . LEU B 1 18  ? 25.620  -25.227 -10.641 1.00 24.92 ? 82   LEU B CD1 1 
ATOM   2975 C  CD2 . LEU B 1 18  ? 23.781  -24.172 -9.301  1.00 24.63 ? 82   LEU B CD2 1 
ATOM   2976 N  N   . GLY B 1 19  ? 21.423  -28.963 -10.007 1.00 23.23 ? 83   GLY B N   1 
ATOM   2977 C  CA  . GLY B 1 19  ? 20.684  -30.014 -10.678 1.00 22.99 ? 83   GLY B CA  1 
ATOM   2978 C  C   . GLY B 1 19  ? 19.189  -29.955 -10.428 1.00 24.35 ? 83   GLY B C   1 
ATOM   2979 O  O   . GLY B 1 19  ? 18.400  -30.472 -11.223 1.00 25.33 ? 83   GLY B O   1 
ATOM   2980 N  N   . ASP B 1 20  ? 18.795  -29.320 -9.328  1.00 23.05 ? 84   ASP B N   1 
ATOM   2981 C  CA  . ASP B 1 20  ? 17.382  -29.201 -8.970  1.00 22.65 ? 84   ASP B CA  1 
ATOM   2982 C  C   . ASP B 1 20  ? 16.679  -28.043 -9.672  1.00 21.90 ? 84   ASP B C   1 
ATOM   2983 O  O   . ASP B 1 20  ? 15.453  -27.942 -9.631  1.00 22.28 ? 84   ASP B O   1 
ATOM   2984 C  CB  . ASP B 1 20  ? 17.234  -29.010 -7.459  1.00 24.25 ? 84   ASP B CB  1 
ATOM   2985 C  CG  . ASP B 1 20  ? 17.715  -30.204 -6.675  1.00 27.29 ? 84   ASP B CG  1 
ATOM   2986 O  OD1 . ASP B 1 20  ? 17.155  -31.302 -6.873  1.00 29.62 ? 84   ASP B OD1 1 
ATOM   2987 O  OD2 . ASP B 1 20  ? 18.654  -30.043 -5.861  1.00 28.67 ? 84   ASP B OD2 1 
ATOM   2988 N  N   . VAL B 1 21  ? 17.454  -27.174 -10.306 1.00 20.02 ? 85   VAL B N   1 
ATOM   2989 C  CA  . VAL B 1 21  ? 16.905  -26.012 -10.992 1.00 21.09 ? 85   VAL B CA  1 
ATOM   2990 C  C   . VAL B 1 21  ? 15.837  -26.322 -12.034 1.00 20.98 ? 85   VAL B C   1 
ATOM   2991 O  O   . VAL B 1 21  ? 14.792  -25.671 -12.070 1.00 21.39 ? 85   VAL B O   1 
ATOM   2992 C  CB  . VAL B 1 21  ? 18.025  -25.191 -11.675 1.00 20.37 ? 85   VAL B CB  1 
ATOM   2993 C  CG1 . VAL B 1 21  ? 17.421  -24.108 -12.549 1.00 19.02 ? 85   VAL B CG1 1 
ATOM   2994 C  CG2 . VAL B 1 21  ? 18.927  -24.564 -10.615 1.00 20.12 ? 85   VAL B CG2 1 
ATOM   2995 N  N   . HIS B 1 22  ? 16.092  -27.310 -12.881 1.00 20.24 ? 86   HIS B N   1 
ATOM   2996 C  CA  . HIS B 1 22  ? 15.138  -27.657 -13.923 1.00 21.73 ? 86   HIS B CA  1 
ATOM   2997 C  C   . HIS B 1 22  ? 13.735  -28.035 -13.434 1.00 21.90 ? 86   HIS B C   1 
ATOM   2998 O  O   . HIS B 1 22  ? 12.738  -27.511 -13.944 1.00 21.66 ? 86   HIS B O   1 
ATOM   2999 C  CB  . HIS B 1 22  ? 15.691  -28.775 -14.805 1.00 22.98 ? 86   HIS B CB  1 
ATOM   3000 C  CG  . HIS B 1 22  ? 14.793  -29.120 -15.949 1.00 26.97 ? 86   HIS B CG  1 
ATOM   3001 N  ND1 . HIS B 1 22  ? 13.639  -29.859 -15.792 1.00 28.36 ? 86   HIS B ND1 1 
ATOM   3002 C  CD2 . HIS B 1 22  ? 14.829  -28.752 -17.251 1.00 27.24 ? 86   HIS B CD2 1 
ATOM   3003 C  CE1 . HIS B 1 22  ? 13.003  -29.928 -16.946 1.00 28.58 ? 86   HIS B CE1 1 
ATOM   3004 N  NE2 . HIS B 1 22  ? 13.703  -29.264 -17.848 1.00 29.31 ? 86   HIS B NE2 1 
ATOM   3005 N  N   . ASP B 1 23  ? 13.641  -28.937 -12.462 1.00 22.64 ? 87   ASP B N   1 
ATOM   3006 C  CA  . ASP B 1 23  ? 12.327  -29.336 -11.961 1.00 24.39 ? 87   ASP B CA  1 
ATOM   3007 C  C   . ASP B 1 23  ? 11.664  -28.208 -11.181 1.00 24.53 ? 87   ASP B C   1 
ATOM   3008 O  O   . ASP B 1 23  ? 10.435  -28.104 -11.129 1.00 23.51 ? 87   ASP B O   1 
ATOM   3009 C  CB  . ASP B 1 23  ? 12.435  -30.591 -11.095 1.00 25.69 ? 87   ASP B CB  1 
ATOM   3010 C  CG  . ASP B 1 23  ? 12.831  -31.810 -11.899 1.00 28.90 ? 87   ASP B CG  1 
ATOM   3011 O  OD1 . ASP B 1 23  ? 12.573  -31.820 -13.124 1.00 30.01 ? 87   ASP B OD1 1 
ATOM   3012 O  OD2 . ASP B 1 23  ? 13.389  -32.762 -11.311 1.00 32.74 ? 87   ASP B OD2 1 
ATOM   3013 N  N   . PHE B 1 24  ? 12.492  -27.367 -10.572 1.00 23.95 ? 88   PHE B N   1 
ATOM   3014 C  CA  . PHE B 1 24  ? 12.013  -26.217 -9.821  1.00 23.85 ? 88   PHE B CA  1 
ATOM   3015 C  C   . PHE B 1 24  ? 11.233  -25.324 -10.790 1.00 23.68 ? 88   PHE B C   1 
ATOM   3016 O  O   . PHE B 1 24  ? 10.068  -24.986 -10.554 1.00 22.28 ? 88   PHE B O   1 
ATOM   3017 C  CB  . PHE B 1 24  ? 13.209  -25.464 -9.238  1.00 24.21 ? 88   PHE B CB  1 
ATOM   3018 C  CG  . PHE B 1 24  ? 12.882  -24.092 -8.725  1.00 25.05 ? 88   PHE B CG  1 
ATOM   3019 C  CD1 . PHE B 1 24  ? 11.958  -23.917 -7.700  1.00 24.76 ? 88   PHE B CD1 1 
ATOM   3020 C  CD2 . PHE B 1 24  ? 13.519  -22.971 -9.258  1.00 26.24 ? 88   PHE B CD2 1 
ATOM   3021 C  CE1 . PHE B 1 24  ? 11.673  -22.644 -7.208  1.00 27.11 ? 88   PHE B CE1 1 
ATOM   3022 C  CE2 . PHE B 1 24  ? 13.244  -21.694 -8.778  1.00 27.70 ? 88   PHE B CE2 1 
ATOM   3023 C  CZ  . PHE B 1 24  ? 12.317  -21.529 -7.748  1.00 27.37 ? 88   PHE B CZ  1 
ATOM   3024 N  N   . LEU B 1 25  ? 11.882  -24.963 -11.892 1.00 23.40 ? 89   LEU B N   1 
ATOM   3025 C  CA  . LEU B 1 25  ? 11.261  -24.111 -12.896 1.00 25.00 ? 89   LEU B CA  1 
ATOM   3026 C  C   . LEU B 1 25  ? 10.037  -24.779 -13.511 1.00 24.06 ? 89   LEU B C   1 
ATOM   3027 O  O   . LEU B 1 25  ? 9.020   -24.130 -13.736 1.00 23.98 ? 89   LEU B O   1 
ATOM   3028 C  CB  . LEU B 1 25  ? 12.270  -23.760 -13.993 1.00 23.67 ? 89   LEU B CB  1 
ATOM   3029 C  CG  . LEU B 1 25  ? 13.459  -22.901 -13.550 1.00 24.08 ? 89   LEU B CG  1 
ATOM   3030 C  CD1 . LEU B 1 25  ? 14.435  -22.729 -14.697 1.00 22.70 ? 89   LEU B CD1 1 
ATOM   3031 C  CD2 . LEU B 1 25  ? 12.957  -21.546 -13.065 1.00 26.13 ? 89   LEU B CD2 1 
ATOM   3032 N  N   . LEU B 1 26  ? 10.144  -26.078 -13.774 1.00 24.62 ? 90   LEU B N   1 
ATOM   3033 C  CA  . LEU B 1 26  ? 9.053   -26.834 -14.362 1.00 24.90 ? 90   LEU B CA  1 
ATOM   3034 C  C   . LEU B 1 26  ? 7.793   -26.786 -13.504 1.00 25.76 ? 90   LEU B C   1 
ATOM   3035 O  O   . LEU B 1 26  ? 6.709   -26.495 -14.008 1.00 25.83 ? 90   LEU B O   1 
ATOM   3036 C  CB  . LEU B 1 26  ? 9.472   -28.289 -14.573 1.00 23.76 ? 90   LEU B CB  1 
ATOM   3037 C  CG  . LEU B 1 26  ? 8.380   -29.224 -15.096 1.00 24.38 ? 90   LEU B CG  1 
ATOM   3038 C  CD1 . LEU B 1 26  ? 7.841   -28.709 -16.429 1.00 24.40 ? 90   LEU B CD1 1 
ATOM   3039 C  CD2 . LEU B 1 26  ? 8.946   -30.623 -15.256 1.00 24.35 ? 90   LEU B CD2 1 
ATOM   3040 N  N   . ARG B 1 27  ? 7.929   -27.082 -12.212 1.00 25.79 ? 91   ARG B N   1 
ATOM   3041 C  CA  . ARG B 1 27  ? 6.776   -27.064 -11.312 1.00 26.30 ? 91   ARG B CA  1 
ATOM   3042 C  C   . ARG B 1 27  ? 6.193   -25.665 -11.196 1.00 26.44 ? 91   ARG B C   1 
ATOM   3043 O  O   . ARG B 1 27  ? 4.985   -25.490 -11.050 1.00 25.48 ? 91   ARG B O   1 
ATOM   3044 C  CB  . ARG B 1 27  ? 7.163   -27.547 -9.914  1.00 26.02 ? 91   ARG B CB  1 
ATOM   3045 C  CG  . ARG B 1 27  ? 7.596   -28.990 -9.841  1.00 26.94 ? 91   ARG B CG  1 
ATOM   3046 C  CD  . ARG B 1 27  ? 7.638   -29.481 -8.406  1.00 26.54 ? 91   ARG B CD  1 
ATOM   3047 N  NE  . ARG B 1 27  ? 8.201   -30.822 -8.334  1.00 28.86 ? 91   ARG B NE  1 
ATOM   3048 C  CZ  . ARG B 1 27  ? 9.505   -31.088 -8.326  1.00 30.14 ? 91   ARG B CZ  1 
ATOM   3049 N  NH1 . ARG B 1 27  ? 10.394  -30.100 -8.373  1.00 29.76 ? 91   ARG B NH1 1 
ATOM   3050 N  NH2 . ARG B 1 27  ? 9.922   -32.348 -8.299  1.00 29.30 ? 91   ARG B NH2 1 
ATOM   3051 N  N   . LEU B 1 28  ? 7.063   -24.667 -11.269 1.00 28.01 ? 92   LEU B N   1 
ATOM   3052 C  CA  . LEU B 1 28  ? 6.647   -23.282 -11.149 1.00 29.86 ? 92   LEU B CA  1 
ATOM   3053 C  C   . LEU B 1 28  ? 5.827   -22.797 -12.349 1.00 29.98 ? 92   LEU B C   1 
ATOM   3054 O  O   . LEU B 1 28  ? 4.858   -22.052 -12.185 1.00 29.22 ? 92   LEU B O   1 
ATOM   3055 C  CB  . LEU B 1 28  ? 7.881   -22.410 -10.940 1.00 32.12 ? 92   LEU B CB  1 
ATOM   3056 C  CG  . LEU B 1 28  ? 7.660   -20.944 -10.599 1.00 34.65 ? 92   LEU B CG  1 
ATOM   3057 C  CD1 . LEU B 1 28  ? 8.780   -20.477 -9.677  1.00 34.31 ? 92   LEU B CD1 1 
ATOM   3058 C  CD2 . LEU B 1 28  ? 7.597   -20.121 -11.885 1.00 35.84 ? 92   LEU B CD2 1 
ATOM   3059 N  N   . PHE B 1 29  ? 6.197   -23.215 -13.554 1.00 28.92 ? 93   PHE B N   1 
ATOM   3060 C  CA  . PHE B 1 29  ? 5.434   -22.790 -14.719 1.00 29.67 ? 93   PHE B CA  1 
ATOM   3061 C  C   . PHE B 1 29  ? 4.180   -23.626 -14.942 1.00 30.09 ? 93   PHE B C   1 
ATOM   3062 O  O   . PHE B 1 29  ? 3.347   -23.290 -15.783 1.00 30.51 ? 93   PHE B O   1 
ATOM   3063 C  CB  . PHE B 1 29  ? 6.311   -22.788 -15.971 1.00 27.98 ? 93   PHE B CB  1 
ATOM   3064 C  CG  . PHE B 1 29  ? 7.274   -21.641 -16.014 1.00 28.61 ? 93   PHE B CG  1 
ATOM   3065 C  CD1 . PHE B 1 29  ? 8.607   -21.817 -15.672 1.00 26.89 ? 93   PHE B CD1 1 
ATOM   3066 C  CD2 . PHE B 1 29  ? 6.831   -20.366 -16.343 1.00 29.28 ? 93   PHE B CD2 1 
ATOM   3067 C  CE1 . PHE B 1 29  ? 9.483   -20.743 -15.653 1.00 28.18 ? 93   PHE B CE1 1 
ATOM   3068 C  CE2 . PHE B 1 29  ? 7.706   -19.281 -16.325 1.00 30.07 ? 93   PHE B CE2 1 
ATOM   3069 C  CZ  . PHE B 1 29  ? 9.033   -19.473 -15.979 1.00 29.99 ? 93   PHE B CZ  1 
ATOM   3070 N  N   . LEU B 1 30  ? 4.042   -24.699 -14.170 1.00 30.14 ? 94   LEU B N   1 
ATOM   3071 C  CA  . LEU B 1 30  ? 2.882   -25.581 -14.258 1.00 30.40 ? 94   LEU B CA  1 
ATOM   3072 C  C   . LEU B 1 30  ? 1.776   -25.181 -13.278 1.00 32.95 ? 94   LEU B C   1 
ATOM   3073 O  O   . LEU B 1 30  ? 0.664   -25.713 -13.340 1.00 34.76 ? 94   LEU B O   1 
ATOM   3074 C  CB  . LEU B 1 30  ? 3.288   -27.027 -13.962 1.00 28.70 ? 94   LEU B CB  1 
ATOM   3075 C  CG  . LEU B 1 30  ? 3.986   -27.831 -15.054 1.00 30.16 ? 94   LEU B CG  1 
ATOM   3076 C  CD1 . LEU B 1 30  ? 4.362   -29.204 -14.510 1.00 28.65 ? 94   LEU B CD1 1 
ATOM   3077 C  CD2 . LEU B 1 30  ? 3.059   -27.964 -16.257 1.00 31.23 ? 94   LEU B CD2 1 
ATOM   3078 N  N   . ASP B 1 31  ? 2.082   -24.255 -12.373 1.00 33.89 ? 95   ASP B N   1 
ATOM   3079 C  CA  . ASP B 1 31  ? 1.114   -23.812 -11.368 1.00 35.54 ? 95   ASP B CA  1 
ATOM   3080 C  C   . ASP B 1 31  ? 0.097   -22.842 -11.957 1.00 36.47 ? 95   ASP B C   1 
ATOM   3081 O  O   . ASP B 1 31  ? 0.447   -21.731 -12.357 1.00 35.95 ? 95   ASP B O   1 
ATOM   3082 C  CB  . ASP B 1 31  ? 1.848   -23.153 -10.191 1.00 35.73 ? 95   ASP B CB  1 
ATOM   3083 C  CG  . ASP B 1 31  ? 0.918   -22.785 -9.039  1.00 36.38 ? 95   ASP B CG  1 
ATOM   3084 O  OD1 . ASP B 1 31  ? 1.424   -22.301 -8.003  1.00 36.93 ? 95   ASP B OD1 1 
ATOM   3085 O  OD2 . ASP B 1 31  ? -0.311  -22.975 -9.162  1.00 36.50 ? 95   ASP B OD2 1 
ATOM   3086 N  N   . ARG B 1 32  ? -1.161  -23.272 -12.005 1.00 38.40 ? 96   ARG B N   1 
ATOM   3087 C  CA  . ARG B 1 32  ? -2.246  -22.450 -12.542 1.00 40.02 ? 96   ARG B CA  1 
ATOM   3088 C  C   . ARG B 1 32  ? -2.518  -21.258 -11.621 1.00 40.13 ? 96   ARG B C   1 
ATOM   3089 O  O   . ARG B 1 32  ? -2.878  -20.175 -12.077 1.00 40.11 ? 96   ARG B O   1 
ATOM   3090 C  CB  . ARG B 1 32  ? -3.523  -23.283 -12.674 1.00 41.82 ? 96   ARG B CB  1 
ATOM   3091 C  CG  . ARG B 1 32  ? -3.327  -24.667 -13.284 1.00 45.37 ? 96   ARG B CG  1 
ATOM   3092 C  CD  . ARG B 1 32  ? -2.797  -24.620 -14.701 1.00 46.51 ? 96   ARG B CD  1 
ATOM   3093 N  NE  . ARG B 1 32  ? -1.699  -25.326 -14.946 1.00 47.81 ? 96   ARG B NE  1 
ATOM   3094 N  N   . ASP B 1 33  ? -2.348  -21.476 -10.320 1.00 40.79 ? 97   ASP B N   1 
ATOM   3095 C  CA  . ASP B 1 33  ? -2.563  -20.435 -9.316  1.00 41.04 ? 97   ASP B CA  1 
ATOM   3096 C  C   . ASP B 1 33  ? -1.566  -19.300 -9.506  1.00 42.22 ? 97   ASP B C   1 
ATOM   3097 O  O   . ASP B 1 33  ? -1.811  -18.171 -9.084  1.00 42.73 ? 97   ASP B O   1 
ATOM   3098 C  CB  . ASP B 1 33  ? -2.377  -21.011 -7.908  1.00 41.83 ? 97   ASP B CB  1 
ATOM   3099 C  CG  . ASP B 1 33  ? -3.399  -22.072 -7.567  1.00 41.76 ? 97   ASP B CG  1 
ATOM   3100 O  OD1 . ASP B 1 33  ? -3.123  -22.891 -6.666  1.00 43.39 ? 97   ASP B OD1 1 
ATOM   3101 O  OD2 . ASP B 1 33  ? -4.481  -22.085 -8.188  1.00 42.93 ? 97   ASP B OD2 1 
ATOM   3102 N  N   . LEU B 1 34  ? -0.441  -19.608 -10.145 1.00 42.05 ? 98   LEU B N   1 
ATOM   3103 C  CA  . LEU B 1 34  ? 0.614   -18.626 -10.368 1.00 41.53 ? 98   LEU B CA  1 
ATOM   3104 C  C   . LEU B 1 34  ? 0.545   -17.942 -11.728 1.00 42.19 ? 98   LEU B C   1 
ATOM   3105 O  O   . LEU B 1 34  ? 0.880   -16.764 -11.850 1.00 42.55 ? 98   LEU B O   1 
ATOM   3106 C  CB  . LEU B 1 34  ? 1.984   -19.293 -10.200 1.00 40.55 ? 98   LEU B CB  1 
ATOM   3107 C  CG  . LEU B 1 34  ? 3.202   -18.371 -10.214 1.00 40.51 ? 98   LEU B CG  1 
ATOM   3108 C  CD1 . LEU B 1 34  ? 3.103   -17.385 -9.052  1.00 39.49 ? 98   LEU B CD1 1 
ATOM   3109 C  CD2 . LEU B 1 34  ? 4.476   -19.195 -10.103 1.00 38.39 ? 98   LEU B CD2 1 
ATOM   3110 N  N   . MET B 1 35  ? 0.119   -18.673 -12.753 1.00 42.71 ? 99   MET B N   1 
ATOM   3111 C  CA  . MET B 1 35  ? 0.029   -18.094 -14.090 1.00 42.99 ? 99   MET B CA  1 
ATOM   3112 C  C   . MET B 1 35  ? -0.654  -19.027 -15.079 1.00 43.44 ? 99   MET B C   1 
ATOM   3113 O  O   . MET B 1 35  ? -0.336  -20.215 -15.147 1.00 43.17 ? 99   MET B O   1 
ATOM   3114 C  CB  . MET B 1 35  ? 1.428   -17.765 -14.621 1.00 43.43 ? 99   MET B CB  1 
ATOM   3115 C  CG  . MET B 1 35  ? 2.265   -19.002 -14.929 1.00 44.30 ? 99   MET B CG  1 
ATOM   3116 S  SD  . MET B 1 35  ? 3.932   -18.645 -15.512 1.00 46.43 ? 99   MET B SD  1 
ATOM   3117 C  CE  . MET B 1 35  ? 4.767   -18.356 -13.964 1.00 44.93 ? 99   MET B CE  1 
ATOM   3118 N  N   . THR B 1 36  ? -1.592  -18.487 -15.849 1.00 43.20 ? 100  THR B N   1 
ATOM   3119 C  CA  . THR B 1 36  ? -2.277  -19.288 -16.853 1.00 43.35 ? 100  THR B CA  1 
ATOM   3120 C  C   . THR B 1 36  ? -1.530  -19.072 -18.163 1.00 42.59 ? 100  THR B C   1 
ATOM   3121 O  O   . THR B 1 36  ? -1.117  -17.955 -18.474 1.00 42.35 ? 100  THR B O   1 
ATOM   3122 C  CB  . THR B 1 36  ? -3.756  -18.867 -17.024 1.00 43.92 ? 100  THR B CB  1 
ATOM   3123 O  OG1 . THR B 1 36  ? -3.826  -17.482 -17.387 1.00 45.46 ? 100  THR B OG1 1 
ATOM   3124 C  CG2 . THR B 1 36  ? -4.528  -19.096 -15.731 1.00 42.49 ? 100  THR B CG2 1 
ATOM   3125 N  N   . LEU B 1 37  ? -1.342  -20.148 -18.916 1.00 42.18 ? 101  LEU B N   1 
ATOM   3126 C  CA  . LEU B 1 37  ? -0.631  -20.076 -20.184 1.00 41.66 ? 101  LEU B CA  1 
ATOM   3127 C  C   . LEU B 1 37  ? -1.262  -21.003 -21.208 1.00 42.53 ? 101  LEU B C   1 
ATOM   3128 O  O   . LEU B 1 37  ? -1.793  -22.058 -20.857 1.00 42.75 ? 101  LEU B O   1 
ATOM   3129 C  CB  . LEU B 1 37  ? 0.828   -20.488 -19.993 1.00 40.34 ? 101  LEU B CB  1 
ATOM   3130 C  CG  . LEU B 1 37  ? 1.667   -19.700 -18.989 1.00 39.39 ? 101  LEU B CG  1 
ATOM   3131 C  CD1 . LEU B 1 37  ? 3.015   -20.379 -18.812 1.00 36.94 ? 101  LEU B CD1 1 
ATOM   3132 C  CD2 . LEU B 1 37  ? 1.840   -18.270 -19.474 1.00 38.37 ? 101  LEU B CD2 1 
ATOM   3133 N  N   . PRO B 1 38  ? -1.225  -20.615 -22.492 1.00 43.09 ? 102  PRO B N   1 
ATOM   3134 C  CA  . PRO B 1 38  ? -1.801  -21.456 -23.544 1.00 43.11 ? 102  PRO B CA  1 
ATOM   3135 C  C   . PRO B 1 38  ? -1.038  -22.777 -23.542 1.00 43.10 ? 102  PRO B C   1 
ATOM   3136 O  O   . PRO B 1 38  ? 0.178   -22.782 -23.334 1.00 43.73 ? 102  PRO B O   1 
ATOM   3137 C  CB  . PRO B 1 38  ? -1.545  -20.643 -24.808 1.00 43.72 ? 102  PRO B CB  1 
ATOM   3138 C  CG  . PRO B 1 38  ? -1.625  -19.224 -24.307 1.00 43.69 ? 102  PRO B CG  1 
ATOM   3139 C  CD  . PRO B 1 38  ? -0.830  -19.299 -23.025 1.00 43.75 ? 102  PRO B CD  1 
ATOM   3140 N  N   . ILE B 1 39  ? -1.741  -23.885 -23.768 1.00 42.56 ? 103  ILE B N   1 
ATOM   3141 C  CA  . ILE B 1 39  ? -1.115  -25.209 -23.765 1.00 41.23 ? 103  ILE B CA  1 
ATOM   3142 C  C   . ILE B 1 39  ? 0.019   -25.231 -22.740 1.00 40.04 ? 103  ILE B C   1 
ATOM   3143 O  O   . ILE B 1 39  ? 1.164   -25.563 -23.057 1.00 38.49 ? 103  ILE B O   1 
ATOM   3144 C  CB  . ILE B 1 39  ? -0.565  -25.576 -25.167 1.00 41.92 ? 103  ILE B CB  1 
ATOM   3145 C  CG1 . ILE B 1 39  ? 0.393   -24.491 -25.665 1.00 41.75 ? 103  ILE B CG1 1 
ATOM   3146 C  CG2 . ILE B 1 39  ? -1.721  -25.745 -26.142 1.00 42.27 ? 103  ILE B CG2 1 
ATOM   3147 C  CD1 . ILE B 1 39  ? 1.081   -24.827 -26.967 1.00 42.89 ? 103  ILE B CD1 1 
ATOM   3148 N  N   . GLN B 1 40  ? -0.325  -24.866 -21.508 1.00 38.95 ? 104  GLN B N   1 
ATOM   3149 C  CA  . GLN B 1 40  ? 0.628   -24.794 -20.408 1.00 38.87 ? 104  GLN B CA  1 
ATOM   3150 C  C   . GLN B 1 40  ? 1.434   -26.071 -20.183 1.00 38.48 ? 104  GLN B C   1 
ATOM   3151 O  O   . GLN B 1 40  ? 2.655   -26.013 -20.045 1.00 36.96 ? 104  GLN B O   1 
ATOM   3152 C  CB  . GLN B 1 40  ? -0.100  -24.410 -19.115 1.00 39.32 ? 104  GLN B CB  1 
ATOM   3153 C  CG  . GLN B 1 40  ? 0.698   -23.474 -18.210 1.00 39.34 ? 104  GLN B CG  1 
ATOM   3154 C  CD  . GLN B 1 40  ? -0.093  -23.008 -17.002 1.00 39.01 ? 104  GLN B CD  1 
ATOM   3155 O  OE1 . GLN B 1 40  ? -1.269  -22.656 -17.114 1.00 38.39 ? 104  GLN B OE1 1 
ATOM   3156 N  NE2 . GLN B 1 40  ? 0.554   -22.987 -15.842 1.00 37.26 ? 104  GLN B NE2 1 
ATOM   3157 N  N   . ASN B 1 41  ? 0.761   -27.217 -20.152 1.00 38.67 ? 105  ASN B N   1 
ATOM   3158 C  CA  . ASN B 1 41  ? 1.445   -28.490 -19.926 1.00 39.44 ? 105  ASN B CA  1 
ATOM   3159 C  C   . ASN B 1 41  ? 2.549   -28.759 -20.941 1.00 40.17 ? 105  ASN B C   1 
ATOM   3160 O  O   . ASN B 1 41  ? 3.469   -29.541 -20.684 1.00 39.30 ? 105  ASN B O   1 
ATOM   3161 C  CB  . ASN B 1 41  ? 0.446   -29.650 -19.952 1.00 40.11 ? 105  ASN B CB  1 
ATOM   3162 C  CG  . ASN B 1 41  ? -0.550  -29.586 -18.810 1.00 40.96 ? 105  ASN B CG  1 
ATOM   3163 O  OD1 . ASN B 1 41  ? -0.168  -29.498 -17.641 1.00 41.10 ? 105  ASN B OD1 1 
ATOM   3164 N  ND2 . ASN B 1 41  ? -1.838  -29.640 -19.142 1.00 41.46 ? 105  ASN B ND2 1 
ATOM   3165 N  N   . LYS B 1 42  ? 2.455   -28.107 -22.095 1.00 40.50 ? 106  LYS B N   1 
ATOM   3166 C  CA  . LYS B 1 42  ? 3.443   -28.281 -23.148 1.00 41.18 ? 106  LYS B CA  1 
ATOM   3167 C  C   . LYS B 1 42  ? 4.484   -27.169 -23.140 1.00 40.37 ? 106  LYS B C   1 
ATOM   3168 O  O   . LYS B 1 42  ? 5.665   -27.419 -23.372 1.00 40.92 ? 106  LYS B O   1 
ATOM   3169 C  CB  . LYS B 1 42  ? 2.745   -28.330 -24.506 1.00 43.24 ? 106  LYS B CB  1 
ATOM   3170 C  CG  . LYS B 1 42  ? 1.738   -29.458 -24.624 1.00 45.67 ? 106  LYS B CG  1 
ATOM   3171 C  CD  . LYS B 1 42  ? 1.016   -29.419 -25.957 1.00 47.44 ? 106  LYS B CD  1 
ATOM   3172 C  CE  . LYS B 1 42  ? 0.023   -30.563 -26.061 1.00 48.91 ? 106  LYS B CE  1 
ATOM   3173 N  NZ  . LYS B 1 42  ? -0.946  -30.544 -24.928 1.00 49.61 ? 106  LYS B NZ  1 
ATOM   3174 N  N   . LEU B 1 43  ? 4.051   -25.942 -22.870 1.00 40.53 ? 107  LEU B N   1 
ATOM   3175 C  CA  . LEU B 1 43  ? 4.980   -24.820 -22.842 1.00 39.50 ? 107  LEU B CA  1 
ATOM   3176 C  C   . LEU B 1 43  ? 5.850   -24.825 -21.589 1.00 38.43 ? 107  LEU B C   1 
ATOM   3177 O  O   . LEU B 1 43  ? 7.041   -24.523 -21.655 1.00 39.14 ? 107  LEU B O   1 
ATOM   3178 C  CB  . LEU B 1 43  ? 4.225   -23.492 -22.935 1.00 40.33 ? 107  LEU B CB  1 
ATOM   3179 C  CG  . LEU B 1 43  ? 3.451   -23.218 -24.229 1.00 40.79 ? 107  LEU B CG  1 
ATOM   3180 C  CD1 . LEU B 1 43  ? 2.900   -21.795 -24.201 1.00 40.95 ? 107  LEU B CD1 1 
ATOM   3181 C  CD2 . LEU B 1 43  ? 4.364   -23.401 -25.431 1.00 42.54 ? 107  LEU B CD2 1 
ATOM   3182 N  N   . ALA B 1 44  ? 5.255   -25.179 -20.453 1.00 36.86 ? 108  ALA B N   1 
ATOM   3183 C  CA  . ALA B 1 44  ? 5.979   -25.206 -19.185 1.00 35.25 ? 108  ALA B CA  1 
ATOM   3184 C  C   . ALA B 1 44  ? 7.328   -25.930 -19.262 1.00 34.86 ? 108  ALA B C   1 
ATOM   3185 O  O   . ALA B 1 44  ? 8.366   -25.346 -18.952 1.00 33.98 ? 108  ALA B O   1 
ATOM   3186 C  CB  . ALA B 1 44  ? 5.105   -25.826 -18.093 1.00 34.39 ? 108  ALA B CB  1 
ATOM   3187 N  N   . PRO B 1 45  ? 7.337   -27.207 -19.678 1.00 34.03 ? 109  PRO B N   1 
ATOM   3188 C  CA  . PRO B 1 45  ? 8.626   -27.903 -19.752 1.00 33.99 ? 109  PRO B CA  1 
ATOM   3189 C  C   . PRO B 1 45  ? 9.624   -27.222 -20.681 1.00 33.39 ? 109  PRO B C   1 
ATOM   3190 O  O   . PRO B 1 45  ? 10.828  -27.196 -20.413 1.00 32.50 ? 109  PRO B O   1 
ATOM   3191 C  CB  . PRO B 1 45  ? 8.239   -29.309 -20.218 1.00 34.83 ? 109  PRO B CB  1 
ATOM   3192 C  CG  . PRO B 1 45  ? 6.957   -29.095 -20.965 1.00 34.96 ? 109  PRO B CG  1 
ATOM   3193 C  CD  . PRO B 1 45  ? 6.236   -28.082 -20.116 1.00 34.19 ? 109  PRO B CD  1 
ATOM   3194 N  N   . PHE B 1 46  ? 9.122   -26.660 -21.772 1.00 33.98 ? 110  PHE B N   1 
ATOM   3195 C  CA  . PHE B 1 46  ? 9.989   -25.976 -22.715 1.00 34.34 ? 110  PHE B CA  1 
ATOM   3196 C  C   . PHE B 1 46  ? 10.616  -24.736 -22.086 1.00 34.56 ? 110  PHE B C   1 
ATOM   3197 O  O   . PHE B 1 46  ? 11.826  -24.525 -22.179 1.00 34.49 ? 110  PHE B O   1 
ATOM   3198 C  CB  . PHE B 1 46  ? 9.209   -25.561 -23.957 1.00 35.55 ? 110  PHE B CB  1 
ATOM   3199 C  CG  . PHE B 1 46  ? 9.969   -24.641 -24.850 1.00 35.38 ? 110  PHE B CG  1 
ATOM   3200 C  CD1 . PHE B 1 46  ? 11.080  -25.097 -25.549 1.00 36.34 ? 110  PHE B CD1 1 
ATOM   3201 C  CD2 . PHE B 1 46  ? 9.625   -23.300 -24.935 1.00 36.88 ? 110  PHE B CD2 1 
ATOM   3202 C  CE1 . PHE B 1 46  ? 11.842  -24.228 -26.319 1.00 37.43 ? 110  PHE B CE1 1 
ATOM   3203 C  CE2 . PHE B 1 46  ? 10.379  -22.423 -25.700 1.00 38.26 ? 110  PHE B CE2 1 
ATOM   3204 C  CZ  . PHE B 1 46  ? 11.493  -22.888 -26.393 1.00 38.11 ? 110  PHE B CZ  1 
ATOM   3205 N  N   . ILE B 1 47  ? 9.784   -23.912 -21.456 1.00 34.16 ? 111  ILE B N   1 
ATOM   3206 C  CA  . ILE B 1 47  ? 10.258  -22.690 -20.819 1.00 33.86 ? 111  ILE B CA  1 
ATOM   3207 C  C   . ILE B 1 47  ? 11.279  -23.002 -19.726 1.00 32.86 ? 111  ILE B C   1 
ATOM   3208 O  O   . ILE B 1 47  ? 12.267  -22.290 -19.563 1.00 31.67 ? 111  ILE B O   1 
ATOM   3209 C  CB  . ILE B 1 47  ? 9.089   -21.893 -20.204 1.00 33.44 ? 111  ILE B CB  1 
ATOM   3210 C  CG1 . ILE B 1 47  ? 8.067   -21.545 -21.295 1.00 34.00 ? 111  ILE B CG1 1 
ATOM   3211 C  CG2 . ILE B 1 47  ? 9.615   -20.628 -19.547 1.00 33.66 ? 111  ILE B CG2 1 
ATOM   3212 C  CD1 . ILE B 1 47  ? 6.892   -20.714 -20.812 1.00 33.23 ? 111  ILE B CD1 1 
ATOM   3213 N  N   . ALA B 1 48  ? 11.035  -24.074 -18.984 1.00 32.10 ? 112  ALA B N   1 
ATOM   3214 C  CA  . ALA B 1 48  ? 11.937  -24.479 -17.917 1.00 31.77 ? 112  ALA B CA  1 
ATOM   3215 C  C   . ALA B 1 48  ? 13.312  -24.835 -18.478 1.00 32.43 ? 112  ALA B C   1 
ATOM   3216 O  O   . ALA B 1 48  ? 14.338  -24.478 -17.899 1.00 31.09 ? 112  ALA B O   1 
ATOM   3217 C  CB  . ALA B 1 48  ? 11.354  -25.672 -17.168 1.00 30.10 ? 112  ALA B CB  1 
ATOM   3218 N  N   . LYS B 1 49  ? 13.324  -25.532 -19.612 1.00 32.25 ? 113  LYS B N   1 
ATOM   3219 C  CA  . LYS B 1 49  ? 14.574  -25.950 -20.236 1.00 32.60 ? 113  LYS B CA  1 
ATOM   3220 C  C   . LYS B 1 49  ? 15.434  -24.784 -20.700 1.00 32.29 ? 113  LYS B C   1 
ATOM   3221 O  O   . LYS B 1 49  ? 16.653  -24.819 -20.553 1.00 32.64 ? 113  LYS B O   1 
ATOM   3222 C  CB  . LYS B 1 49  ? 14.294  -26.889 -21.410 1.00 32.76 ? 113  LYS B CB  1 
ATOM   3223 N  N   . ARG B 1 50  ? 14.817  -23.747 -21.255 1.00 32.08 ? 114  ARG B N   1 
ATOM   3224 C  CA  . ARG B 1 50  ? 15.602  -22.621 -21.732 1.00 33.48 ? 114  ARG B CA  1 
ATOM   3225 C  C   . ARG B 1 50  ? 16.065  -21.681 -20.633 1.00 32.37 ? 114  ARG B C   1 
ATOM   3226 O  O   . ARG B 1 50  ? 17.085  -21.008 -20.784 1.00 32.07 ? 114  ARG B O   1 
ATOM   3227 C  CB  . ARG B 1 50  ? 14.846  -21.834 -22.807 1.00 37.36 ? 114  ARG B CB  1 
ATOM   3228 C  CG  . ARG B 1 50  ? 13.477  -21.332 -22.414 1.00 41.35 ? 114  ARG B CG  1 
ATOM   3229 C  CD  . ARG B 1 50  ? 13.224  -19.978 -23.063 1.00 46.00 ? 114  ARG B CD  1 
ATOM   3230 N  NE  . ARG B 1 50  ? 13.716  -19.930 -24.439 1.00 49.74 ? 114  ARG B NE  1 
ATOM   3231 C  CZ  . ARG B 1 50  ? 13.713  -18.837 -25.196 1.00 51.31 ? 114  ARG B CZ  1 
ATOM   3232 N  NH1 . ARG B 1 50  ? 13.242  -17.695 -24.711 1.00 52.14 ? 114  ARG B NH1 1 
ATOM   3233 N  NH2 . ARG B 1 50  ? 14.183  -18.884 -26.436 1.00 51.27 ? 114  ARG B NH2 1 
ATOM   3234 N  N   . LEU B 1 51  ? 15.328  -21.632 -19.528 1.00 30.53 ? 115  LEU B N   1 
ATOM   3235 C  CA  . LEU B 1 51  ? 15.709  -20.768 -18.420 1.00 29.32 ? 115  LEU B CA  1 
ATOM   3236 C  C   . LEU B 1 51  ? 16.722  -21.436 -17.494 1.00 28.28 ? 115  LEU B C   1 
ATOM   3237 O  O   . LEU B 1 51  ? 17.471  -20.755 -16.801 1.00 28.18 ? 115  LEU B O   1 
ATOM   3238 C  CB  . LEU B 1 51  ? 14.481  -20.365 -17.596 1.00 30.74 ? 115  LEU B CB  1 
ATOM   3239 C  CG  . LEU B 1 51  ? 13.496  -19.354 -18.188 1.00 30.66 ? 115  LEU B CG  1 
ATOM   3240 C  CD1 . LEU B 1 51  ? 12.371  -19.104 -17.187 1.00 31.32 ? 115  LEU B CD1 1 
ATOM   3241 C  CD2 . LEU B 1 51  ? 14.217  -18.055 -18.517 1.00 31.91 ? 115  LEU B CD2 1 
ATOM   3242 N  N   . THR B 1 52  ? 16.751  -22.766 -17.493 1.00 26.01 ? 116  THR B N   1 
ATOM   3243 C  CA  . THR B 1 52  ? 17.650  -23.516 -16.620 1.00 25.81 ? 116  THR B CA  1 
ATOM   3244 C  C   . THR B 1 52  ? 19.103  -23.048 -16.571 1.00 25.56 ? 116  THR B C   1 
ATOM   3245 O  O   . THR B 1 52  ? 19.632  -22.800 -15.489 1.00 25.73 ? 116  THR B O   1 
ATOM   3246 C  CB  . THR B 1 52  ? 17.598  -25.028 -16.946 1.00 25.38 ? 116  THR B CB  1 
ATOM   3247 O  OG1 . THR B 1 52  ? 16.319  -25.541 -16.561 1.00 24.75 ? 116  THR B OG1 1 
ATOM   3248 C  CG2 . THR B 1 52  ? 18.681  -25.798 -16.187 1.00 23.92 ? 116  THR B CG2 1 
ATOM   3249 N  N   . PRO B 1 53  ? 19.769  -22.916 -17.733 1.00 26.43 ? 117  PRO B N   1 
ATOM   3250 C  CA  . PRO B 1 53  ? 21.166  -22.470 -17.728 1.00 26.10 ? 117  PRO B CA  1 
ATOM   3251 C  C   . PRO B 1 53  ? 21.384  -21.124 -17.039 1.00 26.47 ? 117  PRO B C   1 
ATOM   3252 O  O   . PRO B 1 53  ? 22.318  -20.964 -16.253 1.00 25.20 ? 117  PRO B O   1 
ATOM   3253 C  CB  . PRO B 1 53  ? 21.515  -22.418 -19.213 1.00 26.19 ? 117  PRO B CB  1 
ATOM   3254 C  CG  . PRO B 1 53  ? 20.661  -23.511 -19.792 1.00 25.55 ? 117  PRO B CG  1 
ATOM   3255 C  CD  . PRO B 1 53  ? 19.341  -23.262 -19.100 1.00 26.13 ? 117  PRO B CD  1 
ATOM   3256 N  N   . LYS B 1 54  ? 20.520  -20.158 -17.333 1.00 26.13 ? 118  LYS B N   1 
ATOM   3257 C  CA  . LYS B 1 54  ? 20.653  -18.834 -16.742 1.00 26.23 ? 118  LYS B CA  1 
ATOM   3258 C  C   . LYS B 1 54  ? 20.398  -18.848 -15.235 1.00 24.75 ? 118  LYS B C   1 
ATOM   3259 O  O   . LYS B 1 54  ? 21.072  -18.150 -14.481 1.00 25.22 ? 118  LYS B O   1 
ATOM   3260 C  CB  . LYS B 1 54  ? 19.706  -17.847 -17.433 1.00 26.23 ? 118  LYS B CB  1 
ATOM   3261 N  N   . ILE B 1 55  ? 19.428  -19.644 -14.799 1.00 23.62 ? 119  ILE B N   1 
ATOM   3262 C  CA  . ILE B 1 55  ? 19.106  -19.716 -13.380 1.00 22.98 ? 119  ILE B CA  1 
ATOM   3263 C  C   . ILE B 1 55  ? 20.190  -20.482 -12.615 1.00 22.27 ? 119  ILE B C   1 
ATOM   3264 O  O   . ILE B 1 55  ? 20.544  -20.105 -11.499 1.00 21.47 ? 119  ILE B O   1 
ATOM   3265 C  CB  . ILE B 1 55  ? 17.719  -20.370 -13.160 1.00 22.82 ? 119  ILE B CB  1 
ATOM   3266 C  CG1 . ILE B 1 55  ? 16.662  -19.623 -13.983 1.00 23.96 ? 119  ILE B CG1 1 
ATOM   3267 C  CG2 . ILE B 1 55  ? 17.333  -20.323 -11.682 1.00 20.04 ? 119  ILE B CG2 1 
ATOM   3268 C  CD1 . ILE B 1 55  ? 16.541  -18.150 -13.643 1.00 25.83 ? 119  ILE B CD1 1 
ATOM   3269 N  N   . GLN B 1 56  ? 20.720  -21.543 -13.220 1.00 21.95 ? 120  GLN B N   1 
ATOM   3270 C  CA  . GLN B 1 56  ? 21.782  -22.326 -12.588 1.00 22.82 ? 120  GLN B CA  1 
ATOM   3271 C  C   . GLN B 1 56  ? 23.001  -21.440 -12.367 1.00 23.70 ? 120  GLN B C   1 
ATOM   3272 O  O   . GLN B 1 56  ? 23.677  -21.543 -11.342 1.00 22.71 ? 120  GLN B O   1 
ATOM   3273 C  CB  . GLN B 1 56  ? 22.191  -23.513 -13.468 1.00 22.59 ? 120  GLN B CB  1 
ATOM   3274 C  CG  . GLN B 1 56  ? 21.185  -24.650 -13.535 1.00 22.68 ? 120  GLN B CG  1 
ATOM   3275 C  CD  . GLN B 1 56  ? 21.673  -25.785 -14.421 1.00 23.12 ? 120  GLN B CD  1 
ATOM   3276 O  OE1 . GLN B 1 56  ? 22.243  -25.550 -15.483 1.00 23.94 ? 120  GLN B OE1 1 
ATOM   3277 N  NE2 . GLN B 1 56  ? 21.443  -27.017 -13.994 1.00 21.25 ? 120  GLN B NE2 1 
ATOM   3278 N  N   . GLU B 1 57  ? 23.273  -20.576 -13.343 1.00 24.30 ? 121  GLU B N   1 
ATOM   3279 C  CA  . GLU B 1 57  ? 24.401  -19.655 -13.286 1.00 24.70 ? 121  GLU B CA  1 
ATOM   3280 C  C   . GLU B 1 57  ? 24.220  -18.690 -12.125 1.00 24.41 ? 121  GLU B C   1 
ATOM   3281 O  O   . GLU B 1 57  ? 25.187  -18.332 -11.459 1.00 25.33 ? 121  GLU B O   1 
ATOM   3282 C  CB  . GLU B 1 57  ? 24.519  -18.886 -14.610 1.00 25.96 ? 121  GLU B CB  1 
ATOM   3283 C  CG  . GLU B 1 57  ? 25.539  -17.754 -14.636 1.00 27.71 ? 121  GLU B CG  1 
ATOM   3284 C  CD  . GLU B 1 57  ? 26.952  -18.210 -14.329 1.00 30.45 ? 121  GLU B CD  1 
ATOM   3285 O  OE1 . GLU B 1 57  ? 27.281  -19.384 -14.615 1.00 32.23 ? 121  GLU B OE1 1 
ATOM   3286 O  OE2 . GLU B 1 57  ? 27.744  -17.387 -13.817 1.00 33.16 ? 121  GLU B OE2 1 
ATOM   3287 N  N   . GLN B 1 58  ? 22.981  -18.273 -11.885 1.00 23.14 ? 122  GLN B N   1 
ATOM   3288 C  CA  . GLN B 1 58  ? 22.694  -17.368 -10.778 1.00 22.37 ? 122  GLN B CA  1 
ATOM   3289 C  C   . GLN B 1 58  ? 22.978  -18.071 -9.451  1.00 20.41 ? 122  GLN B C   1 
ATOM   3290 O  O   . GLN B 1 58  ? 23.583  -17.495 -8.548  1.00 19.21 ? 122  GLN B O   1 
ATOM   3291 C  CB  . GLN B 1 58  ? 21.232  -16.910 -10.814 1.00 23.68 ? 122  GLN B CB  1 
ATOM   3292 C  CG  . GLN B 1 58  ? 20.968  -15.716 -11.726 1.00 25.23 ? 122  GLN B CG  1 
ATOM   3293 C  CD  . GLN B 1 58  ? 19.499  -15.291 -11.728 1.00 28.13 ? 122  GLN B CD  1 
ATOM   3294 O  OE1 . GLN B 1 58  ? 18.791  -15.449 -10.734 1.00 29.61 ? 122  GLN B OE1 1 
ATOM   3295 N  NE2 . GLN B 1 58  ? 19.048  -14.735 -12.842 1.00 29.28 ? 122  GLN B NE2 1 
ATOM   3296 N  N   . TYR B 1 59  ? 22.542  -19.319 -9.332  1.00 19.21 ? 123  TYR B N   1 
ATOM   3297 C  CA  . TYR B 1 59  ? 22.785  -20.059 -8.107  1.00 18.97 ? 123  TYR B CA  1 
ATOM   3298 C  C   . TYR B 1 59  ? 24.263  -20.384 -7.925  1.00 16.55 ? 123  TYR B C   1 
ATOM   3299 O  O   . TYR B 1 59  ? 24.746  -20.450 -6.803  1.00 16.46 ? 123  TYR B O   1 
ATOM   3300 C  CB  . TYR B 1 59  ? 21.936  -21.333 -8.062  1.00 17.97 ? 123  TYR B CB  1 
ATOM   3301 C  CG  . TYR B 1 59  ? 20.507  -21.050 -7.665  1.00 19.20 ? 123  TYR B CG  1 
ATOM   3302 C  CD1 . TYR B 1 59  ? 19.532  -20.798 -8.625  1.00 19.74 ? 123  TYR B CD1 1 
ATOM   3303 C  CD2 . TYR B 1 59  ? 20.140  -20.984 -6.321  1.00 19.99 ? 123  TYR B CD2 1 
ATOM   3304 C  CE1 . TYR B 1 59  ? 18.220  -20.485 -8.260  1.00 20.40 ? 123  TYR B CE1 1 
ATOM   3305 C  CE2 . TYR B 1 59  ? 18.833  -20.672 -5.944  1.00 20.98 ? 123  TYR B CE2 1 
ATOM   3306 C  CZ  . TYR B 1 59  ? 17.879  -20.423 -6.918  1.00 21.26 ? 123  TYR B CZ  1 
ATOM   3307 O  OH  . TYR B 1 59  ? 16.585  -20.117 -6.557  1.00 21.28 ? 123  TYR B OH  1 
ATOM   3308 N  N   . ARG B 1 60  ? 24.981  -20.578 -9.029  1.00 16.63 ? 124  ARG B N   1 
ATOM   3309 C  CA  . ARG B 1 60  ? 26.409  -20.856 -8.937  1.00 17.27 ? 124  ARG B CA  1 
ATOM   3310 C  C   . ARG B 1 60  ? 27.078  -19.630 -8.332  1.00 17.93 ? 124  ARG B C   1 
ATOM   3311 O  O   . ARG B 1 60  ? 27.975  -19.757 -7.500  1.00 18.87 ? 124  ARG B O   1 
ATOM   3312 C  CB  . ARG B 1 60  ? 27.017  -21.127 -10.321 1.00 18.25 ? 124  ARG B CB  1 
ATOM   3313 C  CG  . ARG B 1 60  ? 28.516  -21.458 -10.287 1.00 18.02 ? 124  ARG B CG  1 
ATOM   3314 C  CD  . ARG B 1 60  ? 29.093  -21.652 -11.691 1.00 17.24 ? 124  ARG B CD  1 
ATOM   3315 N  NE  . ARG B 1 60  ? 29.167  -20.399 -12.439 1.00 17.86 ? 124  ARG B NE  1 
ATOM   3316 C  CZ  . ARG B 1 60  ? 30.064  -19.442 -12.216 1.00 19.14 ? 124  ARG B CZ  1 
ATOM   3317 N  NH1 . ARG B 1 60  ? 30.977  -19.588 -11.262 1.00 17.24 ? 124  ARG B NH1 1 
ATOM   3318 N  NH2 . ARG B 1 60  ? 30.053  -18.336 -12.955 1.00 18.66 ? 124  ARG B NH2 1 
ATOM   3319 N  N   . ARG B 1 61  ? 26.629  -18.442 -8.740  1.00 18.47 ? 125  ARG B N   1 
ATOM   3320 C  CA  . ARG B 1 61  ? 27.213  -17.195 -8.244  1.00 17.56 ? 125  ARG B CA  1 
ATOM   3321 C  C   . ARG B 1 61  ? 27.038  -16.993 -6.743  1.00 17.96 ? 125  ARG B C   1 
ATOM   3322 O  O   . ARG B 1 61  ? 27.749  -16.183 -6.153  1.00 17.20 ? 125  ARG B O   1 
ATOM   3323 C  CB  . ARG B 1 61  ? 26.636  -15.982 -8.983  1.00 17.02 ? 125  ARG B CB  1 
ATOM   3324 C  CG  . ARG B 1 61  ? 26.955  -15.915 -10.480 1.00 19.16 ? 125  ARG B CG  1 
ATOM   3325 C  CD  . ARG B 1 61  ? 28.456  -15.858 -10.748 1.00 18.68 ? 125  ARG B CD  1 
ATOM   3326 N  NE  . ARG B 1 61  ? 29.097  -14.750 -10.052 1.00 18.87 ? 125  ARG B NE  1 
ATOM   3327 C  CZ  . ARG B 1 61  ? 28.942  -13.471 -10.375 1.00 19.60 ? 125  ARG B CZ  1 
ATOM   3328 N  NH1 . ARG B 1 61  ? 28.165  -13.129 -11.398 1.00 19.38 ? 125  ARG B NH1 1 
ATOM   3329 N  NH2 . ARG B 1 61  ? 29.555  -12.533 -9.665  1.00 22.62 ? 125  ARG B NH2 1 
ATOM   3330 N  N   . ILE B 1 62  ? 26.104  -17.715 -6.122  1.00 17.72 ? 126  ILE B N   1 
ATOM   3331 C  CA  . ILE B 1 62  ? 25.908  -17.566 -4.682  1.00 18.19 ? 126  ILE B CA  1 
ATOM   3332 C  C   . ILE B 1 62  ? 26.378  -18.786 -3.899  1.00 19.41 ? 126  ILE B C   1 
ATOM   3333 O  O   . ILE B 1 62  ? 26.142  -18.878 -2.700  1.00 20.48 ? 126  ILE B O   1 
ATOM   3334 C  CB  . ILE B 1 62  ? 24.422  -17.303 -4.292  1.00 19.60 ? 126  ILE B CB  1 
ATOM   3335 C  CG1 . ILE B 1 62  ? 23.558  -18.525 -4.617  1.00 18.42 ? 126  ILE B CG1 1 
ATOM   3336 C  CG2 . ILE B 1 62  ? 23.904  -16.062 -5.009  1.00 20.28 ? 126  ILE B CG2 1 
ATOM   3337 C  CD1 . ILE B 1 62  ? 22.226  -18.540 -3.878  1.00 17.50 ? 126  ILE B CD1 1 
ATOM   3338 N  N   . GLY B 1 63  ? 27.032  -19.729 -4.568  1.00 18.96 ? 127  GLY B N   1 
ATOM   3339 C  CA  . GLY B 1 63  ? 27.508  -20.894 -3.848  1.00 17.94 ? 127  GLY B CA  1 
ATOM   3340 C  C   . GLY B 1 63  ? 27.058  -22.253 -4.349  1.00 18.61 ? 127  GLY B C   1 
ATOM   3341 O  O   . GLY B 1 63  ? 27.530  -23.268 -3.840  1.00 18.96 ? 127  GLY B O   1 
ATOM   3342 N  N   . GLY B 1 64  ? 26.141  -22.289 -5.317  1.00 18.57 ? 128  GLY B N   1 
ATOM   3343 C  CA  . GLY B 1 64  ? 25.702  -23.566 -5.855  1.00 18.95 ? 128  GLY B CA  1 
ATOM   3344 C  C   . GLY B 1 64  ? 24.334  -24.074 -5.438  1.00 19.52 ? 128  GLY B C   1 
ATOM   3345 O  O   . GLY B 1 64  ? 23.947  -25.188 -5.801  1.00 18.38 ? 128  GLY B O   1 
ATOM   3346 N  N   . GLY B 1 65  ? 23.596  -23.272 -4.680  1.00 21.21 ? 129  GLY B N   1 
ATOM   3347 C  CA  . GLY B 1 65  ? 22.278  -23.696 -4.253  1.00 21.15 ? 129  GLY B CA  1 
ATOM   3348 C  C   . GLY B 1 65  ? 21.612  -22.739 -3.284  1.00 22.36 ? 129  GLY B C   1 
ATOM   3349 O  O   . GLY B 1 65  ? 22.204  -21.753 -2.852  1.00 22.64 ? 129  GLY B O   1 
ATOM   3350 N  N   . SER B 1 66  ? 20.362  -23.037 -2.952  1.00 21.45 ? 130  SER B N   1 
ATOM   3351 C  CA  . SER B 1 66  ? 19.590  -22.220 -2.031  1.00 20.85 ? 130  SER B CA  1 
ATOM   3352 C  C   . SER B 1 66  ? 19.713  -22.753 -0.610  1.00 18.04 ? 130  SER B C   1 
ATOM   3353 O  O   . SER B 1 66  ? 19.734  -23.967 -0.395  1.00 18.86 ? 130  SER B O   1 
ATOM   3354 C  CB  . SER B 1 66  ? 18.116  -22.220 -2.441  1.00 21.11 ? 130  SER B CB  1 
ATOM   3355 O  OG  . SER B 1 66  ? 17.349  -21.475 -1.518  1.00 25.54 ? 130  SER B OG  1 
ATOM   3356 N  N   . PRO B 1 67  ? 19.807  -21.849 0.377   1.00 17.08 ? 131  PRO B N   1 
ATOM   3357 C  CA  . PRO B 1 67  ? 19.925  -22.215 1.791   1.00 17.14 ? 131  PRO B CA  1 
ATOM   3358 C  C   . PRO B 1 67  ? 18.562  -22.282 2.477   1.00 18.11 ? 131  PRO B C   1 
ATOM   3359 O  O   . PRO B 1 67  ? 18.476  -22.556 3.673   1.00 18.04 ? 131  PRO B O   1 
ATOM   3360 C  CB  . PRO B 1 67  ? 20.775  -21.089 2.357   1.00 15.78 ? 131  PRO B CB  1 
ATOM   3361 C  CG  . PRO B 1 67  ? 20.238  -19.906 1.620   1.00 15.80 ? 131  PRO B CG  1 
ATOM   3362 C  CD  . PRO B 1 67  ? 20.122  -20.417 0.187   1.00 15.87 ? 131  PRO B CD  1 
ATOM   3363 N  N   . ILE B 1 68  ? 17.499  -22.042 1.716   1.00 20.50 ? 132  ILE B N   1 
ATOM   3364 C  CA  . ILE B 1 68  ? 16.153  -22.035 2.271   1.00 21.29 ? 132  ILE B CA  1 
ATOM   3365 C  C   . ILE B 1 68  ? 15.739  -23.238 3.121   1.00 20.94 ? 132  ILE B C   1 
ATOM   3366 O  O   . ILE B 1 68  ? 15.097  -23.066 4.153   1.00 20.12 ? 132  ILE B O   1 
ATOM   3367 C  CB  . ILE B 1 68  ? 15.098  -21.784 1.158   1.00 23.07 ? 132  ILE B CB  1 
ATOM   3368 C  CG1 . ILE B 1 68  ? 15.262  -22.778 0.006   1.00 24.67 ? 132  ILE B CG1 1 
ATOM   3369 C  CG2 . ILE B 1 68  ? 15.260  -20.377 0.618   1.00 25.63 ? 132  ILE B CG2 1 
ATOM   3370 C  CD1 . ILE B 1 68  ? 14.634  -24.132 0.246   1.00 26.85 ? 132  ILE B CD1 1 
ATOM   3371 N  N   . LYS B 1 69  ? 16.099  -24.447 2.710   1.00 21.24 ? 133  LYS B N   1 
ATOM   3372 C  CA  . LYS B 1 69  ? 15.723  -25.618 3.492   1.00 23.35 ? 133  LYS B CA  1 
ATOM   3373 C  C   . LYS B 1 69  ? 16.490  -25.665 4.815   1.00 23.35 ? 133  LYS B C   1 
ATOM   3374 O  O   . LYS B 1 69  ? 15.942  -26.042 5.853   1.00 22.31 ? 133  LYS B O   1 
ATOM   3375 C  CB  . LYS B 1 69  ? 15.972  -26.907 2.702   1.00 24.24 ? 133  LYS B CB  1 
ATOM   3376 C  CG  . LYS B 1 69  ? 15.559  -28.153 3.469   1.00 28.29 ? 133  LYS B CG  1 
ATOM   3377 C  CD  . LYS B 1 69  ? 15.730  -29.428 2.664   1.00 30.46 ? 133  LYS B CD  1 
ATOM   3378 C  CE  . LYS B 1 69  ? 15.189  -30.624 3.444   1.00 33.63 ? 133  LYS B CE  1 
ATOM   3379 N  NZ  . LYS B 1 69  ? 15.305  -31.907 2.692   1.00 36.16 ? 133  LYS B NZ  1 
ATOM   3380 N  N   . ILE B 1 70  ? 17.758  -25.276 4.772   1.00 22.49 ? 134  ILE B N   1 
ATOM   3381 C  CA  . ILE B 1 70  ? 18.592  -25.265 5.969   1.00 22.19 ? 134  ILE B CA  1 
ATOM   3382 C  C   . ILE B 1 70  ? 18.054  -24.271 6.996   1.00 21.43 ? 134  ILE B C   1 
ATOM   3383 O  O   . ILE B 1 70  ? 17.927  -24.589 8.182   1.00 19.73 ? 134  ILE B O   1 
ATOM   3384 C  CB  . ILE B 1 70  ? 20.030  -24.866 5.632   1.00 23.53 ? 134  ILE B CB  1 
ATOM   3385 C  CG1 . ILE B 1 70  ? 20.628  -25.865 4.642   1.00 26.57 ? 134  ILE B CG1 1 
ATOM   3386 C  CG2 . ILE B 1 70  ? 20.855  -24.809 6.902   1.00 24.25 ? 134  ILE B CG2 1 
ATOM   3387 C  CD1 . ILE B 1 70  ? 21.982  -25.442 4.096   1.00 29.59 ? 134  ILE B CD1 1 
ATOM   3388 N  N   . TRP B 1 71  ? 17.751  -23.059 6.540   1.00 19.04 ? 135  TRP B N   1 
ATOM   3389 C  CA  . TRP B 1 71  ? 17.229  -22.040 7.435   1.00 17.77 ? 135  TRP B CA  1 
ATOM   3390 C  C   . TRP B 1 71  ? 15.820  -22.386 7.921   1.00 16.18 ? 135  TRP B C   1 
ATOM   3391 O  O   . TRP B 1 71  ? 15.502  -22.159 9.084   1.00 13.88 ? 135  TRP B O   1 
ATOM   3392 C  CB  . TRP B 1 71  ? 17.248  -20.671 6.747   1.00 17.34 ? 135  TRP B CB  1 
ATOM   3393 C  CG  . TRP B 1 71  ? 18.632  -20.070 6.663   1.00 17.92 ? 135  TRP B CG  1 
ATOM   3394 C  CD1 . TRP B 1 71  ? 19.243  -19.580 5.551   1.00 18.45 ? 135  TRP B CD1 1 
ATOM   3395 C  CD2 . TRP B 1 71  ? 19.572  -19.917 7.738   1.00 17.81 ? 135  TRP B CD2 1 
ATOM   3396 N  NE1 . TRP B 1 71  ? 20.505  -19.136 5.860   1.00 19.97 ? 135  TRP B NE1 1 
ATOM   3397 C  CE2 . TRP B 1 71  ? 20.733  -19.330 7.195   1.00 18.46 ? 135  TRP B CE2 1 
ATOM   3398 C  CE3 . TRP B 1 71  ? 19.543  -20.220 9.109   1.00 20.11 ? 135  TRP B CE3 1 
ATOM   3399 C  CZ2 . TRP B 1 71  ? 21.864  -19.038 7.972   1.00 19.78 ? 135  TRP B CZ2 1 
ATOM   3400 C  CZ3 . TRP B 1 71  ? 20.671  -19.929 9.885   1.00 20.74 ? 135  TRP B CZ3 1 
ATOM   3401 C  CH2 . TRP B 1 71  ? 21.815  -19.343 9.309   1.00 19.21 ? 135  TRP B CH2 1 
ATOM   3402 N  N   . THR B 1 72  ? 14.987  -22.938 7.038   1.00 17.24 ? 136  THR B N   1 
ATOM   3403 C  CA  . THR B 1 72  ? 13.624  -23.325 7.404   1.00 18.44 ? 136  THR B CA  1 
ATOM   3404 C  C   . THR B 1 72  ? 13.677  -24.430 8.456   1.00 18.44 ? 136  THR B C   1 
ATOM   3405 O  O   . THR B 1 72  ? 12.902  -24.420 9.413   1.00 20.22 ? 136  THR B O   1 
ATOM   3406 C  CB  . THR B 1 72  ? 12.814  -23.860 6.189   1.00 17.92 ? 136  THR B CB  1 
ATOM   3407 O  OG1 . THR B 1 72  ? 12.716  -22.850 5.180   1.00 20.55 ? 136  THR B OG1 1 
ATOM   3408 C  CG2 . THR B 1 72  ? 11.406  -24.239 6.617   1.00 18.71 ? 136  THR B CG2 1 
ATOM   3409 N  N   . SER B 1 73  ? 14.593  -25.381 8.270   1.00 19.98 ? 137  SER B N   1 
ATOM   3410 C  CA  . SER B 1 73  ? 14.767  -26.491 9.207   1.00 19.90 ? 137  SER B CA  1 
ATOM   3411 C  C   . SER B 1 73  ? 15.154  -26.024 10.601  1.00 20.38 ? 137  SER B C   1 
ATOM   3412 O  O   . SER B 1 73  ? 14.585  -26.482 11.586  1.00 20.42 ? 137  SER B O   1 
ATOM   3413 C  CB  . SER B 1 73  ? 15.835  -27.466 8.701   1.00 20.86 ? 137  SER B CB  1 
ATOM   3414 O  OG  . SER B 1 73  ? 15.332  -28.268 7.651   1.00 23.08 ? 137  SER B OG  1 
ATOM   3415 N  N   . LYS B 1 74  ? 16.130  -25.122 10.680  1.00 20.61 ? 138  LYS B N   1 
ATOM   3416 C  CA  . LYS B 1 74  ? 16.597  -24.597 11.962  1.00 22.01 ? 138  LYS B CA  1 
ATOM   3417 C  C   . LYS B 1 74  ? 15.511  -23.792 12.675  1.00 21.63 ? 138  LYS B C   1 
ATOM   3418 O  O   . LYS B 1 74  ? 15.391  -23.851 13.901  1.00 19.59 ? 138  LYS B O   1 
ATOM   3419 C  CB  . LYS B 1 74  ? 17.836  -23.709 11.769  1.00 23.54 ? 138  LYS B CB  1 
ATOM   3420 C  CG  . LYS B 1 74  ? 19.067  -24.448 11.241  1.00 31.85 ? 138  LYS B CG  1 
ATOM   3421 C  CD  . LYS B 1 74  ? 20.256  -23.504 11.040  1.00 34.77 ? 138  LYS B CD  1 
ATOM   3422 C  CE  . LYS B 1 74  ? 21.492  -24.253 10.524  1.00 37.63 ? 138  LYS B CE  1 
ATOM   3423 N  NZ  . LYS B 1 74  ? 22.626  -23.331 10.173  1.00 37.96 ? 138  LYS B NZ  1 
ATOM   3424 N  N   . GLN B 1 75  ? 14.731  -23.034 11.909  1.00 20.75 ? 139  GLN B N   1 
ATOM   3425 C  CA  . GLN B 1 75  ? 13.665  -22.228 12.486  1.00 20.71 ? 139  GLN B CA  1 
ATOM   3426 C  C   . GLN B 1 75  ? 12.559  -23.142 12.982  1.00 21.87 ? 139  GLN B C   1 
ATOM   3427 O  O   . GLN B 1 75  ? 12.005  -22.925 14.056  1.00 24.40 ? 139  GLN B O   1 
ATOM   3428 C  CB  . GLN B 1 75  ? 13.117  -21.242 11.451  1.00 20.02 ? 139  GLN B CB  1 
ATOM   3429 C  CG  . GLN B 1 75  ? 14.159  -20.252 10.942  1.00 20.70 ? 139  GLN B CG  1 
ATOM   3430 C  CD  . GLN B 1 75  ? 13.660  -19.420 9.777   1.00 22.65 ? 139  GLN B CD  1 
ATOM   3431 O  OE1 . GLN B 1 75  ? 12.755  -19.832 9.045   1.00 24.27 ? 139  GLN B OE1 1 
ATOM   3432 N  NE2 . GLN B 1 75  ? 14.261  -18.248 9.585   1.00 22.86 ? 139  GLN B NE2 1 
ATOM   3433 N  N   . GLY B 1 76  ? 12.249  -24.171 12.200  1.00 22.45 ? 140  GLY B N   1 
ATOM   3434 C  CA  . GLY B 1 76  ? 11.217  -25.113 12.591  1.00 22.49 ? 140  GLY B CA  1 
ATOM   3435 C  C   . GLY B 1 76  ? 11.597  -25.858 13.861  1.00 22.18 ? 140  GLY B C   1 
ATOM   3436 O  O   . GLY B 1 76  ? 10.778  -26.017 14.767  1.00 21.90 ? 140  GLY B O   1 
ATOM   3437 N  N   . GLU B 1 77  ? 12.841  -26.320 13.925  1.00 23.50 ? 141  GLU B N   1 
ATOM   3438 C  CA  . GLU B 1 77  ? 13.336  -27.040 15.092  1.00 24.60 ? 141  GLU B CA  1 
ATOM   3439 C  C   . GLU B 1 77  ? 13.286  -26.139 16.317  1.00 23.41 ? 141  GLU B C   1 
ATOM   3440 O  O   . GLU B 1 77  ? 12.882  -26.566 17.403  1.00 21.29 ? 141  GLU B O   1 
ATOM   3441 C  CB  . GLU B 1 77  ? 14.778  -27.500 14.855  1.00 29.92 ? 141  GLU B CB  1 
ATOM   3442 C  CG  . GLU B 1 77  ? 14.916  -28.632 13.851  1.00 35.89 ? 141  GLU B CG  1 
ATOM   3443 C  CD  . GLU B 1 77  ? 16.343  -28.806 13.355  1.00 40.22 ? 141  GLU B CD  1 
ATOM   3444 O  OE1 . GLU B 1 77  ? 17.281  -28.709 14.179  1.00 41.46 ? 141  GLU B OE1 1 
ATOM   3445 O  OE2 . GLU B 1 77  ? 16.526  -29.052 12.140  1.00 42.91 ? 141  GLU B OE2 1 
ATOM   3446 N  N   . GLY B 1 78  ? 13.698  -24.888 16.141  1.00 22.35 ? 142  GLY B N   1 
ATOM   3447 C  CA  . GLY B 1 78  ? 13.680  -23.950 17.249  1.00 21.57 ? 142  GLY B CA  1 
ATOM   3448 C  C   . GLY B 1 78  ? 12.250  -23.735 17.710  1.00 21.33 ? 142  GLY B C   1 
ATOM   3449 O  O   . GLY B 1 78  ? 11.970  -23.691 18.909  1.00 19.88 ? 142  GLY B O   1 
ATOM   3450 N  N   . MET B 1 79  ? 11.346  -23.608 16.743  1.00 20.46 ? 143  MET B N   1 
ATOM   3451 C  CA  . MET B 1 79  ? 9.927   -23.400 17.008  1.00 20.68 ? 143  MET B CA  1 
ATOM   3452 C  C   . MET B 1 79  ? 9.344   -24.553 17.825  1.00 21.55 ? 143  MET B C   1 
ATOM   3453 O  O   . MET B 1 79  ? 8.712   -24.337 18.858  1.00 21.36 ? 143  MET B O   1 
ATOM   3454 C  CB  . MET B 1 79  ? 9.169   -23.274 15.681  1.00 18.64 ? 143  MET B CB  1 
ATOM   3455 C  CG  . MET B 1 79  ? 7.653   -23.205 15.818  1.00 20.98 ? 143  MET B CG  1 
ATOM   3456 S  SD  . MET B 1 79  ? 6.823   -23.161 14.210  1.00 22.98 ? 143  MET B SD  1 
ATOM   3457 C  CE  . MET B 1 79  ? 6.929   -24.860 13.737  1.00 22.97 ? 143  MET B CE  1 
ATOM   3458 N  N   . VAL B 1 80  ? 9.559   -25.774 17.346  1.00 22.45 ? 144  VAL B N   1 
ATOM   3459 C  CA  . VAL B 1 80  ? 9.063   -26.970 18.015  1.00 23.51 ? 144  VAL B CA  1 
ATOM   3460 C  C   . VAL B 1 80  ? 9.577   -27.063 19.447  1.00 24.26 ? 144  VAL B C   1 
ATOM   3461 O  O   . VAL B 1 80  ? 8.813   -27.330 20.375  1.00 24.78 ? 144  VAL B O   1 
ATOM   3462 C  CB  . VAL B 1 80  ? 9.469   -28.243 17.233  1.00 23.04 ? 144  VAL B CB  1 
ATOM   3463 C  CG1 . VAL B 1 80  ? 9.270   -29.482 18.090  1.00 25.35 ? 144  VAL B CG1 1 
ATOM   3464 C  CG2 . VAL B 1 80  ? 8.638   -28.347 15.966  1.00 20.68 ? 144  VAL B CG2 1 
ATOM   3465 N  N   . LYS B 1 81  ? 10.871  -26.834 19.625  1.00 24.96 ? 145  LYS B N   1 
ATOM   3466 C  CA  . LYS B 1 81  ? 11.469  -26.897 20.949  1.00 25.81 ? 145  LYS B CA  1 
ATOM   3467 C  C   . LYS B 1 81  ? 10.742  -25.972 21.921  1.00 25.07 ? 145  LYS B C   1 
ATOM   3468 O  O   . LYS B 1 81  ? 10.540  -26.320 23.086  1.00 25.66 ? 145  LYS B O   1 
ATOM   3469 C  CB  . LYS B 1 81  ? 12.951  -26.529 20.867  1.00 27.97 ? 145  LYS B CB  1 
ATOM   3470 C  CG  . LYS B 1 81  ? 13.634  -26.409 22.206  1.00 33.50 ? 145  LYS B CG  1 
ATOM   3471 C  CD  . LYS B 1 81  ? 15.104  -26.050 22.037  1.00 36.58 ? 145  LYS B CD  1 
ATOM   3472 C  CE  . LYS B 1 81  ? 15.590  -25.215 23.215  1.00 38.23 ? 145  LYS B CE  1 
ATOM   3473 N  NZ  . LYS B 1 81  ? 14.831  -23.926 23.302  1.00 38.63 ? 145  LYS B NZ  1 
ATOM   3474 N  N   . LEU B 1 82  ? 10.337  -24.802 21.437  1.00 24.06 ? 146  LEU B N   1 
ATOM   3475 C  CA  . LEU B 1 82  ? 9.630   -23.839 22.271  1.00 24.54 ? 146  LEU B CA  1 
ATOM   3476 C  C   . LEU B 1 82  ? 8.172   -24.233 22.494  1.00 24.16 ? 146  LEU B C   1 
ATOM   3477 O  O   . LEU B 1 82  ? 7.664   -24.136 23.607  1.00 24.43 ? 146  LEU B O   1 
ATOM   3478 C  CB  . LEU B 1 82  ? 9.700   -22.445 21.642  1.00 24.14 ? 146  LEU B CB  1 
ATOM   3479 C  CG  . LEU B 1 82  ? 11.100  -21.828 21.540  1.00 26.28 ? 146  LEU B CG  1 
ATOM   3480 C  CD1 . LEU B 1 82  ? 11.042  -20.520 20.755  1.00 25.72 ? 146  LEU B CD1 1 
ATOM   3481 C  CD2 . LEU B 1 82  ? 11.653  -21.594 22.948  1.00 25.74 ? 146  LEU B CD2 1 
ATOM   3482 N  N   . LEU B 1 83  ? 7.502   -24.687 21.439  1.00 23.96 ? 147  LEU B N   1 
ATOM   3483 C  CA  . LEU B 1 83  ? 6.102   -25.080 21.552  1.00 25.31 ? 147  LEU B CA  1 
ATOM   3484 C  C   . LEU B 1 83  ? 5.874   -26.217 22.540  1.00 26.70 ? 147  LEU B C   1 
ATOM   3485 O  O   . LEU B 1 83  ? 4.880   -26.224 23.265  1.00 26.96 ? 147  LEU B O   1 
ATOM   3486 C  CB  . LEU B 1 83  ? 5.539   -25.469 20.182  1.00 24.86 ? 147  LEU B CB  1 
ATOM   3487 C  CG  . LEU B 1 83  ? 5.223   -24.312 19.227  1.00 23.13 ? 147  LEU B CG  1 
ATOM   3488 C  CD1 . LEU B 1 83  ? 4.792   -24.864 17.880  1.00 21.94 ? 147  LEU B CD1 1 
ATOM   3489 C  CD2 . LEU B 1 83  ? 4.135   -23.437 19.825  1.00 21.53 ? 147  LEU B CD2 1 
ATOM   3490 N  N   . ASP B 1 84  ? 6.785   -27.180 22.572  1.00 28.26 ? 148  ASP B N   1 
ATOM   3491 C  CA  . ASP B 1 84  ? 6.632   -28.292 23.497  1.00 31.26 ? 148  ASP B CA  1 
ATOM   3492 C  C   . ASP B 1 84  ? 6.558   -27.816 24.949  1.00 32.33 ? 148  ASP B C   1 
ATOM   3493 O  O   . ASP B 1 84  ? 5.965   -28.485 25.794  1.00 33.13 ? 148  ASP B O   1 
ATOM   3494 C  CB  . ASP B 1 84  ? 7.765   -29.306 23.317  1.00 31.79 ? 148  ASP B CB  1 
ATOM   3495 C  CG  . ASP B 1 84  ? 7.598   -30.150 22.058  1.00 33.47 ? 148  ASP B CG  1 
ATOM   3496 O  OD1 . ASP B 1 84  ? 6.505   -30.117 21.455  1.00 33.72 ? 148  ASP B OD1 1 
ATOM   3497 O  OD2 . ASP B 1 84  ? 8.553   -30.857 21.674  1.00 35.79 ? 148  ASP B OD2 1 
ATOM   3498 N  N   . GLU B 1 85  ? 7.136   -26.651 25.232  1.00 32.85 ? 149  GLU B N   1 
ATOM   3499 C  CA  . GLU B 1 85  ? 7.105   -26.100 26.585  1.00 34.44 ? 149  GLU B CA  1 
ATOM   3500 C  C   . GLU B 1 85  ? 5.977   -25.078 26.748  1.00 34.71 ? 149  GLU B C   1 
ATOM   3501 O  O   . GLU B 1 85  ? 5.396   -24.950 27.825  1.00 34.76 ? 149  GLU B O   1 
ATOM   3502 C  CB  . GLU B 1 85  ? 8.446   -25.444 26.918  1.00 35.33 ? 149  GLU B CB  1 
ATOM   3503 C  CG  . GLU B 1 85  ? 9.637   -26.352 26.673  1.00 39.61 ? 149  GLU B CG  1 
ATOM   3504 C  CD  . GLU B 1 85  ? 9.548   -27.663 27.442  1.00 43.68 ? 149  GLU B CD  1 
ATOM   3505 O  OE1 . GLU B 1 85  ? 10.228  -28.635 27.042  1.00 44.63 ? 149  GLU B OE1 1 
ATOM   3506 O  OE2 . GLU B 1 85  ? 8.806   -27.722 28.450  1.00 45.71 ? 149  GLU B OE2 1 
ATOM   3507 N  N   . LEU B 1 86  ? 5.673   -24.360 25.669  1.00 35.09 ? 150  LEU B N   1 
ATOM   3508 C  CA  . LEU B 1 86  ? 4.622   -23.343 25.666  1.00 34.96 ? 150  LEU B CA  1 
ATOM   3509 C  C   . LEU B 1 86  ? 3.219   -23.931 25.684  1.00 34.80 ? 150  LEU B C   1 
ATOM   3510 O  O   . LEU B 1 86  ? 2.326   -23.414 26.355  1.00 34.57 ? 150  LEU B O   1 
ATOM   3511 C  CB  . LEU B 1 86  ? 4.734   -22.462 24.419  1.00 35.98 ? 150  LEU B CB  1 
ATOM   3512 C  CG  . LEU B 1 86  ? 5.837   -21.416 24.271  1.00 36.95 ? 150  LEU B CG  1 
ATOM   3513 C  CD1 . LEU B 1 86  ? 5.814   -20.878 22.846  1.00 38.15 ? 150  LEU B CD1 1 
ATOM   3514 C  CD2 . LEU B 1 86  ? 5.628   -20.287 25.265  1.00 37.97 ? 150  LEU B CD2 1 
ATOM   3515 N  N   . SER B 1 87  ? 3.027   -25.005 24.928  1.00 34.92 ? 151  SER B N   1 
ATOM   3516 C  CA  . SER B 1 87  ? 1.719   -25.634 24.818  1.00 34.52 ? 151  SER B CA  1 
ATOM   3517 C  C   . SER B 1 87  ? 1.775   -27.145 25.064  1.00 34.46 ? 151  SER B C   1 
ATOM   3518 O  O   . SER B 1 87  ? 1.728   -27.944 24.126  1.00 33.92 ? 151  SER B O   1 
ATOM   3519 C  CB  . SER B 1 87  ? 1.142   -25.335 23.425  1.00 33.97 ? 151  SER B CB  1 
ATOM   3520 O  OG  . SER B 1 87  ? -0.192  -25.794 23.290  1.00 34.94 ? 151  SER B OG  1 
ATOM   3521 N  N   . PRO B 1 88  ? 1.867   -27.554 26.340  1.00 35.07 ? 152  PRO B N   1 
ATOM   3522 C  CA  . PRO B 1 88  ? 1.929   -28.971 26.716  1.00 34.48 ? 152  PRO B CA  1 
ATOM   3523 C  C   . PRO B 1 88  ? 0.671   -29.730 26.292  1.00 34.55 ? 152  PRO B C   1 
ATOM   3524 O  O   . PRO B 1 88  ? 0.704   -30.939 26.072  1.00 33.81 ? 152  PRO B O   1 
ATOM   3525 C  CB  . PRO B 1 88  ? 2.075   -28.920 28.237  1.00 35.70 ? 152  PRO B CB  1 
ATOM   3526 C  CG  . PRO B 1 88  ? 2.708   -27.581 28.486  1.00 36.08 ? 152  PRO B CG  1 
ATOM   3527 C  CD  . PRO B 1 88  ? 1.958   -26.696 27.533  1.00 35.26 ? 152  PRO B CD  1 
ATOM   3528 N  N   . ASN B 1 89  ? -0.436  -29.005 26.179  1.00 35.28 ? 153  ASN B N   1 
ATOM   3529 C  CA  . ASN B 1 89  ? -1.708  -29.601 25.788  1.00 36.50 ? 153  ASN B CA  1 
ATOM   3530 C  C   . ASN B 1 89  ? -1.704  -30.125 24.357  1.00 36.46 ? 153  ASN B C   1 
ATOM   3531 O  O   . ASN B 1 89  ? -2.429  -31.071 24.036  1.00 37.13 ? 153  ASN B O   1 
ATOM   3532 C  CB  . ASN B 1 89  ? -2.832  -28.576 25.940  1.00 39.24 ? 153  ASN B CB  1 
ATOM   3533 C  CG  . ASN B 1 89  ? -2.988  -28.092 27.365  1.00 41.79 ? 153  ASN B CG  1 
ATOM   3534 O  OD1 . ASN B 1 89  ? -3.308  -28.872 28.263  1.00 42.01 ? 153  ASN B OD1 1 
ATOM   3535 N  ND2 . ASN B 1 89  ? -2.757  -26.798 27.584  1.00 42.43 ? 153  ASN B ND2 1 
ATOM   3536 N  N   . THR B 1 90  ? -0.894  -29.514 23.497  1.00 34.59 ? 154  THR B N   1 
ATOM   3537 C  CA  . THR B 1 90  ? -0.835  -29.933 22.102  1.00 31.95 ? 154  THR B CA  1 
ATOM   3538 C  C   . THR B 1 90  ? 0.468   -30.635 21.731  1.00 31.47 ? 154  THR B C   1 
ATOM   3539 O  O   . THR B 1 90  ? 0.703   -30.946 20.566  1.00 30.97 ? 154  THR B O   1 
ATOM   3540 C  CB  . THR B 1 90  ? -1.063  -28.726 21.155  1.00 32.86 ? 154  THR B CB  1 
ATOM   3541 O  OG1 . THR B 1 90  ? -0.060  -27.727 21.380  1.00 31.31 ? 154  THR B OG1 1 
ATOM   3542 C  CG2 . THR B 1 90  ? -2.436  -28.112 21.409  1.00 31.99 ? 154  THR B CG2 1 
ATOM   3543 N  N   . ALA B 1 91  ? 1.314   -30.893 22.723  1.00 30.56 ? 155  ALA B N   1 
ATOM   3544 C  CA  . ALA B 1 91  ? 2.584   -31.568 22.472  1.00 30.07 ? 155  ALA B CA  1 
ATOM   3545 C  C   . ALA B 1 91  ? 2.358   -33.076 22.360  1.00 29.25 ? 155  ALA B C   1 
ATOM   3546 O  O   . ALA B 1 91  ? 1.352   -33.594 22.838  1.00 30.11 ? 155  ALA B O   1 
ATOM   3547 C  CB  . ALA B 1 91  ? 3.572   -31.262 23.593  1.00 29.41 ? 155  ALA B CB  1 
ATOM   3548 N  N   . PRO B 1 92  ? 3.284   -33.796 21.708  1.00 28.94 ? 156  PRO B N   1 
ATOM   3549 C  CA  . PRO B 1 92  ? 4.503   -33.265 21.083  1.00 28.64 ? 156  PRO B CA  1 
ATOM   3550 C  C   . PRO B 1 92  ? 4.189   -32.544 19.774  1.00 27.11 ? 156  PRO B C   1 
ATOM   3551 O  O   . PRO B 1 92  ? 3.202   -32.854 19.104  1.00 27.06 ? 156  PRO B O   1 
ATOM   3552 C  CB  . PRO B 1 92  ? 5.348   -34.520 20.837  1.00 29.01 ? 156  PRO B CB  1 
ATOM   3553 C  CG  . PRO B 1 92  ? 4.787   -35.537 21.807  1.00 29.68 ? 156  PRO B CG  1 
ATOM   3554 C  CD  . PRO B 1 92  ? 3.312   -35.268 21.715  1.00 29.20 ? 156  PRO B CD  1 
ATOM   3555 N  N   . HIS B 1 93  ? 5.025   -31.580 19.410  1.00 25.77 ? 157  HIS B N   1 
ATOM   3556 C  CA  . HIS B 1 93  ? 4.817   -30.865 18.163  1.00 25.57 ? 157  HIS B CA  1 
ATOM   3557 C  C   . HIS B 1 93  ? 5.869   -31.323 17.180  1.00 24.86 ? 157  HIS B C   1 
ATOM   3558 O  O   . HIS B 1 93  ? 6.982   -31.666 17.571  1.00 25.91 ? 157  HIS B O   1 
ATOM   3559 C  CB  . HIS B 1 93  ? 4.939   -29.355 18.356  1.00 24.20 ? 157  HIS B CB  1 
ATOM   3560 C  CG  . HIS B 1 93  ? 3.942   -28.783 19.313  1.00 25.78 ? 157  HIS B CG  1 
ATOM   3561 N  ND1 . HIS B 1 93  ? 4.092   -28.862 20.679  1.00 26.08 ? 157  HIS B ND1 1 
ATOM   3562 C  CD2 . HIS B 1 93  ? 2.780   -28.120 19.099  1.00 26.87 ? 157  HIS B CD2 1 
ATOM   3563 C  CE1 . HIS B 1 93  ? 3.067   -28.271 21.267  1.00 26.09 ? 157  HIS B CE1 1 
ATOM   3564 N  NE2 . HIS B 1 93  ? 2.257   -27.812 20.331  1.00 26.74 ? 157  HIS B NE2 1 
ATOM   3565 N  N   . LYS B 1 94  ? 5.510   -31.333 15.905  1.00 24.44 ? 158  LYS B N   1 
ATOM   3566 C  CA  . LYS B 1 94  ? 6.435   -31.722 14.858  1.00 23.90 ? 158  LYS B CA  1 
ATOM   3567 C  C   . LYS B 1 94  ? 6.261   -30.752 13.695  1.00 23.56 ? 158  LYS B C   1 
ATOM   3568 O  O   . LYS B 1 94  ? 5.136   -30.403 13.338  1.00 25.39 ? 158  LYS B O   1 
ATOM   3569 C  CB  . LYS B 1 94  ? 6.148   -33.151 14.395  1.00 22.67 ? 158  LYS B CB  1 
ATOM   3570 C  CG  . LYS B 1 94  ? 7.141   -33.669 13.368  1.00 25.14 ? 158  LYS B CG  1 
ATOM   3571 C  CD  . LYS B 1 94  ? 6.850   -35.114 12.983  1.00 26.74 ? 158  LYS B CD  1 
ATOM   3572 C  CE  . LYS B 1 94  ? 7.877   -35.627 11.988  1.00 27.43 ? 158  LYS B CE  1 
ATOM   3573 N  NZ  . LYS B 1 94  ? 7.612   -37.037 11.597  1.00 30.30 ? 158  LYS B NZ  1 
ATOM   3574 N  N   . TYR B 1 95  ? 7.370   -30.304 13.115  1.00 22.01 ? 159  TYR B N   1 
ATOM   3575 C  CA  . TYR B 1 95  ? 7.298   -29.381 11.994  1.00 20.17 ? 159  TYR B CA  1 
ATOM   3576 C  C   . TYR B 1 95  ? 7.517   -30.157 10.709  1.00 20.85 ? 159  TYR B C   1 
ATOM   3577 O  O   . TYR B 1 95  ? 8.266   -31.136 10.688  1.00 21.29 ? 159  TYR B O   1 
ATOM   3578 C  CB  . TYR B 1 95  ? 8.360   -28.272 12.127  1.00 17.69 ? 159  TYR B CB  1 
ATOM   3579 C  CG  . TYR B 1 95  ? 9.770   -28.668 11.707  1.00 18.98 ? 159  TYR B CG  1 
ATOM   3580 C  CD1 . TYR B 1 95  ? 10.161  -28.626 10.364  1.00 18.49 ? 159  TYR B CD1 1 
ATOM   3581 C  CD2 . TYR B 1 95  ? 10.706  -29.100 12.651  1.00 16.75 ? 159  TYR B CD2 1 
ATOM   3582 C  CE1 . TYR B 1 95  ? 11.450  -29.006 9.974   1.00 19.96 ? 159  TYR B CE1 1 
ATOM   3583 C  CE2 . TYR B 1 95  ? 11.994  -29.485 12.272  1.00 17.52 ? 159  TYR B CE2 1 
ATOM   3584 C  CZ  . TYR B 1 95  ? 12.359  -29.436 10.934  1.00 18.84 ? 159  TYR B CZ  1 
ATOM   3585 O  OH  . TYR B 1 95  ? 13.621  -29.833 10.558  1.00 22.25 ? 159  TYR B OH  1 
ATOM   3586 N  N   . TYR B 1 96  ? 6.848   -29.730 9.646   1.00 19.66 ? 160  TYR B N   1 
ATOM   3587 C  CA  . TYR B 1 96  ? 6.991   -30.363 8.344   1.00 20.01 ? 160  TYR B CA  1 
ATOM   3588 C  C   . TYR B 1 96  ? 7.231   -29.259 7.335   1.00 19.35 ? 160  TYR B C   1 
ATOM   3589 O  O   . TYR B 1 96  ? 6.606   -28.208 7.398   1.00 21.07 ? 160  TYR B O   1 
ATOM   3590 C  CB  . TYR B 1 96  ? 5.725   -31.121 7.934   1.00 20.88 ? 160  TYR B CB  1 
ATOM   3591 C  CG  . TYR B 1 96  ? 5.304   -32.230 8.867   1.00 21.95 ? 160  TYR B CG  1 
ATOM   3592 C  CD1 . TYR B 1 96  ? 4.650   -31.947 10.061  1.00 20.84 ? 160  TYR B CD1 1 
ATOM   3593 C  CD2 . TYR B 1 96  ? 5.537   -33.567 8.542   1.00 23.24 ? 160  TYR B CD2 1 
ATOM   3594 C  CE1 . TYR B 1 96  ? 4.233   -32.959 10.904  1.00 22.83 ? 160  TYR B CE1 1 
ATOM   3595 C  CE2 . TYR B 1 96  ? 5.123   -34.593 9.384   1.00 23.35 ? 160  TYR B CE2 1 
ATOM   3596 C  CZ  . TYR B 1 96  ? 4.469   -34.280 10.562  1.00 24.11 ? 160  TYR B CZ  1 
ATOM   3597 O  OH  . TYR B 1 96  ? 4.030   -35.282 11.399  1.00 26.72 ? 160  TYR B OH  1 
ATOM   3598 N  N   . ILE B 1 97  ? 8.145   -29.489 6.408   1.00 19.99 ? 161  ILE B N   1 
ATOM   3599 C  CA  . ILE B 1 97  ? 8.415   -28.489 5.399   1.00 19.73 ? 161  ILE B CA  1 
ATOM   3600 C  C   . ILE B 1 97  ? 7.624   -28.804 4.137   1.00 19.49 ? 161  ILE B C   1 
ATOM   3601 O  O   . ILE B 1 97  ? 7.696   -29.910 3.600   1.00 19.77 ? 161  ILE B O   1 
ATOM   3602 C  CB  . ILE B 1 97  ? 9.909   -28.420 5.073   1.00 19.97 ? 161  ILE B CB  1 
ATOM   3603 C  CG1 . ILE B 1 97  ? 10.678  -27.942 6.307   1.00 20.48 ? 161  ILE B CG1 1 
ATOM   3604 C  CG2 . ILE B 1 97  ? 10.140  -27.491 3.897   1.00 18.92 ? 161  ILE B CG2 1 
ATOM   3605 C  CD1 . ILE B 1 97  ? 12.178  -27.935 6.123   1.00 20.46 ? 161  ILE B CD1 1 
ATOM   3606 N  N   . GLY B 1 98  ? 6.861   -27.815 3.684   1.00 18.20 ? 162  GLY B N   1 
ATOM   3607 C  CA  . GLY B 1 98  ? 6.062   -27.965 2.486   1.00 17.84 ? 162  GLY B CA  1 
ATOM   3608 C  C   . GLY B 1 98  ? 6.426   -26.900 1.466   1.00 19.41 ? 162  GLY B C   1 
ATOM   3609 O  O   . GLY B 1 98  ? 5.829   -25.818 1.436   1.00 19.09 ? 162  GLY B O   1 
ATOM   3610 N  N   . PHE B 1 99  ? 7.432   -27.189 0.645   1.00 19.46 ? 163  PHE B N   1 
ATOM   3611 C  CA  . PHE B 1 99  ? 7.838   -26.251 -0.382  1.00 20.36 ? 163  PHE B CA  1 
ATOM   3612 C  C   . PHE B 1 99  ? 6.886   -26.459 -1.544  1.00 21.11 ? 163  PHE B C   1 
ATOM   3613 O  O   . PHE B 1 99  ? 6.468   -27.577 -1.834  1.00 22.63 ? 163  PHE B O   1 
ATOM   3614 C  CB  . PHE B 1 99  ? 9.281   -26.504 -0.817  1.00 18.98 ? 163  PHE B CB  1 
ATOM   3615 C  CG  . PHE B 1 99  ? 10.304  -26.095 0.211   1.00 20.15 ? 163  PHE B CG  1 
ATOM   3616 C  CD1 . PHE B 1 99  ? 11.511  -26.771 0.314   1.00 21.10 ? 163  PHE B CD1 1 
ATOM   3617 C  CD2 . PHE B 1 99  ? 10.054  -25.036 1.082   1.00 21.20 ? 163  PHE B CD2 1 
ATOM   3618 C  CE1 . PHE B 1 99  ? 12.453  -26.403 1.271   1.00 22.04 ? 163  PHE B CE1 1 
ATOM   3619 C  CE2 . PHE B 1 99  ? 10.992  -24.660 2.041   1.00 21.20 ? 163  PHE B CE2 1 
ATOM   3620 C  CZ  . PHE B 1 99  ? 12.190  -25.343 2.136   1.00 20.40 ? 163  PHE B CZ  1 
ATOM   3621 N  N   . ARG B 1 100 ? 6.534   -25.364 -2.193  1.00 20.86 ? 164  ARG B N   1 
ATOM   3622 C  CA  . ARG B 1 100 ? 5.624   -25.402 -3.319  1.00 21.38 ? 164  ARG B CA  1 
ATOM   3623 C  C   . ARG B 1 100 ? 6.242   -25.974 -4.599  1.00 21.29 ? 164  ARG B C   1 
ATOM   3624 O  O   . ARG B 1 100 ? 5.575   -26.690 -5.336  1.00 21.13 ? 164  ARG B O   1 
ATOM   3625 C  CB  . ARG B 1 100 ? 5.119   -23.984 -3.600  1.00 20.45 ? 164  ARG B CB  1 
ATOM   3626 C  CG  . ARG B 1 100 ? 3.959   -23.917 -4.558  1.00 24.24 ? 164  ARG B CG  1 
ATOM   3627 C  CD  . ARG B 1 100 ? 2.677   -24.328 -3.877  1.00 25.51 ? 164  ARG B CD  1 
ATOM   3628 N  NE  . ARG B 1 100 ? 1.542   -24.239 -4.787  1.00 29.83 ? 164  ARG B NE  1 
ATOM   3629 C  CZ  . ARG B 1 100 ? 1.220   -25.172 -5.676  1.00 31.28 ? 164  ARG B CZ  1 
ATOM   3630 N  NH1 . ARG B 1 100 ? 1.944   -26.279 -5.774  1.00 30.92 ? 164  ARG B NH1 1 
ATOM   3631 N  NH2 . ARG B 1 100 ? 0.182   -24.988 -6.477  1.00 32.67 ? 164  ARG B NH2 1 
ATOM   3632 N  N   . TYR B 1 101 ? 7.512   -25.673 -4.861  1.00 21.52 ? 165  TYR B N   1 
ATOM   3633 C  CA  . TYR B 1 101 ? 8.128   -26.123 -6.110  1.00 22.27 ? 165  TYR B CA  1 
ATOM   3634 C  C   . TYR B 1 101 ? 9.346   -27.049 -6.068  1.00 22.17 ? 165  TYR B C   1 
ATOM   3635 O  O   . TYR B 1 101 ? 9.906   -27.379 -7.115  1.00 21.45 ? 165  TYR B O   1 
ATOM   3636 C  CB  . TYR B 1 101 ? 8.454   -24.900 -6.966  1.00 21.12 ? 165  TYR B CB  1 
ATOM   3637 C  CG  . TYR B 1 101 ? 7.276   -23.959 -7.120  1.00 23.61 ? 165  TYR B CG  1 
ATOM   3638 C  CD1 . TYR B 1 101 ? 7.293   -22.686 -6.546  1.00 24.09 ? 165  TYR B CD1 1 
ATOM   3639 C  CD2 . TYR B 1 101 ? 6.133   -24.355 -7.805  1.00 24.12 ? 165  TYR B CD2 1 
ATOM   3640 C  CE1 . TYR B 1 101 ? 6.196   -21.830 -6.650  1.00 25.01 ? 165  TYR B CE1 1 
ATOM   3641 C  CE2 . TYR B 1 101 ? 5.029   -23.513 -7.914  1.00 26.05 ? 165  TYR B CE2 1 
ATOM   3642 C  CZ  . TYR B 1 101 ? 5.065   -22.252 -7.334  1.00 26.21 ? 165  TYR B CZ  1 
ATOM   3643 O  OH  . TYR B 1 101 ? 3.962   -21.431 -7.424  1.00 28.36 ? 165  TYR B OH  1 
ATOM   3644 N  N   . VAL B 1 102 ? 9.758   -27.464 -4.875  1.00 21.68 ? 166  VAL B N   1 
ATOM   3645 C  CA  . VAL B 1 102 ? 10.889  -28.372 -4.752  1.00 21.59 ? 166  VAL B CA  1 
ATOM   3646 C  C   . VAL B 1 102 ? 10.624  -29.320 -3.600  1.00 22.57 ? 166  VAL B C   1 
ATOM   3647 O  O   . VAL B 1 102 ? 9.765   -29.051 -2.759  1.00 21.14 ? 166  VAL B O   1 
ATOM   3648 C  CB  . VAL B 1 102 ? 12.215  -27.619 -4.481  1.00 20.11 ? 166  VAL B CB  1 
ATOM   3649 C  CG1 . VAL B 1 102 ? 12.568  -26.750 -5.678  1.00 19.96 ? 166  VAL B CG1 1 
ATOM   3650 C  CG2 . VAL B 1 102 ? 12.100  -26.778 -3.218  1.00 20.09 ? 166  VAL B CG2 1 
ATOM   3651 N  N   . HIS B 1 103 ? 11.345  -30.436 -3.573  1.00 22.59 ? 167  HIS B N   1 
ATOM   3652 C  CA  . HIS B 1 103 ? 11.192  -31.402 -2.496  1.00 23.94 ? 167  HIS B CA  1 
ATOM   3653 C  C   . HIS B 1 103 ? 11.755  -30.789 -1.223  1.00 24.09 ? 167  HIS B C   1 
ATOM   3654 O  O   . HIS B 1 103 ? 12.769  -30.090 -1.264  1.00 26.11 ? 167  HIS B O   1 
ATOM   3655 C  CB  . HIS B 1 103 ? 11.964  -32.685 -2.812  1.00 26.66 ? 167  HIS B CB  1 
ATOM   3656 C  CG  . HIS B 1 103 ? 11.425  -33.440 -3.983  1.00 28.24 ? 167  HIS B CG  1 
ATOM   3657 N  ND1 . HIS B 1 103 ? 10.196  -34.064 -3.962  1.00 30.04 ? 167  HIS B ND1 1 
ATOM   3658 C  CD2 . HIS B 1 103 ? 11.936  -33.656 -5.217  1.00 29.41 ? 167  HIS B CD2 1 
ATOM   3659 C  CE1 . HIS B 1 103 ? 9.973   -34.631 -5.134  1.00 30.48 ? 167  HIS B CE1 1 
ATOM   3660 N  NE2 . HIS B 1 103 ? 11.013  -34.398 -5.914  1.00 30.39 ? 167  HIS B NE2 1 
ATOM   3661 N  N   . PRO B 1 104 ? 11.090  -31.009 -0.080  1.00 23.31 ? 168  PRO B N   1 
ATOM   3662 C  CA  . PRO B 1 104 ? 9.856   -31.788 0.050   1.00 23.06 ? 168  PRO B CA  1 
ATOM   3663 C  C   . PRO B 1 104 ? 8.636   -30.959 -0.361  1.00 23.19 ? 168  PRO B C   1 
ATOM   3664 O  O   . PRO B 1 104 ? 8.397   -29.867 0.166   1.00 22.82 ? 168  PRO B O   1 
ATOM   3665 C  CB  . PRO B 1 104 ? 9.841   -32.162 1.528   1.00 22.07 ? 168  PRO B CB  1 
ATOM   3666 C  CG  . PRO B 1 104 ? 10.488  -30.996 2.168   1.00 23.92 ? 168  PRO B CG  1 
ATOM   3667 C  CD  . PRO B 1 104 ? 11.653  -30.697 1.244   1.00 22.88 ? 168  PRO B CD  1 
ATOM   3668 N  N   . LEU B 1 105 ? 7.879   -31.484 -1.316  1.00 21.88 ? 169  LEU B N   1 
ATOM   3669 C  CA  . LEU B 1 105 ? 6.691   -30.816 -1.825  1.00 22.93 ? 169  LEU B CA  1 
ATOM   3670 C  C   . LEU B 1 105 ? 5.557   -30.764 -0.803  1.00 21.94 ? 169  LEU B C   1 
ATOM   3671 O  O   . LEU B 1 105 ? 5.473   -31.601 0.094   1.00 21.87 ? 169  LEU B O   1 
ATOM   3672 C  CB  . LEU B 1 105 ? 6.213   -31.525 -3.091  1.00 23.79 ? 169  LEU B CB  1 
ATOM   3673 C  CG  . LEU B 1 105 ? 7.175   -31.445 -4.277  1.00 23.18 ? 169  LEU B CG  1 
ATOM   3674 C  CD1 . LEU B 1 105 ? 6.775   -32.468 -5.335  1.00 24.26 ? 169  LEU B CD1 1 
ATOM   3675 C  CD2 . LEU B 1 105 ? 7.164   -30.027 -4.843  1.00 21.96 ? 169  LEU B CD2 1 
ATOM   3676 N  N   . THR B 1 106 ? 4.690   -29.772 -0.944  1.00 20.53 ? 170  THR B N   1 
ATOM   3677 C  CA  . THR B 1 106 ? 3.565   -29.618 -0.034  1.00 23.27 ? 170  THR B CA  1 
ATOM   3678 C  C   . THR B 1 106 ? 2.804   -30.940 0.065   1.00 23.41 ? 170  THR B C   1 
ATOM   3679 O  O   . THR B 1 106 ? 2.437   -31.375 1.151   1.00 24.57 ? 170  THR B O   1 
ATOM   3680 C  CB  . THR B 1 106 ? 2.594   -28.530 -0.527  1.00 23.67 ? 170  THR B CB  1 
ATOM   3681 O  OG1 . THR B 1 106 ? 3.335   -27.376 -0.946  1.00 23.17 ? 170  THR B OG1 1 
ATOM   3682 C  CG2 . THR B 1 106 ? 1.636   -28.133 0.596   1.00 24.76 ? 170  THR B CG2 1 
ATOM   3683 N  N   . GLU B 1 107 ? 2.579   -31.575 -1.079  1.00 24.31 ? 171  GLU B N   1 
ATOM   3684 C  CA  . GLU B 1 107 ? 1.866   -32.848 -1.131  1.00 26.24 ? 171  GLU B CA  1 
ATOM   3685 C  C   . GLU B 1 107 ? 2.570   -33.948 -0.330  1.00 26.18 ? 171  GLU B C   1 
ATOM   3686 O  O   . GLU B 1 107 ? 1.932   -34.687 0.424   1.00 26.09 ? 171  GLU B O   1 
ATOM   3687 C  CB  . GLU B 1 107 ? 1.720   -33.304 -2.584  1.00 27.62 ? 171  GLU B CB  1 
ATOM   3688 C  CG  . GLU B 1 107 ? 0.943   -32.345 -3.482  1.00 29.67 ? 171  GLU B CG  1 
ATOM   3689 C  CD  . GLU B 1 107 ? 1.621   -30.994 -3.658  1.00 29.45 ? 171  GLU B CD  1 
ATOM   3690 O  OE1 . GLU B 1 107 ? 2.863   -30.919 -3.526  1.00 29.56 ? 171  GLU B OE1 1 
ATOM   3691 O  OE2 . GLU B 1 107 ? 0.905   -30.008 -3.947  1.00 29.92 ? 171  GLU B OE2 1 
ATOM   3692 N  N   . GLU B 1 108 ? 3.884   -34.058 -0.499  1.00 25.19 ? 172  GLU B N   1 
ATOM   3693 C  CA  . GLU B 1 108 ? 4.649   -35.073 0.213   1.00 25.91 ? 172  GLU B CA  1 
ATOM   3694 C  C   . GLU B 1 108 ? 4.543   -34.839 1.719   1.00 25.93 ? 172  GLU B C   1 
ATOM   3695 O  O   . GLU B 1 108 ? 4.436   -35.784 2.502   1.00 26.06 ? 172  GLU B O   1 
ATOM   3696 C  CB  . GLU B 1 108 ? 6.117   -35.038 -0.229  1.00 25.50 ? 172  GLU B CB  1 
ATOM   3697 C  CG  . GLU B 1 108 ? 6.295   -35.141 -1.740  1.00 27.26 ? 172  GLU B CG  1 
ATOM   3698 C  CD  . GLU B 1 108 ? 7.748   -35.068 -2.183  1.00 29.21 ? 172  GLU B CD  1 
ATOM   3699 O  OE1 . GLU B 1 108 ? 8.493   -34.200 -1.684  1.00 28.56 ? 172  GLU B OE1 1 
ATOM   3700 O  OE2 . GLU B 1 108 ? 8.142   -35.877 -3.049  1.00 33.48 ? 172  GLU B OE2 1 
ATOM   3701 N  N   . ALA B 1 109 ? 4.560   -33.574 2.118   1.00 25.84 ? 173  ALA B N   1 
ATOM   3702 C  CA  . ALA B 1 109 ? 4.462   -33.226 3.527   1.00 25.54 ? 173  ALA B CA  1 
ATOM   3703 C  C   . ALA B 1 109 ? 3.108   -33.630 4.102   1.00 24.55 ? 173  ALA B C   1 
ATOM   3704 O  O   . ALA B 1 109 ? 3.037   -34.210 5.180   1.00 24.54 ? 173  ALA B O   1 
ATOM   3705 C  CB  . ALA B 1 109 ? 4.681   -31.734 3.712   1.00 25.83 ? 173  ALA B CB  1 
ATOM   3706 N  N   . ILE B 1 110 ? 2.036   -33.317 3.384   1.00 24.67 ? 174  ILE B N   1 
ATOM   3707 C  CA  . ILE B 1 110 ? 0.691   -33.653 3.851   1.00 25.66 ? 174  ILE B CA  1 
ATOM   3708 C  C   . ILE B 1 110 ? 0.567   -35.164 3.969   1.00 26.97 ? 174  ILE B C   1 
ATOM   3709 O  O   . ILE B 1 110 ? 0.020   -35.687 4.941   1.00 28.17 ? 174  ILE B O   1 
ATOM   3710 C  CB  . ILE B 1 110 ? -0.393  -33.131 2.878   1.00 24.86 ? 174  ILE B CB  1 
ATOM   3711 C  CG1 . ILE B 1 110 ? -0.333  -31.604 2.804   1.00 25.68 ? 174  ILE B CG1 1 
ATOM   3712 C  CG2 . ILE B 1 110 ? -1.776  -33.574 3.345   1.00 25.16 ? 174  ILE B CG2 1 
ATOM   3713 C  CD1 . ILE B 1 110 ? -1.290  -30.999 1.803   1.00 26.47 ? 174  ILE B CD1 1 
ATOM   3714 N  N   . GLU B 1 111 ? 1.090   -35.861 2.971   1.00 28.54 ? 175  GLU B N   1 
ATOM   3715 C  CA  . GLU B 1 111 ? 1.048   -37.315 2.958   1.00 30.94 ? 175  GLU B CA  1 
ATOM   3716 C  C   . GLU B 1 111 ? 1.763   -37.852 4.198   1.00 29.88 ? 175  GLU B C   1 
ATOM   3717 O  O   . GLU B 1 111 ? 1.297   -38.802 4.830   1.00 29.65 ? 175  GLU B O   1 
ATOM   3718 C  CB  . GLU B 1 111 ? 1.703   -37.828 1.673   1.00 34.62 ? 175  GLU B CB  1 
ATOM   3719 C  CG  . GLU B 1 111 ? 1.662   -39.332 1.479   1.00 41.12 ? 175  GLU B CG  1 
ATOM   3720 C  CD  . GLU B 1 111 ? 2.052   -39.732 0.063   1.00 45.17 ? 175  GLU B CD  1 
ATOM   3721 O  OE1 . GLU B 1 111 ? 1.278   -39.436 -0.876  1.00 47.11 ? 175  GLU B OE1 1 
ATOM   3722 O  OE2 . GLU B 1 111 ? 3.135   -40.332 -0.115  1.00 47.69 ? 175  GLU B OE2 1 
ATOM   3723 N  N   . GLU B 1 112 ? 2.879   -37.221 4.560   1.00 28.55 ? 176  GLU B N   1 
ATOM   3724 C  CA  . GLU B 1 112 ? 3.648   -37.636 5.731   1.00 28.46 ? 176  GLU B CA  1 
ATOM   3725 C  C   . GLU B 1 112 ? 2.903   -37.295 7.022   1.00 26.89 ? 176  GLU B C   1 
ATOM   3726 O  O   . GLU B 1 112 ? 2.912   -38.071 7.975   1.00 26.11 ? 176  GLU B O   1 
ATOM   3727 C  CB  . GLU B 1 112 ? 5.027   -36.963 5.749   1.00 29.54 ? 176  GLU B CB  1 
ATOM   3728 C  CG  . GLU B 1 112 ? 6.045   -37.684 6.636   1.00 35.92 ? 176  GLU B CG  1 
ATOM   3729 C  CD  . GLU B 1 112 ? 7.257   -36.830 7.007   1.00 38.72 ? 176  GLU B CD  1 
ATOM   3730 O  OE1 . GLU B 1 112 ? 7.778   -36.089 6.143   1.00 39.17 ? 176  GLU B OE1 1 
ATOM   3731 O  OE2 . GLU B 1 112 ? 7.701   -36.915 8.173   1.00 41.31 ? 176  GLU B OE2 1 
ATOM   3732 N  N   . MET B 1 113 ? 2.264   -36.130 7.059   1.00 25.90 ? 177  MET B N   1 
ATOM   3733 C  CA  . MET B 1 113 ? 1.514   -35.725 8.246   1.00 27.42 ? 177  MET B CA  1 
ATOM   3734 C  C   . MET B 1 113 ? 0.373   -36.700 8.537   1.00 27.98 ? 177  MET B C   1 
ATOM   3735 O  O   . MET B 1 113 ? 0.120   -37.038 9.687   1.00 29.45 ? 177  MET B O   1 
ATOM   3736 C  CB  . MET B 1 113 ? 0.946   -34.313 8.067   1.00 25.41 ? 177  MET B CB  1 
ATOM   3737 C  CG  . MET B 1 113 ? 1.998   -33.217 8.077   1.00 23.72 ? 177  MET B CG  1 
ATOM   3738 S  SD  . MET B 1 113 ? 1.325   -31.632 7.546   1.00 21.98 ? 177  MET B SD  1 
ATOM   3739 C  CE  . MET B 1 113 ? 0.706   -31.016 9.101   1.00 22.04 ? 177  MET B CE  1 
ATOM   3740 N  N   . GLU B 1 114 ? -0.318  -37.143 7.494   1.00 29.56 ? 178  GLU B N   1 
ATOM   3741 C  CA  . GLU B 1 114 ? -1.416  -38.085 7.670   1.00 32.34 ? 178  GLU B CA  1 
ATOM   3742 C  C   . GLU B 1 114 ? -0.889  -39.431 8.177   1.00 33.59 ? 178  GLU B C   1 
ATOM   3743 O  O   . GLU B 1 114 ? -1.480  -40.026 9.077   1.00 33.30 ? 178  GLU B O   1 
ATOM   3744 C  CB  . GLU B 1 114 ? -2.179  -38.263 6.351   1.00 33.51 ? 178  GLU B CB  1 
ATOM   3745 C  CG  . GLU B 1 114 ? -2.986  -37.024 5.943   1.00 35.43 ? 178  GLU B CG  1 
ATOM   3746 C  CD  . GLU B 1 114 ? -4.486  -37.187 6.156   1.00 36.86 ? 178  GLU B CD  1 
ATOM   3747 O  OE1 . GLU B 1 114 ? -5.199  -36.160 6.203   1.00 37.15 ? 178  GLU B OE1 1 
ATOM   3748 O  OE2 . GLU B 1 114 ? -4.958  -38.340 6.261   1.00 38.19 ? 178  GLU B OE2 1 
ATOM   3749 N  N   . ARG B 1 115 ? 0.227   -39.893 7.612   1.00 35.43 ? 179  ARG B N   1 
ATOM   3750 C  CA  . ARG B 1 115 ? 0.834   -41.159 8.023   1.00 36.61 ? 179  ARG B CA  1 
ATOM   3751 C  C   . ARG B 1 115 ? 1.251   -41.108 9.486   1.00 36.76 ? 179  ARG B C   1 
ATOM   3752 O  O   . ARG B 1 115 ? 1.281   -42.134 10.159  1.00 38.50 ? 179  ARG B O   1 
ATOM   3753 C  CB  . ARG B 1 115 ? 2.070   -41.493 7.174   1.00 36.47 ? 179  ARG B CB  1 
ATOM   3754 C  CG  . ARG B 1 115 ? 1.806   -41.671 5.688   1.00 39.31 ? 179  ARG B CG  1 
ATOM   3755 C  CD  . ARG B 1 115 ? 2.859   -42.579 5.042   1.00 41.00 ? 179  ARG B CD  1 
ATOM   3756 N  NE  . ARG B 1 115 ? 4.229   -42.110 5.253   1.00 43.44 ? 179  ARG B NE  1 
ATOM   3757 C  CZ  . ARG B 1 115 ? 4.780   -41.076 4.620   1.00 44.80 ? 179  ARG B CZ  1 
ATOM   3758 N  NH1 . ARG B 1 115 ? 4.080   -40.392 3.723   1.00 45.80 ? 179  ARG B NH1 1 
ATOM   3759 N  NH2 . ARG B 1 115 ? 6.034   -40.725 4.881   1.00 44.62 ? 179  ARG B NH2 1 
ATOM   3760 N  N   . ASP B 1 116 ? 1.591   -39.917 9.974   1.00 36.76 ? 180  ASP B N   1 
ATOM   3761 C  CA  . ASP B 1 116 ? 1.998   -39.766 11.365  1.00 35.89 ? 180  ASP B CA  1 
ATOM   3762 C  C   . ASP B 1 116 ? 0.766   -39.751 12.255  1.00 34.92 ? 180  ASP B C   1 
ATOM   3763 O  O   . ASP B 1 116 ? 0.878   -39.711 13.482  1.00 33.81 ? 180  ASP B O   1 
ATOM   3764 C  CB  . ASP B 1 116 ? 2.795   -38.470 11.576  1.00 37.47 ? 180  ASP B CB  1 
ATOM   3765 C  CG  . ASP B 1 116 ? 4.185   -38.526 10.967  1.00 39.12 ? 180  ASP B CG  1 
ATOM   3766 O  OD1 . ASP B 1 116 ? 4.855   -39.569 11.111  1.00 40.09 ? 180  ASP B OD1 1 
ATOM   3767 O  OD2 . ASP B 1 116 ? 4.618   -37.524 10.356  1.00 40.60 ? 180  ASP B OD2 1 
ATOM   3768 N  N   . GLY B 1 117 ? -0.408  -39.775 11.633  1.00 34.21 ? 181  GLY B N   1 
ATOM   3769 C  CA  . GLY B 1 117 ? -1.644  -39.777 12.395  1.00 35.23 ? 181  GLY B CA  1 
ATOM   3770 C  C   . GLY B 1 117 ? -1.747  -38.652 13.409  1.00 35.47 ? 181  GLY B C   1 
ATOM   3771 O  O   . GLY B 1 117 ? -1.936  -38.883 14.604  1.00 36.00 ? 181  GLY B O   1 
ATOM   3772 N  N   . LEU B 1 118 ? -1.630  -37.423 12.926  1.00 35.11 ? 182  LEU B N   1 
ATOM   3773 C  CA  . LEU B 1 118 ? -1.715  -36.252 13.787  1.00 33.85 ? 182  LEU B CA  1 
ATOM   3774 C  C   . LEU B 1 118 ? -3.173  -35.941 14.075  1.00 34.33 ? 182  LEU B C   1 
ATOM   3775 O  O   . LEU B 1 118 ? -4.063  -36.352 13.327  1.00 34.43 ? 182  LEU B O   1 
ATOM   3776 C  CB  . LEU B 1 118 ? -1.092  -35.041 13.090  1.00 32.19 ? 182  LEU B CB  1 
ATOM   3777 C  CG  . LEU B 1 118 ? 0.317   -35.203 12.528  1.00 30.02 ? 182  LEU B CG  1 
ATOM   3778 C  CD1 . LEU B 1 118 ? 0.647   -34.013 11.640  1.00 28.72 ? 182  LEU B CD1 1 
ATOM   3779 C  CD2 . LEU B 1 118 ? 1.314   -35.332 13.675  1.00 31.32 ? 182  LEU B CD2 1 
ATOM   3780 N  N   . GLU B 1 119 ? -3.407  -35.207 15.157  1.00 35.09 ? 183  GLU B N   1 
ATOM   3781 C  CA  . GLU B 1 119 ? -4.750  -34.793 15.533  1.00 35.48 ? 183  GLU B CA  1 
ATOM   3782 C  C   . GLU B 1 119 ? -4.973  -33.380 14.997  1.00 34.84 ? 183  GLU B C   1 
ATOM   3783 O  O   . GLU B 1 119 ? -6.055  -33.047 14.511  1.00 34.52 ? 183  GLU B O   1 
ATOM   3784 C  CB  . GLU B 1 119 ? -4.907  -34.761 17.055  1.00 37.90 ? 183  GLU B CB  1 
ATOM   3785 C  CG  . GLU B 1 119 ? -4.810  -36.111 17.747  1.00 42.63 ? 183  GLU B CG  1 
ATOM   3786 C  CD  . GLU B 1 119 ? -4.995  -35.999 19.253  1.00 45.24 ? 183  GLU B CD  1 
ATOM   3787 O  OE1 . GLU B 1 119 ? -6.017  -35.418 19.684  1.00 47.23 ? 183  GLU B OE1 1 
ATOM   3788 O  OE2 . GLU B 1 119 ? -4.123  -36.491 20.005  1.00 45.82 ? 183  GLU B OE2 1 
ATOM   3789 N  N   . ARG B 1 120 ? -3.926  -32.562 15.082  1.00 32.37 ? 184  ARG B N   1 
ATOM   3790 C  CA  . ARG B 1 120 ? -3.985  -31.168 14.657  1.00 31.46 ? 184  ARG B CA  1 
ATOM   3791 C  C   . ARG B 1 120 ? -2.966  -30.844 13.560  1.00 29.33 ? 184  ARG B C   1 
ATOM   3792 O  O   . ARG B 1 120 ? -1.787  -31.187 13.676  1.00 29.97 ? 184  ARG B O   1 
ATOM   3793 C  CB  . ARG B 1 120 ? -3.710  -30.276 15.868  1.00 34.19 ? 184  ARG B CB  1 
ATOM   3794 C  CG  . ARG B 1 120 ? -4.525  -29.003 15.952  1.00 37.78 ? 184  ARG B CG  1 
ATOM   3795 C  CD  . ARG B 1 120 ? -3.836  -28.014 16.883  1.00 41.91 ? 184  ARG B CD  1 
ATOM   3796 N  NE  . ARG B 1 120 ? -4.775  -27.257 17.710  1.00 46.31 ? 184  ARG B NE  1 
ATOM   3797 C  CZ  . ARG B 1 120 ? -5.417  -27.765 18.757  1.00 48.06 ? 184  ARG B CZ  1 
ATOM   3798 N  NH1 . ARG B 1 120 ? -5.223  -29.029 19.105  1.00 47.29 ? 184  ARG B NH1 1 
ATOM   3799 N  NH2 . ARG B 1 120 ? -6.252  -27.009 19.459  1.00 50.18 ? 184  ARG B NH2 1 
ATOM   3800 N  N   . ALA B 1 121 ? -3.424  -30.172 12.509  1.00 26.26 ? 185  ALA B N   1 
ATOM   3801 C  CA  . ALA B 1 121 ? -2.558  -29.773 11.401  1.00 24.31 ? 185  ALA B CA  1 
ATOM   3802 C  C   . ALA B 1 121 ? -2.698  -28.272 11.171  1.00 22.54 ? 185  ALA B C   1 
ATOM   3803 O  O   . ALA B 1 121 ? -3.793  -27.774 10.910  1.00 22.51 ? 185  ALA B O   1 
ATOM   3804 C  CB  . ALA B 1 121 ? -2.932  -30.532 10.126  1.00 24.09 ? 185  ALA B CB  1 
ATOM   3805 N  N   . ILE B 1 122 ? -1.582  -27.557 11.266  1.00 21.20 ? 186  ILE B N   1 
ATOM   3806 C  CA  . ILE B 1 122 ? -1.579  -26.111 11.077  1.00 18.72 ? 186  ILE B CA  1 
ATOM   3807 C  C   . ILE B 1 122 ? -0.763  -25.679 9.857   1.00 17.99 ? 186  ILE B C   1 
ATOM   3808 O  O   . ILE B 1 122 ? 0.449   -25.893 9.808   1.00 17.84 ? 186  ILE B O   1 
ATOM   3809 C  CB  . ILE B 1 122 ? -1.009  -25.403 12.327  1.00 18.91 ? 186  ILE B CB  1 
ATOM   3810 C  CG1 . ILE B 1 122 ? -1.925  -25.661 13.522  1.00 18.74 ? 186  ILE B CG1 1 
ATOM   3811 C  CG2 . ILE B 1 122 ? -0.873  -23.904 12.074  1.00 19.14 ? 186  ILE B CG2 1 
ATOM   3812 C  CD1 . ILE B 1 122 ? -1.310  -25.273 14.848  1.00 18.48 ? 186  ILE B CD1 1 
ATOM   3813 N  N   . ALA B 1 123 ? -1.436  -25.085 8.874   1.00 16.88 ? 187  ALA B N   1 
ATOM   3814 C  CA  . ALA B 1 123 ? -0.770  -24.587 7.668   1.00 16.25 ? 187  ALA B CA  1 
ATOM   3815 C  C   . ALA B 1 123 ? -0.160  -23.233 8.050   1.00 16.38 ? 187  ALA B C   1 
ATOM   3816 O  O   . ALA B 1 123 ? -0.854  -22.224 8.097   1.00 14.69 ? 187  ALA B O   1 
ATOM   3817 C  CB  . ALA B 1 123 ? -1.780  -24.412 6.534   1.00 14.27 ? 187  ALA B CB  1 
ATOM   3818 N  N   . PHE B 1 124 ? 1.139   -23.225 8.324   1.00 14.95 ? 188  PHE B N   1 
ATOM   3819 C  CA  . PHE B 1 124 ? 1.824   -22.009 8.751   1.00 15.97 ? 188  PHE B CA  1 
ATOM   3820 C  C   . PHE B 1 124 ? 2.654   -21.390 7.631   1.00 16.03 ? 188  PHE B C   1 
ATOM   3821 O  O   . PHE B 1 124 ? 3.795   -21.789 7.399   1.00 17.96 ? 188  PHE B O   1 
ATOM   3822 C  CB  . PHE B 1 124 ? 2.718   -22.349 9.951   1.00 16.01 ? 188  PHE B CB  1 
ATOM   3823 C  CG  . PHE B 1 124 ? 3.256   -21.151 10.680  1.00 15.53 ? 188  PHE B CG  1 
ATOM   3824 C  CD1 . PHE B 1 124 ? 4.048   -21.319 11.805  1.00 14.68 ? 188  PHE B CD1 1 
ATOM   3825 C  CD2 . PHE B 1 124 ? 2.963   -19.859 10.257  1.00 16.48 ? 188  PHE B CD2 1 
ATOM   3826 C  CE1 . PHE B 1 124 ? 4.539   -20.214 12.500  1.00 15.85 ? 188  PHE B CE1 1 
ATOM   3827 C  CE2 . PHE B 1 124 ? 3.450   -18.754 10.946  1.00 14.79 ? 188  PHE B CE2 1 
ATOM   3828 C  CZ  . PHE B 1 124 ? 4.237   -18.934 12.068  1.00 13.51 ? 188  PHE B CZ  1 
ATOM   3829 N  N   . THR B 1 125 ? 2.089   -20.407 6.941   1.00 16.20 ? 189  THR B N   1 
ATOM   3830 C  CA  . THR B 1 125 ? 2.810   -19.771 5.852   1.00 16.27 ? 189  THR B CA  1 
ATOM   3831 C  C   . THR B 1 125 ? 4.046   -19.045 6.369   1.00 15.87 ? 189  THR B C   1 
ATOM   3832 O  O   . THR B 1 125 ? 4.017   -18.426 7.432   1.00 15.75 ? 189  THR B O   1 
ATOM   3833 C  CB  . THR B 1 125 ? 1.919   -18.766 5.083   1.00 16.71 ? 189  THR B CB  1 
ATOM   3834 O  OG1 . THR B 1 125 ? 2.661   -18.232 3.981   1.00 18.62 ? 189  THR B OG1 1 
ATOM   3835 C  CG2 . THR B 1 125 ? 1.475   -17.626 5.986   1.00 13.51 ? 189  THR B CG2 1 
ATOM   3836 N  N   . GLN B 1 126 ? 5.136   -19.137 5.623   1.00 15.42 ? 190  GLN B N   1 
ATOM   3837 C  CA  . GLN B 1 126 ? 6.361   -18.475 6.022   1.00 15.50 ? 190  GLN B CA  1 
ATOM   3838 C  C   . GLN B 1 126 ? 6.501   -17.116 5.344   1.00 16.51 ? 190  GLN B C   1 
ATOM   3839 O  O   . GLN B 1 126 ? 7.556   -16.491 5.393   1.00 16.00 ? 190  GLN B O   1 
ATOM   3840 C  CB  . GLN B 1 126 ? 7.566   -19.375 5.737   1.00 16.58 ? 190  GLN B CB  1 
ATOM   3841 C  CG  . GLN B 1 126 ? 7.551   -20.642 6.580   1.00 18.25 ? 190  GLN B CG  1 
ATOM   3842 C  CD  . GLN B 1 126 ? 7.457   -20.345 8.078   1.00 19.77 ? 190  GLN B CD  1 
ATOM   3843 O  OE1 . GLN B 1 126 ? 8.382   -19.789 8.671   1.00 21.22 ? 190  GLN B OE1 1 
ATOM   3844 N  NE2 . GLN B 1 126 ? 6.333   -20.711 8.690   1.00 19.87 ? 190  GLN B NE2 1 
ATOM   3845 N  N   . TYR B 1 127 ? 5.426   -16.671 4.698   1.00 17.75 ? 191  TYR B N   1 
ATOM   3846 C  CA  . TYR B 1 127 ? 5.389   -15.356 4.076   1.00 18.81 ? 191  TYR B CA  1 
ATOM   3847 C  C   . TYR B 1 127 ? 4.554   -14.521 5.046   1.00 17.85 ? 191  TYR B C   1 
ATOM   3848 O  O   . TYR B 1 127 ? 3.361   -14.766 5.209   1.00 17.14 ? 191  TYR B O   1 
ATOM   3849 C  CB  . TYR B 1 127 ? 4.661   -15.377 2.728   1.00 22.10 ? 191  TYR B CB  1 
ATOM   3850 C  CG  . TYR B 1 127 ? 5.276   -16.249 1.667   1.00 25.68 ? 191  TYR B CG  1 
ATOM   3851 C  CD1 . TYR B 1 127 ? 4.751   -17.509 1.385   1.00 26.43 ? 191  TYR B CD1 1 
ATOM   3852 C  CD2 . TYR B 1 127 ? 6.371   -15.807 0.927   1.00 28.64 ? 191  TYR B CD2 1 
ATOM   3853 C  CE1 . TYR B 1 127 ? 5.296   -18.303 0.392   1.00 29.25 ? 191  TYR B CE1 1 
ATOM   3854 C  CE2 . TYR B 1 127 ? 6.926   -16.596 -0.071  1.00 30.62 ? 191  TYR B CE2 1 
ATOM   3855 C  CZ  . TYR B 1 127 ? 6.382   -17.839 -0.333  1.00 30.18 ? 191  TYR B CZ  1 
ATOM   3856 O  OH  . TYR B 1 127 ? 6.923   -18.617 -1.324  1.00 32.08 ? 191  TYR B OH  1 
ATOM   3857 N  N   . PRO B 1 128 ? 5.166   -13.539 5.715   1.00 17.36 ? 192  PRO B N   1 
ATOM   3858 C  CA  . PRO B 1 128 ? 4.397   -12.713 6.655   1.00 17.37 ? 192  PRO B CA  1 
ATOM   3859 C  C   . PRO B 1 128 ? 3.281   -11.908 5.977   1.00 16.51 ? 192  PRO B C   1 
ATOM   3860 O  O   . PRO B 1 128 ? 2.224   -11.681 6.565   1.00 16.09 ? 192  PRO B O   1 
ATOM   3861 C  CB  . PRO B 1 128 ? 5.459   -11.808 7.275   1.00 16.53 ? 192  PRO B CB  1 
ATOM   3862 C  CG  . PRO B 1 128 ? 6.696   -12.653 7.220   1.00 18.06 ? 192  PRO B CG  1 
ATOM   3863 C  CD  . PRO B 1 128 ? 6.607   -13.265 5.829   1.00 16.86 ? 192  PRO B CD  1 
ATOM   3864 N  N   . GLN B 1 129 ? 3.520   -11.475 4.742   1.00 15.45 ? 193  GLN B N   1 
ATOM   3865 C  CA  . GLN B 1 129 ? 2.524   -10.695 4.014   1.00 13.18 ? 193  GLN B CA  1 
ATOM   3866 C  C   . GLN B 1 129 ? 1.856   -11.570 2.959   1.00 12.21 ? 193  GLN B C   1 
ATOM   3867 O  O   . GLN B 1 129 ? 2.513   -12.134 2.086   1.00 10.42 ? 193  GLN B O   1 
ATOM   3868 C  CB  . GLN B 1 129 ? 3.163   -9.470  3.360   1.00 12.69 ? 193  GLN B CB  1 
ATOM   3869 C  CG  . GLN B 1 129 ? 3.939   -8.584  4.315   1.00 13.99 ? 193  GLN B CG  1 
ATOM   3870 C  CD  . GLN B 1 129 ? 5.428   -8.894  4.329   1.00 14.00 ? 193  GLN B CD  1 
ATOM   3871 O  OE1 . GLN B 1 129 ? 5.910   -9.733  3.565   1.00 14.28 ? 193  GLN B OE1 1 
ATOM   3872 N  NE2 . GLN B 1 129 ? 6.164   -8.206  5.188   1.00 9.70  ? 193  GLN B NE2 1 
ATOM   3873 N  N   . TYR B 1 130 ? 0.539   -11.672 3.053   1.00 10.98 ? 194  TYR B N   1 
ATOM   3874 C  CA  . TYR B 1 130 ? -0.233  -12.508 2.154   1.00 13.33 ? 194  TYR B CA  1 
ATOM   3875 C  C   . TYR B 1 130 ? -0.312  -12.071 0.697   1.00 14.52 ? 194  TYR B C   1 
ATOM   3876 O  O   . TYR B 1 130 ? -0.572  -10.914 0.376   1.00 16.15 ? 194  TYR B O   1 
ATOM   3877 C  CB  . TYR B 1 130 ? -1.658  -12.652 2.689   1.00 13.82 ? 194  TYR B CB  1 
ATOM   3878 C  CG  . TYR B 1 130 ? -2.515  -13.659 1.948   1.00 15.06 ? 194  TYR B CG  1 
ATOM   3879 C  CD1 . TYR B 1 130 ? -2.660  -14.959 2.426   1.00 16.65 ? 194  TYR B CD1 1 
ATOM   3880 C  CD2 . TYR B 1 130 ? -3.188  -13.312 0.770   1.00 16.59 ? 194  TYR B CD2 1 
ATOM   3881 C  CE1 . TYR B 1 130 ? -3.447  -15.891 1.760   1.00 15.13 ? 194  TYR B CE1 1 
ATOM   3882 C  CE2 . TYR B 1 130 ? -3.985  -14.246 0.091   1.00 16.31 ? 194  TYR B CE2 1 
ATOM   3883 C  CZ  . TYR B 1 130 ? -4.103  -15.533 0.597   1.00 17.40 ? 194  TYR B CZ  1 
ATOM   3884 O  OH  . TYR B 1 130 ? -4.859  -16.477 -0.060  1.00 19.60 ? 194  TYR B OH  1 
ATOM   3885 N  N   . SER B 1 131 ? -0.078  -13.028 -0.185  1.00 14.93 ? 195  SER B N   1 
ATOM   3886 C  CA  . SER B 1 131 ? -0.219  -12.788 -1.606  1.00 15.28 ? 195  SER B CA  1 
ATOM   3887 C  C   . SER B 1 131 ? -0.888  -14.042 -2.144  1.00 16.15 ? 195  SER B C   1 
ATOM   3888 O  O   . SER B 1 131 ? -0.545  -15.157 -1.745  1.00 14.84 ? 195  SER B O   1 
ATOM   3889 C  CB  . SER B 1 131 ? 1.128   -12.600 -2.286  1.00 16.34 ? 195  SER B CB  1 
ATOM   3890 O  OG  . SER B 1 131 ? 0.916   -12.341 -3.654  1.00 17.80 ? 195  SER B OG  1 
ATOM   3891 N  N   . CYS B 1 132 ? -1.846  -13.865 -3.040  1.00 17.20 ? 196  CYS B N   1 
ATOM   3892 C  CA  . CYS B 1 132 ? -2.534  -15.007 -3.619  1.00 19.15 ? 196  CYS B CA  1 
ATOM   3893 C  C   . CYS B 1 132 ? -1.542  -15.845 -4.425  1.00 19.02 ? 196  CYS B C   1 
ATOM   3894 O  O   . CYS B 1 132 ? -1.759  -17.031 -4.656  1.00 18.49 ? 196  CYS B O   1 
ATOM   3895 C  CB  . CYS B 1 132 ? -3.691  -14.511 -4.489  1.00 20.20 ? 196  CYS B CB  1 
ATOM   3896 S  SG  . CYS B 1 132 ? -4.814  -13.398 -3.567  1.00 24.55 ? 196  CYS B SG  1 
ATOM   3897 N  N   . SER B 1 133 ? -0.431  -15.231 -4.820  1.00 20.02 ? 197  SER B N   1 
ATOM   3898 C  CA  . SER B 1 133 ? 0.580   -15.936 -5.595  1.00 20.85 ? 197  SER B CA  1 
ATOM   3899 C  C   . SER B 1 133 ? 1.561   -16.717 -4.719  1.00 20.61 ? 197  SER B C   1 
ATOM   3900 O  O   . SER B 1 133 ? 2.237   -17.626 -5.198  1.00 20.81 ? 197  SER B O   1 
ATOM   3901 C  CB  . SER B 1 133 ? 1.349   -14.954 -6.496  1.00 22.21 ? 197  SER B CB  1 
ATOM   3902 O  OG  . SER B 1 133 ? 2.070   -13.990 -5.744  1.00 25.14 ? 197  SER B OG  1 
ATOM   3903 N  N   . THR B 1 134 ? 1.641   -16.370 -3.437  1.00 20.23 ? 198  THR B N   1 
ATOM   3904 C  CA  . THR B 1 134 ? 2.551   -17.066 -2.534  1.00 18.38 ? 198  THR B CA  1 
ATOM   3905 C  C   . THR B 1 134 ? 1.778   -17.926 -1.546  1.00 18.64 ? 198  THR B C   1 
ATOM   3906 O  O   . THR B 1 134 ? 1.641   -19.137 -1.746  1.00 18.63 ? 198  THR B O   1 
ATOM   3907 C  CB  . THR B 1 134 ? 3.459   -16.078 -1.756  1.00 18.03 ? 198  THR B CB  1 
ATOM   3908 O  OG1 . THR B 1 134 ? 2.659   -15.067 -1.130  1.00 18.74 ? 198  THR B OG1 1 
ATOM   3909 C  CG2 . THR B 1 134 ? 4.463   -15.420 -2.700  1.00 16.91 ? 198  THR B CG2 1 
ATOM   3910 N  N   . THR B 1 135 ? 1.278   -17.306 -0.480  1.00 17.43 ? 199  THR B N   1 
ATOM   3911 C  CA  . THR B 1 135 ? 0.513   -18.038 0.523   1.00 17.19 ? 199  THR B CA  1 
ATOM   3912 C  C   . THR B 1 135 ? -0.737  -18.656 -0.113  1.00 15.94 ? 199  THR B C   1 
ATOM   3913 O  O   . THR B 1 135 ? -1.068  -19.808 0.147   1.00 15.58 ? 199  THR B O   1 
ATOM   3914 C  CB  . THR B 1 135 ? 0.066   -17.115 1.685   1.00 17.82 ? 199  THR B CB  1 
ATOM   3915 O  OG1 . THR B 1 135 ? 1.217   -16.580 2.350   1.00 17.86 ? 199  THR B OG1 1 
ATOM   3916 C  CG2 . THR B 1 135 ? -0.781  -17.898 2.685   1.00 17.20 ? 199  THR B CG2 1 
ATOM   3917 N  N   . GLY B 1 136 ? -1.430  -17.879 -0.938  1.00 15.73 ? 200  GLY B N   1 
ATOM   3918 C  CA  . GLY B 1 136 ? -2.630  -18.376 -1.589  1.00 17.92 ? 200  GLY B CA  1 
ATOM   3919 C  C   . GLY B 1 136 ? -2.396  -19.665 -2.357  1.00 19.56 ? 200  GLY B C   1 
ATOM   3920 O  O   . GLY B 1 136 ? -3.152  -20.624 -2.224  1.00 18.82 ? 200  GLY B O   1 
ATOM   3921 N  N   . SER B 1 137 ? -1.337  -19.684 -3.161  1.00 20.28 ? 201  SER B N   1 
ATOM   3922 C  CA  . SER B 1 137 ? -0.989  -20.854 -3.952  1.00 21.72 ? 201  SER B CA  1 
ATOM   3923 C  C   . SER B 1 137 ? -0.690  -22.071 -3.065  1.00 21.52 ? 201  SER B C   1 
ATOM   3924 O  O   . SER B 1 137 ? -1.043  -23.198 -3.411  1.00 20.96 ? 201  SER B O   1 
ATOM   3925 C  CB  . SER B 1 137 ? 0.223   -20.541 -4.833  1.00 21.71 ? 201  SER B CB  1 
ATOM   3926 O  OG  . SER B 1 137 ? 0.649   -21.694 -5.530  1.00 23.69 ? 201  SER B OG  1 
ATOM   3927 N  N   . SER B 1 138 ? -0.037  -21.834 -1.929  1.00 21.05 ? 202  SER B N   1 
ATOM   3928 C  CA  . SER B 1 138 ? 0.300   -22.909 -1.003  1.00 21.39 ? 202  SER B CA  1 
ATOM   3929 C  C   . SER B 1 138 ? -0.952  -23.475 -0.342  1.00 20.89 ? 202  SER B C   1 
ATOM   3930 O  O   . SER B 1 138 ? -1.075  -24.689 -0.175  1.00 22.25 ? 202  SER B O   1 
ATOM   3931 C  CB  . SER B 1 138 ? 1.274   -22.410 0.072   1.00 21.75 ? 202  SER B CB  1 
ATOM   3932 O  OG  . SER B 1 138 ? 2.593   -22.308 -0.446  1.00 26.10 ? 202  SER B OG  1 
ATOM   3933 N  N   . LEU B 1 139 ? -1.876  -22.598 0.041   1.00 18.70 ? 203  LEU B N   1 
ATOM   3934 C  CA  . LEU B 1 139 ? -3.107  -23.060 0.658   1.00 19.65 ? 203  LEU B CA  1 
ATOM   3935 C  C   . LEU B 1 139 ? -3.940  -23.822 -0.387  1.00 18.87 ? 203  LEU B C   1 
ATOM   3936 O  O   . LEU B 1 139 ? -4.576  -24.830 -0.068  1.00 17.82 ? 203  LEU B O   1 
ATOM   3937 C  CB  . LEU B 1 139 ? -3.893  -21.876 1.242   1.00 18.01 ? 203  LEU B CB  1 
ATOM   3938 C  CG  . LEU B 1 139 ? -3.161  -21.079 2.337   1.00 17.85 ? 203  LEU B CG  1 
ATOM   3939 C  CD1 . LEU B 1 139 ? -4.055  -19.966 2.885   1.00 16.14 ? 203  LEU B CD1 1 
ATOM   3940 C  CD2 . LEU B 1 139 ? -2.754  -22.008 3.456   1.00 15.25 ? 203  LEU B CD2 1 
ATOM   3941 N  N   . ASN B 1 140 ? -3.920  -23.353 -1.634  1.00 19.39 ? 204  ASN B N   1 
ATOM   3942 C  CA  . ASN B 1 140 ? -4.662  -24.017 -2.703  1.00 19.07 ? 204  ASN B CA  1 
ATOM   3943 C  C   . ASN B 1 140 ? -4.149  -25.438 -2.931  1.00 19.53 ? 204  ASN B C   1 
ATOM   3944 O  O   . ASN B 1 140 ? -4.921  -26.336 -3.256  1.00 19.08 ? 204  ASN B O   1 
ATOM   3945 C  CB  . ASN B 1 140 ? -4.558  -23.243 -4.020  1.00 18.74 ? 204  ASN B CB  1 
ATOM   3946 C  CG  . ASN B 1 140 ? -5.287  -21.917 -3.982  1.00 19.97 ? 204  ASN B CG  1 
ATOM   3947 O  OD1 . ASN B 1 140 ? -6.247  -21.744 -3.234  1.00 20.93 ? 204  ASN B OD1 1 
ATOM   3948 N  ND2 . ASN B 1 140 ? -4.843  -20.975 -4.805  1.00 21.69 ? 204  ASN B ND2 1 
ATOM   3949 N  N   . ALA B 1 141 ? -2.846  -25.639 -2.767  1.00 19.48 ? 205  ALA B N   1 
ATOM   3950 C  CA  . ALA B 1 141 ? -2.255  -26.959 -2.954  1.00 19.90 ? 205  ALA B CA  1 
ATOM   3951 C  C   . ALA B 1 141 ? -2.746  -27.941 -1.887  1.00 19.83 ? 205  ALA B C   1 
ATOM   3952 O  O   . ALA B 1 141 ? -2.876  -29.134 -2.145  1.00 20.52 ? 205  ALA B O   1 
ATOM   3953 C  CB  . ALA B 1 141 ? -0.730  -26.860 -2.915  1.00 19.52 ? 205  ALA B CB  1 
ATOM   3954 N  N   . ILE B 1 142 ? -3.008  -27.443 -0.683  1.00 19.37 ? 206  ILE B N   1 
ATOM   3955 C  CA  . ILE B 1 142 ? -3.487  -28.309 0.385   1.00 19.49 ? 206  ILE B CA  1 
ATOM   3956 C  C   . ILE B 1 142 ? -4.890  -28.773 0.026   1.00 20.95 ? 206  ILE B C   1 
ATOM   3957 O  O   . ILE B 1 142 ? -5.205  -29.958 0.112   1.00 22.05 ? 206  ILE B O   1 
ATOM   3958 C  CB  . ILE B 1 142 ? -3.517  -27.574 1.733   1.00 18.85 ? 206  ILE B CB  1 
ATOM   3959 C  CG1 . ILE B 1 142 ? -2.101  -27.112 2.094   1.00 17.78 ? 206  ILE B CG1 1 
ATOM   3960 C  CG2 . ILE B 1 142 ? -4.097  -28.483 2.812   1.00 17.87 ? 206  ILE B CG2 1 
ATOM   3961 C  CD1 . ILE B 1 142 ? -2.023  -26.292 3.374   1.00 14.62 ? 206  ILE B CD1 1 
ATOM   3962 N  N   . TYR B 1 143 ? -5.730  -27.834 -0.387  1.00 22.13 ? 207  TYR B N   1 
ATOM   3963 C  CA  . TYR B 1 143 ? -7.094  -28.166 -0.777  1.00 23.40 ? 207  TYR B CA  1 
ATOM   3964 C  C   . TYR B 1 143 ? -7.084  -29.122 -1.974  1.00 23.72 ? 207  TYR B C   1 
ATOM   3965 O  O   . TYR B 1 143 ? -7.771  -30.145 -1.975  1.00 21.58 ? 207  TYR B O   1 
ATOM   3966 C  CB  . TYR B 1 143 ? -7.868  -26.902 -1.156  1.00 24.37 ? 207  TYR B CB  1 
ATOM   3967 C  CG  . TYR B 1 143 ? -9.145  -27.204 -1.905  1.00 27.50 ? 207  TYR B CG  1 
ATOM   3968 C  CD1 . TYR B 1 143 ? -10.253 -27.746 -1.249  1.00 27.00 ? 207  TYR B CD1 1 
ATOM   3969 C  CD2 . TYR B 1 143 ? -9.217  -27.022 -3.286  1.00 27.42 ? 207  TYR B CD2 1 
ATOM   3970 C  CE1 . TYR B 1 143 ? -11.398 -28.107 -1.955  1.00 29.28 ? 207  TYR B CE1 1 
ATOM   3971 C  CE2 . TYR B 1 143 ? -10.353 -27.380 -3.999  1.00 29.68 ? 207  TYR B CE2 1 
ATOM   3972 C  CZ  . TYR B 1 143 ? -11.436 -27.923 -3.331  1.00 29.70 ? 207  TYR B CZ  1 
ATOM   3973 O  OH  . TYR B 1 143 ? -12.545 -28.302 -4.052  1.00 32.59 ? 207  TYR B OH  1 
ATOM   3974 N  N   . ARG B 1 144 ? -6.305  -28.777 -2.993  1.00 24.09 ? 208  ARG B N   1 
ATOM   3975 C  CA  . ARG B 1 144 ? -6.216  -29.601 -4.190  1.00 26.70 ? 208  ARG B CA  1 
ATOM   3976 C  C   . ARG B 1 144 ? -5.694  -30.997 -3.897  1.00 26.45 ? 208  ARG B C   1 
ATOM   3977 O  O   . ARG B 1 144 ? -6.056  -31.947 -4.583  1.00 26.35 ? 208  ARG B O   1 
ATOM   3978 C  CB  . ARG B 1 144 ? -5.316  -28.946 -5.240  1.00 28.55 ? 208  ARG B CB  1 
ATOM   3979 C  CG  . ARG B 1 144 ? -5.922  -27.744 -5.943  1.00 31.33 ? 208  ARG B CG  1 
ATOM   3980 C  CD  . ARG B 1 144 ? -5.465  -27.727 -7.392  1.00 35.36 ? 208  ARG B CD  1 
ATOM   3981 N  NE  . ARG B 1 144 ? -5.924  -26.553 -8.129  1.00 38.04 ? 208  ARG B NE  1 
ATOM   3982 C  CZ  . ARG B 1 144 ? -5.408  -25.338 -7.989  1.00 40.12 ? 208  ARG B CZ  1 
ATOM   3983 N  NH1 . ARG B 1 144 ? -4.414  -25.138 -7.135  1.00 41.05 ? 208  ARG B NH1 1 
ATOM   3984 N  NH2 . ARG B 1 144 ? -5.878  -24.328 -8.711  1.00 40.72 ? 208  ARG B NH2 1 
ATOM   3985 N  N   . TYR B 1 145 ? -4.837  -31.126 -2.889  1.00 26.24 ? 209  TYR B N   1 
ATOM   3986 C  CA  . TYR B 1 145 ? -4.294  -32.434 -2.548  1.00 26.77 ? 209  TYR B CA  1 
ATOM   3987 C  C   . TYR B 1 145 ? -5.405  -33.384 -2.113  1.00 27.65 ? 209  TYR B C   1 
ATOM   3988 O  O   . TYR B 1 145 ? -5.490  -34.514 -2.587  1.00 27.97 ? 209  TYR B O   1 
ATOM   3989 C  CB  . TYR B 1 145 ? -3.274  -32.328 -1.416  1.00 26.67 ? 209  TYR B CB  1 
ATOM   3990 C  CG  . TYR B 1 145 ? -2.881  -33.676 -0.849  1.00 28.25 ? 209  TYR B CG  1 
ATOM   3991 C  CD1 . TYR B 1 145 ? -1.944  -34.481 -1.496  1.00 29.56 ? 209  TYR B CD1 1 
ATOM   3992 C  CD2 . TYR B 1 145 ? -3.484  -34.169 0.305   1.00 26.51 ? 209  TYR B CD2 1 
ATOM   3993 C  CE1 . TYR B 1 145 ? -1.618  -35.747 -1.006  1.00 30.31 ? 209  TYR B CE1 1 
ATOM   3994 C  CE2 . TYR B 1 145 ? -3.168  -35.430 0.801   1.00 28.04 ? 209  TYR B CE2 1 
ATOM   3995 C  CZ  . TYR B 1 145 ? -2.235  -36.212 0.140   1.00 29.52 ? 209  TYR B CZ  1 
ATOM   3996 O  OH  . TYR B 1 145 ? -1.917  -37.460 0.625   1.00 32.20 ? 209  TYR B OH  1 
ATOM   3997 N  N   . TYR B 1 146 ? -6.248  -32.928 -1.195  1.00 28.26 ? 210  TYR B N   1 
ATOM   3998 C  CA  . TYR B 1 146 ? -7.325  -33.764 -0.705  1.00 29.74 ? 210  TYR B CA  1 
ATOM   3999 C  C   . TYR B 1 146 ? -8.382  -34.008 -1.758  1.00 32.74 ? 210  TYR B C   1 
ATOM   4000 O  O   . TYR B 1 146 ? -8.964  -35.090 -1.830  1.00 32.71 ? 210  TYR B O   1 
ATOM   4001 C  CB  . TYR B 1 146 ? -7.956  -33.135 0.528   1.00 26.62 ? 210  TYR B CB  1 
ATOM   4002 C  CG  . TYR B 1 146 ? -7.087  -33.271 1.745   1.00 25.25 ? 210  TYR B CG  1 
ATOM   4003 C  CD1 . TYR B 1 146 ? -6.384  -32.177 2.257   1.00 22.19 ? 210  TYR B CD1 1 
ATOM   4004 C  CD2 . TYR B 1 146 ? -6.939  -34.508 2.370   1.00 23.37 ? 210  TYR B CD2 1 
ATOM   4005 C  CE1 . TYR B 1 146 ? -5.556  -32.319 3.366   1.00 21.72 ? 210  TYR B CE1 1 
ATOM   4006 C  CE2 . TYR B 1 146 ? -6.118  -34.659 3.472   1.00 23.57 ? 210  TYR B CE2 1 
ATOM   4007 C  CZ  . TYR B 1 146 ? -5.431  -33.564 3.968   1.00 21.97 ? 210  TYR B CZ  1 
ATOM   4008 O  OH  . TYR B 1 146 ? -4.645  -33.725 5.079   1.00 21.35 ? 210  TYR B OH  1 
ATOM   4009 N  N   . ASN B 1 147 ? -8.621  -32.999 -2.584  1.00 36.24 ? 211  ASN B N   1 
ATOM   4010 C  CA  . ASN B 1 147 ? -9.615  -33.111 -3.633  1.00 39.96 ? 211  ASN B CA  1 
ATOM   4011 C  C   . ASN B 1 147 ? -9.116  -34.056 -4.724  1.00 41.38 ? 211  ASN B C   1 
ATOM   4012 O  O   . ASN B 1 147 ? -9.907  -34.773 -5.332  1.00 41.94 ? 211  ASN B O   1 
ATOM   4013 C  CB  . ASN B 1 147 ? -9.923  -31.722 -4.200  1.00 41.84 ? 211  ASN B CB  1 
ATOM   4014 C  CG  . ASN B 1 147 ? -11.229 -31.680 -4.966  1.00 44.42 ? 211  ASN B CG  1 
ATOM   4015 O  OD1 . ASN B 1 147 ? -11.262 -31.892 -6.178  1.00 45.32 ? 211  ASN B OD1 1 
ATOM   4016 N  ND2 . ASN B 1 147 ? -12.319 -31.417 -4.255  1.00 45.08 ? 211  ASN B ND2 1 
ATOM   4017 N  N   . GLN B 1 148 ? -7.804  -34.078 -4.955  1.00 42.51 ? 212  GLN B N   1 
ATOM   4018 C  CA  . GLN B 1 148 ? -7.236  -34.958 -5.978  1.00 43.47 ? 212  GLN B CA  1 
ATOM   4019 C  C   . GLN B 1 148 ? -7.097  -36.395 -5.473  1.00 43.21 ? 212  GLN B C   1 
ATOM   4020 O  O   . GLN B 1 148 ? -7.248  -37.349 -6.240  1.00 43.52 ? 212  GLN B O   1 
ATOM   4021 C  CB  . GLN B 1 148 ? -5.853  -34.468 -6.428  1.00 45.60 ? 212  GLN B CB  1 
ATOM   4022 C  CG  . GLN B 1 148 ? -4.724  -34.807 -5.450  1.00 49.03 ? 212  GLN B CG  1 
ATOM   4023 C  CD  . GLN B 1 148 ? -3.336  -34.801 -6.093  1.00 51.67 ? 212  GLN B CD  1 
ATOM   4024 O  OE1 . GLN B 1 148 ? -2.330  -35.079 -5.429  1.00 51.60 ? 212  GLN B OE1 1 
ATOM   4025 N  NE2 . GLN B 1 148 ? -3.278  -34.488 -7.387  1.00 51.86 ? 212  GLN B NE2 1 
ATOM   4026 N  N   . VAL B 1 149 ? -6.796  -36.547 -4.187  1.00 42.20 ? 213  VAL B N   1 
ATOM   4027 C  CA  . VAL B 1 149 ? -6.625  -37.871 -3.602  1.00 41.55 ? 213  VAL B CA  1 
ATOM   4028 C  C   . VAL B 1 149 ? -7.985  -38.517 -3.362  1.00 42.45 ? 213  VAL B C   1 
ATOM   4029 O  O   . VAL B 1 149 ? -8.077  -39.710 -3.065  1.00 42.60 ? 213  VAL B O   1 
ATOM   4030 C  CB  . VAL B 1 149 ? -5.848  -37.797 -2.267  1.00 40.60 ? 213  VAL B CB  1 
ATOM   4031 C  CG1 . VAL B 1 149 ? -6.751  -37.294 -1.159  1.00 40.07 ? 213  VAL B CG1 1 
ATOM   4032 C  CG2 . VAL B 1 149 ? -5.273  -39.153 -1.926  1.00 40.33 ? 213  VAL B CG2 1 
ATOM   4033 N  N   . GLY B 1 150 ? -9.038  -37.717 -3.497  1.00 42.51 ? 214  GLY B N   1 
ATOM   4034 C  CA  . GLY B 1 150 ? -10.385 -38.217 -3.304  1.00 42.57 ? 214  GLY B CA  1 
ATOM   4035 C  C   . GLY B 1 150 ? -10.656 -38.730 -1.906  1.00 42.91 ? 214  GLY B C   1 
ATOM   4036 O  O   . GLY B 1 150 ? -11.408 -39.685 -1.727  1.00 43.82 ? 214  GLY B O   1 
ATOM   4037 N  N   . ARG B 1 151 ? -10.043 -38.100 -0.910  1.00 43.37 ? 215  ARG B N   1 
ATOM   4038 C  CA  . ARG B 1 151 ? -10.236 -38.501 0.479   1.00 43.78 ? 215  ARG B CA  1 
ATOM   4039 C  C   . ARG B 1 151 ? -10.305 -37.270 1.377   1.00 43.21 ? 215  ARG B C   1 
ATOM   4040 O  O   . ARG B 1 151 ? -9.672  -36.249 1.107   1.00 43.73 ? 215  ARG B O   1 
ATOM   4041 C  CB  . ARG B 1 151 ? -9.093  -39.419 0.934   1.00 45.92 ? 215  ARG B CB  1 
ATOM   4042 C  CG  . ARG B 1 151 ? -9.007  -40.733 0.154   1.00 48.60 ? 215  ARG B CG  1 
ATOM   4043 C  CD  . ARG B 1 151 ? -7.830  -41.610 0.594   1.00 51.24 ? 215  ARG B CD  1 
ATOM   4044 N  NE  . ARG B 1 151 ? -6.531  -40.976 0.364   1.00 52.16 ? 215  ARG B NE  1 
ATOM   4045 C  CZ  . ARG B 1 151 ? -5.362  -41.608 0.454   1.00 52.84 ? 215  ARG B CZ  1 
ATOM   4046 N  NH1 . ARG B 1 151 ? -5.322  -42.897 0.766   1.00 53.43 ? 215  ARG B NH1 1 
ATOM   4047 N  NH2 . ARG B 1 151 ? -4.232  -40.950 0.234   1.00 52.83 ? 215  ARG B NH2 1 
ATOM   4048 N  N   . LYS B 1 152 ? -11.086 -37.366 2.443   1.00 41.67 ? 216  LYS B N   1 
ATOM   4049 C  CA  . LYS B 1 152 ? -11.225 -36.259 3.373   1.00 40.50 ? 216  LYS B CA  1 
ATOM   4050 C  C   . LYS B 1 152 ? -10.019 -36.302 4.308   1.00 39.65 ? 216  LYS B C   1 
ATOM   4051 O  O   . LYS B 1 152 ? -9.419  -37.360 4.504   1.00 38.76 ? 216  LYS B O   1 
ATOM   4052 C  CB  . LYS B 1 152 ? -12.518 -36.416 4.176   1.00 41.56 ? 216  LYS B CB  1 
ATOM   4053 C  CG  . LYS B 1 152 ? -13.026 -35.142 4.825   1.00 44.43 ? 216  LYS B CG  1 
ATOM   4054 C  CD  . LYS B 1 152 ? -13.488 -34.128 3.778   1.00 46.07 ? 216  LYS B CD  1 
ATOM   4055 C  CE  . LYS B 1 152 ? -14.125 -32.903 4.431   1.00 47.48 ? 216  LYS B CE  1 
ATOM   4056 N  NZ  . LYS B 1 152 ? -14.677 -31.945 3.423   1.00 47.50 ? 216  LYS B NZ  1 
ATOM   4057 N  N   . PRO B 1 153 ? -9.632  -35.149 4.877   1.00 38.51 ? 217  PRO B N   1 
ATOM   4058 C  CA  . PRO B 1 153 ? -8.485  -35.113 5.792   1.00 37.80 ? 217  PRO B CA  1 
ATOM   4059 C  C   . PRO B 1 153 ? -8.776  -35.905 7.063   1.00 37.34 ? 217  PRO B C   1 
ATOM   4060 O  O   . PRO B 1 153 ? -9.921  -35.970 7.504   1.00 37.42 ? 217  PRO B O   1 
ATOM   4061 C  CB  . PRO B 1 153 ? -8.321  -33.622 6.080   1.00 37.45 ? 217  PRO B CB  1 
ATOM   4062 C  CG  . PRO B 1 153 ? -8.811  -32.980 4.824   1.00 37.66 ? 217  PRO B CG  1 
ATOM   4063 C  CD  . PRO B 1 153 ? -10.049 -33.785 4.510   1.00 37.99 ? 217  PRO B CD  1 
ATOM   4064 N  N   . THR B 1 154 ? -7.741  -36.498 7.651   1.00 37.82 ? 218  THR B N   1 
ATOM   4065 C  CA  . THR B 1 154 ? -7.900  -37.272 8.879   1.00 36.76 ? 218  THR B CA  1 
ATOM   4066 C  C   . THR B 1 154 ? -7.493  -36.462 10.110  1.00 36.03 ? 218  THR B C   1 
ATOM   4067 O  O   . THR B 1 154 ? -7.598  -36.936 11.241  1.00 37.20 ? 218  THR B O   1 
ATOM   4068 C  CB  . THR B 1 154 ? -7.058  -38.562 8.839   1.00 38.29 ? 218  THR B CB  1 
ATOM   4069 O  OG1 . THR B 1 154 ? -5.673  -38.227 8.667   1.00 38.45 ? 218  THR B OG1 1 
ATOM   4070 C  CG2 . THR B 1 154 ? -7.513  -39.458 7.689   1.00 37.34 ? 218  THR B CG2 1 
ATOM   4071 N  N   . MET B 1 155 ? -7.031  -35.238 9.880   1.00 34.59 ? 219  MET B N   1 
ATOM   4072 C  CA  . MET B 1 155 ? -6.610  -34.351 10.959  1.00 32.94 ? 219  MET B CA  1 
ATOM   4073 C  C   . MET B 1 155 ? -7.394  -33.045 10.853  1.00 31.49 ? 219  MET B C   1 
ATOM   4074 O  O   . MET B 1 155 ? -7.819  -32.659 9.768   1.00 29.85 ? 219  MET B O   1 
ATOM   4075 C  CB  . MET B 1 155 ? -5.110  -34.045 10.834  1.00 32.98 ? 219  MET B CB  1 
ATOM   4076 C  CG  . MET B 1 155 ? -4.393  -34.875 9.773   1.00 34.23 ? 219  MET B CG  1 
ATOM   4077 S  SD  . MET B 1 155 ? -2.691  -34.338 9.446   1.00 37.13 ? 219  MET B SD  1 
ATOM   4078 C  CE  . MET B 1 155 ? -2.884  -33.613 7.825   1.00 35.75 ? 219  MET B CE  1 
ATOM   4079 N  N   . LYS B 1 156 ? -7.580  -32.364 11.978  1.00 30.83 ? 220  LYS B N   1 
ATOM   4080 C  CA  . LYS B 1 156 ? -8.292  -31.093 11.982  1.00 30.77 ? 220  LYS B CA  1 
ATOM   4081 C  C   . LYS B 1 156 ? -7.336  -30.006 11.491  1.00 29.47 ? 220  LYS B C   1 
ATOM   4082 O  O   . LYS B 1 156 ? -6.314  -29.743 12.124  1.00 30.47 ? 220  LYS B O   1 
ATOM   4083 C  CB  . LYS B 1 156 ? -8.775  -30.764 13.396  1.00 32.06 ? 220  LYS B CB  1 
ATOM   4084 C  CG  . LYS B 1 156 ? -9.789  -31.768 13.941  1.00 37.28 ? 220  LYS B CG  1 
ATOM   4085 C  CD  . LYS B 1 156 ? -10.082 -31.550 15.425  1.00 39.43 ? 220  LYS B CD  1 
ATOM   4086 C  CE  . LYS B 1 156 ? -8.882  -31.915 16.300  1.00 41.66 ? 220  LYS B CE  1 
ATOM   4087 N  NZ  . LYS B 1 156 ? -9.169  -31.732 17.757  1.00 42.37 ? 220  LYS B NZ  1 
ATOM   4088 N  N   . TRP B 1 157 ? -7.671  -29.381 10.366  1.00 26.34 ? 221  TRP B N   1 
ATOM   4089 C  CA  . TRP B 1 157 ? -6.834  -28.331 9.793   1.00 23.26 ? 221  TRP B CA  1 
ATOM   4090 C  C   . TRP B 1 157 ? -7.163  -26.904 10.225  1.00 21.92 ? 221  TRP B C   1 
ATOM   4091 O  O   . TRP B 1 157 ? -8.254  -26.612 10.712  1.00 20.63 ? 221  TRP B O   1 
ATOM   4092 C  CB  . TRP B 1 157 ? -6.898  -28.369 8.264   1.00 21.33 ? 221  TRP B CB  1 
ATOM   4093 C  CG  . TRP B 1 157 ? -6.025  -29.392 7.621   1.00 20.53 ? 221  TRP B CG  1 
ATOM   4094 C  CD1 . TRP B 1 157 ? -6.376  -30.656 7.247   1.00 18.25 ? 221  TRP B CD1 1 
ATOM   4095 C  CD2 . TRP B 1 157 ? -4.655  -29.223 7.236   1.00 20.08 ? 221  TRP B CD2 1 
ATOM   4096 N  NE1 . TRP B 1 157 ? -5.311  -31.284 6.647   1.00 19.10 ? 221  TRP B NE1 1 
ATOM   4097 C  CE2 . TRP B 1 157 ? -4.241  -30.426 6.628   1.00 20.51 ? 221  TRP B CE2 1 
ATOM   4098 C  CE3 . TRP B 1 157 ? -3.736  -28.170 7.347   1.00 19.81 ? 221  TRP B CE3 1 
ATOM   4099 C  CZ2 . TRP B 1 157 ? -2.944  -30.605 6.130   1.00 20.96 ? 221  TRP B CZ2 1 
ATOM   4100 C  CZ3 . TRP B 1 157 ? -2.450  -28.350 6.853   1.00 19.69 ? 221  TRP B CZ3 1 
ATOM   4101 C  CH2 . TRP B 1 157 ? -2.068  -29.557 6.253   1.00 19.74 ? 221  TRP B CH2 1 
ATOM   4102 N  N   . SER B 1 158 ? -6.196  -26.017 10.018  1.00 20.59 ? 222  SER B N   1 
ATOM   4103 C  CA  . SER B 1 158 ? -6.346  -24.603 10.316  1.00 21.44 ? 222  SER B CA  1 
ATOM   4104 C  C   . SER B 1 158 ? -5.127  -23.912 9.720   1.00 20.78 ? 222  SER B C   1 
ATOM   4105 O  O   . SER B 1 158 ? -4.140  -24.576 9.370   1.00 21.03 ? 222  SER B O   1 
ATOM   4106 C  CB  . SER B 1 158 ? -6.416  -24.359 11.826  1.00 21.77 ? 222  SER B CB  1 
ATOM   4107 O  OG  . SER B 1 158 ? -5.148  -24.497 12.427  1.00 22.45 ? 222  SER B OG  1 
ATOM   4108 N  N   . THR B 1 159 ? -5.186  -22.592 9.585   1.00 18.12 ? 223  THR B N   1 
ATOM   4109 C  CA  . THR B 1 159 ? -4.056  -21.883 9.014   1.00 19.79 ? 223  THR B CA  1 
ATOM   4110 C  C   . THR B 1 159 ? -3.734  -20.527 9.599   1.00 18.39 ? 223  THR B C   1 
ATOM   4111 O  O   . THR B 1 159 ? -4.610  -19.795 10.056  1.00 19.49 ? 223  THR B O   1 
ATOM   4112 C  CB  . THR B 1 159 ? -4.211  -21.684 7.479   1.00 20.17 ? 223  THR B CB  1 
ATOM   4113 O  OG1 . THR B 1 159 ? -3.090  -20.940 6.979   1.00 21.16 ? 223  THR B OG1 1 
ATOM   4114 C  CG2 . THR B 1 159 ? -5.488  -20.921 7.155   1.00 18.20 ? 223  THR B CG2 1 
ATOM   4115 N  N   . ILE B 1 160 ? -2.442  -20.228 9.599   1.00 17.21 ? 224  ILE B N   1 
ATOM   4116 C  CA  . ILE B 1 160 ? -1.930  -18.939 10.022  1.00 17.36 ? 224  ILE B CA  1 
ATOM   4117 C  C   . ILE B 1 160 ? -1.540  -18.463 8.630   1.00 18.33 ? 224  ILE B C   1 
ATOM   4118 O  O   . ILE B 1 160 ? -0.441  -18.733 8.151   1.00 18.17 ? 224  ILE B O   1 
ATOM   4119 C  CB  . ILE B 1 160 ? -0.690  -19.093 10.929  1.00 17.21 ? 224  ILE B CB  1 
ATOM   4120 C  CG1 . ILE B 1 160 ? -1.112  -19.706 12.269  1.00 17.71 ? 224  ILE B CG1 1 
ATOM   4121 C  CG2 . ILE B 1 160 ? -0.028  -17.738 11.154  1.00 14.06 ? 224  ILE B CG2 1 
ATOM   4122 C  CD1 . ILE B 1 160 ? 0.051   -20.010 13.195  1.00 19.80 ? 224  ILE B CD1 1 
ATOM   4123 N  N   . ASP B 1 161 ? -2.480  -17.802 7.964   1.00 18.29 ? 225  ASP B N   1 
ATOM   4124 C  CA  . ASP B 1 161 ? -2.284  -17.342 6.598   1.00 18.87 ? 225  ASP B CA  1 
ATOM   4125 C  C   . ASP B 1 161 ? -1.545  -16.027 6.420   1.00 19.02 ? 225  ASP B C   1 
ATOM   4126 O  O   . ASP B 1 161 ? -1.219  -15.656 5.290   1.00 17.80 ? 225  ASP B O   1 
ATOM   4127 C  CB  . ASP B 1 161 ? -3.635  -17.270 5.881   1.00 19.91 ? 225  ASP B CB  1 
ATOM   4128 C  CG  . ASP B 1 161 ? -4.659  -16.469 6.653   1.00 18.88 ? 225  ASP B CG  1 
ATOM   4129 O  OD1 . ASP B 1 161 ? -5.065  -16.915 7.747   1.00 19.08 ? 225  ASP B OD1 1 
ATOM   4130 O  OD2 . ASP B 1 161 ? -5.053  -15.392 6.172   1.00 20.14 ? 225  ASP B OD2 1 
ATOM   4131 N  N   . ARG B 1 162 ? -1.302  -15.315 7.517   1.00 17.37 ? 226  ARG B N   1 
ATOM   4132 C  CA  . ARG B 1 162 ? -0.561  -14.056 7.449   1.00 17.38 ? 226  ARG B CA  1 
ATOM   4133 C  C   . ARG B 1 162 ? -0.230  -13.532 8.841   1.00 17.37 ? 226  ARG B C   1 
ATOM   4134 O  O   . ARG B 1 162 ? -0.913  -13.843 9.808   1.00 16.74 ? 226  ARG B O   1 
ATOM   4135 C  CB  . ARG B 1 162 ? -1.347  -12.993 6.671   1.00 16.31 ? 226  ARG B CB  1 
ATOM   4136 C  CG  . ARG B 1 162 ? -2.523  -12.384 7.416   1.00 17.96 ? 226  ARG B CG  1 
ATOM   4137 C  CD  . ARG B 1 162 ? -3.448  -11.698 6.425   1.00 17.57 ? 226  ARG B CD  1 
ATOM   4138 N  NE  . ARG B 1 162 ? -4.112  -12.688 5.596   1.00 18.74 ? 226  ARG B NE  1 
ATOM   4139 C  CZ  . ARG B 1 162 ? -4.701  -12.442 4.431   1.00 17.20 ? 226  ARG B CZ  1 
ATOM   4140 N  NH1 . ARG B 1 162 ? -4.711  -11.221 3.915   1.00 17.15 ? 226  ARG B NH1 1 
ATOM   4141 N  NH2 . ARG B 1 162 ? -5.310  -13.431 3.795   1.00 17.19 ? 226  ARG B NH2 1 
ATOM   4142 N  N   . TRP B 1 163 ? 0.823   -12.727 8.922   1.00 16.29 ? 227  TRP B N   1 
ATOM   4143 C  CA  . TRP B 1 163 ? 1.273   -12.148 10.181  1.00 15.46 ? 227  TRP B CA  1 
ATOM   4144 C  C   . TRP B 1 163 ? 2.252   -11.017 9.866   1.00 15.42 ? 227  TRP B C   1 
ATOM   4145 O  O   . TRP B 1 163 ? 3.370   -10.981 10.378  1.00 15.58 ? 227  TRP B O   1 
ATOM   4146 C  CB  . TRP B 1 163 ? 1.949   -13.223 11.043  1.00 14.53 ? 227  TRP B CB  1 
ATOM   4147 C  CG  . TRP B 1 163 ? 2.839   -14.166 10.283  1.00 14.62 ? 227  TRP B CG  1 
ATOM   4148 C  CD1 . TRP B 1 163 ? 2.448   -15.121 9.385   1.00 13.30 ? 227  TRP B CD1 1 
ATOM   4149 C  CD2 . TRP B 1 163 ? 4.261   -14.289 10.401  1.00 12.91 ? 227  TRP B CD2 1 
ATOM   4150 N  NE1 . TRP B 1 163 ? 3.534   -15.833 8.943   1.00 15.94 ? 227  TRP B NE1 1 
ATOM   4151 C  CE2 . TRP B 1 163 ? 4.661   -15.344 9.551   1.00 14.81 ? 227  TRP B CE2 1 
ATOM   4152 C  CE3 . TRP B 1 163 ? 5.235   -13.611 11.142  1.00 15.73 ? 227  TRP B CE3 1 
ATOM   4153 C  CZ2 . TRP B 1 163 ? 5.994   -15.739 9.425   1.00 14.89 ? 227  TRP B CZ2 1 
ATOM   4154 C  CZ3 . TRP B 1 163 ? 6.566   -14.004 11.015  1.00 15.42 ? 227  TRP B CZ3 1 
ATOM   4155 C  CH2 . TRP B 1 163 ? 6.929   -15.059 10.164  1.00 15.82 ? 227  TRP B CH2 1 
ATOM   4156 N  N   . PRO B 1 164 ? 1.811   -10.054 9.042   1.00 15.39 ? 228  PRO B N   1 
ATOM   4157 C  CA  . PRO B 1 164 ? 2.603   -8.901  8.613   1.00 13.96 ? 228  PRO B CA  1 
ATOM   4158 C  C   . PRO B 1 164 ? 3.133   -7.991  9.714   1.00 15.52 ? 228  PRO B C   1 
ATOM   4159 O  O   . PRO B 1 164 ? 4.158   -7.336  9.535   1.00 14.36 ? 228  PRO B O   1 
ATOM   4160 C  CB  . PRO B 1 164 ? 1.649   -8.170  7.673   1.00 13.73 ? 228  PRO B CB  1 
ATOM   4161 C  CG  . PRO B 1 164 ? 0.316   -8.394  8.341   1.00 12.52 ? 228  PRO B CG  1 
ATOM   4162 C  CD  . PRO B 1 164 ? 0.391   -9.875  8.666   1.00 13.04 ? 228  PRO B CD  1 
ATOM   4163 N  N   . THR B 1 165 ? 2.449   -7.946  10.853  1.00 16.28 ? 229  THR B N   1 
ATOM   4164 C  CA  . THR B 1 165 ? 2.897   -7.075  11.923  1.00 18.67 ? 229  THR B CA  1 
ATOM   4165 C  C   . THR B 1 165 ? 3.156   -7.737  13.273  1.00 19.88 ? 229  THR B C   1 
ATOM   4166 O  O   . THR B 1 165 ? 3.143   -7.050  14.287  1.00 21.67 ? 229  THR B O   1 
ATOM   4167 C  CB  . THR B 1 165 ? 1.893   -5.914  12.152  1.00 18.66 ? 229  THR B CB  1 
ATOM   4168 O  OG1 . THR B 1 165 ? 0.631   -6.450  12.559  1.00 21.13 ? 229  THR B OG1 1 
ATOM   4169 C  CG2 . THR B 1 165 ? 1.698   -5.104  10.872  1.00 18.23 ? 229  THR B CG2 1 
ATOM   4170 N  N   . HIS B 1 166 ? 3.385   -9.046  13.314  1.00 20.18 ? 230  HIS B N   1 
ATOM   4171 C  CA  . HIS B 1 166 ? 3.642   -9.674  14.610  1.00 20.73 ? 230  HIS B CA  1 
ATOM   4172 C  C   . HIS B 1 166 ? 4.780   -8.920  15.288  1.00 20.68 ? 230  HIS B C   1 
ATOM   4173 O  O   . HIS B 1 166 ? 5.858   -8.752  14.707  1.00 20.22 ? 230  HIS B O   1 
ATOM   4174 C  CB  . HIS B 1 166 ? 4.009   -11.148 14.472  1.00 17.90 ? 230  HIS B CB  1 
ATOM   4175 C  CG  . HIS B 1 166 ? 4.063   -11.860 15.784  1.00 21.05 ? 230  HIS B CG  1 
ATOM   4176 N  ND1 . HIS B 1 166 ? 5.206   -11.919 16.553  1.00 22.20 ? 230  HIS B ND1 1 
ATOM   4177 C  CD2 . HIS B 1 166 ? 3.085   -12.443 16.519  1.00 19.38 ? 230  HIS B CD2 1 
ATOM   4178 C  CE1 . HIS B 1 166 ? 4.930   -12.503 17.705  1.00 20.58 ? 230  HIS B CE1 1 
ATOM   4179 N  NE2 . HIS B 1 166 ? 3.649   -12.829 17.710  1.00 20.46 ? 230  HIS B NE2 1 
ATOM   4180 N  N   . HIS B 1 167 ? 4.538   -8.476  16.517  1.00 21.58 ? 231  HIS B N   1 
ATOM   4181 C  CA  . HIS B 1 167 ? 5.518   -7.680  17.245  1.00 23.63 ? 231  HIS B CA  1 
ATOM   4182 C  C   . HIS B 1 167 ? 6.939   -8.234  17.336  1.00 22.84 ? 231  HIS B C   1 
ATOM   4183 O  O   . HIS B 1 167 ? 7.880   -7.455  17.396  1.00 21.87 ? 231  HIS B O   1 
ATOM   4184 C  CB  . HIS B 1 167 ? 4.996   -7.336  18.649  1.00 26.09 ? 231  HIS B CB  1 
ATOM   4185 C  CG  . HIS B 1 167 ? 5.138   -8.444  19.643  1.00 30.82 ? 231  HIS B CG  1 
ATOM   4186 N  ND1 . HIS B 1 167 ? 4.427   -9.622  19.555  1.00 34.32 ? 231  HIS B ND1 1 
ATOM   4187 C  CD2 . HIS B 1 167 ? 5.917   -8.555  20.744  1.00 31.76 ? 231  HIS B CD2 1 
ATOM   4188 C  CE1 . HIS B 1 167 ? 4.763   -10.412 20.560  1.00 34.48 ? 231  HIS B CE1 1 
ATOM   4189 N  NE2 . HIS B 1 167 ? 5.666   -9.788  21.296  1.00 34.13 ? 231  HIS B NE2 1 
ATOM   4190 N  N   . LEU B 1 168 ? 7.110   -9.555  17.339  1.00 21.46 ? 232  LEU B N   1 
ATOM   4191 C  CA  . LEU B 1 168 ? 8.459   -10.115 17.414  1.00 20.68 ? 232  LEU B CA  1 
ATOM   4192 C  C   . LEU B 1 168 ? 9.129   -10.132 16.043  1.00 20.44 ? 232  LEU B C   1 
ATOM   4193 O  O   . LEU B 1 168 ? 10.351  -10.050 15.937  1.00 19.92 ? 232  LEU B O   1 
ATOM   4194 C  CB  . LEU B 1 168 ? 8.437   -11.515 18.027  1.00 20.75 ? 232  LEU B CB  1 
ATOM   4195 C  CG  . LEU B 1 168 ? 8.195   -11.520 19.544  1.00 22.34 ? 232  LEU B CG  1 
ATOM   4196 C  CD1 . LEU B 1 168 ? 8.112   -12.954 20.050  1.00 22.97 ? 232  LEU B CD1 1 
ATOM   4197 C  CD2 . LEU B 1 168 ? 9.320   -10.769 20.245  1.00 23.00 ? 232  LEU B CD2 1 
ATOM   4198 N  N   . LEU B 1 169 ? 8.324   -10.240 14.994  1.00 19.11 ? 233  LEU B N   1 
ATOM   4199 C  CA  . LEU B 1 169 ? 8.853   -10.205 13.638  1.00 16.39 ? 233  LEU B CA  1 
ATOM   4200 C  C   . LEU B 1 169 ? 9.406   -8.802  13.421  1.00 16.34 ? 233  LEU B C   1 
ATOM   4201 O  O   . LEU B 1 169 ? 10.499  -8.623  12.882  1.00 16.61 ? 233  LEU B O   1 
ATOM   4202 C  CB  . LEU B 1 169 ? 7.744   -10.456 12.616  1.00 15.89 ? 233  LEU B CB  1 
ATOM   4203 C  CG  . LEU B 1 169 ? 8.144   -10.143 11.172  1.00 15.00 ? 233  LEU B CG  1 
ATOM   4204 C  CD1 . LEU B 1 169 ? 9.081   -11.240 10.664  1.00 14.94 ? 233  LEU B CD1 1 
ATOM   4205 C  CD2 . LEU B 1 169 ? 6.899   -10.038 10.297  1.00 13.79 ? 233  LEU B CD2 1 
ATOM   4206 N  N   . ILE B 1 170 ? 8.630   -7.807  13.837  1.00 15.50 ? 234  ILE B N   1 
ATOM   4207 C  CA  . ILE B 1 170 ? 9.034   -6.417  13.702  1.00 16.86 ? 234  ILE B CA  1 
ATOM   4208 C  C   . ILE B 1 170 ? 10.307  -6.132  14.504  1.00 18.99 ? 234  ILE B C   1 
ATOM   4209 O  O   . ILE B 1 170 ? 11.202  -5.437  14.023  1.00 18.17 ? 234  ILE B O   1 
ATOM   4210 C  CB  . ILE B 1 170 ? 7.913   -5.469  14.159  1.00 16.99 ? 234  ILE B CB  1 
ATOM   4211 C  CG1 . ILE B 1 170 ? 6.686   -5.674  13.271  1.00 16.45 ? 234  ILE B CG1 1 
ATOM   4212 C  CG2 . ILE B 1 170 ? 8.382   -4.012  14.088  1.00 17.57 ? 234  ILE B CG2 1 
ATOM   4213 C  CD1 . ILE B 1 170 ? 6.968   -5.502  11.783  1.00 13.87 ? 234  ILE B CD1 1 
ATOM   4214 N  N   . GLN B 1 171 ? 10.395  -6.674  15.717  1.00 18.43 ? 235  GLN B N   1 
ATOM   4215 C  CA  . GLN B 1 171 ? 11.587  -6.459  16.535  1.00 20.18 ? 235  GLN B CA  1 
ATOM   4216 C  C   . GLN B 1 171 ? 12.820  -7.075  15.876  1.00 19.20 ? 235  GLN B C   1 
ATOM   4217 O  O   . GLN B 1 171 ? 13.909  -6.516  15.961  1.00 19.51 ? 235  GLN B O   1 
ATOM   4218 C  CB  . GLN B 1 171 ? 11.400  -7.037  17.944  1.00 21.39 ? 235  GLN B CB  1 
ATOM   4219 C  CG  . GLN B 1 171 ? 12.646  -6.927  18.813  1.00 25.78 ? 235  GLN B CG  1 
ATOM   4220 C  CD  . GLN B 1 171 ? 12.399  -7.287  20.274  1.00 29.59 ? 235  GLN B CD  1 
ATOM   4221 O  OE1 . GLN B 1 171 ? 13.346  -7.472  21.042  1.00 31.77 ? 235  GLN B OE1 1 
ATOM   4222 N  NE2 . GLN B 1 171 ? 11.129  -7.375  20.665  1.00 28.92 ? 235  GLN B NE2 1 
ATOM   4223 N  N   . CYS B 1 172 ? 12.652  -8.220  15.218  1.00 18.73 ? 236  CYS B N   1 
ATOM   4224 C  CA  . CYS B 1 172 ? 13.773  -8.865  14.540  1.00 20.79 ? 236  CYS B CA  1 
ATOM   4225 C  C   . CYS B 1 172 ? 14.322  -7.984  13.423  1.00 20.23 ? 236  CYS B C   1 
ATOM   4226 O  O   . CYS B 1 172 ? 15.537  -7.810  13.303  1.00 20.56 ? 236  CYS B O   1 
ATOM   4227 C  CB  . CYS B 1 172 ? 13.358  -10.219 13.957  1.00 22.66 ? 236  CYS B CB  1 
ATOM   4228 S  SG  . CYS B 1 172 ? 13.241  -11.541 15.179  1.00 29.29 ? 236  CYS B SG  1 
ATOM   4229 N  N   . PHE B 1 173 ? 13.427  -7.438  12.604  1.00 18.52 ? 237  PHE B N   1 
ATOM   4230 C  CA  . PHE B 1 173 ? 13.831  -6.557  11.512  1.00 18.68 ? 237  PHE B CA  1 
ATOM   4231 C  C   . PHE B 1 173 ? 14.513  -5.310  12.079  1.00 17.40 ? 237  PHE B C   1 
ATOM   4232 O  O   . PHE B 1 173 ? 15.590  -4.920  11.631  1.00 14.99 ? 237  PHE B O   1 
ATOM   4233 C  CB  . PHE B 1 173 ? 12.612  -6.137  10.681  1.00 18.65 ? 237  PHE B CB  1 
ATOM   4234 C  CG  . PHE B 1 173 ? 12.198  -7.145  9.647   1.00 19.30 ? 237  PHE B CG  1 
ATOM   4235 C  CD1 . PHE B 1 173 ? 10.862  -7.506  9.507   1.00 20.35 ? 237  PHE B CD1 1 
ATOM   4236 C  CD2 . PHE B 1 173 ? 13.137  -7.705  8.783   1.00 20.53 ? 237  PHE B CD2 1 
ATOM   4237 C  CE1 . PHE B 1 173 ? 10.466  -8.406  8.522   1.00 18.30 ? 237  PHE B CE1 1 
ATOM   4238 C  CE2 . PHE B 1 173 ? 12.750  -8.609  7.793   1.00 20.09 ? 237  PHE B CE2 1 
ATOM   4239 C  CZ  . PHE B 1 173 ? 11.414  -8.958  7.664   1.00 20.45 ? 237  PHE B CZ  1 
ATOM   4240 N  N   . ALA B 1 174 ? 13.881  -4.687  13.068  1.00 17.37 ? 238  ALA B N   1 
ATOM   4241 C  CA  . ALA B 1 174 ? 14.442  -3.488  13.683  1.00 18.99 ? 238  ALA B CA  1 
ATOM   4242 C  C   . ALA B 1 174 ? 15.851  -3.769  14.216  1.00 19.70 ? 238  ALA B C   1 
ATOM   4243 O  O   . ALA B 1 174 ? 16.778  -3.000  13.966  1.00 20.15 ? 238  ALA B O   1 
ATOM   4244 C  CB  . ALA B 1 174 ? 13.539  -3.006  14.807  1.00 15.52 ? 238  ALA B CB  1 
ATOM   4245 N  N   . ASP B 1 175 ? 16.007  -4.877  14.938  1.00 19.68 ? 239  ASP B N   1 
ATOM   4246 C  CA  . ASP B 1 175 ? 17.310  -5.250  15.487  1.00 21.66 ? 239  ASP B CA  1 
ATOM   4247 C  C   . ASP B 1 175 ? 18.369  -5.407  14.396  1.00 21.35 ? 239  ASP B C   1 
ATOM   4248 O  O   . ASP B 1 175 ? 19.475  -4.890  14.530  1.00 22.33 ? 239  ASP B O   1 
ATOM   4249 C  CB  . ASP B 1 175 ? 17.211  -6.558  16.282  1.00 23.47 ? 239  ASP B CB  1 
ATOM   4250 C  CG  . ASP B 1 175 ? 16.538  -6.379  17.638  1.00 26.74 ? 239  ASP B CG  1 
ATOM   4251 O  OD1 . ASP B 1 175 ? 16.340  -7.400  18.331  1.00 28.06 ? 239  ASP B OD1 1 
ATOM   4252 O  OD2 . ASP B 1 175 ? 16.211  -5.230  18.018  1.00 29.34 ? 239  ASP B OD2 1 
ATOM   4253 N  N   . HIS B 1 176 ? 18.039  -6.124  13.323  1.00 19.91 ? 240  HIS B N   1 
ATOM   4254 C  CA  . HIS B 1 176 ? 18.993  -6.321  12.234  1.00 18.91 ? 240  HIS B CA  1 
ATOM   4255 C  C   . HIS B 1 176 ? 19.326  -5.031  11.495  1.00 18.65 ? 240  HIS B C   1 
ATOM   4256 O  O   . HIS B 1 176 ? 20.443  -4.858  11.005  1.00 16.32 ? 240  HIS B O   1 
ATOM   4257 C  CB  . HIS B 1 176 ? 18.485  -7.373  11.246  1.00 18.87 ? 240  HIS B CB  1 
ATOM   4258 C  CG  . HIS B 1 176 ? 18.590  -8.775  11.760  1.00 21.11 ? 240  HIS B CG  1 
ATOM   4259 N  ND1 . HIS B 1 176 ? 18.503  -9.879  10.940  1.00 23.64 ? 240  HIS B ND1 1 
ATOM   4260 C  CD2 . HIS B 1 176 ? 18.781  -9.253  13.013  1.00 22.09 ? 240  HIS B CD2 1 
ATOM   4261 C  CE1 . HIS B 1 176 ? 18.639  -10.975 11.664  1.00 22.98 ? 240  HIS B CE1 1 
ATOM   4262 N  NE2 . HIS B 1 176 ? 18.809  -10.623 12.925  1.00 23.76 ? 240  HIS B NE2 1 
ATOM   4263 N  N   . ILE B 1 177 ? 18.359  -4.127  11.417  1.00 18.04 ? 241  ILE B N   1 
ATOM   4264 C  CA  . ILE B 1 177 ? 18.581  -2.851  10.759  1.00 18.30 ? 241  ILE B CA  1 
ATOM   4265 C  C   . ILE B 1 177 ? 19.565  -2.033  11.602  1.00 20.10 ? 241  ILE B C   1 
ATOM   4266 O  O   . ILE B 1 177 ? 20.539  -1.486  11.080  1.00 18.85 ? 241  ILE B O   1 
ATOM   4267 C  CB  . ILE B 1 177 ? 17.258  -2.075  10.607  1.00 16.74 ? 241  ILE B CB  1 
ATOM   4268 C  CG1 . ILE B 1 177 ? 16.366  -2.789  9.590   1.00 15.44 ? 241  ILE B CG1 1 
ATOM   4269 C  CG2 . ILE B 1 177 ? 17.532  -0.635  10.187  1.00 14.35 ? 241  ILE B CG2 1 
ATOM   4270 C  CD1 . ILE B 1 177 ? 14.931  -2.313  9.604   1.00 14.61 ? 241  ILE B CD1 1 
ATOM   4271 N  N   . LEU B 1 178 ? 19.309  -1.965  12.905  1.00 20.86 ? 242  LEU B N   1 
ATOM   4272 C  CA  . LEU B 1 178 ? 20.178  -1.221  13.805  1.00 21.79 ? 242  LEU B CA  1 
ATOM   4273 C  C   . LEU B 1 178 ? 21.604  -1.770  13.814  1.00 23.18 ? 242  LEU B C   1 
ATOM   4274 O  O   . LEU B 1 178 ? 22.559  -1.003  13.734  1.00 22.31 ? 242  LEU B O   1 
ATOM   4275 C  CB  . LEU B 1 178 ? 19.606  -1.225  15.226  1.00 21.35 ? 242  LEU B CB  1 
ATOM   4276 C  CG  . LEU B 1 178 ? 18.358  -0.362  15.453  1.00 20.37 ? 242  LEU B CG  1 
ATOM   4277 C  CD1 . LEU B 1 178 ? 17.760  -0.675  16.812  1.00 22.91 ? 242  LEU B CD1 1 
ATOM   4278 C  CD2 . LEU B 1 178 ? 18.726  1.119   15.364  1.00 19.91 ? 242  LEU B CD2 1 
ATOM   4279 N  N   . LYS B 1 179 ? 21.766  -3.088  13.891  1.00 23.13 ? 243  LYS B N   1 
ATOM   4280 C  CA  . LYS B 1 179 ? 23.122  -3.616  13.914  1.00 25.18 ? 243  LYS B CA  1 
ATOM   4281 C  C   . LYS B 1 179 ? 23.825  -3.389  12.581  1.00 24.78 ? 243  LYS B C   1 
ATOM   4282 O  O   . LYS B 1 179 ? 25.051  -3.274  12.538  1.00 24.09 ? 243  LYS B O   1 
ATOM   4283 C  CB  . LYS B 1 179 ? 23.146  -5.101  14.307  1.00 26.03 ? 243  LYS B CB  1 
ATOM   4284 C  CG  . LYS B 1 179 ? 22.836  -6.094  13.215  1.00 29.15 ? 243  LYS B CG  1 
ATOM   4285 C  CD  . LYS B 1 179 ? 22.913  -7.521  13.767  1.00 33.53 ? 243  LYS B CD  1 
ATOM   4286 C  CE  . LYS B 1 179 ? 22.643  -8.566  12.686  1.00 34.26 ? 243  LYS B CE  1 
ATOM   4287 N  NZ  . LYS B 1 179 ? 23.674  -8.551  11.601  1.00 35.66 ? 243  LYS B NZ  1 
ATOM   4288 N  N   . GLU B 1 180 ? 23.061  -3.299  11.493  1.00 24.43 ? 244  GLU B N   1 
ATOM   4289 C  CA  . GLU B 1 180 ? 23.682  -3.056  10.205  1.00 24.82 ? 244  GLU B CA  1 
ATOM   4290 C  C   . GLU B 1 180 ? 24.054  -1.574  10.074  1.00 26.37 ? 244  GLU B C   1 
ATOM   4291 O  O   . GLU B 1 180 ? 25.039  -1.234  9.423   1.00 26.43 ? 244  GLU B O   1 
ATOM   4292 C  CB  . GLU B 1 180 ? 22.763  -3.471  9.056   1.00 24.89 ? 244  GLU B CB  1 
ATOM   4293 C  CG  . GLU B 1 180 ? 23.534  -3.701  7.767   1.00 26.00 ? 244  GLU B CG  1 
ATOM   4294 C  CD  . GLU B 1 180 ? 24.576  -4.815  7.906   1.00 26.21 ? 244  GLU B CD  1 
ATOM   4295 O  OE1 . GLU B 1 180 ? 25.559  -4.811  7.137   1.00 26.21 ? 244  GLU B OE1 1 
ATOM   4296 O  OE2 . GLU B 1 180 ? 24.408  -5.702  8.773   1.00 24.00 ? 244  GLU B OE2 1 
ATOM   4297 N  N   . LEU B 1 181 ? 23.267  -0.696  10.693  1.00 26.91 ? 245  LEU B N   1 
ATOM   4298 C  CA  . LEU B 1 181 ? 23.553  0.738   10.655  1.00 28.05 ? 245  LEU B CA  1 
ATOM   4299 C  C   . LEU B 1 181 ? 24.856  0.990   11.400  1.00 29.14 ? 245  LEU B C   1 
ATOM   4300 O  O   . LEU B 1 181 ? 25.586  1.929   11.080  1.00 29.76 ? 245  LEU B O   1 
ATOM   4301 C  CB  . LEU B 1 181 ? 22.427  1.548   11.314  1.00 26.09 ? 245  LEU B CB  1 
ATOM   4302 C  CG  . LEU B 1 181 ? 21.139  1.712   10.503  1.00 28.77 ? 245  LEU B CG  1 
ATOM   4303 C  CD1 . LEU B 1 181 ? 20.076  2.420   11.335  1.00 26.46 ? 245  LEU B CD1 1 
ATOM   4304 C  CD2 . LEU B 1 181 ? 21.443  2.494   9.231   1.00 27.53 ? 245  LEU B CD2 1 
ATOM   4305 N  N   . ASP B 1 182 ? 25.128  0.149   12.399  1.00 29.27 ? 246  ASP B N   1 
ATOM   4306 C  CA  . ASP B 1 182 ? 26.345  0.245   13.198  1.00 30.18 ? 246  ASP B CA  1 
ATOM   4307 C  C   . ASP B 1 182 ? 27.567  -0.067  12.343  1.00 30.18 ? 246  ASP B C   1 
ATOM   4308 O  O   . ASP B 1 182 ? 28.681  0.329   12.677  1.00 29.35 ? 246  ASP B O   1 
ATOM   4309 C  CB  . ASP B 1 182 ? 26.300  -0.741  14.365  1.00 33.05 ? 246  ASP B CB  1 
ATOM   4310 C  CG  . ASP B 1 182 ? 25.319  -0.332  15.444  1.00 37.61 ? 246  ASP B CG  1 
ATOM   4311 O  OD1 . ASP B 1 182 ? 25.073  -1.159  16.348  1.00 40.56 ? 246  ASP B OD1 1 
ATOM   4312 O  OD2 . ASP B 1 182 ? 24.799  0.807   15.401  1.00 39.71 ? 246  ASP B OD2 1 
ATOM   4313 N  N   . HIS B 1 183 ? 27.352  -0.789  11.248  1.00 29.66 ? 247  HIS B N   1 
ATOM   4314 C  CA  . HIS B 1 183 ? 28.437  -1.155  10.348  1.00 31.30 ? 247  HIS B CA  1 
ATOM   4315 C  C   . HIS B 1 183 ? 28.809  -0.052  9.366   1.00 29.11 ? 247  HIS B C   1 
ATOM   4316 O  O   . HIS B 1 183 ? 29.797  -0.168  8.646   1.00 28.90 ? 247  HIS B O   1 
ATOM   4317 C  CB  . HIS B 1 183 ? 28.089  -2.435  9.582   1.00 33.65 ? 247  HIS B CB  1 
ATOM   4318 C  CG  . HIS B 1 183 ? 28.063  -3.660  10.443  1.00 37.15 ? 247  HIS B CG  1 
ATOM   4319 N  ND1 . HIS B 1 183 ? 29.104  -4.002  11.280  1.00 39.20 ? 247  HIS B ND1 1 
ATOM   4320 C  CD2 . HIS B 1 183 ? 27.127  -4.628  10.591  1.00 38.57 ? 247  HIS B CD2 1 
ATOM   4321 C  CE1 . HIS B 1 183 ? 28.811  -5.128  11.907  1.00 39.34 ? 247  HIS B CE1 1 
ATOM   4322 N  NE2 . HIS B 1 183 ? 27.617  -5.528  11.507  1.00 40.22 ? 247  HIS B NE2 1 
ATOM   4323 N  N   . PHE B 1 184 ? 28.013  1.012   9.321   1.00 27.55 ? 248  PHE B N   1 
ATOM   4324 C  CA  . PHE B 1 184 ? 28.323  2.122   8.434   1.00 26.42 ? 248  PHE B CA  1 
ATOM   4325 C  C   . PHE B 1 184 ? 29.333  3.012   9.139   1.00 27.35 ? 248  PHE B C   1 
ATOM   4326 O  O   . PHE B 1 184 ? 29.451  2.980   10.366  1.00 24.90 ? 248  PHE B O   1 
ATOM   4327 C  CB  . PHE B 1 184 ? 27.082  2.969   8.140   1.00 24.58 ? 248  PHE B CB  1 
ATOM   4328 C  CG  . PHE B 1 184 ? 26.200  2.417   7.059   1.00 22.34 ? 248  PHE B CG  1 
ATOM   4329 C  CD1 . PHE B 1 184 ? 25.265  1.429   7.341   1.00 20.22 ? 248  PHE B CD1 1 
ATOM   4330 C  CD2 . PHE B 1 184 ? 26.276  2.925   5.762   1.00 22.75 ? 248  PHE B CD2 1 
ATOM   4331 C  CE1 . PHE B 1 184 ? 24.409  0.955   6.350   1.00 21.67 ? 248  PHE B CE1 1 
ATOM   4332 C  CE2 . PHE B 1 184 ? 25.429  2.462   4.763   1.00 22.94 ? 248  PHE B CE2 1 
ATOM   4333 C  CZ  . PHE B 1 184 ? 24.487  1.472   5.057   1.00 22.58 ? 248  PHE B CZ  1 
ATOM   4334 N  N   . PRO B 1 185 ? 30.089  3.812   8.372   1.00 28.27 ? 249  PRO B N   1 
ATOM   4335 C  CA  . PRO B 1 185 ? 31.054  4.688   9.039   1.00 29.60 ? 249  PRO B CA  1 
ATOM   4336 C  C   . PRO B 1 185 ? 30.219  5.624   9.911   1.00 29.25 ? 249  PRO B C   1 
ATOM   4337 O  O   . PRO B 1 185 ? 29.151  6.070   9.495   1.00 29.33 ? 249  PRO B O   1 
ATOM   4338 C  CB  . PRO B 1 185 ? 31.722  5.415   7.874   1.00 29.75 ? 249  PRO B CB  1 
ATOM   4339 C  CG  . PRO B 1 185 ? 31.674  4.393   6.769   1.00 30.39 ? 249  PRO B CG  1 
ATOM   4340 C  CD  . PRO B 1 185 ? 30.261  3.852   6.909   1.00 29.33 ? 249  PRO B CD  1 
ATOM   4341 N  N   . LEU B 1 186 ? 30.694  5.902   11.118  1.00 30.90 ? 250  LEU B N   1 
ATOM   4342 C  CA  . LEU B 1 186 ? 29.980  6.765   12.051  1.00 33.10 ? 250  LEU B CA  1 
ATOM   4343 C  C   . LEU B 1 186 ? 29.497  8.082   11.434  1.00 32.94 ? 250  LEU B C   1 
ATOM   4344 O  O   . LEU B 1 186 ? 28.376  8.523   11.688  1.00 32.90 ? 250  LEU B O   1 
ATOM   4345 C  CB  . LEU B 1 186 ? 30.871  7.074   13.259  1.00 35.11 ? 250  LEU B CB  1 
ATOM   4346 C  CG  . LEU B 1 186 ? 31.538  5.886   13.969  1.00 39.61 ? 250  LEU B CG  1 
ATOM   4347 C  CD1 . LEU B 1 186 ? 32.623  5.274   13.076  1.00 38.94 ? 250  LEU B CD1 1 
ATOM   4348 C  CD2 . LEU B 1 186 ? 32.151  6.358   15.285  1.00 39.09 ? 250  LEU B CD2 1 
ATOM   4349 N  N   . GLU B 1 187 ? 30.345  8.701   10.619  1.00 32.20 ? 251  GLU B N   1 
ATOM   4350 C  CA  . GLU B 1 187 ? 30.023  9.981   9.996   1.00 33.45 ? 251  GLU B CA  1 
ATOM   4351 C  C   . GLU B 1 187 ? 28.855  9.944   9.014   1.00 31.73 ? 251  GLU B C   1 
ATOM   4352 O  O   . GLU B 1 187 ? 28.292  10.986  8.689   1.00 30.62 ? 251  GLU B O   1 
ATOM   4353 C  CB  . GLU B 1 187 ? 31.240  10.541  9.246   1.00 35.76 ? 251  GLU B CB  1 
ATOM   4354 C  CG  . GLU B 1 187 ? 32.597  10.208  9.838   1.00 41.03 ? 251  GLU B CG  1 
ATOM   4355 C  CD  . GLU B 1 187 ? 33.069  8.800   9.491   1.00 42.93 ? 251  GLU B CD  1 
ATOM   4356 O  OE1 . GLU B 1 187 ? 32.559  7.825   10.092  1.00 44.81 ? 251  GLU B OE1 1 
ATOM   4357 O  OE2 . GLU B 1 187 ? 33.950  8.669   8.608   1.00 43.30 ? 251  GLU B OE2 1 
ATOM   4358 N  N   . LYS B 1 188 ? 28.498  8.759   8.533   1.00 29.66 ? 252  LYS B N   1 
ATOM   4359 C  CA  . LYS B 1 188 ? 27.421  8.647   7.553   1.00 30.46 ? 252  LYS B CA  1 
ATOM   4360 C  C   . LYS B 1 188 ? 26.144  7.979   8.054   1.00 29.57 ? 252  LYS B C   1 
ATOM   4361 O  O   . LYS B 1 188 ? 25.173  7.856   7.304   1.00 28.31 ? 252  LYS B O   1 
ATOM   4362 C  CB  . LYS B 1 188 ? 27.939  7.910   6.313   1.00 31.51 ? 252  LYS B CB  1 
ATOM   4363 N  N   . ARG B 1 189 ? 26.135  7.561   9.314   1.00 30.09 ? 253  ARG B N   1 
ATOM   4364 C  CA  . ARG B 1 189 ? 24.973  6.877   9.871   1.00 30.58 ? 253  ARG B CA  1 
ATOM   4365 C  C   . ARG B 1 189 ? 23.665  7.646   9.693   1.00 29.26 ? 253  ARG B C   1 
ATOM   4366 O  O   . ARG B 1 189 ? 22.663  7.084   9.253   1.00 29.32 ? 253  ARG B O   1 
ATOM   4367 C  CB  . ARG B 1 189 ? 25.179  6.581   11.359  1.00 30.81 ? 253  ARG B CB  1 
ATOM   4368 C  CG  . ARG B 1 189 ? 24.147  5.599   11.917  1.00 33.60 ? 253  ARG B CG  1 
ATOM   4369 C  CD  . ARG B 1 189 ? 23.764  5.927   13.350  1.00 35.68 ? 253  ARG B CD  1 
ATOM   4370 N  NE  . ARG B 1 189 ? 22.683  5.075   13.840  1.00 37.04 ? 253  ARG B NE  1 
ATOM   4371 C  CZ  . ARG B 1 189 ? 22.842  3.824   14.261  1.00 38.61 ? 253  ARG B CZ  1 
ATOM   4372 N  NH1 . ARG B 1 189 ? 24.048  3.263   14.260  1.00 39.12 ? 253  ARG B NH1 1 
ATOM   4373 N  NH2 . ARG B 1 189 ? 21.795  3.133   14.687  1.00 38.03 ? 253  ARG B NH2 1 
ATOM   4374 N  N   . SER B 1 190 ? 23.679  8.928   10.034  1.00 28.27 ? 254  SER B N   1 
ATOM   4375 C  CA  . SER B 1 190 ? 22.484  9.755   9.929   1.00 28.83 ? 254  SER B CA  1 
ATOM   4376 C  C   . SER B 1 190 ? 22.094  10.064  8.488   1.00 27.80 ? 254  SER B C   1 
ATOM   4377 O  O   . SER B 1 190 ? 20.948  10.411  8.208   1.00 28.87 ? 254  SER B O   1 
ATOM   4378 C  CB  . SER B 1 190 ? 22.685  11.059  10.705  1.00 30.61 ? 254  SER B CB  1 
ATOM   4379 O  OG  . SER B 1 190 ? 22.814  10.803  12.096  1.00 33.46 ? 254  SER B OG  1 
ATOM   4380 N  N   . GLU B 1 191 ? 23.049  9.925   7.577   1.00 24.24 ? 255  GLU B N   1 
ATOM   4381 C  CA  . GLU B 1 191 ? 22.812  10.197  6.166   1.00 23.21 ? 255  GLU B CA  1 
ATOM   4382 C  C   . GLU B 1 191 ? 22.256  8.982   5.414   1.00 19.75 ? 255  GLU B C   1 
ATOM   4383 O  O   . GLU B 1 191 ? 21.785  9.102   4.286   1.00 17.14 ? 255  GLU B O   1 
ATOM   4384 C  CB  . GLU B 1 191 ? 24.127  10.672  5.520   1.00 24.84 ? 255  GLU B CB  1 
ATOM   4385 C  CG  . GLU B 1 191 ? 24.185  10.582  4.000   1.00 30.36 ? 255  GLU B CG  1 
ATOM   4386 C  CD  . GLU B 1 191 ? 23.133  11.437  3.303   1.00 34.91 ? 255  GLU B CD  1 
ATOM   4387 O  OE1 . GLU B 1 191 ? 23.029  11.351  2.055   1.00 33.61 ? 255  GLU B OE1 1 
ATOM   4388 O  OE2 . GLU B 1 191 ? 22.414  12.194  4.000   1.00 37.70 ? 255  GLU B OE2 1 
ATOM   4389 N  N   . VAL B 1 192 ? 22.299  7.816   6.045   1.00 18.21 ? 256  VAL B N   1 
ATOM   4390 C  CA  . VAL B 1 192 ? 21.818  6.600   5.405   1.00 17.57 ? 256  VAL B CA  1 
ATOM   4391 C  C   . VAL B 1 192 ? 20.318  6.606   5.091   1.00 17.17 ? 256  VAL B C   1 
ATOM   4392 O  O   . VAL B 1 192 ? 19.499  7.009   5.917   1.00 16.20 ? 256  VAL B O   1 
ATOM   4393 C  CB  . VAL B 1 192 ? 22.128  5.355   6.272   1.00 17.70 ? 256  VAL B CB  1 
ATOM   4394 C  CG1 . VAL B 1 192 ? 21.574  4.106   5.606   1.00 16.59 ? 256  VAL B CG1 1 
ATOM   4395 C  CG2 . VAL B 1 192 ? 23.633  5.214   6.470   1.00 19.12 ? 256  VAL B CG2 1 
ATOM   4396 N  N   . VAL B 1 193 ? 19.973  6.169   3.881   1.00 17.68 ? 257  VAL B N   1 
ATOM   4397 C  CA  . VAL B 1 193 ? 18.578  6.072   3.469   1.00 18.55 ? 257  VAL B CA  1 
ATOM   4398 C  C   . VAL B 1 193 ? 18.225  4.585   3.437   1.00 18.15 ? 257  VAL B C   1 
ATOM   4399 O  O   . VAL B 1 193 ? 18.934  3.776   2.839   1.00 17.56 ? 257  VAL B O   1 
ATOM   4400 C  CB  . VAL B 1 193 ? 18.341  6.697   2.072   1.00 21.09 ? 257  VAL B CB  1 
ATOM   4401 C  CG1 . VAL B 1 193 ? 18.596  8.192   2.126   1.00 22.35 ? 257  VAL B CG1 1 
ATOM   4402 C  CG2 . VAL B 1 193 ? 19.249  6.055   1.045   1.00 26.05 ? 257  VAL B CG2 1 
ATOM   4403 N  N   . ILE B 1 194 ? 17.139  4.218   4.102   1.00 17.75 ? 258  ILE B N   1 
ATOM   4404 C  CA  . ILE B 1 194 ? 16.731  2.822   4.147   1.00 16.42 ? 258  ILE B CA  1 
ATOM   4405 C  C   . ILE B 1 194 ? 15.782  2.451   3.013   1.00 17.02 ? 258  ILE B C   1 
ATOM   4406 O  O   . ILE B 1 194 ? 14.708  3.034   2.863   1.00 15.88 ? 258  ILE B O   1 
ATOM   4407 C  CB  . ILE B 1 194 ? 16.050  2.490   5.490   1.00 18.25 ? 258  ILE B CB  1 
ATOM   4408 C  CG1 . ILE B 1 194 ? 16.993  2.833   6.647   1.00 18.03 ? 258  ILE B CG1 1 
ATOM   4409 C  CG2 . ILE B 1 194 ? 15.677  1.020   5.532   1.00 18.86 ? 258  ILE B CG2 1 
ATOM   4410 C  CD1 . ILE B 1 194 ? 16.359  2.719   8.020   1.00 17.05 ? 258  ILE B CD1 1 
ATOM   4411 N  N   . LEU B 1 195 ? 16.195  1.491   2.197   1.00 16.36 ? 259  LEU B N   1 
ATOM   4412 C  CA  . LEU B 1 195 ? 15.345  1.039   1.115   1.00 18.19 ? 259  LEU B CA  1 
ATOM   4413 C  C   . LEU B 1 195 ? 14.775  -0.306  1.511   1.00 18.35 ? 259  LEU B C   1 
ATOM   4414 O  O   . LEU B 1 195 ? 15.504  -1.301  1.590   1.00 18.72 ? 259  LEU B O   1 
ATOM   4415 C  CB  . LEU B 1 195 ? 16.120  0.888   -0.199  1.00 18.09 ? 259  LEU B CB  1 
ATOM   4416 C  CG  . LEU B 1 195 ? 16.427  2.131   -1.041  1.00 20.91 ? 259  LEU B CG  1 
ATOM   4417 C  CD1 . LEU B 1 195 ? 17.092  1.689   -2.350  1.00 17.59 ? 259  LEU B CD1 1 
ATOM   4418 C  CD2 . LEU B 1 195 ? 15.132  2.902   -1.339  1.00 17.26 ? 259  LEU B CD2 1 
ATOM   4419 N  N   . PHE B 1 196 ? 13.482  -0.320  1.813   1.00 16.00 ? 260  PHE B N   1 
ATOM   4420 C  CA  . PHE B 1 196 ? 12.814  -1.562  2.151   1.00 16.59 ? 260  PHE B CA  1 
ATOM   4421 C  C   . PHE B 1 196 ? 12.509  -2.158  0.795   1.00 17.09 ? 260  PHE B C   1 
ATOM   4422 O  O   . PHE B 1 196 ? 11.828  -1.543  -0.034  1.00 19.26 ? 260  PHE B O   1 
ATOM   4423 C  CB  . PHE B 1 196 ? 11.527  -1.304  2.947   1.00 12.44 ? 260  PHE B CB  1 
ATOM   4424 C  CG  . PHE B 1 196 ? 11.777  -0.941  4.390   1.00 12.51 ? 260  PHE B CG  1 
ATOM   4425 C  CD1 . PHE B 1 196 ? 11.862  0.391   4.786   1.00 9.83  ? 260  PHE B CD1 1 
ATOM   4426 C  CD2 . PHE B 1 196 ? 11.956  -1.937  5.348   1.00 10.74 ? 260  PHE B CD2 1 
ATOM   4427 C  CE1 . PHE B 1 196 ? 12.122  0.730   6.112   1.00 10.66 ? 260  PHE B CE1 1 
ATOM   4428 C  CE2 . PHE B 1 196 ? 12.216  -1.611  6.686   1.00 11.97 ? 260  PHE B CE2 1 
ATOM   4429 C  CZ  . PHE B 1 196 ? 12.299  -0.273  7.066   1.00 10.66 ? 260  PHE B CZ  1 
ATOM   4430 N  N   . SER B 1 197 ? 13.039  -3.344  0.550   1.00 16.94 ? 261  SER B N   1 
ATOM   4431 C  CA  . SER B 1 197 ? 12.842  -3.981  -0.734  1.00 17.51 ? 261  SER B CA  1 
ATOM   4432 C  C   . SER B 1 197 ? 12.033  -5.265  -0.624  1.00 17.58 ? 261  SER B C   1 
ATOM   4433 O  O   . SER B 1 197 ? 12.433  -6.209  0.048   1.00 18.71 ? 261  SER B O   1 
ATOM   4434 C  CB  . SER B 1 197 ? 14.210  -4.255  -1.372  1.00 16.37 ? 261  SER B CB  1 
ATOM   4435 O  OG  . SER B 1 197 ? 14.075  -4.725  -2.697  1.00 16.87 ? 261  SER B OG  1 
ATOM   4436 N  N   . ALA B 1 198 ? 10.890  -5.292  -1.297  1.00 18.93 ? 262  ALA B N   1 
ATOM   4437 C  CA  . ALA B 1 198 ? 10.029  -6.467  -1.283  1.00 18.91 ? 262  ALA B CA  1 
ATOM   4438 C  C   . ALA B 1 198 ? 9.845   -6.949  -2.711  1.00 18.78 ? 262  ALA B C   1 
ATOM   4439 O  O   . ALA B 1 198 ? 10.026  -6.192  -3.659  1.00 16.79 ? 262  ALA B O   1 
ATOM   4440 C  CB  . ALA B 1 198 ? 8.670   -6.122  -0.662  1.00 18.73 ? 262  ALA B CB  1 
ATOM   4441 N  N   . CYS B 1 199 ? 9.495   -8.214  -2.872  1.00 22.42 ? 263  CYS B N   1 
ATOM   4442 C  CA  . CYS B 1 199 ? 9.282   -8.736  -4.207  1.00 22.88 ? 263  CYS B CA  1 
ATOM   4443 C  C   . CYS B 1 199 ? 8.093   -8.032  -4.839  1.00 22.31 ? 263  CYS B C   1 
ATOM   4444 O  O   . CYS B 1 199 ? 7.041   -7.883  -4.220  1.00 19.69 ? 263  CYS B O   1 
ATOM   4445 C  CB  . CYS B 1 199 ? 9.058   -10.252 -4.171  1.00 26.74 ? 263  CYS B CB  1 
ATOM   4446 S  SG  . CYS B 1 199 ? 10.621  -11.178 -4.178  1.00 35.70 ? 263  CYS B SG  1 
ATOM   4447 N  N   . SER B 1 200 ? 8.287   -7.587  -6.076  1.00 19.58 ? 264  SER B N   1 
ATOM   4448 C  CA  . SER B 1 200 ? 7.256   -6.890  -6.824  1.00 19.29 ? 264  SER B CA  1 
ATOM   4449 C  C   . SER B 1 200 ? 6.198   -7.853  -7.356  1.00 18.68 ? 264  SER B C   1 
ATOM   4450 O  O   . SER B 1 200 ? 6.371   -9.069  -7.322  1.00 16.76 ? 264  SER B O   1 
ATOM   4451 C  CB  . SER B 1 200 ? 7.887   -6.136  -8.000  1.00 18.24 ? 264  SER B CB  1 
ATOM   4452 O  OG  . SER B 1 200 ? 6.919   -5.358  -8.688  1.00 21.18 ? 264  SER B OG  1 
ATOM   4453 N  N   . LEU B 1 201 ? 5.098   -7.290  -7.842  1.00 18.45 ? 265  LEU B N   1 
ATOM   4454 C  CA  . LEU B 1 201 ? 4.009   -8.074  -8.412  1.00 19.00 ? 265  LEU B CA  1 
ATOM   4455 C  C   . LEU B 1 201 ? 3.582   -7.408  -9.698  1.00 17.73 ? 265  LEU B C   1 
ATOM   4456 O  O   . LEU B 1 201 ? 3.687   -6.189  -9.837  1.00 16.59 ? 265  LEU B O   1 
ATOM   4457 C  CB  . LEU B 1 201 ? 2.790   -8.108  -7.488  1.00 20.22 ? 265  LEU B CB  1 
ATOM   4458 C  CG  . LEU B 1 201 ? 2.821   -8.905  -6.188  1.00 24.11 ? 265  LEU B CG  1 
ATOM   4459 C  CD1 . LEU B 1 201 ? 1.476   -8.754  -5.475  1.00 23.20 ? 265  LEU B CD1 1 
ATOM   4460 C  CD2 . LEU B 1 201 ? 3.107   -10.370 -6.494  1.00 24.50 ? 265  LEU B CD2 1 
ATOM   4461 N  N   . PRO B 1 202 ? 3.110   -8.198  -10.668 1.00 16.49 ? 266  PRO B N   1 
ATOM   4462 C  CA  . PRO B 1 202 ? 2.671   -7.588  -11.924 1.00 15.90 ? 266  PRO B CA  1 
ATOM   4463 C  C   . PRO B 1 202 ? 1.439   -6.740  -11.593 1.00 16.47 ? 266  PRO B C   1 
ATOM   4464 O  O   . PRO B 1 202 ? 0.652   -7.093  -10.712 1.00 15.75 ? 266  PRO B O   1 
ATOM   4465 C  CB  . PRO B 1 202 ? 2.320   -8.794  -12.789 1.00 16.07 ? 266  PRO B CB  1 
ATOM   4466 C  CG  . PRO B 1 202 ? 3.224   -9.879  -12.254 1.00 17.56 ? 266  PRO B CG  1 
ATOM   4467 C  CD  . PRO B 1 202 ? 3.116   -9.669  -10.763 1.00 16.66 ? 266  PRO B CD  1 
ATOM   4468 N  N   . MET B 1 203 ? 1.275   -5.618  -12.275 1.00 17.03 ? 267  MET B N   1 
ATOM   4469 C  CA  . MET B 1 203 ? 0.125   -4.771  -12.010 1.00 17.98 ? 267  MET B CA  1 
ATOM   4470 C  C   . MET B 1 203 ? -1.203  -5.485  -12.233 1.00 17.89 ? 267  MET B C   1 
ATOM   4471 O  O   . MET B 1 203 ? -2.203  -5.122  -11.620 1.00 18.94 ? 267  MET B O   1 
ATOM   4472 C  CB  . MET B 1 203 ? 0.197   -3.500  -12.855 1.00 17.96 ? 267  MET B CB  1 
ATOM   4473 C  CG  . MET B 1 203 ? 1.283   -2.530  -12.397 1.00 17.06 ? 267  MET B CG  1 
ATOM   4474 S  SD  . MET B 1 203 ? 1.165   -2.152  -10.621 1.00 21.12 ? 267  MET B SD  1 
ATOM   4475 C  CE  . MET B 1 203 ? -0.371  -1.180  -10.544 1.00 17.37 ? 267  MET B CE  1 
ATOM   4476 N  N   . SER B 1 204 ? -1.229  -6.506  -13.085 1.00 19.28 ? 268  SER B N   1 
ATOM   4477 C  CA  . SER B 1 204 ? -2.485  -7.222  -13.319 1.00 19.89 ? 268  SER B CA  1 
ATOM   4478 C  C   . SER B 1 204 ? -2.911  -7.957  -12.056 1.00 20.07 ? 268  SER B C   1 
ATOM   4479 O  O   . SER B 1 204 ? -4.101  -8.182  -11.824 1.00 22.25 ? 268  SER B O   1 
ATOM   4480 C  CB  . SER B 1 204 ? -2.360  -8.213  -14.484 1.00 21.29 ? 268  SER B CB  1 
ATOM   4481 O  OG  . SER B 1 204 ? -1.382  -9.204  -14.232 1.00 25.11 ? 268  SER B OG  1 
ATOM   4482 N  N   . VAL B 1 205 ? -1.940  -8.339  -11.236 1.00 18.51 ? 269  VAL B N   1 
ATOM   4483 C  CA  . VAL B 1 205 ? -2.254  -9.022  -9.993  1.00 16.43 ? 269  VAL B CA  1 
ATOM   4484 C  C   . VAL B 1 205 ? -2.651  -7.975  -8.946  1.00 15.49 ? 269  VAL B C   1 
ATOM   4485 O  O   . VAL B 1 205 ? -3.644  -8.139  -8.241  1.00 14.12 ? 269  VAL B O   1 
ATOM   4486 C  CB  . VAL B 1 205 ? -1.052  -9.845  -9.498  1.00 19.21 ? 269  VAL B CB  1 
ATOM   4487 C  CG1 . VAL B 1 205 ? -1.317  -10.365 -8.095  1.00 16.48 ? 269  VAL B CG1 1 
ATOM   4488 C  CG2 . VAL B 1 205 ? -0.795  -11.004 -10.462 1.00 17.77 ? 269  VAL B CG2 1 
ATOM   4489 N  N   . VAL B 1 206 ? -1.872  -6.900  -8.852  1.00 14.90 ? 270  VAL B N   1 
ATOM   4490 C  CA  . VAL B 1 206 ? -2.164  -5.818  -7.914  1.00 15.07 ? 270  VAL B CA  1 
ATOM   4491 C  C   . VAL B 1 206 ? -3.588  -5.315  -8.165  1.00 14.67 ? 270  VAL B C   1 
ATOM   4492 O  O   . VAL B 1 206 ? -4.379  -5.156  -7.242  1.00 12.21 ? 270  VAL B O   1 
ATOM   4493 C  CB  . VAL B 1 206 ? -1.197  -4.604  -8.110  1.00 16.07 ? 270  VAL B CB  1 
ATOM   4494 C  CG1 . VAL B 1 206 ? -1.664  -3.421  -7.262  1.00 16.59 ? 270  VAL B CG1 1 
ATOM   4495 C  CG2 . VAL B 1 206 ? 0.235   -4.991  -7.736  1.00 13.80 ? 270  VAL B CG2 1 
ATOM   4496 N  N   . ASN B 1 207 ? -3.905  -5.075  -9.431  1.00 15.90 ? 271  ASN B N   1 
ATOM   4497 C  CA  . ASN B 1 207 ? -5.214  -4.559  -9.795  1.00 17.84 ? 271  ASN B CA  1 
ATOM   4498 C  C   . ASN B 1 207 ? -6.409  -5.475  -9.576  1.00 18.04 ? 271  ASN B C   1 
ATOM   4499 O  O   . ASN B 1 207 ? -7.542  -5.004  -9.633  1.00 16.67 ? 271  ASN B O   1 
ATOM   4500 C  CB  . ASN B 1 207 ? -5.197  -4.054  -11.243 1.00 17.70 ? 271  ASN B CB  1 
ATOM   4501 C  CG  . ASN B 1 207 ? -4.332  -2.825  -11.406 1.00 18.74 ? 271  ASN B CG  1 
ATOM   4502 O  OD1 . ASN B 1 207 ? -4.204  -2.025  -10.479 1.00 19.09 ? 271  ASN B OD1 1 
ATOM   4503 N  ND2 . ASN B 1 207 ? -3.739  -2.660  -12.583 1.00 18.54 ? 271  ASN B ND2 1 
ATOM   4504 N  N   . ARG B 1 208 ? -6.192  -6.766  -9.324  1.00 19.01 ? 272  ARG B N   1 
ATOM   4505 C  CA  . ARG B 1 208 ? -7.350  -7.612  -9.086  1.00 20.44 ? 272  ARG B CA  1 
ATOM   4506 C  C   . ARG B 1 208 ? -7.721  -7.611  -7.610  1.00 20.03 ? 272  ARG B C   1 
ATOM   4507 O  O   . ARG B 1 208 ? -8.769  -8.129  -7.222  1.00 21.41 ? 272  ARG B O   1 
ATOM   4508 C  CB  . ARG B 1 208 ? -7.162  -9.046  -9.619  1.00 24.14 ? 272  ARG B CB  1 
ATOM   4509 C  CG  . ARG B 1 208 ? -6.016  -9.888  -9.088  1.00 28.97 ? 272  ARG B CG  1 
ATOM   4510 C  CD  . ARG B 1 208 ? -6.232  -11.328 -9.577  1.00 32.85 ? 272  ARG B CD  1 
ATOM   4511 N  NE  . ARG B 1 208 ? -5.069  -12.211 -9.470  1.00 36.06 ? 272  ARG B NE  1 
ATOM   4512 C  CZ  . ARG B 1 208 ? -4.403  -12.459 -8.346  1.00 38.14 ? 272  ARG B CZ  1 
ATOM   4513 N  NH1 . ARG B 1 208 ? -4.769  -11.881 -7.201  1.00 40.77 ? 272  ARG B NH1 1 
ATOM   4514 N  NH2 . ARG B 1 208 ? -3.378  -13.303 -8.361  1.00 36.89 ? 272  ARG B NH2 1 
ATOM   4515 N  N   . GLY B 1 209 ? -6.868  -6.998  -6.794  1.00 18.86 ? 273  GLY B N   1 
ATOM   4516 C  CA  . GLY B 1 209 ? -7.141  -6.914  -5.370  1.00 17.80 ? 273  GLY B CA  1 
ATOM   4517 C  C   . GLY B 1 209 ? -6.172  -7.608  -4.433  1.00 16.94 ? 273  GLY B C   1 
ATOM   4518 O  O   . GLY B 1 209 ? -6.477  -7.776  -3.253  1.00 17.07 ? 273  GLY B O   1 
ATOM   4519 N  N   . ASP B 1 210 ? -5.002  -7.997  -4.931  1.00 16.30 ? 274  ASP B N   1 
ATOM   4520 C  CA  . ASP B 1 210 ? -4.045  -8.685  -4.082  1.00 17.15 ? 274  ASP B CA  1 
ATOM   4521 C  C   . ASP B 1 210 ? -3.726  -7.840  -2.846  1.00 16.41 ? 274  ASP B C   1 
ATOM   4522 O  O   . ASP B 1 210 ? -3.374  -6.665  -2.949  1.00 15.27 ? 274  ASP B O   1 
ATOM   4523 C  CB  . ASP B 1 210 ? -2.768  -9.010  -4.863  1.00 16.65 ? 274  ASP B CB  1 
ATOM   4524 C  CG  . ASP B 1 210 ? -1.968  -10.133 -4.221  1.00 18.58 ? 274  ASP B CG  1 
ATOM   4525 O  OD1 . ASP B 1 210 ? -1.244  -9.870  -3.242  1.00 17.93 ? 274  ASP B OD1 1 
ATOM   4526 O  OD2 . ASP B 1 210 ? -2.080  -11.288 -4.679  1.00 21.34 ? 274  ASP B OD2 1 
ATOM   4527 N  N   . PRO B 1 211 ? -3.879  -8.430  -1.655  1.00 16.64 ? 275  PRO B N   1 
ATOM   4528 C  CA  . PRO B 1 211 ? -3.613  -7.738  -0.387  1.00 16.93 ? 275  PRO B CA  1 
ATOM   4529 C  C   . PRO B 1 211 ? -2.131  -7.500  -0.046  1.00 14.98 ? 275  PRO B C   1 
ATOM   4530 O  O   . PRO B 1 211 ? -1.810  -6.715  0.843   1.00 12.99 ? 275  PRO B O   1 
ATOM   4531 C  CB  . PRO B 1 211 ? -4.306  -8.630  0.640   1.00 17.22 ? 275  PRO B CB  1 
ATOM   4532 C  CG  . PRO B 1 211 ? -4.206  -9.998  0.040   1.00 16.84 ? 275  PRO B CG  1 
ATOM   4533 C  CD  . PRO B 1 211 ? -4.501  -9.749  -1.422  1.00 17.29 ? 275  PRO B CD  1 
ATOM   4534 N  N   . TYR B 1 212 ? -1.244  -8.161  -0.776  1.00 14.75 ? 276  TYR B N   1 
ATOM   4535 C  CA  . TYR B 1 212 ? 0.202   -8.073  -0.545  1.00 13.49 ? 276  TYR B CA  1 
ATOM   4536 C  C   . TYR B 1 212 ? 0.801   -6.670  -0.344  1.00 11.75 ? 276  TYR B C   1 
ATOM   4537 O  O   . TYR B 1 212 ? 1.388   -6.397  0.693   1.00 12.33 ? 276  TYR B O   1 
ATOM   4538 C  CB  . TYR B 1 212 ? 0.931   -8.798  -1.684  1.00 11.49 ? 276  TYR B CB  1 
ATOM   4539 C  CG  . TYR B 1 212 ? 2.447   -8.787  -1.607  1.00 12.33 ? 276  TYR B CG  1 
ATOM   4540 C  CD1 . TYR B 1 212 ? 3.129   -9.491  -0.609  1.00 11.41 ? 276  TYR B CD1 1 
ATOM   4541 C  CD2 . TYR B 1 212 ? 3.197   -8.126  -2.573  1.00 13.09 ? 276  TYR B CD2 1 
ATOM   4542 C  CE1 . TYR B 1 212 ? 4.530   -9.544  -0.587  1.00 14.19 ? 276  TYR B CE1 1 
ATOM   4543 C  CE2 . TYR B 1 212 ? 4.593   -8.168  -2.563  1.00 14.63 ? 276  TYR B CE2 1 
ATOM   4544 C  CZ  . TYR B 1 212 ? 5.250   -8.876  -1.576  1.00 15.00 ? 276  TYR B CZ  1 
ATOM   4545 O  OH  . TYR B 1 212 ? 6.623   -8.920  -1.589  1.00 18.38 ? 276  TYR B OH  1 
ATOM   4546 N  N   . PRO B 1 213 ? 0.648   -5.765  -1.326  1.00 12.18 ? 277  PRO B N   1 
ATOM   4547 C  CA  . PRO B 1 213 ? 1.213   -4.416  -1.180  1.00 13.69 ? 277  PRO B CA  1 
ATOM   4548 C  C   . PRO B 1 213 ? 0.835   -3.724  0.126   1.00 12.70 ? 277  PRO B C   1 
ATOM   4549 O  O   . PRO B 1 213 ? 1.690   -3.164  0.815   1.00 11.45 ? 277  PRO B O   1 
ATOM   4550 C  CB  . PRO B 1 213 ? 0.661   -3.664  -2.392  1.00 13.27 ? 277  PRO B CB  1 
ATOM   4551 C  CG  . PRO B 1 213 ? 0.399   -4.758  -3.388  1.00 15.65 ? 277  PRO B CG  1 
ATOM   4552 C  CD  . PRO B 1 213 ? -0.179  -5.853  -2.541  1.00 10.80 ? 277  PRO B CD  1 
ATOM   4553 N  N   . GLN B 1 214 ? -0.448  -3.767  0.462   1.00 9.53  ? 278  GLN B N   1 
ATOM   4554 C  CA  . GLN B 1 214 ? -0.917  -3.115  1.671   1.00 10.56 ? 278  GLN B CA  1 
ATOM   4555 C  C   . GLN B 1 214 ? -0.299  -3.737  2.927   1.00 10.69 ? 278  GLN B C   1 
ATOM   4556 O  O   . GLN B 1 214 ? 0.050   -3.027  3.857   1.00 10.52 ? 278  GLN B O   1 
ATOM   4557 C  CB  . GLN B 1 214 ? -2.445  -3.155  1.714   1.00 8.30  ? 278  GLN B CB  1 
ATOM   4558 C  CG  . GLN B 1 214 ? -3.079  -2.375  2.857   1.00 13.39 ? 278  GLN B CG  1 
ATOM   4559 C  CD  . GLN B 1 214 ? -3.022  -3.121  4.167   1.00 13.40 ? 278  GLN B CD  1 
ATOM   4560 O  OE1 . GLN B 1 214 ? -3.213  -4.334  4.201   1.00 18.43 ? 278  GLN B OE1 1 
ATOM   4561 N  NE2 . GLN B 1 214 ? -2.766  -2.402  5.259   1.00 12.87 ? 278  GLN B NE2 1 
ATOM   4562 N  N   . GLU B 1 215 ? -0.139  -5.055  2.944   1.00 11.25 ? 279  GLU B N   1 
ATOM   4563 C  CA  . GLU B 1 215 ? 0.456   -5.706  4.100   1.00 13.65 ? 279  GLU B CA  1 
ATOM   4564 C  C   . GLU B 1 215 ? 1.957   -5.429  4.229   1.00 13.01 ? 279  GLU B C   1 
ATOM   4565 O  O   . GLU B 1 215 ? 2.447   -5.186  5.335   1.00 10.92 ? 279  GLU B O   1 
ATOM   4566 C  CB  . GLU B 1 215 ? 0.171   -7.213  4.067   1.00 15.59 ? 279  GLU B CB  1 
ATOM   4567 C  CG  . GLU B 1 215 ? -1.325  -7.511  4.196   1.00 19.31 ? 279  GLU B CG  1 
ATOM   4568 C  CD  . GLU B 1 215 ? -1.648  -8.972  4.463   1.00 23.60 ? 279  GLU B CD  1 
ATOM   4569 O  OE1 . GLU B 1 215 ? -2.854  -9.292  4.550   1.00 28.23 ? 279  GLU B OE1 1 
ATOM   4570 O  OE2 . GLU B 1 215 ? -0.719  -9.802  4.592   1.00 25.53 ? 279  GLU B OE2 1 
ATOM   4571 N  N   . VAL B 1 216 ? 2.685   -5.452  3.114   1.00 12.97 ? 280  VAL B N   1 
ATOM   4572 C  CA  . VAL B 1 216 ? 4.122   -5.179  3.153   1.00 13.18 ? 280  VAL B CA  1 
ATOM   4573 C  C   . VAL B 1 216 ? 4.294   -3.786  3.725   1.00 14.30 ? 280  VAL B C   1 
ATOM   4574 O  O   . VAL B 1 216 ? 5.145   -3.548  4.586   1.00 13.61 ? 280  VAL B O   1 
ATOM   4575 C  CB  . VAL B 1 216 ? 4.761   -5.207  1.741   1.00 12.91 ? 280  VAL B CB  1 
ATOM   4576 C  CG1 . VAL B 1 216 ? 6.237   -4.794  1.826   1.00 13.21 ? 280  VAL B CG1 1 
ATOM   4577 C  CG2 . VAL B 1 216 ? 4.650   -6.609  1.147   1.00 12.43 ? 280  VAL B CG2 1 
ATOM   4578 N  N   . SER B 1 217 ? 3.456   -2.874  3.241   1.00 15.35 ? 281  SER B N   1 
ATOM   4579 C  CA  . SER B 1 217 ? 3.470   -1.494  3.683   1.00 14.54 ? 281  SER B CA  1 
ATOM   4580 C  C   . SER B 1 217 ? 3.280   -1.401  5.186   1.00 15.70 ? 281  SER B C   1 
ATOM   4581 O  O   . SER B 1 217 ? 3.919   -0.580  5.847   1.00 15.81 ? 281  SER B O   1 
ATOM   4582 C  CB  . SER B 1 217 ? 2.371   -0.714  2.970   1.00 13.95 ? 281  SER B CB  1 
ATOM   4583 O  OG  . SER B 1 217 ? 2.681   -0.560  1.597   1.00 13.92 ? 281  SER B OG  1 
ATOM   4584 N  N   . ALA B 1 218 ? 2.395   -2.244  5.716   1.00 13.32 ? 282  ALA B N   1 
ATOM   4585 C  CA  . ALA B 1 218 ? 2.121   -2.279  7.147   1.00 11.42 ? 282  ALA B CA  1 
ATOM   4586 C  C   . ALA B 1 218 ? 3.377   -2.692  7.903   1.00 11.79 ? 282  ALA B C   1 
ATOM   4587 O  O   . ALA B 1 218 ? 3.704   -2.109  8.927   1.00 12.08 ? 282  ALA B O   1 
ATOM   4588 C  CB  . ALA B 1 218 ? 0.985   -3.268  7.453   1.00 12.44 ? 282  ALA B CB  1 
ATOM   4589 N  N   . THR B 1 219 ? 4.072   -3.706  7.396   1.00 12.33 ? 283  THR B N   1 
ATOM   4590 C  CA  . THR B 1 219 ? 5.290   -4.167  8.042   1.00 13.03 ? 283  THR B CA  1 
ATOM   4591 C  C   . THR B 1 219 ? 6.313   -3.035  8.085   1.00 11.42 ? 283  THR B C   1 
ATOM   4592 O  O   . THR B 1 219 ? 6.909   -2.782  9.127   1.00 12.10 ? 283  THR B O   1 
ATOM   4593 C  CB  . THR B 1 219 ? 5.915   -5.363  7.293   1.00 13.95 ? 283  THR B CB  1 
ATOM   4594 O  OG1 . THR B 1 219 ? 4.928   -6.385  7.108   1.00 14.10 ? 283  THR B OG1 1 
ATOM   4595 C  CG2 . THR B 1 219 ? 7.084   -5.938  8.089   1.00 13.26 ? 283  THR B CG2 1 
ATOM   4596 N  N   . VAL B 1 220 ? 6.502   -2.356  6.953   1.00 12.56 ? 284  VAL B N   1 
ATOM   4597 C  CA  . VAL B 1 220 ? 7.460   -1.249  6.856   1.00 12.50 ? 284  VAL B CA  1 
ATOM   4598 C  C   . VAL B 1 220 ? 7.158   -0.197  7.914   1.00 13.52 ? 284  VAL B C   1 
ATOM   4599 O  O   . VAL B 1 220 ? 8.053   0.247   8.640   1.00 11.60 ? 284  VAL B O   1 
ATOM   4600 C  CB  . VAL B 1 220 ? 7.428   -0.584  5.444   1.00 12.20 ? 284  VAL B CB  1 
ATOM   4601 C  CG1 . VAL B 1 220 ? 8.239   0.715   5.450   1.00 11.09 ? 284  VAL B CG1 1 
ATOM   4602 C  CG2 . VAL B 1 220 ? 7.995   -1.545  4.398   1.00 10.21 ? 284  VAL B CG2 1 
ATOM   4603 N  N   . GLN B 1 221 ? 5.889   0.179   8.024   1.00 13.60 ? 285  GLN B N   1 
ATOM   4604 C  CA  . GLN B 1 221 ? 5.492   1.183   9.002   1.00 15.38 ? 285  GLN B CA  1 
ATOM   4605 C  C   . GLN B 1 221 ? 5.797   0.761   10.444  1.00 16.00 ? 285  GLN B C   1 
ATOM   4606 O  O   . GLN B 1 221 ? 6.288   1.566   11.238  1.00 15.01 ? 285  GLN B O   1 
ATOM   4607 C  CB  . GLN B 1 221 ? 4.000   1.498   8.865   1.00 16.14 ? 285  GLN B CB  1 
ATOM   4608 C  CG  . GLN B 1 221 ? 3.577   2.816   9.500   1.00 19.84 ? 285  GLN B CG  1 
ATOM   4609 C  CD  . GLN B 1 221 ? 4.187   4.025   8.805   1.00 25.12 ? 285  GLN B CD  1 
ATOM   4610 O  OE1 . GLN B 1 221 ? 4.264   4.077   7.578   1.00 30.03 ? 285  GLN B OE1 1 
ATOM   4611 N  NE2 . GLN B 1 221 ? 4.608   5.011   9.586   1.00 28.48 ? 285  GLN B NE2 1 
ATOM   4612 N  N   . LYS B 1 222 ? 5.506   -0.491  10.789  1.00 16.06 ? 286  LYS B N   1 
ATOM   4613 C  CA  . LYS B 1 222 ? 5.768   -0.964  12.145  1.00 18.29 ? 286  LYS B CA  1 
ATOM   4614 C  C   . LYS B 1 222 ? 7.259   -0.959  12.460  1.00 17.13 ? 286  LYS B C   1 
ATOM   4615 O  O   . LYS B 1 222 ? 7.662   -0.570  13.550  1.00 15.19 ? 286  LYS B O   1 
ATOM   4616 C  CB  . LYS B 1 222 ? 5.200   -2.371  12.348  1.00 20.62 ? 286  LYS B CB  1 
ATOM   4617 C  CG  . LYS B 1 222 ? 3.689   -2.399  12.533  1.00 27.09 ? 286  LYS B CG  1 
ATOM   4618 C  CD  . LYS B 1 222 ? 3.291   -2.618  13.994  1.00 31.25 ? 286  LYS B CD  1 
ATOM   4619 C  CE  . LYS B 1 222 ? 3.656   -4.032  14.458  1.00 33.69 ? 286  LYS B CE  1 
ATOM   4620 N  NZ  . LYS B 1 222 ? 3.216   -4.339  15.855  1.00 34.79 ? 286  LYS B NZ  1 
ATOM   4621 N  N   . VAL B 1 223 ? 8.073   -1.390  11.502  1.00 15.20 ? 287  VAL B N   1 
ATOM   4622 C  CA  . VAL B 1 223 ? 9.520   -1.408  11.688  1.00 15.06 ? 287  VAL B CA  1 
ATOM   4623 C  C   . VAL B 1 223 ? 10.031  0.018   11.900  1.00 15.33 ? 287  VAL B C   1 
ATOM   4624 O  O   . VAL B 1 223 ? 10.777  0.283   12.837  1.00 12.94 ? 287  VAL B O   1 
ATOM   4625 C  CB  . VAL B 1 223 ? 10.231  -2.028  10.465  1.00 15.22 ? 287  VAL B CB  1 
ATOM   4626 C  CG1 . VAL B 1 223 ? 11.730  -1.800  10.551  1.00 17.09 ? 287  VAL B CG1 1 
ATOM   4627 C  CG2 . VAL B 1 223 ? 9.931   -3.507  10.395  1.00 13.33 ? 287  VAL B CG2 1 
ATOM   4628 N  N   . MET B 1 224 ? 9.603   0.938   11.041  1.00 16.53 ? 288  MET B N   1 
ATOM   4629 C  CA  . MET B 1 224 ? 10.038  2.322   11.150  1.00 17.19 ? 288  MET B CA  1 
ATOM   4630 C  C   . MET B 1 224 ? 9.609   2.982   12.457  1.00 19.80 ? 288  MET B C   1 
ATOM   4631 O  O   . MET B 1 224 ? 10.335  3.812   13.009  1.00 19.09 ? 288  MET B O   1 
ATOM   4632 C  CB  . MET B 1 224 ? 9.539   3.133   9.954   1.00 16.21 ? 288  MET B CB  1 
ATOM   4633 C  CG  . MET B 1 224 ? 10.285  2.808   8.667   1.00 18.67 ? 288  MET B CG  1 
ATOM   4634 S  SD  . MET B 1 224 ? 12.092  2.740   8.910   1.00 19.55 ? 288  MET B SD  1 
ATOM   4635 C  CE  . MET B 1 224 ? 12.407  4.368   9.669   1.00 22.44 ? 288  MET B CE  1 
ATOM   4636 N  N   . GLU B 1 225 ? 8.440   2.610   12.958  1.00 20.52 ? 289  GLU B N   1 
ATOM   4637 C  CA  . GLU B 1 225 ? 7.957   3.172   14.209  1.00 22.90 ? 289  GLU B CA  1 
ATOM   4638 C  C   . GLU B 1 225 ? 8.811   2.676   15.369  1.00 22.71 ? 289  GLU B C   1 
ATOM   4639 O  O   . GLU B 1 225 ? 9.099   3.423   16.305  1.00 20.82 ? 289  GLU B O   1 
ATOM   4640 C  CB  . GLU B 1 225 ? 6.489   2.798   14.433  1.00 24.56 ? 289  GLU B CB  1 
ATOM   4641 C  CG  . GLU B 1 225 ? 5.534   3.621   13.583  1.00 30.63 ? 289  GLU B CG  1 
ATOM   4642 C  CD  . GLU B 1 225 ? 4.071   3.375   13.913  1.00 34.83 ? 289  GLU B CD  1 
ATOM   4643 O  OE1 . GLU B 1 225 ? 3.765   3.062   15.089  1.00 37.56 ? 289  GLU B OE1 1 
ATOM   4644 O  OE2 . GLU B 1 225 ? 3.228   3.516   12.996  1.00 34.90 ? 289  GLU B OE2 1 
ATOM   4645 N  N   . ARG B 1 226 ? 9.227   1.417   15.299  1.00 22.27 ? 290  ARG B N   1 
ATOM   4646 C  CA  . ARG B 1 226 ? 10.053  0.854   16.352  1.00 22.66 ? 290  ARG B CA  1 
ATOM   4647 C  C   . ARG B 1 226 ? 11.443  1.479   16.321  1.00 22.16 ? 290  ARG B C   1 
ATOM   4648 O  O   . ARG B 1 226 ? 12.096  1.588   17.351  1.00 21.55 ? 290  ARG B O   1 
ATOM   4649 C  CB  . ARG B 1 226 ? 10.153  -0.666  16.213  1.00 24.81 ? 290  ARG B CB  1 
ATOM   4650 C  CG  . ARG B 1 226 ? 10.861  -1.315  17.385  1.00 29.02 ? 290  ARG B CG  1 
ATOM   4651 C  CD  . ARG B 1 226 ? 10.560  -2.793  17.478  1.00 33.76 ? 290  ARG B CD  1 
ATOM   4652 N  NE  . ARG B 1 226 ? 10.792  -3.298  18.831  1.00 37.70 ? 290  ARG B NE  1 
ATOM   4653 C  CZ  . ARG B 1 226 ? 11.980  -3.323  19.423  1.00 38.96 ? 290  ARG B CZ  1 
ATOM   4654 N  NH1 . ARG B 1 226 ? 13.053  -2.873  18.782  1.00 41.56 ? 290  ARG B NH1 1 
ATOM   4655 N  NH2 . ARG B 1 226 ? 12.096  -3.799  20.653  1.00 39.89 ? 290  ARG B NH2 1 
ATOM   4656 N  N   . LEU B 1 227 ? 11.885  1.898   15.139  1.00 20.75 ? 291  LEU B N   1 
ATOM   4657 C  CA  . LEU B 1 227 ? 13.195  2.535   14.984  1.00 21.47 ? 291  LEU B CA  1 
ATOM   4658 C  C   . LEU B 1 227 ? 13.072  4.039   15.220  1.00 23.09 ? 291  LEU B C   1 
ATOM   4659 O  O   . LEU B 1 227 ? 14.028  4.788   15.040  1.00 23.48 ? 291  LEU B O   1 
ATOM   4660 C  CB  . LEU B 1 227 ? 13.745  2.287   13.577  1.00 19.88 ? 291  LEU B CB  1 
ATOM   4661 C  CG  . LEU B 1 227 ? 14.116  0.846   13.240  1.00 19.96 ? 291  LEU B CG  1 
ATOM   4662 C  CD1 . LEU B 1 227 ? 14.398  0.712   11.748  1.00 19.93 ? 291  LEU B CD1 1 
ATOM   4663 C  CD2 . LEU B 1 227 ? 15.336  0.441   14.063  1.00 19.66 ? 291  LEU B CD2 1 
ATOM   4664 N  N   . GLU B 1 228 ? 11.877  4.466   15.617  1.00 24.22 ? 292  GLU B N   1 
ATOM   4665 C  CA  . GLU B 1 228 ? 11.587  5.868   15.883  1.00 25.34 ? 292  GLU B CA  1 
ATOM   4666 C  C   . GLU B 1 228 ? 11.980  6.788   14.730  1.00 24.07 ? 292  GLU B C   1 
ATOM   4667 O  O   . GLU B 1 228 ? 12.466  7.903   14.934  1.00 24.55 ? 292  GLU B O   1 
ATOM   4668 C  CB  . GLU B 1 228 ? 12.252  6.308   17.201  1.00 27.70 ? 292  GLU B CB  1 
ATOM   4669 C  CG  . GLU B 1 228 ? 11.706  5.554   18.421  1.00 32.76 ? 292  GLU B CG  1 
ATOM   4670 C  CD  . GLU B 1 228 ? 12.200  6.103   19.757  1.00 38.15 ? 292  GLU B CD  1 
ATOM   4671 O  OE1 . GLU B 1 228 ? 11.952  7.295   20.050  1.00 40.01 ? 292  GLU B OE1 1 
ATOM   4672 O  OE2 . GLU B 1 228 ? 12.831  5.340   20.523  1.00 40.33 ? 292  GLU B OE2 1 
ATOM   4673 N  N   . TYR B 1 229 ? 11.757  6.309   13.513  1.00 21.23 ? 293  TYR B N   1 
ATOM   4674 C  CA  . TYR B 1 229 ? 12.042  7.082   12.315  1.00 21.39 ? 293  TYR B CA  1 
ATOM   4675 C  C   . TYR B 1 229 ? 13.440  7.681   12.325  1.00 21.92 ? 293  TYR B C   1 
ATOM   4676 O  O   . TYR B 1 229 ? 13.625  8.830   11.936  1.00 20.16 ? 293  TYR B O   1 
ATOM   4677 C  CB  . TYR B 1 229 ? 10.998  8.190   12.185  1.00 22.47 ? 293  TYR B CB  1 
ATOM   4678 C  CG  . TYR B 1 229 ? 9.584   7.658   12.145  1.00 22.55 ? 293  TYR B CG  1 
ATOM   4679 C  CD1 . TYR B 1 229 ? 9.045   7.159   10.960  1.00 23.76 ? 293  TYR B CD1 1 
ATOM   4680 C  CD2 . TYR B 1 229 ? 8.798   7.610   13.301  1.00 24.62 ? 293  TYR B CD2 1 
ATOM   4681 C  CE1 . TYR B 1 229 ? 7.765   6.625   10.917  1.00 24.34 ? 293  TYR B CE1 1 
ATOM   4682 C  CE2 . TYR B 1 229 ? 7.508   7.073   13.273  1.00 24.54 ? 293  TYR B CE2 1 
ATOM   4683 C  CZ  . TYR B 1 229 ? 7.001   6.583   12.074  1.00 26.95 ? 293  TYR B CZ  1 
ATOM   4684 O  OH  . TYR B 1 229 ? 5.732   6.054   12.012  1.00 30.39 ? 293  TYR B OH  1 
ATOM   4685 N  N   . CYS B 1 230 ? 14.424  6.896   12.759  1.00 22.16 ? 294  CYS B N   1 
ATOM   4686 C  CA  . CYS B 1 230 ? 15.800  7.373   12.824  1.00 22.61 ? 294  CYS B CA  1 
ATOM   4687 C  C   . CYS B 1 230 ? 16.347  7.780   11.463  1.00 22.03 ? 294  CYS B C   1 
ATOM   4688 O  O   . CYS B 1 230 ? 17.157  8.695   11.371  1.00 23.84 ? 294  CYS B O   1 
ATOM   4689 C  CB  . CYS B 1 230 ? 16.713  6.310   13.458  1.00 21.96 ? 294  CYS B CB  1 
ATOM   4690 S  SG  . CYS B 1 230 ? 16.730  4.677   12.657  1.00 25.08 ? 294  CYS B SG  1 
ATOM   4691 N  N   . ASN B 1 231 ? 15.901  7.107   10.409  1.00 19.55 ? 295  ASN B N   1 
ATOM   4692 C  CA  . ASN B 1 231 ? 16.371  7.419   9.069   1.00 17.25 ? 295  ASN B CA  1 
ATOM   4693 C  C   . ASN B 1 231 ? 15.228  7.483   8.068   1.00 16.82 ? 295  ASN B C   1 
ATOM   4694 O  O   . ASN B 1 231 ? 14.179  6.870   8.274   1.00 17.21 ? 295  ASN B O   1 
ATOM   4695 C  CB  . ASN B 1 231 ? 17.382  6.371   8.593   1.00 17.04 ? 295  ASN B CB  1 
ATOM   4696 C  CG  . ASN B 1 231 ? 18.693  6.429   9.357   1.00 16.71 ? 295  ASN B CG  1 
ATOM   4697 O  OD1 . ASN B 1 231 ? 18.795  5.946   10.483  1.00 18.37 ? 295  ASN B OD1 1 
ATOM   4698 N  ND2 . ASN B 1 231 ? 19.701  7.032   8.745   1.00 17.03 ? 295  ASN B ND2 1 
ATOM   4699 N  N   . PRO B 1 232 ? 15.412  8.251   6.980   1.00 14.95 ? 296  PRO B N   1 
ATOM   4700 C  CA  . PRO B 1 232 ? 14.385  8.379   5.942   1.00 13.34 ? 296  PRO B CA  1 
ATOM   4701 C  C   . PRO B 1 232 ? 14.342  7.054   5.196   1.00 15.28 ? 296  PRO B C   1 
ATOM   4702 O  O   . PRO B 1 232 ? 15.348  6.333   5.143   1.00 13.52 ? 296  PRO B O   1 
ATOM   4703 C  CB  . PRO B 1 232 ? 14.899  9.524   5.080   1.00 12.63 ? 296  PRO B CB  1 
ATOM   4704 C  CG  . PRO B 1 232 ? 16.393  9.422   5.231   1.00 12.88 ? 296  PRO B CG  1 
ATOM   4705 C  CD  . PRO B 1 232 ? 16.562  9.130   6.700   1.00 14.78 ? 296  PRO B CD  1 
ATOM   4706 N  N   . TYR B 1 233 ? 13.193  6.734   4.614   1.00 13.89 ? 297  TYR B N   1 
ATOM   4707 C  CA  . TYR B 1 233 ? 13.049  5.466   3.924   1.00 14.98 ? 297  TYR B CA  1 
ATOM   4708 C  C   . TYR B 1 233 ? 12.067  5.532   2.772   1.00 15.46 ? 297  TYR B C   1 
ATOM   4709 O  O   . TYR B 1 233 ? 11.346  6.513   2.586   1.00 17.42 ? 297  TYR B O   1 
ATOM   4710 C  CB  . TYR B 1 233 ? 12.569  4.402   4.920   1.00 14.48 ? 297  TYR B CB  1 
ATOM   4711 C  CG  . TYR B 1 233 ? 11.130  4.612   5.348   1.00 17.42 ? 297  TYR B CG  1 
ATOM   4712 C  CD1 . TYR B 1 233 ? 10.080  4.078   4.601   1.00 18.90 ? 297  TYR B CD1 1 
ATOM   4713 C  CD2 . TYR B 1 233 ? 10.813  5.411   6.453   1.00 18.50 ? 297  TYR B CD2 1 
ATOM   4714 C  CE1 . TYR B 1 233 ? 8.747   4.336   4.934   1.00 22.00 ? 297  TYR B CE1 1 
ATOM   4715 C  CE2 . TYR B 1 233 ? 9.480   5.675   6.796   1.00 21.61 ? 297  TYR B CE2 1 
ATOM   4716 C  CZ  . TYR B 1 233 ? 8.454   5.133   6.027   1.00 22.11 ? 297  TYR B CZ  1 
ATOM   4717 O  OH  . TYR B 1 233 ? 7.133   5.390   6.333   1.00 26.67 ? 297  TYR B OH  1 
ATOM   4718 N  N   . ARG B 1 234 ? 12.033  4.451   2.013   1.00 17.37 ? 298  ARG B N   1 
ATOM   4719 C  CA  . ARG B 1 234 ? 11.125  4.326   0.889   1.00 18.84 ? 298  ARG B CA  1 
ATOM   4720 C  C   . ARG B 1 234 ? 10.932  2.824   0.700   1.00 18.02 ? 298  ARG B C   1 
ATOM   4721 O  O   . ARG B 1 234 ? 11.864  2.035   0.907   1.00 16.65 ? 298  ARG B O   1 
ATOM   4722 C  CB  . ARG B 1 234 ? 11.753  4.961   -0.362  1.00 22.52 ? 298  ARG B CB  1 
ATOM   4723 C  CG  . ARG B 1 234 ? 10.779  5.388   -1.458  1.00 23.18 ? 298  ARG B CG  1 
ATOM   4724 C  CD  . ARG B 1 234 ? 9.883   6.568   -1.050  1.00 24.27 ? 298  ARG B CD  1 
ATOM   4725 N  NE  . ARG B 1 234 ? 10.547  7.462   -0.115  1.00 26.45 ? 298  ARG B NE  1 
ATOM   4726 C  CZ  . ARG B 1 234 ? 10.526  8.790   -0.182  1.00 23.77 ? 298  ARG B CZ  1 
ATOM   4727 N  NH1 . ARG B 1 234 ? 9.876   9.414   -1.151  1.00 23.60 ? 298  ARG B NH1 1 
ATOM   4728 N  NH2 . ARG B 1 234 ? 11.155  9.493   0.743   1.00 22.61 ? 298  ARG B NH2 1 
ATOM   4729 N  N   . LEU B 1 235 ? 9.716   2.425   0.350   1.00 15.42 ? 299  LEU B N   1 
ATOM   4730 C  CA  . LEU B 1 235 ? 9.434   1.021   0.102   1.00 14.75 ? 299  LEU B CA  1 
ATOM   4731 C  C   . LEU B 1 235 ? 9.518   0.812   -1.404  1.00 14.31 ? 299  LEU B C   1 
ATOM   4732 O  O   . LEU B 1 235 ? 8.772   1.434   -2.162  1.00 14.21 ? 299  LEU B O   1 
ATOM   4733 C  CB  . LEU B 1 235 ? 8.038   0.648   0.609   1.00 12.93 ? 299  LEU B CB  1 
ATOM   4734 C  CG  . LEU B 1 235 ? 7.511   -0.731  0.203   1.00 12.58 ? 299  LEU B CG  1 
ATOM   4735 C  CD1 . LEU B 1 235 ? 8.487   -1.802  0.628   1.00 9.60  ? 299  LEU B CD1 1 
ATOM   4736 C  CD2 . LEU B 1 235 ? 6.125   -0.965  0.835   1.00 9.45  ? 299  LEU B CD2 1 
ATOM   4737 N  N   . VAL B 1 236 ? 10.446  -0.042  -1.831  1.00 14.35 ? 300  VAL B N   1 
ATOM   4738 C  CA  . VAL B 1 236 ? 10.634  -0.334  -3.243  1.00 13.93 ? 300  VAL B CA  1 
ATOM   4739 C  C   . VAL B 1 236 ? 10.443  -1.819  -3.535  1.00 14.63 ? 300  VAL B C   1 
ATOM   4740 O  O   . VAL B 1 236 ? 10.458  -2.650  -2.628  1.00 15.69 ? 300  VAL B O   1 
ATOM   4741 C  CB  . VAL B 1 236 ? 12.033  0.132   -3.735  1.00 15.00 ? 300  VAL B CB  1 
ATOM   4742 C  CG1 . VAL B 1 236 ? 12.125  1.647   -3.639  1.00 16.72 ? 300  VAL B CG1 1 
ATOM   4743 C  CG2 . VAL B 1 236 ? 13.122  -0.505  -2.909  1.00 14.24 ? 300  VAL B CG2 1 
ATOM   4744 N  N   . TRP B 1 237 ? 10.282  -2.153  -4.811  1.00 15.61 ? 301  TRP B N   1 
ATOM   4745 C  CA  . TRP B 1 237 ? 10.024  -3.528  -5.205  1.00 13.73 ? 301  TRP B CA  1 
ATOM   4746 C  C   . TRP B 1 237 ? 11.070  -4.084  -6.168  1.00 15.05 ? 301  TRP B C   1 
ATOM   4747 O  O   . TRP B 1 237 ? 11.503  -3.414  -7.109  1.00 15.36 ? 301  TRP B O   1 
ATOM   4748 C  CB  . TRP B 1 237 ? 8.621   -3.599  -5.810  1.00 13.18 ? 301  TRP B CB  1 
ATOM   4749 C  CG  . TRP B 1 237 ? 7.638   -2.762  -5.034  1.00 12.82 ? 301  TRP B CG  1 
ATOM   4750 C  CD1 . TRP B 1 237 ? 7.471   -1.411  -5.117  1.00 11.41 ? 301  TRP B CD1 1 
ATOM   4751 C  CD2 . TRP B 1 237 ? 6.756   -3.209  -3.994  1.00 11.99 ? 301  TRP B CD2 1 
ATOM   4752 N  NE1 . TRP B 1 237 ? 6.543   -0.988  -4.190  1.00 11.58 ? 301  TRP B NE1 1 
ATOM   4753 C  CE2 . TRP B 1 237 ? 6.087   -2.071  -3.492  1.00 10.73 ? 301  TRP B CE2 1 
ATOM   4754 C  CE3 . TRP B 1 237 ? 6.468   -4.461  -3.436  1.00 12.80 ? 301  TRP B CE3 1 
ATOM   4755 C  CZ2 . TRP B 1 237 ? 5.147   -2.146  -2.461  1.00 10.74 ? 301  TRP B CZ2 1 
ATOM   4756 C  CZ3 . TRP B 1 237 ? 5.531   -4.532  -2.408  1.00 13.03 ? 301  TRP B CZ3 1 
ATOM   4757 C  CH2 . TRP B 1 237 ? 4.883   -3.379  -1.935  1.00 11.28 ? 301  TRP B CH2 1 
ATOM   4758 N  N   . GLN B 1 238 ? 11.477  -5.320  -5.924  1.00 16.25 ? 302  GLN B N   1 
ATOM   4759 C  CA  . GLN B 1 238 ? 12.496  -5.944  -6.754  1.00 19.70 ? 302  GLN B CA  1 
ATOM   4760 C  C   . GLN B 1 238 ? 11.977  -7.165  -7.506  1.00 21.71 ? 302  GLN B C   1 
ATOM   4761 O  O   . GLN B 1 238 ? 10.844  -7.604  -7.307  1.00 18.40 ? 302  GLN B O   1 
ATOM   4762 C  CB  . GLN B 1 238 ? 13.674  -6.372  -5.871  1.00 18.02 ? 302  GLN B CB  1 
ATOM   4763 C  CG  . GLN B 1 238 ? 13.347  -7.531  -4.930  1.00 17.57 ? 302  GLN B CG  1 
ATOM   4764 C  CD  . GLN B 1 238 ? 14.487  -7.851  -3.966  1.00 21.58 ? 302  GLN B CD  1 
ATOM   4765 O  OE1 . GLN B 1 238 ? 14.739  -7.110  -3.009  1.00 20.57 ? 302  GLN B OE1 1 
ATOM   4766 N  NE2 . GLN B 1 238 ? 15.188  -8.954  -4.224  1.00 20.43 ? 302  GLN B NE2 1 
ATOM   4767 N  N   . SER B 1 239 ? 12.832  -7.697  -8.373  1.00 23.77 ? 303  SER B N   1 
ATOM   4768 C  CA  . SER B 1 239 ? 12.543  -8.908  -9.131  1.00 26.87 ? 303  SER B CA  1 
ATOM   4769 C  C   . SER B 1 239 ? 11.565  -8.811  -10.290 1.00 27.08 ? 303  SER B C   1 
ATOM   4770 O  O   . SER B 1 239 ? 11.021  -9.824  -10.717 1.00 27.42 ? 303  SER B O   1 
ATOM   4771 C  CB  . SER B 1 239 ? 12.083  -10.012 -8.171  1.00 26.12 ? 303  SER B CB  1 
ATOM   4772 O  OG  . SER B 1 239 ? 13.072  -10.270 -7.186  1.00 30.83 ? 303  SER B OG  1 
ATOM   4773 N  N   . LYS B 1 240 ? 11.328  -7.615  -10.806 1.00 28.63 ? 304  LYS B N   1 
ATOM   4774 C  CA  . LYS B 1 240 ? 10.428  -7.496  -11.943 1.00 31.30 ? 304  LYS B CA  1 
ATOM   4775 C  C   . LYS B 1 240 ? 11.048  -8.265  -13.106 1.00 33.61 ? 304  LYS B C   1 
ATOM   4776 O  O   . LYS B 1 240 ? 12.256  -8.220  -13.309 1.00 32.98 ? 304  LYS B O   1 
ATOM   4777 C  CB  . LYS B 1 240 ? 10.253  -6.041  -12.371 1.00 31.48 ? 304  LYS B CB  1 
ATOM   4778 C  CG  . LYS B 1 240 ? 9.583   -5.924  -13.732 1.00 33.10 ? 304  LYS B CG  1 
ATOM   4779 C  CD  . LYS B 1 240 ? 9.668   -4.535  -14.343 1.00 33.27 ? 304  LYS B CD  1 
ATOM   4780 C  CE  . LYS B 1 240 ? 9.050   -4.559  -15.738 1.00 34.91 ? 304  LYS B CE  1 
ATOM   4781 N  NZ  . LYS B 1 240 ? 9.027   -3.226  -16.402 1.00 34.82 ? 304  LYS B NZ  1 
ATOM   4782 N  N   . VAL B 1 241 ? 10.219  -8.966  -13.868 1.00 35.91 ? 305  VAL B N   1 
ATOM   4783 C  CA  . VAL B 1 241 ? 10.702  -9.712  -15.023 1.00 38.02 ? 305  VAL B CA  1 
ATOM   4784 C  C   . VAL B 1 241 ? 9.678   -9.638  -16.153 1.00 38.14 ? 305  VAL B C   1 
ATOM   4785 O  O   . VAL B 1 241 ? 8.469   -9.660  -15.912 1.00 38.72 ? 305  VAL B O   1 
ATOM   4786 C  CB  . VAL B 1 241 ? 10.967  -11.200 -14.669 1.00 39.27 ? 305  VAL B CB  1 
ATOM   4787 C  CG1 . VAL B 1 241 ? 9.680   -11.874 -14.225 1.00 39.56 ? 305  VAL B CG1 1 
ATOM   4788 C  CG2 . VAL B 1 241 ? 11.562  -11.921 -15.873 1.00 41.62 ? 305  VAL B CG2 1 
ATOM   4789 N  N   . GLY B 1 242 ? 10.164  -9.543  -17.386 1.00 38.14 ? 306  GLY B N   1 
ATOM   4790 C  CA  . GLY B 1 242 ? 9.261   -9.469  -18.520 1.00 37.80 ? 306  GLY B CA  1 
ATOM   4791 C  C   . GLY B 1 242 ? 8.992   -8.045  -18.973 1.00 37.54 ? 306  GLY B C   1 
ATOM   4792 O  O   . GLY B 1 242 ? 9.508   -7.094  -18.386 1.00 37.69 ? 306  GLY B O   1 
ATOM   4793 N  N   . PRO B 1 243 ? 8.181   -7.866  -20.029 1.00 37.38 ? 307  PRO B N   1 
ATOM   4794 C  CA  . PRO B 1 243 ? 7.843   -6.545  -20.569 1.00 37.22 ? 307  PRO B CA  1 
ATOM   4795 C  C   . PRO B 1 243 ? 6.591   -5.892  -19.973 1.00 36.62 ? 307  PRO B C   1 
ATOM   4796 O  O   . PRO B 1 243 ? 6.349   -4.700  -20.176 1.00 37.20 ? 307  PRO B O   1 
ATOM   4797 C  CB  . PRO B 1 243 ? 7.675   -6.832  -22.052 1.00 37.39 ? 307  PRO B CB  1 
ATOM   4798 C  CG  . PRO B 1 243 ? 6.980   -8.171  -22.020 1.00 37.39 ? 307  PRO B CG  1 
ATOM   4799 C  CD  . PRO B 1 243 ? 7.746   -8.935  -20.949 1.00 37.24 ? 307  PRO B CD  1 
ATOM   4800 N  N   . MET B 1 244 ? 5.800   -6.670  -19.242 1.00 35.01 ? 308  MET B N   1 
ATOM   4801 C  CA  . MET B 1 244 ? 4.570   -6.157  -18.652 1.00 33.10 ? 308  MET B CA  1 
ATOM   4802 C  C   . MET B 1 244 ? 4.798   -5.208  -17.480 1.00 30.13 ? 308  MET B C   1 
ATOM   4803 O  O   . MET B 1 244 ? 5.875   -5.177  -16.898 1.00 28.99 ? 308  MET B O   1 
ATOM   4804 C  CB  . MET B 1 244 ? 3.690   -7.324  -18.215 1.00 36.21 ? 308  MET B CB  1 
ATOM   4805 C  CG  . MET B 1 244 ? 3.380   -8.289  -19.348 1.00 40.52 ? 308  MET B CG  1 
ATOM   4806 S  SD  . MET B 1 244 ? 2.610   -7.472  -20.772 1.00 44.88 ? 308  MET B SD  1 
ATOM   4807 C  CE  . MET B 1 244 ? 0.870   -7.510  -20.290 1.00 40.86 ? 308  MET B CE  1 
ATOM   4808 N  N   . PRO B 1 245 ? 3.778   -4.407  -17.130 1.00 28.11 ? 309  PRO B N   1 
ATOM   4809 C  CA  . PRO B 1 245 ? 3.882   -3.456  -16.019 1.00 25.37 ? 309  PRO B CA  1 
ATOM   4810 C  C   . PRO B 1 245 ? 3.857   -4.152  -14.661 1.00 22.55 ? 309  PRO B C   1 
ATOM   4811 O  O   . PRO B 1 245 ? 2.992   -4.990  -14.398 1.00 21.71 ? 309  PRO B O   1 
ATOM   4812 C  CB  . PRO B 1 245 ? 2.650   -2.562  -16.197 1.00 26.62 ? 309  PRO B CB  1 
ATOM   4813 C  CG  . PRO B 1 245 ? 2.262   -2.749  -17.634 1.00 27.29 ? 309  PRO B CG  1 
ATOM   4814 C  CD  . PRO B 1 245 ? 2.510   -4.214  -17.850 1.00 28.04 ? 309  PRO B CD  1 
ATOM   4815 N  N   . TRP B 1 246 ? 4.817   -3.808  -13.813 1.00 20.06 ? 310  TRP B N   1 
ATOM   4816 C  CA  . TRP B 1 246 ? 4.891   -4.352  -12.465 1.00 19.26 ? 310  TRP B CA  1 
ATOM   4817 C  C   . TRP B 1 246 ? 4.815   -3.180  -11.496 1.00 19.19 ? 310  TRP B C   1 
ATOM   4818 O  O   . TRP B 1 246 ? 5.022   -2.025  -11.884 1.00 17.19 ? 310  TRP B O   1 
ATOM   4819 C  CB  . TRP B 1 246 ? 6.206   -5.094  -12.237 1.00 20.01 ? 310  TRP B CB  1 
ATOM   4820 C  CG  . TRP B 1 246 ? 6.285   -6.422  -12.911 1.00 19.36 ? 310  TRP B CG  1 
ATOM   4821 C  CD1 . TRP B 1 246 ? 6.180   -6.668  -14.249 1.00 19.09 ? 310  TRP B CD1 1 
ATOM   4822 C  CD2 . TRP B 1 246 ? 6.551   -7.686  -12.288 1.00 19.40 ? 310  TRP B CD2 1 
ATOM   4823 N  NE1 . TRP B 1 246 ? 6.369   -8.005  -14.500 1.00 21.72 ? 310  TRP B NE1 1 
ATOM   4824 C  CE2 . TRP B 1 246 ? 6.600   -8.655  -13.316 1.00 20.46 ? 310  TRP B CE2 1 
ATOM   4825 C  CE3 . TRP B 1 246 ? 6.756   -8.093  -10.963 1.00 19.44 ? 310  TRP B CE3 1 
ATOM   4826 C  CZ2 . TRP B 1 246 ? 6.847   -10.010 -13.061 1.00 21.40 ? 310  TRP B CZ2 1 
ATOM   4827 C  CZ3 . TRP B 1 246 ? 7.002   -9.444  -10.708 1.00 19.96 ? 310  TRP B CZ3 1 
ATOM   4828 C  CH2 . TRP B 1 246 ? 7.046   -10.385 -11.755 1.00 20.24 ? 310  TRP B CH2 1 
ATOM   4829 N  N   . LEU B 1 247 ? 4.520   -3.480  -10.239 1.00 17.63 ? 311  LEU B N   1 
ATOM   4830 C  CA  . LEU B 1 247 ? 4.434   -2.445  -9.221  1.00 17.66 ? 311  LEU B CA  1 
ATOM   4831 C  C   . LEU B 1 247 ? 5.826   -1.886  -8.939  1.00 16.49 ? 311  LEU B C   1 
ATOM   4832 O  O   . LEU B 1 247 ? 6.758   -2.635  -8.671  1.00 15.62 ? 311  LEU B O   1 
ATOM   4833 C  CB  . LEU B 1 247 ? 3.839   -3.012  -7.929  1.00 17.06 ? 311  LEU B CB  1 
ATOM   4834 C  CG  . LEU B 1 247 ? 3.829   -2.030  -6.751  1.00 19.04 ? 311  LEU B CG  1 
ATOM   4835 C  CD1 . LEU B 1 247 ? 3.042   -0.783  -7.138  1.00 17.88 ? 311  LEU B CD1 1 
ATOM   4836 C  CD2 . LEU B 1 247 ? 3.218   -2.696  -5.525  1.00 16.52 ? 311  LEU B CD2 1 
ATOM   4837 N  N   . GLY B 1 248 ? 5.959   -0.569  -9.016  1.00 15.64 ? 312  GLY B N   1 
ATOM   4838 C  CA  . GLY B 1 248 ? 7.241   0.056   -8.751  1.00 15.34 ? 312  GLY B CA  1 
ATOM   4839 C  C   . GLY B 1 248 ? 7.123   0.975   -7.552  1.00 16.19 ? 312  GLY B C   1 
ATOM   4840 O  O   . GLY B 1 248 ? 6.107   0.949   -6.869  1.00 15.72 ? 312  GLY B O   1 
ATOM   4841 N  N   . PRO B 1 249 ? 8.147   1.787   -7.255  1.00 17.27 ? 313  PRO B N   1 
ATOM   4842 C  CA  . PRO B 1 249 ? 9.409   1.880   -7.991  1.00 17.85 ? 313  PRO B CA  1 
ATOM   4843 C  C   . PRO B 1 249 ? 10.257  0.623   -7.841  1.00 17.76 ? 313  PRO B C   1 
ATOM   4844 O  O   . PRO B 1 249 ? 10.150  -0.099  -6.851  1.00 16.34 ? 313  PRO B O   1 
ATOM   4845 C  CB  . PRO B 1 249 ? 10.074  3.110   -7.374  1.00 17.33 ? 313  PRO B CB  1 
ATOM   4846 C  CG  . PRO B 1 249 ? 9.564   3.092   -5.982  1.00 17.69 ? 313  PRO B CG  1 
ATOM   4847 C  CD  . PRO B 1 249 ? 8.111   2.766   -6.159  1.00 16.00 ? 313  PRO B CD  1 
ATOM   4848 N  N   . GLN B 1 250 ? 11.081  0.359   -8.843  1.00 19.72 ? 314  GLN B N   1 
ATOM   4849 C  CA  . GLN B 1 250 ? 11.955  -0.802  -8.830  1.00 21.69 ? 314  GLN B CA  1 
ATOM   4850 C  C   . GLN B 1 250 ? 13.147  -0.492  -7.937  1.00 20.08 ? 314  GLN B C   1 
ATOM   4851 O  O   . GLN B 1 250 ? 13.611  0.644   -7.877  1.00 20.52 ? 314  GLN B O   1 
ATOM   4852 C  CB  . GLN B 1 250 ? 12.439  -1.117  -10.247 1.00 24.28 ? 314  GLN B CB  1 
ATOM   4853 C  CG  . GLN B 1 250 ? 11.331  -1.419  -11.244 1.00 29.37 ? 314  GLN B CG  1 
ATOM   4854 C  CD  . GLN B 1 250 ? 11.859  -1.564  -12.670 1.00 34.47 ? 314  GLN B CD  1 
ATOM   4855 O  OE1 . GLN B 1 250 ? 12.769  -2.358  -12.931 1.00 38.51 ? 314  GLN B OE1 1 
ATOM   4856 N  NE2 . GLN B 1 250 ? 11.289  -0.799  -13.596 1.00 34.23 ? 314  GLN B NE2 1 
ATOM   4857 N  N   . THR B 1 251 ? 13.631  -1.511  -7.242  1.00 18.89 ? 315  THR B N   1 
ATOM   4858 C  CA  . THR B 1 251 ? 14.766  -1.363  -6.346  1.00 19.39 ? 315  THR B CA  1 
ATOM   4859 C  C   . THR B 1 251 ? 16.033  -0.919  -7.080  1.00 19.10 ? 315  THR B C   1 
ATOM   4860 O  O   . THR B 1 251 ? 16.726  -0.009  -6.623  1.00 20.32 ? 315  THR B O   1 
ATOM   4861 C  CB  . THR B 1 251 ? 15.044  -2.688  -5.610  1.00 17.76 ? 315  THR B CB  1 
ATOM   4862 O  OG1 . THR B 1 251 ? 13.849  -3.111  -4.950  1.00 18.25 ? 315  THR B OG1 1 
ATOM   4863 C  CG2 . THR B 1 251 ? 16.148  -2.517  -4.579  1.00 16.26 ? 315  THR B CG2 1 
ATOM   4864 N  N   . ASP B 1 252 ? 16.338  -1.544  -8.216  1.00 20.37 ? 316  ASP B N   1 
ATOM   4865 C  CA  . ASP B 1 252 ? 17.547  -1.173  -8.953  1.00 22.15 ? 316  ASP B CA  1 
ATOM   4866 C  C   . ASP B 1 252 ? 17.527  0.278   -9.426  1.00 21.82 ? 316  ASP B C   1 
ATOM   4867 O  O   . ASP B 1 252 ? 18.511  0.999   -9.262  1.00 21.66 ? 316  ASP B O   1 
ATOM   4868 C  CB  . ASP B 1 252 ? 17.795  -2.132  -10.134 1.00 24.33 ? 316  ASP B CB  1 
ATOM   4869 C  CG  . ASP B 1 252 ? 16.631  -2.198  -11.108 1.00 27.97 ? 316  ASP B CG  1 
ATOM   4870 O  OD1 . ASP B 1 252 ? 16.740  -2.943  -12.105 1.00 29.15 ? 316  ASP B OD1 1 
ATOM   4871 O  OD2 . ASP B 1 252 ? 15.612  -1.516  -10.885 1.00 29.53 ? 316  ASP B OD2 1 
ATOM   4872 N  N   . GLU B 1 253 ? 16.407  0.723   -9.986  1.00 21.17 ? 317  GLU B N   1 
ATOM   4873 C  CA  . GLU B 1 253 ? 16.310  2.103   -10.443 1.00 21.44 ? 317  GLU B CA  1 
ATOM   4874 C  C   . GLU B 1 253 ? 16.338  3.087   -9.274  1.00 19.21 ? 317  GLU B C   1 
ATOM   4875 O  O   . GLU B 1 253 ? 16.840  4.206   -9.411  1.00 17.51 ? 317  GLU B O   1 
ATOM   4876 C  CB  . GLU B 1 253 ? 15.036  2.316   -11.265 1.00 24.67 ? 317  GLU B CB  1 
ATOM   4877 C  CG  . GLU B 1 253 ? 15.000  1.501   -12.547 1.00 30.88 ? 317  GLU B CG  1 
ATOM   4878 C  CD  . GLU B 1 253 ? 13.889  1.932   -13.486 1.00 35.87 ? 317  GLU B CD  1 
ATOM   4879 O  OE1 . GLU B 1 253 ? 12.725  2.035   -13.031 1.00 38.38 ? 317  GLU B OE1 1 
ATOM   4880 O  OE2 . GLU B 1 253 ? 14.181  2.162   -14.682 1.00 37.86 ? 317  GLU B OE2 1 
ATOM   4881 N  N   . SER B 1 254 ? 15.811  2.677   -8.124  1.00 17.78 ? 318  SER B N   1 
ATOM   4882 C  CA  . SER B 1 254 ? 15.807  3.559   -6.956  1.00 16.44 ? 318  SER B CA  1 
ATOM   4883 C  C   . SER B 1 254 ? 17.229  3.755   -6.451  1.00 16.77 ? 318  SER B C   1 
ATOM   4884 O  O   . SER B 1 254 ? 17.620  4.857   -6.073  1.00 16.73 ? 318  SER B O   1 
ATOM   4885 C  CB  . SER B 1 254 ? 14.935  2.978   -5.841  1.00 14.47 ? 318  SER B CB  1 
ATOM   4886 O  OG  . SER B 1 254 ? 13.586  2.896   -6.270  1.00 17.82 ? 318  SER B OG  1 
ATOM   4887 N  N   . ILE B 1 255 ? 18.002  2.677   -6.444  1.00 16.89 ? 319  ILE B N   1 
ATOM   4888 C  CA  . ILE B 1 255 ? 19.388  2.748   -6.000  1.00 18.16 ? 319  ILE B CA  1 
ATOM   4889 C  C   . ILE B 1 255 ? 20.135  3.718   -6.913  1.00 19.29 ? 319  ILE B C   1 
ATOM   4890 O  O   . ILE B 1 255 ? 20.850  4.598   -6.443  1.00 20.86 ? 319  ILE B O   1 
ATOM   4891 C  CB  . ILE B 1 255 ? 20.044  1.356   -6.052  1.00 15.85 ? 319  ILE B CB  1 
ATOM   4892 C  CG1 . ILE B 1 255 ? 19.373  0.452   -5.012  1.00 17.57 ? 319  ILE B CG1 1 
ATOM   4893 C  CG2 . ILE B 1 255 ? 21.552  1.467   -5.829  1.00 17.26 ? 319  ILE B CG2 1 
ATOM   4894 C  CD1 . ILE B 1 255 ? 19.790  -1.015  -5.074  1.00 16.34 ? 319  ILE B CD1 1 
ATOM   4895 N  N   . LYS B 1 256 ? 19.933  3.565   -8.218  1.00 19.20 ? 320  LYS B N   1 
ATOM   4896 C  CA  . LYS B 1 256 ? 20.570  4.420   -9.207  1.00 21.80 ? 320  LYS B CA  1 
ATOM   4897 C  C   . LYS B 1 256 ? 20.058  5.856   -9.109  1.00 21.86 ? 320  LYS B C   1 
ATOM   4898 O  O   . LYS B 1 256 ? 20.823  6.809   -9.262  1.00 20.43 ? 320  LYS B O   1 
ATOM   4899 C  CB  . LYS B 1 256 ? 20.314  3.865   -10.610 1.00 22.91 ? 320  LYS B CB  1 
ATOM   4900 C  CG  . LYS B 1 256 ? 20.856  4.727   -11.739 1.00 27.97 ? 320  LYS B CG  1 
ATOM   4901 C  CD  . LYS B 1 256 ? 20.699  4.014   -13.075 1.00 30.01 ? 320  LYS B CD  1 
ATOM   4902 C  CE  . LYS B 1 256 ? 21.210  4.866   -14.227 1.00 34.42 ? 320  LYS B CE  1 
ATOM   4903 N  NZ  . LYS B 1 256 ? 21.146  4.125   -15.529 1.00 36.67 ? 320  LYS B NZ  1 
ATOM   4904 N  N   . GLY B 1 257 ? 18.760  6.002   -8.855  1.00 22.05 ? 321  GLY B N   1 
ATOM   4905 C  CA  . GLY B 1 257 ? 18.177  7.322   -8.734  1.00 20.41 ? 321  GLY B CA  1 
ATOM   4906 C  C   . GLY B 1 257 ? 18.724  8.033   -7.511  1.00 20.79 ? 321  GLY B C   1 
ATOM   4907 O  O   . GLY B 1 257 ? 19.052  9.217   -7.575  1.00 21.31 ? 321  GLY B O   1 
ATOM   4908 N  N   . LEU B 1 258 ? 18.823  7.311   -6.397  1.00 19.72 ? 322  LEU B N   1 
ATOM   4909 C  CA  . LEU B 1 258 ? 19.340  7.878   -5.160  1.00 21.76 ? 322  LEU B CA  1 
ATOM   4910 C  C   . LEU B 1 258 ? 20.780  8.364   -5.333  1.00 23.77 ? 322  LEU B C   1 
ATOM   4911 O  O   . LEU B 1 258 ? 21.122  9.465   -4.903  1.00 23.20 ? 322  LEU B O   1 
ATOM   4912 C  CB  . LEU B 1 258 ? 19.261  6.846   -4.026  1.00 21.93 ? 322  LEU B CB  1 
ATOM   4913 C  CG  . LEU B 1 258 ? 17.856  6.576   -3.468  1.00 22.63 ? 322  LEU B CG  1 
ATOM   4914 C  CD1 . LEU B 1 258 ? 17.861  5.362   -2.553  1.00 23.41 ? 322  LEU B CD1 1 
ATOM   4915 C  CD2 . LEU B 1 258 ? 17.376  7.808   -2.720  1.00 19.35 ? 322  LEU B CD2 1 
ATOM   4916 N  N   . CYS B 1 259 ? 21.620  7.548   -5.966  1.00 25.09 ? 323  CYS B N   1 
ATOM   4917 C  CA  . CYS B 1 259 ? 23.010  7.932   -6.189  1.00 27.55 ? 323  CYS B CA  1 
ATOM   4918 C  C   . CYS B 1 259 ? 23.113  9.181   -7.055  1.00 27.64 ? 323  CYS B C   1 
ATOM   4919 O  O   . CYS B 1 259 ? 23.867  10.100  -6.742  1.00 28.14 ? 323  CYS B O   1 
ATOM   4920 C  CB  . CYS B 1 259 ? 23.785  6.786   -6.837  1.00 28.79 ? 323  CYS B CB  1 
ATOM   4921 S  SG  . CYS B 1 259 ? 24.041  5.400   -5.718  1.00 36.04 ? 323  CYS B SG  1 
ATOM   4922 N  N   . GLU B 1 260 ? 22.352  9.213   -8.143  1.00 27.45 ? 324  GLU B N   1 
ATOM   4923 C  CA  . GLU B 1 260 ? 22.354  10.368  -9.033  1.00 28.49 ? 324  GLU B CA  1 
ATOM   4924 C  C   . GLU B 1 260 ? 21.922  11.633  -8.299  1.00 28.25 ? 324  GLU B C   1 
ATOM   4925 O  O   . GLU B 1 260 ? 22.282  12.742  -8.689  1.00 29.88 ? 324  GLU B O   1 
ATOM   4926 C  CB  . GLU B 1 260 ? 21.414  10.126  -10.215 1.00 29.21 ? 324  GLU B CB  1 
ATOM   4927 C  CG  . GLU B 1 260 ? 21.982  9.207   -11.275 1.00 34.41 ? 324  GLU B CG  1 
ATOM   4928 C  CD  . GLU B 1 260 ? 21.007  8.949   -12.409 1.00 37.97 ? 324  GLU B CD  1 
ATOM   4929 O  OE1 . GLU B 1 260 ? 20.311  9.902   -12.828 1.00 39.62 ? 324  GLU B OE1 1 
ATOM   4930 O  OE2 . GLU B 1 260 ? 20.946  7.796   -12.892 1.00 40.82 ? 324  GLU B OE2 1 
ATOM   4931 N  N   . ARG B 1 261 ? 21.151  11.468  -7.231  1.00 26.82 ? 325  ARG B N   1 
ATOM   4932 C  CA  . ARG B 1 261 ? 20.677  12.619  -6.479  1.00 25.55 ? 325  ARG B CA  1 
ATOM   4933 C  C   . ARG B 1 261 ? 21.476  12.878  -5.207  1.00 24.70 ? 325  ARG B C   1 
ATOM   4934 O  O   . ARG B 1 261 ? 21.005  13.548  -4.293  1.00 26.94 ? 325  ARG B O   1 
ATOM   4935 C  CB  . ARG B 1 261 ? 19.186  12.445  -6.176  1.00 25.25 ? 325  ARG B CB  1 
ATOM   4936 C  CG  . ARG B 1 261 ? 18.347  12.489  -7.448  1.00 24.55 ? 325  ARG B CG  1 
ATOM   4937 C  CD  . ARG B 1 261 ? 16.970  11.853  -7.291  1.00 24.82 ? 325  ARG B CD  1 
ATOM   4938 N  NE  . ARG B 1 261 ? 16.217  11.926  -8.548  1.00 26.23 ? 325  ARG B NE  1 
ATOM   4939 C  CZ  . ARG B 1 261 ? 16.557  11.301  -9.675  1.00 26.55 ? 325  ARG B CZ  1 
ATOM   4940 N  NH1 . ARG B 1 261 ? 17.639  10.532  -9.721  1.00 27.46 ? 325  ARG B NH1 1 
ATOM   4941 N  NH2 . ARG B 1 261 ? 15.831  11.470  -10.773 1.00 26.68 ? 325  ARG B NH2 1 
ATOM   4942 N  N   . GLY B 1 262 ? 22.690  12.343  -5.153  1.00 25.18 ? 326  GLY B N   1 
ATOM   4943 C  CA  . GLY B 1 262 ? 23.542  12.562  -3.998  1.00 25.06 ? 326  GLY B CA  1 
ATOM   4944 C  C   . GLY B 1 262 ? 23.311  11.741  -2.739  1.00 25.65 ? 326  GLY B C   1 
ATOM   4945 O  O   . GLY B 1 262 ? 23.940  12.016  -1.714  1.00 26.87 ? 326  GLY B O   1 
ATOM   4946 N  N   . ARG B 1 263 ? 22.411  10.760  -2.780  1.00 24.17 ? 327  ARG B N   1 
ATOM   4947 C  CA  . ARG B 1 263 ? 22.181  9.920   -1.605  1.00 22.97 ? 327  ARG B CA  1 
ATOM   4948 C  C   . ARG B 1 263 ? 22.963  8.634   -1.878  1.00 23.17 ? 327  ARG B C   1 
ATOM   4949 O  O   . ARG B 1 263 ? 22.441  7.680   -2.459  1.00 20.93 ? 327  ARG B O   1 
ATOM   4950 C  CB  . ARG B 1 263 ? 20.678  9.633   -1.418  1.00 22.63 ? 327  ARG B CB  1 
ATOM   4951 C  CG  . ARG B 1 263 ? 19.784  10.886  -1.416  1.00 24.54 ? 327  ARG B CG  1 
ATOM   4952 C  CD  . ARG B 1 263 ? 20.342  11.994  -0.516  1.00 23.58 ? 327  ARG B CD  1 
ATOM   4953 N  NE  . ARG B 1 263 ? 20.395  11.602  0.892   1.00 24.90 ? 327  ARG B NE  1 
ATOM   4954 C  CZ  . ARG B 1 263 ? 19.437  11.852  1.784   1.00 25.76 ? 327  ARG B CZ  1 
ATOM   4955 N  NH1 . ARG B 1 263 ? 18.339  12.505  1.422   1.00 25.54 ? 327  ARG B NH1 1 
ATOM   4956 N  NH2 . ARG B 1 263 ? 19.572  11.442  3.039   1.00 23.48 ? 327  ARG B NH2 1 
ATOM   4957 N  N   . LYS B 1 264 ? 24.226  8.615   -1.459  1.00 24.07 ? 328  LYS B N   1 
ATOM   4958 C  CA  . LYS B 1 264 ? 25.091  7.471   -1.722  1.00 25.40 ? 328  LYS B CA  1 
ATOM   4959 C  C   . LYS B 1 264 ? 25.349  6.515   -0.569  1.00 24.14 ? 328  LYS B C   1 
ATOM   4960 O  O   . LYS B 1 264 ? 26.244  5.677   -0.642  1.00 25.32 ? 328  LYS B O   1 
ATOM   4961 C  CB  . LYS B 1 264 ? 26.421  7.971   -2.284  1.00 27.59 ? 328  LYS B CB  1 
ATOM   4962 C  CG  . LYS B 1 264 ? 26.258  8.780   -3.561  1.00 30.84 ? 328  LYS B CG  1 
ATOM   4963 C  CD  . LYS B 1 264 ? 27.584  9.343   -4.040  1.00 32.93 ? 328  LYS B CD  1 
ATOM   4964 C  CE  . LYS B 1 264 ? 27.386  10.219  -5.264  1.00 33.56 ? 328  LYS B CE  1 
ATOM   4965 N  NZ  . LYS B 1 264 ? 26.672  9.473   -6.341  1.00 36.03 ? 328  LYS B NZ  1 
ATOM   4966 N  N   . ASN B 1 265 ? 24.575  6.643   0.498   1.00 21.49 ? 329  ASN B N   1 
ATOM   4967 C  CA  . ASN B 1 265 ? 24.717  5.745   1.626   1.00 21.02 ? 329  ASN B CA  1 
ATOM   4968 C  C   . ASN B 1 265 ? 23.356  5.086   1.794   1.00 19.92 ? 329  ASN B C   1 
ATOM   4969 O  O   . ASN B 1 265 ? 22.412  5.677   2.320   1.00 18.86 ? 329  ASN B O   1 
ATOM   4970 C  CB  . ASN B 1 265 ? 25.155  6.514   2.874   1.00 21.34 ? 329  ASN B CB  1 
ATOM   4971 C  CG  . ASN B 1 265 ? 26.585  7.032   2.757   1.00 24.07 ? 329  ASN B CG  1 
ATOM   4972 O  OD1 . ASN B 1 265 ? 26.818  8.165   2.331   1.00 23.46 ? 329  ASN B OD1 1 
ATOM   4973 N  ND2 . ASN B 1 265 ? 27.549  6.189   3.111   1.00 20.21 ? 329  ASN B ND2 1 
ATOM   4974 N  N   . ILE B 1 266 ? 23.273  3.849   1.324   1.00 19.46 ? 330  ILE B N   1 
ATOM   4975 C  CA  . ILE B 1 266 ? 22.027  3.099   1.327   1.00 18.07 ? 330  ILE B CA  1 
ATOM   4976 C  C   . ILE B 1 266 ? 22.050  1.809   2.127   1.00 18.77 ? 330  ILE B C   1 
ATOM   4977 O  O   . ILE B 1 266 ? 23.036  1.065   2.116   1.00 19.04 ? 330  ILE B O   1 
ATOM   4978 C  CB  . ILE B 1 266 ? 21.641  2.763   -0.130  1.00 18.16 ? 330  ILE B CB  1 
ATOM   4979 C  CG1 . ILE B 1 266 ? 21.576  4.055   -0.945  1.00 16.85 ? 330  ILE B CG1 1 
ATOM   4980 C  CG2 . ILE B 1 266 ? 20.334  1.984   -0.177  1.00 17.79 ? 330  ILE B CG2 1 
ATOM   4981 C  CD1 . ILE B 1 266 ? 21.493  3.837   -2.436  1.00 19.17 ? 330  ILE B CD1 1 
ATOM   4982 N  N   . LEU B 1 267 ? 20.945  1.549   2.819   1.00 17.37 ? 331  LEU B N   1 
ATOM   4983 C  CA  . LEU B 1 267 ? 20.791  0.330   3.593   1.00 15.90 ? 331  LEU B CA  1 
ATOM   4984 C  C   . LEU B 1 267 ? 19.587  -0.403  3.013   1.00 15.78 ? 331  LEU B C   1 
ATOM   4985 O  O   . LEU B 1 267 ? 18.464  0.098   3.065   1.00 16.16 ? 331  LEU B O   1 
ATOM   4986 C  CB  . LEU B 1 267 ? 20.554  0.641   5.080   1.00 15.74 ? 331  LEU B CB  1 
ATOM   4987 C  CG  . LEU B 1 267 ? 20.256  -0.584  5.962   1.00 17.44 ? 331  LEU B CG  1 
ATOM   4988 C  CD1 . LEU B 1 267 ? 21.386  -1.601  5.833   1.00 19.65 ? 331  LEU B CD1 1 
ATOM   4989 C  CD2 . LEU B 1 267 ? 20.106  -0.154  7.418   1.00 18.03 ? 331  LEU B CD2 1 
ATOM   4990 N  N   . LEU B 1 268 ? 19.834  -1.578  2.438   1.00 17.05 ? 332  LEU B N   1 
ATOM   4991 C  CA  . LEU B 1 268 ? 18.774  -2.389  1.852   1.00 15.54 ? 332  LEU B CA  1 
ATOM   4992 C  C   . LEU B 1 268 ? 18.187  -3.315  2.915   1.00 15.67 ? 332  LEU B C   1 
ATOM   4993 O  O   . LEU B 1 268 ? 18.921  -3.886  3.729   1.00 14.13 ? 332  LEU B O   1 
ATOM   4994 C  CB  . LEU B 1 268 ? 19.325  -3.224  0.687   1.00 14.92 ? 332  LEU B CB  1 
ATOM   4995 C  CG  . LEU B 1 268 ? 19.820  -2.471  -0.558  1.00 18.09 ? 332  LEU B CG  1 
ATOM   4996 C  CD1 . LEU B 1 268 ? 20.404  -3.463  -1.561  1.00 16.47 ? 332  LEU B CD1 1 
ATOM   4997 C  CD2 . LEU B 1 268 ? 18.659  -1.693  -1.193  1.00 16.89 ? 332  LEU B CD2 1 
ATOM   4998 N  N   . VAL B 1 269 ? 16.865  -3.459  2.906   1.00 15.30 ? 333  VAL B N   1 
ATOM   4999 C  CA  . VAL B 1 269 ? 16.181  -4.312  3.869   1.00 16.13 ? 333  VAL B CA  1 
ATOM   5000 C  C   . VAL B 1 269 ? 15.159  -5.224  3.188   1.00 18.53 ? 333  VAL B C   1 
ATOM   5001 O  O   . VAL B 1 269 ? 14.141  -4.754  2.682   1.00 19.87 ? 333  VAL B O   1 
ATOM   5002 C  CB  . VAL B 1 269 ? 15.449  -3.466  4.942   1.00 14.93 ? 333  VAL B CB  1 
ATOM   5003 C  CG1 . VAL B 1 269 ? 14.791  -4.382  5.984   1.00 14.94 ? 333  VAL B CG1 1 
ATOM   5004 C  CG2 . VAL B 1 269 ? 16.435  -2.526  5.624   1.00 14.51 ? 333  VAL B CG2 1 
ATOM   5005 N  N   . PRO B 1 270 ? 15.426  -6.542  3.164   1.00 18.84 ? 334  PRO B N   1 
ATOM   5006 C  CA  . PRO B 1 270 ? 14.537  -7.540  2.552   1.00 18.73 ? 334  PRO B CA  1 
ATOM   5007 C  C   . PRO B 1 270 ? 13.356  -7.760  3.496   1.00 18.66 ? 334  PRO B C   1 
ATOM   5008 O  O   . PRO B 1 270 ? 13.309  -8.738  4.241   1.00 21.68 ? 334  PRO B O   1 
ATOM   5009 C  CB  . PRO B 1 270 ? 15.440  -8.768  2.420   1.00 15.97 ? 334  PRO B CB  1 
ATOM   5010 C  CG  . PRO B 1 270 ? 16.323  -8.659  3.628   1.00 19.94 ? 334  PRO B CG  1 
ATOM   5011 C  CD  . PRO B 1 270 ? 16.652  -7.174  3.692   1.00 19.24 ? 334  PRO B CD  1 
ATOM   5012 N  N   . ILE B 1 271 ? 12.400  -6.842  3.426   1.00 16.74 ? 335  ILE B N   1 
ATOM   5013 C  CA  . ILE B 1 271 ? 11.233  -6.818  4.296   1.00 16.14 ? 335  ILE B CA  1 
ATOM   5014 C  C   . ILE B 1 271 ? 10.146  -7.875  4.097   1.00 16.58 ? 335  ILE B C   1 
ATOM   5015 O  O   . ILE B 1 271 ? 9.240   -7.986  4.920   1.00 16.08 ? 335  ILE B O   1 
ATOM   5016 C  CB  . ILE B 1 271 ? 10.579  -5.412  4.231   1.00 15.05 ? 335  ILE B CB  1 
ATOM   5017 C  CG1 . ILE B 1 271 ? 9.708   -5.171  5.458   1.00 15.22 ? 335  ILE B CG1 1 
ATOM   5018 C  CG2 . ILE B 1 271 ? 9.760   -5.276  2.948   1.00 14.44 ? 335  ILE B CG2 1 
ATOM   5019 C  CD1 . ILE B 1 271 ? 10.475  -5.228  6.769   1.00 17.48 ? 335  ILE B CD1 1 
ATOM   5020 N  N   . ALA B 1 272 ? 10.225  -8.657  3.028   1.00 18.71 ? 336  ALA B N   1 
ATOM   5021 C  CA  . ALA B 1 272 ? 9.194   -9.665  2.790   1.00 19.78 ? 336  ALA B CA  1 
ATOM   5022 C  C   . ALA B 1 272 ? 9.688   -11.105 2.879   1.00 20.84 ? 336  ALA B C   1 
ATOM   5023 O  O   . ALA B 1 272 ? 8.962   -12.033 2.531   1.00 23.05 ? 336  ALA B O   1 
ATOM   5024 C  CB  . ALA B 1 272 ? 8.526   -9.415  1.434   1.00 19.46 ? 336  ALA B CB  1 
ATOM   5025 N  N   . PHE B 1 273 ? 10.915  -11.289 3.353   1.00 22.26 ? 337  PHE B N   1 
ATOM   5026 C  CA  . PHE B 1 273 ? 11.493  -12.620 3.505   1.00 23.84 ? 337  PHE B CA  1 
ATOM   5027 C  C   . PHE B 1 273 ? 11.905  -12.863 4.948   1.00 23.59 ? 337  PHE B C   1 
ATOM   5028 O  O   . PHE B 1 273 ? 12.178  -11.928 5.690   1.00 24.49 ? 337  PHE B O   1 
ATOM   5029 C  CB  . PHE B 1 273 ? 12.728  -12.769 2.620   1.00 28.12 ? 337  PHE B CB  1 
ATOM   5030 C  CG  . PHE B 1 273 ? 12.448  -12.611 1.162   1.00 32.85 ? 337  PHE B CG  1 
ATOM   5031 C  CD1 . PHE B 1 273 ? 13.323  -11.899 0.352   1.00 34.56 ? 337  PHE B CD1 1 
ATOM   5032 C  CD2 . PHE B 1 273 ? 11.320  -13.189 0.593   1.00 34.64 ? 337  PHE B CD2 1 
ATOM   5033 C  CE1 . PHE B 1 273 ? 13.079  -11.764 -1.004  1.00 37.14 ? 337  PHE B CE1 1 
ATOM   5034 C  CE2 . PHE B 1 273 ? 11.067  -13.060 -0.765  1.00 36.40 ? 337  PHE B CE2 1 
ATOM   5035 C  CZ  . PHE B 1 273 ? 11.949  -12.347 -1.564  1.00 37.27 ? 337  PHE B CZ  1 
ATOM   5036 N  N   . THR B 1 274 ? 11.975  -14.129 5.336   1.00 23.88 ? 338  THR B N   1 
ATOM   5037 C  CA  . THR B 1 274 ? 12.360  -14.481 6.695   1.00 22.81 ? 338  THR B CA  1 
ATOM   5038 C  C   . THR B 1 274 ? 13.738  -15.139 6.706   1.00 23.57 ? 338  THR B C   1 
ATOM   5039 O  O   . THR B 1 274 ? 14.314  -15.392 7.775   1.00 23.53 ? 338  THR B O   1 
ATOM   5040 C  CB  . THR B 1 274 ? 11.320  -15.430 7.332   1.00 22.87 ? 338  THR B CB  1 
ATOM   5041 O  OG1 . THR B 1 274 ? 11.073  -16.539 6.457   1.00 23.05 ? 338  THR B OG1 1 
ATOM   5042 C  CG2 . THR B 1 274 ? 10.012  -14.682 7.580   1.00 22.92 ? 338  THR B CG2 1 
ATOM   5043 N  N   . SER B 1 275 ? 14.260  -15.412 5.513   1.00 22.70 ? 339  SER B N   1 
ATOM   5044 C  CA  . SER B 1 275 ? 15.579  -16.022 5.385   1.00 23.52 ? 339  SER B CA  1 
ATOM   5045 C  C   . SER B 1 275 ? 16.189  -15.711 4.024   1.00 22.49 ? 339  SER B C   1 
ATOM   5046 O  O   . SER B 1 275 ? 15.535  -15.150 3.149   1.00 22.19 ? 339  SER B O   1 
ATOM   5047 C  CB  . SER B 1 275 ? 15.492  -17.539 5.566   1.00 24.66 ? 339  SER B CB  1 
ATOM   5048 O  OG  . SER B 1 275 ? 15.095  -18.164 4.360   1.00 27.04 ? 339  SER B OG  1 
ATOM   5049 N  N   . ASP B 1 276 ? 17.447  -16.087 3.846   1.00 22.01 ? 340  ASP B N   1 
ATOM   5050 C  CA  . ASP B 1 276 ? 18.123  -15.841 2.583   1.00 22.28 ? 340  ASP B CA  1 
ATOM   5051 C  C   . ASP B 1 276 ? 17.669  -16.753 1.465   1.00 22.42 ? 340  ASP B C   1 
ATOM   5052 O  O   . ASP B 1 276 ? 17.263  -17.892 1.682   1.00 20.42 ? 340  ASP B O   1 
ATOM   5053 C  CB  . ASP B 1 276 ? 19.641  -15.984 2.734   1.00 23.25 ? 340  ASP B CB  1 
ATOM   5054 C  CG  . ASP B 1 276 ? 20.272  -14.799 3.426   1.00 26.49 ? 340  ASP B CG  1 
ATOM   5055 O  OD1 . ASP B 1 276 ? 19.962  -13.649 3.046   1.00 28.46 ? 340  ASP B OD1 1 
ATOM   5056 O  OD2 . ASP B 1 276 ? 21.092  -15.015 4.342   1.00 27.36 ? 340  ASP B OD2 1 
ATOM   5057 N  N   . HIS B 1 277 ? 17.744  -16.196 0.238   1.00 23.37 ? 341  HIS B N   1 
ATOM   5058 C  CA  . HIS B 1 277 ? 17.401  -16.949 -0.949  1.00 24.97 ? 341  HIS B CA  1 
ATOM   5059 C  C   . HIS B 1 277 ? 18.041  -16.233 -2.120  1.00 22.72 ? 341  HIS B C   1 
ATOM   5060 O  O   . HIS B 1 277 ? 18.757  -15.249 -1.943  1.00 20.49 ? 341  HIS B O   1 
ATOM   5061 C  CB  . HIS B 1 277 ? 15.894  -17.048 -1.189  1.00 30.09 ? 341  HIS B CB  1 
ATOM   5062 C  CG  . HIS B 1 277 ? 15.202  -15.719 -1.087  1.00 38.38 ? 341  HIS B CG  1 
ATOM   5063 N  ND1 . HIS B 1 277 ? 13.852  -15.588 -0.836  1.00 40.59 ? 341  HIS B ND1 1 
ATOM   5064 C  CD2 . HIS B 1 277 ? 15.689  -14.457 -1.192  1.00 37.71 ? 341  HIS B CD2 1 
ATOM   5065 C  CE1 . HIS B 1 277 ? 13.539  -14.303 -0.789  1.00 40.84 ? 341  HIS B CE1 1 
ATOM   5066 N  NE2 . HIS B 1 277 ? 14.637  -13.598 -1.002  1.00 39.40 ? 341  HIS B NE2 1 
ATOM   5067 N  N   . ILE B 1 278 ? 17.792  -16.665 -3.329  1.00 20.46 ? 342  ILE B N   1 
ATOM   5068 C  CA  . ILE B 1 278 ? 18.392  -16.044 -4.500  1.00 21.74 ? 342  ILE B CA  1 
ATOM   5069 C  C   . ILE B 1 278 ? 18.121  -14.527 -4.611  1.00 21.62 ? 342  ILE B C   1 
ATOM   5070 O  O   . ILE B 1 278 ? 18.979  -13.774 -5.074  1.00 18.63 ? 342  ILE B O   1 
ATOM   5071 C  CB  . ILE B 1 278 ? 17.941  -16.789 -5.793  1.00 21.65 ? 342  ILE B CB  1 
ATOM   5072 C  CG1 . ILE B 1 278 ? 18.905  -16.490 -6.938  1.00 22.75 ? 342  ILE B CG1 1 
ATOM   5073 C  CG2 . ILE B 1 278 ? 16.524  -16.400 -6.166  1.00 22.62 ? 342  ILE B CG2 1 
ATOM   5074 C  CD1 . ILE B 1 278 ? 20.269  -17.141 -6.772  1.00 23.03 ? 342  ILE B CD1 1 
ATOM   5075 N  N   . GLU B 1 279 ? 16.946  -14.082 -4.170  1.00 21.80 ? 343  GLU B N   1 
ATOM   5076 C  CA  . GLU B 1 279 ? 16.596  -12.662 -4.228  1.00 24.58 ? 343  GLU B CA  1 
ATOM   5077 C  C   . GLU B 1 279 ? 17.504  -11.775 -3.380  1.00 25.15 ? 343  GLU B C   1 
ATOM   5078 O  O   . GLU B 1 279 ? 17.765  -10.628 -3.742  1.00 25.46 ? 343  GLU B O   1 
ATOM   5079 C  CB  . GLU B 1 279 ? 15.146  -12.446 -3.787  1.00 28.57 ? 343  GLU B CB  1 
ATOM   5080 C  CG  . GLU B 1 279 ? 14.108  -12.790 -4.837  1.00 34.18 ? 343  GLU B CG  1 
ATOM   5081 C  CD  . GLU B 1 279 ? 14.267  -14.193 -5.385  1.00 38.39 ? 343  GLU B CD  1 
ATOM   5082 O  OE1 . GLU B 1 279 ? 14.273  -15.151 -4.578  1.00 38.76 ? 343  GLU B OE1 1 
ATOM   5083 O  OE2 . GLU B 1 279 ? 14.385  -14.337 -6.626  1.00 42.25 ? 343  GLU B OE2 1 
ATOM   5084 N  N   . THR B 1 280 ? 17.980  -12.292 -2.251  1.00 24.65 ? 344  THR B N   1 
ATOM   5085 C  CA  . THR B 1 280 ? 18.849  -11.505 -1.388  1.00 24.14 ? 344  THR B CA  1 
ATOM   5086 C  C   . THR B 1 280 ? 20.331  -11.756 -1.660  1.00 24.20 ? 344  THR B C   1 
ATOM   5087 O  O   . THR B 1 280 ? 21.105  -10.809 -1.803  1.00 23.58 ? 344  THR B O   1 
ATOM   5088 C  CB  . THR B 1 280 ? 18.567  -11.776 0.115   1.00 23.97 ? 344  THR B CB  1 
ATOM   5089 O  OG1 . THR B 1 280 ? 18.850  -13.146 0.424   1.00 26.24 ? 344  THR B OG1 1 
ATOM   5090 C  CG2 . THR B 1 280 ? 17.105  -11.476 0.451   1.00 24.83 ? 344  THR B CG2 1 
ATOM   5091 N  N   . LEU B 1 281 ? 20.722  -13.026 -1.746  1.00 23.37 ? 345  LEU B N   1 
ATOM   5092 C  CA  . LEU B 1 281 ? 22.124  -13.376 -1.976  1.00 24.45 ? 345  LEU B CA  1 
ATOM   5093 C  C   . LEU B 1 281 ? 22.634  -13.023 -3.373  1.00 23.57 ? 345  LEU B C   1 
ATOM   5094 O  O   . LEU B 1 281 ? 23.811  -12.717 -3.552  1.00 22.99 ? 345  LEU B O   1 
ATOM   5095 C  CB  . LEU B 1 281 ? 22.349  -14.866 -1.712  1.00 24.21 ? 345  LEU B CB  1 
ATOM   5096 C  CG  . LEU B 1 281 ? 22.071  -15.372 -0.296  1.00 26.34 ? 345  LEU B CG  1 
ATOM   5097 C  CD1 . LEU B 1 281 ? 22.416  -16.855 -0.217  1.00 26.89 ? 345  LEU B CD1 1 
ATOM   5098 C  CD2 . LEU B 1 281 ? 22.892  -14.584 0.713   1.00 27.52 ? 345  LEU B CD2 1 
ATOM   5099 N  N   . TYR B 1 282 ? 21.755  -13.060 -4.366  1.00 22.44 ? 346  TYR B N   1 
ATOM   5100 C  CA  . TYR B 1 282 ? 22.173  -12.729 -5.716  1.00 21.82 ? 346  TYR B CA  1 
ATOM   5101 C  C   . TYR B 1 282 ? 21.715  -11.345 -6.157  1.00 23.30 ? 346  TYR B C   1 
ATOM   5102 O  O   . TYR B 1 282 ? 22.534  -10.459 -6.406  1.00 22.15 ? 346  TYR B O   1 
ATOM   5103 C  CB  . TYR B 1 282 ? 21.645  -13.756 -6.716  1.00 22.90 ? 346  TYR B CB  1 
ATOM   5104 C  CG  . TYR B 1 282 ? 22.049  -13.447 -8.138  1.00 22.63 ? 346  TYR B CG  1 
ATOM   5105 C  CD1 . TYR B 1 282 ? 23.350  -13.684 -8.579  1.00 24.20 ? 346  TYR B CD1 1 
ATOM   5106 C  CD2 . TYR B 1 282 ? 21.145  -12.883 -9.032  1.00 23.45 ? 346  TYR B CD2 1 
ATOM   5107 C  CE1 . TYR B 1 282 ? 23.742  -13.364 -9.877  1.00 22.67 ? 346  TYR B CE1 1 
ATOM   5108 C  CE2 . TYR B 1 282 ? 21.527  -12.558 -10.334 1.00 23.20 ? 346  TYR B CE2 1 
ATOM   5109 C  CZ  . TYR B 1 282 ? 22.826  -12.801 -10.747 1.00 24.02 ? 346  TYR B CZ  1 
ATOM   5110 O  OH  . TYR B 1 282 ? 23.210  -12.473 -12.025 1.00 26.11 ? 346  TYR B OH  1 
ATOM   5111 N  N   . GLU B 1 283 ? 20.402  -11.163 -6.250  1.00 24.23 ? 347  GLU B N   1 
ATOM   5112 C  CA  . GLU B 1 283 ? 19.855  -9.893  -6.711  1.00 26.36 ? 347  GLU B CA  1 
ATOM   5113 C  C   . GLU B 1 283 ? 20.331  -8.686  -5.907  1.00 25.63 ? 347  GLU B C   1 
ATOM   5114 O  O   . GLU B 1 283 ? 20.924  -7.760  -6.465  1.00 22.24 ? 347  GLU B O   1 
ATOM   5115 C  CB  . GLU B 1 283 ? 18.326  -9.940  -6.717  1.00 28.85 ? 347  GLU B CB  1 
ATOM   5116 C  CG  . GLU B 1 283 ? 17.708  -9.192  -7.891  1.00 33.00 ? 347  GLU B CG  1 
ATOM   5117 C  CD  . GLU B 1 283 ? 16.191  -9.110  -7.818  1.00 35.64 ? 347  GLU B CD  1 
ATOM   5118 O  OE1 . GLU B 1 283 ? 15.548  -10.104 -7.416  1.00 37.63 ? 347  GLU B OE1 1 
ATOM   5119 O  OE2 . GLU B 1 283 ? 15.641  -8.050  -8.180  1.00 34.86 ? 347  GLU B OE2 1 
ATOM   5120 N  N   . LEU B 1 284 ? 20.084  -8.707  -4.599  1.00 23.62 ? 348  LEU B N   1 
ATOM   5121 C  CA  . LEU B 1 284 ? 20.471  -7.599  -3.736  1.00 23.23 ? 348  LEU B CA  1 
ATOM   5122 C  C   . LEU B 1 284 ? 21.962  -7.490  -3.429  1.00 23.61 ? 348  LEU B C   1 
ATOM   5123 O  O   . LEU B 1 284 ? 22.526  -6.399  -3.495  1.00 23.62 ? 348  LEU B O   1 
ATOM   5124 C  CB  . LEU B 1 284 ? 19.696  -7.658  -2.410  1.00 22.21 ? 348  LEU B CB  1 
ATOM   5125 C  CG  . LEU B 1 284 ? 18.183  -7.417  -2.437  1.00 21.54 ? 348  LEU B CG  1 
ATOM   5126 C  CD1 . LEU B 1 284 ? 17.625  -7.474  -1.028  1.00 20.51 ? 348  LEU B CD1 1 
ATOM   5127 C  CD2 . LEU B 1 284 ? 17.894  -6.064  -3.047  1.00 22.33 ? 348  LEU B CD2 1 
ATOM   5128 N  N   . ASP B 1 285 ? 22.598  -8.609  -3.087  1.00 24.97 ? 349  ASP B N   1 
ATOM   5129 C  CA  . ASP B 1 285 ? 24.012  -8.589  -2.734  1.00 26.42 ? 349  ASP B CA  1 
ATOM   5130 C  C   . ASP B 1 285 ? 24.981  -8.468  -3.899  1.00 26.51 ? 349  ASP B C   1 
ATOM   5131 O  O   . ASP B 1 285 ? 25.967  -7.739  -3.814  1.00 28.33 ? 349  ASP B O   1 
ATOM   5132 C  CB  . ASP B 1 285 ? 24.374  -9.825  -1.905  1.00 28.57 ? 349  ASP B CB  1 
ATOM   5133 C  CG  . ASP B 1 285 ? 23.652  -9.864  -0.569  1.00 30.02 ? 349  ASP B CG  1 
ATOM   5134 O  OD1 . ASP B 1 285 ? 23.160  -8.806  -0.123  1.00 31.30 ? 349  ASP B OD1 1 
ATOM   5135 O  OD2 . ASP B 1 285 ? 23.583  -10.949 0.039   1.00 32.83 ? 349  ASP B OD2 1 
ATOM   5136 N  N   . ILE B 1 286 ? 24.706  -9.172  -4.987  1.00 26.12 ? 350  ILE B N   1 
ATOM   5137 C  CA  . ILE B 1 286 ? 25.595  -9.130  -6.132  1.00 25.10 ? 350  ILE B CA  1 
ATOM   5138 C  C   . ILE B 1 286 ? 25.134  -8.173  -7.223  1.00 24.44 ? 350  ILE B C   1 
ATOM   5139 O  O   . ILE B 1 286 ? 25.813  -7.197  -7.521  1.00 24.62 ? 350  ILE B O   1 
ATOM   5140 C  CB  . ILE B 1 286 ? 25.788  -10.550 -6.721  1.00 23.35 ? 350  ILE B CB  1 
ATOM   5141 C  CG1 . ILE B 1 286 ? 26.432  -11.454 -5.659  1.00 25.03 ? 350  ILE B CG1 1 
ATOM   5142 C  CG2 . ILE B 1 286 ? 26.651  -10.487 -7.984  1.00 24.56 ? 350  ILE B CG2 1 
ATOM   5143 C  CD1 . ILE B 1 286 ? 26.776  -12.866 -6.134  1.00 21.81 ? 350  ILE B CD1 1 
ATOM   5144 N  N   . GLU B 1 287 ? 23.977  -8.450  -7.808  1.00 25.97 ? 351  GLU B N   1 
ATOM   5145 C  CA  . GLU B 1 287 ? 23.433  -7.622  -8.880  1.00 27.42 ? 351  GLU B CA  1 
ATOM   5146 C  C   . GLU B 1 287 ? 23.345  -6.140  -8.511  1.00 26.67 ? 351  GLU B C   1 
ATOM   5147 O  O   . GLU B 1 287 ? 23.844  -5.283  -9.240  1.00 26.04 ? 351  GLU B O   1 
ATOM   5148 C  CB  . GLU B 1 287 ? 22.048  -8.141  -9.278  1.00 29.43 ? 351  GLU B CB  1 
ATOM   5149 C  CG  . GLU B 1 287 ? 21.600  -7.756  -10.677 1.00 35.42 ? 351  GLU B CG  1 
ATOM   5150 C  CD  . GLU B 1 287 ? 20.264  -8.388  -11.058 1.00 39.16 ? 351  GLU B CD  1 
ATOM   5151 O  OE1 . GLU B 1 287 ? 20.006  -9.537  -10.628 1.00 40.71 ? 351  GLU B OE1 1 
ATOM   5152 O  OE2 . GLU B 1 287 ? 19.480  -7.747  -11.798 1.00 39.00 ? 351  GLU B OE2 1 
ATOM   5153 N  N   . TYR B 1 288 ? 22.735  -5.833  -7.371  1.00 24.75 ? 352  TYR B N   1 
ATOM   5154 C  CA  . TYR B 1 288 ? 22.590  -4.436  -6.973  1.00 25.62 ? 352  TYR B CA  1 
ATOM   5155 C  C   . TYR B 1 288 ? 23.725  -3.843  -6.152  1.00 26.19 ? 352  TYR B C   1 
ATOM   5156 O  O   . TYR B 1 288 ? 24.205  -2.758  -6.463  1.00 25.80 ? 352  TYR B O   1 
ATOM   5157 C  CB  . TYR B 1 288 ? 21.280  -4.226  -6.215  1.00 22.48 ? 352  TYR B CB  1 
ATOM   5158 C  CG  . TYR B 1 288 ? 20.047  -4.641  -6.985  1.00 22.11 ? 352  TYR B CG  1 
ATOM   5159 C  CD1 . TYR B 1 288 ? 20.059  -4.721  -8.379  1.00 19.67 ? 352  TYR B CD1 1 
ATOM   5160 C  CD2 . TYR B 1 288 ? 18.865  -4.948  -6.319  1.00 20.58 ? 352  TYR B CD2 1 
ATOM   5161 C  CE1 . TYR B 1 288 ? 18.919  -5.106  -9.085  1.00 21.83 ? 352  TYR B CE1 1 
ATOM   5162 C  CE2 . TYR B 1 288 ? 17.725  -5.327  -7.012  1.00 21.04 ? 352  TYR B CE2 1 
ATOM   5163 C  CZ  . TYR B 1 288 ? 17.760  -5.408  -8.392  1.00 21.61 ? 352  TYR B CZ  1 
ATOM   5164 O  OH  . TYR B 1 288 ? 16.635  -5.824  -9.066  1.00 26.09 ? 352  TYR B OH  1 
ATOM   5165 N  N   . SER B 1 289 ? 24.153  -4.551  -5.111  1.00 27.39 ? 353  SER B N   1 
ATOM   5166 C  CA  . SER B 1 289 ? 25.211  -4.051  -4.237  1.00 28.63 ? 353  SER B CA  1 
ATOM   5167 C  C   . SER B 1 289 ? 26.622  -4.050  -4.809  1.00 29.01 ? 353  SER B C   1 
ATOM   5168 O  O   . SER B 1 289 ? 27.400  -3.155  -4.508  1.00 30.72 ? 353  SER B O   1 
ATOM   5169 C  CB  . SER B 1 289 ? 25.212  -4.821  -2.917  1.00 28.13 ? 353  SER B CB  1 
ATOM   5170 O  OG  . SER B 1 289 ? 24.033  -4.559  -2.186  1.00 33.02 ? 353  SER B OG  1 
ATOM   5171 N  N   . GLN B 1 290 ? 26.967  -5.043  -5.620  1.00 30.08 ? 354  GLN B N   1 
ATOM   5172 C  CA  . GLN B 1 290 ? 28.312  -5.087  -6.187  1.00 32.17 ? 354  GLN B CA  1 
ATOM   5173 C  C   . GLN B 1 290 ? 28.407  -4.443  -7.565  1.00 31.16 ? 354  GLN B C   1 
ATOM   5174 O  O   . GLN B 1 290 ? 29.212  -3.537  -7.775  1.00 31.98 ? 354  GLN B O   1 
ATOM   5175 C  CB  . GLN B 1 290 ? 28.812  -6.531  -6.255  1.00 33.24 ? 354  GLN B CB  1 
ATOM   5176 C  CG  . GLN B 1 290 ? 28.868  -7.215  -4.897  1.00 37.34 ? 354  GLN B CG  1 
ATOM   5177 C  CD  . GLN B 1 290 ? 29.413  -8.630  -4.977  1.00 40.54 ? 354  GLN B CD  1 
ATOM   5178 O  OE1 . GLN B 1 290 ? 29.448  -9.354  -3.978  1.00 40.98 ? 354  GLN B OE1 1 
ATOM   5179 N  NE2 . GLN B 1 290 ? 29.849  -9.030  -6.169  1.00 43.24 ? 354  GLN B NE2 1 
ATOM   5180 N  N   . VAL B 1 291 ? 27.579  -4.901  -8.496  1.00 30.37 ? 355  VAL B N   1 
ATOM   5181 C  CA  . VAL B 1 291 ? 27.597  -4.377  -9.854  1.00 31.46 ? 355  VAL B CA  1 
ATOM   5182 C  C   . VAL B 1 291 ? 26.972  -2.993  -9.973  1.00 31.47 ? 355  VAL B C   1 
ATOM   5183 O  O   . VAL B 1 291 ? 27.683  -1.995  -10.106 1.00 32.41 ? 355  VAL B O   1 
ATOM   5184 C  CB  . VAL B 1 291 ? 26.877  -5.340  -10.833 1.00 32.94 ? 355  VAL B CB  1 
ATOM   5185 C  CG1 . VAL B 1 291 ? 27.026  -4.843  -12.268 1.00 30.48 ? 355  VAL B CG1 1 
ATOM   5186 C  CG2 . VAL B 1 291 ? 27.459  -6.742  -10.698 1.00 33.01 ? 355  VAL B CG2 1 
ATOM   5187 N  N   . LEU B 1 292 ? 25.645  -2.932  -9.925  1.00 31.38 ? 356  LEU B N   1 
ATOM   5188 C  CA  . LEU B 1 292 ? 24.934  -1.660  -10.046 1.00 31.27 ? 356  LEU B CA  1 
ATOM   5189 C  C   . LEU B 1 292 ? 25.533  -0.547  -9.185  1.00 31.55 ? 356  LEU B C   1 
ATOM   5190 O  O   . LEU B 1 292 ? 25.784  0.557   -9.668  1.00 30.34 ? 356  LEU B O   1 
ATOM   5191 C  CB  . LEU B 1 292 ? 23.456  -1.842  -9.686  1.00 30.76 ? 356  LEU B CB  1 
ATOM   5192 C  CG  . LEU B 1 292 ? 22.606  -0.572  -9.774  1.00 32.01 ? 356  LEU B CG  1 
ATOM   5193 C  CD1 . LEU B 1 292 ? 22.640  -0.027  -11.202 1.00 32.46 ? 356  LEU B CD1 1 
ATOM   5194 C  CD2 . LEU B 1 292 ? 21.177  -0.880  -9.358  1.00 31.97 ? 356  LEU B CD2 1 
ATOM   5195 N  N   . ALA B 1 293 ? 25.763  -0.846  -7.913  1.00 32.74 ? 357  ALA B N   1 
ATOM   5196 C  CA  . ALA B 1 293 ? 26.317  0.128   -6.980  1.00 33.78 ? 357  ALA B CA  1 
ATOM   5197 C  C   . ALA B 1 293 ? 27.651  0.720   -7.429  1.00 34.53 ? 357  ALA B C   1 
ATOM   5198 O  O   . ALA B 1 293 ? 27.873  1.927   -7.313  1.00 34.14 ? 357  ALA B O   1 
ATOM   5199 C  CB  . ALA B 1 293 ? 26.474  -0.509  -5.601  1.00 33.99 ? 357  ALA B CB  1 
ATOM   5200 N  N   . LYS B 1 294 ? 28.541  -0.132  -7.927  1.00 35.73 ? 358  LYS B N   1 
ATOM   5201 C  CA  . LYS B 1 294 ? 29.851  0.319   -8.379  1.00 36.40 ? 358  LYS B CA  1 
ATOM   5202 C  C   . LYS B 1 294 ? 29.729  1.270   -9.567  1.00 36.76 ? 358  LYS B C   1 
ATOM   5203 O  O   . LYS B 1 294 ? 30.404  2.298   -9.622  1.00 37.87 ? 358  LYS B O   1 
ATOM   5204 C  CB  . LYS B 1 294 ? 30.717  -0.884  -8.753  1.00 37.44 ? 358  LYS B CB  1 
ATOM   5205 N  N   . GLU B 1 295 ? 28.864  0.920   -10.515 1.00 35.24 ? 359  GLU B N   1 
ATOM   5206 C  CA  . GLU B 1 295 ? 28.658  1.737   -11.698 1.00 35.20 ? 359  GLU B CA  1 
ATOM   5207 C  C   . GLU B 1 295 ? 27.988  3.068   -11.371 1.00 35.18 ? 359  GLU B C   1 
ATOM   5208 O  O   . GLU B 1 295 ? 28.052  4.008   -12.161 1.00 34.93 ? 359  GLU B O   1 
ATOM   5209 C  CB  . GLU B 1 295 ? 27.822  0.969   -12.721 1.00 34.23 ? 359  GLU B CB  1 
ATOM   5210 N  N   . CYS B 1 296 ? 27.347  3.150   -10.208 1.00 35.04 ? 360  CYS B N   1 
ATOM   5211 C  CA  . CYS B 1 296 ? 26.661  4.378   -9.808  1.00 35.52 ? 360  CYS B CA  1 
ATOM   5212 C  C   . CYS B 1 296 ? 27.467  5.258   -8.863  1.00 34.64 ? 360  CYS B C   1 
ATOM   5213 O  O   . CYS B 1 296 ? 27.095  6.397   -8.601  1.00 34.76 ? 360  CYS B O   1 
ATOM   5214 C  CB  . CYS B 1 296 ? 25.317  4.045   -9.163  1.00 36.61 ? 360  CYS B CB  1 
ATOM   5215 S  SG  . CYS B 1 296 ? 24.138  3.311   -10.306 1.00 41.15 ? 360  CYS B SG  1 
ATOM   5216 N  N   . GLY B 1 297 ? 28.569  4.730   -8.349  1.00 34.20 ? 361  GLY B N   1 
ATOM   5217 C  CA  . GLY B 1 297 ? 29.387  5.511   -7.442  1.00 33.04 ? 361  GLY B CA  1 
ATOM   5218 C  C   . GLY B 1 297 ? 28.827  5.630   -6.033  1.00 32.76 ? 361  GLY B C   1 
ATOM   5219 O  O   . GLY B 1 297 ? 28.908  6.697   -5.420  1.00 31.06 ? 361  GLY B O   1 
ATOM   5220 N  N   . VAL B 1 298 ? 28.252  4.545   -5.515  1.00 32.13 ? 362  VAL B N   1 
ATOM   5221 C  CA  . VAL B 1 298 ? 27.716  4.558   -4.163  1.00 31.23 ? 362  VAL B CA  1 
ATOM   5222 C  C   . VAL B 1 298 ? 28.911  4.662   -3.227  1.00 30.80 ? 362  VAL B C   1 
ATOM   5223 O  O   . VAL B 1 298 ? 29.994  4.187   -3.554  1.00 30.18 ? 362  VAL B O   1 
ATOM   5224 C  CB  . VAL B 1 298 ? 26.964  3.250   -3.820  1.00 32.68 ? 362  VAL B CB  1 
ATOM   5225 C  CG1 . VAL B 1 298 ? 25.853  2.998   -4.824  1.00 34.72 ? 362  VAL B CG1 1 
ATOM   5226 C  CG2 . VAL B 1 298 ? 27.937  2.081   -3.805  1.00 32.32 ? 362  VAL B CG2 1 
ATOM   5227 N  N   . GLU B 1 299 ? 28.721  5.291   -2.074  1.00 31.45 ? 363  GLU B N   1 
ATOM   5228 C  CA  . GLU B 1 299 ? 29.797  5.411   -1.100  1.00 31.34 ? 363  GLU B CA  1 
ATOM   5229 C  C   . GLU B 1 299 ? 29.728  4.179   -0.202  1.00 29.98 ? 363  GLU B C   1 
ATOM   5230 O  O   . GLU B 1 299 ? 30.734  3.518   0.048   1.00 30.39 ? 363  GLU B O   1 
ATOM   5231 C  CB  . GLU B 1 299 ? 29.629  6.686   -0.266  1.00 34.20 ? 363  GLU B CB  1 
ATOM   5232 C  CG  . GLU B 1 299 ? 29.761  7.972   -1.065  1.00 38.66 ? 363  GLU B CG  1 
ATOM   5233 C  CD  . GLU B 1 299 ? 29.595  9.219   -0.213  1.00 42.00 ? 363  GLU B CD  1 
ATOM   5234 O  OE1 . GLU B 1 299 ? 29.703  10.336  -0.766  1.00 45.43 ? 363  GLU B OE1 1 
ATOM   5235 O  OE2 . GLU B 1 299 ? 29.353  9.086   1.008   1.00 43.72 ? 363  GLU B OE2 1 
ATOM   5236 N  N   . ASN B 1 300 ? 28.524  3.872   0.268   1.00 27.73 ? 364  ASN B N   1 
ATOM   5237 C  CA  . ASN B 1 300 ? 28.299  2.716   1.126   1.00 24.55 ? 364  ASN B CA  1 
ATOM   5238 C  C   . ASN B 1 300 ? 26.908  2.133   0.936   1.00 22.48 ? 364  ASN B C   1 
ATOM   5239 O  O   . ASN B 1 300 ? 25.908  2.844   1.055   1.00 17.69 ? 364  ASN B O   1 
ATOM   5240 C  CB  . ASN B 1 300 ? 28.445  3.084   2.605   1.00 25.57 ? 364  ASN B CB  1 
ATOM   5241 C  CG  . ASN B 1 300 ? 29.857  3.451   2.984   1.00 27.93 ? 364  ASN B CG  1 
ATOM   5242 O  OD1 . ASN B 1 300 ? 30.162  4.619   3.230   1.00 27.98 ? 364  ASN B OD1 1 
ATOM   5243 N  ND2 . ASN B 1 300 ? 30.730  2.456   3.034   1.00 28.20 ? 364  ASN B ND2 1 
ATOM   5244 N  N   . ILE B 1 301 ? 26.850  0.842   0.625   1.00 20.58 ? 365  ILE B N   1 
ATOM   5245 C  CA  . ILE B 1 301 ? 25.579  0.155   0.489   1.00 20.18 ? 365  ILE B CA  1 
ATOM   5246 C  C   . ILE B 1 301 ? 25.695  -1.175  1.215   1.00 21.18 ? 365  ILE B C   1 
ATOM   5247 O  O   . ILE B 1 301 ? 26.580  -1.986  0.926   1.00 22.81 ? 365  ILE B O   1 
ATOM   5248 C  CB  . ILE B 1 301 ? 25.179  -0.081  -0.982  1.00 20.31 ? 365  ILE B CB  1 
ATOM   5249 C  CG1 . ILE B 1 301 ? 23.821  -0.793  -1.026  1.00 16.63 ? 365  ILE B CG1 1 
ATOM   5250 C  CG2 . ILE B 1 301 ? 26.236  -0.899  -1.706  1.00 19.68 ? 365  ILE B CG2 1 
ATOM   5251 C  CD1 . ILE B 1 301 ? 23.161  -0.753  -2.383  1.00 18.20 ? 365  ILE B CD1 1 
ATOM   5252 N  N   . ARG B 1 302 ? 24.822  -1.378  2.190   1.00 21.37 ? 366  ARG B N   1 
ATOM   5253 C  CA  . ARG B 1 302 ? 24.826  -2.609  2.964   1.00 20.96 ? 366  ARG B CA  1 
ATOM   5254 C  C   . ARG B 1 302 ? 23.413  -3.161  2.981   1.00 20.85 ? 366  ARG B C   1 
ATOM   5255 O  O   . ARG B 1 302 ? 22.466  -2.474  2.601   1.00 19.93 ? 366  ARG B O   1 
ATOM   5256 C  CB  . ARG B 1 302 ? 25.291  -2.344  4.397   1.00 19.39 ? 366  ARG B CB  1 
ATOM   5257 C  CG  . ARG B 1 302 ? 26.663  -1.686  4.500   1.00 23.80 ? 366  ARG B CG  1 
ATOM   5258 C  CD  . ARG B 1 302 ? 27.077  -1.515  5.958   1.00 25.46 ? 366  ARG B CD  1 
ATOM   5259 N  NE  . ARG B 1 302 ? 27.490  -2.784  6.545   1.00 29.72 ? 366  ARG B NE  1 
ATOM   5260 C  CZ  . ARG B 1 302 ? 28.685  -3.334  6.354   1.00 29.95 ? 366  ARG B CZ  1 
ATOM   5261 N  NH1 . ARG B 1 302 ? 29.588  -2.718  5.600   1.00 29.77 ? 366  ARG B NH1 1 
ATOM   5262 N  NH2 . ARG B 1 302 ? 28.969  -4.508  6.897   1.00 30.41 ? 366  ARG B NH2 1 
ATOM   5263 N  N   . ARG B 1 303 ? 23.276  -4.410  3.403   1.00 20.76 ? 367  ARG B N   1 
ATOM   5264 C  CA  . ARG B 1 303 ? 21.967  -5.039  3.475   1.00 20.15 ? 367  ARG B CA  1 
ATOM   5265 C  C   . ARG B 1 303 ? 21.782  -5.651  4.851   1.00 19.35 ? 367  ARG B C   1 
ATOM   5266 O  O   . ARG B 1 303 ? 22.667  -6.341  5.355   1.00 19.17 ? 367  ARG B O   1 
ATOM   5267 C  CB  . ARG B 1 303 ? 21.820  -6.125  2.407   1.00 20.00 ? 367  ARG B CB  1 
ATOM   5268 C  CG  . ARG B 1 303 ? 20.548  -6.946  2.577   1.00 22.56 ? 367  ARG B CG  1 
ATOM   5269 C  CD  . ARG B 1 303 ? 20.377  -7.979  1.493   1.00 21.51 ? 367  ARG B CD  1 
ATOM   5270 N  NE  . ARG B 1 303 ? 21.347  -9.068  1.564   1.00 21.56 ? 367  ARG B NE  1 
ATOM   5271 C  CZ  . ARG B 1 303 ? 21.308  -10.059 2.451   1.00 22.57 ? 367  ARG B CZ  1 
ATOM   5272 N  NH1 . ARG B 1 303 ? 20.345  -10.108 3.364   1.00 22.57 ? 367  ARG B NH1 1 
ATOM   5273 N  NH2 . ARG B 1 303 ? 22.220  -11.024 2.400   1.00 21.86 ? 367  ARG B NH2 1 
ATOM   5274 N  N   . ALA B 1 304 ? 20.638  -5.380  5.463   1.00 18.91 ? 368  ALA B N   1 
ATOM   5275 C  CA  . ALA B 1 304 ? 20.346  -5.930  6.773   1.00 19.85 ? 368  ALA B CA  1 
ATOM   5276 C  C   . ALA B 1 304 ? 20.376  -7.451  6.654   1.00 21.10 ? 368  ALA B C   1 
ATOM   5277 O  O   . ALA B 1 304 ? 19.899  -8.012  5.661   1.00 19.95 ? 368  ALA B O   1 
ATOM   5278 C  CB  . ALA B 1 304 ? 18.977  -5.475  7.236   1.00 19.14 ? 368  ALA B CB  1 
ATOM   5279 N  N   . GLU B 1 305 ? 20.947  -8.108  7.659   1.00 20.79 ? 369  GLU B N   1 
ATOM   5280 C  CA  . GLU B 1 305 ? 21.024  -9.565  7.670   1.00 23.22 ? 369  GLU B CA  1 
ATOM   5281 C  C   . GLU B 1 305 ? 19.612  -10.148 7.671   1.00 22.16 ? 369  GLU B C   1 
ATOM   5282 O  O   . GLU B 1 305 ? 18.709  -9.596  8.307   1.00 21.26 ? 369  GLU B O   1 
ATOM   5283 C  CB  . GLU B 1 305 ? 21.768  -10.043 8.921   1.00 25.57 ? 369  GLU B CB  1 
ATOM   5284 C  CG  . GLU B 1 305 ? 21.841  -11.555 9.083   1.00 32.23 ? 369  GLU B CG  1 
ATOM   5285 C  CD  . GLU B 1 305 ? 22.574  -11.982 10.354  1.00 36.26 ? 369  GLU B CD  1 
ATOM   5286 O  OE1 . GLU B 1 305 ? 22.902  -13.181 10.478  1.00 39.34 ? 369  GLU B OE1 1 
ATOM   5287 O  OE2 . GLU B 1 305 ? 22.820  -11.125 11.232  1.00 38.70 ? 369  GLU B OE2 1 
ATOM   5288 N  N   . SER B 1 306 ? 19.420  -11.241 6.940   1.00 20.22 ? 370  SER B N   1 
ATOM   5289 C  CA  . SER B 1 306 ? 18.118  -11.902 6.906   1.00 20.76 ? 370  SER B CA  1 
ATOM   5290 C  C   . SER B 1 306 ? 17.889  -12.502 8.295   1.00 22.14 ? 370  SER B C   1 
ATOM   5291 O  O   . SER B 1 306 ? 18.850  -12.821 8.999   1.00 22.03 ? 370  SER B O   1 
ATOM   5292 C  CB  . SER B 1 306 ? 18.111  -13.012 5.855   1.00 20.98 ? 370  SER B CB  1 
ATOM   5293 O  OG  . SER B 1 306 ? 18.258  -12.476 4.556   1.00 23.80 ? 370  SER B OG  1 
ATOM   5294 N  N   . LEU B 1 307 ? 16.628  -12.661 8.685   1.00 22.04 ? 371  LEU B N   1 
ATOM   5295 C  CA  . LEU B 1 307 ? 16.302  -13.200 10.004  1.00 23.38 ? 371  LEU B CA  1 
ATOM   5296 C  C   . LEU B 1 307 ? 16.963  -14.548 10.285  1.00 23.46 ? 371  LEU B C   1 
ATOM   5297 O  O   . LEU B 1 307 ? 17.384  -14.816 11.408  1.00 23.66 ? 371  LEU B O   1 
ATOM   5298 C  CB  . LEU B 1 307 ? 14.785  -13.290 10.164  1.00 22.72 ? 371  LEU B CB  1 
ATOM   5299 C  CG  . LEU B 1 307 ? 14.074  -11.957 9.894   1.00 24.10 ? 371  LEU B CG  1 
ATOM   5300 C  CD1 . LEU B 1 307 ? 12.605  -12.046 10.305  1.00 22.50 ? 371  LEU B CD1 1 
ATOM   5301 C  CD2 . LEU B 1 307 ? 14.767  -10.843 10.665  1.00 22.86 ? 371  LEU B CD2 1 
ATOM   5302 N  N   . ASN B 1 308 ? 17.055  -15.382 9.257   1.00 24.20 ? 372  ASN B N   1 
ATOM   5303 C  CA  . ASN B 1 308 ? 17.688  -16.698 9.347   1.00 25.76 ? 372  ASN B CA  1 
ATOM   5304 C  C   . ASN B 1 308 ? 17.617  -17.425 10.692  1.00 25.96 ? 372  ASN B C   1 
ATOM   5305 O  O   . ASN B 1 308 ? 16.556  -17.878 11.101  1.00 25.97 ? 372  ASN B O   1 
ATOM   5306 C  CB  . ASN B 1 308 ? 19.155  -16.598 8.916   1.00 24.83 ? 372  ASN B CB  1 
ATOM   5307 C  CG  . ASN B 1 308 ? 19.310  -16.210 7.454   1.00 25.35 ? 372  ASN B CG  1 
ATOM   5308 O  OD1 . ASN B 1 308 ? 18.410  -16.429 6.645   1.00 25.45 ? 372  ASN B OD1 1 
ATOM   5309 N  ND2 . ASN B 1 308 ? 20.464  -15.653 7.108   1.00 24.33 ? 372  ASN B ND2 1 
ATOM   5310 N  N   . GLY B 1 309 ? 18.759  -17.531 11.367  1.00 27.80 ? 373  GLY B N   1 
ATOM   5311 C  CA  . GLY B 1 309 ? 18.819  -18.231 12.641  1.00 28.73 ? 373  GLY B CA  1 
ATOM   5312 C  C   . GLY B 1 309 ? 18.603  -17.446 13.925  1.00 29.23 ? 373  GLY B C   1 
ATOM   5313 O  O   . GLY B 1 309 ? 18.800  -17.987 15.011  1.00 30.36 ? 373  GLY B O   1 
ATOM   5314 N  N   . ASN B 1 310 ? 18.208  -16.183 13.820  1.00 28.31 ? 374  ASN B N   1 
ATOM   5315 C  CA  . ASN B 1 310 ? 17.953  -15.359 15.000  1.00 27.75 ? 374  ASN B CA  1 
ATOM   5316 C  C   . ASN B 1 310 ? 16.983  -16.096 15.936  1.00 27.73 ? 374  ASN B C   1 
ATOM   5317 O  O   . ASN B 1 310 ? 15.847  -16.388 15.559  1.00 27.53 ? 374  ASN B O   1 
ATOM   5318 C  CB  . ASN B 1 310 ? 17.357  -14.016 14.561  1.00 29.30 ? 374  ASN B CB  1 
ATOM   5319 C  CG  . ASN B 1 310 ? 17.123  -13.058 15.722  1.00 30.84 ? 374  ASN B CG  1 
ATOM   5320 O  OD1 . ASN B 1 310 ? 16.906  -11.866 15.511  1.00 34.53 ? 374  ASN B OD1 1 
ATOM   5321 N  ND2 . ASN B 1 310 ? 17.156  -13.571 16.944  1.00 32.10 ? 374  ASN B ND2 1 
ATOM   5322 N  N   . PRO B 1 311 ? 17.419  -16.403 17.171  1.00 27.78 ? 375  PRO B N   1 
ATOM   5323 C  CA  . PRO B 1 311 ? 16.545  -17.112 18.116  1.00 27.18 ? 375  PRO B CA  1 
ATOM   5324 C  C   . PRO B 1 311 ? 15.233  -16.394 18.400  1.00 25.37 ? 375  PRO B C   1 
ATOM   5325 O  O   . PRO B 1 311 ? 14.239  -17.022 18.758  1.00 25.24 ? 375  PRO B O   1 
ATOM   5326 C  CB  . PRO B 1 311 ? 17.428  -17.274 19.363  1.00 26.58 ? 375  PRO B CB  1 
ATOM   5327 C  CG  . PRO B 1 311 ? 18.371  -16.108 19.269  1.00 30.07 ? 375  PRO B CG  1 
ATOM   5328 C  CD  . PRO B 1 311 ? 18.714  -16.080 17.796  1.00 27.66 ? 375  PRO B CD  1 
ATOM   5329 N  N   . LEU B 1 312 ? 15.226  -15.078 18.231  1.00 24.59 ? 376  LEU B N   1 
ATOM   5330 C  CA  . LEU B 1 312 ? 14.016  -14.300 18.453  1.00 23.48 ? 376  LEU B CA  1 
ATOM   5331 C  C   . LEU B 1 312 ? 12.971  -14.628 17.381  1.00 23.64 ? 376  LEU B C   1 
ATOM   5332 O  O   . LEU B 1 312 ? 11.770  -14.552 17.628  1.00 23.01 ? 376  LEU B O   1 
ATOM   5333 C  CB  . LEU B 1 312 ? 14.345  -12.808 18.431  1.00 26.07 ? 376  LEU B CB  1 
ATOM   5334 C  CG  . LEU B 1 312 ? 13.195  -11.826 18.656  1.00 28.36 ? 376  LEU B CG  1 
ATOM   5335 C  CD1 . LEU B 1 312 ? 12.471  -12.164 19.952  1.00 27.92 ? 376  LEU B CD1 1 
ATOM   5336 C  CD2 . LEU B 1 312 ? 13.750  -10.402 18.706  1.00 28.84 ? 376  LEU B CD2 1 
ATOM   5337 N  N   . PHE B 1 313 ? 13.427  -15.005 16.192  1.00 23.28 ? 377  PHE B N   1 
ATOM   5338 C  CA  . PHE B 1 313 ? 12.499  -15.342 15.117  1.00 24.12 ? 377  PHE B CA  1 
ATOM   5339 C  C   . PHE B 1 313 ? 11.780  -16.661 15.402  1.00 24.13 ? 377  PHE B C   1 
ATOM   5340 O  O   . PHE B 1 313 ? 10.587  -16.797 15.124  1.00 24.21 ? 377  PHE B O   1 
ATOM   5341 C  CB  . PHE B 1 313 ? 13.231  -15.433 13.774  1.00 24.99 ? 377  PHE B CB  1 
ATOM   5342 C  CG  . PHE B 1 313 ? 12.327  -15.754 12.620  1.00 24.64 ? 377  PHE B CG  1 
ATOM   5343 C  CD1 . PHE B 1 313 ? 12.466  -16.948 11.920  1.00 24.89 ? 377  PHE B CD1 1 
ATOM   5344 C  CD2 . PHE B 1 313 ? 11.313  -14.870 12.248  1.00 24.01 ? 377  PHE B CD2 1 
ATOM   5345 C  CE1 . PHE B 1 313 ? 11.605  -17.260 10.866  1.00 24.79 ? 377  PHE B CE1 1 
ATOM   5346 C  CE2 . PHE B 1 313 ? 10.449  -15.172 11.197  1.00 23.15 ? 377  PHE B CE2 1 
ATOM   5347 C  CZ  . PHE B 1 313 ? 10.595  -16.369 10.505  1.00 23.77 ? 377  PHE B CZ  1 
ATOM   5348 N  N   . SER B 1 314 ? 12.505  -17.637 15.942  1.00 24.72 ? 378  SER B N   1 
ATOM   5349 C  CA  . SER B 1 314 ? 11.894  -18.920 16.278  1.00 25.31 ? 378  SER B CA  1 
ATOM   5350 C  C   . SER B 1 314 ? 10.872  -18.671 17.377  1.00 23.73 ? 378  SER B C   1 
ATOM   5351 O  O   . SER B 1 314 ? 9.828   -19.317 17.423  1.00 22.44 ? 378  SER B O   1 
ATOM   5352 C  CB  . SER B 1 314 ? 12.948  -19.920 16.760  1.00 27.47 ? 378  SER B CB  1 
ATOM   5353 O  OG  . SER B 1 314 ? 13.665  -20.459 15.662  1.00 31.51 ? 378  SER B OG  1 
ATOM   5354 N  N   . LYS B 1 315 ? 11.183  -17.727 18.260  1.00 22.24 ? 379  LYS B N   1 
ATOM   5355 C  CA  . LYS B 1 315 ? 10.271  -17.372 19.338  1.00 22.76 ? 379  LYS B CA  1 
ATOM   5356 C  C   . LYS B 1 315 ? 9.022   -16.771 18.702  1.00 22.28 ? 379  LYS B C   1 
ATOM   5357 O  O   . LYS B 1 315 ? 7.899   -17.050 19.126  1.00 23.56 ? 379  LYS B O   1 
ATOM   5358 C  CB  . LYS B 1 315 ? 10.917  -16.351 20.277  1.00 25.12 ? 379  LYS B CB  1 
ATOM   5359 C  CG  . LYS B 1 315 ? 10.046  -15.947 21.458  1.00 29.96 ? 379  LYS B CG  1 
ATOM   5360 C  CD  . LYS B 1 315 ? 10.695  -14.834 22.267  1.00 35.06 ? 379  LYS B CD  1 
ATOM   5361 C  CE  . LYS B 1 315 ? 9.857   -14.479 23.488  1.00 37.74 ? 379  LYS B CE  1 
ATOM   5362 N  NZ  . LYS B 1 315 ? 9.631   -15.679 24.349  1.00 40.58 ? 379  LYS B NZ  1 
ATOM   5363 N  N   . ALA B 1 316 ? 9.221   -15.948 17.676  1.00 21.32 ? 380  ALA B N   1 
ATOM   5364 C  CA  . ALA B 1 316 ? 8.103   -15.322 16.981  1.00 20.31 ? 380  ALA B CA  1 
ATOM   5365 C  C   . ALA B 1 316 ? 7.194   -16.408 16.413  1.00 19.19 ? 380  ALA B C   1 
ATOM   5366 O  O   . ALA B 1 316 ? 5.970   -16.360 16.566  1.00 17.49 ? 380  ALA B O   1 
ATOM   5367 C  CB  . ALA B 1 316 ? 8.620   -14.423 15.857  1.00 19.98 ? 380  ALA B CB  1 
ATOM   5368 N  N   . LEU B 1 317 ? 7.801   -17.394 15.759  1.00 18.16 ? 381  LEU B N   1 
ATOM   5369 C  CA  . LEU B 1 317 ? 7.044   -18.496 15.176  1.00 18.05 ? 381  LEU B CA  1 
ATOM   5370 C  C   . LEU B 1 317 ? 6.252   -19.274 16.227  1.00 18.13 ? 381  LEU B C   1 
ATOM   5371 O  O   . LEU B 1 317 ? 5.077   -19.583 16.026  1.00 17.93 ? 381  LEU B O   1 
ATOM   5372 C  CB  . LEU B 1 317 ? 7.978   -19.465 14.450  1.00 16.90 ? 381  LEU B CB  1 
ATOM   5373 C  CG  . LEU B 1 317 ? 8.797   -18.967 13.257  1.00 17.40 ? 381  LEU B CG  1 
ATOM   5374 C  CD1 . LEU B 1 317 ? 9.710   -20.099 12.801  1.00 15.99 ? 381  LEU B CD1 1 
ATOM   5375 C  CD2 . LEU B 1 317 ? 7.882   -18.510 12.113  1.00 15.16 ? 381  LEU B CD2 1 
ATOM   5376 N  N   . ALA B 1 318 ? 6.897   -19.601 17.344  1.00 17.65 ? 382  ALA B N   1 
ATOM   5377 C  CA  . ALA B 1 318 ? 6.226   -20.358 18.398  1.00 18.03 ? 382  ALA B CA  1 
ATOM   5378 C  C   . ALA B 1 318 ? 5.081   -19.562 19.014  1.00 18.52 ? 382  ALA B C   1 
ATOM   5379 O  O   . ALA B 1 318 ? 4.034   -20.116 19.319  1.00 17.05 ? 382  ALA B O   1 
ATOM   5380 C  CB  . ALA B 1 318 ? 7.222   -20.768 19.481  1.00 17.78 ? 382  ALA B CB  1 
ATOM   5381 N  N   . ASP B 1 319 ? 5.281   -18.261 19.197  1.00 20.40 ? 383  ASP B N   1 
ATOM   5382 C  CA  . ASP B 1 319 ? 4.236   -17.424 19.775  1.00 21.74 ? 383  ASP B CA  1 
ATOM   5383 C  C   . ASP B 1 319 ? 3.034   -17.325 18.836  1.00 20.70 ? 383  ASP B C   1 
ATOM   5384 O  O   . ASP B 1 319 ? 1.885   -17.339 19.282  1.00 19.74 ? 383  ASP B O   1 
ATOM   5385 C  CB  . ASP B 1 319 ? 4.790   -16.032 20.109  1.00 26.22 ? 383  ASP B CB  1 
ATOM   5386 C  CG  . ASP B 1 319 ? 5.635   -16.027 21.394  1.00 32.41 ? 383  ASP B CG  1 
ATOM   5387 O  OD1 . ASP B 1 319 ? 5.792   -17.106 22.017  1.00 35.22 ? 383  ASP B OD1 1 
ATOM   5388 O  OD2 . ASP B 1 319 ? 6.140   -14.947 21.786  1.00 34.79 ? 383  ASP B OD2 1 
ATOM   5389 N  N   . LEU B 1 320 ? 3.296   -17.237 17.536  1.00 19.94 ? 384  LEU B N   1 
ATOM   5390 C  CA  . LEU B 1 320 ? 2.215   -17.159 16.561  1.00 19.50 ? 384  LEU B CA  1 
ATOM   5391 C  C   . LEU B 1 320 ? 1.402   -18.439 16.603  1.00 19.09 ? 384  LEU B C   1 
ATOM   5392 O  O   . LEU B 1 320 ? 0.174   -18.399 16.634  1.00 18.90 ? 384  LEU B O   1 
ATOM   5393 C  CB  . LEU B 1 320 ? 2.770   -16.956 15.151  1.00 17.70 ? 384  LEU B CB  1 
ATOM   5394 C  CG  . LEU B 1 320 ? 3.066   -15.507 14.767  1.00 19.69 ? 384  LEU B CG  1 
ATOM   5395 C  CD1 . LEU B 1 320 ? 4.061   -15.468 13.628  1.00 17.50 ? 384  LEU B CD1 1 
ATOM   5396 C  CD2 . LEU B 1 320 ? 1.759   -14.810 14.389  1.00 20.61 ? 384  LEU B CD2 1 
ATOM   5397 N  N   . VAL B 1 321 ? 2.094   -19.576 16.605  1.00 18.83 ? 385  VAL B N   1 
ATOM   5398 C  CA  . VAL B 1 321 ? 1.414   -20.863 16.644  1.00 19.90 ? 385  VAL B CA  1 
ATOM   5399 C  C   . VAL B 1 321 ? 0.653   -21.030 17.954  1.00 20.87 ? 385  VAL B C   1 
ATOM   5400 O  O   . VAL B 1 321 ? -0.461  -21.552 17.972  1.00 21.11 ? 385  VAL B O   1 
ATOM   5401 C  CB  . VAL B 1 321 ? 2.412   -22.037 16.486  1.00 20.36 ? 385  VAL B CB  1 
ATOM   5402 C  CG1 . VAL B 1 321 ? 1.717   -23.363 16.769  1.00 21.27 ? 385  VAL B CG1 1 
ATOM   5403 C  CG2 . VAL B 1 321 ? 2.978   -22.049 15.079  1.00 19.67 ? 385  VAL B CG2 1 
ATOM   5404 N  N   . HIS B 1 322 ? 1.254   -20.573 19.047  1.00 20.86 ? 386  HIS B N   1 
ATOM   5405 C  CA  . HIS B 1 322 ? 0.635   -20.689 20.358  1.00 22.86 ? 386  HIS B CA  1 
ATOM   5406 C  C   . HIS B 1 322 ? -0.667  -19.889 20.433  1.00 23.11 ? 386  HIS B C   1 
ATOM   5407 O  O   . HIS B 1 322 ? -1.697  -20.421 20.838  1.00 22.25 ? 386  HIS B O   1 
ATOM   5408 C  CB  . HIS B 1 322 ? 1.608   -20.210 21.442  1.00 24.33 ? 386  HIS B CB  1 
ATOM   5409 C  CG  . HIS B 1 322 ? 1.145   -20.496 22.836  1.00 26.87 ? 386  HIS B CG  1 
ATOM   5410 N  ND1 . HIS B 1 322 ? 1.507   -19.719 23.916  1.00 29.59 ? 386  HIS B ND1 1 
ATOM   5411 C  CD2 . HIS B 1 322 ? 0.363   -21.485 23.330  1.00 26.81 ? 386  HIS B CD2 1 
ATOM   5412 C  CE1 . HIS B 1 322 ? 0.967   -20.217 25.014  1.00 28.66 ? 386  HIS B CE1 1 
ATOM   5413 N  NE2 . HIS B 1 322 ? 0.269   -21.289 24.686  1.00 27.86 ? 386  HIS B NE2 1 
ATOM   5414 N  N   . SER B 1 323 ? -0.616  -18.617 20.042  1.00 23.85 ? 387  SER B N   1 
ATOM   5415 C  CA  . SER B 1 323 ? -1.796  -17.748 20.061  1.00 23.77 ? 387  SER B CA  1 
ATOM   5416 C  C   . SER B 1 323 ? -2.885  -18.291 19.143  1.00 23.24 ? 387  SER B C   1 
ATOM   5417 O  O   . SER B 1 323 ? -4.073  -18.169 19.429  1.00 23.25 ? 387  SER B O   1 
ATOM   5418 C  CB  . SER B 1 323 ? -1.429  -16.336 19.602  1.00 24.51 ? 387  SER B CB  1 
ATOM   5419 O  OG  . SER B 1 323 ? -0.376  -15.803 20.381  1.00 30.86 ? 387  SER B OG  1 
ATOM   5420 N  N   . HIS B 1 324 ? -2.466  -18.876 18.028  1.00 22.58 ? 388  HIS B N   1 
ATOM   5421 C  CA  . HIS B 1 324 ? -3.393  -19.447 17.061  1.00 21.78 ? 388  HIS B CA  1 
ATOM   5422 C  C   . HIS B 1 324 ? -4.146  -20.619 17.690  1.00 22.58 ? 388  HIS B C   1 
ATOM   5423 O  O   . HIS B 1 324 ? -5.357  -20.764 17.509  1.00 21.40 ? 388  HIS B O   1 
ATOM   5424 C  CB  . HIS B 1 324 ? -2.616  -19.914 15.833  1.00 18.63 ? 388  HIS B CB  1 
ATOM   5425 C  CG  . HIS B 1 324 ? -3.465  -20.564 14.786  1.00 21.09 ? 388  HIS B CG  1 
ATOM   5426 N  ND1 . HIS B 1 324 ? -3.647  -21.929 14.717  1.00 18.91 ? 388  HIS B ND1 1 
ATOM   5427 C  CD2 . HIS B 1 324 ? -4.159  -20.038 13.749  1.00 17.47 ? 388  HIS B CD2 1 
ATOM   5428 C  CE1 . HIS B 1 324 ? -4.412  -22.215 13.678  1.00 17.16 ? 388  HIS B CE1 1 
ATOM   5429 N  NE2 . HIS B 1 324 ? -4.737  -21.085 13.075  1.00 18.20 ? 388  HIS B NE2 1 
ATOM   5430 N  N   . ILE B 1 325 ? -3.423  -21.452 18.432  1.00 23.82 ? 389  ILE B N   1 
ATOM   5431 C  CA  . ILE B 1 325 ? -4.035  -22.600 19.091  1.00 25.93 ? 389  ILE B CA  1 
ATOM   5432 C  C   . ILE B 1 325 ? -4.942  -22.168 20.247  1.00 27.64 ? 389  ILE B C   1 
ATOM   5433 O  O   . ILE B 1 325 ? -5.991  -22.758 20.468  1.00 28.27 ? 389  ILE B O   1 
ATOM   5434 C  CB  . ILE B 1 325 ? -2.958  -23.575 19.620  1.00 25.75 ? 389  ILE B CB  1 
ATOM   5435 C  CG1 . ILE B 1 325 ? -2.235  -24.230 18.438  1.00 23.96 ? 389  ILE B CG1 1 
ATOM   5436 C  CG2 . ILE B 1 325 ? -3.596  -24.631 20.521  1.00 26.83 ? 389  ILE B CG2 1 
ATOM   5437 C  CD1 . ILE B 1 325 ? -0.987  -25.004 18.824  1.00 23.42 ? 389  ILE B CD1 1 
ATOM   5438 N  N   . GLN B 1 326 ? -4.542  -21.129 20.972  1.00 30.59 ? 390  GLN B N   1 
ATOM   5439 C  CA  . GLN B 1 326 ? -5.328  -20.637 22.103  1.00 33.01 ? 390  GLN B CA  1 
ATOM   5440 C  C   . GLN B 1 326 ? -6.651  -19.994 21.677  1.00 32.76 ? 390  GLN B C   1 
ATOM   5441 O  O   . GLN B 1 326 ? -7.653  -20.085 22.385  1.00 33.13 ? 390  GLN B O   1 
ATOM   5442 C  CB  . GLN B 1 326 ? -4.522  -19.601 22.891  1.00 36.51 ? 390  GLN B CB  1 
ATOM   5443 C  CG  . GLN B 1 326 ? -3.198  -20.098 23.438  1.00 41.65 ? 390  GLN B CG  1 
ATOM   5444 C  CD  . GLN B 1 326 ? -3.363  -20.995 24.644  1.00 44.04 ? 390  GLN B CD  1 
ATOM   5445 O  OE1 . GLN B 1 326 ? -4.008  -22.045 24.571  1.00 46.15 ? 390  GLN B OE1 1 
ATOM   5446 N  NE2 . GLN B 1 326 ? -2.777  -20.585 25.768  1.00 44.97 ? 390  GLN B NE2 1 
ATOM   5447 N  N   . SER B 1 327 ? -6.646  -19.340 20.521  1.00 31.28 ? 391  SER B N   1 
ATOM   5448 C  CA  . SER B 1 327 ? -7.832  -18.649 20.027  1.00 31.26 ? 391  SER B CA  1 
ATOM   5449 C  C   . SER B 1 327 ? -8.805  -19.509 19.229  1.00 31.85 ? 391  SER B C   1 
ATOM   5450 O  O   . SER B 1 327 ? -9.910  -19.069 18.921  1.00 32.09 ? 391  SER B O   1 
ATOM   5451 C  CB  . SER B 1 327 ? -7.404  -17.468 19.159  1.00 30.28 ? 391  SER B CB  1 
ATOM   5452 O  OG  . SER B 1 327 ? -6.729  -17.935 18.003  1.00 28.39 ? 391  SER B OG  1 
ATOM   5453 N  N   . ASN B 1 328 ? -8.397  -20.728 18.899  1.00 33.23 ? 392  ASN B N   1 
ATOM   5454 C  CA  . ASN B 1 328 ? -9.225  -21.628 18.100  1.00 34.69 ? 392  ASN B CA  1 
ATOM   5455 C  C   . ASN B 1 328 ? -9.461  -21.056 16.716  1.00 34.56 ? 392  ASN B C   1 
ATOM   5456 O  O   . ASN B 1 328 ? -10.433 -21.402 16.051  1.00 36.11 ? 392  ASN B O   1 
ATOM   5457 C  CB  . ASN B 1 328 ? -10.575 -21.904 18.769  1.00 35.61 ? 392  ASN B CB  1 
ATOM   5458 C  CG  . ASN B 1 328 ? -10.545 -23.148 19.630  1.00 36.81 ? 392  ASN B CG  1 
ATOM   5459 O  OD1 . ASN B 1 328 ? -10.013 -23.134 20.738  1.00 38.48 ? 392  ASN B OD1 1 
ATOM   5460 N  ND2 . ASN B 1 328 ? -11.100 -24.242 19.112  1.00 37.05 ? 392  ASN B ND2 1 
ATOM   5461 N  N   . GLU B 1 329 ? -8.565  -20.173 16.295  1.00 33.61 ? 393  GLU B N   1 
ATOM   5462 C  CA  . GLU B 1 329 ? -8.639  -19.557 14.981  1.00 33.03 ? 393  GLU B CA  1 
ATOM   5463 C  C   . GLU B 1 329 ? -8.518  -20.631 13.900  1.00 28.46 ? 393  GLU B C   1 
ATOM   5464 O  O   . GLU B 1 329 ? -7.733  -21.565 14.033  1.00 27.76 ? 393  GLU B O   1 
ATOM   5465 C  CB  . GLU B 1 329 ? -7.495  -18.546 14.826  1.00 37.27 ? 393  GLU B CB  1 
ATOM   5466 C  CG  . GLU B 1 329 ? -7.178  -18.153 13.379  1.00 43.10 ? 393  GLU B CG  1 
ATOM   5467 C  CD  . GLU B 1 329 ? -5.789  -17.532 13.215  1.00 46.52 ? 393  GLU B CD  1 
ATOM   5468 O  OE1 . GLU B 1 329 ? -5.353  -17.345 12.055  1.00 47.63 ? 393  GLU B OE1 1 
ATOM   5469 O  OE2 . GLU B 1 329 ? -5.129  -17.237 14.241  1.00 47.62 ? 393  GLU B OE2 1 
ATOM   5470 N  N   . LEU B 1 330 ? -9.305  -20.503 12.839  1.00 25.29 ? 394  LEU B N   1 
ATOM   5471 C  CA  . LEU B 1 330 ? -9.241  -21.444 11.728  1.00 22.95 ? 394  LEU B CA  1 
ATOM   5472 C  C   . LEU B 1 330 ? -8.450  -20.781 10.603  1.00 21.56 ? 394  LEU B C   1 
ATOM   5473 O  O   . LEU B 1 330 ? -7.807  -21.446 9.795   1.00 21.39 ? 394  LEU B O   1 
ATOM   5474 C  CB  . LEU B 1 330 ? -10.648 -21.801 11.240  1.00 23.98 ? 394  LEU B CB  1 
ATOM   5475 C  CG  . LEU B 1 330 ? -11.471 -22.701 12.170  1.00 24.26 ? 394  LEU B CG  1 
ATOM   5476 C  CD1 . LEU B 1 330 ? -12.883 -22.828 11.644  1.00 22.47 ? 394  LEU B CD1 1 
ATOM   5477 C  CD2 . LEU B 1 330 ? -10.807 -24.074 12.274  1.00 22.94 ? 394  LEU B CD2 1 
ATOM   5478 N  N   . CYS B 1 331 ? -8.519  -19.457 10.570  1.00 20.42 ? 395  CYS B N   1 
ATOM   5479 C  CA  . CYS B 1 331 ? -7.821  -18.636 9.586   1.00 21.59 ? 395  CYS B CA  1 
ATOM   5480 C  C   . CYS B 1 331 ? -8.071  -17.176 9.960   1.00 21.56 ? 395  CYS B C   1 
ATOM   5481 O  O   . CYS B 1 331 ? -8.874  -16.891 10.852  1.00 20.67 ? 395  CYS B O   1 
ATOM   5482 C  CB  . CYS B 1 331 ? -8.356  -18.903 8.179   1.00 20.77 ? 395  CYS B CB  1 
ATOM   5483 S  SG  . CYS B 1 331 ? -10.083 -18.434 7.945   1.00 23.62 ? 395  CYS B SG  1 
ATOM   5484 N  N   . SER B 1 332 ? -7.393  -16.252 9.287   1.00 20.86 ? 396  SER B N   1 
ATOM   5485 C  CA  . SER B 1 332 ? -7.589  -14.841 9.586   1.00 19.58 ? 396  SER B CA  1 
ATOM   5486 C  C   . SER B 1 332 ? -8.904  -14.397 8.977   1.00 19.78 ? 396  SER B C   1 
ATOM   5487 O  O   . SER B 1 332 ? -9.435  -15.050 8.074   1.00 19.09 ? 396  SER B O   1 
ATOM   5488 C  CB  . SER B 1 332 ? -6.464  -13.989 8.994   1.00 19.18 ? 396  SER B CB  1 
ATOM   5489 O  OG  . SER B 1 332 ? -6.590  -13.876 7.582   1.00 18.17 ? 396  SER B OG  1 
ATOM   5490 N  N   . LYS B 1 333 ? -9.429  -13.287 9.481   1.00 19.71 ? 397  LYS B N   1 
ATOM   5491 C  CA  . LYS B 1 333 ? -10.668 -12.738 8.964   1.00 19.70 ? 397  LYS B CA  1 
ATOM   5492 C  C   . LYS B 1 333 ? -10.428 -12.408 7.491   1.00 18.93 ? 397  LYS B C   1 
ATOM   5493 O  O   . LYS B 1 333 ? -11.287 -12.627 6.645   1.00 18.98 ? 397  LYS B O   1 
ATOM   5494 C  CB  . LYS B 1 333 ? -11.041 -11.468 9.737   1.00 18.63 ? 397  LYS B CB  1 
ATOM   5495 C  CG  . LYS B 1 333 ? -12.290 -10.756 9.240   1.00 19.79 ? 397  LYS B CG  1 
ATOM   5496 C  CD  . LYS B 1 333 ? -13.525 -11.603 9.447   1.00 20.29 ? 397  LYS B CD  1 
ATOM   5497 C  CE  . LYS B 1 333 ? -13.775 -11.848 10.936  1.00 23.49 ? 397  LYS B CE  1 
ATOM   5498 N  NZ  . LYS B 1 333 ? -15.041 -12.611 11.161  1.00 24.55 ? 397  LYS B NZ  1 
ATOM   5499 N  N   . GLN B 1 334 ? -9.237  -11.898 7.193   1.00 17.75 ? 398  GLN B N   1 
ATOM   5500 C  CA  . GLN B 1 334 ? -8.879  -11.528 5.830   1.00 16.97 ? 398  GLN B CA  1 
ATOM   5501 C  C   . GLN B 1 334 ? -9.003  -12.658 4.827   1.00 16.58 ? 398  GLN B C   1 
ATOM   5502 O  O   . GLN B 1 334 ? -9.330  -12.414 3.669   1.00 14.62 ? 398  GLN B O   1 
ATOM   5503 C  CB  . GLN B 1 334 ? -7.453  -10.968 5.776   1.00 16.56 ? 398  GLN B CB  1 
ATOM   5504 C  CG  . GLN B 1 334 ? -7.345  -9.532  6.263   1.00 16.28 ? 398  GLN B CG  1 
ATOM   5505 C  CD  . GLN B 1 334 ? -8.176  -8.587  5.420   1.00 17.57 ? 398  GLN B CD  1 
ATOM   5506 O  OE1 . GLN B 1 334 ? -7.690  -8.007  4.447   1.00 19.36 ? 398  GLN B OE1 1 
ATOM   5507 N  NE2 . GLN B 1 334 ? -9.443  -8.444  5.777   1.00 15.55 ? 398  GLN B NE2 1 
ATOM   5508 N  N   . LEU B 1 335 ? -8.750  -13.891 5.254   1.00 16.99 ? 399  LEU B N   1 
ATOM   5509 C  CA  . LEU B 1 335 ? -8.843  -15.004 4.322   1.00 18.99 ? 399  LEU B CA  1 
ATOM   5510 C  C   . LEU B 1 335 ? -10.282 -15.241 3.868   1.00 19.40 ? 399  LEU B C   1 
ATOM   5511 O  O   . LEU B 1 335 ? -10.509 -15.822 2.804   1.00 21.15 ? 399  LEU B O   1 
ATOM   5512 C  CB  . LEU B 1 335 ? -8.285  -16.288 4.941   1.00 18.33 ? 399  LEU B CB  1 
ATOM   5513 C  CG  . LEU B 1 335 ? -8.120  -17.425 3.923   1.00 18.82 ? 399  LEU B CG  1 
ATOM   5514 C  CD1 . LEU B 1 335 ? -7.084  -17.023 2.884   1.00 19.69 ? 399  LEU B CD1 1 
ATOM   5515 C  CD2 . LEU B 1 335 ? -7.688  -18.704 4.614   1.00 19.32 ? 399  LEU B CD2 1 
ATOM   5516 N  N   . THR B 1 336 ? -11.246 -14.782 4.668   1.00 19.12 ? 400  THR B N   1 
ATOM   5517 C  CA  . THR B 1 336 ? -12.662 -14.967 4.350   1.00 19.91 ? 400  THR B CA  1 
ATOM   5518 C  C   . THR B 1 336 ? -13.130 -14.056 3.229   1.00 19.57 ? 400  THR B C   1 
ATOM   5519 O  O   . THR B 1 336 ? -14.267 -14.156 2.779   1.00 21.70 ? 400  THR B O   1 
ATOM   5520 C  CB  . THR B 1 336 ? -13.567 -14.725 5.580   1.00 18.50 ? 400  THR B CB  1 
ATOM   5521 O  OG1 . THR B 1 336 ? -13.468 -13.354 5.991   1.00 18.51 ? 400  THR B OG1 1 
ATOM   5522 C  CG2 . THR B 1 336 ? -13.153 -15.632 6.728   1.00 15.80 ? 400  THR B CG2 1 
ATOM   5523 N  N   . LEU B 1 337 ? -12.258 -13.158 2.787   1.00 19.26 ? 401  LEU B N   1 
ATOM   5524 C  CA  . LEU B 1 337 ? -12.598 -12.261 1.694   1.00 17.89 ? 401  LEU B CA  1 
ATOM   5525 C  C   . LEU B 1 337 ? -11.645 -12.481 0.531   1.00 19.58 ? 401  LEU B C   1 
ATOM   5526 O  O   . LEU B 1 337 ? -10.436 -12.244 0.647   1.00 16.60 ? 401  LEU B O   1 
ATOM   5527 C  CB  . LEU B 1 337 ? -12.516 -10.796 2.132   1.00 18.47 ? 401  LEU B CB  1 
ATOM   5528 C  CG  . LEU B 1 337 ? -12.606 -9.796  0.967   1.00 16.75 ? 401  LEU B CG  1 
ATOM   5529 C  CD1 . LEU B 1 337 ? -13.927 -9.975  0.231   1.00 16.53 ? 401  LEU B CD1 1 
ATOM   5530 C  CD2 . LEU B 1 337 ? -12.482 -8.365  1.491   1.00 17.71 ? 401  LEU B CD2 1 
ATOM   5531 N  N   . SER B 1 338 ? -12.190 -12.942 -0.588  1.00 20.00 ? 402  SER B N   1 
ATOM   5532 C  CA  . SER B 1 338 ? -11.379 -13.170 -1.772  1.00 21.19 ? 402  SER B CA  1 
ATOM   5533 C  C   . SER B 1 338 ? -11.158 -11.839 -2.472  1.00 20.45 ? 402  SER B C   1 
ATOM   5534 O  O   . SER B 1 338 ? -11.855 -10.860 -2.186  1.00 21.21 ? 402  SER B O   1 
ATOM   5535 C  CB  . SER B 1 338 ? -12.088 -14.136 -2.721  1.00 21.37 ? 402  SER B CB  1 
ATOM   5536 O  OG  . SER B 1 338 ? -12.212 -15.412 -2.123  1.00 25.76 ? 402  SER B OG  1 
ATOM   5537 N  N   . CYS B 1 339 ? -10.185 -11.795 -3.376  1.00 19.96 ? 403  CYS B N   1 
ATOM   5538 C  CA  . CYS B 1 339 ? -9.922  -10.572 -4.118  1.00 19.70 ? 403  CYS B CA  1 
ATOM   5539 C  C   . CYS B 1 339 ? -11.209 -10.170 -4.854  1.00 19.64 ? 403  CYS B C   1 
ATOM   5540 O  O   . CYS B 1 339 ? -11.903 -11.013 -5.409  1.00 18.23 ? 403  CYS B O   1 
ATOM   5541 C  CB  . CYS B 1 339 ? -8.793  -10.792 -5.128  1.00 19.92 ? 403  CYS B CB  1 
ATOM   5542 S  SG  . CYS B 1 339 ? -7.178  -11.163 -4.390  1.00 19.99 ? 403  CYS B SG  1 
ATOM   5543 N  N   . PRO B 1 340 ? -11.539 -8.871  -4.855  1.00 20.24 ? 404  PRO B N   1 
ATOM   5544 C  CA  . PRO B 1 340 ? -12.741 -8.358  -5.522  1.00 20.57 ? 404  PRO B CA  1 
ATOM   5545 C  C   . PRO B 1 340 ? -12.853 -8.788  -6.983  1.00 20.14 ? 404  PRO B C   1 
ATOM   5546 O  O   . PRO B 1 340 ? -13.957 -8.925  -7.511  1.00 19.58 ? 404  PRO B O   1 
ATOM   5547 C  CB  . PRO B 1 340 ? -12.595 -6.846  -5.378  1.00 18.32 ? 404  PRO B CB  1 
ATOM   5548 C  CG  . PRO B 1 340 ? -11.912 -6.713  -4.059  1.00 21.26 ? 404  PRO B CG  1 
ATOM   5549 C  CD  . PRO B 1 340 ? -10.846 -7.794  -4.126  1.00 19.14 ? 404  PRO B CD  1 
ATOM   5550 N  N   . LEU B 1 341 ? -11.710 -8.996  -7.627  1.00 19.07 ? 405  LEU B N   1 
ATOM   5551 C  CA  . LEU B 1 341 ? -11.687 -9.405  -9.022  1.00 20.78 ? 405  LEU B CA  1 
ATOM   5552 C  C   . LEU B 1 341 ? -11.054 -10.784 -9.232  1.00 22.48 ? 405  LEU B C   1 
ATOM   5553 O  O   . LEU B 1 341 ? -10.525 -11.081 -10.305 1.00 22.83 ? 405  LEU B O   1 
ATOM   5554 C  CB  . LEU B 1 341 ? -10.950 -8.353  -9.855  1.00 21.93 ? 405  LEU B CB  1 
ATOM   5555 C  CG  . LEU B 1 341 ? -11.673 -7.003  -9.916  1.00 24.92 ? 405  LEU B CG  1 
ATOM   5556 C  CD1 . LEU B 1 341 ? -10.792 -5.964  -10.585 1.00 23.77 ? 405  LEU B CD1 1 
ATOM   5557 C  CD2 . LEU B 1 341 ? -12.991 -7.164  -10.671 1.00 23.47 ? 405  LEU B CD2 1 
ATOM   5558 N  N   . CYS B 1 342 ? -11.108 -11.627 -8.207  1.00 22.41 ? 406  CYS B N   1 
ATOM   5559 C  CA  . CYS B 1 342 ? -10.548 -12.969 -8.317  1.00 24.30 ? 406  CYS B CA  1 
ATOM   5560 C  C   . CYS B 1 342 ? -11.230 -13.751 -9.438  1.00 24.75 ? 406  CYS B C   1 
ATOM   5561 O  O   . CYS B 1 342 ? -12.451 -13.725 -9.555  1.00 23.85 ? 406  CYS B O   1 
ATOM   5562 C  CB  . CYS B 1 342 ? -10.732 -13.725 -6.998  1.00 24.30 ? 406  CYS B CB  1 
ATOM   5563 S  SG  . CYS B 1 342 ? -10.330 -15.476 -7.091  1.00 24.23 ? 406  CYS B SG  1 
ATOM   5564 N  N   . VAL B 1 343 ? -10.441 -14.442 -10.257 1.00 27.16 ? 407  VAL B N   1 
ATOM   5565 C  CA  . VAL B 1 343 ? -10.996 -15.246 -11.347 1.00 30.09 ? 407  VAL B CA  1 
ATOM   5566 C  C   . VAL B 1 343 ? -10.581 -16.710 -11.224 1.00 30.27 ? 407  VAL B C   1 
ATOM   5567 O  O   . VAL B 1 343 ? -10.765 -17.494 -12.150 1.00 33.32 ? 407  VAL B O   1 
ATOM   5568 C  CB  . VAL B 1 343 ? -10.551 -14.738 -12.738 1.00 30.96 ? 407  VAL B CB  1 
ATOM   5569 C  CG1 . VAL B 1 343 ? -11.103 -13.346 -12.986 1.00 29.86 ? 407  VAL B CG1 1 
ATOM   5570 C  CG2 . VAL B 1 343 ? -9.030  -14.759 -12.840 1.00 31.51 ? 407  VAL B CG2 1 
ATOM   5571 N  N   . ASN B 1 344 ? -10.012 -17.071 -10.080 1.00 29.81 ? 408  ASN B N   1 
ATOM   5572 C  CA  . ASN B 1 344 ? -9.588  -18.446 -9.836  1.00 27.91 ? 408  ASN B CA  1 
ATOM   5573 C  C   . ASN B 1 344 ? -10.639 -19.092 -8.933  1.00 25.79 ? 408  ASN B C   1 
ATOM   5574 O  O   . ASN B 1 344 ? -10.749 -18.744 -7.758  1.00 26.46 ? 408  ASN B O   1 
ATOM   5575 C  CB  . ASN B 1 344 ? -8.226  -18.456 -9.140  1.00 28.61 ? 408  ASN B CB  1 
ATOM   5576 C  CG  . ASN B 1 344 ? -7.623  -19.847 -9.051  1.00 28.94 ? 408  ASN B CG  1 
ATOM   5577 O  OD1 . ASN B 1 344 ? -8.329  -20.852 -9.140  1.00 28.56 ? 408  ASN B OD1 1 
ATOM   5578 N  ND2 . ASN B 1 344 ? -6.309  -19.909 -8.862  1.00 29.21 ? 408  ASN B ND2 1 
ATOM   5579 N  N   . PRO B 1 345 ? -11.420 -20.046 -9.467  1.00 25.22 ? 409  PRO B N   1 
ATOM   5580 C  CA  . PRO B 1 345 ? -12.467 -20.731 -8.697  1.00 23.47 ? 409  PRO B CA  1 
ATOM   5581 C  C   . PRO B 1 345 ? -12.003 -21.539 -7.492  1.00 23.73 ? 409  PRO B C   1 
ATOM   5582 O  O   . PRO B 1 345 ? -12.796 -21.829 -6.604  1.00 22.79 ? 409  PRO B O   1 
ATOM   5583 C  CB  . PRO B 1 345 ? -13.144 -21.614 -9.745  1.00 23.70 ? 409  PRO B CB  1 
ATOM   5584 C  CG  . PRO B 1 345 ? -12.012 -21.974 -10.640 1.00 25.04 ? 409  PRO B CG  1 
ATOM   5585 C  CD  . PRO B 1 345 ? -11.309 -20.629 -10.818 1.00 25.00 ? 409  PRO B CD  1 
ATOM   5586 N  N   . VAL B 1 346 ? -10.729 -21.915 -7.458  1.00 22.43 ? 410  VAL B N   1 
ATOM   5587 C  CA  . VAL B 1 346 ? -10.223 -22.700 -6.339  1.00 21.92 ? 410  VAL B CA  1 
ATOM   5588 C  C   . VAL B 1 346 ? -10.035 -21.844 -5.079  1.00 21.45 ? 410  VAL B C   1 
ATOM   5589 O  O   . VAL B 1 346 ? -9.994  -22.372 -3.966  1.00 19.05 ? 410  VAL B O   1 
ATOM   5590 C  CB  . VAL B 1 346 ? -8.873  -23.364 -6.688  1.00 23.18 ? 410  VAL B CB  1 
ATOM   5591 C  CG1 . VAL B 1 346 ? -8.426  -24.261 -5.549  1.00 23.13 ? 410  VAL B CG1 1 
ATOM   5592 C  CG2 . VAL B 1 346 ? -9.004  -24.166 -7.969  1.00 25.91 ? 410  VAL B CG2 1 
ATOM   5593 N  N   . CYS B 1 347 ? -9.927  -20.529 -5.252  1.00 20.52 ? 411  CYS B N   1 
ATOM   5594 C  CA  . CYS B 1 347 ? -9.734  -19.643 -4.103  1.00 21.77 ? 411  CYS B CA  1 
ATOM   5595 C  C   . CYS B 1 347 ? -10.872 -19.750 -3.099  1.00 21.46 ? 411  CYS B C   1 
ATOM   5596 O  O   . CYS B 1 347 ? -10.636 -19.867 -1.898  1.00 18.90 ? 411  CYS B O   1 
ATOM   5597 C  CB  . CYS B 1 347 ? -9.583  -18.186 -4.556  1.00 21.88 ? 411  CYS B CB  1 
ATOM   5598 S  SG  . CYS B 1 347 ? -8.085  -17.869 -5.538  1.00 25.77 ? 411  CYS B SG  1 
ATOM   5599 N  N   . ARG B 1 348 ? -12.103 -19.713 -3.597  1.00 21.68 ? 412  ARG B N   1 
ATOM   5600 C  CA  . ARG B 1 348 ? -13.281 -19.802 -2.744  1.00 22.96 ? 412  ARG B CA  1 
ATOM   5601 C  C   . ARG B 1 348 ? -13.375 -21.180 -2.093  1.00 23.95 ? 412  ARG B C   1 
ATOM   5602 O  O   . ARG B 1 348 ? -13.777 -21.305 -0.938  1.00 23.61 ? 412  ARG B O   1 
ATOM   5603 C  CB  . ARG B 1 348 ? -14.542 -19.542 -3.565  1.00 25.19 ? 412  ARG B CB  1 
ATOM   5604 C  CG  . ARG B 1 348 ? -15.810 -19.483 -2.743  1.00 30.00 ? 412  ARG B CG  1 
ATOM   5605 C  CD  . ARG B 1 348 ? -17.031 -19.505 -3.639  1.00 33.68 ? 412  ARG B CD  1 
ATOM   5606 N  NE  . ARG B 1 348 ? -17.148 -20.783 -4.337  1.00 38.67 ? 412  ARG B NE  1 
ATOM   5607 C  CZ  . ARG B 1 348 ? -17.407 -21.943 -3.738  1.00 40.65 ? 412  ARG B CZ  1 
ATOM   5608 N  NH1 . ARG B 1 348 ? -17.583 -21.994 -2.423  1.00 42.63 ? 412  ARG B NH1 1 
ATOM   5609 N  NH2 . ARG B 1 348 ? -17.486 -23.057 -4.454  1.00 41.45 ? 412  ARG B NH2 1 
ATOM   5610 N  N   . GLU B 1 349 ? -13.012 -22.214 -2.845  1.00 23.89 ? 413  GLU B N   1 
ATOM   5611 C  CA  . GLU B 1 349 ? -13.048 -23.584 -2.337  1.00 23.59 ? 413  GLU B CA  1 
ATOM   5612 C  C   . GLU B 1 349 ? -11.989 -23.762 -1.251  1.00 22.42 ? 413  GLU B C   1 
ATOM   5613 O  O   . GLU B 1 349 ? -12.208 -24.457 -0.253  1.00 21.22 ? 413  GLU B O   1 
ATOM   5614 C  CB  . GLU B 1 349 ? -12.791 -24.569 -3.479  1.00 26.00 ? 413  GLU B CB  1 
ATOM   5615 C  CG  . GLU B 1 349 ? -13.819 -24.489 -4.602  1.00 31.80 ? 413  GLU B CG  1 
ATOM   5616 C  CD  . GLU B 1 349 ? -13.447 -25.342 -5.809  1.00 36.98 ? 413  GLU B CD  1 
ATOM   5617 O  OE1 . GLU B 1 349 ? -13.369 -26.581 -5.670  1.00 40.39 ? 413  GLU B OE1 1 
ATOM   5618 O  OE2 . GLU B 1 349 ? -13.233 -24.772 -6.903  1.00 40.29 ? 413  GLU B OE2 1 
ATOM   5619 N  N   . THR B 1 350 ? -10.840 -23.125 -1.449  1.00 20.30 ? 414  THR B N   1 
ATOM   5620 C  CA  . THR B 1 350 ? -9.755  -23.208 -0.484  1.00 20.01 ? 414  THR B CA  1 
ATOM   5621 C  C   . THR B 1 350 ? -10.147 -22.486 0.803   1.00 21.26 ? 414  THR B C   1 
ATOM   5622 O  O   . THR B 1 350 ? -9.907  -22.983 1.906   1.00 19.22 ? 414  THR B O   1 
ATOM   5623 C  CB  . THR B 1 350 ? -8.475  -22.590 -1.054  1.00 19.96 ? 414  THR B CB  1 
ATOM   5624 O  OG1 . THR B 1 350 ? -8.064  -23.338 -2.207  1.00 19.49 ? 414  THR B OG1 1 
ATOM   5625 C  CG2 . THR B 1 350 ? -7.372  -22.607 -0.018  1.00 18.59 ? 414  THR B CG2 1 
ATOM   5626 N  N   . LYS B 1 351 ? -10.752 -21.313 0.651   1.00 22.13 ? 415  LYS B N   1 
ATOM   5627 C  CA  . LYS B 1 351 ? -11.204 -20.526 1.788   1.00 24.29 ? 415  LYS B CA  1 
ATOM   5628 C  C   . LYS B 1 351 ? -12.180 -21.367 2.600   1.00 24.21 ? 415  LYS B C   1 
ATOM   5629 O  O   . LYS B 1 351 ? -12.037 -21.508 3.818   1.00 24.73 ? 415  LYS B O   1 
ATOM   5630 C  CB  . LYS B 1 351 ? -11.909 -19.247 1.305   1.00 27.72 ? 415  LYS B CB  1 
ATOM   5631 C  CG  . LYS B 1 351 ? -12.618 -18.468 2.408   1.00 30.21 ? 415  LYS B CG  1 
ATOM   5632 C  CD  . LYS B 1 351 ? -13.205 -17.151 1.899   1.00 35.74 ? 415  LYS B CD  1 
ATOM   5633 C  CE  . LYS B 1 351 ? -14.554 -17.326 1.207   1.00 36.25 ? 415  LYS B CE  1 
ATOM   5634 N  NZ  . LYS B 1 351 ? -14.470 -18.230 0.031   1.00 40.06 ? 415  LYS B NZ  1 
ATOM   5635 N  N   . SER B 1 352 ? -13.165 -21.929 1.907   1.00 23.00 ? 416  SER B N   1 
ATOM   5636 C  CA  . SER B 1 352 ? -14.184 -22.754 2.535   1.00 23.68 ? 416  SER B CA  1 
ATOM   5637 C  C   . SER B 1 352 ? -13.597 -23.967 3.239   1.00 21.52 ? 416  SER B C   1 
ATOM   5638 O  O   . SER B 1 352 ? -14.101 -24.390 4.274   1.00 20.62 ? 416  SER B O   1 
ATOM   5639 C  CB  . SER B 1 352 ? -15.203 -23.215 1.494   1.00 25.74 ? 416  SER B CB  1 
ATOM   5640 O  OG  . SER B 1 352 ? -16.119 -24.130 2.072   1.00 31.84 ? 416  SER B OG  1 
ATOM   5641 N  N   . PHE B 1 353 ? -12.529 -24.520 2.676   1.00 21.20 ? 417  PHE B N   1 
ATOM   5642 C  CA  . PHE B 1 353 ? -11.878 -25.681 3.264   1.00 19.63 ? 417  PHE B CA  1 
ATOM   5643 C  C   . PHE B 1 353 ? -11.454 -25.370 4.692   1.00 20.26 ? 417  PHE B C   1 
ATOM   5644 O  O   . PHE B 1 353 ? -11.658 -26.175 5.595   1.00 18.72 ? 417  PHE B O   1 
ATOM   5645 C  CB  . PHE B 1 353 ? -10.639 -26.072 2.453   1.00 21.19 ? 417  PHE B CB  1 
ATOM   5646 C  CG  . PHE B 1 353 ? -9.883  -27.242 3.023   1.00 20.97 ? 417  PHE B CG  1 
ATOM   5647 C  CD1 . PHE B 1 353 ? -10.364 -28.542 2.874   1.00 22.74 ? 417  PHE B CD1 1 
ATOM   5648 C  CD2 . PHE B 1 353 ? -8.694  -27.046 3.715   1.00 20.18 ? 417  PHE B CD2 1 
ATOM   5649 C  CE1 . PHE B 1 353 ? -9.669  -29.627 3.404   1.00 21.31 ? 417  PHE B CE1 1 
ATOM   5650 C  CE2 . PHE B 1 353 ? -7.988  -28.126 4.253   1.00 19.07 ? 417  PHE B CE2 1 
ATOM   5651 C  CZ  . PHE B 1 353 ? -8.479  -29.420 4.096   1.00 20.56 ? 417  PHE B CZ  1 
ATOM   5652 N  N   . PHE B 1 354 ? -10.866 -24.197 4.898   1.00 19.46 ? 418  PHE B N   1 
ATOM   5653 C  CA  . PHE B 1 354 ? -10.413 -23.831 6.231   1.00 20.02 ? 418  PHE B CA  1 
ATOM   5654 C  C   . PHE B 1 354 ? -11.498 -23.289 7.155   1.00 20.22 ? 418  PHE B C   1 
ATOM   5655 O  O   . PHE B 1 354 ? -11.523 -23.627 8.336   1.00 21.79 ? 418  PHE B O   1 
ATOM   5656 C  CB  . PHE B 1 354 ? -9.243  -22.837 6.150   1.00 19.26 ? 418  PHE B CB  1 
ATOM   5657 C  CG  . PHE B 1 354 ? -7.979  -23.445 5.598   1.00 19.68 ? 418  PHE B CG  1 
ATOM   5658 C  CD1 . PHE B 1 354 ? -7.650  -23.306 4.251   1.00 17.96 ? 418  PHE B CD1 1 
ATOM   5659 C  CD2 . PHE B 1 354 ? -7.145  -24.212 6.419   1.00 18.96 ? 418  PHE B CD2 1 
ATOM   5660 C  CE1 . PHE B 1 354 ? -6.516  -23.924 3.727   1.00 20.20 ? 418  PHE B CE1 1 
ATOM   5661 C  CE2 . PHE B 1 354 ? -6.008  -24.836 5.908   1.00 18.44 ? 418  PHE B CE2 1 
ATOM   5662 C  CZ  . PHE B 1 354 ? -5.690  -24.694 4.558   1.00 20.00 ? 418  PHE B CZ  1 
ATOM   5663 N  N   . THR B 1 355 ? -12.408 -22.477 6.630   1.00 19.51 ? 419  THR B N   1 
ATOM   5664 C  CA  . THR B 1 355 ? -13.452 -21.902 7.476   1.00 21.74 ? 419  THR B CA  1 
ATOM   5665 C  C   . THR B 1 355 ? -14.498 -22.919 7.916   1.00 20.34 ? 419  THR B C   1 
ATOM   5666 O  O   . THR B 1 355 ? -15.175 -22.714 8.915   1.00 21.35 ? 419  THR B O   1 
ATOM   5667 C  CB  . THR B 1 355 ? -14.178 -20.738 6.765   1.00 19.60 ? 419  THR B CB  1 
ATOM   5668 O  OG1 . THR B 1 355 ? -14.877 -21.243 5.627   1.00 20.39 ? 419  THR B OG1 1 
ATOM   5669 C  CG2 . THR B 1 355 ? -13.182 -19.681 6.309   1.00 20.08 ? 419  THR B CG2 1 
ATOM   5670 N  N   . SER B 1 356 ? -14.617 -24.013 7.171   1.00 21.75 ? 420  SER B N   1 
ATOM   5671 C  CA  . SER B 1 356 ? -15.589 -25.066 7.458   1.00 22.36 ? 420  SER B CA  1 
ATOM   5672 C  C   . SER B 1 356 ? -15.053 -26.198 8.321   1.00 22.07 ? 420  SER B C   1 
ATOM   5673 O  O   . SER B 1 356 ? -15.789 -27.126 8.667   1.00 18.88 ? 420  SER B O   1 
ATOM   5674 C  CB  . SER B 1 356 ? -16.100 -25.662 6.152   1.00 21.75 ? 420  SER B CB  1 
ATOM   5675 O  OG  . SER B 1 356 ? -16.792 -24.688 5.396   1.00 28.50 ? 420  SER B OG  1 
ATOM   5676 N  N   . GLN B 1 357 ? -13.775 -26.117 8.664   1.00 24.50 ? 421  GLN B N   1 
ATOM   5677 C  CA  . GLN B 1 357 ? -13.123 -27.148 9.462   1.00 28.76 ? 421  GLN B CA  1 
ATOM   5678 C  C   . GLN B 1 357 ? -13.864 -27.459 10.759  1.00 30.82 ? 421  GLN B C   1 
ATOM   5679 O  O   . GLN B 1 357 ? -14.298 -26.560 11.479  1.00 30.90 ? 421  GLN B O   1 
ATOM   5680 C  CB  . GLN B 1 357 ? -11.689 -26.713 9.769   1.00 29.09 ? 421  GLN B CB  1 
ATOM   5681 C  CG  . GLN B 1 357 ? -10.697 -27.844 9.903   1.00 31.21 ? 421  GLN B CG  1 
ATOM   5682 C  CD  . GLN B 1 357 ? -10.600 -28.707 8.656   1.00 31.21 ? 421  GLN B CD  1 
ATOM   5683 O  OE1 . GLN B 1 357 ? -10.712 -28.222 7.531   1.00 29.03 ? 421  GLN B OE1 1 
ATOM   5684 N  NE2 . GLN B 1 357 ? -10.371 -29.996 8.857   1.00 31.83 ? 421  GLN B NE2 1 
ATOM   5685 N  N   . GLN B 1 358 ? -14.006 -28.745 11.053  1.00 34.83 ? 422  GLN B N   1 
ATOM   5686 C  CA  . GLN B 1 358 ? -14.688 -29.175 12.267  1.00 38.62 ? 422  GLN B CA  1 
ATOM   5687 C  C   . GLN B 1 358 ? -13.855 -28.843 13.501  1.00 40.89 ? 422  GLN B C   1 
ATOM   5688 O  O   . GLN B 1 358 ? -12.628 -28.751 13.429  1.00 40.54 ? 422  GLN B O   1 
ATOM   5689 C  CB  . GLN B 1 358 ? -14.959 -30.684 12.220  1.00 39.20 ? 422  GLN B CB  1 
ATOM   5690 C  CG  . GLN B 1 358 ? -15.615 -31.236 13.478  1.00 39.78 ? 422  GLN B CG  1 
ATOM   5691 C  CD  . GLN B 1 358 ? -15.923 -32.718 13.377  1.00 40.59 ? 422  GLN B CD  1 
ATOM   5692 O  OE1 . GLN B 1 358 ? -15.039 -33.531 13.102  1.00 40.25 ? 422  GLN B OE1 1 
ATOM   5693 N  NE2 . GLN B 1 358 ? -17.184 -33.078 13.603  1.00 41.29 ? 422  GLN B NE2 1 
ATOM   5694 N  N   . LEU B 1 359 ? -14.542 -28.661 14.627  1.00 44.24 ? 423  LEU B N   1 
ATOM   5695 C  CA  . LEU B 1 359 ? -13.908 -28.347 15.905  1.00 46.42 ? 423  LEU B CA  1 
ATOM   5696 C  C   . LEU B 1 359 ? -13.274 -26.962 15.847  1.00 47.25 ? 423  LEU B C   1 
ATOM   5697 O  O   . LEU B 1 359 ? -13.795 -26.049 16.527  1.00 47.75 ? 423  LEU B O   1 
ATOM   5698 C  CB  . LEU B 1 359 ? -12.849 -29.411 16.242  1.00 47.49 ? 423  LEU B CB  1 
ATOM   5699 C  CG  . LEU B 1 359 ? -12.240 -29.510 17.650  1.00 49.16 ? 423  LEU B CG  1 
ATOM   5700 C  CD1 . LEU B 1 359 ? -11.413 -28.269 17.960  1.00 48.33 ? 423  LEU B CD1 1 
ATOM   5701 C  CD2 . LEU B 1 359 ? -13.352 -29.701 18.676  1.00 49.05 ? 423  LEU B CD2 1 
ATOM   5702 O  OXT . LEU B 1 359 ? -12.273 -26.805 15.116  1.00 48.00 ? 423  LEU B OXT 1 
HETATM 5703 FE FE1 . FES C 2 .   ? 10.086  15.409  -6.004  1.00 26.46 ? 499  FES A FE1 1 
HETATM 5704 FE FE2 . FES C 2 .   ? 8.645   13.408  -4.878  1.00 23.95 ? 499  FES A FE2 1 
HETATM 5705 S  S1  . FES C 2 .   ? 10.260  14.621  -3.920  1.00 19.87 ? 499  FES A S1  1 
HETATM 5706 S  S2  . FES C 2 .   ? 8.458   14.202  -6.983  1.00 21.46 ? 499  FES A S2  1 
HETATM 5707 C  C1  . CHD D 3 .   ? -10.492 15.917  -13.598 1.00 36.58 ? 501  CHD A C1  1 
HETATM 5708 C  C2  . CHD D 3 .   ? -11.285 14.804  -12.935 1.00 36.23 ? 501  CHD A C2  1 
HETATM 5709 C  C3  . CHD D 3 .   ? -12.280 15.456  -11.977 1.00 36.68 ? 501  CHD A C3  1 
HETATM 5710 O  O3  . CHD D 3 .   ? -13.054 14.439  -11.343 1.00 37.78 ? 501  CHD A O3  1 
HETATM 5711 C  C4  . CHD D 3 .   ? -11.526 16.308  -10.965 1.00 36.60 ? 501  CHD A C4  1 
HETATM 5712 C  C5  . CHD D 3 .   ? -10.658 17.408  -11.617 1.00 36.78 ? 501  CHD A C5  1 
HETATM 5713 C  C6  . CHD D 3 .   ? -9.905  18.265  -10.580 1.00 36.91 ? 501  CHD A C6  1 
HETATM 5714 C  C7  . CHD D 3 .   ? -8.805  17.503  -9.835  1.00 39.02 ? 501  CHD A C7  1 
HETATM 5715 O  O7  . CHD D 3 .   ? -9.383  16.578  -8.964  1.00 38.58 ? 501  CHD A O7  1 
HETATM 5716 C  C8  . CHD D 3 .   ? -7.832  16.840  -10.861 1.00 38.29 ? 501  CHD A C8  1 
HETATM 5717 C  C9  . CHD D 3 .   ? -8.600  15.939  -11.840 1.00 37.72 ? 501  CHD A C9  1 
HETATM 5718 C  C10 . CHD D 3 .   ? -9.669  16.766  -12.615 1.00 37.11 ? 501  CHD A C10 1 
HETATM 5719 C  C11 . CHD D 3 .   ? -7.589  15.280  -12.787 1.00 38.77 ? 501  CHD A C11 1 
HETATM 5720 C  C12 . CHD D 3 .   ? -6.493  14.449  -12.040 1.00 39.94 ? 501  CHD A C12 1 
HETATM 5721 O  O12 . CHD D 3 .   ? -7.074  13.367  -11.376 1.00 41.24 ? 501  CHD A O12 1 
HETATM 5722 C  C13 . CHD D 3 .   ? -5.728  15.383  -11.099 1.00 39.73 ? 501  CHD A C13 1 
HETATM 5723 C  C14 . CHD D 3 .   ? -6.743  16.045  -10.140 1.00 39.36 ? 501  CHD A C14 1 
HETATM 5724 C  C15 . CHD D 3 .   ? -5.860  16.779  -9.115  1.00 41.24 ? 501  CHD A C15 1 
HETATM 5725 C  C16 . CHD D 3 .   ? -4.569  15.918  -9.057  1.00 41.78 ? 501  CHD A C16 1 
HETATM 5726 C  C17 . CHD D 3 .   ? -4.761  14.759  -10.060 1.00 40.53 ? 501  CHD A C17 1 
HETATM 5727 C  C18 . CHD D 3 .   ? -4.977  16.420  -11.939 1.00 39.89 ? 501  CHD A C18 1 
HETATM 5728 C  C19 . CHD D 3 .   ? -8.987  17.859  -13.477 1.00 37.64 ? 501  CHD A C19 1 
HETATM 5729 C  C20 . CHD D 3 .   ? -3.413  14.300  -10.627 1.00 42.06 ? 501  CHD A C20 1 
HETATM 5730 C  C21 . CHD D 3 .   ? -3.583  13.199  -11.627 1.00 42.65 ? 501  CHD A C21 1 
HETATM 5731 C  C22 . CHD D 3 .   ? -2.498  13.767  -9.531  1.00 42.27 ? 501  CHD A C22 1 
HETATM 5732 C  C23 . CHD D 3 .   ? -1.154  13.337  -10.111 1.00 45.34 ? 501  CHD A C23 1 
HETATM 5733 O  O25 . CHD D 3 .   ? -0.322  11.696  -8.595  1.00 51.86 ? 501  CHD A O25 1 
HETATM 5734 C  C24 . CHD D 3 .   ? -0.162  12.802  -9.119  1.00 49.24 ? 501  CHD A C24 1 
HETATM 5735 O  O26 . CHD D 3 .   ? 0.824   13.580  -8.894  1.00 51.55 ? 501  CHD A O26 1 
HETATM 5736 C  C1  . CHD E 3 .   ? -2.037  11.484  -15.320 1.00 40.86 ? 502  CHD A C1  1 
HETATM 5737 C  C2  . CHD E 3 .   ? -1.716  10.529  -16.455 1.00 41.60 ? 502  CHD A C2  1 
HETATM 5738 C  C3  . CHD E 3 .   ? -0.325  10.887  -16.980 1.00 42.18 ? 502  CHD A C3  1 
HETATM 5739 O  O3  . CHD E 3 .   ? 0.019   9.997   -18.048 1.00 44.75 ? 502  CHD A O3  1 
HETATM 5740 C  C4  . CHD E 3 .   ? -0.313  12.340  -17.429 1.00 41.29 ? 502  CHD A C4  1 
HETATM 5741 C  C5  . CHD E 3 .   ? -0.703  13.328  -16.307 1.00 40.62 ? 502  CHD A C5  1 
HETATM 5742 C  C6  . CHD E 3 .   ? -0.681  14.794  -16.774 1.00 40.29 ? 502  CHD A C6  1 
HETATM 5743 C  C7  . CHD E 3 .   ? -1.782  15.136  -17.780 1.00 40.84 ? 502  CHD A C7  1 
HETATM 5744 O  O7  . CHD E 3 .   ? -1.511  14.495  -18.994 1.00 40.09 ? 502  CHD A O7  1 
HETATM 5745 C  C8  . CHD E 3 .   ? -3.175  14.747  -17.188 1.00 40.91 ? 502  CHD A C8  1 
HETATM 5746 C  C9  . CHD E 3 .   ? -3.199  13.261  -16.801 1.00 40.38 ? 502  CHD A C9  1 
HETATM 5747 C  C10 . CHD E 3 .   ? -2.092  12.963  -15.743 1.00 40.77 ? 502  CHD A C10 1 
HETATM 5748 C  C11 . CHD E 3 .   ? -4.601  12.922  -16.272 1.00 40.44 ? 502  CHD A C11 1 
HETATM 5749 C  C12 . CHD E 3 .   ? -5.753  13.223  -17.295 1.00 41.33 ? 502  CHD A C12 1 
HETATM 5750 O  O12 . CHD E 3 .   ? -5.642  12.386  -18.410 1.00 42.28 ? 502  CHD A O12 1 
HETATM 5751 C  C13 . CHD E 3 .   ? -5.717  14.712  -17.663 1.00 41.03 ? 502  CHD A C13 1 
HETATM 5752 C  C14 . CHD E 3 .   ? -4.294  15.054  -18.182 1.00 41.05 ? 502  CHD A C14 1 
HETATM 5753 C  C15 . CHD E 3 .   ? -4.427  16.505  -18.684 1.00 41.63 ? 502  CHD A C15 1 
HETATM 5754 C  C16 . CHD E 3 .   ? -5.902  16.587  -19.161 1.00 42.45 ? 502  CHD A C16 1 
HETATM 5755 C  C17 . CHD E 3 .   ? -6.523  15.198  -18.890 1.00 42.85 ? 502  CHD A C17 1 
HETATM 5756 C  C18 . CHD E 3 .   ? -6.095  15.542  -16.438 1.00 41.17 ? 502  CHD A C18 1 
HETATM 5757 C  C19 . CHD E 3 .   ? -2.374  13.763  -14.449 1.00 40.91 ? 502  CHD A C19 1 
HETATM 5758 C  C20 . CHD E 3 .   ? -8.048  15.314  -18.739 1.00 45.36 ? 502  CHD A C20 1 
HETATM 5759 C  C21 . CHD E 3 .   ? -8.704  13.996  -18.433 1.00 46.86 ? 502  CHD A C21 1 
HETATM 5760 C  C22 . CHD E 3 .   ? -8.631  15.848  -20.047 1.00 47.52 ? 502  CHD A C22 1 
HETATM 5761 C  C23 . CHD E 3 .   ? -10.146 16.012  -20.022 1.00 51.17 ? 502  CHD A C23 1 
HETATM 5762 O  O25 . CHD E 3 .   ? -10.021 17.162  -22.122 1.00 53.47 ? 502  CHD A O25 1 
HETATM 5763 C  C24 . CHD E 3 .   ? -10.729 16.541  -21.313 1.00 52.39 ? 502  CHD A C24 1 
HETATM 5764 O  O26 . CHD E 3 .   ? -11.970 16.292  -21.472 1.00 53.48 ? 502  CHD A O26 1 
HETATM 5765 C  C1  . CHD F 3 .   ? -7.110  17.878  -27.958 1.00 47.44 ? 503  CHD A C1  1 
HETATM 5766 C  C2  . CHD F 3 .   ? -7.668  16.483  -28.185 1.00 47.76 ? 503  CHD A C2  1 
HETATM 5767 C  C3  . CHD F 3 .   ? -8.990  16.372  -27.432 1.00 48.43 ? 503  CHD A C3  1 
HETATM 5768 O  O3  . CHD F 3 .   ? -9.536  15.065  -27.637 1.00 48.58 ? 503  CHD A O3  1 
HETATM 5769 C  C4  . CHD F 3 .   ? -8.762  16.672  -25.958 1.00 48.42 ? 503  CHD A C4  1 
HETATM 5770 C  C5  . CHD F 3 .   ? -8.148  18.070  -25.710 1.00 48.07 ? 503  CHD A C5  1 
HETATM 5771 C  C6  . CHD F 3 .   ? -7.931  18.354  -24.211 1.00 48.47 ? 503  CHD A C6  1 
HETATM 5772 C  C7  . CHD F 3 .   ? -6.883  17.441  -23.581 1.00 48.86 ? 503  CHD A C7  1 
HETATM 5773 O  O7  . CHD F 3 .   ? -7.383  16.139  -23.518 1.00 49.21 ? 503  CHD A O7  1 
HETATM 5774 C  C8  . CHD F 3 .   ? -5.548  17.540  -24.386 1.00 48.31 ? 503  CHD A C8  1 
HETATM 5775 C  C9  . CHD F 3 .   ? -5.781  17.212  -25.869 1.00 47.52 ? 503  CHD A C9  1 
HETATM 5776 C  C10 . CHD F 3 .   ? -6.816  18.185  -26.481 1.00 47.81 ? 503  CHD A C10 1 
HETATM 5777 C  C11 . CHD F 3 .   ? -4.435  17.282  -26.598 1.00 47.94 ? 503  CHD A C11 1 
HETATM 5778 C  C12 . CHD F 3 .   ? -3.365  16.306  -26.008 1.00 48.77 ? 503  CHD A C12 1 
HETATM 5779 O  O12 . CHD F 3 .   ? -3.784  14.986  -26.193 1.00 47.95 ? 503  CHD A O12 1 
HETATM 5780 C  C13 . CHD F 3 .   ? -3.128  16.649  -24.532 1.00 48.65 ? 503  CHD A C13 1 
HETATM 5781 C  C14 . CHD F 3 .   ? -4.495  16.605  -23.803 1.00 48.49 ? 503  CHD A C14 1 
HETATM 5782 C  C15 . CHD F 3 .   ? -4.123  16.775  -22.317 1.00 48.89 ? 503  CHD A C15 1 
HETATM 5783 C  C16 . CHD F 3 .   ? -2.722  16.115  -22.217 1.00 49.13 ? 503  CHD A C16 1 
HETATM 5784 C  C17 . CHD F 3 .   ? -2.374  15.633  -23.641 1.00 49.30 ? 503  CHD A C17 1 
HETATM 5785 C  C18 . CHD F 3 .   ? -2.465  18.028  -24.433 1.00 48.60 ? 503  CHD A C18 1 
HETATM 5786 C  C19 . CHD F 3 .   ? -6.293  19.647  -26.443 1.00 47.45 ? 503  CHD A C19 1 
HETATM 5787 C  C20 . CHD F 3 .   ? -0.852  15.524  -23.817 1.00 50.44 ? 503  CHD A C20 1 
HETATM 5788 C  C21 . CHD F 3 .   ? -0.465  15.093  -25.205 1.00 50.62 ? 503  CHD A C21 1 
HETATM 5789 C  C22 . CHD F 3 .   ? -0.323  14.494  -22.816 1.00 52.14 ? 503  CHD A C22 1 
HETATM 5790 C  C23 . CHD F 3 .   ? 1.185   14.278  -22.867 1.00 52.91 ? 503  CHD A C23 1 
HETATM 5791 O  O25 . CHD F 3 .   ? 2.050   13.596  -20.735 1.00 54.45 ? 503  CHD A O25 1 
HETATM 5792 C  C24 . CHD F 3 .   ? 1.681   13.255  -21.868 1.00 53.75 ? 503  CHD A C24 1 
HETATM 5793 O  O26 . CHD F 3 .   ? 1.672   12.055  -22.297 1.00 53.62 ? 503  CHD A O26 1 
HETATM 5794 FE FE1 . FES G 2 .   ? -6.871  -13.452 -4.679  1.00 23.65 ? 999  FES B FE1 1 
HETATM 5795 FE FE2 . FES G 2 .   ? -8.300  -15.475 -5.785  1.00 22.21 ? 999  FES B FE2 1 
HETATM 5796 S  S1  . FES G 2 .   ? -8.496  -14.654 -3.722  1.00 19.14 ? 999  FES B S1  1 
HETATM 5797 S  S2  . FES G 2 .   ? -6.674  -14.279 -6.768  1.00 23.30 ? 999  FES B S2  1 
HETATM 5798 C  C1  . CHD H 3 .   ? 12.503  -15.867 -13.648 1.00 39.90 ? 501  CHD B C1  1 
HETATM 5799 C  C2  . CHD H 3 .   ? 13.230  -14.725 -12.962 1.00 39.69 ? 501  CHD B C2  1 
HETATM 5800 C  C3  . CHD H 3 .   ? 14.205  -15.334 -11.954 1.00 40.10 ? 501  CHD B C3  1 
HETATM 5801 O  O3  . CHD H 3 .   ? 14.916  -14.288 -11.295 1.00 39.84 ? 501  CHD B O3  1 
HETATM 5802 C  C4  . CHD H 3 .   ? 13.441  -16.204 -10.967 1.00 39.70 ? 501  CHD B C4  1 
HETATM 5803 C  C5  . CHD H 3 .   ? 12.644  -17.338 -11.644 1.00 39.43 ? 501  CHD B C5  1 
HETATM 5804 C  C6  . CHD H 3 .   ? 11.885  -18.212 -10.629 1.00 39.55 ? 501  CHD B C6  1 
HETATM 5805 C  C7  . CHD H 3 .   ? 10.728  -17.487 -9.935  1.00 40.88 ? 501  CHD B C7  1 
HETATM 5806 O  O7  . CHD H 3 .   ? 11.228  -16.533 -9.046  1.00 40.09 ? 501  CHD B O7  1 
HETATM 5807 C  C8  . CHD H 3 .   ? 9.775   -16.872 -11.004 1.00 40.83 ? 501  CHD B C8  1 
HETATM 5808 C  C9  . CHD H 3 .   ? 10.543  -15.949 -11.964 1.00 40.76 ? 501  CHD B C9  1 
HETATM 5809 C  C10 . CHD H 3 .   ? 11.672  -16.740 -12.689 1.00 40.32 ? 501  CHD B C10 1 
HETATM 5810 C  C11 . CHD H 3 .   ? 9.541   -15.338 -12.957 1.00 40.82 ? 501  CHD B C11 1 
HETATM 5811 C  C12 . CHD H 3 .   ? 8.386   -14.544 -12.260 1.00 42.59 ? 501  CHD B C12 1 
HETATM 5812 O  O12 . CHD H 3 .   ? 8.904   -13.430 -11.593 1.00 43.58 ? 501  CHD B O12 1 
HETATM 5813 C  C13 . CHD H 3 .   ? 7.627   -15.501 -11.330 1.00 41.99 ? 501  CHD B C13 1 
HETATM 5814 C  C14 . CHD H 3 .   ? 8.634   -16.118 -10.331 1.00 41.87 ? 501  CHD B C14 1 
HETATM 5815 C  C15 . CHD H 3 .   ? 7.753   -16.884 -9.330  1.00 43.74 ? 501  CHD B C15 1 
HETATM 5816 C  C16 . CHD H 3 .   ? 6.430   -16.078 -9.318  1.00 44.44 ? 501  CHD B C16 1 
HETATM 5817 C  C17 . CHD H 3 .   ? 6.606   -14.917 -10.321 1.00 43.09 ? 501  CHD B C17 1 
HETATM 5818 C  C18 . CHD H 3 .   ? 6.946   -16.574 -12.182 1.00 42.01 ? 501  CHD B C18 1 
HETATM 5819 C  C19 . CHD H 3 .   ? 11.062  -17.862 -13.573 1.00 41.00 ? 501  CHD B C19 1 
HETATM 5820 C  C20 . CHD H 3 .   ? 5.256   -14.518 -10.921 1.00 44.28 ? 501  CHD B C20 1 
HETATM 5821 C  C21 . CHD H 3 .   ? 5.402   -13.409 -11.916 1.00 44.21 ? 501  CHD B C21 1 
HETATM 5822 C  C22 . CHD H 3 .   ? 4.296   -14.037 -9.837  1.00 44.11 ? 501  CHD B C22 1 
HETATM 5823 C  C23 . CHD H 3 .   ? 2.941   -13.662 -10.429 1.00 46.31 ? 501  CHD B C23 1 
HETATM 5824 O  O25 . CHD H 3 .   ? 2.238   -12.505 -8.466  1.00 50.64 ? 501  CHD B O25 1 
HETATM 5825 C  C24 . CHD H 3 .   ? 1.919   -13.203 -9.433  1.00 48.40 ? 501  CHD B C24 1 
HETATM 5826 O  O26 . CHD H 3 .   ? 0.738   -13.606 -9.685  1.00 49.55 ? 501  CHD B O26 1 
HETATM 5827 C  C1  . CHD I 3 .   ? 3.401   -11.338 -15.432 1.00 46.08 ? 502  CHD B C1  1 
HETATM 5828 C  C2  . CHD I 3 .   ? 3.099   -10.425 -16.607 1.00 47.74 ? 502  CHD B C2  1 
HETATM 5829 C  C3  . CHD I 3 .   ? 1.715   -10.800 -17.136 1.00 48.53 ? 502  CHD B C3  1 
HETATM 5830 O  O3  . CHD I 3 .   ? 1.390   -9.954  -18.240 1.00 51.57 ? 502  CHD B O3  1 
HETATM 5831 C  C4  . CHD I 3 .   ? 1.702   -12.269 -17.530 1.00 47.16 ? 502  CHD B C4  1 
HETATM 5832 C  C5  . CHD I 3 .   ? 2.071   -13.215 -16.367 1.00 45.84 ? 502  CHD B C5  1 
HETATM 5833 C  C6  . CHD I 3 .   ? 2.047   -14.701 -16.780 1.00 45.04 ? 502  CHD B C6  1 
HETATM 5834 C  C7  . CHD I 3 .   ? 3.157   -15.081 -17.760 1.00 44.13 ? 502  CHD B C7  1 
HETATM 5835 O  O7  . CHD I 3 .   ? 2.897   -14.500 -19.003 1.00 43.08 ? 502  CHD B O7  1 
HETATM 5836 C  C8  . CHD I 3 .   ? 4.545   -14.663 -17.181 1.00 44.16 ? 502  CHD B C8  1 
HETATM 5837 C  C9  . CHD I 3 .   ? 4.569   -13.167 -16.849 1.00 44.37 ? 502  CHD B C9  1 
HETATM 5838 C  C10 . CHD I 3 .   ? 3.457   -12.833 -15.803 1.00 45.72 ? 502  CHD B C10 1 
HETATM 5839 C  C11 . CHD I 3 .   ? 5.973   -12.813 -16.333 1.00 44.02 ? 502  CHD B C11 1 
HETATM 5840 C  C12 . CHD I 3 .   ? 7.128   -13.141 -17.349 1.00 44.66 ? 502  CHD B C12 1 
HETATM 5841 O  O12 . CHD I 3 .   ? 7.021   -12.323 -18.476 1.00 45.40 ? 502  CHD B O12 1 
HETATM 5842 C  C13 . CHD I 3 .   ? 7.091   -14.642 -17.688 1.00 44.04 ? 502  CHD B C13 1 
HETATM 5843 C  C14 . CHD I 3 .   ? 5.655   -15.003 -18.165 1.00 44.20 ? 502  CHD B C14 1 
HETATM 5844 C  C15 . CHD I 3 .   ? 5.775   -16.472 -18.611 1.00 44.56 ? 502  CHD B C15 1 
HETATM 5845 C  C16 . CHD I 3 .   ? 7.229   -16.569 -19.129 1.00 45.01 ? 502  CHD B C16 1 
HETATM 5846 C  C17 . CHD I 3 .   ? 7.848   -15.170 -18.933 1.00 44.59 ? 502  CHD B C17 1 
HETATM 5847 C  C18 . CHD I 3 .   ? 7.513   -15.438 -16.455 1.00 43.69 ? 502  CHD B C18 1 
HETATM 5848 C  C19 . CHD I 3 .   ? 3.720   -13.587 -14.478 1.00 45.41 ? 502  CHD B C19 1 
HETATM 5849 C  C20 . CHD I 3 .   ? 9.376   -15.281 -18.868 1.00 46.55 ? 502  CHD B C20 1 
HETATM 5850 C  C21 . CHD I 3 .   ? 10.048  -13.954 -18.641 1.00 47.15 ? 502  CHD B C21 1 
HETATM 5851 C  C22 . CHD I 3 .   ? 9.872   -15.865 -20.197 1.00 48.01 ? 502  CHD B C22 1 
HETATM 5852 C  C23 . CHD I 3 .   ? 11.384  -16.037 -20.275 1.00 50.87 ? 502  CHD B C23 1 
HETATM 5853 O  O25 . CHD I 3 .   ? 11.189  -17.439 -22.213 1.00 53.04 ? 502  CHD B O25 1 
HETATM 5854 C  C24 . CHD I 3 .   ? 11.876  -16.618 -21.582 1.00 52.58 ? 502  CHD B C24 1 
HETATM 5855 O  O26 . CHD I 3 .   ? 13.026  -16.194 -21.948 1.00 52.85 ? 502  CHD B O26 1 
HETATM 5856 C  C1  . CHD J 3 .   ? 6.612   -17.822 -27.623 1.00 46.04 ? 503  CHD B C1  1 
HETATM 5857 C  C2  . CHD J 3 .   ? 7.105   -16.430 -27.975 1.00 46.51 ? 503  CHD B C2  1 
HETATM 5858 C  C3  . CHD J 3 .   ? 8.467   -16.237 -27.311 1.00 47.43 ? 503  CHD B C3  1 
HETATM 5859 O  O3  . CHD J 3 .   ? 8.964   -14.934 -27.631 1.00 49.39 ? 503  CHD B O3  1 
HETATM 5860 C  C4  . CHD J 3 .   ? 8.332   -16.434 -25.812 1.00 46.76 ? 503  CHD B C4  1 
HETATM 5861 C  C5  . CHD J 3 .   ? 7.776   -17.817 -25.428 1.00 46.04 ? 503  CHD B C5  1 
HETATM 5862 C  C6  . CHD J 3 .   ? 7.649   -17.989 -23.904 1.00 46.68 ? 503  CHD B C6  1 
HETATM 5863 C  C7  . CHD J 3 .   ? 6.594   -17.066 -23.285 1.00 47.64 ? 503  CHD B C7  1 
HETATM 5864 O  O7  . CHD J 3 .   ? 7.040   -15.743 -23.360 1.00 47.92 ? 503  CHD B O7  1 
HETATM 5865 C  C8  . CHD J 3 .   ? 5.222   -17.282 -24.001 1.00 47.74 ? 503  CHD B C8  1 
HETATM 5866 C  C9  . CHD J 3 .   ? 5.361   -17.056 -25.514 1.00 46.65 ? 503  CHD B C9  1 
HETATM 5867 C  C10 . CHD J 3 .   ? 6.412   -18.031 -26.113 1.00 46.56 ? 503  CHD B C10 1 
HETATM 5868 C  C11 . CHD J 3 .   ? 3.985   -17.236 -26.167 1.00 47.48 ? 503  CHD B C11 1 
HETATM 5869 C  C12 . CHD J 3 .   ? 2.892   -16.276 -25.590 1.00 47.99 ? 503  CHD B C12 1 
HETATM 5870 O  O12 . CHD J 3 .   ? 3.217   -14.948 -25.885 1.00 47.40 ? 503  CHD B O12 1 
HETATM 5871 C  C13 . CHD J 3 .   ? 2.750   -16.536 -24.084 1.00 48.49 ? 503  CHD B C13 1 
HETATM 5872 C  C14 . CHD J 3 .   ? 4.149   -16.354 -23.428 1.00 48.01 ? 503  CHD B C14 1 
HETATM 5873 C  C15 . CHD J 3 .   ? 3.858   -16.424 -21.916 1.00 48.57 ? 503  CHD B C15 1 
HETATM 5874 C  C16 . CHD J 3 .   ? 2.414   -15.857 -21.794 1.00 49.38 ? 503  CHD B C16 1 
HETATM 5875 C  C17 . CHD J 3 .   ? 1.947   -15.519 -23.231 1.00 49.83 ? 503  CHD B C17 1 
HETATM 5876 C  C18 . CHD J 3 .   ? 2.195   -17.948 -23.866 1.00 48.37 ? 503  CHD B C18 1 
HETATM 5877 C  C19 . CHD J 3 .   ? 5.952   -19.505 -25.948 1.00 46.10 ? 503  CHD B C19 1 
HETATM 5878 C  C20 . CHD J 3 .   ? 0.406   -15.584 -23.333 1.00 51.68 ? 503  CHD B C20 1 
HETATM 5879 C  C21 . CHD J 3 .   ? -0.086  -15.303 -24.726 1.00 52.10 ? 503  CHD B C21 1 
HETATM 5880 C  C22 . CHD J 3 .   ? -0.224  -14.544 -22.391 1.00 53.80 ? 503  CHD B C22 1 
HETATM 5881 C  C23 . CHD J 3 .   ? -1.759  -14.541 -22.421 1.00 56.19 ? 503  CHD B C23 1 
HETATM 5882 O  O25 . CHD J 3 .   ? -3.513  -13.016 -21.796 1.00 56.71 ? 503  CHD B O25 1 
HETATM 5883 C  C24 . CHD J 3 .   ? -2.417  -13.524 -21.505 1.00 57.30 ? 503  CHD B C24 1 
HETATM 5884 O  O26 . CHD J 3 .   ? -1.752  -13.255 -20.447 1.00 58.60 ? 503  CHD B O26 1 
HETATM 5885 O  O   . HOH K 4 .   ? -5.863  -4.292  0.259   1.00 15.01 ? 504  HOH A O   1 
HETATM 5886 O  O   . HOH K 4 .   ? 0.893   14.742  3.896   1.00 19.80 ? 505  HOH A O   1 
HETATM 5887 O  O   . HOH K 4 .   ? -15.332 -13.480 -0.837  1.00 18.70 ? 506  HOH A O   1 
HETATM 5888 O  O   . HOH K 4 .   ? -4.082  12.147  2.449   1.00 20.50 ? 507  HOH A O   1 
HETATM 5889 O  O   . HOH K 4 .   ? -3.197  -1.803  -4.376  1.00 21.17 ? 508  HOH A O   1 
HETATM 5890 O  O   . HOH K 4 .   ? -2.130  24.718  -0.189  1.00 22.18 ? 509  HOH A O   1 
HETATM 5891 O  O   . HOH K 4 .   ? -20.145 6.816   10.131  1.00 19.43 ? 510  HOH A O   1 
HETATM 5892 O  O   . HOH K 4 .   ? 6.639   8.149   3.985   1.00 23.37 ? 511  HOH A O   1 
HETATM 5893 O  O   . HOH K 4 .   ? 5.828   4.665   -4.437  1.00 19.88 ? 512  HOH A O   1 
HETATM 5894 O  O   . HOH K 4 .   ? -2.166  13.197  -0.005  1.00 24.36 ? 513  HOH A O   1 
HETATM 5895 O  O   . HOH K 4 .   ? -6.044  4.833   17.919  1.00 23.46 ? 514  HOH A O   1 
HETATM 5896 O  O   . HOH K 4 .   ? 9.048   12.516  1.544   1.00 23.84 ? 515  HOH A O   1 
HETATM 5897 O  O   . HOH K 4 .   ? 9.251   14.556  -9.956  1.00 26.38 ? 516  HOH A O   1 
HETATM 5898 O  O   . HOH K 4 .   ? 11.668  8.299   8.492   1.00 22.27 ? 517  HOH A O   1 
HETATM 5899 O  O   . HOH K 4 .   ? -10.110 8.957   0.854   1.00 24.93 ? 518  HOH A O   1 
HETATM 5900 O  O   . HOH K 4 .   ? 0.829   6.153   -15.584 1.00 19.81 ? 519  HOH A O   1 
HETATM 5901 O  O   . HOH K 4 .   ? -19.931 12.575  5.688   1.00 26.27 ? 520  HOH A O   1 
HETATM 5902 O  O   . HOH K 4 .   ? -9.371  4.586   -9.797  1.00 29.74 ? 521  HOH A O   1 
HETATM 5903 O  O   . HOH K 4 .   ? -4.312  0.758   15.894  1.00 24.61 ? 522  HOH A O   1 
HETATM 5904 O  O   . HOH K 4 .   ? -5.296  2.032   -14.668 1.00 22.70 ? 523  HOH A O   1 
HETATM 5905 O  O   . HOH K 4 .   ? -14.153 30.732  -11.816 1.00 26.06 ? 524  HOH A O   1 
HETATM 5906 O  O   . HOH K 4 .   ? -11.159 29.555  17.626  1.00 28.04 ? 525  HOH A O   1 
HETATM 5907 O  O   . HOH K 4 .   ? 1.652   9.350   11.980  1.00 30.46 ? 526  HOH A O   1 
HETATM 5908 O  O   . HOH K 4 .   ? -8.000  31.912  6.632   1.00 34.14 ? 527  HOH A O   1 
HETATM 5909 O  O   . HOH K 4 .   ? -13.041 3.879   -8.722  1.00 26.67 ? 528  HOH A O   1 
HETATM 5910 O  O   . HOH K 4 .   ? -1.578  28.082  -3.820  1.00 28.79 ? 529  HOH A O   1 
HETATM 5911 O  O   . HOH K 4 .   ? -3.718  -7.951  7.201   1.00 35.36 ? 530  HOH A O   1 
HETATM 5912 O  O   . HOH K 4 .   ? -23.123 27.468  -6.548  1.00 23.98 ? 531  HOH A O   1 
HETATM 5913 O  O   . HOH K 4 .   ? -27.361 21.997  -6.367  1.00 23.78 ? 532  HOH A O   1 
HETATM 5914 O  O   . HOH K 4 .   ? -2.353  -0.113  -13.713 1.00 24.01 ? 533  HOH A O   1 
HETATM 5915 O  O   . HOH K 4 .   ? -9.858  -8.495  8.640   1.00 18.46 ? 534  HOH A O   1 
HETATM 5916 O  O   . HOH K 4 .   ? 5.398   8.235   6.928   1.00 34.23 ? 535  HOH A O   1 
HETATM 5917 O  O   . HOH K 4 .   ? 9.750   10.459  9.256   1.00 28.02 ? 536  HOH A O   1 
HETATM 5918 O  O   . HOH K 4 .   ? -20.672 -8.695  1.717   1.00 26.82 ? 537  HOH A O   1 
HETATM 5919 O  O   . HOH K 4 .   ? -16.999 28.326  -13.103 1.00 24.15 ? 538  HOH A O   1 
HETATM 5920 O  O   . HOH K 4 .   ? 13.529  18.779  12.428  1.00 27.47 ? 539  HOH A O   1 
HETATM 5921 O  O   . HOH K 4 .   ? 3.503   29.939  -4.829  1.00 28.39 ? 540  HOH A O   1 
HETATM 5922 O  O   . HOH K 4 .   ? -11.069 -11.156 13.262  1.00 30.39 ? 541  HOH A O   1 
HETATM 5923 O  O   . HOH K 4 .   ? 18.320  19.859  3.550   1.00 29.76 ? 542  HOH A O   1 
HETATM 5924 O  O   . HOH K 4 .   ? -4.218  -2.151  -1.812  1.00 29.71 ? 543  HOH A O   1 
HETATM 5925 O  O   . HOH K 4 .   ? -8.818  20.966  5.205   1.00 27.58 ? 544  HOH A O   1 
HETATM 5926 O  O   . HOH K 4 .   ? -20.347 17.756  4.447   1.00 25.76 ? 545  HOH A O   1 
HETATM 5927 O  O   . HOH K 4 .   ? -7.869  31.535  14.541  1.00 25.85 ? 546  HOH A O   1 
HETATM 5928 O  O   . HOH K 4 .   ? -19.136 16.499  11.921  1.00 34.78 ? 547  HOH A O   1 
HETATM 5929 O  O   . HOH K 4 .   ? -6.425  -4.452  -2.652  1.00 29.67 ? 548  HOH A O   1 
HETATM 5930 O  O   . HOH K 4 .   ? -7.447  33.356  8.891   1.00 35.31 ? 549  HOH A O   1 
HETATM 5931 O  O   . HOH K 4 .   ? -13.914 28.620  -4.092  1.00 35.39 ? 550  HOH A O   1 
HETATM 5932 O  O   . HOH K 4 .   ? -6.406  32.297  4.939   1.00 37.02 ? 551  HOH A O   1 
HETATM 5933 O  O   . HOH K 4 .   ? 14.750  18.219  -6.503  1.00 27.83 ? 552  HOH A O   1 
HETATM 5934 O  O   . HOH K 4 .   ? -14.519 -9.985  -13.003 1.00 36.72 ? 553  HOH A O   1 
HETATM 5935 O  O   . HOH K 4 .   ? 6.082   5.830   2.289   1.00 23.88 ? 554  HOH A O   1 
HETATM 5936 O  O   . HOH K 4 .   ? 4.644   4.428   -1.009  1.00 24.44 ? 555  HOH A O   1 
HETATM 5937 O  O   . HOH K 4 .   ? -4.438  8.862   -17.418 1.00 35.23 ? 556  HOH A O   1 
HETATM 5938 O  O   . HOH K 4 .   ? -17.417 20.165  -19.531 1.00 39.51 ? 557  HOH A O   1 
HETATM 5939 O  O   . HOH K 4 .   ? -30.579 -6.260  3.761   1.00 30.02 ? 558  HOH A O   1 
HETATM 5940 O  O   . HOH K 4 .   ? 3.123   26.186  26.779  1.00 45.53 ? 559  HOH A O   1 
HETATM 5941 O  O   . HOH K 4 .   ? 8.476   22.815  15.996  1.00 36.57 ? 560  HOH A O   1 
HETATM 5942 O  O   . HOH K 4 .   ? -13.532 18.442  13.944  1.00 39.02 ? 561  HOH A O   1 
HETATM 5943 O  O   . HOH K 4 .   ? -13.253 18.586  -8.572  1.00 30.66 ? 562  HOH A O   1 
HETATM 5944 O  O   . HOH K 4 .   ? -11.576 4.392   -11.137 1.00 39.80 ? 563  HOH A O   1 
HETATM 5945 O  O   . HOH K 4 .   ? -20.043 29.463  -15.556 1.00 36.85 ? 564  HOH A O   1 
HETATM 5946 O  O   . HOH K 4 .   ? 10.376  12.056  11.746  1.00 32.01 ? 565  HOH A O   1 
HETATM 5947 O  O   . HOH K 4 .   ? -12.729 34.772  -12.666 1.00 48.89 ? 566  HOH A O   1 
HETATM 5948 O  O   . HOH K 4 .   ? -13.856 26.094  -0.844  1.00 49.75 ? 567  HOH A O   1 
HETATM 5949 O  O   . HOH K 4 .   ? -25.377 14.302  -13.247 1.00 32.24 ? 568  HOH A O   1 
HETATM 5950 O  O   . HOH K 4 .   ? -9.054  -2.529  -10.889 1.00 35.58 ? 569  HOH A O   1 
HETATM 5951 O  O   . HOH K 4 .   ? -15.627 -5.391  -12.076 1.00 35.57 ? 570  HOH A O   1 
HETATM 5952 O  O   . HOH K 4 .   ? -2.158  20.857  -2.334  1.00 35.21 ? 571  HOH A O   1 
HETATM 5953 O  O   . HOH K 4 .   ? -17.322 4.272   18.715  1.00 36.46 ? 572  HOH A O   1 
HETATM 5954 O  O   . HOH K 4 .   ? -26.261 4.090   0.438   1.00 40.21 ? 573  HOH A O   1 
HETATM 5955 O  O   . HOH K 4 .   ? -28.027 14.336  -7.087  1.00 29.83 ? 574  HOH A O   1 
HETATM 5956 O  O   . HOH K 4 .   ? -18.470 -6.405  12.816  1.00 31.70 ? 575  HOH A O   1 
HETATM 5957 O  O   . HOH K 4 .   ? -11.966 29.612  -7.825  1.00 34.46 ? 576  HOH A O   1 
HETATM 5958 O  O   . HOH K 4 .   ? -22.451 14.457  -13.101 1.00 33.07 ? 577  HOH A O   1 
HETATM 5959 O  O   . HOH K 4 .   ? 5.531   4.153   -14.877 1.00 34.53 ? 578  HOH A O   1 
HETATM 5960 O  O   . HOH K 4 .   ? -20.827 15.833  -14.767 1.00 28.63 ? 579  HOH A O   1 
HETATM 5961 O  O   . HOH K 4 .   ? -6.397  32.572  19.639  1.00 32.61 ? 580  HOH A O   1 
HETATM 5962 O  O   . HOH K 4 .   ? -24.968 7.973   12.926  1.00 43.08 ? 581  HOH A O   1 
HETATM 5963 O  O   . HOH K 4 .   ? 11.430  15.951  -0.177  1.00 29.44 ? 582  HOH A O   1 
HETATM 5964 O  O   . HOH K 4 .   ? -7.172  17.386  7.801   1.00 36.47 ? 583  HOH A O   1 
HETATM 5965 O  O   . HOH K 4 .   ? -2.756  28.280  -7.427  1.00 34.42 ? 584  HOH A O   1 
HETATM 5966 O  O   . HOH K 4 .   ? -8.168  34.235  -12.022 1.00 46.06 ? 585  HOH A O   1 
HETATM 5967 O  O   . HOH K 4 .   ? 14.977  30.999  8.754   1.00 37.57 ? 586  HOH A O   1 
HETATM 5968 O  O   . HOH K 4 .   ? 11.008  9.882   -12.666 1.00 32.51 ? 587  HOH A O   1 
HETATM 5969 O  O   . HOH K 4 .   ? -12.812 11.699  6.495   1.00 35.08 ? 588  HOH A O   1 
HETATM 5970 O  O   . HOH K 4 .   ? -15.866 25.337  0.593   1.00 37.85 ? 589  HOH A O   1 
HETATM 5971 O  O   . HOH K 4 .   ? -23.071 13.825  12.520  1.00 44.73 ? 590  HOH A O   1 
HETATM 5972 O  O   . HOH K 4 .   ? -8.773  19.797  7.553   1.00 41.31 ? 591  HOH A O   1 
HETATM 5973 O  O   . HOH K 4 .   ? -14.200 8.643   7.515   1.00 40.17 ? 592  HOH A O   1 
HETATM 5974 O  O   . HOH K 4 .   ? -23.944 -12.133 -7.725  1.00 39.98 ? 593  HOH A O   1 
HETATM 5975 O  O   . HOH K 4 .   ? 17.160  22.255  -7.024  1.00 49.46 ? 594  HOH A O   1 
HETATM 5976 O  O   . HOH K 4 .   ? -1.821  20.160  -5.282  1.00 31.75 ? 595  HOH A O   1 
HETATM 5977 O  O   . HOH K 4 .   ? -12.481 32.348  0.229   1.00 48.81 ? 596  HOH A O   1 
HETATM 5978 O  O   . HOH K 4 .   ? 5.675   16.099  10.280  1.00 42.80 ? 597  HOH A O   1 
HETATM 5979 O  O   . HOH K 4 .   ? -11.038 33.090  -8.859  1.00 43.83 ? 598  HOH A O   1 
HETATM 5980 O  O   . HOH K 4 .   ? -12.344 30.710  7.610   1.00 41.46 ? 599  HOH A O   1 
HETATM 5981 O  O   . HOH K 4 .   ? 10.510  23.699  22.909  1.00 47.04 ? 600  HOH A O   1 
HETATM 5982 O  O   . HOH K 4 .   ? 9.147   22.969  -10.659 1.00 50.59 ? 601  HOH A O   1 
HETATM 5983 O  O   . HOH K 4 .   ? 3.441   16.307  15.935  1.00 33.36 ? 602  HOH A O   1 
HETATM 5984 O  O   . HOH K 4 .   ? -9.144  28.439  24.496  1.00 40.81 ? 603  HOH A O   1 
HETATM 5985 O  O   . HOH K 4 .   ? -23.921 13.484  -1.839  1.00 31.13 ? 604  HOH A O   1 
HETATM 5986 O  O   . HOH K 4 .   ? -21.345 18.468  12.659  1.00 41.79 ? 605  HOH A O   1 
HETATM 5987 O  O   . HOH K 4 .   ? -20.236 -14.092 6.296   1.00 35.97 ? 606  HOH A O   1 
HETATM 5988 O  O   . HOH K 4 .   ? -7.293  3.135   -10.467 1.00 24.11 ? 607  HOH A O   1 
HETATM 5989 O  O   . HOH K 4 .   ? 0.270   8.855   17.776  1.00 28.56 ? 608  HOH A O   1 
HETATM 5990 O  O   . HOH K 4 .   ? -3.917  3.819   16.881  1.00 28.34 ? 609  HOH A O   1 
HETATM 5991 O  O   . HOH K 4 .   ? -7.288  -1.211  -12.396 1.00 31.49 ? 610  HOH A O   1 
HETATM 5992 O  O   . HOH K 4 .   ? -5.804  32.821  -12.224 1.00 33.95 ? 611  HOH A O   1 
HETATM 5993 O  O   . HOH K 4 .   ? -26.825 24.336  -7.470  1.00 34.14 ? 612  HOH A O   1 
HETATM 5994 O  O   . HOH K 4 .   ? 1.569   11.412  13.686  1.00 30.65 ? 613  HOH A O   1 
HETATM 5995 O  O   . HOH K 4 .   ? -4.369  -0.482  -15.956 1.00 37.13 ? 614  HOH A O   1 
HETATM 5996 O  O   . HOH K 4 .   ? -0.320  -0.953  -15.069 1.00 35.22 ? 615  HOH A O   1 
HETATM 5997 O  O   . HOH K 4 .   ? -11.461 17.360  -7.169  1.00 39.23 ? 616  HOH A O   1 
HETATM 5998 O  O   . HOH K 4 .   ? 16.841  20.198  10.120  1.00 35.26 ? 617  HOH A O   1 
HETATM 5999 O  O   . HOH K 4 .   ? 9.507   13.842  -0.753  1.00 31.43 ? 618  HOH A O   1 
HETATM 6000 O  O   . HOH K 4 .   ? -17.036 -10.397 10.210  1.00 34.41 ? 619  HOH A O   1 
HETATM 6001 O  O   . HOH K 4 .   ? -8.844  32.637  12.280  1.00 42.65 ? 620  HOH A O   1 
HETATM 6002 O  O   . HOH K 4 .   ? -20.812 15.655  9.252   1.00 28.90 ? 621  HOH A O   1 
HETATM 6003 O  O   . HOH K 4 .   ? -12.080 30.377  -5.251  1.00 37.34 ? 622  HOH A O   1 
HETATM 6004 O  O   . HOH K 4 .   ? 17.682  17.844  5.282   1.00 42.22 ? 623  HOH A O   1 
HETATM 6005 O  O   . HOH K 4 .   ? -23.933 5.830   4.686   1.00 33.64 ? 624  HOH A O   1 
HETATM 6006 O  O   . HOH K 4 .   ? 6.002   18.314  -5.406  1.00 33.16 ? 625  HOH A O   1 
HETATM 6007 O  O   . HOH K 4 .   ? 8.831   38.285  3.821   1.00 33.02 ? 626  HOH A O   1 
HETATM 6008 O  O   . HOH K 4 .   ? -14.569 32.714  -13.562 1.00 43.82 ? 627  HOH A O   1 
HETATM 6009 O  O   . HOH K 4 .   ? -22.238 15.965  -17.522 1.00 43.05 ? 628  HOH A O   1 
HETATM 6010 O  O   . HOH K 4 .   ? -1.537  27.106  -9.937  1.00 36.61 ? 629  HOH A O   1 
HETATM 6011 O  O   . HOH K 4 .   ? -24.114 -10.215 11.441  1.00 43.70 ? 630  HOH A O   1 
HETATM 6012 O  O   . HOH K 4 .   ? 3.396   27.942  -6.853  1.00 48.96 ? 631  HOH A O   1 
HETATM 6013 O  O   . HOH K 4 .   ? -6.129  1.060   -12.034 1.00 37.44 ? 632  HOH A O   1 
HETATM 6014 O  O   . HOH K 4 .   ? -4.644  -9.911  9.103   1.00 40.39 ? 633  HOH A O   1 
HETATM 6015 O  O   . HOH K 4 .   ? -17.253 26.508  9.466   1.00 32.80 ? 634  HOH A O   1 
HETATM 6016 O  O   . HOH K 4 .   ? -5.177  17.785  22.144  1.00 41.37 ? 635  HOH A O   1 
HETATM 6017 O  O   . HOH K 4 .   ? -10.084 30.891  15.575  1.00 43.60 ? 636  HOH A O   1 
HETATM 6018 O  O   . HOH K 4 .   ? -1.977  -0.728  16.386  1.00 44.23 ? 637  HOH A O   1 
HETATM 6019 O  O   . HOH K 4 .   ? -22.484 30.144  -8.601  1.00 44.71 ? 638  HOH A O   1 
HETATM 6020 O  O   . HOH K 4 .   ? -23.690 -11.274 8.780   1.00 36.95 ? 639  HOH A O   1 
HETATM 6021 O  O   . HOH K 4 .   ? -7.662  15.693  3.679   1.00 43.70 ? 640  HOH A O   1 
HETATM 6022 O  O   . HOH K 4 .   ? 10.221  18.596  -0.599  1.00 37.28 ? 641  HOH A O   1 
HETATM 6023 O  O   . HOH K 4 .   ? 5.292   30.977  19.009  1.00 44.88 ? 642  HOH A O   1 
HETATM 6024 O  O   . HOH K 4 .   ? 7.817   16.425  -3.054  1.00 43.28 ? 643  HOH A O   1 
HETATM 6025 O  O   . HOH K 4 .   ? -23.297 -10.612 1.024   1.00 37.33 ? 644  HOH A O   1 
HETATM 6026 O  O   . HOH K 4 .   ? -25.222 26.460  -7.495  1.00 41.95 ? 645  HOH A O   1 
HETATM 6027 O  O   . HOH K 4 .   ? 3.781   41.822  -1.211  1.00 47.21 ? 646  HOH A O   1 
HETATM 6028 O  O   . HOH K 4 .   ? 3.524   13.311  12.430  1.00 36.29 ? 647  HOH A O   1 
HETATM 6029 O  O   . HOH K 4 .   ? 11.515  27.529  12.773  1.00 41.59 ? 648  HOH A O   1 
HETATM 6030 O  O   . HOH K 4 .   ? 20.294  22.176  -0.680  1.00 46.30 ? 649  HOH A O   1 
HETATM 6031 O  O   . HOH K 4 .   ? 7.980   7.096   -13.708 1.00 37.46 ? 650  HOH A O   1 
HETATM 6032 O  O   . HOH K 4 .   ? -6.190  34.976  3.812   1.00 46.88 ? 651  HOH A O   1 
HETATM 6033 O  O   . HOH K 4 .   ? 18.204  15.902  2.398   1.00 44.93 ? 652  HOH A O   1 
HETATM 6034 O  O   . HOH K 4 .   ? 3.912   11.669  -14.236 1.00 41.78 ? 653  HOH A O   1 
HETATM 6035 O  O   . HOH K 4 .   ? -14.578 12.930  -12.927 1.00 40.64 ? 654  HOH A O   1 
HETATM 6036 O  O   . HOH K 4 .   ? -21.893 -13.661 8.681   1.00 46.86 ? 655  HOH A O   1 
HETATM 6037 O  O   . HOH K 4 .   ? -12.511 19.563  20.495  1.00 41.85 ? 656  HOH A O   1 
HETATM 6038 O  O   . HOH K 4 .   ? 17.346  18.838  -7.607  1.00 43.75 ? 657  HOH A O   1 
HETATM 6039 O  O   . HOH K 4 .   ? 9.365   24.666  18.688  1.00 35.98 ? 658  HOH A O   1 
HETATM 6040 O  O   . HOH K 4 .   ? 8.156   16.230  -11.947 1.00 37.79 ? 659  HOH A O   1 
HETATM 6041 O  O   . HOH K 4 .   ? -7.107  12.427  -8.500  1.00 44.42 ? 660  HOH A O   1 
HETATM 6042 O  O   . HOH L 4 .   ? 7.738   4.303   0.220   1.00 13.04 ? 1000 HOH B O   1 
HETATM 6043 O  O   . HOH L 4 .   ? -4.786  -8.127  4.061   1.00 28.69 ? 1001 HOH B O   1 
HETATM 6044 O  O   . HOH L 4 .   ? 16.162  -19.223 -3.392  1.00 22.38 ? 1002 HOH B O   1 
HETATM 6045 O  O   . HOH L 4 .   ? 0.823   -14.800 4.018   1.00 18.13 ? 1003 HOH B O   1 
HETATM 6046 O  O   . HOH L 4 .   ? 4.864   1.725   -4.490  1.00 21.09 ? 1004 HOH B O   1 
HETATM 6047 O  O   . HOH L 4 .   ? 25.674  -23.211 -1.188  1.00 25.99 ? 1005 HOH B O   1 
HETATM 6048 O  O   . HOH L 4 .   ? 5.880   -12.106 2.391   1.00 16.40 ? 1006 HOH B O   1 
HETATM 6049 O  O   . HOH L 4 .   ? 17.053  13.450  -0.973  1.00 23.48 ? 1007 HOH B O   1 
HETATM 6050 O  O   . HOH L 4 .   ? 4.111   -13.116 0.046   1.00 25.89 ? 1008 HOH B O   1 
HETATM 6051 O  O   . HOH L 4 .   ? -4.022  -4.745  -4.403  1.00 16.74 ? 1009 HOH B O   1 
HETATM 6052 O  O   . HOH L 4 .   ? 7.999   -4.751  17.837  1.00 23.73 ? 1010 HOH B O   1 
HETATM 6053 O  O   . HOH L 4 .   ? 3.261   -28.024 -3.726  1.00 26.54 ? 1011 HOH B O   1 
HETATM 6054 O  O   . HOH L 4 .   ? -7.078  -12.521 1.678   1.00 19.74 ? 1012 HOH B O   1 
HETATM 6055 O  O   . HOH L 4 .   ? 21.635  -12.508 5.568   1.00 22.60 ? 1013 HOH B O   1 
HETATM 6056 O  O   . HOH L 4 .   ? 22.472  8.882   1.619   1.00 23.55 ? 1014 HOH B O   1 
HETATM 6057 O  O   . HOH L 4 .   ? 15.438  -18.316 13.700  1.00 25.77 ? 1015 HOH B O   1 
HETATM 6058 O  O   . HOH L 4 .   ? 1.841   -8.785  17.740  1.00 28.35 ? 1016 HOH B O   1 
HETATM 6059 O  O   . HOH L 4 .   ? -7.531  -14.612 -9.856  1.00 28.53 ? 1017 HOH B O   1 
HETATM 6060 O  O   . HOH L 4 .   ? 21.988  -6.853  9.840   1.00 24.77 ? 1018 HOH B O   1 
HETATM 6061 O  O   . HOH L 4 .   ? 15.886  -30.581 -11.817 1.00 26.13 ? 1019 HOH B O   1 
HETATM 6062 O  O   . HOH L 4 .   ? 29.293  -21.997 -6.587  1.00 20.55 ? 1020 HOH B O   1 
HETATM 6063 O  O   . HOH L 4 .   ? -2.849  -4.420  -1.123  1.00 22.42 ? 1021 HOH B O   1 
HETATM 6064 O  O   . HOH L 4 .   ? -4.244  -5.798  2.450   1.00 26.05 ? 1022 HOH B O   1 
HETATM 6065 O  O   . HOH L 4 .   ? 32.501  6.141   3.653   1.00 21.97 ? 1023 HOH B O   1 
HETATM 6066 O  O   . HOH L 4 .   ? 9.960   -31.683 14.416  1.00 24.43 ? 1024 HOH B O   1 
HETATM 6067 O  O   . HOH L 4 .   ? 7.109   -2.122  -14.740 1.00 23.20 ? 1025 HOH B O   1 
HETATM 6068 O  O   . HOH L 4 .   ? 29.746  -14.541 -7.070  1.00 23.30 ? 1026 HOH B O   1 
HETATM 6069 O  O   . HOH L 4 .   ? 9.631   -31.952 6.543   1.00 35.72 ? 1027 HOH B O   1 
HETATM 6070 O  O   . HOH L 4 .   ? 21.092  -16.461 11.752  1.00 34.52 ? 1028 HOH B O   1 
HETATM 6071 O  O   . HOH L 4 .   ? 14.931  -3.998  -8.829  1.00 29.17 ? 1029 HOH B O   1 
HETATM 6072 O  O   . HOH L 4 .   ? 12.102  -8.943  0.747   1.00 29.78 ? 1030 HOH B O   1 
HETATM 6073 O  O   . HOH L 4 .   ? 22.268  -17.674 4.234   1.00 26.80 ? 1031 HOH B O   1 
HETATM 6074 O  O   . HOH L 4 .   ? 25.061  -27.501 -6.756  1.00 28.18 ? 1032 HOH B O   1 
HETATM 6075 O  O   . HOH L 4 .   ? 6.400   -0.714  15.940  1.00 24.86 ? 1033 HOH B O   1 
HETATM 6076 O  O   . HOH L 4 .   ? 3.988   -24.709 -0.213  1.00 26.55 ? 1034 HOH B O   1 
HETATM 6077 O  O   . HOH L 4 .   ? 11.170  -4.693  -9.801  1.00 26.86 ? 1035 HOH B O   1 
HETATM 6078 O  O   . HOH L 4 .   ? 22.711  -15.558 9.158   1.00 25.16 ? 1036 HOH B O   1 
HETATM 6079 O  O   . HOH L 4 .   ? -5.625  -27.019 13.533  1.00 30.11 ? 1037 HOH B O   1 
HETATM 6080 O  O   . HOH L 4 .   ? 10.603  -20.918 5.243   1.00 25.21 ? 1038 HOH B O   1 
HETATM 6081 O  O   . HOH L 4 .   ? -16.029 -12.600 5.482   1.00 23.12 ? 1039 HOH B O   1 
HETATM 6082 O  O   . HOH L 4 .   ? 0.761   -6.374  -15.348 1.00 22.43 ? 1040 HOH B O   1 
HETATM 6083 O  O   . HOH L 4 .   ? 8.255   4.325   -2.844  1.00 26.65 ? 1041 HOH B O   1 
HETATM 6084 O  O   . HOH L 4 .   ? 12.966  -33.104 -8.761  1.00 38.42 ? 1042 HOH B O   1 
HETATM 6085 O  O   . HOH L 4 .   ? 18.100  12.642  5.076   1.00 31.32 ? 1043 HOH B O   1 
HETATM 6086 O  O   . HOH L 4 .   ? 24.273  -14.452 -13.256 1.00 28.71 ? 1044 HOH B O   1 
HETATM 6087 O  O   . HOH L 4 .   ? 13.199  -29.411 17.666  1.00 33.19 ? 1045 HOH B O   1 
HETATM 6088 O  O   . HOH L 4 .   ? 18.761  10.364  9.916   1.00 26.26 ? 1046 HOH B O   1 
HETATM 6089 O  O   . HOH L 4 .   ? -11.736 -18.786 12.813  1.00 30.93 ? 1047 HOH B O   1 
HETATM 6090 O  O   . HOH L 4 .   ? -6.456  -22.859 16.021  1.00 29.66 ? 1048 HOH B O   1 
HETATM 6091 O  O   . HOH L 4 .   ? 0.327   -9.333  12.111  1.00 29.91 ? 1049 HOH B O   1 
HETATM 6092 O  O   . HOH L 4 .   ? 26.940  -8.235  12.938  1.00 37.81 ? 1050 HOH B O   1 
HETATM 6093 O  O   . HOH L 4 .   ? 13.289  -4.587  -11.214 1.00 40.91 ? 1051 HOH B O   1 
HETATM 6094 O  O   . HOH L 4 .   ? -1.698  -30.016 -4.476  1.00 30.84 ? 1052 HOH B O   1 
HETATM 6095 O  O   . HOH L 4 .   ? -3.581  -4.213  -14.877 1.00 30.47 ? 1053 HOH B O   1 
HETATM 6096 O  O   . HOH L 4 .   ? -7.771  -10.453 9.481   1.00 31.42 ? 1054 HOH B O   1 
HETATM 6097 O  O   . HOH L 4 .   ? -14.982 -20.405 10.147  1.00 36.43 ? 1055 HOH B O   1 
HETATM 6098 O  O   . HOH L 4 .   ? -8.465  -18.801 -0.369  1.00 34.24 ? 1056 HOH B O   1 
HETATM 6099 O  O   . HOH L 4 .   ? 14.750  -11.614 6.463   1.00 32.17 ? 1057 HOH B O   1 
HETATM 6100 O  O   . HOH L 4 .   ? 6.347   -9.008  -17.347 1.00 35.03 ? 1058 HOH B O   1 
HETATM 6101 O  O   . HOH L 4 .   ? -3.278  -30.831 19.155  1.00 33.79 ? 1059 HOH B O   1 
HETATM 6102 O  O   . HOH L 4 .   ? 11.461  -28.622 24.350  1.00 28.90 ? 1060 HOH B O   1 
HETATM 6103 O  O   . HOH L 4 .   ? 14.839  -28.674 -1.302  1.00 54.02 ? 1061 HOH B O   1 
HETATM 6104 O  O   . HOH L 4 .   ? 5.617   -3.603  16.757  1.00 27.52 ? 1062 HOH B O   1 
HETATM 6105 O  O   . HOH L 4 .   ? 10.799  2.409   -10.942 1.00 29.77 ? 1063 HOH B O   1 
HETATM 6106 O  O   . HOH L 4 .   ? -1.489  -16.375 16.007  1.00 24.66 ? 1064 HOH B O   1 
HETATM 6107 O  O   . HOH L 4 .   ? 18.657  -28.351 -13.332 1.00 24.79 ? 1065 HOH B O   1 
HETATM 6108 O  O   . HOH L 4 .   ? -6.960  -38.411 3.774   1.00 34.30 ? 1066 HOH B O   1 
HETATM 6109 O  O   . HOH L 4 .   ? 14.278  -22.999 20.439  1.00 37.51 ? 1067 HOH B O   1 
HETATM 6110 O  O   . HOH L 4 .   ? 6.046   2.106   -1.825  1.00 30.89 ? 1068 HOH B O   1 
HETATM 6111 O  O   . HOH L 4 .   ? 3.603   -20.004 -5.192  1.00 32.01 ? 1069 HOH B O   1 
HETATM 6112 O  O   . HOH L 4 .   ? -9.435  -10.090 -12.598 1.00 32.15 ? 1070 HOH B O   1 
HETATM 6113 O  O   . HOH L 4 .   ? 13.600  -29.383 -8.102  1.00 32.89 ? 1071 HOH B O   1 
HETATM 6114 O  O   . HOH L 4 .   ? 28.073  -4.217  0.328   1.00 40.94 ? 1072 HOH B O   1 
HETATM 6115 O  O   . HOH L 4 .   ? 15.896  -28.758 -4.277  1.00 31.90 ? 1073 HOH B O   1 
HETATM 6116 O  O   . HOH L 4 .   ? 20.531  6.209   12.669  1.00 32.04 ? 1074 HOH B O   1 
HETATM 6117 O  O   . HOH L 4 .   ? -8.348  -12.032 11.914  1.00 32.92 ? 1075 HOH B O   1 
HETATM 6118 O  O   . HOH L 4 .   ? -3.827  -18.503 -5.577  1.00 36.00 ? 1076 HOH B O   1 
HETATM 6119 O  O   . HOH L 4 .   ? 3.521   -38.083 24.812  1.00 46.33 ? 1077 HOH B O   1 
HETATM 6120 O  O   . HOH L 4 .   ? -16.488 -19.817 3.677   1.00 31.36 ? 1078 HOH B O   1 
HETATM 6121 O  O   . HOH L 4 .   ? 21.991  -29.641 -15.454 1.00 45.94 ? 1079 HOH B O   1 
HETATM 6122 O  O   . HOH L 4 .   ? 25.064  10.458  0.572   1.00 33.69 ? 1080 HOH B O   1 
HETATM 6123 O  O   . HOH L 4 .   ? 4.012   0.164   -13.581 1.00 32.06 ? 1081 HOH B O   1 
HETATM 6124 O  O   . HOH L 4 .   ? -12.205 -34.173 -0.740  1.00 40.85 ? 1082 HOH B O   1 
HETATM 6125 O  O   . HOH L 4 .   ? 12.795  11.309  12.947  1.00 33.54 ? 1083 HOH B O   1 
HETATM 6126 O  O   . HOH L 4 .   ? 8.510   -32.546 19.569  1.00 35.58 ? 1084 HOH B O   1 
HETATM 6127 O  O   . HOH L 4 .   ? 22.545  -15.805 -14.919 1.00 28.97 ? 1085 HOH B O   1 
HETATM 6128 O  O   . HOH L 4 .   ? 9.506   -33.412 9.066   1.00 38.47 ? 1086 HOH B O   1 
HETATM 6129 O  O   . HOH L 4 .   ? -12.985 -18.433 -6.158  1.00 32.49 ? 1087 HOH B O   1 
HETATM 6130 O  O   . HOH L 4 .   ? 7.917   -0.978  -11.998 1.00 40.29 ? 1088 HOH B O   1 
HETATM 6131 O  O   . HOH L 4 .   ? -9.503  -27.395 13.126  1.00 41.11 ? 1089 HOH B O   1 
HETATM 6132 O  O   . HOH L 4 .   ? 26.998  -14.513 -13.571 1.00 29.24 ? 1090 HOH B O   1 
HETATM 6133 O  O   . HOH L 4 .   ? 16.099  9.963   -13.239 1.00 38.71 ? 1091 HOH B O   1 
HETATM 6134 O  O   . HOH L 4 .   ? 18.801  -19.690 -19.700 1.00 42.83 ? 1092 HOH B O   1 
HETATM 6135 O  O   . HOH L 4 .   ? 29.471  -0.574  -0.298  1.00 49.26 ? 1093 HOH B O   1 
HETATM 6136 O  O   . HOH L 4 .   ? 21.888  14.257  5.899   1.00 31.50 ? 1094 HOH B O   1 
HETATM 6137 O  O   . HOH L 4 .   ? 18.643  -3.796  19.022  1.00 36.25 ? 1095 HOH B O   1 
HETATM 6138 O  O   . HOH L 4 .   ? -14.716 -11.512 -3.530  1.00 39.97 ? 1096 HOH B O   1 
HETATM 6139 O  O   . HOH L 4 .   ? -6.002  -19.249 -1.027  1.00 41.87 ? 1097 HOH B O   1 
HETATM 6140 O  O   . HOH L 4 .   ? 4.321   -28.137 -7.406  1.00 36.12 ? 1098 HOH B O   1 
HETATM 6141 O  O   . HOH L 4 .   ? 18.799  -25.399 1.703   1.00 39.03 ? 1099 HOH B O   1 
HETATM 6142 O  O   . HOH L 4 .   ? -15.306 -21.669 -6.948  1.00 36.02 ? 1100 HOH B O   1 
HETATM 6143 O  O   . HOH L 4 .   ? 25.819  -5.780  4.069   1.00 32.15 ? 1101 HOH B O   1 
HETATM 6144 O  O   . HOH L 4 .   ? 9.072   -3.268  -10.240 1.00 33.31 ? 1102 HOH B O   1 
HETATM 6145 O  O   . HOH L 4 .   ? 9.272   1.093   -12.556 1.00 34.85 ? 1103 HOH B O   1 
HETATM 6146 O  O   . HOH L 4 .   ? -7.464  -13.802 -0.586  1.00 28.33 ? 1104 HOH B O   1 
HETATM 6147 O  O   . HOH L 4 .   ? 0.370   -11.365 13.926  1.00 27.16 ? 1105 HOH B O   1 
HETATM 6148 O  O   . HOH L 4 .   ? 2.004   0.743   -15.041 1.00 34.87 ? 1106 HOH B O   1 
HETATM 6149 O  O   . HOH L 4 .   ? 28.701  -24.468 -8.037  1.00 32.21 ? 1107 HOH B O   1 
HETATM 6150 O  O   . HOH L 4 .   ? 23.783  -23.758 0.414   1.00 39.22 ? 1108 HOH B O   1 
HETATM 6151 O  O   . HOH L 4 .   ? 26.068  -25.919 -0.899  1.00 35.74 ? 1109 HOH B O   1 
HETATM 6152 O  O   . HOH L 4 .   ? 17.437  15.408  -2.328  1.00 47.67 ? 1110 HOH B O   1 
HETATM 6153 O  O   . HOH L 4 .   ? 4.147   -20.838 -2.415  1.00 37.68 ? 1111 HOH B O   1 
HETATM 6154 O  O   . HOH L 4 .   ? 12.024  -30.689 15.623  1.00 32.00 ? 1112 HOH B O   1 
HETATM 6155 O  O   . HOH L 4 .   ? -15.845 -17.758 5.132   1.00 35.20 ? 1113 HOH B O   1 
HETATM 6156 O  O   . HOH L 4 .   ? 5.931   0.113   -15.978 1.00 37.30 ? 1114 HOH B O   1 
HETATM 6157 O  O   . HOH L 4 .   ? -5.180  -25.220 15.694  1.00 43.44 ? 1115 HOH B O   1 
HETATM 6158 O  O   . HOH L 4 .   ? 17.778  -9.899  17.436  1.00 37.39 ? 1116 HOH B O   1 
HETATM 6159 O  O   . HOH L 4 .   ? 27.097  -26.475 -7.823  1.00 44.67 ? 1117 HOH B O   1 
HETATM 6160 O  O   . HOH L 4 .   ? 25.912  10.199  11.402  1.00 40.85 ? 1118 HOH B O   1 
HETATM 6161 O  O   . HOH L 4 .   ? 3.284   -27.187 -9.935  1.00 35.68 ? 1119 HOH B O   1 
HETATM 6162 O  O   . HOH L 4 .   ? 1.264   -29.233 -7.102  1.00 41.70 ? 1120 HOH B O   1 
HETATM 6163 O  O   . HOH L 4 .   ? 30.184  -0.580  2.249   1.00 44.22 ? 1121 HOH B O   1 
HETATM 6164 O  O   . HOH L 4 .   ? 3.444   -35.577 25.501  1.00 42.75 ? 1122 HOH B O   1 
HETATM 6165 O  O   . HOH L 4 .   ? 7.418   -0.704  18.826  1.00 46.15 ? 1123 HOH B O   1 
HETATM 6166 O  O   . HOH L 4 .   ? 12.151  -31.800 5.954   1.00 40.09 ? 1124 HOH B O   1 
HETATM 6167 O  O   . HOH L 4 .   ? -4.855  -17.215 -7.852  1.00 43.58 ? 1125 HOH B O   1 
HETATM 6168 O  O   . HOH L 4 .   ? 17.133  5.389   -12.380 1.00 33.53 ? 1126 HOH B O   1 
HETATM 6169 O  O   . HOH L 4 .   ? 20.599  -4.548  17.454  1.00 47.28 ? 1127 HOH B O   1 
HETATM 6170 O  O   . HOH L 4 .   ? -14.055 -26.708 0.147   1.00 37.59 ? 1128 HOH B O   1 
HETATM 6171 O  O   . HOH L 4 .   ? -5.551  -12.593 -12.328 1.00 43.47 ? 1129 HOH B O   1 
HETATM 6172 O  O   . HOH L 4 .   ? -6.200  -16.082 -11.748 1.00 37.97 ? 1130 HOH B O   1 
HETATM 6173 O  O   . HOH L 4 .   ? 21.052  -13.536 -14.726 1.00 40.66 ? 1131 HOH B O   1 
HETATM 6174 O  O   . HOH L 4 .   ? -18.374 -24.808 0.686   1.00 45.45 ? 1132 HOH B O   1 
HETATM 6175 O  O   . HOH L 4 .   ? 19.403  -26.714 9.119   1.00 34.49 ? 1133 HOH B O   1 
HETATM 6176 O  O   . HOH L 4 .   ? 10.626  -32.700 12.124  1.00 47.24 ? 1134 HOH B O   1 
HETATM 6177 O  O   . HOH L 4 .   ? 10.768  -19.474 7.421   1.00 39.26 ? 1135 HOH B O   1 
HETATM 6178 O  O   . HOH L 4 .   ? 19.210  4.835   14.759  1.00 35.91 ? 1136 HOH B O   1 
HETATM 6179 O  O   . HOH L 4 .   ? 21.486  -26.144 -0.629  1.00 36.21 ? 1137 HOH B O   1 
HETATM 6180 O  O   . HOH L 4 .   ? 33.539  2.858   3.679   1.00 43.59 ? 1138 HOH B O   1 
HETATM 6181 O  O   . HOH L 4 .   ? 9.405   -25.378 30.398  1.00 44.74 ? 1139 HOH B O   1 
HETATM 6182 O  O   . HOH L 4 .   ? 1.279   -14.259 18.822  1.00 47.34 ? 1140 HOH B O   1 
HETATM 6183 O  O   . HOH L 4 .   ? 13.919  -30.440 -5.556  1.00 43.04 ? 1141 HOH B O   1 
HETATM 6184 O  O   . HOH L 4 .   ? -9.458  -16.035 0.007   1.00 41.57 ? 1142 HOH B O   1 
HETATM 6185 O  O   . HOH L 4 .   ? 24.745  -22.357 -16.597 1.00 32.40 ? 1143 HOH B O   1 
HETATM 6186 O  O   . HOH L 4 .   ? 4.317   0.680   16.353  1.00 47.24 ? 1144 HOH B O   1 
HETATM 6187 O  O   . HOH L 4 .   ? -7.519  -24.426 19.071  1.00 38.88 ? 1145 HOH B O   1 
HETATM 6188 O  O   . HOH L 4 .   ? -5.909  -16.748 -2.847  1.00 40.21 ? 1146 HOH B O   1 
HETATM 6189 O  O   . HOH L 4 .   ? 14.194  -30.850 7.767   1.00 45.44 ? 1147 HOH B O   1 
HETATM 6190 O  O   . HOH L 4 .   ? 8.140   -35.108 3.785   1.00 41.66 ? 1148 HOH B O   1 
HETATM 6191 O  O   . HOH L 4 .   ? -4.631  -15.663 16.647  1.00 48.75 ? 1149 HOH B O   1 
HETATM 6192 O  O   . HOH L 4 .   ? -15.789 -18.727 -7.050  1.00 44.69 ? 1150 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   65  65  ARG ARG A . n 
A 1 2   LYS 2   66  66  LYS LYS A . n 
A 1 3   PRO 3   67  67  PRO PRO A . n 
A 1 4   LYS 4   68  68  LYS LYS A . n 
A 1 5   THR 5   69  69  THR THR A . n 
A 1 6   GLY 6   70  70  GLY GLY A . n 
A 1 7   ILE 7   71  71  ILE ILE A . n 
A 1 8   LEU 8   72  72  LEU LEU A . n 
A 1 9   MET 9   73  73  MET MET A . n 
A 1 10  LEU 10  74  74  LEU LEU A . n 
A 1 11  ASN 11  75  75  ASN ASN A . n 
A 1 12  MET 12  76  76  MET MET A . n 
A 1 13  GLY 13  77  77  GLY GLY A . n 
A 1 14  GLY 14  78  78  GLY GLY A . n 
A 1 15  PRO 15  79  79  PRO PRO A . n 
A 1 16  GLU 16  80  80  GLU GLU A . n 
A 1 17  THR 17  81  81  THR THR A . n 
A 1 18  LEU 18  82  82  LEU LEU A . n 
A 1 19  GLY 19  83  83  GLY GLY A . n 
A 1 20  ASP 20  84  84  ASP ASP A . n 
A 1 21  VAL 21  85  85  VAL VAL A . n 
A 1 22  HIS 22  86  86  HIS HIS A . n 
A 1 23  ASP 23  87  87  ASP ASP A . n 
A 1 24  PHE 24  88  88  PHE PHE A . n 
A 1 25  LEU 25  89  89  LEU LEU A . n 
A 1 26  LEU 26  90  90  LEU LEU A . n 
A 1 27  ARG 27  91  91  ARG ARG A . n 
A 1 28  LEU 28  92  92  LEU LEU A . n 
A 1 29  PHE 29  93  93  PHE PHE A . n 
A 1 30  LEU 30  94  94  LEU LEU A . n 
A 1 31  ASP 31  95  95  ASP ASP A . n 
A 1 32  ARG 32  96  96  ARG ARG A . n 
A 1 33  ASP 33  97  97  ASP ASP A . n 
A 1 34  LEU 34  98  98  LEU LEU A . n 
A 1 35  MET 35  99  99  MET MET A . n 
A 1 36  THR 36  100 100 THR THR A . n 
A 1 37  LEU 37  101 101 LEU LEU A . n 
A 1 38  PRO 38  102 102 PRO PRO A . n 
A 1 39  ILE 39  103 103 ILE ILE A . n 
A 1 40  GLN 40  104 104 GLN GLN A . n 
A 1 41  ASN 41  105 105 ASN ASN A . n 
A 1 42  LYS 42  106 106 LYS LYS A . n 
A 1 43  LEU 43  107 107 LEU LEU A . n 
A 1 44  ALA 44  108 108 ALA ALA A . n 
A 1 45  PRO 45  109 109 PRO PRO A . n 
A 1 46  PHE 46  110 110 PHE PHE A . n 
A 1 47  ILE 47  111 111 ILE ILE A . n 
A 1 48  ALA 48  112 112 ALA ALA A . n 
A 1 49  LYS 49  113 113 LYS LYS A . n 
A 1 50  ARG 50  114 114 ARG ARG A . n 
A 1 51  LEU 51  115 115 LEU LEU A . n 
A 1 52  THR 52  116 116 THR THR A . n 
A 1 53  PRO 53  117 117 PRO PRO A . n 
A 1 54  LYS 54  118 118 LYS LYS A . n 
A 1 55  ILE 55  119 119 ILE ILE A . n 
A 1 56  GLN 56  120 120 GLN GLN A . n 
A 1 57  GLU 57  121 121 GLU GLU A . n 
A 1 58  GLN 58  122 122 GLN GLN A . n 
A 1 59  TYR 59  123 123 TYR TYR A . n 
A 1 60  ARG 60  124 124 ARG ARG A . n 
A 1 61  ARG 61  125 125 ARG ARG A . n 
A 1 62  ILE 62  126 126 ILE ILE A . n 
A 1 63  GLY 63  127 127 GLY GLY A . n 
A 1 64  GLY 64  128 128 GLY GLY A . n 
A 1 65  GLY 65  129 129 GLY GLY A . n 
A 1 66  SER 66  130 130 SER SER A . n 
A 1 67  PRO 67  131 131 PRO PRO A . n 
A 1 68  ILE 68  132 132 ILE ILE A . n 
A 1 69  LYS 69  133 133 LYS LYS A . n 
A 1 70  ILE 70  134 134 ILE ILE A . n 
A 1 71  TRP 71  135 135 TRP TRP A . n 
A 1 72  THR 72  136 136 THR THR A . n 
A 1 73  SER 73  137 137 SER SER A . n 
A 1 74  LYS 74  138 138 LYS LYS A . n 
A 1 75  GLN 75  139 139 GLN GLN A . n 
A 1 76  GLY 76  140 140 GLY GLY A . n 
A 1 77  GLU 77  141 141 GLU GLU A . n 
A 1 78  GLY 78  142 142 GLY GLY A . n 
A 1 79  MET 79  143 143 MET MET A . n 
A 1 80  VAL 80  144 144 VAL VAL A . n 
A 1 81  LYS 81  145 145 LYS LYS A . n 
A 1 82  LEU 82  146 146 LEU LEU A . n 
A 1 83  LEU 83  147 147 LEU LEU A . n 
A 1 84  ASP 84  148 148 ASP ASP A . n 
A 1 85  GLU 85  149 149 GLU GLU A . n 
A 1 86  LEU 86  150 150 LEU LEU A . n 
A 1 87  SER 87  151 151 SER SER A . n 
A 1 88  PRO 88  152 152 PRO PRO A . n 
A 1 89  ASN 89  153 153 ASN ASN A . n 
A 1 90  THR 90  154 154 THR THR A . n 
A 1 91  ALA 91  155 155 ALA ALA A . n 
A 1 92  PRO 92  156 156 PRO PRO A . n 
A 1 93  HIS 93  157 157 HIS HIS A . n 
A 1 94  LYS 94  158 158 LYS LYS A . n 
A 1 95  TYR 95  159 159 TYR TYR A . n 
A 1 96  TYR 96  160 160 TYR TYR A . n 
A 1 97  ILE 97  161 161 ILE ILE A . n 
A 1 98  GLY 98  162 162 GLY GLY A . n 
A 1 99  PHE 99  163 163 PHE PHE A . n 
A 1 100 ARG 100 164 164 ARG ARG A . n 
A 1 101 TYR 101 165 165 TYR TYR A . n 
A 1 102 VAL 102 166 166 VAL VAL A . n 
A 1 103 HIS 103 167 167 HIS HIS A . n 
A 1 104 PRO 104 168 168 PRO PRO A . n 
A 1 105 LEU 105 169 169 LEU LEU A . n 
A 1 106 THR 106 170 170 THR THR A . n 
A 1 107 GLU 107 171 171 GLU GLU A . n 
A 1 108 GLU 108 172 172 GLU GLU A . n 
A 1 109 ALA 109 173 173 ALA ALA A . n 
A 1 110 ILE 110 174 174 ILE ILE A . n 
A 1 111 GLU 111 175 175 GLU GLU A . n 
A 1 112 GLU 112 176 176 GLU GLU A . n 
A 1 113 MET 113 177 177 MET MET A . n 
A 1 114 GLU 114 178 178 GLU GLU A . n 
A 1 115 ARG 115 179 179 ARG ARG A . n 
A 1 116 ASP 116 180 180 ASP ASP A . n 
A 1 117 GLY 117 181 181 GLY GLY A . n 
A 1 118 LEU 118 182 182 LEU LEU A . n 
A 1 119 GLU 119 183 183 GLU GLU A . n 
A 1 120 ARG 120 184 184 ARG ARG A . n 
A 1 121 ALA 121 185 185 ALA ALA A . n 
A 1 122 ILE 122 186 186 ILE ILE A . n 
A 1 123 ALA 123 187 187 ALA ALA A . n 
A 1 124 PHE 124 188 188 PHE PHE A . n 
A 1 125 THR 125 189 189 THR THR A . n 
A 1 126 GLN 126 190 190 GLN GLN A . n 
A 1 127 TYR 127 191 191 TYR TYR A . n 
A 1 128 PRO 128 192 192 PRO PRO A . n 
A 1 129 GLN 129 193 193 GLN GLN A . n 
A 1 130 TYR 130 194 194 TYR TYR A . n 
A 1 131 SER 131 195 195 SER SER A . n 
A 1 132 CYS 132 196 196 CYS CYS A . n 
A 1 133 SER 133 197 197 SER SER A . n 
A 1 134 THR 134 198 198 THR THR A . n 
A 1 135 THR 135 199 199 THR THR A . n 
A 1 136 GLY 136 200 200 GLY GLY A . n 
A 1 137 SER 137 201 201 SER SER A . n 
A 1 138 SER 138 202 202 SER SER A . n 
A 1 139 LEU 139 203 203 LEU LEU A . n 
A 1 140 ASN 140 204 204 ASN ASN A . n 
A 1 141 ALA 141 205 205 ALA ALA A . n 
A 1 142 ILE 142 206 206 ILE ILE A . n 
A 1 143 TYR 143 207 207 TYR TYR A . n 
A 1 144 ARG 144 208 208 ARG ARG A . n 
A 1 145 TYR 145 209 209 TYR TYR A . n 
A 1 146 TYR 146 210 210 TYR TYR A . n 
A 1 147 ASN 147 211 211 ASN ASN A . n 
A 1 148 GLN 148 212 212 GLN GLN A . n 
A 1 149 VAL 149 213 213 VAL VAL A . n 
A 1 150 GLY 150 214 214 GLY GLY A . n 
A 1 151 ARG 151 215 215 ARG ARG A . n 
A 1 152 LYS 152 216 216 LYS LYS A . n 
A 1 153 PRO 153 217 217 PRO PRO A . n 
A 1 154 THR 154 218 218 THR THR A . n 
A 1 155 MET 155 219 219 MET MET A . n 
A 1 156 LYS 156 220 220 LYS LYS A . n 
A 1 157 TRP 157 221 221 TRP TRP A . n 
A 1 158 SER 158 222 222 SER SER A . n 
A 1 159 THR 159 223 223 THR THR A . n 
A 1 160 ILE 160 224 224 ILE ILE A . n 
A 1 161 ASP 161 225 225 ASP ASP A . n 
A 1 162 ARG 162 226 226 ARG ARG A . n 
A 1 163 TRP 163 227 227 TRP TRP A . n 
A 1 164 PRO 164 228 228 PRO PRO A . n 
A 1 165 THR 165 229 229 THR THR A . n 
A 1 166 HIS 166 230 230 HIS HIS A . n 
A 1 167 HIS 167 231 231 HIS HIS A . n 
A 1 168 LEU 168 232 232 LEU LEU A . n 
A 1 169 LEU 169 233 233 LEU LEU A . n 
A 1 170 ILE 170 234 234 ILE ILE A . n 
A 1 171 GLN 171 235 235 GLN GLN A . n 
A 1 172 CYS 172 236 236 CYS CYS A . n 
A 1 173 PHE 173 237 237 PHE PHE A . n 
A 1 174 ALA 174 238 238 ALA ALA A . n 
A 1 175 ASP 175 239 239 ASP ASP A . n 
A 1 176 HIS 176 240 240 HIS HIS A . n 
A 1 177 ILE 177 241 241 ILE ILE A . n 
A 1 178 LEU 178 242 242 LEU LEU A . n 
A 1 179 LYS 179 243 243 LYS LYS A . n 
A 1 180 GLU 180 244 244 GLU GLU A . n 
A 1 181 LEU 181 245 245 LEU LEU A . n 
A 1 182 ASP 182 246 246 ASP ASP A . n 
A 1 183 HIS 183 247 247 HIS HIS A . n 
A 1 184 PHE 184 248 248 PHE PHE A . n 
A 1 185 PRO 185 249 249 PRO PRO A . n 
A 1 186 LEU 186 250 250 LEU LEU A . n 
A 1 187 GLU 187 251 251 GLU GLU A . n 
A 1 188 LYS 188 252 252 LYS LYS A . n 
A 1 189 ARG 189 253 253 ARG ARG A . n 
A 1 190 SER 190 254 254 SER SER A . n 
A 1 191 GLU 191 255 255 GLU GLU A . n 
A 1 192 VAL 192 256 256 VAL VAL A . n 
A 1 193 VAL 193 257 257 VAL VAL A . n 
A 1 194 ILE 194 258 258 ILE ILE A . n 
A 1 195 LEU 195 259 259 LEU LEU A . n 
A 1 196 PHE 196 260 260 PHE PHE A . n 
A 1 197 SER 197 261 261 SER SER A . n 
A 1 198 ALA 198 262 262 ALA ALA A . n 
A 1 199 CYS 199 263 263 CYS CYS A . n 
A 1 200 SER 200 264 264 SER SER A . n 
A 1 201 LEU 201 265 265 LEU LEU A . n 
A 1 202 PRO 202 266 266 PRO PRO A . n 
A 1 203 MET 203 267 267 MET MET A . n 
A 1 204 SER 204 268 268 SER SER A . n 
A 1 205 VAL 205 269 269 VAL VAL A . n 
A 1 206 VAL 206 270 270 VAL VAL A . n 
A 1 207 ASN 207 271 271 ASN ASN A . n 
A 1 208 ARG 208 272 272 ARG ARG A . n 
A 1 209 GLY 209 273 273 GLY GLY A . n 
A 1 210 ASP 210 274 274 ASP ASP A . n 
A 1 211 PRO 211 275 275 PRO PRO A . n 
A 1 212 TYR 212 276 276 TYR TYR A . n 
A 1 213 PRO 213 277 277 PRO PRO A . n 
A 1 214 GLN 214 278 278 GLN GLN A . n 
A 1 215 GLU 215 279 279 GLU GLU A . n 
A 1 216 VAL 216 280 280 VAL VAL A . n 
A 1 217 SER 217 281 281 SER SER A . n 
A 1 218 ALA 218 282 282 ALA ALA A . n 
A 1 219 THR 219 283 283 THR THR A . n 
A 1 220 VAL 220 284 284 VAL VAL A . n 
A 1 221 GLN 221 285 285 GLN GLN A . n 
A 1 222 LYS 222 286 286 LYS LYS A . n 
A 1 223 VAL 223 287 287 VAL VAL A . n 
A 1 224 MET 224 288 288 MET MET A . n 
A 1 225 GLU 225 289 289 GLU GLU A . n 
A 1 226 ARG 226 290 290 ARG ARG A . n 
A 1 227 LEU 227 291 291 LEU LEU A . n 
A 1 228 GLU 228 292 292 GLU GLU A . n 
A 1 229 TYR 229 293 293 TYR TYR A . n 
A 1 230 CYS 230 294 294 CYS CYS A . n 
A 1 231 ASN 231 295 295 ASN ASN A . n 
A 1 232 PRO 232 296 296 PRO PRO A . n 
A 1 233 TYR 233 297 297 TYR TYR A . n 
A 1 234 ARG 234 298 298 ARG ARG A . n 
A 1 235 LEU 235 299 299 LEU LEU A . n 
A 1 236 VAL 236 300 300 VAL VAL A . n 
A 1 237 TRP 237 301 301 TRP TRP A . n 
A 1 238 GLN 238 302 302 GLN GLN A . n 
A 1 239 SER 239 303 303 SER SER A . n 
A 1 240 LYS 240 304 304 LYS LYS A . n 
A 1 241 VAL 241 305 305 VAL VAL A . n 
A 1 242 GLY 242 306 306 GLY GLY A . n 
A 1 243 PRO 243 307 307 PRO PRO A . n 
A 1 244 MET 244 308 308 MET MET A . n 
A 1 245 PRO 245 309 309 PRO PRO A . n 
A 1 246 TRP 246 310 310 TRP TRP A . n 
A 1 247 LEU 247 311 311 LEU LEU A . n 
A 1 248 GLY 248 312 312 GLY GLY A . n 
A 1 249 PRO 249 313 313 PRO PRO A . n 
A 1 250 GLN 250 314 314 GLN GLN A . n 
A 1 251 THR 251 315 315 THR THR A . n 
A 1 252 ASP 252 316 316 ASP ASP A . n 
A 1 253 GLU 253 317 317 GLU GLU A . n 
A 1 254 SER 254 318 318 SER SER A . n 
A 1 255 ILE 255 319 319 ILE ILE A . n 
A 1 256 LYS 256 320 320 LYS LYS A . n 
A 1 257 GLY 257 321 321 GLY GLY A . n 
A 1 258 LEU 258 322 322 LEU LEU A . n 
A 1 259 CYS 259 323 323 CYS CYS A . n 
A 1 260 GLU 260 324 324 GLU GLU A . n 
A 1 261 ARG 261 325 325 ARG ARG A . n 
A 1 262 GLY 262 326 326 GLY GLY A . n 
A 1 263 ARG 263 327 327 ARG ARG A . n 
A 1 264 LYS 264 328 328 LYS LYS A . n 
A 1 265 ASN 265 329 329 ASN ASN A . n 
A 1 266 ILE 266 330 330 ILE ILE A . n 
A 1 267 LEU 267 331 331 LEU LEU A . n 
A 1 268 LEU 268 332 332 LEU LEU A . n 
A 1 269 VAL 269 333 333 VAL VAL A . n 
A 1 270 PRO 270 334 334 PRO PRO A . n 
A 1 271 ILE 271 335 335 ILE ILE A . n 
A 1 272 ALA 272 336 336 ALA ALA A . n 
A 1 273 PHE 273 337 337 PHE PHE A . n 
A 1 274 THR 274 338 338 THR THR A . n 
A 1 275 SER 275 339 339 SER SER A . n 
A 1 276 ASP 276 340 340 ASP ASP A . n 
A 1 277 HIS 277 341 341 HIS HIS A . n 
A 1 278 ILE 278 342 342 ILE ILE A . n 
A 1 279 GLU 279 343 343 GLU GLU A . n 
A 1 280 THR 280 344 344 THR THR A . n 
A 1 281 LEU 281 345 345 LEU LEU A . n 
A 1 282 TYR 282 346 346 TYR TYR A . n 
A 1 283 GLU 283 347 347 GLU GLU A . n 
A 1 284 LEU 284 348 348 LEU LEU A . n 
A 1 285 ASP 285 349 349 ASP ASP A . n 
A 1 286 ILE 286 350 350 ILE ILE A . n 
A 1 287 GLU 287 351 351 GLU GLU A . n 
A 1 288 TYR 288 352 352 TYR TYR A . n 
A 1 289 SER 289 353 353 SER SER A . n 
A 1 290 GLN 290 354 354 GLN GLN A . n 
A 1 291 VAL 291 355 355 VAL VAL A . n 
A 1 292 LEU 292 356 356 LEU LEU A . n 
A 1 293 ALA 293 357 357 ALA ALA A . n 
A 1 294 LYS 294 358 358 LYS LYS A . n 
A 1 295 GLU 295 359 359 GLU GLU A . n 
A 1 296 CYS 296 360 360 CYS CYS A . n 
A 1 297 GLY 297 361 361 GLY GLY A . n 
A 1 298 VAL 298 362 362 VAL VAL A . n 
A 1 299 GLU 299 363 363 GLU GLU A . n 
A 1 300 ASN 300 364 364 ASN ASN A . n 
A 1 301 ILE 301 365 365 ILE ILE A . n 
A 1 302 ARG 302 366 366 ARG ARG A . n 
A 1 303 ARG 303 367 367 ARG ARG A . n 
A 1 304 ALA 304 368 368 ALA ALA A . n 
A 1 305 GLU 305 369 369 GLU GLU A . n 
A 1 306 SER 306 370 370 SER SER A . n 
A 1 307 LEU 307 371 371 LEU LEU A . n 
A 1 308 ASN 308 372 372 ASN ASN A . n 
A 1 309 GLY 309 373 373 GLY GLY A . n 
A 1 310 ASN 310 374 374 ASN ASN A . n 
A 1 311 PRO 311 375 375 PRO PRO A . n 
A 1 312 LEU 312 376 376 LEU LEU A . n 
A 1 313 PHE 313 377 377 PHE PHE A . n 
A 1 314 SER 314 378 378 SER SER A . n 
A 1 315 LYS 315 379 379 LYS LYS A . n 
A 1 316 ALA 316 380 380 ALA ALA A . n 
A 1 317 LEU 317 381 381 LEU LEU A . n 
A 1 318 ALA 318 382 382 ALA ALA A . n 
A 1 319 ASP 319 383 383 ASP ASP A . n 
A 1 320 LEU 320 384 384 LEU LEU A . n 
A 1 321 VAL 321 385 385 VAL VAL A . n 
A 1 322 HIS 322 386 386 HIS HIS A . n 
A 1 323 SER 323 387 387 SER SER A . n 
A 1 324 HIS 324 388 388 HIS HIS A . n 
A 1 325 ILE 325 389 389 ILE ILE A . n 
A 1 326 GLN 326 390 390 GLN GLN A . n 
A 1 327 SER 327 391 391 SER SER A . n 
A 1 328 ASN 328 392 392 ASN ASN A . n 
A 1 329 GLU 329 393 393 GLU GLU A . n 
A 1 330 LEU 330 394 394 LEU LEU A . n 
A 1 331 CYS 331 395 395 CYS CYS A . n 
A 1 332 SER 332 396 396 SER SER A . n 
A 1 333 LYS 333 397 397 LYS LYS A . n 
A 1 334 GLN 334 398 398 GLN GLN A . n 
A 1 335 LEU 335 399 399 LEU LEU A . n 
A 1 336 THR 336 400 400 THR THR A . n 
A 1 337 LEU 337 401 401 LEU LEU A . n 
A 1 338 SER 338 402 402 SER SER A . n 
A 1 339 CYS 339 403 403 CYS CYS A . n 
A 1 340 PRO 340 404 404 PRO PRO A . n 
A 1 341 LEU 341 405 405 LEU LEU A . n 
A 1 342 CYS 342 406 406 CYS CYS A . n 
A 1 343 VAL 343 407 407 VAL VAL A . n 
A 1 344 ASN 344 408 408 ASN ASN A . n 
A 1 345 PRO 345 409 409 PRO PRO A . n 
A 1 346 VAL 346 410 410 VAL VAL A . n 
A 1 347 CYS 347 411 411 CYS CYS A . n 
A 1 348 ARG 348 412 412 ARG ARG A . n 
A 1 349 GLU 349 413 413 GLU GLU A . n 
A 1 350 THR 350 414 414 THR THR A . n 
A 1 351 LYS 351 415 415 LYS LYS A . n 
A 1 352 SER 352 416 416 SER SER A . n 
A 1 353 PHE 353 417 417 PHE PHE A . n 
A 1 354 PHE 354 418 418 PHE PHE A . n 
A 1 355 THR 355 419 419 THR THR A . n 
A 1 356 SER 356 420 420 SER SER A . n 
A 1 357 GLN 357 421 421 GLN GLN A . n 
A 1 358 GLN 358 422 422 GLN GLN A . n 
A 1 359 LEU 359 423 423 LEU LEU A . n 
B 1 1   ARG 1   65  65  ARG ARG B . n 
B 1 2   LYS 2   66  66  LYS LYS B . n 
B 1 3   PRO 3   67  67  PRO PRO B . n 
B 1 4   LYS 4   68  68  LYS LYS B . n 
B 1 5   THR 5   69  69  THR THR B . n 
B 1 6   GLY 6   70  70  GLY GLY B . n 
B 1 7   ILE 7   71  71  ILE ILE B . n 
B 1 8   LEU 8   72  72  LEU LEU B . n 
B 1 9   MET 9   73  73  MET MET B . n 
B 1 10  LEU 10  74  74  LEU LEU B . n 
B 1 11  ASN 11  75  75  ASN ASN B . n 
B 1 12  MET 12  76  76  MET MET B . n 
B 1 13  GLY 13  77  77  GLY GLY B . n 
B 1 14  GLY 14  78  78  GLY GLY B . n 
B 1 15  PRO 15  79  79  PRO PRO B . n 
B 1 16  GLU 16  80  80  GLU GLU B . n 
B 1 17  THR 17  81  81  THR THR B . n 
B 1 18  LEU 18  82  82  LEU LEU B . n 
B 1 19  GLY 19  83  83  GLY GLY B . n 
B 1 20  ASP 20  84  84  ASP ASP B . n 
B 1 21  VAL 21  85  85  VAL VAL B . n 
B 1 22  HIS 22  86  86  HIS HIS B . n 
B 1 23  ASP 23  87  87  ASP ASP B . n 
B 1 24  PHE 24  88  88  PHE PHE B . n 
B 1 25  LEU 25  89  89  LEU LEU B . n 
B 1 26  LEU 26  90  90  LEU LEU B . n 
B 1 27  ARG 27  91  91  ARG ARG B . n 
B 1 28  LEU 28  92  92  LEU LEU B . n 
B 1 29  PHE 29  93  93  PHE PHE B . n 
B 1 30  LEU 30  94  94  LEU LEU B . n 
B 1 31  ASP 31  95  95  ASP ASP B . n 
B 1 32  ARG 32  96  96  ARG ARG B . n 
B 1 33  ASP 33  97  97  ASP ASP B . n 
B 1 34  LEU 34  98  98  LEU LEU B . n 
B 1 35  MET 35  99  99  MET MET B . n 
B 1 36  THR 36  100 100 THR THR B . n 
B 1 37  LEU 37  101 101 LEU LEU B . n 
B 1 38  PRO 38  102 102 PRO PRO B . n 
B 1 39  ILE 39  103 103 ILE ILE B . n 
B 1 40  GLN 40  104 104 GLN GLN B . n 
B 1 41  ASN 41  105 105 ASN ASN B . n 
B 1 42  LYS 42  106 106 LYS LYS B . n 
B 1 43  LEU 43  107 107 LEU LEU B . n 
B 1 44  ALA 44  108 108 ALA ALA B . n 
B 1 45  PRO 45  109 109 PRO PRO B . n 
B 1 46  PHE 46  110 110 PHE PHE B . n 
B 1 47  ILE 47  111 111 ILE ILE B . n 
B 1 48  ALA 48  112 112 ALA ALA B . n 
B 1 49  LYS 49  113 113 LYS LYS B . n 
B 1 50  ARG 50  114 114 ARG ARG B . n 
B 1 51  LEU 51  115 115 LEU LEU B . n 
B 1 52  THR 52  116 116 THR THR B . n 
B 1 53  PRO 53  117 117 PRO PRO B . n 
B 1 54  LYS 54  118 118 LYS LYS B . n 
B 1 55  ILE 55  119 119 ILE ILE B . n 
B 1 56  GLN 56  120 120 GLN GLN B . n 
B 1 57  GLU 57  121 121 GLU GLU B . n 
B 1 58  GLN 58  122 122 GLN GLN B . n 
B 1 59  TYR 59  123 123 TYR TYR B . n 
B 1 60  ARG 60  124 124 ARG ARG B . n 
B 1 61  ARG 61  125 125 ARG ARG B . n 
B 1 62  ILE 62  126 126 ILE ILE B . n 
B 1 63  GLY 63  127 127 GLY GLY B . n 
B 1 64  GLY 64  128 128 GLY GLY B . n 
B 1 65  GLY 65  129 129 GLY GLY B . n 
B 1 66  SER 66  130 130 SER SER B . n 
B 1 67  PRO 67  131 131 PRO PRO B . n 
B 1 68  ILE 68  132 132 ILE ILE B . n 
B 1 69  LYS 69  133 133 LYS LYS B . n 
B 1 70  ILE 70  134 134 ILE ILE B . n 
B 1 71  TRP 71  135 135 TRP TRP B . n 
B 1 72  THR 72  136 136 THR THR B . n 
B 1 73  SER 73  137 137 SER SER B . n 
B 1 74  LYS 74  138 138 LYS LYS B . n 
B 1 75  GLN 75  139 139 GLN GLN B . n 
B 1 76  GLY 76  140 140 GLY GLY B . n 
B 1 77  GLU 77  141 141 GLU GLU B . n 
B 1 78  GLY 78  142 142 GLY GLY B . n 
B 1 79  MET 79  143 143 MET MET B . n 
B 1 80  VAL 80  144 144 VAL VAL B . n 
B 1 81  LYS 81  145 145 LYS LYS B . n 
B 1 82  LEU 82  146 146 LEU LEU B . n 
B 1 83  LEU 83  147 147 LEU LEU B . n 
B 1 84  ASP 84  148 148 ASP ASP B . n 
B 1 85  GLU 85  149 149 GLU GLU B . n 
B 1 86  LEU 86  150 150 LEU LEU B . n 
B 1 87  SER 87  151 151 SER SER B . n 
B 1 88  PRO 88  152 152 PRO PRO B . n 
B 1 89  ASN 89  153 153 ASN ASN B . n 
B 1 90  THR 90  154 154 THR THR B . n 
B 1 91  ALA 91  155 155 ALA ALA B . n 
B 1 92  PRO 92  156 156 PRO PRO B . n 
B 1 93  HIS 93  157 157 HIS HIS B . n 
B 1 94  LYS 94  158 158 LYS LYS B . n 
B 1 95  TYR 95  159 159 TYR TYR B . n 
B 1 96  TYR 96  160 160 TYR TYR B . n 
B 1 97  ILE 97  161 161 ILE ILE B . n 
B 1 98  GLY 98  162 162 GLY GLY B . n 
B 1 99  PHE 99  163 163 PHE PHE B . n 
B 1 100 ARG 100 164 164 ARG ARG B . n 
B 1 101 TYR 101 165 165 TYR TYR B . n 
B 1 102 VAL 102 166 166 VAL VAL B . n 
B 1 103 HIS 103 167 167 HIS HIS B . n 
B 1 104 PRO 104 168 168 PRO PRO B . n 
B 1 105 LEU 105 169 169 LEU LEU B . n 
B 1 106 THR 106 170 170 THR THR B . n 
B 1 107 GLU 107 171 171 GLU GLU B . n 
B 1 108 GLU 108 172 172 GLU GLU B . n 
B 1 109 ALA 109 173 173 ALA ALA B . n 
B 1 110 ILE 110 174 174 ILE ILE B . n 
B 1 111 GLU 111 175 175 GLU GLU B . n 
B 1 112 GLU 112 176 176 GLU GLU B . n 
B 1 113 MET 113 177 177 MET MET B . n 
B 1 114 GLU 114 178 178 GLU GLU B . n 
B 1 115 ARG 115 179 179 ARG ARG B . n 
B 1 116 ASP 116 180 180 ASP ASP B . n 
B 1 117 GLY 117 181 181 GLY GLY B . n 
B 1 118 LEU 118 182 182 LEU LEU B . n 
B 1 119 GLU 119 183 183 GLU GLU B . n 
B 1 120 ARG 120 184 184 ARG ARG B . n 
B 1 121 ALA 121 185 185 ALA ALA B . n 
B 1 122 ILE 122 186 186 ILE ILE B . n 
B 1 123 ALA 123 187 187 ALA ALA B . n 
B 1 124 PHE 124 188 188 PHE PHE B . n 
B 1 125 THR 125 189 189 THR THR B . n 
B 1 126 GLN 126 190 190 GLN GLN B . n 
B 1 127 TYR 127 191 191 TYR TYR B . n 
B 1 128 PRO 128 192 192 PRO PRO B . n 
B 1 129 GLN 129 193 193 GLN GLN B . n 
B 1 130 TYR 130 194 194 TYR TYR B . n 
B 1 131 SER 131 195 195 SER SER B . n 
B 1 132 CYS 132 196 196 CYS CYS B . n 
B 1 133 SER 133 197 197 SER SER B . n 
B 1 134 THR 134 198 198 THR THR B . n 
B 1 135 THR 135 199 199 THR THR B . n 
B 1 136 GLY 136 200 200 GLY GLY B . n 
B 1 137 SER 137 201 201 SER SER B . n 
B 1 138 SER 138 202 202 SER SER B . n 
B 1 139 LEU 139 203 203 LEU LEU B . n 
B 1 140 ASN 140 204 204 ASN ASN B . n 
B 1 141 ALA 141 205 205 ALA ALA B . n 
B 1 142 ILE 142 206 206 ILE ILE B . n 
B 1 143 TYR 143 207 207 TYR TYR B . n 
B 1 144 ARG 144 208 208 ARG ARG B . n 
B 1 145 TYR 145 209 209 TYR TYR B . n 
B 1 146 TYR 146 210 210 TYR TYR B . n 
B 1 147 ASN 147 211 211 ASN ASN B . n 
B 1 148 GLN 148 212 212 GLN GLN B . n 
B 1 149 VAL 149 213 213 VAL VAL B . n 
B 1 150 GLY 150 214 214 GLY GLY B . n 
B 1 151 ARG 151 215 215 ARG ARG B . n 
B 1 152 LYS 152 216 216 LYS LYS B . n 
B 1 153 PRO 153 217 217 PRO PRO B . n 
B 1 154 THR 154 218 218 THR THR B . n 
B 1 155 MET 155 219 219 MET MET B . n 
B 1 156 LYS 156 220 220 LYS LYS B . n 
B 1 157 TRP 157 221 221 TRP TRP B . n 
B 1 158 SER 158 222 222 SER SER B . n 
B 1 159 THR 159 223 223 THR THR B . n 
B 1 160 ILE 160 224 224 ILE ILE B . n 
B 1 161 ASP 161 225 225 ASP ASP B . n 
B 1 162 ARG 162 226 226 ARG ARG B . n 
B 1 163 TRP 163 227 227 TRP TRP B . n 
B 1 164 PRO 164 228 228 PRO PRO B . n 
B 1 165 THR 165 229 229 THR THR B . n 
B 1 166 HIS 166 230 230 HIS HIS B . n 
B 1 167 HIS 167 231 231 HIS HIS B . n 
B 1 168 LEU 168 232 232 LEU LEU B . n 
B 1 169 LEU 169 233 233 LEU LEU B . n 
B 1 170 ILE 170 234 234 ILE ILE B . n 
B 1 171 GLN 171 235 235 GLN GLN B . n 
B 1 172 CYS 172 236 236 CYS CYS B . n 
B 1 173 PHE 173 237 237 PHE PHE B . n 
B 1 174 ALA 174 238 238 ALA ALA B . n 
B 1 175 ASP 175 239 239 ASP ASP B . n 
B 1 176 HIS 176 240 240 HIS HIS B . n 
B 1 177 ILE 177 241 241 ILE ILE B . n 
B 1 178 LEU 178 242 242 LEU LEU B . n 
B 1 179 LYS 179 243 243 LYS LYS B . n 
B 1 180 GLU 180 244 244 GLU GLU B . n 
B 1 181 LEU 181 245 245 LEU LEU B . n 
B 1 182 ASP 182 246 246 ASP ASP B . n 
B 1 183 HIS 183 247 247 HIS HIS B . n 
B 1 184 PHE 184 248 248 PHE PHE B . n 
B 1 185 PRO 185 249 249 PRO PRO B . n 
B 1 186 LEU 186 250 250 LEU LEU B . n 
B 1 187 GLU 187 251 251 GLU GLU B . n 
B 1 188 LYS 188 252 252 LYS LYS B . n 
B 1 189 ARG 189 253 253 ARG ARG B . n 
B 1 190 SER 190 254 254 SER SER B . n 
B 1 191 GLU 191 255 255 GLU GLU B . n 
B 1 192 VAL 192 256 256 VAL VAL B . n 
B 1 193 VAL 193 257 257 VAL VAL B . n 
B 1 194 ILE 194 258 258 ILE ILE B . n 
B 1 195 LEU 195 259 259 LEU LEU B . n 
B 1 196 PHE 196 260 260 PHE PHE B . n 
B 1 197 SER 197 261 261 SER SER B . n 
B 1 198 ALA 198 262 262 ALA ALA B . n 
B 1 199 CYS 199 263 263 CYS CYS B . n 
B 1 200 SER 200 264 264 SER SER B . n 
B 1 201 LEU 201 265 265 LEU LEU B . n 
B 1 202 PRO 202 266 266 PRO PRO B . n 
B 1 203 MET 203 267 267 MET MET B . n 
B 1 204 SER 204 268 268 SER SER B . n 
B 1 205 VAL 205 269 269 VAL VAL B . n 
B 1 206 VAL 206 270 270 VAL VAL B . n 
B 1 207 ASN 207 271 271 ASN ASN B . n 
B 1 208 ARG 208 272 272 ARG ARG B . n 
B 1 209 GLY 209 273 273 GLY GLY B . n 
B 1 210 ASP 210 274 274 ASP ASP B . n 
B 1 211 PRO 211 275 275 PRO PRO B . n 
B 1 212 TYR 212 276 276 TYR TYR B . n 
B 1 213 PRO 213 277 277 PRO PRO B . n 
B 1 214 GLN 214 278 278 GLN GLN B . n 
B 1 215 GLU 215 279 279 GLU GLU B . n 
B 1 216 VAL 216 280 280 VAL VAL B . n 
B 1 217 SER 217 281 281 SER SER B . n 
B 1 218 ALA 218 282 282 ALA ALA B . n 
B 1 219 THR 219 283 283 THR THR B . n 
B 1 220 VAL 220 284 284 VAL VAL B . n 
B 1 221 GLN 221 285 285 GLN GLN B . n 
B 1 222 LYS 222 286 286 LYS LYS B . n 
B 1 223 VAL 223 287 287 VAL VAL B . n 
B 1 224 MET 224 288 288 MET MET B . n 
B 1 225 GLU 225 289 289 GLU GLU B . n 
B 1 226 ARG 226 290 290 ARG ARG B . n 
B 1 227 LEU 227 291 291 LEU LEU B . n 
B 1 228 GLU 228 292 292 GLU GLU B . n 
B 1 229 TYR 229 293 293 TYR TYR B . n 
B 1 230 CYS 230 294 294 CYS CYS B . n 
B 1 231 ASN 231 295 295 ASN ASN B . n 
B 1 232 PRO 232 296 296 PRO PRO B . n 
B 1 233 TYR 233 297 297 TYR TYR B . n 
B 1 234 ARG 234 298 298 ARG ARG B . n 
B 1 235 LEU 235 299 299 LEU LEU B . n 
B 1 236 VAL 236 300 300 VAL VAL B . n 
B 1 237 TRP 237 301 301 TRP TRP B . n 
B 1 238 GLN 238 302 302 GLN GLN B . n 
B 1 239 SER 239 303 303 SER SER B . n 
B 1 240 LYS 240 304 304 LYS LYS B . n 
B 1 241 VAL 241 305 305 VAL VAL B . n 
B 1 242 GLY 242 306 306 GLY GLY B . n 
B 1 243 PRO 243 307 307 PRO PRO B . n 
B 1 244 MET 244 308 308 MET MET B . n 
B 1 245 PRO 245 309 309 PRO PRO B . n 
B 1 246 TRP 246 310 310 TRP TRP B . n 
B 1 247 LEU 247 311 311 LEU LEU B . n 
B 1 248 GLY 248 312 312 GLY GLY B . n 
B 1 249 PRO 249 313 313 PRO PRO B . n 
B 1 250 GLN 250 314 314 GLN GLN B . n 
B 1 251 THR 251 315 315 THR THR B . n 
B 1 252 ASP 252 316 316 ASP ASP B . n 
B 1 253 GLU 253 317 317 GLU GLU B . n 
B 1 254 SER 254 318 318 SER SER B . n 
B 1 255 ILE 255 319 319 ILE ILE B . n 
B 1 256 LYS 256 320 320 LYS LYS B . n 
B 1 257 GLY 257 321 321 GLY GLY B . n 
B 1 258 LEU 258 322 322 LEU LEU B . n 
B 1 259 CYS 259 323 323 CYS CYS B . n 
B 1 260 GLU 260 324 324 GLU GLU B . n 
B 1 261 ARG 261 325 325 ARG ARG B . n 
B 1 262 GLY 262 326 326 GLY GLY B . n 
B 1 263 ARG 263 327 327 ARG ARG B . n 
B 1 264 LYS 264 328 328 LYS LYS B . n 
B 1 265 ASN 265 329 329 ASN ASN B . n 
B 1 266 ILE 266 330 330 ILE ILE B . n 
B 1 267 LEU 267 331 331 LEU LEU B . n 
B 1 268 LEU 268 332 332 LEU LEU B . n 
B 1 269 VAL 269 333 333 VAL VAL B . n 
B 1 270 PRO 270 334 334 PRO PRO B . n 
B 1 271 ILE 271 335 335 ILE ILE B . n 
B 1 272 ALA 272 336 336 ALA ALA B . n 
B 1 273 PHE 273 337 337 PHE PHE B . n 
B 1 274 THR 274 338 338 THR THR B . n 
B 1 275 SER 275 339 339 SER SER B . n 
B 1 276 ASP 276 340 340 ASP ASP B . n 
B 1 277 HIS 277 341 341 HIS HIS B . n 
B 1 278 ILE 278 342 342 ILE ILE B . n 
B 1 279 GLU 279 343 343 GLU GLU B . n 
B 1 280 THR 280 344 344 THR THR B . n 
B 1 281 LEU 281 345 345 LEU LEU B . n 
B 1 282 TYR 282 346 346 TYR TYR B . n 
B 1 283 GLU 283 347 347 GLU GLU B . n 
B 1 284 LEU 284 348 348 LEU LEU B . n 
B 1 285 ASP 285 349 349 ASP ASP B . n 
B 1 286 ILE 286 350 350 ILE ILE B . n 
B 1 287 GLU 287 351 351 GLU GLU B . n 
B 1 288 TYR 288 352 352 TYR TYR B . n 
B 1 289 SER 289 353 353 SER SER B . n 
B 1 290 GLN 290 354 354 GLN GLN B . n 
B 1 291 VAL 291 355 355 VAL VAL B . n 
B 1 292 LEU 292 356 356 LEU LEU B . n 
B 1 293 ALA 293 357 357 ALA ALA B . n 
B 1 294 LYS 294 358 358 LYS LYS B . n 
B 1 295 GLU 295 359 359 GLU GLU B . n 
B 1 296 CYS 296 360 360 CYS CYS B . n 
B 1 297 GLY 297 361 361 GLY GLY B . n 
B 1 298 VAL 298 362 362 VAL VAL B . n 
B 1 299 GLU 299 363 363 GLU GLU B . n 
B 1 300 ASN 300 364 364 ASN ASN B . n 
B 1 301 ILE 301 365 365 ILE ILE B . n 
B 1 302 ARG 302 366 366 ARG ARG B . n 
B 1 303 ARG 303 367 367 ARG ARG B . n 
B 1 304 ALA 304 368 368 ALA ALA B . n 
B 1 305 GLU 305 369 369 GLU GLU B . n 
B 1 306 SER 306 370 370 SER SER B . n 
B 1 307 LEU 307 371 371 LEU LEU B . n 
B 1 308 ASN 308 372 372 ASN ASN B . n 
B 1 309 GLY 309 373 373 GLY GLY B . n 
B 1 310 ASN 310 374 374 ASN ASN B . n 
B 1 311 PRO 311 375 375 PRO PRO B . n 
B 1 312 LEU 312 376 376 LEU LEU B . n 
B 1 313 PHE 313 377 377 PHE PHE B . n 
B 1 314 SER 314 378 378 SER SER B . n 
B 1 315 LYS 315 379 379 LYS LYS B . n 
B 1 316 ALA 316 380 380 ALA ALA B . n 
B 1 317 LEU 317 381 381 LEU LEU B . n 
B 1 318 ALA 318 382 382 ALA ALA B . n 
B 1 319 ASP 319 383 383 ASP ASP B . n 
B 1 320 LEU 320 384 384 LEU LEU B . n 
B 1 321 VAL 321 385 385 VAL VAL B . n 
B 1 322 HIS 322 386 386 HIS HIS B . n 
B 1 323 SER 323 387 387 SER SER B . n 
B 1 324 HIS 324 388 388 HIS HIS B . n 
B 1 325 ILE 325 389 389 ILE ILE B . n 
B 1 326 GLN 326 390 390 GLN GLN B . n 
B 1 327 SER 327 391 391 SER SER B . n 
B 1 328 ASN 328 392 392 ASN ASN B . n 
B 1 329 GLU 329 393 393 GLU GLU B . n 
B 1 330 LEU 330 394 394 LEU LEU B . n 
B 1 331 CYS 331 395 395 CYS CYS B . n 
B 1 332 SER 332 396 396 SER SER B . n 
B 1 333 LYS 333 397 397 LYS LYS B . n 
B 1 334 GLN 334 398 398 GLN GLN B . n 
B 1 335 LEU 335 399 399 LEU LEU B . n 
B 1 336 THR 336 400 400 THR THR B . n 
B 1 337 LEU 337 401 401 LEU LEU B . n 
B 1 338 SER 338 402 402 SER SER B . n 
B 1 339 CYS 339 403 403 CYS CYS B . n 
B 1 340 PRO 340 404 404 PRO PRO B . n 
B 1 341 LEU 341 405 405 LEU LEU B . n 
B 1 342 CYS 342 406 406 CYS CYS B . n 
B 1 343 VAL 343 407 407 VAL VAL B . n 
B 1 344 ASN 344 408 408 ASN ASN B . n 
B 1 345 PRO 345 409 409 PRO PRO B . n 
B 1 346 VAL 346 410 410 VAL VAL B . n 
B 1 347 CYS 347 411 411 CYS CYS B . n 
B 1 348 ARG 348 412 412 ARG ARG B . n 
B 1 349 GLU 349 413 413 GLU GLU B . n 
B 1 350 THR 350 414 414 THR THR B . n 
B 1 351 LYS 351 415 415 LYS LYS B . n 
B 1 352 SER 352 416 416 SER SER B . n 
B 1 353 PHE 353 417 417 PHE PHE B . n 
B 1 354 PHE 354 418 418 PHE PHE B . n 
B 1 355 THR 355 419 419 THR THR B . n 
B 1 356 SER 356 420 420 SER SER B . n 
B 1 357 GLN 357 421 421 GLN GLN B . n 
B 1 358 GLN 358 422 422 GLN GLN B . n 
B 1 359 LEU 359 423 423 LEU LEU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 FES 1   499  499 FES FES A . 
D 3 CHD 1   501  501 CHD CHD A . 
E 3 CHD 1   502  502 CHD CHD A . 
F 3 CHD 1   503  503 CHD CHD A . 
G 2 FES 1   999  999 FES FES B . 
H 3 CHD 1   501  501 CHD CHD B . 
I 3 CHD 1   502  502 CHD CHD B . 
J 3 CHD 1   503  503 CHD CHD B . 
K 4 HOH 1   504  2   HOH HOH A . 
K 4 HOH 2   505  3   HOH HOH A . 
K 4 HOH 3   506  5   HOH HOH A . 
K 4 HOH 4   507  8   HOH HOH A . 
K 4 HOH 5   508  9   HOH HOH A . 
K 4 HOH 6   509  10  HOH HOH A . 
K 4 HOH 7   510  11  HOH HOH A . 
K 4 HOH 8   511  17  HOH HOH A . 
K 4 HOH 9   512  18  HOH HOH A . 
K 4 HOH 10  513  19  HOH HOH A . 
K 4 HOH 11  514  22  HOH HOH A . 
K 4 HOH 12  515  25  HOH HOH A . 
K 4 HOH 13  516  27  HOH HOH A . 
K 4 HOH 14  517  30  HOH HOH A . 
K 4 HOH 15  518  31  HOH HOH A . 
K 4 HOH 16  519  32  HOH HOH A . 
K 4 HOH 17  520  39  HOH HOH A . 
K 4 HOH 18  521  42  HOH HOH A . 
K 4 HOH 19  522  43  HOH HOH A . 
K 4 HOH 20  523  44  HOH HOH A . 
K 4 HOH 21  524  47  HOH HOH A . 
K 4 HOH 22  525  50  HOH HOH A . 
K 4 HOH 23  526  51  HOH HOH A . 
K 4 HOH 24  527  52  HOH HOH A . 
K 4 HOH 25  528  54  HOH HOH A . 
K 4 HOH 26  529  55  HOH HOH A . 
K 4 HOH 27  530  56  HOH HOH A . 
K 4 HOH 28  531  57  HOH HOH A . 
K 4 HOH 29  532  59  HOH HOH A . 
K 4 HOH 30  533  60  HOH HOH A . 
K 4 HOH 31  534  61  HOH HOH A . 
K 4 HOH 32  535  64  HOH HOH A . 
K 4 HOH 33  536  65  HOH HOH A . 
K 4 HOH 34  537  74  HOH HOH A . 
K 4 HOH 35  538  76  HOH HOH A . 
K 4 HOH 36  539  78  HOH HOH A . 
K 4 HOH 37  540  79  HOH HOH A . 
K 4 HOH 38  541  80  HOH HOH A . 
K 4 HOH 39  542  83  HOH HOH A . 
K 4 HOH 40  543  84  HOH HOH A . 
K 4 HOH 41  544  88  HOH HOH A . 
K 4 HOH 42  545  90  HOH HOH A . 
K 4 HOH 43  546  91  HOH HOH A . 
K 4 HOH 44  547  93  HOH HOH A . 
K 4 HOH 45  548  94  HOH HOH A . 
K 4 HOH 46  549  95  HOH HOH A . 
K 4 HOH 47  550  100 HOH HOH A . 
K 4 HOH 48  551  101 HOH HOH A . 
K 4 HOH 49  552  102 HOH HOH A . 
K 4 HOH 50  553  104 HOH HOH A . 
K 4 HOH 51  554  105 HOH HOH A . 
K 4 HOH 52  555  107 HOH HOH A . 
K 4 HOH 53  556  108 HOH HOH A . 
K 4 HOH 54  557  109 HOH HOH A . 
K 4 HOH 55  558  110 HOH HOH A . 
K 4 HOH 56  559  111 HOH HOH A . 
K 4 HOH 57  560  115 HOH HOH A . 
K 4 HOH 58  561  116 HOH HOH A . 
K 4 HOH 59  562  117 HOH HOH A . 
K 4 HOH 60  563  120 HOH HOH A . 
K 4 HOH 61  564  122 HOH HOH A . 
K 4 HOH 62  565  123 HOH HOH A . 
K 4 HOH 63  566  124 HOH HOH A . 
K 4 HOH 64  567  125 HOH HOH A . 
K 4 HOH 65  568  127 HOH HOH A . 
K 4 HOH 66  569  128 HOH HOH A . 
K 4 HOH 67  570  131 HOH HOH A . 
K 4 HOH 68  571  134 HOH HOH A . 
K 4 HOH 69  572  136 HOH HOH A . 
K 4 HOH 70  573  137 HOH HOH A . 
K 4 HOH 71  574  138 HOH HOH A . 
K 4 HOH 72  575  140 HOH HOH A . 
K 4 HOH 73  576  141 HOH HOH A . 
K 4 HOH 74  577  142 HOH HOH A . 
K 4 HOH 75  578  143 HOH HOH A . 
K 4 HOH 76  579  145 HOH HOH A . 
K 4 HOH 77  580  150 HOH HOH A . 
K 4 HOH 78  581  153 HOH HOH A . 
K 4 HOH 79  582  155 HOH HOH A . 
K 4 HOH 80  583  159 HOH HOH A . 
K 4 HOH 81  584  160 HOH HOH A . 
K 4 HOH 82  585  161 HOH HOH A . 
K 4 HOH 83  586  162 HOH HOH A . 
K 4 HOH 84  587  163 HOH HOH A . 
K 4 HOH 85  588  164 HOH HOH A . 
K 4 HOH 86  589  165 HOH HOH A . 
K 4 HOH 87  590  166 HOH HOH A . 
K 4 HOH 88  591  169 HOH HOH A . 
K 4 HOH 89  592  170 HOH HOH A . 
K 4 HOH 90  593  173 HOH HOH A . 
K 4 HOH 91  594  182 HOH HOH A . 
K 4 HOH 92  595  184 HOH HOH A . 
K 4 HOH 93  596  186 HOH HOH A . 
K 4 HOH 94  597  187 HOH HOH A . 
K 4 HOH 95  598  189 HOH HOH A . 
K 4 HOH 96  599  194 HOH HOH A . 
K 4 HOH 97  600  197 HOH HOH A . 
K 4 HOH 98  601  199 HOH HOH A . 
K 4 HOH 99  602  200 HOH HOH A . 
K 4 HOH 100 603  201 HOH HOH A . 
K 4 HOH 101 604  203 HOH HOH A . 
K 4 HOH 102 605  204 HOH HOH A . 
K 4 HOH 103 606  205 HOH HOH A . 
K 4 HOH 104 607  206 HOH HOH A . 
K 4 HOH 105 608  207 HOH HOH A . 
K 4 HOH 106 609  208 HOH HOH A . 
K 4 HOH 107 610  212 HOH HOH A . 
K 4 HOH 108 611  216 HOH HOH A . 
K 4 HOH 109 612  219 HOH HOH A . 
K 4 HOH 110 613  220 HOH HOH A . 
K 4 HOH 111 614  221 HOH HOH A . 
K 4 HOH 112 615  222 HOH HOH A . 
K 4 HOH 113 616  223 HOH HOH A . 
K 4 HOH 114 617  224 HOH HOH A . 
K 4 HOH 115 618  225 HOH HOH A . 
K 4 HOH 116 619  228 HOH HOH A . 
K 4 HOH 117 620  230 HOH HOH A . 
K 4 HOH 118 621  231 HOH HOH A . 
K 4 HOH 119 622  232 HOH HOH A . 
K 4 HOH 120 623  233 HOH HOH A . 
K 4 HOH 121 624  235 HOH HOH A . 
K 4 HOH 122 625  241 HOH HOH A . 
K 4 HOH 123 626  242 HOH HOH A . 
K 4 HOH 124 627  245 HOH HOH A . 
K 4 HOH 125 628  249 HOH HOH A . 
K 4 HOH 126 629  250 HOH HOH A . 
K 4 HOH 127 630  252 HOH HOH A . 
K 4 HOH 128 631  253 HOH HOH A . 
K 4 HOH 129 632  254 HOH HOH A . 
K 4 HOH 130 633  256 HOH HOH A . 
K 4 HOH 131 634  257 HOH HOH A . 
K 4 HOH 132 635  258 HOH HOH A . 
K 4 HOH 133 636  259 HOH HOH A . 
K 4 HOH 134 637  261 HOH HOH A . 
K 4 HOH 135 638  262 HOH HOH A . 
K 4 HOH 136 639  267 HOH HOH A . 
K 4 HOH 137 640  269 HOH HOH A . 
K 4 HOH 138 641  270 HOH HOH A . 
K 4 HOH 139 642  272 HOH HOH A . 
K 4 HOH 140 643  273 HOH HOH A . 
K 4 HOH 141 644  274 HOH HOH A . 
K 4 HOH 142 645  277 HOH HOH A . 
K 4 HOH 143 646  281 HOH HOH A . 
K 4 HOH 144 647  284 HOH HOH A . 
K 4 HOH 145 648  285 HOH HOH A . 
K 4 HOH 146 649  287 HOH HOH A . 
K 4 HOH 147 650  288 HOH HOH A . 
K 4 HOH 148 651  290 HOH HOH A . 
K 4 HOH 149 652  292 HOH HOH A . 
K 4 HOH 150 653  293 HOH HOH A . 
K 4 HOH 151 654  294 HOH HOH A . 
K 4 HOH 152 655  295 HOH HOH A . 
K 4 HOH 153 656  298 HOH HOH A . 
K 4 HOH 154 657  299 HOH HOH A . 
K 4 HOH 155 658  301 HOH HOH A . 
K 4 HOH 156 659  303 HOH HOH A . 
K 4 HOH 157 660  304 HOH HOH A . 
L 4 HOH 1   1000 1   HOH HOH B . 
L 4 HOH 2   1001 4   HOH HOH B . 
L 4 HOH 3   1002 6   HOH HOH B . 
L 4 HOH 4   1003 7   HOH HOH B . 
L 4 HOH 5   1004 12  HOH HOH B . 
L 4 HOH 6   1005 13  HOH HOH B . 
L 4 HOH 7   1006 14  HOH HOH B . 
L 4 HOH 8   1007 15  HOH HOH B . 
L 4 HOH 9   1008 16  HOH HOH B . 
L 4 HOH 10  1009 20  HOH HOH B . 
L 4 HOH 11  1010 21  HOH HOH B . 
L 4 HOH 12  1011 23  HOH HOH B . 
L 4 HOH 13  1012 24  HOH HOH B . 
L 4 HOH 14  1013 26  HOH HOH B . 
L 4 HOH 15  1014 28  HOH HOH B . 
L 4 HOH 16  1015 29  HOH HOH B . 
L 4 HOH 17  1016 33  HOH HOH B . 
L 4 HOH 18  1017 34  HOH HOH B . 
L 4 HOH 19  1018 35  HOH HOH B . 
L 4 HOH 20  1019 36  HOH HOH B . 
L 4 HOH 21  1020 37  HOH HOH B . 
L 4 HOH 22  1021 38  HOH HOH B . 
L 4 HOH 23  1022 40  HOH HOH B . 
L 4 HOH 24  1023 41  HOH HOH B . 
L 4 HOH 25  1024 45  HOH HOH B . 
L 4 HOH 26  1025 46  HOH HOH B . 
L 4 HOH 27  1026 48  HOH HOH B . 
L 4 HOH 28  1027 49  HOH HOH B . 
L 4 HOH 29  1028 53  HOH HOH B . 
L 4 HOH 30  1029 58  HOH HOH B . 
L 4 HOH 31  1030 62  HOH HOH B . 
L 4 HOH 32  1031 63  HOH HOH B . 
L 4 HOH 33  1032 66  HOH HOH B . 
L 4 HOH 34  1033 67  HOH HOH B . 
L 4 HOH 35  1034 68  HOH HOH B . 
L 4 HOH 36  1035 69  HOH HOH B . 
L 4 HOH 37  1036 70  HOH HOH B . 
L 4 HOH 38  1037 71  HOH HOH B . 
L 4 HOH 39  1038 72  HOH HOH B . 
L 4 HOH 40  1039 73  HOH HOH B . 
L 4 HOH 41  1040 75  HOH HOH B . 
L 4 HOH 42  1041 77  HOH HOH B . 
L 4 HOH 43  1042 81  HOH HOH B . 
L 4 HOH 44  1043 82  HOH HOH B . 
L 4 HOH 45  1044 85  HOH HOH B . 
L 4 HOH 46  1045 86  HOH HOH B . 
L 4 HOH 47  1046 87  HOH HOH B . 
L 4 HOH 48  1047 89  HOH HOH B . 
L 4 HOH 49  1048 92  HOH HOH B . 
L 4 HOH 50  1049 96  HOH HOH B . 
L 4 HOH 51  1050 97  HOH HOH B . 
L 4 HOH 52  1051 98  HOH HOH B . 
L 4 HOH 53  1052 99  HOH HOH B . 
L 4 HOH 54  1053 103 HOH HOH B . 
L 4 HOH 55  1054 106 HOH HOH B . 
L 4 HOH 56  1055 112 HOH HOH B . 
L 4 HOH 57  1056 113 HOH HOH B . 
L 4 HOH 58  1057 114 HOH HOH B . 
L 4 HOH 59  1058 118 HOH HOH B . 
L 4 HOH 60  1059 119 HOH HOH B . 
L 4 HOH 61  1060 121 HOH HOH B . 
L 4 HOH 62  1061 126 HOH HOH B . 
L 4 HOH 63  1062 129 HOH HOH B . 
L 4 HOH 64  1063 130 HOH HOH B . 
L 4 HOH 65  1064 132 HOH HOH B . 
L 4 HOH 66  1065 133 HOH HOH B . 
L 4 HOH 67  1066 135 HOH HOH B . 
L 4 HOH 68  1067 139 HOH HOH B . 
L 4 HOH 69  1068 144 HOH HOH B . 
L 4 HOH 70  1069 146 HOH HOH B . 
L 4 HOH 71  1070 147 HOH HOH B . 
L 4 HOH 72  1071 148 HOH HOH B . 
L 4 HOH 73  1072 149 HOH HOH B . 
L 4 HOH 74  1073 151 HOH HOH B . 
L 4 HOH 75  1074 152 HOH HOH B . 
L 4 HOH 76  1075 154 HOH HOH B . 
L 4 HOH 77  1076 156 HOH HOH B . 
L 4 HOH 78  1077 157 HOH HOH B . 
L 4 HOH 79  1078 158 HOH HOH B . 
L 4 HOH 80  1079 167 HOH HOH B . 
L 4 HOH 81  1080 168 HOH HOH B . 
L 4 HOH 82  1081 171 HOH HOH B . 
L 4 HOH 83  1082 172 HOH HOH B . 
L 4 HOH 84  1083 174 HOH HOH B . 
L 4 HOH 85  1084 175 HOH HOH B . 
L 4 HOH 86  1085 176 HOH HOH B . 
L 4 HOH 87  1086 177 HOH HOH B . 
L 4 HOH 88  1087 178 HOH HOH B . 
L 4 HOH 89  1088 179 HOH HOH B . 
L 4 HOH 90  1089 180 HOH HOH B . 
L 4 HOH 91  1090 181 HOH HOH B . 
L 4 HOH 92  1091 183 HOH HOH B . 
L 4 HOH 93  1092 185 HOH HOH B . 
L 4 HOH 94  1093 188 HOH HOH B . 
L 4 HOH 95  1094 190 HOH HOH B . 
L 4 HOH 96  1095 191 HOH HOH B . 
L 4 HOH 97  1096 192 HOH HOH B . 
L 4 HOH 98  1097 193 HOH HOH B . 
L 4 HOH 99  1098 195 HOH HOH B . 
L 4 HOH 100 1099 196 HOH HOH B . 
L 4 HOH 101 1100 198 HOH HOH B . 
L 4 HOH 102 1101 202 HOH HOH B . 
L 4 HOH 103 1102 209 HOH HOH B . 
L 4 HOH 104 1103 210 HOH HOH B . 
L 4 HOH 105 1104 211 HOH HOH B . 
L 4 HOH 106 1105 213 HOH HOH B . 
L 4 HOH 107 1106 214 HOH HOH B . 
L 4 HOH 108 1107 215 HOH HOH B . 
L 4 HOH 109 1108 217 HOH HOH B . 
L 4 HOH 110 1109 218 HOH HOH B . 
L 4 HOH 111 1110 226 HOH HOH B . 
L 4 HOH 112 1111 227 HOH HOH B . 
L 4 HOH 113 1112 229 HOH HOH B . 
L 4 HOH 114 1113 234 HOH HOH B . 
L 4 HOH 115 1114 236 HOH HOH B . 
L 4 HOH 116 1115 237 HOH HOH B . 
L 4 HOH 117 1116 238 HOH HOH B . 
L 4 HOH 118 1117 239 HOH HOH B . 
L 4 HOH 119 1118 240 HOH HOH B . 
L 4 HOH 120 1119 243 HOH HOH B . 
L 4 HOH 121 1120 244 HOH HOH B . 
L 4 HOH 122 1121 246 HOH HOH B . 
L 4 HOH 123 1122 247 HOH HOH B . 
L 4 HOH 124 1123 248 HOH HOH B . 
L 4 HOH 125 1124 251 HOH HOH B . 
L 4 HOH 126 1125 255 HOH HOH B . 
L 4 HOH 127 1126 260 HOH HOH B . 
L 4 HOH 128 1127 263 HOH HOH B . 
L 4 HOH 129 1128 264 HOH HOH B . 
L 4 HOH 130 1129 265 HOH HOH B . 
L 4 HOH 131 1130 266 HOH HOH B . 
L 4 HOH 132 1131 268 HOH HOH B . 
L 4 HOH 133 1132 271 HOH HOH B . 
L 4 HOH 134 1133 275 HOH HOH B . 
L 4 HOH 135 1134 276 HOH HOH B . 
L 4 HOH 136 1135 278 HOH HOH B . 
L 4 HOH 137 1136 279 HOH HOH B . 
L 4 HOH 138 1137 280 HOH HOH B . 
L 4 HOH 139 1138 282 HOH HOH B . 
L 4 HOH 140 1139 283 HOH HOH B . 
L 4 HOH 141 1140 286 HOH HOH B . 
L 4 HOH 142 1141 289 HOH HOH B . 
L 4 HOH 143 1142 291 HOH HOH B . 
L 4 HOH 144 1143 296 HOH HOH B . 
L 4 HOH 145 1144 297 HOH HOH B . 
L 4 HOH 146 1145 300 HOH HOH B . 
L 4 HOH 147 1146 302 HOH HOH B . 
L 4 HOH 148 1147 305 HOH HOH B . 
L 4 HOH 149 1148 306 HOH HOH B . 
L 4 HOH 150 1149 307 HOH HOH B . 
L 4 HOH 151 1150 308 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 132 ? A CYS 196 ? 1_555 FE2 ? C FES . ? A FES 499 ? 1_555 S1 ? C FES .   ? A FES 499 ? 1_555 115.2 ? 
2  SG ? A CYS 132 ? A CYS 196 ? 1_555 FE2 ? C FES . ? A FES 499 ? 1_555 S2 ? C FES .   ? A FES 499 ? 1_555 112.0 ? 
3  S1 ? C FES .   ? A FES 499 ? 1_555 FE2 ? C FES . ? A FES 499 ? 1_555 S2 ? C FES .   ? A FES 499 ? 1_555 105.6 ? 
4  SG ? A CYS 132 ? A CYS 196 ? 1_555 FE2 ? C FES . ? A FES 499 ? 1_555 SG ? A CYS 339 ? A CYS 403 ? 1_555 93.1  ? 
5  S1 ? C FES .   ? A FES 499 ? 1_555 FE2 ? C FES . ? A FES 499 ? 1_555 SG ? A CYS 339 ? A CYS 403 ? 1_555 111.3 ? 
6  S2 ? C FES .   ? A FES 499 ? 1_555 FE2 ? C FES . ? A FES 499 ? 1_555 SG ? A CYS 339 ? A CYS 403 ? 1_555 119.9 ? 
7  SG ? A CYS 342 ? A CYS 406 ? 1_555 FE1 ? C FES . ? A FES 499 ? 1_555 S1 ? C FES .   ? A FES 499 ? 1_555 118.8 ? 
8  SG ? A CYS 342 ? A CYS 406 ? 1_555 FE1 ? C FES . ? A FES 499 ? 1_555 S2 ? C FES .   ? A FES 499 ? 1_555 111.2 ? 
9  S1 ? C FES .   ? A FES 499 ? 1_555 FE1 ? C FES . ? A FES 499 ? 1_555 S2 ? C FES .   ? A FES 499 ? 1_555 105.8 ? 
10 SG ? A CYS 342 ? A CYS 406 ? 1_555 FE1 ? C FES . ? A FES 499 ? 1_555 SG ? A CYS 347 ? A CYS 411 ? 1_555 97.2  ? 
11 S1 ? C FES .   ? A FES 499 ? 1_555 FE1 ? C FES . ? A FES 499 ? 1_555 SG ? A CYS 347 ? A CYS 411 ? 1_555 104.3 ? 
12 S2 ? C FES .   ? A FES 499 ? 1_555 FE1 ? C FES . ? A FES 499 ? 1_555 SG ? A CYS 347 ? A CYS 411 ? 1_555 119.9 ? 
13 SG ? B CYS 132 ? B CYS 196 ? 1_555 FE1 ? G FES . ? B FES 999 ? 1_555 S1 ? G FES .   ? B FES 999 ? 1_555 116.6 ? 
14 SG ? B CYS 132 ? B CYS 196 ? 1_555 FE1 ? G FES . ? B FES 999 ? 1_555 S2 ? G FES .   ? B FES 999 ? 1_555 111.8 ? 
15 S1 ? G FES .   ? B FES 999 ? 1_555 FE1 ? G FES . ? B FES 999 ? 1_555 S2 ? G FES .   ? B FES 999 ? 1_555 105.2 ? 
16 SG ? B CYS 132 ? B CYS 196 ? 1_555 FE1 ? G FES . ? B FES 999 ? 1_555 SG ? B CYS 339 ? B CYS 403 ? 1_555 92.0  ? 
17 S1 ? G FES .   ? B FES 999 ? 1_555 FE1 ? G FES . ? B FES 999 ? 1_555 SG ? B CYS 339 ? B CYS 403 ? 1_555 112.3 ? 
18 S2 ? G FES .   ? B FES 999 ? 1_555 FE1 ? G FES . ? B FES 999 ? 1_555 SG ? B CYS 339 ? B CYS 403 ? 1_555 119.2 ? 
19 SG ? B CYS 342 ? B CYS 406 ? 1_555 FE2 ? G FES . ? B FES 999 ? 1_555 S1 ? G FES .   ? B FES 999 ? 1_555 115.3 ? 
20 SG ? B CYS 342 ? B CYS 406 ? 1_555 FE2 ? G FES . ? B FES 999 ? 1_555 S2 ? G FES .   ? B FES 999 ? 1_555 111.9 ? 
21 S1 ? G FES .   ? B FES 999 ? 1_555 FE2 ? G FES . ? B FES 999 ? 1_555 S2 ? G FES .   ? B FES 999 ? 1_555 105.8 ? 
22 SG ? B CYS 342 ? B CYS 406 ? 1_555 FE2 ? G FES . ? B FES 999 ? 1_555 SG ? B CYS 347 ? B CYS 411 ? 1_555 97.5  ? 
23 S1 ? G FES .   ? B FES 999 ? 1_555 FE2 ? G FES . ? B FES 999 ? 1_555 SG ? B CYS 347 ? B CYS 411 ? 1_555 106.1 ? 
24 S2 ? G FES .   ? B FES 999 ? 1_555 FE2 ? G FES . ? B FES 999 ? 1_555 SG ? B CYS 347 ? B CYS 411 ? 1_555 120.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-10-02 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2016-02-24 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Data collection'           
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.name'    
2 4 'Structure model' '_software.version' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CrystalClear 'data collection' .     ? 1 
CNS          refinement        1.0   ? 2 
DENZO        'data reduction'  1.9.1 ? 3 
SCALEPACK    'data scaling'    1.9.1 ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A ARG 96 ? ? NE A ARG 96 ? ? 2.076 1.460 0.616  0.017 N 
2 1 CD B ARG 96 ? ? NE B ARG 96 ? ? 1.328 1.460 -0.132 0.017 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 103 ? ? 34.83   47.67   
2  1 THR A 198 ? ? -110.47 -83.02  
3  1 ARG A 215 ? ? 178.44  141.37  
4  1 TRP A 227 ? ? -165.64 56.28   
5  1 TYR A 346 ? ? -106.87 -63.27  
6  1 ILE A 350 ? ? -99.73  -60.34  
7  1 GLN A 354 ? ? -99.61  -60.18  
8  1 VAL A 355 ? ? -71.83  -71.63  
9  1 ASN A 372 ? ? 34.15   -109.18 
10 1 MET B 99  ? ? -172.22 133.17  
11 1 ILE B 103 ? ? 33.64   54.35   
12 1 THR B 198 ? ? -109.39 -81.76  
13 1 TRP B 227 ? ? -165.57 55.00   
14 1 TYR B 346 ? ? -104.22 -64.12  
15 1 ILE B 350 ? ? -98.42  -63.04  
16 1 VAL B 355 ? ? -74.53  -75.43  
17 1 ASN B 372 ? ? 30.74   -109.81 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 65  ? CG  ? A ARG 1   CG  
2  1 Y 1 A ARG 65  ? CD  ? A ARG 1   CD  
3  1 Y 1 A ARG 65  ? NE  ? A ARG 1   NE  
4  1 Y 1 A ARG 65  ? CZ  ? A ARG 1   CZ  
5  1 Y 1 A ARG 65  ? NH1 ? A ARG 1   NH1 
6  1 Y 1 A ARG 65  ? NH2 ? A ARG 1   NH2 
7  1 Y 1 A LYS 66  ? CG  ? A LYS 2   CG  
8  1 Y 1 A LYS 66  ? CD  ? A LYS 2   CD  
9  1 Y 1 A LYS 66  ? CE  ? A LYS 2   CE  
10 1 Y 1 A LYS 66  ? NZ  ? A LYS 2   NZ  
11 1 Y 1 A ARG 96  ? CZ  ? A ARG 32  CZ  
12 1 Y 1 A ARG 96  ? NH1 ? A ARG 32  NH1 
13 1 Y 1 A ARG 96  ? NH2 ? A ARG 32  NH2 
14 1 Y 1 A LYS 113 ? CG  ? A LYS 49  CG  
15 1 Y 1 A LYS 113 ? CD  ? A LYS 49  CD  
16 1 Y 1 A LYS 113 ? CE  ? A LYS 49  CE  
17 1 Y 1 A LYS 113 ? NZ  ? A LYS 49  NZ  
18 1 Y 1 A LYS 118 ? CG  ? A LYS 54  CG  
19 1 Y 1 A LYS 118 ? CD  ? A LYS 54  CD  
20 1 Y 1 A LYS 118 ? CE  ? A LYS 54  CE  
21 1 Y 1 A LYS 118 ? NZ  ? A LYS 54  NZ  
22 1 Y 1 A LYS 252 ? CG  ? A LYS 188 CG  
23 1 Y 1 A LYS 252 ? CD  ? A LYS 188 CD  
24 1 Y 1 A LYS 252 ? CE  ? A LYS 188 CE  
25 1 Y 1 A LYS 252 ? NZ  ? A LYS 188 NZ  
26 1 Y 1 A LYS 358 ? CG  ? A LYS 294 CG  
27 1 Y 1 A LYS 358 ? CD  ? A LYS 294 CD  
28 1 Y 1 A LYS 358 ? CE  ? A LYS 294 CE  
29 1 Y 1 A LYS 358 ? NZ  ? A LYS 294 NZ  
30 1 Y 1 A GLU 359 ? CG  ? A GLU 295 CG  
31 1 Y 1 A GLU 359 ? CD  ? A GLU 295 CD  
32 1 Y 1 A GLU 359 ? OE1 ? A GLU 295 OE1 
33 1 Y 1 A GLU 359 ? OE2 ? A GLU 295 OE2 
34 1 Y 1 B ARG 65  ? CG  ? B ARG 1   CG  
35 1 Y 1 B ARG 65  ? CD  ? B ARG 1   CD  
36 1 Y 1 B ARG 65  ? NE  ? B ARG 1   NE  
37 1 Y 1 B ARG 65  ? CZ  ? B ARG 1   CZ  
38 1 Y 1 B ARG 65  ? NH1 ? B ARG 1   NH1 
39 1 Y 1 B ARG 65  ? NH2 ? B ARG 1   NH2 
40 1 Y 1 B LYS 66  ? CG  ? B LYS 2   CG  
41 1 Y 1 B LYS 66  ? CD  ? B LYS 2   CD  
42 1 Y 1 B LYS 66  ? CE  ? B LYS 2   CE  
43 1 Y 1 B LYS 66  ? NZ  ? B LYS 2   NZ  
44 1 Y 1 B ARG 96  ? CZ  ? B ARG 32  CZ  
45 1 Y 1 B ARG 96  ? NH1 ? B ARG 32  NH1 
46 1 Y 1 B ARG 96  ? NH2 ? B ARG 32  NH2 
47 1 Y 1 B LYS 113 ? CG  ? B LYS 49  CG  
48 1 Y 1 B LYS 113 ? CD  ? B LYS 49  CD  
49 1 Y 1 B LYS 113 ? CE  ? B LYS 49  CE  
50 1 Y 1 B LYS 113 ? NZ  ? B LYS 49  NZ  
51 1 Y 1 B LYS 118 ? CG  ? B LYS 54  CG  
52 1 Y 1 B LYS 118 ? CD  ? B LYS 54  CD  
53 1 Y 1 B LYS 118 ? CE  ? B LYS 54  CE  
54 1 Y 1 B LYS 118 ? NZ  ? B LYS 54  NZ  
55 1 Y 1 B LYS 252 ? CG  ? B LYS 188 CG  
56 1 Y 1 B LYS 252 ? CD  ? B LYS 188 CD  
57 1 Y 1 B LYS 252 ? CE  ? B LYS 188 CE  
58 1 Y 1 B LYS 252 ? NZ  ? B LYS 188 NZ  
59 1 Y 1 B LYS 358 ? CG  ? B LYS 294 CG  
60 1 Y 1 B LYS 358 ? CD  ? B LYS 294 CD  
61 1 Y 1 B LYS 358 ? CE  ? B LYS 294 CE  
62 1 Y 1 B LYS 358 ? NZ  ? B LYS 294 NZ  
63 1 Y 1 B GLU 359 ? CG  ? B GLU 295 CG  
64 1 Y 1 B GLU 359 ? CD  ? B GLU 295 CD  
65 1 Y 1 B GLU 359 ? OE1 ? B GLU 295 OE1 
66 1 Y 1 B GLU 359 ? OE2 ? B GLU 295 OE2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE2/S2 (INORGANIC) CLUSTER' FES 
3 'CHOLIC ACID'                CHD 
4 water                        HOH 
#