data_2Q5E
# 
_entry.id   2Q5E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.338 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Q5E         
RCSB  RCSB043170   
WWPDB D_1000043170 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          NYSGXRC-8717a 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2Q5E 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-05-31 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bonanno, J.B.'                                                  1  ?                   
'Dickey, M.'                                                     2  ?                   
'Bain, K.T.'                                                     3  ?                   
'Lau, C.'                                                        4  ?                   
'Romero, R.'                                                     5  ?                   
'Smith, D.'                                                      6  ?                   
'Wasserman, S.'                                                  7  ?                   
'Sauder, J.M.'                                                   8  0000-0002-0254-4955 
'Burley, S.K.'                                                   9  0000-0002-2487-9713 
'Almo, S.C.'                                                     10 ?                   
'New York SGX Research Center for Structural Genomics (NYSGXRC)' 11 ?                   
# 
_citation.id                        primary 
_citation.title                     'Structural genomics of protein phosphatases.' 
_citation.journal_abbrev            J.Struct.Funct.Genom. 
_citation.journal_volume            8 
_citation.page_first                121 
_citation.page_last                 140 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   NE 
_citation.journal_id_ISSN           1345-711X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18058037 
_citation.pdbx_database_id_DOI      10.1007/s10969-007-9036-1 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Almo, S.C.'        1  ?                   
primary 'Bonanno, J.B.'     2  ?                   
primary 'Sauder, J.M.'      3  ?                   
primary 'Emtage, S.'        4  ?                   
primary 'Dilorenzo, T.P.'   5  ?                   
primary 'Malashkevich, V.'  6  ?                   
primary 'Wasserman, S.R.'   7  ?                   
primary 'Swaminathan, S.'   8  ?                   
primary 'Eswaramoorthy, S.' 9  ?                   
primary 'Agarwal, R.'       10 ?                   
primary 'Kumaran, D.'       11 ?                   
primary 'Madegowda, M.'     12 ?                   
primary 'Ragumani, S.'      13 ?                   
primary 'Patskovsky, Y.'    14 ?                   
primary 'Alvarado, J.'      15 ?                   
primary 'Ramagopal, U.A.'   16 ?                   
primary 'Faber-Barata, J.'  17 ?                   
primary 'Chance, M.R.'      18 ?                   
primary 'Sali, A.'          19 ?                   
primary 'Fiser, A.'         20 ?                   
primary 'Zhang, Z.Y.'       21 ?                   
primary 'Lawrence, D.S.'    22 ?                   
primary 'Burley, S.K.'      23 0000-0002-2487-9713 
# 
_cell.length_a           108.643 
_cell.length_b           117.637 
_cell.length_c           170.134 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2Q5E 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              32 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         2Q5E 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2' 21240.197 8  3.1.3.16 ? 
'Residues 87-271' ? 
2 non-polymer syn 'MAGNESIUM ION'                                                               24.305    8  ?        ? ? ? 
3 water       nat water                                                                         18.015    91 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Small CTD phosphatase 2, SCP2, Nuclear LIM interactor-interacting factor 2, NLI-interacting factor 2, Protein OS-4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SLGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTA
SLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTE
LLNLIPIFEELSGAEDVYTSLGQLRAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SLGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTA
SLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTE
LLNLIPIFEELSGAEDVYTSLGQLRAP
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         NYSGXRC-8717a 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   LEU n 
1 3   GLY n 
1 4   THR n 
1 5   CYS n 
1 6   LEU n 
1 7   LEU n 
1 8   PRO n 
1 9   GLU n 
1 10  VAL n 
1 11  THR n 
1 12  GLU n 
1 13  GLU n 
1 14  ASP n 
1 15  GLN n 
1 16  GLY n 
1 17  ARG n 
1 18  ILE n 
1 19  CYS n 
1 20  VAL n 
1 21  VAL n 
1 22  ILE n 
1 23  ASP n 
1 24  LEU n 
1 25  ASP n 
1 26  GLU n 
1 27  THR n 
1 28  LEU n 
1 29  VAL n 
1 30  HIS n 
1 31  SER n 
1 32  SER n 
1 33  PHE n 
1 34  LYS n 
1 35  PRO n 
1 36  ILE n 
1 37  ASN n 
1 38  ASN n 
1 39  ALA n 
1 40  ASP n 
1 41  PHE n 
1 42  ILE n 
1 43  VAL n 
1 44  PRO n 
1 45  ILE n 
1 46  GLU n 
1 47  ILE n 
1 48  GLU n 
1 49  GLY n 
1 50  THR n 
1 51  THR n 
1 52  HIS n 
1 53  GLN n 
1 54  VAL n 
1 55  TYR n 
1 56  VAL n 
1 57  LEU n 
1 58  LYS n 
1 59  ARG n 
1 60  PRO n 
1 61  TYR n 
1 62  VAL n 
1 63  ASP n 
1 64  GLU n 
1 65  PHE n 
1 66  LEU n 
1 67  ARG n 
1 68  ARG n 
1 69  MET n 
1 70  GLY n 
1 71  GLU n 
1 72  LEU n 
1 73  PHE n 
1 74  GLU n 
1 75  CYS n 
1 76  VAL n 
1 77  LEU n 
1 78  PHE n 
1 79  THR n 
1 80  ALA n 
1 81  SER n 
1 82  LEU n 
1 83  ALA n 
1 84  LYS n 
1 85  TYR n 
1 86  ALA n 
1 87  ASP n 
1 88  PRO n 
1 89  VAL n 
1 90  THR n 
1 91  ASP n 
1 92  LEU n 
1 93  LEU n 
1 94  ASP n 
1 95  ARG n 
1 96  CYS n 
1 97  GLY n 
1 98  VAL n 
1 99  PHE n 
1 100 ARG n 
1 101 ALA n 
1 102 ARG n 
1 103 LEU n 
1 104 PHE n 
1 105 ARG n 
1 106 GLU n 
1 107 SER n 
1 108 CYS n 
1 109 VAL n 
1 110 PHE n 
1 111 HIS n 
1 112 GLN n 
1 113 GLY n 
1 114 CYS n 
1 115 TYR n 
1 116 VAL n 
1 117 LYS n 
1 118 ASP n 
1 119 LEU n 
1 120 SER n 
1 121 ARG n 
1 122 LEU n 
1 123 GLY n 
1 124 ARG n 
1 125 ASP n 
1 126 LEU n 
1 127 ARG n 
1 128 LYS n 
1 129 THR n 
1 130 LEU n 
1 131 ILE n 
1 132 LEU n 
1 133 ASP n 
1 134 ASN n 
1 135 SER n 
1 136 PRO n 
1 137 ALA n 
1 138 SER n 
1 139 TYR n 
1 140 ILE n 
1 141 PHE n 
1 142 HIS n 
1 143 PRO n 
1 144 GLU n 
1 145 ASN n 
1 146 ALA n 
1 147 VAL n 
1 148 PRO n 
1 149 VAL n 
1 150 GLN n 
1 151 SER n 
1 152 TRP n 
1 153 PHE n 
1 154 ASP n 
1 155 ASP n 
1 156 MET n 
1 157 ALA n 
1 158 ASP n 
1 159 THR n 
1 160 GLU n 
1 161 LEU n 
1 162 LEU n 
1 163 ASN n 
1 164 LEU n 
1 165 ILE n 
1 166 PRO n 
1 167 ILE n 
1 168 PHE n 
1 169 GLU n 
1 170 GLU n 
1 171 LEU n 
1 172 SER n 
1 173 GLY n 
1 174 ALA n 
1 175 GLU n 
1 176 ASP n 
1 177 VAL n 
1 178 TYR n 
1 179 THR n 
1 180 SER n 
1 181 LEU n 
1 182 GLY n 
1 183 GLN n 
1 184 LEU n 
1 185 ARG n 
1 186 ALA n 
1 187 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'CTDSP2, NIF2, OS4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               pET 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'modified pET26' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CTDS2_HUMAN 
_struct_ref.pdbx_db_accession          O14595 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASL
AKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELL
NLIPIFEELSGAEDVYTSLGQLRAP
;
_struct_ref.pdbx_align_begin           87 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2Q5E A 3 ? 187 ? O14595 87 ? 271 ? 87 271 
2 1 2Q5E B 3 ? 187 ? O14595 87 ? 271 ? 87 271 
3 1 2Q5E C 3 ? 187 ? O14595 87 ? 271 ? 87 271 
4 1 2Q5E D 3 ? 187 ? O14595 87 ? 271 ? 87 271 
5 1 2Q5E E 3 ? 187 ? O14595 87 ? 271 ? 87 271 
6 1 2Q5E F 3 ? 187 ? O14595 87 ? 271 ? 87 271 
7 1 2Q5E G 3 ? 187 ? O14595 87 ? 271 ? 87 271 
8 1 2Q5E H 3 ? 187 ? O14595 87 ? 271 ? 87 271 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Q5E SER A 1 ? UNP O14595 ? ? 'cloning artifact' 85 1  
1 2Q5E LEU A 2 ? UNP O14595 ? ? 'cloning artifact' 86 2  
2 2Q5E SER B 1 ? UNP O14595 ? ? 'cloning artifact' 85 3  
2 2Q5E LEU B 2 ? UNP O14595 ? ? 'cloning artifact' 86 4  
3 2Q5E SER C 1 ? UNP O14595 ? ? 'cloning artifact' 85 5  
3 2Q5E LEU C 2 ? UNP O14595 ? ? 'cloning artifact' 86 6  
4 2Q5E SER D 1 ? UNP O14595 ? ? 'cloning artifact' 85 7  
4 2Q5E LEU D 2 ? UNP O14595 ? ? 'cloning artifact' 86 8  
5 2Q5E SER E 1 ? UNP O14595 ? ? 'cloning artifact' 85 9  
5 2Q5E LEU E 2 ? UNP O14595 ? ? 'cloning artifact' 86 10 
6 2Q5E SER F 1 ? UNP O14595 ? ? 'cloning artifact' 85 11 
6 2Q5E LEU F 2 ? UNP O14595 ? ? 'cloning artifact' 86 12 
7 2Q5E SER G 1 ? UNP O14595 ? ? 'cloning artifact' 85 13 
7 2Q5E LEU G 2 ? UNP O14595 ? ? 'cloning artifact' 86 14 
8 2Q5E SER H 1 ? UNP O14595 ? ? 'cloning artifact' 85 15 
8 2Q5E LEU H 2 ? UNP O14595 ? ? 'cloning artifact' 86 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2Q5E 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.20 
_exptl_crystal.density_percent_sol   61.53 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.pdbx_details    '2.8 M Sodium acetate, pH 7.0, VAPOR DIFFUSION, temperature 294K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-04-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97958 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 31-ID' 
_diffrn_source.pdbx_wavelength_list        0.97958 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   31-ID 
# 
_reflns.entry_id                     2Q5E 
_reflns.d_resolution_high            2.510 
_reflns.d_resolution_low             96.760 
_reflns.number_obs                   72419 
_reflns.pdbx_Rmerge_I_obs            0.072 
_reflns.pdbx_netI_over_sigmaI        18.6 
_reflns.pdbx_Rsym_value              0.072 
_reflns.pdbx_redundancy              5.100 
_reflns.percent_possible_obs         96.500 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   72419 
_reflns.B_iso_Wilson_estimate        56.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.51 
_reflns_shell.d_res_low              2.65 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.447 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_Rsym_value        0.447 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        3.60 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      8821 
_reflns_shell.percent_possible_all   81.70 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2Q5E 
_refine.ls_d_res_high                            2.510 
_refine.ls_d_res_low                             20.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    96.380 
_refine.ls_number_reflns_obs                     72246 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.219 
_refine.ls_R_factor_R_work                       0.216 
_refine.ls_R_factor_R_free                       0.278 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  3629 
_refine.B_iso_mean                               45.075 
_refine.aniso_B[1][1]                            -0.510 
_refine.aniso_B[2][2]                            -0.060 
_refine.aniso_B[3][3]                            0.570 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.932 
_refine.correlation_coeff_Fo_to_Fc_free          0.891 
_refine.pdbx_overall_ESU_R                       0.402 
_refine.pdbx_overall_ESU_R_Free                  0.295 
_refine.overall_SU_ML                            0.232 
_refine.overall_SU_B                             10.246 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     72246 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11467 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             91 
_refine_hist.number_atoms_total               11566 
_refine_hist.d_res_high                       2.510 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         11709 0.022  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      15901 2.084  1.977  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   1413  7.280  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   576   38.309 23.715 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1977  20.709 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   93    23.685 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1825  0.141  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     8905  0.008  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            5052  0.243  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          7926  0.330  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    515   0.211  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      1     0.022  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   51    0.199  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 7     0.382  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              7294  1.225  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             11605 2.059  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4891  3.067  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             4296  4.716  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.510 
_refine_ls_shell.d_res_low                        2.574 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               75.800 
_refine_ls_shell.number_reflns_R_work             3860 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.323 
_refine_ls_shell.R_factor_R_free                  0.413 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             227 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                4087 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2Q5E 
_struct.title                     
'Crystal structure of human carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2' 
_struct.pdbx_descriptor           'Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 (E.C.3.1.3.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Q5E 
_struct_keywords.text            
'STRUCTURAL GENOMICS, HYDROLASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 3 ? 
T N N 3 ? 
U N N 3 ? 
V N N 3 ? 
W N N 3 ? 
X N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
2 ? 
3 ? 
4 ? 
5 ? 
6 ? 
7 ? 
8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 61  ? PHE A 73  ? TYR A 145 PHE A 157 1 ? 13 
HELX_P HELX_P2  2  LEU A 82  ? ASP A 94  ? LEU A 166 ASP A 178 1 ? 13 
HELX_P HELX_P3  3  PHE A 104 ? CYS A 108 ? PHE A 188 CYS A 192 5 ? 5  
HELX_P HELX_P4  4  ASP A 118 ? LEU A 122 ? ASP A 202 LEU A 206 5 ? 5  
HELX_P HELX_P5  5  ASP A 125 ? ARG A 127 ? ASP A 209 ARG A 211 5 ? 3  
HELX_P HELX_P6  6  SER A 135 ? ILE A 140 ? SER A 219 ILE A 224 5 ? 6  
HELX_P HELX_P7  7  HIS A 142 ? GLU A 144 ? HIS A 226 GLU A 228 5 ? 3  
HELX_P HELX_P8  8  THR A 159 ? SER A 172 ? THR A 243 SER A 256 1 ? 14 
HELX_P HELX_P9  9  ASP A 176 ? ARG A 185 ? ASP A 260 ARG A 269 1 ? 10 
HELX_P HELX_P10 10 TYR B 61  ? PHE B 73  ? TYR B 145 PHE B 157 1 ? 13 
HELX_P HELX_P11 11 LEU B 82  ? ASP B 94  ? LEU B 166 ASP B 178 1 ? 13 
HELX_P HELX_P12 12 PHE B 104 ? CYS B 108 ? PHE B 188 CYS B 192 5 ? 5  
HELX_P HELX_P13 13 ASP B 118 ? LEU B 122 ? ASP B 202 LEU B 206 5 ? 5  
HELX_P HELX_P14 14 ASP B 125 ? ARG B 127 ? ASP B 209 ARG B 211 5 ? 3  
HELX_P HELX_P15 15 SER B 135 ? ILE B 140 ? SER B 219 ILE B 224 5 ? 6  
HELX_P HELX_P16 16 HIS B 142 ? GLU B 144 ? HIS B 226 GLU B 228 5 ? 3  
HELX_P HELX_P17 17 THR B 159 ? SER B 172 ? THR B 243 SER B 256 1 ? 14 
HELX_P HELX_P18 18 ASP B 176 ? GLN B 183 ? ASP B 260 GLN B 267 1 ? 8  
HELX_P HELX_P19 19 THR C 11  ? GLN C 15  ? THR C 95  GLN C 99  5 ? 5  
HELX_P HELX_P20 20 TYR C 61  ? PHE C 73  ? TYR C 145 PHE C 157 1 ? 13 
HELX_P HELX_P21 21 LEU C 82  ? ASP C 94  ? LEU C 166 ASP C 178 1 ? 13 
HELX_P HELX_P22 22 PHE C 104 ? CYS C 108 ? PHE C 188 CYS C 192 5 ? 5  
HELX_P HELX_P23 23 ASP C 118 ? LEU C 122 ? ASP C 202 LEU C 206 5 ? 5  
HELX_P HELX_P24 24 ASP C 125 ? ARG C 127 ? ASP C 209 ARG C 211 5 ? 3  
HELX_P HELX_P25 25 SER C 135 ? ILE C 140 ? SER C 219 ILE C 224 5 ? 6  
HELX_P HELX_P26 26 HIS C 142 ? ALA C 146 ? HIS C 226 ALA C 230 5 ? 5  
HELX_P HELX_P27 27 THR C 159 ? SER C 172 ? THR C 243 SER C 256 1 ? 14 
HELX_P HELX_P28 28 ASP C 176 ? ARG C 185 ? ASP C 260 ARG C 269 1 ? 10 
HELX_P HELX_P29 29 THR D 11  ? GLN D 15  ? THR D 95  GLN D 99  5 ? 5  
HELX_P HELX_P30 30 TYR D 61  ? PHE D 73  ? TYR D 145 PHE D 157 1 ? 13 
HELX_P HELX_P31 31 LEU D 82  ? ASP D 94  ? LEU D 166 ASP D 178 1 ? 13 
HELX_P HELX_P32 32 PHE D 104 ? CYS D 108 ? PHE D 188 CYS D 192 5 ? 5  
HELX_P HELX_P33 33 ASP D 118 ? LEU D 122 ? ASP D 202 LEU D 206 5 ? 5  
HELX_P HELX_P34 34 ASP D 125 ? ARG D 127 ? ASP D 209 ARG D 211 5 ? 3  
HELX_P HELX_P35 35 SER D 135 ? ILE D 140 ? SER D 219 ILE D 224 5 ? 6  
HELX_P HELX_P36 36 HIS D 142 ? ALA D 146 ? HIS D 226 ALA D 230 5 ? 5  
HELX_P HELX_P37 37 THR D 159 ? SER D 172 ? THR D 243 SER D 256 1 ? 14 
HELX_P HELX_P38 38 TYR E 61  ? PHE E 73  ? TYR E 145 PHE E 157 1 ? 13 
HELX_P HELX_P39 39 LEU E 82  ? ASP E 94  ? LEU E 166 ASP E 178 1 ? 13 
HELX_P HELX_P40 40 PHE E 104 ? CYS E 108 ? PHE E 188 CYS E 192 5 ? 5  
HELX_P HELX_P41 41 ASP E 118 ? LEU E 122 ? ASP E 202 LEU E 206 5 ? 5  
HELX_P HELX_P42 42 ASP E 125 ? ARG E 127 ? ASP E 209 ARG E 211 5 ? 3  
HELX_P HELX_P43 43 SER E 135 ? ILE E 140 ? SER E 219 ILE E 224 5 ? 6  
HELX_P HELX_P44 44 HIS E 142 ? GLU E 144 ? HIS E 226 GLU E 228 5 ? 3  
HELX_P HELX_P45 45 THR E 159 ? SER E 172 ? THR E 243 SER E 256 1 ? 14 
HELX_P HELX_P46 46 ASP E 176 ? GLN E 183 ? ASP E 260 GLN E 267 1 ? 8  
HELX_P HELX_P47 47 THR F 11  ? GLN F 15  ? THR F 95  GLN F 99  5 ? 5  
HELX_P HELX_P48 48 TYR F 61  ? PHE F 73  ? TYR F 145 PHE F 157 1 ? 13 
HELX_P HELX_P49 49 LEU F 82  ? ASP F 94  ? LEU F 166 ASP F 178 1 ? 13 
HELX_P HELX_P50 50 PHE F 104 ? CYS F 108 ? PHE F 188 CYS F 192 5 ? 5  
HELX_P HELX_P51 51 ASP F 118 ? LEU F 122 ? ASP F 202 LEU F 206 5 ? 5  
HELX_P HELX_P52 52 ASP F 125 ? ARG F 127 ? ASP F 209 ARG F 211 5 ? 3  
HELX_P HELX_P53 53 SER F 135 ? ILE F 140 ? SER F 219 ILE F 224 5 ? 6  
HELX_P HELX_P54 54 HIS F 142 ? ALA F 146 ? HIS F 226 ALA F 230 5 ? 5  
HELX_P HELX_P55 55 THR F 159 ? GLY F 173 ? THR F 243 GLY F 257 1 ? 15 
HELX_P HELX_P56 56 ASP F 176 ? LEU F 184 ? ASP F 260 LEU F 268 1 ? 9  
HELX_P HELX_P57 57 TYR G 61  ? PHE G 73  ? TYR G 145 PHE G 157 1 ? 13 
HELX_P HELX_P58 58 LEU G 82  ? ASP G 94  ? LEU G 166 ASP G 178 1 ? 13 
HELX_P HELX_P59 59 PHE G 104 ? CYS G 108 ? PHE G 188 CYS G 192 5 ? 5  
HELX_P HELX_P60 60 ASP G 118 ? LEU G 122 ? ASP G 202 LEU G 206 5 ? 5  
HELX_P HELX_P61 61 ASP G 125 ? ARG G 127 ? ASP G 209 ARG G 211 5 ? 3  
HELX_P HELX_P62 62 SER G 135 ? ILE G 140 ? SER G 219 ILE G 224 5 ? 6  
HELX_P HELX_P63 63 HIS G 142 ? GLU G 144 ? HIS G 226 GLU G 228 5 ? 3  
HELX_P HELX_P64 64 THR G 159 ? GLU G 170 ? THR G 243 GLU G 254 1 ? 12 
HELX_P HELX_P65 65 ASP G 176 ? ARG G 185 ? ASP G 260 ARG G 269 1 ? 10 
HELX_P HELX_P66 66 THR H 11  ? GLN H 15  ? THR H 95  GLN H 99  5 ? 5  
HELX_P HELX_P67 67 TYR H 61  ? PHE H 73  ? TYR H 145 PHE H 157 1 ? 13 
HELX_P HELX_P68 68 LEU H 82  ? ASP H 94  ? LEU H 166 ASP H 178 1 ? 13 
HELX_P HELX_P69 69 PHE H 104 ? CYS H 108 ? PHE H 188 CYS H 192 5 ? 5  
HELX_P HELX_P70 70 ASP H 118 ? LEU H 122 ? ASP H 202 LEU H 206 5 ? 5  
HELX_P HELX_P71 71 ASP H 125 ? ARG H 127 ? ASP H 209 ARG H 211 5 ? 3  
HELX_P HELX_P72 72 SER H 135 ? ILE H 140 ? SER H 219 ILE H 224 5 ? 6  
HELX_P HELX_P73 73 HIS H 142 ? ALA H 146 ? HIS H 226 ALA H 230 5 ? 5  
HELX_P HELX_P74 74 THR H 159 ? SER H 172 ? THR H 243 SER H 256 1 ? 14 
HELX_P HELX_P75 75 ASP H 176 ? GLN H 183 ? ASP H 260 GLN H 267 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? I MG . MG ? ? ? 1_555 A ASP 23  OD2 ? ? A MG 1 A ASP 107 1_555 ? ? ? ? ? ? ? 2.287 ? ? 
metalc2  metalc ? ? I MG . MG ? ? ? 1_555 A ASP 25  O   ? ? A MG 1 A ASP 109 1_555 ? ? ? ? ? ? ? 2.508 ? ? 
metalc3  metalc ? ? I MG . MG ? ? ? 1_555 A ASN 134 OD1 ? ? A MG 1 A ASN 218 1_555 ? ? ? ? ? ? ? 2.554 ? ? 
metalc4  metalc ? ? J MG . MG ? ? ? 1_555 B ASP 23  OD2 ? ? B MG 1 B ASP 107 1_555 ? ? ? ? ? ? ? 2.283 ? ? 
metalc5  metalc ? ? J MG . MG ? ? ? 1_555 B ASP 25  O   ? ? B MG 1 B ASP 109 1_555 ? ? ? ? ? ? ? 2.513 ? ? 
metalc6  metalc ? ? J MG . MG ? ? ? 1_555 B ASN 134 OD1 ? ? B MG 1 B ASN 218 1_555 ? ? ? ? ? ? ? 2.399 ? ? 
metalc7  metalc ? ? J MG . MG ? ? ? 1_555 R HOH .   O   ? ? B MG 1 B HOH 275 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc8  metalc ? ? J MG . MG ? ? ? 1_555 R HOH .   O   ? ? B MG 1 B HOH 280 1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc9  metalc ? ? K MG . MG ? ? ? 1_555 C ASP 23  OD2 ? ? C MG 1 C ASP 107 1_555 ? ? ? ? ? ? ? 2.501 ? ? 
metalc10 metalc ? ? K MG . MG ? ? ? 1_555 C ASP 25  O   ? ? C MG 1 C ASP 109 1_555 ? ? ? ? ? ? ? 2.199 ? ? 
metalc11 metalc ? ? K MG . MG ? ? ? 1_555 C ASN 134 OD1 ? ? C MG 1 C ASN 218 1_555 ? ? ? ? ? ? ? 2.672 ? ? 
metalc12 metalc ? ? L MG . MG ? ? ? 1_555 D ASP 23  OD2 ? ? D MG 1 D ASP 107 1_555 ? ? ? ? ? ? ? 1.996 ? ? 
metalc13 metalc ? ? L MG . MG ? ? ? 1_555 D ASP 25  O   ? ? D MG 1 D ASP 109 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc14 metalc ? ? L MG . MG ? ? ? 1_555 D ASN 134 OD1 ? ? D MG 1 D ASN 218 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc15 metalc ? ? M MG . MG ? ? ? 1_555 E ASP 23  OD2 ? ? E MG 1 E ASP 107 1_555 ? ? ? ? ? ? ? 2.224 ? ? 
metalc16 metalc ? ? M MG . MG ? ? ? 1_555 E ASP 25  O   ? ? E MG 1 E ASP 109 1_555 ? ? ? ? ? ? ? 2.386 ? ? 
metalc17 metalc ? ? M MG . MG ? ? ? 1_555 E ASN 134 OD1 ? ? E MG 1 E ASN 218 1_555 ? ? ? ? ? ? ? 2.211 ? ? 
metalc18 metalc ? ? N MG . MG ? ? ? 1_555 F ASP 23  OD2 ? ? F MG 1 F ASP 107 1_555 ? ? ? ? ? ? ? 1.967 ? ? 
metalc19 metalc ? ? N MG . MG ? ? ? 1_555 F ASP 25  O   ? ? F MG 1 F ASP 109 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc20 metalc ? ? N MG . MG ? ? ? 1_555 F ASN 134 OD1 ? ? F MG 1 F ASN 218 1_555 ? ? ? ? ? ? ? 2.565 ? ? 
metalc21 metalc ? ? O MG . MG ? ? ? 1_555 G ASP 23  OD2 ? ? G MG 1 G ASP 107 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc22 metalc ? ? O MG . MG ? ? ? 1_555 G ASP 25  O   ? ? G MG 1 G ASP 109 1_555 ? ? ? ? ? ? ? 2.757 ? ? 
metalc23 metalc ? ? O MG . MG ? ? ? 1_555 G ASN 134 OD1 ? ? G MG 1 G ASN 218 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
metalc24 metalc ? ? P MG . MG ? ? ? 1_555 H ASP 23  OD2 ? ? H MG 1 H ASP 107 1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc25 metalc ? ? P MG . MG ? ? ? 1_555 H ASP 25  O   ? ? H MG 1 H ASP 109 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc26 metalc ? ? P MG . MG ? ? ? 1_555 H ASN 134 OD1 ? ? H MG 1 H ASN 218 1_555 ? ? ? ? ? ? ? 2.624 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 6 ? 
D ? 5 ? 
E ? 3 ? 
F ? 6 ? 
G ? 6 ? 
H ? 3 ? 
I ? 2 ? 
J ? 3 ? 
K ? 2 ? 
L ? 5 ? 
M ? 3 ? 
N ? 3 ? 
O ? 2 ? 
P ? 5 ? 
Q ? 3 ? 
R ? 6 ? 
S ? 3 ? 
T ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? parallel      
P 3 4 ? parallel      
P 4 5 ? parallel      
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? parallel      
R 3 4 ? parallel      
R 4 5 ? parallel      
R 5 6 ? parallel      
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
T 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 99  ? LEU A 103 ? PHE A 183 LEU A 187 
A 2 GLU A 74  ? PHE A 78  ? GLU A 158 PHE A 162 
A 3 CYS A 19  ? ILE A 22  ? CYS A 103 ILE A 106 
A 4 THR A 129 ? ASP A 133 ? THR A 213 ASP A 217 
A 5 ALA A 146 ? PRO A 148 ? ALA A 230 PRO A 232 
B 1 VAL A 29  ? SER A 32  ? VAL A 113 SER A 116 
B 2 THR A 50  ? LYS A 58  ? THR A 134 LYS A 142 
B 3 PHE A 41  ? ILE A 47  ? PHE A 125 ILE A 131 
C 1 CYS A 114 ? VAL A 116 ? CYS A 198 VAL A 200 
C 2 VAL A 109 ? HIS A 111 ? VAL A 193 HIS A 195 
C 3 PHE F 99  ? LEU F 103 ? PHE F 183 LEU F 187 
C 4 GLU F 74  ? PHE F 78  ? GLU F 158 PHE F 162 
C 5 CYS F 19  ? ILE F 22  ? CYS F 103 ILE F 106 
C 6 THR F 129 ? LEU F 132 ? THR F 213 LEU F 216 
D 1 PHE B 99  ? LEU B 103 ? PHE B 183 LEU B 187 
D 2 GLU B 74  ? PHE B 78  ? GLU B 158 PHE B 162 
D 3 CYS B 19  ? ILE B 22  ? CYS B 103 ILE B 106 
D 4 THR B 129 ? ASP B 133 ? THR B 213 ASP B 217 
D 5 ALA B 146 ? PRO B 148 ? ALA B 230 PRO B 232 
E 1 VAL B 29  ? SER B 32  ? VAL B 113 SER B 116 
E 2 THR B 50  ? LYS B 58  ? THR B 134 LYS B 142 
E 3 PHE B 41  ? ILE B 47  ? PHE B 125 ILE B 131 
F 1 CYS B 114 ? VAL B 116 ? CYS B 198 VAL B 200 
F 2 VAL B 109 ? HIS B 111 ? VAL B 193 HIS B 195 
F 3 PHE D 99  ? LEU D 103 ? PHE D 183 LEU D 187 
F 4 GLU D 74  ? PHE D 78  ? GLU D 158 PHE D 162 
F 5 CYS D 19  ? ILE D 22  ? CYS D 103 ILE D 106 
F 6 THR D 129 ? LEU D 132 ? THR D 213 LEU D 216 
G 1 THR C 129 ? LEU C 132 ? THR C 213 LEU C 216 
G 2 CYS C 19  ? ILE C 22  ? CYS C 103 ILE C 106 
G 3 GLU C 74  ? PHE C 78  ? GLU C 158 PHE C 162 
G 4 PHE C 99  ? LEU C 103 ? PHE C 183 LEU C 187 
G 5 VAL E 109 ? HIS E 111 ? VAL E 193 HIS E 195 
G 6 CYS E 114 ? VAL E 116 ? CYS E 198 VAL E 200 
H 1 VAL C 29  ? SER C 32  ? VAL C 113 SER C 116 
H 2 THR C 50  ? LYS C 58  ? THR C 134 LYS C 142 
H 3 PHE C 41  ? ILE C 47  ? PHE C 125 ILE C 131 
I 1 VAL C 109 ? HIS C 111 ? VAL C 193 HIS C 195 
I 2 CYS C 114 ? VAL C 116 ? CYS C 198 VAL C 200 
J 1 VAL D 29  ? SER D 32  ? VAL D 113 SER D 116 
J 2 THR D 50  ? LYS D 58  ? THR D 134 LYS D 142 
J 3 PHE D 41  ? ILE D 47  ? PHE D 125 ILE D 131 
K 1 VAL D 109 ? HIS D 111 ? VAL D 193 HIS D 195 
K 2 CYS D 114 ? VAL D 116 ? CYS D 198 VAL D 200 
L 1 ALA E 101 ? LEU E 103 ? ALA E 185 LEU E 187 
L 2 GLU E 74  ? PHE E 78  ? GLU E 158 PHE E 162 
L 3 CYS E 19  ? ILE E 22  ? CYS E 103 ILE E 106 
L 4 THR E 129 ? ASP E 133 ? THR E 213 ASP E 217 
L 5 ALA E 146 ? PRO E 148 ? ALA E 230 PRO E 232 
M 1 VAL E 29  ? SER E 32  ? VAL E 113 SER E 116 
M 2 THR E 50  ? LYS E 58  ? THR E 134 LYS E 142 
M 3 PHE E 41  ? ILE E 47  ? PHE E 125 ILE E 131 
N 1 VAL F 29  ? SER F 32  ? VAL F 113 SER F 116 
N 2 THR F 50  ? LYS F 58  ? THR F 134 LYS F 142 
N 3 PHE F 41  ? ILE F 47  ? PHE F 125 ILE F 131 
O 1 VAL F 109 ? HIS F 111 ? VAL F 193 HIS F 195 
O 2 CYS F 114 ? VAL F 116 ? CYS F 198 VAL F 200 
P 1 PHE G 99  ? LEU G 103 ? PHE G 183 LEU G 187 
P 2 GLU G 74  ? PHE G 78  ? GLU G 158 PHE G 162 
P 3 CYS G 19  ? ILE G 22  ? CYS G 103 ILE G 106 
P 4 THR G 129 ? ASP G 133 ? THR G 213 ASP G 217 
P 5 ALA G 146 ? PRO G 148 ? ALA G 230 PRO G 232 
Q 1 VAL G 29  ? HIS G 30  ? VAL G 113 HIS G 114 
Q 2 THR G 50  ? LYS G 58  ? THR G 134 LYS G 142 
Q 3 PHE G 41  ? ILE G 47  ? PHE G 125 ILE G 131 
R 1 CYS G 114 ? VAL G 116 ? CYS G 198 VAL G 200 
R 2 VAL G 109 ? HIS G 111 ? VAL G 193 HIS G 195 
R 3 PHE H 99  ? LEU H 103 ? PHE H 183 LEU H 187 
R 4 GLU H 74  ? PHE H 78  ? GLU H 158 PHE H 162 
R 5 CYS H 19  ? ILE H 22  ? CYS H 103 ILE H 106 
R 6 THR H 129 ? LEU H 132 ? THR H 213 LEU H 216 
S 1 VAL H 29  ? SER H 32  ? VAL H 113 SER H 116 
S 2 THR H 50  ? LYS H 58  ? THR H 134 LYS H 142 
S 3 PHE H 41  ? ILE H 47  ? PHE H 125 ILE H 131 
T 1 VAL H 109 ? HIS H 111 ? VAL H 193 HIS H 195 
T 2 CYS H 114 ? VAL H 116 ? CYS H 198 VAL H 200 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 103 ? O LEU A 187 N LEU A 77  ? N LEU A 161 
A 2 3 O VAL A 76  ? O VAL A 160 N VAL A 20  ? N VAL A 104 
A 3 4 N VAL A 21  ? N VAL A 105 O LEU A 132 ? O LEU A 216 
A 4 5 N ILE A 131 ? N ILE A 215 O VAL A 147 ? O VAL A 231 
B 1 2 N SER A 32  ? N SER A 116 O TYR A 55  ? O TYR A 139 
B 2 3 O THR A 50  ? O THR A 134 N ILE A 47  ? N ILE A 131 
C 1 2 O VAL A 116 ? O VAL A 200 N VAL A 109 ? N VAL A 193 
C 2 3 N PHE A 110 ? N PHE A 194 O ARG F 100 ? O ARG F 184 
C 3 4 O LEU F 103 ? O LEU F 187 N LEU F 77  ? N LEU F 161 
C 4 5 O VAL F 76  ? O VAL F 160 N ILE F 22  ? N ILE F 106 
C 5 6 N CYS F 19  ? N CYS F 103 O LEU F 130 ? O LEU F 214 
D 1 2 O LEU B 103 ? O LEU B 187 N LEU B 77  ? N LEU B 161 
D 2 3 O VAL B 76  ? O VAL B 160 N ILE B 22  ? N ILE B 106 
D 3 4 N VAL B 21  ? N VAL B 105 O LEU B 130 ? O LEU B 214 
D 4 5 N ILE B 131 ? N ILE B 215 O VAL B 147 ? O VAL B 231 
E 1 2 N SER B 32  ? N SER B 116 O TYR B 55  ? O TYR B 139 
E 2 3 O VAL B 54  ? O VAL B 138 N VAL B 43  ? N VAL B 127 
F 1 2 O VAL B 116 ? O VAL B 200 N VAL B 109 ? N VAL B 193 
F 2 3 N PHE B 110 ? N PHE B 194 O ARG D 102 ? O ARG D 186 
F 3 4 O LEU D 103 ? O LEU D 187 N LEU D 77  ? N LEU D 161 
F 4 5 O PHE D 78  ? O PHE D 162 N ILE D 22  ? N ILE D 106 
F 5 6 N VAL D 21  ? N VAL D 105 O LEU D 132 ? O LEU D 216 
G 1 2 O LEU C 132 ? O LEU C 216 N VAL C 21  ? N VAL C 105 
G 2 3 N ILE C 22  ? N ILE C 106 O VAL C 76  ? O VAL C 160 
G 3 4 N LEU C 77  ? N LEU C 161 O LEU C 103 ? O LEU C 187 
G 4 5 N ARG C 100 ? N ARG C 184 O PHE E 110 ? O PHE E 194 
G 5 6 N VAL E 109 ? N VAL E 193 O VAL E 116 ? O VAL E 200 
H 1 2 N SER C 32  ? N SER C 116 O TYR C 55  ? O TYR C 139 
H 2 3 O HIS C 52  ? O HIS C 136 N ILE C 45  ? N ILE C 129 
I 1 2 N HIS C 111 ? N HIS C 195 O CYS C 114 ? O CYS C 198 
J 1 2 N SER D 32  ? N SER D 116 O TYR D 55  ? O TYR D 139 
J 2 3 O HIS D 52  ? O HIS D 136 N ILE D 45  ? N ILE D 129 
K 1 2 N HIS D 111 ? N HIS D 195 O CYS D 114 ? O CYS D 198 
L 1 2 O LEU E 103 ? O LEU E 187 N LEU E 77  ? N LEU E 161 
L 2 3 O VAL E 76  ? O VAL E 160 N VAL E 20  ? N VAL E 104 
L 3 4 N VAL E 21  ? N VAL E 105 O LEU E 132 ? O LEU E 216 
L 4 5 N ILE E 131 ? N ILE E 215 O VAL E 147 ? O VAL E 231 
M 1 2 N SER E 32  ? N SER E 116 O TYR E 55  ? O TYR E 139 
M 2 3 O VAL E 56  ? O VAL E 140 N PHE E 41  ? N PHE E 125 
N 1 2 N HIS F 30  ? N HIS F 114 O LEU F 57  ? O LEU F 141 
N 2 3 O VAL F 56  ? O VAL F 140 N PHE F 41  ? N PHE F 125 
O 1 2 N HIS F 111 ? N HIS F 195 O CYS F 114 ? O CYS F 198 
P 1 2 O LEU G 103 ? O LEU G 187 N LEU G 77  ? N LEU G 161 
P 2 3 O VAL G 76  ? O VAL G 160 N VAL G 20  ? N VAL G 104 
P 3 4 N VAL G 21  ? N VAL G 105 O LEU G 130 ? O LEU G 214 
P 4 5 N ILE G 131 ? N ILE G 215 O VAL G 147 ? O VAL G 231 
Q 1 2 N HIS G 30  ? N HIS G 114 O LEU G 57  ? O LEU G 141 
Q 2 3 O VAL G 54  ? O VAL G 138 N VAL G 43  ? N VAL G 127 
R 1 2 O CYS G 114 ? O CYS G 198 N HIS G 111 ? N HIS G 195 
R 2 3 N PHE G 110 ? N PHE G 194 O ARG H 100 ? O ARG H 184 
R 3 4 O LEU H 103 ? O LEU H 187 N LEU H 77  ? N LEU H 161 
R 4 5 O GLU H 74  ? O GLU H 158 N VAL H 20  ? N VAL H 104 
R 5 6 N VAL H 21  ? N VAL H 105 O LEU H 132 ? O LEU H 216 
S 1 2 N SER H 32  ? N SER H 116 O TYR H 55  ? O TYR H 139 
S 2 3 O VAL H 56  ? O VAL H 140 N PHE H 41  ? N PHE H 125 
T 1 2 N HIS H 111 ? N HIS H 195 O CYS H 114 ? O CYS H 198 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG 1 ? 3 'BINDING SITE FOR RESIDUE MG A 1' 
AC2 Software B MG 1 ? 6 'BINDING SITE FOR RESIDUE MG B 1' 
AC3 Software C MG 1 ? 3 'BINDING SITE FOR RESIDUE MG C 1' 
AC4 Software D MG 1 ? 4 'BINDING SITE FOR RESIDUE MG D 1' 
AC5 Software E MG 1 ? 4 'BINDING SITE FOR RESIDUE MG E 1' 
AC6 Software F MG 1 ? 4 'BINDING SITE FOR RESIDUE MG F 1' 
AC7 Software G MG 1 ? 6 'BINDING SITE FOR RESIDUE MG G 1' 
AC8 Software H MG 1 ? 3 'BINDING SITE FOR RESIDUE MG H 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ASP A 23  ? ASP A 107 . ? 1_555 ? 
2  AC1 3 ASP A 25  ? ASP A 109 . ? 1_555 ? 
3  AC1 3 ASN A 134 ? ASN A 218 . ? 1_555 ? 
4  AC2 6 ASP B 23  ? ASP B 107 . ? 1_555 ? 
5  AC2 6 ASP B 25  ? ASP B 109 . ? 1_555 ? 
6  AC2 6 ASN B 134 ? ASN B 218 . ? 1_555 ? 
7  AC2 6 SER B 135 ? SER B 219 . ? 1_555 ? 
8  AC2 6 HOH R .   ? HOH B 275 . ? 1_555 ? 
9  AC2 6 HOH R .   ? HOH B 280 . ? 1_555 ? 
10 AC3 3 ASP C 23  ? ASP C 107 . ? 1_555 ? 
11 AC3 3 ASP C 25  ? ASP C 109 . ? 1_555 ? 
12 AC3 3 ASN C 134 ? ASN C 218 . ? 1_555 ? 
13 AC4 4 ASP D 23  ? ASP D 107 . ? 1_555 ? 
14 AC4 4 ASP D 25  ? ASP D 109 . ? 1_555 ? 
15 AC4 4 THR D 27  ? THR D 111 . ? 1_555 ? 
16 AC4 4 ASN D 134 ? ASN D 218 . ? 1_555 ? 
17 AC5 4 ASP E 23  ? ASP E 107 . ? 1_555 ? 
18 AC5 4 ASP E 25  ? ASP E 109 . ? 1_555 ? 
19 AC5 4 THR E 27  ? THR E 111 . ? 1_555 ? 
20 AC5 4 ASN E 134 ? ASN E 218 . ? 1_555 ? 
21 AC6 4 ASP F 23  ? ASP F 107 . ? 1_555 ? 
22 AC6 4 ASP F 25  ? ASP F 109 . ? 1_555 ? 
23 AC6 4 ASP F 133 ? ASP F 217 . ? 1_555 ? 
24 AC6 4 ASN F 134 ? ASN F 218 . ? 1_555 ? 
25 AC7 6 ASP G 23  ? ASP G 107 . ? 1_555 ? 
26 AC7 6 ASP G 25  ? ASP G 109 . ? 1_555 ? 
27 AC7 6 THR G 27  ? THR G 111 . ? 1_555 ? 
28 AC7 6 ASP G 133 ? ASP G 217 . ? 1_555 ? 
29 AC7 6 ASN G 134 ? ASN G 218 . ? 1_555 ? 
30 AC7 6 SER G 135 ? SER G 219 . ? 1_555 ? 
31 AC8 3 ASP H 23  ? ASP H 107 . ? 1_555 ? 
32 AC8 3 ASP H 25  ? ASP H 109 . ? 1_555 ? 
33 AC8 3 ASN H 134 ? ASN H 218 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2Q5E 
_atom_sites.fract_transf_matrix[1][1]   0.009204 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008501 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005878 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . LEU A 1 6   ? 21.438 -8.365  17.558  1.00 36.58 ? 90  LEU A N   1 
ATOM   2     C  CA  . LEU A 1 6   ? 22.406 -7.325  18.046  1.00 39.46 ? 90  LEU A CA  1 
ATOM   3     C  C   . LEU A 1 6   ? 21.824 -6.353  19.037  1.00 40.24 ? 90  LEU A C   1 
ATOM   4     O  O   . LEU A 1 6   ? 22.478 -5.951  19.980  1.00 39.24 ? 90  LEU A O   1 
ATOM   5     C  CB  . LEU A 1 6   ? 22.937 -6.474  16.900  1.00 40.05 ? 90  LEU A CB  1 
ATOM   6     C  CG  . LEU A 1 6   ? 24.396 -5.953  16.939  1.00 39.78 ? 90  LEU A CG  1 
ATOM   7     C  CD1 . LEU A 1 6   ? 25.427 -7.083  16.986  1.00 34.62 ? 90  LEU A CD1 1 
ATOM   8     C  CD2 . LEU A 1 6   ? 24.627 -5.097  15.677  1.00 38.48 ? 90  LEU A CD2 1 
ATOM   9     N  N   . LEU A 1 7   ? 20.592 -5.950  18.749  1.00 41.98 ? 91  LEU A N   1 
ATOM   10    C  CA  . LEU A 1 7   ? 19.756 -5.176  19.646  1.00 43.48 ? 91  LEU A CA  1 
ATOM   11    C  C   . LEU A 1 7   ? 18.693 -6.079  20.268  1.00 45.36 ? 91  LEU A C   1 
ATOM   12    O  O   . LEU A 1 7   ? 18.100 -6.927  19.584  1.00 45.20 ? 91  LEU A O   1 
ATOM   13    C  CB  . LEU A 1 7   ? 19.026 -4.056  18.898  1.00 41.45 ? 91  LEU A CB  1 
ATOM   14    C  CG  . LEU A 1 7   ? 19.741 -2.810  18.427  1.00 38.19 ? 91  LEU A CG  1 
ATOM   15    C  CD1 . LEU A 1 7   ? 18.609 -1.901  17.940  1.00 37.47 ? 91  LEU A CD1 1 
ATOM   16    C  CD2 . LEU A 1 7   ? 20.567 -2.116  19.487  1.00 31.46 ? 91  LEU A CD2 1 
ATOM   17    N  N   . PRO A 1 8   ? 18.410 -5.834  21.543  1.00 47.20 ? 92  PRO A N   1 
ATOM   18    C  CA  . PRO A 1 8   ? 17.273 -6.394  22.262  1.00 49.86 ? 92  PRO A CA  1 
ATOM   19    C  C   . PRO A 1 8   ? 16.014 -6.203  21.434  1.00 52.07 ? 92  PRO A C   1 
ATOM   20    O  O   . PRO A 1 8   ? 15.930 -5.262  20.657  1.00 52.54 ? 92  PRO A O   1 
ATOM   21    C  CB  . PRO A 1 8   ? 17.136 -5.475  23.493  1.00 49.71 ? 92  PRO A CB  1 
ATOM   22    C  CG  . PRO A 1 8   ? 18.129 -4.328  23.284  1.00 49.48 ? 92  PRO A CG  1 
ATOM   23    C  CD  . PRO A 1 8   ? 19.179 -4.881  22.352  1.00 47.29 ? 92  PRO A CD  1 
ATOM   24    N  N   . GLU A 1 9   ? 15.037 -7.064  21.618  1.00 54.44 ? 93  GLU A N   1 
ATOM   25    C  CA  . GLU A 1 9   ? 13.698 -6.804  21.089  1.00 58.15 ? 93  GLU A CA  1 
ATOM   26    C  C   . GLU A 1 9   ? 13.161 -5.382  21.429  1.00 56.62 ? 93  GLU A C   1 
ATOM   27    O  O   . GLU A 1 9   ? 13.323 -4.892  22.537  1.00 55.74 ? 93  GLU A O   1 
ATOM   28    C  CB  . GLU A 1 9   ? 12.713 -7.959  21.454  1.00 58.11 ? 93  GLU A CB  1 
ATOM   29    C  CG  . GLU A 1 9   ? 12.993 -9.221  20.548  1.00 63.25 ? 93  GLU A CG  1 
ATOM   30    C  CD  . GLU A 1 9   ? 11.877 -10.307 20.549  1.00 63.58 ? 93  GLU A CD  1 
ATOM   31    O  OE1 . GLU A 1 9   ? 11.781 -11.069 21.555  1.00 69.09 ? 93  GLU A OE1 1 
ATOM   32    O  OE2 . GLU A 1 9   ? 11.139 -10.407 19.525  1.00 67.52 ? 93  GLU A OE2 1 
ATOM   33    N  N   . VAL A 1 10  ? 12.592 -4.721  20.424  1.00 56.35 ? 94  VAL A N   1 
ATOM   34    C  CA  . VAL A 1 10  ? 11.994 -3.420  20.593  1.00 57.17 ? 94  VAL A CA  1 
ATOM   35    C  C   . VAL A 1 10  ? 11.029 -3.461  21.786  1.00 58.40 ? 94  VAL A C   1 
ATOM   36    O  O   . VAL A 1 10  ? 10.377 -4.479  22.006  1.00 59.06 ? 94  VAL A O   1 
ATOM   37    C  CB  . VAL A 1 10  ? 11.268 -2.996  19.275  1.00 56.79 ? 94  VAL A CB  1 
ATOM   38    C  CG1 . VAL A 1 10  ? 10.165 -3.969  18.899  1.00 55.96 ? 94  VAL A CG1 1 
ATOM   39    C  CG2 . VAL A 1 10  ? 10.699 -1.586  19.372  1.00 56.99 ? 94  VAL A CG2 1 
ATOM   40    N  N   . THR A 1 11  ? 10.938 -2.390  22.567  1.00 59.09 ? 95  THR A N   1 
ATOM   41    C  CA  . THR A 1 11  ? 9.957  -2.360  23.663  1.00 59.94 ? 95  THR A CA  1 
ATOM   42    C  C   . THR A 1 11  ? 8.541  -1.985  23.225  1.00 61.18 ? 95  THR A C   1 
ATOM   43    O  O   . THR A 1 11  ? 8.318  -1.590  22.081  1.00 61.28 ? 95  THR A O   1 
ATOM   44    C  CB  . THR A 1 11  ? 10.309 -1.335  24.730  1.00 59.52 ? 95  THR A CB  1 
ATOM   45    O  OG1 . THR A 1 11  ? 10.260 -0.028  24.153  1.00 59.58 ? 95  THR A OG1 1 
ATOM   46    C  CG2 . THR A 1 11  ? 11.659 -1.612  25.347  1.00 58.55 ? 95  THR A CG2 1 
ATOM   47    N  N   . GLU A 1 12  ? 7.606  -2.076  24.178  1.00 62.42 ? 96  GLU A N   1 
ATOM   48    C  CA  . GLU A 1 12  ? 6.215  -1.616  24.008  1.00 63.90 ? 96  GLU A CA  1 
ATOM   49    C  C   . GLU A 1 12  ? 6.221  -0.143  23.561  1.00 62.48 ? 96  GLU A C   1 
ATOM   50    O  O   . GLU A 1 12  ? 5.592  0.198   22.544  1.00 62.58 ? 96  GLU A O   1 
ATOM   51    C  CB  . GLU A 1 12  ? 5.404  -1.709  25.331  1.00 64.33 ? 96  GLU A CB  1 
ATOM   52    C  CG  . GLU A 1 12  ? 4.682  -3.027  25.702  1.00 67.17 ? 96  GLU A CG  1 
ATOM   53    C  CD  . GLU A 1 12  ? 4.210  -3.043  27.207  1.00 67.12 ? 96  GLU A CD  1 
ATOM   54    O  OE1 . GLU A 1 12  ? 3.350  -2.192  27.571  1.00 67.93 ? 96  GLU A OE1 1 
ATOM   55    O  OE2 . GLU A 1 12  ? 4.706  -3.897  28.015  1.00 68.42 ? 96  GLU A OE2 1 
ATOM   56    N  N   . GLU A 1 13  ? 6.895  0.724   24.328  1.00 60.51 ? 97  GLU A N   1 
ATOM   57    C  CA  . GLU A 1 13  ? 6.956  2.132   23.940  1.00 59.43 ? 97  GLU A CA  1 
ATOM   58    C  C   . GLU A 1 13  ? 7.692  2.396   22.639  1.00 57.09 ? 97  GLU A C   1 
ATOM   59    O  O   . GLU A 1 13  ? 7.275  3.258   21.931  1.00 58.03 ? 97  GLU A O   1 
ATOM   60    C  CB  . GLU A 1 13  ? 7.424  3.080   25.060  1.00 60.18 ? 97  GLU A CB  1 
ATOM   61    C  CG  . GLU A 1 13  ? 8.499  2.507   26.014  1.00 65.84 ? 97  GLU A CG  1 
ATOM   62    C  CD  . GLU A 1 13  ? 9.866  3.248   25.946  1.00 70.26 ? 97  GLU A CD  1 
ATOM   63    O  OE1 . GLU A 1 13  ? 9.860  4.513   26.161  1.00 67.16 ? 97  GLU A OE1 1 
ATOM   64    O  OE2 . GLU A 1 13  ? 10.915 2.534   25.701  1.00 69.50 ? 97  GLU A OE2 1 
ATOM   65    N  N   . ASP A 1 14  ? 8.735  1.659   22.279  1.00 54.61 ? 98  ASP A N   1 
ATOM   66    C  CA  . ASP A 1 14  ? 9.440  1.979   21.028  1.00 52.55 ? 98  ASP A CA  1 
ATOM   67    C  C   . ASP A 1 14  ? 8.727  1.440   19.808  1.00 52.56 ? 98  ASP A C   1 
ATOM   68    O  O   . ASP A 1 14  ? 9.095  1.746   18.666  1.00 52.05 ? 98  ASP A O   1 
ATOM   69    C  CB  . ASP A 1 14  ? 10.878 1.469   21.031  1.00 50.99 ? 98  ASP A CB  1 
ATOM   70    C  CG  . ASP A 1 14  ? 11.687 2.073   22.091  1.00 48.06 ? 98  ASP A CG  1 
ATOM   71    O  OD1 . ASP A 1 14  ? 11.375 3.219   22.454  1.00 47.59 ? 98  ASP A OD1 1 
ATOM   72    O  OD2 . ASP A 1 14  ? 12.643 1.425   22.582  1.00 46.15 ? 98  ASP A OD2 1 
ATOM   73    N  N   . GLN A 1 15  ? 7.703  0.640   20.075  1.00 52.51 ? 99  GLN A N   1 
ATOM   74    C  CA  . GLN A 1 15  ? 7.022  -0.165  19.085  1.00 52.57 ? 99  GLN A CA  1 
ATOM   75    C  C   . GLN A 1 15  ? 7.062  0.396   17.643  1.00 51.20 ? 99  GLN A C   1 
ATOM   76    O  O   . GLN A 1 15  ? 7.645  -0.241  16.698  1.00 51.61 ? 99  GLN A O   1 
ATOM   77    C  CB  . GLN A 1 15  ? 5.597  -0.427  19.562  1.00 54.06 ? 99  GLN A CB  1 
ATOM   78    C  CG  . GLN A 1 15  ? 5.063  -1.830  19.281  1.00 58.89 ? 99  GLN A CG  1 
ATOM   79    C  CD  . GLN A 1 15  ? 4.564  -2.522  20.570  1.00 63.91 ? 99  GLN A CD  1 
ATOM   80    O  OE1 . GLN A 1 15  ? 3.661  -2.014  21.295  1.00 62.60 ? 99  GLN A OE1 1 
ATOM   81    N  NE2 . GLN A 1 15  ? 5.173  -3.680  20.873  1.00 63.31 ? 99  GLN A NE2 1 
ATOM   82    N  N   . GLY A 1 16  ? 6.498  1.572   17.412  1.00 47.98 ? 100 GLY A N   1 
ATOM   83    C  CA  . GLY A 1 16  ? 6.469  1.954   15.968  1.00 44.52 ? 100 GLY A CA  1 
ATOM   84    C  C   . GLY A 1 16  ? 7.538  2.936   15.529  1.00 41.55 ? 100 GLY A C   1 
ATOM   85    O  O   . GLY A 1 16  ? 7.393  3.589   14.516  1.00 40.80 ? 100 GLY A O   1 
ATOM   86    N  N   . ARG A 1 17  ? 8.594  3.071   16.320  1.00 38.80 ? 101 ARG A N   1 
ATOM   87    C  CA  . ARG A 1 17  ? 9.470  4.194   16.165  1.00 36.41 ? 101 ARG A CA  1 
ATOM   88    C  C   . ARG A 1 17  ? 10.622 3.845   15.246  1.00 35.58 ? 101 ARG A C   1 
ATOM   89    O  O   . ARG A 1 17  ? 11.058 2.696   15.135  1.00 35.90 ? 101 ARG A O   1 
ATOM   90    C  CB  . ARG A 1 17  ? 10.011 4.594   17.509  1.00 37.46 ? 101 ARG A CB  1 
ATOM   91    C  CG  . ARG A 1 17  ? 9.030  5.290   18.467  1.00 36.83 ? 101 ARG A CG  1 
ATOM   92    C  CD  . ARG A 1 17  ? 9.803  5.631   19.710  1.00 39.58 ? 101 ARG A CD  1 
ATOM   93    N  NE  . ARG A 1 17  ? 8.978  6.132   20.785  1.00 41.95 ? 101 ARG A NE  1 
ATOM   94    C  CZ  . ARG A 1 17  ? 9.407  6.926   21.745  1.00 41.28 ? 101 ARG A CZ  1 
ATOM   95    N  NH1 . ARG A 1 17  ? 10.662 7.341   21.771  1.00 43.25 ? 101 ARG A NH1 1 
ATOM   96    N  NH2 . ARG A 1 17  ? 8.571  7.333   22.666  1.00 40.69 ? 101 ARG A NH2 1 
ATOM   97    N  N   . ILE A 1 18  ? 11.109 4.833   14.542  1.00 33.84 ? 102 ILE A N   1 
ATOM   98    C  CA  . ILE A 1 18  ? 12.309 4.650   13.774  1.00 32.19 ? 102 ILE A CA  1 
ATOM   99    C  C   . ILE A 1 18  ? 13.432 4.437   14.755  1.00 31.22 ? 102 ILE A C   1 
ATOM   100   O  O   . ILE A 1 18  ? 13.412 4.952   15.852  1.00 31.34 ? 102 ILE A O   1 
ATOM   101   C  CB  . ILE A 1 18  ? 12.533 5.865   12.911  1.00 32.63 ? 102 ILE A CB  1 
ATOM   102   C  CG1 . ILE A 1 18  ? 11.593 5.784   11.694  1.00 31.31 ? 102 ILE A CG1 1 
ATOM   103   C  CG2 . ILE A 1 18  ? 13.976 5.980   12.468  1.00 33.05 ? 102 ILE A CG2 1 
ATOM   104   C  CD1 . ILE A 1 18  ? 11.389 7.112   10.988  1.00 30.36 ? 102 ILE A CD1 1 
ATOM   105   N  N   . CYS A 1 19  ? 14.377 3.606   14.391  1.00 31.03 ? 103 CYS A N   1 
ATOM   106   C  CA  . CYS A 1 19  ? 15.543 3.368   15.227  1.00 30.58 ? 103 CYS A CA  1 
ATOM   107   C  C   . CYS A 1 19  ? 16.723 4.284   14.794  1.00 30.33 ? 103 CYS A C   1 
ATOM   108   O  O   . CYS A 1 19  ? 17.137 4.224   13.660  1.00 29.89 ? 103 CYS A O   1 
ATOM   109   C  CB  . CYS A 1 19  ? 15.949 1.914   15.077  1.00 29.59 ? 103 CYS A CB  1 
ATOM   110   S  SG  . CYS A 1 19  ? 17.536 1.647   15.866  1.00 33.40 ? 103 CYS A SG  1 
ATOM   111   N  N   . VAL A 1 20  ? 17.237 5.131   15.676  1.00 30.84 ? 104 VAL A N   1 
ATOM   112   C  CA  . VAL A 1 20  ? 18.338 6.054   15.303  1.00 31.68 ? 104 VAL A CA  1 
ATOM   113   C  C   . VAL A 1 20  ? 19.622 5.661   15.985  1.00 31.49 ? 104 VAL A C   1 
ATOM   114   O  O   . VAL A 1 20  ? 19.673 5.612   17.207  1.00 33.01 ? 104 VAL A O   1 
ATOM   115   C  CB  . VAL A 1 20  ? 18.101 7.492   15.669  1.00 31.59 ? 104 VAL A CB  1 
ATOM   116   C  CG1 . VAL A 1 20  ? 19.244 8.311   15.098  1.00 33.37 ? 104 VAL A CG1 1 
ATOM   117   C  CG2 . VAL A 1 20  ? 16.792 7.980   15.096  1.00 31.30 ? 104 VAL A CG2 1 
ATOM   118   N  N   . VAL A 1 21  ? 20.621 5.300   15.198  1.00 30.02 ? 105 VAL A N   1 
ATOM   119   C  CA  . VAL A 1 21  ? 21.884 4.898   15.744  1.00 29.02 ? 105 VAL A CA  1 
ATOM   120   C  C   . VAL A 1 21  ? 22.751 6.164   15.832  1.00 28.70 ? 105 VAL A C   1 
ATOM   121   O  O   . VAL A 1 21  ? 22.872 6.915   14.860  1.00 26.47 ? 105 VAL A O   1 
ATOM   122   C  CB  . VAL A 1 21  ? 22.482 3.817   14.820  1.00 30.20 ? 105 VAL A CB  1 
ATOM   123   C  CG1 . VAL A 1 21  ? 24.004 3.729   14.920  1.00 29.39 ? 105 VAL A CG1 1 
ATOM   124   C  CG2 . VAL A 1 21  ? 21.794 2.457   15.073  1.00 29.50 ? 105 VAL A CG2 1 
ATOM   125   N  N   . ILE A 1 22  ? 23.338 6.417   17.001  1.00 28.88 ? 106 ILE A N   1 
ATOM   126   C  CA  . ILE A 1 22  ? 24.082 7.660   17.218  1.00 28.67 ? 106 ILE A CA  1 
ATOM   127   C  C   . ILE A 1 22  ? 25.506 7.362   17.723  1.00 29.53 ? 106 ILE A C   1 
ATOM   128   O  O   . ILE A 1 22  ? 25.697 6.597   18.682  1.00 28.55 ? 106 ILE A O   1 
ATOM   129   C  CB  . ILE A 1 22  ? 23.358 8.611   18.190  1.00 29.07 ? 106 ILE A CB  1 
ATOM   130   C  CG1 . ILE A 1 22  ? 21.845 8.748   17.864  1.00 29.84 ? 106 ILE A CG1 1 
ATOM   131   C  CG2 . ILE A 1 22  ? 24.008 10.012  18.166  1.00 29.94 ? 106 ILE A CG2 1 
ATOM   132   C  CD1 . ILE A 1 22  ? 21.154 9.928   18.648  1.00 27.53 ? 106 ILE A CD1 1 
ATOM   133   N  N   . ASP A 1 23  ? 26.483 7.967   17.048  1.00 29.29 ? 107 ASP A N   1 
ATOM   134   C  CA  . ASP A 1 23  ? 27.878 7.893   17.417  1.00 29.99 ? 107 ASP A CA  1 
ATOM   135   C  C   . ASP A 1 23  ? 28.209 8.884   18.557  1.00 28.94 ? 107 ASP A C   1 
ATOM   136   O  O   . ASP A 1 23  ? 27.475 9.828   18.823  1.00 28.29 ? 107 ASP A O   1 
ATOM   137   C  CB  . ASP A 1 23  ? 28.711 8.168   16.155  1.00 31.87 ? 107 ASP A CB  1 
ATOM   138   C  CG  . ASP A 1 23  ? 30.214 8.276   16.419  1.00 36.58 ? 107 ASP A CG  1 
ATOM   139   O  OD1 . ASP A 1 23  ? 30.951 7.303   16.729  1.00 34.85 ? 107 ASP A OD1 1 
ATOM   140   O  OD2 . ASP A 1 23  ? 30.664 9.426   16.337  1.00 45.24 ? 107 ASP A OD2 1 
ATOM   141   N  N   . LEU A 1 24  ? 29.328 8.638   19.232  1.00 27.66 ? 108 LEU A N   1 
ATOM   142   C  CA  . LEU A 1 24  ? 29.805 9.426   20.370  1.00 25.56 ? 108 LEU A CA  1 
ATOM   143   C  C   . LEU A 1 24  ? 30.925 10.430  20.065  1.00 25.56 ? 108 LEU A C   1 
ATOM   144   O  O   . LEU A 1 24  ? 30.687 11.633  20.047  1.00 24.63 ? 108 LEU A O   1 
ATOM   145   C  CB  . LEU A 1 24  ? 30.266 8.454   21.434  1.00 24.28 ? 108 LEU A CB  1 
ATOM   146   C  CG  . LEU A 1 24  ? 30.637 9.035   22.783  1.00 26.72 ? 108 LEU A CG  1 
ATOM   147   C  CD1 . LEU A 1 24  ? 29.467 9.730   23.564  1.00 23.36 ? 108 LEU A CD1 1 
ATOM   148   C  CD2 . LEU A 1 24  ? 31.236 7.907   23.532  1.00 23.01 ? 108 LEU A CD2 1 
ATOM   149   N  N   . ASP A 1 25  ? 32.151 9.965   19.857  1.00 27.16 ? 109 ASP A N   1 
ATOM   150   C  CA  . ASP A 1 25  ? 33.295 10.907  19.701  1.00 29.33 ? 109 ASP A CA  1 
ATOM   151   C  C   . ASP A 1 25  ? 33.152 11.797  18.484  1.00 29.26 ? 109 ASP A C   1 
ATOM   152   O  O   . ASP A 1 25  ? 32.868 11.346  17.373  1.00 28.72 ? 109 ASP A O   1 
ATOM   153   C  CB  . ASP A 1 25  ? 34.625 10.199  19.648  1.00 30.58 ? 109 ASP A CB  1 
ATOM   154   C  CG  . ASP A 1 25  ? 34.978 9.553   20.983  1.00 34.81 ? 109 ASP A CG  1 
ATOM   155   O  OD1 . ASP A 1 25  ? 35.096 10.249  22.030  1.00 32.81 ? 109 ASP A OD1 1 
ATOM   156   O  OD2 . ASP A 1 25  ? 35.099 8.318   20.958  1.00 41.76 ? 109 ASP A OD2 1 
ATOM   157   N  N   . GLU A 1 26  ? 33.284 13.084  18.757  1.00 28.80 ? 110 GLU A N   1 
ATOM   158   C  CA  . GLU A 1 26  ? 33.168 14.130  17.752  1.00 28.27 ? 110 GLU A CA  1 
ATOM   159   C  C   . GLU A 1 26  ? 31.759 14.375  17.133  1.00 27.80 ? 110 GLU A C   1 
ATOM   160   O  O   . GLU A 1 26  ? 31.618 15.286  16.311  1.00 28.35 ? 110 GLU A O   1 
ATOM   161   C  CB  . GLU A 1 26  ? 34.313 14.003  16.697  1.00 27.68 ? 110 GLU A CB  1 
ATOM   162   C  CG  . GLU A 1 26  ? 35.705 14.216  17.269  1.00 25.15 ? 110 GLU A CG  1 
ATOM   163   C  CD  . GLU A 1 26  ? 36.243 12.985  17.980  1.00 29.18 ? 110 GLU A CD  1 
ATOM   164   O  OE1 . GLU A 1 26  ? 36.254 11.880  17.357  1.00 28.73 ? 110 GLU A OE1 1 
ATOM   165   O  OE2 . GLU A 1 26  ? 36.682 13.114  19.158  1.00 28.08 ? 110 GLU A OE2 1 
ATOM   166   N  N   . THR A 1 27  ? 30.763 13.569  17.515  1.00 26.78 ? 111 THR A N   1 
ATOM   167   C  CA  . THR A 1 27  ? 29.365 13.755  17.146  1.00 26.07 ? 111 THR A CA  1 
ATOM   168   C  C   . THR A 1 27  ? 28.602 14.393  18.311  1.00 26.71 ? 111 THR A C   1 
ATOM   169   O  O   . THR A 1 27  ? 27.998 15.458  18.145  1.00 26.73 ? 111 THR A O   1 
ATOM   170   C  CB  . THR A 1 27  ? 28.717 12.435  16.837  1.00 26.21 ? 111 THR A CB  1 
ATOM   171   O  OG1 . THR A 1 27  ? 29.411 11.812  15.775  1.00 25.98 ? 111 THR A OG1 1 
ATOM   172   C  CG2 . THR A 1 27  ? 27.276 12.591  16.395  1.00 24.51 ? 111 THR A CG2 1 
ATOM   173   N  N   . LEU A 1 28  ? 28.672 13.760  19.497  1.00 26.43 ? 112 LEU A N   1 
ATOM   174   C  CA  . LEU A 1 28  ? 28.076 14.292  20.736  1.00 25.58 ? 112 LEU A CA  1 
ATOM   175   C  C   . LEU A 1 28  ? 29.078 14.890  21.697  1.00 26.14 ? 112 LEU A C   1 
ATOM   176   O  O   . LEU A 1 28  ? 28.729 15.751  22.463  1.00 26.48 ? 112 LEU A O   1 
ATOM   177   C  CB  . LEU A 1 28  ? 27.287 13.218  21.498  1.00 24.02 ? 112 LEU A CB  1 
ATOM   178   C  CG  . LEU A 1 28  ? 26.184 12.537  20.705  1.00 23.38 ? 112 LEU A CG  1 
ATOM   179   C  CD1 . LEU A 1 28  ? 25.487 11.496  21.521  1.00 18.94 ? 112 LEU A CD1 1 
ATOM   180   C  CD2 . LEU A 1 28  ? 25.184 13.512  20.023  1.00 18.67 ? 112 LEU A CD2 1 
ATOM   181   N  N   . VAL A 1 29  ? 30.307 14.373  21.714  1.00 26.71 ? 113 VAL A N   1 
ATOM   182   C  CA  . VAL A 1 29  ? 31.317 14.838  22.662  1.00 26.46 ? 113 VAL A CA  1 
ATOM   183   C  C   . VAL A 1 29  ? 32.683 14.875  22.002  1.00 27.46 ? 113 VAL A C   1 
ATOM   184   O  O   . VAL A 1 29  ? 32.904 14.362  20.898  1.00 26.90 ? 113 VAL A O   1 
ATOM   185   C  CB  . VAL A 1 29  ? 31.473 13.921  23.915  1.00 26.42 ? 113 VAL A CB  1 
ATOM   186   C  CG1 . VAL A 1 29  ? 30.190 13.815  24.748  1.00 24.52 ? 113 VAL A CG1 1 
ATOM   187   C  CG2 . VAL A 1 29  ? 31.998 12.578  23.519  1.00 25.73 ? 113 VAL A CG2 1 
ATOM   188   N  N   . HIS A 1 30  ? 33.633 15.463  22.708  1.00 29.06 ? 114 HIS A N   1 
ATOM   189   C  CA  . HIS A 1 30  ? 35.014 15.446  22.237  1.00 29.10 ? 114 HIS A CA  1 
ATOM   190   C  C   . HIS A 1 30  ? 35.896 15.263  23.395  1.00 28.53 ? 114 HIS A C   1 
ATOM   191   O  O   . HIS A 1 30  ? 35.814 15.991  24.318  1.00 28.47 ? 114 HIS A O   1 
ATOM   192   C  CB  . HIS A 1 30  ? 35.399 16.717  21.442  1.00 29.06 ? 114 HIS A CB  1 
ATOM   193   C  CG  . HIS A 1 30  ? 36.838 16.732  21.098  1.00 32.10 ? 114 HIS A CG  1 
ATOM   194   N  ND1 . HIS A 1 30  ? 37.419 15.722  20.349  1.00 35.75 ? 114 HIS A ND1 1 
ATOM   195   C  CD2 . HIS A 1 30  ? 37.851 17.503  21.549  1.00 30.92 ? 114 HIS A CD2 1 
ATOM   196   C  CE1 . HIS A 1 30  ? 38.714 15.932  20.281  1.00 32.81 ? 114 HIS A CE1 1 
ATOM   197   N  NE2 . HIS A 1 30  ? 39.006 16.990  21.017  1.00 32.45 ? 114 HIS A NE2 1 
ATOM   198   N  N   . SER A 1 31  ? 36.735 14.244  23.368  1.00 31.01 ? 115 SER A N   1 
ATOM   199   C  CA  . SER A 1 31  ? 37.595 13.905  24.530  1.00 31.92 ? 115 SER A CA  1 
ATOM   200   C  C   . SER A 1 31  ? 39.077 14.098  24.332  1.00 32.41 ? 115 SER A C   1 
ATOM   201   O  O   . SER A 1 31  ? 39.557 14.079  23.195  1.00 33.02 ? 115 SER A O   1 
ATOM   202   C  CB  . SER A 1 31  ? 37.403 12.475  24.835  1.00 31.89 ? 115 SER A CB  1 
ATOM   203   O  OG  . SER A 1 31  ? 36.223 12.399  25.600  1.00 39.10 ? 115 SER A OG  1 
ATOM   204   N  N   . SER A 1 32  ? 39.789 14.253  25.445  1.00 33.26 ? 116 SER A N   1 
ATOM   205   C  CA  . SER A 1 32  ? 41.213 14.481  25.460  1.00 33.73 ? 116 SER A CA  1 
ATOM   206   C  C   . SER A 1 32  ? 41.939 14.084  26.749  1.00 33.47 ? 116 SER A C   1 
ATOM   207   O  O   . SER A 1 32  ? 41.347 14.081  27.835  1.00 32.42 ? 116 SER A O   1 
ATOM   208   C  CB  . SER A 1 32  ? 41.460 15.927  25.219  1.00 34.39 ? 116 SER A CB  1 
ATOM   209   O  OG  . SER A 1 32  ? 42.820 16.123  24.962  1.00 39.42 ? 116 SER A OG  1 
ATOM   210   N  N   . PHE A 1 33  ? 43.237 13.772  26.605  1.00 33.16 ? 117 PHE A N   1 
ATOM   211   C  CA  . PHE A 1 33  ? 44.107 13.427  27.746  1.00 34.13 ? 117 PHE A CA  1 
ATOM   212   C  C   . PHE A 1 33  ? 44.765 14.652  28.282  1.00 34.57 ? 117 PHE A C   1 
ATOM   213   O  O   . PHE A 1 33  ? 45.386 14.589  29.319  1.00 36.43 ? 117 PHE A O   1 
ATOM   214   C  CB  . PHE A 1 33  ? 45.195 12.411  27.405  1.00 33.71 ? 117 PHE A CB  1 
ATOM   215   C  CG  . PHE A 1 33  ? 44.660 11.091  26.979  1.00 34.42 ? 117 PHE A CG  1 
ATOM   216   C  CD1 . PHE A 1 33  ? 44.724 10.709  25.659  1.00 32.96 ? 117 PHE A CD1 1 
ATOM   217   C  CD2 . PHE A 1 33  ? 44.052 10.237  27.899  1.00 35.10 ? 117 PHE A CD2 1 
ATOM   218   C  CE1 . PHE A 1 33  ? 44.187 9.496   25.257  1.00 36.84 ? 117 PHE A CE1 1 
ATOM   219   C  CE2 . PHE A 1 33  ? 43.523 9.011   27.510  1.00 34.49 ? 117 PHE A CE2 1 
ATOM   220   C  CZ  . PHE A 1 33  ? 43.558 8.656   26.198  1.00 36.81 ? 117 PHE A CZ  1 
ATOM   221   N  N   . LYS A 1 34  ? 44.621 15.767  27.578  1.00 35.38 ? 118 LYS A N   1 
ATOM   222   C  CA  . LYS A 1 34  ? 45.175 17.012  28.007  1.00 36.53 ? 118 LYS A CA  1 
ATOM   223   C  C   . LYS A 1 34  ? 44.226 17.674  29.039  1.00 38.34 ? 118 LYS A C   1 
ATOM   224   O  O   . LYS A 1 34  ? 43.124 17.960  28.741  1.00 36.95 ? 118 LYS A O   1 
ATOM   225   C  CB  . LYS A 1 34  ? 45.426 17.931  26.804  1.00 34.42 ? 118 LYS A CB  1 
ATOM   226   C  CG  . LYS A 1 34  ? 45.674 19.352  27.285  1.00 34.51 ? 118 LYS A CG  1 
ATOM   227   C  CD  . LYS A 1 34  ? 46.117 20.231  26.186  1.00 42.55 ? 118 LYS A CD  1 
ATOM   228   C  CE  . LYS A 1 34  ? 46.450 21.643  26.687  1.00 48.98 ? 118 LYS A CE  1 
ATOM   229   N  NZ  . LYS A 1 34  ? 45.460 22.673  26.141  1.00 54.30 ? 118 LYS A NZ  1 
ATOM   230   N  N   . PRO A 1 35  ? 44.678 17.916  30.255  1.00 41.17 ? 119 PRO A N   1 
ATOM   231   C  CA  . PRO A 1 35  ? 43.811 18.603  31.215  1.00 43.75 ? 119 PRO A CA  1 
ATOM   232   C  C   . PRO A 1 35  ? 43.349 19.923  30.700  1.00 47.08 ? 119 PRO A C   1 
ATOM   233   O  O   . PRO A 1 35  ? 44.147 20.708  30.217  1.00 49.21 ? 119 PRO A O   1 
ATOM   234   C  CB  . PRO A 1 35  ? 44.731 18.880  32.411  1.00 43.66 ? 119 PRO A CB  1 
ATOM   235   C  CG  . PRO A 1 35  ? 45.835 17.836  32.333  1.00 42.54 ? 119 PRO A CG  1 
ATOM   236   C  CD  . PRO A 1 35  ? 45.975 17.512  30.822  1.00 41.58 ? 119 PRO A CD  1 
ATOM   237   N  N   . ILE A 1 36  ? 42.063 20.192  30.840  1.00 49.99 ? 120 ILE A N   1 
ATOM   238   C  CA  . ILE A 1 36  ? 41.514 21.511  30.598  1.00 51.80 ? 120 ILE A CA  1 
ATOM   239   C  C   . ILE A 1 36  ? 40.611 21.967  31.778  1.00 53.50 ? 120 ILE A C   1 
ATOM   240   O  O   . ILE A 1 36  ? 40.095 21.130  32.552  1.00 54.48 ? 120 ILE A O   1 
ATOM   241   C  CB  . ILE A 1 36  ? 40.773 21.486  29.311  1.00 52.18 ? 120 ILE A CB  1 
ATOM   242   C  CG1 . ILE A 1 36  ? 39.513 20.619  29.420  1.00 50.39 ? 120 ILE A CG1 1 
ATOM   243   C  CG2 . ILE A 1 36  ? 41.704 20.949  28.245  1.00 52.66 ? 120 ILE A CG2 1 
ATOM   244   C  CD1 . ILE A 1 36  ? 39.125 20.060  28.088  1.00 50.76 ? 120 ILE A CD1 1 
ATOM   245   N  N   . ASN A 1 37  ? 40.432 23.278  31.950  1.00 54.29 ? 121 ASN A N   1 
ATOM   246   C  CA  . ASN A 1 37  ? 39.644 23.735  33.110  1.00 54.98 ? 121 ASN A CA  1 
ATOM   247   C  C   . ASN A 1 37  ? 38.152 23.827  32.804  1.00 53.48 ? 121 ASN A C   1 
ATOM   248   O  O   . ASN A 1 37  ? 37.323 23.923  33.687  1.00 53.32 ? 121 ASN A O   1 
ATOM   249   C  CB  . ASN A 1 37  ? 40.211 25.053  33.638  1.00 56.51 ? 121 ASN A CB  1 
ATOM   250   C  CG  . ASN A 1 37  ? 41.095 24.843  34.859  1.00 60.03 ? 121 ASN A CG  1 
ATOM   251   O  OD1 . ASN A 1 37  ? 40.867 23.909  35.643  1.00 62.87 ? 121 ASN A OD1 1 
ATOM   252   N  ND2 . ASN A 1 37  ? 42.101 25.708  35.032  1.00 61.43 ? 121 ASN A ND2 1 
ATOM   253   N  N   . ASN A 1 38  ? 37.895 23.709  31.509  1.00 52.11 ? 122 ASN A N   1 
ATOM   254   C  CA  . ASN A 1 38  ? 36.683 23.954  30.732  1.00 51.06 ? 122 ASN A CA  1 
ATOM   255   C  C   . ASN A 1 38  ? 35.712 22.737  30.668  1.00 49.29 ? 122 ASN A C   1 
ATOM   256   O  O   . ASN A 1 38  ? 34.631 22.817  30.101  1.00 49.92 ? 122 ASN A O   1 
ATOM   257   C  CB  . ASN A 1 38  ? 37.256 24.183  29.309  1.00 51.06 ? 122 ASN A CB  1 
ATOM   258   C  CG  . ASN A 1 38  ? 36.302 24.874  28.365  1.00 56.79 ? 122 ASN A CG  1 
ATOM   259   O  OD1 . ASN A 1 38  ? 35.377 25.613  28.779  1.00 61.49 ? 122 ASN A OD1 1 
ATOM   260   N  ND2 . ASN A 1 38  ? 36.538 24.669  27.064  1.00 56.60 ? 122 ASN A ND2 1 
ATOM   261   N  N   . ALA A 1 39  ? 36.133 21.608  31.222  1.00 46.29 ? 123 ALA A N   1 
ATOM   262   C  CA  . ALA A 1 39  ? 35.612 20.322  30.883  1.00 42.71 ? 123 ALA A CA  1 
ATOM   263   C  C   . ALA A 1 39  ? 34.354 20.082  31.629  1.00 41.83 ? 123 ALA A C   1 
ATOM   264   O  O   . ALA A 1 39  ? 34.217 20.523  32.775  1.00 41.23 ? 123 ALA A O   1 
ATOM   265   C  CB  . ALA A 1 39  ? 36.620 19.255  31.262  1.00 42.22 ? 123 ALA A CB  1 
ATOM   266   N  N   . ASP A 1 40  ? 33.451 19.327  30.996  1.00 39.75 ? 124 ASP A N   1 
ATOM   267   C  CA  . ASP A 1 40  ? 32.170 19.014  31.563  1.00 37.32 ? 124 ASP A CA  1 
ATOM   268   C  C   . ASP A 1 40  ? 32.255 17.791  32.400  1.00 36.87 ? 124 ASP A C   1 
ATOM   269   O  O   . ASP A 1 40  ? 31.504 17.667  33.392  1.00 35.40 ? 124 ASP A O   1 
ATOM   270   C  CB  . ASP A 1 40  ? 31.199 18.770  30.437  1.00 37.65 ? 124 ASP A CB  1 
ATOM   271   C  CG  . ASP A 1 40  ? 31.036 19.997  29.531  1.00 40.28 ? 124 ASP A CG  1 
ATOM   272   O  OD1 . ASP A 1 40  ? 30.646 21.071  30.063  1.00 41.44 ? 124 ASP A OD1 1 
ATOM   273   O  OD2 . ASP A 1 40  ? 31.285 19.886  28.298  1.00 40.42 ? 124 ASP A OD2 1 
ATOM   274   N  N   . PHE A 1 41  ? 33.117 16.838  31.979  1.00 36.19 ? 125 PHE A N   1 
ATOM   275   C  CA  . PHE A 1 41  ? 33.381 15.646  32.789  1.00 35.30 ? 125 PHE A CA  1 
ATOM   276   C  C   . PHE A 1 41  ? 34.826 15.257  32.777  1.00 34.93 ? 125 PHE A C   1 
ATOM   277   O  O   . PHE A 1 41  ? 35.531 15.456  31.813  1.00 35.44 ? 125 PHE A O   1 
ATOM   278   C  CB  . PHE A 1 41  ? 32.567 14.369  32.426  1.00 36.81 ? 125 PHE A CB  1 
ATOM   279   C  CG  . PHE A 1 41  ? 31.362 14.559  31.550  1.00 37.59 ? 125 PHE A CG  1 
ATOM   280   C  CD1 . PHE A 1 41  ? 31.284 13.872  30.330  1.00 40.27 ? 125 PHE A CD1 1 
ATOM   281   C  CD2 . PHE A 1 41  ? 30.263 15.309  31.962  1.00 41.55 ? 125 PHE A CD2 1 
ATOM   282   C  CE1 . PHE A 1 41  ? 30.175 13.997  29.494  1.00 37.52 ? 125 PHE A CE1 1 
ATOM   283   C  CE2 . PHE A 1 41  ? 29.117 15.436  31.117  1.00 42.60 ? 125 PHE A CE2 1 
ATOM   284   C  CZ  . PHE A 1 41  ? 29.091 14.790  29.890  1.00 38.07 ? 125 PHE A CZ  1 
ATOM   285   N  N   . ILE A 1 42  ? 35.278 14.658  33.859  1.00 34.71 ? 126 ILE A N   1 
ATOM   286   C  CA  . ILE A 1 42  ? 36.626 14.092  33.909  1.00 34.18 ? 126 ILE A CA  1 
ATOM   287   C  C   . ILE A 1 42  ? 36.402 12.637  34.251  1.00 35.69 ? 126 ILE A C   1 
ATOM   288   O  O   . ILE A 1 42  ? 35.747 12.354  35.236  1.00 37.01 ? 126 ILE A O   1 
ATOM   289   C  CB  . ILE A 1 42  ? 37.444 14.779  34.990  1.00 32.82 ? 126 ILE A CB  1 
ATOM   290   C  CG1 . ILE A 1 42  ? 37.454 16.278  34.720  1.00 32.27 ? 126 ILE A CG1 1 
ATOM   291   C  CG2 . ILE A 1 42  ? 38.776 14.180  35.079  1.00 28.83 ? 126 ILE A CG2 1 
ATOM   292   C  CD1 . ILE A 1 42  ? 38.166 17.088  35.723  1.00 35.17 ? 126 ILE A CD1 1 
ATOM   293   N  N   . VAL A 1 43  ? 36.877 11.707  33.445  1.00 36.36 ? 127 VAL A N   1 
ATOM   294   C  CA  . VAL A 1 43  ? 36.693 10.332  33.811  1.00 38.48 ? 127 VAL A CA  1 
ATOM   295   C  C   . VAL A 1 43  ? 37.994 9.546   33.843  1.00 39.56 ? 127 VAL A C   1 
ATOM   296   O  O   . VAL A 1 43  ? 38.757 9.592   32.905  1.00 37.74 ? 127 VAL A O   1 
ATOM   297   C  CB  . VAL A 1 43  ? 35.606 9.623   32.987  1.00 38.22 ? 127 VAL A CB  1 
ATOM   298   C  CG1 . VAL A 1 43  ? 34.901 10.561  32.153  1.00 39.67 ? 127 VAL A CG1 1 
ATOM   299   C  CG2 . VAL A 1 43  ? 36.169 8.554   32.167  1.00 39.93 ? 127 VAL A CG2 1 
ATOM   300   N  N   . PRO A 1 44  ? 38.248 8.859   34.962  1.00 41.61 ? 128 PRO A N   1 
ATOM   301   C  CA  . PRO A 1 44  ? 39.437 8.090   35.129  1.00 43.41 ? 128 PRO A CA  1 
ATOM   302   C  C   . PRO A 1 44  ? 39.359 6.759   34.398  1.00 45.92 ? 128 PRO A C   1 
ATOM   303   O  O   . PRO A 1 44  ? 38.511 5.943   34.666  1.00 45.38 ? 128 PRO A O   1 
ATOM   304   C  CB  . PRO A 1 44  ? 39.536 7.932   36.649  1.00 43.33 ? 128 PRO A CB  1 
ATOM   305   C  CG  . PRO A 1 44  ? 38.121 7.869   37.094  1.00 42.38 ? 128 PRO A CG  1 
ATOM   306   C  CD  . PRO A 1 44  ? 37.412 8.845   36.179  1.00 42.12 ? 128 PRO A CD  1 
ATOM   307   N  N   . ILE A 1 45  ? 40.262 6.572   33.449  1.00 50.06 ? 129 ILE A N   1 
ATOM   308   C  CA  . ILE A 1 45  ? 40.371 5.314   32.748  1.00 55.42 ? 129 ILE A CA  1 
ATOM   309   C  C   . ILE A 1 45  ? 41.746 4.643   32.982  1.00 58.89 ? 129 ILE A C   1 
ATOM   310   O  O   . ILE A 1 45  ? 42.820 5.247   32.739  1.00 59.37 ? 129 ILE A O   1 
ATOM   311   C  CB  . ILE A 1 45  ? 40.031 5.497   31.305  1.00 54.68 ? 129 ILE A CB  1 
ATOM   312   C  CG1 . ILE A 1 45  ? 38.517 5.664   31.186  1.00 56.44 ? 129 ILE A CG1 1 
ATOM   313   C  CG2 . ILE A 1 45  ? 40.436 4.317   30.559  1.00 56.63 ? 129 ILE A CG2 1 
ATOM   314   C  CD1 . ILE A 1 45  ? 38.058 6.613   30.057  1.00 59.16 ? 129 ILE A CD1 1 
ATOM   315   N  N   . GLU A 1 46  ? 41.704 3.423   33.526  1.00 63.21 ? 130 GLU A N   1 
ATOM   316   C  CA  . GLU A 1 46  ? 42.944 2.685   33.866  1.00 67.56 ? 130 GLU A CA  1 
ATOM   317   C  C   . GLU A 1 46  ? 43.508 1.983   32.614  1.00 69.11 ? 130 GLU A C   1 
ATOM   318   O  O   . GLU A 1 46  ? 42.850 1.112   32.029  1.00 69.25 ? 130 GLU A O   1 
ATOM   319   C  CB  . GLU A 1 46  ? 42.772 1.761   35.099  1.00 67.58 ? 130 GLU A CB  1 
ATOM   320   C  CG  . GLU A 1 46  ? 43.813 0.636   35.186  1.00 71.87 ? 130 GLU A CG  1 
ATOM   321   C  CD  . GLU A 1 46  ? 44.595 0.555   36.527  1.00 77.13 ? 130 GLU A CD  1 
ATOM   322   O  OE1 . GLU A 1 46  ? 45.164 1.582   36.994  1.00 77.25 ? 130 GLU A OE1 1 
ATOM   323   O  OE2 . GLU A 1 46  ? 44.678 -0.569  37.095  1.00 79.10 ? 130 GLU A OE2 1 
ATOM   324   N  N   . ILE A 1 47  ? 44.705 2.422   32.202  1.00 71.59 ? 131 ILE A N   1 
ATOM   325   C  CA  . ILE A 1 47  ? 45.281 2.108   30.873  1.00 74.50 ? 131 ILE A CA  1 
ATOM   326   C  C   . ILE A 1 47  ? 46.499 1.209   31.014  1.00 75.83 ? 131 ILE A C   1 
ATOM   327   O  O   . ILE A 1 47  ? 47.441 1.530   31.770  1.00 75.32 ? 131 ILE A O   1 
ATOM   328   C  CB  . ILE A 1 47  ? 45.694 3.392   30.061  1.00 74.79 ? 131 ILE A CB  1 
ATOM   329   C  CG1 . ILE A 1 47  ? 44.464 4.159   29.514  1.00 75.36 ? 131 ILE A CG1 1 
ATOM   330   C  CG2 . ILE A 1 47  ? 46.750 3.061   28.960  1.00 75.19 ? 131 ILE A CG2 1 
ATOM   331   C  CD1 . ILE A 1 47  ? 43.855 3.679   28.173  1.00 77.31 ? 131 ILE A CD1 1 
ATOM   332   N  N   . GLU A 1 48  ? 46.477 0.100   30.254  1.00 77.83 ? 132 GLU A N   1 
ATOM   333   C  CA  . GLU A 1 48  ? 47.427 -1.007  30.462  1.00 79.87 ? 132 GLU A CA  1 
ATOM   334   C  C   . GLU A 1 48  ? 47.689 -1.038  31.974  1.00 79.42 ? 132 GLU A C   1 
ATOM   335   O  O   . GLU A 1 48  ? 48.863 -1.012  32.394  1.00 80.36 ? 132 GLU A O   1 
ATOM   336   C  CB  . GLU A 1 48  ? 48.773 -0.819  29.686  1.00 79.86 ? 132 GLU A CB  1 
ATOM   337   C  CG  . GLU A 1 48  ? 48.711 -0.840  28.117  1.00 81.52 ? 132 GLU A CG  1 
ATOM   338   C  CD  . GLU A 1 48  ? 50.114 -0.697  27.420  1.00 82.52 ? 132 GLU A CD  1 
ATOM   339   O  OE1 . GLU A 1 48  ? 51.156 -0.904  28.098  1.00 85.68 ? 132 GLU A OE1 1 
ATOM   340   O  OE2 . GLU A 1 48  ? 50.178 -0.388  26.189  1.00 84.49 ? 132 GLU A OE2 1 
ATOM   341   N  N   . GLY A 1 49  ? 46.610 -1.015  32.774  1.00 78.12 ? 133 GLY A N   1 
ATOM   342   C  CA  . GLY A 1 49  ? 46.737 -1.063  34.224  1.00 77.00 ? 133 GLY A CA  1 
ATOM   343   C  C   . GLY A 1 49  ? 47.374 0.180   34.835  1.00 76.47 ? 133 GLY A C   1 
ATOM   344   O  O   . GLY A 1 49  ? 47.982 0.126   35.924  1.00 76.20 ? 133 GLY A O   1 
ATOM   345   N  N   . THR A 1 50  ? 47.250 1.309   34.143  1.00 75.42 ? 134 THR A N   1 
ATOM   346   C  CA  . THR A 1 50  ? 47.581 2.598   34.776  1.00 74.73 ? 134 THR A CA  1 
ATOM   347   C  C   . THR A 1 50  ? 46.435 3.617   34.543  1.00 73.01 ? 134 THR A C   1 
ATOM   348   O  O   . THR A 1 50  ? 45.631 3.468   33.604  1.00 72.35 ? 134 THR A O   1 
ATOM   349   C  CB  . THR A 1 50  ? 48.984 3.165   34.335  1.00 75.44 ? 134 THR A CB  1 
ATOM   350   O  OG1 . THR A 1 50  ? 48.811 4.179   33.333  1.00 77.21 ? 134 THR A OG1 1 
ATOM   351   C  CG2 . THR A 1 50  ? 49.936 2.035   33.803  1.00 75.79 ? 134 THR A CG2 1 
ATOM   352   N  N   . THR A 1 51  ? 46.357 4.651   35.382  1.00 70.16 ? 135 THR A N   1 
ATOM   353   C  CA  . THR A 1 51  ? 45.142 5.454   35.368  1.00 67.37 ? 135 THR A CA  1 
ATOM   354   C  C   . THR A 1 51  ? 45.208 6.860   34.773  1.00 64.62 ? 135 THR A C   1 
ATOM   355   O  O   . THR A 1 51  ? 45.849 7.782   35.338  1.00 64.13 ? 135 THR A O   1 
ATOM   356   C  CB  . THR A 1 51  ? 44.451 5.466   36.733  1.00 68.16 ? 135 THR A CB  1 
ATOM   357   O  OG1 . THR A 1 51  ? 45.423 5.718   37.763  1.00 69.63 ? 135 THR A OG1 1 
ATOM   358   C  CG2 . THR A 1 51  ? 43.771 4.103   36.959  1.00 68.21 ? 135 THR A CG2 1 
ATOM   359   N  N   . HIS A 1 52  ? 44.472 6.989   33.658  1.00 60.21 ? 136 HIS A N   1 
ATOM   360   C  CA  . HIS A 1 52  ? 44.403 8.194   32.826  1.00 56.31 ? 136 HIS A CA  1 
ATOM   361   C  C   . HIS A 1 52  ? 43.100 8.972   32.966  1.00 52.19 ? 136 HIS A C   1 
ATOM   362   O  O   . HIS A 1 52  ? 42.045 8.439   32.699  1.00 50.34 ? 136 HIS A O   1 
ATOM   363   C  CB  . HIS A 1 52  ? 44.581 7.776   31.369  1.00 57.01 ? 136 HIS A CB  1 
ATOM   364   C  CG  . HIS A 1 52  ? 45.932 7.183   31.084  1.00 61.01 ? 136 HIS A CG  1 
ATOM   365   N  ND1 . HIS A 1 52  ? 47.008 7.326   31.944  1.00 62.60 ? 136 HIS A ND1 1 
ATOM   366   C  CD2 . HIS A 1 52  ? 46.396 6.497   30.014  1.00 61.74 ? 136 HIS A CD2 1 
ATOM   367   C  CE1 . HIS A 1 52  ? 48.064 6.735   31.423  1.00 63.85 ? 136 HIS A CE1 1 
ATOM   368   N  NE2 . HIS A 1 52  ? 47.719 6.226   30.253  1.00 64.67 ? 136 HIS A NE2 1 
ATOM   369   N  N   . GLN A 1 53  ? 43.213 10.219  33.409  1.00 47.75 ? 137 GLN A N   1 
ATOM   370   C  CA  . GLN A 1 53  ? 42.136 11.184  33.407  1.00 45.03 ? 137 GLN A CA  1 
ATOM   371   C  C   . GLN A 1 53  ? 41.748 11.496  31.972  1.00 41.50 ? 137 GLN A C   1 
ATOM   372   O  O   . GLN A 1 53  ? 42.624 11.791  31.176  1.00 41.09 ? 137 GLN A O   1 
ATOM   373   C  CB  . GLN A 1 53  ? 42.624 12.494  34.048  1.00 46.17 ? 137 GLN A CB  1 
ATOM   374   C  CG  . GLN A 1 53  ? 42.927 12.449  35.576  1.00 49.88 ? 137 GLN A CG  1 
ATOM   375   C  CD  . GLN A 1 53  ? 41.797 11.811  36.371  1.00 54.31 ? 137 GLN A CD  1 
ATOM   376   O  OE1 . GLN A 1 53  ? 41.831 10.618  36.640  1.00 56.53 ? 137 GLN A OE1 1 
ATOM   377   N  NE2 . GLN A 1 53  ? 40.778 12.599  36.723  1.00 54.28 ? 137 GLN A NE2 1 
ATOM   378   N  N   . VAL A 1 54  ? 40.454 11.427  31.647  1.00 36.86 ? 138 VAL A N   1 
ATOM   379   C  CA  . VAL A 1 54  ? 39.954 11.830  30.345  1.00 33.57 ? 138 VAL A CA  1 
ATOM   380   C  C   . VAL A 1 54  ? 39.033 13.025  30.498  1.00 32.20 ? 138 VAL A C   1 
ATOM   381   O  O   . VAL A 1 54  ? 38.116 12.987  31.274  1.00 31.67 ? 138 VAL A O   1 
ATOM   382   C  CB  . VAL A 1 54  ? 39.278 10.696  29.624  1.00 33.92 ? 138 VAL A CB  1 
ATOM   383   C  CG1 . VAL A 1 54  ? 38.576 11.163  28.412  1.00 34.13 ? 138 VAL A CG1 1 
ATOM   384   C  CG2 . VAL A 1 54  ? 40.300 9.653   29.233  1.00 34.24 ? 138 VAL A CG2 1 
ATOM   385   N  N   . TYR A 1 55  ? 39.318 14.101  29.760  1.00 31.02 ? 139 TYR A N   1 
ATOM   386   C  CA  . TYR A 1 55  ? 38.624 15.353  29.853  1.00 29.92 ? 139 TYR A CA  1 
ATOM   387   C  C   . TYR A 1 55  ? 37.632 15.456  28.712  1.00 29.76 ? 139 TYR A C   1 
ATOM   388   O  O   . TYR A 1 55  ? 38.032 15.390  27.576  1.00 30.78 ? 139 TYR A O   1 
ATOM   389   C  CB  . TYR A 1 55  ? 39.629 16.488  29.793  1.00 30.74 ? 139 TYR A CB  1 
ATOM   390   C  CG  . TYR A 1 55  ? 40.515 16.448  30.958  1.00 30.38 ? 139 TYR A CG  1 
ATOM   391   C  CD1 . TYR A 1 55  ? 41.639 15.659  30.937  1.00 31.90 ? 139 TYR A CD1 1 
ATOM   392   C  CD2 . TYR A 1 55  ? 40.180 17.106  32.135  1.00 32.50 ? 139 TYR A CD2 1 
ATOM   393   C  CE1 . TYR A 1 55  ? 42.461 15.560  32.050  1.00 32.54 ? 139 TYR A CE1 1 
ATOM   394   C  CE2 . TYR A 1 55  ? 40.977 16.986  33.274  1.00 33.53 ? 139 TYR A CE2 1 
ATOM   395   C  CZ  . TYR A 1 55  ? 42.128 16.219  33.196  1.00 32.48 ? 139 TYR A CZ  1 
ATOM   396   O  OH  . TYR A 1 55  ? 42.984 16.096  34.250  1.00 36.37 ? 139 TYR A OH  1 
ATOM   397   N  N   . VAL A 1 56  ? 36.340 15.614  29.010  1.00 28.91 ? 140 VAL A N   1 
ATOM   398   C  CA  . VAL A 1 56  ? 35.290 15.508  28.013  1.00 28.23 ? 140 VAL A CA  1 
ATOM   399   C  C   . VAL A 1 56  ? 34.553 16.830  27.884  1.00 28.01 ? 140 VAL A C   1 
ATOM   400   O  O   . VAL A 1 56  ? 34.147 17.381  28.882  1.00 28.53 ? 140 VAL A O   1 
ATOM   401   C  CB  . VAL A 1 56  ? 34.303 14.341  28.366  1.00 28.40 ? 140 VAL A CB  1 
ATOM   402   C  CG1 . VAL A 1 56  ? 33.179 14.303  27.391  1.00 27.54 ? 140 VAL A CG1 1 
ATOM   403   C  CG2 . VAL A 1 56  ? 35.040 12.998  28.342  1.00 27.23 ? 140 VAL A CG2 1 
ATOM   404   N  N   . LEU A 1 57  ? 34.416 17.357  26.667  1.00 26.71 ? 141 LEU A N   1 
ATOM   405   C  CA  . LEU A 1 57  ? 33.566 18.494  26.437  1.00 26.21 ? 141 LEU A CA  1 
ATOM   406   C  C   . LEU A 1 57  ? 32.316 17.943  25.783  1.00 26.22 ? 141 LEU A C   1 
ATOM   407   O  O   . LEU A 1 57  ? 32.427 17.140  24.862  1.00 25.34 ? 141 LEU A O   1 
ATOM   408   C  CB  . LEU A 1 57  ? 34.229 19.461  25.490  1.00 26.52 ? 141 LEU A CB  1 
ATOM   409   C  CG  . LEU A 1 57  ? 35.423 20.224  26.099  1.00 31.85 ? 141 LEU A CG  1 
ATOM   410   C  CD1 . LEU A 1 57  ? 36.142 21.084  25.075  1.00 31.66 ? 141 LEU A CD1 1 
ATOM   411   C  CD2 . LEU A 1 57  ? 35.075 21.076  27.279  1.00 30.32 ? 141 LEU A CD2 1 
ATOM   412   N  N   . LYS A 1 58  ? 31.153 18.290  26.330  1.00 26.62 ? 142 LYS A N   1 
ATOM   413   C  CA  . LYS A 1 58  ? 29.826 18.162  25.684  1.00 28.53 ? 142 LYS A CA  1 
ATOM   414   C  C   . LYS A 1 58  ? 29.537 19.186  24.504  1.00 28.83 ? 142 LYS A C   1 
ATOM   415   O  O   . LYS A 1 58  ? 29.654 20.406  24.691  1.00 30.34 ? 142 LYS A O   1 
ATOM   416   C  CB  . LYS A 1 58  ? 28.799 18.421  26.781  1.00 28.18 ? 142 LYS A CB  1 
ATOM   417   C  CG  . LYS A 1 58  ? 28.532 17.237  27.669  1.00 29.98 ? 142 LYS A CG  1 
ATOM   418   C  CD  . LYS A 1 58  ? 27.847 17.657  28.925  1.00 33.51 ? 142 LYS A CD  1 
ATOM   419   C  CE  . LYS A 1 58  ? 26.348 18.047  28.655  1.00 39.06 ? 142 LYS A CE  1 
ATOM   420   N  NZ  . LYS A 1 58  ? 25.867 19.159  29.548  1.00 39.33 ? 142 LYS A NZ  1 
ATOM   421   N  N   . ARG A 1 59  ? 29.159 18.719  23.313  1.00 28.14 ? 143 ARG A N   1 
ATOM   422   C  CA  . ARG A 1 59  ? 28.726 19.613  22.195  1.00 27.68 ? 143 ARG A CA  1 
ATOM   423   C  C   . ARG A 1 59  ? 27.534 20.531  22.562  1.00 28.00 ? 143 ARG A C   1 
ATOM   424   O  O   . ARG A 1 59  ? 26.673 20.145  23.345  1.00 28.65 ? 143 ARG A O   1 
ATOM   425   C  CB  . ARG A 1 59  ? 28.306 18.727  21.033  1.00 27.21 ? 143 ARG A CB  1 
ATOM   426   C  CG  . ARG A 1 59  ? 28.305 19.407  19.714  1.00 25.38 ? 143 ARG A CG  1 
ATOM   427   C  CD  . ARG A 1 59  ? 27.757 18.515  18.575  1.00 26.22 ? 143 ARG A CD  1 
ATOM   428   N  NE  . ARG A 1 59  ? 27.996 19.186  17.306  1.00 24.56 ? 143 ARG A NE  1 
ATOM   429   C  CZ  . ARG A 1 59  ? 28.365 18.615  16.171  1.00 26.98 ? 143 ARG A CZ  1 
ATOM   430   N  NH1 . ARG A 1 59  ? 28.540 17.318  16.094  1.00 24.97 ? 143 ARG A NH1 1 
ATOM   431   N  NH2 . ARG A 1 59  ? 28.640 19.376  15.130  1.00 25.60 ? 143 ARG A NH2 1 
ATOM   432   N  N   . PRO A 1 60  ? 27.491 21.784  22.069  1.00 28.57 ? 144 PRO A N   1 
ATOM   433   C  CA  . PRO A 1 60  ? 26.318 22.575  22.410  1.00 27.22 ? 144 PRO A CA  1 
ATOM   434   C  C   . PRO A 1 60  ? 25.038 21.864  22.046  1.00 27.74 ? 144 PRO A C   1 
ATOM   435   O  O   . PRO A 1 60  ? 24.959 21.272  20.984  1.00 28.69 ? 144 PRO A O   1 
ATOM   436   C  CB  . PRO A 1 60  ? 26.520 23.840  21.613  1.00 25.79 ? 144 PRO A CB  1 
ATOM   437   C  CG  . PRO A 1 60  ? 28.046 24.036  21.658  1.00 26.88 ? 144 PRO A CG  1 
ATOM   438   C  CD  . PRO A 1 60  ? 28.534 22.631  21.431  1.00 29.74 ? 144 PRO A CD  1 
ATOM   439   N  N   . TYR A 1 61  ? 24.084 21.874  22.980  1.00 27.13 ? 145 TYR A N   1 
ATOM   440   C  CA  . TYR A 1 61  ? 22.701 21.441  22.818  1.00 28.02 ? 145 TYR A CA  1 
ATOM   441   C  C   . TYR A 1 61  ? 22.479 19.963  22.919  1.00 29.90 ? 145 TYR A C   1 
ATOM   442   O  O   . TYR A 1 61  ? 21.354 19.518  22.686  1.00 32.68 ? 145 TYR A O   1 
ATOM   443   C  CB  . TYR A 1 61  ? 22.045 21.979  21.532  1.00 27.84 ? 145 TYR A CB  1 
ATOM   444   C  CG  . TYR A 1 61  ? 22.062 23.428  21.479  1.00 26.23 ? 145 TYR A CG  1 
ATOM   445   C  CD1 . TYR A 1 61  ? 23.040 24.112  20.750  1.00 28.23 ? 145 TYR A CD1 1 
ATOM   446   C  CD2 . TYR A 1 61  ? 21.136 24.156  22.204  1.00 30.39 ? 145 TYR A CD2 1 
ATOM   447   C  CE1 . TYR A 1 61  ? 23.061 25.525  20.716  1.00 28.40 ? 145 TYR A CE1 1 
ATOM   448   C  CE2 . TYR A 1 61  ? 21.130 25.557  22.219  1.00 30.38 ? 145 TYR A CE2 1 
ATOM   449   C  CZ  . TYR A 1 61  ? 22.089 26.235  21.484  1.00 33.57 ? 145 TYR A CZ  1 
ATOM   450   O  OH  . TYR A 1 61  ? 22.027 27.628  21.507  1.00 34.21 ? 145 TYR A OH  1 
ATOM   451   N  N   . VAL A 1 62  ? 23.506 19.197  23.282  1.00 30.57 ? 146 VAL A N   1 
ATOM   452   C  CA  . VAL A 1 62  ? 23.425 17.738  23.190  1.00 29.82 ? 146 VAL A CA  1 
ATOM   453   C  C   . VAL A 1 62  ? 22.380 17.251  24.136  1.00 30.54 ? 146 VAL A C   1 
ATOM   454   O  O   . VAL A 1 62  ? 21.712 16.262  23.854  1.00 32.99 ? 146 VAL A O   1 
ATOM   455   C  CB  . VAL A 1 62  ? 24.830 17.018  23.465  1.00 30.13 ? 146 VAL A CB  1 
ATOM   456   C  CG1 . VAL A 1 62  ? 25.322 17.229  24.917  1.00 27.57 ? 146 VAL A CG1 1 
ATOM   457   C  CG2 . VAL A 1 62  ? 24.723 15.580  23.239  1.00 26.79 ? 146 VAL A CG2 1 
ATOM   458   N  N   . ASP A 1 63  ? 22.246 17.913  25.279  1.00 31.07 ? 147 ASP A N   1 
ATOM   459   C  CA  . ASP A 1 63  ? 21.252 17.504  26.297  1.00 31.15 ? 147 ASP A CA  1 
ATOM   460   C  C   . ASP A 1 63  ? 19.872 17.773  25.823  1.00 30.85 ? 147 ASP A C   1 
ATOM   461   O  O   . ASP A 1 63  ? 18.999 16.946  25.969  1.00 31.68 ? 147 ASP A O   1 
ATOM   462   C  CB  . ASP A 1 63  ? 21.402 18.297  27.571  1.00 31.92 ? 147 ASP A CB  1 
ATOM   463   C  CG  . ASP A 1 63  ? 22.509 17.813  28.433  1.00 33.09 ? 147 ASP A CG  1 
ATOM   464   O  OD1 . ASP A 1 63  ? 22.914 16.611  28.321  1.00 36.47 ? 147 ASP A OD1 1 
ATOM   465   O  OD2 . ASP A 1 63  ? 22.939 18.661  29.236  1.00 33.57 ? 147 ASP A OD2 1 
ATOM   466   N  N   . GLU A 1 64  ? 19.630 18.925  25.239  1.00 29.94 ? 148 GLU A N   1 
ATOM   467   C  CA  . GLU A 1 64  ? 18.303 19.056  24.733  1.00 30.25 ? 148 GLU A CA  1 
ATOM   468   C  C   . GLU A 1 64  ? 18.071 18.221  23.465  1.00 30.47 ? 148 GLU A C   1 
ATOM   469   O  O   . GLU A 1 64  ? 16.967 17.719  23.238  1.00 31.50 ? 148 GLU A O   1 
ATOM   470   C  CB  . GLU A 1 64  ? 17.784 20.496  24.673  1.00 30.35 ? 148 GLU A CB  1 
ATOM   471   C  CG  . GLU A 1 64  ? 18.645 21.712  24.777  1.00 34.08 ? 148 GLU A CG  1 
ATOM   472   C  CD  . GLU A 1 64  ? 19.877 21.672  25.745  1.00 43.15 ? 148 GLU A CD  1 
ATOM   473   O  OE1 . GLU A 1 64  ? 19.982 22.543  26.659  1.00 41.49 ? 148 GLU A OE1 1 
ATOM   474   O  OE2 . GLU A 1 64  ? 20.788 20.828  25.528  1.00 45.26 ? 148 GLU A OE2 1 
ATOM   475   N  N   . PHE A 1 65  ? 19.109 18.031  22.648  1.00 29.72 ? 149 PHE A N   1 
ATOM   476   C  CA  . PHE A 1 65  ? 18.961 17.218  21.446  1.00 28.47 ? 149 PHE A CA  1 
ATOM   477   C  C   . PHE A 1 65  ? 18.604 15.779  21.867  1.00 30.81 ? 149 PHE A C   1 
ATOM   478   O  O   . PHE A 1 65  ? 17.633 15.170  21.327  1.00 31.02 ? 149 PHE A O   1 
ATOM   479   C  CB  . PHE A 1 65  ? 20.212 17.281  20.588  1.00 27.08 ? 149 PHE A CB  1 
ATOM   480   C  CG  . PHE A 1 65  ? 20.216 16.322  19.476  1.00 24.32 ? 149 PHE A CG  1 
ATOM   481   C  CD1 . PHE A 1 65  ? 19.473 16.570  18.324  1.00 26.65 ? 149 PHE A CD1 1 
ATOM   482   C  CD2 . PHE A 1 65  ? 20.971 15.143  19.571  1.00 24.05 ? 149 PHE A CD2 1 
ATOM   483   C  CE1 . PHE A 1 65  ? 19.448 15.650  17.256  1.00 22.78 ? 149 PHE A CE1 1 
ATOM   484   C  CE2 . PHE A 1 65  ? 20.956 14.217  18.588  1.00 23.19 ? 149 PHE A CE2 1 
ATOM   485   C  CZ  . PHE A 1 65  ? 20.211 14.474  17.385  1.00 27.14 ? 149 PHE A CZ  1 
ATOM   486   N  N   . LEU A 1 66  ? 19.326 15.250  22.867  1.00 30.25 ? 150 LEU A N   1 
ATOM   487   C  CA  . LEU A 1 66  ? 19.090 13.876  23.222  1.00 31.53 ? 150 LEU A CA  1 
ATOM   488   C  C   . LEU A 1 66  ? 17.686 13.666  23.818  1.00 32.88 ? 150 LEU A C   1 
ATOM   489   O  O   . LEU A 1 66  ? 17.093 12.593  23.662  1.00 32.09 ? 150 LEU A O   1 
ATOM   490   C  CB  . LEU A 1 66  ? 20.187 13.355  24.173  1.00 31.40 ? 150 LEU A CB  1 
ATOM   491   C  CG  . LEU A 1 66  ? 21.492 13.004  23.492  1.00 29.51 ? 150 LEU A CG  1 
ATOM   492   C  CD1 . LEU A 1 66  ? 22.499 12.420  24.464  1.00 28.43 ? 150 LEU A CD1 1 
ATOM   493   C  CD2 . LEU A 1 66  ? 21.221 12.075  22.368  1.00 22.51 ? 150 LEU A CD2 1 
ATOM   494   N  N   . ARG A 1 67  ? 17.154 14.696  24.476  1.00 34.41 ? 151 ARG A N   1 
ATOM   495   C  CA  . ARG A 1 67  ? 15.882 14.564  25.196  1.00 36.39 ? 151 ARG A CA  1 
ATOM   496   C  C   . ARG A 1 67  ? 14.747 14.474  24.179  1.00 35.35 ? 151 ARG A C   1 
ATOM   497   O  O   . ARG A 1 67  ? 13.959 13.527  24.177  1.00 34.57 ? 151 ARG A O   1 
ATOM   498   C  CB  . ARG A 1 67  ? 15.655 15.742  26.144  1.00 36.43 ? 151 ARG A CB  1 
ATOM   499   C  CG  . ARG A 1 67  ? 14.832 15.401  27.398  1.00 40.61 ? 151 ARG A CG  1 
ATOM   500   C  CD  . ARG A 1 67  ? 14.023 16.640  28.007  1.00 40.74 ? 151 ARG A CD  1 
ATOM   501   N  NE  . ARG A 1 67  ? 14.866 17.737  28.459  1.00 45.06 ? 151 ARG A NE  1 
ATOM   502   C  CZ  . ARG A 1 67  ? 14.745 18.981  28.004  1.00 51.60 ? 151 ARG A CZ  1 
ATOM   503   N  NH1 . ARG A 1 67  ? 13.798 19.251  27.117  1.00 53.78 ? 151 ARG A NH1 1 
ATOM   504   N  NH2 . ARG A 1 67  ? 15.572 19.954  28.414  1.00 52.82 ? 151 ARG A NH2 1 
ATOM   505   N  N   . ARG A 1 68  ? 14.702 15.456  23.292  1.00 33.88 ? 152 ARG A N   1 
ATOM   506   C  CA  . ARG A 1 68  ? 13.802 15.353  22.196  1.00 32.89 ? 152 ARG A CA  1 
ATOM   507   C  C   . ARG A 1 68  ? 13.907 14.025  21.418  1.00 33.57 ? 152 ARG A C   1 
ATOM   508   O  O   . ARG A 1 68  ? 12.869 13.429  21.100  1.00 34.70 ? 152 ARG A O   1 
ATOM   509   C  CB  . ARG A 1 68  ? 14.020 16.517  21.261  1.00 32.47 ? 152 ARG A CB  1 
ATOM   510   C  CG  . ARG A 1 68  ? 12.924 16.628  20.231  1.00 33.52 ? 152 ARG A CG  1 
ATOM   511   C  CD  . ARG A 1 68  ? 11.516 16.537  20.977  1.00 32.73 ? 152 ARG A CD  1 
ATOM   512   N  NE  . ARG A 1 68  ? 10.485 16.762  19.998  1.00 33.30 ? 152 ARG A NE  1 
ATOM   513   C  CZ  . ARG A 1 68  ? 9.206  16.441  20.108  1.00 30.83 ? 152 ARG A CZ  1 
ATOM   514   N  NH1 . ARG A 1 68  ? 8.721  15.878  21.214  1.00 25.70 ? 152 ARG A NH1 1 
ATOM   515   N  NH2 . ARG A 1 68  ? 8.425  16.706  19.061  1.00 29.41 ? 152 ARG A NH2 1 
ATOM   516   N  N   . MET A 1 69  ? 15.123 13.569  21.070  1.00 32.94 ? 153 MET A N   1 
ATOM   517   C  CA  . MET A 1 69  ? 15.254 12.306  20.335  1.00 32.86 ? 153 MET A CA  1 
ATOM   518   C  C   . MET A 1 69  ? 14.608 11.126  21.081  1.00 32.22 ? 153 MET A C   1 
ATOM   519   O  O   . MET A 1 69  ? 13.907 10.334  20.471  1.00 31.98 ? 153 MET A O   1 
ATOM   520   C  CB  . MET A 1 69  ? 16.725 11.974  19.955  1.00 32.84 ? 153 MET A CB  1 
ATOM   521   C  CG  . MET A 1 69  ? 17.421 13.017  19.068  1.00 33.94 ? 153 MET A CG  1 
ATOM   522   S  SD  . MET A 1 69  ? 16.719 13.325  17.399  1.00 31.48 ? 153 MET A SD  1 
ATOM   523   C  CE  . MET A 1 69  ? 16.974 11.714  16.797  1.00 30.44 ? 153 MET A CE  1 
ATOM   524   N  N   . GLY A 1 70  ? 14.869 11.025  22.381  1.00 31.50 ? 154 GLY A N   1 
ATOM   525   C  CA  . GLY A 1 70  ? 14.216 10.064  23.254  1.00 31.96 ? 154 GLY A CA  1 
ATOM   526   C  C   . GLY A 1 70  ? 12.680 10.105  23.270  1.00 33.68 ? 154 GLY A C   1 
ATOM   527   O  O   . GLY A 1 70  ? 12.031 9.064   23.516  1.00 34.29 ? 154 GLY A O   1 
ATOM   528   N  N   . GLU A 1 71  ? 12.089 11.271  22.989  1.00 33.74 ? 155 GLU A N   1 
ATOM   529   C  CA  . GLU A 1 71  ? 10.643 11.374  22.853  1.00 35.37 ? 155 GLU A CA  1 
ATOM   530   C  C   . GLU A 1 71  ? 10.200 10.824  21.501  1.00 34.67 ? 155 GLU A C   1 
ATOM   531   O  O   . GLU A 1 71  ? 9.100  10.328  21.392  1.00 36.04 ? 155 GLU A O   1 
ATOM   532   C  CB  . GLU A 1 71  ? 10.134 12.830  23.056  1.00 35.01 ? 155 GLU A CB  1 
ATOM   533   C  CG  . GLU A 1 71  ? 10.345 13.317  24.474  1.00 35.27 ? 155 GLU A CG  1 
ATOM   534   C  CD  . GLU A 1 71  ? 10.060 14.792  24.683  1.00 37.95 ? 155 GLU A CD  1 
ATOM   535   O  OE1 . GLU A 1 71  ? 9.773  15.502  23.683  1.00 41.64 ? 155 GLU A OE1 1 
ATOM   536   O  OE2 . GLU A 1 71  ? 10.099 15.228  25.883  1.00 40.34 ? 155 GLU A OE2 1 
ATOM   537   N  N   . LEU A 1 72  ? 11.048 10.883  20.480  1.00 33.08 ? 156 LEU A N   1 
ATOM   538   C  CA  . LEU A 1 72  ? 10.626 10.514  19.127  1.00 31.02 ? 156 LEU A CA  1 
ATOM   539   C  C   . LEU A 1 72  ? 11.134 9.190   18.495  1.00 30.59 ? 156 LEU A C   1 
ATOM   540   O  O   . LEU A 1 72  ? 10.535 8.689   17.531  1.00 31.01 ? 156 LEU A O   1 
ATOM   541   C  CB  . LEU A 1 72  ? 10.963 11.631  18.169  1.00 30.02 ? 156 LEU A CB  1 
ATOM   542   C  CG  . LEU A 1 72  ? 10.372 12.972  18.488  1.00 33.01 ? 156 LEU A CG  1 
ATOM   543   C  CD1 . LEU A 1 72  ? 11.101 13.944  17.638  1.00 33.64 ? 156 LEU A CD1 1 
ATOM   544   C  CD2 . LEU A 1 72  ? 8.786  13.004  18.254  1.00 30.96 ? 156 LEU A CD2 1 
ATOM   545   N  N   . PHE A 1 73  ? 12.226 8.633   18.978  1.00 28.89 ? 157 PHE A N   1 
ATOM   546   C  CA  . PHE A 1 73  ? 12.824 7.553   18.239  1.00 28.73 ? 157 PHE A CA  1 
ATOM   547   C  C   . PHE A 1 73  ? 13.280 6.538   19.242  1.00 28.84 ? 157 PHE A C   1 
ATOM   548   O  O   . PHE A 1 73  ? 13.356 6.842   20.436  1.00 28.84 ? 157 PHE A O   1 
ATOM   549   C  CB  . PHE A 1 73  ? 14.047 8.077   17.486  1.00 28.80 ? 157 PHE A CB  1 
ATOM   550   C  CG  . PHE A 1 73  ? 13.727 9.005   16.327  1.00 30.54 ? 157 PHE A CG  1 
ATOM   551   C  CD1 . PHE A 1 73  ? 13.789 10.374  16.481  1.00 33.00 ? 157 PHE A CD1 1 
ATOM   552   C  CD2 . PHE A 1 73  ? 13.431 8.508   15.071  1.00 27.73 ? 157 PHE A CD2 1 
ATOM   553   C  CE1 . PHE A 1 73  ? 13.532 11.240  15.392  1.00 30.88 ? 157 PHE A CE1 1 
ATOM   554   C  CE2 . PHE A 1 73  ? 13.200 9.354   14.018  1.00 28.69 ? 157 PHE A CE2 1 
ATOM   555   C  CZ  . PHE A 1 73  ? 13.228 10.712  14.186  1.00 30.13 ? 157 PHE A CZ  1 
ATOM   556   N  N   . GLU A 1 74  ? 13.609 5.346   18.777  1.00 28.33 ? 158 GLU A N   1 
ATOM   557   C  CA  . GLU A 1 74  ? 14.332 4.432   19.607  1.00 28.74 ? 158 GLU A CA  1 
ATOM   558   C  C   . GLU A 1 74  ? 15.855 4.703   19.420  1.00 29.37 ? 158 GLU A C   1 
ATOM   559   O  O   . GLU A 1 74  ? 16.410 4.254   18.439  1.00 28.63 ? 158 GLU A O   1 
ATOM   560   C  CB  . GLU A 1 74  ? 13.994 3.005   19.203  1.00 28.35 ? 158 GLU A CB  1 
ATOM   561   C  CG  . GLU A 1 74  ? 14.768 2.019   19.971  1.00 28.87 ? 158 GLU A CG  1 
ATOM   562   C  CD  . GLU A 1 74  ? 14.628 0.640   19.438  1.00 36.73 ? 158 GLU A CD  1 
ATOM   563   O  OE1 . GLU A 1 74  ? 14.496 0.458   18.191  1.00 39.63 ? 158 GLU A OE1 1 
ATOM   564   O  OE2 . GLU A 1 74  ? 14.668 -0.289  20.277  1.00 37.22 ? 158 GLU A OE2 1 
ATOM   565   N  N   . CYS A 1 75  ? 16.498 5.401   20.368  1.00 29.69 ? 159 CYS A N   1 
ATOM   566   C  CA  . CYS A 1 75  ? 17.888 5.833   20.228  1.00 31.31 ? 159 CYS A CA  1 
ATOM   567   C  C   . CYS A 1 75  ? 18.891 4.791   20.657  1.00 31.45 ? 159 CYS A C   1 
ATOM   568   O  O   . CYS A 1 75  ? 18.806 4.210   21.745  1.00 32.40 ? 159 CYS A O   1 
ATOM   569   C  CB  . CYS A 1 75  ? 18.107 7.076   21.037  1.00 31.62 ? 159 CYS A CB  1 
ATOM   570   S  SG  . CYS A 1 75  ? 17.022 8.404   20.515  1.00 36.44 ? 159 CYS A SG  1 
ATOM   571   N  N   . VAL A 1 76  ? 19.862 4.519   19.803  1.00 31.27 ? 160 VAL A N   1 
ATOM   572   C  CA  . VAL A 1 76  ? 20.896 3.545   20.180  1.00 29.97 ? 160 VAL A CA  1 
ATOM   573   C  C   . VAL A 1 76  ? 22.261 4.237   20.166  1.00 30.56 ? 160 VAL A C   1 
ATOM   574   O  O   . VAL A 1 76  ? 22.503 5.074   19.314  1.00 30.52 ? 160 VAL A O   1 
ATOM   575   C  CB  . VAL A 1 76  ? 20.845 2.426   19.201  1.00 30.16 ? 160 VAL A CB  1 
ATOM   576   C  CG1 . VAL A 1 76  ? 22.023 1.507   19.391  1.00 29.77 ? 160 VAL A CG1 1 
ATOM   577   C  CG2 . VAL A 1 76  ? 19.494 1.690   19.356  1.00 29.10 ? 160 VAL A CG2 1 
ATOM   578   N  N   . LEU A 1 77  ? 23.162 3.931   21.102  1.00 31.26 ? 161 LEU A N   1 
ATOM   579   C  CA  . LEU A 1 77  ? 24.545 4.367   20.938  1.00 30.58 ? 161 LEU A CA  1 
ATOM   580   C  C   . LEU A 1 77  ? 25.376 3.278   20.284  1.00 30.38 ? 161 LEU A C   1 
ATOM   581   O  O   . LEU A 1 77  ? 25.417 2.157   20.761  1.00 29.89 ? 161 LEU A O   1 
ATOM   582   C  CB  . LEU A 1 77  ? 25.152 4.761   22.268  1.00 32.55 ? 161 LEU A CB  1 
ATOM   583   C  CG  . LEU A 1 77  ? 26.606 5.309   22.267  1.00 33.73 ? 161 LEU A CG  1 
ATOM   584   C  CD1 . LEU A 1 77  ? 26.698 6.769   21.907  1.00 33.39 ? 161 LEU A CD1 1 
ATOM   585   C  CD2 . LEU A 1 77  ? 27.103 5.169   23.612  1.00 34.79 ? 161 LEU A CD2 1 
ATOM   586   N  N   . PHE A 1 78  ? 26.070 3.624   19.200  1.00 30.08 ? 162 PHE A N   1 
ATOM   587   C  CA  . PHE A 1 78  ? 26.837 2.661   18.448  1.00 29.36 ? 162 PHE A CA  1 
ATOM   588   C  C   . PHE A 1 78  ? 28.147 3.360   18.168  1.00 30.23 ? 162 PHE A C   1 
ATOM   589   O  O   . PHE A 1 78  ? 28.227 4.278   17.403  1.00 30.80 ? 162 PHE A O   1 
ATOM   590   C  CB  . PHE A 1 78  ? 26.090 2.282   17.166  1.00 28.83 ? 162 PHE A CB  1 
ATOM   591   C  CG  . PHE A 1 78  ? 26.509 0.966   16.512  1.00 24.25 ? 162 PHE A CG  1 
ATOM   592   C  CD1 . PHE A 1 78  ? 25.686 0.397   15.572  1.00 24.05 ? 162 PHE A CD1 1 
ATOM   593   C  CD2 . PHE A 1 78  ? 27.696 0.335   16.798  1.00 22.35 ? 162 PHE A CD2 1 
ATOM   594   C  CE1 . PHE A 1 78  ? 26.032 -0.796  14.940  1.00 23.10 ? 162 PHE A CE1 1 
ATOM   595   C  CE2 . PHE A 1 78  ? 28.070 -0.835  16.144  1.00 19.10 ? 162 PHE A CE2 1 
ATOM   596   C  CZ  . PHE A 1 78  ? 27.228 -1.397  15.254  1.00 24.65 ? 162 PHE A CZ  1 
ATOM   597   N  N   . THR A 1 79  ? 29.203 2.909   18.802  1.00 30.53 ? 163 THR A N   1 
ATOM   598   C  CA  . THR A 1 79  ? 30.449 3.592   18.659  1.00 30.11 ? 163 THR A CA  1 
ATOM   599   C  C   . THR A 1 79  ? 31.551 2.591   18.357  1.00 30.12 ? 163 THR A C   1 
ATOM   600   O  O   . THR A 1 79  ? 31.406 1.445   18.675  1.00 30.84 ? 163 THR A O   1 
ATOM   601   C  CB  . THR A 1 79  ? 30.720 4.373   19.943  1.00 30.17 ? 163 THR A CB  1 
ATOM   602   O  OG1 . THR A 1 79  ? 32.070 4.894   19.964  1.00 33.32 ? 163 THR A OG1 1 
ATOM   603   C  CG2 . THR A 1 79  ? 30.539 3.505   21.101  1.00 29.23 ? 163 THR A CG2 1 
ATOM   604   N  N   . ALA A 1 80  ? 32.648 3.001   17.731  1.00 30.89 ? 164 ALA A N   1 
ATOM   605   C  CA  . ALA A 1 80  ? 33.754 2.059   17.466  1.00 30.75 ? 164 ALA A CA  1 
ATOM   606   C  C   . ALA A 1 80  ? 34.743 2.194   18.579  1.00 32.64 ? 164 ALA A C   1 
ATOM   607   O  O   . ALA A 1 80  ? 35.799 1.581   18.534  1.00 32.92 ? 164 ALA A O   1 
ATOM   608   C  CB  . ALA A 1 80  ? 34.437 2.359   16.195  1.00 30.19 ? 164 ALA A CB  1 
ATOM   609   N  N   . SER A 1 81  ? 34.434 3.005   19.596  1.00 33.72 ? 165 SER A N   1 
ATOM   610   C  CA  . SER A 1 81  ? 35.391 3.120   20.665  1.00 35.18 ? 165 SER A CA  1 
ATOM   611   C  C   . SER A 1 81  ? 35.235 1.948   21.645  1.00 35.69 ? 165 SER A C   1 
ATOM   612   O  O   . SER A 1 81  ? 34.293 1.170   21.552  1.00 36.10 ? 165 SER A O   1 
ATOM   613   C  CB  . SER A 1 81  ? 35.293 4.486   21.314  1.00 34.97 ? 165 SER A CB  1 
ATOM   614   O  OG  . SER A 1 81  ? 34.223 4.407   22.211  1.00 40.48 ? 165 SER A OG  1 
ATOM   615   N  N   . LEU A 1 82  ? 36.191 1.753   22.546  1.00 37.12 ? 166 LEU A N   1 
ATOM   616   C  CA  . LEU A 1 82  ? 36.097 0.602   23.475  1.00 37.08 ? 166 LEU A CA  1 
ATOM   617   C  C   . LEU A 1 82  ? 35.131 0.905   24.629  1.00 36.49 ? 166 LEU A C   1 
ATOM   618   O  O   . LEU A 1 82  ? 35.087 2.045   25.103  1.00 36.46 ? 166 LEU A O   1 
ATOM   619   C  CB  . LEU A 1 82  ? 37.473 0.305   24.040  1.00 37.28 ? 166 LEU A CB  1 
ATOM   620   C  CG  . LEU A 1 82  ? 38.437 -0.469  23.102  1.00 41.23 ? 166 LEU A CG  1 
ATOM   621   C  CD1 . LEU A 1 82  ? 39.881 -0.316  23.581  1.00 42.56 ? 166 LEU A CD1 1 
ATOM   622   C  CD2 . LEU A 1 82  ? 38.098 -1.988  22.967  1.00 44.67 ? 166 LEU A CD2 1 
ATOM   623   N  N   . ALA A 1 83  ? 34.369 -0.094  25.083  1.00 35.56 ? 167 ALA A N   1 
ATOM   624   C  CA  . ALA A 1 83  ? 33.432 0.106   26.228  1.00 35.07 ? 167 ALA A CA  1 
ATOM   625   C  C   . ALA A 1 83  ? 34.035 0.759   27.439  1.00 34.30 ? 167 ALA A C   1 
ATOM   626   O  O   . ALA A 1 83  ? 33.395 1.647   28.021  1.00 35.54 ? 167 ALA A O   1 
ATOM   627   C  CB  . ALA A 1 83  ? 32.704 -1.233  26.671  1.00 34.63 ? 167 ALA A CB  1 
ATOM   628   N  N   . LYS A 1 84  ? 35.234 0.351   27.835  1.00 33.56 ? 168 LYS A N   1 
ATOM   629   C  CA  . LYS A 1 84  ? 35.891 0.939   29.058  1.00 34.24 ? 168 LYS A CA  1 
ATOM   630   C  C   . LYS A 1 84  ? 36.001 2.424   28.991  1.00 32.65 ? 168 LYS A C   1 
ATOM   631   O  O   . LYS A 1 84  ? 35.972 3.078   29.999  1.00 33.04 ? 168 LYS A O   1 
ATOM   632   C  CB  . LYS A 1 84  ? 37.284 0.332   29.359  1.00 34.28 ? 168 LYS A CB  1 
ATOM   633   C  CG  . LYS A 1 84  ? 38.277 0.500   28.244  1.00 38.97 ? 168 LYS A CG  1 
ATOM   634   C  CD  . LYS A 1 84  ? 39.742 0.690   28.733  1.00 46.56 ? 168 LYS A CD  1 
ATOM   635   C  CE  . LYS A 1 84  ? 40.692 0.351   27.611  1.00 52.07 ? 168 LYS A CE  1 
ATOM   636   N  NZ  . LYS A 1 84  ? 42.096 0.734   28.011  1.00 62.22 ? 168 LYS A NZ  1 
ATOM   637   N  N   . TYR A 1 85  ? 36.117 2.958   27.788  1.00 32.47 ? 169 TYR A N   1 
ATOM   638   C  CA  . TYR A 1 85  ? 35.944 4.372   27.584  1.00 32.90 ? 169 TYR A CA  1 
ATOM   639   C  C   . TYR A 1 85  ? 34.447 4.744   27.378  1.00 32.68 ? 169 TYR A C   1 
ATOM   640   O  O   . TYR A 1 85  ? 33.967 5.680   27.970  1.00 33.63 ? 169 TYR A O   1 
ATOM   641   C  CB  . TYR A 1 85  ? 36.841 4.858   26.396  1.00 34.71 ? 169 TYR A CB  1 
ATOM   642   C  CG  . TYR A 1 85  ? 36.505 6.278   25.859  1.00 36.08 ? 169 TYR A CG  1 
ATOM   643   C  CD1 . TYR A 1 85  ? 36.902 7.414   26.553  1.00 34.87 ? 169 TYR A CD1 1 
ATOM   644   C  CD2 . TYR A 1 85  ? 35.761 6.466   24.666  1.00 35.25 ? 169 TYR A CD2 1 
ATOM   645   C  CE1 . TYR A 1 85  ? 36.587 8.710   26.067  1.00 36.32 ? 169 TYR A CE1 1 
ATOM   646   C  CE2 . TYR A 1 85  ? 35.431 7.759   24.197  1.00 34.76 ? 169 TYR A CE2 1 
ATOM   647   C  CZ  . TYR A 1 85  ? 35.862 8.867   24.912  1.00 36.50 ? 169 TYR A CZ  1 
ATOM   648   O  OH  . TYR A 1 85  ? 35.589 10.150  24.491  1.00 39.85 ? 169 TYR A OH  1 
ATOM   649   N  N   . ALA A 1 86  ? 33.718 4.036   26.543  1.00 31.61 ? 170 ALA A N   1 
ATOM   650   C  CA  . ALA A 1 86  ? 32.451 4.569   26.031  1.00 31.08 ? 170 ALA A CA  1 
ATOM   651   C  C   . ALA A 1 86  ? 31.351 4.481   27.060  1.00 31.11 ? 170 ALA A C   1 
ATOM   652   O  O   . ALA A 1 86  ? 30.615 5.440   27.225  1.00 31.97 ? 170 ALA A O   1 
ATOM   653   C  CB  . ALA A 1 86  ? 32.051 3.933   24.736  1.00 29.81 ? 170 ALA A CB  1 
ATOM   654   N  N   . ASP A 1 87  ? 31.261 3.375   27.796  1.00 31.21 ? 171 ASP A N   1 
ATOM   655   C  CA  . ASP A 1 87  ? 30.322 3.264   28.945  1.00 30.70 ? 171 ASP A CA  1 
ATOM   656   C  C   . ASP A 1 87  ? 30.381 4.396   30.043  1.00 29.68 ? 171 ASP A C   1 
ATOM   657   O  O   . ASP A 1 87  ? 29.392 5.014   30.305  1.00 31.63 ? 171 ASP A O   1 
ATOM   658   C  CB  . ASP A 1 87  ? 30.450 1.887   29.566  1.00 30.70 ? 171 ASP A CB  1 
ATOM   659   C  CG  . ASP A 1 87  ? 29.180 1.086   29.466  1.00 37.39 ? 171 ASP A CG  1 
ATOM   660   O  OD1 . ASP A 1 87  ? 28.390 1.279   28.508  1.00 41.56 ? 171 ASP A OD1 1 
ATOM   661   O  OD2 . ASP A 1 87  ? 28.926 0.267   30.385  1.00 43.95 ? 171 ASP A OD2 1 
ATOM   662   N  N   . PRO A 1 88  ? 31.523 4.669   30.691  1.00 28.79 ? 172 PRO A N   1 
ATOM   663   C  CA  . PRO A 1 88  ? 31.463 5.824   31.620  1.00 29.10 ? 172 PRO A CA  1 
ATOM   664   C  C   . PRO A 1 88  ? 31.140 7.184   30.988  1.00 29.14 ? 172 PRO A C   1 
ATOM   665   O  O   . PRO A 1 88  ? 30.429 7.999   31.581  1.00 29.11 ? 172 PRO A O   1 
ATOM   666   C  CB  . PRO A 1 88  ? 32.861 5.896   32.245  1.00 29.15 ? 172 PRO A CB  1 
ATOM   667   C  CG  . PRO A 1 88  ? 33.602 4.658   31.717  1.00 29.03 ? 172 PRO A CG  1 
ATOM   668   C  CD  . PRO A 1 88  ? 32.820 3.968   30.698  1.00 27.96 ? 172 PRO A CD  1 
ATOM   669   N  N   . VAL A 1 89  ? 31.659 7.433   29.801  1.00 28.72 ? 173 VAL A N   1 
ATOM   670   C  CA  . VAL A 1 89  ? 31.387 8.689   29.137  1.00 28.15 ? 173 VAL A CA  1 
ATOM   671   C  C   . VAL A 1 89  ? 29.853 8.812   28.766  1.00 28.90 ? 173 VAL A C   1 
ATOM   672   O  O   . VAL A 1 89  ? 29.212 9.808   29.086  1.00 27.95 ? 173 VAL A O   1 
ATOM   673   C  CB  . VAL A 1 89  ? 32.312 8.841   27.962  1.00 27.71 ? 173 VAL A CB  1 
ATOM   674   C  CG1 . VAL A 1 89  ? 31.801 9.933   26.992  1.00 28.93 ? 173 VAL A CG1 1 
ATOM   675   C  CG2 . VAL A 1 89  ? 33.745 9.105   28.464  1.00 25.99 ? 173 VAL A CG2 1 
ATOM   676   N  N   . THR A 1 90  ? 29.275 7.793   28.135  1.00 29.03 ? 174 THR A N   1 
ATOM   677   C  CA  . THR A 1 90  ? 27.839 7.769   27.923  1.00 30.07 ? 174 THR A CA  1 
ATOM   678   C  C   . THR A 1 90  ? 26.990 7.809   29.222  1.00 31.61 ? 174 THR A C   1 
ATOM   679   O  O   . THR A 1 90  ? 25.975 8.473   29.238  1.00 31.61 ? 174 THR A O   1 
ATOM   680   C  CB  . THR A 1 90  ? 27.473 6.569   27.190  1.00 29.50 ? 174 THR A CB  1 
ATOM   681   O  OG1 . THR A 1 90  ? 28.261 6.534   26.014  1.00 29.67 ? 174 THR A OG1 1 
ATOM   682   C  CG2 . THR A 1 90  ? 26.046 6.658   26.790  1.00 31.63 ? 174 THR A CG2 1 
ATOM   683   N  N   . ASP A 1 91  ? 27.406 7.112   30.291  1.00 32.27 ? 175 ASP A N   1 
ATOM   684   C  CA  . ASP A 1 91  ? 26.729 7.202   31.602  1.00 32.55 ? 175 ASP A CA  1 
ATOM   685   C  C   . ASP A 1 91  ? 26.618 8.604   32.070  1.00 32.80 ? 175 ASP A C   1 
ATOM   686   O  O   . ASP A 1 91  ? 25.604 8.986   32.578  1.00 34.72 ? 175 ASP A O   1 
ATOM   687   C  CB  . ASP A 1 91  ? 27.487 6.479   32.665  1.00 32.46 ? 175 ASP A CB  1 
ATOM   688   C  CG  . ASP A 1 91  ? 27.102 5.023   32.785  1.00 35.03 ? 175 ASP A CG  1 
ATOM   689   O  OD1 . ASP A 1 91  ? 26.249 4.498   31.979  1.00 31.70 ? 175 ASP A OD1 1 
ATOM   690   O  OD2 . ASP A 1 91  ? 27.687 4.406   33.725  1.00 36.20 ? 175 ASP A OD2 1 
ATOM   691   N  N   . LEU A 1 92  ? 27.647 9.398   31.875  1.00 33.54 ? 176 LEU A N   1 
ATOM   692   C  CA  . LEU A 1 92  ? 27.626 10.780  32.324  1.00 33.92 ? 176 LEU A CA  1 
ATOM   693   C  C   . LEU A 1 92  ? 26.963 11.682  31.296  1.00 34.38 ? 176 LEU A C   1 
ATOM   694   O  O   . LEU A 1 92  ? 26.276 12.614  31.654  1.00 33.04 ? 176 LEU A O   1 
ATOM   695   C  CB  . LEU A 1 92  ? 29.048 11.270  32.626  1.00 34.00 ? 176 LEU A CB  1 
ATOM   696   C  CG  . LEU A 1 92  ? 29.687 10.624  33.883  1.00 34.61 ? 176 LEU A CG  1 
ATOM   697   C  CD1 . LEU A 1 92  ? 31.181 10.494  33.760  1.00 32.60 ? 176 LEU A CD1 1 
ATOM   698   C  CD2 . LEU A 1 92  ? 29.288 11.300  35.208  1.00 31.07 ? 176 LEU A CD2 1 
ATOM   699   N  N   . LEU A 1 93  ? 27.238 11.428  30.011  1.00 35.34 ? 177 LEU A N   1 
ATOM   700   C  CA  . LEU A 1 93  ? 26.604 12.164  28.943  1.00 34.97 ? 177 LEU A CA  1 
ATOM   701   C  C   . LEU A 1 93  ? 25.050 11.991  29.005  1.00 35.53 ? 177 LEU A C   1 
ATOM   702   O  O   . LEU A 1 93  ? 24.364 12.959  29.192  1.00 35.76 ? 177 LEU A O   1 
ATOM   703   C  CB  . LEU A 1 93  ? 27.175 11.778  27.589  1.00 34.26 ? 177 LEU A CB  1 
ATOM   704   C  CG  . LEU A 1 93  ? 26.277 12.150  26.403  1.00 33.58 ? 177 LEU A CG  1 
ATOM   705   C  CD1 . LEU A 1 93  ? 26.311 13.654  26.185  1.00 32.16 ? 177 LEU A CD1 1 
ATOM   706   C  CD2 . LEU A 1 93  ? 26.620 11.405  25.133  1.00 28.60 ? 177 LEU A CD2 1 
ATOM   707   N  N   . ASP A 1 94  ? 24.539 10.776  28.887  1.00 36.07 ? 178 ASP A N   1 
ATOM   708   C  CA  . ASP A 1 94  ? 23.111 10.485  28.829  1.00 37.76 ? 178 ASP A CA  1 
ATOM   709   C  C   . ASP A 1 94  ? 22.380 10.652  30.165  1.00 38.66 ? 178 ASP A C   1 
ATOM   710   O  O   . ASP A 1 94  ? 21.758 9.736   30.678  1.00 38.82 ? 178 ASP A O   1 
ATOM   711   C  CB  . ASP A 1 94  ? 22.913 9.069   28.311  1.00 38.01 ? 178 ASP A CB  1 
ATOM   712   C  CG  . ASP A 1 94  ? 21.506 8.818   27.844  1.00 42.52 ? 178 ASP A CG  1 
ATOM   713   O  OD1 . ASP A 1 94  ? 20.715 9.808   27.873  1.00 46.65 ? 178 ASP A OD1 1 
ATOM   714   O  OD2 . ASP A 1 94  ? 21.186 7.648   27.456  1.00 43.57 ? 178 ASP A OD2 1 
ATOM   715   N  N   . ARG A 1 95  ? 22.409 11.851  30.699  1.00 39.62 ? 179 ARG A N   1 
ATOM   716   C  CA  . ARG A 1 95  ? 21.836 12.112  31.991  1.00 41.97 ? 179 ARG A CA  1 
ATOM   717   C  C   . ARG A 1 95  ? 20.301 11.876  32.091  1.00 41.63 ? 179 ARG A C   1 
ATOM   718   O  O   . ARG A 1 95  ? 19.782 11.842  33.198  1.00 42.25 ? 179 ARG A O   1 
ATOM   719   C  CB  . ARG A 1 95  ? 22.195 13.544  32.440  1.00 42.02 ? 179 ARG A CB  1 
ATOM   720   C  CG  . ARG A 1 95  ? 21.500 14.649  31.600  1.00 44.12 ? 179 ARG A CG  1 
ATOM   721   C  CD  . ARG A 1 95  ? 21.806 16.049  32.095  1.00 45.82 ? 179 ARG A CD  1 
ATOM   722   N  NE  . ARG A 1 95  ? 20.803 16.977  31.565  1.00 55.94 ? 179 ARG A NE  1 
ATOM   723   C  CZ  . ARG A 1 95  ? 20.945 18.304  31.461  1.00 58.84 ? 179 ARG A CZ  1 
ATOM   724   N  NH1 . ARG A 1 95  ? 22.095 18.894  31.832  1.00 60.14 ? 179 ARG A NH1 1 
ATOM   725   N  NH2 . ARG A 1 95  ? 19.939 19.043  30.954  1.00 56.23 ? 179 ARG A NH2 1 
ATOM   726   N  N   . CYS A 1 96  ? 19.597 11.718  30.968  1.00 40.55 ? 180 CYS A N   1 
ATOM   727   C  CA  . CYS A 1 96  ? 18.172 11.308  30.985  1.00 40.65 ? 180 CYS A CA  1 
ATOM   728   C  C   . CYS A 1 96  ? 17.820 9.918   30.506  1.00 38.28 ? 180 CYS A C   1 
ATOM   729   O  O   . CYS A 1 96  ? 16.643 9.642   30.284  1.00 36.70 ? 180 CYS A O   1 
ATOM   730   C  CB  . CYS A 1 96  ? 17.297 12.270  30.183  1.00 40.86 ? 180 CYS A CB  1 
ATOM   731   S  SG  . CYS A 1 96  ? 17.212 13.831  31.076  1.00 51.90 ? 180 CYS A SG  1 
ATOM   732   N  N   . GLY A 1 97  ? 18.787 9.044   30.294  1.00 36.93 ? 181 GLY A N   1 
ATOM   733   C  CA  . GLY A 1 97  ? 18.377 7.664   29.984  1.00 37.20 ? 181 GLY A CA  1 
ATOM   734   C  C   . GLY A 1 97  ? 17.826 7.368   28.603  1.00 36.32 ? 181 GLY A C   1 
ATOM   735   O  O   . GLY A 1 97  ? 17.344 6.287   28.365  1.00 37.54 ? 181 GLY A O   1 
ATOM   736   N  N   . VAL A 1 98  ? 17.964 8.318   27.690  1.00 35.64 ? 182 VAL A N   1 
ATOM   737   C  CA  . VAL A 1 98  ? 17.614 8.201   26.270  1.00 35.34 ? 182 VAL A CA  1 
ATOM   738   C  C   . VAL A 1 98  ? 18.050 6.930   25.470  1.00 34.84 ? 182 VAL A C   1 
ATOM   739   O  O   . VAL A 1 98  ? 17.224 6.404   24.711  1.00 34.28 ? 182 VAL A O   1 
ATOM   740   C  CB  . VAL A 1 98  ? 18.045 9.491   25.542  1.00 36.17 ? 182 VAL A CB  1 
ATOM   741   C  CG1 . VAL A 1 98  ? 17.983 9.364   24.033  1.00 35.80 ? 182 VAL A CG1 1 
ATOM   742   C  CG2 . VAL A 1 98  ? 17.161 10.649  26.054  1.00 35.90 ? 182 VAL A CG2 1 
ATOM   743   N  N   . PHE A 1 99  ? 19.283 6.431   25.664  1.00 33.80 ? 183 PHE A N   1 
ATOM   744   C  CA  . PHE A 1 99  ? 19.763 5.235   24.943  1.00 33.01 ? 183 PHE A CA  1 
ATOM   745   C  C   . PHE A 1 99  ? 19.146 3.916   25.395  1.00 33.98 ? 183 PHE A C   1 
ATOM   746   O  O   . PHE A 1 99  ? 19.223 3.567   26.572  1.00 34.93 ? 183 PHE A O   1 
ATOM   747   C  CB  . PHE A 1 99  ? 21.304 5.148   24.978  1.00 31.63 ? 183 PHE A CB  1 
ATOM   748   C  CG  . PHE A 1 99  ? 21.967 6.283   24.285  1.00 29.19 ? 183 PHE A CG  1 
ATOM   749   C  CD1 . PHE A 1 99  ? 22.782 7.170   24.995  1.00 30.96 ? 183 PHE A CD1 1 
ATOM   750   C  CD2 . PHE A 1 99  ? 21.710 6.524   22.945  1.00 24.66 ? 183 PHE A CD2 1 
ATOM   751   C  CE1 . PHE A 1 99  ? 23.371 8.268   24.369  1.00 29.60 ? 183 PHE A CE1 1 
ATOM   752   C  CE2 . PHE A 1 99  ? 22.260 7.594   22.302  1.00 27.39 ? 183 PHE A CE2 1 
ATOM   753   C  CZ  . PHE A 1 99  ? 23.098 8.480   22.998  1.00 29.46 ? 183 PHE A CZ  1 
ATOM   754   N  N   . ARG A 1 100 ? 18.579 3.156   24.461  1.00 33.82 ? 184 ARG A N   1 
ATOM   755   C  CA  . ARG A 1 100 ? 17.969 1.881   24.802  1.00 34.89 ? 184 ARG A CA  1 
ATOM   756   C  C   . ARG A 1 100 ? 19.010 0.775   24.820  1.00 34.94 ? 184 ARG A C   1 
ATOM   757   O  O   . ARG A 1 100 ? 18.759 -0.326  25.324  1.00 37.31 ? 184 ARG A O   1 
ATOM   758   C  CB  . ARG A 1 100 ? 16.921 1.488   23.757  1.00 34.70 ? 184 ARG A CB  1 
ATOM   759   C  CG  . ARG A 1 100 ? 15.974 2.587   23.370  1.00 38.92 ? 184 ARG A CG  1 
ATOM   760   C  CD  . ARG A 1 100 ? 15.176 3.120   24.541  1.00 44.47 ? 184 ARG A CD  1 
ATOM   761   N  NE  . ARG A 1 100 ? 14.355 4.246   24.115  1.00 52.37 ? 184 ARG A NE  1 
ATOM   762   C  CZ  . ARG A 1 100 ? 13.946 5.232   24.919  1.00 57.30 ? 184 ARG A CZ  1 
ATOM   763   N  NH1 . ARG A 1 100 ? 14.293 5.231   26.219  1.00 57.28 ? 184 ARG A NH1 1 
ATOM   764   N  NH2 . ARG A 1 100 ? 13.211 6.235   24.416  1.00 57.93 ? 184 ARG A NH2 1 
ATOM   765   N  N   . ALA A 1 101 ? 20.162 1.034   24.236  1.00 33.17 ? 185 ALA A N   1 
ATOM   766   C  CA  . ALA A 1 101 ? 21.160 0.010   24.023  1.00 31.91 ? 185 ALA A CA  1 
ATOM   767   C  C   . ALA A 1 101 ? 22.473 0.731   23.719  1.00 31.00 ? 185 ALA A C   1 
ATOM   768   O  O   . ALA A 1 101 ? 22.470 1.873   23.297  1.00 29.97 ? 185 ALA A O   1 
ATOM   769   C  CB  . ALA A 1 101 ? 20.758 -0.824  22.859  1.00 31.07 ? 185 ALA A CB  1 
ATOM   770   N  N   . ARG A 1 102 ? 23.585 0.063   23.957  1.00 30.34 ? 186 ARG A N   1 
ATOM   771   C  CA  . ARG A 1 102 ? 24.887 0.642   23.698  1.00 28.97 ? 186 ARG A CA  1 
ATOM   772   C  C   . ARG A 1 102 ? 25.724 -0.407  23.073  1.00 29.14 ? 186 ARG A C   1 
ATOM   773   O  O   . ARG A 1 102 ? 25.892 -1.482  23.664  1.00 30.75 ? 186 ARG A O   1 
ATOM   774   C  CB  . ARG A 1 102 ? 25.519 1.084   24.977  1.00 28.59 ? 186 ARG A CB  1 
ATOM   775   C  CG  . ARG A 1 102 ? 24.807 2.253   25.679  1.00 27.80 ? 186 ARG A CG  1 
ATOM   776   C  CD  . ARG A 1 102 ? 25.508 2.406   27.051  1.00 30.82 ? 186 ARG A CD  1 
ATOM   777   N  NE  . ARG A 1 102 ? 24.872 3.296   27.989  1.00 28.53 ? 186 ARG A NE  1 
ATOM   778   C  CZ  . ARG A 1 102 ? 25.468 3.830   29.050  1.00 31.97 ? 186 ARG A CZ  1 
ATOM   779   N  NH1 . ARG A 1 102 ? 26.770 3.610   29.338  1.00 34.55 ? 186 ARG A NH1 1 
ATOM   780   N  NH2 . ARG A 1 102 ? 24.769 4.628   29.827  1.00 29.28 ? 186 ARG A NH2 1 
ATOM   781   N  N   . LEU A 1 103 ? 26.188 -0.148  21.841  1.00 27.90 ? 187 LEU A N   1 
ATOM   782   C  CA  . LEU A 1 103 ? 26.998 -1.092  21.095  1.00 25.37 ? 187 LEU A CA  1 
ATOM   783   C  C   . LEU A 1 103 ? 28.356 -0.436  20.938  1.00 26.04 ? 187 LEU A C   1 
ATOM   784   O  O   . LEU A 1 103 ? 28.428 0.770   20.738  1.00 27.49 ? 187 LEU A O   1 
ATOM   785   C  CB  . LEU A 1 103 ? 26.387 -1.343  19.763  1.00 24.12 ? 187 LEU A CB  1 
ATOM   786   C  CG  . LEU A 1 103 ? 24.923 -1.759  19.719  1.00 27.88 ? 187 LEU A CG  1 
ATOM   787   C  CD1 . LEU A 1 103 ? 24.412 -1.919  18.301  1.00 27.11 ? 187 LEU A CD1 1 
ATOM   788   C  CD2 . LEU A 1 103 ? 24.715 -3.055  20.467  1.00 28.03 ? 187 LEU A CD2 1 
ATOM   789   N  N   . PHE A 1 104 ? 29.431 -1.215  21.002  1.00 26.08 ? 188 PHE A N   1 
ATOM   790   C  CA  . PHE A 1 104 ? 30.787 -0.710  21.021  1.00 26.36 ? 188 PHE A CA  1 
ATOM   791   C  C   . PHE A 1 104 ? 31.645 -1.341  19.971  1.00 27.32 ? 188 PHE A C   1 
ATOM   792   O  O   . PHE A 1 104 ? 31.175 -2.103  19.138  1.00 25.95 ? 188 PHE A O   1 
ATOM   793   C  CB  . PHE A 1 104 ? 31.414 -1.002  22.383  1.00 26.77 ? 188 PHE A CB  1 
ATOM   794   C  CG  . PHE A 1 104 ? 30.670 -0.415  23.508  1.00 26.65 ? 188 PHE A CG  1 
ATOM   795   C  CD1 . PHE A 1 104 ? 30.019 -1.224  24.423  1.00 31.38 ? 188 PHE A CD1 1 
ATOM   796   C  CD2 . PHE A 1 104 ? 30.577 0.948   23.644  1.00 29.22 ? 188 PHE A CD2 1 
ATOM   797   C  CE1 . PHE A 1 104 ? 29.293 -0.671  25.499  1.00 31.47 ? 188 PHE A CE1 1 
ATOM   798   C  CE2 . PHE A 1 104 ? 29.849 1.524   24.688  1.00 29.94 ? 188 PHE A CE2 1 
ATOM   799   C  CZ  . PHE A 1 104 ? 29.218 0.705   25.630  1.00 29.92 ? 188 PHE A CZ  1 
ATOM   800   N  N   . ARG A 1 105 ? 32.955 -1.097  20.071  1.00 30.31 ? 189 ARG A N   1 
ATOM   801   C  CA  . ARG A 1 105 ? 33.887 -1.564  19.057  1.00 32.45 ? 189 ARG A CA  1 
ATOM   802   C  C   . ARG A 1 105 ? 33.472 -2.920  18.543  1.00 34.08 ? 189 ARG A C   1 
ATOM   803   O  O   . ARG A 1 105 ? 33.267 -3.041  17.380  1.00 35.83 ? 189 ARG A O   1 
ATOM   804   C  CB  . ARG A 1 105 ? 35.258 -1.657  19.623  1.00 33.05 ? 189 ARG A CB  1 
ATOM   805   C  CG  . ARG A 1 105 ? 36.223 -2.342  18.747  1.00 32.89 ? 189 ARG A CG  1 
ATOM   806   C  CD  . ARG A 1 105 ? 37.057 -1.398  18.141  1.00 34.36 ? 189 ARG A CD  1 
ATOM   807   N  NE  . ARG A 1 105 ? 38.309 -1.312  18.839  1.00 39.04 ? 189 ARG A NE  1 
ATOM   808   C  CZ  . ARG A 1 105 ? 38.849 -0.196  19.314  1.00 39.55 ? 189 ARG A CZ  1 
ATOM   809   N  NH1 . ARG A 1 105 ? 38.225 0.953   19.197  1.00 37.87 ? 189 ARG A NH1 1 
ATOM   810   N  NH2 . ARG A 1 105 ? 40.026 -0.251  19.915  1.00 38.80 ? 189 ARG A NH2 1 
ATOM   811   N  N   . GLU A 1 106 ? 33.276 -3.913  19.409  1.00 36.14 ? 190 GLU A N   1 
ATOM   812   C  CA  . GLU A 1 106 ? 33.093 -5.345  18.991  1.00 37.77 ? 190 GLU A CA  1 
ATOM   813   C  C   . GLU A 1 106 ? 31.854 -5.695  18.219  1.00 37.26 ? 190 GLU A C   1 
ATOM   814   O  O   . GLU A 1 106 ? 31.832 -6.781  17.660  1.00 36.60 ? 190 GLU A O   1 
ATOM   815   C  CB  . GLU A 1 106 ? 33.056 -6.299  20.167  1.00 38.19 ? 190 GLU A CB  1 
ATOM   816   C  CG  . GLU A 1 106 ? 33.664 -5.728  21.387  1.00 42.99 ? 190 GLU A CG  1 
ATOM   817   C  CD  . GLU A 1 106 ? 32.614 -5.032  22.200  1.00 48.15 ? 190 GLU A CD  1 
ATOM   818   O  OE1 . GLU A 1 106 ? 32.942 -3.933  22.723  1.00 50.35 ? 190 GLU A OE1 1 
ATOM   819   O  OE2 . GLU A 1 106 ? 31.477 -5.595  22.306  1.00 47.33 ? 190 GLU A OE2 1 
ATOM   820   N  N   . SER A 1 107 ? 30.837 -4.816  18.239  1.00 36.10 ? 191 SER A N   1 
ATOM   821   C  CA  . SER A 1 107 ? 29.632 -4.977  17.425  1.00 35.00 ? 191 SER A CA  1 
ATOM   822   C  C   . SER A 1 107 ? 29.761 -4.365  16.019  1.00 34.67 ? 191 SER A C   1 
ATOM   823   O  O   . SER A 1 107 ? 28.896 -4.578  15.138  1.00 35.04 ? 191 SER A O   1 
ATOM   824   C  CB  . SER A 1 107 ? 28.479 -4.376  18.147  1.00 34.99 ? 191 SER A CB  1 
ATOM   825   O  OG  . SER A 1 107 ? 28.533 -4.806  19.478  1.00 36.76 ? 191 SER A OG  1 
ATOM   826   N  N   . CYS A 1 108 ? 30.856 -3.647  15.806  1.00 33.22 ? 192 CYS A N   1 
ATOM   827   C  CA  . CYS A 1 108 ? 31.182 -3.061  14.534  1.00 33.95 ? 192 CYS A CA  1 
ATOM   828   C  C   . CYS A 1 108 ? 31.752 -4.156  13.716  1.00 32.86 ? 192 CYS A C   1 
ATOM   829   O  O   . CYS A 1 108 ? 32.272 -5.100  14.292  1.00 35.72 ? 192 CYS A O   1 
ATOM   830   C  CB  . CYS A 1 108 ? 32.276 -1.990  14.731  1.00 34.02 ? 192 CYS A CB  1 
ATOM   831   S  SG  . CYS A 1 108 ? 31.637 -0.517  15.470  1.00 36.08 ? 192 CYS A SG  1 
ATOM   832   N  N   . VAL A 1 109 ? 31.709 -4.066  12.398  1.00 30.47 ? 193 VAL A N   1 
ATOM   833   C  CA  . VAL A 1 109 ? 32.608 -4.933  11.621  1.00 29.41 ? 193 VAL A CA  1 
ATOM   834   C  C   . VAL A 1 109 ? 33.884 -4.266  11.181  1.00 29.50 ? 193 VAL A C   1 
ATOM   835   O  O   . VAL A 1 109 ? 33.907 -3.075  10.836  1.00 31.12 ? 193 VAL A O   1 
ATOM   836   C  CB  . VAL A 1 109 ? 31.999 -5.521  10.387  1.00 28.69 ? 193 VAL A CB  1 
ATOM   837   C  CG1 . VAL A 1 109 ? 30.633 -5.186  10.219  1.00 29.89 ? 193 VAL A CG1 1 
ATOM   838   C  CG2 . VAL A 1 109 ? 32.782 -5.120  9.182   1.00 30.48 ? 193 VAL A CG2 1 
ATOM   839   N  N   . PHE A 1 110 ? 34.949 -5.035  11.126  1.00 28.54 ? 194 PHE A N   1 
ATOM   840   C  CA  . PHE A 1 110 ? 36.224 -4.519  10.705  1.00 28.11 ? 194 PHE A CA  1 
ATOM   841   C  C   . PHE A 1 110 ? 36.403 -4.606  9.209   1.00 28.36 ? 194 PHE A C   1 
ATOM   842   O  O   . PHE A 1 110 ? 36.427 -5.688  8.687   1.00 29.73 ? 194 PHE A O   1 
ATOM   843   C  CB  . PHE A 1 110 ? 37.258 -5.369  11.384  1.00 28.78 ? 194 PHE A CB  1 
ATOM   844   C  CG  . PHE A 1 110 ? 38.626 -4.953  11.115  1.00 27.53 ? 194 PHE A CG  1 
ATOM   845   C  CD1 . PHE A 1 110 ? 39.174 -3.875  11.814  1.00 30.32 ? 194 PHE A CD1 1 
ATOM   846   C  CD2 . PHE A 1 110 ? 39.385 -5.651  10.200  1.00 26.05 ? 194 PHE A CD2 1 
ATOM   847   C  CE1 . PHE A 1 110 ? 40.499 -3.452  11.594  1.00 35.16 ? 194 PHE A CE1 1 
ATOM   848   C  CE2 . PHE A 1 110 ? 40.694 -5.270  9.943   1.00 32.78 ? 194 PHE A CE2 1 
ATOM   849   C  CZ  . PHE A 1 110 ? 41.283 -4.159  10.641  1.00 32.72 ? 194 PHE A CZ  1 
ATOM   850   N  N   . HIS A 1 111 ? 36.553 -3.487  8.516   1.00 28.87 ? 195 HIS A N   1 
ATOM   851   C  CA  . HIS A 1 111 ? 36.703 -3.428  7.050   1.00 29.93 ? 195 HIS A CA  1 
ATOM   852   C  C   . HIS A 1 111 ? 38.108 -2.846  6.714   1.00 32.16 ? 195 HIS A C   1 
ATOM   853   O  O   . HIS A 1 111 ? 38.279 -1.644  6.728   1.00 33.85 ? 195 HIS A O   1 
ATOM   854   C  CB  . HIS A 1 111 ? 35.606 -2.483  6.648   1.00 29.42 ? 195 HIS A CB  1 
ATOM   855   C  CG  . HIS A 1 111 ? 35.355 -2.351  5.190   1.00 30.49 ? 195 HIS A CG  1 
ATOM   856   N  ND1 . HIS A 1 111 ? 35.976 -1.394  4.414   1.00 33.71 ? 195 HIS A ND1 1 
ATOM   857   C  CD2 . HIS A 1 111 ? 34.437 -2.937  4.388   1.00 30.35 ? 195 HIS A CD2 1 
ATOM   858   C  CE1 . HIS A 1 111 ? 35.519 -1.456  3.173   1.00 30.35 ? 195 HIS A CE1 1 
ATOM   859   N  NE2 . HIS A 1 111 ? 34.588 -2.395  3.130   1.00 32.90 ? 195 HIS A NE2 1 
ATOM   860   N  N   . GLN A 1 112 ? 39.123 -3.690  6.443   1.00 33.76 ? 196 GLN A N   1 
ATOM   861   C  CA  . GLN A 1 112 ? 40.543 -3.285  6.393   1.00 35.89 ? 196 GLN A CA  1 
ATOM   862   C  C   . GLN A 1 112 ? 40.831 -2.015  7.148   1.00 36.79 ? 196 GLN A C   1 
ATOM   863   O  O   . GLN A 1 112 ? 41.040 -0.974  6.535   1.00 36.76 ? 196 GLN A O   1 
ATOM   864   C  CB  . GLN A 1 112 ? 41.073 -2.991  4.987   1.00 36.55 ? 196 GLN A CB  1 
ATOM   865   C  CG  . GLN A 1 112 ? 40.741 -3.939  3.955   1.00 36.78 ? 196 GLN A CG  1 
ATOM   866   C  CD  . GLN A 1 112 ? 41.670 -3.808  2.774   1.00 34.42 ? 196 GLN A CD  1 
ATOM   867   O  OE1 . GLN A 1 112 ? 42.437 -4.696  2.539   1.00 39.68 ? 196 GLN A OE1 1 
ATOM   868   N  NE2 . GLN A 1 112 ? 41.577 -2.732  2.018   1.00 30.43 ? 196 GLN A NE2 1 
ATOM   869   N  N   . GLY A 1 113 ? 40.810 -2.063  8.459   1.00 37.87 ? 197 GLY A N   1 
ATOM   870   C  CA  . GLY A 1 113 ? 41.245 -0.890  9.160   1.00 39.01 ? 197 GLY A CA  1 
ATOM   871   C  C   . GLY A 1 113 ? 40.184 0.108   9.557   1.00 39.49 ? 197 GLY A C   1 
ATOM   872   O  O   . GLY A 1 113 ? 40.467 0.876   10.431  1.00 39.62 ? 197 GLY A O   1 
ATOM   873   N  N   . CYS A 1 114 ? 39.008 0.127   8.915   1.00 38.83 ? 198 CYS A N   1 
ATOM   874   C  CA  . CYS A 1 114 ? 37.836 0.855   9.459   1.00 39.64 ? 198 CYS A CA  1 
ATOM   875   C  C   . CYS A 1 114 ? 36.945 -0.009  10.304  1.00 36.58 ? 198 CYS A C   1 
ATOM   876   O  O   . CYS A 1 114 ? 36.858 -1.170  10.063  1.00 36.92 ? 198 CYS A O   1 
ATOM   877   C  CB  . CYS A 1 114 ? 36.900 1.284   8.332   1.00 40.33 ? 198 CYS A CB  1 
ATOM   878   S  SG  . CYS A 1 114 ? 37.584 2.572   7.443   1.00 52.90 ? 198 CYS A SG  1 
ATOM   879   N  N   . TYR A 1 115 ? 36.182 0.581   11.205  1.00 34.54 ? 199 TYR A N   1 
ATOM   880   C  CA  . TYR A 1 115 ? 35.148 -0.139  11.925  1.00 32.90 ? 199 TYR A CA  1 
ATOM   881   C  C   . TYR A 1 115 ? 33.866 0.385   11.374  1.00 31.54 ? 199 TYR A C   1 
ATOM   882   O  O   . TYR A 1 115 ? 33.632 1.547   11.468  1.00 32.25 ? 199 TYR A O   1 
ATOM   883   C  CB  . TYR A 1 115 ? 35.233 0.116   13.416  1.00 32.37 ? 199 TYR A CB  1 
ATOM   884   C  CG  . TYR A 1 115 ? 36.385 -0.642  14.079  1.00 35.21 ? 199 TYR A CG  1 
ATOM   885   C  CD1 . TYR A 1 115 ? 37.570 0.019   14.454  1.00 36.45 ? 199 TYR A CD1 1 
ATOM   886   C  CD2 . TYR A 1 115 ? 36.315 -2.017  14.299  1.00 34.88 ? 199 TYR A CD2 1 
ATOM   887   C  CE1 . TYR A 1 115 ? 38.604 -0.655  15.041  1.00 33.20 ? 199 TYR A CE1 1 
ATOM   888   C  CE2 . TYR A 1 115 ? 37.366 -2.697  14.881  1.00 32.99 ? 199 TYR A CE2 1 
ATOM   889   C  CZ  . TYR A 1 115 ? 38.499 -2.017  15.253  1.00 34.25 ? 199 TYR A CZ  1 
ATOM   890   O  OH  . TYR A 1 115 ? 39.551 -2.703  15.870  1.00 37.22 ? 199 TYR A OH  1 
ATOM   891   N  N   . VAL A 1 116 ? 33.064 -0.470  10.760  1.00 29.41 ? 200 VAL A N   1 
ATOM   892   C  CA  . VAL A 1 116 ? 31.856 -0.059  10.110  1.00 26.84 ? 200 VAL A CA  1 
ATOM   893   C  C   . VAL A 1 116 ? 30.678 -0.441  10.946  1.00 27.42 ? 200 VAL A C   1 
ATOM   894   O  O   . VAL A 1 116 ? 30.650 -1.491  11.576  1.00 28.11 ? 200 VAL A O   1 
ATOM   895   C  CB  . VAL A 1 116 ? 31.701 -0.776  8.807   1.00 26.20 ? 200 VAL A CB  1 
ATOM   896   C  CG1 . VAL A 1 116 ? 30.352 -0.518  8.257   1.00 23.78 ? 200 VAL A CG1 1 
ATOM   897   C  CG2 . VAL A 1 116 ? 32.801 -0.356  7.835   1.00 22.10 ? 200 VAL A CG2 1 
ATOM   898   N  N   . LYS A 1 117 ? 29.676 0.410   10.996  1.00 28.04 ? 201 LYS A N   1 
ATOM   899   C  CA  . LYS A 1 117 ? 28.464 0.031   11.709  1.00 27.47 ? 201 LYS A CA  1 
ATOM   900   C  C   . LYS A 1 117 ? 27.449 -0.568  10.746  1.00 28.17 ? 201 LYS A C   1 
ATOM   901   O  O   . LYS A 1 117 ? 26.771 0.152   10.001  1.00 29.66 ? 201 LYS A O   1 
ATOM   902   C  CB  . LYS A 1 117 ? 27.947 1.240   12.446  1.00 27.90 ? 201 LYS A CB  1 
ATOM   903   C  CG  . LYS A 1 117 ? 28.837 1.625   13.567  1.00 26.61 ? 201 LYS A CG  1 
ATOM   904   C  CD  . LYS A 1 117 ? 28.735 3.066   13.828  1.00 31.41 ? 201 LYS A CD  1 
ATOM   905   C  CE  . LYS A 1 117 ? 29.969 3.550   14.558  1.00 33.41 ? 201 LYS A CE  1 
ATOM   906   N  NZ  . LYS A 1 117 ? 29.827 5.003   14.973  1.00 35.51 ? 201 LYS A NZ  1 
ATOM   907   N  N   . ASP A 1 118 ? 27.455 -1.891  10.676  1.00 27.84 ? 202 ASP A N   1 
ATOM   908   C  CA  . ASP A 1 118 ? 26.654 -2.614  9.759   1.00 28.20 ? 202 ASP A CA  1 
ATOM   909   C  C   . ASP A 1 118 ? 25.231 -2.529  10.215  1.00 28.10 ? 202 ASP A C   1 
ATOM   910   O  O   . ASP A 1 118 ? 24.786 -3.284  11.060  1.00 29.43 ? 202 ASP A O   1 
ATOM   911   C  CB  . ASP A 1 118 ? 27.104 -4.062  9.702   1.00 27.16 ? 202 ASP A CB  1 
ATOM   912   C  CG  . ASP A 1 118 ? 26.393 -4.838  8.584   1.00 32.71 ? 202 ASP A CG  1 
ATOM   913   O  OD1 . ASP A 1 118 ? 25.232 -4.423  8.183   1.00 31.57 ? 202 ASP A OD1 1 
ATOM   914   O  OD2 . ASP A 1 118 ? 27.015 -5.851  8.125   1.00 33.17 ? 202 ASP A OD2 1 
ATOM   915   N  N   . LEU A 1 119 ? 24.480 -1.621  9.661   1.00 28.56 ? 203 LEU A N   1 
ATOM   916   C  CA  . LEU A 1 119 ? 23.096 -1.492  10.135  1.00 28.90 ? 203 LEU A CA  1 
ATOM   917   C  C   . LEU A 1 119 ? 22.235 -2.757  9.981   1.00 29.26 ? 203 LEU A C   1 
ATOM   918   O  O   . LEU A 1 119 ? 21.185 -2.826  10.561  1.00 29.95 ? 203 LEU A O   1 
ATOM   919   C  CB  . LEU A 1 119 ? 22.365 -0.322  9.488   1.00 27.09 ? 203 LEU A CB  1 
ATOM   920   C  CG  . LEU A 1 119 ? 22.989 1.007   9.746   1.00 27.48 ? 203 LEU A CG  1 
ATOM   921   C  CD1 . LEU A 1 119 ? 22.004 2.082   9.374   1.00 26.67 ? 203 LEU A CD1 1 
ATOM   922   C  CD2 . LEU A 1 119 ? 23.376 1.037   11.215  1.00 26.85 ? 203 LEU A CD2 1 
ATOM   923   N  N   . SER A 1 120 ? 22.663 -3.733  9.213   1.00 30.06 ? 204 SER A N   1 
ATOM   924   C  CA  . SER A 1 120 ? 21.769 -4.858  8.922   1.00 32.17 ? 204 SER A CA  1 
ATOM   925   C  C   . SER A 1 120 ? 21.914 -5.958  9.994   1.00 32.53 ? 204 SER A C   1 
ATOM   926   O  O   . SER A 1 120 ? 21.254 -6.973  9.934   1.00 33.57 ? 204 SER A O   1 
ATOM   927   C  CB  . SER A 1 120 ? 22.087 -5.437  7.550   1.00 32.06 ? 204 SER A CB  1 
ATOM   928   O  OG  . SER A 1 120 ? 23.397 -6.003  7.636   1.00 33.77 ? 204 SER A OG  1 
ATOM   929   N  N   . ARG A 1 121 ? 22.808 -5.754  10.953  1.00 32.38 ? 205 ARG A N   1 
ATOM   930   C  CA  . ARG A 1 121 ? 23.020 -6.694  12.050  1.00 31.60 ? 205 ARG A CA  1 
ATOM   931   C  C   . ARG A 1 121 ? 22.165 -6.281  13.224  1.00 30.89 ? 205 ARG A C   1 
ATOM   932   O  O   . ARG A 1 121 ? 22.257 -6.815  14.280  1.00 31.27 ? 205 ARG A O   1 
ATOM   933   C  CB  . ARG A 1 121 ? 24.516 -6.691  12.448  1.00 31.99 ? 205 ARG A CB  1 
ATOM   934   C  CG  . ARG A 1 121 ? 25.390 -7.596  11.645  1.00 32.27 ? 205 ARG A CG  1 
ATOM   935   C  CD  . ARG A 1 121 ? 26.871 -7.201  11.782  1.00 37.86 ? 205 ARG A CD  1 
ATOM   936   N  NE  . ARG A 1 121 ? 27.850 -8.328  11.810  1.00 38.99 ? 205 ARG A NE  1 
ATOM   937   C  CZ  . ARG A 1 121 ? 28.455 -8.845  10.752  1.00 39.29 ? 205 ARG A CZ  1 
ATOM   938   N  NH1 . ARG A 1 121 ? 29.279 -9.826  10.943  1.00 43.55 ? 205 ARG A NH1 1 
ATOM   939   N  NH2 . ARG A 1 121 ? 28.273 -8.379  9.516   1.00 39.88 ? 205 ARG A NH2 1 
ATOM   940   N  N   . LEU A 1 122 ? 21.345 -5.280  13.049  1.00 31.00 ? 206 LEU A N   1 
ATOM   941   C  CA  . LEU A 1 122 ? 20.755 -4.629  14.180  1.00 30.99 ? 206 LEU A CA  1 
ATOM   942   C  C   . LEU A 1 122 ? 19.454 -5.300  14.635  1.00 32.81 ? 206 LEU A C   1 
ATOM   943   O  O   . LEU A 1 122 ? 19.101 -5.294  15.827  1.00 34.02 ? 206 LEU A O   1 
ATOM   944   C  CB  . LEU A 1 122 ? 20.542 -3.152  13.812  1.00 30.32 ? 206 LEU A CB  1 
ATOM   945   C  CG  . LEU A 1 122 ? 21.144 -1.937  14.520  1.00 29.49 ? 206 LEU A CG  1 
ATOM   946   C  CD1 . LEU A 1 122 ? 22.576 -2.099  15.137  1.00 24.36 ? 206 LEU A CD1 1 
ATOM   947   C  CD2 . LEU A 1 122 ? 21.065 -0.753  13.592  1.00 28.40 ? 206 LEU A CD2 1 
ATOM   948   N  N   . GLY A 1 123 ? 18.717 -5.868  13.696  1.00 33.94 ? 207 GLY A N   1 
ATOM   949   C  CA  . GLY A 1 123 ? 17.451 -6.554  14.029  1.00 34.68 ? 207 GLY A CA  1 
ATOM   950   C  C   . GLY A 1 123 ? 16.271 -5.596  13.921  1.00 35.83 ? 207 GLY A C   1 
ATOM   951   O  O   . GLY A 1 123 ? 15.242 -5.788  14.608  1.00 35.09 ? 207 GLY A O   1 
ATOM   952   N  N   . ARG A 1 124 ? 16.451 -4.540  13.099  1.00 35.16 ? 208 ARG A N   1 
ATOM   953   C  CA  . ARG A 1 124 ? 15.437 -3.540  12.833  1.00 34.48 ? 208 ARG A CA  1 
ATOM   954   C  C   . ARG A 1 124 ? 15.198 -3.400  11.312  1.00 35.87 ? 208 ARG A C   1 
ATOM   955   O  O   . ARG A 1 124 ? 16.055 -3.757  10.481  1.00 36.80 ? 208 ARG A O   1 
ATOM   956   C  CB  . ARG A 1 124 ? 15.787 -2.186  13.426  1.00 33.25 ? 208 ARG A CB  1 
ATOM   957   C  CG  . ARG A 1 124 ? 16.040 -2.068  14.915  1.00 33.25 ? 208 ARG A CG  1 
ATOM   958   C  CD  . ARG A 1 124 ? 14.818 -2.183  15.919  1.00 33.33 ? 208 ARG A CD  1 
ATOM   959   N  NE  . ARG A 1 124 ? 15.038 -3.409  16.684  1.00 33.28 ? 208 ARG A NE  1 
ATOM   960   C  CZ  . ARG A 1 124 ? 15.191 -3.530  17.997  1.00 30.03 ? 208 ARG A CZ  1 
ATOM   961   N  NH1 . ARG A 1 124 ? 15.050 -2.525  18.861  1.00 23.96 ? 208 ARG A NH1 1 
ATOM   962   N  NH2 . ARG A 1 124 ? 15.436 -4.741  18.438  1.00 30.55 ? 208 ARG A NH2 1 
ATOM   963   N  N   . ASP A 1 125 ? 14.021 -2.907  10.936  1.00 36.29 ? 209 ASP A N   1 
ATOM   964   C  CA  . ASP A 1 125 ? 13.712 -2.713  9.543   1.00 37.12 ? 209 ASP A CA  1 
ATOM   965   C  C   . ASP A 1 125 ? 14.591 -1.542  9.063   1.00 37.17 ? 209 ASP A C   1 
ATOM   966   O  O   . ASP A 1 125 ? 14.544 -0.421  9.618   1.00 37.00 ? 209 ASP A O   1 
ATOM   967   C  CB  . ASP A 1 125 ? 12.218 -2.400  9.412   1.00 37.98 ? 209 ASP A CB  1 
ATOM   968   C  CG  . ASP A 1 125 ? 11.756 -2.337  7.985   1.00 42.80 ? 209 ASP A CG  1 
ATOM   969   O  OD1 . ASP A 1 125 ? 12.544 -2.672  7.064   1.00 48.98 ? 209 ASP A OD1 1 
ATOM   970   O  OD2 . ASP A 1 125 ? 10.589 -1.940  7.762   1.00 48.33 ? 209 ASP A OD2 1 
ATOM   971   N  N   . LEU A 1 126 ? 15.435 -1.801  8.073   1.00 37.05 ? 210 LEU A N   1 
ATOM   972   C  CA  . LEU A 1 126 ? 16.325 -0.757  7.590   1.00 36.55 ? 210 LEU A CA  1 
ATOM   973   C  C   . LEU A 1 126 ? 15.540 0.405   6.938   1.00 36.21 ? 210 LEU A C   1 
ATOM   974   O  O   . LEU A 1 126 ? 16.050 1.504   6.753   1.00 35.95 ? 210 LEU A O   1 
ATOM   975   C  CB  . LEU A 1 126 ? 17.307 -1.314  6.591   1.00 36.06 ? 210 LEU A CB  1 
ATOM   976   C  CG  . LEU A 1 126 ? 18.489 -2.192  6.953   1.00 35.80 ? 210 LEU A CG  1 
ATOM   977   C  CD1 . LEU A 1 126 ? 19.291 -2.375  5.690   1.00 32.73 ? 210 LEU A CD1 1 
ATOM   978   C  CD2 . LEU A 1 126 ? 19.352 -1.581  7.996   1.00 35.16 ? 210 LEU A CD2 1 
ATOM   979   N  N   . ARG A 1 127 ? 14.305 0.161   6.582   1.00 35.91 ? 211 ARG A N   1 
ATOM   980   C  CA  . ARG A 1 127 ? 13.522 1.222   6.018   1.00 36.82 ? 211 ARG A CA  1 
ATOM   981   C  C   . ARG A 1 127 ? 13.053 2.157   7.120   1.00 35.59 ? 211 ARG A C   1 
ATOM   982   O  O   . ARG A 1 127 ? 12.510 3.214   6.808   1.00 35.37 ? 211 ARG A O   1 
ATOM   983   C  CB  . ARG A 1 127 ? 12.328 0.644   5.270   1.00 38.05 ? 211 ARG A CB  1 
ATOM   984   C  CG  . ARG A 1 127 ? 12.531 0.565   3.750   1.00 43.79 ? 211 ARG A CG  1 
ATOM   985   C  CD  . ARG A 1 127 ? 11.594 -0.440  3.030   1.00 51.89 ? 211 ARG A CD  1 
ATOM   986   N  NE  . ARG A 1 127 ? 10.161 -0.311  3.395   1.00 61.85 ? 211 ARG A NE  1 
ATOM   987   C  CZ  . ARG A 1 127 ? 9.451  -1.159  4.183   1.00 65.55 ? 211 ARG A CZ  1 
ATOM   988   N  NH1 . ARG A 1 127 ? 9.981  -2.256  4.761   1.00 63.61 ? 211 ARG A NH1 1 
ATOM   989   N  NH2 . ARG A 1 127 ? 8.163  -0.901  4.402   1.00 69.54 ? 211 ARG A NH2 1 
ATOM   990   N  N   . LYS A 1 128 ? 13.244 1.744   8.391   1.00 35.21 ? 212 LYS A N   1 
ATOM   991   C  CA  . LYS A 1 128 ? 12.899 2.500   9.624   1.00 34.20 ? 212 LYS A CA  1 
ATOM   992   C  C   . LYS A 1 128 ? 14.112 2.674   10.547  1.00 32.89 ? 212 LYS A C   1 
ATOM   993   O  O   . LYS A 1 128 ? 13.972 2.680   11.781  1.00 32.72 ? 212 LYS A O   1 
ATOM   994   C  CB  . LYS A 1 128 ? 11.826 1.782   10.464  1.00 35.36 ? 212 LYS A CB  1 
ATOM   995   C  CG  . LYS A 1 128 ? 10.452 1.569   9.877   1.00 38.15 ? 212 LYS A CG  1 
ATOM   996   C  CD  . LYS A 1 128 ? 9.502  2.670   10.194  1.00 44.16 ? 212 LYS A CD  1 
ATOM   997   C  CE  . LYS A 1 128 ? 8.987  2.597   11.614  1.00 48.60 ? 212 LYS A CE  1 
ATOM   998   N  NZ  . LYS A 1 128 ? 7.561  2.976   11.590  1.00 53.18 ? 212 LYS A NZ  1 
ATOM   999   N  N   . THR A 1 129 ? 15.290 2.838   9.956   1.00 31.72 ? 213 THR A N   1 
ATOM   1000  C  CA  . THR A 1 129 ? 16.580 3.049   10.666  1.00 29.82 ? 213 THR A CA  1 
ATOM   1001  C  C   . THR A 1 129 ? 17.334 4.251   10.122  1.00 28.24 ? 213 THR A C   1 
ATOM   1002  O  O   . THR A 1 129 ? 17.436 4.417   8.939   1.00 27.10 ? 213 THR A O   1 
ATOM   1003  C  CB  . THR A 1 129 ? 17.508 1.913   10.434  1.00 29.69 ? 213 THR A CB  1 
ATOM   1004  O  OG1 . THR A 1 129 ? 16.880 0.729   10.896  1.00 28.98 ? 213 THR A OG1 1 
ATOM   1005  C  CG2 . THR A 1 129 ? 18.824 2.111   11.234  1.00 31.91 ? 213 THR A CG2 1 
ATOM   1006  N  N   . LEU A 1 130 ? 17.883 5.068   10.995  1.00 26.52 ? 214 LEU A N   1 
ATOM   1007  C  CA  . LEU A 1 130 ? 18.733 6.153   10.559  1.00 26.24 ? 214 LEU A CA  1 
ATOM   1008  C  C   . LEU A 1 130 ? 20.063 6.015   11.228  1.00 25.90 ? 214 LEU A C   1 
ATOM   1009  O  O   . LEU A 1 130 ? 20.141 5.421   12.310  1.00 26.35 ? 214 LEU A O   1 
ATOM   1010  C  CB  . LEU A 1 130 ? 18.122 7.500   10.954  1.00 26.14 ? 214 LEU A CB  1 
ATOM   1011  C  CG  . LEU A 1 130 ? 16.810 7.895   10.262  1.00 24.74 ? 214 LEU A CG  1 
ATOM   1012  C  CD1 . LEU A 1 130 ? 16.324 9.176   10.936  1.00 24.59 ? 214 LEU A CD1 1 
ATOM   1013  C  CD2 . LEU A 1 130 ? 17.014 8.122   8.782   1.00 19.36 ? 214 LEU A CD2 1 
ATOM   1014  N  N   . ILE A 1 131 ? 21.104 6.611   10.668  1.00 25.17 ? 215 ILE A N   1 
ATOM   1015  C  CA  . ILE A 1 131 ? 22.350 6.728   11.459  1.00 25.57 ? 215 ILE A CA  1 
ATOM   1016  C  C   . ILE A 1 131 ? 22.925 8.147   11.484  1.00 26.69 ? 215 ILE A C   1 
ATOM   1017  O  O   . ILE A 1 131 ? 23.154 8.753   10.422  1.00 28.40 ? 215 ILE A O   1 
ATOM   1018  C  CB  . ILE A 1 131 ? 23.472 5.777   10.974  1.00 25.61 ? 215 ILE A CB  1 
ATOM   1019  C  CG1 . ILE A 1 131 ? 24.793 6.040   11.762  1.00 25.17 ? 215 ILE A CG1 1 
ATOM   1020  C  CG2 . ILE A 1 131 ? 23.686 5.967   9.507   1.00 25.19 ? 215 ILE A CG2 1 
ATOM   1021  C  CD1 . ILE A 1 131 ? 25.828 4.981   11.652  1.00 23.95 ? 215 ILE A CD1 1 
ATOM   1022  N  N   . LEU A 1 132 ? 23.208 8.649   12.678  1.00 25.55 ? 216 LEU A N   1 
ATOM   1023  C  CA  . LEU A 1 132 ? 23.764 9.981   12.835  1.00 25.94 ? 216 LEU A CA  1 
ATOM   1024  C  C   . LEU A 1 132 ? 25.233 9.869   13.227  1.00 26.08 ? 216 LEU A C   1 
ATOM   1025  O  O   . LEU A 1 132 ? 25.505 9.354   14.290  1.00 25.60 ? 216 LEU A O   1 
ATOM   1026  C  CB  . LEU A 1 132 ? 22.979 10.714  13.957  1.00 24.99 ? 216 LEU A CB  1 
ATOM   1027  C  CG  . LEU A 1 132 ? 23.462 12.112  14.277  1.00 25.65 ? 216 LEU A CG  1 
ATOM   1028  C  CD1 . LEU A 1 132 ? 23.229 13.036  13.063  1.00 26.66 ? 216 LEU A CD1 1 
ATOM   1029  C  CD2 . LEU A 1 132 ? 22.792 12.625  15.481  1.00 25.09 ? 216 LEU A CD2 1 
ATOM   1030  N  N   . ASP A 1 133 ? 26.172 10.377  12.422  1.00 26.52 ? 217 ASP A N   1 
ATOM   1031  C  CA  . ASP A 1 133 ? 27.605 10.065  12.640  1.00 27.22 ? 217 ASP A CA  1 
ATOM   1032  C  C   . ASP A 1 133 ? 28.421 11.005  11.867  1.00 26.98 ? 217 ASP A C   1 
ATOM   1033  O  O   . ASP A 1 133 ? 28.132 11.203  10.716  1.00 28.13 ? 217 ASP A O   1 
ATOM   1034  C  CB  . ASP A 1 133 ? 27.905 8.696   12.083  1.00 29.07 ? 217 ASP A CB  1 
ATOM   1035  C  CG  . ASP A 1 133 ? 29.196 8.098   12.607  1.00 36.96 ? 217 ASP A CG  1 
ATOM   1036  O  OD1 . ASP A 1 133 ? 30.260 8.772   12.459  1.00 47.23 ? 217 ASP A OD1 1 
ATOM   1037  O  OD2 . ASP A 1 133 ? 29.162 6.938   13.113  1.00 39.24 ? 217 ASP A OD2 1 
ATOM   1038  N  N   . ASN A 1 134 ? 29.459 11.605  12.454  1.00 27.30 ? 218 ASN A N   1 
ATOM   1039  C  CA  . ASN A 1 134 ? 30.358 12.449  11.668  1.00 26.48 ? 218 ASN A CA  1 
ATOM   1040  C  C   . ASN A 1 134 ? 31.354 11.683  10.779  1.00 26.45 ? 218 ASN A C   1 
ATOM   1041  O  O   . ASN A 1 134 ? 32.066 12.314  10.039  1.00 25.85 ? 218 ASN A O   1 
ATOM   1042  C  CB  . ASN A 1 134 ? 31.181 13.311  12.569  1.00 26.96 ? 218 ASN A CB  1 
ATOM   1043  C  CG  . ASN A 1 134 ? 32.275 12.533  13.193  1.00 27.84 ? 218 ASN A CG  1 
ATOM   1044  O  OD1 . ASN A 1 134 ? 32.047 11.523  13.870  1.00 30.38 ? 218 ASN A OD1 1 
ATOM   1045  N  ND2 . ASN A 1 134 ? 33.455 12.930  12.923  1.00 23.77 ? 218 ASN A ND2 1 
ATOM   1046  N  N   . SER A 1 135 ? 31.449 10.354  10.848  1.00 26.93 ? 219 SER A N   1 
ATOM   1047  C  CA  . SER A 1 135 ? 32.353 9.633   9.897   1.00 28.42 ? 219 SER A CA  1 
ATOM   1048  C  C   . SER A 1 135 ? 31.664 8.801   8.821   1.00 28.89 ? 219 SER A C   1 
ATOM   1049  O  O   . SER A 1 135 ? 31.032 7.779   9.148   1.00 29.26 ? 219 SER A O   1 
ATOM   1050  C  CB  . SER A 1 135 ? 33.356 8.708   10.626  1.00 28.43 ? 219 SER A CB  1 
ATOM   1051  O  OG  . SER A 1 135 ? 33.883 9.366   11.762  1.00 30.63 ? 219 SER A OG  1 
ATOM   1052  N  N   . PRO A 1 136 ? 31.786 9.205   7.548   1.00 28.48 ? 220 PRO A N   1 
ATOM   1053  C  CA  . PRO A 1 136 ? 31.143 8.397   6.552   1.00 29.01 ? 220 PRO A CA  1 
ATOM   1054  C  C   . PRO A 1 136 ? 31.669 7.016   6.507   1.00 29.90 ? 220 PRO A C   1 
ATOM   1055  O  O   . PRO A 1 136 ? 30.972 6.148   6.074   1.00 32.64 ? 220 PRO A O   1 
ATOM   1056  C  CB  . PRO A 1 136 ? 31.397 9.157   5.245   1.00 29.14 ? 220 PRO A CB  1 
ATOM   1057  C  CG  . PRO A 1 136 ? 31.593 10.536  5.681   1.00 29.03 ? 220 PRO A CG  1 
ATOM   1058  C  CD  . PRO A 1 136 ? 32.331 10.438  6.961   1.00 29.05 ? 220 PRO A CD  1 
ATOM   1059  N  N   . ALA A 1 137 ? 32.869 6.765   6.973   1.00 30.82 ? 221 ALA A N   1 
ATOM   1060  C  CA  . ALA A 1 137 ? 33.358 5.386   7.069   1.00 29.98 ? 221 ALA A CA  1 
ATOM   1061  C  C   . ALA A 1 137 ? 32.580 4.485   8.022   1.00 31.02 ? 221 ALA A C   1 
ATOM   1062  O  O   . ALA A 1 137 ? 32.542 3.280   7.796   1.00 32.56 ? 221 ALA A O   1 
ATOM   1063  C  CB  . ALA A 1 137 ? 34.753 5.365   7.418   1.00 29.44 ? 221 ALA A CB  1 
ATOM   1064  N  N   . SER A 1 138 ? 31.911 5.013   9.044   1.00 30.72 ? 222 SER A N   1 
ATOM   1065  C  CA  . SER A 1 138 ? 31.056 4.158   9.875   1.00 29.87 ? 222 SER A CA  1 
ATOM   1066  C  C   . SER A 1 138 ? 29.903 3.576   9.105   1.00 30.71 ? 222 SER A C   1 
ATOM   1067  O  O   . SER A 1 138 ? 29.315 2.529   9.519   1.00 31.81 ? 222 SER A O   1 
ATOM   1068  C  CB  . SER A 1 138 ? 30.441 4.953   10.997  1.00 30.26 ? 222 SER A CB  1 
ATOM   1069  O  OG  . SER A 1 138 ? 31.430 5.724   11.625  1.00 34.00 ? 222 SER A OG  1 
ATOM   1070  N  N   . TYR A 1 139 ? 29.490 4.251   8.031   1.00 29.69 ? 223 TYR A N   1 
ATOM   1071  C  CA  . TYR A 1 139 ? 28.293 3.810   7.374   1.00 29.14 ? 223 TYR A CA  1 
ATOM   1072  C  C   . TYR A 1 139 ? 28.543 3.413   5.948   1.00 29.33 ? 223 TYR A C   1 
ATOM   1073  O  O   . TYR A 1 139 ? 27.684 3.569   5.078   1.00 30.15 ? 223 TYR A O   1 
ATOM   1074  C  CB  . TYR A 1 139 ? 27.089 4.768   7.550   1.00 29.88 ? 223 TYR A CB  1 
ATOM   1075  C  CG  . TYR A 1 139 ? 27.314 6.241   7.301   1.00 29.02 ? 223 TYR A CG  1 
ATOM   1076  C  CD1 . TYR A 1 139 ? 27.362 6.736   6.032   1.00 26.37 ? 223 TYR A CD1 1 
ATOM   1077  C  CD2 . TYR A 1 139 ? 27.456 7.146   8.366   1.00 28.90 ? 223 TYR A CD2 1 
ATOM   1078  C  CE1 . TYR A 1 139 ? 27.615 8.095   5.786   1.00 23.10 ? 223 TYR A CE1 1 
ATOM   1079  C  CE2 . TYR A 1 139 ? 27.648 8.484   8.139   1.00 24.84 ? 223 TYR A CE2 1 
ATOM   1080  C  CZ  . TYR A 1 139 ? 27.699 8.944   6.817   1.00 27.31 ? 223 TYR A CZ  1 
ATOM   1081  O  OH  . TYR A 1 139 ? 27.908 10.282  6.515   1.00 33.18 ? 223 TYR A OH  1 
ATOM   1082  N  N   . ILE A 1 140 ? 29.688 2.802   5.721   1.00 28.62 ? 224 ILE A N   1 
ATOM   1083  C  CA  . ILE A 1 140 ? 30.045 2.414   4.374   1.00 28.21 ? 224 ILE A CA  1 
ATOM   1084  C  C   . ILE A 1 140 ? 28.958 1.617   3.708   1.00 28.34 ? 224 ILE A C   1 
ATOM   1085  O  O   . ILE A 1 140 ? 28.734 1.829   2.535   1.00 29.57 ? 224 ILE A O   1 
ATOM   1086  C  CB  . ILE A 1 140 ? 31.377 1.669   4.340   1.00 28.37 ? 224 ILE A CB  1 
ATOM   1087  C  CG1 . ILE A 1 140 ? 32.499 2.675   4.461   1.00 29.48 ? 224 ILE A CG1 1 
ATOM   1088  C  CG2 . ILE A 1 140 ? 31.600 0.939   3.044   1.00 26.82 ? 224 ILE A CG2 1 
ATOM   1089  C  CD1 . ILE A 1 140 ? 33.827 1.933   4.834   1.00 30.16 ? 224 ILE A CD1 1 
ATOM   1090  N  N   . PHE A 1 141 ? 28.285 0.734   4.450   1.00 27.74 ? 225 PHE A N   1 
ATOM   1091  C  CA  . PHE A 1 141 ? 27.322 -0.187  3.901   1.00 27.56 ? 225 PHE A CA  1 
ATOM   1092  C  C   . PHE A 1 141 ? 25.914 0.397   3.747   1.00 28.12 ? 225 PHE A C   1 
ATOM   1093  O  O   . PHE A 1 141 ? 25.093 -0.173  3.031   1.00 29.24 ? 225 PHE A O   1 
ATOM   1094  C  CB  . PHE A 1 141 ? 27.144 -1.399  4.788   1.00 27.85 ? 225 PHE A CB  1 
ATOM   1095  C  CG  . PHE A 1 141 ? 28.392 -2.156  5.080   1.00 26.63 ? 225 PHE A CG  1 
ATOM   1096  C  CD1 . PHE A 1 141 ? 28.466 -2.927  6.246   1.00 23.65 ? 225 PHE A CD1 1 
ATOM   1097  C  CD2 . PHE A 1 141 ? 29.474 -2.137  4.194   1.00 27.10 ? 225 PHE A CD2 1 
ATOM   1098  C  CE1 . PHE A 1 141 ? 29.620 -3.664  6.521   1.00 29.91 ? 225 PHE A CE1 1 
ATOM   1099  C  CE2 . PHE A 1 141 ? 30.663 -2.867  4.436   1.00 24.77 ? 225 PHE A CE2 1 
ATOM   1100  C  CZ  . PHE A 1 141 ? 30.744 -3.630  5.603   1.00 28.66 ? 225 PHE A CZ  1 
ATOM   1101  N  N   . HIS A 1 142 ? 25.632 1.496   4.429   1.00 27.31 ? 226 HIS A N   1 
ATOM   1102  C  CA  . HIS A 1 142 ? 24.326 2.101   4.406   1.00 26.42 ? 226 HIS A CA  1 
ATOM   1103  C  C   . HIS A 1 142 ? 24.362 3.593   4.278   1.00 26.53 ? 226 HIS A C   1 
ATOM   1104  O  O   . HIS A 1 142 ? 23.810 4.238   5.113   1.00 24.88 ? 226 HIS A O   1 
ATOM   1105  C  CB  . HIS A 1 142 ? 23.609 1.747   5.686   1.00 26.59 ? 226 HIS A CB  1 
ATOM   1106  C  CG  . HIS A 1 142 ? 23.587 0.282   5.915   1.00 30.47 ? 226 HIS A CG  1 
ATOM   1107  N  ND1 . HIS A 1 142 ? 22.784 -0.571  5.178   1.00 29.03 ? 226 HIS A ND1 1 
ATOM   1108  C  CD2 . HIS A 1 142 ? 24.374 -0.503  6.692   1.00 31.69 ? 226 HIS A CD2 1 
ATOM   1109  C  CE1 . HIS A 1 142 ? 23.035 -1.820  5.547   1.00 32.92 ? 226 HIS A CE1 1 
ATOM   1110  N  NE2 . HIS A 1 142 ? 23.994 -1.805  6.468   1.00 31.51 ? 226 HIS A NE2 1 
ATOM   1111  N  N   . PRO A 1 143 ? 24.980 4.158   3.198   1.00 27.47 ? 227 PRO A N   1 
ATOM   1112  C  CA  . PRO A 1 143 ? 25.031 5.613   3.250   1.00 28.06 ? 227 PRO A CA  1 
ATOM   1113  C  C   . PRO A 1 143 ? 23.650 6.180   2.961   1.00 29.15 ? 227 PRO A C   1 
ATOM   1114  O  O   . PRO A 1 143 ? 23.363 7.318   3.274   1.00 29.36 ? 227 PRO A O   1 
ATOM   1115  C  CB  . PRO A 1 143 ? 26.033 5.960   2.145   1.00 26.47 ? 227 PRO A CB  1 
ATOM   1116  C  CG  . PRO A 1 143 ? 25.805 4.945   1.202   1.00 26.60 ? 227 PRO A CG  1 
ATOM   1117  C  CD  . PRO A 1 143 ? 25.602 3.666   1.964   1.00 25.70 ? 227 PRO A CD  1 
ATOM   1118  N  N   . GLU A 1 144 ? 22.770 5.386   2.385   1.00 30.88 ? 228 GLU A N   1 
ATOM   1119  C  CA  . GLU A 1 144 ? 21.452 5.930   2.192   1.00 32.66 ? 228 GLU A CA  1 
ATOM   1120  C  C   . GLU A 1 144 ? 20.555 6.085   3.447   1.00 31.55 ? 228 GLU A C   1 
ATOM   1121  O  O   . GLU A 1 144 ? 19.519 6.752   3.352   1.00 32.45 ? 228 GLU A O   1 
ATOM   1122  C  CB  . GLU A 1 144 ? 20.766 5.306   0.992   1.00 34.36 ? 228 GLU A CB  1 
ATOM   1123  C  CG  . GLU A 1 144 ? 20.565 3.815   1.088   1.00 44.77 ? 228 GLU A CG  1 
ATOM   1124  C  CD  . GLU A 1 144 ? 21.853 2.947   0.960   1.00 52.00 ? 228 GLU A CD  1 
ATOM   1125  O  OE1 . GLU A 1 144 ? 21.909 1.939   1.744   1.00 53.98 ? 228 GLU A OE1 1 
ATOM   1126  O  OE2 . GLU A 1 144 ? 22.740 3.271   0.110   1.00 50.19 ? 228 GLU A OE2 1 
ATOM   1127  N  N   . ASN A 1 145 ? 20.991 5.559   4.606   1.00 29.30 ? 229 ASN A N   1 
ATOM   1128  C  CA  . ASN A 1 145 ? 20.312 5.730   5.875   1.00 28.35 ? 229 ASN A CA  1 
ATOM   1129  C  C   . ASN A 1 145 ? 20.926 6.781   6.727   1.00 28.26 ? 229 ASN A C   1 
ATOM   1130  O  O   . ASN A 1 145 ? 20.445 6.993   7.841   1.00 28.47 ? 229 ASN A O   1 
ATOM   1131  C  CB  . ASN A 1 145 ? 20.344 4.482   6.744   1.00 27.76 ? 229 ASN A CB  1 
ATOM   1132  C  CG  . ASN A 1 145 ? 19.588 3.393   6.170   1.00 27.86 ? 229 ASN A CG  1 
ATOM   1133  O  OD1 . ASN A 1 145 ? 20.062 2.731   5.253   1.00 27.45 ? 229 ASN A OD1 1 
ATOM   1134  N  ND2 . ASN A 1 145 ? 18.395 3.153   6.700   1.00 25.95 ? 229 ASN A ND2 1 
ATOM   1135  N  N   . ALA A 1 146 ? 21.984 7.412   6.221   1.00 26.87 ? 230 ALA A N   1 
ATOM   1136  C  CA  . ALA A 1 146 ? 22.769 8.340   6.979   1.00 26.25 ? 230 ALA A CA  1 
ATOM   1137  C  C   . ALA A 1 146 ? 22.168 9.719   7.079   1.00 27.03 ? 230 ALA A C   1 
ATOM   1138  O  O   . ALA A 1 146 ? 21.601 10.227  6.090   1.00 26.59 ? 230 ALA A O   1 
ATOM   1139  C  CB  . ALA A 1 146 ? 24.198 8.439   6.341   1.00 25.38 ? 230 ALA A CB  1 
ATOM   1140  N  N   . VAL A 1 147 ? 22.368 10.371  8.232   1.00 27.20 ? 231 VAL A N   1 
ATOM   1141  C  CA  . VAL A 1 147 ? 22.204 11.832  8.285   1.00 28.07 ? 231 VAL A CA  1 
ATOM   1142  C  C   . VAL A 1 147 ? 23.510 12.484  8.686   1.00 28.77 ? 231 VAL A C   1 
ATOM   1143  O  O   . VAL A 1 147 ? 23.825 12.583  9.845   1.00 31.01 ? 231 VAL A O   1 
ATOM   1144  C  CB  . VAL A 1 147 ? 21.224 12.267  9.339   1.00 28.65 ? 231 VAL A CB  1 
ATOM   1145  C  CG1 . VAL A 1 147 ? 21.187 13.780  9.359   1.00 29.06 ? 231 VAL A CG1 1 
ATOM   1146  C  CG2 . VAL A 1 147 ? 19.805 11.671  9.134   1.00 27.18 ? 231 VAL A CG2 1 
ATOM   1147  N  N   . PRO A 1 148 ? 24.306 12.928  7.743   1.00 28.82 ? 232 PRO A N   1 
ATOM   1148  C  CA  . PRO A 1 148 ? 25.635 13.313  8.166   1.00 27.80 ? 232 PRO A CA  1 
ATOM   1149  C  C   . PRO A 1 148 ? 25.594 14.526  9.076   1.00 28.19 ? 232 PRO A C   1 
ATOM   1150  O  O   . PRO A 1 148 ? 24.641 15.282  9.042   1.00 28.62 ? 232 PRO A O   1 
ATOM   1151  C  CB  . PRO A 1 148 ? 26.281 13.691  6.863   1.00 26.73 ? 232 PRO A CB  1 
ATOM   1152  C  CG  . PRO A 1 148 ? 25.558 12.922  5.844   1.00 27.42 ? 232 PRO A CG  1 
ATOM   1153  C  CD  . PRO A 1 148 ? 24.142 13.027  6.288   1.00 29.18 ? 232 PRO A CD  1 
ATOM   1154  N  N   . VAL A 1 149 ? 26.621 14.670  9.894   1.00 27.50 ? 233 VAL A N   1 
ATOM   1155  C  CA  . VAL A 1 149 ? 26.775 15.760  10.828  1.00 27.72 ? 233 VAL A CA  1 
ATOM   1156  C  C   . VAL A 1 149 ? 28.294 16.129  10.888  1.00 28.49 ? 233 VAL A C   1 
ATOM   1157  O  O   . VAL A 1 149 ? 29.170 15.320  10.746  1.00 28.52 ? 233 VAL A O   1 
ATOM   1158  C  CB  . VAL A 1 149 ? 26.199 15.440  12.221  1.00 26.69 ? 233 VAL A CB  1 
ATOM   1159  C  CG1 . VAL A 1 149 ? 27.133 14.608  12.997  1.00 25.95 ? 233 VAL A CG1 1 
ATOM   1160  C  CG2 . VAL A 1 149 ? 26.070 16.668  12.983  1.00 27.81 ? 233 VAL A CG2 1 
ATOM   1161  N  N   . GLN A 1 150 ? 28.569 17.393  11.028  1.00 29.19 ? 234 GLN A N   1 
ATOM   1162  C  CA  . GLN A 1 150 ? 29.909 17.922  11.041  1.00 29.15 ? 234 GLN A CA  1 
ATOM   1163  C  C   . GLN A 1 150 ? 30.582 17.446  12.335  1.00 27.71 ? 234 GLN A C   1 
ATOM   1164  O  O   . GLN A 1 150 ? 29.958 17.446  13.413  1.00 27.60 ? 234 GLN A O   1 
ATOM   1165  C  CB  . GLN A 1 150 ? 29.731 19.438  11.133  1.00 29.80 ? 234 GLN A CB  1 
ATOM   1166  C  CG  . GLN A 1 150 ? 30.767 20.268  10.513  1.00 36.25 ? 234 GLN A CG  1 
ATOM   1167  C  CD  . GLN A 1 150 ? 30.303 21.679  10.283  1.00 40.14 ? 234 GLN A CD  1 
ATOM   1168  O  OE1 . GLN A 1 150 ? 30.063 22.437  11.190  1.00 41.12 ? 234 GLN A OE1 1 
ATOM   1169  N  NE2 . GLN A 1 150 ? 30.205 22.037  9.035   1.00 50.55 ? 234 GLN A NE2 1 
ATOM   1170  N  N   . SER A 1 151 ? 31.850 17.080  12.242  1.00 25.88 ? 235 SER A N   1 
ATOM   1171  C  CA  . SER A 1 151 ? 32.649 16.819  13.431  1.00 25.59 ? 235 SER A CA  1 
ATOM   1172  C  C   . SER A 1 151 ? 32.667 18.034  14.349  1.00 25.94 ? 235 SER A C   1 
ATOM   1173  O  O   . SER A 1 151 ? 32.696 19.198  13.915  1.00 25.68 ? 235 SER A O   1 
ATOM   1174  C  CB  . SER A 1 151 ? 34.090 16.454  13.101  1.00 24.58 ? 235 SER A CB  1 
ATOM   1175  O  OG  . SER A 1 151 ? 34.163 15.453  12.093  1.00 24.44 ? 235 SER A OG  1 
ATOM   1176  N  N   . TRP A 1 152 ? 32.627 17.741  15.623  1.00 26.05 ? 236 TRP A N   1 
ATOM   1177  C  CA  . TRP A 1 152 ? 32.788 18.774  16.598  1.00 27.14 ? 236 TRP A CA  1 
ATOM   1178  C  C   . TRP A 1 152 ? 33.948 18.477  17.603  1.00 28.83 ? 236 TRP A C   1 
ATOM   1179  O  O   . TRP A 1 152 ? 34.243 17.328  17.937  1.00 28.89 ? 236 TRP A O   1 
ATOM   1180  C  CB  . TRP A 1 152 ? 31.518 18.807  17.382  1.00 25.38 ? 236 TRP A CB  1 
ATOM   1181  C  CG  . TRP A 1 152 ? 31.522 19.991  18.251  1.00 24.68 ? 236 TRP A CG  1 
ATOM   1182  C  CD1 . TRP A 1 152 ? 31.179 21.297  17.913  1.00 20.60 ? 236 TRP A CD1 1 
ATOM   1183  C  CD2 . TRP A 1 152 ? 31.840 20.033  19.661  1.00 20.53 ? 236 TRP A CD2 1 
ATOM   1184  N  NE1 . TRP A 1 152 ? 31.310 22.128  19.055  1.00 22.44 ? 236 TRP A NE1 1 
ATOM   1185  C  CE2 . TRP A 1 152 ? 31.703 21.351  20.079  1.00 19.64 ? 236 TRP A CE2 1 
ATOM   1186  C  CE3 . TRP A 1 152 ? 32.233 19.030  20.614  1.00 23.49 ? 236 TRP A CE3 1 
ATOM   1187  C  CZ2 . TRP A 1 152 ? 31.965 21.732  21.401  1.00 22.49 ? 236 TRP A CZ2 1 
ATOM   1188  C  CZ3 . TRP A 1 152 ? 32.473 19.358  21.903  1.00 21.27 ? 236 TRP A CZ3 1 
ATOM   1189  C  CH2 . TRP A 1 152 ? 32.329 20.731  22.318  1.00 24.92 ? 236 TRP A CH2 1 
ATOM   1190  N  N   . PHE A 1 153 ? 34.582 19.530  18.106  1.00 30.24 ? 237 PHE A N   1 
ATOM   1191  C  CA  . PHE A 1 153 ? 35.789 19.431  18.950  1.00 29.76 ? 237 PHE A CA  1 
ATOM   1192  C  C   . PHE A 1 153 ? 35.719 20.396  20.083  1.00 31.15 ? 237 PHE A C   1 
ATOM   1193  O  O   . PHE A 1 153 ? 35.796 20.021  21.214  1.00 34.54 ? 237 PHE A O   1 
ATOM   1194  C  CB  . PHE A 1 153 ? 37.065 19.737  18.174  1.00 27.84 ? 237 PHE A CB  1 
ATOM   1195  C  CG  . PHE A 1 153 ? 37.159 19.042  16.891  1.00 24.75 ? 237 PHE A CG  1 
ATOM   1196  C  CD1 . PHE A 1 153 ? 36.635 19.623  15.738  1.00 22.50 ? 237 PHE A CD1 1 
ATOM   1197  C  CD2 . PHE A 1 153 ? 37.766 17.776  16.810  1.00 27.09 ? 237 PHE A CD2 1 
ATOM   1198  C  CE1 . PHE A 1 153 ? 36.690 18.934  14.482  1.00 27.79 ? 237 PHE A CE1 1 
ATOM   1199  C  CE2 . PHE A 1 153 ? 37.836 17.064  15.545  1.00 25.67 ? 237 PHE A CE2 1 
ATOM   1200  C  CZ  . PHE A 1 153 ? 37.268 17.636  14.395  1.00 25.15 ? 237 PHE A CZ  1 
ATOM   1201  N  N   . ASP A 1 154 ? 35.540 21.658  19.838  1.00 32.51 ? 238 ASP A N   1 
ATOM   1202  C  CA  . ASP A 1 154 ? 35.609 22.541  20.960  1.00 34.27 ? 238 ASP A CA  1 
ATOM   1203  C  C   . ASP A 1 154 ? 34.870 23.837  20.672  1.00 34.30 ? 238 ASP A C   1 
ATOM   1204  O  O   . ASP A 1 154 ? 34.751 24.680  21.518  1.00 36.62 ? 238 ASP A O   1 
ATOM   1205  C  CB  . ASP A 1 154 ? 37.114 22.794  21.322  1.00 35.19 ? 238 ASP A CB  1 
ATOM   1206  C  CG  . ASP A 1 154 ? 37.914 23.514  20.182  1.00 38.29 ? 238 ASP A CG  1 
ATOM   1207  O  OD1 . ASP A 1 154 ? 37.402 23.775  19.076  1.00 41.14 ? 238 ASP A OD1 1 
ATOM   1208  O  OD2 . ASP A 1 154 ? 39.106 23.802  20.382  1.00 47.68 ? 238 ASP A OD2 1 
ATOM   1209  N  N   . ASP A 1 155 ? 34.360 23.993  19.487  1.00 34.48 ? 239 ASP A N   1 
ATOM   1210  C  CA  . ASP A 1 155 ? 33.589 25.167  19.140  1.00 36.75 ? 239 ASP A CA  1 
ATOM   1211  C  C   . ASP A 1 155 ? 32.276 25.383  19.908  1.00 37.34 ? 239 ASP A C   1 
ATOM   1212  O  O   . ASP A 1 155 ? 31.268 24.840  19.522  1.00 37.20 ? 239 ASP A O   1 
ATOM   1213  C  CB  . ASP A 1 155 ? 33.241 25.030  17.665  1.00 37.52 ? 239 ASP A CB  1 
ATOM   1214  C  CG  . ASP A 1 155 ? 32.732 26.295  17.070  1.00 40.69 ? 239 ASP A CG  1 
ATOM   1215  O  OD1 . ASP A 1 155 ? 32.532 27.318  17.810  1.00 43.17 ? 239 ASP A OD1 1 
ATOM   1216  O  OD2 . ASP A 1 155 ? 32.521 26.234  15.833  1.00 45.21 ? 239 ASP A OD2 1 
ATOM   1217  N  N   . MET A 1 156 ? 32.304 26.209  20.951  1.00 38.00 ? 240 MET A N   1 
ATOM   1218  C  CA  . MET A 1 156 ? 31.143 26.516  21.783  1.00 39.28 ? 240 MET A CA  1 
ATOM   1219  C  C   . MET A 1 156 ? 29.996 27.274  21.092  1.00 39.57 ? 240 MET A C   1 
ATOM   1220  O  O   . MET A 1 156 ? 28.858 27.309  21.607  1.00 40.69 ? 240 MET A O   1 
ATOM   1221  C  CB  . MET A 1 156 ? 31.553 27.259  23.070  1.00 39.15 ? 240 MET A CB  1 
ATOM   1222  C  CG  . MET A 1 156 ? 32.046 26.358  24.228  1.00 41.06 ? 240 MET A CG  1 
ATOM   1223  S  SD  . MET A 1 156 ? 31.756 24.543  24.142  1.00 44.02 ? 240 MET A SD  1 
ATOM   1224  C  CE  . MET A 1 156 ? 30.285 24.278  25.113  1.00 47.52 ? 240 MET A CE  1 
ATOM   1225  N  N   . ALA A 1 157 ? 30.287 27.883  19.957  1.00 39.04 ? 241 ALA A N   1 
ATOM   1226  C  CA  . ALA A 1 157 ? 29.253 28.454  19.099  1.00 38.83 ? 241 ALA A CA  1 
ATOM   1227  C  C   . ALA A 1 157 ? 28.570 27.488  18.137  1.00 38.80 ? 241 ALA A C   1 
ATOM   1228  O  O   . ALA A 1 157 ? 27.851 27.953  17.270  1.00 38.99 ? 241 ALA A O   1 
ATOM   1229  C  CB  . ALA A 1 157 ? 29.881 29.558  18.250  1.00 39.35 ? 241 ALA A CB  1 
ATOM   1230  N  N   . ASP A 1 158 ? 28.843 26.171  18.204  1.00 38.42 ? 242 ASP A N   1 
ATOM   1231  C  CA  . ASP A 1 158 ? 28.198 25.179  17.304  1.00 37.06 ? 242 ASP A CA  1 
ATOM   1232  C  C   . ASP A 1 158 ? 26.712 25.169  17.593  1.00 36.65 ? 242 ASP A C   1 
ATOM   1233  O  O   . ASP A 1 158 ? 26.320 25.300  18.764  1.00 37.54 ? 242 ASP A O   1 
ATOM   1234  C  CB  . ASP A 1 158 ? 28.738 23.787  17.616  1.00 37.20 ? 242 ASP A CB  1 
ATOM   1235  C  CG  . ASP A 1 158 ? 28.435 22.760  16.536  1.00 37.19 ? 242 ASP A CG  1 
ATOM   1236  O  OD1 . ASP A 1 158 ? 27.621 21.845  16.756  1.00 33.02 ? 242 ASP A OD1 1 
ATOM   1237  O  OD2 . ASP A 1 158 ? 29.066 22.825  15.474  1.00 38.69 ? 242 ASP A OD2 1 
ATOM   1238  N  N   . THR A 1 159 ? 25.889 24.988  16.564  1.00 36.14 ? 243 THR A N   1 
ATOM   1239  C  CA  . THR A 1 159 ? 24.428 24.882  16.729  1.00 35.48 ? 243 THR A CA  1 
ATOM   1240  C  C   . THR A 1 159 ? 23.896 23.772  15.866  1.00 36.34 ? 243 THR A C   1 
ATOM   1241  O  O   . THR A 1 159 ? 22.678 23.668  15.653  1.00 37.17 ? 243 THR A O   1 
ATOM   1242  C  CB  . THR A 1 159 ? 23.656 26.175  16.365  1.00 35.05 ? 243 THR A CB  1 
ATOM   1243  O  OG1 . THR A 1 159 ? 23.850 26.492  14.983  1.00 36.32 ? 243 THR A OG1 1 
ATOM   1244  C  CG2 . THR A 1 159 ? 24.129 27.342  17.142  1.00 34.46 ? 243 THR A CG2 1 
ATOM   1245  N  N   . GLU A 1 160 ? 24.796 22.900  15.421  1.00 36.44 ? 244 GLU A N   1 
ATOM   1246  C  CA  . GLU A 1 160 ? 24.417 21.738  14.611  1.00 37.73 ? 244 GLU A CA  1 
ATOM   1247  C  C   . GLU A 1 160 ? 23.352 20.830  15.197  1.00 36.82 ? 244 GLU A C   1 
ATOM   1248  O  O   . GLU A 1 160 ? 22.484 20.372  14.450  1.00 37.73 ? 244 GLU A O   1 
ATOM   1249  C  CB  . GLU A 1 160 ? 25.634 20.948  14.147  1.00 37.78 ? 244 GLU A CB  1 
ATOM   1250  C  CG  . GLU A 1 160 ? 26.093 21.379  12.730  1.00 46.67 ? 244 GLU A CG  1 
ATOM   1251  C  CD  . GLU A 1 160 ? 25.404 20.522  11.634  1.00 59.61 ? 244 GLU A CD  1 
ATOM   1252  O  OE1 . GLU A 1 160 ? 24.145 20.282  11.779  1.00 62.81 ? 244 GLU A OE1 1 
ATOM   1253  O  OE2 . GLU A 1 160 ? 26.118 20.060  10.662  1.00 60.05 ? 244 GLU A OE2 1 
ATOM   1254  N  N   . LEU A 1 161 ? 23.406 20.543  16.496  1.00 35.13 ? 245 LEU A N   1 
ATOM   1255  C  CA  . LEU A 1 161 ? 22.371 19.721  17.077  1.00 34.92 ? 245 LEU A CA  1 
ATOM   1256  C  C   . LEU A 1 161 ? 21.003 20.446  17.199  1.00 36.42 ? 245 LEU A C   1 
ATOM   1257  O  O   . LEU A 1 161 ? 19.965 19.861  16.952  1.00 37.30 ? 245 LEU A O   1 
ATOM   1258  C  CB  . LEU A 1 161 ? 22.845 19.083  18.366  1.00 34.14 ? 245 LEU A CB  1 
ATOM   1259  C  CG  . LEU A 1 161 ? 24.132 18.221  18.259  1.00 32.15 ? 245 LEU A CG  1 
ATOM   1260  C  CD1 . LEU A 1 161 ? 24.395 17.522  19.542  1.00 26.66 ? 245 LEU A CD1 1 
ATOM   1261  C  CD2 . LEU A 1 161 ? 24.123 17.174  17.090  1.00 30.12 ? 245 LEU A CD2 1 
ATOM   1262  N  N   . LEU A 1 162 ? 21.021 21.726  17.555  1.00 37.51 ? 246 LEU A N   1 
ATOM   1263  C  CA  . LEU A 1 162 ? 19.894 22.627  17.393  1.00 37.67 ? 246 LEU A CA  1 
ATOM   1264  C  C   . LEU A 1 162 ? 19.380 22.665  15.935  1.00 38.11 ? 246 LEU A C   1 
ATOM   1265  O  O   . LEU A 1 162 ? 18.217 22.532  15.714  1.00 38.00 ? 246 LEU A O   1 
ATOM   1266  C  CB  . LEU A 1 162 ? 20.357 24.032  17.783  1.00 38.68 ? 246 LEU A CB  1 
ATOM   1267  C  CG  . LEU A 1 162 ? 19.414 25.230  17.818  1.00 37.64 ? 246 LEU A CG  1 
ATOM   1268  C  CD1 . LEU A 1 162 ? 18.188 24.847  18.702  1.00 38.37 ? 246 LEU A CD1 1 
ATOM   1269  C  CD2 . LEU A 1 162 ? 20.154 26.344  18.439  1.00 36.82 ? 246 LEU A CD2 1 
ATOM   1270  N  N   . ASN A 1 163 ? 20.232 22.869  14.939  1.00 37.91 ? 247 ASN A N   1 
ATOM   1271  C  CA  . ASN A 1 163 ? 19.713 22.846  13.603  1.00 38.08 ? 247 ASN A CA  1 
ATOM   1272  C  C   . ASN A 1 163 ? 19.009 21.524  13.271  1.00 38.07 ? 247 ASN A C   1 
ATOM   1273  O  O   . ASN A 1 163 ? 18.061 21.531  12.510  1.00 39.19 ? 247 ASN A O   1 
ATOM   1274  C  CB  . ASN A 1 163 ? 20.785 23.260  12.559  1.00 38.53 ? 247 ASN A CB  1 
ATOM   1275  C  CG  . ASN A 1 163 ? 21.264 24.745  12.753  1.00 43.38 ? 247 ASN A CG  1 
ATOM   1276  O  OD1 . ASN A 1 163 ? 20.483 25.606  13.194  1.00 46.46 ? 247 ASN A OD1 1 
ATOM   1277  N  ND2 . ASN A 1 163 ? 22.561 25.024  12.484  1.00 45.93 ? 247 ASN A ND2 1 
ATOM   1278  N  N   . LEU A 1 164 ? 19.428 20.388  13.850  1.00 36.82 ? 248 LEU A N   1 
ATOM   1279  C  CA  . LEU A 1 164 ? 18.978 19.100  13.330  1.00 34.79 ? 248 LEU A CA  1 
ATOM   1280  C  C   . LEU A 1 164 ? 17.673 18.652  13.947  1.00 34.95 ? 248 LEU A C   1 
ATOM   1281  O  O   . LEU A 1 164 ? 17.022 17.701  13.472  1.00 33.40 ? 248 LEU A O   1 
ATOM   1282  C  CB  . LEU A 1 164 ? 20.005 18.014  13.576  1.00 34.51 ? 248 LEU A CB  1 
ATOM   1283  C  CG  . LEU A 1 164 ? 21.183 17.673  12.670  1.00 33.81 ? 248 LEU A CG  1 
ATOM   1284  C  CD1 . LEU A 1 164 ? 22.126 16.729  13.448  1.00 33.53 ? 248 LEU A CD1 1 
ATOM   1285  C  CD2 . LEU A 1 164 ? 20.799 17.050  11.335  1.00 28.05 ? 248 LEU A CD2 1 
ATOM   1286  N  N   . ILE A 1 165 ? 17.289 19.323  15.023  1.00 34.88 ? 249 ILE A N   1 
ATOM   1287  C  CA  . ILE A 1 165 ? 16.101 18.911  15.714  1.00 34.44 ? 249 ILE A CA  1 
ATOM   1288  C  C   . ILE A 1 165 ? 14.868 18.954  14.804  1.00 35.24 ? 249 ILE A C   1 
ATOM   1289  O  O   . ILE A 1 165 ? 14.200 17.978  14.734  1.00 35.96 ? 249 ILE A O   1 
ATOM   1290  C  CB  . ILE A 1 165 ? 15.858 19.693  17.006  1.00 35.51 ? 249 ILE A CB  1 
ATOM   1291  C  CG1 . ILE A 1 165 ? 16.945 19.332  18.060  1.00 33.46 ? 249 ILE A CG1 1 
ATOM   1292  C  CG2 . ILE A 1 165 ? 14.336 19.483  17.409  1.00 32.03 ? 249 ILE A CG2 1 
ATOM   1293  C  CD1 . ILE A 1 165 ? 16.745 19.923  19.477  1.00 32.88 ? 249 ILE A CD1 1 
ATOM   1294  N  N   . PRO A 1 166 ? 14.590 20.061  14.087  1.00 35.76 ? 250 PRO A N   1 
ATOM   1295  C  CA  . PRO A 1 166 ? 13.445 20.069  13.146  1.00 35.92 ? 250 PRO A CA  1 
ATOM   1296  C  C   . PRO A 1 166 ? 13.541 18.993  12.091  1.00 36.24 ? 250 PRO A C   1 
ATOM   1297  O  O   . PRO A 1 166 ? 12.534 18.395  11.736  1.00 37.79 ? 250 PRO A O   1 
ATOM   1298  C  CB  . PRO A 1 166 ? 13.594 21.395  12.384  1.00 36.81 ? 250 PRO A CB  1 
ATOM   1299  C  CG  . PRO A 1 166 ? 14.908 22.019  12.781  1.00 35.65 ? 250 PRO A CG  1 
ATOM   1300  C  CD  . PRO A 1 166 ? 15.318 21.349  14.087  1.00 35.83 ? 250 PRO A CD  1 
ATOM   1301  N  N   . ILE A 1 167 ? 14.738 18.770  11.579  1.00 36.15 ? 251 ILE A N   1 
ATOM   1302  C  CA  . ILE A 1 167 ? 15.045 17.696  10.613  1.00 36.81 ? 251 ILE A CA  1 
ATOM   1303  C  C   . ILE A 1 167 ? 14.560 16.314  11.120  1.00 37.34 ? 251 ILE A C   1 
ATOM   1304  O  O   . ILE A 1 167 ? 13.770 15.630  10.458  1.00 37.67 ? 251 ILE A O   1 
ATOM   1305  C  CB  . ILE A 1 167 ? 16.577 17.753  10.271  1.00 37.41 ? 251 ILE A CB  1 
ATOM   1306  C  CG1 . ILE A 1 167 ? 16.889 19.155  9.647   1.00 38.20 ? 251 ILE A CG1 1 
ATOM   1307  C  CG2 . ILE A 1 167 ? 17.059 16.560  9.462   1.00 35.59 ? 251 ILE A CG2 1 
ATOM   1308  C  CD1 . ILE A 1 167 ? 18.178 19.256  8.940   1.00 43.22 ? 251 ILE A CD1 1 
ATOM   1309  N  N   . PHE A 1 168 ? 14.946 15.936  12.331  1.00 36.72 ? 252 PHE A N   1 
ATOM   1310  C  CA  . PHE A 1 168 ? 14.463 14.707  12.863  1.00 35.89 ? 252 PHE A CA  1 
ATOM   1311  C  C   . PHE A 1 168 ? 13.008 14.804  13.218  1.00 36.84 ? 252 PHE A C   1 
ATOM   1312  O  O   . PHE A 1 168 ? 12.300 13.826  13.116  1.00 38.43 ? 252 PHE A O   1 
ATOM   1313  C  CB  . PHE A 1 168 ? 15.287 14.254  14.039  1.00 34.47 ? 252 PHE A CB  1 
ATOM   1314  C  CG  . PHE A 1 168 ? 16.619 13.636  13.648  1.00 34.80 ? 252 PHE A CG  1 
ATOM   1315  C  CD1 . PHE A 1 168 ? 17.769 14.399  13.557  1.00 34.61 ? 252 PHE A CD1 1 
ATOM   1316  C  CD2 . PHE A 1 168 ? 16.735 12.296  13.405  1.00 32.27 ? 252 PHE A CD2 1 
ATOM   1317  C  CE1 . PHE A 1 168 ? 18.994 13.836  13.206  1.00 33.06 ? 252 PHE A CE1 1 
ATOM   1318  C  CE2 . PHE A 1 168 ? 17.965 11.740  13.103  1.00 31.38 ? 252 PHE A CE2 1 
ATOM   1319  C  CZ  . PHE A 1 168 ? 19.094 12.521  12.990  1.00 30.76 ? 252 PHE A CZ  1 
ATOM   1320  N  N   . GLU A 1 169 ? 12.539 15.964  13.638  1.00 38.11 ? 253 GLU A N   1 
ATOM   1321  C  CA  . GLU A 1 169 ? 11.096 16.160  13.888  1.00 39.25 ? 253 GLU A CA  1 
ATOM   1322  C  C   . GLU A 1 169 ? 10.294 15.848  12.608  1.00 41.36 ? 253 GLU A C   1 
ATOM   1323  O  O   . GLU A 1 169 ? 9.352  15.055  12.642  1.00 39.89 ? 253 GLU A O   1 
ATOM   1324  C  CB  . GLU A 1 169 ? 10.799 17.538  14.465  1.00 37.87 ? 253 GLU A CB  1 
ATOM   1325  C  CG  . GLU A 1 169 ? 10.428 17.448  15.915  1.00 39.63 ? 253 GLU A CG  1 
ATOM   1326  C  CD  . GLU A 1 169 ? 10.799 18.660  16.818  1.00 43.39 ? 253 GLU A CD  1 
ATOM   1327  O  OE1 . GLU A 1 169 ? 10.995 19.805  16.353  1.00 42.72 ? 253 GLU A OE1 1 
ATOM   1328  O  OE2 . GLU A 1 169 ? 10.829 18.464  18.063  1.00 45.56 ? 253 GLU A OE2 1 
ATOM   1329  N  N   . GLU A 1 170 ? 10.759 16.387  11.469  1.00 44.00 ? 254 GLU A N   1 
ATOM   1330  C  CA  . GLU A 1 170 ? 10.186 16.060  10.169  1.00 46.52 ? 254 GLU A CA  1 
ATOM   1331  C  C   . GLU A 1 170 ? 10.309 14.576  9.945   1.00 45.60 ? 254 GLU A C   1 
ATOM   1332  O  O   . GLU A 1 170 ? 9.399  13.989  9.437   1.00 47.84 ? 254 GLU A O   1 
ATOM   1333  C  CB  . GLU A 1 170 ? 10.822 16.848  9.003   1.00 46.16 ? 254 GLU A CB  1 
ATOM   1334  C  CG  . GLU A 1 170 ? 10.284 18.333  8.751   1.00 51.20 ? 254 GLU A CG  1 
ATOM   1335  C  CD  . GLU A 1 170 ? 10.855 19.077  7.415   1.00 52.96 ? 254 GLU A CD  1 
ATOM   1336  O  OE1 . GLU A 1 170 ? 12.069 19.488  7.402   1.00 60.15 ? 254 GLU A OE1 1 
ATOM   1337  O  OE2 . GLU A 1 170 ? 10.085 19.275  6.400   1.00 56.62 ? 254 GLU A OE2 1 
ATOM   1338  N  N   . LEU A 1 171 ? 11.399 13.924  10.329  1.00 44.73 ? 255 LEU A N   1 
ATOM   1339  C  CA  . LEU A 1 171 ? 11.559 12.546  9.846   1.00 42.43 ? 255 LEU A CA  1 
ATOM   1340  C  C   . LEU A 1 171 ? 10.750 11.563  10.680  1.00 41.82 ? 255 LEU A C   1 
ATOM   1341  O  O   . LEU A 1 171 ? 10.409 10.502  10.192  1.00 40.97 ? 255 LEU A O   1 
ATOM   1342  C  CB  . LEU A 1 171 ? 13.037 12.100  9.817   1.00 41.52 ? 255 LEU A CB  1 
ATOM   1343  C  CG  . LEU A 1 171 ? 13.967 12.574  8.706   1.00 41.25 ? 255 LEU A CG  1 
ATOM   1344  C  CD1 . LEU A 1 171 ? 15.441 12.652  9.160   1.00 38.49 ? 255 LEU A CD1 1 
ATOM   1345  C  CD2 . LEU A 1 171 ? 13.855 11.775  7.441   1.00 38.66 ? 255 LEU A CD2 1 
ATOM   1346  N  N   . SER A 1 172 ? 10.507 11.899  11.949  1.00 41.57 ? 256 SER A N   1 
ATOM   1347  C  CA  . SER A 1 172 ? 10.101 10.912  12.980  1.00 41.54 ? 256 SER A CA  1 
ATOM   1348  C  C   . SER A 1 172 ? 8.874  10.081  12.685  1.00 41.78 ? 256 SER A C   1 
ATOM   1349  O  O   . SER A 1 172 ? 8.724  9.010   13.253  1.00 41.86 ? 256 SER A O   1 
ATOM   1350  C  CB  . SER A 1 172 ? 9.824  11.609  14.298  1.00 41.82 ? 256 SER A CB  1 
ATOM   1351  O  OG  . SER A 1 172 ? 8.794  12.576  14.138  1.00 42.67 ? 256 SER A OG  1 
ATOM   1352  N  N   . GLY A 1 173 ? 7.978  10.583  11.830  1.00 42.97 ? 257 GLY A N   1 
ATOM   1353  C  CA  . GLY A 1 173 ? 6.756  9.853   11.479  1.00 43.81 ? 257 GLY A CA  1 
ATOM   1354  C  C   . GLY A 1 173 ? 6.797  9.104   10.157  1.00 45.00 ? 257 GLY A C   1 
ATOM   1355  O  O   . GLY A 1 173 ? 5.822  8.528   9.759   1.00 46.43 ? 257 GLY A O   1 
ATOM   1356  N  N   . ALA A 1 174 ? 7.935  9.078   9.488   1.00 45.65 ? 258 ALA A N   1 
ATOM   1357  C  CA  . ALA A 1 174 ? 8.075  8.437   8.207   1.00 45.98 ? 258 ALA A CA  1 
ATOM   1358  C  C   . ALA A 1 174 ? 7.844  6.936   8.272   1.00 46.90 ? 258 ALA A C   1 
ATOM   1359  O  O   . ALA A 1 174 ? 8.267  6.250   9.231   1.00 47.19 ? 258 ALA A O   1 
ATOM   1360  C  CB  . ALA A 1 174 ? 9.464  8.717   7.653   1.00 45.71 ? 258 ALA A CB  1 
ATOM   1361  N  N   . GLU A 1 175 ? 7.190  6.416   7.232   1.00 47.48 ? 259 GLU A N   1 
ATOM   1362  C  CA  . GLU A 1 175 ? 7.128  4.958   7.059   1.00 48.13 ? 259 GLU A CA  1 
ATOM   1363  C  C   . GLU A 1 175 ? 8.283  4.360   6.236   1.00 45.91 ? 259 GLU A C   1 
ATOM   1364  O  O   . GLU A 1 175 ? 8.551  3.172   6.301   1.00 45.43 ? 259 GLU A O   1 
ATOM   1365  C  CB  . GLU A 1 175 ? 5.736  4.507   6.580   1.00 49.74 ? 259 GLU A CB  1 
ATOM   1366  C  CG  . GLU A 1 175 ? 4.614  4.738   7.671   1.00 55.73 ? 259 GLU A CG  1 
ATOM   1367  C  CD  . GLU A 1 175 ? 4.658  3.727   8.884   1.00 63.61 ? 259 GLU A CD  1 
ATOM   1368  O  OE1 . GLU A 1 175 ? 3.949  2.694   8.798   1.00 67.08 ? 259 GLU A OE1 1 
ATOM   1369  O  OE2 . GLU A 1 175 ? 5.359  3.951   9.917   1.00 64.40 ? 259 GLU A OE2 1 
ATOM   1370  N  N   . ASP A 1 176 ? 9.000  5.187   5.500   1.00 44.44 ? 260 ASP A N   1 
ATOM   1371  C  CA  . ASP A 1 176 ? 10.166 4.705   4.799   1.00 43.60 ? 260 ASP A CA  1 
ATOM   1372  C  C   . ASP A 1 176 ? 11.125 5.877   4.775   1.00 42.94 ? 260 ASP A C   1 
ATOM   1373  O  O   . ASP A 1 176 ? 10.830 6.948   4.194   1.00 43.04 ? 260 ASP A O   1 
ATOM   1374  C  CB  . ASP A 1 176 ? 9.760  4.171   3.422   1.00 43.68 ? 260 ASP A CB  1 
ATOM   1375  C  CG  . ASP A 1 176 ? 10.948 3.879   2.482   1.00 46.84 ? 260 ASP A CG  1 
ATOM   1376  O  OD1 . ASP A 1 176 ? 11.964 4.620   2.491   1.00 48.66 ? 260 ASP A OD1 1 
ATOM   1377  O  OD2 . ASP A 1 176 ? 10.835 2.916   1.669   1.00 50.88 ? 260 ASP A OD2 1 
ATOM   1378  N  N   . VAL A 1 177 ? 12.271 5.697   5.442   1.00 41.78 ? 261 VAL A N   1 
ATOM   1379  C  CA  . VAL A 1 177 ? 13.267 6.780   5.513   1.00 39.46 ? 261 VAL A CA  1 
ATOM   1380  C  C   . VAL A 1 177 ? 13.891 7.111   4.201   1.00 39.31 ? 261 VAL A C   1 
ATOM   1381  O  O   . VAL A 1 177 ? 14.349 8.239   4.014   1.00 39.89 ? 261 VAL A O   1 
ATOM   1382  C  CB  . VAL A 1 177 ? 14.376 6.561   6.561   1.00 39.28 ? 261 VAL A CB  1 
ATOM   1383  C  CG1 . VAL A 1 177 ? 13.748 6.413   7.973   1.00 37.69 ? 261 VAL A CG1 1 
ATOM   1384  C  CG2 . VAL A 1 177 ? 15.311 5.410   6.163   1.00 35.46 ? 261 VAL A CG2 1 
ATOM   1385  N  N   . TYR A 1 178 ? 13.912 6.169   3.274   1.00 39.02 ? 262 TYR A N   1 
ATOM   1386  C  CA  . TYR A 1 178 ? 14.524 6.482   1.992   1.00 39.68 ? 262 TYR A CA  1 
ATOM   1387  C  C   . TYR A 1 178 ? 13.716 7.515   1.206   1.00 41.19 ? 262 TYR A C   1 
ATOM   1388  O  O   . TYR A 1 178 ? 14.279 8.379   0.549   1.00 41.37 ? 262 TYR A O   1 
ATOM   1389  C  CB  . TYR A 1 178 ? 14.773 5.239   1.183   1.00 38.38 ? 262 TYR A CB  1 
ATOM   1390  C  CG  . TYR A 1 178 ? 15.603 4.236   1.900   1.00 36.62 ? 262 TYR A CG  1 
ATOM   1391  C  CD1 . TYR A 1 178 ? 15.175 2.928   2.042   1.00 36.68 ? 262 TYR A CD1 1 
ATOM   1392  C  CD2 . TYR A 1 178 ? 16.835 4.577   2.427   1.00 35.85 ? 262 TYR A CD2 1 
ATOM   1393  C  CE1 . TYR A 1 178 ? 15.958 1.975   2.729   1.00 35.07 ? 262 TYR A CE1 1 
ATOM   1394  C  CE2 . TYR A 1 178 ? 17.634 3.629   3.082   1.00 34.25 ? 262 TYR A CE2 1 
ATOM   1395  C  CZ  . TYR A 1 178 ? 17.178 2.345   3.226   1.00 34.84 ? 262 TYR A CZ  1 
ATOM   1396  O  OH  . TYR A 1 178 ? 17.960 1.430   3.874   1.00 38.99 ? 262 TYR A OH  1 
ATOM   1397  N  N   . THR A 1 179 ? 12.391 7.440   1.309   1.00 43.10 ? 263 THR A N   1 
ATOM   1398  C  CA  . THR A 1 179 ? 11.511 8.440   0.707   1.00 44.61 ? 263 THR A CA  1 
ATOM   1399  C  C   . THR A 1 179 ? 11.656 9.801   1.434   1.00 45.01 ? 263 THR A C   1 
ATOM   1400  O  O   . THR A 1 179 ? 12.009 10.805  0.812   1.00 45.19 ? 263 THR A O   1 
ATOM   1401  C  CB  . THR A 1 179 ? 10.070 7.941   0.767   1.00 45.17 ? 263 THR A CB  1 
ATOM   1402  O  OG1 . THR A 1 179 ? 9.996  6.636   0.183   1.00 47.65 ? 263 THR A OG1 1 
ATOM   1403  C  CG2 . THR A 1 179 ? 9.121  8.888   0.055   1.00 45.59 ? 263 THR A CG2 1 
ATOM   1404  N  N   . SER A 1 180 ? 11.395 9.814   2.744   1.00 45.28 ? 264 SER A N   1 
ATOM   1405  C  CA  . SER A 1 180 ? 11.579 10.994  3.579   1.00 46.12 ? 264 SER A CA  1 
ATOM   1406  C  C   . SER A 1 180 ? 12.903 11.708  3.429   1.00 46.54 ? 264 SER A C   1 
ATOM   1407  O  O   . SER A 1 180 ? 12.892 12.887  3.137   1.00 47.17 ? 264 SER A O   1 
ATOM   1408  C  CB  . SER A 1 180 ? 11.325 10.671  5.030   1.00 46.33 ? 264 SER A CB  1 
ATOM   1409  O  OG  . SER A 1 180 ? 9.948  10.321  5.175   1.00 50.62 ? 264 SER A OG  1 
ATOM   1410  N  N   . LEU A 1 181 ? 14.043 11.041  3.576   1.00 46.56 ? 265 LEU A N   1 
ATOM   1411  C  CA  . LEU A 1 181 ? 15.287 11.765  3.355   1.00 47.52 ? 265 LEU A CA  1 
ATOM   1412  C  C   . LEU A 1 181 ? 15.317 12.347  1.953   1.00 49.42 ? 265 LEU A C   1 
ATOM   1413  O  O   . LEU A 1 181 ? 15.958 13.361  1.724   1.00 50.43 ? 265 LEU A O   1 
ATOM   1414  C  CB  . LEU A 1 181 ? 16.535 10.885  3.556   1.00 47.22 ? 265 LEU A CB  1 
ATOM   1415  C  CG  . LEU A 1 181 ? 16.886 10.301  4.932   1.00 46.76 ? 265 LEU A CG  1 
ATOM   1416  C  CD1 . LEU A 1 181 ? 18.027 9.311   4.753   1.00 43.47 ? 265 LEU A CD1 1 
ATOM   1417  C  CD2 . LEU A 1 181 ? 17.251 11.391  5.995   1.00 44.65 ? 265 LEU A CD2 1 
ATOM   1418  N  N   . GLY A 1 182 ? 14.659 11.695  0.999   1.00 51.52 ? 266 GLY A N   1 
ATOM   1419  C  CA  . GLY A 1 182 ? 14.637 12.177  -0.378  1.00 54.93 ? 266 GLY A CA  1 
ATOM   1420  C  C   . GLY A 1 182 ? 13.871 13.494  -0.441  1.00 57.66 ? 266 GLY A C   1 
ATOM   1421  O  O   . GLY A 1 182 ? 14.353 14.464  -1.030  1.00 57.43 ? 266 GLY A O   1 
ATOM   1422  N  N   . GLN A 1 183 ? 12.694 13.544  0.200   1.00 59.61 ? 267 GLN A N   1 
ATOM   1423  C  CA  . GLN A 1 183 ? 11.932 14.785  0.205   1.00 62.21 ? 267 GLN A CA  1 
ATOM   1424  C  C   . GLN A 1 183 ? 12.550 15.857  1.089   1.00 63.50 ? 267 GLN A C   1 
ATOM   1425  O  O   . GLN A 1 183 ? 12.436 17.044  0.791   1.00 63.86 ? 267 GLN A O   1 
ATOM   1426  C  CB  . GLN A 1 183 ? 10.400 14.608  0.384   1.00 62.19 ? 267 GLN A CB  1 
ATOM   1427  C  CG  . GLN A 1 183 ? 9.939  13.423  1.220   1.00 64.32 ? 267 GLN A CG  1 
ATOM   1428  C  CD  . GLN A 1 183 ? 8.708  12.686  0.658   1.00 63.85 ? 267 GLN A CD  1 
ATOM   1429  O  OE1 . GLN A 1 183 ? 8.435  12.723  -0.544  1.00 63.81 ? 267 GLN A OE1 1 
ATOM   1430  N  NE2 . GLN A 1 183 ? 7.985  11.980  1.540   1.00 63.89 ? 267 GLN A NE2 1 
ATOM   1431  N  N   . LEU A 1 184 ? 13.269 15.467  2.129   1.00 65.44 ? 268 LEU A N   1 
ATOM   1432  C  CA  . LEU A 1 184 ? 13.986 16.492  2.862   1.00 67.28 ? 268 LEU A CA  1 
ATOM   1433  C  C   . LEU A 1 184 ? 15.015 17.108  1.961   1.00 68.25 ? 268 LEU A C   1 
ATOM   1434  O  O   . LEU A 1 184 ? 15.159 18.323  1.920   1.00 69.01 ? 268 LEU A O   1 
ATOM   1435  C  CB  . LEU A 1 184 ? 14.587 16.017  4.195   1.00 67.39 ? 268 LEU A CB  1 
ATOM   1436  C  CG  . LEU A 1 184 ? 13.712 16.532  5.364   1.00 68.65 ? 268 LEU A CG  1 
ATOM   1437  C  CD1 . LEU A 1 184 ? 12.377 15.728  5.545   1.00 70.48 ? 268 LEU A CD1 1 
ATOM   1438  C  CD2 . LEU A 1 184 ? 14.461 16.594  6.663   1.00 69.34 ? 268 LEU A CD2 1 
ATOM   1439  N  N   . ARG A 1 185 ? 15.707 16.299  1.192   1.00 68.96 ? 269 ARG A N   1 
ATOM   1440  C  CA  . ARG A 1 185 ? 16.769 16.896  0.405   1.00 70.15 ? 269 ARG A CA  1 
ATOM   1441  C  C   . ARG A 1 185 ? 16.185 17.620  -0.796  1.00 70.47 ? 269 ARG A C   1 
ATOM   1442  O  O   . ARG A 1 185 ? 16.925 18.292  -1.536  1.00 70.85 ? 269 ARG A O   1 
ATOM   1443  C  CB  . ARG A 1 185 ? 17.846 15.867  0.014   1.00 70.24 ? 269 ARG A CB  1 
ATOM   1444  C  CG  . ARG A 1 185 ? 18.904 15.738  1.087   1.00 70.66 ? 269 ARG A CG  1 
ATOM   1445  C  CD  . ARG A 1 185 ? 19.440 14.306  1.306   1.00 71.87 ? 269 ARG A CD  1 
ATOM   1446  N  NE  . ARG A 1 185 ? 20.065 14.243  2.630   1.00 70.88 ? 269 ARG A NE  1 
ATOM   1447  C  CZ  . ARG A 1 185 ? 20.364 13.134  3.305   1.00 70.26 ? 269 ARG A CZ  1 
ATOM   1448  N  NH1 . ARG A 1 185 ? 20.103 11.924  2.800   1.00 69.55 ? 269 ARG A NH1 1 
ATOM   1449  N  NH2 . ARG A 1 185 ? 20.923 13.251  4.508   1.00 68.40 ? 269 ARG A NH2 1 
ATOM   1450  N  N   . ALA A 1 186 ? 14.865 17.485  -0.980  1.00 70.47 ? 270 ALA A N   1 
ATOM   1451  C  CA  . ALA A 1 186 ? 14.167 18.092  -2.137  1.00 70.42 ? 270 ALA A CA  1 
ATOM   1452  C  C   . ALA A 1 186 ? 13.775 19.542  -1.845  1.00 69.93 ? 270 ALA A C   1 
ATOM   1453  O  O   . ALA A 1 186 ? 14.604 20.340  -1.408  1.00 69.39 ? 270 ALA A O   1 
ATOM   1454  C  CB  . ALA A 1 186 ? 12.930 17.260  -2.558  1.00 69.87 ? 270 ALA A CB  1 
ATOM   1455  N  N   . LEU B 1 6   ? 65.216 7.821   -40.373 1.00 51.77 ? 90  LEU B N   1 
ATOM   1456  C  CA  . LEU B 1 6   ? 64.367 9.087   -40.208 1.00 52.11 ? 90  LEU B CA  1 
ATOM   1457  C  C   . LEU B 1 6   ? 65.104 10.447  -40.422 1.00 52.86 ? 90  LEU B C   1 
ATOM   1458  O  O   . LEU B 1 6   ? 64.606 11.344  -41.105 1.00 52.71 ? 90  LEU B O   1 
ATOM   1459  C  CB  . LEU B 1 6   ? 63.627 9.065   -38.871 1.00 52.38 ? 90  LEU B CB  1 
ATOM   1460  C  CG  . LEU B 1 6   ? 62.198 9.643   -38.630 1.00 52.49 ? 90  LEU B CG  1 
ATOM   1461  C  CD1 . LEU B 1 6   ? 61.155 9.233   -39.638 1.00 52.64 ? 90  LEU B CD1 1 
ATOM   1462  C  CD2 . LEU B 1 6   ? 61.670 9.349   -37.232 1.00 50.57 ? 90  LEU B CD2 1 
ATOM   1463  N  N   . LEU B 1 7   ? 66.302 10.590  -39.862 1.00 53.43 ? 91  LEU B N   1 
ATOM   1464  C  CA  . LEU B 1 7   ? 67.215 11.649  -40.279 1.00 53.64 ? 91  LEU B CA  1 
ATOM   1465  C  C   . LEU B 1 7   ? 68.190 11.133  -41.354 1.00 54.99 ? 91  LEU B C   1 
ATOM   1466  O  O   . LEU B 1 7   ? 68.590 9.990   -41.283 1.00 54.54 ? 91  LEU B O   1 
ATOM   1467  C  CB  . LEU B 1 7   ? 68.037 12.109  -39.077 1.00 52.23 ? 91  LEU B CB  1 
ATOM   1468  C  CG  . LEU B 1 7   ? 67.342 12.893  -37.975 1.00 49.54 ? 91  LEU B CG  1 
ATOM   1469  C  CD1 . LEU B 1 7   ? 68.373 13.426  -37.050 1.00 45.45 ? 91  LEU B CD1 1 
ATOM   1470  C  CD2 . LEU B 1 7   ? 66.516 13.999  -38.509 1.00 44.80 ? 91  LEU B CD2 1 
ATOM   1471  N  N   . PRO B 1 8   ? 68.651 12.008  -42.276 1.00 57.13 ? 92  PRO B N   1 
ATOM   1472  C  CA  . PRO B 1 8   ? 69.708 11.687  -43.260 1.00 59.20 ? 92  PRO B CA  1 
ATOM   1473  C  C   . PRO B 1 8   ? 70.976 11.213  -42.569 1.00 61.14 ? 92  PRO B C   1 
ATOM   1474  O  O   . PRO B 1 8   ? 70.969 11.021  -41.354 1.00 62.01 ? 92  PRO B O   1 
ATOM   1475  C  CB  . PRO B 1 8   ? 69.983 13.037  -43.942 1.00 59.03 ? 92  PRO B CB  1 
ATOM   1476  C  CG  . PRO B 1 8   ? 69.467 14.077  -42.949 1.00 59.08 ? 92  PRO B CG  1 
ATOM   1477  C  CD  . PRO B 1 8   ? 68.231 13.418  -42.399 1.00 57.49 ? 92  PRO B CD  1 
ATOM   1478  N  N   . GLU B 1 9   ? 72.046 10.985  -43.328 1.00 63.28 ? 93  GLU B N   1 
ATOM   1479  C  CA  . GLU B 1 9   ? 73.336 10.572  -42.745 1.00 65.00 ? 93  GLU B CA  1 
ATOM   1480  C  C   . GLU B 1 9   ? 73.878 11.788  -42.041 1.00 63.92 ? 93  GLU B C   1 
ATOM   1481  O  O   . GLU B 1 9   ? 73.740 12.906  -42.534 1.00 63.14 ? 93  GLU B O   1 
ATOM   1482  C  CB  . GLU B 1 9   ? 74.356 10.159  -43.830 1.00 65.30 ? 93  GLU B CB  1 
ATOM   1483  C  CG  . GLU B 1 9   ? 74.208 8.736   -44.439 1.00 68.27 ? 93  GLU B CG  1 
ATOM   1484  C  CD  . GLU B 1 9   ? 75.448 8.276   -45.291 1.00 68.68 ? 93  GLU B CD  1 
ATOM   1485  O  OE1 . GLU B 1 9   ? 76.410 9.076   -45.520 1.00 70.88 ? 93  GLU B OE1 1 
ATOM   1486  O  OE2 . GLU B 1 9   ? 75.445 7.091   -45.729 1.00 71.94 ? 93  GLU B OE2 1 
ATOM   1487  N  N   . VAL B 1 10  ? 74.507 11.588  -40.897 1.00 63.78 ? 94  VAL B N   1 
ATOM   1488  C  CA  . VAL B 1 10  ? 75.218 12.701  -40.299 1.00 64.05 ? 94  VAL B CA  1 
ATOM   1489  C  C   . VAL B 1 10  ? 76.167 13.314  -41.349 1.00 63.96 ? 94  VAL B C   1 
ATOM   1490  O  O   . VAL B 1 10  ? 76.880 12.602  -42.061 1.00 63.56 ? 94  VAL B O   1 
ATOM   1491  C  CB  . VAL B 1 10  ? 75.967 12.226  -39.079 1.00 64.39 ? 94  VAL B CB  1 
ATOM   1492  C  CG1 . VAL B 1 10  ? 76.956 11.096  -39.477 1.00 66.44 ? 94  VAL B CG1 1 
ATOM   1493  C  CG2 . VAL B 1 10  ? 76.661 13.386  -38.340 1.00 64.60 ? 94  VAL B CG2 1 
ATOM   1494  N  N   . THR B 1 11  ? 76.143 14.635  -41.483 1.00 63.99 ? 95  THR B N   1 
ATOM   1495  C  CA  . THR B 1 11  ? 77.067 15.293  -42.408 1.00 63.64 ? 95  THR B CA  1 
ATOM   1496  C  C   . THR B 1 11  ? 78.474 15.275  -41.844 1.00 64.18 ? 95  THR B C   1 
ATOM   1497  O  O   . THR B 1 11  ? 78.697 14.906  -40.690 1.00 63.98 ? 95  THR B O   1 
ATOM   1498  C  CB  . THR B 1 11  ? 76.718 16.759  -42.688 1.00 63.16 ? 95  THR B CB  1 
ATOM   1499  O  OG1 . THR B 1 11  ? 76.979 17.545  -41.515 1.00 62.51 ? 95  THR B OG1 1 
ATOM   1500  C  CG2 . THR B 1 11  ? 75.289 16.902  -43.140 1.00 62.02 ? 95  THR B CG2 1 
ATOM   1501  N  N   . GLU B 1 12  ? 79.426 15.695  -42.668 1.00 65.03 ? 96  GLU B N   1 
ATOM   1502  C  CA  . GLU B 1 12  ? 80.816 15.700  -42.244 1.00 65.69 ? 96  GLU B CA  1 
ATOM   1503  C  C   . GLU B 1 12  ? 81.045 16.691  -41.107 1.00 64.13 ? 96  GLU B C   1 
ATOM   1504  O  O   . GLU B 1 12  ? 81.679 16.316  -40.117 1.00 63.56 ? 96  GLU B O   1 
ATOM   1505  C  CB  . GLU B 1 12  ? 81.782 15.872  -43.445 1.00 67.18 ? 96  GLU B CB  1 
ATOM   1506  C  CG  . GLU B 1 12  ? 81.367 14.963  -44.684 1.00 72.08 ? 96  GLU B CG  1 
ATOM   1507  C  CD  . GLU B 1 12  ? 82.521 14.072  -45.249 1.00 77.21 ? 96  GLU B CD  1 
ATOM   1508  O  OE1 . GLU B 1 12  ? 83.499 13.757  -44.506 1.00 77.28 ? 96  GLU B OE1 1 
ATOM   1509  O  OE2 . GLU B 1 12  ? 82.420 13.677  -46.446 1.00 77.92 ? 96  GLU B OE2 1 
ATOM   1510  N  N   . GLU B 1 13  ? 80.485 17.906  -41.208 1.00 62.63 ? 97  GLU B N   1 
ATOM   1511  C  CA  . GLU B 1 13  ? 80.612 18.863  -40.101 1.00 62.23 ? 97  GLU B CA  1 
ATOM   1512  C  C   . GLU B 1 13  ? 80.168 18.326  -38.761 1.00 61.39 ? 97  GLU B C   1 
ATOM   1513  O  O   . GLU B 1 13  ? 80.864 18.541  -37.756 1.00 62.00 ? 97  GLU B O   1 
ATOM   1514  C  CB  . GLU B 1 13  ? 79.955 20.243  -40.323 1.00 62.56 ? 97  GLU B CB  1 
ATOM   1515  C  CG  . GLU B 1 13  ? 79.015 20.433  -41.505 1.00 64.64 ? 97  GLU B CG  1 
ATOM   1516  C  CD  . GLU B 1 13  ? 77.851 21.401  -41.182 1.00 67.00 ? 97  GLU B CD  1 
ATOM   1517  O  OE1 . GLU B 1 13  ? 78.116 22.590  -40.800 1.00 62.55 ? 97  GLU B OE1 1 
ATOM   1518  O  OE2 . GLU B 1 13  ? 76.671 20.926  -41.313 1.00 67.17 ? 97  GLU B OE2 1 
ATOM   1519  N  N   . ASP B 1 14  ? 79.043 17.605  -38.748 1.00 60.10 ? 98  ASP B N   1 
ATOM   1520  C  CA  . ASP B 1 14  ? 78.403 17.188  -37.498 1.00 58.93 ? 98  ASP B CA  1 
ATOM   1521  C  C   . ASP B 1 14  ? 78.955 15.877  -36.910 1.00 59.29 ? 98  ASP B C   1 
ATOM   1522  O  O   . ASP B 1 14  ? 78.577 15.483  -35.791 1.00 58.90 ? 98  ASP B O   1 
ATOM   1523  C  CB  . ASP B 1 14  ? 76.862 17.137  -37.653 1.00 58.24 ? 98  ASP B CB  1 
ATOM   1524  C  CG  . ASP B 1 14  ? 76.244 18.505  -38.028 1.00 57.05 ? 98  ASP B CG  1 
ATOM   1525  O  OD1 . ASP B 1 14  ? 76.675 19.542  -37.458 1.00 53.48 ? 98  ASP B OD1 1 
ATOM   1526  O  OD2 . ASP B 1 14  ? 75.316 18.540  -38.890 1.00 53.63 ? 98  ASP B OD2 1 
ATOM   1527  N  N   . GLN B 1 15  ? 79.877 15.228  -37.629 1.00 59.37 ? 99  GLN B N   1 
ATOM   1528  C  CA  . GLN B 1 15  ? 80.269 13.857  -37.311 1.00 59.67 ? 99  GLN B CA  1 
ATOM   1529  C  C   . GLN B 1 15  ? 80.386 13.536  -35.842 1.00 57.43 ? 99  GLN B C   1 
ATOM   1530  O  O   . GLN B 1 15  ? 79.735 12.608  -35.367 1.00 58.84 ? 99  GLN B O   1 
ATOM   1531  C  CB  . GLN B 1 15  ? 81.505 13.378  -38.078 1.00 60.66 ? 99  GLN B CB  1 
ATOM   1532  C  CG  . GLN B 1 15  ? 81.222 12.244  -39.104 1.00 63.11 ? 99  GLN B CG  1 
ATOM   1533  C  CD  . GLN B 1 15  ? 82.178 12.288  -40.355 1.00 63.57 ? 99  GLN B CD  1 
ATOM   1534  O  OE1 . GLN B 1 15  ? 83.434 12.344  -40.221 1.00 64.32 ? 99  GLN B OE1 1 
ATOM   1535  N  NE2 . GLN B 1 15  ? 81.570 12.257  -41.570 1.00 64.29 ? 99  GLN B NE2 1 
ATOM   1536  N  N   . GLY B 1 16  ? 81.152 14.262  -35.062 1.00 54.69 ? 100 GLY B N   1 
ATOM   1537  C  CA  . GLY B 1 16  ? 81.196 13.778  -33.654 1.00 51.73 ? 100 GLY B CA  1 
ATOM   1538  C  C   . GLY B 1 16  ? 80.188 14.364  -32.657 1.00 48.59 ? 100 GLY B C   1 
ATOM   1539  O  O   . GLY B 1 16  ? 80.358 14.247  -31.450 1.00 48.23 ? 100 GLY B O   1 
ATOM   1540  N  N   . ARG B 1 17  ? 79.158 15.022  -33.166 1.00 45.91 ? 101 ARG B N   1 
ATOM   1541  C  CA  . ARG B 1 17  ? 78.376 15.950  -32.352 1.00 43.40 ? 101 ARG B CA  1 
ATOM   1542  C  C   . ARG B 1 17  ? 77.181 15.210  -31.727 1.00 40.87 ? 101 ARG B C   1 
ATOM   1543  O  O   . ARG B 1 17  ? 76.649 14.273  -32.321 1.00 39.63 ? 101 ARG B O   1 
ATOM   1544  C  CB  . ARG B 1 17  ? 77.907 17.134  -33.227 1.00 43.63 ? 101 ARG B CB  1 
ATOM   1545  C  CG  . ARG B 1 17  ? 78.914 18.249  -33.421 1.00 43.80 ? 101 ARG B CG  1 
ATOM   1546  C  CD  . ARG B 1 17  ? 78.543 19.078  -34.632 1.00 49.66 ? 101 ARG B CD  1 
ATOM   1547  N  NE  . ARG B 1 17  ? 79.394 20.253  -34.907 1.00 50.80 ? 101 ARG B NE  1 
ATOM   1548  C  CZ  . ARG B 1 17  ? 78.913 21.383  -35.441 1.00 51.36 ? 101 ARG B CZ  1 
ATOM   1549  N  NH1 . ARG B 1 17  ? 77.618 21.491  -35.708 1.00 51.56 ? 101 ARG B NH1 1 
ATOM   1550  N  NH2 . ARG B 1 17  ? 79.691 22.427  -35.682 1.00 50.72 ? 101 ARG B NH2 1 
ATOM   1551  N  N   . ILE B 1 18  ? 76.791 15.606  -30.522 1.00 37.98 ? 102 ILE B N   1 
ATOM   1552  C  CA  . ILE B 1 18  ? 75.505 15.166  -29.960 1.00 35.96 ? 102 ILE B CA  1 
ATOM   1553  C  C   . ILE B 1 18  ? 74.324 15.617  -30.837 1.00 34.92 ? 102 ILE B C   1 
ATOM   1554  O  O   . ILE B 1 18  ? 74.365 16.651  -31.462 1.00 34.69 ? 102 ILE B O   1 
ATOM   1555  C  CB  . ILE B 1 18  ? 75.398 15.613  -28.505 1.00 35.49 ? 102 ILE B CB  1 
ATOM   1556  C  CG1 . ILE B 1 18  ? 76.305 14.737  -27.678 1.00 33.75 ? 102 ILE B CG1 1 
ATOM   1557  C  CG2 . ILE B 1 18  ? 74.001 15.459  -27.954 1.00 35.44 ? 102 ILE B CG2 1 
ATOM   1558  C  CD1 . ILE B 1 18  ? 76.829 15.334  -26.523 1.00 33.59 ? 102 ILE B CD1 1 
ATOM   1559  N  N   . CYS B 1 19  ? 73.315 14.781  -31.000 1.00 35.64 ? 103 CYS B N   1 
ATOM   1560  C  CA  . CYS B 1 19  ? 72.128 15.208  -31.794 1.00 35.51 ? 103 CYS B CA  1 
ATOM   1561  C  C   . CYS B 1 19  ? 71.096 15.830  -30.858 1.00 34.75 ? 103 CYS B C   1 
ATOM   1562  O  O   . CYS B 1 19  ? 70.744 15.187  -29.828 1.00 34.53 ? 103 CYS B O   1 
ATOM   1563  C  CB  . CYS B 1 19  ? 71.464 14.044  -32.516 1.00 35.15 ? 103 CYS B CB  1 
ATOM   1564  S  SG  . CYS B 1 19  ? 70.000 14.619  -33.401 1.00 38.33 ? 103 CYS B SG  1 
ATOM   1565  N  N   . VAL B 1 20  ? 70.651 17.061  -31.154 1.00 33.02 ? 104 VAL B N   1 
ATOM   1566  C  CA  . VAL B 1 20  ? 69.670 17.716  -30.269 1.00 32.84 ? 104 VAL B CA  1 
ATOM   1567  C  C   . VAL B 1 20  ? 68.350 17.992  -30.946 1.00 33.11 ? 104 VAL B C   1 
ATOM   1568  O  O   . VAL B 1 20  ? 68.278 18.791  -31.851 1.00 34.31 ? 104 VAL B O   1 
ATOM   1569  C  CB  . VAL B 1 20  ? 70.163 18.986  -29.687 1.00 31.98 ? 104 VAL B CB  1 
ATOM   1570  C  CG1 . VAL B 1 20  ? 69.103 19.563  -28.792 1.00 32.95 ? 104 VAL B CG1 1 
ATOM   1571  C  CG2 . VAL B 1 20  ? 71.369 18.707  -28.876 1.00 32.83 ? 104 VAL B CG2 1 
ATOM   1572  N  N   . VAL B 1 21  ? 67.297 17.329  -30.501 1.00 32.62 ? 105 VAL B N   1 
ATOM   1573  C  CA  . VAL B 1 21  ? 65.984 17.517  -31.112 1.00 31.35 ? 105 VAL B CA  1 
ATOM   1574  C  C   . VAL B 1 21  ? 65.242 18.693  -30.441 1.00 29.77 ? 105 VAL B C   1 
ATOM   1575  O  O   . VAL B 1 21  ? 65.058 18.689  -29.209 1.00 28.74 ? 105 VAL B O   1 
ATOM   1576  C  CB  . VAL B 1 21  ? 65.197 16.193  -30.993 1.00 31.74 ? 105 VAL B CB  1 
ATOM   1577  C  CG1 . VAL B 1 21  ? 63.710 16.434  -31.219 1.00 32.77 ? 105 VAL B CG1 1 
ATOM   1578  C  CG2 . VAL B 1 21  ? 65.762 15.198  -31.968 1.00 30.98 ? 105 VAL B CG2 1 
ATOM   1579  N  N   . ILE B 1 22  ? 64.815 19.684  -31.208 1.00 27.94 ? 106 ILE B N   1 
ATOM   1580  C  CA  . ILE B 1 22  ? 64.268 20.869  -30.571 1.00 28.66 ? 106 ILE B CA  1 
ATOM   1581  C  C   . ILE B 1 22  ? 62.841 21.097  -30.963 1.00 29.30 ? 106 ILE B C   1 
ATOM   1582  O  O   . ILE B 1 22  ? 62.522 21.003  -32.119 1.00 31.09 ? 106 ILE B O   1 
ATOM   1583  C  CB  . ILE B 1 22  ? 65.183 22.143  -30.824 1.00 29.06 ? 106 ILE B CB  1 
ATOM   1584  C  CG1 . ILE B 1 22  ? 66.603 21.862  -30.347 1.00 27.48 ? 106 ILE B CG1 1 
ATOM   1585  C  CG2 . ILE B 1 22  ? 64.640 23.395  -30.064 1.00 28.64 ? 106 ILE B CG2 1 
ATOM   1586  C  CD1 . ILE B 1 22  ? 67.654 22.935  -30.673 1.00 29.17 ? 106 ILE B CD1 1 
ATOM   1587  N  N   . ASP B 1 23  ? 61.941 21.349  -30.027 1.00 30.30 ? 107 ASP B N   1 
ATOM   1588  C  CA  . ASP B 1 23  ? 60.550 21.608  -30.433 1.00 31.19 ? 107 ASP B CA  1 
ATOM   1589  C  C   . ASP B 1 23  ? 60.341 23.092  -30.792 1.00 31.21 ? 107 ASP B C   1 
ATOM   1590  O  O   . ASP B 1 23  ? 61.163 23.908  -30.465 1.00 31.76 ? 107 ASP B O   1 
ATOM   1591  C  CB  . ASP B 1 23  ? 59.574 21.121  -29.328 1.00 32.63 ? 107 ASP B CB  1 
ATOM   1592  C  CG  . ASP B 1 23  ? 58.077 21.371  -29.669 1.00 35.91 ? 107 ASP B CG  1 
ATOM   1593  O  OD1 . ASP B 1 23  ? 57.631 21.090  -30.826 1.00 37.47 ? 107 ASP B OD1 1 
ATOM   1594  O  OD2 . ASP B 1 23  ? 57.362 21.855  -28.763 1.00 38.82 ? 107 ASP B OD2 1 
ATOM   1595  N  N   . LEU B 1 24  ? 59.224 23.437  -31.427 1.00 30.85 ? 108 LEU B N   1 
ATOM   1596  C  CA  . LEU B 1 24  ? 58.858 24.816  -31.760 1.00 29.66 ? 108 LEU B CA  1 
ATOM   1597  C  C   . LEU B 1 24  ? 57.881 25.554  -30.821 1.00 29.51 ? 108 LEU B C   1 
ATOM   1598  O  O   . LEU B 1 24  ? 58.285 26.390  -30.047 1.00 30.24 ? 108 LEU B O   1 
ATOM   1599  C  CB  . LEU B 1 24  ? 58.234 24.774  -33.131 1.00 30.13 ? 108 LEU B CB  1 
ATOM   1600  C  CG  . LEU B 1 24  ? 58.117 26.046  -33.959 1.00 33.80 ? 108 LEU B CG  1 
ATOM   1601  C  CD1 . LEU B 1 24  ? 59.529 26.713  -34.175 1.00 32.04 ? 108 LEU B CD1 1 
ATOM   1602  C  CD2 . LEU B 1 24  ? 57.441 25.645  -35.290 1.00 32.20 ? 108 LEU B CD2 1 
ATOM   1603  N  N   . ASP B 1 25  ? 56.586 25.276  -30.882 1.00 30.02 ? 109 ASP B N   1 
ATOM   1604  C  CA  . ASP B 1 25  ? 55.642 26.054  -30.129 1.00 31.02 ? 109 ASP B CA  1 
ATOM   1605  C  C   . ASP B 1 25  ? 55.912 25.961  -28.673 1.00 30.59 ? 109 ASP B C   1 
ATOM   1606  O  O   . ASP B 1 25  ? 56.046 24.872  -28.101 1.00 30.39 ? 109 ASP B O   1 
ATOM   1607  C  CB  . ASP B 1 25  ? 54.181 25.713  -30.433 1.00 32.43 ? 109 ASP B CB  1 
ATOM   1608  C  CG  . ASP B 1 25  ? 53.800 25.985  -31.889 1.00 38.34 ? 109 ASP B CG  1 
ATOM   1609  O  OD1 . ASP B 1 25  ? 53.852 27.163  -32.423 1.00 35.98 ? 109 ASP B OD1 1 
ATOM   1610  O  OD2 . ASP B 1 25  ? 53.426 24.958  -32.491 1.00 48.78 ? 109 ASP B OD2 1 
ATOM   1611  N  N   . GLU B 1 26  ? 56.014 27.134  -28.089 1.00 30.01 ? 110 GLU B N   1 
ATOM   1612  C  CA  . GLU B 1 26  ? 56.214 27.295  -26.678 1.00 30.34 ? 110 GLU B CA  1 
ATOM   1613  C  C   . GLU B 1 26  ? 57.629 26.899  -26.149 1.00 30.68 ? 110 GLU B C   1 
ATOM   1614  O  O   . GLU B 1 26  ? 57.925 27.019  -24.953 1.00 30.56 ? 110 GLU B O   1 
ATOM   1615  C  CB  . GLU B 1 26  ? 55.058 26.628  -25.942 1.00 30.97 ? 110 GLU B CB  1 
ATOM   1616  C  CG  . GLU B 1 26  ? 53.741 27.425  -26.032 1.00 30.98 ? 110 GLU B CG  1 
ATOM   1617  C  CD  . GLU B 1 26  ? 52.919 27.095  -27.282 1.00 36.55 ? 110 GLU B CD  1 
ATOM   1618  O  OE1 . GLU B 1 26  ? 52.660 25.857  -27.571 1.00 33.46 ? 110 GLU B OE1 1 
ATOM   1619  O  OE2 . GLU B 1 26  ? 52.504 28.107  -27.953 1.00 36.67 ? 110 GLU B OE2 1 
ATOM   1620  N  N   . THR B 1 27  ? 58.509 26.460  -27.039 1.00 30.44 ? 111 THR B N   1 
ATOM   1621  C  CA  . THR B 1 27  ? 59.908 26.252  -26.683 1.00 30.59 ? 111 THR B CA  1 
ATOM   1622  C  C   . THR B 1 27  ? 60.717 27.416  -27.293 1.00 31.29 ? 111 THR B C   1 
ATOM   1623  O  O   . THR B 1 27  ? 61.431 28.092  -26.576 1.00 31.79 ? 111 THR B O   1 
ATOM   1624  C  CB  . THR B 1 27  ? 60.372 24.906  -27.224 1.00 31.40 ? 111 THR B CB  1 
ATOM   1625  O  OG1 . THR B 1 27  ? 59.445 23.922  -26.770 1.00 30.86 ? 111 THR B OG1 1 
ATOM   1626  C  CG2 . THR B 1 27  ? 61.803 24.532  -26.806 1.00 27.14 ? 111 THR B CG2 1 
ATOM   1627  N  N   . LEU B 1 28  ? 60.566 27.658  -28.602 1.00 30.54 ? 112 LEU B N   1 
ATOM   1628  C  CA  . LEU B 1 28  ? 61.307 28.705  -29.331 1.00 29.15 ? 112 LEU B CA  1 
ATOM   1629  C  C   . LEU B 1 28  ? 60.419 29.888  -29.682 1.00 31.12 ? 112 LEU B C   1 
ATOM   1630  O  O   . LEU B 1 28  ? 60.896 31.002  -29.741 1.00 32.05 ? 112 LEU B O   1 
ATOM   1631  C  CB  . LEU B 1 28  ? 61.889 28.140  -30.630 1.00 28.48 ? 112 LEU B CB  1 
ATOM   1632  C  CG  . LEU B 1 28  ? 62.928 26.991  -30.542 1.00 24.13 ? 112 LEU B CG  1 
ATOM   1633  C  CD1 . LEU B 1 28  ? 63.503 26.669  -31.873 1.00 21.41 ? 112 LEU B CD1 1 
ATOM   1634  C  CD2 . LEU B 1 28  ? 64.011 27.276  -29.525 1.00 16.00 ? 112 LEU B CD2 1 
ATOM   1635  N  N   . VAL B 1 29  ? 59.111 29.672  -29.897 1.00 31.36 ? 113 VAL B N   1 
ATOM   1636  C  CA  . VAL B 1 29  ? 58.249 30.748  -30.321 1.00 29.57 ? 113 VAL B CA  1 
ATOM   1637  C  C   . VAL B 1 29  ? 56.883 30.526  -29.741 1.00 30.70 ? 113 VAL B C   1 
ATOM   1638  O  O   . VAL B 1 29  ? 56.608 29.499  -29.172 1.00 31.52 ? 113 VAL B O   1 
ATOM   1639  C  CB  . VAL B 1 29  ? 58.168 30.839  -31.892 1.00 29.37 ? 113 VAL B CB  1 
ATOM   1640  C  CG1 . VAL B 1 29  ? 59.516 30.897  -32.481 1.00 25.16 ? 113 VAL B CG1 1 
ATOM   1641  C  CG2 . VAL B 1 29  ? 57.417 29.658  -32.505 1.00 29.04 ? 113 VAL B CG2 1 
ATOM   1642  N  N   . HIS B 1 30  ? 55.998 31.490  -29.893 1.00 30.87 ? 114 HIS B N   1 
ATOM   1643  C  CA  . HIS B 1 30  ? 54.630 31.269  -29.534 1.00 30.44 ? 114 HIS B CA  1 
ATOM   1644  C  C   . HIS B 1 30  ? 53.713 31.989  -30.515 1.00 31.41 ? 114 HIS B C   1 
ATOM   1645  O  O   . HIS B 1 30  ? 53.771 33.187  -30.585 1.00 30.79 ? 114 HIS B O   1 
ATOM   1646  C  CB  . HIS B 1 30  ? 54.380 31.764  -28.130 1.00 29.59 ? 114 HIS B CB  1 
ATOM   1647  C  CG  . HIS B 1 30  ? 52.940 31.793  -27.774 1.00 29.46 ? 114 HIS B CG  1 
ATOM   1648  N  ND1 . HIS B 1 30  ? 52.215 30.648  -27.506 1.00 29.25 ? 114 HIS B ND1 1 
ATOM   1649  C  CD2 . HIS B 1 30  ? 52.071 32.820  -27.692 1.00 27.36 ? 114 HIS B CD2 1 
ATOM   1650  C  CE1 . HIS B 1 30  ? 50.973 30.983  -27.213 1.00 22.31 ? 114 HIS B CE1 1 
ATOM   1651  N  NE2 . HIS B 1 30  ? 50.858 32.287  -27.338 1.00 25.27 ? 114 HIS B NE2 1 
ATOM   1652  N  N   . SER B 1 31  ? 52.853 31.247  -31.232 1.00 32.41 ? 115 SER B N   1 
ATOM   1653  C  CA  . SER B 1 31  ? 52.023 31.784  -32.305 1.00 33.60 ? 115 SER B CA  1 
ATOM   1654  C  C   . SER B 1 31  ? 50.606 32.053  -31.877 1.00 34.19 ? 115 SER B C   1 
ATOM   1655  O  O   . SER B 1 31  ? 50.202 31.541  -30.874 1.00 35.53 ? 115 SER B O   1 
ATOM   1656  C  CB  . SER B 1 31  ? 52.004 30.783  -33.389 1.00 34.34 ? 115 SER B CB  1 
ATOM   1657  O  OG  . SER B 1 31  ? 53.352 30.497  -33.723 1.00 39.03 ? 115 SER B OG  1 
ATOM   1658  N  N   . SER B 1 32  ? 49.851 32.890  -32.591 1.00 34.69 ? 116 SER B N   1 
ATOM   1659  C  CA  . SER B 1 32  ? 48.493 33.246  -32.180 1.00 34.22 ? 116 SER B CA  1 
ATOM   1660  C  C   . SER B 1 32  ? 47.672 33.677  -33.386 1.00 35.88 ? 116 SER B C   1 
ATOM   1661  O  O   . SER B 1 32  ? 48.240 34.108  -34.390 1.00 36.24 ? 116 SER B O   1 
ATOM   1662  C  CB  . SER B 1 32  ? 48.538 34.370  -31.165 1.00 33.55 ? 116 SER B CB  1 
ATOM   1663  O  OG  . SER B 1 32  ? 47.221 34.762  -30.769 1.00 31.72 ? 116 SER B OG  1 
ATOM   1664  N  N   . PHE B 1 33  ? 46.349 33.535  -33.332 1.00 36.73 ? 117 PHE B N   1 
ATOM   1665  C  CA  . PHE B 1 33  ? 45.511 34.086  -34.423 1.00 37.44 ? 117 PHE B CA  1 
ATOM   1666  C  C   . PHE B 1 33  ? 45.015 35.521  -34.122 1.00 38.13 ? 117 PHE B C   1 
ATOM   1667  O  O   . PHE B 1 33  ? 44.641 36.206  -35.020 1.00 38.21 ? 117 PHE B O   1 
ATOM   1668  C  CB  . PHE B 1 33  ? 44.342 33.172  -34.802 1.00 37.00 ? 117 PHE B CB  1 
ATOM   1669  C  CG  . PHE B 1 33  ? 44.756 31.820  -35.350 1.00 37.41 ? 117 PHE B CG  1 
ATOM   1670  C  CD1 . PHE B 1 33  ? 44.606 30.655  -34.578 1.00 34.96 ? 117 PHE B CD1 1 
ATOM   1671  C  CD2 . PHE B 1 33  ? 45.265 31.698  -36.636 1.00 34.47 ? 117 PHE B CD2 1 
ATOM   1672  C  CE1 . PHE B 1 33  ? 44.981 29.399  -35.110 1.00 36.66 ? 117 PHE B CE1 1 
ATOM   1673  C  CE2 . PHE B 1 33  ? 45.643 30.434  -37.170 1.00 35.26 ? 117 PHE B CE2 1 
ATOM   1674  C  CZ  . PHE B 1 33  ? 45.509 29.288  -36.402 1.00 34.40 ? 117 PHE B CZ  1 
ATOM   1675  N  N   . LYS B 1 34  ? 45.050 35.978  -32.874 1.00 39.91 ? 118 LYS B N   1 
ATOM   1676  C  CA  . LYS B 1 34  ? 44.810 37.384  -32.569 1.00 42.32 ? 118 LYS B CA  1 
ATOM   1677  C  C   . LYS B 1 34  ? 45.951 38.275  -33.136 1.00 44.69 ? 118 LYS B C   1 
ATOM   1678  O  O   . LYS B 1 34  ? 47.108 38.072  -32.852 1.00 43.98 ? 118 LYS B O   1 
ATOM   1679  C  CB  . LYS B 1 34  ? 44.676 37.558  -31.056 1.00 42.05 ? 118 LYS B CB  1 
ATOM   1680  C  CG  . LYS B 1 34  ? 44.910 38.943  -30.558 1.00 42.88 ? 118 LYS B CG  1 
ATOM   1681  C  CD  . LYS B 1 34  ? 43.875 39.359  -29.479 1.00 50.02 ? 118 LYS B CD  1 
ATOM   1682  C  CE  . LYS B 1 34  ? 44.271 40.680  -28.740 1.00 49.84 ? 118 LYS B CE  1 
ATOM   1683  N  NZ  . LYS B 1 34  ? 45.628 40.569  -28.045 1.00 53.80 ? 118 LYS B NZ  1 
ATOM   1684  N  N   . PRO B 1 35  ? 45.629 39.246  -33.979 1.00 47.33 ? 119 PRO B N   1 
ATOM   1685  C  CA  . PRO B 1 35  ? 46.693 40.175  -34.370 1.00 48.95 ? 119 PRO B CA  1 
ATOM   1686  C  C   . PRO B 1 35  ? 47.186 40.955  -33.193 1.00 50.63 ? 119 PRO B C   1 
ATOM   1687  O  O   . PRO B 1 35  ? 46.372 41.537  -32.467 1.00 52.66 ? 119 PRO B O   1 
ATOM   1688  C  CB  . PRO B 1 35  ? 45.973 41.128  -35.317 1.00 49.17 ? 119 PRO B CB  1 
ATOM   1689  C  CG  . PRO B 1 35  ? 44.817 40.300  -35.859 1.00 48.25 ? 119 PRO B CG  1 
ATOM   1690  C  CD  . PRO B 1 35  ? 44.360 39.524  -34.680 1.00 47.52 ? 119 PRO B CD  1 
ATOM   1691  N  N   . ILE B 1 36  ? 48.496 40.968  -32.978 1.00 52.13 ? 120 ILE B N   1 
ATOM   1692  C  CA  . ILE B 1 36  ? 49.102 41.746  -31.874 1.00 52.73 ? 120 ILE B CA  1 
ATOM   1693  C  C   . ILE B 1 36  ? 49.812 42.959  -32.436 1.00 53.70 ? 120 ILE B C   1 
ATOM   1694  O  O   . ILE B 1 36  ? 50.533 42.811  -33.433 1.00 54.93 ? 120 ILE B O   1 
ATOM   1695  C  CB  . ILE B 1 36  ? 50.159 40.942  -31.094 1.00 53.23 ? 120 ILE B CB  1 
ATOM   1696  C  CG1 . ILE B 1 36  ? 50.822 39.883  -31.981 1.00 51.23 ? 120 ILE B CG1 1 
ATOM   1697  C  CG2 . ILE B 1 36  ? 49.561 40.356  -29.795 1.00 54.17 ? 120 ILE B CG2 1 
ATOM   1698  C  CD1 . ILE B 1 36  ? 51.696 38.982  -31.220 1.00 50.27 ? 120 ILE B CD1 1 
ATOM   1699  N  N   . ALA B 1 39  ? 54.824 41.604  -32.832 1.00 40.99 ? 123 ALA B N   1 
ATOM   1700  C  CA  . ALA B 1 39  ? 54.835 40.283  -33.507 1.00 40.70 ? 123 ALA B CA  1 
ATOM   1701  C  C   . ALA B 1 39  ? 56.103 40.345  -34.257 1.00 40.81 ? 123 ALA B C   1 
ATOM   1702  O  O   . ALA B 1 39  ? 56.377 41.386  -34.840 1.00 41.95 ? 123 ALA B O   1 
ATOM   1703  C  CB  . ALA B 1 39  ? 53.696 40.095  -34.466 1.00 38.96 ? 123 ALA B CB  1 
ATOM   1704  N  N   . ASP B 1 40  ? 56.899 39.285  -34.174 1.00 39.54 ? 124 ASP B N   1 
ATOM   1705  C  CA  . ASP B 1 40  ? 58.197 39.221  -34.797 1.00 39.44 ? 124 ASP B CA  1 
ATOM   1706  C  C   . ASP B 1 40  ? 58.030 38.680  -36.235 1.00 40.51 ? 124 ASP B C   1 
ATOM   1707  O  O   . ASP B 1 40  ? 58.855 38.968  -37.119 1.00 40.31 ? 124 ASP B O   1 
ATOM   1708  C  CB  . ASP B 1 40  ? 59.128 38.329  -33.943 1.00 38.79 ? 124 ASP B CB  1 
ATOM   1709  C  CG  . ASP B 1 40  ? 59.403 38.927  -32.564 1.00 40.12 ? 124 ASP B CG  1 
ATOM   1710  O  OD1 . ASP B 1 40  ? 59.761 40.106  -32.548 1.00 46.75 ? 124 ASP B OD1 1 
ATOM   1711  O  OD2 . ASP B 1 40  ? 59.255 38.296  -31.486 1.00 37.79 ? 124 ASP B OD2 1 
ATOM   1712  N  N   . PHE B 1 41  ? 56.992 37.856  -36.457 1.00 40.21 ? 125 PHE B N   1 
ATOM   1713  C  CA  . PHE B 1 41  ? 56.719 37.318  -37.781 1.00 40.86 ? 125 PHE B CA  1 
ATOM   1714  C  C   . PHE B 1 41  ? 55.236 37.251  -38.001 1.00 41.45 ? 125 PHE B C   1 
ATOM   1715  O  O   . PHE B 1 41  ? 54.499 36.857  -37.104 1.00 41.54 ? 125 PHE B O   1 
ATOM   1716  C  CB  . PHE B 1 41  ? 57.219 35.876  -37.983 1.00 41.37 ? 125 PHE B CB  1 
ATOM   1717  C  CG  . PHE B 1 41  ? 58.640 35.639  -37.603 1.00 41.73 ? 125 PHE B CG  1 
ATOM   1718  C  CD1 . PHE B 1 41  ? 58.958 34.597  -36.720 1.00 39.19 ? 125 PHE B CD1 1 
ATOM   1719  C  CD2 . PHE B 1 41  ? 59.659 36.426  -38.119 1.00 40.37 ? 125 PHE B CD2 1 
ATOM   1720  C  CE1 . PHE B 1 41  ? 60.255 34.340  -36.382 1.00 39.64 ? 125 PHE B CE1 1 
ATOM   1721  C  CE2 . PHE B 1 41  ? 60.977 36.196  -37.740 1.00 40.46 ? 125 PHE B CE2 1 
ATOM   1722  C  CZ  . PHE B 1 41  ? 61.277 35.152  -36.875 1.00 38.37 ? 125 PHE B CZ  1 
ATOM   1723  N  N   . ILE B 1 42  ? 54.809 37.577  -39.213 1.00 41.52 ? 126 ILE B N   1 
ATOM   1724  C  CA  . ILE B 1 42  ? 53.435 37.362  -39.601 1.00 43.24 ? 126 ILE B CA  1 
ATOM   1725  C  C   . ILE B 1 42  ? 53.420 36.309  -40.685 1.00 43.57 ? 126 ILE B C   1 
ATOM   1726  O  O   . ILE B 1 42  ? 54.081 36.494  -41.685 1.00 43.93 ? 126 ILE B O   1 
ATOM   1727  C  CB  . ILE B 1 42  ? 52.820 38.653  -40.109 1.00 43.32 ? 126 ILE B CB  1 
ATOM   1728  C  CG1 . ILE B 1 42  ? 53.007 39.731  -39.048 1.00 43.55 ? 126 ILE B CG1 1 
ATOM   1729  C  CG2 . ILE B 1 42  ? 51.372 38.452  -40.389 1.00 43.47 ? 126 ILE B CG2 1 
ATOM   1730  C  CD1 . ILE B 1 42  ? 53.009 41.117  -39.610 1.00 45.80 ? 126 ILE B CD1 1 
ATOM   1731  N  N   . VAL B 1 43  ? 52.718 35.192  -40.487 1.00 44.11 ? 127 VAL B N   1 
ATOM   1732  C  CA  . VAL B 1 43  ? 52.702 34.133  -41.528 1.00 45.59 ? 127 VAL B CA  1 
ATOM   1733  C  C   . VAL B 1 43  ? 51.274 33.744  -41.964 1.00 46.68 ? 127 VAL B C   1 
ATOM   1734  O  O   . VAL B 1 43  ? 50.403 33.527  -41.125 1.00 46.39 ? 127 VAL B O   1 
ATOM   1735  C  CB  . VAL B 1 43  ? 53.506 32.886  -41.120 1.00 44.92 ? 127 VAL B CB  1 
ATOM   1736  C  CG1 . VAL B 1 43  ? 54.911 33.257  -40.683 1.00 44.75 ? 127 VAL B CG1 1 
ATOM   1737  C  CG2 . VAL B 1 43  ? 52.875 32.269  -39.939 1.00 48.67 ? 127 VAL B CG2 1 
ATOM   1738  N  N   . PRO B 1 44  ? 51.017 33.712  -43.274 1.00 48.28 ? 128 PRO B N   1 
ATOM   1739  C  CA  . PRO B 1 44  ? 49.733 33.273  -43.784 1.00 49.40 ? 128 PRO B CA  1 
ATOM   1740  C  C   . PRO B 1 44  ? 49.722 31.769  -44.072 1.00 50.59 ? 128 PRO B C   1 
ATOM   1741  O  O   . PRO B 1 44  ? 50.592 31.247  -44.776 1.00 50.65 ? 128 PRO B O   1 
ATOM   1742  C  CB  . PRO B 1 44  ? 49.568 34.088  -45.093 1.00 48.96 ? 128 PRO B CB  1 
ATOM   1743  C  CG  . PRO B 1 44  ? 50.827 34.928  -45.221 1.00 50.09 ? 128 PRO B CG  1 
ATOM   1744  C  CD  . PRO B 1 44  ? 51.862 34.177  -44.385 1.00 49.22 ? 128 PRO B CD  1 
ATOM   1745  N  N   . ILE B 1 45  ? 48.721 31.102  -43.523 1.00 51.85 ? 129 ILE B N   1 
ATOM   1746  C  CA  . ILE B 1 45  ? 48.589 29.669  -43.563 1.00 54.04 ? 129 ILE B CA  1 
ATOM   1747  C  C   . ILE B 1 45  ? 47.208 29.444  -44.183 1.00 56.04 ? 129 ILE B C   1 
ATOM   1748  O  O   . ILE B 1 45  ? 46.299 30.224  -43.922 1.00 56.04 ? 129 ILE B O   1 
ATOM   1749  C  CB  . ILE B 1 45  ? 48.702 29.176  -42.093 1.00 53.58 ? 129 ILE B CB  1 
ATOM   1750  C  CG1 . ILE B 1 45  ? 50.041 28.539  -41.847 1.00 52.71 ? 129 ILE B CG1 1 
ATOM   1751  C  CG2 . ILE B 1 45  ? 47.634 28.250  -41.678 1.00 53.85 ? 129 ILE B CG2 1 
ATOM   1752  C  CD1 . ILE B 1 45  ? 51.000 29.440  -41.207 1.00 50.21 ? 129 ILE B CD1 1 
ATOM   1753  N  N   . GLU B 1 46  ? 47.045 28.452  -45.051 1.00 59.13 ? 130 GLU B N   1 
ATOM   1754  C  CA  . GLU B 1 46  ? 45.674 28.103  -45.497 1.00 63.11 ? 130 GLU B CA  1 
ATOM   1755  C  C   . GLU B 1 46  ? 45.009 27.075  -44.586 1.00 62.95 ? 130 GLU B C   1 
ATOM   1756  O  O   . GLU B 1 46  ? 45.497 25.963  -44.369 1.00 62.35 ? 130 GLU B O   1 
ATOM   1757  C  CB  . GLU B 1 46  ? 45.522 27.792  -47.012 1.00 62.83 ? 130 GLU B CB  1 
ATOM   1758  C  CG  . GLU B 1 46  ? 45.414 26.276  -47.416 1.00 67.28 ? 130 GLU B CG  1 
ATOM   1759  C  CD  . GLU B 1 46  ? 44.469 25.986  -48.654 1.00 67.95 ? 130 GLU B CD  1 
ATOM   1760  O  OE1 . GLU B 1 46  ? 44.117 26.926  -49.463 1.00 70.52 ? 130 GLU B OE1 1 
ATOM   1761  O  OE2 . GLU B 1 46  ? 44.092 24.784  -48.788 1.00 71.36 ? 130 GLU B OE2 1 
ATOM   1762  N  N   . ILE B 1 47  ? 43.916 27.539  -44.001 1.00 65.01 ? 131 ILE B N   1 
ATOM   1763  C  CA  . ILE B 1 47  ? 43.030 26.747  -43.182 1.00 67.01 ? 131 ILE B CA  1 
ATOM   1764  C  C   . ILE B 1 47  ? 41.765 26.601  -44.008 1.00 68.90 ? 131 ILE B C   1 
ATOM   1765  O  O   . ILE B 1 47  ? 41.031 27.604  -44.266 1.00 68.73 ? 131 ILE B O   1 
ATOM   1766  C  CB  . ILE B 1 47  ? 42.642 27.476  -41.899 1.00 66.79 ? 131 ILE B CB  1 
ATOM   1767  C  CG1 . ILE B 1 47  ? 43.892 27.921  -41.096 1.00 66.47 ? 131 ILE B CG1 1 
ATOM   1768  C  CG2 . ILE B 1 47  ? 41.617 26.642  -41.120 1.00 67.47 ? 131 ILE B CG2 1 
ATOM   1769  C  CD1 . ILE B 1 47  ? 44.450 26.911  -40.044 1.00 66.40 ? 131 ILE B CD1 1 
ATOM   1770  N  N   . GLU B 1 48  ? 41.525 25.361  -44.452 1.00 70.69 ? 132 GLU B N   1 
ATOM   1771  C  CA  . GLU B 1 48  ? 40.312 25.027  -45.212 1.00 71.99 ? 132 GLU B CA  1 
ATOM   1772  C  C   . GLU B 1 48  ? 40.051 26.116  -46.273 1.00 72.10 ? 132 GLU B C   1 
ATOM   1773  O  O   . GLU B 1 48  ? 38.981 26.741  -46.346 1.00 72.09 ? 132 GLU B O   1 
ATOM   1774  C  CB  . GLU B 1 48  ? 39.141 24.771  -44.242 1.00 72.08 ? 132 GLU B CB  1 
ATOM   1775  C  CG  . GLU B 1 48  ? 39.086 23.294  -43.775 1.00 74.22 ? 132 GLU B CG  1 
ATOM   1776  C  CD  . GLU B 1 48  ? 39.100 23.083  -42.234 1.00 77.38 ? 132 GLU B CD  1 
ATOM   1777  O  OE1 . GLU B 1 48  ? 39.406 24.033  -41.450 1.00 78.18 ? 132 GLU B OE1 1 
ATOM   1778  O  OE2 . GLU B 1 48  ? 38.823 21.930  -41.816 1.00 76.03 ? 132 GLU B OE2 1 
ATOM   1779  N  N   . GLY B 1 49  ? 41.098 26.360  -47.059 1.00 72.47 ? 133 GLY B N   1 
ATOM   1780  C  CA  . GLY B 1 49  ? 40.980 27.120  -48.290 1.00 72.79 ? 133 GLY B CA  1 
ATOM   1781  C  C   . GLY B 1 49  ? 40.945 28.625  -48.121 1.00 72.75 ? 133 GLY B C   1 
ATOM   1782  O  O   . GLY B 1 49  ? 40.985 29.391  -49.114 1.00 73.43 ? 133 GLY B O   1 
ATOM   1783  N  N   . THR B 1 50  ? 40.860 29.072  -46.879 1.00 71.57 ? 134 THR B N   1 
ATOM   1784  C  CA  . THR B 1 50  ? 41.060 30.495  -46.640 1.00 70.39 ? 134 THR B CA  1 
ATOM   1785  C  C   . THR B 1 50  ? 42.466 30.673  -46.020 1.00 68.85 ? 134 THR B C   1 
ATOM   1786  O  O   . THR B 1 50  ? 42.980 29.755  -45.359 1.00 67.99 ? 134 THR B O   1 
ATOM   1787  C  CB  . THR B 1 50  ? 39.860 31.134  -45.843 1.00 70.58 ? 134 THR B CB  1 
ATOM   1788  O  OG1 . THR B 1 50  ? 39.731 30.534  -44.549 1.00 70.06 ? 134 THR B OG1 1 
ATOM   1789  C  CG2 . THR B 1 50  ? 38.547 30.886  -46.602 1.00 71.58 ? 134 THR B CG2 1 
ATOM   1790  N  N   . THR B 1 51  ? 43.106 31.815  -46.286 1.00 66.80 ? 135 THR B N   1 
ATOM   1791  C  CA  . THR B 1 51  ? 44.387 32.081  -45.639 1.00 64.60 ? 135 THR B CA  1 
ATOM   1792  C  C   . THR B 1 51  ? 44.128 32.844  -44.337 1.00 62.22 ? 135 THR B C   1 
ATOM   1793  O  O   . THR B 1 51  ? 43.340 33.793  -44.316 1.00 60.85 ? 135 THR B O   1 
ATOM   1794  C  CB  . THR B 1 51  ? 45.538 32.714  -46.573 1.00 65.04 ? 135 THR B CB  1 
ATOM   1795  O  OG1 . THR B 1 51  ? 45.285 34.096  -46.858 1.00 64.56 ? 135 THR B OG1 1 
ATOM   1796  C  CG2 . THR B 1 51  ? 45.715 31.923  -47.895 1.00 65.24 ? 135 THR B CG2 1 
ATOM   1797  N  N   . HIS B 1 52  ? 44.752 32.350  -43.266 1.00 59.32 ? 136 HIS B N   1 
ATOM   1798  C  CA  . HIS B 1 52  ? 44.740 32.987  -41.963 1.00 57.77 ? 136 HIS B CA  1 
ATOM   1799  C  C   . HIS B 1 52  ? 46.120 33.506  -41.599 1.00 55.11 ? 136 HIS B C   1 
ATOM   1800  O  O   . HIS B 1 52  ? 47.133 32.931  -41.970 1.00 54.44 ? 136 HIS B O   1 
ATOM   1801  C  CB  . HIS B 1 52  ? 44.264 32.009  -40.885 1.00 58.34 ? 136 HIS B CB  1 
ATOM   1802  C  CG  . HIS B 1 52  ? 42.821 31.631  -41.015 1.00 64.05 ? 136 HIS B CG  1 
ATOM   1803  N  ND1 . HIS B 1 52  ? 41.889 32.439  -41.645 1.00 68.37 ? 136 HIS B ND1 1 
ATOM   1804  C  CD2 . HIS B 1 52  ? 42.138 30.545  -40.577 1.00 68.00 ? 136 HIS B CD2 1 
ATOM   1805  C  CE1 . HIS B 1 52  ? 40.702 31.859  -41.608 1.00 68.66 ? 136 HIS B CE1 1 
ATOM   1806  N  NE2 . HIS B 1 52  ? 40.828 30.706  -40.971 1.00 71.17 ? 136 HIS B NE2 1 
ATOM   1807  N  N   . GLN B 1 53  ? 46.156 34.595  -40.855 1.00 52.37 ? 137 GLN B N   1 
ATOM   1808  C  CA  . GLN B 1 53  ? 47.410 35.149  -40.464 1.00 49.95 ? 137 GLN B CA  1 
ATOM   1809  C  C   . GLN B 1 53  ? 47.790 34.692  -39.056 1.00 48.03 ? 137 GLN B C   1 
ATOM   1810  O  O   . GLN B 1 53  ? 47.058 34.932  -38.077 1.00 47.84 ? 137 GLN B O   1 
ATOM   1811  C  CB  . GLN B 1 53  ? 47.346 36.666  -40.538 1.00 50.63 ? 137 GLN B CB  1 
ATOM   1812  C  CG  . GLN B 1 53  ? 47.061 37.206  -41.920 1.00 51.85 ? 137 GLN B CG  1 
ATOM   1813  C  CD  . GLN B 1 53  ? 48.278 37.305  -42.773 1.00 54.61 ? 137 GLN B CD  1 
ATOM   1814  O  OE1 . GLN B 1 53  ? 48.701 36.340  -43.426 1.00 56.00 ? 137 GLN B OE1 1 
ATOM   1815  N  NE2 . GLN B 1 53  ? 48.847 38.495  -42.806 1.00 56.65 ? 137 GLN B NE2 1 
ATOM   1816  N  N   . VAL B 1 54  ? 48.937 34.031  -38.970 1.00 44.95 ? 138 VAL B N   1 
ATOM   1817  C  CA  . VAL B 1 54  ? 49.516 33.660  -37.706 1.00 42.65 ? 138 VAL B CA  1 
ATOM   1818  C  C   . VAL B 1 54  ? 50.509 34.728  -37.259 1.00 41.24 ? 138 VAL B C   1 
ATOM   1819  O  O   . VAL B 1 54  ? 51.430 35.089  -38.005 1.00 42.13 ? 138 VAL B O   1 
ATOM   1820  C  CB  . VAL B 1 54  ? 50.179 32.289  -37.814 1.00 42.81 ? 138 VAL B CB  1 
ATOM   1821  C  CG1 . VAL B 1 54  ? 50.725 31.879  -36.496 1.00 43.70 ? 138 VAL B CG1 1 
ATOM   1822  C  CG2 . VAL B 1 54  ? 49.161 31.250  -38.272 1.00 41.96 ? 138 VAL B CG2 1 
ATOM   1823  N  N   . TYR B 1 55  ? 50.309 35.234  -36.051 1.00 39.05 ? 139 TYR B N   1 
ATOM   1824  C  CA  . TYR B 1 55  ? 51.205 36.182  -35.412 1.00 38.00 ? 139 TYR B CA  1 
ATOM   1825  C  C   . TYR B 1 55  ? 52.141 35.520  -34.434 1.00 36.67 ? 139 TYR B C   1 
ATOM   1826  O  O   . TYR B 1 55  ? 51.733 34.944  -33.425 1.00 38.34 ? 139 TYR B O   1 
ATOM   1827  C  CB  . TYR B 1 55  ? 50.412 37.294  -34.741 1.00 38.26 ? 139 TYR B CB  1 
ATOM   1828  C  CG  . TYR B 1 55  ? 49.542 37.978  -35.753 1.00 40.22 ? 139 TYR B CG  1 
ATOM   1829  C  CD1 . TYR B 1 55  ? 48.311 37.421  -36.139 1.00 42.32 ? 139 TYR B CD1 1 
ATOM   1830  C  CD2 . TYR B 1 55  ? 49.964 39.133  -36.393 1.00 41.17 ? 139 TYR B CD2 1 
ATOM   1831  C  CE1 . TYR B 1 55  ? 47.510 38.039  -37.099 1.00 43.54 ? 139 TYR B CE1 1 
ATOM   1832  C  CE2 . TYR B 1 55  ? 49.168 39.759  -37.367 1.00 42.34 ? 139 TYR B CE2 1 
ATOM   1833  C  CZ  . TYR B 1 55  ? 47.933 39.221  -37.704 1.00 43.77 ? 139 TYR B CZ  1 
ATOM   1834  O  OH  . TYR B 1 55  ? 47.125 39.850  -38.672 1.00 45.84 ? 139 TYR B OH  1 
ATOM   1835  N  N   . VAL B 1 56  ? 53.415 35.609  -34.731 1.00 34.68 ? 140 VAL B N   1 
ATOM   1836  C  CA  . VAL B 1 56  ? 54.407 34.823  -34.032 1.00 32.82 ? 140 VAL B CA  1 
ATOM   1837  C  C   . VAL B 1 56  ? 55.288 35.690  -33.222 1.00 31.89 ? 140 VAL B C   1 
ATOM   1838  O  O   . VAL B 1 56  ? 55.855 36.617  -33.752 1.00 31.91 ? 140 VAL B O   1 
ATOM   1839  C  CB  . VAL B 1 56  ? 55.326 34.084  -35.048 1.00 32.79 ? 140 VAL B CB  1 
ATOM   1840  C  CG1 . VAL B 1 56  ? 56.375 33.297  -34.318 1.00 30.70 ? 140 VAL B CG1 1 
ATOM   1841  C  CG2 . VAL B 1 56  ? 54.479 33.195  -35.985 1.00 32.36 ? 140 VAL B CG2 1 
ATOM   1842  N  N   . LEU B 1 57  ? 55.443 35.375  -31.947 1.00 31.51 ? 141 LEU B N   1 
ATOM   1843  C  CA  . LEU B 1 57  ? 56.480 35.999  -31.115 1.00 31.25 ? 141 LEU B CA  1 
ATOM   1844  C  C   . LEU B 1 57  ? 57.695 35.071  -30.946 1.00 31.47 ? 141 LEU B C   1 
ATOM   1845  O  O   . LEU B 1 57  ? 57.480 33.899  -30.695 1.00 31.87 ? 141 LEU B O   1 
ATOM   1846  C  CB  . LEU B 1 57  ? 55.888 36.240  -29.756 1.00 29.87 ? 141 LEU B CB  1 
ATOM   1847  C  CG  . LEU B 1 57  ? 54.884 37.354  -29.722 1.00 30.81 ? 141 LEU B CG  1 
ATOM   1848  C  CD1 . LEU B 1 57  ? 54.217 37.296  -28.374 1.00 25.73 ? 141 LEU B CD1 1 
ATOM   1849  C  CD2 . LEU B 1 57  ? 55.681 38.662  -29.879 1.00 29.22 ? 141 LEU B CD2 1 
ATOM   1850  N  N   . LYS B 1 58  ? 58.937 35.588  -31.034 1.00 31.97 ? 142 LYS B N   1 
ATOM   1851  C  CA  . LYS B 1 58  ? 60.214 34.843  -30.698 1.00 31.58 ? 142 LYS B CA  1 
ATOM   1852  C  C   . LYS B 1 58  ? 60.492 34.793  -29.224 1.00 31.05 ? 142 LYS B C   1 
ATOM   1853  O  O   . LYS B 1 58  ? 60.407 35.788  -28.601 1.00 32.64 ? 142 LYS B O   1 
ATOM   1854  C  CB  . LYS B 1 58  ? 61.407 35.511  -31.375 1.00 30.96 ? 142 LYS B CB  1 
ATOM   1855  C  CG  . LYS B 1 58  ? 61.437 35.263  -32.888 1.00 35.14 ? 142 LYS B CG  1 
ATOM   1856  C  CD  . LYS B 1 58  ? 62.861 35.346  -33.402 1.00 39.98 ? 142 LYS B CD  1 
ATOM   1857  C  CE  . LYS B 1 58  ? 63.241 36.748  -33.882 1.00 41.56 ? 142 LYS B CE  1 
ATOM   1858  N  NZ  . LYS B 1 58  ? 64.533 37.187  -33.313 1.00 41.37 ? 142 LYS B NZ  1 
ATOM   1859  N  N   . ARG B 1 59  ? 60.823 33.650  -28.645 1.00 31.18 ? 143 ARG B N   1 
ATOM   1860  C  CA  . ARG B 1 59  ? 61.268 33.599  -27.239 1.00 29.98 ? 143 ARG B CA  1 
ATOM   1861  C  C   . ARG B 1 59  ? 62.567 34.431  -27.126 1.00 29.55 ? 143 ARG B C   1 
ATOM   1862  O  O   . ARG B 1 59  ? 63.405 34.354  -28.021 1.00 30.56 ? 143 ARG B O   1 
ATOM   1863  C  CB  . ARG B 1 59  ? 61.551 32.139  -26.814 1.00 28.75 ? 143 ARG B CB  1 
ATOM   1864  C  CG  . ARG B 1 59  ? 61.750 31.956  -25.338 1.00 26.86 ? 143 ARG B CG  1 
ATOM   1865  C  CD  . ARG B 1 59  ? 61.916 30.556  -24.987 1.00 21.63 ? 143 ARG B CD  1 
ATOM   1866  N  NE  . ARG B 1 59  ? 61.783 30.398  -23.545 1.00 25.48 ? 143 ARG B NE  1 
ATOM   1867  C  CZ  . ARG B 1 59  ? 61.337 29.267  -22.987 1.00 26.81 ? 143 ARG B CZ  1 
ATOM   1868  N  NH1 . ARG B 1 59  ? 61.011 28.275  -23.792 1.00 22.46 ? 143 ARG B NH1 1 
ATOM   1869  N  NH2 . ARG B 1 59  ? 61.199 29.147  -21.660 1.00 19.73 ? 143 ARG B NH2 1 
ATOM   1870  N  N   . PRO B 1 60  ? 62.718 35.212  -26.045 1.00 28.72 ? 144 PRO B N   1 
ATOM   1871  C  CA  . PRO B 1 60  ? 63.941 35.955  -25.805 1.00 27.54 ? 144 PRO B CA  1 
ATOM   1872  C  C   . PRO B 1 60  ? 65.201 35.089  -25.945 1.00 28.12 ? 144 PRO B C   1 
ATOM   1873  O  O   . PRO B 1 60  ? 65.293 34.034  -25.359 1.00 29.04 ? 144 PRO B O   1 
ATOM   1874  C  CB  . PRO B 1 60  ? 63.773 36.452  -24.365 1.00 27.53 ? 144 PRO B CB  1 
ATOM   1875  C  CG  . PRO B 1 60  ? 62.197 36.697  -24.243 1.00 27.39 ? 144 PRO B CG  1 
ATOM   1876  C  CD  . PRO B 1 60  ? 61.658 35.478  -25.024 1.00 29.00 ? 144 PRO B CD  1 
ATOM   1877  N  N   . TYR B 1 61  ? 66.171 35.581  -26.725 1.00 27.60 ? 145 TYR B N   1 
ATOM   1878  C  CA  . TYR B 1 61  ? 67.522 35.070  -26.879 1.00 27.99 ? 145 TYR B CA  1 
ATOM   1879  C  C   . TYR B 1 61  ? 67.606 33.914  -27.795 1.00 29.63 ? 145 TYR B C   1 
ATOM   1880  O  O   . TYR B 1 61  ? 68.614 33.176  -27.764 1.00 31.03 ? 145 TYR B O   1 
ATOM   1881  C  CB  . TYR B 1 61  ? 68.210 34.745  -25.529 1.00 27.88 ? 145 TYR B CB  1 
ATOM   1882  C  CG  . TYR B 1 61  ? 68.163 35.876  -24.529 1.00 27.44 ? 145 TYR B CG  1 
ATOM   1883  C  CD1 . TYR B 1 61  ? 67.411 35.768  -23.327 1.00 27.78 ? 145 TYR B CD1 1 
ATOM   1884  C  CD2 . TYR B 1 61  ? 68.850 37.068  -24.781 1.00 26.70 ? 145 TYR B CD2 1 
ATOM   1885  C  CE1 . TYR B 1 61  ? 67.398 36.783  -22.393 1.00 21.47 ? 145 TYR B CE1 1 
ATOM   1886  C  CE2 . TYR B 1 61  ? 68.809 38.123  -23.877 1.00 26.45 ? 145 TYR B CE2 1 
ATOM   1887  C  CZ  . TYR B 1 61  ? 68.096 37.965  -22.697 1.00 28.25 ? 145 TYR B CZ  1 
ATOM   1888  O  OH  . TYR B 1 61  ? 68.085 39.054  -21.872 1.00 29.21 ? 145 TYR B OH  1 
ATOM   1889  N  N   . VAL B 1 62  ? 66.587 33.728  -28.630 1.00 30.87 ? 146 VAL B N   1 
ATOM   1890  C  CA  . VAL B 1 62  ? 66.529 32.516  -29.479 1.00 31.31 ? 146 VAL B CA  1 
ATOM   1891  C  C   . VAL B 1 62  ? 67.533 32.505  -30.599 1.00 32.53 ? 146 VAL B C   1 
ATOM   1892  O  O   . VAL B 1 62  ? 68.088 31.450  -30.929 1.00 33.69 ? 146 VAL B O   1 
ATOM   1893  C  CB  . VAL B 1 62  ? 65.085 32.158  -30.015 1.00 31.10 ? 146 VAL B CB  1 
ATOM   1894  C  CG1 . VAL B 1 62  ? 64.600 33.175  -31.044 1.00 29.84 ? 146 VAL B CG1 1 
ATOM   1895  C  CG2 . VAL B 1 62  ? 65.037 30.738  -30.566 1.00 25.75 ? 146 VAL B CG2 1 
ATOM   1896  N  N   . ASP B 1 63  ? 67.753 33.647  -31.224 1.00 33.81 ? 147 ASP B N   1 
ATOM   1897  C  CA  . ASP B 1 63  ? 68.820 33.750  -32.240 1.00 34.56 ? 147 ASP B CA  1 
ATOM   1898  C  C   . ASP B 1 63  ? 70.212 33.432  -31.685 1.00 33.86 ? 147 ASP B C   1 
ATOM   1899  O  O   . ASP B 1 63  ? 70.961 32.701  -32.304 1.00 33.78 ? 147 ASP B O   1 
ATOM   1900  C  CB  . ASP B 1 63  ? 68.826 35.141  -32.806 1.00 36.41 ? 147 ASP B CB  1 
ATOM   1901  C  CG  . ASP B 1 63  ? 67.569 35.430  -33.619 1.00 40.55 ? 147 ASP B CG  1 
ATOM   1902  O  OD1 . ASP B 1 63  ? 67.043 34.434  -34.205 1.00 44.42 ? 147 ASP B OD1 1 
ATOM   1903  O  OD2 . ASP B 1 63  ? 67.156 36.637  -33.683 1.00 44.46 ? 147 ASP B OD2 1 
ATOM   1904  N  N   . GLU B 1 64  ? 70.552 33.904  -30.501 1.00 32.99 ? 148 GLU B N   1 
ATOM   1905  C  CA  . GLU B 1 64  ? 71.857 33.552  -30.017 1.00 34.35 ? 148 GLU B CA  1 
ATOM   1906  C  C   . GLU B 1 64  ? 71.878 32.183  -29.511 1.00 34.07 ? 148 GLU B C   1 
ATOM   1907  O  O   . GLU B 1 64  ? 72.951 31.553  -29.529 1.00 34.83 ? 148 GLU B O   1 
ATOM   1908  C  CB  . GLU B 1 64  ? 72.395 34.450  -28.889 1.00 35.43 ? 148 GLU B CB  1 
ATOM   1909  C  CG  . GLU B 1 64  ? 71.417 35.340  -28.268 1.00 39.02 ? 148 GLU B CG  1 
ATOM   1910  C  CD  . GLU B 1 64  ? 70.917 36.382  -29.241 1.00 43.56 ? 148 GLU B CD  1 
ATOM   1911  O  OE1 . GLU B 1 64  ? 71.735 37.095  -29.865 1.00 46.14 ? 148 GLU B OE1 1 
ATOM   1912  O  OE2 . GLU B 1 64  ? 69.699 36.481  -29.368 1.00 45.40 ? 148 GLU B OE2 1 
ATOM   1913  N  N   . PHE B 1 65  ? 70.733 31.716  -29.012 1.00 33.63 ? 149 PHE B N   1 
ATOM   1914  C  CA  . PHE B 1 65  ? 70.638 30.322  -28.548 1.00 32.75 ? 149 PHE B CA  1 
ATOM   1915  C  C   . PHE B 1 65  ? 70.934 29.377  -29.685 1.00 32.11 ? 149 PHE B C   1 
ATOM   1916  O  O   . PHE B 1 65  ? 71.782 28.527  -29.557 1.00 32.17 ? 149 PHE B O   1 
ATOM   1917  C  CB  . PHE B 1 65  ? 69.281 30.038  -27.910 1.00 32.71 ? 149 PHE B CB  1 
ATOM   1918  C  CG  . PHE B 1 65  ? 69.047 28.600  -27.600 1.00 32.89 ? 149 PHE B CG  1 
ATOM   1919  C  CD1 . PHE B 1 65  ? 69.667 27.999  -26.526 1.00 34.74 ? 149 PHE B CD1 1 
ATOM   1920  C  CD2 . PHE B 1 65  ? 68.217 27.828  -28.398 1.00 33.52 ? 149 PHE B CD2 1 
ATOM   1921  C  CE1 . PHE B 1 65  ? 69.462 26.655  -26.238 1.00 31.49 ? 149 PHE B CE1 1 
ATOM   1922  C  CE2 . PHE B 1 65  ? 68.035 26.495  -28.116 1.00 32.70 ? 149 PHE B CE2 1 
ATOM   1923  C  CZ  . PHE B 1 65  ? 68.640 25.926  -27.023 1.00 30.87 ? 149 PHE B CZ  1 
ATOM   1924  N  N   . LEU B 1 66  ? 70.247 29.546  -30.799 1.00 32.57 ? 150 LEU B N   1 
ATOM   1925  C  CA  . LEU B 1 66  ? 70.410 28.678  -31.963 1.00 34.96 ? 150 LEU B CA  1 
ATOM   1926  C  C   . LEU B 1 66  ? 71.782 28.754  -32.614 1.00 36.51 ? 150 LEU B C   1 
ATOM   1927  O  O   . LEU B 1 66  ? 72.275 27.787  -33.146 1.00 37.31 ? 150 LEU B O   1 
ATOM   1928  C  CB  . LEU B 1 66  ? 69.362 29.012  -33.041 1.00 34.72 ? 150 LEU B CB  1 
ATOM   1929  C  CG  . LEU B 1 66  ? 67.908 28.785  -32.662 1.00 35.99 ? 150 LEU B CG  1 
ATOM   1930  C  CD1 . LEU B 1 66  ? 67.037 28.831  -33.889 1.00 35.40 ? 150 LEU B CD1 1 
ATOM   1931  C  CD2 . LEU B 1 66  ? 67.784 27.414  -31.974 1.00 38.99 ? 150 LEU B CD2 1 
ATOM   1932  N  N   . ARG B 1 67  ? 72.369 29.932  -32.620 1.00 38.03 ? 151 ARG B N   1 
ATOM   1933  C  CA  . ARG B 1 67  ? 73.655 30.111  -33.205 1.00 39.01 ? 151 ARG B CA  1 
ATOM   1934  C  C   . ARG B 1 67  ? 74.629 29.355  -32.354 1.00 38.37 ? 151 ARG B C   1 
ATOM   1935  O  O   . ARG B 1 67  ? 75.421 28.610  -32.879 1.00 39.11 ? 151 ARG B O   1 
ATOM   1936  C  CB  . ARG B 1 67  ? 74.001 31.590  -33.244 1.00 40.04 ? 151 ARG B CB  1 
ATOM   1937  C  CG  . ARG B 1 67  ? 75.137 31.929  -34.144 1.00 43.67 ? 151 ARG B CG  1 
ATOM   1938  C  CD  . ARG B 1 67  ? 75.418 33.436  -34.037 1.00 54.25 ? 151 ARG B CD  1 
ATOM   1939  N  NE  . ARG B 1 67  ? 74.403 34.294  -34.688 1.00 59.23 ? 151 ARG B NE  1 
ATOM   1940  C  CZ  . ARG B 1 67  ? 74.225 35.586  -34.402 1.00 62.09 ? 151 ARG B CZ  1 
ATOM   1941  N  NH1 . ARG B 1 67  ? 74.993 36.177  -33.473 1.00 60.67 ? 151 ARG B NH1 1 
ATOM   1942  N  NH2 . ARG B 1 67  ? 73.285 36.287  -35.041 1.00 61.77 ? 151 ARG B NH2 1 
ATOM   1943  N  N   . ARG B 1 68  ? 74.561 29.500  -31.041 1.00 37.92 ? 152 ARG B N   1 
ATOM   1944  C  CA  . ARG B 1 68  ? 75.479 28.749  -30.212 1.00 37.68 ? 152 ARG B CA  1 
ATOM   1945  C  C   . ARG B 1 68  ? 75.281 27.267  -30.380 1.00 39.60 ? 152 ARG B C   1 
ATOM   1946  O  O   . ARG B 1 68  ? 76.296 26.536  -30.457 1.00 40.79 ? 152 ARG B O   1 
ATOM   1947  C  CB  . ARG B 1 68  ? 75.380 29.114  -28.754 1.00 36.85 ? 152 ARG B CB  1 
ATOM   1948  C  CG  . ARG B 1 68  ? 76.455 28.451  -27.931 1.00 37.35 ? 152 ARG B CG  1 
ATOM   1949  C  CD  . ARG B 1 68  ? 77.874 28.926  -28.381 1.00 38.13 ? 152 ARG B CD  1 
ATOM   1950  N  NE  . ARG B 1 68  ? 78.908 28.470  -27.467 1.00 35.34 ? 152 ARG B NE  1 
ATOM   1951  C  CZ  . ARG B 1 68  ? 79.985 27.778  -27.816 1.00 35.56 ? 152 ARG B CZ  1 
ATOM   1952  N  NH1 . ARG B 1 68  ? 80.221 27.454  -29.074 1.00 33.94 ? 152 ARG B NH1 1 
ATOM   1953  N  NH2 . ARG B 1 68  ? 80.829 27.397  -26.868 1.00 36.99 ? 152 ARG B NH2 1 
ATOM   1954  N  N   . MET B 1 69  ? 74.013 26.798  -30.471 1.00 39.66 ? 153 MET B N   1 
ATOM   1955  C  CA  . MET B 1 69  ? 73.756 25.324  -30.590 1.00 39.21 ? 153 MET B CA  1 
ATOM   1956  C  C   . MET B 1 69  ? 74.275 24.728  -31.869 1.00 39.49 ? 153 MET B C   1 
ATOM   1957  O  O   . MET B 1 69  ? 74.872 23.635  -31.839 1.00 40.01 ? 153 MET B O   1 
ATOM   1958  C  CB  . MET B 1 69  ? 72.275 24.898  -30.397 1.00 38.83 ? 153 MET B CB  1 
ATOM   1959  C  CG  . MET B 1 69  ? 71.640 25.319  -29.067 1.00 36.38 ? 153 MET B CG  1 
ATOM   1960  S  SD  . MET B 1 69  ? 72.266 24.566  -27.573 1.00 31.85 ? 153 MET B SD  1 
ATOM   1961  C  CE  . MET B 1 69  ? 71.429 23.050  -27.777 1.00 36.06 ? 153 MET B CE  1 
ATOM   1962  N  N   . GLY B 1 70  ? 73.991 25.407  -32.978 1.00 39.41 ? 154 GLY B N   1 
ATOM   1963  C  CA  . GLY B 1 70  ? 74.583 25.092  -34.286 1.00 40.42 ? 154 GLY B CA  1 
ATOM   1964  C  C   . GLY B 1 70  ? 76.111 24.864  -34.271 1.00 41.73 ? 154 GLY B C   1 
ATOM   1965  O  O   . GLY B 1 70  ? 76.590 23.972  -34.972 1.00 40.97 ? 154 GLY B O   1 
ATOM   1966  N  N   . GLU B 1 71  ? 76.846 25.647  -33.449 1.00 42.44 ? 155 GLU B N   1 
ATOM   1967  C  CA  . GLU B 1 71  ? 78.313 25.556  -33.281 1.00 43.68 ? 155 GLU B CA  1 
ATOM   1968  C  C   . GLU B 1 71  ? 78.697 24.230  -32.625 1.00 43.03 ? 155 GLU B C   1 
ATOM   1969  O  O   . GLU B 1 71  ? 79.672 23.562  -33.025 1.00 43.26 ? 155 GLU B O   1 
ATOM   1970  C  CB  . GLU B 1 71  ? 78.898 26.748  -32.437 1.00 42.90 ? 155 GLU B CB  1 
ATOM   1971  C  CG  . GLU B 1 71  ? 78.896 28.108  -33.128 1.00 43.70 ? 155 GLU B CG  1 
ATOM   1972  C  CD  . GLU B 1 71  ? 79.211 29.311  -32.196 1.00 47.32 ? 155 GLU B CD  1 
ATOM   1973  O  OE1 . GLU B 1 71  ? 79.897 29.152  -31.150 1.00 50.60 ? 155 GLU B OE1 1 
ATOM   1974  O  OE2 . GLU B 1 71  ? 78.772 30.456  -32.522 1.00 52.62 ? 155 GLU B OE2 1 
ATOM   1975  N  N   . LEU B 1 72  ? 77.915 23.872  -31.609 1.00 42.50 ? 156 LEU B N   1 
ATOM   1976  C  CA  . LEU B 1 72  ? 78.183 22.731  -30.720 1.00 41.57 ? 156 LEU B CA  1 
ATOM   1977  C  C   . LEU B 1 72  ? 77.421 21.410  -31.035 1.00 40.95 ? 156 LEU B C   1 
ATOM   1978  O  O   . LEU B 1 72  ? 77.823 20.348  -30.541 1.00 40.84 ? 156 LEU B O   1 
ATOM   1979  C  CB  . LEU B 1 72  ? 77.884 23.124  -29.264 1.00 41.05 ? 156 LEU B CB  1 
ATOM   1980  C  CG  . LEU B 1 72  ? 78.682 24.240  -28.580 1.00 42.71 ? 156 LEU B CG  1 
ATOM   1981  C  CD1 . LEU B 1 72  ? 78.108 24.617  -27.204 1.00 42.94 ? 156 LEU B CD1 1 
ATOM   1982  C  CD2 . LEU B 1 72  ? 80.136 23.854  -28.403 1.00 44.60 ? 156 LEU B CD2 1 
ATOM   1983  N  N   . PHE B 1 73  ? 76.333 21.455  -31.819 1.00 39.77 ? 157 PHE B N   1 
ATOM   1984  C  CA  . PHE B 1 73  ? 75.508 20.251  -31.983 1.00 38.61 ? 157 PHE B CA  1 
ATOM   1985  C  C   . PHE B 1 73  ? 74.989 20.000  -33.373 1.00 38.13 ? 157 PHE B C   1 
ATOM   1986  O  O   . PHE B 1 73  ? 75.043 20.858  -34.253 1.00 38.01 ? 157 PHE B O   1 
ATOM   1987  C  CB  . PHE B 1 73  ? 74.267 20.290  -31.066 1.00 38.00 ? 157 PHE B CB  1 
ATOM   1988  C  CG  . PHE B 1 73  ? 74.570 20.255  -29.618 1.00 34.35 ? 157 PHE B CG  1 
ATOM   1989  C  CD1 . PHE B 1 73  ? 74.601 21.418  -28.886 1.00 33.54 ? 157 PHE B CD1 1 
ATOM   1990  C  CD2 . PHE B 1 73  ? 74.811 19.082  -28.992 1.00 32.19 ? 157 PHE B CD2 1 
ATOM   1991  C  CE1 . PHE B 1 73  ? 74.883 21.409  -27.536 1.00 32.84 ? 157 PHE B CE1 1 
ATOM   1992  C  CE2 . PHE B 1 73  ? 75.096 19.055  -27.615 1.00 32.24 ? 157 PHE B CE2 1 
ATOM   1993  C  CZ  . PHE B 1 73  ? 75.150 20.228  -26.900 1.00 33.40 ? 157 PHE B CZ  1 
ATOM   1994  N  N   . GLU B 1 74  ? 74.424 18.820  -33.555 1.00 37.12 ? 158 GLU B N   1 
ATOM   1995  C  CA  . GLU B 1 74  ? 73.631 18.631  -34.733 1.00 37.44 ? 158 GLU B CA  1 
ATOM   1996  C  C   . GLU B 1 74  ? 72.163 18.872  -34.348 1.00 37.31 ? 158 GLU B C   1 
ATOM   1997  O  O   . GLU B 1 74  ? 71.595 18.088  -33.640 1.00 37.30 ? 158 GLU B O   1 
ATOM   1998  C  CB  . GLU B 1 74  ? 73.836 17.242  -35.288 1.00 37.15 ? 158 GLU B CB  1 
ATOM   1999  C  CG  . GLU B 1 74  ? 72.896 16.921  -36.418 1.00 38.63 ? 158 GLU B CG  1 
ATOM   2000  C  CD  . GLU B 1 74  ? 72.866 15.472  -36.723 1.00 39.87 ? 158 GLU B CD  1 
ATOM   2001  O  OE1 . GLU B 1 74  ? 73.299 14.703  -35.818 1.00 44.93 ? 158 GLU B OE1 1 
ATOM   2002  O  OE2 . GLU B 1 74  ? 72.412 15.101  -37.850 1.00 39.58 ? 158 GLU B OE2 1 
ATOM   2003  N  N   . CYS B 1 75  ? 71.582 19.974  -34.806 1.00 37.49 ? 159 CYS B N   1 
ATOM   2004  C  CA  . CYS B 1 75  ? 70.277 20.409  -34.356 1.00 37.83 ? 159 CYS B CA  1 
ATOM   2005  C  C   . CYS B 1 75  ? 69.169 20.033  -35.328 1.00 37.26 ? 159 CYS B C   1 
ATOM   2006  O  O   . CYS B 1 75  ? 69.261 20.238  -36.545 1.00 37.17 ? 159 CYS B O   1 
ATOM   2007  C  CB  . CYS B 1 75  ? 70.277 21.908  -34.120 1.00 37.43 ? 159 CYS B CB  1 
ATOM   2008  S  SG  . CYS B 1 75  ? 71.437 22.413  -32.831 1.00 42.48 ? 159 CYS B SG  1 
ATOM   2009  N  N   . VAL B 1 76  ? 68.097 19.494  -34.785 1.00 35.91 ? 160 VAL B N   1 
ATOM   2010  C  CA  . VAL B 1 76  ? 67.032 19.066  -35.624 1.00 35.57 ? 160 VAL B CA  1 
ATOM   2011  C  C   . VAL B 1 76  ? 65.789 19.632  -35.045 1.00 34.89 ? 160 VAL B C   1 
ATOM   2012  O  O   . VAL B 1 76  ? 65.560 19.539  -33.872 1.00 35.45 ? 160 VAL B O   1 
ATOM   2013  C  CB  . VAL B 1 76  ? 66.983 17.538  -35.586 1.00 36.21 ? 160 VAL B CB  1 
ATOM   2014  C  CG1 . VAL B 1 76  ? 65.626 16.979  -36.096 1.00 36.11 ? 160 VAL B CG1 1 
ATOM   2015  C  CG2 . VAL B 1 76  ? 68.237 16.928  -36.315 1.00 36.05 ? 160 VAL B CG2 1 
ATOM   2016  N  N   . LEU B 1 77  ? 64.961 20.218  -35.868 1.00 34.81 ? 161 LEU B N   1 
ATOM   2017  C  CA  . LEU B 1 77  ? 63.674 20.628  -35.417 1.00 34.57 ? 161 LEU B CA  1 
ATOM   2018  C  C   . LEU B 1 77  ? 62.716 19.406  -35.486 1.00 34.66 ? 161 LEU B C   1 
ATOM   2019  O  O   . LEU B 1 77  ? 62.457 18.865  -36.573 1.00 33.53 ? 161 LEU B O   1 
ATOM   2020  C  CB  . LEU B 1 77  ? 63.187 21.740  -36.324 1.00 34.93 ? 161 LEU B CB  1 
ATOM   2021  C  CG  . LEU B 1 77  ? 61.780 22.179  -35.930 1.00 36.95 ? 161 LEU B CG  1 
ATOM   2022  C  CD1 . LEU B 1 77  ? 61.869 23.361  -35.003 1.00 37.11 ? 161 LEU B CD1 1 
ATOM   2023  C  CD2 . LEU B 1 77  ? 60.999 22.548  -37.144 1.00 36.00 ? 161 LEU B CD2 1 
ATOM   2024  N  N   . PHE B 1 78  ? 62.189 18.977  -34.338 1.00 34.09 ? 162 PHE B N   1 
ATOM   2025  C  CA  . PHE B 1 78  ? 61.183 17.910  -34.335 1.00 33.54 ? 162 PHE B CA  1 
ATOM   2026  C  C   . PHE B 1 78  ? 59.887 18.423  -33.682 1.00 34.01 ? 162 PHE B C   1 
ATOM   2027  O  O   . PHE B 1 78  ? 59.849 18.691  -32.477 1.00 33.34 ? 162 PHE B O   1 
ATOM   2028  C  CB  . PHE B 1 78  ? 61.739 16.680  -33.624 1.00 32.25 ? 162 PHE B CB  1 
ATOM   2029  C  CG  . PHE B 1 78  ? 61.004 15.410  -33.906 1.00 30.75 ? 162 PHE B CG  1 
ATOM   2030  C  CD1 . PHE B 1 78  ? 61.586 14.190  -33.590 1.00 33.06 ? 162 PHE B CD1 1 
ATOM   2031  C  CD2 . PHE B 1 78  ? 59.739 15.404  -34.475 1.00 32.62 ? 162 PHE B CD2 1 
ATOM   2032  C  CE1 . PHE B 1 78  ? 60.908 12.988  -33.833 1.00 31.18 ? 162 PHE B CE1 1 
ATOM   2033  C  CE2 . PHE B 1 78  ? 59.036 14.201  -34.687 1.00 29.14 ? 162 PHE B CE2 1 
ATOM   2034  C  CZ  . PHE B 1 78  ? 59.635 13.011  -34.390 1.00 28.92 ? 162 PHE B CZ  1 
ATOM   2035  N  N   . THR B 1 79  ? 58.818 18.537  -34.463 1.00 34.24 ? 163 THR B N   1 
ATOM   2036  C  CA  . THR B 1 79  ? 57.615 19.194  -33.953 1.00 35.95 ? 163 THR B CA  1 
ATOM   2037  C  C   . THR B 1 79  ? 56.283 18.380  -34.194 1.00 36.92 ? 163 THR B C   1 
ATOM   2038  O  O   . THR B 1 79  ? 56.190 17.617  -35.151 1.00 38.10 ? 163 THR B O   1 
ATOM   2039  C  CB  . THR B 1 79  ? 57.586 20.632  -34.525 1.00 35.61 ? 163 THR B CB  1 
ATOM   2040  O  OG1 . THR B 1 79  ? 56.354 21.296  -34.204 1.00 36.77 ? 163 THR B OG1 1 
ATOM   2041  C  CG2 . THR B 1 79  ? 57.788 20.625  -36.050 1.00 35.72 ? 163 THR B CG2 1 
ATOM   2042  N  N   . ALA B 1 80  ? 55.265 18.523  -33.338 1.00 37.08 ? 164 ALA B N   1 
ATOM   2043  C  CA  . ALA B 1 80  ? 53.977 17.855  -33.597 1.00 36.28 ? 164 ALA B CA  1 
ATOM   2044  C  C   . ALA B 1 80  ? 53.020 18.704  -34.430 1.00 36.31 ? 164 ALA B C   1 
ATOM   2045  O  O   . ALA B 1 80  ? 51.964 18.243  -34.838 1.00 37.02 ? 164 ALA B O   1 
ATOM   2046  C  CB  . ALA B 1 80  ? 53.325 17.478  -32.321 1.00 36.72 ? 164 ALA B CB  1 
ATOM   2047  N  N   . SER B 1 81  ? 53.390 19.939  -34.711 1.00 36.08 ? 165 SER B N   1 
ATOM   2048  C  CA  . SER B 1 81  ? 52.624 20.795  -35.624 1.00 36.63 ? 165 SER B CA  1 
ATOM   2049  C  C   . SER B 1 81  ? 52.834 20.426  -37.093 1.00 36.94 ? 165 SER B C   1 
ATOM   2050  O  O   . SER B 1 81  ? 53.732 19.693  -37.410 1.00 37.59 ? 165 SER B O   1 
ATOM   2051  C  CB  . SER B 1 81  ? 52.983 22.259  -35.375 1.00 36.31 ? 165 SER B CB  1 
ATOM   2052  O  OG  . SER B 1 81  ? 54.246 22.532  -35.971 1.00 41.82 ? 165 SER B OG  1 
ATOM   2053  N  N   . LEU B 1 82  ? 51.961 20.895  -37.979 1.00 38.28 ? 166 LEU B N   1 
ATOM   2054  C  CA  . LEU B 1 82  ? 51.996 20.508  -39.388 1.00 39.01 ? 166 LEU B CA  1 
ATOM   2055  C  C   . LEU B 1 82  ? 52.952 21.399  -40.155 1.00 39.75 ? 166 LEU B C   1 
ATOM   2056  O  O   . LEU B 1 82  ? 52.998 22.599  -39.931 1.00 39.51 ? 166 LEU B O   1 
ATOM   2057  C  CB  . LEU B 1 82  ? 50.602 20.659  -40.023 1.00 38.82 ? 166 LEU B CB  1 
ATOM   2058  C  CG  . LEU B 1 82  ? 49.461 19.725  -39.558 1.00 42.45 ? 166 LEU B CG  1 
ATOM   2059  C  CD1 . LEU B 1 82  ? 48.044 20.303  -39.860 1.00 43.28 ? 166 LEU B CD1 1 
ATOM   2060  C  CD2 . LEU B 1 82  ? 49.627 18.288  -40.069 1.00 40.49 ? 166 LEU B CD2 1 
ATOM   2061  N  N   . ALA B 1 83  ? 53.659 20.817  -41.115 1.00 40.64 ? 167 ALA B N   1 
ATOM   2062  C  CA  . ALA B 1 83  ? 54.547 21.573  -42.005 1.00 42.04 ? 167 ALA B CA  1 
ATOM   2063  C  C   . ALA B 1 83  ? 53.970 22.864  -42.565 1.00 42.01 ? 167 ALA B C   1 
ATOM   2064  O  O   . ALA B 1 83  ? 54.685 23.829  -42.705 1.00 42.37 ? 167 ALA B O   1 
ATOM   2065  C  CB  . ALA B 1 83  ? 55.050 20.687  -43.179 1.00 42.46 ? 167 ALA B CB  1 
ATOM   2066  N  N   . LYS B 1 84  ? 52.697 22.882  -42.909 1.00 41.76 ? 168 LYS B N   1 
ATOM   2067  C  CA  . LYS B 1 84  ? 52.132 24.095  -43.494 1.00 42.76 ? 168 LYS B CA  1 
ATOM   2068  C  C   . LYS B 1 84  ? 52.260 25.273  -42.527 1.00 40.79 ? 168 LYS B C   1 
ATOM   2069  O  O   . LYS B 1 84  ? 52.299 26.415  -42.939 1.00 40.04 ? 168 LYS B O   1 
ATOM   2070  C  CB  . LYS B 1 84  ? 50.669 23.877  -43.931 1.00 43.16 ? 168 LYS B CB  1 
ATOM   2071  C  CG  . LYS B 1 84  ? 49.577 24.178  -42.855 1.00 45.41 ? 168 LYS B CG  1 
ATOM   2072  C  CD  . LYS B 1 84  ? 48.272 23.434  -43.197 1.00 46.29 ? 168 LYS B CD  1 
ATOM   2073  C  CE  . LYS B 1 84  ? 47.175 23.826  -42.206 1.00 54.97 ? 168 LYS B CE  1 
ATOM   2074  N  NZ  . LYS B 1 84  ? 45.893 23.153  -42.617 1.00 59.18 ? 168 LYS B NZ  1 
ATOM   2075  N  N   . TYR B 1 85  ? 52.311 24.956  -41.244 1.00 40.37 ? 169 TYR B N   1 
ATOM   2076  C  CA  . TYR B 1 85  ? 52.633 25.919  -40.200 1.00 39.86 ? 169 TYR B CA  1 
ATOM   2077  C  C   . TYR B 1 85  ? 54.131 25.971  -39.870 1.00 39.48 ? 169 TYR B C   1 
ATOM   2078  O  O   . TYR B 1 85  ? 54.666 27.032  -39.747 1.00 41.00 ? 169 TYR B O   1 
ATOM   2079  C  CB  . TYR B 1 85  ? 51.846 25.613  -38.926 1.00 38.84 ? 169 TYR B CB  1 
ATOM   2080  C  CG  . TYR B 1 85  ? 52.375 26.352  -37.725 1.00 39.77 ? 169 TYR B CG  1 
ATOM   2081  C  CD1 . TYR B 1 85  ? 52.140 27.705  -37.571 1.00 38.42 ? 169 TYR B CD1 1 
ATOM   2082  C  CD2 . TYR B 1 85  ? 53.138 25.681  -36.718 1.00 39.47 ? 169 TYR B CD2 1 
ATOM   2083  C  CE1 . TYR B 1 85  ? 52.625 28.405  -36.453 1.00 39.02 ? 169 TYR B CE1 1 
ATOM   2084  C  CE2 . TYR B 1 85  ? 53.620 26.354  -35.597 1.00 37.15 ? 169 TYR B CE2 1 
ATOM   2085  C  CZ  . TYR B 1 85  ? 53.364 27.734  -35.468 1.00 41.90 ? 169 TYR B CZ  1 
ATOM   2086  O  OH  . TYR B 1 85  ? 53.846 28.461  -34.364 1.00 42.23 ? 169 TYR B OH  1 
ATOM   2087  N  N   . ALA B 1 86  ? 54.802 24.844  -39.684 1.00 38.84 ? 170 ALA B N   1 
ATOM   2088  C  CA  . ALA B 1 86  ? 56.129 24.876  -39.119 1.00 38.56 ? 170 ALA B CA  1 
ATOM   2089  C  C   . ALA B 1 86  ? 57.176 25.237  -40.154 1.00 39.48 ? 170 ALA B C   1 
ATOM   2090  O  O   . ALA B 1 86  ? 58.089 25.954  -39.805 1.00 40.48 ? 170 ALA B O   1 
ATOM   2091  C  CB  . ALA B 1 86  ? 56.466 23.601  -38.459 1.00 38.13 ? 170 ALA B CB  1 
ATOM   2092  N  N   . ASP B 1 87  ? 57.041 24.814  -41.416 1.00 39.74 ? 171 ASP B N   1 
ATOM   2093  C  CA  . ASP B 1 87  ? 57.928 25.305  -42.488 1.00 40.39 ? 171 ASP B CA  1 
ATOM   2094  C  C   . ASP B 1 87  ? 58.055 26.824  -42.640 1.00 40.09 ? 171 ASP B C   1 
ATOM   2095  O  O   . ASP B 1 87  ? 59.122 27.374  -42.426 1.00 40.93 ? 171 ASP B O   1 
ATOM   2096  C  CB  . ASP B 1 87  ? 57.611 24.695  -43.831 1.00 40.49 ? 171 ASP B CB  1 
ATOM   2097  C  CG  . ASP B 1 87  ? 58.500 23.508  -44.149 1.00 46.04 ? 171 ASP B CG  1 
ATOM   2098  O  OD1 . ASP B 1 87  ? 59.636 23.495  -43.605 1.00 49.05 ? 171 ASP B OD1 1 
ATOM   2099  O  OD2 . ASP B 1 87  ? 58.064 22.586  -44.928 1.00 51.05 ? 171 ASP B OD2 1 
ATOM   2100  N  N   . PRO B 1 88  ? 56.991 27.513  -43.042 1.00 39.92 ? 172 PRO B N   1 
ATOM   2101  C  CA  . PRO B 1 88  ? 57.189 28.940  -43.177 1.00 38.58 ? 172 PRO B CA  1 
ATOM   2102  C  C   . PRO B 1 88  ? 57.680 29.621  -41.896 1.00 38.40 ? 172 PRO B C   1 
ATOM   2103  O  O   . PRO B 1 88  ? 58.523 30.471  -41.956 1.00 38.57 ? 172 PRO B O   1 
ATOM   2104  C  CB  . PRO B 1 88  ? 55.779 29.433  -43.519 1.00 38.47 ? 172 PRO B CB  1 
ATOM   2105  C  CG  . PRO B 1 88  ? 54.880 28.402  -43.108 1.00 38.08 ? 172 PRO B CG  1 
ATOM   2106  C  CD  . PRO B 1 88  ? 55.604 27.139  -43.382 1.00 39.67 ? 172 PRO B CD  1 
ATOM   2107  N  N   . VAL B 1 89  ? 57.135 29.265  -40.742 1.00 38.44 ? 173 VAL B N   1 
ATOM   2108  C  CA  . VAL B 1 89  ? 57.598 29.813  -39.486 1.00 37.20 ? 173 VAL B CA  1 
ATOM   2109  C  C   . VAL B 1 89  ? 59.083 29.534  -39.204 1.00 36.96 ? 173 VAL B C   1 
ATOM   2110  O  O   . VAL B 1 89  ? 59.775 30.386  -38.710 1.00 36.65 ? 173 VAL B O   1 
ATOM   2111  C  CB  . VAL B 1 89  ? 56.807 29.254  -38.353 1.00 37.22 ? 173 VAL B CB  1 
ATOM   2112  C  CG1 . VAL B 1 89  ? 57.453 29.685  -36.952 1.00 36.52 ? 173 VAL B CG1 1 
ATOM   2113  C  CG2 . VAL B 1 89  ? 55.380 29.692  -38.472 1.00 36.84 ? 173 VAL B CG2 1 
ATOM   2114  N  N   . THR B 1 90  ? 59.570 28.348  -39.492 1.00 36.78 ? 174 THR B N   1 
ATOM   2115  C  CA  . THR B 1 90  ? 60.997 28.061  -39.254 1.00 37.28 ? 174 THR B CA  1 
ATOM   2116  C  C   . THR B 1 90  ? 61.942 28.672  -40.283 1.00 38.02 ? 174 THR B C   1 
ATOM   2117  O  O   . THR B 1 90  ? 63.082 28.996  -39.928 1.00 38.08 ? 174 THR B O   1 
ATOM   2118  C  CB  . THR B 1 90  ? 61.263 26.591  -39.108 1.00 36.87 ? 174 THR B CB  1 
ATOM   2119  O  OG1 . THR B 1 90  ? 60.508 26.110  -38.004 1.00 38.54 ? 174 THR B OG1 1 
ATOM   2120  C  CG2 . THR B 1 90  ? 62.698 26.344  -38.798 1.00 38.44 ? 174 THR B CG2 1 
ATOM   2121  N  N   . ASP B 1 91  ? 61.461 28.873  -41.528 1.00 38.80 ? 175 ASP B N   1 
ATOM   2122  C  CA  . ASP B 1 91  ? 62.212 29.568  -42.568 1.00 39.00 ? 175 ASP B CA  1 
ATOM   2123  C  C   . ASP B 1 91  ? 62.508 30.970  -42.062 1.00 39.60 ? 175 ASP B C   1 
ATOM   2124  O  O   . ASP B 1 91  ? 63.550 31.545  -42.385 1.00 40.45 ? 175 ASP B O   1 
ATOM   2125  C  CB  . ASP B 1 91  ? 61.411 29.724  -43.845 1.00 38.11 ? 175 ASP B CB  1 
ATOM   2126  C  CG  . ASP B 1 91  ? 61.432 28.483  -44.710 1.00 44.16 ? 175 ASP B CG  1 
ATOM   2127  O  OD1 . ASP B 1 91  ? 62.273 27.559  -44.419 1.00 43.64 ? 175 ASP B OD1 1 
ATOM   2128  O  OD2 . ASP B 1 91  ? 60.585 28.438  -45.673 1.00 46.44 ? 175 ASP B OD2 1 
ATOM   2129  N  N   . LEU B 1 92  ? 61.580 31.517  -41.287 1.00 38.89 ? 176 LEU B N   1 
ATOM   2130  C  CA  . LEU B 1 92  ? 61.705 32.851  -40.816 1.00 39.02 ? 176 LEU B CA  1 
ATOM   2131  C  C   . LEU B 1 92  ? 62.531 32.861  -39.546 1.00 39.95 ? 176 LEU B C   1 
ATOM   2132  O  O   . LEU B 1 92  ? 63.370 33.724  -39.366 1.00 41.38 ? 176 LEU B O   1 
ATOM   2133  C  CB  . LEU B 1 92  ? 60.333 33.465  -40.599 1.00 39.10 ? 176 LEU B CB  1 
ATOM   2134  C  CG  . LEU B 1 92  ? 59.595 33.840  -41.891 1.00 39.18 ? 176 LEU B CG  1 
ATOM   2135  C  CD1 . LEU B 1 92  ? 58.146 34.264  -41.641 1.00 33.12 ? 176 LEU B CD1 1 
ATOM   2136  C  CD2 . LEU B 1 92  ? 60.396 34.961  -42.608 1.00 37.10 ? 176 LEU B CD2 1 
ATOM   2137  N  N   . LEU B 1 93  ? 62.336 31.889  -38.678 1.00 40.23 ? 177 LEU B N   1 
ATOM   2138  C  CA  . LEU B 1 93  ? 63.068 31.881  -37.422 1.00 40.52 ? 177 LEU B CA  1 
ATOM   2139  C  C   . LEU B 1 93  ? 64.543 31.370  -37.583 1.00 42.12 ? 177 LEU B C   1 
ATOM   2140  O  O   . LEU B 1 93  ? 65.439 31.874  -36.956 1.00 42.11 ? 177 LEU B O   1 
ATOM   2141  C  CB  . LEU B 1 93  ? 62.270 31.115  -36.342 1.00 38.95 ? 177 LEU B CB  1 
ATOM   2142  C  CG  . LEU B 1 93  ? 62.997 30.790  -35.039 1.00 34.68 ? 177 LEU B CG  1 
ATOM   2143  C  CD1 . LEU B 1 93  ? 62.796 31.862  -34.049 1.00 23.89 ? 177 LEU B CD1 1 
ATOM   2144  C  CD2 . LEU B 1 93  ? 62.566 29.512  -34.490 1.00 29.49 ? 177 LEU B CD2 1 
ATOM   2145  N  N   . ASP B 1 94  ? 64.797 30.390  -38.434 1.00 44.18 ? 178 ASP B N   1 
ATOM   2146  C  CA  . ASP B 1 94  ? 66.151 29.867  -38.550 1.00 46.10 ? 178 ASP B CA  1 
ATOM   2147  C  C   . ASP B 1 94  ? 67.047 30.595  -39.591 1.00 47.44 ? 178 ASP B C   1 
ATOM   2148  O  O   . ASP B 1 94  ? 67.570 29.978  -40.518 1.00 45.94 ? 178 ASP B O   1 
ATOM   2149  C  CB  . ASP B 1 94  ? 66.106 28.377  -38.870 1.00 45.46 ? 178 ASP B CB  1 
ATOM   2150  C  CG  . ASP B 1 94  ? 67.478 27.742  -38.812 1.00 46.50 ? 178 ASP B CG  1 
ATOM   2151  O  OD1 . ASP B 1 94  ? 68.416 28.473  -38.377 1.00 47.33 ? 178 ASP B OD1 1 
ATOM   2152  O  OD2 . ASP B 1 94  ? 67.615 26.534  -39.193 1.00 46.36 ? 178 ASP B OD2 1 
ATOM   2153  N  N   . ARG B 1 95  ? 67.271 31.890  -39.401 1.00 50.08 ? 179 ARG B N   1 
ATOM   2154  C  CA  . ARG B 1 95  ? 67.911 32.718  -40.452 1.00 52.44 ? 179 ARG B CA  1 
ATOM   2155  C  C   . ARG B 1 95  ? 69.164 32.074  -41.067 1.00 52.48 ? 179 ARG B C   1 
ATOM   2156  O  O   . ARG B 1 95  ? 69.336 32.144  -42.267 1.00 53.30 ? 179 ARG B O   1 
ATOM   2157  C  CB  . ARG B 1 95  ? 68.166 34.165  -39.980 1.00 53.62 ? 179 ARG B CB  1 
ATOM   2158  C  CG  . ARG B 1 95  ? 68.739 34.311  -38.521 1.00 57.58 ? 179 ARG B CG  1 
ATOM   2159  C  CD  . ARG B 1 95  ? 69.865 35.432  -38.430 1.00 62.26 ? 179 ARG B CD  1 
ATOM   2160  N  NE  . ARG B 1 95  ? 69.994 36.104  -37.121 1.00 63.15 ? 179 ARG B NE  1 
ATOM   2161  C  CZ  . ARG B 1 95  ? 69.112 36.986  -36.611 1.00 66.15 ? 179 ARG B CZ  1 
ATOM   2162  N  NH1 . ARG B 1 95  ? 67.984 37.294  -37.270 1.00 64.70 ? 179 ARG B NH1 1 
ATOM   2163  N  NH2 . ARG B 1 95  ? 69.353 37.559  -35.427 1.00 63.54 ? 179 ARG B NH2 1 
ATOM   2164  N  N   . CYS B 1 96  ? 69.991 31.384  -40.274 1.00 52.21 ? 180 CYS B N   1 
ATOM   2165  C  CA  . CYS B 1 96  ? 71.185 30.755  -40.821 1.00 51.57 ? 180 CYS B CA  1 
ATOM   2166  C  C   . CYS B 1 96  ? 71.202 29.226  -41.041 1.00 49.53 ? 180 CYS B C   1 
ATOM   2167  O  O   . CYS B 1 96  ? 72.276 28.658  -41.227 1.00 49.80 ? 180 CYS B O   1 
ATOM   2168  C  CB  . CYS B 1 96  ? 72.377 31.126  -39.959 1.00 52.98 ? 180 CYS B CB  1 
ATOM   2169  S  SG  . CYS B 1 96  ? 72.278 32.748  -39.148 1.00 61.41 ? 180 CYS B SG  1 
ATOM   2170  N  N   . GLY B 1 97  ? 70.063 28.532  -41.010 1.00 47.31 ? 181 GLY B N   1 
ATOM   2171  C  CA  . GLY B 1 97  ? 70.083 27.082  -41.271 1.00 43.25 ? 181 GLY B CA  1 
ATOM   2172  C  C   . GLY B 1 97  ? 70.768 26.238  -40.205 1.00 41.40 ? 181 GLY B C   1 
ATOM   2173  O  O   . GLY B 1 97  ? 71.376 25.237  -40.484 1.00 40.85 ? 181 GLY B O   1 
ATOM   2174  N  N   . VAL B 1 98  ? 70.678 26.629  -38.963 1.00 39.78 ? 182 VAL B N   1 
ATOM   2175  C  CA  . VAL B 1 98  ? 71.092 25.751  -37.900 1.00 40.09 ? 182 VAL B CA  1 
ATOM   2176  C  C   . VAL B 1 98  ? 70.366 24.355  -37.872 1.00 41.45 ? 182 VAL B C   1 
ATOM   2177  O  O   . VAL B 1 98  ? 70.916 23.385  -37.402 1.00 42.70 ? 182 VAL B O   1 
ATOM   2178  C  CB  . VAL B 1 98  ? 70.902 26.484  -36.568 1.00 40.28 ? 182 VAL B CB  1 
ATOM   2179  C  CG1 . VAL B 1 98  ? 70.958 25.520  -35.360 1.00 37.69 ? 182 VAL B CG1 1 
ATOM   2180  C  CG2 . VAL B 1 98  ? 71.927 27.604  -36.455 1.00 38.05 ? 182 VAL B CG2 1 
ATOM   2181  N  N   . PHE B 1 99  ? 69.139 24.234  -38.359 1.00 41.56 ? 183 PHE B N   1 
ATOM   2182  C  CA  . PHE B 1 99  ? 68.558 22.916  -38.460 1.00 41.00 ? 183 PHE B CA  1 
ATOM   2183  C  C   . PHE B 1 99  ? 69.070 22.069  -39.628 1.00 41.99 ? 183 PHE B C   1 
ATOM   2184  O  O   . PHE B 1 99  ? 68.889 22.398  -40.785 1.00 41.70 ? 183 PHE B O   1 
ATOM   2185  C  CB  . PHE B 1 99  ? 67.033 23.013  -38.443 1.00 40.01 ? 183 PHE B CB  1 
ATOM   2186  C  CG  . PHE B 1 99  ? 66.517 23.597  -37.181 1.00 37.81 ? 183 PHE B CG  1 
ATOM   2187  C  CD1 . PHE B 1 99  ? 65.868 24.818  -37.181 1.00 34.41 ? 183 PHE B CD1 1 
ATOM   2188  C  CD2 . PHE B 1 99  ? 66.742 22.955  -35.974 1.00 34.75 ? 183 PHE B CD2 1 
ATOM   2189  C  CE1 . PHE B 1 99  ? 65.453 25.386  -35.999 1.00 32.98 ? 183 PHE B CE1 1 
ATOM   2190  C  CE2 . PHE B 1 99  ? 66.306 23.526  -34.785 1.00 33.33 ? 183 PHE B CE2 1 
ATOM   2191  C  CZ  . PHE B 1 99  ? 65.653 24.733  -34.809 1.00 33.64 ? 183 PHE B CZ  1 
ATOM   2192  N  N   . ARG B 1 100 ? 69.694 20.943  -39.306 1.00 43.19 ? 184 ARG B N   1 
ATOM   2193  C  CA  . ARG B 1 100 ? 70.153 20.031  -40.328 1.00 44.49 ? 184 ARG B CA  1 
ATOM   2194  C  C   . ARG B 1 100 ? 69.026 19.218  -40.924 1.00 44.28 ? 184 ARG B C   1 
ATOM   2195  O  O   . ARG B 1 100 ? 69.302 18.327  -41.695 1.00 45.43 ? 184 ARG B O   1 
ATOM   2196  C  CB  . ARG B 1 100 ? 71.159 19.046  -39.755 1.00 45.21 ? 184 ARG B CB  1 
ATOM   2197  C  CG  . ARG B 1 100 ? 72.052 19.607  -38.663 1.00 50.07 ? 184 ARG B CG  1 
ATOM   2198  C  CD  . ARG B 1 100 ? 72.753 20.827  -39.138 1.00 56.12 ? 184 ARG B CD  1 
ATOM   2199  N  NE  . ARG B 1 100 ? 73.927 21.083  -38.317 1.00 63.50 ? 184 ARG B NE  1 
ATOM   2200  C  CZ  . ARG B 1 100 ? 74.620 22.221  -38.344 1.00 67.06 ? 184 ARG B CZ  1 
ATOM   2201  N  NH1 . ARG B 1 100 ? 74.249 23.217  -39.164 1.00 69.16 ? 184 ARG B NH1 1 
ATOM   2202  N  NH2 . ARG B 1 100 ? 75.683 22.362  -37.559 1.00 66.20 ? 184 ARG B NH2 1 
ATOM   2203  N  N   . ALA B 1 101 ? 67.773 19.517  -40.574 1.00 43.38 ? 185 ALA B N   1 
ATOM   2204  C  CA  . ALA B 1 101 ? 66.621 18.620  -40.808 1.00 41.22 ? 185 ALA B CA  1 
ATOM   2205  C  C   . ALA B 1 101 ? 65.447 19.069  -39.963 1.00 40.39 ? 185 ALA B C   1 
ATOM   2206  O  O   . ALA B 1 101 ? 65.614 19.478  -38.813 1.00 39.82 ? 185 ALA B O   1 
ATOM   2207  C  CB  . ALA B 1 101 ? 66.963 17.185  -40.444 1.00 40.89 ? 185 ALA B CB  1 
ATOM   2208  N  N   . ARG B 1 102 ? 64.261 18.923  -40.520 1.00 38.91 ? 186 ARG B N   1 
ATOM   2209  C  CA  . ARG B 1 102 ? 63.057 19.371  -39.892 1.00 38.94 ? 186 ARG B CA  1 
ATOM   2210  C  C   . ARG B 1 102 ? 62.073 18.228  -39.881 1.00 39.38 ? 186 ARG B C   1 
ATOM   2211  O  O   . ARG B 1 102 ? 61.724 17.748  -40.944 1.00 40.94 ? 186 ARG B O   1 
ATOM   2212  C  CB  . ARG B 1 102 ? 62.450 20.474  -40.733 1.00 38.30 ? 186 ARG B CB  1 
ATOM   2213  C  CG  . ARG B 1 102 ? 63.335 21.644  -40.918 1.00 36.36 ? 186 ARG B CG  1 
ATOM   2214  C  CD  . ARG B 1 102 ? 62.545 22.676  -41.614 1.00 35.49 ? 186 ARG B CD  1 
ATOM   2215  N  NE  . ARG B 1 102 ? 63.312 23.890  -41.811 1.00 37.43 ? 186 ARG B NE  1 
ATOM   2216  C  CZ  . ARG B 1 102 ? 62.825 24.990  -42.366 1.00 39.26 ? 186 ARG B CZ  1 
ATOM   2217  N  NH1 . ARG B 1 102 ? 61.537 25.036  -42.786 1.00 41.72 ? 186 ARG B NH1 1 
ATOM   2218  N  NH2 . ARG B 1 102 ? 63.599 26.070  -42.429 1.00 34.95 ? 186 ARG B NH2 1 
ATOM   2219  N  N   . LEU B 1 103 ? 61.608 17.788  -38.713 1.00 38.87 ? 187 LEU B N   1 
ATOM   2220  C  CA  . LEU B 1 103 ? 60.624 16.671  -38.636 1.00 37.33 ? 187 LEU B CA  1 
ATOM   2221  C  C   . LEU B 1 103 ? 59.261 17.157  -38.178 1.00 37.04 ? 187 LEU B C   1 
ATOM   2222  O  O   . LEU B 1 103 ? 59.170 18.058  -37.323 1.00 37.86 ? 187 LEU B O   1 
ATOM   2223  C  CB  . LEU B 1 103 ? 61.123 15.564  -37.741 1.00 36.47 ? 187 LEU B CB  1 
ATOM   2224  C  CG  . LEU B 1 103 ? 62.350 14.893  -38.342 1.00 35.60 ? 187 LEU B CG  1 
ATOM   2225  C  CD1 . LEU B 1 103 ? 62.877 13.837  -37.449 1.00 35.61 ? 187 LEU B CD1 1 
ATOM   2226  C  CD2 . LEU B 1 103 ? 62.096 14.325  -39.686 1.00 35.60 ? 187 LEU B CD2 1 
ATOM   2227  N  N   . PHE B 1 104 ? 58.197 16.605  -38.749 1.00 35.53 ? 188 PHE B N   1 
ATOM   2228  C  CA  . PHE B 1 104 ? 56.873 17.161  -38.463 1.00 35.42 ? 188 PHE B CA  1 
ATOM   2229  C  C   . PHE B 1 104 ? 55.914 16.238  -37.808 1.00 34.30 ? 188 PHE B C   1 
ATOM   2230  O  O   . PHE B 1 104 ? 56.265 15.131  -37.518 1.00 33.16 ? 188 PHE B O   1 
ATOM   2231  C  CB  . PHE B 1 104 ? 56.274 17.823  -39.697 1.00 35.85 ? 188 PHE B CB  1 
ATOM   2232  C  CG  . PHE B 1 104 ? 57.177 18.858  -40.300 1.00 38.20 ? 188 PHE B CG  1 
ATOM   2233  C  CD1 . PHE B 1 104 ? 57.804 18.625  -41.528 1.00 37.99 ? 188 PHE B CD1 1 
ATOM   2234  C  CD2 . PHE B 1 104 ? 57.460 20.049  -39.603 1.00 37.74 ? 188 PHE B CD2 1 
ATOM   2235  C  CE1 . PHE B 1 104 ? 58.646 19.601  -42.081 1.00 36.78 ? 188 PHE B CE1 1 
ATOM   2236  C  CE2 . PHE B 1 104 ? 58.329 20.997  -40.132 1.00 35.55 ? 188 PHE B CE2 1 
ATOM   2237  C  CZ  . PHE B 1 104 ? 58.909 20.782  -41.383 1.00 35.38 ? 188 PHE B CZ  1 
ATOM   2238  N  N   . ARG B 1 105 ? 54.701 16.729  -37.551 1.00 35.37 ? 189 ARG B N   1 
ATOM   2239  C  CA  . ARG B 1 105 ? 53.619 15.900  -37.000 1.00 36.06 ? 189 ARG B CA  1 
ATOM   2240  C  C   . ARG B 1 105 ? 53.631 14.447  -37.466 1.00 36.87 ? 189 ARG B C   1 
ATOM   2241  O  O   . ARG B 1 105 ? 53.563 13.556  -36.658 1.00 36.60 ? 189 ARG B O   1 
ATOM   2242  C  CB  . ARG B 1 105 ? 52.309 16.532  -37.331 1.00 35.71 ? 189 ARG B CB  1 
ATOM   2243  C  CG  . ARG B 1 105 ? 51.134 15.650  -37.133 1.00 36.85 ? 189 ARG B CG  1 
ATOM   2244  C  CD  . ARG B 1 105 ? 50.247 16.153  -36.099 1.00 36.67 ? 189 ARG B CD  1 
ATOM   2245  N  NE  . ARG B 1 105 ? 49.311 17.022  -36.718 1.00 41.08 ? 189 ARG B NE  1 
ATOM   2246  C  CZ  . ARG B 1 105 ? 48.753 18.058  -36.128 1.00 46.24 ? 189 ARG B CZ  1 
ATOM   2247  N  NH1 . ARG B 1 105 ? 49.022 18.364  -34.873 1.00 49.67 ? 189 ARG B NH1 1 
ATOM   2248  N  NH2 . ARG B 1 105 ? 47.909 18.791  -36.813 1.00 51.74 ? 189 ARG B NH2 1 
ATOM   2249  N  N   . GLU B 1 106 ? 53.735 14.240  -38.776 1.00 38.86 ? 190 GLU B N   1 
ATOM   2250  C  CA  . GLU B 1 106 ? 53.807 12.924  -39.428 1.00 40.64 ? 190 GLU B CA  1 
ATOM   2251  C  C   . GLU B 1 106 ? 54.928 12.020  -38.922 1.00 39.46 ? 190 GLU B C   1 
ATOM   2252  O  O   . GLU B 1 106 ? 54.798 10.790  -38.997 1.00 39.42 ? 190 GLU B O   1 
ATOM   2253  C  CB  . GLU B 1 106 ? 54.003 13.080  -40.943 1.00 42.21 ? 190 GLU B CB  1 
ATOM   2254  C  CG  . GLU B 1 106 ? 53.390 14.388  -41.545 1.00 51.70 ? 190 GLU B CG  1 
ATOM   2255  C  CD  . GLU B 1 106 ? 54.438 15.430  -42.104 1.00 62.44 ? 190 GLU B CD  1 
ATOM   2256  O  OE1 . GLU B 1 106 ? 54.047 16.660  -42.157 1.00 64.63 ? 190 GLU B OE1 1 
ATOM   2257  O  OE2 . GLU B 1 106 ? 55.595 15.021  -42.515 1.00 62.34 ? 190 GLU B OE2 1 
ATOM   2258  N  N   . SER B 1 107 ? 56.034 12.606  -38.457 1.00 38.52 ? 191 SER B N   1 
ATOM   2259  C  CA  . SER B 1 107 ? 57.151 11.814  -37.931 1.00 38.32 ? 191 SER B CA  1 
ATOM   2260  C  C   . SER B 1 107 ? 57.001 11.430  -36.424 1.00 37.82 ? 191 SER B C   1 
ATOM   2261  O  O   . SER B 1 107 ? 57.875 10.735  -35.862 1.00 38.30 ? 191 SER B O   1 
ATOM   2262  C  CB  . SER B 1 107 ? 58.487 12.531  -38.155 1.00 38.51 ? 191 SER B CB  1 
ATOM   2263  O  OG  . SER B 1 107 ? 58.775 12.719  -39.529 1.00 40.99 ? 191 SER B OG  1 
ATOM   2264  N  N   . CYS B 1 108 ? 55.915 11.863  -35.783 1.00 36.26 ? 192 CYS B N   1 
ATOM   2265  C  CA  . CYS B 1 108 ? 55.700 11.571  -34.380 1.00 36.51 ? 192 CYS B CA  1 
ATOM   2266  C  C   . CYS B 1 108 ? 54.880 10.281  -34.275 1.00 36.53 ? 192 CYS B C   1 
ATOM   2267  O  O   . CYS B 1 108 ? 54.166 9.911   -35.197 1.00 37.44 ? 192 CYS B O   1 
ATOM   2268  C  CB  . CYS B 1 108 ? 54.924 12.699  -33.692 1.00 36.29 ? 192 CYS B CB  1 
ATOM   2269  S  SG  . CYS B 1 108 ? 55.680 14.307  -33.627 1.00 36.60 ? 192 CYS B SG  1 
ATOM   2270  N  N   . VAL B 1 109 ? 54.968 9.587   -33.153 1.00 35.18 ? 193 VAL B N   1 
ATOM   2271  C  CA  . VAL B 1 109 ? 53.978 8.592   -32.911 1.00 33.38 ? 193 VAL B CA  1 
ATOM   2272  C  C   . VAL B 1 109 ? 52.718 9.144   -32.199 1.00 33.21 ? 193 VAL B C   1 
ATOM   2273  O  O   . VAL B 1 109 ? 52.787 9.884   -31.218 1.00 31.64 ? 193 VAL B O   1 
ATOM   2274  C  CB  . VAL B 1 109 ? 54.544 7.247   -32.348 1.00 32.93 ? 193 VAL B CB  1 
ATOM   2275  C  CG1 . VAL B 1 109 ? 55.994 7.200   -32.282 1.00 28.79 ? 193 VAL B CG1 1 
ATOM   2276  C  CG2 . VAL B 1 109 ? 53.864 6.800   -31.032 1.00 35.88 ? 193 VAL B CG2 1 
ATOM   2277  N  N   . PHE B 1 110 ? 51.560 8.754   -32.720 1.00 32.49 ? 194 PHE B N   1 
ATOM   2278  C  CA  . PHE B 1 110 ? 50.320 9.017   -32.041 1.00 31.83 ? 194 PHE B CA  1 
ATOM   2279  C  C   . PHE B 1 110 ? 50.184 8.050   -30.871 1.00 33.23 ? 194 PHE B C   1 
ATOM   2280  O  O   . PHE B 1 110 ? 50.234 6.857   -31.070 1.00 33.58 ? 194 PHE B O   1 
ATOM   2281  C  CB  . PHE B 1 110 ? 49.190 8.847   -33.021 1.00 31.08 ? 194 PHE B CB  1 
ATOM   2282  C  CG  . PHE B 1 110 ? 47.918 9.290   -32.486 1.00 30.87 ? 194 PHE B CG  1 
ATOM   2283  C  CD1 . PHE B 1 110 ? 47.683 10.653  -32.293 1.00 30.45 ? 194 PHE B CD1 1 
ATOM   2284  C  CD2 . PHE B 1 110 ? 46.965 8.357   -32.066 1.00 27.01 ? 194 PHE B CD2 1 
ATOM   2285  C  CE1 . PHE B 1 110 ? 46.500 11.105  -31.698 1.00 27.33 ? 194 PHE B CE1 1 
ATOM   2286  C  CE2 . PHE B 1 110 ? 45.753 8.808   -31.492 1.00 30.83 ? 194 PHE B CE2 1 
ATOM   2287  C  CZ  . PHE B 1 110 ? 45.525 10.194  -31.314 1.00 28.99 ? 194 PHE B CZ  1 
ATOM   2288  N  N   . HIS B 1 111 ? 50.043 8.571   -29.652 1.00 33.93 ? 195 HIS B N   1 
ATOM   2289  C  CA  . HIS B 1 111 ? 49.947 7.801   -28.406 1.00 34.37 ? 195 HIS B CA  1 
ATOM   2290  C  C   . HIS B 1 111 ? 48.660 8.327   -27.631 1.00 35.98 ? 195 HIS B C   1 
ATOM   2291  O  O   . HIS B 1 111 ? 48.762 9.253   -26.780 1.00 36.18 ? 195 HIS B O   1 
ATOM   2292  C  CB  . HIS B 1 111 ? 51.251 8.095   -27.653 1.00 32.31 ? 195 HIS B CB  1 
ATOM   2293  C  CG  . HIS B 1 111 ? 51.464 7.311   -26.410 1.00 31.20 ? 195 HIS B CG  1 
ATOM   2294  N  ND1 . HIS B 1 111 ? 50.995 7.723   -25.177 1.00 31.64 ? 195 HIS B ND1 1 
ATOM   2295  C  CD2 . HIS B 1 111 ? 52.134 6.151   -26.187 1.00 32.58 ? 195 HIS B CD2 1 
ATOM   2296  C  CE1 . HIS B 1 111 ? 51.364 6.852   -24.250 1.00 31.91 ? 195 HIS B CE1 1 
ATOM   2297  N  NE2 . HIS B 1 111 ? 52.062 5.888   -24.837 1.00 33.07 ? 195 HIS B NE2 1 
ATOM   2298  N  N   . GLN B 1 112 ? 47.472 7.770   -27.955 1.00 36.03 ? 196 GLN B N   1 
ATOM   2299  C  CA  . GLN B 1 112 ? 46.114 8.305   -27.539 1.00 36.62 ? 196 GLN B CA  1 
ATOM   2300  C  C   . GLN B 1 112 ? 46.009 9.795   -27.361 1.00 37.08 ? 196 GLN B C   1 
ATOM   2301  O  O   . GLN B 1 112 ? 45.859 10.236  -26.262 1.00 37.00 ? 196 GLN B O   1 
ATOM   2302  C  CB  . GLN B 1 112 ? 45.520 7.761   -26.210 1.00 35.72 ? 196 GLN B CB  1 
ATOM   2303  C  CG  . GLN B 1 112 ? 45.877 6.433   -25.767 1.00 38.75 ? 196 GLN B CG  1 
ATOM   2304  C  CD  . GLN B 1 112 ? 44.737 5.730   -24.998 1.00 38.57 ? 196 GLN B CD  1 
ATOM   2305  O  OE1 . GLN B 1 112 ? 43.830 5.181   -25.611 1.00 37.58 ? 196 GLN B OE1 1 
ATOM   2306  N  NE2 . GLN B 1 112 ? 44.814 5.722   -23.664 1.00 35.33 ? 196 GLN B NE2 1 
ATOM   2307  N  N   . GLY B 1 113 ? 46.036 10.555  -28.426 1.00 38.22 ? 197 GLY B N   1 
ATOM   2308  C  CA  . GLY B 1 113 ? 46.010 11.989  -28.308 1.00 39.62 ? 197 GLY B CA  1 
ATOM   2309  C  C   . GLY B 1 113 ? 47.331 12.682  -28.055 1.00 40.92 ? 197 GLY B C   1 
ATOM   2310  O  O   . GLY B 1 113 ? 47.371 13.898  -28.127 1.00 43.18 ? 197 GLY B O   1 
ATOM   2311  N  N   . CYS B 1 114 ? 48.394 11.972  -27.706 1.00 39.86 ? 198 CYS B N   1 
ATOM   2312  C  CA  . CYS B 1 114 ? 49.718 12.632  -27.631 1.00 40.88 ? 198 CYS B CA  1 
ATOM   2313  C  C   . CYS B 1 114 ? 50.531 12.423  -28.870 1.00 38.80 ? 198 CYS B C   1 
ATOM   2314  O  O   . CYS B 1 114 ? 50.490 11.332  -29.405 1.00 40.46 ? 198 CYS B O   1 
ATOM   2315  C  CB  . CYS B 1 114 ? 50.542 12.018  -26.528 1.00 40.15 ? 198 CYS B CB  1 
ATOM   2316  S  SG  . CYS B 1 114 ? 49.898 12.621  -25.146 1.00 51.04 ? 198 CYS B SG  1 
ATOM   2317  N  N   . TYR B 1 115 ? 51.337 13.392  -29.281 1.00 37.02 ? 199 TYR B N   1 
ATOM   2318  C  CA  . TYR B 1 115 ? 52.281 13.141  -30.355 1.00 35.31 ? 199 TYR B CA  1 
ATOM   2319  C  C   . TYR B 1 115 ? 53.620 12.978  -29.728 1.00 34.59 ? 199 TYR B C   1 
ATOM   2320  O  O   . TYR B 1 115 ? 54.144 13.917  -29.187 1.00 36.11 ? 199 TYR B O   1 
ATOM   2321  C  CB  . TYR B 1 115 ? 52.276 14.263  -31.377 1.00 35.11 ? 199 TYR B CB  1 
ATOM   2322  C  CG  . TYR B 1 115 ? 51.099 14.186  -32.274 1.00 34.90 ? 199 TYR B CG  1 
ATOM   2323  C  CD1 . TYR B 1 115 ? 49.982 14.994  -32.058 1.00 36.35 ? 199 TYR B CD1 1 
ATOM   2324  C  CD2 . TYR B 1 115 ? 51.057 13.265  -33.314 1.00 37.75 ? 199 TYR B CD2 1 
ATOM   2325  C  CE1 . TYR B 1 115 ? 48.874 14.895  -32.854 1.00 35.35 ? 199 TYR B CE1 1 
ATOM   2326  C  CE2 . TYR B 1 115 ? 49.945 13.149  -34.133 1.00 36.62 ? 199 TYR B CE2 1 
ATOM   2327  C  CZ  . TYR B 1 115 ? 48.866 13.982  -33.889 1.00 37.43 ? 199 TYR B CZ  1 
ATOM   2328  O  OH  . TYR B 1 115 ? 47.776 13.911  -34.681 1.00 39.41 ? 199 TYR B OH  1 
ATOM   2329  N  N   . VAL B 1 116 ? 54.161 11.783  -29.739 1.00 33.20 ? 200 VAL B N   1 
ATOM   2330  C  CA  . VAL B 1 116 ? 55.429 11.544  -29.087 1.00 32.29 ? 200 VAL B CA  1 
ATOM   2331  C  C   . VAL B 1 116 ? 56.578 11.556  -30.077 1.00 32.81 ? 200 VAL B C   1 
ATOM   2332  O  O   . VAL B 1 116 ? 56.471 11.063  -31.202 1.00 32.49 ? 200 VAL B O   1 
ATOM   2333  C  CB  . VAL B 1 116 ? 55.422 10.198  -28.358 1.00 32.89 ? 200 VAL B CB  1 
ATOM   2334  C  CG1 . VAL B 1 116 ? 56.818 9.857   -27.811 1.00 30.01 ? 200 VAL B CG1 1 
ATOM   2335  C  CG2 . VAL B 1 116 ? 54.318 10.149  -27.302 1.00 28.79 ? 200 VAL B CG2 1 
ATOM   2336  N  N   . LYS B 1 117 ? 57.688 12.135  -29.649 1.00 33.77 ? 201 LYS B N   1 
ATOM   2337  C  CA  . LYS B 1 117 ? 58.897 12.202  -30.454 1.00 33.88 ? 201 LYS B CA  1 
ATOM   2338  C  C   . LYS B 1 117 ? 59.803 11.014  -30.084 1.00 34.69 ? 201 LYS B C   1 
ATOM   2339  O  O   . LYS B 1 117 ? 60.437 10.986  -29.025 1.00 35.14 ? 201 LYS B O   1 
ATOM   2340  C  CB  . LYS B 1 117 ? 59.509 13.555  -30.237 1.00 34.19 ? 201 LYS B CB  1 
ATOM   2341  C  CG  . LYS B 1 117 ? 58.630 14.602  -30.894 1.00 34.58 ? 201 LYS B CG  1 
ATOM   2342  C  CD  . LYS B 1 117 ? 58.893 15.933  -30.379 1.00 34.66 ? 201 LYS B CD  1 
ATOM   2343  C  CE  . LYS B 1 117 ? 57.785 16.824  -30.733 1.00 34.03 ? 201 LYS B CE  1 
ATOM   2344  N  NZ  . LYS B 1 117 ? 58.077 18.151  -30.105 1.00 35.26 ? 201 LYS B NZ  1 
ATOM   2345  N  N   . ASP B 1 118 ? 59.753 9.972   -30.920 1.00 34.85 ? 202 ASP B N   1 
ATOM   2346  C  CA  . ASP B 1 118 ? 60.401 8.720   -30.601 1.00 34.70 ? 202 ASP B CA  1 
ATOM   2347  C  C   . ASP B 1 118 ? 61.861 8.800   -31.005 1.00 34.10 ? 202 ASP B C   1 
ATOM   2348  O  O   . ASP B 1 118 ? 62.184 8.646   -32.146 1.00 33.86 ? 202 ASP B O   1 
ATOM   2349  C  CB  . ASP B 1 118 ? 59.679 7.563   -31.286 1.00 34.66 ? 202 ASP B CB  1 
ATOM   2350  C  CG  . ASP B 1 118 ? 60.297 6.180   -30.940 1.00 37.03 ? 202 ASP B CG  1 
ATOM   2351  O  OD1 . ASP B 1 118 ? 61.318 6.134   -30.239 1.00 37.84 ? 202 ASP B OD1 1 
ATOM   2352  O  OD2 . ASP B 1 118 ? 59.738 5.132   -31.342 1.00 38.50 ? 202 ASP B OD2 1 
ATOM   2353  N  N   . LEU B 1 119 ? 62.756 9.059   -30.066 1.00 34.89 ? 203 LEU B N   1 
ATOM   2354  C  CA  . LEU B 1 119 ? 64.149 9.295   -30.415 1.00 34.98 ? 203 LEU B CA  1 
ATOM   2355  C  C   . LEU B 1 119 ? 64.719 8.078   -31.103 1.00 36.43 ? 203 LEU B C   1 
ATOM   2356  O  O   . LEU B 1 119 ? 65.577 8.209   -31.924 1.00 37.92 ? 203 LEU B O   1 
ATOM   2357  C  CB  . LEU B 1 119 ? 64.970 9.653   -29.193 1.00 34.09 ? 203 LEU B CB  1 
ATOM   2358  C  CG  . LEU B 1 119 ? 64.463 10.940  -28.487 1.00 34.66 ? 203 LEU B CG  1 
ATOM   2359  C  CD1 . LEU B 1 119 ? 65.387 11.422  -27.378 1.00 31.02 ? 203 LEU B CD1 1 
ATOM   2360  C  CD2 . LEU B 1 119 ? 64.157 12.081  -29.436 1.00 30.46 ? 203 LEU B CD2 1 
ATOM   2361  N  N   . SER B 1 120 ? 64.204 6.892   -30.823 1.00 37.56 ? 204 SER B N   1 
ATOM   2362  C  CA  . SER B 1 120 ? 64.745 5.685   -31.417 1.00 38.20 ? 204 SER B CA  1 
ATOM   2363  C  C   . SER B 1 120 ? 64.571 5.604   -32.949 1.00 38.88 ? 204 SER B C   1 
ATOM   2364  O  O   . SER B 1 120 ? 65.297 4.874   -33.611 1.00 39.77 ? 204 SER B O   1 
ATOM   2365  C  CB  . SER B 1 120 ? 64.142 4.477   -30.730 1.00 37.85 ? 204 SER B CB  1 
ATOM   2366  O  OG  . SER B 1 120 ? 62.825 4.284   -31.232 1.00 40.10 ? 204 SER B OG  1 
ATOM   2367  N  N   . ARG B 1 121 ? 63.656 6.367   -33.522 1.00 38.33 ? 205 ARG B N   1 
ATOM   2368  C  CA  . ARG B 1 121 ? 63.453 6.287   -34.954 1.00 39.68 ? 205 ARG B CA  1 
ATOM   2369  C  C   . ARG B 1 121 ? 64.372 7.248   -35.715 1.00 40.26 ? 205 ARG B C   1 
ATOM   2370  O  O   . ARG B 1 121 ? 64.179 7.558   -36.899 1.00 38.59 ? 205 ARG B O   1 
ATOM   2371  C  CB  . ARG B 1 121 ? 61.992 6.596   -35.288 1.00 39.89 ? 205 ARG B CB  1 
ATOM   2372  C  CG  . ARG B 1 121 ? 61.046 5.680   -34.627 1.00 43.29 ? 205 ARG B CG  1 
ATOM   2373  C  CD  . ARG B 1 121 ? 59.717 6.354   -34.473 1.00 48.54 ? 205 ARG B CD  1 
ATOM   2374  N  NE  . ARG B 1 121 ? 58.620 5.741   -35.233 1.00 50.62 ? 205 ARG B NE  1 
ATOM   2375  C  CZ  . ARG B 1 121 ? 57.927 4.703   -34.788 1.00 51.57 ? 205 ARG B CZ  1 
ATOM   2376  N  NH1 . ARG B 1 121 ? 56.944 4.204   -35.523 1.00 48.97 ? 205 ARG B NH1 1 
ATOM   2377  N  NH2 . ARG B 1 121 ? 58.234 4.181   -33.590 1.00 51.37 ? 205 ARG B NH2 1 
ATOM   2378  N  N   . LEU B 1 122 ? 65.387 7.722   -35.018 1.00 41.50 ? 206 LEU B N   1 
ATOM   2379  C  CA  . LEU B 1 122 ? 66.242 8.772   -35.557 1.00 42.63 ? 206 LEU B CA  1 
ATOM   2380  C  C   . LEU B 1 122 ? 67.403 8.269   -36.395 1.00 42.29 ? 206 LEU B C   1 
ATOM   2381  O  O   . LEU B 1 122 ? 67.655 8.805   -37.437 1.00 43.45 ? 206 LEU B O   1 
ATOM   2382  C  CB  . LEU B 1 122 ? 66.759 9.660   -34.420 1.00 42.58 ? 206 LEU B CB  1 
ATOM   2383  C  CG  . LEU B 1 122 ? 66.371 11.125  -34.275 1.00 42.46 ? 206 LEU B CG  1 
ATOM   2384  C  CD1 . LEU B 1 122 ? 64.942 11.531  -34.724 1.00 41.41 ? 206 LEU B CD1 1 
ATOM   2385  C  CD2 . LEU B 1 122 ? 66.638 11.456  -32.812 1.00 42.27 ? 206 LEU B CD2 1 
ATOM   2386  N  N   . GLY B 1 123 ? 68.117 7.259   -35.946 1.00 42.56 ? 207 GLY B N   1 
ATOM   2387  C  CA  . GLY B 1 123 ? 69.332 6.860   -36.653 1.00 43.06 ? 207 GLY B CA  1 
ATOM   2388  C  C   . GLY B 1 123 ? 70.576 7.504   -36.043 1.00 43.34 ? 207 GLY B C   1 
ATOM   2389  O  O   . GLY B 1 123 ? 71.531 7.841   -36.760 1.00 43.16 ? 207 GLY B O   1 
ATOM   2390  N  N   . ARG B 1 124 ? 70.537 7.704   -34.722 1.00 42.82 ? 208 ARG B N   1 
ATOM   2391  C  CA  . ARG B 1 124 ? 71.669 8.179   -33.924 1.00 42.19 ? 208 ARG B CA  1 
ATOM   2392  C  C   . ARG B 1 124 ? 71.705 7.371   -32.639 1.00 42.45 ? 208 ARG B C   1 
ATOM   2393  O  O   . ARG B 1 124 ? 70.670 6.918   -32.178 1.00 43.04 ? 208 ARG B O   1 
ATOM   2394  C  CB  . ARG B 1 124 ? 71.515 9.643   -33.556 1.00 41.73 ? 208 ARG B CB  1 
ATOM   2395  C  CG  . ARG B 1 124 ? 71.247 10.564  -34.687 1.00 40.07 ? 208 ARG B CG  1 
ATOM   2396  C  CD  . ARG B 1 124 ? 72.512 10.845  -35.531 1.00 40.71 ? 208 ARG B CD  1 
ATOM   2397  N  NE  . ARG B 1 124 ? 72.169 10.690  -36.947 1.00 40.37 ? 208 ARG B NE  1 
ATOM   2398  C  CZ  . ARG B 1 124 ? 71.925 11.688  -37.760 1.00 39.50 ? 208 ARG B CZ  1 
ATOM   2399  N  NH1 . ARG B 1 124 ? 72.051 12.911  -37.304 1.00 41.71 ? 208 ARG B NH1 1 
ATOM   2400  N  NH2 . ARG B 1 124 ? 71.583 11.471  -39.018 1.00 36.09 ? 208 ARG B NH2 1 
ATOM   2401  N  N   . ASP B 1 125 ? 72.895 7.149   -32.091 1.00 43.03 ? 209 ASP B N   1 
ATOM   2402  C  CA  . ASP B 1 125 ? 73.053 6.621   -30.749 1.00 43.85 ? 209 ASP B CA  1 
ATOM   2403  C  C   . ASP B 1 125 ? 72.273 7.488   -29.766 1.00 44.14 ? 209 ASP B C   1 
ATOM   2404  O  O   . ASP B 1 125 ? 72.317 8.714   -29.841 1.00 44.41 ? 209 ASP B O   1 
ATOM   2405  C  CB  . ASP B 1 125 ? 74.512 6.663   -30.360 1.00 44.21 ? 209 ASP B CB  1 
ATOM   2406  C  CG  . ASP B 1 125 ? 74.839 5.715   -29.221 1.00 50.85 ? 209 ASP B CG  1 
ATOM   2407  O  OD1 . ASP B 1 125 ? 73.935 5.362   -28.398 1.00 53.01 ? 209 ASP B OD1 1 
ATOM   2408  O  OD2 . ASP B 1 125 ? 76.041 5.314   -29.144 1.00 60.05 ? 209 ASP B OD2 1 
ATOM   2409  N  N   . LEU B 1 126 ? 71.564 6.858   -28.835 1.00 44.54 ? 210 LEU B N   1 
ATOM   2410  C  CA  . LEU B 1 126 ? 70.685 7.579   -27.931 1.00 44.68 ? 210 LEU B CA  1 
ATOM   2411  C  C   . LEU B 1 126 ? 71.510 7.989   -26.795 1.00 44.31 ? 210 LEU B C   1 
ATOM   2412  O  O   . LEU B 1 126 ? 71.093 8.803   -25.957 1.00 44.46 ? 210 LEU B O   1 
ATOM   2413  C  CB  . LEU B 1 126 ? 69.519 6.711   -27.434 1.00 45.13 ? 210 LEU B CB  1 
ATOM   2414  C  CG  . LEU B 1 126 ? 68.480 6.457   -28.535 1.00 45.65 ? 210 LEU B CG  1 
ATOM   2415  C  CD1 . LEU B 1 126 ? 67.441 5.461   -28.132 1.00 45.08 ? 210 LEU B CD1 1 
ATOM   2416  C  CD2 . LEU B 1 126 ? 67.853 7.749   -28.969 1.00 46.42 ? 210 LEU B CD2 1 
ATOM   2417  N  N   . ARG B 1 127 ? 72.688 7.405   -26.750 1.00 43.99 ? 211 ARG B N   1 
ATOM   2418  C  CA  . ARG B 1 127 ? 73.687 7.865   -25.806 1.00 44.49 ? 211 ARG B CA  1 
ATOM   2419  C  C   . ARG B 1 127 ? 74.237 9.199   -26.304 1.00 43.14 ? 211 ARG B C   1 
ATOM   2420  O  O   . ARG B 1 127 ? 74.918 9.872   -25.557 1.00 43.11 ? 211 ARG B O   1 
ATOM   2421  C  CB  . ARG B 1 127 ? 74.803 6.825   -25.636 1.00 45.67 ? 211 ARG B CB  1 
ATOM   2422  C  CG  . ARG B 1 127 ? 74.473 5.711   -24.629 1.00 50.41 ? 211 ARG B CG  1 
ATOM   2423  C  CD  . ARG B 1 127 ? 75.320 4.450   -24.835 1.00 58.16 ? 211 ARG B CD  1 
ATOM   2424  N  NE  . ARG B 1 127 ? 76.728 4.761   -25.142 1.00 65.28 ? 211 ARG B NE  1 
ATOM   2425  C  CZ  . ARG B 1 127 ? 77.405 4.402   -26.246 1.00 66.71 ? 211 ARG B CZ  1 
ATOM   2426  N  NH1 . ARG B 1 127 ? 76.834 3.663   -27.207 1.00 63.68 ? 211 ARG B NH1 1 
ATOM   2427  N  NH2 . ARG B 1 127 ? 78.688 4.775   -26.364 1.00 66.21 ? 211 ARG B NH2 1 
ATOM   2428  N  N   . LYS B 1 128 ? 73.888 9.582   -27.536 1.00 41.61 ? 212 LYS B N   1 
ATOM   2429  C  CA  . LYS B 1 128 ? 74.291 10.838  -28.135 1.00 41.70 ? 212 LYS B CA  1 
ATOM   2430  C  C   . LYS B 1 128 ? 73.145 11.719  -28.644 1.00 40.81 ? 212 LYS B C   1 
ATOM   2431  O  O   . LYS B 1 128 ? 73.309 12.453  -29.635 1.00 41.34 ? 212 LYS B O   1 
ATOM   2432  C  CB  . LYS B 1 128 ? 75.178 10.529  -29.333 1.00 42.47 ? 212 LYS B CB  1 
ATOM   2433  C  CG  . LYS B 1 128 ? 76.399 9.728   -28.959 1.00 46.87 ? 212 LYS B CG  1 
ATOM   2434  C  CD  . LYS B 1 128 ? 77.521 10.622  -28.454 1.00 52.95 ? 212 LYS B CD  1 
ATOM   2435  C  CE  . LYS B 1 128 ? 78.348 11.089  -29.667 1.00 57.05 ? 212 LYS B CE  1 
ATOM   2436  N  NZ  . LYS B 1 128 ? 79.510 11.852  -29.193 1.00 60.29 ? 212 LYS B NZ  1 
ATOM   2437  N  N   . THR B 1 129 ? 71.990 11.664  -27.993 1.00 39.13 ? 213 THR B N   1 
ATOM   2438  C  CA  . THR B 1 129 ? 70.840 12.422  -28.429 1.00 37.23 ? 213 THR B CA  1 
ATOM   2439  C  C   . THR B 1 129 ? 70.217 13.067  -27.231 1.00 36.15 ? 213 THR B C   1 
ATOM   2440  O  O   . THR B 1 129 ? 70.234 12.484  -26.145 1.00 37.13 ? 213 THR B O   1 
ATOM   2441  C  CB  . THR B 1 129 ? 69.781 11.546  -29.076 1.00 37.89 ? 213 THR B CB  1 
ATOM   2442  O  OG1 . THR B 1 129 ? 70.318 10.923  -30.254 1.00 37.85 ? 213 THR B OG1 1 
ATOM   2443  C  CG2 . THR B 1 129 ? 68.590 12.389  -29.504 1.00 36.88 ? 213 THR B CG2 1 
ATOM   2444  N  N   . LEU B 1 130 ? 69.713 14.283  -27.433 1.00 33.47 ? 214 LEU B N   1 
ATOM   2445  C  CA  . LEU B 1 130 ? 68.911 15.002  -26.459 1.00 31.15 ? 214 LEU B CA  1 
ATOM   2446  C  C   . LEU B 1 130 ? 67.628 15.545  -27.112 1.00 29.72 ? 214 LEU B C   1 
ATOM   2447  O  O   . LEU B 1 130 ? 67.503 15.646  -28.356 1.00 28.05 ? 214 LEU B O   1 
ATOM   2448  C  CB  . LEU B 1 130 ? 69.692 16.161  -25.880 1.00 30.42 ? 214 LEU B CB  1 
ATOM   2449  C  CG  . LEU B 1 130 ? 70.969 15.786  -25.142 1.00 32.46 ? 214 LEU B CG  1 
ATOM   2450  C  CD1 . LEU B 1 130 ? 71.848 17.071  -24.915 1.00 33.50 ? 214 LEU B CD1 1 
ATOM   2451  C  CD2 . LEU B 1 130 ? 70.689 15.043  -23.811 1.00 28.59 ? 214 LEU B CD2 1 
ATOM   2452  N  N   . ILE B 1 131 ? 66.679 15.907  -26.262 1.00 28.03 ? 215 ILE B N   1 
ATOM   2453  C  CA  . ILE B 1 131 ? 65.456 16.534  -26.734 1.00 27.48 ? 215 ILE B CA  1 
ATOM   2454  C  C   . ILE B 1 131 ? 65.225 17.717  -25.845 1.00 27.57 ? 215 ILE B C   1 
ATOM   2455  O  O   . ILE B 1 131 ? 65.224 17.553  -24.636 1.00 29.16 ? 215 ILE B O   1 
ATOM   2456  C  CB  . ILE B 1 131 ? 64.223 15.537  -26.794 1.00 27.37 ? 215 ILE B CB  1 
ATOM   2457  C  CG1 . ILE B 1 131 ? 62.915 16.293  -27.063 1.00 27.08 ? 215 ILE B CG1 1 
ATOM   2458  C  CG2 . ILE B 1 131 ? 64.076 14.722  -25.526 1.00 25.91 ? 215 ILE B CG2 1 
ATOM   2459  C  CD1 . ILE B 1 131 ? 62.003 15.511  -27.878 1.00 23.87 ? 215 ILE B CD1 1 
ATOM   2460  N  N   . LEU B 1 132 ? 65.104 18.905  -26.428 1.00 26.60 ? 216 LEU B N   1 
ATOM   2461  C  CA  . LEU B 1 132 ? 64.683 20.086  -25.694 1.00 26.67 ? 216 LEU B CA  1 
ATOM   2462  C  C   . LEU B 1 132 ? 63.227 20.403  -26.041 1.00 26.60 ? 216 LEU B C   1 
ATOM   2463  O  O   . LEU B 1 132 ? 62.928 20.675  -27.212 1.00 26.92 ? 216 LEU B O   1 
ATOM   2464  C  CB  . LEU B 1 132 ? 65.550 21.258  -26.125 1.00 27.44 ? 216 LEU B CB  1 
ATOM   2465  C  CG  . LEU B 1 132 ? 65.264 22.700  -25.595 1.00 28.74 ? 216 LEU B CG  1 
ATOM   2466  C  CD1 . LEU B 1 132 ? 65.446 22.855  -24.058 1.00 23.69 ? 216 LEU B CD1 1 
ATOM   2467  C  CD2 . LEU B 1 132 ? 66.178 23.589  -26.337 1.00 30.01 ? 216 LEU B CD2 1 
ATOM   2468  N  N   . ASP B 1 133 ? 62.323 20.394  -25.071 1.00 26.62 ? 217 ASP B N   1 
ATOM   2469  C  CA  . ASP B 1 133 ? 60.869 20.479  -25.356 1.00 27.83 ? 217 ASP B CA  1 
ATOM   2470  C  C   . ASP B 1 133 ? 60.123 20.949  -24.104 1.00 27.55 ? 217 ASP B C   1 
ATOM   2471  O  O   . ASP B 1 133 ? 60.500 20.542  -22.990 1.00 27.43 ? 217 ASP B O   1 
ATOM   2472  C  CB  . ASP B 1 133 ? 60.405 19.088  -25.679 1.00 28.08 ? 217 ASP B CB  1 
ATOM   2473  C  CG  . ASP B 1 133 ? 59.122 19.043  -26.468 1.00 36.32 ? 217 ASP B CG  1 
ATOM   2474  O  OD1 . ASP B 1 133 ? 58.047 19.573  -26.038 1.00 43.69 ? 217 ASP B OD1 1 
ATOM   2475  O  OD2 . ASP B 1 133 ? 59.169 18.374  -27.535 1.00 46.02 ? 217 ASP B OD2 1 
ATOM   2476  N  N   . ASN B 1 134 ? 59.081 21.783  -24.245 1.00 27.09 ? 218 ASN B N   1 
ATOM   2477  C  CA  . ASN B 1 134 ? 58.286 22.183  -23.047 1.00 28.98 ? 218 ASN B CA  1 
ATOM   2478  C  C   . ASN B 1 134 ? 57.256 21.134  -22.616 1.00 28.73 ? 218 ASN B C   1 
ATOM   2479  O  O   . ASN B 1 134 ? 56.757 21.235  -21.519 1.00 29.50 ? 218 ASN B O   1 
ATOM   2480  C  CB  . ASN B 1 134 ? 57.488 23.469  -23.258 1.00 28.21 ? 218 ASN B CB  1 
ATOM   2481  C  CG  . ASN B 1 134 ? 56.580 23.328  -24.426 1.00 31.25 ? 218 ASN B CG  1 
ATOM   2482  O  OD1 . ASN B 1 134 ? 57.046 22.922  -25.511 1.00 33.38 ? 218 ASN B OD1 1 
ATOM   2483  N  ND2 . ASN B 1 134 ? 55.290 23.517  -24.223 1.00 25.68 ? 218 ASN B ND2 1 
ATOM   2484  N  N   . SER B 1 135 ? 56.897 20.181  -23.464 1.00 28.57 ? 219 SER B N   1 
ATOM   2485  C  CA  . SER B 1 135 ? 55.890 19.196  -23.054 1.00 29.94 ? 219 SER B CA  1 
ATOM   2486  C  C   . SER B 1 135 ? 56.467 17.854  -22.784 1.00 29.31 ? 219 SER B C   1 
ATOM   2487  O  O   . SER B 1 135 ? 57.014 17.236  -23.714 1.00 30.74 ? 219 SER B O   1 
ATOM   2488  C  CB  . SER B 1 135 ? 54.821 19.004  -24.122 1.00 29.63 ? 219 SER B CB  1 
ATOM   2489  O  OG  . SER B 1 135 ? 54.557 20.260  -24.698 1.00 35.38 ? 219 SER B OG  1 
ATOM   2490  N  N   . PRO B 1 136 ? 56.347 17.374  -21.536 1.00 28.56 ? 220 PRO B N   1 
ATOM   2491  C  CA  . PRO B 1 136 ? 56.782 16.017  -21.182 1.00 28.44 ? 220 PRO B CA  1 
ATOM   2492  C  C   . PRO B 1 136 ? 56.102 14.932  -22.040 1.00 29.55 ? 220 PRO B C   1 
ATOM   2493  O  O   . PRO B 1 136 ? 56.740 14.004  -22.447 1.00 29.54 ? 220 PRO B O   1 
ATOM   2494  C  CB  . PRO B 1 136 ? 56.444 15.921  -19.694 1.00 27.75 ? 220 PRO B CB  1 
ATOM   2495  C  CG  . PRO B 1 136 ? 56.466 17.340  -19.237 1.00 29.40 ? 220 PRO B CG  1 
ATOM   2496  C  CD  . PRO B 1 136 ? 55.889 18.124  -20.366 1.00 28.22 ? 220 PRO B CD  1 
ATOM   2497  N  N   . ALA B 1 137 ? 54.832 15.074  -22.375 1.00 31.40 ? 221 ALA B N   1 
ATOM   2498  C  CA  . ALA B 1 137 ? 54.236 14.165  -23.348 1.00 32.94 ? 221 ALA B CA  1 
ATOM   2499  C  C   . ALA B 1 137 ? 55.058 13.907  -24.588 1.00 33.83 ? 221 ALA B C   1 
ATOM   2500  O  O   . ALA B 1 137 ? 54.989 12.793  -25.118 1.00 34.18 ? 221 ALA B O   1 
ATOM   2501  C  CB  . ALA B 1 137 ? 52.883 14.614  -23.772 1.00 33.32 ? 221 ALA B CB  1 
ATOM   2502  N  N   . SER B 1 138 ? 55.798 14.916  -25.078 1.00 33.39 ? 222 SER B N   1 
ATOM   2503  C  CA  . SER B 1 138 ? 56.585 14.740  -26.294 1.00 32.52 ? 222 SER B CA  1 
ATOM   2504  C  C   . SER B 1 138 ? 57.709 13.698  -26.168 1.00 32.05 ? 222 SER B C   1 
ATOM   2505  O  O   . SER B 1 138 ? 58.145 13.124  -27.178 1.00 33.40 ? 222 SER B O   1 
ATOM   2506  C  CB  . SER B 1 138 ? 57.192 16.049  -26.704 1.00 33.77 ? 222 SER B CB  1 
ATOM   2507  O  OG  . SER B 1 138 ? 56.166 16.990  -26.960 1.00 37.18 ? 222 SER B OG  1 
ATOM   2508  N  N   . TYR B 1 139 ? 58.179 13.415  -24.961 1.00 29.96 ? 223 TYR B N   1 
ATOM   2509  C  CA  . TYR B 1 139 ? 59.315 12.527  -24.832 1.00 28.46 ? 223 TYR B CA  1 
ATOM   2510  C  C   . TYR B 1 139 ? 59.036 11.327  -23.925 1.00 28.26 ? 223 TYR B C   1 
ATOM   2511  O  O   . TYR B 1 139 ? 59.941 10.872  -23.171 1.00 26.27 ? 223 TYR B O   1 
ATOM   2512  C  CB  . TYR B 1 139 ? 60.583 13.292  -24.398 1.00 28.46 ? 223 TYR B CB  1 
ATOM   2513  C  CG  . TYR B 1 139 ? 60.481 14.235  -23.203 1.00 26.07 ? 223 TYR B CG  1 
ATOM   2514  C  CD1 . TYR B 1 139 ? 60.410 13.777  -21.894 1.00 24.77 ? 223 TYR B CD1 1 
ATOM   2515  C  CD2 . TYR B 1 139 ? 60.488 15.599  -23.406 1.00 29.15 ? 223 TYR B CD2 1 
ATOM   2516  C  CE1 . TYR B 1 139 ? 60.295 14.682  -20.809 1.00 21.61 ? 223 TYR B CE1 1 
ATOM   2517  C  CE2 . TYR B 1 139 ? 60.423 16.513  -22.352 1.00 26.80 ? 223 TYR B CE2 1 
ATOM   2518  C  CZ  . TYR B 1 139 ? 60.323 16.055  -21.061 1.00 26.60 ? 223 TYR B CZ  1 
ATOM   2519  O  OH  . TYR B 1 139 ? 60.266 17.017  -20.068 1.00 26.94 ? 223 TYR B OH  1 
ATOM   2520  N  N   . ILE B 1 140 ? 57.799 10.798  -24.070 1.00 27.59 ? 224 ILE B N   1 
ATOM   2521  C  CA  . ILE B 1 140 ? 57.245 9.730   -23.227 1.00 26.43 ? 224 ILE B CA  1 
ATOM   2522  C  C   . ILE B 1 140 ? 58.124 8.531   -23.325 1.00 26.80 ? 224 ILE B C   1 
ATOM   2523  O  O   . ILE B 1 140 ? 58.344 7.859   -22.364 1.00 27.41 ? 224 ILE B O   1 
ATOM   2524  C  CB  . ILE B 1 140 ? 55.773 9.396   -23.612 1.00 26.01 ? 224 ILE B CB  1 
ATOM   2525  C  CG1 . ILE B 1 140 ? 54.844 10.504  -23.134 1.00 27.22 ? 224 ILE B CG1 1 
ATOM   2526  C  CG2 . ILE B 1 140 ? 55.340 8.152   -22.944 1.00 26.10 ? 224 ILE B CG2 1 
ATOM   2527  C  CD1 . ILE B 1 140 ? 53.348 10.552  -23.751 1.00 26.05 ? 224 ILE B CD1 1 
ATOM   2528  N  N   . PHE B 1 141 ? 58.727 8.280   -24.473 1.00 28.25 ? 225 PHE B N   1 
ATOM   2529  C  CA  . PHE B 1 141 ? 59.504 7.054   -24.573 1.00 28.59 ? 225 PHE B CA  1 
ATOM   2530  C  C   . PHE B 1 141 ? 60.894 7.294   -24.114 1.00 29.69 ? 225 PHE B C   1 
ATOM   2531  O  O   . PHE B 1 141 ? 61.590 6.368   -23.850 1.00 30.49 ? 225 PHE B O   1 
ATOM   2532  C  CB  . PHE B 1 141 ? 59.520 6.502   -25.995 1.00 28.85 ? 225 PHE B CB  1 
ATOM   2533  C  CG  . PHE B 1 141 ? 58.156 6.299   -26.616 1.00 27.56 ? 225 PHE B CG  1 
ATOM   2534  C  CD1 . PHE B 1 141 ? 58.014 6.347   -27.986 1.00 30.98 ? 225 PHE B CD1 1 
ATOM   2535  C  CD2 . PHE B 1 141 ? 57.033 6.047   -25.853 1.00 26.53 ? 225 PHE B CD2 1 
ATOM   2536  C  CE1 . PHE B 1 141 ? 56.768 6.086   -28.597 1.00 31.93 ? 225 PHE B CE1 1 
ATOM   2537  C  CE2 . PHE B 1 141 ? 55.809 5.815   -26.432 1.00 27.78 ? 225 PHE B CE2 1 
ATOM   2538  C  CZ  . PHE B 1 141 ? 55.669 5.849   -27.809 1.00 30.33 ? 225 PHE B CZ  1 
ATOM   2539  N  N   . HIS B 1 142 ? 61.330 8.545   -24.005 1.00 30.59 ? 226 HIS B N   1 
ATOM   2540  C  CA  . HIS B 1 142 ? 62.723 8.777   -23.594 1.00 30.28 ? 226 HIS B CA  1 
ATOM   2541  C  C   . HIS B 1 142 ? 62.947 9.889   -22.566 1.00 30.33 ? 226 HIS B C   1 
ATOM   2542  O  O   . HIS B 1 142 ? 63.705 10.782  -22.829 1.00 28.34 ? 226 HIS B O   1 
ATOM   2543  C  CB  . HIS B 1 142 ? 63.514 9.100   -24.830 1.00 30.59 ? 226 HIS B CB  1 
ATOM   2544  C  CG  . HIS B 1 142 ? 63.403 8.051   -25.873 1.00 32.17 ? 226 HIS B CG  1 
ATOM   2545  N  ND1 . HIS B 1 142 ? 64.254 6.974   -25.925 1.00 33.18 ? 226 HIS B ND1 1 
ATOM   2546  C  CD2 . HIS B 1 142 ? 62.499 7.872   -26.862 1.00 32.45 ? 226 HIS B CD2 1 
ATOM   2547  C  CE1 . HIS B 1 142 ? 63.907 6.203   -26.938 1.00 31.71 ? 226 HIS B CE1 1 
ATOM   2548  N  NE2 . HIS B 1 142 ? 62.846 6.728   -27.523 1.00 29.86 ? 226 HIS B NE2 1 
ATOM   2549  N  N   . PRO B 1 143 ? 62.284 9.831   -21.394 1.00 30.40 ? 227 PRO B N   1 
ATOM   2550  C  CA  . PRO B 1 143 ? 62.401 10.991  -20.531 1.00 31.00 ? 227 PRO B CA  1 
ATOM   2551  C  C   . PRO B 1 143 ? 63.839 11.233  -20.096 1.00 32.50 ? 227 PRO B C   1 
ATOM   2552  O  O   . PRO B 1 143 ? 64.185 12.331  -19.665 1.00 33.18 ? 227 PRO B O   1 
ATOM   2553  C  CB  . PRO B 1 143 ? 61.577 10.583  -19.293 1.00 30.27 ? 227 PRO B CB  1 
ATOM   2554  C  CG  . PRO B 1 143 ? 61.545 9.089   -19.341 1.00 28.15 ? 227 PRO B CG  1 
ATOM   2555  C  CD  . PRO B 1 143 ? 61.416 8.806   -20.794 1.00 29.56 ? 227 PRO B CD  1 
ATOM   2556  N  N   . GLU B 1 144 ? 64.669 10.213  -20.129 1.00 33.91 ? 228 GLU B N   1 
ATOM   2557  C  CA  . GLU B 1 144 ? 66.033 10.424  -19.639 1.00 36.23 ? 228 GLU B CA  1 
ATOM   2558  C  C   . GLU B 1 144 ? 67.006 11.036  -20.703 1.00 36.23 ? 228 GLU B C   1 
ATOM   2559  O  O   . GLU B 1 144 ? 68.178 11.285  -20.455 1.00 36.44 ? 228 GLU B O   1 
ATOM   2560  C  CB  . GLU B 1 144 ? 66.533 9.169   -18.929 1.00 37.23 ? 228 GLU B CB  1 
ATOM   2561  C  CG  . GLU B 1 144 ? 66.750 8.012   -19.836 1.00 45.01 ? 228 GLU B CG  1 
ATOM   2562  C  CD  . GLU B 1 144 ? 65.440 7.284   -20.289 1.00 55.37 ? 228 GLU B CD  1 
ATOM   2563  O  OE1 . GLU B 1 144 ? 65.444 6.876   -21.500 1.00 57.20 ? 228 GLU B OE1 1 
ATOM   2564  O  OE2 . GLU B 1 144 ? 64.470 7.112   -19.464 1.00 52.42 ? 228 GLU B OE2 1 
ATOM   2565  N  N   . ASN B 1 145 ? 66.462 11.363  -21.874 1.00 35.89 ? 229 ASN B N   1 
ATOM   2566  C  CA  . ASN B 1 145 ? 67.153 12.142  -22.835 1.00 35.19 ? 229 ASN B CA  1 
ATOM   2567  C  C   . ASN B 1 145 ? 66.666 13.588  -22.826 1.00 34.94 ? 229 ASN B C   1 
ATOM   2568  O  O   . ASN B 1 145 ? 67.068 14.350  -23.700 1.00 36.40 ? 229 ASN B O   1 
ATOM   2569  C  CB  . ASN B 1 145 ? 66.925 11.565  -24.221 1.00 34.96 ? 229 ASN B CB  1 
ATOM   2570  C  CG  . ASN B 1 145 ? 67.781 10.361  -24.482 1.00 36.80 ? 229 ASN B CG  1 
ATOM   2571  O  OD1 . ASN B 1 145 ? 67.399 9.256   -24.124 1.00 36.34 ? 229 ASN B OD1 1 
ATOM   2572  N  ND2 . ASN B 1 145 ? 68.976 10.565  -25.089 1.00 35.40 ? 229 ASN B ND2 1 
ATOM   2573  N  N   . ALA B 1 146 ? 65.795 13.969  -21.897 1.00 32.52 ? 230 ALA B N   1 
ATOM   2574  C  CA  . ALA B 1 146 ? 65.157 15.273  -21.979 1.00 31.79 ? 230 ALA B CA  1 
ATOM   2575  C  C   . ALA B 1 146 ? 65.941 16.332  -21.257 1.00 32.30 ? 230 ALA B C   1 
ATOM   2576  O  O   . ALA B 1 146 ? 66.474 16.099  -20.189 1.00 32.24 ? 230 ALA B O   1 
ATOM   2577  C  CB  . ALA B 1 146 ? 63.747 15.233  -21.416 1.00 31.40 ? 230 ALA B CB  1 
ATOM   2578  N  N   . VAL B 1 147 ? 66.038 17.498  -21.870 1.00 32.92 ? 231 VAL B N   1 
ATOM   2579  C  CA  . VAL B 1 147 ? 66.420 18.706  -21.155 1.00 33.18 ? 231 VAL B CA  1 
ATOM   2580  C  C   . VAL B 1 147 ? 65.149 19.580  -21.104 1.00 32.82 ? 231 VAL B C   1 
ATOM   2581  O  O   . VAL B 1 147 ? 64.806 20.216  -22.066 1.00 32.22 ? 231 VAL B O   1 
ATOM   2582  C  CB  . VAL B 1 147 ? 67.556 19.431  -21.873 1.00 33.22 ? 231 VAL B CB  1 
ATOM   2583  C  CG1 . VAL B 1 147 ? 67.961 20.671  -21.091 1.00 33.06 ? 231 VAL B CG1 1 
ATOM   2584  C  CG2 . VAL B 1 147 ? 68.768 18.476  -22.056 1.00 33.89 ? 231 VAL B CG2 1 
ATOM   2585  N  N   . PRO B 1 148 ? 64.405 19.525  -20.008 1.00 33.19 ? 232 PRO B N   1 
ATOM   2586  C  CA  . PRO B 1 148 ? 63.152 20.272  -20.015 1.00 34.30 ? 232 PRO B CA  1 
ATOM   2587  C  C   . PRO B 1 148 ? 63.356 21.768  -19.930 1.00 34.33 ? 232 PRO B C   1 
ATOM   2588  O  O   . PRO B 1 148 ? 64.370 22.224  -19.416 1.00 35.77 ? 232 PRO B O   1 
ATOM   2589  C  CB  . PRO B 1 148 ? 62.390 19.741  -18.796 1.00 33.66 ? 232 PRO B CB  1 
ATOM   2590  C  CG  . PRO B 1 148 ? 63.131 18.463  -18.412 1.00 34.13 ? 232 PRO B CG  1 
ATOM   2591  C  CD  . PRO B 1 148 ? 64.561 18.746  -18.777 1.00 33.12 ? 232 PRO B CD  1 
ATOM   2592  N  N   . VAL B 1 149 ? 62.424 22.492  -20.533 1.00 33.26 ? 233 VAL B N   1 
ATOM   2593  C  CA  . VAL B 1 149 ? 62.446 23.881  -20.549 1.00 33.10 ? 233 VAL B CA  1 
ATOM   2594  C  C   . VAL B 1 149 ? 61.000 24.237  -20.286 1.00 33.66 ? 233 VAL B C   1 
ATOM   2595  O  O   . VAL B 1 149 ? 60.114 23.515  -20.689 1.00 33.99 ? 233 VAL B O   1 
ATOM   2596  C  CB  . VAL B 1 149 ? 62.997 24.373  -21.929 1.00 33.99 ? 233 VAL B CB  1 
ATOM   2597  C  CG1 . VAL B 1 149 ? 62.217 23.786  -23.122 1.00 33.34 ? 233 VAL B CG1 1 
ATOM   2598  C  CG2 . VAL B 1 149 ? 63.042 25.847  -21.989 1.00 33.77 ? 233 VAL B CG2 1 
ATOM   2599  N  N   . GLN B 1 150 ? 60.750 25.346  -19.605 1.00 34.29 ? 234 GLN B N   1 
ATOM   2600  C  CA  . GLN B 1 150 ? 59.412 25.705  -19.273 1.00 34.81 ? 234 GLN B CA  1 
ATOM   2601  C  C   . GLN B 1 150 ? 58.854 26.397  -20.481 1.00 34.01 ? 234 GLN B C   1 
ATOM   2602  O  O   . GLN B 1 150 ? 59.581 26.996  -21.312 1.00 34.97 ? 234 GLN B O   1 
ATOM   2603  C  CB  . GLN B 1 150 ? 59.368 26.576  -18.026 1.00 34.68 ? 234 GLN B CB  1 
ATOM   2604  C  CG  . GLN B 1 150 ? 59.575 28.072  -18.225 1.00 38.70 ? 234 GLN B CG  1 
ATOM   2605  C  CD  . GLN B 1 150 ? 59.695 28.868  -16.876 1.00 40.39 ? 234 GLN B CD  1 
ATOM   2606  O  OE1 . GLN B 1 150 ? 58.970 29.825  -16.661 1.00 46.09 ? 234 GLN B OE1 1 
ATOM   2607  N  NE2 . GLN B 1 150 ? 60.634 28.473  -16.000 1.00 44.24 ? 234 GLN B NE2 1 
ATOM   2608  N  N   . SER B 1 151 ? 57.552 26.248  -20.607 1.00 32.09 ? 235 SER B N   1 
ATOM   2609  C  CA  . SER B 1 151 ? 56.780 26.869  -21.647 1.00 29.97 ? 235 SER B CA  1 
ATOM   2610  C  C   . SER B 1 151 ? 57.030 28.365  -21.741 1.00 29.46 ? 235 SER B C   1 
ATOM   2611  O  O   . SER B 1 151 ? 57.142 29.032  -20.726 1.00 29.19 ? 235 SER B O   1 
ATOM   2612  C  CB  . SER B 1 151 ? 55.306 26.574  -21.334 1.00 29.12 ? 235 SER B CB  1 
ATOM   2613  O  OG  . SER B 1 151 ? 55.098 25.193  -21.513 1.00 26.20 ? 235 SER B OG  1 
ATOM   2614  N  N   . TRP B 1 152 ? 57.105 28.896  -22.963 1.00 29.15 ? 236 TRP B N   1 
ATOM   2615  C  CA  . TRP B 1 152 ? 57.102 30.338  -23.159 1.00 27.79 ? 236 TRP B CA  1 
ATOM   2616  C  C   . TRP B 1 152 ? 55.896 30.789  -23.974 1.00 29.27 ? 236 TRP B C   1 
ATOM   2617  O  O   . TRP B 1 152 ? 55.510 30.129  -24.917 1.00 30.73 ? 236 TRP B O   1 
ATOM   2618  C  CB  . TRP B 1 152 ? 58.373 30.797  -23.818 1.00 25.84 ? 236 TRP B CB  1 
ATOM   2619  C  CG  . TRP B 1 152 ? 58.435 32.266  -23.885 1.00 24.49 ? 236 TRP B CG  1 
ATOM   2620  C  CD1 . TRP B 1 152 ? 58.762 33.150  -22.855 1.00 24.40 ? 236 TRP B CD1 1 
ATOM   2621  C  CD2 . TRP B 1 152 ? 58.172 33.067  -25.027 1.00 23.49 ? 236 TRP B CD2 1 
ATOM   2622  N  NE1 . TRP B 1 152 ? 58.692 34.463  -23.312 1.00 24.60 ? 236 TRP B NE1 1 
ATOM   2623  C  CE2 . TRP B 1 152 ? 58.305 34.432  -24.631 1.00 26.17 ? 236 TRP B CE2 1 
ATOM   2624  C  CE3 . TRP B 1 152 ? 57.792 32.772  -26.351 1.00 22.89 ? 236 TRP B CE3 1 
ATOM   2625  C  CZ2 . TRP B 1 152 ? 58.069 35.479  -25.513 1.00 25.48 ? 236 TRP B CZ2 1 
ATOM   2626  C  CZ3 . TRP B 1 152 ? 57.580 33.781  -27.219 1.00 24.10 ? 236 TRP B CZ3 1 
ATOM   2627  C  CH2 . TRP B 1 152 ? 57.733 35.148  -26.804 1.00 25.86 ? 236 TRP B CH2 1 
ATOM   2628  N  N   . PHE B 1 153 ? 55.340 31.937  -23.622 1.00 30.22 ? 237 PHE B N   1 
ATOM   2629  C  CA  . PHE B 1 153 ? 54.107 32.451  -24.200 1.00 31.18 ? 237 PHE B CA  1 
ATOM   2630  C  C   . PHE B 1 153 ? 54.303 33.904  -24.588 1.00 33.03 ? 237 PHE B C   1 
ATOM   2631  O  O   . PHE B 1 153 ? 54.270 34.244  -25.742 1.00 35.27 ? 237 PHE B O   1 
ATOM   2632  C  CB  . PHE B 1 153 ? 52.946 32.338  -23.186 1.00 30.13 ? 237 PHE B CB  1 
ATOM   2633  C  CG  . PHE B 1 153 ? 52.624 30.910  -22.780 1.00 29.11 ? 237 PHE B CG  1 
ATOM   2634  C  CD1 . PHE B 1 153 ? 53.090 30.393  -21.565 1.00 27.07 ? 237 PHE B CD1 1 
ATOM   2635  C  CD2 . PHE B 1 153 ? 51.878 30.077  -23.632 1.00 24.95 ? 237 PHE B CD2 1 
ATOM   2636  C  CE1 . PHE B 1 153 ? 52.805 29.065  -21.185 1.00 29.26 ? 237 PHE B CE1 1 
ATOM   2637  C  CE2 . PHE B 1 153 ? 51.602 28.760  -23.263 1.00 28.85 ? 237 PHE B CE2 1 
ATOM   2638  C  CZ  . PHE B 1 153 ? 52.049 28.252  -22.021 1.00 28.13 ? 237 PHE B CZ  1 
ATOM   2639  N  N   . ASP B 1 154 ? 54.555 34.772  -23.642 1.00 35.15 ? 238 ASP B N   1 
ATOM   2640  C  CA  . ASP B 1 154 ? 54.864 36.126  -24.016 1.00 37.25 ? 238 ASP B CA  1 
ATOM   2641  C  C   . ASP B 1 154 ? 55.682 36.963  -23.007 1.00 37.12 ? 238 ASP B C   1 
ATOM   2642  O  O   . ASP B 1 154 ? 55.743 38.151  -23.150 1.00 38.54 ? 238 ASP B O   1 
ATOM   2643  C  CB  . ASP B 1 154 ? 53.570 36.839  -24.410 1.00 38.20 ? 238 ASP B CB  1 
ATOM   2644  C  CG  . ASP B 1 154 ? 52.605 37.023  -23.223 1.00 42.21 ? 238 ASP B CG  1 
ATOM   2645  O  OD1 . ASP B 1 154 ? 52.928 36.661  -22.051 1.00 43.49 ? 238 ASP B OD1 1 
ATOM   2646  O  OD2 . ASP B 1 154 ? 51.512 37.564  -23.503 1.00 48.08 ? 238 ASP B OD2 1 
ATOM   2647  N  N   . ASP B 1 155 ? 56.322 36.335  -22.033 1.00 36.90 ? 239 ASP B N   1 
ATOM   2648  C  CA  . ASP B 1 155 ? 57.071 36.978  -20.975 1.00 37.33 ? 239 ASP B CA  1 
ATOM   2649  C  C   . ASP B 1 155 ? 58.384 37.489  -21.552 1.00 38.09 ? 239 ASP B C   1 
ATOM   2650  O  O   . ASP B 1 155 ? 59.312 36.712  -21.768 1.00 38.27 ? 239 ASP B O   1 
ATOM   2651  C  CB  . ASP B 1 155 ? 57.330 35.915  -19.873 1.00 37.17 ? 239 ASP B CB  1 
ATOM   2652  C  CG  . ASP B 1 155 ? 58.123 36.441  -18.654 1.00 40.88 ? 239 ASP B CG  1 
ATOM   2653  O  OD1 . ASP B 1 155 ? 58.352 37.654  -18.467 1.00 42.85 ? 239 ASP B OD1 1 
ATOM   2654  O  OD2 . ASP B 1 155 ? 58.525 35.595  -17.840 1.00 45.66 ? 239 ASP B OD2 1 
ATOM   2655  N  N   . MET B 1 156 ? 58.475 38.793  -21.818 1.00 39.15 ? 240 MET B N   1 
ATOM   2656  C  CA  . MET B 1 156 ? 59.749 39.372  -22.319 1.00 39.36 ? 240 MET B CA  1 
ATOM   2657  C  C   . MET B 1 156 ? 60.963 39.362  -21.340 1.00 38.98 ? 240 MET B C   1 
ATOM   2658  O  O   . MET B 1 156 ? 62.091 39.614  -21.755 1.00 39.73 ? 240 MET B O   1 
ATOM   2659  C  CB  . MET B 1 156 ? 59.533 40.737  -22.949 1.00 39.50 ? 240 MET B CB  1 
ATOM   2660  C  CG  . MET B 1 156 ? 58.726 40.766  -24.314 1.00 42.32 ? 240 MET B CG  1 
ATOM   2661  S  SD  . MET B 1 156 ? 58.879 39.447  -25.575 1.00 41.60 ? 240 MET B SD  1 
ATOM   2662  C  CE  . MET B 1 156 ? 60.580 39.602  -25.980 1.00 48.61 ? 240 MET B CE  1 
ATOM   2663  N  N   . ALA B 1 157 ? 60.742 39.012  -20.080 1.00 37.24 ? 241 ALA B N   1 
ATOM   2664  C  CA  . ALA B 1 157 ? 61.815 38.805  -19.107 1.00 35.59 ? 241 ALA B CA  1 
ATOM   2665  C  C   . ALA B 1 157 ? 62.343 37.370  -19.068 1.00 35.03 ? 241 ALA B C   1 
ATOM   2666  O  O   . ALA B 1 157 ? 63.156 37.057  -18.217 1.00 35.23 ? 241 ALA B O   1 
ATOM   2667  C  CB  . ALA B 1 157 ? 61.308 39.186  -17.666 1.00 35.12 ? 241 ALA B CB  1 
ATOM   2668  N  N   . ASP B 1 158 ? 61.862 36.480  -19.926 1.00 34.72 ? 242 ASP B N   1 
ATOM   2669  C  CA  . ASP B 1 158 ? 62.324 35.094  -19.905 1.00 34.64 ? 242 ASP B CA  1 
ATOM   2670  C  C   . ASP B 1 158 ? 63.782 35.047  -20.325 1.00 35.85 ? 242 ASP B C   1 
ATOM   2671  O  O   . ASP B 1 158 ? 64.180 35.730  -21.272 1.00 36.20 ? 242 ASP B O   1 
ATOM   2672  C  CB  . ASP B 1 158 ? 61.532 34.252  -20.886 1.00 33.17 ? 242 ASP B CB  1 
ATOM   2673  C  CG  . ASP B 1 158 ? 61.868 32.756  -20.812 1.00 33.16 ? 242 ASP B CG  1 
ATOM   2674  O  OD1 . ASP B 1 158 ? 62.681 32.235  -21.574 1.00 36.59 ? 242 ASP B OD1 1 
ATOM   2675  O  OD2 . ASP B 1 158 ? 61.291 32.040  -20.024 1.00 32.99 ? 242 ASP B OD2 1 
ATOM   2676  N  N   . THR B 1 159 ? 64.567 34.218  -19.658 1.00 36.89 ? 243 THR B N   1 
ATOM   2677  C  CA  . THR B 1 159 ? 65.979 34.118  -19.950 1.00 38.37 ? 243 THR B CA  1 
ATOM   2678  C  C   . THR B 1 159 ? 66.416 32.632  -19.984 1.00 38.04 ? 243 THR B C   1 
ATOM   2679  O  O   . THR B 1 159 ? 67.583 32.325  -19.880 1.00 38.44 ? 243 THR B O   1 
ATOM   2680  C  CB  . THR B 1 159 ? 66.825 34.968  -18.889 1.00 38.30 ? 243 THR B CB  1 
ATOM   2681  O  OG1 . THR B 1 159 ? 66.663 34.390  -17.615 1.00 41.84 ? 243 THR B OG1 1 
ATOM   2682  C  CG2 . THR B 1 159 ? 66.274 36.365  -18.686 1.00 38.34 ? 243 THR B CG2 1 
ATOM   2683  N  N   . GLU B 1 160 ? 65.473 31.719  -20.138 1.00 38.27 ? 244 GLU B N   1 
ATOM   2684  C  CA  . GLU B 1 160 ? 65.756 30.281  -20.020 1.00 38.54 ? 244 GLU B CA  1 
ATOM   2685  C  C   . GLU B 1 160 ? 66.616 29.791  -21.145 1.00 37.93 ? 244 GLU B C   1 
ATOM   2686  O  O   . GLU B 1 160 ? 67.450 28.924  -20.955 1.00 39.89 ? 244 GLU B O   1 
ATOM   2687  C  CB  . GLU B 1 160 ? 64.469 29.466  -19.996 1.00 39.62 ? 244 GLU B CB  1 
ATOM   2688  C  CG  . GLU B 1 160 ? 63.791 29.316  -18.612 1.00 47.01 ? 244 GLU B CG  1 
ATOM   2689  C  CD  . GLU B 1 160 ? 64.157 27.944  -17.975 1.00 59.14 ? 244 GLU B CD  1 
ATOM   2690  O  OE1 . GLU B 1 160 ? 65.382 27.858  -17.585 1.00 62.64 ? 244 GLU B OE1 1 
ATOM   2691  O  OE2 . GLU B 1 160 ? 63.272 26.975  -17.929 1.00 56.37 ? 244 GLU B OE2 1 
ATOM   2692  N  N   . LEU B 1 161 ? 66.439 30.325  -22.336 1.00 36.86 ? 245 LEU B N   1 
ATOM   2693  C  CA  . LEU B 1 161 ? 67.258 29.891  -23.446 1.00 36.50 ? 245 LEU B CA  1 
ATOM   2694  C  C   . LEU B 1 161 ? 68.703 30.298  -23.163 1.00 36.70 ? 245 LEU B C   1 
ATOM   2695  O  O   . LEU B 1 161 ? 69.632 29.562  -23.424 1.00 36.83 ? 245 LEU B O   1 
ATOM   2696  C  CB  . LEU B 1 161 ? 66.736 30.475  -24.774 1.00 36.33 ? 245 LEU B CB  1 
ATOM   2697  C  CG  . LEU B 1 161 ? 65.413 29.915  -25.341 1.00 34.87 ? 245 LEU B CG  1 
ATOM   2698  C  CD1 . LEU B 1 161 ? 65.255 30.311  -26.785 1.00 33.33 ? 245 LEU B CD1 1 
ATOM   2699  C  CD2 . LEU B 1 161 ? 65.257 28.353  -25.187 1.00 29.99 ? 245 LEU B CD2 1 
ATOM   2700  N  N   . LEU B 1 162 ? 68.881 31.469  -22.582 1.00 36.91 ? 246 LEU B N   1 
ATOM   2701  C  CA  . LEU B 1 162 ? 70.205 31.904  -22.229 1.00 37.04 ? 246 LEU B CA  1 
ATOM   2702  C  C   . LEU B 1 162 ? 70.786 31.104  -21.061 1.00 37.16 ? 246 LEU B C   1 
ATOM   2703  O  O   . LEU B 1 162 ? 71.932 30.636  -21.146 1.00 36.96 ? 246 LEU B O   1 
ATOM   2704  C  CB  . LEU B 1 162 ? 70.183 33.378  -21.942 1.00 36.94 ? 246 LEU B CB  1 
ATOM   2705  C  CG  . LEU B 1 162 ? 71.412 34.092  -22.429 1.00 38.02 ? 246 LEU B CG  1 
ATOM   2706  C  CD1 . LEU B 1 162 ? 71.621 33.748  -23.946 1.00 36.86 ? 246 LEU B CD1 1 
ATOM   2707  C  CD2 . LEU B 1 162 ? 71.098 35.529  -22.188 1.00 37.34 ? 246 LEU B CD2 1 
ATOM   2708  N  N   . ASN B 1 163 ? 69.987 30.877  -20.016 1.00 35.97 ? 247 ASN B N   1 
ATOM   2709  C  CA  . ASN B 1 163 ? 70.417 30.003  -18.980 1.00 35.81 ? 247 ASN B CA  1 
ATOM   2710  C  C   . ASN B 1 163 ? 70.762 28.573  -19.423 1.00 36.09 ? 247 ASN B C   1 
ATOM   2711  O  O   . ASN B 1 163 ? 71.513 27.868  -18.752 1.00 35.78 ? 247 ASN B O   1 
ATOM   2712  C  CB  . ASN B 1 163 ? 69.435 30.026  -17.840 1.00 36.35 ? 247 ASN B CB  1 
ATOM   2713  C  CG  . ASN B 1 163 ? 69.406 31.384  -17.138 1.00 38.13 ? 247 ASN B CG  1 
ATOM   2714  O  OD1 . ASN B 1 163 ? 70.436 32.049  -17.033 1.00 41.73 ? 247 ASN B OD1 1 
ATOM   2715  N  ND2 . ASN B 1 163 ? 68.237 31.798  -16.656 1.00 36.15 ? 247 ASN B ND2 1 
ATOM   2716  N  N   . LEU B 1 164 ? 70.283 28.135  -20.574 1.00 35.73 ? 248 LEU B N   1 
ATOM   2717  C  CA  . LEU B 1 164 ? 70.528 26.770  -20.918 1.00 34.91 ? 248 LEU B CA  1 
ATOM   2718  C  C   . LEU B 1 164 ? 71.843 26.607  -21.632 1.00 35.84 ? 248 LEU B C   1 
ATOM   2719  O  O   . LEU B 1 164 ? 72.405 25.503  -21.656 1.00 35.37 ? 248 LEU B O   1 
ATOM   2720  C  CB  . LEU B 1 164 ? 69.374 26.239  -21.757 1.00 35.64 ? 248 LEU B CB  1 
ATOM   2721  C  CG  . LEU B 1 164 ? 68.071 25.757  -21.106 1.00 33.83 ? 248 LEU B CG  1 
ATOM   2722  C  CD1 . LEU B 1 164 ? 67.103 25.454  -22.173 1.00 33.18 ? 248 LEU B CD1 1 
ATOM   2723  C  CD2 . LEU B 1 164 ? 68.336 24.527  -20.386 1.00 31.48 ? 248 LEU B CD2 1 
ATOM   2724  N  N   . ILE B 1 165 ? 72.368 27.697  -22.209 1.00 36.91 ? 249 ILE B N   1 
ATOM   2725  C  CA  . ILE B 1 165 ? 73.697 27.607  -22.901 1.00 37.36 ? 249 ILE B CA  1 
ATOM   2726  C  C   . ILE B 1 165 ? 74.872 27.064  -22.019 1.00 37.36 ? 249 ILE B C   1 
ATOM   2727  O  O   . ILE B 1 165 ? 75.533 26.094  -22.417 1.00 38.45 ? 249 ILE B O   1 
ATOM   2728  C  CB  . ILE B 1 165 ? 74.118 28.893  -23.506 1.00 37.65 ? 249 ILE B CB  1 
ATOM   2729  C  CG1 . ILE B 1 165 ? 73.261 29.194  -24.714 1.00 35.85 ? 249 ILE B CG1 1 
ATOM   2730  C  CG2 . ILE B 1 165 ? 75.624 28.824  -23.851 1.00 37.39 ? 249 ILE B CG2 1 
ATOM   2731  C  CD1 . ILE B 1 165 ? 73.224 30.622  -25.008 1.00 35.77 ? 249 ILE B CD1 1 
ATOM   2732  N  N   . PRO B 1 166 ? 75.112 27.628  -20.832 1.00 36.05 ? 250 PRO B N   1 
ATOM   2733  C  CA  . PRO B 1 166 ? 76.182 26.939  -20.150 1.00 38.42 ? 250 PRO B CA  1 
ATOM   2734  C  C   . PRO B 1 166 ? 75.845 25.450  -19.932 1.00 40.07 ? 250 PRO B C   1 
ATOM   2735  O  O   . PRO B 1 166 ? 76.736 24.618  -19.844 1.00 40.94 ? 250 PRO B O   1 
ATOM   2736  C  CB  . PRO B 1 166 ? 76.281 27.677  -18.798 1.00 37.91 ? 250 PRO B CB  1 
ATOM   2737  C  CG  . PRO B 1 166 ? 75.003 28.302  -18.648 1.00 36.39 ? 250 PRO B CG  1 
ATOM   2738  C  CD  . PRO B 1 166 ? 74.604 28.723  -20.024 1.00 35.88 ? 250 PRO B CD  1 
ATOM   2739  N  N   . ILE B 1 167 ? 74.558 25.117  -19.899 1.00 41.10 ? 251 ILE B N   1 
ATOM   2740  C  CA  . ILE B 1 167 ? 74.182 23.737  -19.596 1.00 40.35 ? 251 ILE B CA  1 
ATOM   2741  C  C   . ILE B 1 167 ? 74.502 22.850  -20.771 1.00 39.34 ? 251 ILE B C   1 
ATOM   2742  O  O   . ILE B 1 167 ? 75.110 21.796  -20.606 1.00 38.51 ? 251 ILE B O   1 
ATOM   2743  C  CB  . ILE B 1 167 ? 72.738 23.658  -19.048 1.00 40.43 ? 251 ILE B CB  1 
ATOM   2744  C  CG1 . ILE B 1 167 ? 72.784 24.188  -17.607 1.00 40.45 ? 251 ILE B CG1 1 
ATOM   2745  C  CG2 . ILE B 1 167 ? 72.219 22.236  -19.119 1.00 40.03 ? 251 ILE B CG2 1 
ATOM   2746  C  CD1 . ILE B 1 167 ? 71.560 23.927  -16.756 1.00 47.96 ? 251 ILE B CD1 1 
ATOM   2747  N  N   . PHE B 1 168 ? 74.153 23.317  -21.961 1.00 39.45 ? 252 PHE B N   1 
ATOM   2748  C  CA  . PHE B 1 168 ? 74.478 22.592  -23.170 1.00 39.98 ? 252 PHE B CA  1 
ATOM   2749  C  C   . PHE B 1 168 ? 75.956 22.627  -23.453 1.00 40.97 ? 252 PHE B C   1 
ATOM   2750  O  O   . PHE B 1 168 ? 76.465 21.751  -24.122 1.00 40.66 ? 252 PHE B O   1 
ATOM   2751  C  CB  . PHE B 1 168 ? 73.721 23.131  -24.372 1.00 38.84 ? 252 PHE B CB  1 
ATOM   2752  C  CG  . PHE B 1 168 ? 72.361 22.549  -24.512 1.00 39.50 ? 252 PHE B CG  1 
ATOM   2753  C  CD1 . PHE B 1 168 ? 71.229 23.299  -24.210 1.00 38.98 ? 252 PHE B CD1 1 
ATOM   2754  C  CD2 . PHE B 1 168 ? 72.194 21.244  -24.900 1.00 38.26 ? 252 PHE B CD2 1 
ATOM   2755  C  CE1 . PHE B 1 168 ? 69.983 22.758  -24.326 1.00 36.96 ? 252 PHE B CE1 1 
ATOM   2756  C  CE2 . PHE B 1 168 ? 70.919 20.705  -25.027 1.00 38.17 ? 252 PHE B CE2 1 
ATOM   2757  C  CZ  . PHE B 1 168 ? 69.824 21.454  -24.708 1.00 37.18 ? 252 PHE B CZ  1 
ATOM   2758  N  N   . GLU B 1 169 ? 76.639 23.651  -22.953 1.00 42.50 ? 253 GLU B N   1 
ATOM   2759  C  CA  . GLU B 1 169 ? 78.079 23.762  -23.153 1.00 43.05 ? 253 GLU B CA  1 
ATOM   2760  C  C   . GLU B 1 169 ? 78.798 22.637  -22.441 1.00 44.12 ? 253 GLU B C   1 
ATOM   2761  O  O   . GLU B 1 169 ? 79.771 22.116  -22.945 1.00 44.28 ? 253 GLU B O   1 
ATOM   2762  C  CB  . GLU B 1 169 ? 78.586 25.166  -22.773 1.00 42.24 ? 253 GLU B CB  1 
ATOM   2763  C  CG  . GLU B 1 169 ? 78.580 26.019  -23.995 1.00 41.78 ? 253 GLU B CG  1 
ATOM   2764  C  CD  . GLU B 1 169 ? 79.018 27.468  -23.839 1.00 44.87 ? 253 GLU B CD  1 
ATOM   2765  O  OE1 . GLU B 1 169 ? 78.971 28.039  -22.708 1.00 43.82 ? 253 GLU B OE1 1 
ATOM   2766  O  OE2 . GLU B 1 169 ? 79.379 28.051  -24.913 1.00 44.35 ? 253 GLU B OE2 1 
ATOM   2767  N  N   . GLU B 1 170 ? 78.287 22.241  -21.289 1.00 45.92 ? 254 GLU B N   1 
ATOM   2768  C  CA  . GLU B 1 170 ? 78.874 21.144  -20.518 1.00 48.66 ? 254 GLU B CA  1 
ATOM   2769  C  C   . GLU B 1 170 ? 78.664 19.754  -21.121 1.00 48.61 ? 254 GLU B C   1 
ATOM   2770  O  O   . GLU B 1 170 ? 79.474 18.868  -20.912 1.00 49.72 ? 254 GLU B O   1 
ATOM   2771  C  CB  . GLU B 1 170 ? 78.331 21.135  -19.089 1.00 49.04 ? 254 GLU B CB  1 
ATOM   2772  C  CG  . GLU B 1 170 ? 79.151 20.247  -18.122 1.00 56.65 ? 254 GLU B CG  1 
ATOM   2773  C  CD  . GLU B 1 170 ? 79.963 21.080  -17.120 1.00 66.55 ? 254 GLU B CD  1 
ATOM   2774  O  OE1 . GLU B 1 170 ? 81.227 21.091  -17.215 1.00 69.61 ? 254 GLU B OE1 1 
ATOM   2775  O  OE2 . GLU B 1 170 ? 79.324 21.744  -16.248 1.00 69.46 ? 254 GLU B OE2 1 
ATOM   2776  N  N   . LEU B 1 171 ? 77.553 19.579  -21.828 1.00 48.77 ? 255 LEU B N   1 
ATOM   2777  C  CA  . LEU B 1 171 ? 77.111 18.312  -22.388 1.00 47.51 ? 255 LEU B CA  1 
ATOM   2778  C  C   . LEU B 1 171 ? 77.683 18.111  -23.799 1.00 47.89 ? 255 LEU B C   1 
ATOM   2779  O  O   . LEU B 1 171 ? 77.794 16.980  -24.271 1.00 48.28 ? 255 LEU B O   1 
ATOM   2780  C  CB  . LEU B 1 171 ? 75.558 18.263  -22.453 1.00 46.01 ? 255 LEU B CB  1 
ATOM   2781  C  CG  . LEU B 1 171 ? 74.622 18.384  -21.217 1.00 44.55 ? 255 LEU B CG  1 
ATOM   2782  C  CD1 . LEU B 1 171 ? 73.190 18.405  -21.641 1.00 40.37 ? 255 LEU B CD1 1 
ATOM   2783  C  CD2 . LEU B 1 171 ? 74.750 17.334  -20.073 1.00 42.30 ? 255 LEU B CD2 1 
ATOM   2784  N  N   . SER B 1 172 ? 78.030 19.200  -24.467 1.00 47.64 ? 256 SER B N   1 
ATOM   2785  C  CA  . SER B 1 172 ? 78.397 19.188  -25.875 1.00 48.15 ? 256 SER B CA  1 
ATOM   2786  C  C   . SER B 1 172 ? 79.485 18.174  -26.231 1.00 49.60 ? 256 SER B C   1 
ATOM   2787  O  O   . SER B 1 172 ? 79.455 17.553  -27.304 1.00 49.05 ? 256 SER B O   1 
ATOM   2788  C  CB  . SER B 1 172 ? 78.860 20.581  -26.299 1.00 48.10 ? 256 SER B CB  1 
ATOM   2789  O  OG  . SER B 1 172 ? 80.039 20.925  -25.620 1.00 45.26 ? 256 SER B OG  1 
ATOM   2790  N  N   . GLY B 1 173 ? 80.434 18.008  -25.324 1.00 50.63 ? 257 GLY B N   1 
ATOM   2791  C  CA  . GLY B 1 173 ? 81.506 17.084  -25.555 1.00 53.61 ? 257 GLY B CA  1 
ATOM   2792  C  C   . GLY B 1 173 ? 81.411 15.834  -24.710 1.00 55.52 ? 257 GLY B C   1 
ATOM   2793  O  O   . GLY B 1 173 ? 82.441 15.245  -24.385 1.00 55.96 ? 257 GLY B O   1 
ATOM   2794  N  N   . ALA B 1 174 ? 80.189 15.441  -24.333 1.00 56.36 ? 258 ALA B N   1 
ATOM   2795  C  CA  . ALA B 1 174 ? 79.983 14.174  -23.628 1.00 56.68 ? 258 ALA B CA  1 
ATOM   2796  C  C   . ALA B 1 174 ? 79.890 13.043  -24.612 1.00 57.11 ? 258 ALA B C   1 
ATOM   2797  O  O   . ALA B 1 174 ? 79.633 13.226  -25.795 1.00 57.20 ? 258 ALA B O   1 
ATOM   2798  C  CB  . ALA B 1 174 ? 78.747 14.206  -22.723 1.00 56.27 ? 258 ALA B CB  1 
ATOM   2799  N  N   . GLU B 1 175 ? 80.121 11.857  -24.091 1.00 58.75 ? 259 GLU B N   1 
ATOM   2800  C  CA  . GLU B 1 175 ? 80.148 10.653  -24.886 1.00 59.94 ? 259 GLU B CA  1 
ATOM   2801  C  C   . GLU B 1 175 ? 78.958 9.843   -24.460 1.00 59.07 ? 259 GLU B C   1 
ATOM   2802  O  O   . GLU B 1 175 ? 78.426 9.061   -25.235 1.00 58.98 ? 259 GLU B O   1 
ATOM   2803  C  CB  . GLU B 1 175 ? 81.459 9.900   -24.611 1.00 61.40 ? 259 GLU B CB  1 
ATOM   2804  C  CG  . GLU B 1 175 ? 82.695 10.585  -25.252 1.00 65.62 ? 259 GLU B CG  1 
ATOM   2805  C  CD  . GLU B 1 175 ? 82.586 10.542  -26.759 1.00 71.24 ? 259 GLU B CD  1 
ATOM   2806  O  OE1 . GLU B 1 175 ? 82.152 9.461   -27.218 1.00 74.93 ? 259 GLU B OE1 1 
ATOM   2807  O  OE2 . GLU B 1 175 ? 82.893 11.551  -27.466 1.00 71.88 ? 259 GLU B OE2 1 
ATOM   2808  N  N   . ASP B 1 176 ? 78.541 10.055  -23.212 1.00 58.23 ? 260 ASP B N   1 
ATOM   2809  C  CA  . ASP B 1 176 ? 77.325 9.466   -22.712 1.00 57.13 ? 260 ASP B CA  1 
ATOM   2810  C  C   . ASP B 1 176 ? 76.459 10.466  -21.916 1.00 55.40 ? 260 ASP B C   1 
ATOM   2811  O  O   . ASP B 1 176 ? 76.708 10.770  -20.723 1.00 54.78 ? 260 ASP B O   1 
ATOM   2812  C  CB  . ASP B 1 176 ? 77.620 8.182   -21.936 1.00 57.81 ? 260 ASP B CB  1 
ATOM   2813  C  CG  . ASP B 1 176 ? 76.358 7.461   -21.544 1.00 60.94 ? 260 ASP B CG  1 
ATOM   2814  O  OD1 . ASP B 1 176 ? 75.717 7.873   -20.546 1.00 63.39 ? 260 ASP B OD1 1 
ATOM   2815  O  OD2 . ASP B 1 176 ? 75.983 6.503   -22.250 1.00 65.28 ? 260 ASP B OD2 1 
ATOM   2816  N  N   . VAL B 1 177 ? 75.404 10.928  -22.589 1.00 53.15 ? 261 VAL B N   1 
ATOM   2817  C  CA  . VAL B 1 177 ? 74.558 11.983  -22.059 1.00 50.16 ? 261 VAL B CA  1 
ATOM   2818  C  C   . VAL B 1 177 ? 73.718 11.512  -20.899 1.00 49.90 ? 261 VAL B C   1 
ATOM   2819  O  O   . VAL B 1 177 ? 73.348 12.332  -20.060 1.00 49.42 ? 261 VAL B O   1 
ATOM   2820  C  CB  . VAL B 1 177 ? 73.679 12.645  -23.122 1.00 49.47 ? 261 VAL B CB  1 
ATOM   2821  C  CG1 . VAL B 1 177 ? 74.507 13.105  -24.268 1.00 47.95 ? 261 VAL B CG1 1 
ATOM   2822  C  CG2 . VAL B 1 177 ? 72.645 11.707  -23.575 1.00 48.74 ? 261 VAL B CG2 1 
ATOM   2823  N  N   . TYR B 1 178 ? 73.420 10.212  -20.802 1.00 49.20 ? 262 TYR B N   1 
ATOM   2824  C  CA  . TYR B 1 178 ? 72.813 9.740   -19.528 1.00 48.58 ? 262 TYR B CA  1 
ATOM   2825  C  C   . TYR B 1 178 ? 73.793 9.952   -18.372 1.00 49.27 ? 262 TYR B C   1 
ATOM   2826  O  O   . TYR B 1 178 ? 73.377 10.282  -17.269 1.00 49.13 ? 262 TYR B O   1 
ATOM   2827  C  CB  . TYR B 1 178 ? 72.301 8.292   -19.568 1.00 46.72 ? 262 TYR B CB  1 
ATOM   2828  C  CG  . TYR B 1 178 ? 71.442 7.964   -20.763 1.00 46.57 ? 262 TYR B CG  1 
ATOM   2829  C  CD1 . TYR B 1 178 ? 71.840 7.003   -21.698 1.00 46.42 ? 262 TYR B CD1 1 
ATOM   2830  C  CD2 . TYR B 1 178 ? 70.260 8.636   -20.994 1.00 43.90 ? 262 TYR B CD2 1 
ATOM   2831  C  CE1 . TYR B 1 178 ? 71.056 6.702   -22.816 1.00 44.60 ? 262 TYR B CE1 1 
ATOM   2832  C  CE2 . TYR B 1 178 ? 69.474 8.353   -22.095 1.00 44.93 ? 262 TYR B CE2 1 
ATOM   2833  C  CZ  . TYR B 1 178 ? 69.866 7.390   -23.013 1.00 46.01 ? 262 TYR B CZ  1 
ATOM   2834  O  OH  . TYR B 1 178 ? 69.059 7.115   -24.108 1.00 43.52 ? 262 TYR B OH  1 
ATOM   2835  N  N   . THR B 1 179 ? 75.094 9.802   -18.636 1.00 50.52 ? 263 THR B N   1 
ATOM   2836  C  CA  . THR B 1 179 ? 76.081 9.988   -17.589 1.00 51.78 ? 263 THR B CA  1 
ATOM   2837  C  C   . THR B 1 179 ? 76.193 11.477  -17.239 1.00 52.54 ? 263 THR B C   1 
ATOM   2838  O  O   . THR B 1 179 ? 76.018 11.846  -16.065 1.00 53.42 ? 263 THR B O   1 
ATOM   2839  C  CB  . THR B 1 179 ? 77.491 9.396   -17.935 1.00 52.83 ? 263 THR B CB  1 
ATOM   2840  O  OG1 . THR B 1 179 ? 77.393 8.042   -18.430 1.00 52.06 ? 263 THR B OG1 1 
ATOM   2841  C  CG2 . THR B 1 179 ? 78.393 9.440   -16.698 1.00 51.62 ? 263 THR B CG2 1 
ATOM   2842  N  N   . SER B 1 180 ? 76.449 12.343  -18.225 1.00 52.11 ? 264 SER B N   1 
ATOM   2843  C  CA  . SER B 1 180 ? 76.484 13.772  -17.915 1.00 51.92 ? 264 SER B CA  1 
ATOM   2844  C  C   . SER B 1 180 ? 75.171 14.311  -17.331 1.00 52.08 ? 264 SER B C   1 
ATOM   2845  O  O   . SER B 1 180 ? 75.187 14.978  -16.318 1.00 52.02 ? 264 SER B O   1 
ATOM   2846  C  CB  . SER B 1 180 ? 76.864 14.599  -19.122 1.00 52.01 ? 264 SER B CB  1 
ATOM   2847  O  OG  . SER B 1 180 ? 77.765 13.915  -19.949 1.00 52.32 ? 264 SER B OG  1 
ATOM   2848  N  N   . LEU B 1 181 ? 74.029 14.044  -17.946 1.00 52.92 ? 265 LEU B N   1 
ATOM   2849  C  CA  . LEU B 1 181 ? 72.810 14.615  -17.395 1.00 54.50 ? 265 LEU B CA  1 
ATOM   2850  C  C   . LEU B 1 181 ? 72.788 14.310  -15.909 1.00 57.47 ? 265 LEU B C   1 
ATOM   2851  O  O   . LEU B 1 181 ? 72.469 15.194  -15.090 1.00 57.56 ? 265 LEU B O   1 
ATOM   2852  C  CB  . LEU B 1 181 ? 71.553 14.109  -18.082 1.00 52.79 ? 265 LEU B CB  1 
ATOM   2853  C  CG  . LEU B 1 181 ? 71.292 14.680  -19.485 1.00 51.56 ? 265 LEU B CG  1 
ATOM   2854  C  CD1 . LEU B 1 181 ? 70.191 13.905  -20.170 1.00 48.72 ? 265 LEU B CD1 1 
ATOM   2855  C  CD2 . LEU B 1 181 ? 70.972 16.131  -19.482 1.00 47.45 ? 265 LEU B CD2 1 
ATOM   2856  N  N   . GLY B 1 182 ? 73.192 13.073  -15.577 1.00 60.15 ? 266 GLY B N   1 
ATOM   2857  C  CA  . GLY B 1 182 ? 73.168 12.547  -14.212 1.00 63.38 ? 266 GLY B CA  1 
ATOM   2858  C  C   . GLY B 1 182 ? 74.094 13.277  -13.253 1.00 65.66 ? 266 GLY B C   1 
ATOM   2859  O  O   . GLY B 1 182 ? 73.655 13.757  -12.198 1.00 66.08 ? 266 GLY B O   1 
ATOM   2860  N  N   . GLN B 1 183 ? 75.370 13.382  -13.617 1.00 67.35 ? 267 GLN B N   1 
ATOM   2861  C  CA  . GLN B 1 183 ? 76.342 14.072  -12.757 1.00 69.23 ? 267 GLN B CA  1 
ATOM   2862  C  C   . GLN B 1 183 ? 76.142 15.603  -12.768 1.00 70.14 ? 267 GLN B C   1 
ATOM   2863  O  O   . GLN B 1 183 ? 77.037 16.365  -12.379 1.00 70.62 ? 267 GLN B O   1 
ATOM   2864  C  CB  . GLN B 1 183 ? 77.787 13.694  -13.131 1.00 69.05 ? 267 GLN B CB  1 
ATOM   2865  C  CG  . GLN B 1 183 ? 78.310 14.320  -14.451 1.00 70.29 ? 267 GLN B CG  1 
ATOM   2866  C  CD  . GLN B 1 183 ? 79.590 13.647  -14.982 1.00 69.76 ? 267 GLN B CD  1 
ATOM   2867  O  OE1 . GLN B 1 183 ? 80.330 13.015  -14.224 1.00 70.93 ? 267 GLN B OE1 1 
ATOM   2868  N  NE2 . GLN B 1 183 ? 79.855 13.801  -16.280 1.00 68.74 ? 267 GLN B NE2 1 
ATOM   2869  N  N   . LEU B 1 184 ? 74.974 16.048  -13.213 1.00 70.58 ? 268 LEU B N   1 
ATOM   2870  C  CA  . LEU B 1 184 ? 74.656 17.450  -13.181 1.00 71.39 ? 268 LEU B CA  1 
ATOM   2871  C  C   . LEU B 1 184 ? 73.603 17.540  -12.129 1.00 71.76 ? 268 LEU B C   1 
ATOM   2872  O  O   . LEU B 1 184 ? 73.780 18.197  -11.096 1.00 72.23 ? 268 LEU B O   1 
ATOM   2873  C  CB  . LEU B 1 184 ? 74.038 17.853  -14.505 1.00 72.24 ? 268 LEU B CB  1 
ATOM   2874  C  CG  . LEU B 1 184 ? 74.306 19.193  -15.193 1.00 72.89 ? 268 LEU B CG  1 
ATOM   2875  C  CD1 . LEU B 1 184 ? 75.720 19.236  -15.792 1.00 74.69 ? 268 LEU B CD1 1 
ATOM   2876  C  CD2 . LEU B 1 184 ? 73.279 19.333  -16.291 1.00 72.89 ? 268 LEU B CD2 1 
ATOM   2877  N  N   . ARG B 1 185 ? 72.516 16.814  -12.386 1.00 72.12 ? 269 ARG B N   1 
ATOM   2878  C  CA  . ARG B 1 185 ? 71.269 16.853  -11.585 1.00 72.28 ? 269 ARG B CA  1 
ATOM   2879  C  C   . ARG B 1 185 ? 71.370 16.317  -10.129 1.00 71.76 ? 269 ARG B C   1 
ATOM   2880  O  O   . ARG B 1 185 ? 72.448 16.248  -9.538  1.00 71.01 ? 269 ARG B O   1 
ATOM   2881  C  CB  . ARG B 1 185 ? 70.137 16.131  -12.342 1.00 71.90 ? 269 ARG B CB  1 
ATOM   2882  C  CG  . ARG B 1 185 ? 69.821 16.718  -13.717 1.00 72.21 ? 269 ARG B CG  1 
ATOM   2883  C  CD  . ARG B 1 185 ? 68.958 15.801  -14.599 1.00 72.20 ? 269 ARG B CD  1 
ATOM   2884  N  NE  . ARG B 1 185 ? 68.507 16.560  -15.762 1.00 73.95 ? 269 ARG B NE  1 
ATOM   2885  C  CZ  . ARG B 1 185 ? 67.913 16.072  -16.851 1.00 72.79 ? 269 ARG B CZ  1 
ATOM   2886  N  NH1 . ARG B 1 185 ? 67.659 14.775  -16.989 1.00 72.84 ? 269 ARG B NH1 1 
ATOM   2887  N  NH2 . ARG B 1 185 ? 67.588 16.908  -17.824 1.00 71.32 ? 269 ARG B NH2 1 
ATOM   2888  N  N   . LEU C 1 6   ? 38.243 16.378  -30.044 1.00 32.82 ? 90  LEU C N   1 
ATOM   2889  C  CA  . LEU C 1 6   ? 37.687 16.801  -28.686 1.00 35.99 ? 90  LEU C CA  1 
ATOM   2890  C  C   . LEU C 1 6   ? 36.137 17.055  -28.594 1.00 35.61 ? 90  LEU C C   1 
ATOM   2891  O  O   . LEU C 1 6   ? 35.435 16.348  -27.871 1.00 35.64 ? 90  LEU C O   1 
ATOM   2892  C  CB  . LEU C 1 6   ? 38.445 17.973  -28.116 1.00 34.95 ? 90  LEU C CB  1 
ATOM   2893  C  CG  . LEU C 1 6   ? 38.720 17.895  -26.621 1.00 36.52 ? 90  LEU C CG  1 
ATOM   2894  C  CD1 . LEU C 1 6   ? 39.434 16.577  -26.203 1.00 36.97 ? 90  LEU C CD1 1 
ATOM   2895  C  CD2 . LEU C 1 6   ? 39.460 19.140  -26.081 1.00 36.36 ? 90  LEU C CD2 1 
ATOM   2896  N  N   . LEU C 1 7   ? 35.619 18.038  -29.320 1.00 35.40 ? 91  LEU C N   1 
ATOM   2897  C  CA  . LEU C 1 7   ? 34.161 18.082  -29.597 1.00 35.81 ? 91  LEU C CA  1 
ATOM   2898  C  C   . LEU C 1 7   ? 33.801 17.349  -30.889 1.00 36.59 ? 91  LEU C C   1 
ATOM   2899  O  O   . LEU C 1 7   ? 34.663 17.132  -31.718 1.00 34.85 ? 91  LEU C O   1 
ATOM   2900  C  CB  . LEU C 1 7   ? 33.630 19.521  -29.619 1.00 33.94 ? 91  LEU C CB  1 
ATOM   2901  C  CG  . LEU C 1 7   ? 33.747 20.227  -28.277 1.00 32.62 ? 91  LEU C CG  1 
ATOM   2902  C  CD1 . LEU C 1 7   ? 33.380 21.726  -28.354 1.00 31.53 ? 91  LEU C CD1 1 
ATOM   2903  C  CD2 . LEU C 1 7   ? 32.856 19.484  -27.313 1.00 29.07 ? 91  LEU C CD2 1 
ATOM   2904  N  N   . PRO C 1 8   ? 32.523 16.950  -31.038 1.00 38.58 ? 92  PRO C N   1 
ATOM   2905  C  CA  . PRO C 1 8   ? 31.899 16.466  -32.303 1.00 40.18 ? 92  PRO C CA  1 
ATOM   2906  C  C   . PRO C 1 8   ? 31.749 17.621  -33.258 1.00 42.10 ? 92  PRO C C   1 
ATOM   2907  O  O   . PRO C 1 8   ? 31.960 18.735  -32.871 1.00 42.83 ? 92  PRO C O   1 
ATOM   2908  C  CB  . PRO C 1 8   ? 30.481 16.065  -31.897 1.00 39.36 ? 92  PRO C CB  1 
ATOM   2909  C  CG  . PRO C 1 8   ? 30.395 16.198  -30.422 1.00 39.36 ? 92  PRO C CG  1 
ATOM   2910  C  CD  . PRO C 1 8   ? 31.582 16.947  -29.907 1.00 38.62 ? 92  PRO C CD  1 
ATOM   2911  N  N   . GLU C 1 9   ? 31.361 17.363  -34.495 1.00 45.16 ? 93  GLU C N   1 
ATOM   2912  C  CA  . GLU C 1 9   ? 31.017 18.441  -35.415 1.00 48.71 ? 93  GLU C CA  1 
ATOM   2913  C  C   . GLU C 1 9   ? 29.791 19.132  -34.816 1.00 47.57 ? 93  GLU C C   1 
ATOM   2914  O  O   . GLU C 1 9   ? 28.908 18.472  -34.267 1.00 47.06 ? 93  GLU C O   1 
ATOM   2915  C  CB  . GLU C 1 9   ? 30.681 17.869  -36.822 1.00 48.67 ? 93  GLU C CB  1 
ATOM   2916  C  CG  . GLU C 1 9   ? 31.373 16.501  -37.129 1.00 53.86 ? 93  GLU C CG  1 
ATOM   2917  C  CD  . GLU C 1 9   ? 30.832 15.717  -38.373 1.00 54.10 ? 93  GLU C CD  1 
ATOM   2918  O  OE1 . GLU C 1 9   ? 30.844 14.460  -38.261 1.00 60.14 ? 93  GLU C OE1 1 
ATOM   2919  O  OE2 . GLU C 1 9   ? 30.427 16.320  -39.430 1.00 56.53 ? 93  GLU C OE2 1 
ATOM   2920  N  N   . VAL C 1 10  ? 29.736 20.444  -34.933 1.00 48.47 ? 94  VAL C N   1 
ATOM   2921  C  CA  . VAL C 1 10  ? 28.572 21.208  -34.457 1.00 50.15 ? 94  VAL C CA  1 
ATOM   2922  C  C   . VAL C 1 10  ? 27.262 20.774  -35.102 1.00 51.55 ? 94  VAL C C   1 
ATOM   2923  O  O   . VAL C 1 10  ? 27.158 20.652  -36.334 1.00 53.03 ? 94  VAL C O   1 
ATOM   2924  C  CB  . VAL C 1 10  ? 28.746 22.708  -34.679 1.00 49.68 ? 94  VAL C CB  1 
ATOM   2925  C  CG1 . VAL C 1 10  ? 28.932 22.999  -36.171 1.00 51.29 ? 94  VAL C CG1 1 
ATOM   2926  C  CG2 . VAL C 1 10  ? 27.565 23.459  -34.172 1.00 48.34 ? 94  VAL C CG2 1 
ATOM   2927  N  N   . THR C 1 11  ? 26.259 20.553  -34.269 1.00 52.36 ? 95  THR C N   1 
ATOM   2928  C  CA  . THR C 1 11  ? 24.962 20.137  -34.747 1.00 53.14 ? 95  THR C CA  1 
ATOM   2929  C  C   . THR C 1 11  ? 24.297 21.268  -35.457 1.00 54.56 ? 95  THR C C   1 
ATOM   2930  O  O   . THR C 1 11  ? 24.765 22.381  -35.386 1.00 54.00 ? 95  THR C O   1 
ATOM   2931  C  CB  . THR C 1 11  ? 24.052 19.737  -33.594 1.00 53.15 ? 95  THR C CB  1 
ATOM   2932  O  OG1 . THR C 1 11  ? 23.793 20.884  -32.776 1.00 50.12 ? 95  THR C OG1 1 
ATOM   2933  C  CG2 . THR C 1 11  ? 24.683 18.572  -32.790 1.00 51.00 ? 95  THR C CG2 1 
ATOM   2934  N  N   . GLU C 1 12  ? 23.182 20.959  -36.118 1.00 57.74 ? 96  GLU C N   1 
ATOM   2935  C  CA  . GLU C 1 12  ? 22.452 21.899  -36.996 1.00 61.28 ? 96  GLU C CA  1 
ATOM   2936  C  C   . GLU C 1 12  ? 21.989 23.195  -36.337 1.00 60.73 ? 96  GLU C C   1 
ATOM   2937  O  O   . GLU C 1 12  ? 22.148 24.262  -36.910 1.00 60.95 ? 96  GLU C O   1 
ATOM   2938  C  CB  . GLU C 1 12  ? 21.272 21.191  -37.688 1.00 61.13 ? 96  GLU C CB  1 
ATOM   2939  C  CG  . GLU C 1 12  ? 21.596 20.643  -39.113 1.00 65.40 ? 96  GLU C CG  1 
ATOM   2940  C  CD  . GLU C 1 12  ? 20.547 19.625  -39.630 1.00 66.61 ? 96  GLU C CD  1 
ATOM   2941  O  OE1 . GLU C 1 12  ? 19.411 19.585  -39.060 1.00 72.22 ? 96  GLU C OE1 1 
ATOM   2942  O  OE2 . GLU C 1 12  ? 20.863 18.867  -40.602 1.00 71.33 ? 96  GLU C OE2 1 
ATOM   2943  N  N   . GLU C 1 13  ? 21.444 23.125  -35.133 1.00 61.69 ? 97  GLU C N   1 
ATOM   2944  C  CA  . GLU C 1 13  ? 20.988 24.357  -34.517 1.00 63.70 ? 97  GLU C CA  1 
ATOM   2945  C  C   . GLU C 1 13  ? 22.057 25.273  -33.897 1.00 63.03 ? 97  GLU C C   1 
ATOM   2946  O  O   . GLU C 1 13  ? 21.794 26.452  -33.723 1.00 63.42 ? 97  GLU C O   1 
ATOM   2947  C  CB  . GLU C 1 13  ? 19.845 24.111  -33.542 1.00 65.14 ? 97  GLU C CB  1 
ATOM   2948  C  CG  . GLU C 1 13  ? 20.243 23.405  -32.271 1.00 70.85 ? 97  GLU C CG  1 
ATOM   2949  C  CD  . GLU C 1 13  ? 19.241 23.687  -31.163 1.00 79.11 ? 97  GLU C CD  1 
ATOM   2950  O  OE1 . GLU C 1 13  ? 18.982 24.915  -30.913 1.00 78.92 ? 97  GLU C OE1 1 
ATOM   2951  O  OE2 . GLU C 1 13  ? 18.728 22.680  -30.563 1.00 81.91 ? 97  GLU C OE2 1 
ATOM   2952  N  N   . ASP C 1 14  ? 23.252 24.771  -33.591 1.00 62.15 ? 98  ASP C N   1 
ATOM   2953  C  CA  . ASP C 1 14  ? 24.338 25.675  -33.201 1.00 61.71 ? 98  ASP C CA  1 
ATOM   2954  C  C   . ASP C 1 14  ? 25.245 26.219  -34.341 1.00 61.91 ? 98  ASP C C   1 
ATOM   2955  O  O   . ASP C 1 14  ? 26.290 26.837  -34.035 1.00 61.88 ? 98  ASP C O   1 
ATOM   2956  C  CB  . ASP C 1 14  ? 25.200 25.038  -32.122 1.00 61.53 ? 98  ASP C CB  1 
ATOM   2957  C  CG  . ASP C 1 14  ? 24.449 24.823  -30.825 1.00 62.10 ? 98  ASP C CG  1 
ATOM   2958  O  OD1 . ASP C 1 14  ? 24.011 25.830  -30.215 1.00 63.07 ? 98  ASP C OD1 1 
ATOM   2959  O  OD2 . ASP C 1 14  ? 24.319 23.651  -30.398 1.00 61.38 ? 98  ASP C OD2 1 
ATOM   2960  N  N   . GLN C 1 15  ? 24.835 26.036  -35.611 1.00 61.13 ? 99  GLN C N   1 
ATOM   2961  C  CA  . GLN C 1 15  ? 25.677 26.264  -36.810 1.00 61.58 ? 99  GLN C CA  1 
ATOM   2962  C  C   . GLN C 1 15  ? 26.702 27.425  -36.782 1.00 59.57 ? 99  GLN C C   1 
ATOM   2963  O  O   . GLN C 1 15  ? 27.910 27.172  -36.891 1.00 61.41 ? 99  GLN C O   1 
ATOM   2964  C  CB  . GLN C 1 15  ? 24.854 26.302  -38.127 1.00 62.02 ? 99  GLN C CB  1 
ATOM   2965  C  CG  . GLN C 1 15  ? 25.000 25.054  -39.073 1.00 65.07 ? 99  GLN C CG  1 
ATOM   2966  C  CD  . GLN C 1 15  ? 23.725 24.779  -39.962 1.00 65.81 ? 99  GLN C CD  1 
ATOM   2967  O  OE1 . GLN C 1 15  ? 23.234 25.668  -40.685 1.00 70.89 ? 99  GLN C OE1 1 
ATOM   2968  N  NE2 . GLN C 1 15  ? 23.205 23.542  -39.896 1.00 69.02 ? 99  GLN C NE2 1 
ATOM   2969  N  N   . GLY C 1 16  ? 26.281 28.679  -36.682 1.00 56.11 ? 100 GLY C N   1 
ATOM   2970  C  CA  . GLY C 1 16  ? 27.285 29.754  -36.725 1.00 51.80 ? 100 GLY C CA  1 
ATOM   2971  C  C   . GLY C 1 16  ? 27.323 30.436  -35.373 1.00 49.88 ? 100 GLY C C   1 
ATOM   2972  O  O   . GLY C 1 16  ? 27.411 31.666  -35.257 1.00 49.91 ? 100 GLY C O   1 
ATOM   2973  N  N   . ARG C 1 17  ? 27.200 29.632  -34.330 1.00 46.77 ? 101 ARG C N   1 
ATOM   2974  C  CA  . ARG C 1 17  ? 27.219 30.168  -33.002 1.00 44.21 ? 101 ARG C CA  1 
ATOM   2975  C  C   . ARG C 1 17  ? 28.653 30.054  -32.493 1.00 41.94 ? 101 ARG C C   1 
ATOM   2976  O  O   . ARG C 1 17  ? 29.387 29.161  -32.856 1.00 42.49 ? 101 ARG C O   1 
ATOM   2977  C  CB  . ARG C 1 17  ? 26.311 29.346  -32.100 1.00 43.88 ? 101 ARG C CB  1 
ATOM   2978  C  CG  . ARG C 1 17  ? 24.877 29.488  -32.355 1.00 43.88 ? 101 ARG C CG  1 
ATOM   2979  C  CD  . ARG C 1 17  ? 24.144 29.112  -31.075 1.00 48.43 ? 101 ARG C CD  1 
ATOM   2980  N  NE  . ARG C 1 17  ? 22.715 29.003  -31.306 1.00 50.30 ? 101 ARG C NE  1 
ATOM   2981  C  CZ  . ARG C 1 17  ? 21.797 28.772  -30.370 1.00 52.11 ? 101 ARG C CZ  1 
ATOM   2982  N  NH1 . ARG C 1 17  ? 22.125 28.623  -29.075 1.00 51.59 ? 101 ARG C NH1 1 
ATOM   2983  N  NH2 . ARG C 1 17  ? 20.532 28.704  -30.747 1.00 49.36 ? 101 ARG C NH2 1 
ATOM   2984  N  N   . ILE C 1 18  ? 29.039 30.975  -31.653 1.00 39.20 ? 102 ILE C N   1 
ATOM   2985  C  CA  . ILE C 1 18  ? 30.275 30.869  -30.915 1.00 36.56 ? 102 ILE C CA  1 
ATOM   2986  C  C   . ILE C 1 18  ? 30.117 29.791  -29.837 1.00 35.25 ? 102 ILE C C   1 
ATOM   2987  O  O   . ILE C 1 18  ? 29.076 29.675  -29.186 1.00 34.88 ? 102 ILE C O   1 
ATOM   2988  C  CB  . ILE C 1 18  ? 30.643 32.263  -30.333 1.00 36.45 ? 102 ILE C CB  1 
ATOM   2989  C  CG1 . ILE C 1 18  ? 31.142 33.119  -31.467 1.00 33.85 ? 102 ILE C CG1 1 
ATOM   2990  C  CG2 . ILE C 1 18  ? 31.615 32.165  -29.191 1.00 35.88 ? 102 ILE C CG2 1 
ATOM   2991  C  CD1 . ILE C 1 18  ? 30.887 34.486  -31.241 1.00 36.11 ? 102 ILE C CD1 1 
ATOM   2992  N  N   . CYS C 1 19  ? 31.170 28.993  -29.711 1.00 33.98 ? 103 CYS C N   1 
ATOM   2993  C  CA  . CYS C 1 19  ? 31.295 27.961  -28.732 1.00 33.27 ? 103 CYS C CA  1 
ATOM   2994  C  C   . CYS C 1 19  ? 31.917 28.678  -27.544 1.00 32.59 ? 103 CYS C C   1 
ATOM   2995  O  O   . CYS C 1 19  ? 32.931 29.347  -27.711 1.00 33.79 ? 103 CYS C O   1 
ATOM   2996  C  CB  . CYS C 1 19  ? 32.225 26.868  -29.254 1.00 32.29 ? 103 CYS C CB  1 
ATOM   2997  S  SG  . CYS C 1 19  ? 32.565 25.581  -28.038 1.00 35.00 ? 103 CYS C SG  1 
ATOM   2998  N  N   . VAL C 1 20  ? 31.249 28.637  -26.398 1.00 30.43 ? 104 VAL C N   1 
ATOM   2999  C  CA  . VAL C 1 20  ? 31.809 29.125  -25.146 1.00 29.38 ? 104 VAL C CA  1 
ATOM   3000  C  C   . VAL C 1 20  ? 32.024 27.906  -24.282 1.00 29.26 ? 104 VAL C C   1 
ATOM   3001  O  O   . VAL C 1 20  ? 31.141 27.079  -24.138 1.00 31.44 ? 104 VAL C O   1 
ATOM   3002  C  CB  . VAL C 1 20  ? 30.878 30.031  -24.383 1.00 28.91 ? 104 VAL C CB  1 
ATOM   3003  C  CG1 . VAL C 1 20  ? 31.645 30.654  -23.231 1.00 28.01 ? 104 VAL C CG1 1 
ATOM   3004  C  CG2 . VAL C 1 20  ? 30.385 31.118  -25.298 1.00 29.78 ? 104 VAL C CG2 1 
ATOM   3005  N  N   . VAL C 1 21  ? 33.203 27.810  -23.721 1.00 28.24 ? 105 VAL C N   1 
ATOM   3006  C  CA  . VAL C 1 21  ? 33.695 26.681  -23.002 1.00 27.73 ? 105 VAL C CA  1 
ATOM   3007  C  C   . VAL C 1 21  ? 33.742 27.221  -21.555 1.00 27.60 ? 105 VAL C C   1 
ATOM   3008  O  O   . VAL C 1 21  ? 34.353 28.252  -21.270 1.00 25.12 ? 105 VAL C O   1 
ATOM   3009  C  CB  . VAL C 1 21  ? 35.051 26.296  -23.672 1.00 28.52 ? 105 VAL C CB  1 
ATOM   3010  C  CG1 . VAL C 1 21  ? 36.139 26.108  -22.716 1.00 28.21 ? 105 VAL C CG1 1 
ATOM   3011  C  CG2 . VAL C 1 21  ? 34.913 25.095  -24.567 1.00 26.58 ? 105 VAL C CG2 1 
ATOM   3012  N  N   . ILE C 1 22  ? 33.006 26.551  -20.663 1.00 28.50 ? 106 ILE C N   1 
ATOM   3013  C  CA  . ILE C 1 22  ? 32.708 27.056  -19.321 1.00 28.95 ? 106 ILE C CA  1 
ATOM   3014  C  C   . ILE C 1 22  ? 33.164 26.066  -18.243 1.00 30.41 ? 106 ILE C C   1 
ATOM   3015  O  O   . ILE C 1 22  ? 32.860 24.869  -18.290 1.00 31.09 ? 106 ILE C O   1 
ATOM   3016  C  CB  . ILE C 1 22  ? 31.154 27.397  -19.148 1.00 28.54 ? 106 ILE C CB  1 
ATOM   3017  C  CG1 . ILE C 1 22  ? 30.681 28.427  -20.165 1.00 29.65 ? 106 ILE C CG1 1 
ATOM   3018  C  CG2 . ILE C 1 22  ? 30.848 27.981  -17.766 1.00 30.29 ? 106 ILE C CG2 1 
ATOM   3019  C  CD1 . ILE C 1 22  ? 29.117 28.827  -20.063 1.00 28.46 ? 106 ILE C CD1 1 
ATOM   3020  N  N   . ASP C 1 23  ? 33.875 26.563  -17.252 1.00 31.61 ? 107 ASP C N   1 
ATOM   3021  C  CA  . ASP C 1 23  ? 34.228 25.751  -16.102 1.00 33.65 ? 107 ASP C CA  1 
ATOM   3022  C  C   . ASP C 1 23  ? 33.118 25.698  -15.041 1.00 34.81 ? 107 ASP C C   1 
ATOM   3023  O  O   . ASP C 1 23  ? 32.367 26.645  -14.853 1.00 36.30 ? 107 ASP C O   1 
ATOM   3024  C  CB  . ASP C 1 23  ? 35.455 26.366  -15.467 1.00 33.25 ? 107 ASP C CB  1 
ATOM   3025  C  CG  . ASP C 1 23  ? 36.041 25.509  -14.426 1.00 38.49 ? 107 ASP C CG  1 
ATOM   3026  O  OD1 . ASP C 1 23  ? 35.894 24.267  -14.461 1.00 47.75 ? 107 ASP C OD1 1 
ATOM   3027  O  OD2 . ASP C 1 23  ? 36.687 26.081  -13.537 1.00 48.22 ? 107 ASP C OD2 1 
ATOM   3028  N  N   . LEU C 1 24  ? 33.068 24.628  -14.284 1.00 34.84 ? 108 LEU C N   1 
ATOM   3029  C  CA  . LEU C 1 24  ? 32.184 24.534  -13.149 1.00 35.26 ? 108 LEU C CA  1 
ATOM   3030  C  C   . LEU C 1 24  ? 32.735 25.169  -11.817 1.00 36.02 ? 108 LEU C C   1 
ATOM   3031  O  O   . LEU C 1 24  ? 32.346 26.262  -11.417 1.00 37.47 ? 108 LEU C O   1 
ATOM   3032  C  CB  . LEU C 1 24  ? 31.931 23.047  -12.983 1.00 34.32 ? 108 LEU C CB  1 
ATOM   3033  C  CG  . LEU C 1 24  ? 30.816 22.641  -12.050 1.00 36.57 ? 108 LEU C CG  1 
ATOM   3034  C  CD1 . LEU C 1 24  ? 29.468 23.235  -12.521 1.00 32.72 ? 108 LEU C CD1 1 
ATOM   3035  C  CD2 . LEU C 1 24  ? 30.835 21.135  -11.890 1.00 32.06 ? 108 LEU C CD2 1 
ATOM   3036  N  N   . ASP C 1 25  ? 33.661 24.497  -11.145 1.00 36.89 ? 109 ASP C N   1 
ATOM   3037  C  CA  . ASP C 1 25  ? 34.152 24.893  -9.799  1.00 37.51 ? 109 ASP C CA  1 
ATOM   3038  C  C   . ASP C 1 25  ? 34.686 26.291  -9.685  1.00 36.48 ? 109 ASP C C   1 
ATOM   3039  O  O   . ASP C 1 25  ? 35.419 26.721  -10.521 1.00 36.54 ? 109 ASP C O   1 
ATOM   3040  C  CB  . ASP C 1 25  ? 35.203 23.904  -9.367  1.00 38.54 ? 109 ASP C CB  1 
ATOM   3041  C  CG  . ASP C 1 25  ? 34.609 22.775  -8.615  1.00 44.86 ? 109 ASP C CG  1 
ATOM   3042  O  OD1 . ASP C 1 25  ? 33.989 23.050  -7.536  1.00 52.42 ? 109 ASP C OD1 1 
ATOM   3043  O  OD2 . ASP C 1 25  ? 34.739 21.624  -9.093  1.00 50.58 ? 109 ASP C OD2 1 
ATOM   3044  N  N   . GLU C 1 26  ? 34.275 27.016  -8.662  1.00 37.46 ? 110 GLU C N   1 
ATOM   3045  C  CA  . GLU C 1 26  ? 34.537 28.482  -8.535  1.00 38.14 ? 110 GLU C CA  1 
ATOM   3046  C  C   . GLU C 1 26  ? 34.066 29.374  -9.726  1.00 38.63 ? 110 GLU C C   1 
ATOM   3047  O  O   . GLU C 1 26  ? 34.438 30.536  -9.814  1.00 38.08 ? 110 GLU C O   1 
ATOM   3048  C  CB  . GLU C 1 26  ? 36.013 28.779  -8.213  1.00 38.38 ? 110 GLU C CB  1 
ATOM   3049  C  CG  . GLU C 1 26  ? 36.625 28.215  -6.890  1.00 37.52 ? 110 GLU C CG  1 
ATOM   3050  C  CD  . GLU C 1 26  ? 36.554 26.678  -6.697  1.00 41.56 ? 110 GLU C CD  1 
ATOM   3051  O  OE1 . GLU C 1 26  ? 37.162 25.857  -7.438  1.00 44.84 ? 110 GLU C OE1 1 
ATOM   3052  O  OE2 . GLU C 1 26  ? 35.901 26.256  -5.733  1.00 43.00 ? 110 GLU C OE2 1 
ATOM   3053  N  N   . THR C 1 27  ? 33.270 28.859  -10.670 1.00 38.90 ? 111 THR C N   1 
ATOM   3054  C  CA  . THR C 1 27  ? 32.833 29.773  -11.741 1.00 38.50 ? 111 THR C CA  1 
ATOM   3055  C  C   . THR C 1 27  ? 31.346 29.945  -11.675 1.00 38.80 ? 111 THR C C   1 
ATOM   3056  O  O   . THR C 1 27  ? 30.862 31.059  -11.579 1.00 38.10 ? 111 THR C O   1 
ATOM   3057  C  CB  . THR C 1 27  ? 33.258 29.350  -13.155 1.00 38.57 ? 111 THR C CB  1 
ATOM   3058  O  OG1 . THR C 1 27  ? 34.669 29.231  -13.189 1.00 39.70 ? 111 THR C OG1 1 
ATOM   3059  C  CG2 . THR C 1 27  ? 32.887 30.416  -14.159 1.00 36.37 ? 111 THR C CG2 1 
ATOM   3060  N  N   . LEU C 1 28  ? 30.644 28.821  -11.661 1.00 38.84 ? 112 LEU C N   1 
ATOM   3061  C  CA  . LEU C 1 28  ? 29.203 28.820  -11.590 1.00 39.73 ? 112 LEU C CA  1 
ATOM   3062  C  C   . LEU C 1 28  ? 28.665 28.409  -10.205 1.00 41.11 ? 112 LEU C C   1 
ATOM   3063  O  O   . LEU C 1 28  ? 27.662 28.965  -9.760  1.00 42.19 ? 112 LEU C O   1 
ATOM   3064  C  CB  . LEU C 1 28  ? 28.636 27.913  -12.691 1.00 38.67 ? 112 LEU C CB  1 
ATOM   3065  C  CG  . LEU C 1 28  ? 29.132 28.191  -14.130 1.00 35.55 ? 112 LEU C CG  1 
ATOM   3066  C  CD1 . LEU C 1 28  ? 28.773 27.076  -15.072 1.00 31.66 ? 112 LEU C CD1 1 
ATOM   3067  C  CD2 . LEU C 1 28  ? 28.649 29.477  -14.647 1.00 30.47 ? 112 LEU C CD2 1 
ATOM   3068  N  N   . VAL C 1 29  ? 29.314 27.415  -9.595  1.00 41.42 ? 113 VAL C N   1 
ATOM   3069  C  CA  . VAL C 1 29  ? 29.089 26.888  -8.271  1.00 41.61 ? 113 VAL C CA  1 
ATOM   3070  C  C   . VAL C 1 29  ? 30.421 26.843  -7.456  1.00 42.64 ? 113 VAL C C   1 
ATOM   3071  O  O   . VAL C 1 29  ? 31.466 27.239  -7.938  1.00 42.60 ? 113 VAL C O   1 
ATOM   3072  C  CB  . VAL C 1 29  ? 28.557 25.442  -8.308  1.00 41.40 ? 113 VAL C CB  1 
ATOM   3073  C  CG1 . VAL C 1 29  ? 27.275 25.300  -9.085  1.00 39.04 ? 113 VAL C CG1 1 
ATOM   3074  C  CG2 . VAL C 1 29  ? 29.604 24.490  -8.835  1.00 42.82 ? 113 VAL C CG2 1 
ATOM   3075  N  N   . HIS C 1 30  ? 30.322 26.413  -6.199  1.00 43.99 ? 114 HIS C N   1 
ATOM   3076  C  CA  . HIS C 1 30  ? 31.437 26.100  -5.299  1.00 45.52 ? 114 HIS C CA  1 
ATOM   3077  C  C   . HIS C 1 30  ? 31.043 24.951  -4.380  1.00 45.86 ? 114 HIS C C   1 
ATOM   3078  O  O   . HIS C 1 30  ? 30.060 25.065  -3.678  1.00 46.21 ? 114 HIS C O   1 
ATOM   3079  C  CB  . HIS C 1 30  ? 31.819 27.286  -4.436  1.00 46.45 ? 114 HIS C CB  1 
ATOM   3080  C  CG  . HIS C 1 30  ? 32.656 26.913  -3.250  1.00 50.34 ? 114 HIS C CG  1 
ATOM   3081  N  ND1 . HIS C 1 30  ? 33.864 26.250  -3.367  1.00 52.74 ? 114 HIS C ND1 1 
ATOM   3082  C  CD2 . HIS C 1 30  ? 32.453 27.095  -1.925  1.00 53.16 ? 114 HIS C CD2 1 
ATOM   3083  C  CE1 . HIS C 1 30  ? 34.364 26.034  -2.167  1.00 55.03 ? 114 HIS C CE1 1 
ATOM   3084  N  NE2 . HIS C 1 30  ? 33.520 26.522  -1.273  1.00 56.08 ? 114 HIS C NE2 1 
ATOM   3085  N  N   . SER C 1 31  ? 31.799 23.855  -4.392  1.00 46.36 ? 115 SER C N   1 
ATOM   3086  C  CA  . SER C 1 31  ? 31.487 22.660  -3.602  1.00 47.72 ? 115 SER C CA  1 
ATOM   3087  C  C   . SER C 1 31  ? 32.378 22.466  -2.396  1.00 47.81 ? 115 SER C C   1 
ATOM   3088  O  O   . SER C 1 31  ? 33.494 23.013  -2.385  1.00 48.37 ? 115 SER C O   1 
ATOM   3089  C  CB  . SER C 1 31  ? 31.698 21.453  -4.478  1.00 48.22 ? 115 SER C CB  1 
ATOM   3090  O  OG  . SER C 1 31  ? 30.690 21.450  -5.473  1.00 53.63 ? 115 SER C OG  1 
ATOM   3091  N  N   . SER C 1 32  ? 31.914 21.678  -1.407  1.00 46.97 ? 116 SER C N   1 
ATOM   3092  C  CA  . SER C 1 32  ? 32.754 21.270  -0.286  1.00 46.78 ? 116 SER C CA  1 
ATOM   3093  C  C   . SER C 1 32  ? 32.269 20.032  0.426   1.00 46.61 ? 116 SER C C   1 
ATOM   3094  O  O   . SER C 1 32  ? 31.053 19.796  0.455   1.00 46.84 ? 116 SER C O   1 
ATOM   3095  C  CB  . SER C 1 32  ? 32.926 22.382  0.749   1.00 47.69 ? 116 SER C CB  1 
ATOM   3096  O  OG  . SER C 1 32  ? 33.390 21.814  1.980   1.00 50.26 ? 116 SER C OG  1 
ATOM   3097  N  N   . PHE C 1 33  ? 33.213 19.270  1.030   1.00 45.64 ? 117 PHE C N   1 
ATOM   3098  C  CA  . PHE C 1 33  ? 32.897 18.004  1.707   1.00 45.51 ? 117 PHE C CA  1 
ATOM   3099  C  C   . PHE C 1 33  ? 32.482 18.168  3.168   1.00 47.62 ? 117 PHE C C   1 
ATOM   3100  O  O   . PHE C 1 33  ? 32.156 17.175  3.859   1.00 46.73 ? 117 PHE C O   1 
ATOM   3101  C  CB  . PHE C 1 33  ? 34.055 17.036  1.652   1.00 43.55 ? 117 PHE C CB  1 
ATOM   3102  C  CG  . PHE C 1 33  ? 34.225 16.330  0.341   1.00 40.67 ? 117 PHE C CG  1 
ATOM   3103  C  CD1 . PHE C 1 33  ? 35.134 16.784  -0.579  1.00 34.81 ? 117 PHE C CD1 1 
ATOM   3104  C  CD2 . PHE C 1 33  ? 33.518 15.181  0.052   1.00 38.96 ? 117 PHE C CD2 1 
ATOM   3105  C  CE1 . PHE C 1 33  ? 35.336 16.148  -1.751  1.00 33.03 ? 117 PHE C CE1 1 
ATOM   3106  C  CE2 . PHE C 1 33  ? 33.703 14.547  -1.169  1.00 40.99 ? 117 PHE C CE2 1 
ATOM   3107  C  CZ  . PHE C 1 33  ? 34.633 15.041  -2.068  1.00 38.30 ? 117 PHE C CZ  1 
ATOM   3108  N  N   . LYS C 1 34  ? 32.475 19.428  3.604   1.00 49.89 ? 118 LYS C N   1 
ATOM   3109  C  CA  . LYS C 1 34  ? 32.257 19.821  4.988   1.00 53.21 ? 118 LYS C CA  1 
ATOM   3110  C  C   . LYS C 1 34  ? 30.777 20.161  5.270   1.00 55.13 ? 118 LYS C C   1 
ATOM   3111  O  O   . LYS C 1 34  ? 30.316 21.249  4.905   1.00 55.59 ? 118 LYS C O   1 
ATOM   3112  C  CB  . LYS C 1 34  ? 33.123 21.050  5.235   1.00 53.22 ? 118 LYS C CB  1 
ATOM   3113  C  CG  . LYS C 1 34  ? 33.067 21.557  6.620   1.00 56.44 ? 118 LYS C CG  1 
ATOM   3114  C  CD  . LYS C 1 34  ? 33.982 22.764  6.764   1.00 61.18 ? 118 LYS C CD  1 
ATOM   3115  C  CE  . LYS C 1 34  ? 34.354 22.939  8.248   1.00 63.56 ? 118 LYS C CE  1 
ATOM   3116  N  NZ  . LYS C 1 34  ? 33.124 22.730  9.103   1.00 65.84 ? 118 LYS C NZ  1 
ATOM   3117  N  N   . PRO C 1 35  ? 30.029 19.261  5.944   1.00 56.72 ? 119 PRO C N   1 
ATOM   3118  C  CA  . PRO C 1 35  ? 28.552 19.446  5.950   1.00 58.03 ? 119 PRO C CA  1 
ATOM   3119  C  C   . PRO C 1 35  ? 28.055 20.830  6.427   1.00 58.91 ? 119 PRO C C   1 
ATOM   3120  O  O   . PRO C 1 35  ? 28.418 21.309  7.500   1.00 58.82 ? 119 PRO C O   1 
ATOM   3121  C  CB  . PRO C 1 35  ? 28.032 18.307  6.854   1.00 58.59 ? 119 PRO C CB  1 
ATOM   3122  C  CG  . PRO C 1 35  ? 29.171 17.262  6.845   1.00 57.50 ? 119 PRO C CG  1 
ATOM   3123  C  CD  . PRO C 1 35  ? 30.449 18.088  6.736   1.00 56.61 ? 119 PRO C CD  1 
ATOM   3124  N  N   . ILE C 1 36  ? 27.254 21.474  5.581   1.00 59.53 ? 120 ILE C N   1 
ATOM   3125  C  CA  . ILE C 1 36  ? 26.708 22.801  5.866   1.00 59.43 ? 120 ILE C CA  1 
ATOM   3126  C  C   . ILE C 1 36  ? 25.192 22.732  5.670   1.00 59.26 ? 120 ILE C C   1 
ATOM   3127  O  O   . ILE C 1 36  ? 24.594 21.664  5.877   1.00 59.30 ? 120 ILE C O   1 
ATOM   3128  C  CB  . ILE C 1 36  ? 27.375 23.935  5.010   1.00 58.68 ? 120 ILE C CB  1 
ATOM   3129  C  CG1 . ILE C 1 36  ? 27.094 23.766  3.515   1.00 60.17 ? 120 ILE C CG1 1 
ATOM   3130  C  CG2 . ILE C 1 36  ? 28.849 23.973  5.234   1.00 58.10 ? 120 ILE C CG2 1 
ATOM   3131  C  CD1 . ILE C 1 36  ? 27.441 25.001  2.655   1.00 60.66 ? 120 ILE C CD1 1 
ATOM   3132  N  N   . ALA C 1 39  ? 22.366 26.364  1.031   1.00 46.06 ? 123 ALA C N   1 
ATOM   3133  C  CA  . ALA C 1 39  ? 22.841 24.969  0.831   1.00 47.20 ? 123 ALA C CA  1 
ATOM   3134  C  C   . ALA C 1 39  ? 22.057 24.283  -0.331  1.00 47.12 ? 123 ALA C C   1 
ATOM   3135  O  O   . ALA C 1 39  ? 21.283 23.303  -0.130  1.00 46.56 ? 123 ALA C O   1 
ATOM   3136  C  CB  . ALA C 1 39  ? 22.732 24.181  2.123   1.00 47.41 ? 123 ALA C CB  1 
ATOM   3137  N  N   . ASP C 1 40  ? 22.280 24.833  -1.541  1.00 46.34 ? 124 ASP C N   1 
ATOM   3138  C  CA  . ASP C 1 40  ? 21.462 24.576  -2.702  1.00 45.30 ? 124 ASP C CA  1 
ATOM   3139  C  C   . ASP C 1 40  ? 21.374 23.117  -3.071  1.00 44.65 ? 124 ASP C C   1 
ATOM   3140  O  O   . ASP C 1 40  ? 20.299 22.660  -3.313  1.00 45.38 ? 124 ASP C O   1 
ATOM   3141  C  CB  . ASP C 1 40  ? 21.949 25.408  -3.854  1.00 45.23 ? 124 ASP C CB  1 
ATOM   3142  C  CG  . ASP C 1 40  ? 21.776 26.918  -3.604  1.00 50.11 ? 124 ASP C CG  1 
ATOM   3143  O  OD1 . ASP C 1 40  ? 20.579 27.363  -3.459  1.00 53.92 ? 124 ASP C OD1 1 
ATOM   3144  O  OD2 . ASP C 1 40  ? 22.815 27.666  -3.589  1.00 47.36 ? 124 ASP C OD2 1 
ATOM   3145  N  N   . PHE C 1 41  ? 22.481 22.375  -3.143  1.00 45.09 ? 125 PHE C N   1 
ATOM   3146  C  CA  . PHE C 1 41  ? 22.403 20.910  -3.421  1.00 44.68 ? 125 PHE C CA  1 
ATOM   3147  C  C   . PHE C 1 41  ? 23.395 20.190  -2.544  1.00 44.07 ? 125 PHE C C   1 
ATOM   3148  O  O   . PHE C 1 41  ? 24.411 20.762  -2.131  1.00 42.81 ? 125 PHE C O   1 
ATOM   3149  C  CB  . PHE C 1 41  ? 22.718 20.470  -4.900  1.00 45.33 ? 125 PHE C CB  1 
ATOM   3150  C  CG  . PHE C 1 41  ? 22.342 21.452  -5.944  1.00 46.96 ? 125 PHE C CG  1 
ATOM   3151  C  CD1 . PHE C 1 41  ? 23.307 22.273  -6.514  1.00 49.14 ? 125 PHE C CD1 1 
ATOM   3152  C  CD2 . PHE C 1 41  ? 21.015 21.571  -6.366  1.00 50.64 ? 125 PHE C CD2 1 
ATOM   3153  C  CE1 . PHE C 1 41  ? 22.963 23.180  -7.464  1.00 47.08 ? 125 PHE C CE1 1 
ATOM   3154  C  CE2 . PHE C 1 41  ? 20.663 22.487  -7.315  1.00 48.73 ? 125 PHE C CE2 1 
ATOM   3155  C  CZ  . PHE C 1 41  ? 21.632 23.292  -7.854  1.00 48.95 ? 125 PHE C CZ  1 
ATOM   3156  N  N   . ILE C 1 42  ? 23.129 18.908  -2.364  1.00 43.73 ? 126 ILE C N   1 
ATOM   3157  C  CA  . ILE C 1 42  ? 24.022 18.028  -1.701  1.00 45.33 ? 126 ILE C CA  1 
ATOM   3158  C  C   . ILE C 1 42  ? 24.161 16.859  -2.629  1.00 46.81 ? 126 ILE C C   1 
ATOM   3159  O  O   . ILE C 1 42  ? 23.139 16.379  -3.151  1.00 46.59 ? 126 ILE C O   1 
ATOM   3160  C  CB  . ILE C 1 42  ? 23.390 17.538  -0.430  1.00 45.41 ? 126 ILE C CB  1 
ATOM   3161  C  CG1 . ILE C 1 42  ? 23.506 18.639  0.633   1.00 46.58 ? 126 ILE C CG1 1 
ATOM   3162  C  CG2 . ILE C 1 42  ? 24.008 16.200  0.022   1.00 46.32 ? 126 ILE C CG2 1 
ATOM   3163  C  CD1 . ILE C 1 42  ? 22.317 18.654  1.588   1.00 48.62 ? 126 ILE C CD1 1 
ATOM   3164  N  N   . VAL C 1 43  ? 25.398 16.387  -2.863  1.00 47.14 ? 127 VAL C N   1 
ATOM   3165  C  CA  . VAL C 1 43  ? 25.503 15.174  -3.644  1.00 47.82 ? 127 VAL C CA  1 
ATOM   3166  C  C   . VAL C 1 43  ? 26.420 14.073  -3.052  1.00 48.62 ? 127 VAL C C   1 
ATOM   3167  O  O   . VAL C 1 43  ? 27.463 14.341  -2.505  1.00 48.66 ? 127 VAL C O   1 
ATOM   3168  C  CB  . VAL C 1 43  ? 25.671 15.463  -5.193  1.00 48.14 ? 127 VAL C CB  1 
ATOM   3169  C  CG1 . VAL C 1 43  ? 25.015 16.772  -5.574  1.00 47.24 ? 127 VAL C CG1 1 
ATOM   3170  C  CG2 . VAL C 1 43  ? 27.113 15.465  -5.629  1.00 48.92 ? 127 VAL C CG2 1 
ATOM   3171  N  N   . PRO C 1 44  ? 25.977 12.821  -3.114  1.00 49.61 ? 128 PRO C N   1 
ATOM   3172  C  CA  . PRO C 1 44  ? 26.812 11.755  -2.612  1.00 49.95 ? 128 PRO C CA  1 
ATOM   3173  C  C   . PRO C 1 44  ? 27.892 11.356  -3.616  1.00 50.22 ? 128 PRO C C   1 
ATOM   3174  O  O   . PRO C 1 44  ? 27.603 11.203  -4.784  1.00 51.14 ? 128 PRO C O   1 
ATOM   3175  C  CB  . PRO C 1 44  ? 25.804 10.611  -2.443  1.00 50.14 ? 128 PRO C CB  1 
ATOM   3176  C  CG  . PRO C 1 44  ? 24.825 10.806  -3.607  1.00 49.98 ? 128 PRO C CG  1 
ATOM   3177  C  CD  . PRO C 1 44  ? 24.664 12.321  -3.599  1.00 50.05 ? 128 PRO C CD  1 
ATOM   3178  N  N   . ILE C 1 45  ? 29.117 11.157  -3.166  1.00 50.38 ? 129 ILE C N   1 
ATOM   3179  C  CA  . ILE C 1 45  ? 30.204 10.788  -4.063  1.00 50.61 ? 129 ILE C CA  1 
ATOM   3180  C  C   . ILE C 1 45  ? 30.965 9.619   -3.458  1.00 50.63 ? 129 ILE C C   1 
ATOM   3181  O  O   . ILE C 1 45  ? 31.298 9.697   -2.307  1.00 49.85 ? 129 ILE C O   1 
ATOM   3182  C  CB  . ILE C 1 45  ? 31.181 11.986  -4.183  1.00 50.11 ? 129 ILE C CB  1 
ATOM   3183  C  CG1 . ILE C 1 45  ? 30.447 13.298  -4.555  1.00 49.89 ? 129 ILE C CG1 1 
ATOM   3184  C  CG2 . ILE C 1 45  ? 32.384 11.638  -5.063  1.00 50.06 ? 129 ILE C CG2 1 
ATOM   3185  C  CD1 . ILE C 1 45  ? 29.779 13.394  -5.961  1.00 45.92 ? 129 ILE C CD1 1 
ATOM   3186  N  N   . GLU C 1 46  ? 31.232 8.554   -4.211  1.00 51.72 ? 130 GLU C N   1 
ATOM   3187  C  CA  . GLU C 1 46  ? 32.076 7.465   -3.693  1.00 54.01 ? 130 GLU C CA  1 
ATOM   3188  C  C   . GLU C 1 46  ? 33.545 7.845   -3.821  1.00 53.81 ? 130 GLU C C   1 
ATOM   3189  O  O   . GLU C 1 46  ? 33.993 8.370   -4.840  1.00 53.65 ? 130 GLU C O   1 
ATOM   3190  C  CB  . GLU C 1 46  ? 31.831 6.087   -4.378  1.00 54.83 ? 130 GLU C CB  1 
ATOM   3191  C  CG  . GLU C 1 46  ? 33.056 5.575   -5.297  1.00 61.22 ? 130 GLU C CG  1 
ATOM   3192  C  CD  . GLU C 1 46  ? 33.922 4.411   -4.704  1.00 67.09 ? 130 GLU C CD  1 
ATOM   3193  O  OE1 . GLU C 1 46  ? 33.317 3.484   -4.131  1.00 70.76 ? 130 GLU C OE1 1 
ATOM   3194  O  OE2 . GLU C 1 46  ? 35.187 4.402   -4.825  1.00 65.78 ? 130 GLU C OE2 1 
ATOM   3195  N  N   . ILE C 1 47  ? 34.288 7.564   -2.769  1.00 54.28 ? 131 ILE C N   1 
ATOM   3196  C  CA  . ILE C 1 47  ? 35.705 7.796   -2.743  1.00 54.47 ? 131 ILE C CA  1 
ATOM   3197  C  C   . ILE C 1 47  ? 36.357 6.636   -2.047  1.00 55.25 ? 131 ILE C C   1 
ATOM   3198  O  O   . ILE C 1 47  ? 36.266 6.483   -0.826  1.00 55.15 ? 131 ILE C O   1 
ATOM   3199  C  CB  . ILE C 1 47  ? 36.086 9.068   -2.021  1.00 54.08 ? 131 ILE C CB  1 
ATOM   3200  C  CG1 . ILE C 1 47  ? 35.290 10.258  -2.509  1.00 52.59 ? 131 ILE C CG1 1 
ATOM   3201  C  CG2 . ILE C 1 47  ? 37.574 9.347   -2.235  1.00 55.02 ? 131 ILE C CG2 1 
ATOM   3202  C  CD1 . ILE C 1 47  ? 35.751 11.594  -1.829  1.00 50.35 ? 131 ILE C CD1 1 
ATOM   3203  N  N   . GLU C 1 48  ? 37.043 5.838   -2.848  1.00 57.07 ? 132 GLU C N   1 
ATOM   3204  C  CA  . GLU C 1 48  ? 37.642 4.598   -2.393  1.00 58.86 ? 132 GLU C CA  1 
ATOM   3205  C  C   . GLU C 1 48  ? 36.596 3.894   -1.542  1.00 58.20 ? 132 GLU C C   1 
ATOM   3206  O  O   . GLU C 1 48  ? 36.673 3.918   -0.331  1.00 58.41 ? 132 GLU C O   1 
ATOM   3207  C  CB  . GLU C 1 48  ? 38.966 4.854   -1.640  1.00 59.61 ? 132 GLU C CB  1 
ATOM   3208  C  CG  . GLU C 1 48  ? 40.257 4.828   -2.563  1.00 64.48 ? 132 GLU C CG  1 
ATOM   3209  C  CD  . GLU C 1 48  ? 41.211 6.030   -2.311  1.00 69.51 ? 132 GLU C CD  1 
ATOM   3210  O  OE1 . GLU C 1 48  ? 41.313 6.502   -1.140  1.00 70.60 ? 132 GLU C OE1 1 
ATOM   3211  O  OE2 . GLU C 1 48  ? 41.842 6.508   -3.292  1.00 69.19 ? 132 GLU C OE2 1 
ATOM   3212  N  N   . GLY C 1 49  ? 35.582 3.337   -2.208  1.00 57.83 ? 133 GLY C N   1 
ATOM   3213  C  CA  . GLY C 1 49  ? 34.462 2.648   -1.550  1.00 56.19 ? 133 GLY C CA  1 
ATOM   3214  C  C   . GLY C 1 49  ? 33.526 3.410   -0.597  1.00 54.72 ? 133 GLY C C   1 
ATOM   3215  O  O   . GLY C 1 49  ? 32.496 2.863   -0.189  1.00 55.31 ? 133 GLY C O   1 
ATOM   3216  N  N   . THR C 1 50  ? 33.849 4.626   -0.182  1.00 52.24 ? 134 THR C N   1 
ATOM   3217  C  CA  . THR C 1 50  ? 32.920 5.267   0.739   1.00 50.65 ? 134 THR C CA  1 
ATOM   3218  C  C   . THR C 1 50  ? 32.233 6.571   0.264   1.00 49.76 ? 134 THR C C   1 
ATOM   3219  O  O   . THR C 1 50  ? 32.901 7.528   -0.147  1.00 48.49 ? 134 THR C O   1 
ATOM   3220  C  CB  . THR C 1 50  ? 33.492 5.404   2.200   1.00 50.88 ? 134 THR C CB  1 
ATOM   3221  O  OG1 . THR C 1 50  ? 33.806 6.765   2.509   1.00 50.99 ? 134 THR C OG1 1 
ATOM   3222  C  CG2 . THR C 1 50  ? 34.723 4.517   2.458   1.00 51.73 ? 134 THR C CG2 1 
ATOM   3223  N  N   . THR C 1 51  ? 30.900 6.617   0.406   1.00 48.37 ? 135 THR C N   1 
ATOM   3224  C  CA  . THR C 1 51  ? 30.127 7.782   0.010   1.00 46.90 ? 135 THR C CA  1 
ATOM   3225  C  C   . THR C 1 51  ? 30.340 8.920   0.957   1.00 46.15 ? 135 THR C C   1 
ATOM   3226  O  O   . THR C 1 51  ? 30.184 8.739   2.114   1.00 47.57 ? 135 THR C O   1 
ATOM   3227  C  CB  . THR C 1 51  ? 28.605 7.461   -0.108  1.00 47.37 ? 135 THR C CB  1 
ATOM   3228  O  OG1 . THR C 1 51  ? 28.406 6.311   -0.934  1.00 49.06 ? 135 THR C OG1 1 
ATOM   3229  C  CG2 . THR C 1 51  ? 27.838 8.598   -0.746  1.00 44.13 ? 135 THR C CG2 1 
ATOM   3230  N  N   . HIS C 1 52  ? 30.715 10.090  0.454   1.00 45.62 ? 136 HIS C N   1 
ATOM   3231  C  CA  . HIS C 1 52  ? 30.666 11.382  1.175   1.00 43.77 ? 136 HIS C CA  1 
ATOM   3232  C  C   . HIS C 1 52  ? 29.598 12.293  0.534   1.00 44.48 ? 136 HIS C C   1 
ATOM   3233  O  O   . HIS C 1 52  ? 29.153 12.018  -0.563  1.00 45.27 ? 136 HIS C O   1 
ATOM   3234  C  CB  . HIS C 1 52  ? 32.005 12.108  1.015   1.00 42.93 ? 136 HIS C CB  1 
ATOM   3235  C  CG  . HIS C 1 52  ? 33.141 11.412  1.667   1.00 39.76 ? 136 HIS C CG  1 
ATOM   3236  N  ND1 . HIS C 1 52  ? 33.693 10.266  1.155   1.00 35.27 ? 136 HIS C ND1 1 
ATOM   3237  C  CD2 . HIS C 1 52  ? 33.784 11.653  2.833   1.00 37.47 ? 136 HIS C CD2 1 
ATOM   3238  C  CE1 . HIS C 1 52  ? 34.638 9.829   1.970   1.00 30.18 ? 136 HIS C CE1 1 
ATOM   3239  N  NE2 . HIS C 1 52  ? 34.720 10.659  2.981   1.00 33.71 ? 136 HIS C NE2 1 
ATOM   3240  N  N   . GLN C 1 53  ? 29.258 13.413  1.160   1.00 43.80 ? 137 GLN C N   1 
ATOM   3241  C  CA  . GLN C 1 53  ? 28.269 14.306  0.617   1.00 43.88 ? 137 GLN C CA  1 
ATOM   3242  C  C   . GLN C 1 53  ? 29.057 15.484  0.244   1.00 43.27 ? 137 GLN C C   1 
ATOM   3243  O  O   . GLN C 1 53  ? 29.964 15.865  0.990   1.00 44.31 ? 137 GLN C O   1 
ATOM   3244  C  CB  . GLN C 1 53  ? 27.263 14.789  1.677   1.00 44.60 ? 137 GLN C CB  1 
ATOM   3245  C  CG  . GLN C 1 53  ? 26.428 13.721  2.400   1.00 50.05 ? 137 GLN C CG  1 
ATOM   3246  C  CD  . GLN C 1 53  ? 25.447 12.963  1.513   1.00 57.96 ? 137 GLN C CD  1 
ATOM   3247  O  OE1 . GLN C 1 53  ? 25.597 12.895  0.290   1.00 62.36 ? 137 GLN C OE1 1 
ATOM   3248  N  NE2 . GLN C 1 53  ? 24.415 12.398  2.135   1.00 62.67 ? 137 GLN C NE2 1 
ATOM   3249  N  N   . VAL C 1 54  ? 28.713 16.088  -0.884  1.00 41.79 ? 138 VAL C N   1 
ATOM   3250  C  CA  . VAL C 1 54  ? 29.331 17.323  -1.326  1.00 41.73 ? 138 VAL C CA  1 
ATOM   3251  C  C   . VAL C 1 54  ? 28.253 18.376  -1.250  1.00 42.40 ? 138 VAL C C   1 
ATOM   3252  O  O   . VAL C 1 54  ? 27.106 18.101  -1.568  1.00 43.63 ? 138 VAL C O   1 
ATOM   3253  C  CB  . VAL C 1 54  ? 29.879 17.186  -2.770  1.00 41.53 ? 138 VAL C CB  1 
ATOM   3254  C  CG1 . VAL C 1 54  ? 30.524 18.444  -3.228  1.00 38.52 ? 138 VAL C CG1 1 
ATOM   3255  C  CG2 . VAL C 1 54  ? 30.877 16.051  -2.813  1.00 42.66 ? 138 VAL C CG2 1 
ATOM   3256  N  N   . TYR C 1 55  ? 28.621 19.570  -0.817  1.00 43.16 ? 139 TYR C N   1 
ATOM   3257  C  CA  . TYR C 1 55  ? 27.689 20.578  -0.408  1.00 44.16 ? 139 TYR C CA  1 
ATOM   3258  C  C   . TYR C 1 55  ? 27.979 21.693  -1.331  1.00 43.32 ? 139 TYR C C   1 
ATOM   3259  O  O   . TYR C 1 55  ? 29.013 22.391  -1.217  1.00 44.98 ? 139 TYR C O   1 
ATOM   3260  C  CB  . TYR C 1 55  ? 27.925 21.012  1.059   1.00 46.39 ? 139 TYR C CB  1 
ATOM   3261  C  CG  . TYR C 1 55  ? 27.587 19.891  2.013   1.00 50.14 ? 139 TYR C CG  1 
ATOM   3262  C  CD1 . TYR C 1 55  ? 28.473 18.825  2.185   1.00 54.51 ? 139 TYR C CD1 1 
ATOM   3263  C  CD2 . TYR C 1 55  ? 26.378 19.854  2.699   1.00 53.37 ? 139 TYR C CD2 1 
ATOM   3264  C  CE1 . TYR C 1 55  ? 28.173 17.754  3.011   1.00 55.37 ? 139 TYR C CE1 1 
ATOM   3265  C  CE2 . TYR C 1 55  ? 26.054 18.762  3.544   1.00 54.59 ? 139 TYR C CE2 1 
ATOM   3266  C  CZ  . TYR C 1 55  ? 26.972 17.724  3.694   1.00 55.19 ? 139 TYR C CZ  1 
ATOM   3267  O  OH  . TYR C 1 55  ? 26.734 16.624  4.505   1.00 56.29 ? 139 TYR C OH  1 
ATOM   3268  N  N   . VAL C 1 56  ? 27.050 21.890  -2.248  1.00 41.56 ? 140 VAL C N   1 
ATOM   3269  C  CA  . VAL C 1 56  ? 27.245 22.796  -3.354  1.00 38.50 ? 140 VAL C CA  1 
ATOM   3270  C  C   . VAL C 1 56  ? 26.319 23.937  -3.078  1.00 39.32 ? 140 VAL C C   1 
ATOM   3271  O  O   . VAL C 1 56  ? 25.101 23.722  -2.791  1.00 38.78 ? 140 VAL C O   1 
ATOM   3272  C  CB  . VAL C 1 56  ? 26.753 22.134  -4.696  1.00 38.25 ? 140 VAL C CB  1 
ATOM   3273  C  CG1 . VAL C 1 56  ? 27.310 22.848  -5.855  1.00 34.54 ? 140 VAL C CG1 1 
ATOM   3274  C  CG2 . VAL C 1 56  ? 27.019 20.606  -4.727  1.00 34.57 ? 140 VAL C CG2 1 
ATOM   3275  N  N   . LEU C 1 57  ? 26.891 25.125  -3.224  1.00 39.65 ? 141 LEU C N   1 
ATOM   3276  C  CA  . LEU C 1 57  ? 26.202 26.379  -3.374  1.00 41.45 ? 141 LEU C CA  1 
ATOM   3277  C  C   . LEU C 1 57  ? 26.285 26.988  -4.798  1.00 43.27 ? 141 LEU C C   1 
ATOM   3278  O  O   . LEU C 1 57  ? 27.375 27.075  -5.377  1.00 45.44 ? 141 LEU C O   1 
ATOM   3279  C  CB  . LEU C 1 57  ? 26.882 27.366  -2.423  1.00 42.01 ? 141 LEU C CB  1 
ATOM   3280  C  CG  . LEU C 1 57  ? 26.888 26.995  -0.930  1.00 43.42 ? 141 LEU C CG  1 
ATOM   3281  C  CD1 . LEU C 1 57  ? 27.559 28.121  -0.091  1.00 40.54 ? 141 LEU C CD1 1 
ATOM   3282  C  CD2 . LEU C 1 57  ? 25.430 26.643  -0.421  1.00 39.74 ? 141 LEU C CD2 1 
ATOM   3283  N  N   . LYS C 1 58  ? 25.170 27.481  -5.339  1.00 44.06 ? 142 LYS C N   1 
ATOM   3284  C  CA  . LYS C 1 58  ? 25.125 28.038  -6.680  1.00 44.37 ? 142 LYS C CA  1 
ATOM   3285  C  C   . LYS C 1 58  ? 25.442 29.482  -6.566  1.00 44.58 ? 142 LYS C C   1 
ATOM   3286  O  O   . LYS C 1 58  ? 24.877 30.119  -5.714  1.00 47.34 ? 142 LYS C O   1 
ATOM   3287  C  CB  . LYS C 1 58  ? 23.714 27.969  -7.217  1.00 44.30 ? 142 LYS C CB  1 
ATOM   3288  C  CG  . LYS C 1 58  ? 23.172 26.589  -7.288  1.00 44.84 ? 142 LYS C CG  1 
ATOM   3289  C  CD  . LYS C 1 58  ? 21.938 26.556  -8.148  1.00 50.13 ? 142 LYS C CD  1 
ATOM   3290  C  CE  . LYS C 1 58  ? 20.722 27.271  -7.540  1.00 50.56 ? 142 LYS C CE  1 
ATOM   3291  N  NZ  . LYS C 1 58  ? 19.728 27.439  -8.665  1.00 51.97 ? 142 LYS C NZ  1 
ATOM   3292  N  N   . ARG C 1 59  ? 26.298 30.017  -7.433  1.00 43.67 ? 143 ARG C N   1 
ATOM   3293  C  CA  . ARG C 1 59  ? 26.724 31.424  -7.422  1.00 41.69 ? 143 ARG C CA  1 
ATOM   3294  C  C   . ARG C 1 59  ? 25.579 32.245  -7.943  1.00 42.99 ? 143 ARG C C   1 
ATOM   3295  O  O   . ARG C 1 59  ? 24.785 31.724  -8.733  1.00 44.12 ? 143 ARG C O   1 
ATOM   3296  C  CB  . ARG C 1 59  ? 27.905 31.592  -8.341  1.00 39.80 ? 143 ARG C CB  1 
ATOM   3297  C  CG  . ARG C 1 59  ? 28.216 32.968  -8.664  1.00 36.94 ? 143 ARG C CG  1 
ATOM   3298  C  CD  . ARG C 1 59  ? 29.293 33.056  -9.673  1.00 32.95 ? 143 ARG C CD  1 
ATOM   3299  N  NE  . ARG C 1 59  ? 30.177 34.226  -9.557  1.00 32.14 ? 143 ARG C NE  1 
ATOM   3300  C  CZ  . ARG C 1 59  ? 31.457 34.223  -9.942  1.00 37.89 ? 143 ARG C CZ  1 
ATOM   3301  N  NH1 . ARG C 1 59  ? 32.032 33.123  -10.445 1.00 40.99 ? 143 ARG C NH1 1 
ATOM   3302  N  NH2 . ARG C 1 59  ? 32.182 35.306  -9.833  1.00 40.08 ? 143 ARG C NH2 1 
ATOM   3303  N  N   . PRO C 1 60  ? 25.418 33.501  -7.444  1.00 43.33 ? 144 PRO C N   1 
ATOM   3304  C  CA  . PRO C 1 60  ? 24.250 34.305  -7.768  1.00 41.49 ? 144 PRO C CA  1 
ATOM   3305  C  C   . PRO C 1 60  ? 24.022 34.617  -9.216  1.00 40.58 ? 144 PRO C C   1 
ATOM   3306  O  O   . PRO C 1 60  ? 24.877 35.195  -9.887  1.00 42.40 ? 144 PRO C O   1 
ATOM   3307  C  CB  . PRO C 1 60  ? 24.478 35.569  -6.962  1.00 39.49 ? 144 PRO C CB  1 
ATOM   3308  C  CG  . PRO C 1 60  ? 25.078 35.072  -5.795  1.00 42.23 ? 144 PRO C CG  1 
ATOM   3309  C  CD  . PRO C 1 60  ? 26.172 34.168  -6.359  1.00 44.06 ? 144 PRO C CD  1 
ATOM   3310  N  N   . TYR C 1 61  ? 22.816 34.294  -9.662  1.00 38.78 ? 145 TYR C N   1 
ATOM   3311  C  CA  . TYR C 1 61  ? 22.408 34.622  -10.989 1.00 38.99 ? 145 TYR C CA  1 
ATOM   3312  C  C   . TYR C 1 61  ? 22.774 33.553  -12.024 1.00 38.07 ? 145 TYR C C   1 
ATOM   3313  O  O   . TYR C 1 61  ? 22.739 33.785  -13.214 1.00 38.09 ? 145 TYR C O   1 
ATOM   3314  C  CB  . TYR C 1 61  ? 22.932 36.020  -11.304 1.00 38.88 ? 145 TYR C CB  1 
ATOM   3315  C  CG  . TYR C 1 61  ? 22.339 36.958  -10.244 1.00 41.32 ? 145 TYR C CG  1 
ATOM   3316  C  CD1 . TYR C 1 61  ? 23.116 37.929  -9.570  1.00 45.46 ? 145 TYR C CD1 1 
ATOM   3317  C  CD2 . TYR C 1 61  ? 20.968 36.823  -9.852  1.00 46.27 ? 145 TYR C CD2 1 
ATOM   3318  C  CE1 . TYR C 1 61  ? 22.502 38.781  -8.559  1.00 45.87 ? 145 TYR C CE1 1 
ATOM   3319  C  CE2 . TYR C 1 61  ? 20.350 37.619  -8.837  1.00 40.19 ? 145 TYR C CE2 1 
ATOM   3320  C  CZ  . TYR C 1 61  ? 21.121 38.577  -8.213  1.00 43.81 ? 145 TYR C CZ  1 
ATOM   3321  O  OH  . TYR C 1 61  ? 20.528 39.376  -7.250  1.00 44.46 ? 145 TYR C OH  1 
ATOM   3322  N  N   . VAL C 1 62  ? 23.108 32.367  -11.535 1.00 39.06 ? 146 VAL C N   1 
ATOM   3323  C  CA  . VAL C 1 62  ? 23.601 31.335  -12.403 1.00 39.21 ? 146 VAL C CA  1 
ATOM   3324  C  C   . VAL C 1 62  ? 22.489 30.763  -13.292 1.00 40.09 ? 146 VAL C C   1 
ATOM   3325  O  O   . VAL C 1 62  ? 22.676 30.689  -14.511 1.00 39.80 ? 146 VAL C O   1 
ATOM   3326  C  CB  . VAL C 1 62  ? 24.404 30.306  -11.629 1.00 39.18 ? 146 VAL C CB  1 
ATOM   3327  C  CG1 . VAL C 1 62  ? 23.509 29.407  -10.879 1.00 36.55 ? 146 VAL C CG1 1 
ATOM   3328  C  CG2 . VAL C 1 62  ? 25.282 29.509  -12.608 1.00 38.09 ? 146 VAL C CG2 1 
ATOM   3329  N  N   . ASP C 1 63  ? 21.354 30.367  -12.692 1.00 40.93 ? 147 ASP C N   1 
ATOM   3330  C  CA  . ASP C 1 63  ? 20.162 29.997  -13.461 1.00 42.74 ? 147 ASP C CA  1 
ATOM   3331  C  C   . ASP C 1 63  ? 19.915 30.933  -14.666 1.00 42.92 ? 147 ASP C C   1 
ATOM   3332  O  O   . ASP C 1 63  ? 19.913 30.508  -15.839 1.00 43.18 ? 147 ASP C O   1 
ATOM   3333  C  CB  . ASP C 1 63  ? 18.946 29.969  -12.558 1.00 43.14 ? 147 ASP C CB  1 
ATOM   3334  C  CG  . ASP C 1 63  ? 19.168 29.107  -11.301 1.00 49.77 ? 147 ASP C CG  1 
ATOM   3335  O  OD1 . ASP C 1 63  ? 19.159 27.834  -11.455 1.00 51.66 ? 147 ASP C OD1 1 
ATOM   3336  O  OD2 . ASP C 1 63  ? 19.362 29.706  -10.175 1.00 52.32 ? 147 ASP C OD2 1 
ATOM   3337  N  N   . GLU C 1 64  ? 19.746 32.213  -14.394 1.00 42.63 ? 148 GLU C N   1 
ATOM   3338  C  CA  . GLU C 1 64  ? 19.481 33.142  -15.479 1.00 42.85 ? 148 GLU C CA  1 
ATOM   3339  C  C   . GLU C 1 64  ? 20.657 33.387  -16.387 1.00 42.51 ? 148 GLU C C   1 
ATOM   3340  O  O   . GLU C 1 64  ? 20.486 33.508  -17.630 1.00 44.30 ? 148 GLU C O   1 
ATOM   3341  C  CB  . GLU C 1 64  ? 18.896 34.427  -14.928 1.00 43.69 ? 148 GLU C CB  1 
ATOM   3342  C  CG  . GLU C 1 64  ? 17.390 34.193  -14.649 1.00 44.20 ? 148 GLU C CG  1 
ATOM   3343  C  CD  . GLU C 1 64  ? 16.639 34.423  -15.931 1.00 46.64 ? 148 GLU C CD  1 
ATOM   3344  O  OE1 . GLU C 1 64  ? 16.577 35.633  -16.326 1.00 46.38 ? 148 GLU C OE1 1 
ATOM   3345  O  OE2 . GLU C 1 64  ? 16.200 33.419  -16.557 1.00 45.47 ? 148 GLU C OE2 1 
ATOM   3346  N  N   . PHE C 1 65  ? 21.853 33.437  -15.804 1.00 40.59 ? 149 PHE C N   1 
ATOM   3347  C  CA  . PHE C 1 65  ? 23.084 33.419  -16.609 1.00 38.61 ? 149 PHE C CA  1 
ATOM   3348  C  C   . PHE C 1 65  ? 23.091 32.278  -17.636 1.00 37.61 ? 149 PHE C C   1 
ATOM   3349  O  O   . PHE C 1 65  ? 23.178 32.521  -18.864 1.00 36.43 ? 149 PHE C O   1 
ATOM   3350  C  CB  . PHE C 1 65  ? 24.332 33.295  -15.728 1.00 38.07 ? 149 PHE C CB  1 
ATOM   3351  C  CG  . PHE C 1 65  ? 25.601 33.356  -16.509 1.00 36.22 ? 149 PHE C CG  1 
ATOM   3352  C  CD1 . PHE C 1 65  ? 26.038 34.552  -17.027 1.00 32.38 ? 149 PHE C CD1 1 
ATOM   3353  C  CD2 . PHE C 1 65  ? 26.325 32.198  -16.775 1.00 35.38 ? 149 PHE C CD2 1 
ATOM   3354  C  CE1 . PHE C 1 65  ? 27.194 34.604  -17.765 1.00 32.57 ? 149 PHE C CE1 1 
ATOM   3355  C  CE2 . PHE C 1 65  ? 27.477 32.243  -17.516 1.00 33.89 ? 149 PHE C CE2 1 
ATOM   3356  C  CZ  . PHE C 1 65  ? 27.911 33.439  -18.016 1.00 34.97 ? 149 PHE C CZ  1 
ATOM   3357  N  N   . LEU C 1 66  ? 22.996 31.044  -17.132 1.00 35.81 ? 150 LEU C N   1 
ATOM   3358  C  CA  . LEU C 1 66  ? 22.964 29.885  -18.015 1.00 35.64 ? 150 LEU C CA  1 
ATOM   3359  C  C   . LEU C 1 66  ? 21.911 29.946  -19.109 1.00 37.44 ? 150 LEU C C   1 
ATOM   3360  O  O   . LEU C 1 66  ? 22.216 29.621  -20.282 1.00 38.84 ? 150 LEU C O   1 
ATOM   3361  C  CB  . LEU C 1 66  ? 22.855 28.586  -17.251 1.00 33.64 ? 150 LEU C CB  1 
ATOM   3362  C  CG  . LEU C 1 66  ? 24.168 28.229  -16.554 1.00 32.69 ? 150 LEU C CG  1 
ATOM   3363  C  CD1 . LEU C 1 66  ? 23.954 26.936  -15.959 1.00 27.16 ? 150 LEU C CD1 1 
ATOM   3364  C  CD2 . LEU C 1 66  ? 25.496 28.244  -17.464 1.00 29.46 ? 150 LEU C CD2 1 
ATOM   3365  N  N   . ARG C 1 67  ? 20.694 30.355  -18.738 1.00 37.82 ? 151 ARG C N   1 
ATOM   3366  C  CA  . ARG C 1 67  ? 19.574 30.302  -19.619 1.00 38.92 ? 151 ARG C CA  1 
ATOM   3367  C  C   . ARG C 1 67  ? 19.877 31.159  -20.800 1.00 39.27 ? 151 ARG C C   1 
ATOM   3368  O  O   . ARG C 1 67  ? 19.767 30.721  -21.977 1.00 40.09 ? 151 ARG C O   1 
ATOM   3369  C  CB  . ARG C 1 67  ? 18.324 30.826  -18.911 1.00 40.55 ? 151 ARG C CB  1 
ATOM   3370  C  CG  . ARG C 1 67  ? 17.017 30.215  -19.424 1.00 41.27 ? 151 ARG C CG  1 
ATOM   3371  C  CD  . ARG C 1 67  ? 16.140 31.248  -20.120 1.00 46.22 ? 151 ARG C CD  1 
ATOM   3372  N  NE  . ARG C 1 67  ? 16.026 32.470  -19.314 1.00 47.23 ? 151 ARG C NE  1 
ATOM   3373  C  CZ  . ARG C 1 67  ? 15.676 33.652  -19.802 1.00 44.97 ? 151 ARG C CZ  1 
ATOM   3374  N  NH1 . ARG C 1 67  ? 15.344 33.786  -21.098 1.00 42.46 ? 151 ARG C NH1 1 
ATOM   3375  N  NH2 . ARG C 1 67  ? 15.697 34.682  -18.990 1.00 40.39 ? 151 ARG C NH2 1 
ATOM   3376  N  N   . ARG C 1 68  ? 20.290 32.380  -20.478 1.00 39.41 ? 152 ARG C N   1 
ATOM   3377  C  CA  . ARG C 1 68  ? 20.571 33.393  -21.474 1.00 39.15 ? 152 ARG C CA  1 
ATOM   3378  C  C   . ARG C 1 68  ? 21.820 33.072  -22.321 1.00 39.94 ? 152 ARG C C   1 
ATOM   3379  O  O   . ARG C 1 68  ? 21.800 33.325  -23.536 1.00 41.67 ? 152 ARG C O   1 
ATOM   3380  C  CB  . ARG C 1 68  ? 20.598 34.744  -20.784 1.00 39.85 ? 152 ARG C CB  1 
ATOM   3381  C  CG  . ARG C 1 68  ? 19.116 35.149  -20.188 1.00 41.35 ? 152 ARG C CG  1 
ATOM   3382  C  CD  . ARG C 1 68  ? 19.071 36.422  -19.300 1.00 39.35 ? 152 ARG C CD  1 
ATOM   3383  N  NE  . ARG C 1 68  ? 19.342 37.655  -20.041 1.00 40.03 ? 152 ARG C NE  1 
ATOM   3384  C  CZ  . ARG C 1 68  ? 19.550 38.857  -19.472 1.00 41.34 ? 152 ARG C CZ  1 
ATOM   3385  N  NH1 . ARG C 1 68  ? 19.517 39.012  -18.146 1.00 33.85 ? 152 ARG C NH1 1 
ATOM   3386  N  NH2 . ARG C 1 68  ? 19.784 39.920  -20.248 1.00 40.58 ? 152 ARG C NH2 1 
ATOM   3387  N  N   . MET C 1 69  ? 22.870 32.452  -21.744 1.00 38.88 ? 153 MET C N   1 
ATOM   3388  C  CA  . MET C 1 69  ? 24.030 32.014  -22.555 1.00 36.94 ? 153 MET C CA  1 
ATOM   3389  C  C   . MET C 1 69  ? 23.547 31.001  -23.540 1.00 36.28 ? 153 MET C C   1 
ATOM   3390  O  O   . MET C 1 69  ? 24.003 31.000  -24.669 1.00 37.13 ? 153 MET C O   1 
ATOM   3391  C  CB  . MET C 1 69  ? 25.157 31.352  -21.724 1.00 37.12 ? 153 MET C CB  1 
ATOM   3392  C  CG  . MET C 1 69  ? 25.918 32.308  -20.749 1.00 36.22 ? 153 MET C CG  1 
ATOM   3393  S  SD  . MET C 1 69  ? 26.595 33.651  -21.694 1.00 28.98 ? 153 MET C SD  1 
ATOM   3394  C  CE  . MET C 1 69  ? 27.979 32.684  -22.292 1.00 27.46 ? 153 MET C CE  1 
ATOM   3395  N  N   . GLY C 1 70  ? 22.637 30.134  -23.123 1.00 35.47 ? 154 GLY C N   1 
ATOM   3396  C  CA  . GLY C 1 70  ? 22.174 29.068  -23.990 1.00 36.30 ? 154 GLY C CA  1 
ATOM   3397  C  C   . GLY C 1 70  ? 21.270 29.496  -25.155 1.00 37.30 ? 154 GLY C C   1 
ATOM   3398  O  O   . GLY C 1 70  ? 20.967 28.711  -25.994 1.00 37.01 ? 154 GLY C O   1 
ATOM   3399  N  N   . GLU C 1 71  ? 20.852 30.752  -25.224 1.00 38.90 ? 155 GLU C N   1 
ATOM   3400  C  CA  . GLU C 1 71  ? 20.065 31.200  -26.358 1.00 41.54 ? 155 GLU C CA  1 
ATOM   3401  C  C   . GLU C 1 71  ? 20.955 31.816  -27.358 1.00 40.73 ? 155 GLU C C   1 
ATOM   3402  O  O   . GLU C 1 71  ? 20.534 32.035  -28.494 1.00 42.00 ? 155 GLU C O   1 
ATOM   3403  C  CB  . GLU C 1 71  ? 18.973 32.195  -25.960 1.00 41.38 ? 155 GLU C CB  1 
ATOM   3404  C  CG  . GLU C 1 71  ? 17.714 31.546  -25.329 1.00 43.59 ? 155 GLU C CG  1 
ATOM   3405  C  CD  . GLU C 1 71  ? 16.903 32.552  -24.460 1.00 48.34 ? 155 GLU C CD  1 
ATOM   3406  O  OE1 . GLU C 1 71  ? 17.231 33.799  -24.465 1.00 55.06 ? 155 GLU C OE1 1 
ATOM   3407  O  OE2 . GLU C 1 71  ? 15.923 32.092  -23.776 1.00 57.70 ? 155 GLU C OE2 1 
ATOM   3408  N  N   . LEU C 1 72  ? 22.208 32.042  -26.971 1.00 40.16 ? 156 LEU C N   1 
ATOM   3409  C  CA  . LEU C 1 72  ? 23.134 32.776  -27.808 1.00 38.92 ? 156 LEU C CA  1 
ATOM   3410  C  C   . LEU C 1 72  ? 24.351 32.027  -28.283 1.00 37.93 ? 156 LEU C C   1 
ATOM   3411  O  O   . LEU C 1 72  ? 25.005 32.484  -29.182 1.00 37.58 ? 156 LEU C O   1 
ATOM   3412  C  CB  . LEU C 1 72  ? 23.617 33.989  -27.065 1.00 39.59 ? 156 LEU C CB  1 
ATOM   3413  C  CG  . LEU C 1 72  ? 22.534 35.012  -26.776 1.00 41.06 ? 156 LEU C CG  1 
ATOM   3414  C  CD1 . LEU C 1 72  ? 23.130 36.090  -25.856 1.00 42.52 ? 156 LEU C CD1 1 
ATOM   3415  C  CD2 . LEU C 1 72  ? 22.047 35.607  -28.116 1.00 41.58 ? 156 LEU C CD2 1 
ATOM   3416  N  N   . PHE C 1 73  ? 24.691 30.905  -27.672 1.00 36.85 ? 157 PHE C N   1 
ATOM   3417  C  CA  . PHE C 1 73  ? 26.013 30.359  -27.889 1.00 35.13 ? 157 PHE C CA  1 
ATOM   3418  C  C   . PHE C 1 73  ? 25.846 28.915  -27.810 1.00 34.88 ? 157 PHE C C   1 
ATOM   3419  O  O   . PHE C 1 73  ? 24.854 28.485  -27.297 1.00 34.95 ? 157 PHE C O   1 
ATOM   3420  C  CB  . PHE C 1 73  ? 26.924 30.729  -26.734 1.00 34.63 ? 157 PHE C CB  1 
ATOM   3421  C  CG  . PHE C 1 73  ? 27.298 32.159  -26.669 1.00 33.18 ? 157 PHE C CG  1 
ATOM   3422  C  CD1 . PHE C 1 73  ? 26.719 32.993  -25.748 1.00 37.48 ? 157 PHE C CD1 1 
ATOM   3423  C  CD2 . PHE C 1 73  ? 28.281 32.673  -27.480 1.00 32.37 ? 157 PHE C CD2 1 
ATOM   3424  C  CE1 . PHE C 1 73  ? 27.123 34.377  -25.652 1.00 37.31 ? 157 PHE C CE1 1 
ATOM   3425  C  CE2 . PHE C 1 73  ? 28.690 34.042  -27.395 1.00 32.52 ? 157 PHE C CE2 1 
ATOM   3426  C  CZ  . PHE C 1 73  ? 28.113 34.873  -26.518 1.00 34.61 ? 157 PHE C CZ  1 
ATOM   3427  N  N   . GLU C 1 74  ? 26.826 28.164  -28.306 1.00 34.25 ? 158 GLU C N   1 
ATOM   3428  C  CA  . GLU C 1 74  ? 26.956 26.737  -28.020 1.00 33.05 ? 158 GLU C CA  1 
ATOM   3429  C  C   . GLU C 1 74  ? 27.825 26.621  -26.730 1.00 32.55 ? 158 GLU C C   1 
ATOM   3430  O  O   . GLU C 1 74  ? 29.009 26.947  -26.721 1.00 34.23 ? 158 GLU C O   1 
ATOM   3431  C  CB  . GLU C 1 74  ? 27.592 26.029  -29.207 1.00 32.13 ? 158 GLU C CB  1 
ATOM   3432  C  CG  . GLU C 1 74  ? 27.796 24.575  -28.993 1.00 32.79 ? 158 GLU C CG  1 
ATOM   3433  C  CD  . GLU C 1 74  ? 28.844 23.959  -29.967 1.00 38.13 ? 158 GLU C CD  1 
ATOM   3434  O  OE1 . GLU C 1 74  ? 29.701 24.707  -30.537 1.00 38.61 ? 158 GLU C OE1 1 
ATOM   3435  O  OE2 . GLU C 1 74  ? 28.810 22.716  -30.156 1.00 35.91 ? 158 GLU C OE2 1 
ATOM   3436  N  N   . CYS C 1 75  ? 27.211 26.199  -25.650 1.00 30.96 ? 159 CYS C N   1 
ATOM   3437  C  CA  . CYS C 1 75  ? 27.785 26.229  -24.344 1.00 30.34 ? 159 CYS C CA  1 
ATOM   3438  C  C   . CYS C 1 75  ? 28.308 24.847  -24.088 1.00 29.88 ? 159 CYS C C   1 
ATOM   3439  O  O   . CYS C 1 75  ? 27.591 23.859  -24.218 1.00 29.88 ? 159 CYS C O   1 
ATOM   3440  C  CB  . CYS C 1 75  ? 26.692 26.561  -23.326 1.00 29.55 ? 159 CYS C CB  1 
ATOM   3441  S  SG  . CYS C 1 75  ? 26.048 28.225  -23.544 1.00 34.85 ? 159 CYS C SG  1 
ATOM   3442  N  N   . VAL C 1 76  ? 29.574 24.766  -23.721 1.00 29.54 ? 160 VAL C N   1 
ATOM   3443  C  CA  . VAL C 1 76  ? 30.198 23.473  -23.472 1.00 28.97 ? 160 VAL C CA  1 
ATOM   3444  C  C   . VAL C 1 76  ? 30.769 23.440  -22.050 1.00 29.30 ? 160 VAL C C   1 
ATOM   3445  O  O   . VAL C 1 76  ? 31.452 24.402  -21.614 1.00 29.47 ? 160 VAL C O   1 
ATOM   3446  C  CB  . VAL C 1 76  ? 31.289 23.239  -24.532 1.00 28.71 ? 160 VAL C CB  1 
ATOM   3447  C  CG1 . VAL C 1 76  ? 32.139 22.055  -24.197 1.00 27.12 ? 160 VAL C CG1 1 
ATOM   3448  C  CG2 . VAL C 1 76  ? 30.630 23.068  -25.901 1.00 27.61 ? 160 VAL C CG2 1 
ATOM   3449  N  N   . LEU C 1 77  ? 30.503 22.388  -21.293 1.00 28.06 ? 161 LEU C N   1 
ATOM   3450  C  CA  . LEU C 1 77  ? 31.113 22.403  -19.988 1.00 28.47 ? 161 LEU C CA  1 
ATOM   3451  C  C   . LEU C 1 77  ? 32.513 21.858  -20.161 1.00 29.00 ? 161 LEU C C   1 
ATOM   3452  O  O   . LEU C 1 77  ? 32.662 20.774  -20.615 1.00 30.15 ? 161 LEU C O   1 
ATOM   3453  C  CB  . LEU C 1 77  ? 30.354 21.548  -18.993 1.00 27.95 ? 161 LEU C CB  1 
ATOM   3454  C  CG  . LEU C 1 77  ? 30.946 21.367  -17.574 1.00 28.01 ? 161 LEU C CG  1 
ATOM   3455  C  CD1 . LEU C 1 77  ? 30.633 22.505  -16.629 1.00 24.61 ? 161 LEU C CD1 1 
ATOM   3456  C  CD2 . LEU C 1 77  ? 30.473 20.116  -16.943 1.00 25.59 ? 161 LEU C CD2 1 
ATOM   3457  N  N   . PHE C 1 78  ? 33.536 22.592  -19.778 1.00 29.29 ? 162 PHE C N   1 
ATOM   3458  C  CA  . PHE C 1 78  ? 34.888 22.073  -19.793 1.00 29.45 ? 162 PHE C CA  1 
ATOM   3459  C  C   . PHE C 1 78  ? 35.467 22.253  -18.404 1.00 29.70 ? 162 PHE C C   1 
ATOM   3460  O  O   . PHE C 1 78  ? 35.724 23.379  -17.981 1.00 29.76 ? 162 PHE C O   1 
ATOM   3461  C  CB  . PHE C 1 78  ? 35.699 22.820  -20.802 1.00 28.13 ? 162 PHE C CB  1 
ATOM   3462  C  CG  . PHE C 1 78  ? 36.926 22.111  -21.226 1.00 29.56 ? 162 PHE C CG  1 
ATOM   3463  C  CD1 . PHE C 1 78  ? 37.567 22.447  -22.438 1.00 29.24 ? 162 PHE C CD1 1 
ATOM   3464  C  CD2 . PHE C 1 78  ? 37.462 21.115  -20.452 1.00 29.17 ? 162 PHE C CD2 1 
ATOM   3465  C  CE1 . PHE C 1 78  ? 38.734 21.777  -22.862 1.00 28.63 ? 162 PHE C CE1 1 
ATOM   3466  C  CE2 . PHE C 1 78  ? 38.654 20.436  -20.892 1.00 30.45 ? 162 PHE C CE2 1 
ATOM   3467  C  CZ  . PHE C 1 78  ? 39.266 20.752  -22.066 1.00 24.24 ? 162 PHE C CZ  1 
ATOM   3468  N  N   . THR C 1 79  ? 35.612 21.162  -17.662 1.00 30.15 ? 163 THR C N   1 
ATOM   3469  C  CA  . THR C 1 79  ? 36.041 21.242  -16.246 1.00 30.54 ? 163 THR C CA  1 
ATOM   3470  C  C   . THR C 1 79  ? 37.303 20.379  -16.030 1.00 31.35 ? 163 THR C C   1 
ATOM   3471  O  O   . THR C 1 79  ? 37.501 19.407  -16.689 1.00 31.89 ? 163 THR C O   1 
ATOM   3472  C  CB  . THR C 1 79  ? 34.870 20.783  -15.291 1.00 30.45 ? 163 THR C CB  1 
ATOM   3473  O  OG1 . THR C 1 79  ? 35.353 20.523  -13.964 1.00 33.25 ? 163 THR C OG1 1 
ATOM   3474  C  CG2 . THR C 1 79  ? 34.261 19.534  -15.768 1.00 26.17 ? 163 THR C CG2 1 
ATOM   3475  N  N   . ALA C 1 80  ? 38.128 20.739  -15.072 1.00 33.33 ? 164 ALA C N   1 
ATOM   3476  C  CA  . ALA C 1 80  ? 39.277 19.920  -14.644 1.00 34.59 ? 164 ALA C CA  1 
ATOM   3477  C  C   . ALA C 1 80  ? 38.953 18.889  -13.533 1.00 35.15 ? 164 ALA C C   1 
ATOM   3478  O  O   . ALA C 1 80  ? 39.835 18.146  -13.104 1.00 36.10 ? 164 ALA C O   1 
ATOM   3479  C  CB  . ALA C 1 80  ? 40.447 20.830  -14.200 1.00 33.57 ? 164 ALA C CB  1 
ATOM   3480  N  N   . SER C 1 81  ? 37.709 18.825  -13.084 1.00 35.35 ? 165 SER C N   1 
ATOM   3481  C  CA  . SER C 1 81  ? 37.319 17.833  -12.092 1.00 36.33 ? 165 SER C CA  1 
ATOM   3482  C  C   . SER C 1 81  ? 36.869 16.552  -12.773 1.00 36.19 ? 165 SER C C   1 
ATOM   3483  O  O   . SER C 1 81  ? 36.800 16.487  -13.990 1.00 36.68 ? 165 SER C O   1 
ATOM   3484  C  CB  . SER C 1 81  ? 36.205 18.401  -11.210 1.00 36.94 ? 165 SER C CB  1 
ATOM   3485  O  OG  . SER C 1 81  ? 35.052 18.684  -11.976 1.00 42.55 ? 165 SER C OG  1 
ATOM   3486  N  N   . LEU C 1 82  ? 36.574 15.509  -12.025 1.00 37.12 ? 166 LEU C N   1 
ATOM   3487  C  CA  . LEU C 1 82  ? 36.182 14.249  -12.679 1.00 37.93 ? 166 LEU C CA  1 
ATOM   3488  C  C   . LEU C 1 82  ? 34.662 14.165  -12.901 1.00 36.98 ? 166 LEU C C   1 
ATOM   3489  O  O   . LEU C 1 82  ? 33.908 14.723  -12.157 1.00 37.21 ? 166 LEU C O   1 
ATOM   3490  C  CB  . LEU C 1 82  ? 36.681 13.046  -11.868 1.00 38.76 ? 166 LEU C CB  1 
ATOM   3491  C  CG  . LEU C 1 82  ? 38.207 12.746  -11.820 1.00 41.49 ? 166 LEU C CG  1 
ATOM   3492  C  CD1 . LEU C 1 82  ? 38.585 12.163  -10.435 1.00 43.98 ? 166 LEU C CD1 1 
ATOM   3493  C  CD2 . LEU C 1 82  ? 38.625 11.800  -12.923 1.00 40.48 ? 166 LEU C CD2 1 
ATOM   3494  N  N   . ALA C 1 83  ? 34.238 13.475  -13.942 1.00 36.51 ? 167 ALA C N   1 
ATOM   3495  C  CA  . ALA C 1 83  ? 32.845 13.307  -14.253 1.00 36.54 ? 167 ALA C CA  1 
ATOM   3496  C  C   . ALA C 1 83  ? 31.976 12.947  -13.029 1.00 38.30 ? 167 ALA C C   1 
ATOM   3497  O  O   . ALA C 1 83  ? 30.885 13.502  -12.863 1.00 37.11 ? 167 ALA C O   1 
ATOM   3498  C  CB  . ALA C 1 83  ? 32.705 12.294  -15.305 1.00 35.53 ? 167 ALA C CB  1 
ATOM   3499  N  N   . LYS C 1 84  ? 32.508 12.081  -12.151 1.00 39.81 ? 168 LYS C N   1 
ATOM   3500  C  CA  . LYS C 1 84  ? 31.775 11.495  -11.024 1.00 41.15 ? 168 LYS C CA  1 
ATOM   3501  C  C   . LYS C 1 84  ? 31.344 12.538  -10.058 1.00 40.43 ? 168 LYS C C   1 
ATOM   3502  O  O   . LYS C 1 84  ? 30.529 12.260  -9.193  1.00 40.18 ? 168 LYS C O   1 
ATOM   3503  C  CB  . LYS C 1 84  ? 32.614 10.433  -10.277 1.00 42.80 ? 168 LYS C CB  1 
ATOM   3504  C  CG  . LYS C 1 84  ? 33.503 11.014  -9.134  1.00 46.62 ? 168 LYS C CG  1 
ATOM   3505  C  CD  . LYS C 1 84  ? 34.376 9.960   -8.534  1.00 52.75 ? 168 LYS C CD  1 
ATOM   3506  C  CE  . LYS C 1 84  ? 35.310 10.611  -7.504  1.00 57.00 ? 168 LYS C CE  1 
ATOM   3507  N  NZ  . LYS C 1 84  ? 36.033 9.543   -6.683  1.00 58.39 ? 168 LYS C NZ  1 
ATOM   3508  N  N   . TYR C 1 85  ? 31.916 13.729  -10.205 1.00 40.75 ? 169 TYR C N   1 
ATOM   3509  C  CA  . TYR C 1 85  ? 31.524 14.908  -9.421  1.00 40.94 ? 169 TYR C CA  1 
ATOM   3510  C  C   . TYR C 1 85  ? 30.861 15.957  -10.307 1.00 40.88 ? 169 TYR C C   1 
ATOM   3511  O  O   . TYR C 1 85  ? 29.905 16.630  -9.869  1.00 41.92 ? 169 TYR C O   1 
ATOM   3512  C  CB  . TYR C 1 85  ? 32.706 15.532  -8.663  1.00 40.57 ? 169 TYR C CB  1 
ATOM   3513  C  CG  . TYR C 1 85  ? 32.533 17.026  -8.359  1.00 41.67 ? 169 TYR C CG  1 
ATOM   3514  C  CD1 . TYR C 1 85  ? 31.924 17.481  -7.176  1.00 43.60 ? 169 TYR C CD1 1 
ATOM   3515  C  CD2 . TYR C 1 85  ? 32.973 17.986  -9.261  1.00 42.71 ? 169 TYR C CD2 1 
ATOM   3516  C  CE1 . TYR C 1 85  ? 31.765 18.884  -6.919  1.00 42.51 ? 169 TYR C CE1 1 
ATOM   3517  C  CE2 . TYR C 1 85  ? 32.804 19.357  -9.035  1.00 42.11 ? 169 TYR C CE2 1 
ATOM   3518  C  CZ  . TYR C 1 85  ? 32.206 19.805  -7.866  1.00 42.54 ? 169 TYR C CZ  1 
ATOM   3519  O  OH  . TYR C 1 85  ? 32.105 21.176  -7.687  1.00 42.61 ? 169 TYR C OH  1 
ATOM   3520  N  N   . ALA C 1 86  ? 31.327 16.099  -11.545 1.00 39.16 ? 170 ALA C N   1 
ATOM   3521  C  CA  . ALA C 1 86  ? 30.827 17.197  -12.328 1.00 38.66 ? 170 ALA C CA  1 
ATOM   3522  C  C   . ALA C 1 86  ? 29.464 16.854  -12.855 1.00 38.39 ? 170 ALA C C   1 
ATOM   3523  O  O   . ALA C 1 86  ? 28.625 17.728  -12.972 1.00 40.20 ? 170 ALA C O   1 
ATOM   3524  C  CB  . ALA C 1 86  ? 31.747 17.516  -13.467 1.00 38.81 ? 170 ALA C CB  1 
ATOM   3525  N  N   . ASP C 1 87  ? 29.256 15.594  -13.197 1.00 37.58 ? 171 ASP C N   1 
ATOM   3526  C  CA  . ASP C 1 87  ? 28.048 15.136  -13.785 1.00 37.59 ? 171 ASP C CA  1 
ATOM   3527  C  C   . ASP C 1 87  ? 26.868 15.356  -12.817 1.00 38.49 ? 171 ASP C C   1 
ATOM   3528  O  O   . ASP C 1 87  ? 25.900 16.057  -13.158 1.00 37.83 ? 171 ASP C O   1 
ATOM   3529  C  CB  . ASP C 1 87  ? 28.192 13.671  -14.152 1.00 37.36 ? 171 ASP C CB  1 
ATOM   3530  C  CG  . ASP C 1 87  ? 28.699 13.453  -15.558 1.00 39.58 ? 171 ASP C CG  1 
ATOM   3531  O  OD1 . ASP C 1 87  ? 28.639 14.401  -16.354 1.00 43.55 ? 171 ASP C OD1 1 
ATOM   3532  O  OD2 . ASP C 1 87  ? 29.074 12.295  -15.919 1.00 38.63 ? 171 ASP C OD2 1 
ATOM   3533  N  N   . PRO C 1 88  ? 26.937 14.758  -11.604 1.00 38.80 ? 172 PRO C N   1 
ATOM   3534  C  CA  . PRO C 1 88  ? 25.757 14.862  -10.742 1.00 38.22 ? 172 PRO C CA  1 
ATOM   3535  C  C   . PRO C 1 88  ? 25.547 16.330  -10.402 1.00 37.26 ? 172 PRO C C   1 
ATOM   3536  O  O   . PRO C 1 88  ? 24.409 16.757  -10.270 1.00 37.51 ? 172 PRO C O   1 
ATOM   3537  C  CB  . PRO C 1 88  ? 26.143 14.029  -9.509  1.00 38.56 ? 172 PRO C CB  1 
ATOM   3538  C  CG  . PRO C 1 88  ? 27.750 14.189  -9.449  1.00 39.26 ? 172 PRO C CG  1 
ATOM   3539  C  CD  . PRO C 1 88  ? 28.020 13.986  -10.950 1.00 39.35 ? 172 PRO C CD  1 
ATOM   3540  N  N   . VAL C 1 89  ? 26.630 17.110  -10.326 1.00 36.41 ? 173 VAL C N   1 
ATOM   3541  C  CA  . VAL C 1 89  ? 26.491 18.517  -10.017 1.00 34.79 ? 173 VAL C CA  1 
ATOM   3542  C  C   . VAL C 1 89  ? 25.810 19.234  -11.156 1.00 35.95 ? 173 VAL C C   1 
ATOM   3543  O  O   . VAL C 1 89  ? 24.820 19.939  -10.920 1.00 36.71 ? 173 VAL C O   1 
ATOM   3544  C  CB  . VAL C 1 89  ? 27.802 19.213  -9.658  1.00 34.37 ? 173 VAL C CB  1 
ATOM   3545  C  CG1 . VAL C 1 89  ? 27.622 20.761  -9.608  1.00 31.67 ? 173 VAL C CG1 1 
ATOM   3546  C  CG2 . VAL C 1 89  ? 28.350 18.723  -8.304  1.00 34.26 ? 173 VAL C CG2 1 
ATOM   3547  N  N   . THR C 1 90  ? 26.334 19.065  -12.371 1.00 35.61 ? 174 THR C N   1 
ATOM   3548  C  CA  . THR C 1 90  ? 25.795 19.676  -13.556 1.00 35.78 ? 174 THR C CA  1 
ATOM   3549  C  C   . THR C 1 90  ? 24.356 19.234  -13.789 1.00 36.83 ? 174 THR C C   1 
ATOM   3550  O  O   . THR C 1 90  ? 23.535 20.037  -14.173 1.00 38.42 ? 174 THR C O   1 
ATOM   3551  C  CB  . THR C 1 90  ? 26.654 19.259  -14.817 1.00 36.60 ? 174 THR C CB  1 
ATOM   3552  O  OG1 . THR C 1 90  ? 27.996 19.594  -14.575 1.00 35.77 ? 174 THR C OG1 1 
ATOM   3553  C  CG2 . THR C 1 90  ? 26.226 19.976  -16.132 1.00 34.14 ? 174 THR C CG2 1 
ATOM   3554  N  N   . ASP C 1 91  ? 24.037 17.963  -13.624 1.00 37.11 ? 175 ASP C N   1 
ATOM   3555  C  CA  . ASP C 1 91  ? 22.646 17.573  -13.755 1.00 39.23 ? 175 ASP C CA  1 
ATOM   3556  C  C   . ASP C 1 91  ? 21.723 18.463  -12.932 1.00 39.84 ? 175 ASP C C   1 
ATOM   3557  O  O   . ASP C 1 91  ? 20.680 18.875  -13.401 1.00 40.37 ? 175 ASP C O   1 
ATOM   3558  C  CB  . ASP C 1 91  ? 22.418 16.109  -13.393 1.00 39.31 ? 175 ASP C CB  1 
ATOM   3559  C  CG  . ASP C 1 91  ? 23.029 15.172  -14.395 1.00 42.19 ? 175 ASP C CG  1 
ATOM   3560  O  OD1 . ASP C 1 91  ? 23.172 15.563  -15.565 1.00 44.63 ? 175 ASP C OD1 1 
ATOM   3561  O  OD2 . ASP C 1 91  ? 23.337 14.022  -14.044 1.00 47.68 ? 175 ASP C OD2 1 
ATOM   3562  N  N   . LEU C 1 92  ? 22.110 18.781  -11.712 1.00 40.27 ? 176 LEU C N   1 
ATOM   3563  C  CA  . LEU C 1 92  ? 21.240 19.600  -10.916 1.00 40.56 ? 176 LEU C CA  1 
ATOM   3564  C  C   . LEU C 1 92  ? 21.393 21.064  -11.216 1.00 41.12 ? 176 LEU C C   1 
ATOM   3565  O  O   . LEU C 1 92  ? 20.420 21.814  -11.124 1.00 43.36 ? 176 LEU C O   1 
ATOM   3566  C  CB  . LEU C 1 92  ? 21.391 19.321  -9.419  1.00 40.30 ? 176 LEU C CB  1 
ATOM   3567  C  CG  . LEU C 1 92  ? 21.200 17.872  -8.990  1.00 40.12 ? 176 LEU C CG  1 
ATOM   3568  C  CD1 . LEU C 1 92  ? 21.846 17.686  -7.658  1.00 40.47 ? 176 LEU C CD1 1 
ATOM   3569  C  CD2 . LEU C 1 92  ? 19.737 17.434  -8.964  1.00 38.89 ? 176 LEU C CD2 1 
ATOM   3570  N  N   . LEU C 1 93  ? 22.569 21.517  -11.574 1.00 40.79 ? 177 LEU C N   1 
ATOM   3571  C  CA  . LEU C 1 93  ? 22.688 22.931  -11.866 1.00 41.16 ? 177 LEU C CA  1 
ATOM   3572  C  C   . LEU C 1 93  ? 22.055 23.387  -13.210 1.00 43.56 ? 177 LEU C C   1 
ATOM   3573  O  O   . LEU C 1 93  ? 21.477 24.461  -13.307 1.00 46.06 ? 177 LEU C O   1 
ATOM   3574  C  CB  . LEU C 1 93  ? 24.123 23.290  -11.842 1.00 39.76 ? 177 LEU C CB  1 
ATOM   3575  C  CG  . LEU C 1 93  ? 24.371 24.678  -12.306 1.00 36.68 ? 177 LEU C CG  1 
ATOM   3576  C  CD1 . LEU C 1 93  ? 24.226 25.402  -11.055 1.00 36.25 ? 177 LEU C CD1 1 
ATOM   3577  C  CD2 . LEU C 1 93  ? 25.780 24.779  -12.786 1.00 35.61 ? 177 LEU C CD2 1 
ATOM   3578  N  N   . ASP C 1 94  ? 22.129 22.565  -14.247 1.00 44.71 ? 178 ASP C N   1 
ATOM   3579  C  CA  . ASP C 1 94  ? 21.811 22.990  -15.593 1.00 44.26 ? 178 ASP C CA  1 
ATOM   3580  C  C   . ASP C 1 94  ? 20.376 22.533  -15.919 1.00 45.93 ? 178 ASP C C   1 
ATOM   3581  O  O   . ASP C 1 94  ? 20.149 21.632  -16.743 1.00 44.66 ? 178 ASP C O   1 
ATOM   3582  C  CB  . ASP C 1 94  ? 22.831 22.339  -16.502 1.00 43.58 ? 178 ASP C CB  1 
ATOM   3583  C  CG  . ASP C 1 94  ? 22.543 22.555  -17.951 1.00 43.83 ? 178 ASP C CG  1 
ATOM   3584  O  OD1 . ASP C 1 94  ? 21.993 23.658  -18.245 1.00 43.71 ? 178 ASP C OD1 1 
ATOM   3585  O  OD2 . ASP C 1 94  ? 22.884 21.627  -18.780 1.00 37.70 ? 178 ASP C OD2 1 
ATOM   3586  N  N   . ARG C 1 95  ? 19.396 23.174  -15.277 1.00 46.97 ? 179 ARG C N   1 
ATOM   3587  C  CA  . ARG C 1 95  ? 17.996 22.800  -15.505 1.00 47.80 ? 179 ARG C CA  1 
ATOM   3588  C  C   . ARG C 1 95  ? 17.447 23.127  -16.923 1.00 46.81 ? 179 ARG C C   1 
ATOM   3589  O  O   . ARG C 1 95  ? 16.542 22.442  -17.386 1.00 47.64 ? 179 ARG C O   1 
ATOM   3590  C  CB  . ARG C 1 95  ? 17.112 23.372  -14.426 1.00 48.01 ? 179 ARG C CB  1 
ATOM   3591  C  CG  . ARG C 1 95  ? 17.254 24.867  -14.299 1.00 53.82 ? 179 ARG C CG  1 
ATOM   3592  C  CD  . ARG C 1 95  ? 16.047 25.471  -13.555 1.00 62.07 ? 179 ARG C CD  1 
ATOM   3593  N  NE  . ARG C 1 95  ? 16.460 26.192  -12.345 1.00 67.18 ? 179 ARG C NE  1 
ATOM   3594  C  CZ  . ARG C 1 95  ? 16.240 25.772  -11.090 1.00 69.01 ? 179 ARG C CZ  1 
ATOM   3595  N  NH1 . ARG C 1 95  ? 15.591 24.626  -10.855 1.00 70.29 ? 179 ARG C NH1 1 
ATOM   3596  N  NH2 . ARG C 1 95  ? 16.645 26.517  -10.073 1.00 67.18 ? 179 ARG C NH2 1 
ATOM   3597  N  N   . CYS C 1 96  ? 17.999 24.112  -17.636 1.00 45.03 ? 180 CYS C N   1 
ATOM   3598  C  CA  . CYS C 1 96  ? 17.602 24.315  -19.038 1.00 43.18 ? 180 CYS C CA  1 
ATOM   3599  C  C   . CYS C 1 96  ? 18.249 23.436  -20.104 1.00 41.13 ? 180 CYS C C   1 
ATOM   3600  O  O   . CYS C 1 96  ? 17.946 23.657  -21.304 1.00 41.55 ? 180 CYS C O   1 
ATOM   3601  C  CB  . CYS C 1 96  ? 17.820 25.741  -19.471 1.00 43.67 ? 180 CYS C CB  1 
ATOM   3602  S  SG  . CYS C 1 96  ? 16.987 26.887  -18.413 1.00 49.31 ? 180 CYS C SG  1 
ATOM   3603  N  N   . GLY C 1 97  ? 19.146 22.512  -19.696 1.00 38.22 ? 181 GLY C N   1 
ATOM   3604  C  CA  . GLY C 1 97  ? 19.855 21.575  -20.589 1.00 35.11 ? 181 GLY C CA  1 
ATOM   3605  C  C   . GLY C 1 97  ? 20.777 22.302  -21.571 1.00 34.23 ? 181 GLY C C   1 
ATOM   3606  O  O   . GLY C 1 97  ? 20.923 21.938  -22.699 1.00 33.87 ? 181 GLY C O   1 
ATOM   3607  N  N   . VAL C 1 98  ? 21.407 23.354  -21.116 1.00 33.56 ? 182 VAL C N   1 
ATOM   3608  C  CA  . VAL C 1 98  ? 22.209 24.222  -21.940 1.00 33.39 ? 182 VAL C CA  1 
ATOM   3609  C  C   . VAL C 1 98  ? 23.527 23.566  -22.402 1.00 32.85 ? 182 VAL C C   1 
ATOM   3610  O  O   . VAL C 1 98  ? 24.030 23.912  -23.440 1.00 33.84 ? 182 VAL C O   1 
ATOM   3611  C  CB  . VAL C 1 98  ? 22.351 25.544  -21.160 1.00 34.03 ? 182 VAL C CB  1 
ATOM   3612  C  CG1 . VAL C 1 98  ? 23.754 25.972  -20.865 1.00 32.48 ? 182 VAL C CG1 1 
ATOM   3613  C  CG2 . VAL C 1 98  ? 21.590 26.591  -21.839 1.00 37.34 ? 182 VAL C CG2 1 
ATOM   3614  N  N   . PHE C 1 99  ? 24.049 22.587  -21.670 1.00 31.74 ? 183 PHE C N   1 
ATOM   3615  C  CA  . PHE C 1 99  ? 25.295 21.892  -22.056 1.00 31.14 ? 183 PHE C CA  1 
ATOM   3616  C  C   . PHE C 1 99  ? 24.954 20.627  -22.777 1.00 32.29 ? 183 PHE C C   1 
ATOM   3617  O  O   . PHE C 1 99  ? 24.611 19.614  -22.149 1.00 33.46 ? 183 PHE C O   1 
ATOM   3618  C  CB  . PHE C 1 99  ? 26.091 21.476  -20.797 1.00 29.31 ? 183 PHE C CB  1 
ATOM   3619  C  CG  . PHE C 1 99  ? 26.626 22.655  -20.019 1.00 26.70 ? 183 PHE C CG  1 
ATOM   3620  C  CD1 . PHE C 1 99  ? 26.241 22.863  -18.724 1.00 22.59 ? 183 PHE C CD1 1 
ATOM   3621  C  CD2 . PHE C 1 99  ? 27.413 23.598  -20.637 1.00 19.20 ? 183 PHE C CD2 1 
ATOM   3622  C  CE1 . PHE C 1 99  ? 26.678 23.960  -18.007 1.00 23.35 ? 183 PHE C CE1 1 
ATOM   3623  C  CE2 . PHE C 1 99  ? 27.832 24.697  -19.931 1.00 21.50 ? 183 PHE C CE2 1 
ATOM   3624  C  CZ  . PHE C 1 99  ? 27.450 24.861  -18.578 1.00 22.08 ? 183 PHE C CZ  1 
ATOM   3625  N  N   . ARG C 1 100 ? 25.034 20.608  -24.086 1.00 32.89 ? 184 ARG C N   1 
ATOM   3626  C  CA  . ARG C 1 100 ? 24.769 19.337  -24.648 1.00 32.97 ? 184 ARG C CA  1 
ATOM   3627  C  C   . ARG C 1 100 ? 26.081 18.637  -24.752 1.00 32.98 ? 184 ARG C C   1 
ATOM   3628  O  O   . ARG C 1 100 ? 26.110 17.427  -25.029 1.00 35.63 ? 184 ARG C O   1 
ATOM   3629  C  CB  . ARG C 1 100 ? 23.894 19.390  -25.915 1.00 34.33 ? 184 ARG C CB  1 
ATOM   3630  C  CG  . ARG C 1 100 ? 24.496 18.956  -27.239 1.00 38.76 ? 184 ARG C CG  1 
ATOM   3631  C  CD  . ARG C 1 100 ? 24.379 17.445  -27.668 1.00 42.46 ? 184 ARG C CD  1 
ATOM   3632  N  NE  . ARG C 1 100 ? 25.369 17.260  -28.751 1.00 47.86 ? 184 ARG C NE  1 
ATOM   3633  C  CZ  . ARG C 1 100 ? 25.430 16.305  -29.680 1.00 47.50 ? 184 ARG C CZ  1 
ATOM   3634  N  NH1 . ARG C 1 100 ? 24.547 15.321  -29.756 1.00 49.19 ? 184 ARG C NH1 1 
ATOM   3635  N  NH2 . ARG C 1 100 ? 26.404 16.371  -30.577 1.00 47.88 ? 184 ARG C NH2 1 
ATOM   3636  N  N   . ALA C 1 101 ? 27.174 19.338  -24.437 1.00 30.81 ? 185 ALA C N   1 
ATOM   3637  C  CA  . ALA C 1 101 ? 28.484 18.679  -24.429 1.00 28.57 ? 185 ALA C CA  1 
ATOM   3638  C  C   . ALA C 1 101 ? 29.188 18.835  -23.125 1.00 27.24 ? 185 ALA C C   1 
ATOM   3639  O  O   . ALA C 1 101 ? 29.172 19.897  -22.569 1.00 28.59 ? 185 ALA C O   1 
ATOM   3640  C  CB  . ALA C 1 101 ? 29.356 19.177  -25.559 1.00 26.51 ? 185 ALA C CB  1 
ATOM   3641  N  N   . ARG C 1 102 ? 29.879 17.818  -22.669 1.00 25.59 ? 186 ARG C N   1 
ATOM   3642  C  CA  . ARG C 1 102 ? 30.642 17.952  -21.436 1.00 25.76 ? 186 ARG C CA  1 
ATOM   3643  C  C   . ARG C 1 102 ? 32.024 17.373  -21.524 1.00 26.70 ? 186 ARG C C   1 
ATOM   3644  O  O   . ARG C 1 102 ? 32.174 16.266  -22.011 1.00 27.19 ? 186 ARG C O   1 
ATOM   3645  C  CB  . ARG C 1 102 ? 29.925 17.226  -20.296 1.00 25.52 ? 186 ARG C CB  1 
ATOM   3646  C  CG  . ARG C 1 102 ? 28.530 17.735  -19.974 1.00 24.30 ? 186 ARG C CG  1 
ATOM   3647  C  CD  . ARG C 1 102 ? 28.043 17.113  -18.652 1.00 28.93 ? 186 ARG C CD  1 
ATOM   3648  N  NE  . ARG C 1 102 ? 26.593 17.226  -18.556 1.00 30.00 ? 186 ARG C NE  1 
ATOM   3649  C  CZ  . ARG C 1 102 ? 25.833 16.769  -17.569 1.00 32.05 ? 186 ARG C CZ  1 
ATOM   3650  N  NH1 . ARG C 1 102 ? 26.358 16.126  -16.542 1.00 36.77 ? 186 ARG C NH1 1 
ATOM   3651  N  NH2 . ARG C 1 102 ? 24.525 16.940  -17.622 1.00 29.70 ? 186 ARG C NH2 1 
ATOM   3652  N  N   . LEU C 1 103 ? 33.037 18.088  -21.025 1.00 26.64 ? 187 LEU C N   1 
ATOM   3653  C  CA  . LEU C 1 103 ? 34.418 17.598  -21.054 1.00 26.95 ? 187 LEU C CA  1 
ATOM   3654  C  C   . LEU C 1 103 ? 35.005 17.709  -19.640 1.00 27.80 ? 187 LEU C C   1 
ATOM   3655  O  O   . LEU C 1 103 ? 34.785 18.731  -18.973 1.00 27.95 ? 187 LEU C O   1 
ATOM   3656  C  CB  . LEU C 1 103 ? 35.246 18.405  -22.053 1.00 26.03 ? 187 LEU C CB  1 
ATOM   3657  C  CG  . LEU C 1 103 ? 34.775 18.580  -23.525 1.00 25.84 ? 187 LEU C CG  1 
ATOM   3658  C  CD1 . LEU C 1 103 ? 35.520 19.644  -24.204 1.00 26.14 ? 187 LEU C CD1 1 
ATOM   3659  C  CD2 . LEU C 1 103 ? 34.909 17.336  -24.381 1.00 25.53 ? 187 LEU C CD2 1 
ATOM   3660  N  N   . PHE C 1 104 ? 35.768 16.695  -19.211 1.00 27.60 ? 188 PHE C N   1 
ATOM   3661  C  CA  . PHE C 1 104 ? 36.327 16.632  -17.862 1.00 29.32 ? 188 PHE C CA  1 
ATOM   3662  C  C   . PHE C 1 104 ? 37.851 16.562  -17.777 1.00 30.72 ? 188 PHE C C   1 
ATOM   3663  O  O   . PHE C 1 104 ? 38.572 16.895  -18.732 1.00 31.73 ? 188 PHE C O   1 
ATOM   3664  C  CB  . PHE C 1 104 ? 35.749 15.409  -17.146 1.00 29.08 ? 188 PHE C CB  1 
ATOM   3665  C  CG  . PHE C 1 104 ? 34.281 15.319  -17.228 1.00 30.04 ? 188 PHE C CG  1 
ATOM   3666  C  CD1 . PHE C 1 104 ? 33.672 14.409  -18.093 1.00 31.75 ? 188 PHE C CD1 1 
ATOM   3667  C  CD2 . PHE C 1 104 ? 33.492 16.168  -16.485 1.00 27.97 ? 188 PHE C CD2 1 
ATOM   3668  C  CE1 . PHE C 1 104 ? 32.278 14.321  -18.182 1.00 30.70 ? 188 PHE C CE1 1 
ATOM   3669  C  CE2 . PHE C 1 104 ? 32.109 16.052  -16.563 1.00 31.90 ? 188 PHE C CE2 1 
ATOM   3670  C  CZ  . PHE C 1 104 ? 31.513 15.101  -17.420 1.00 26.61 ? 188 PHE C CZ  1 
ATOM   3671  N  N   . ARG C 1 105 ? 38.339 16.080  -16.651 1.00 31.75 ? 189 ARG C N   1 
ATOM   3672  C  CA  . ARG C 1 105 ? 39.722 16.163  -16.359 1.00 34.18 ? 189 ARG C CA  1 
ATOM   3673  C  C   . ARG C 1 105 ? 40.570 15.580  -17.472 1.00 35.30 ? 189 ARG C C   1 
ATOM   3674  O  O   . ARG C 1 105 ? 41.593 16.200  -17.836 1.00 36.00 ? 189 ARG C O   1 
ATOM   3675  C  CB  . ARG C 1 105 ? 40.072 15.541  -15.024 1.00 34.46 ? 189 ARG C CB  1 
ATOM   3676  C  CG  . ARG C 1 105 ? 41.547 15.623  -14.713 1.00 36.62 ? 189 ARG C CG  1 
ATOM   3677  C  CD  . ARG C 1 105 ? 41.789 14.930  -13.411 1.00 41.23 ? 189 ARG C CD  1 
ATOM   3678  N  NE  . ARG C 1 105 ? 41.433 15.826  -12.322 1.00 48.46 ? 189 ARG C NE  1 
ATOM   3679  C  CZ  . ARG C 1 105 ? 41.419 15.516  -11.018 1.00 50.43 ? 189 ARG C CZ  1 
ATOM   3680  N  NH1 . ARG C 1 105 ? 41.088 16.458  -10.115 1.00 47.56 ? 189 ARG C NH1 1 
ATOM   3681  N  NH2 . ARG C 1 105 ? 41.730 14.288  -10.616 1.00 49.92 ? 189 ARG C NH2 1 
ATOM   3682  N  N   . GLU C 1 106 ? 40.130 14.465  -18.056 1.00 35.00 ? 190 GLU C N   1 
ATOM   3683  C  CA  . GLU C 1 106 ? 40.957 13.759  -19.024 1.00 35.20 ? 190 GLU C CA  1 
ATOM   3684  C  C   . GLU C 1 106 ? 41.002 14.448  -20.364 1.00 35.21 ? 190 GLU C C   1 
ATOM   3685  O  O   . GLU C 1 106 ? 41.702 13.997  -21.259 1.00 36.70 ? 190 GLU C O   1 
ATOM   3686  C  CB  . GLU C 1 106 ? 40.510 12.311  -19.249 1.00 36.81 ? 190 GLU C CB  1 
ATOM   3687  C  CG  . GLU C 1 106 ? 40.427 11.401  -17.981 1.00 40.80 ? 190 GLU C CG  1 
ATOM   3688  C  CD  . GLU C 1 106 ? 39.115 11.612  -17.199 1.00 47.19 ? 190 GLU C CD  1 
ATOM   3689  O  OE1 . GLU C 1 106 ? 39.012 11.058  -16.076 1.00 48.88 ? 190 GLU C OE1 1 
ATOM   3690  O  OE2 . GLU C 1 106 ? 38.203 12.353  -17.698 1.00 48.93 ? 190 GLU C OE2 1 
ATOM   3691  N  N   . SER C 1 107 ? 40.240 15.514  -20.536 1.00 34.70 ? 191 SER C N   1 
ATOM   3692  C  CA  . SER C 1 107 ? 40.324 16.354  -21.725 1.00 33.25 ? 191 SER C CA  1 
ATOM   3693  C  C   . SER C 1 107 ? 41.224 17.571  -21.494 1.00 33.19 ? 191 SER C C   1 
ATOM   3694  O  O   . SER C 1 107 ? 41.450 18.331  -22.400 1.00 33.90 ? 191 SER C O   1 
ATOM   3695  C  CB  . SER C 1 107 ? 38.943 16.845  -22.102 1.00 32.47 ? 191 SER C CB  1 
ATOM   3696  O  OG  . SER C 1 107 ? 38.207 15.784  -22.663 1.00 32.71 ? 191 SER C OG  1 
ATOM   3697  N  N   . CYS C 1 108 ? 41.686 17.779  -20.265 1.00 31.97 ? 192 CYS C N   1 
ATOM   3698  C  CA  . CYS C 1 108 ? 42.626 18.820  -19.982 1.00 30.80 ? 192 CYS C CA  1 
ATOM   3699  C  C   . CYS C 1 108 ? 44.044 18.258  -20.204 1.00 30.23 ? 192 CYS C C   1 
ATOM   3700  O  O   . CYS C 1 108 ? 44.219 17.067  -20.298 1.00 29.84 ? 192 CYS C O   1 
ATOM   3701  C  CB  . CYS C 1 108 ? 42.440 19.242  -18.534 1.00 31.83 ? 192 CYS C CB  1 
ATOM   3702  S  SG  . CYS C 1 108 ? 40.835 19.955  -18.177 1.00 29.62 ? 192 CYS C SG  1 
ATOM   3703  N  N   . VAL C 1 109 ? 45.052 19.095  -20.348 1.00 30.24 ? 193 VAL C N   1 
ATOM   3704  C  CA  . VAL C 1 109 ? 46.410 18.561  -20.320 1.00 31.11 ? 193 VAL C CA  1 
ATOM   3705  C  C   . VAL C 1 109 ? 47.170 19.010  -19.071 1.00 31.45 ? 193 VAL C C   1 
ATOM   3706  O  O   . VAL C 1 109 ? 47.037 20.129  -18.626 1.00 31.33 ? 193 VAL C O   1 
ATOM   3707  C  CB  . VAL C 1 109 ? 47.211 18.688  -21.653 1.00 31.25 ? 193 VAL C CB  1 
ATOM   3708  C  CG1 . VAL C 1 109 ? 46.538 19.521  -22.647 1.00 29.81 ? 193 VAL C CG1 1 
ATOM   3709  C  CG2 . VAL C 1 109 ? 48.649 19.140  -21.400 1.00 31.86 ? 193 VAL C CG2 1 
ATOM   3710  N  N   . PHE C 1 110 ? 47.863 18.081  -18.431 1.00 32.16 ? 194 PHE C N   1 
ATOM   3711  C  CA  . PHE C 1 110 ? 48.604 18.472  -17.262 1.00 32.46 ? 194 PHE C CA  1 
ATOM   3712  C  C   . PHE C 1 110 ? 49.815 19.216  -17.721 1.00 31.88 ? 194 PHE C C   1 
ATOM   3713  O  O   . PHE C 1 110 ? 50.602 18.688  -18.479 1.00 33.86 ? 194 PHE C O   1 
ATOM   3714  C  CB  . PHE C 1 110 ? 49.069 17.277  -16.490 1.00 33.01 ? 194 PHE C CB  1 
ATOM   3715  C  CG  . PHE C 1 110 ? 49.347 17.578  -15.055 1.00 34.50 ? 194 PHE C CG  1 
ATOM   3716  C  CD1 . PHE C 1 110 ? 48.618 18.532  -14.395 1.00 36.51 ? 194 PHE C CD1 1 
ATOM   3717  C  CD2 . PHE C 1 110 ? 50.320 16.888  -14.363 1.00 36.41 ? 194 PHE C CD2 1 
ATOM   3718  C  CE1 . PHE C 1 110 ? 48.854 18.796  -13.061 1.00 41.43 ? 194 PHE C CE1 1 
ATOM   3719  C  CE2 . PHE C 1 110 ? 50.548 17.124  -13.020 1.00 36.84 ? 194 PHE C CE2 1 
ATOM   3720  C  CZ  . PHE C 1 110 ? 49.833 18.070  -12.369 1.00 39.84 ? 194 PHE C CZ  1 
ATOM   3721  N  N   . HIS C 1 111 ? 49.982 20.410  -17.219 1.00 30.54 ? 195 HIS C N   1 
ATOM   3722  C  CA  . HIS C 1 111 ? 50.970 21.271  -17.679 1.00 30.62 ? 195 HIS C CA  1 
ATOM   3723  C  C   . HIS C 1 111 ? 51.419 22.128  -16.525 1.00 31.65 ? 195 HIS C C   1 
ATOM   3724  O  O   . HIS C 1 111 ? 50.616 22.834  -15.892 1.00 33.01 ? 195 HIS C O   1 
ATOM   3725  C  CB  . HIS C 1 111 ? 50.404 22.119  -18.803 1.00 30.55 ? 195 HIS C CB  1 
ATOM   3726  C  CG  . HIS C 1 111 ? 51.320 23.203  -19.224 1.00 32.35 ? 195 HIS C CG  1 
ATOM   3727  N  ND1 . HIS C 1 111 ? 51.153 24.514  -18.809 1.00 32.70 ? 195 HIS C ND1 1 
ATOM   3728  C  CD2 . HIS C 1 111 ? 52.460 23.168  -19.966 1.00 31.86 ? 195 HIS C CD2 1 
ATOM   3729  C  CE1 . HIS C 1 111 ? 52.152 25.237  -19.287 1.00 35.08 ? 195 HIS C CE1 1 
ATOM   3730  N  NE2 . HIS C 1 111 ? 52.964 24.443  -19.976 1.00 34.60 ? 195 HIS C NE2 1 
ATOM   3731  N  N   . GLN C 1 112 ? 52.720 22.062  -16.257 1.00 32.31 ? 196 GLN C N   1 
ATOM   3732  C  CA  . GLN C 1 112 ? 53.364 22.712  -15.141 1.00 32.65 ? 196 GLN C CA  1 
ATOM   3733  C  C   . GLN C 1 112 ? 52.547 22.704  -13.852 1.00 33.94 ? 196 GLN C C   1 
ATOM   3734  O  O   . GLN C 1 112 ? 52.468 23.689  -13.110 1.00 34.94 ? 196 GLN C O   1 
ATOM   3735  C  CB  . GLN C 1 112 ? 53.894 24.064  -15.567 1.00 31.58 ? 196 GLN C CB  1 
ATOM   3736  C  CG  . GLN C 1 112 ? 54.956 23.828  -16.671 1.00 34.56 ? 196 GLN C CG  1 
ATOM   3737  C  CD  . GLN C 1 112 ? 55.418 25.065  -17.446 1.00 33.80 ? 196 GLN C CD  1 
ATOM   3738  O  OE1 . GLN C 1 112 ? 56.208 24.961  -18.403 1.00 34.65 ? 196 GLN C OE1 1 
ATOM   3739  N  NE2 . GLN C 1 112 ? 54.940 26.217  -17.048 1.00 30.28 ? 196 GLN C NE2 1 
ATOM   3740  N  N   . GLY C 1 113 ? 51.954 21.548  -13.585 1.00 34.42 ? 197 GLY C N   1 
ATOM   3741  C  CA  . GLY C 1 113 ? 51.197 21.327  -12.353 1.00 34.69 ? 197 GLY C CA  1 
ATOM   3742  C  C   . GLY C 1 113 ? 49.783 21.862  -12.367 1.00 35.45 ? 197 GLY C C   1 
ATOM   3743  O  O   . GLY C 1 113 ? 49.149 21.951  -11.340 1.00 35.08 ? 197 GLY C O   1 
ATOM   3744  N  N   . CYS C 1 114 ? 49.290 22.232  -13.533 1.00 36.10 ? 198 CYS C N   1 
ATOM   3745  C  CA  . CYS C 1 114 ? 47.924 22.628  -13.642 1.00 37.65 ? 198 CYS C CA  1 
ATOM   3746  C  C   . CYS C 1 114 ? 47.235 21.807  -14.717 1.00 36.69 ? 198 CYS C C   1 
ATOM   3747  O  O   . CYS C 1 114 ? 47.868 21.251  -15.601 1.00 36.92 ? 198 CYS C O   1 
ATOM   3748  C  CB  . CYS C 1 114 ? 47.871 24.080  -14.027 1.00 39.07 ? 198 CYS C CB  1 
ATOM   3749  S  SG  . CYS C 1 114 ? 48.649 25.121  -12.818 1.00 47.54 ? 198 CYS C SG  1 
ATOM   3750  N  N   . TYR C 1 115 ? 45.922 21.737  -14.637 1.00 35.53 ? 199 TYR C N   1 
ATOM   3751  C  CA  . TYR C 1 115 ? 45.119 21.204  -15.731 1.00 33.46 ? 199 TYR C CA  1 
ATOM   3752  C  C   . TYR C 1 115 ? 44.757 22.380  -16.621 1.00 32.59 ? 199 TYR C C   1 
ATOM   3753  O  O   . TYR C 1 115 ? 44.148 23.318  -16.164 1.00 33.34 ? 199 TYR C O   1 
ATOM   3754  C  CB  . TYR C 1 115 ? 43.929 20.398  -15.203 1.00 33.36 ? 199 TYR C CB  1 
ATOM   3755  C  CG  . TYR C 1 115 ? 44.385 19.045  -14.688 1.00 32.47 ? 199 TYR C CG  1 
ATOM   3756  C  CD1 . TYR C 1 115 ? 44.607 18.827  -13.340 1.00 34.31 ? 199 TYR C CD1 1 
ATOM   3757  C  CD2 . TYR C 1 115 ? 44.661 18.018  -15.560 1.00 30.53 ? 199 TYR C CD2 1 
ATOM   3758  C  CE1 . TYR C 1 115 ? 45.049 17.573  -12.852 1.00 31.97 ? 199 TYR C CE1 1 
ATOM   3759  C  CE2 . TYR C 1 115 ? 45.101 16.817  -15.136 1.00 33.09 ? 199 TYR C CE2 1 
ATOM   3760  C  CZ  . TYR C 1 115 ? 45.293 16.591  -13.760 1.00 36.89 ? 199 TYR C CZ  1 
ATOM   3761  O  OH  . TYR C 1 115 ? 45.778 15.377  -13.329 1.00 39.18 ? 199 TYR C OH  1 
ATOM   3762  N  N   . VAL C 1 116 ? 45.193 22.321  -17.874 1.00 30.65 ? 200 VAL C N   1 
ATOM   3763  C  CA  . VAL C 1 116 ? 45.147 23.388  -18.815 1.00 30.00 ? 200 VAL C CA  1 
ATOM   3764  C  C   . VAL C 1 116 ? 44.129 22.998  -19.914 1.00 30.26 ? 200 VAL C C   1 
ATOM   3765  O  O   . VAL C 1 116 ? 43.958 21.845  -20.227 1.00 28.52 ? 200 VAL C O   1 
ATOM   3766  C  CB  . VAL C 1 116 ? 46.631 23.618  -19.337 1.00 31.29 ? 200 VAL C CB  1 
ATOM   3767  C  CG1 . VAL C 1 116 ? 46.698 23.957  -20.787 1.00 29.47 ? 200 VAL C CG1 1 
ATOM   3768  C  CG2 . VAL C 1 116 ? 47.376 24.693  -18.468 1.00 31.65 ? 200 VAL C CG2 1 
ATOM   3769  N  N   . LYS C 1 117 ? 43.426 23.966  -20.469 1.00 31.33 ? 201 LYS C N   1 
ATOM   3770  C  CA  . LYS C 1 117 ? 42.265 23.690  -21.325 1.00 33.15 ? 201 LYS C CA  1 
ATOM   3771  C  C   . LYS C 1 117 ? 42.670 24.183  -22.678 1.00 33.76 ? 201 LYS C C   1 
ATOM   3772  O  O   . LYS C 1 117 ? 42.506 25.310  -23.018 1.00 34.57 ? 201 LYS C O   1 
ATOM   3773  C  CB  . LYS C 1 117 ? 41.014 24.439  -20.816 1.00 33.53 ? 201 LYS C CB  1 
ATOM   3774  C  CG  . LYS C 1 117 ? 40.480 23.829  -19.588 1.00 32.36 ? 201 LYS C CG  1 
ATOM   3775  C  CD  . LYS C 1 117 ? 39.546 24.649  -18.820 1.00 33.52 ? 201 LYS C CD  1 
ATOM   3776  C  CE  . LYS C 1 117 ? 39.069 23.757  -17.675 1.00 34.56 ? 201 LYS C CE  1 
ATOM   3777  N  NZ  . LYS C 1 117 ? 39.110 24.507  -16.400 1.00 40.51 ? 201 LYS C NZ  1 
ATOM   3778  N  N   . ASP C 1 118 ? 43.270 23.330  -23.444 1.00 35.70 ? 202 ASP C N   1 
ATOM   3779  C  CA  . ASP C 1 118 ? 43.912 23.806  -24.595 1.00 37.46 ? 202 ASP C CA  1 
ATOM   3780  C  C   . ASP C 1 118 ? 42.886 23.752  -25.654 1.00 36.87 ? 202 ASP C C   1 
ATOM   3781  O  O   . ASP C 1 118 ? 42.410 22.675  -26.002 1.00 37.26 ? 202 ASP C O   1 
ATOM   3782  C  CB  . ASP C 1 118 ? 45.082 22.887  -24.938 1.00 39.77 ? 202 ASP C CB  1 
ATOM   3783  C  CG  . ASP C 1 118 ? 45.644 23.101  -26.356 1.00 43.89 ? 202 ASP C CG  1 
ATOM   3784  O  OD1 . ASP C 1 118 ? 45.033 23.753  -27.259 1.00 50.28 ? 202 ASP C OD1 1 
ATOM   3785  O  OD2 . ASP C 1 118 ? 46.740 22.570  -26.560 1.00 51.05 ? 202 ASP C OD2 1 
ATOM   3786  N  N   . LEU C 1 119 ? 42.624 24.925  -26.213 1.00 36.10 ? 203 LEU C N   1 
ATOM   3787  C  CA  . LEU C 1 119 ? 41.546 25.143  -27.116 1.00 36.00 ? 203 LEU C CA  1 
ATOM   3788  C  C   . LEU C 1 119 ? 41.863 24.714  -28.530 1.00 37.69 ? 203 LEU C C   1 
ATOM   3789  O  O   . LEU C 1 119 ? 40.972 24.809  -29.377 1.00 37.97 ? 203 LEU C O   1 
ATOM   3790  C  CB  . LEU C 1 119 ? 41.161 26.620  -27.133 1.00 33.87 ? 203 LEU C CB  1 
ATOM   3791  C  CG  . LEU C 1 119 ? 40.784 27.289  -25.825 1.00 32.80 ? 203 LEU C CG  1 
ATOM   3792  C  CD1 . LEU C 1 119 ? 40.068 28.547  -26.158 1.00 30.93 ? 203 LEU C CD1 1 
ATOM   3793  C  CD2 . LEU C 1 119 ? 39.927 26.434  -24.931 1.00 30.79 ? 203 LEU C CD2 1 
ATOM   3794  N  N   . SER C 1 120 ? 43.105 24.297  -28.807 1.00 38.72 ? 204 SER C N   1 
ATOM   3795  C  CA  . SER C 1 120 ? 43.483 23.994  -30.216 1.00 40.75 ? 204 SER C CA  1 
ATOM   3796  C  C   . SER C 1 120 ? 43.036 22.620  -30.641 1.00 42.50 ? 204 SER C C   1 
ATOM   3797  O  O   . SER C 1 120 ? 43.358 22.185  -31.711 1.00 43.50 ? 204 SER C O   1 
ATOM   3798  C  CB  . SER C 1 120 ? 44.994 24.065  -30.432 1.00 40.28 ? 204 SER C CB  1 
ATOM   3799  O  OG  . SER C 1 120 ? 45.723 23.235  -29.503 1.00 35.67 ? 204 SER C OG  1 
ATOM   3800  N  N   . ARG C 1 121 ? 42.309 21.929  -29.791 1.00 43.77 ? 205 ARG C N   1 
ATOM   3801  C  CA  . ARG C 1 121 ? 42.174 20.495  -29.910 1.00 46.61 ? 205 ARG C CA  1 
ATOM   3802  C  C   . ARG C 1 121 ? 40.678 20.350  -29.918 1.00 44.77 ? 205 ARG C C   1 
ATOM   3803  O  O   . ARG C 1 121 ? 40.135 19.249  -29.991 1.00 43.97 ? 205 ARG C O   1 
ATOM   3804  C  CB  . ARG C 1 121 ? 42.681 19.930  -28.568 1.00 47.49 ? 205 ARG C CB  1 
ATOM   3805  C  CG  . ARG C 1 121 ? 43.615 18.680  -28.552 1.00 51.88 ? 205 ARG C CG  1 
ATOM   3806  C  CD  . ARG C 1 121 ? 43.916 18.346  -27.006 1.00 53.45 ? 205 ARG C CD  1 
ATOM   3807  N  NE  . ARG C 1 121 ? 45.023 17.394  -26.820 1.00 67.61 ? 205 ARG C NE  1 
ATOM   3808  C  CZ  . ARG C 1 121 ? 46.338 17.703  -26.811 1.00 70.50 ? 205 ARG C CZ  1 
ATOM   3809  N  NH1 . ARG C 1 121 ? 47.231 16.723  -26.645 1.00 71.20 ? 205 ARG C NH1 1 
ATOM   3810  N  NH2 . ARG C 1 121 ? 46.774 18.972  -26.963 1.00 70.43 ? 205 ARG C NH2 1 
ATOM   3811  N  N   . LEU C 1 122 ? 40.022 21.505  -29.786 1.00 44.20 ? 206 LEU C N   1 
ATOM   3812  C  CA  . LEU C 1 122 ? 38.630 21.580  -29.438 1.00 43.75 ? 206 LEU C CA  1 
ATOM   3813  C  C   . LEU C 1 122 ? 37.777 21.156  -30.576 1.00 43.55 ? 206 LEU C C   1 
ATOM   3814  O  O   . LEU C 1 122 ? 36.826 20.436  -30.354 1.00 44.35 ? 206 LEU C O   1 
ATOM   3815  C  CB  . LEU C 1 122 ? 38.249 22.994  -28.997 1.00 44.20 ? 206 LEU C CB  1 
ATOM   3816  C  CG  . LEU C 1 122 ? 36.947 23.138  -28.196 1.00 43.89 ? 206 LEU C CG  1 
ATOM   3817  C  CD1 . LEU C 1 122 ? 37.088 22.525  -26.820 1.00 41.12 ? 206 LEU C CD1 1 
ATOM   3818  C  CD2 . LEU C 1 122 ? 36.535 24.608  -28.082 1.00 44.25 ? 206 LEU C CD2 1 
ATOM   3819  N  N   . GLY C 1 123 ? 38.120 21.567  -31.798 1.00 42.90 ? 207 GLY C N   1 
ATOM   3820  C  CA  . GLY C 1 123 ? 37.323 21.175  -32.978 1.00 41.57 ? 207 GLY C CA  1 
ATOM   3821  C  C   . GLY C 1 123 ? 36.356 22.280  -33.348 1.00 40.79 ? 207 GLY C C   1 
ATOM   3822  O  O   . GLY C 1 123 ? 35.304 22.020  -33.898 1.00 42.00 ? 207 GLY C O   1 
ATOM   3823  N  N   . ARG C 1 124 ? 36.700 23.498  -32.990 1.00 38.70 ? 208 ARG C N   1 
ATOM   3824  C  CA  . ARG C 1 124 ? 35.875 24.627  -33.165 1.00 39.24 ? 208 ARG C CA  1 
ATOM   3825  C  C   . ARG C 1 124 ? 36.900 25.632  -33.639 1.00 40.68 ? 208 ARG C C   1 
ATOM   3826  O  O   . ARG C 1 124 ? 38.061 25.603  -33.231 1.00 41.57 ? 208 ARG C O   1 
ATOM   3827  C  CB  . ARG C 1 124 ? 35.329 25.163  -31.825 1.00 38.34 ? 208 ARG C CB  1 
ATOM   3828  C  CG  . ARG C 1 124 ? 34.151 24.477  -31.169 1.00 37.84 ? 208 ARG C CG  1 
ATOM   3829  C  CD  . ARG C 1 124 ? 32.830 24.351  -32.019 1.00 35.22 ? 208 ARG C CD  1 
ATOM   3830  N  NE  . ARG C 1 124 ? 32.776 23.024  -32.590 1.00 34.10 ? 208 ARG C NE  1 
ATOM   3831  C  CZ  . ARG C 1 124 ? 32.032 22.000  -32.188 1.00 35.95 ? 208 ARG C CZ  1 
ATOM   3832  N  NH1 . ARG C 1 124 ? 31.143 22.061  -31.230 1.00 35.59 ? 208 ARG C NH1 1 
ATOM   3833  N  NH2 . ARG C 1 124 ? 32.195 20.861  -32.798 1.00 41.80 ? 208 ARG C NH2 1 
ATOM   3834  N  N   . ASP C 1 125 ? 36.491 26.572  -34.460 1.00 41.16 ? 209 ASP C N   1 
ATOM   3835  C  CA  . ASP C 1 125 ? 37.456 27.490  -34.950 1.00 42.55 ? 209 ASP C CA  1 
ATOM   3836  C  C   . ASP C 1 125 ? 37.726 28.524  -33.836 1.00 42.12 ? 209 ASP C C   1 
ATOM   3837  O  O   . ASP C 1 125 ? 36.804 29.114  -33.259 1.00 43.53 ? 209 ASP C O   1 
ATOM   3838  C  CB  . ASP C 1 125 ? 37.021 27.987  -36.357 1.00 42.42 ? 209 ASP C CB  1 
ATOM   3839  C  CG  . ASP C 1 125 ? 37.233 29.483  -36.586 1.00 49.14 ? 209 ASP C CG  1 
ATOM   3840  O  OD1 . ASP C 1 125 ? 38.317 30.070  -36.249 1.00 51.92 ? 209 ASP C OD1 1 
ATOM   3841  O  OD2 . ASP C 1 125 ? 36.276 30.089  -37.161 1.00 58.26 ? 209 ASP C OD2 1 
ATOM   3842  N  N   . LEU C 1 126 ? 38.991 28.712  -33.513 1.00 40.94 ? 210 LEU C N   1 
ATOM   3843  C  CA  . LEU C 1 126 ? 39.371 29.676  -32.510 1.00 40.68 ? 210 LEU C CA  1 
ATOM   3844  C  C   . LEU C 1 126 ? 38.851 31.058  -32.728 1.00 41.15 ? 210 LEU C C   1 
ATOM   3845  O  O   . LEU C 1 126 ? 38.772 31.864  -31.768 1.00 40.43 ? 210 LEU C O   1 
ATOM   3846  C  CB  . LEU C 1 126 ? 40.885 29.721  -32.349 1.00 40.45 ? 210 LEU C CB  1 
ATOM   3847  C  CG  . LEU C 1 126 ? 41.512 28.377  -31.953 1.00 41.81 ? 210 LEU C CG  1 
ATOM   3848  C  CD1 . LEU C 1 126 ? 43.024 28.484  -31.805 1.00 38.91 ? 210 LEU C CD1 1 
ATOM   3849  C  CD2 . LEU C 1 126 ? 40.879 27.849  -30.667 1.00 42.30 ? 210 LEU C CD2 1 
ATOM   3850  N  N   . ARG C 1 127 ? 38.526 31.382  -33.971 1.00 41.98 ? 211 ARG C N   1 
ATOM   3851  C  CA  . ARG C 1 127 ? 38.005 32.722  -34.233 1.00 44.56 ? 211 ARG C CA  1 
ATOM   3852  C  C   . ARG C 1 127 ? 36.598 32.851  -33.585 1.00 43.79 ? 211 ARG C C   1 
ATOM   3853  O  O   . ARG C 1 127 ? 36.142 33.950  -33.279 1.00 44.06 ? 211 ARG C O   1 
ATOM   3854  C  CB  . ARG C 1 127 ? 37.998 33.016  -35.735 1.00 46.24 ? 211 ARG C CB  1 
ATOM   3855  C  CG  . ARG C 1 127 ? 39.202 33.837  -36.202 1.00 52.01 ? 211 ARG C CG  1 
ATOM   3856  C  CD  . ARG C 1 127 ? 39.816 33.368  -37.544 1.00 61.61 ? 211 ARG C CD  1 
ATOM   3857  N  NE  . ARG C 1 127 ? 38.921 33.330  -38.722 1.00 70.17 ? 211 ARG C NE  1 
ATOM   3858  C  CZ  . ARG C 1 127 ? 38.460 32.214  -39.329 1.00 71.64 ? 211 ARG C CZ  1 
ATOM   3859  N  NH1 . ARG C 1 127 ? 38.789 31.004  -38.856 1.00 68.93 ? 211 ARG C NH1 1 
ATOM   3860  N  NH2 . ARG C 1 127 ? 37.666 32.309  -40.415 1.00 69.22 ? 211 ARG C NH2 1 
ATOM   3861  N  N   . LYS C 1 128 ? 35.982 31.701  -33.289 1.00 42.52 ? 212 LYS C N   1 
ATOM   3862  C  CA  . LYS C 1 128 ? 34.625 31.632  -32.789 1.00 41.53 ? 212 LYS C CA  1 
ATOM   3863  C  C   . LYS C 1 128 ? 34.563 30.938  -31.439 1.00 40.07 ? 212 LYS C C   1 
ATOM   3864  O  O   . LYS C 1 128 ? 33.616 30.206  -31.196 1.00 41.13 ? 212 LYS C O   1 
ATOM   3865  C  CB  . LYS C 1 128 ? 33.757 30.814  -33.751 1.00 42.13 ? 212 LYS C CB  1 
ATOM   3866  C  CG  . LYS C 1 128 ? 33.666 31.319  -35.178 1.00 45.30 ? 212 LYS C CG  1 
ATOM   3867  C  CD  . LYS C 1 128 ? 32.597 32.405  -35.323 1.00 50.73 ? 212 LYS C CD  1 
ATOM   3868  C  CE  . LYS C 1 128 ? 31.180 31.752  -35.449 1.00 56.01 ? 212 LYS C CE  1 
ATOM   3869  N  NZ  . LYS C 1 128 ? 30.121 32.666  -36.013 1.00 57.43 ? 212 LYS C NZ  1 
ATOM   3870  N  N   . THR C 1 129 ? 35.537 31.132  -30.556 1.00 37.35 ? 213 THR C N   1 
ATOM   3871  C  CA  . THR C 1 129 ? 35.534 30.395  -29.294 1.00 34.75 ? 213 THR C CA  1 
ATOM   3872  C  C   . THR C 1 129 ? 35.883 31.335  -28.192 1.00 33.50 ? 213 THR C C   1 
ATOM   3873  O  O   . THR C 1 129 ? 36.710 32.193  -28.370 1.00 33.70 ? 213 THR C O   1 
ATOM   3874  C  CB  . THR C 1 129 ? 36.564 29.240  -29.311 1.00 34.30 ? 213 THR C CB  1 
ATOM   3875  O  OG1 . THR C 1 129 ? 36.246 28.352  -30.356 1.00 32.87 ? 213 THR C OG1 1 
ATOM   3876  C  CG2 . THR C 1 129 ? 36.500 28.424  -28.070 1.00 35.63 ? 213 THR C CG2 1 
ATOM   3877  N  N   . LEU C 1 130 ? 35.245 31.197  -27.048 1.00 32.58 ? 214 LEU C N   1 
ATOM   3878  C  CA  . LEU C 1 130 ? 35.658 31.936  -25.862 1.00 32.31 ? 214 LEU C CA  1 
ATOM   3879  C  C   . LEU C 1 130 ? 35.740 30.960  -24.710 1.00 31.79 ? 214 LEU C C   1 
ATOM   3880  O  O   . LEU C 1 130 ? 35.117 29.906  -24.745 1.00 32.56 ? 214 LEU C O   1 
ATOM   3881  C  CB  . LEU C 1 130 ? 34.662 33.026  -25.536 1.00 32.97 ? 214 LEU C CB  1 
ATOM   3882  C  CG  . LEU C 1 130 ? 34.364 34.121  -26.582 1.00 36.34 ? 214 LEU C CG  1 
ATOM   3883  C  CD1 . LEU C 1 130 ? 33.068 34.747  -26.227 1.00 35.11 ? 214 LEU C CD1 1 
ATOM   3884  C  CD2 . LEU C 1 130 ? 35.463 35.203  -26.596 1.00 37.31 ? 214 LEU C CD2 1 
ATOM   3885  N  N   . ILE C 1 131 ? 36.524 31.262  -23.709 1.00 30.74 ? 215 ILE C N   1 
ATOM   3886  C  CA  . ILE C 1 131 ? 36.611 30.405  -22.549 1.00 31.15 ? 215 ILE C CA  1 
ATOM   3887  C  C   . ILE C 1 131 ? 36.265 31.276  -21.393 1.00 31.50 ? 215 ILE C C   1 
ATOM   3888  O  O   . ILE C 1 131 ? 36.629 32.434  -21.394 1.00 31.99 ? 215 ILE C O   1 
ATOM   3889  C  CB  . ILE C 1 131 ? 38.037 29.714  -22.357 1.00 32.07 ? 215 ILE C CB  1 
ATOM   3890  C  CG1 . ILE C 1 131 ? 38.227 29.174  -20.918 1.00 32.02 ? 215 ILE C CG1 1 
ATOM   3891  C  CG2 . ILE C 1 131 ? 39.204 30.654  -22.624 1.00 32.24 ? 215 ILE C CG2 1 
ATOM   3892  C  CD1 . ILE C 1 131 ? 39.257 28.028  -20.805 1.00 29.99 ? 215 ILE C CD1 1 
ATOM   3893  N  N   . LEU C 1 132 ? 35.556 30.720  -20.415 1.00 32.16 ? 216 LEU C N   1 
ATOM   3894  C  CA  . LEU C 1 132 ? 35.181 31.411  -19.196 1.00 32.73 ? 216 LEU C CA  1 
ATOM   3895  C  C   . LEU C 1 132 ? 35.566 30.510  -18.039 1.00 33.29 ? 216 LEU C C   1 
ATOM   3896  O  O   . LEU C 1 132 ? 34.978 29.449  -17.861 1.00 33.81 ? 216 LEU C O   1 
ATOM   3897  C  CB  . LEU C 1 132 ? 33.655 31.632  -19.218 1.00 32.87 ? 216 LEU C CB  1 
ATOM   3898  C  CG  . LEU C 1 132 ? 32.935 32.234  -17.993 1.00 33.11 ? 216 LEU C CG  1 
ATOM   3899  C  CD1 . LEU C 1 132 ? 33.393 33.649  -17.670 1.00 28.19 ? 216 LEU C CD1 1 
ATOM   3900  C  CD2 . LEU C 1 132 ? 31.411 32.166  -18.169 1.00 33.27 ? 216 LEU C CD2 1 
ATOM   3901  N  N   . ASP C 1 133 ? 36.564 30.916  -17.266 1.00 34.48 ? 217 ASP C N   1 
ATOM   3902  C  CA  . ASP C 1 133 ? 37.173 30.099  -16.191 1.00 35.18 ? 217 ASP C CA  1 
ATOM   3903  C  C   . ASP C 1 133 ? 37.775 31.086  -15.194 1.00 35.48 ? 217 ASP C C   1 
ATOM   3904  O  O   . ASP C 1 133 ? 38.325 32.108  -15.593 1.00 35.13 ? 217 ASP C O   1 
ATOM   3905  C  CB  . ASP C 1 133 ? 38.285 29.197  -16.781 1.00 34.33 ? 217 ASP C CB  1 
ATOM   3906  C  CG  . ASP C 1 133 ? 38.766 28.090  -15.821 1.00 37.49 ? 217 ASP C CG  1 
ATOM   3907  O  OD1 . ASP C 1 133 ? 38.968 28.289  -14.619 1.00 43.21 ? 217 ASP C OD1 1 
ATOM   3908  O  OD2 . ASP C 1 133 ? 39.009 26.964  -16.275 1.00 43.95 ? 217 ASP C OD2 1 
ATOM   3909  N  N   . ASN C 1 134 ? 37.659 30.796  -13.902 1.00 36.70 ? 218 ASN C N   1 
ATOM   3910  C  CA  . ASN C 1 134 ? 38.145 31.712  -12.892 1.00 38.13 ? 218 ASN C CA  1 
ATOM   3911  C  C   . ASN C 1 134 ? 39.654 31.664  -12.763 1.00 39.51 ? 218 ASN C C   1 
ATOM   3912  O  O   . ASN C 1 134 ? 40.284 32.621  -12.235 1.00 40.19 ? 218 ASN C O   1 
ATOM   3913  C  CB  . ASN C 1 134 ? 37.502 31.428  -11.557 1.00 38.22 ? 218 ASN C CB  1 
ATOM   3914  C  CG  . ASN C 1 134 ? 37.725 30.000  -11.085 1.00 39.79 ? 218 ASN C CG  1 
ATOM   3915  O  OD1 . ASN C 1 134 ? 37.231 29.021  -11.660 1.00 36.85 ? 218 ASN C OD1 1 
ATOM   3916  N  ND2 . ASN C 1 134 ? 38.498 29.878  -10.033 1.00 44.41 ? 218 ASN C ND2 1 
ATOM   3917  N  N   . SER C 1 135 ? 40.239 30.577  -13.276 1.00 39.56 ? 219 SER C N   1 
ATOM   3918  C  CA  . SER C 1 135 ? 41.688 30.343  -13.205 1.00 40.18 ? 219 SER C CA  1 
ATOM   3919  C  C   . SER C 1 135 ? 42.400 30.656  -14.519 1.00 39.94 ? 219 SER C C   1 
ATOM   3920  O  O   . SER C 1 135 ? 42.355 29.883  -15.483 1.00 39.99 ? 219 SER C O   1 
ATOM   3921  C  CB  . SER C 1 135 ? 41.999 28.876  -12.840 1.00 40.70 ? 219 SER C CB  1 
ATOM   3922  O  OG  . SER C 1 135 ? 41.355 28.406  -11.655 1.00 44.80 ? 219 SER C OG  1 
ATOM   3923  N  N   . PRO C 1 136 ? 43.156 31.728  -14.537 1.00 40.18 ? 220 PRO C N   1 
ATOM   3924  C  CA  . PRO C 1 136 ? 43.925 32.129  -15.724 1.00 40.83 ? 220 PRO C CA  1 
ATOM   3925  C  C   . PRO C 1 136 ? 44.930 31.037  -16.180 1.00 41.41 ? 220 PRO C C   1 
ATOM   3926  O  O   . PRO C 1 136 ? 45.436 31.065  -17.330 1.00 41.96 ? 220 PRO C O   1 
ATOM   3927  C  CB  . PRO C 1 136 ? 44.697 33.351  -15.239 1.00 40.95 ? 220 PRO C CB  1 
ATOM   3928  C  CG  . PRO C 1 136 ? 43.947 33.849  -14.002 1.00 41.21 ? 220 PRO C CG  1 
ATOM   3929  C  CD  . PRO C 1 136 ? 43.354 32.616  -13.383 1.00 40.57 ? 220 PRO C CD  1 
ATOM   3930  N  N   . ALA C 1 137 ? 45.212 30.090  -15.287 1.00 40.49 ? 221 ALA C N   1 
ATOM   3931  C  CA  . ALA C 1 137 ? 46.214 29.059  -15.528 1.00 39.36 ? 221 ALA C CA  1 
ATOM   3932  C  C   . ALA C 1 137 ? 45.659 28.060  -16.496 1.00 38.70 ? 221 ALA C C   1 
ATOM   3933  O  O   . ALA C 1 137 ? 46.394 27.453  -17.283 1.00 38.75 ? 221 ALA C O   1 
ATOM   3934  C  CB  . ALA C 1 137 ? 46.540 28.359  -14.242 1.00 40.64 ? 221 ALA C CB  1 
ATOM   3935  N  N   . SER C 1 138 ? 44.347 27.897  -16.413 1.00 37.59 ? 222 SER C N   1 
ATOM   3936  C  CA  . SER C 1 138 ? 43.567 27.038  -17.301 1.00 36.44 ? 222 SER C CA  1 
ATOM   3937  C  C   . SER C 1 138 ? 43.599 27.485  -18.730 1.00 33.88 ? 222 SER C C   1 
ATOM   3938  O  O   . SER C 1 138 ? 43.425 26.670  -19.598 1.00 33.64 ? 222 SER C O   1 
ATOM   3939  C  CB  . SER C 1 138 ? 42.094 26.997  -16.851 1.00 36.86 ? 222 SER C CB  1 
ATOM   3940  O  OG  . SER C 1 138 ? 42.027 26.359  -15.585 1.00 40.77 ? 222 SER C OG  1 
ATOM   3941  N  N   . TYR C 1 139 ? 43.772 28.771  -18.977 1.00 33.19 ? 223 TYR C N   1 
ATOM   3942  C  CA  . TYR C 1 139 ? 43.804 29.270  -20.362 1.00 33.63 ? 223 TYR C CA  1 
ATOM   3943  C  C   . TYR C 1 139 ? 45.126 29.948  -20.781 1.00 34.10 ? 223 TYR C C   1 
ATOM   3944  O  O   . TYR C 1 139 ? 45.182 30.737  -21.743 1.00 34.74 ? 223 TYR C O   1 
ATOM   3945  C  CB  . TYR C 1 139 ? 42.593 30.125  -20.711 1.00 32.53 ? 223 TYR C CB  1 
ATOM   3946  C  CG  . TYR C 1 139 ? 42.332 31.305  -19.806 1.00 32.88 ? 223 TYR C CG  1 
ATOM   3947  C  CD1 . TYR C 1 139 ? 43.079 32.477  -19.903 1.00 30.65 ? 223 TYR C CD1 1 
ATOM   3948  C  CD2 . TYR C 1 139 ? 41.292 31.271  -18.883 1.00 31.85 ? 223 TYR C CD2 1 
ATOM   3949  C  CE1 . TYR C 1 139 ? 42.793 33.605  -19.083 1.00 29.77 ? 223 TYR C CE1 1 
ATOM   3950  C  CE2 . TYR C 1 139 ? 41.009 32.366  -18.053 1.00 34.07 ? 223 TYR C CE2 1 
ATOM   3951  C  CZ  . TYR C 1 139 ? 41.756 33.542  -18.168 1.00 35.46 ? 223 TYR C CZ  1 
ATOM   3952  O  OH  . TYR C 1 139 ? 41.450 34.638  -17.337 1.00 36.98 ? 223 TYR C OH  1 
ATOM   3953  N  N   . ILE C 1 140 ? 46.196 29.586  -20.088 1.00 33.70 ? 224 ILE C N   1 
ATOM   3954  C  CA  . ILE C 1 140 ? 47.506 30.100  -20.403 1.00 32.20 ? 224 ILE C CA  1 
ATOM   3955  C  C   . ILE C 1 140 ? 47.931 29.931  -21.883 1.00 30.76 ? 224 ILE C C   1 
ATOM   3956  O  O   . ILE C 1 140 ? 48.669 30.750  -22.403 1.00 32.11 ? 224 ILE C O   1 
ATOM   3957  C  CB  . ILE C 1 140 ? 48.556 29.539  -19.428 1.00 32.07 ? 224 ILE C CB  1 
ATOM   3958  C  CG1 . ILE C 1 140 ? 49.793 30.450  -19.470 1.00 34.31 ? 224 ILE C CG1 1 
ATOM   3959  C  CG2 . ILE C 1 140 ? 48.832 28.048  -19.683 1.00 25.37 ? 224 ILE C CG2 1 
ATOM   3960  C  CD1 . ILE C 1 140 ? 50.814 30.197  -18.294 1.00 34.45 ? 224 ILE C CD1 1 
ATOM   3961  N  N   . PHE C 1 141 ? 47.459 28.902  -22.554 1.00 28.87 ? 225 PHE C N   1 
ATOM   3962  C  CA  . PHE C 1 141 ? 47.766 28.697  -23.971 1.00 28.17 ? 225 PHE C CA  1 
ATOM   3963  C  C   . PHE C 1 141 ? 46.886 29.481  -24.931 1.00 28.71 ? 225 PHE C C   1 
ATOM   3964  O  O   . PHE C 1 141 ? 47.090 29.365  -26.117 1.00 30.25 ? 225 PHE C O   1 
ATOM   3965  C  CB  . PHE C 1 141 ? 47.627 27.217  -24.355 1.00 27.40 ? 225 PHE C CB  1 
ATOM   3966  C  CG  . PHE C 1 141 ? 48.838 26.341  -23.999 1.00 26.91 ? 225 PHE C CG  1 
ATOM   3967  C  CD1 . PHE C 1 141 ? 49.751 25.957  -24.984 1.00 25.73 ? 225 PHE C CD1 1 
ATOM   3968  C  CD2 . PHE C 1 141 ? 49.037 25.880  -22.692 1.00 26.14 ? 225 PHE C CD2 1 
ATOM   3969  C  CE1 . PHE C 1 141 ? 50.846 25.128  -24.678 1.00 28.12 ? 225 PHE C CE1 1 
ATOM   3970  C  CE2 . PHE C 1 141 ? 50.124 25.055  -22.344 1.00 29.51 ? 225 PHE C CE2 1 
ATOM   3971  C  CZ  . PHE C 1 141 ? 51.041 24.672  -23.338 1.00 30.68 ? 225 PHE C CZ  1 
ATOM   3972  N  N   . HIS C 1 142 ? 45.850 30.181  -24.444 1.00 28.73 ? 226 HIS C N   1 
ATOM   3973  C  CA  . HIS C 1 142 ? 44.934 30.914  -25.292 1.00 28.46 ? 226 HIS C CA  1 
ATOM   3974  C  C   . HIS C 1 142 ? 44.312 32.096  -24.506 1.00 30.35 ? 226 HIS C C   1 
ATOM   3975  O  O   . HIS C 1 142 ? 43.093 32.202  -24.439 1.00 30.85 ? 226 HIS C O   1 
ATOM   3976  C  CB  . HIS C 1 142 ? 43.852 29.973  -25.840 1.00 27.77 ? 226 HIS C CB  1 
ATOM   3977  C  CG  . HIS C 1 142 ? 44.380 28.858  -26.701 1.00 27.73 ? 226 HIS C CG  1 
ATOM   3978  N  ND1 . HIS C 1 142 ? 44.662 29.019  -28.044 1.00 29.06 ? 226 HIS C ND1 1 
ATOM   3979  C  CD2 . HIS C 1 142 ? 44.737 27.590  -26.398 1.00 24.54 ? 226 HIS C CD2 1 
ATOM   3980  C  CE1 . HIS C 1 142 ? 45.144 27.892  -28.538 1.00 26.66 ? 226 HIS C CE1 1 
ATOM   3981  N  NE2 . HIS C 1 142 ? 45.187 27.006  -27.561 1.00 29.31 ? 226 HIS C NE2 1 
ATOM   3982  N  N   . PRO C 1 143 ? 45.136 32.985  -23.867 1.00 31.19 ? 227 PRO C N   1 
ATOM   3983  C  CA  . PRO C 1 143 ? 44.494 34.049  -23.037 1.00 31.88 ? 227 PRO C CA  1 
ATOM   3984  C  C   . PRO C 1 143 ? 43.713 35.036  -23.878 1.00 32.85 ? 227 PRO C C   1 
ATOM   3985  O  O   . PRO C 1 143 ? 42.825 35.677  -23.390 1.00 35.34 ? 227 PRO C O   1 
ATOM   3986  C  CB  . PRO C 1 143 ? 45.673 34.740  -22.397 1.00 31.68 ? 227 PRO C CB  1 
ATOM   3987  C  CG  . PRO C 1 143 ? 46.753 34.473  -23.457 1.00 31.72 ? 227 PRO C CG  1 
ATOM   3988  C  CD  . PRO C 1 143 ? 46.595 33.098  -23.824 1.00 29.11 ? 227 PRO C CD  1 
ATOM   3989  N  N   . GLU C 1 144 ? 43.992 35.114  -25.151 1.00 33.24 ? 228 GLU C N   1 
ATOM   3990  C  CA  . GLU C 1 144 ? 43.190 35.916  -25.998 1.00 33.83 ? 228 GLU C CA  1 
ATOM   3991  C  C   . GLU C 1 144 ? 41.736 35.405  -26.147 1.00 36.19 ? 228 GLU C C   1 
ATOM   3992  O  O   . GLU C 1 144 ? 40.834 36.183  -26.498 1.00 37.78 ? 228 GLU C O   1 
ATOM   3993  C  CB  . GLU C 1 144 ? 43.857 36.047  -27.380 1.00 32.98 ? 228 GLU C CB  1 
ATOM   3994  C  CG  . GLU C 1 144 ? 43.977 34.767  -28.188 1.00 32.22 ? 228 GLU C CG  1 
ATOM   3995  C  CD  . GLU C 1 144 ? 45.314 34.019  -27.968 1.00 34.79 ? 228 GLU C CD  1 
ATOM   3996  O  OE1 . GLU C 1 144 ? 45.838 33.432  -28.965 1.00 29.13 ? 228 GLU C OE1 1 
ATOM   3997  O  OE2 . GLU C 1 144 ? 45.817 34.016  -26.786 1.00 33.12 ? 228 GLU C OE2 1 
ATOM   3998  N  N   . ASN C 1 145 ? 41.482 34.106  -25.941 1.00 36.96 ? 229 ASN C N   1 
ATOM   3999  C  CA  . ASN C 1 145 ? 40.117 33.645  -26.040 1.00 35.63 ? 229 ASN C CA  1 
ATOM   4000  C  C   . ASN C 1 145 ? 39.393 33.790  -24.729 1.00 36.77 ? 229 ASN C C   1 
ATOM   4001  O  O   . ASN C 1 145 ? 38.219 33.513  -24.641 1.00 37.27 ? 229 ASN C O   1 
ATOM   4002  C  CB  . ASN C 1 145 ? 40.033 32.266  -26.609 1.00 34.13 ? 229 ASN C CB  1 
ATOM   4003  C  CG  . ASN C 1 145 ? 40.372 32.238  -28.089 1.00 34.79 ? 229 ASN C CG  1 
ATOM   4004  O  OD1 . ASN C 1 145 ? 41.542 32.184  -28.436 1.00 35.91 ? 229 ASN C OD1 1 
ATOM   4005  N  ND2 . ASN C 1 145 ? 39.347 32.285  -28.980 1.00 26.04 ? 229 ASN C ND2 1 
ATOM   4006  N  N   . ALA C 1 146 ? 40.060 34.304  -23.713 1.00 37.02 ? 230 ALA C N   1 
ATOM   4007  C  CA  . ALA C 1 146 ? 39.409 34.313  -22.397 1.00 38.38 ? 230 ALA C CA  1 
ATOM   4008  C  C   . ALA C 1 146 ? 38.482 35.456  -22.145 1.00 38.59 ? 230 ALA C C   1 
ATOM   4009  O  O   . ALA C 1 146 ? 38.751 36.561  -22.537 1.00 39.78 ? 230 ALA C O   1 
ATOM   4010  C  CB  . ALA C 1 146 ? 40.457 34.263  -21.259 1.00 36.49 ? 230 ALA C CB  1 
ATOM   4011  N  N   . VAL C 1 147 ? 37.424 35.211  -21.394 1.00 40.10 ? 231 VAL C N   1 
ATOM   4012  C  CA  . VAL C 1 147 ? 36.642 36.302  -20.779 1.00 39.90 ? 231 VAL C CA  1 
ATOM   4013  C  C   . VAL C 1 147 ? 36.802 36.123  -19.267 1.00 40.75 ? 231 VAL C C   1 
ATOM   4014  O  O   . VAL C 1 147 ? 36.193 35.252  -18.701 1.00 41.75 ? 231 VAL C O   1 
ATOM   4015  C  CB  . VAL C 1 147 ? 35.154 36.190  -21.141 1.00 39.24 ? 231 VAL C CB  1 
ATOM   4016  C  CG1 . VAL C 1 147 ? 34.362 37.361  -20.559 1.00 39.03 ? 231 VAL C CG1 1 
ATOM   4017  C  CG2 . VAL C 1 147 ? 34.981 36.125  -22.619 1.00 37.24 ? 231 VAL C CG2 1 
ATOM   4018  N  N   . PRO C 1 148 ? 37.687 36.878  -18.630 1.00 41.13 ? 232 PRO C N   1 
ATOM   4019  C  CA  . PRO C 1 148 ? 37.956 36.846  -17.181 1.00 41.51 ? 232 PRO C CA  1 
ATOM   4020  C  C   . PRO C 1 148 ? 36.743 36.924  -16.267 1.00 41.85 ? 232 PRO C C   1 
ATOM   4021  O  O   . PRO C 1 148 ? 35.832 37.718  -16.534 1.00 41.81 ? 232 PRO C O   1 
ATOM   4022  C  CB  . PRO C 1 148 ? 38.804 38.090  -16.949 1.00 41.43 ? 232 PRO C CB  1 
ATOM   4023  C  CG  . PRO C 1 148 ? 39.518 38.290  -18.272 1.00 42.69 ? 232 PRO C CG  1 
ATOM   4024  C  CD  . PRO C 1 148 ? 38.617 37.749  -19.358 1.00 41.79 ? 232 PRO C CD  1 
ATOM   4025  N  N   . VAL C 1 149 ? 36.792 36.109  -15.205 1.00 41.35 ? 233 VAL C N   1 
ATOM   4026  C  CA  . VAL C 1 149 ? 35.849 36.039  -14.139 1.00 41.99 ? 233 VAL C CA  1 
ATOM   4027  C  C   . VAL C 1 149 ? 36.513 35.596  -12.843 1.00 44.87 ? 233 VAL C C   1 
ATOM   4028  O  O   . VAL C 1 149 ? 37.208 34.581  -12.782 1.00 45.65 ? 233 VAL C O   1 
ATOM   4029  C  CB  . VAL C 1 149 ? 34.604 35.129  -14.466 1.00 42.01 ? 233 VAL C CB  1 
ATOM   4030  C  CG1 . VAL C 1 149 ? 34.878 33.667  -14.289 1.00 37.84 ? 233 VAL C CG1 1 
ATOM   4031  C  CG2 . VAL C 1 149 ? 33.431 35.508  -13.590 1.00 40.30 ? 233 VAL C CG2 1 
ATOM   4032  N  N   . GLN C 1 150 ? 36.242 36.368  -11.793 1.00 47.72 ? 234 GLN C N   1 
ATOM   4033  C  CA  . GLN C 1 150 ? 36.694 36.182  -10.435 1.00 50.04 ? 234 GLN C CA  1 
ATOM   4034  C  C   . GLN C 1 150 ? 36.279 34.860  -9.834  1.00 48.86 ? 234 GLN C C   1 
ATOM   4035  O  O   . GLN C 1 150 ? 35.240 34.314  -10.168 1.00 50.44 ? 234 GLN C O   1 
ATOM   4036  C  CB  . GLN C 1 150 ? 36.024 37.282  -9.639  1.00 50.64 ? 234 GLN C CB  1 
ATOM   4037  C  CG  . GLN C 1 150 ? 36.966 38.014  -8.661  1.00 57.09 ? 234 GLN C CG  1 
ATOM   4038  C  CD  . GLN C 1 150 ? 36.414 39.378  -8.182  1.00 56.32 ? 234 GLN C CD  1 
ATOM   4039  O  OE1 . GLN C 1 150 ? 35.194 39.555  -7.999  1.00 60.14 ? 234 GLN C OE1 1 
ATOM   4040  N  NE2 . GLN C 1 150 ? 37.333 40.348  -7.978  1.00 63.80 ? 234 GLN C NE2 1 
ATOM   4041  N  N   . SER C 1 151 ? 37.055 34.328  -8.916  1.00 48.28 ? 235 SER C N   1 
ATOM   4042  C  CA  . SER C 1 151 ? 36.645 33.093  -8.282  1.00 47.61 ? 235 SER C CA  1 
ATOM   4043  C  C   . SER C 1 151 ? 35.594 33.401  -7.301  1.00 46.77 ? 235 SER C C   1 
ATOM   4044  O  O   . SER C 1 151 ? 35.588 34.465  -6.743  1.00 46.95 ? 235 SER C O   1 
ATOM   4045  C  CB  . SER C 1 151 ? 37.798 32.451  -7.542  1.00 48.16 ? 235 SER C CB  1 
ATOM   4046  O  OG  . SER C 1 151 ? 38.946 32.412  -8.341  1.00 48.81 ? 235 SER C OG  1 
ATOM   4047  N  N   . TRP C 1 152 ? 34.748 32.427  -7.034  1.00 46.84 ? 236 TRP C N   1 
ATOM   4048  C  CA  . TRP C 1 152 ? 33.564 32.636  -6.217  1.00 46.15 ? 236 TRP C CA  1 
ATOM   4049  C  C   . TRP C 1 152 ? 33.390 31.556  -5.213  1.00 47.83 ? 236 TRP C C   1 
ATOM   4050  O  O   . TRP C 1 152 ? 33.418 30.368  -5.554  1.00 48.73 ? 236 TRP C O   1 
ATOM   4051  C  CB  . TRP C 1 152 ? 32.296 32.690  -7.066  1.00 43.93 ? 236 TRP C CB  1 
ATOM   4052  C  CG  . TRP C 1 152 ? 31.148 32.923  -6.194  1.00 41.22 ? 236 TRP C CG  1 
ATOM   4053  C  CD1 . TRP C 1 152 ? 30.744 34.133  -5.664  1.00 37.12 ? 236 TRP C CD1 1 
ATOM   4054  C  CD2 . TRP C 1 152 ? 30.288 31.932  -5.643  1.00 38.64 ? 236 TRP C CD2 1 
ATOM   4055  N  NE1 . TRP C 1 152 ? 29.707 33.924  -4.798  1.00 37.68 ? 236 TRP C NE1 1 
ATOM   4056  C  CE2 . TRP C 1 152 ? 29.399 32.586  -4.783  1.00 38.22 ? 236 TRP C CE2 1 
ATOM   4057  C  CE3 . TRP C 1 152 ? 30.215 30.543  -5.755  1.00 40.01 ? 236 TRP C CE3 1 
ATOM   4058  C  CZ2 . TRP C 1 152 ? 28.396 31.913  -4.114  1.00 37.20 ? 236 TRP C CZ2 1 
ATOM   4059  C  CZ3 . TRP C 1 152 ? 29.229 29.868  -5.074  1.00 38.77 ? 236 TRP C CZ3 1 
ATOM   4060  C  CH2 . TRP C 1 152 ? 28.329 30.560  -4.263  1.00 39.34 ? 236 TRP C CH2 1 
ATOM   4061  N  N   . PHE C 1 153 ? 33.149 31.954  -3.971  1.00 50.03 ? 237 PHE C N   1 
ATOM   4062  C  CA  . PHE C 1 153 ? 33.052 30.969  -2.913  1.00 52.08 ? 237 PHE C CA  1 
ATOM   4063  C  C   . PHE C 1 153 ? 31.712 30.943  -2.171  1.00 54.06 ? 237 PHE C C   1 
ATOM   4064  O  O   . PHE C 1 153 ? 31.008 29.903  -2.148  1.00 54.88 ? 237 PHE C O   1 
ATOM   4065  C  CB  . PHE C 1 153 ? 34.231 31.118  -1.941  1.00 51.81 ? 237 PHE C CB  1 
ATOM   4066  C  CG  . PHE C 1 153 ? 35.553 30.859  -2.574  1.00 50.43 ? 237 PHE C CG  1 
ATOM   4067  C  CD1 . PHE C 1 153 ? 36.309 31.902  -3.032  1.00 47.87 ? 237 PHE C CD1 1 
ATOM   4068  C  CD2 . PHE C 1 153 ? 36.008 29.550  -2.743  1.00 51.91 ? 237 PHE C CD2 1 
ATOM   4069  C  CE1 . PHE C 1 153 ? 37.504 31.677  -3.667  1.00 48.59 ? 237 PHE C CE1 1 
ATOM   4070  C  CE2 . PHE C 1 153 ? 37.199 29.300  -3.362  1.00 50.89 ? 237 PHE C CE2 1 
ATOM   4071  C  CZ  . PHE C 1 153 ? 37.954 30.380  -3.834  1.00 51.77 ? 237 PHE C CZ  1 
ATOM   4072  N  N   . ASP C 1 154 ? 31.371 32.054  -1.534  1.00 54.88 ? 238 ASP C N   1 
ATOM   4073  C  CA  . ASP C 1 154 ? 30.241 32.043  -0.625  1.00 56.08 ? 238 ASP C CA  1 
ATOM   4074  C  C   . ASP C 1 154 ? 29.624 33.415  -0.547  1.00 55.53 ? 238 ASP C C   1 
ATOM   4075  O  O   . ASP C 1 154 ? 28.514 33.577  -0.070  1.00 55.91 ? 238 ASP C O   1 
ATOM   4076  C  CB  . ASP C 1 154 ? 30.650 31.536  0.761   1.00 57.20 ? 238 ASP C CB  1 
ATOM   4077  C  CG  . ASP C 1 154 ? 31.886 32.277  1.360   1.00 61.74 ? 238 ASP C CG  1 
ATOM   4078  O  OD1 . ASP C 1 154 ? 32.318 33.397  0.894   1.00 61.01 ? 238 ASP C OD1 1 
ATOM   4079  O  OD2 . ASP C 1 154 ? 32.426 31.686  2.344   1.00 67.08 ? 238 ASP C OD2 1 
ATOM   4080  N  N   . ASP C 1 155 ? 30.328 34.395  -1.073  1.00 55.42 ? 239 ASP C N   1 
ATOM   4081  C  CA  . ASP C 1 155 ? 29.819 35.735  -1.089  1.00 56.26 ? 239 ASP C CA  1 
ATOM   4082  C  C   . ASP C 1 155 ? 28.517 35.849  -1.900  1.00 56.17 ? 239 ASP C C   1 
ATOM   4083  O  O   . ASP C 1 155 ? 28.519 36.112  -3.101  1.00 56.41 ? 239 ASP C O   1 
ATOM   4084  C  CB  . ASP C 1 155 ? 30.907 36.702  -1.557  1.00 56.78 ? 239 ASP C CB  1 
ATOM   4085  C  CG  . ASP C 1 155 ? 30.353 38.018  -2.013  1.00 60.31 ? 239 ASP C CG  1 
ATOM   4086  O  OD1 . ASP C 1 155 ? 29.357 38.471  -1.403  1.00 63.82 ? 239 ASP C OD1 1 
ATOM   4087  O  OD2 . ASP C 1 155 ? 30.908 38.600  -2.983  1.00 63.98 ? 239 ASP C OD2 1 
ATOM   4088  N  N   . MET C 1 156 ? 27.406 35.651  -1.203  1.00 55.81 ? 240 MET C N   1 
ATOM   4089  C  CA  . MET C 1 156 ? 26.082 35.921  -1.729  1.00 56.24 ? 240 MET C CA  1 
ATOM   4090  C  C   . MET C 1 156 ? 25.791 37.341  -2.252  1.00 56.37 ? 240 MET C C   1 
ATOM   4091  O  O   . MET C 1 156 ? 24.688 37.619  -2.755  1.00 55.84 ? 240 MET C O   1 
ATOM   4092  C  CB  . MET C 1 156 ? 25.062 35.525  -0.692  1.00 56.31 ? 240 MET C CB  1 
ATOM   4093  C  CG  . MET C 1 156 ? 25.072 34.044  -0.522  1.00 58.04 ? 240 MET C CG  1 
ATOM   4094  S  SD  . MET C 1 156 ? 24.958 33.341  -2.179  1.00 55.34 ? 240 MET C SD  1 
ATOM   4095  C  CE  . MET C 1 156 ? 24.594 31.619  -1.714  1.00 56.76 ? 240 MET C CE  1 
ATOM   4096  N  N   . ALA C 1 157 ? 26.774 38.225  -2.187  1.00 56.06 ? 241 ALA C N   1 
ATOM   4097  C  CA  . ALA C 1 157 ? 26.611 39.488  -2.858  1.00 56.65 ? 241 ALA C CA  1 
ATOM   4098  C  C   . ALA C 1 157 ? 27.474 39.569  -4.106  1.00 57.43 ? 241 ALA C C   1 
ATOM   4099  O  O   . ALA C 1 157 ? 27.704 40.699  -4.597  1.00 57.72 ? 241 ALA C O   1 
ATOM   4100  C  CB  . ALA C 1 157 ? 26.953 40.651  -1.901  1.00 57.26 ? 241 ALA C CB  1 
ATOM   4101  N  N   . ASP C 1 158 ? 28.000 38.428  -4.611  1.00 57.32 ? 242 ASP C N   1 
ATOM   4102  C  CA  . ASP C 1 158 ? 28.694 38.477  -5.919  1.00 56.98 ? 242 ASP C CA  1 
ATOM   4103  C  C   . ASP C 1 158 ? 27.681 38.796  -7.009  1.00 56.61 ? 242 ASP C C   1 
ATOM   4104  O  O   . ASP C 1 158 ? 26.534 38.336  -6.926  1.00 56.55 ? 242 ASP C O   1 
ATOM   4105  C  CB  . ASP C 1 158 ? 29.445 37.195  -6.301  1.00 57.41 ? 242 ASP C CB  1 
ATOM   4106  C  CG  . ASP C 1 158 ? 29.897 37.217  -7.790  1.00 58.76 ? 242 ASP C CG  1 
ATOM   4107  O  OD1 . ASP C 1 158 ? 29.070 36.938  -8.676  1.00 58.14 ? 242 ASP C OD1 1 
ATOM   4108  O  OD2 . ASP C 1 158 ? 31.055 37.592  -8.093  1.00 62.09 ? 242 ASP C OD2 1 
ATOM   4109  N  N   . THR C 1 159 ? 28.087 39.570  -8.014  1.00 55.63 ? 243 THR C N   1 
ATOM   4110  C  CA  . THR C 1 159 ? 27.225 39.786  -9.162  1.00 55.57 ? 243 THR C CA  1 
ATOM   4111  C  C   . THR C 1 159 ? 27.963 39.686  -10.468 1.00 55.61 ? 243 THR C C   1 
ATOM   4112  O  O   . THR C 1 159 ? 27.631 40.402  -11.440 1.00 56.27 ? 243 THR C O   1 
ATOM   4113  C  CB  . THR C 1 159 ? 26.573 41.174  -9.130  1.00 56.32 ? 243 THR C CB  1 
ATOM   4114  O  OG1 . THR C 1 159 ? 27.554 42.177  -8.798  1.00 54.39 ? 243 THR C OG1 1 
ATOM   4115  C  CG2 . THR C 1 159 ? 25.375 41.185  -8.143  1.00 57.96 ? 243 THR C CG2 1 
ATOM   4116  N  N   . GLU C 1 160 ? 28.971 38.820  -10.521 1.00 55.09 ? 244 GLU C N   1 
ATOM   4117  C  CA  . GLU C 1 160 ? 29.860 38.806  -11.690 1.00 54.61 ? 244 GLU C CA  1 
ATOM   4118  C  C   . GLU C 1 160 ? 29.131 38.307  -12.945 1.00 53.12 ? 244 GLU C C   1 
ATOM   4119  O  O   . GLU C 1 160 ? 29.232 38.926  -14.023 1.00 52.25 ? 244 GLU C O   1 
ATOM   4120  C  CB  . GLU C 1 160 ? 31.131 37.995  -11.387 1.00 55.73 ? 244 GLU C CB  1 
ATOM   4121  C  CG  . GLU C 1 160 ? 32.229 38.742  -10.628 1.00 57.48 ? 244 GLU C CG  1 
ATOM   4122  C  CD  . GLU C 1 160 ? 33.231 39.432  -11.566 1.00 63.49 ? 244 GLU C CD  1 
ATOM   4123  O  OE1 . GLU C 1 160 ? 33.484 40.650  -11.352 1.00 66.54 ? 244 GLU C OE1 1 
ATOM   4124  O  OE2 . GLU C 1 160 ? 33.776 38.770  -12.507 1.00 62.34 ? 244 GLU C OE2 1 
ATOM   4125  N  N   . LEU C 1 161 ? 28.374 37.216  -12.787 1.00 51.56 ? 245 LEU C N   1 
ATOM   4126  C  CA  . LEU C 1 161 ? 27.613 36.613  -13.915 1.00 50.92 ? 245 LEU C CA  1 
ATOM   4127  C  C   . LEU C 1 161 ? 26.624 37.572  -14.590 1.00 51.64 ? 245 LEU C C   1 
ATOM   4128  O  O   . LEU C 1 161 ? 26.522 37.620  -15.842 1.00 51.89 ? 245 LEU C O   1 
ATOM   4129  C  CB  . LEU C 1 161 ? 26.930 35.297  -13.510 1.00 49.91 ? 245 LEU C CB  1 
ATOM   4130  C  CG  . LEU C 1 161 ? 27.761 34.200  -12.818 1.00 46.59 ? 245 LEU C CG  1 
ATOM   4131  C  CD1 . LEU C 1 161 ? 26.916 33.015  -12.607 1.00 44.95 ? 245 LEU C CD1 1 
ATOM   4132  C  CD2 . LEU C 1 161 ? 28.960 33.810  -13.600 1.00 41.04 ? 245 LEU C CD2 1 
ATOM   4133  N  N   . LEU C 1 162 ? 25.938 38.359  -13.753 1.00 52.30 ? 246 LEU C N   1 
ATOM   4134  C  CA  . LEU C 1 162 ? 25.119 39.481  -14.202 1.00 52.93 ? 246 LEU C CA  1 
ATOM   4135  C  C   . LEU C 1 162 ? 25.891 40.436  -15.073 1.00 52.66 ? 246 LEU C C   1 
ATOM   4136  O  O   . LEU C 1 162 ? 25.520 40.662  -16.214 1.00 53.24 ? 246 LEU C O   1 
ATOM   4137  C  CB  . LEU C 1 162 ? 24.598 40.280  -13.027 1.00 53.72 ? 246 LEU C CB  1 
ATOM   4138  C  CG  . LEU C 1 162 ? 23.419 41.107  -13.544 1.00 55.82 ? 246 LEU C CG  1 
ATOM   4139  C  CD1 . LEU C 1 162 ? 22.132 40.273  -13.397 1.00 56.19 ? 246 LEU C CD1 1 
ATOM   4140  C  CD2 . LEU C 1 162 ? 23.282 42.477  -12.848 1.00 57.03 ? 246 LEU C CD2 1 
ATOM   4141  N  N   . ASN C 1 163 ? 26.960 41.006  -14.534 1.00 52.39 ? 247 ASN C N   1 
ATOM   4142  C  CA  . ASN C 1 163 ? 27.790 41.926  -15.308 1.00 52.44 ? 247 ASN C CA  1 
ATOM   4143  C  C   . ASN C 1 163 ? 28.291 41.371  -16.675 1.00 52.19 ? 247 ASN C C   1 
ATOM   4144  O  O   . ASN C 1 163 ? 28.452 42.141  -17.632 1.00 52.83 ? 247 ASN C O   1 
ATOM   4145  C  CB  . ASN C 1 163 ? 28.940 42.430  -14.437 1.00 52.82 ? 247 ASN C CB  1 
ATOM   4146  C  CG  . ASN C 1 163 ? 28.441 43.173  -13.173 1.00 55.90 ? 247 ASN C CG  1 
ATOM   4147  O  OD1 . ASN C 1 163 ? 27.602 44.064  -13.274 1.00 58.98 ? 247 ASN C OD1 1 
ATOM   4148  N  ND2 . ASN C 1 163 ? 28.941 42.789  -11.986 1.00 56.87 ? 247 ASN C ND2 1 
ATOM   4149  N  N   . LEU C 1 164 ? 28.478 40.041  -16.774 1.00 50.61 ? 248 LEU C N   1 
ATOM   4150  C  CA  . LEU C 1 164 ? 29.019 39.408  -17.978 1.00 48.60 ? 248 LEU C CA  1 
ATOM   4151  C  C   . LEU C 1 164 ? 28.017 39.262  -19.052 1.00 49.26 ? 248 LEU C C   1 
ATOM   4152  O  O   . LEU C 1 164 ? 28.409 39.169  -20.214 1.00 49.62 ? 248 LEU C O   1 
ATOM   4153  C  CB  . LEU C 1 164 ? 29.607 38.014  -17.679 1.00 47.62 ? 248 LEU C CB  1 
ATOM   4154  C  CG  . LEU C 1 164 ? 30.955 38.019  -16.947 1.00 44.50 ? 248 LEU C CG  1 
ATOM   4155  C  CD1 . LEU C 1 164 ? 31.362 36.689  -16.413 1.00 41.68 ? 248 LEU C CD1 1 
ATOM   4156  C  CD2 . LEU C 1 164 ? 31.995 38.576  -17.869 1.00 40.60 ? 248 LEU C CD2 1 
ATOM   4157  N  N   . ILE C 1 165 ? 26.729 39.177  -18.682 1.00 49.56 ? 249 ILE C N   1 
ATOM   4158  C  CA  . ILE C 1 165 ? 25.662 38.962  -19.677 1.00 49.74 ? 249 ILE C CA  1 
ATOM   4159  C  C   . ILE C 1 165 ? 25.686 39.979  -20.791 1.00 49.37 ? 249 ILE C C   1 
ATOM   4160  O  O   . ILE C 1 165 ? 25.744 39.596  -21.950 1.00 49.07 ? 249 ILE C O   1 
ATOM   4161  C  CB  . ILE C 1 165 ? 24.242 38.849  -19.080 1.00 50.07 ? 249 ILE C CB  1 
ATOM   4162  C  CG1 . ILE C 1 165 ? 24.251 37.917  -17.890 1.00 52.03 ? 249 ILE C CG1 1 
ATOM   4163  C  CG2 . ILE C 1 165 ? 23.292 38.232  -20.077 1.00 50.34 ? 249 ILE C CG2 1 
ATOM   4164  C  CD1 . ILE C 1 165 ? 22.915 37.857  -17.165 1.00 54.68 ? 249 ILE C CD1 1 
ATOM   4165  N  N   . PRO C 1 166 ? 25.686 41.276  -20.459 1.00 50.01 ? 250 PRO C N   1 
ATOM   4166  C  CA  . PRO C 1 166 ? 25.717 42.246  -21.551 1.00 50.80 ? 250 PRO C CA  1 
ATOM   4167  C  C   . PRO C 1 166 ? 26.993 42.167  -22.327 1.00 51.27 ? 250 PRO C C   1 
ATOM   4168  O  O   . PRO C 1 166 ? 26.984 42.463  -23.520 1.00 52.77 ? 250 PRO C O   1 
ATOM   4169  C  CB  . PRO C 1 166 ? 25.601 43.607  -20.856 1.00 50.36 ? 250 PRO C CB  1 
ATOM   4170  C  CG  . PRO C 1 166 ? 26.003 43.369  -19.500 1.00 51.16 ? 250 PRO C CG  1 
ATOM   4171  C  CD  . PRO C 1 166 ? 25.641 41.945  -19.154 1.00 50.79 ? 250 PRO C CD  1 
ATOM   4172  N  N   . ILE C 1 167 ? 28.079 41.769  -21.670 1.00 51.26 ? 251 ILE C N   1 
ATOM   4173  C  CA  . ILE C 1 167 ? 29.344 41.517  -22.375 1.00 51.02 ? 251 ILE C CA  1 
ATOM   4174  C  C   . ILE C 1 167 ? 29.129 40.371  -23.340 1.00 50.37 ? 251 ILE C C   1 
ATOM   4175  O  O   . ILE C 1 167 ? 29.512 40.453  -24.519 1.00 50.52 ? 251 ILE C O   1 
ATOM   4176  C  CB  . ILE C 1 167 ? 30.561 41.277  -21.396 1.00 51.97 ? 251 ILE C CB  1 
ATOM   4177  C  CG1 . ILE C 1 167 ? 30.825 42.538  -20.536 1.00 51.54 ? 251 ILE C CG1 1 
ATOM   4178  C  CG2 . ILE C 1 167 ? 31.826 40.883  -22.165 1.00 51.16 ? 251 ILE C CG2 1 
ATOM   4179  C  CD1 . ILE C 1 167 ? 31.355 42.238  -19.127 1.00 52.81 ? 251 ILE C CD1 1 
ATOM   4180  N  N   . PHE C 1 168 ? 28.464 39.329  -22.884 1.00 49.36 ? 252 PHE C N   1 
ATOM   4181  C  CA  . PHE C 1 168 ? 28.252 38.229  -23.799 1.00 50.05 ? 252 PHE C CA  1 
ATOM   4182  C  C   . PHE C 1 168 ? 27.257 38.477  -24.928 1.00 51.06 ? 252 PHE C C   1 
ATOM   4183  O  O   . PHE C 1 168 ? 27.472 38.004  -26.041 1.00 49.34 ? 252 PHE C O   1 
ATOM   4184  C  CB  . PHE C 1 168 ? 27.991 36.922  -23.057 1.00 50.00 ? 252 PHE C CB  1 
ATOM   4185  C  CG  . PHE C 1 168 ? 29.247 36.233  -22.644 1.00 48.00 ? 252 PHE C CG  1 
ATOM   4186  C  CD1 . PHE C 1 168 ? 29.627 36.204  -21.315 1.00 46.55 ? 252 PHE C CD1 1 
ATOM   4187  C  CD2 . PHE C 1 168 ? 30.063 35.643  -23.594 1.00 47.48 ? 252 PHE C CD2 1 
ATOM   4188  C  CE1 . PHE C 1 168 ? 30.783 35.583  -20.937 1.00 48.50 ? 252 PHE C CE1 1 
ATOM   4189  C  CE2 . PHE C 1 168 ? 31.237 35.001  -23.231 1.00 48.74 ? 252 PHE C CE2 1 
ATOM   4190  C  CZ  . PHE C 1 168 ? 31.598 34.962  -21.905 1.00 49.25 ? 252 PHE C CZ  1 
ATOM   4191  N  N   . GLU C 1 169 ? 26.170 39.204  -24.635 1.00 53.55 ? 253 GLU C N   1 
ATOM   4192  C  CA  . GLU C 1 169 ? 25.227 39.628  -25.675 1.00 56.09 ? 253 GLU C CA  1 
ATOM   4193  C  C   . GLU C 1 169 ? 25.962 40.369  -26.795 1.00 56.54 ? 253 GLU C C   1 
ATOM   4194  O  O   . GLU C 1 169 ? 25.773 40.032  -27.958 1.00 56.79 ? 253 GLU C O   1 
ATOM   4195  C  CB  . GLU C 1 169 ? 24.107 40.488  -25.096 1.00 55.93 ? 253 GLU C CB  1 
ATOM   4196  C  CG  . GLU C 1 169 ? 22.948 39.681  -24.480 1.00 57.22 ? 253 GLU C CG  1 
ATOM   4197  C  CD  . GLU C 1 169 ? 21.978 40.545  -23.646 1.00 59.69 ? 253 GLU C CD  1 
ATOM   4198  O  OE1 . GLU C 1 169 ? 22.306 41.734  -23.294 1.00 63.33 ? 253 GLU C OE1 1 
ATOM   4199  O  OE2 . GLU C 1 169 ? 20.875 40.015  -23.325 1.00 64.68 ? 253 GLU C OE2 1 
ATOM   4200  N  N   . GLU C 1 170 ? 26.828 41.330  -26.431 1.00 57.30 ? 254 GLU C N   1 
ATOM   4201  C  CA  . GLU C 1 170 ? 27.668 42.073  -27.403 1.00 58.93 ? 254 GLU C CA  1 
ATOM   4202  C  C   . GLU C 1 170 ? 28.485 41.155  -28.289 1.00 56.48 ? 254 GLU C C   1 
ATOM   4203  O  O   . GLU C 1 170 ? 28.415 41.255  -29.485 1.00 56.41 ? 254 GLU C O   1 
ATOM   4204  C  CB  . GLU C 1 170 ? 28.565 43.170  -26.742 1.00 58.80 ? 254 GLU C CB  1 
ATOM   4205  C  CG  . GLU C 1 170 ? 27.846 44.564  -26.563 1.00 62.96 ? 254 GLU C CG  1 
ATOM   4206  C  CD  . GLU C 1 170 ? 28.763 45.763  -26.076 1.00 64.72 ? 254 GLU C CD  1 
ATOM   4207  O  OE1 . GLU C 1 170 ? 28.597 46.924  -26.591 1.00 68.60 ? 254 GLU C OE1 1 
ATOM   4208  O  OE2 . GLU C 1 170 ? 29.619 45.558  -25.158 1.00 70.50 ? 254 GLU C OE2 1 
ATOM   4209  N  N   . LEU C 1 171 ? 29.227 40.239  -27.687 1.00 55.76 ? 255 LEU C N   1 
ATOM   4210  C  CA  . LEU C 1 171 ? 30.081 39.298  -28.413 1.00 54.30 ? 255 LEU C CA  1 
ATOM   4211  C  C   . LEU C 1 171 ? 29.308 38.385  -29.309 1.00 53.75 ? 255 LEU C C   1 
ATOM   4212  O  O   . LEU C 1 171 ? 29.799 38.013  -30.383 1.00 53.26 ? 255 LEU C O   1 
ATOM   4213  C  CB  . LEU C 1 171 ? 30.909 38.447  -27.435 1.00 54.27 ? 255 LEU C CB  1 
ATOM   4214  C  CG  . LEU C 1 171 ? 32.205 39.159  -27.031 1.00 55.20 ? 255 LEU C CG  1 
ATOM   4215  C  CD1 . LEU C 1 171 ? 32.855 38.548  -25.850 1.00 53.25 ? 255 LEU C CD1 1 
ATOM   4216  C  CD2 . LEU C 1 171 ? 33.162 39.181  -28.200 1.00 56.70 ? 255 LEU C CD2 1 
ATOM   4217  N  N   . SER C 1 172 ? 28.088 38.052  -28.871 1.00 53.23 ? 256 SER C N   1 
ATOM   4218  C  CA  . SER C 1 172 ? 27.332 36.894  -29.375 1.00 52.66 ? 256 SER C CA  1 
ATOM   4219  C  C   . SER C 1 172 ? 27.233 36.819  -30.888 1.00 52.05 ? 256 SER C C   1 
ATOM   4220  O  O   . SER C 1 172 ? 27.121 35.721  -31.456 1.00 50.26 ? 256 SER C O   1 
ATOM   4221  C  CB  . SER C 1 172 ? 25.941 36.860  -28.750 1.00 53.06 ? 256 SER C CB  1 
ATOM   4222  O  OG  . SER C 1 172 ? 25.047 37.708  -29.446 1.00 53.97 ? 256 SER C OG  1 
ATOM   4223  N  N   . GLY C 1 173 ? 27.302 38.005  -31.513 1.00 52.56 ? 257 GLY C N   1 
ATOM   4224  C  CA  . GLY C 1 173 ? 27.153 38.182  -32.969 1.00 53.55 ? 257 GLY C CA  1 
ATOM   4225  C  C   . GLY C 1 173 ? 28.426 38.334  -33.808 1.00 54.40 ? 257 GLY C C   1 
ATOM   4226  O  O   . GLY C 1 173 ? 28.337 38.424  -35.032 1.00 54.46 ? 257 GLY C O   1 
ATOM   4227  N  N   . ALA C 1 174 ? 29.595 38.345  -33.157 1.00 54.84 ? 258 ALA C N   1 
ATOM   4228  C  CA  . ALA C 1 174 ? 30.887 38.525  -33.800 1.00 55.19 ? 258 ALA C CA  1 
ATOM   4229  C  C   . ALA C 1 174 ? 31.199 37.488  -34.860 1.00 55.92 ? 258 ALA C C   1 
ATOM   4230  O  O   . ALA C 1 174 ? 30.825 36.332  -34.722 1.00 55.23 ? 258 ALA C O   1 
ATOM   4231  C  CB  . ALA C 1 174 ? 31.976 38.505  -32.743 1.00 55.10 ? 258 ALA C CB  1 
ATOM   4232  N  N   . GLU C 1 175 ? 31.895 37.883  -35.925 1.00 57.65 ? 259 GLU C N   1 
ATOM   4233  C  CA  . GLU C 1 175 ? 32.432 36.849  -36.848 1.00 59.87 ? 259 GLU C CA  1 
ATOM   4234  C  C   . GLU C 1 175 ? 33.821 36.380  -36.372 1.00 58.80 ? 259 GLU C C   1 
ATOM   4235  O  O   . GLU C 1 175 ? 34.290 35.297  -36.751 1.00 58.30 ? 259 GLU C O   1 
ATOM   4236  C  CB  . GLU C 1 175 ? 32.526 37.345  -38.295 1.00 61.79 ? 259 GLU C CB  1 
ATOM   4237  C  CG  . GLU C 1 175 ? 31.182 37.884  -38.909 1.00 68.92 ? 259 GLU C CG  1 
ATOM   4238  C  CD  . GLU C 1 175 ? 30.379 36.785  -39.609 1.00 77.51 ? 259 GLU C CD  1 
ATOM   4239  O  OE1 . GLU C 1 175 ? 30.495 35.586  -39.178 1.00 80.65 ? 259 GLU C OE1 1 
ATOM   4240  O  OE2 . GLU C 1 175 ? 29.652 37.130  -40.593 1.00 78.93 ? 259 GLU C OE2 1 
ATOM   4241  N  N   . ASP C 1 176 ? 34.459 37.195  -35.535 1.00 57.41 ? 260 ASP C N   1 
ATOM   4242  C  CA  . ASP C 1 176 ? 35.785 36.898  -35.063 1.00 57.42 ? 260 ASP C CA  1 
ATOM   4243  C  C   . ASP C 1 176 ? 35.867 37.503  -33.689 1.00 56.04 ? 260 ASP C C   1 
ATOM   4244  O  O   . ASP C 1 176 ? 35.801 38.718  -33.570 1.00 56.44 ? 260 ASP C O   1 
ATOM   4245  C  CB  . ASP C 1 176 ? 36.845 37.487  -36.037 1.00 58.12 ? 260 ASP C CB  1 
ATOM   4246  C  CG  . ASP C 1 176 ? 38.268 37.692  -35.391 1.00 61.65 ? 260 ASP C CG  1 
ATOM   4247  O  OD1 . ASP C 1 176 ? 38.433 37.820  -34.130 1.00 62.24 ? 260 ASP C OD1 1 
ATOM   4248  O  OD2 . ASP C 1 176 ? 39.240 37.760  -36.186 1.00 63.65 ? 260 ASP C OD2 1 
ATOM   4249  N  N   . VAL C 1 177 ? 36.027 36.673  -32.659 1.00 54.16 ? 261 VAL C N   1 
ATOM   4250  C  CA  . VAL C 1 177 ? 36.024 37.197  -31.305 1.00 53.41 ? 261 VAL C CA  1 
ATOM   4251  C  C   . VAL C 1 177 ? 37.252 38.031  -30.978 1.00 53.17 ? 261 VAL C C   1 
ATOM   4252  O  O   . VAL C 1 177 ? 37.219 38.836  -30.032 1.00 53.03 ? 261 VAL C O   1 
ATOM   4253  C  CB  . VAL C 1 177 ? 35.833 36.131  -30.218 1.00 53.14 ? 261 VAL C CB  1 
ATOM   4254  C  CG1 . VAL C 1 177 ? 34.484 35.458  -30.401 1.00 54.58 ? 261 VAL C CG1 1 
ATOM   4255  C  CG2 . VAL C 1 177 ? 36.981 35.124  -30.218 1.00 51.40 ? 261 VAL C CG2 1 
ATOM   4256  N  N   . TYR C 1 178 ? 38.329 37.857  -31.739 1.00 52.10 ? 262 TYR C N   1 
ATOM   4257  C  CA  . TYR C 1 178 ? 39.496 38.691  -31.473 1.00 52.05 ? 262 TYR C CA  1 
ATOM   4258  C  C   . TYR C 1 178 ? 39.104 40.133  -31.690 1.00 53.78 ? 262 TYR C C   1 
ATOM   4259  O  O   . TYR C 1 178 ? 39.225 40.927  -30.775 1.00 54.44 ? 262 TYR C O   1 
ATOM   4260  C  CB  . TYR C 1 178 ? 40.726 38.247  -32.272 1.00 49.20 ? 262 TYR C CB  1 
ATOM   4261  C  CG  . TYR C 1 178 ? 41.070 36.817  -31.958 1.00 45.02 ? 262 TYR C CG  1 
ATOM   4262  C  CD1 . TYR C 1 178 ? 41.320 35.888  -32.975 1.00 37.96 ? 262 TYR C CD1 1 
ATOM   4263  C  CD2 . TYR C 1 178 ? 41.084 36.379  -30.637 1.00 39.41 ? 262 TYR C CD2 1 
ATOM   4264  C  CE1 . TYR C 1 178 ? 41.615 34.580  -32.678 1.00 35.38 ? 262 TYR C CE1 1 
ATOM   4265  C  CE2 . TYR C 1 178 ? 41.335 35.095  -30.353 1.00 39.27 ? 262 TYR C CE2 1 
ATOM   4266  C  CZ  . TYR C 1 178 ? 41.620 34.208  -31.359 1.00 39.21 ? 262 TYR C CZ  1 
ATOM   4267  O  OH  . TYR C 1 178 ? 41.894 32.925  -31.009 1.00 42.97 ? 262 TYR C OH  1 
ATOM   4268  N  N   . THR C 1 179 ? 38.543 40.438  -32.859 1.00 55.92 ? 263 THR C N   1 
ATOM   4269  C  CA  . THR C 1 179 ? 38.049 41.776  -33.136 1.00 57.96 ? 263 THR C CA  1 
ATOM   4270  C  C   . THR C 1 179 ? 37.079 42.273  -32.043 1.00 59.39 ? 263 THR C C   1 
ATOM   4271  O  O   . THR C 1 179 ? 37.283 43.363  -31.457 1.00 59.67 ? 263 THR C O   1 
ATOM   4272  C  CB  . THR C 1 179 ? 37.378 41.862  -34.525 1.00 58.41 ? 263 THR C CB  1 
ATOM   4273  O  OG1 . THR C 1 179 ? 38.176 41.174  -35.502 1.00 57.76 ? 263 THR C OG1 1 
ATOM   4274  C  CG2 . THR C 1 179 ? 37.210 43.300  -34.936 1.00 58.53 ? 263 THR C CG2 1 
ATOM   4275  N  N   . SER C 1 180 ? 36.051 41.481  -31.740 1.00 60.21 ? 264 SER C N   1 
ATOM   4276  C  CA  . SER C 1 180 ? 34.991 41.994  -30.893 1.00 61.22 ? 264 SER C CA  1 
ATOM   4277  C  C   . SER C 1 180 ? 35.390 42.249  -29.478 1.00 62.21 ? 264 SER C C   1 
ATOM   4278  O  O   . SER C 1 180 ? 34.939 43.212  -28.891 1.00 62.84 ? 264 SER C O   1 
ATOM   4279  C  CB  . SER C 1 180 ? 33.755 41.137  -30.971 1.00 61.66 ? 264 SER C CB  1 
ATOM   4280  O  OG  . SER C 1 180 ? 33.072 41.436  -32.185 1.00 63.06 ? 264 SER C OG  1 
ATOM   4281  N  N   . LEU C 1 181 ? 36.239 41.398  -28.919 1.00 63.89 ? 265 LEU C N   1 
ATOM   4282  C  CA  . LEU C 1 181 ? 36.819 41.658  -27.601 1.00 64.76 ? 265 LEU C CA  1 
ATOM   4283  C  C   . LEU C 1 181 ? 37.715 42.888  -27.711 1.00 66.62 ? 265 LEU C C   1 
ATOM   4284  O  O   . LEU C 1 181 ? 37.870 43.648  -26.761 1.00 66.29 ? 265 LEU C O   1 
ATOM   4285  C  CB  . LEU C 1 181 ? 37.614 40.444  -27.084 1.00 63.90 ? 265 LEU C CB  1 
ATOM   4286  C  CG  . LEU C 1 181 ? 36.882 39.223  -26.492 1.00 62.14 ? 265 LEU C CG  1 
ATOM   4287  C  CD1 . LEU C 1 181 ? 37.800 38.010  -26.415 1.00 59.27 ? 265 LEU C CD1 1 
ATOM   4288  C  CD2 . LEU C 1 181 ? 36.264 39.495  -25.124 1.00 60.00 ? 265 LEU C CD2 1 
ATOM   4289  N  N   . GLY C 1 182 ? 38.292 43.065  -28.897 1.00 69.02 ? 266 GLY C N   1 
ATOM   4290  C  CA  . GLY C 1 182 ? 39.135 44.219  -29.214 1.00 72.20 ? 266 GLY C CA  1 
ATOM   4291  C  C   . GLY C 1 182 ? 38.365 45.515  -29.032 1.00 74.31 ? 266 GLY C C   1 
ATOM   4292  O  O   . GLY C 1 182 ? 38.735 46.340  -28.175 1.00 74.42 ? 266 GLY C O   1 
ATOM   4293  N  N   . GLN C 1 183 ? 37.287 45.705  -29.805 1.00 76.01 ? 267 GLN C N   1 
ATOM   4294  C  CA  . GLN C 1 183 ? 36.498 46.931  -29.622 1.00 77.53 ? 267 GLN C CA  1 
ATOM   4295  C  C   . GLN C 1 183 ? 35.923 47.083  -28.199 1.00 78.24 ? 267 GLN C C   1 
ATOM   4296  O  O   . GLN C 1 183 ? 36.317 48.028  -27.510 1.00 78.89 ? 267 GLN C O   1 
ATOM   4297  C  CB  . GLN C 1 183 ? 35.528 47.277  -30.772 1.00 77.25 ? 267 GLN C CB  1 
ATOM   4298  C  CG  . GLN C 1 183 ? 34.713 46.152  -31.335 1.00 79.08 ? 267 GLN C CG  1 
ATOM   4299  C  CD  . GLN C 1 183 ? 34.667 46.158  -32.873 1.00 81.68 ? 267 GLN C CD  1 
ATOM   4300  O  OE1 . GLN C 1 183 ? 35.624 46.584  -33.548 1.00 81.81 ? 267 GLN C OE1 1 
ATOM   4301  N  NE2 . GLN C 1 183 ? 33.565 45.646  -33.433 1.00 82.00 ? 267 GLN C NE2 1 
ATOM   4302  N  N   . LEU C 1 184 ? 35.083 46.165  -27.718 1.00 78.74 ? 268 LEU C N   1 
ATOM   4303  C  CA  . LEU C 1 184 ? 34.595 46.268  -26.320 1.00 79.68 ? 268 LEU C CA  1 
ATOM   4304  C  C   . LEU C 1 184 ? 35.703 46.738  -25.363 1.00 80.04 ? 268 LEU C C   1 
ATOM   4305  O  O   . LEU C 1 184 ? 35.468 47.599  -24.506 1.00 79.93 ? 268 LEU C O   1 
ATOM   4306  C  CB  . LEU C 1 184 ? 34.016 44.945  -25.809 1.00 79.73 ? 268 LEU C CB  1 
ATOM   4307  C  CG  . LEU C 1 184 ? 32.507 44.714  -25.948 1.00 80.97 ? 268 LEU C CG  1 
ATOM   4308  C  CD1 . LEU C 1 184 ? 32.076 44.360  -27.390 1.00 81.54 ? 268 LEU C CD1 1 
ATOM   4309  C  CD2 . LEU C 1 184 ? 32.034 43.632  -24.975 1.00 80.46 ? 268 LEU C CD2 1 
ATOM   4310  N  N   . ARG C 1 185 ? 36.898 46.159  -25.515 1.00 80.26 ? 269 ARG C N   1 
ATOM   4311  C  CA  . ARG C 1 185 ? 38.091 46.650  -24.840 1.00 80.82 ? 269 ARG C CA  1 
ATOM   4312  C  C   . ARG C 1 185 ? 38.624 47.853  -25.627 1.00 80.78 ? 269 ARG C C   1 
ATOM   4313  O  O   . ARG C 1 185 ? 38.850 48.923  -25.075 1.00 80.65 ? 269 ARG C O   1 
ATOM   4314  C  CB  . ARG C 1 185 ? 39.189 45.570  -24.759 1.00 80.76 ? 269 ARG C CB  1 
ATOM   4315  C  CG  . ARG C 1 185 ? 38.909 44.342  -23.872 1.00 81.04 ? 269 ARG C CG  1 
ATOM   4316  C  CD  . ARG C 1 185 ? 40.004 43.286  -24.145 1.00 81.46 ? 269 ARG C CD  1 
ATOM   4317  N  NE  . ARG C 1 185 ? 39.709 41.869  -23.848 1.00 81.09 ? 269 ARG C NE  1 
ATOM   4318  C  CZ  . ARG C 1 185 ? 38.830 41.403  -22.954 1.00 81.00 ? 269 ARG C CZ  1 
ATOM   4319  N  NH1 . ARG C 1 185 ? 38.085 42.230  -22.211 1.00 81.73 ? 269 ARG C NH1 1 
ATOM   4320  N  NH2 . ARG C 1 185 ? 38.698 40.087  -22.803 1.00 77.75 ? 269 ARG C NH2 1 
ATOM   4321  N  N   . LEU D 1 6   ? 39.273 8.613   -32.468 1.00 37.14 ? 90  LEU D N   1 
ATOM   4322  C  CA  . LEU D 1 6   ? 40.407 7.716   -31.939 1.00 38.08 ? 90  LEU D CA  1 
ATOM   4323  C  C   . LEU D 1 6   ? 41.780 7.863   -32.637 1.00 39.25 ? 90  LEU D C   1 
ATOM   4324  O  O   . LEU D 1 6   ? 42.833 7.895   -31.976 1.00 40.11 ? 90  LEU D O   1 
ATOM   4325  C  CB  . LEU D 1 6   ? 40.020 6.245   -31.985 1.00 37.56 ? 90  LEU D CB  1 
ATOM   4326  C  CG  . LEU D 1 6   ? 39.867 5.336   -30.742 1.00 37.75 ? 90  LEU D CG  1 
ATOM   4327  C  CD1 . LEU D 1 6   ? 39.282 5.981   -29.502 1.00 35.79 ? 90  LEU D CD1 1 
ATOM   4328  C  CD2 . LEU D 1 6   ? 39.129 4.017   -31.067 1.00 33.70 ? 90  LEU D CD2 1 
ATOM   4329  N  N   . LEU D 1 7   ? 41.767 7.943   -33.970 1.00 39.34 ? 91  LEU D N   1 
ATOM   4330  C  CA  . LEU D 1 7   ? 42.993 8.106   -34.738 1.00 39.71 ? 91  LEU D CA  1 
ATOM   4331  C  C   . LEU D 1 7   ? 42.991 9.408   -35.507 1.00 41.30 ? 91  LEU D C   1 
ATOM   4332  O  O   . LEU D 1 7   ? 41.934 9.924   -35.904 1.00 42.48 ? 91  LEU D O   1 
ATOM   4333  C  CB  . LEU D 1 7   ? 43.183 6.970   -35.725 1.00 38.05 ? 91  LEU D CB  1 
ATOM   4334  C  CG  . LEU D 1 7   ? 43.694 5.650   -35.199 1.00 36.36 ? 91  LEU D CG  1 
ATOM   4335  C  CD1 . LEU D 1 7   ? 44.041 4.809   -36.381 1.00 35.84 ? 91  LEU D CD1 1 
ATOM   4336  C  CD2 . LEU D 1 7   ? 44.902 5.787   -34.277 1.00 31.53 ? 91  LEU D CD2 1 
ATOM   4337  N  N   . PRO D 1 8   ? 44.171 9.971   -35.705 1.00 42.15 ? 92  PRO D N   1 
ATOM   4338  C  CA  . PRO D 1 8   ? 44.228 11.150  -36.562 1.00 43.82 ? 92  PRO D CA  1 
ATOM   4339  C  C   . PRO D 1 8   ? 44.240 10.830  -38.076 1.00 44.49 ? 92  PRO D C   1 
ATOM   4340  O  O   . PRO D 1 8   ? 44.392 9.673   -38.466 1.00 44.42 ? 92  PRO D O   1 
ATOM   4341  C  CB  . PRO D 1 8   ? 45.547 11.803  -36.131 1.00 43.43 ? 92  PRO D CB  1 
ATOM   4342  C  CG  . PRO D 1 8   ? 46.389 10.643  -35.734 1.00 42.70 ? 92  PRO D CG  1 
ATOM   4343  C  CD  . PRO D 1 8   ? 45.470 9.650   -35.108 1.00 41.80 ? 92  PRO D CD  1 
ATOM   4344  N  N   . GLU D 1 9   ? 44.115 11.863  -38.898 1.00 45.65 ? 93  GLU D N   1 
ATOM   4345  C  CA  . GLU D 1 9   ? 44.199 11.713  -40.333 1.00 48.31 ? 93  GLU D CA  1 
ATOM   4346  C  C   . GLU D 1 9   ? 45.417 10.905  -40.664 1.00 46.98 ? 93  GLU D C   1 
ATOM   4347  O  O   . GLU D 1 9   ? 46.495 11.180  -40.163 1.00 46.69 ? 93  GLU D O   1 
ATOM   4348  C  CB  . GLU D 1 9   ? 44.218 13.087  -41.066 1.00 48.36 ? 93  GLU D CB  1 
ATOM   4349  C  CG  . GLU D 1 9   ? 42.785 13.762  -41.182 1.00 52.28 ? 93  GLU D CG  1 
ATOM   4350  C  CD  . GLU D 1 9   ? 42.649 14.880  -42.273 1.00 54.43 ? 93  GLU D CD  1 
ATOM   4351  O  OE1 . GLU D 1 9   ? 43.649 15.199  -42.985 1.00 59.46 ? 93  GLU D OE1 1 
ATOM   4352  O  OE2 . GLU D 1 9   ? 41.519 15.447  -42.402 1.00 60.69 ? 93  GLU D OE2 1 
ATOM   4353  N  N   . VAL D 1 10  ? 45.199 9.885   -41.490 1.00 46.92 ? 94  VAL D N   1 
ATOM   4354  C  CA  . VAL D 1 10  ? 46.221 9.086   -42.116 1.00 46.78 ? 94  VAL D CA  1 
ATOM   4355  C  C   . VAL D 1 10  ? 47.207 9.961   -42.831 1.00 47.60 ? 94  VAL D C   1 
ATOM   4356  O  O   . VAL D 1 10  ? 46.843 10.846  -43.567 1.00 48.25 ? 94  VAL D O   1 
ATOM   4357  C  CB  . VAL D 1 10  ? 45.608 8.114   -43.149 1.00 47.36 ? 94  VAL D CB  1 
ATOM   4358  C  CG1 . VAL D 1 10  ? 44.987 8.897   -44.321 1.00 48.05 ? 94  VAL D CG1 1 
ATOM   4359  C  CG2 . VAL D 1 10  ? 46.637 7.092   -43.656 1.00 44.03 ? 94  VAL D CG2 1 
ATOM   4360  N  N   . THR D 1 11  ? 48.475 9.683   -42.616 1.00 48.99 ? 95  THR D N   1 
ATOM   4361  C  CA  . THR D 1 11  ? 49.548 10.439  -43.180 1.00 49.65 ? 95  THR D CA  1 
ATOM   4362  C  C   . THR D 1 11  ? 49.757 10.060  -44.640 1.00 51.98 ? 95  THR D C   1 
ATOM   4363  O  O   . THR D 1 11  ? 49.394 8.952   -45.044 1.00 51.47 ? 95  THR D O   1 
ATOM   4364  C  CB  . THR D 1 11  ? 50.824 10.096  -42.398 1.00 49.01 ? 95  THR D CB  1 
ATOM   4365  O  OG1 . THR D 1 11  ? 51.257 8.763   -42.713 1.00 47.65 ? 95  THR D OG1 1 
ATOM   4366  C  CG2 . THR D 1 11  ? 50.588 10.217  -40.919 1.00 46.68 ? 95  THR D CG2 1 
ATOM   4367  N  N   . GLU D 1 12  ? 50.385 10.964  -45.398 1.00 55.31 ? 96  GLU D N   1 
ATOM   4368  C  CA  . GLU D 1 12  ? 50.898 10.723  -46.779 1.00 59.88 ? 96  GLU D CA  1 
ATOM   4369  C  C   . GLU D 1 12  ? 51.504 9.335   -46.997 1.00 60.20 ? 96  GLU D C   1 
ATOM   4370  O  O   . GLU D 1 12  ? 51.084 8.610   -47.905 1.00 60.51 ? 96  GLU D O   1 
ATOM   4371  C  CB  . GLU D 1 12  ? 51.978 11.764  -47.145 1.00 59.95 ? 96  GLU D CB  1 
ATOM   4372  C  CG  . GLU D 1 12  ? 51.663 12.784  -48.278 1.00 64.23 ? 96  GLU D CG  1 
ATOM   4373  C  CD  . GLU D 1 12  ? 52.967 13.297  -48.977 1.00 65.60 ? 96  GLU D CD  1 
ATOM   4374  O  OE1 . GLU D 1 12  ? 53.924 12.477  -49.180 1.00 70.77 ? 96  GLU D OE1 1 
ATOM   4375  O  OE2 . GLU D 1 12  ? 53.033 14.516  -49.324 1.00 71.32 ? 96  GLU D OE2 1 
ATOM   4376  N  N   . GLU D 1 13  ? 52.483 8.977   -46.156 1.00 61.23 ? 97  GLU D N   1 
ATOM   4377  C  CA  . GLU D 1 13  ? 53.185 7.688   -46.231 1.00 62.96 ? 97  GLU D CA  1 
ATOM   4378  C  C   . GLU D 1 13  ? 52.271 6.451   -46.208 1.00 61.89 ? 97  GLU D C   1 
ATOM   4379  O  O   . GLU D 1 13  ? 52.538 5.496   -46.925 1.00 62.06 ? 97  GLU D O   1 
ATOM   4380  C  CB  . GLU D 1 13  ? 54.216 7.572   -45.105 1.00 62.53 ? 97  GLU D CB  1 
ATOM   4381  C  CG  . GLU D 1 13  ? 55.696 7.547   -45.553 1.00 66.73 ? 97  GLU D CG  1 
ATOM   4382  C  CD  . GLU D 1 13  ? 56.716 7.824   -44.383 1.00 67.82 ? 97  GLU D CD  1 
ATOM   4383  O  OE1 . GLU D 1 13  ? 56.701 7.063   -43.367 1.00 71.85 ? 97  GLU D OE1 1 
ATOM   4384  O  OE2 . GLU D 1 13  ? 57.533 8.800   -44.500 1.00 71.89 ? 97  GLU D OE2 1 
ATOM   4385  N  N   . ASP D 1 14  ? 51.215 6.475   -45.377 1.00 61.30 ? 98  ASP D N   1 
ATOM   4386  C  CA  . ASP D 1 14  ? 50.291 5.335   -45.181 1.00 59.84 ? 98  ASP D CA  1 
ATOM   4387  C  C   . ASP D 1 14  ? 48.990 5.491   -45.957 1.00 58.91 ? 98  ASP D C   1 
ATOM   4388  O  O   . ASP D 1 14  ? 48.142 4.616   -45.940 1.00 57.65 ? 98  ASP D O   1 
ATOM   4389  C  CB  . ASP D 1 14  ? 49.978 5.190   -43.702 1.00 59.41 ? 98  ASP D CB  1 
ATOM   4390  C  CG  . ASP D 1 14  ? 51.142 4.627   -42.918 1.00 61.43 ? 98  ASP D CG  1 
ATOM   4391  O  OD1 . ASP D 1 14  ? 51.958 3.883   -43.527 1.00 61.53 ? 98  ASP D OD1 1 
ATOM   4392  O  OD2 . ASP D 1 14  ? 51.236 4.907   -41.687 1.00 63.14 ? 98  ASP D OD2 1 
ATOM   4393  N  N   . GLN D 1 15  ? 48.904 6.605   -46.682 1.00 58.63 ? 99  GLN D N   1 
ATOM   4394  C  CA  . GLN D 1 15  ? 47.689 7.120   -47.325 1.00 59.06 ? 99  GLN D CA  1 
ATOM   4395  C  C   . GLN D 1 15  ? 46.766 6.134   -48.004 1.00 56.81 ? 99  GLN D C   1 
ATOM   4396  O  O   . GLN D 1 15  ? 45.545 6.279   -47.881 1.00 58.14 ? 99  GLN D O   1 
ATOM   4397  C  CB  . GLN D 1 15  ? 47.988 8.337   -48.238 1.00 59.23 ? 99  GLN D CB  1 
ATOM   4398  C  CG  . GLN D 1 15  ? 46.776 9.254   -48.569 1.00 61.87 ? 99  GLN D CG  1 
ATOM   4399  C  CD  . GLN D 1 15  ? 47.138 10.794  -48.641 1.00 63.50 ? 99  GLN D CD  1 
ATOM   4400  O  OE1 . GLN D 1 15  ? 48.131 11.219  -49.281 1.00 67.94 ? 99  GLN D OE1 1 
ATOM   4401  N  NE2 . GLN D 1 15  ? 46.308 11.616  -47.986 1.00 66.86 ? 99  GLN D NE2 1 
ATOM   4402  N  N   . GLY D 1 16  ? 47.264 5.137   -48.717 1.00 54.29 ? 100 GLY D N   1 
ATOM   4403  C  CA  . GLY D 1 16  ? 46.271 4.233   -49.329 1.00 50.89 ? 100 GLY D CA  1 
ATOM   4404  C  C   . GLY D 1 16  ? 45.974 2.942   -48.574 1.00 49.24 ? 100 GLY D C   1 
ATOM   4405  O  O   . GLY D 1 16  ? 45.044 2.203   -48.943 1.00 49.56 ? 100 GLY D O   1 
ATOM   4406  N  N   . ARG D 1 17  ? 46.743 2.665   -47.518 1.00 46.38 ? 101 ARG D N   1 
ATOM   4407  C  CA  . ARG D 1 17  ? 46.797 1.333   -46.942 1.00 44.96 ? 101 ARG D CA  1 
ATOM   4408  C  C   . ARG D 1 17  ? 45.578 0.904   -46.117 1.00 43.45 ? 101 ARG D C   1 
ATOM   4409  O  O   . ARG D 1 17  ? 44.818 1.721   -45.609 1.00 43.15 ? 101 ARG D O   1 
ATOM   4410  C  CB  . ARG D 1 17  ? 48.070 1.200   -46.121 1.00 45.28 ? 101 ARG D CB  1 
ATOM   4411  C  CG  . ARG D 1 17  ? 49.362 1.087   -46.980 1.00 48.01 ? 101 ARG D CG  1 
ATOM   4412  C  CD  . ARG D 1 17  ? 50.522 1.868   -46.316 1.00 52.56 ? 101 ARG D CD  1 
ATOM   4413  N  NE  . ARG D 1 17  ? 51.817 1.769   -46.991 1.00 53.42 ? 101 ARG D NE  1 
ATOM   4414  C  CZ  . ARG D 1 17  ? 52.896 1.175   -46.478 1.00 53.39 ? 101 ARG D CZ  1 
ATOM   4415  N  NH1 . ARG D 1 17  ? 52.845 0.585   -45.294 1.00 55.73 ? 101 ARG D NH1 1 
ATOM   4416  N  NH2 . ARG D 1 17  ? 54.019 1.127   -47.173 1.00 49.68 ? 101 ARG D NH2 1 
ATOM   4417  N  N   . ILE D 1 18  ? 45.378 -0.397  -46.002 1.00 41.94 ? 102 ILE D N   1 
ATOM   4418  C  CA  . ILE D 1 18  ? 44.455 -0.933  -44.992 1.00 39.98 ? 102 ILE D CA  1 
ATOM   4419  C  C   . ILE D 1 18  ? 45.080 -0.701  -43.592 1.00 40.07 ? 102 ILE D C   1 
ATOM   4420  O  O   . ILE D 1 18  ? 46.298 -0.872  -43.387 1.00 40.53 ? 102 ILE D O   1 
ATOM   4421  C  CB  . ILE D 1 18  ? 44.195 -2.417  -45.287 1.00 39.88 ? 102 ILE D CB  1 
ATOM   4422  C  CG1 . ILE D 1 18  ? 43.263 -2.565  -46.499 1.00 37.78 ? 102 ILE D CG1 1 
ATOM   4423  C  CG2 . ILE D 1 18  ? 43.677 -3.181  -44.064 1.00 39.07 ? 102 ILE D CG2 1 
ATOM   4424  C  CD1 . ILE D 1 18  ? 43.369 -3.891  -47.157 1.00 32.96 ? 102 ILE D CD1 1 
ATOM   4425  N  N   . CYS D 1 19  ? 44.255 -0.277  -42.642 1.00 39.11 ? 103 CYS D N   1 
ATOM   4426  C  CA  . CYS D 1 19  ? 44.692 -0.018  -41.284 1.00 38.00 ? 103 CYS D CA  1 
ATOM   4427  C  C   . CYS D 1 19  ? 44.514 -1.304  -40.513 1.00 37.43 ? 103 CYS D C   1 
ATOM   4428  O  O   . CYS D 1 19  ? 43.379 -1.771  -40.412 1.00 38.83 ? 103 CYS D O   1 
ATOM   4429  C  CB  . CYS D 1 19  ? 43.804 1.051   -40.675 1.00 36.70 ? 103 CYS D CB  1 
ATOM   4430  S  SG  . CYS D 1 19  ? 44.198 1.344   -38.920 1.00 38.55 ? 103 CYS D SG  1 
ATOM   4431  N  N   . VAL D 1 20  ? 45.602 -1.878  -40.001 1.00 35.57 ? 104 VAL D N   1 
ATOM   4432  C  CA  . VAL D 1 20  ? 45.545 -3.056  -39.152 1.00 33.80 ? 104 VAL D CA  1 
ATOM   4433  C  C   . VAL D 1 20  ? 45.870 -2.696  -37.703 1.00 33.48 ? 104 VAL D C   1 
ATOM   4434  O  O   . VAL D 1 20  ? 46.826 -2.002  -37.421 1.00 34.15 ? 104 VAL D O   1 
ATOM   4435  C  CB  . VAL D 1 20  ? 46.528 -4.130  -39.621 1.00 34.65 ? 104 VAL D CB  1 
ATOM   4436  C  CG1 . VAL D 1 20  ? 46.219 -5.501  -38.970 1.00 32.39 ? 104 VAL D CG1 1 
ATOM   4437  C  CG2 . VAL D 1 20  ? 46.462 -4.268  -41.150 1.00 33.88 ? 104 VAL D CG2 1 
ATOM   4438  N  N   . VAL D 1 21  ? 45.092 -3.247  -36.787 1.00 32.74 ? 105 VAL D N   1 
ATOM   4439  C  CA  . VAL D 1 21  ? 44.997 -2.852  -35.416 1.00 30.97 ? 105 VAL D CA  1 
ATOM   4440  C  C   . VAL D 1 21  ? 45.281 -4.153  -34.747 1.00 30.23 ? 105 VAL D C   1 
ATOM   4441  O  O   . VAL D 1 21  ? 44.555 -5.099  -34.967 1.00 30.43 ? 105 VAL D O   1 
ATOM   4442  C  CB  . VAL D 1 21  ? 43.557 -2.325  -35.206 1.00 31.62 ? 105 VAL D CB  1 
ATOM   4443  C  CG1 . VAL D 1 21  ? 42.838 -3.028  -34.206 1.00 32.39 ? 105 VAL D CG1 1 
ATOM   4444  C  CG2 . VAL D 1 21  ? 43.546 -0.839  -34.929 1.00 31.79 ? 105 VAL D CG2 1 
ATOM   4445  N  N   . ILE D 1 22  ? 46.374 -4.222  -33.974 1.00 29.46 ? 106 ILE D N   1 
ATOM   4446  C  CA  . ILE D 1 22  ? 46.919 -5.469  -33.457 1.00 28.31 ? 106 ILE D CA  1 
ATOM   4447  C  C   . ILE D 1 22  ? 47.014 -5.419  -31.961 1.00 29.89 ? 106 ILE D C   1 
ATOM   4448  O  O   . ILE D 1 22  ? 47.357 -4.420  -31.398 1.00 30.77 ? 106 ILE D O   1 
ATOM   4449  C  CB  . ILE D 1 22  ? 48.305 -5.701  -34.059 1.00 28.37 ? 106 ILE D CB  1 
ATOM   4450  C  CG1 . ILE D 1 22  ? 48.200 -5.619  -35.586 1.00 27.56 ? 106 ILE D CG1 1 
ATOM   4451  C  CG2 . ILE D 1 22  ? 48.903 -7.021  -33.622 1.00 25.62 ? 106 ILE D CG2 1 
ATOM   4452  C  CD1 . ILE D 1 22  ? 49.529 -5.663  -36.270 1.00 28.34 ? 106 ILE D CD1 1 
ATOM   4453  N  N   . ASP D 1 23  ? 46.620 -6.486  -31.296 1.00 32.05 ? 107 ASP D N   1 
ATOM   4454  C  CA  . ASP D 1 23  ? 46.751 -6.591  -29.846 1.00 34.16 ? 107 ASP D CA  1 
ATOM   4455  C  C   . ASP D 1 23  ? 48.150 -7.057  -29.476 1.00 34.39 ? 107 ASP D C   1 
ATOM   4456  O  O   . ASP D 1 23  ? 48.849 -7.565  -30.314 1.00 35.25 ? 107 ASP D O   1 
ATOM   4457  C  CB  . ASP D 1 23  ? 45.723 -7.603  -29.331 1.00 34.63 ? 107 ASP D CB  1 
ATOM   4458  C  CG  . ASP D 1 23  ? 45.562 -7.533  -27.842 1.00 37.88 ? 107 ASP D CG  1 
ATOM   4459  O  OD1 . ASP D 1 23  ? 46.010 -6.534  -27.235 1.00 43.84 ? 107 ASP D OD1 1 
ATOM   4460  O  OD2 . ASP D 1 23  ? 45.028 -8.484  -27.246 1.00 42.13 ? 107 ASP D OD2 1 
ATOM   4461  N  N   . LEU D 1 24  ? 48.566 -6.904  -28.227 1.00 35.59 ? 108 LEU D N   1 
ATOM   4462  C  CA  . LEU D 1 24  ? 49.907 -7.328  -27.777 1.00 35.72 ? 108 LEU D CA  1 
ATOM   4463  C  C   . LEU D 1 24  ? 49.862 -8.676  -27.092 1.00 36.80 ? 108 LEU D C   1 
ATOM   4464  O  O   . LEU D 1 24  ? 50.317 -9.667  -27.656 1.00 37.61 ? 108 LEU D O   1 
ATOM   4465  C  CB  . LEU D 1 24  ? 50.480 -6.286  -26.831 1.00 36.05 ? 108 LEU D CB  1 
ATOM   4466  C  CG  . LEU D 1 24  ? 51.949 -6.278  -26.398 1.00 37.92 ? 108 LEU D CG  1 
ATOM   4467  C  CD1 . LEU D 1 24  ? 52.935 -6.158  -27.623 1.00 38.49 ? 108 LEU D CD1 1 
ATOM   4468  C  CD2 . LEU D 1 24  ? 52.232 -5.192  -25.326 1.00 35.32 ? 108 LEU D CD2 1 
ATOM   4469  N  N   . ASP D 1 25  ? 49.267 -8.741  -25.895 1.00 38.32 ? 109 ASP D N   1 
ATOM   4470  C  CA  . ASP D 1 25  ? 49.313 -9.948  -25.037 1.00 38.76 ? 109 ASP D CA  1 
ATOM   4471  C  C   . ASP D 1 25  ? 48.641 -11.162 -25.669 1.00 38.20 ? 109 ASP D C   1 
ATOM   4472  O  O   . ASP D 1 25  ? 47.546 -11.060 -26.161 1.00 38.30 ? 109 ASP D O   1 
ATOM   4473  C  CB  . ASP D 1 25  ? 48.662 -9.658  -23.691 1.00 39.92 ? 109 ASP D CB  1 
ATOM   4474  C  CG  . ASP D 1 25  ? 49.411 -8.583  -22.897 1.00 44.49 ? 109 ASP D CG  1 
ATOM   4475  O  OD1 . ASP D 1 25  ? 50.594 -8.828  -22.557 1.00 51.22 ? 109 ASP D OD1 1 
ATOM   4476  O  OD2 . ASP D 1 25  ? 48.827 -7.499  -22.615 1.00 50.11 ? 109 ASP D OD2 1 
ATOM   4477  N  N   . GLU D 1 26  ? 49.312 -12.307 -25.644 1.00 37.33 ? 110 GLU D N   1 
ATOM   4478  C  CA  . GLU D 1 26  ? 48.790 -13.541 -26.217 1.00 36.87 ? 110 GLU D CA  1 
ATOM   4479  C  C   . GLU D 1 26  ? 48.610 -13.467 -27.712 1.00 35.57 ? 110 GLU D C   1 
ATOM   4480  O  O   . GLU D 1 26  ? 48.230 -14.418 -28.333 1.00 34.69 ? 110 GLU D O   1 
ATOM   4481  C  CB  . GLU D 1 26  ? 47.498 -14.004 -25.528 1.00 37.37 ? 110 GLU D CB  1 
ATOM   4482  C  CG  . GLU D 1 26  ? 47.686 -14.535 -24.059 1.00 38.89 ? 110 GLU D CG  1 
ATOM   4483  C  CD  . GLU D 1 26  ? 47.924 -13.433 -23.063 1.00 45.82 ? 110 GLU D CD  1 
ATOM   4484  O  OE1 . GLU D 1 26  ? 47.122 -12.484 -22.968 1.00 49.09 ? 110 GLU D OE1 1 
ATOM   4485  O  OE2 . GLU D 1 26  ? 48.952 -13.474 -22.365 1.00 52.43 ? 110 GLU D OE2 1 
ATOM   4486  N  N   . THR D 1 27  ? 48.922 -12.328 -28.296 1.00 35.13 ? 111 THR D N   1 
ATOM   4487  C  CA  . THR D 1 27  ? 48.821 -12.191 -29.732 1.00 34.60 ? 111 THR D CA  1 
ATOM   4488  C  C   . THR D 1 27  ? 50.230 -12.141 -30.322 1.00 34.40 ? 111 THR D C   1 
ATOM   4489  O  O   . THR D 1 27  ? 50.575 -12.971 -31.150 1.00 35.05 ? 111 THR D O   1 
ATOM   4490  C  CB  . THR D 1 27  ? 48.008 -10.937 -30.067 1.00 35.01 ? 111 THR D CB  1 
ATOM   4491  O  OG1 . THR D 1 27  ? 46.699 -11.102 -29.544 1.00 36.03 ? 111 THR D OG1 1 
ATOM   4492  C  CG2 . THR D 1 27  ? 47.938 -10.675 -31.563 1.00 33.72 ? 111 THR D CG2 1 
ATOM   4493  N  N   . LEU D 1 28  ? 51.047 -11.184 -29.900 1.00 33.62 ? 112 LEU D N   1 
ATOM   4494  C  CA  . LEU D 1 28  ? 52.436 -11.085 -30.418 1.00 33.32 ? 112 LEU D CA  1 
ATOM   4495  C  C   . LEU D 1 28  ? 53.454 -11.569 -29.374 1.00 34.66 ? 112 LEU D C   1 
ATOM   4496  O  O   . LEU D 1 28  ? 54.554 -11.938 -29.736 1.00 35.13 ? 112 LEU D O   1 
ATOM   4497  C  CB  . LEU D 1 28  ? 52.782 -9.667  -30.861 1.00 31.23 ? 112 LEU D CB  1 
ATOM   4498  C  CG  . LEU D 1 28  ? 51.902 -8.892  -31.885 1.00 30.45 ? 112 LEU D CG  1 
ATOM   4499  C  CD1 . LEU D 1 28  ? 52.300 -7.458  -32.056 1.00 23.16 ? 112 LEU D CD1 1 
ATOM   4500  C  CD2 . LEU D 1 28  ? 51.875 -9.542  -33.228 1.00 24.70 ? 112 LEU D CD2 1 
ATOM   4501  N  N   . VAL D 1 29  ? 53.066 -11.562 -28.092 1.00 35.45 ? 113 VAL D N   1 
ATOM   4502  C  CA  . VAL D 1 29  ? 53.958 -11.863 -26.984 1.00 36.64 ? 113 VAL D CA  1 
ATOM   4503  C  C   . VAL D 1 29  ? 53.207 -12.486 -25.810 1.00 37.82 ? 113 VAL D C   1 
ATOM   4504  O  O   . VAL D 1 29  ? 51.983 -12.593 -25.790 1.00 38.00 ? 113 VAL D O   1 
ATOM   4505  C  CB  . VAL D 1 29  ? 54.735 -10.609 -26.418 1.00 36.56 ? 113 VAL D CB  1 
ATOM   4506  C  CG1 . VAL D 1 29  ? 55.604 -9.907  -27.451 1.00 33.56 ? 113 VAL D CG1 1 
ATOM   4507  C  CG2 . VAL D 1 29  ? 53.802 -9.639  -25.804 1.00 37.15 ? 113 VAL D CG2 1 
ATOM   4508  N  N   . HIS D 1 30  ? 53.965 -12.931 -24.834 1.00 39.43 ? 114 HIS D N   1 
ATOM   4509  C  CA  . HIS D 1 30  ? 53.368 -13.353 -23.591 1.00 41.77 ? 114 HIS D CA  1 
ATOM   4510  C  C   . HIS D 1 30  ? 54.278 -12.867 -22.473 1.00 42.53 ? 114 HIS D C   1 
ATOM   4511  O  O   . HIS D 1 30  ? 55.494 -13.039 -22.570 1.00 42.38 ? 114 HIS D O   1 
ATOM   4512  C  CB  . HIS D 1 30  ? 53.166 -14.850 -23.526 1.00 41.33 ? 114 HIS D CB  1 
ATOM   4513  C  CG  . HIS D 1 30  ? 52.727 -15.308 -22.183 1.00 45.39 ? 114 HIS D CG  1 
ATOM   4514  N  ND1 . HIS D 1 30  ? 51.550 -14.874 -21.602 1.00 49.41 ? 114 HIS D ND1 1 
ATOM   4515  C  CD2 . HIS D 1 30  ? 53.321 -16.122 -21.275 1.00 47.73 ? 114 HIS D CD2 1 
ATOM   4516  C  CE1 . HIS D 1 30  ? 51.423 -15.426 -20.406 1.00 51.36 ? 114 HIS D CE1 1 
ATOM   4517  N  NE2 . HIS D 1 30  ? 52.485 -16.189 -20.184 1.00 52.39 ? 114 HIS D NE2 1 
ATOM   4518  N  N   . SER D 1 31  ? 53.693 -12.209 -21.466 1.00 43.22 ? 115 SER D N   1 
ATOM   4519  C  CA  . SER D 1 31  ? 54.454 -11.652 -20.344 1.00 44.65 ? 115 SER D CA  1 
ATOM   4520  C  C   . SER D 1 31  ? 54.054 -12.305 -19.059 1.00 45.20 ? 115 SER D C   1 
ATOM   4521  O  O   . SER D 1 31  ? 52.948 -12.835 -18.940 1.00 44.83 ? 115 SER D O   1 
ATOM   4522  C  CB  . SER D 1 31  ? 54.200 -10.163 -20.193 1.00 44.80 ? 115 SER D CB  1 
ATOM   4523  O  OG  . SER D 1 31  ? 54.491 -9.469  -21.404 1.00 48.41 ? 115 SER D OG  1 
ATOM   4524  N  N   . SER D 1 32  ? 54.968 -12.235 -18.094 1.00 46.21 ? 116 SER D N   1 
ATOM   4525  C  CA  . SER D 1 32  ? 54.783 -12.798 -16.766 1.00 46.29 ? 116 SER D CA  1 
ATOM   4526  C  C   . SER D 1 32  ? 55.641 -12.102 -15.704 1.00 46.31 ? 116 SER D C   1 
ATOM   4527  O  O   . SER D 1 32  ? 56.753 -11.561 -16.000 1.00 45.83 ? 116 SER D O   1 
ATOM   4528  C  CB  . SER D 1 32  ? 55.139 -14.256 -16.799 1.00 45.79 ? 116 SER D CB  1 
ATOM   4529  O  OG  . SER D 1 32  ? 54.190 -15.005 -16.079 1.00 51.62 ? 116 SER D OG  1 
ATOM   4530  N  N   . PHE D 1 33  ? 55.130 -12.123 -14.470 1.00 46.34 ? 117 PHE D N   1 
ATOM   4531  C  CA  . PHE D 1 33  ? 55.821 -11.486 -13.361 1.00 47.28 ? 117 PHE D CA  1 
ATOM   4532  C  C   . PHE D 1 33  ? 56.633 -12.512 -12.629 1.00 48.47 ? 117 PHE D C   1 
ATOM   4533  O  O   . PHE D 1 33  ? 57.431 -12.173 -11.741 1.00 49.46 ? 117 PHE D O   1 
ATOM   4534  C  CB  . PHE D 1 33  ? 54.873 -10.845 -12.370 1.00 46.34 ? 117 PHE D CB  1 
ATOM   4535  C  CG  . PHE D 1 33  ? 54.265 -9.550  -12.824 1.00 46.31 ? 117 PHE D CG  1 
ATOM   4536  C  CD1 . PHE D 1 33  ? 52.968 -9.518  -13.337 1.00 45.52 ? 117 PHE D CD1 1 
ATOM   4537  C  CD2 . PHE D 1 33  ? 54.936 -8.367  -12.681 1.00 45.50 ? 117 PHE D CD2 1 
ATOM   4538  C  CE1 . PHE D 1 33  ? 52.384 -8.357  -13.730 1.00 40.87 ? 117 PHE D CE1 1 
ATOM   4539  C  CE2 . PHE D 1 33  ? 54.333 -7.198  -13.062 1.00 46.01 ? 117 PHE D CE2 1 
ATOM   4540  C  CZ  . PHE D 1 33  ? 53.052 -7.199  -13.576 1.00 43.73 ? 117 PHE D CZ  1 
ATOM   4541  N  N   . LYS D 1 34  ? 56.418 -13.766 -12.985 1.00 49.53 ? 118 LYS D N   1 
ATOM   4542  C  CA  . LYS D 1 34  ? 57.304 -14.840 -12.574 1.00 51.74 ? 118 LYS D CA  1 
ATOM   4543  C  C   . LYS D 1 34  ? 58.619 -14.709 -13.371 1.00 52.31 ? 118 LYS D C   1 
ATOM   4544  O  O   . LYS D 1 34  ? 58.610 -14.754 -14.597 1.00 51.43 ? 118 LYS D O   1 
ATOM   4545  C  CB  . LYS D 1 34  ? 56.620 -16.170 -12.873 1.00 52.44 ? 118 LYS D CB  1 
ATOM   4546  C  CG  . LYS D 1 34  ? 57.136 -17.352 -12.073 1.00 56.27 ? 118 LYS D CG  1 
ATOM   4547  C  CD  . LYS D 1 34  ? 55.954 -18.176 -11.546 1.00 59.69 ? 118 LYS D CD  1 
ATOM   4548  C  CE  . LYS D 1 34  ? 56.398 -19.537 -11.076 1.00 58.46 ? 118 LYS D CE  1 
ATOM   4549  N  NZ  . LYS D 1 34  ? 55.875 -20.578 -11.996 1.00 59.70 ? 118 LYS D NZ  1 
ATOM   4550  N  N   . PRO D 1 35  ? 59.759 -14.509 -12.682 1.00 53.66 ? 119 PRO D N   1 
ATOM   4551  C  CA  . PRO D 1 35  ? 60.998 -14.422 -13.464 1.00 54.64 ? 119 PRO D CA  1 
ATOM   4552  C  C   . PRO D 1 35  ? 61.339 -15.743 -14.150 1.00 55.31 ? 119 PRO D C   1 
ATOM   4553  O  O   . PRO D 1 35  ? 61.223 -16.807 -13.546 1.00 55.98 ? 119 PRO D O   1 
ATOM   4554  C  CB  . PRO D 1 35  ? 62.066 -14.055 -12.414 1.00 55.05 ? 119 PRO D CB  1 
ATOM   4555  C  CG  . PRO D 1 35  ? 61.274 -13.546 -11.202 1.00 54.69 ? 119 PRO D CG  1 
ATOM   4556  C  CD  . PRO D 1 35  ? 60.008 -14.344 -11.233 1.00 53.77 ? 119 PRO D CD  1 
ATOM   4557  N  N   . ILE D 1 36  ? 61.727 -15.670 -15.417 1.00 55.81 ? 120 ILE D N   1 
ATOM   4558  C  CA  . ILE D 1 36  ? 62.171 -16.863 -16.149 1.00 55.81 ? 120 ILE D CA  1 
ATOM   4559  C  C   . ILE D 1 36  ? 63.630 -16.689 -16.634 1.00 56.69 ? 120 ILE D C   1 
ATOM   4560  O  O   . ILE D 1 36  ? 64.290 -15.675 -16.298 1.00 56.97 ? 120 ILE D O   1 
ATOM   4561  C  CB  . ILE D 1 36  ? 61.180 -17.268 -17.296 1.00 55.46 ? 120 ILE D CB  1 
ATOM   4562  C  CG1 . ILE D 1 36  ? 60.904 -16.107 -18.246 1.00 54.70 ? 120 ILE D CG1 1 
ATOM   4563  C  CG2 . ILE D 1 36  ? 59.875 -17.857 -16.722 1.00 53.64 ? 120 ILE D CG2 1 
ATOM   4564  C  CD1 . ILE D 1 36  ? 59.918 -16.473 -19.444 1.00 56.18 ? 120 ILE D CD1 1 
ATOM   4565  N  N   . ALA D 1 39  ? 63.968 -15.702 -21.616 1.00 49.61 ? 123 ALA D N   1 
ATOM   4566  C  CA  . ALA D 1 39  ? 63.093 -14.562 -21.914 1.00 50.79 ? 123 ALA D CA  1 
ATOM   4567  C  C   . ALA D 1 39  ? 63.797 -13.540 -22.795 1.00 50.65 ? 123 ALA D C   1 
ATOM   4568  O  O   . ALA D 1 39  ? 64.965 -13.196 -22.552 1.00 50.87 ? 123 ALA D O   1 
ATOM   4569  C  CB  . ALA D 1 39  ? 62.566 -13.866 -20.619 1.00 50.07 ? 123 ALA D CB  1 
ATOM   4570  N  N   . ASP D 1 40  ? 63.065 -13.021 -23.770 1.00 49.65 ? 124 ASP D N   1 
ATOM   4571  C  CA  . ASP D 1 40  ? 63.648 -12.103 -24.706 1.00 50.15 ? 124 ASP D CA  1 
ATOM   4572  C  C   . ASP D 1 40  ? 63.863 -10.735 -24.098 1.00 50.07 ? 124 ASP D C   1 
ATOM   4573  O  O   . ASP D 1 40  ? 64.896 -10.125 -24.311 1.00 51.45 ? 124 ASP D O   1 
ATOM   4574  C  CB  . ASP D 1 40  ? 62.785 -12.042 -25.958 1.00 50.13 ? 124 ASP D CB  1 
ATOM   4575  C  CG  . ASP D 1 40  ? 62.574 -13.423 -26.570 1.00 51.93 ? 124 ASP D CG  1 
ATOM   4576  O  OD1 . ASP D 1 40  ? 63.513 -13.943 -27.231 1.00 55.34 ? 124 ASP D OD1 1 
ATOM   4577  O  OD2 . ASP D 1 40  ? 61.494 -14.010 -26.363 1.00 51.90 ? 124 ASP D OD2 1 
ATOM   4578  N  N   . PHE D 1 41  ? 62.873 -10.260 -23.358 1.00 49.63 ? 125 PHE D N   1 
ATOM   4579  C  CA  . PHE D 1 41  ? 62.892 -8.973  -22.726 1.00 48.77 ? 125 PHE D CA  1 
ATOM   4580  C  C   . PHE D 1 41  ? 62.544 -9.114  -21.215 1.00 48.11 ? 125 PHE D C   1 
ATOM   4581  O  O   . PHE D 1 41  ? 61.830 -10.033 -20.783 1.00 47.16 ? 125 PHE D O   1 
ATOM   4582  C  CB  . PHE D 1 41  ? 61.837 -8.064  -23.381 1.00 49.74 ? 125 PHE D CB  1 
ATOM   4583  C  CG  . PHE D 1 41  ? 61.854 -8.055  -24.870 1.00 50.87 ? 125 PHE D CG  1 
ATOM   4584  C  CD1 . PHE D 1 41  ? 60.657 -8.192  -25.581 1.00 53.24 ? 125 PHE D CD1 1 
ATOM   4585  C  CD2 . PHE D 1 41  ? 63.035 -7.870  -25.579 1.00 53.03 ? 125 PHE D CD2 1 
ATOM   4586  C  CE1 . PHE D 1 41  ? 60.632 -8.152  -26.967 1.00 50.93 ? 125 PHE D CE1 1 
ATOM   4587  C  CE2 . PHE D 1 41  ? 63.036 -7.854  -26.983 1.00 52.28 ? 125 PHE D CE2 1 
ATOM   4588  C  CZ  . PHE D 1 41  ? 61.820 -7.997  -27.677 1.00 51.13 ? 125 PHE D CZ  1 
ATOM   4589  N  N   . ILE D 1 42  ? 63.045 -8.176  -20.423 1.00 47.27 ? 126 ILE D N   1 
ATOM   4590  C  CA  . ILE D 1 42  ? 62.773 -8.092  -19.000 1.00 46.62 ? 126 ILE D CA  1 
ATOM   4591  C  C   . ILE D 1 42  ? 62.569 -6.605  -18.895 1.00 46.11 ? 126 ILE D C   1 
ATOM   4592  O  O   . ILE D 1 42  ? 63.473 -5.818  -19.266 1.00 44.12 ? 126 ILE D O   1 
ATOM   4593  C  CB  . ILE D 1 42  ? 64.002 -8.406  -18.187 1.00 46.56 ? 126 ILE D CB  1 
ATOM   4594  C  CG1 . ILE D 1 42  ? 64.393 -9.878  -18.333 1.00 48.16 ? 126 ILE D CG1 1 
ATOM   4595  C  CG2 . ILE D 1 42  ? 63.790 -8.041  -16.707 1.00 49.15 ? 126 ILE D CG2 1 
ATOM   4596  C  CD1 . ILE D 1 42  ? 65.724 -10.261 -17.585 1.00 48.95 ? 126 ILE D CD1 1 
ATOM   4597  N  N   . VAL D 1 43  ? 61.358 -6.210  -18.482 1.00 45.76 ? 127 VAL D N   1 
ATOM   4598  C  CA  . VAL D 1 43  ? 61.082 -4.800  -18.317 1.00 45.42 ? 127 VAL D CA  1 
ATOM   4599  C  C   . VAL D 1 43  ? 60.492 -4.546  -16.919 1.00 46.70 ? 127 VAL D C   1 
ATOM   4600  O  O   . VAL D 1 43  ? 59.697 -5.364  -16.417 1.00 48.14 ? 127 VAL D O   1 
ATOM   4601  C  CB  . VAL D 1 43  ? 60.279 -4.133  -19.488 1.00 45.05 ? 127 VAL D CB  1 
ATOM   4602  C  CG1 . VAL D 1 43  ? 60.189 -5.000  -20.748 1.00 43.61 ? 127 VAL D CG1 1 
ATOM   4603  C  CG2 . VAL D 1 43  ? 58.951 -3.612  -19.024 1.00 43.95 ? 127 VAL D CG2 1 
ATOM   4604  N  N   . PRO D 1 44  ? 60.934 -3.454  -16.263 1.00 46.34 ? 128 PRO D N   1 
ATOM   4605  C  CA  . PRO D 1 44  ? 60.500 -3.153  -14.930 1.00 46.07 ? 128 PRO D CA  1 
ATOM   4606  C  C   . PRO D 1 44  ? 59.207 -2.364  -14.963 1.00 45.81 ? 128 PRO D C   1 
ATOM   4607  O  O   . PRO D 1 44  ? 59.068 -1.386  -15.731 1.00 44.93 ? 128 PRO D O   1 
ATOM   4608  C  CB  . PRO D 1 44  ? 61.606 -2.228  -14.420 1.00 46.37 ? 128 PRO D CB  1 
ATOM   4609  C  CG  . PRO D 1 44  ? 61.971 -1.441  -15.651 1.00 47.99 ? 128 PRO D CG  1 
ATOM   4610  C  CD  . PRO D 1 44  ? 61.871 -2.432  -16.780 1.00 46.33 ? 128 PRO D CD  1 
ATOM   4611  N  N   . ILE D 1 45  ? 58.290 -2.743  -14.093 1.00 45.68 ? 129 ILE D N   1 
ATOM   4612  C  CA  . ILE D 1 45  ? 57.001 -2.074  -14.068 1.00 47.40 ? 129 ILE D CA  1 
ATOM   4613  C  C   . ILE D 1 45  ? 56.640 -1.579  -12.639 1.00 47.80 ? 129 ILE D C   1 
ATOM   4614  O  O   . ILE D 1 45  ? 56.670 -2.331  -11.677 1.00 47.65 ? 129 ILE D O   1 
ATOM   4615  C  CB  . ILE D 1 45  ? 55.952 -2.953  -14.853 1.00 47.06 ? 129 ILE D CB  1 
ATOM   4616  C  CG1 . ILE D 1 45  ? 56.345 -2.892  -16.348 1.00 46.89 ? 129 ILE D CG1 1 
ATOM   4617  C  CG2 . ILE D 1 45  ? 54.536 -2.501  -14.596 1.00 46.36 ? 129 ILE D CG2 1 
ATOM   4618  C  CD1 . ILE D 1 45  ? 55.382 -3.422  -17.345 1.00 47.25 ? 129 ILE D CD1 1 
ATOM   4619  N  N   . GLU D 1 46  ? 56.384 -0.295  -12.498 1.00 49.07 ? 130 GLU D N   1 
ATOM   4620  C  CA  . GLU D 1 46  ? 56.024 0.194   -11.184 1.00 51.85 ? 130 GLU D CA  1 
ATOM   4621  C  C   . GLU D 1 46  ? 54.542 -0.091  -10.968 1.00 52.16 ? 130 GLU D C   1 
ATOM   4622  O  O   . GLU D 1 46  ? 53.694 0.130   -11.844 1.00 53.32 ? 130 GLU D O   1 
ATOM   4623  C  CB  . GLU D 1 46  ? 56.342 1.672   -10.995 1.00 52.35 ? 130 GLU D CB  1 
ATOM   4624  C  CG  . GLU D 1 46  ? 55.097 2.586   -10.842 1.00 58.31 ? 130 GLU D CG  1 
ATOM   4625  C  CD  . GLU D 1 46  ? 54.761 2.915   -9.392  1.00 65.47 ? 130 GLU D CD  1 
ATOM   4626  O  OE1 . GLU D 1 46  ? 55.563 2.536   -8.496  1.00 68.23 ? 130 GLU D OE1 1 
ATOM   4627  O  OE2 . GLU D 1 46  ? 53.711 3.563   -9.148  1.00 65.41 ? 130 GLU D OE2 1 
ATOM   4628  N  N   . ILE D 1 47  ? 54.253 -0.659  -9.821  1.00 51.76 ? 131 ILE D N   1 
ATOM   4629  C  CA  . ILE D 1 47  ? 52.920 -0.933  -9.438  1.00 51.31 ? 131 ILE D CA  1 
ATOM   4630  C  C   . ILE D 1 47  ? 52.825 -0.469  -7.997  1.00 51.38 ? 131 ILE D C   1 
ATOM   4631  O  O   . ILE D 1 47  ? 53.553 -0.934  -7.127  1.00 51.64 ? 131 ILE D O   1 
ATOM   4632  C  CB  . ILE D 1 47  ? 52.612 -2.427  -9.620  1.00 51.51 ? 131 ILE D CB  1 
ATOM   4633  C  CG1 . ILE D 1 47  ? 52.387 -2.740  -11.099 1.00 50.47 ? 131 ILE D CG1 1 
ATOM   4634  C  CG2 . ILE D 1 47  ? 51.388 -2.852  -8.804  1.00 51.37 ? 131 ILE D CG2 1 
ATOM   4635  C  CD1 . ILE D 1 47  ? 52.583 -4.206  -11.441 1.00 47.58 ? 131 ILE D CD1 1 
ATOM   4636  N  N   . GLU D 1 48  ? 51.941 0.485   -7.753  1.00 52.34 ? 132 GLU D N   1 
ATOM   4637  C  CA  . GLU D 1 48  ? 51.650 0.952   -6.390  1.00 52.70 ? 132 GLU D CA  1 
ATOM   4638  C  C   . GLU D 1 48  ? 52.980 1.301   -5.682  1.00 52.05 ? 132 GLU D C   1 
ATOM   4639  O  O   . GLU D 1 48  ? 53.237 0.879   -4.547  1.00 51.13 ? 132 GLU D O   1 
ATOM   4640  C  CB  . GLU D 1 48  ? 50.822 -0.100  -5.611  1.00 53.20 ? 132 GLU D CB  1 
ATOM   4641  C  CG  . GLU D 1 48  ? 49.582 0.481   -4.821  1.00 57.00 ? 132 GLU D CG  1 
ATOM   4642  C  CD  . GLU D 1 48  ? 48.482 1.070   -5.756  1.00 59.58 ? 132 GLU D CD  1 
ATOM   4643  O  OE1 . GLU D 1 48  ? 48.241 2.311   -5.694  1.00 56.55 ? 132 GLU D OE1 1 
ATOM   4644  O  OE2 . GLU D 1 48  ? 47.896 0.277   -6.556  1.00 58.61 ? 132 GLU D OE2 1 
ATOM   4645  N  N   . GLY D 1 49  ? 53.816 2.066   -6.393  1.00 50.61 ? 133 GLY D N   1 
ATOM   4646  C  CA  . GLY D 1 49  ? 55.004 2.616   -5.810  1.00 49.01 ? 133 GLY D CA  1 
ATOM   4647  C  C   . GLY D 1 49  ? 56.177 1.659   -5.949  1.00 48.50 ? 133 GLY D C   1 
ATOM   4648  O  O   . GLY D 1 49  ? 57.327 2.084   -5.849  1.00 49.08 ? 133 GLY D O   1 
ATOM   4649  N  N   . THR D 1 50  ? 55.919 0.373   -6.169  1.00 46.81 ? 134 THR D N   1 
ATOM   4650  C  CA  . THR D 1 50  ? 57.031 -0.562  -6.228  1.00 45.49 ? 134 THR D CA  1 
ATOM   4651  C  C   . THR D 1 50  ? 57.240 -1.164  -7.587  1.00 43.43 ? 134 THR D C   1 
ATOM   4652  O  O   . THR D 1 50  ? 56.313 -1.345  -8.346  1.00 41.60 ? 134 THR D O   1 
ATOM   4653  C  CB  . THR D 1 50  ? 56.975 -1.633  -5.098  1.00 46.27 ? 134 THR D CB  1 
ATOM   4654  O  OG1 . THR D 1 50  ? 56.872 -2.958  -5.636  1.00 49.42 ? 134 THR D OG1 1 
ATOM   4655  C  CG2 . THR D 1 50  ? 55.822 -1.332  -4.093  1.00 47.56 ? 134 THR D CG2 1 
ATOM   4656  N  N   . THR D 1 51  ? 58.504 -1.459  -7.879  1.00 43.09 ? 135 THR D N   1 
ATOM   4657  C  CA  . THR D 1 51  ? 58.943 -1.953  -9.189  1.00 41.64 ? 135 THR D CA  1 
ATOM   4658  C  C   . THR D 1 51  ? 59.074 -3.440  -9.286  1.00 41.01 ? 135 THR D C   1 
ATOM   4659  O  O   . THR D 1 51  ? 59.867 -4.019  -8.558  1.00 40.84 ? 135 THR D O   1 
ATOM   4660  C  CB  . THR D 1 51  ? 60.294 -1.459  -9.506  1.00 41.71 ? 135 THR D CB  1 
ATOM   4661  O  OG1 . THR D 1 51  ? 60.221 -0.040  -9.564  1.00 42.35 ? 135 THR D OG1 1 
ATOM   4662  C  CG2 . THR D 1 51  ? 60.766 -2.045  -10.887 1.00 40.88 ? 135 THR D CG2 1 
ATOM   4663  N  N   . HIS D 1 52  ? 58.331 -4.029  -10.225 1.00 39.73 ? 136 HIS D N   1 
ATOM   4664  C  CA  . HIS D 1 52  ? 58.328 -5.457  -10.447 1.00 39.23 ? 136 HIS D CA  1 
ATOM   4665  C  C   . HIS D 1 52  ? 58.907 -5.640  -11.828 1.00 40.21 ? 136 HIS D C   1 
ATOM   4666  O  O   . HIS D 1 52  ? 58.761 -4.754  -12.673 1.00 39.94 ? 136 HIS D O   1 
ATOM   4667  C  CB  . HIS D 1 52  ? 56.905 -5.977  -10.450 1.00 38.91 ? 136 HIS D CB  1 
ATOM   4668  C  CG  . HIS D 1 52  ? 56.243 -5.876  -9.136  1.00 37.29 ? 136 HIS D CG  1 
ATOM   4669  N  ND1 . HIS D 1 52  ? 56.106 -6.960  -8.300  1.00 41.14 ? 136 HIS D ND1 1 
ATOM   4670  C  CD2 . HIS D 1 52  ? 55.745 -4.818  -8.467  1.00 34.59 ? 136 HIS D CD2 1 
ATOM   4671  C  CE1 . HIS D 1 52  ? 55.494 -6.590  -7.190  1.00 34.38 ? 136 HIS D CE1 1 
ATOM   4672  N  NE2 . HIS D 1 52  ? 55.299 -5.288  -7.252  1.00 36.80 ? 136 HIS D NE2 1 
ATOM   4673  N  N   . GLN D 1 53  ? 59.544 -6.786  -12.065 1.00 41.21 ? 137 GLN D N   1 
ATOM   4674  C  CA  . GLN D 1 53  ? 60.120 -7.067  -13.375 1.00 42.72 ? 137 GLN D CA  1 
ATOM   4675  C  C   . GLN D 1 53  ? 59.136 -7.932  -14.086 1.00 42.10 ? 137 GLN D C   1 
ATOM   4676  O  O   . GLN D 1 53  ? 58.595 -8.880  -13.483 1.00 41.57 ? 137 GLN D O   1 
ATOM   4677  C  CB  . GLN D 1 53  ? 61.426 -7.843  -13.267 1.00 43.81 ? 137 GLN D CB  1 
ATOM   4678  C  CG  . GLN D 1 53  ? 62.497 -7.133  -12.496 1.00 49.98 ? 137 GLN D CG  1 
ATOM   4679  C  CD  . GLN D 1 53  ? 63.442 -6.430  -13.400 1.00 58.99 ? 137 GLN D CD  1 
ATOM   4680  O  OE1 . GLN D 1 53  ? 64.524 -6.966  -13.719 1.00 64.68 ? 137 GLN D OE1 1 
ATOM   4681  N  NE2 . GLN D 1 53  ? 63.052 -5.232  -13.859 1.00 61.93 ? 137 GLN D NE2 1 
ATOM   4682  N  N   . VAL D 1 54  ? 58.893 -7.575  -15.347 1.00 41.29 ? 138 VAL D N   1 
ATOM   4683  C  CA  . VAL D 1 54  ? 58.029 -8.348  -16.207 1.00 42.18 ? 138 VAL D CA  1 
ATOM   4684  C  C   . VAL D 1 54  ? 58.838 -9.078  -17.257 1.00 42.52 ? 138 VAL D C   1 
ATOM   4685  O  O   . VAL D 1 54  ? 59.708 -8.473  -17.904 1.00 43.19 ? 138 VAL D O   1 
ATOM   4686  C  CB  . VAL D 1 54  ? 56.923 -7.465  -16.817 1.00 42.23 ? 138 VAL D CB  1 
ATOM   4687  C  CG1 . VAL D 1 54  ? 56.254 -8.149  -17.928 1.00 40.26 ? 138 VAL D CG1 1 
ATOM   4688  C  CG2 . VAL D 1 54  ? 55.888 -7.186  -15.745 1.00 43.40 ? 138 VAL D CG2 1 
ATOM   4689  N  N   . TYR D 1 55  ? 58.556 -10.373 -17.397 1.00 42.96 ? 139 TYR D N   1 
ATOM   4690  C  CA  . TYR D 1 55  ? 59.355 -11.272 -18.233 1.00 44.19 ? 139 TYR D CA  1 
ATOM   4691  C  C   . TYR D 1 55  ? 58.555 -11.607 -19.474 1.00 43.13 ? 139 TYR D C   1 
ATOM   4692  O  O   . TYR D 1 55  ? 57.440 -12.144 -19.390 1.00 44.00 ? 139 TYR D O   1 
ATOM   4693  C  CB  . TYR D 1 55  ? 59.800 -12.542 -17.425 1.00 46.47 ? 139 TYR D CB  1 
ATOM   4694  C  CG  . TYR D 1 55  ? 60.660 -12.146 -16.239 1.00 49.05 ? 139 TYR D CG  1 
ATOM   4695  C  CD1 . TYR D 1 55  ? 60.086 -11.552 -15.109 1.00 51.40 ? 139 TYR D CD1 1 
ATOM   4696  C  CD2 . TYR D 1 55  ? 62.033 -12.276 -16.276 1.00 52.32 ? 139 TYR D CD2 1 
ATOM   4697  C  CE1 . TYR D 1 55  ? 60.843 -11.131 -14.044 1.00 51.39 ? 139 TYR D CE1 1 
ATOM   4698  C  CE2 . TYR D 1 55  ? 62.813 -11.851 -15.205 1.00 54.07 ? 139 TYR D CE2 1 
ATOM   4699  C  CZ  . TYR D 1 55  ? 62.211 -11.280 -14.089 1.00 53.52 ? 139 TYR D CZ  1 
ATOM   4700  O  OH  . TYR D 1 55  ? 62.975 -10.830 -13.018 1.00 53.79 ? 139 TYR D OH  1 
ATOM   4701  N  N   . VAL D 1 56  ? 59.134 -11.279 -20.613 1.00 41.47 ? 140 VAL D N   1 
ATOM   4702  C  CA  . VAL D 1 56  ? 58.458 -11.319 -21.887 1.00 40.96 ? 140 VAL D CA  1 
ATOM   4703  C  C   . VAL D 1 56  ? 59.103 -12.276 -22.905 1.00 41.96 ? 140 VAL D C   1 
ATOM   4704  O  O   . VAL D 1 56  ? 60.310 -12.180 -23.199 1.00 41.94 ? 140 VAL D O   1 
ATOM   4705  C  CB  . VAL D 1 56  ? 58.495 -9.938  -22.577 1.00 40.89 ? 140 VAL D CB  1 
ATOM   4706  C  CG1 . VAL D 1 56  ? 57.614 -9.967  -23.823 1.00 39.34 ? 140 VAL D CG1 1 
ATOM   4707  C  CG2 . VAL D 1 56  ? 58.093 -8.824  -21.621 1.00 39.77 ? 140 VAL D CG2 1 
ATOM   4708  N  N   . LEU D 1 57  ? 58.266 -13.147 -23.469 1.00 42.27 ? 141 LEU D N   1 
ATOM   4709  C  CA  . LEU D 1 57  ? 58.580 -14.022 -24.571 1.00 43.38 ? 141 LEU D CA  1 
ATOM   4710  C  C   . LEU D 1 57  ? 57.926 -13.606 -25.903 1.00 43.79 ? 141 LEU D C   1 
ATOM   4711  O  O   . LEU D 1 57  ? 56.712 -13.461 -25.962 1.00 45.40 ? 141 LEU D O   1 
ATOM   4712  C  CB  . LEU D 1 57  ? 58.039 -15.387 -24.221 1.00 43.75 ? 141 LEU D CB  1 
ATOM   4713  C  CG  . LEU D 1 57  ? 58.825 -16.107 -23.137 1.00 45.53 ? 141 LEU D CG  1 
ATOM   4714  C  CD1 . LEU D 1 57  ? 58.043 -17.376 -22.804 1.00 46.75 ? 141 LEU D CD1 1 
ATOM   4715  C  CD2 . LEU D 1 57  ? 60.274 -16.438 -23.577 1.00 43.35 ? 141 LEU D CD2 1 
ATOM   4716  N  N   . LYS D 1 58  ? 58.717 -13.431 -26.959 1.00 43.29 ? 142 LYS D N   1 
ATOM   4717  C  CA  . LYS D 1 58  ? 58.229 -13.266 -28.327 1.00 42.63 ? 142 LYS D CA  1 
ATOM   4718  C  C   . LYS D 1 58  ? 57.538 -14.509 -28.853 1.00 43.12 ? 142 LYS D C   1 
ATOM   4719  O  O   . LYS D 1 58  ? 57.901 -15.626 -28.511 1.00 45.80 ? 142 LYS D O   1 
ATOM   4720  C  CB  . LYS D 1 58  ? 59.386 -12.927 -29.232 1.00 42.70 ? 142 LYS D CB  1 
ATOM   4721  C  CG  . LYS D 1 58  ? 60.284 -11.847 -28.680 1.00 42.85 ? 142 LYS D CG  1 
ATOM   4722  C  CD  . LYS D 1 58  ? 60.888 -10.979 -29.752 1.00 48.54 ? 142 LYS D CD  1 
ATOM   4723  C  CE  . LYS D 1 58  ? 62.102 -11.589 -30.474 1.00 52.42 ? 142 LYS D CE  1 
ATOM   4724  N  NZ  . LYS D 1 58  ? 62.631 -10.658 -31.552 1.00 50.10 ? 142 LYS D NZ  1 
ATOM   4725  N  N   . ARG D 1 59  ? 56.496 -14.355 -29.652 1.00 42.70 ? 143 ARG D N   1 
ATOM   4726  C  CA  . ARG D 1 59  ? 55.873 -15.505 -30.263 1.00 41.26 ? 143 ARG D CA  1 
ATOM   4727  C  C   . ARG D 1 59  ? 56.814 -15.777 -31.447 1.00 41.02 ? 143 ARG D C   1 
ATOM   4728  O  O   . ARG D 1 59  ? 57.448 -14.848 -31.946 1.00 41.32 ? 143 ARG D O   1 
ATOM   4729  C  CB  . ARG D 1 59  ? 54.480 -15.128 -30.732 1.00 41.10 ? 143 ARG D CB  1 
ATOM   4730  C  CG  . ARG D 1 59  ? 53.494 -16.263 -30.899 1.00 39.83 ? 143 ARG D CG  1 
ATOM   4731  C  CD  . ARG D 1 59  ? 52.344 -15.880 -31.846 1.00 37.67 ? 143 ARG D CD  1 
ATOM   4732  N  NE  . ARG D 1 59  ? 51.288 -16.911 -31.997 1.00 37.05 ? 143 ARG D NE  1 
ATOM   4733  C  CZ  . ARG D 1 59  ? 49.999 -16.731 -31.698 1.00 37.90 ? 143 ARG D CZ  1 
ATOM   4734  N  NH1 . ARG D 1 59  ? 49.592 -15.557 -31.230 1.00 36.20 ? 143 ARG D NH1 1 
ATOM   4735  N  NH2 . ARG D 1 59  ? 49.113 -17.722 -31.859 1.00 37.93 ? 143 ARG D NH2 1 
ATOM   4736  N  N   . PRO D 1 60  ? 56.935 -17.041 -31.891 1.00 40.46 ? 144 PRO D N   1 
ATOM   4737  C  CA  . PRO D 1 60  ? 57.756 -17.343 -33.088 1.00 39.31 ? 144 PRO D CA  1 
ATOM   4738  C  C   . PRO D 1 60  ? 57.339 -16.598 -34.336 1.00 36.86 ? 144 PRO D C   1 
ATOM   4739  O  O   . PRO D 1 60  ? 56.176 -16.501 -34.646 1.00 36.24 ? 144 PRO D O   1 
ATOM   4740  C  CB  . PRO D 1 60  ? 57.501 -18.825 -33.311 1.00 39.40 ? 144 PRO D CB  1 
ATOM   4741  C  CG  . PRO D 1 60  ? 57.201 -19.342 -31.951 1.00 40.73 ? 144 PRO D CG  1 
ATOM   4742  C  CD  . PRO D 1 60  ? 56.340 -18.275 -31.343 1.00 41.07 ? 144 PRO D CD  1 
ATOM   4743  N  N   . TYR D 1 61  ? 58.333 -16.093 -35.035 1.00 35.02 ? 145 TYR D N   1 
ATOM   4744  C  CA  . TYR D 1 61  ? 58.207 -15.469 -36.355 1.00 35.39 ? 145 TYR D CA  1 
ATOM   4745  C  C   . TYR D 1 61  ? 57.696 -14.061 -36.291 1.00 36.68 ? 145 TYR D C   1 
ATOM   4746  O  O   . TYR D 1 61  ? 57.324 -13.486 -37.338 1.00 37.73 ? 145 TYR D O   1 
ATOM   4747  C  CB  . TYR D 1 61  ? 57.346 -16.308 -37.322 1.00 35.07 ? 145 TYR D CB  1 
ATOM   4748  C  CG  . TYR D 1 61  ? 57.899 -17.675 -37.535 1.00 31.28 ? 145 TYR D CG  1 
ATOM   4749  C  CD1 . TYR D 1 61  ? 57.278 -18.751 -36.982 1.00 31.79 ? 145 TYR D CD1 1 
ATOM   4750  C  CD2 . TYR D 1 61  ? 59.073 -17.873 -38.264 1.00 31.78 ? 145 TYR D CD2 1 
ATOM   4751  C  CE1 . TYR D 1 61  ? 57.785 -20.059 -37.146 1.00 34.01 ? 145 TYR D CE1 1 
ATOM   4752  C  CE2 . TYR D 1 61  ? 59.602 -19.158 -38.441 1.00 31.27 ? 145 TYR D CE2 1 
ATOM   4753  C  CZ  . TYR D 1 61  ? 58.940 -20.229 -37.875 1.00 32.99 ? 145 TYR D CZ  1 
ATOM   4754  O  OH  . TYR D 1 61  ? 59.420 -21.505 -37.992 1.00 35.87 ? 145 TYR D OH  1 
ATOM   4755  N  N   . VAL D 1 62  ? 57.720 -13.485 -35.086 1.00 38.37 ? 146 VAL D N   1 
ATOM   4756  C  CA  . VAL D 1 62  ? 57.056 -12.172 -34.842 1.00 39.31 ? 146 VAL D CA  1 
ATOM   4757  C  C   . VAL D 1 62  ? 57.798 -11.014 -35.512 1.00 40.09 ? 146 VAL D C   1 
ATOM   4758  O  O   . VAL D 1 62  ? 57.193 -10.014 -35.914 1.00 39.88 ? 146 VAL D O   1 
ATOM   4759  C  CB  . VAL D 1 62  ? 56.822 -11.909 -33.305 1.00 38.49 ? 146 VAL D CB  1 
ATOM   4760  C  CG1 . VAL D 1 62  ? 58.086 -11.580 -32.598 1.00 37.15 ? 146 VAL D CG1 1 
ATOM   4761  C  CG2 . VAL D 1 62  ? 55.826 -10.778 -33.095 1.00 38.81 ? 146 VAL D CG2 1 
ATOM   4762  N  N   . ASP D 1 63  ? 59.110 -11.152 -35.632 1.00 41.19 ? 147 ASP D N   1 
ATOM   4763  C  CA  . ASP D 1 63  ? 59.914 -10.078 -36.239 1.00 42.99 ? 147 ASP D CA  1 
ATOM   4764  C  C   . ASP D 1 63  ? 59.678 -10.037 -37.702 1.00 42.90 ? 147 ASP D C   1 
ATOM   4765  O  O   . ASP D 1 63  ? 59.590 -8.936  -38.248 1.00 42.37 ? 147 ASP D O   1 
ATOM   4766  C  CB  . ASP D 1 63  ? 61.388 -10.281 -36.016 1.00 42.82 ? 147 ASP D CB  1 
ATOM   4767  C  CG  . ASP D 1 63  ? 61.670 -10.648 -34.611 1.00 48.39 ? 147 ASP D CG  1 
ATOM   4768  O  OD1 . ASP D 1 63  ? 61.681 -9.704  -33.775 1.00 47.55 ? 147 ASP D OD1 1 
ATOM   4769  O  OD2 . ASP D 1 63  ? 61.803 -11.893 -34.359 1.00 53.09 ? 147 ASP D OD2 1 
ATOM   4770  N  N   . GLU D 1 64  ? 59.584 -11.227 -38.331 1.00 42.71 ? 148 GLU D N   1 
ATOM   4771  C  CA  . GLU D 1 64  ? 59.344 -11.236 -39.747 1.00 43.67 ? 148 GLU D CA  1 
ATOM   4772  C  C   . GLU D 1 64  ? 57.910 -10.825 -40.004 1.00 41.99 ? 148 GLU D C   1 
ATOM   4773  O  O   . GLU D 1 64  ? 57.656 -10.020 -40.892 1.00 40.09 ? 148 GLU D O   1 
ATOM   4774  C  CB  . GLU D 1 64  ? 59.805 -12.488 -40.516 1.00 44.11 ? 148 GLU D CB  1 
ATOM   4775  C  CG  . GLU D 1 64  ? 59.782 -13.767 -39.787 1.00 51.27 ? 148 GLU D CG  1 
ATOM   4776  C  CD  . GLU D 1 64  ? 60.808 -13.820 -38.656 1.00 57.93 ? 148 GLU D CD  1 
ATOM   4777  O  OE1 . GLU D 1 64  ? 61.715 -14.670 -38.726 1.00 60.33 ? 148 GLU D OE1 1 
ATOM   4778  O  OE2 . GLU D 1 64  ? 60.695 -13.029 -37.698 1.00 60.10 ? 148 GLU D OE2 1 
ATOM   4779  N  N   . PHE D 1 65  ? 57.008 -11.342 -39.177 1.00 41.21 ? 149 PHE D N   1 
ATOM   4780  C  CA  . PHE D 1 65  ? 55.620 -10.946 -39.287 1.00 41.56 ? 149 PHE D CA  1 
ATOM   4781  C  C   . PHE D 1 65  ? 55.428 -9.425  -39.310 1.00 41.31 ? 149 PHE D C   1 
ATOM   4782  O  O   . PHE D 1 65  ? 54.739 -8.929  -40.213 1.00 41.24 ? 149 PHE D O   1 
ATOM   4783  C  CB  . PHE D 1 65  ? 54.763 -11.594 -38.235 1.00 41.40 ? 149 PHE D CB  1 
ATOM   4784  C  CG  . PHE D 1 65  ? 53.375 -11.036 -38.172 1.00 43.79 ? 149 PHE D CG  1 
ATOM   4785  C  CD1 . PHE D 1 65  ? 52.422 -11.404 -39.110 1.00 47.20 ? 149 PHE D CD1 1 
ATOM   4786  C  CD2 . PHE D 1 65  ? 53.004 -10.141 -37.157 1.00 43.83 ? 149 PHE D CD2 1 
ATOM   4787  C  CE1 . PHE D 1 65  ? 51.120 -10.879 -39.038 1.00 45.61 ? 149 PHE D CE1 1 
ATOM   4788  C  CE2 . PHE D 1 65  ? 51.720 -9.636  -37.083 1.00 41.22 ? 149 PHE D CE2 1 
ATOM   4789  C  CZ  . PHE D 1 65  ? 50.791 -10.003 -38.013 1.00 42.56 ? 149 PHE D CZ  1 
ATOM   4790  N  N   . LEU D 1 66  ? 56.057 -8.707  -38.368 1.00 40.48 ? 150 LEU D N   1 
ATOM   4791  C  CA  . LEU D 1 66  ? 55.867 -7.259  -38.238 1.00 40.90 ? 150 LEU D CA  1 
ATOM   4792  C  C   . LEU D 1 66  ? 56.524 -6.529  -39.368 1.00 42.30 ? 150 LEU D C   1 
ATOM   4793  O  O   . LEU D 1 66  ? 55.981 -5.532  -39.870 1.00 43.07 ? 150 LEU D O   1 
ATOM   4794  C  CB  . LEU D 1 66  ? 56.337 -6.679  -36.877 1.00 39.04 ? 150 LEU D CB  1 
ATOM   4795  C  CG  . LEU D 1 66  ? 55.480 -7.056  -35.645 1.00 37.57 ? 150 LEU D CG  1 
ATOM   4796  C  CD1 . LEU D 1 66  ? 56.060 -6.549  -34.373 1.00 36.93 ? 150 LEU D CD1 1 
ATOM   4797  C  CD2 . LEU D 1 66  ? 54.010 -6.631  -35.681 1.00 31.17 ? 150 LEU D CD2 1 
ATOM   4798  N  N   . ARG D 1 67  ? 57.686 -7.018  -39.777 1.00 43.41 ? 151 ARG D N   1 
ATOM   4799  C  CA  . ARG D 1 67  ? 58.440 -6.352  -40.800 1.00 44.96 ? 151 ARG D CA  1 
ATOM   4800  C  C   . ARG D 1 67  ? 57.591 -6.297  -42.059 1.00 43.95 ? 151 ARG D C   1 
ATOM   4801  O  O   . ARG D 1 67  ? 57.444 -5.240  -42.683 1.00 42.95 ? 151 ARG D O   1 
ATOM   4802  C  CB  . ARG D 1 67  ? 59.785 -7.063  -41.070 1.00 46.82 ? 151 ARG D CB  1 
ATOM   4803  C  CG  . ARG D 1 67  ? 60.758 -6.165  -41.939 1.00 53.16 ? 151 ARG D CG  1 
ATOM   4804  C  CD  . ARG D 1 67  ? 61.637 -6.959  -42.913 1.00 61.91 ? 151 ARG D CD  1 
ATOM   4805  N  NE  . ARG D 1 67  ? 62.866 -7.494  -42.308 1.00 70.44 ? 151 ARG D NE  1 
ATOM   4806  C  CZ  . ARG D 1 67  ? 63.149 -8.804  -42.164 1.00 76.05 ? 151 ARG D CZ  1 
ATOM   4807  N  NH1 . ARG D 1 67  ? 62.280 -9.755  -42.556 1.00 75.66 ? 151 ARG D NH1 1 
ATOM   4808  N  NH2 . ARG D 1 67  ? 64.317 -9.178  -41.621 1.00 76.96 ? 151 ARG D NH2 1 
ATOM   4809  N  N   . ARG D 1 68  ? 57.028 -7.449  -42.413 1.00 43.56 ? 152 ARG D N   1 
ATOM   4810  C  CA  . ARG D 1 68  ? 56.154 -7.535  -43.559 1.00 43.17 ? 152 ARG D CA  1 
ATOM   4811  C  C   . ARG D 1 68  ? 54.913 -6.642  -43.379 1.00 42.65 ? 152 ARG D C   1 
ATOM   4812  O  O   . ARG D 1 68  ? 54.576 -5.912  -44.341 1.00 42.71 ? 152 ARG D O   1 
ATOM   4813  C  CB  . ARG D 1 68  ? 55.794 -8.991  -43.942 1.00 43.36 ? 152 ARG D CB  1 
ATOM   4814  C  CG  . ARG D 1 68  ? 54.952 -9.105  -45.312 1.00 44.56 ? 152 ARG D CG  1 
ATOM   4815  C  CD  . ARG D 1 68  ? 55.874 -9.318  -46.533 1.00 44.49 ? 152 ARG D CD  1 
ATOM   4816  N  NE  . ARG D 1 68  ? 55.415 -8.807  -47.823 1.00 45.24 ? 152 ARG D NE  1 
ATOM   4817  C  CZ  . ARG D 1 68  ? 55.902 -7.703  -48.406 1.00 50.44 ? 152 ARG D CZ  1 
ATOM   4818  N  NH1 . ARG D 1 68  ? 56.860 -6.960  -47.800 1.00 49.94 ? 152 ARG D NH1 1 
ATOM   4819  N  NH2 . ARG D 1 68  ? 55.438 -7.324  -49.602 1.00 49.46 ? 152 ARG D NH2 1 
ATOM   4820  N  N   . MET D 1 69  ? 54.274 -6.661  -42.186 1.00 40.98 ? 153 MET D N   1 
ATOM   4821  C  CA  . MET D 1 69  ? 53.082 -5.783  -41.934 1.00 40.83 ? 153 MET D CA  1 
ATOM   4822  C  C   . MET D 1 69  ? 53.390 -4.325  -42.144 1.00 40.43 ? 153 MET D C   1 
ATOM   4823  O  O   . MET D 1 69  ? 52.657 -3.633  -42.852 1.00 41.39 ? 153 MET D O   1 
ATOM   4824  C  CB  . MET D 1 69  ? 52.404 -5.942  -40.545 1.00 40.69 ? 153 MET D CB  1 
ATOM   4825  C  CG  . MET D 1 69  ? 51.899 -7.367  -40.240 1.00 41.38 ? 153 MET D CG  1 
ATOM   4826  S  SD  . MET D 1 69  ? 50.573 -8.002  -41.342 1.00 39.96 ? 153 MET D SD  1 
ATOM   4827  C  CE  . MET D 1 69  ? 49.265 -7.081  -40.562 1.00 38.54 ? 153 MET D CE  1 
ATOM   4828  N  N   . GLY D 1 70  ? 54.461 -3.845  -41.533 1.00 39.14 ? 154 GLY D N   1 
ATOM   4829  C  CA  . GLY D 1 70  ? 54.868 -2.472  -41.737 1.00 38.08 ? 154 GLY D CA  1 
ATOM   4830  C  C   . GLY D 1 70  ? 55.064 -2.137  -43.177 1.00 39.44 ? 154 GLY D C   1 
ATOM   4831  O  O   . GLY D 1 70  ? 54.784 -1.011  -43.574 1.00 40.17 ? 154 GLY D O   1 
ATOM   4832  N  N   . GLU D 1 71  ? 55.525 -3.099  -43.976 1.00 40.82 ? 155 GLU D N   1 
ATOM   4833  C  CA  . GLU D 1 71  ? 55.766 -2.862  -45.406 1.00 43.65 ? 155 GLU D CA  1 
ATOM   4834  C  C   . GLU D 1 71  ? 54.430 -2.534  -46.096 1.00 43.36 ? 155 GLU D C   1 
ATOM   4835  O  O   . GLU D 1 71  ? 54.349 -1.568  -46.884 1.00 44.41 ? 155 GLU D O   1 
ATOM   4836  C  CB  . GLU D 1 71  ? 56.519 -4.038  -46.113 1.00 43.40 ? 155 GLU D CB  1 
ATOM   4837  C  CG  . GLU D 1 71  ? 58.101 -4.096  -45.835 1.00 47.03 ? 155 GLU D CG  1 
ATOM   4838  C  CD  . GLU D 1 71  ? 58.868 -5.422  -46.290 1.00 47.93 ? 155 GLU D CD  1 
ATOM   4839  O  OE1 . GLU D 1 71  ? 58.624 -6.563  -45.770 1.00 46.39 ? 155 GLU D OE1 1 
ATOM   4840  O  OE2 . GLU D 1 71  ? 59.775 -5.276  -47.166 1.00 55.73 ? 155 GLU D OE2 1 
ATOM   4841  N  N   . LEU D 1 72  ? 53.391 -3.289  -45.714 1.00 41.84 ? 156 LEU D N   1 
ATOM   4842  C  CA  . LEU D 1 72  ? 52.129 -3.358  -46.416 1.00 40.27 ? 156 LEU D CA  1 
ATOM   4843  C  C   . LEU D 1 72  ? 50.925 -2.558  -45.828 1.00 40.28 ? 156 LEU D C   1 
ATOM   4844  O  O   . LEU D 1 72  ? 49.937 -2.274  -46.541 1.00 40.12 ? 156 LEU D O   1 
ATOM   4845  C  CB  . LEU D 1 72  ? 51.769 -4.836  -46.510 1.00 40.18 ? 156 LEU D CB  1 
ATOM   4846  C  CG  . LEU D 1 72  ? 52.581 -5.642  -47.544 1.00 40.94 ? 156 LEU D CG  1 
ATOM   4847  C  CD1 . LEU D 1 72  ? 52.378 -7.196  -47.433 1.00 38.00 ? 156 LEU D CD1 1 
ATOM   4848  C  CD2 . LEU D 1 72  ? 52.331 -5.104  -48.983 1.00 38.26 ? 156 LEU D CD2 1 
ATOM   4849  N  N   . PHE D 1 73  ? 50.989 -2.207  -44.537 1.00 39.36 ? 157 PHE D N   1 
ATOM   4850  C  CA  . PHE D 1 73  ? 49.816 -1.741  -43.824 1.00 37.58 ? 157 PHE D CA  1 
ATOM   4851  C  C   . PHE D 1 73  ? 50.101 -0.531  -43.019 1.00 37.13 ? 157 PHE D C   1 
ATOM   4852  O  O   . PHE D 1 73  ? 51.239 -0.099  -42.916 1.00 38.95 ? 157 PHE D O   1 
ATOM   4853  C  CB  . PHE D 1 73  ? 49.314 -2.847  -42.929 1.00 37.15 ? 157 PHE D CB  1 
ATOM   4854  C  CG  . PHE D 1 73  ? 48.642 -3.931  -43.660 1.00 37.42 ? 157 PHE D CG  1 
ATOM   4855  C  CD1 . PHE D 1 73  ? 49.302 -5.077  -43.965 1.00 39.83 ? 157 PHE D CD1 1 
ATOM   4856  C  CD2 . PHE D 1 73  ? 47.352 -3.775  -44.122 1.00 38.66 ? 157 PHE D CD2 1 
ATOM   4857  C  CE1 . PHE D 1 73  ? 48.662 -6.103  -44.696 1.00 40.68 ? 157 PHE D CE1 1 
ATOM   4858  C  CE2 . PHE D 1 73  ? 46.709 -4.803  -44.849 1.00 37.94 ? 157 PHE D CE2 1 
ATOM   4859  C  CZ  . PHE D 1 73  ? 47.355 -5.945  -45.115 1.00 37.67 ? 157 PHE D CZ  1 
ATOM   4860  N  N   . GLU D 1 74  ? 49.063 0.046   -42.457 1.00 35.95 ? 158 GLU D N   1 
ATOM   4861  C  CA  . GLU D 1 74  ? 49.232 1.009   -41.412 1.00 35.23 ? 158 GLU D CA  1 
ATOM   4862  C  C   . GLU D 1 74  ? 48.913 0.241   -40.155 1.00 35.57 ? 158 GLU D C   1 
ATOM   4863  O  O   . GLU D 1 74  ? 47.736 -0.053  -39.898 1.00 37.20 ? 158 GLU D O   1 
ATOM   4864  C  CB  . GLU D 1 74  ? 48.275 2.150   -41.602 1.00 34.51 ? 158 GLU D CB  1 
ATOM   4865  C  CG  . GLU D 1 74  ? 48.269 3.059   -40.407 1.00 37.62 ? 158 GLU D CG  1 
ATOM   4866  C  CD  . GLU D 1 74  ? 47.267 4.207   -40.518 1.00 39.74 ? 158 GLU D CD  1 
ATOM   4867  O  OE1 . GLU D 1 74  ? 46.217 4.077   -41.194 1.00 43.06 ? 158 GLU D OE1 1 
ATOM   4868  O  OE2 . GLU D 1 74  ? 47.538 5.254   -39.923 1.00 39.14 ? 158 GLU D OE2 1 
ATOM   4869  N  N   . CYS D 1 75  ? 49.954 -0.135  -39.408 1.00 35.14 ? 159 CYS D N   1 
ATOM   4870  C  CA  . CYS D 1 75  ? 49.849 -0.910  -38.158 1.00 35.12 ? 159 CYS D CA  1 
ATOM   4871  C  C   . CYS D 1 75  ? 49.683 -0.005  -36.928 1.00 34.32 ? 159 CYS D C   1 
ATOM   4872  O  O   . CYS D 1 75  ? 50.445 1.012   -36.723 1.00 34.72 ? 159 CYS D O   1 
ATOM   4873  C  CB  . CYS D 1 75  ? 51.060 -1.798  -37.949 1.00 34.37 ? 159 CYS D CB  1 
ATOM   4874  S  SG  . CYS D 1 75  ? 51.434 -2.772  -39.366 1.00 42.58 ? 159 CYS D SG  1 
ATOM   4875  N  N   . VAL D 1 76  ? 48.667 -0.368  -36.148 1.00 31.50 ? 160 VAL D N   1 
ATOM   4876  C  CA  . VAL D 1 76  ? 48.246 0.358   -34.991 1.00 29.10 ? 160 VAL D CA  1 
ATOM   4877  C  C   . VAL D 1 76  ? 48.239 -0.582  -33.838 1.00 28.20 ? 160 VAL D C   1 
ATOM   4878  O  O   . VAL D 1 76  ? 47.779 -1.647  -33.932 1.00 29.07 ? 160 VAL D O   1 
ATOM   4879  C  CB  . VAL D 1 76  ? 46.863 0.976   -35.260 1.00 29.49 ? 160 VAL D CB  1 
ATOM   4880  C  CG1 . VAL D 1 76  ? 46.310 1.731   -34.049 1.00 27.21 ? 160 VAL D CG1 1 
ATOM   4881  C  CG2 . VAL D 1 76  ? 47.047 1.951   -36.308 1.00 28.07 ? 160 VAL D CG2 1 
ATOM   4882  N  N   . LEU D 1 77  ? 48.824 -0.227  -32.735 1.00 28.26 ? 161 LEU D N   1 
ATOM   4883  C  CA  . LEU D 1 77  ? 48.795 -1.092  -31.586 1.00 28.14 ? 161 LEU D CA  1 
ATOM   4884  C  C   . LEU D 1 77  ? 47.506 -0.769  -30.867 1.00 28.55 ? 161 LEU D C   1 
ATOM   4885  O  O   . LEU D 1 77  ? 47.295 0.375   -30.543 1.00 28.61 ? 161 LEU D O   1 
ATOM   4886  C  CB  . LEU D 1 77  ? 49.959 -0.745  -30.687 1.00 28.25 ? 161 LEU D CB  1 
ATOM   4887  C  CG  . LEU D 1 77  ? 49.900 -1.540  -29.394 1.00 30.70 ? 161 LEU D CG  1 
ATOM   4888  C  CD1 . LEU D 1 77  ? 50.332 -2.967  -29.705 1.00 31.42 ? 161 LEU D CD1 1 
ATOM   4889  C  CD2 . LEU D 1 77  ? 50.773 -0.913  -28.284 1.00 30.32 ? 161 LEU D CD2 1 
ATOM   4890  N  N   . PHE D 1 78  ? 46.622 -1.738  -30.641 1.00 28.66 ? 162 PHE D N   1 
ATOM   4891  C  CA  . PHE D 1 78  ? 45.405 -1.416  -29.903 1.00 29.50 ? 162 PHE D CA  1 
ATOM   4892  C  C   . PHE D 1 78  ? 45.205 -2.511  -28.853 1.00 30.73 ? 162 PHE D C   1 
ATOM   4893  O  O   . PHE D 1 78  ? 44.913 -3.666  -29.180 1.00 31.73 ? 162 PHE D O   1 
ATOM   4894  C  CB  . PHE D 1 78  ? 44.239 -1.286  -30.877 1.00 29.36 ? 162 PHE D CB  1 
ATOM   4895  C  CG  . PHE D 1 78  ? 42.976 -0.665  -30.295 1.00 28.34 ? 162 PHE D CG  1 
ATOM   4896  C  CD1 . PHE D 1 78  ? 41.889 -0.410  -31.130 1.00 23.11 ? 162 PHE D CD1 1 
ATOM   4897  C  CD2 . PHE D 1 78  ? 42.889 -0.290  -28.953 1.00 26.81 ? 162 PHE D CD2 1 
ATOM   4898  C  CE1 . PHE D 1 78  ? 40.703 0.182   -30.602 1.00 30.57 ? 162 PHE D CE1 1 
ATOM   4899  C  CE2 . PHE D 1 78  ? 41.692 0.294   -28.417 1.00 30.91 ? 162 PHE D CE2 1 
ATOM   4900  C  CZ  . PHE D 1 78  ? 40.599 0.526   -29.231 1.00 26.03 ? 162 PHE D CZ  1 
ATOM   4901  N  N   . THR D 1 79  ? 45.435 -2.172  -27.593 1.00 30.82 ? 163 THR D N   1 
ATOM   4902  C  CA  . THR D 1 79  ? 45.610 -3.180  -26.549 1.00 31.74 ? 163 THR D CA  1 
ATOM   4903  C  C   . THR D 1 79  ? 44.741 -2.755  -25.389 1.00 32.60 ? 163 THR D C   1 
ATOM   4904  O  O   . THR D 1 79  ? 44.552 -1.577  -25.196 1.00 33.95 ? 163 THR D O   1 
ATOM   4905  C  CB  . THR D 1 79  ? 47.105 -3.165  -26.066 1.00 32.42 ? 163 THR D CB  1 
ATOM   4906  O  OG1 . THR D 1 79  ? 47.303 -4.122  -25.025 1.00 34.21 ? 163 THR D OG1 1 
ATOM   4907  C  CG2 . THR D 1 79  ? 47.498 -1.813  -25.522 1.00 30.46 ? 163 THR D CG2 1 
ATOM   4908  N  N   . ALA D 1 80  ? 44.196 -3.684  -24.624 1.00 34.38 ? 164 ALA D N   1 
ATOM   4909  C  CA  . ALA D 1 80  ? 43.319 -3.332  -23.481 1.00 35.81 ? 164 ALA D CA  1 
ATOM   4910  C  C   . ALA D 1 80  ? 44.103 -3.181  -22.193 1.00 37.46 ? 164 ALA D C   1 
ATOM   4911  O  O   . ALA D 1 80  ? 43.505 -2.988  -21.124 1.00 38.50 ? 164 ALA D O   1 
ATOM   4912  C  CB  . ALA D 1 80  ? 42.256 -4.379  -23.270 1.00 35.49 ? 164 ALA D CB  1 
ATOM   4913  N  N   . SER D 1 81  ? 45.431 -3.322  -22.287 1.00 37.87 ? 165 SER D N   1 
ATOM   4914  C  CA  . SER D 1 81  ? 46.333 -3.048  -21.174 1.00 37.84 ? 165 SER D CA  1 
ATOM   4915  C  C   . SER D 1 81  ? 46.712 -1.571  -21.109 1.00 37.04 ? 165 SER D C   1 
ATOM   4916  O  O   . SER D 1 81  ? 46.163 -0.733  -21.797 1.00 35.91 ? 165 SER D O   1 
ATOM   4917  C  CB  . SER D 1 81  ? 47.551 -3.965  -21.236 1.00 38.40 ? 165 SER D CB  1 
ATOM   4918  O  OG  . SER D 1 81  ? 48.278 -3.718  -22.426 1.00 43.29 ? 165 SER D OG  1 
ATOM   4919  N  N   . LEU D 1 82  ? 47.622 -1.246  -20.224 1.00 38.10 ? 166 LEU D N   1 
ATOM   4920  C  CA  . LEU D 1 82  ? 47.847 0.144   -19.849 1.00 37.93 ? 166 LEU D CA  1 
ATOM   4921  C  C   . LEU D 1 82  ? 49.167 0.539   -20.392 1.00 36.56 ? 166 LEU D C   1 
ATOM   4922  O  O   . LEU D 1 82  ? 50.100 -0.231  -20.391 1.00 35.35 ? 166 LEU D O   1 
ATOM   4923  C  CB  . LEU D 1 82  ? 47.841 0.303   -18.327 1.00 39.42 ? 166 LEU D CB  1 
ATOM   4924  C  CG  . LEU D 1 82  ? 46.454 0.267   -17.642 1.00 41.56 ? 166 LEU D CG  1 
ATOM   4925  C  CD1 . LEU D 1 82  ? 46.583 0.180   -16.110 1.00 40.47 ? 166 LEU D CD1 1 
ATOM   4926  C  CD2 . LEU D 1 82  ? 45.731 1.506   -18.005 1.00 44.50 ? 166 LEU D CD2 1 
ATOM   4927  N  N   . ALA D 1 83  ? 49.241 1.768   -20.844 1.00 37.45 ? 167 ALA D N   1 
ATOM   4928  C  CA  . ALA D 1 83  ? 50.430 2.241   -21.483 1.00 38.92 ? 167 ALA D CA  1 
ATOM   4929  C  C   . ALA D 1 83  ? 51.696 1.929   -20.642 1.00 40.66 ? 167 ALA D C   1 
ATOM   4930  O  O   . ALA D 1 83  ? 52.744 1.625   -21.207 1.00 40.77 ? 167 ALA D O   1 
ATOM   4931  C  CB  . ALA D 1 83  ? 50.292 3.666   -21.809 1.00 37.75 ? 167 ALA D CB  1 
ATOM   4932  N  N   . LYS D 1 84  ? 51.575 1.931   -19.316 1.00 42.02 ? 168 LYS D N   1 
ATOM   4933  C  CA  . LYS D 1 84  ? 52.743 1.750   -18.479 1.00 45.15 ? 168 LYS D CA  1 
ATOM   4934  C  C   . LYS D 1 84  ? 53.311 0.380   -18.666 1.00 44.71 ? 168 LYS D C   1 
ATOM   4935  O  O   . LYS D 1 84  ? 54.503 0.228   -18.411 1.00 45.39 ? 168 LYS D O   1 
ATOM   4936  C  CB  . LYS D 1 84  ? 52.527 2.055   -16.965 1.00 44.83 ? 168 LYS D CB  1 
ATOM   4937  C  CG  . LYS D 1 84  ? 51.996 0.912   -16.140 1.00 46.61 ? 168 LYS D CG  1 
ATOM   4938  C  CD  . LYS D 1 84  ? 52.066 1.219   -14.631 1.00 49.63 ? 168 LYS D CD  1 
ATOM   4939  C  CE  . LYS D 1 84  ? 50.943 0.527   -13.795 1.00 54.90 ? 168 LYS D CE  1 
ATOM   4940  N  NZ  . LYS D 1 84  ? 50.635 -0.930  -14.149 1.00 57.64 ? 168 LYS D NZ  1 
ATOM   4941  N  N   . TYR D 1 85  ? 52.480 -0.595  -19.078 1.00 44.37 ? 169 TYR D N   1 
ATOM   4942  C  CA  . TYR D 1 85  ? 52.973 -1.934  -19.445 1.00 44.85 ? 169 TYR D CA  1 
ATOM   4943  C  C   . TYR D 1 85  ? 53.218 -2.093  -20.948 1.00 43.86 ? 169 TYR D C   1 
ATOM   4944  O  O   . TYR D 1 85  ? 54.237 -2.623  -21.343 1.00 44.30 ? 169 TYR D O   1 
ATOM   4945  C  CB  . TYR D 1 85  ? 52.041 -3.052  -19.002 1.00 47.06 ? 169 TYR D CB  1 
ATOM   4946  C  CG  . TYR D 1 85  ? 52.255 -4.367  -19.789 1.00 50.81 ? 169 TYR D CG  1 
ATOM   4947  C  CD1 . TYR D 1 85  ? 53.319 -5.252  -19.493 1.00 53.05 ? 169 TYR D CD1 1 
ATOM   4948  C  CD2 . TYR D 1 85  ? 51.383 -4.726  -20.840 1.00 54.48 ? 169 TYR D CD2 1 
ATOM   4949  C  CE1 . TYR D 1 85  ? 53.488 -6.469  -20.218 1.00 51.78 ? 169 TYR D CE1 1 
ATOM   4950  C  CE2 . TYR D 1 85  ? 51.554 -5.901  -21.568 1.00 53.68 ? 169 TYR D CE2 1 
ATOM   4951  C  CZ  . TYR D 1 85  ? 52.600 -6.762  -21.255 1.00 53.11 ? 169 TYR D CZ  1 
ATOM   4952  O  OH  . TYR D 1 85  ? 52.733 -7.901  -22.011 1.00 53.04 ? 169 TYR D OH  1 
ATOM   4953  N  N   . ALA D 1 86  ? 52.267 -1.644  -21.765 1.00 41.78 ? 170 ALA D N   1 
ATOM   4954  C  CA  . ALA D 1 86  ? 52.324 -1.796  -23.199 1.00 39.33 ? 170 ALA D CA  1 
ATOM   4955  C  C   . ALA D 1 86  ? 53.490 -1.035  -23.795 1.00 38.42 ? 170 ALA D C   1 
ATOM   4956  O  O   . ALA D 1 86  ? 54.234 -1.593  -24.525 1.00 38.31 ? 170 ALA D O   1 
ATOM   4957  C  CB  . ALA D 1 86  ? 51.023 -1.396  -23.834 1.00 37.50 ? 170 ALA D CB  1 
ATOM   4958  N  N   . ASP D 1 87  ? 53.650 0.233   -23.479 1.00 38.50 ? 171 ASP D N   1 
ATOM   4959  C  CA  . ASP D 1 87  ? 54.724 1.061   -24.063 1.00 38.24 ? 171 ASP D CA  1 
ATOM   4960  C  C   . ASP D 1 87  ? 56.136 0.418   -23.941 1.00 38.22 ? 171 ASP D C   1 
ATOM   4961  O  O   . ASP D 1 87  ? 56.729 0.104   -24.931 1.00 38.13 ? 171 ASP D O   1 
ATOM   4962  C  CB  . ASP D 1 87  ? 54.737 2.476   -23.437 1.00 38.06 ? 171 ASP D CB  1 
ATOM   4963  C  CG  . ASP D 1 87  ? 53.841 3.487   -24.162 1.00 39.54 ? 171 ASP D CG  1 
ATOM   4964  O  OD1 . ASP D 1 87  ? 53.798 3.485   -25.423 1.00 39.88 ? 171 ASP D OD1 1 
ATOM   4965  O  OD2 . ASP D 1 87  ? 53.233 4.355   -23.458 1.00 37.34 ? 171 ASP D OD2 1 
ATOM   4966  N  N   . PRO D 1 88  ? 56.656 0.192   -22.719 1.00 38.73 ? 172 PRO D N   1 
ATOM   4967  C  CA  . PRO D 1 88  ? 58.010 -0.353  -22.636 1.00 38.75 ? 172 PRO D CA  1 
ATOM   4968  C  C   . PRO D 1 88  ? 58.159 -1.691  -23.377 1.00 39.11 ? 172 PRO D C   1 
ATOM   4969  O  O   . PRO D 1 88  ? 59.221 -1.995  -23.887 1.00 39.90 ? 172 PRO D O   1 
ATOM   4970  C  CB  . PRO D 1 88  ? 58.226 -0.572  -21.125 1.00 38.52 ? 172 PRO D CB  1 
ATOM   4971  C  CG  . PRO D 1 88  ? 56.847 -0.648  -20.530 1.00 38.52 ? 172 PRO D CG  1 
ATOM   4972  C  CD  . PRO D 1 88  ? 56.031 0.318   -21.377 1.00 39.11 ? 172 PRO D CD  1 
ATOM   4973  N  N   . VAL D 1 89  ? 57.101 -2.478  -23.468 1.00 39.08 ? 173 VAL D N   1 
ATOM   4974  C  CA  . VAL D 1 89  ? 57.190 -3.745  -24.184 1.00 38.22 ? 173 VAL D CA  1 
ATOM   4975  C  C   . VAL D 1 89  ? 57.200 -3.540  -25.660 1.00 38.82 ? 173 VAL D C   1 
ATOM   4976  O  O   . VAL D 1 89  ? 58.023 -4.155  -26.335 1.00 39.92 ? 173 VAL D O   1 
ATOM   4977  C  CB  . VAL D 1 89  ? 56.063 -4.698  -23.807 1.00 37.91 ? 173 VAL D CB  1 
ATOM   4978  C  CG1 . VAL D 1 89  ? 55.987 -5.887  -24.786 1.00 35.27 ? 173 VAL D CG1 1 
ATOM   4979  C  CG2 . VAL D 1 89  ? 56.252 -5.130  -22.379 1.00 36.58 ? 173 VAL D CG2 1 
ATOM   4980  N  N   . THR D 1 90  ? 56.322 -2.678  -26.169 1.00 38.30 ? 174 THR D N   1 
ATOM   4981  C  CA  . THR D 1 90  ? 56.314 -2.376  -27.605 1.00 39.33 ? 174 THR D CA  1 
ATOM   4982  C  C   . THR D 1 90  ? 57.610 -1.692  -28.065 1.00 40.45 ? 174 THR D C   1 
ATOM   4983  O  O   . THR D 1 90  ? 58.103 -1.970  -29.123 1.00 40.94 ? 174 THR D O   1 
ATOM   4984  C  CB  . THR D 1 90  ? 55.122 -1.544  -28.037 1.00 39.25 ? 174 THR D CB  1 
ATOM   4985  O  OG1 . THR D 1 90  ? 53.937 -2.104  -27.477 1.00 38.95 ? 174 THR D OG1 1 
ATOM   4986  C  CG2 . THR D 1 90  ? 55.018 -1.536  -29.570 1.00 39.06 ? 174 THR D CG2 1 
ATOM   4987  N  N   . ASP D 1 91  ? 58.147 -0.802  -27.259 1.00 41.62 ? 175 ASP D N   1 
ATOM   4988  C  CA  . ASP D 1 91  ? 59.432 -0.191  -27.517 1.00 43.83 ? 175 ASP D CA  1 
ATOM   4989  C  C   . ASP D 1 91  ? 60.528 -1.211  -27.867 1.00 44.07 ? 175 ASP D C   1 
ATOM   4990  O  O   . ASP D 1 91  ? 61.210 -1.063  -28.871 1.00 44.79 ? 175 ASP D O   1 
ATOM   4991  C  CB  . ASP D 1 91  ? 59.800 0.675   -26.311 1.00 44.55 ? 175 ASP D CB  1 
ATOM   4992  C  CG  . ASP D 1 91  ? 59.027 2.023   -26.315 1.00 48.66 ? 175 ASP D CG  1 
ATOM   4993  O  OD1 . ASP D 1 91  ? 58.429 2.371   -27.394 1.00 47.55 ? 175 ASP D OD1 1 
ATOM   4994  O  OD2 . ASP D 1 91  ? 59.023 2.731   -25.251 1.00 54.23 ? 175 ASP D OD2 1 
ATOM   4995  N  N   . LEU D 1 92  ? 60.650 -2.270  -27.080 1.00 43.88 ? 176 LEU D N   1 
ATOM   4996  C  CA  . LEU D 1 92  ? 61.613 -3.323  -27.337 1.00 43.99 ? 176 LEU D CA  1 
ATOM   4997  C  C   . LEU D 1 92  ? 61.183 -4.244  -28.482 1.00 44.36 ? 176 LEU D C   1 
ATOM   4998  O  O   . LEU D 1 92  ? 61.979 -4.588  -29.357 1.00 43.25 ? 176 LEU D O   1 
ATOM   4999  C  CB  . LEU D 1 92  ? 61.767 -4.174  -26.089 1.00 44.01 ? 176 LEU D CB  1 
ATOM   5000  C  CG  . LEU D 1 92  ? 62.523 -3.599  -24.891 1.00 45.81 ? 176 LEU D CG  1 
ATOM   5001  C  CD1 . LEU D 1 92  ? 62.313 -4.539  -23.730 1.00 46.19 ? 176 LEU D CD1 1 
ATOM   5002  C  CD2 . LEU D 1 92  ? 64.033 -3.417  -25.186 1.00 45.46 ? 176 LEU D CD2 1 
ATOM   5003  N  N   . LEU D 1 93  ? 59.923 -4.664  -28.458 1.00 45.04 ? 177 LEU D N   1 
ATOM   5004  C  CA  . LEU D 1 93  ? 59.396 -5.546  -29.504 1.00 45.17 ? 177 LEU D CA  1 
ATOM   5005  C  C   . LEU D 1 93  ? 59.415 -4.942  -30.924 1.00 45.18 ? 177 LEU D C   1 
ATOM   5006  O  O   . LEU D 1 93  ? 59.756 -5.601  -31.889 1.00 45.32 ? 177 LEU D O   1 
ATOM   5007  C  CB  . LEU D 1 93  ? 57.990 -5.946  -29.143 1.00 44.97 ? 177 LEU D CB  1 
ATOM   5008  C  CG  . LEU D 1 93  ? 57.249 -6.719  -30.207 1.00 46.46 ? 177 LEU D CG  1 
ATOM   5009  C  CD1 . LEU D 1 93  ? 57.732 -8.165  -30.194 1.00 45.52 ? 177 LEU D CD1 1 
ATOM   5010  C  CD2 . LEU D 1 93  ? 55.784 -6.622  -29.934 1.00 45.17 ? 177 LEU D CD2 1 
ATOM   5011  N  N   . ASP D 1 94  ? 59.076 -3.678  -31.052 1.00 45.34 ? 178 ASP D N   1 
ATOM   5012  C  CA  . ASP D 1 94  ? 58.769 -3.150  -32.346 1.00 45.48 ? 178 ASP D CA  1 
ATOM   5013  C  C   . ASP D 1 94  ? 60.057 -2.601  -32.960 1.00 46.86 ? 178 ASP D C   1 
ATOM   5014  O  O   . ASP D 1 94  ? 60.255 -1.375  -33.069 1.00 46.20 ? 178 ASP D O   1 
ATOM   5015  C  CB  . ASP D 1 94  ? 57.690 -2.097  -32.185 1.00 44.91 ? 178 ASP D CB  1 
ATOM   5016  C  CG  . ASP D 1 94  ? 57.273 -1.512  -33.481 1.00 46.97 ? 178 ASP D CG  1 
ATOM   5017  O  OD1 . ASP D 1 94  ? 57.512 -2.246  -34.480 1.00 49.43 ? 178 ASP D OD1 1 
ATOM   5018  O  OD2 . ASP D 1 94  ? 56.748 -0.345  -33.517 1.00 40.57 ? 178 ASP D OD2 1 
ATOM   5019  N  N   . ARG D 1 95  ? 60.941 -3.509  -33.384 1.00 48.09 ? 179 ARG D N   1 
ATOM   5020  C  CA  . ARG D 1 95  ? 62.289 -3.066  -33.737 1.00 50.23 ? 179 ARG D CA  1 
ATOM   5021  C  C   . ARG D 1 95  ? 62.513 -2.259  -35.044 1.00 49.82 ? 179 ARG D C   1 
ATOM   5022  O  O   . ARG D 1 95  ? 63.454 -1.475  -35.141 1.00 49.76 ? 179 ARG D O   1 
ATOM   5023  C  CB  . ARG D 1 95  ? 63.366 -4.123  -33.424 1.00 51.67 ? 179 ARG D CB  1 
ATOM   5024  C  CG  . ARG D 1 95  ? 63.514 -5.314  -34.351 1.00 55.19 ? 179 ARG D CG  1 
ATOM   5025  C  CD  . ARG D 1 95  ? 64.771 -6.071  -33.861 1.00 61.06 ? 179 ARG D CD  1 
ATOM   5026  N  NE  . ARG D 1 95  ? 65.315 -7.047  -34.804 1.00 63.19 ? 179 ARG D NE  1 
ATOM   5027  C  CZ  . ARG D 1 95  ? 65.413 -8.355  -34.553 1.00 65.07 ? 179 ARG D CZ  1 
ATOM   5028  N  NH1 . ARG D 1 95  ? 64.979 -8.845  -33.390 1.00 62.35 ? 179 ARG D NH1 1 
ATOM   5029  N  NH2 . ARG D 1 95  ? 65.939 -9.182  -35.474 1.00 65.62 ? 179 ARG D NH2 1 
ATOM   5030  N  N   . CYS D 1 96  ? 61.634 -2.396  -36.022 1.00 49.55 ? 180 CYS D N   1 
ATOM   5031  C  CA  . CYS D 1 96  ? 61.649 -1.428  -37.118 1.00 48.78 ? 180 CYS D CA  1 
ATOM   5032  C  C   . CYS D 1 96  ? 60.448 -0.476  -37.210 1.00 46.58 ? 180 CYS D C   1 
ATOM   5033  O  O   . CYS D 1 96  ? 59.931 -0.287  -38.312 1.00 45.82 ? 180 CYS D O   1 
ATOM   5034  C  CB  . CYS D 1 96  ? 61.981 -2.074  -38.483 1.00 50.13 ? 180 CYS D CB  1 
ATOM   5035  S  SG  . CYS D 1 96  ? 61.367 -3.757  -38.810 1.00 56.96 ? 180 CYS D SG  1 
ATOM   5036  N  N   . GLY D 1 97  ? 60.017 0.107   -36.066 1.00 43.89 ? 181 GLY D N   1 
ATOM   5037  C  CA  . GLY D 1 97  ? 59.100 1.266   -36.062 1.00 41.24 ? 181 GLY D CA  1 
ATOM   5038  C  C   . GLY D 1 97  ? 57.768 1.059   -36.804 1.00 39.98 ? 181 GLY D C   1 
ATOM   5039  O  O   . GLY D 1 97  ? 57.266 1.922   -37.519 1.00 38.83 ? 181 GLY D O   1 
ATOM   5040  N  N   . VAL D 1 98  ? 57.173 -0.099  -36.604 1.00 37.97 ? 182 VAL D N   1 
ATOM   5041  C  CA  . VAL D 1 98  ? 56.023 -0.447  -37.373 1.00 37.49 ? 182 VAL D CA  1 
ATOM   5042  C  C   . VAL D 1 98  ? 54.765 0.337   -36.903 1.00 37.23 ? 182 VAL D C   1 
ATOM   5043  O  O   . VAL D 1 98  ? 53.948 0.772   -37.720 1.00 37.70 ? 182 VAL D O   1 
ATOM   5044  C  CB  . VAL D 1 98  ? 55.921 -1.972  -37.363 1.00 36.78 ? 182 VAL D CB  1 
ATOM   5045  C  CG1 . VAL D 1 98  ? 54.565 -2.439  -37.379 1.00 35.45 ? 182 VAL D CG1 1 
ATOM   5046  C  CG2 . VAL D 1 98  ? 56.763 -2.551  -38.533 1.00 37.44 ? 182 VAL D CG2 1 
ATOM   5047  N  N   . PHE D 1 99  ? 54.673 0.560   -35.600 1.00 36.67 ? 183 PHE D N   1 
ATOM   5048  C  CA  . PHE D 1 99  ? 53.502 1.123   -34.991 1.00 36.38 ? 183 PHE D CA  1 
ATOM   5049  C  C   . PHE D 1 99  ? 53.497 2.620   -35.049 1.00 37.53 ? 183 PHE D C   1 
ATOM   5050  O  O   . PHE D 1 99  ? 54.059 3.302   -34.258 1.00 37.45 ? 183 PHE D O   1 
ATOM   5051  C  CB  . PHE D 1 99  ? 53.292 0.580   -33.572 1.00 34.89 ? 183 PHE D CB  1 
ATOM   5052  C  CG  . PHE D 1 99  ? 52.998 -0.902  -33.546 1.00 32.64 ? 183 PHE D CG  1 
ATOM   5053  C  CD1 . PHE D 1 99  ? 53.882 -1.778  -33.031 1.00 29.56 ? 183 PHE D CD1 1 
ATOM   5054  C  CD2 . PHE D 1 99  ? 51.858 -1.403  -34.143 1.00 31.03 ? 183 PHE D CD2 1 
ATOM   5055  C  CE1 . PHE D 1 99  ? 53.580 -3.144  -33.026 1.00 31.41 ? 183 PHE D CE1 1 
ATOM   5056  C  CE2 . PHE D 1 99  ? 51.571 -2.718  -34.161 1.00 28.71 ? 183 PHE D CE2 1 
ATOM   5057  C  CZ  . PHE D 1 99  ? 52.434 -3.604  -33.585 1.00 30.77 ? 183 PHE D CZ  1 
ATOM   5058  N  N   . ARG D 1 100 ? 52.790 3.114   -36.036 1.00 39.82 ? 184 ARG D N   1 
ATOM   5059  C  CA  . ARG D 1 100 ? 52.626 4.528   -36.241 1.00 41.55 ? 184 ARG D CA  1 
ATOM   5060  C  C   . ARG D 1 100 ? 51.857 5.117   -35.059 1.00 39.23 ? 184 ARG D C   1 
ATOM   5061  O  O   . ARG D 1 100 ? 51.958 6.278   -34.786 1.00 39.88 ? 184 ARG D O   1 
ATOM   5062  C  CB  . ARG D 1 100 ? 51.839 4.751   -37.588 1.00 44.63 ? 184 ARG D CB  1 
ATOM   5063  C  CG  . ARG D 1 100 ? 51.817 3.490   -38.658 1.00 48.30 ? 184 ARG D CG  1 
ATOM   5064  C  CD  . ARG D 1 100 ? 53.139 3.318   -39.474 1.00 54.25 ? 184 ARG D CD  1 
ATOM   5065  N  NE  . ARG D 1 100 ? 53.153 2.268   -40.532 1.00 58.72 ? 184 ARG D NE  1 
ATOM   5066  C  CZ  . ARG D 1 100 ? 53.890 2.327   -41.685 1.00 63.61 ? 184 ARG D CZ  1 
ATOM   5067  N  NH1 . ARG D 1 100 ? 54.669 3.397   -41.981 1.00 61.50 ? 184 ARG D NH1 1 
ATOM   5068  N  NH2 . ARG D 1 100 ? 53.851 1.319   -42.571 1.00 59.34 ? 184 ARG D NH2 1 
ATOM   5069  N  N   . ALA D 1 101 ? 51.037 4.312   -34.398 1.00 37.10 ? 185 ALA D N   1 
ATOM   5070  C  CA  . ALA D 1 101 ? 50.030 4.810   -33.443 1.00 34.05 ? 185 ALA D CA  1 
ATOM   5071  C  C   . ALA D 1 101 ? 49.887 3.809   -32.353 1.00 32.60 ? 185 ALA D C   1 
ATOM   5072  O  O   . ALA D 1 101 ? 50.208 2.659   -32.549 1.00 32.69 ? 185 ALA D O   1 
ATOM   5073  C  CB  . ALA D 1 101 ? 48.713 5.052   -34.093 1.00 31.87 ? 185 ALA D CB  1 
ATOM   5074  N  N   . ARG D 1 102 ? 49.419 4.253   -31.199 1.00 30.90 ? 186 ARG D N   1 
ATOM   5075  C  CA  . ARG D 1 102 ? 49.266 3.396   -30.084 1.00 30.75 ? 186 ARG D CA  1 
ATOM   5076  C  C   . ARG D 1 102 ? 48.079 3.789   -29.252 1.00 31.18 ? 186 ARG D C   1 
ATOM   5077  O  O   . ARG D 1 102 ? 48.010 4.937   -28.782 1.00 32.07 ? 186 ARG D O   1 
ATOM   5078  C  CB  . ARG D 1 102 ? 50.509 3.454   -29.221 1.00 31.02 ? 186 ARG D CB  1 
ATOM   5079  C  CG  . ARG D 1 102 ? 51.655 2.714   -29.786 1.00 31.75 ? 186 ARG D CG  1 
ATOM   5080  C  CD  . ARG D 1 102 ? 52.780 2.660   -28.758 1.00 36.40 ? 186 ARG D CD  1 
ATOM   5081  N  NE  . ARG D 1 102 ? 54.069 2.559   -29.444 1.00 37.61 ? 186 ARG D NE  1 
ATOM   5082  C  CZ  . ARG D 1 102 ? 55.218 2.313   -28.855 1.00 38.96 ? 186 ARG D CZ  1 
ATOM   5083  N  NH1 . ARG D 1 102 ? 55.272 2.146   -27.547 1.00 43.06 ? 186 ARG D NH1 1 
ATOM   5084  N  NH2 . ARG D 1 102 ? 56.320 2.252   -29.587 1.00 40.47 ? 186 ARG D NH2 1 
ATOM   5085  N  N   . LEU D 1 103 ? 47.186 2.802   -29.029 1.00 30.37 ? 187 LEU D N   1 
ATOM   5086  C  CA  . LEU D 1 103 ? 45.907 2.930   -28.343 1.00 28.08 ? 187 LEU D CA  1 
ATOM   5087  C  C   . LEU D 1 103 ? 45.814 1.896   -27.238 1.00 29.08 ? 187 LEU D C   1 
ATOM   5088  O  O   . LEU D 1 103 ? 46.176 0.721   -27.441 1.00 29.86 ? 187 LEU D O   1 
ATOM   5089  C  CB  . LEU D 1 103 ? 44.809 2.654   -29.320 1.00 26.91 ? 187 LEU D CB  1 
ATOM   5090  C  CG  . LEU D 1 103 ? 44.707 3.597   -30.499 1.00 26.46 ? 187 LEU D CG  1 
ATOM   5091  C  CD1 . LEU D 1 103 ? 43.520 3.236   -31.415 1.00 20.64 ? 187 LEU D CD1 1 
ATOM   5092  C  CD2 . LEU D 1 103 ? 44.615 5.088   -30.054 1.00 24.23 ? 187 LEU D CD2 1 
ATOM   5093  N  N   . PHE D 1 104 ? 45.269 2.293   -26.086 1.00 29.42 ? 188 PHE D N   1 
ATOM   5094  C  CA  . PHE D 1 104 ? 45.343 1.468   -24.892 1.00 30.61 ? 188 PHE D CA  1 
ATOM   5095  C  C   . PHE D 1 104 ? 43.968 1.206   -24.209 1.00 32.00 ? 188 PHE D C   1 
ATOM   5096  O  O   . PHE D 1 104 ? 42.904 1.278   -24.835 1.00 32.42 ? 188 PHE D O   1 
ATOM   5097  C  CB  . PHE D 1 104 ? 46.280 2.152   -23.878 1.00 30.72 ? 188 PHE D CB  1 
ATOM   5098  C  CG  . PHE D 1 104 ? 47.669 2.426   -24.399 1.00 28.84 ? 188 PHE D CG  1 
ATOM   5099  C  CD1 . PHE D 1 104 ? 47.997 3.659   -24.897 1.00 25.91 ? 188 PHE D CD1 1 
ATOM   5100  C  CD2 . PHE D 1 104 ? 48.643 1.438   -24.362 1.00 25.43 ? 188 PHE D CD2 1 
ATOM   5101  C  CE1 . PHE D 1 104 ? 49.317 3.908   -25.366 1.00 28.43 ? 188 PHE D CE1 1 
ATOM   5102  C  CE2 . PHE D 1 104 ? 49.896 1.689   -24.804 1.00 29.18 ? 188 PHE D CE2 1 
ATOM   5103  C  CZ  . PHE D 1 104 ? 50.235 2.936   -25.331 1.00 27.69 ? 188 PHE D CZ  1 
ATOM   5104  N  N   . ARG D 1 105 ? 43.983 0.942   -22.913 1.00 32.39 ? 189 ARG D N   1 
ATOM   5105  C  CA  . ARG D 1 105 ? 42.776 0.578   -22.277 1.00 34.18 ? 189 ARG D CA  1 
ATOM   5106  C  C   . ARG D 1 105 ? 41.716 1.719   -22.299 1.00 35.94 ? 189 ARG D C   1 
ATOM   5107  O  O   . ARG D 1 105 ? 40.569 1.482   -22.670 1.00 37.44 ? 189 ARG D O   1 
ATOM   5108  C  CB  . ARG D 1 105 ? 43.047 0.044   -20.901 1.00 34.39 ? 189 ARG D CB  1 
ATOM   5109  C  CG  . ARG D 1 105 ? 41.798 -0.387  -20.171 1.00 36.56 ? 189 ARG D CG  1 
ATOM   5110  C  CD  . ARG D 1 105 ? 42.149 -0.788  -18.788 1.00 37.43 ? 189 ARG D CD  1 
ATOM   5111  N  NE  . ARG D 1 105 ? 42.990 -1.971  -18.771 1.00 40.95 ? 189 ARG D NE  1 
ATOM   5112  C  CZ  . ARG D 1 105 ? 43.542 -2.472  -17.666 1.00 45.31 ? 189 ARG D CZ  1 
ATOM   5113  N  NH1 . ARG D 1 105 ? 44.298 -3.573  -17.732 1.00 46.21 ? 189 ARG D NH1 1 
ATOM   5114  N  NH2 . ARG D 1 105 ? 43.360 -1.865  -16.490 1.00 44.63 ? 189 ARG D NH2 1 
ATOM   5115  N  N   . GLU D 1 106 ? 42.096 2.954   -22.003 1.00 36.03 ? 190 GLU D N   1 
ATOM   5116  C  CA  . GLU D 1 106 ? 41.162 4.060   -22.087 1.00 35.94 ? 190 GLU D CA  1 
ATOM   5117  C  C   . GLU D 1 106 ? 40.405 4.128   -23.407 1.00 36.12 ? 190 GLU D C   1 
ATOM   5118  O  O   . GLU D 1 106 ? 39.364 4.790   -23.467 1.00 36.23 ? 190 GLU D O   1 
ATOM   5119  C  CB  . GLU D 1 106 ? 41.859 5.382   -21.835 1.00 36.38 ? 190 GLU D CB  1 
ATOM   5120  C  CG  . GLU D 1 106 ? 42.498 5.439   -20.423 1.00 40.49 ? 190 GLU D CG  1 
ATOM   5121  C  CD  . GLU D 1 106 ? 43.676 4.483   -20.274 1.00 47.13 ? 190 GLU D CD  1 
ATOM   5122  O  OE1 . GLU D 1 106 ? 43.784 3.809   -19.206 1.00 51.42 ? 190 GLU D OE1 1 
ATOM   5123  O  OE2 . GLU D 1 106 ? 44.473 4.362   -21.237 1.00 46.21 ? 190 GLU D OE2 1 
ATOM   5124  N  N   . SER D 1 107 ? 40.913 3.468   -24.453 1.00 35.23 ? 191 SER D N   1 
ATOM   5125  C  CA  . SER D 1 107 ? 40.312 3.565   -25.790 1.00 34.55 ? 191 SER D CA  1 
ATOM   5126  C  C   . SER D 1 107 ? 39.367 2.420   -26.049 1.00 34.70 ? 191 SER D C   1 
ATOM   5127  O  O   . SER D 1 107 ? 38.651 2.449   -27.034 1.00 33.28 ? 191 SER D O   1 
ATOM   5128  C  CB  . SER D 1 107 ? 41.372 3.555   -26.863 1.00 34.10 ? 191 SER D CB  1 
ATOM   5129  O  OG  . SER D 1 107 ? 41.966 4.833   -26.937 1.00 35.82 ? 191 SER D OG  1 
ATOM   5130  N  N   . CYS D 1 108 ? 39.377 1.420   -25.151 1.00 34.36 ? 192 CYS D N   1 
ATOM   5131  C  CA  . CYS D 1 108 ? 38.487 0.291   -25.282 1.00 34.61 ? 192 CYS D CA  1 
ATOM   5132  C  C   . CYS D 1 108 ? 37.226 0.687   -24.626 1.00 34.95 ? 192 CYS D C   1 
ATOM   5133  O  O   . CYS D 1 108 ? 37.208 1.644   -23.880 1.00 35.93 ? 192 CYS D O   1 
ATOM   5134  C  CB  . CYS D 1 108 ? 39.062 -0.963  -24.632 1.00 34.88 ? 192 CYS D CB  1 
ATOM   5135  S  SG  . CYS D 1 108 ? 40.650 -1.483  -25.302 1.00 33.76 ? 192 CYS D SG  1 
ATOM   5136  N  N   . VAL D 1 109 ? 36.130 0.022   -24.951 1.00 35.82 ? 193 VAL D N   1 
ATOM   5137  C  CA  . VAL D 1 109 ? 34.932 0.248   -24.167 1.00 35.78 ? 193 VAL D CA  1 
ATOM   5138  C  C   . VAL D 1 109 ? 34.570 -1.024  -23.405 1.00 35.19 ? 193 VAL D C   1 
ATOM   5139  O  O   . VAL D 1 109 ? 34.589 -2.116  -23.937 1.00 36.07 ? 193 VAL D O   1 
ATOM   5140  C  CB  . VAL D 1 109 ? 33.769 0.874   -25.002 1.00 37.44 ? 193 VAL D CB  1 
ATOM   5141  C  CG1 . VAL D 1 109 ? 34.319 1.597   -26.249 1.00 34.53 ? 193 VAL D CG1 1 
ATOM   5142  C  CG2 . VAL D 1 109 ? 32.643 -0.161  -25.337 1.00 36.97 ? 193 VAL D CG2 1 
ATOM   5143  N  N   . PHE D 1 110 ? 34.322 -0.879  -22.127 1.00 34.70 ? 194 PHE D N   1 
ATOM   5144  C  CA  . PHE D 1 110 ? 34.075 -2.030  -21.256 1.00 33.73 ? 194 PHE D CA  1 
ATOM   5145  C  C   . PHE D 1 110 ? 32.642 -2.460  -21.535 1.00 34.12 ? 194 PHE D C   1 
ATOM   5146  O  O   . PHE D 1 110 ? 31.699 -1.685  -21.401 1.00 33.24 ? 194 PHE D O   1 
ATOM   5147  C  CB  . PHE D 1 110 ? 34.255 -1.615  -19.799 1.00 32.28 ? 194 PHE D CB  1 
ATOM   5148  C  CG  . PHE D 1 110 ? 34.218 -2.737  -18.861 1.00 33.05 ? 194 PHE D CG  1 
ATOM   5149  C  CD1 . PHE D 1 110 ? 35.158 -3.731  -18.913 1.00 35.75 ? 194 PHE D CD1 1 
ATOM   5150  C  CD2 . PHE D 1 110 ? 33.215 -2.842  -17.931 1.00 36.14 ? 194 PHE D CD2 1 
ATOM   5151  C  CE1 . PHE D 1 110 ? 35.081 -4.836  -18.065 1.00 37.44 ? 194 PHE D CE1 1 
ATOM   5152  C  CE2 . PHE D 1 110 ? 33.177 -3.910  -17.035 1.00 35.74 ? 194 PHE D CE2 1 
ATOM   5153  C  CZ  . PHE D 1 110 ? 34.099 -4.903  -17.118 1.00 35.52 ? 194 PHE D CZ  1 
ATOM   5154  N  N   . HIS D 1 111 ? 32.485 -3.691  -21.964 1.00 34.96 ? 195 HIS D N   1 
ATOM   5155  C  CA  . HIS D 1 111 ? 31.214 -4.146  -22.465 1.00 35.72 ? 195 HIS D CA  1 
ATOM   5156  C  C   . HIS D 1 111 ? 31.069 -5.575  -22.028 1.00 36.87 ? 195 HIS D C   1 
ATOM   5157  O  O   . HIS D 1 111 ? 31.914 -6.430  -22.328 1.00 36.40 ? 195 HIS D O   1 
ATOM   5158  C  CB  . HIS D 1 111 ? 31.121 -3.990  -23.983 1.00 35.50 ? 195 HIS D CB  1 
ATOM   5159  C  CG  . HIS D 1 111 ? 30.047 -4.816  -24.613 1.00 37.39 ? 195 HIS D CG  1 
ATOM   5160  N  ND1 . HIS D 1 111 ? 30.311 -6.021  -25.252 1.00 40.42 ? 195 HIS D ND1 1 
ATOM   5161  C  CD2 . HIS D 1 111 ? 28.703 -4.637  -24.670 1.00 33.82 ? 195 HIS D CD2 1 
ATOM   5162  C  CE1 . HIS D 1 111 ? 29.173 -6.532  -25.695 1.00 39.21 ? 195 HIS D CE1 1 
ATOM   5163  N  NE2 . HIS D 1 111 ? 28.185 -5.722  -25.339 1.00 38.01 ? 195 HIS D NE2 1 
ATOM   5164  N  N   . GLN D 1 112 ? 29.988 -5.779  -21.264 1.00 38.99 ? 196 GLN D N   1 
ATOM   5165  C  CA  . GLN D 1 112 ? 29.707 -6.960  -20.436 1.00 40.11 ? 196 GLN D CA  1 
ATOM   5166  C  C   . GLN D 1 112 ? 30.919 -7.830  -20.127 1.00 40.23 ? 196 GLN D C   1 
ATOM   5167  O  O   . GLN D 1 112 ? 31.026 -8.963  -20.559 1.00 41.67 ? 196 GLN D O   1 
ATOM   5168  C  CB  . GLN D 1 112 ? 28.518 -7.747  -21.014 1.00 41.05 ? 196 GLN D CB  1 
ATOM   5169  C  CG  . GLN D 1 112 ? 28.621 -8.078  -22.460 1.00 43.43 ? 196 GLN D CG  1 
ATOM   5170  C  CD  . GLN D 1 112 ? 27.275 -8.092  -23.260 1.00 48.20 ? 196 GLN D CD  1 
ATOM   5171  O  OE1 . GLN D 1 112 ? 26.358 -7.252  -23.091 1.00 48.74 ? 196 GLN D OE1 1 
ATOM   5172  N  NE2 . GLN D 1 112 ? 27.217 -9.014  -24.208 1.00 50.05 ? 196 GLN D NE2 1 
ATOM   5173  N  N   . GLY D 1 113 ? 31.873 -7.250  -19.436 1.00 39.44 ? 197 GLY D N   1 
ATOM   5174  C  CA  . GLY D 1 113 ? 32.914 -7.998  -18.841 1.00 39.30 ? 197 GLY D CA  1 
ATOM   5175  C  C   . GLY D 1 113 ? 34.212 -7.900  -19.565 1.00 40.88 ? 197 GLY D C   1 
ATOM   5176  O  O   . GLY D 1 113 ? 35.238 -8.328  -19.041 1.00 40.69 ? 197 GLY D O   1 
ATOM   5177  N  N   . CYS D 1 114 ? 34.167 -7.388  -20.788 1.00 41.64 ? 198 CYS D N   1 
ATOM   5178  C  CA  . CYS D 1 114 ? 35.353 -7.358  -21.613 1.00 43.21 ? 198 CYS D CA  1 
ATOM   5179  C  C   . CYS D 1 114 ? 35.648 -5.961  -22.162 1.00 42.16 ? 198 CYS D C   1 
ATOM   5180  O  O   . CYS D 1 114 ? 34.736 -5.096  -22.291 1.00 42.83 ? 198 CYS D O   1 
ATOM   5181  C  CB  . CYS D 1 114 ? 35.205 -8.316  -22.782 1.00 43.17 ? 198 CYS D CB  1 
ATOM   5182  S  SG  . CYS D 1 114 ? 34.625 -9.970  -22.343 1.00 54.29 ? 198 CYS D SG  1 
ATOM   5183  N  N   . TYR D 1 115 ? 36.907 -5.747  -22.524 1.00 40.12 ? 199 TYR D N   1 
ATOM   5184  C  CA  . TYR D 1 115 ? 37.229 -4.549  -23.274 1.00 39.55 ? 199 TYR D CA  1 
ATOM   5185  C  C   . TYR D 1 115 ? 37.099 -4.778  -24.773 1.00 39.02 ? 199 TYR D C   1 
ATOM   5186  O  O   . TYR D 1 115 ? 37.782 -5.593  -25.355 1.00 40.64 ? 199 TYR D O   1 
ATOM   5187  C  CB  . TYR D 1 115 ? 38.582 -4.007  -22.890 1.00 38.68 ? 199 TYR D CB  1 
ATOM   5188  C  CG  . TYR D 1 115 ? 38.570 -3.466  -21.483 1.00 38.20 ? 199 TYR D CG  1 
ATOM   5189  C  CD1 . TYR D 1 115 ? 39.050 -4.214  -20.469 1.00 39.13 ? 199 TYR D CD1 1 
ATOM   5190  C  CD2 . TYR D 1 115 ? 38.079 -2.191  -21.180 1.00 40.10 ? 199 TYR D CD2 1 
ATOM   5191  C  CE1 . TYR D 1 115 ? 39.072 -3.745  -19.196 1.00 40.91 ? 199 TYR D CE1 1 
ATOM   5192  C  CE2 . TYR D 1 115 ? 38.129 -1.686  -19.902 1.00 37.79 ? 199 TYR D CE2 1 
ATOM   5193  C  CZ  . TYR D 1 115 ? 38.630 -2.490  -18.910 1.00 40.11 ? 199 TYR D CZ  1 
ATOM   5194  O  OH  . TYR D 1 115 ? 38.703 -2.119  -17.585 1.00 40.33 ? 199 TYR D OH  1 
ATOM   5195  N  N   . VAL D 1 116 ? 36.190 -4.049  -25.369 1.00 37.61 ? 200 VAL D N   1 
ATOM   5196  C  CA  . VAL D 1 116 ? 35.798 -4.204  -26.727 1.00 36.76 ? 200 VAL D CA  1 
ATOM   5197  C  C   . VAL D 1 116 ? 36.537 -3.099  -27.458 1.00 36.44 ? 200 VAL D C   1 
ATOM   5198  O  O   . VAL D 1 116 ? 36.700 -1.998  -26.951 1.00 36.90 ? 200 VAL D O   1 
ATOM   5199  C  CB  . VAL D 1 116 ? 34.261 -4.036  -26.772 1.00 36.48 ? 200 VAL D CB  1 
ATOM   5200  C  CG1 . VAL D 1 116 ? 33.809 -3.718  -28.091 1.00 39.40 ? 200 VAL D CG1 1 
ATOM   5201  C  CG2 . VAL D 1 116 ? 33.640 -5.292  -26.354 1.00 35.75 ? 200 VAL D CG2 1 
ATOM   5202  N  N   . LYS D 1 117 ? 37.049 -3.413  -28.622 1.00 36.46 ? 201 LYS D N   1 
ATOM   5203  C  CA  . LYS D 1 117 ? 37.750 -2.428  -29.437 1.00 36.47 ? 201 LYS D CA  1 
ATOM   5204  C  C   . LYS D 1 117 ? 36.788 -2.050  -30.526 1.00 36.42 ? 201 LYS D C   1 
ATOM   5205  O  O   . LYS D 1 117 ? 36.587 -2.804  -31.423 1.00 35.33 ? 201 LYS D O   1 
ATOM   5206  C  CB  . LYS D 1 117 ? 39.030 -3.038  -30.015 1.00 36.13 ? 201 LYS D CB  1 
ATOM   5207  C  CG  . LYS D 1 117 ? 39.898 -3.484  -28.897 1.00 33.96 ? 201 LYS D CG  1 
ATOM   5208  C  CD  . LYS D 1 117 ? 40.983 -4.364  -29.311 1.00 33.29 ? 201 LYS D CD  1 
ATOM   5209  C  CE  . LYS D 1 117 ? 41.979 -4.397  -28.166 1.00 35.55 ? 201 LYS D CE  1 
ATOM   5210  N  NZ  . LYS D 1 117 ? 42.612 -5.731  -28.071 1.00 35.57 ? 201 LYS D NZ  1 
ATOM   5211  N  N   . ASP D 1 118 ? 36.157 -0.897  -30.413 1.00 37.90 ? 202 ASP D N   1 
ATOM   5212  C  CA  . ASP D 1 118 ? 35.110 -0.561  -31.346 1.00 39.84 ? 202 ASP D CA  1 
ATOM   5213  C  C   . ASP D 1 118 ? 35.684 0.160   -32.540 1.00 39.36 ? 202 ASP D C   1 
ATOM   5214  O  O   . ASP D 1 118 ? 36.174 1.286   -32.420 1.00 39.51 ? 202 ASP D O   1 
ATOM   5215  C  CB  . ASP D 1 118 ? 33.978 0.252   -30.686 1.00 41.18 ? 202 ASP D CB  1 
ATOM   5216  C  CG  . ASP D 1 118 ? 32.969 0.799   -31.723 1.00 46.86 ? 202 ASP D CG  1 
ATOM   5217  O  OD1 . ASP D 1 118 ? 32.774 0.135   -32.778 1.00 53.13 ? 202 ASP D OD1 1 
ATOM   5218  O  OD2 . ASP D 1 118 ? 32.393 1.903   -31.526 1.00 51.11 ? 202 ASP D OD2 1 
ATOM   5219  N  N   . LEU D 1 119 ? 35.621 -0.490  -33.701 1.00 38.79 ? 203 LEU D N   1 
ATOM   5220  C  CA  . LEU D 1 119 ? 36.265 0.046   -34.886 1.00 38.87 ? 203 LEU D CA  1 
ATOM   5221  C  C   . LEU D 1 119 ? 35.487 1.203   -35.518 1.00 40.10 ? 203 LEU D C   1 
ATOM   5222  O  O   . LEU D 1 119 ? 36.022 1.927   -36.334 1.00 41.50 ? 203 LEU D O   1 
ATOM   5223  C  CB  . LEU D 1 119 ? 36.542 -1.048  -35.899 1.00 37.61 ? 203 LEU D CB  1 
ATOM   5224  C  CG  . LEU D 1 119 ? 37.448 -2.200  -35.472 1.00 36.32 ? 203 LEU D CG  1 
ATOM   5225  C  CD1 . LEU D 1 119 ? 37.587 -3.098  -36.645 1.00 32.44 ? 203 LEU D CD1 1 
ATOM   5226  C  CD2 . LEU D 1 119 ? 38.833 -1.700  -35.083 1.00 35.49 ? 203 LEU D CD2 1 
ATOM   5227  N  N   . SER D 1 120 ? 34.233 1.391   -35.147 1.00 40.90 ? 204 SER D N   1 
ATOM   5228  C  CA  . SER D 1 120 ? 33.451 2.469   -35.753 1.00 41.71 ? 204 SER D CA  1 
ATOM   5229  C  C   . SER D 1 120 ? 33.946 3.833   -35.277 1.00 42.62 ? 204 SER D C   1 
ATOM   5230  O  O   . SER D 1 120 ? 33.609 4.844   -35.888 1.00 43.16 ? 204 SER D O   1 
ATOM   5231  C  CB  . SER D 1 120 ? 31.958 2.301   -35.428 1.00 41.47 ? 204 SER D CB  1 
ATOM   5232  O  OG  . SER D 1 120 ? 31.759 2.146   -34.016 1.00 41.24 ? 204 SER D OG  1 
ATOM   5233  N  N   . ARG D 1 121 ? 34.762 3.841   -34.214 1.00 43.27 ? 205 ARG D N   1 
ATOM   5234  C  CA  . ARG D 1 121 ? 35.287 5.044   -33.567 1.00 44.79 ? 205 ARG D CA  1 
ATOM   5235  C  C   . ARG D 1 121 ? 36.740 5.309   -33.995 1.00 43.03 ? 205 ARG D C   1 
ATOM   5236  O  O   . ARG D 1 121 ? 37.385 6.254   -33.539 1.00 43.19 ? 205 ARG D O   1 
ATOM   5237  C  CB  . ARG D 1 121 ? 35.301 4.808   -32.035 1.00 45.43 ? 205 ARG D CB  1 
ATOM   5238  C  CG  . ARG D 1 121 ? 34.010 5.084   -31.200 1.00 48.60 ? 205 ARG D CG  1 
ATOM   5239  C  CD  . ARG D 1 121 ? 34.043 4.149   -29.928 1.00 51.56 ? 205 ARG D CD  1 
ATOM   5240  N  NE  . ARG D 1 121 ? 33.712 4.759   -28.600 1.00 66.33 ? 205 ARG D NE  1 
ATOM   5241  C  CZ  . ARG D 1 121 ? 32.647 4.424   -27.831 1.00 69.14 ? 205 ARG D CZ  1 
ATOM   5242  N  NH1 . ARG D 1 121 ? 32.450 5.030   -26.645 1.00 66.68 ? 205 ARG D NH1 1 
ATOM   5243  N  NH2 . ARG D 1 121 ? 31.776 3.475   -28.241 1.00 67.96 ? 205 ARG D NH2 1 
ATOM   5244  N  N   . LEU D 1 122 ? 37.277 4.455   -34.846 1.00 41.87 ? 206 LEU D N   1 
ATOM   5245  C  CA  . LEU D 1 122 ? 38.662 4.519   -35.223 1.00 40.97 ? 206 LEU D CA  1 
ATOM   5246  C  C   . LEU D 1 122 ? 39.086 5.777   -36.050 1.00 40.68 ? 206 LEU D C   1 
ATOM   5247  O  O   . LEU D 1 122 ? 40.177 6.262   -35.893 1.00 41.23 ? 206 LEU D O   1 
ATOM   5248  C  CB  . LEU D 1 122 ? 38.997 3.248   -35.983 1.00 40.69 ? 206 LEU D CB  1 
ATOM   5249  C  CG  . LEU D 1 122 ? 40.433 2.789   -35.885 1.00 42.74 ? 206 LEU D CG  1 
ATOM   5250  C  CD1 . LEU D 1 122 ? 40.806 2.538   -34.415 1.00 42.50 ? 206 LEU D CD1 1 
ATOM   5251  C  CD2 . LEU D 1 122 ? 40.715 1.544   -36.783 1.00 41.13 ? 206 LEU D CD2 1 
ATOM   5252  N  N   . GLY D 1 123 ? 38.241 6.302   -36.925 1.00 39.67 ? 207 GLY D N   1 
ATOM   5253  C  CA  . GLY D 1 123 ? 38.705 7.258   -37.888 1.00 39.31 ? 207 GLY D CA  1 
ATOM   5254  C  C   . GLY D 1 123 ? 39.280 6.628   -39.142 1.00 39.86 ? 207 GLY D C   1 
ATOM   5255  O  O   . GLY D 1 123 ? 40.021 7.259   -39.887 1.00 40.24 ? 207 GLY D O   1 
ATOM   5256  N  N   . ARG D 1 124 ? 38.985 5.367   -39.380 1.00 39.68 ? 208 ARG D N   1 
ATOM   5257  C  CA  . ARG D 1 124 ? 39.362 4.756   -40.638 1.00 40.25 ? 208 ARG D CA  1 
ATOM   5258  C  C   . ARG D 1 124 ? 38.073 4.221   -41.274 1.00 40.84 ? 208 ARG D C   1 
ATOM   5259  O  O   . ARG D 1 124 ? 37.158 3.864   -40.571 1.00 42.57 ? 208 ARG D O   1 
ATOM   5260  C  CB  . ARG D 1 124 ? 40.352 3.598   -40.419 1.00 39.04 ? 208 ARG D CB  1 
ATOM   5261  C  CG  . ARG D 1 124 ? 41.635 3.931   -39.687 1.00 37.90 ? 208 ARG D CG  1 
ATOM   5262  C  CD  . ARG D 1 124 ? 42.782 4.625   -40.534 1.00 37.46 ? 208 ARG D CD  1 
ATOM   5263  N  NE  . ARG D 1 124 ? 42.616 6.026   -40.287 1.00 42.29 ? 208 ARG D NE  1 
ATOM   5264  C  CZ  . ARG D 1 124 ? 43.459 6.904   -39.747 1.00 41.58 ? 208 ARG D CZ  1 
ATOM   5265  N  NH1 . ARG D 1 124 ? 44.739 6.655   -39.454 1.00 41.58 ? 208 ARG D NH1 1 
ATOM   5266  N  NH2 . ARG D 1 124 ? 42.959 8.117   -39.566 1.00 37.01 ? 208 ARG D NH2 1 
ATOM   5267  N  N   . ASP D 1 125 ? 38.002 4.126   -42.583 1.00 41.10 ? 209 ASP D N   1 
ATOM   5268  C  CA  . ASP D 1 125 ? 36.859 3.497   -43.234 1.00 41.87 ? 209 ASP D CA  1 
ATOM   5269  C  C   . ASP D 1 125 ? 36.841 2.065   -42.765 1.00 40.93 ? 209 ASP D C   1 
ATOM   5270  O  O   . ASP D 1 125 ? 37.825 1.366   -42.872 1.00 40.54 ? 209 ASP D O   1 
ATOM   5271  C  CB  . ASP D 1 125 ? 37.092 3.541   -44.746 1.00 43.43 ? 209 ASP D CB  1 
ATOM   5272  C  CG  . ASP D 1 125 ? 35.849 3.231   -45.582 1.00 50.17 ? 209 ASP D CG  1 
ATOM   5273  O  OD1 . ASP D 1 125 ? 35.250 2.124   -45.470 1.00 54.07 ? 209 ASP D OD1 1 
ATOM   5274  O  OD2 . ASP D 1 125 ? 35.500 4.096   -46.428 1.00 57.48 ? 209 ASP D OD2 1 
ATOM   5275  N  N   . LEU D 1 126 ? 35.714 1.620   -42.229 1.00 40.79 ? 210 LEU D N   1 
ATOM   5276  C  CA  . LEU D 1 126 ? 35.511 0.203   -41.944 1.00 39.33 ? 210 LEU D CA  1 
ATOM   5277  C  C   . LEU D 1 126 ? 35.801 -0.749  -43.107 1.00 39.36 ? 210 LEU D C   1 
ATOM   5278  O  O   . LEU D 1 126 ? 36.152 -1.901  -42.868 1.00 39.50 ? 210 LEU D O   1 
ATOM   5279  C  CB  . LEU D 1 126 ? 34.104 -0.031  -41.479 1.00 39.19 ? 210 LEU D CB  1 
ATOM   5280  C  CG  . LEU D 1 126 ? 33.783 0.302   -40.034 1.00 38.94 ? 210 LEU D CG  1 
ATOM   5281  C  CD1 . LEU D 1 126 ? 32.324 0.074   -39.706 1.00 30.88 ? 210 LEU D CD1 1 
ATOM   5282  C  CD2 . LEU D 1 126 ? 34.662 -0.559  -39.153 1.00 39.16 ? 210 LEU D CD2 1 
ATOM   5283  N  N   . ARG D 1 127 ? 35.645 -0.306  -44.349 1.00 38.27 ? 211 ARG D N   1 
ATOM   5284  C  CA  . ARG D 1 127 ? 36.086 -1.123  -45.501 1.00 37.85 ? 211 ARG D CA  1 
ATOM   5285  C  C   . ARG D 1 127 ? 37.592 -1.431  -45.575 1.00 36.61 ? 211 ARG D C   1 
ATOM   5286  O  O   . ARG D 1 127 ? 37.984 -2.376  -46.259 1.00 37.51 ? 211 ARG D O   1 
ATOM   5287  C  CB  . ARG D 1 127 ? 35.695 -0.445  -46.814 1.00 38.80 ? 211 ARG D CB  1 
ATOM   5288  C  CG  . ARG D 1 127 ? 34.334 -0.860  -47.347 1.00 42.17 ? 211 ARG D CG  1 
ATOM   5289  C  CD  . ARG D 1 127 ? 33.483 0.352   -47.628 1.00 46.42 ? 211 ARG D CD  1 
ATOM   5290  N  NE  . ARG D 1 127 ? 33.823 1.044   -48.882 1.00 52.11 ? 211 ARG D NE  1 
ATOM   5291  C  CZ  . ARG D 1 127 ? 34.139 2.341   -49.021 1.00 52.83 ? 211 ARG D CZ  1 
ATOM   5292  N  NH1 . ARG D 1 127 ? 34.219 3.173   -47.980 1.00 48.40 ? 211 ARG D NH1 1 
ATOM   5293  N  NH2 . ARG D 1 127 ? 34.374 2.804   -50.246 1.00 54.78 ? 211 ARG D NH2 1 
ATOM   5294  N  N   . LYS D 1 128 ? 38.419 -0.641  -44.890 1.00 34.72 ? 212 LYS D N   1 
ATOM   5295  C  CA  . LYS D 1 128 ? 39.853 -0.702  -45.008 1.00 33.56 ? 212 LYS D CA  1 
ATOM   5296  C  C   . LYS D 1 128 ? 40.505 -0.812  -43.626 1.00 33.28 ? 212 LYS D C   1 
ATOM   5297  O  O   . LYS D 1 128 ? 41.423 -0.096  -43.337 1.00 33.99 ? 212 LYS D O   1 
ATOM   5298  C  CB  . LYS D 1 128 ? 40.368 0.563   -45.716 1.00 33.59 ? 212 LYS D CB  1 
ATOM   5299  C  CG  . LYS D 1 128 ? 39.886 0.823   -47.175 1.00 35.84 ? 212 LYS D CG  1 
ATOM   5300  C  CD  . LYS D 1 128 ? 40.703 0.173   -48.315 1.00 34.10 ? 212 LYS D CD  1 
ATOM   5301  C  CE  . LYS D 1 128 ? 42.034 0.825   -48.530 1.00 42.06 ? 212 LYS D CE  1 
ATOM   5302  N  NZ  . LYS D 1 128 ? 42.161 1.788   -49.683 1.00 46.36 ? 212 LYS D NZ  1 
ATOM   5303  N  N   . THR D 1 129 ? 40.012 -1.703  -42.776 1.00 33.26 ? 213 THR D N   1 
ATOM   5304  C  CA  . THR D 1 129 ? 40.411 -1.839  -41.391 1.00 33.25 ? 213 THR D CA  1 
ATOM   5305  C  C   . THR D 1 129 ? 40.336 -3.308  -40.979 1.00 32.59 ? 213 THR D C   1 
ATOM   5306  O  O   . THR D 1 129 ? 39.312 -3.949  -41.183 1.00 32.24 ? 213 THR D O   1 
ATOM   5307  C  CB  . THR D 1 129 ? 39.442 -1.063  -40.479 1.00 33.94 ? 213 THR D CB  1 
ATOM   5308  O  OG1 . THR D 1 129 ? 39.598 0.344   -40.702 1.00 38.51 ? 213 THR D OG1 1 
ATOM   5309  C  CG2 . THR D 1 129 ? 39.758 -1.312  -39.037 1.00 35.62 ? 213 THR D CG2 1 
ATOM   5310  N  N   . LEU D 1 130 ? 41.419 -3.841  -40.417 1.00 31.45 ? 214 LEU D N   1 
ATOM   5311  C  CA  . LEU D 1 130 ? 41.444 -5.209  -39.940 1.00 30.73 ? 214 LEU D CA  1 
ATOM   5312  C  C   . LEU D 1 130 ? 41.735 -5.210  -38.485 1.00 30.96 ? 214 LEU D C   1 
ATOM   5313  O  O   . LEU D 1 130 ? 42.310 -4.232  -37.923 1.00 32.12 ? 214 LEU D O   1 
ATOM   5314  C  CB  . LEU D 1 130 ? 42.539 -6.005  -40.628 1.00 30.18 ? 214 LEU D CB  1 
ATOM   5315  C  CG  . LEU D 1 130 ? 42.277 -6.189  -42.131 1.00 32.77 ? 214 LEU D CG  1 
ATOM   5316  C  CD1 . LEU D 1 130 ? 43.539 -6.715  -42.767 1.00 26.58 ? 214 LEU D CD1 1 
ATOM   5317  C  CD2 . LEU D 1 130 ? 40.973 -7.078  -42.464 1.00 26.60 ? 214 LEU D CD2 1 
ATOM   5318  N  N   . ILE D 1 131 ? 41.374 -6.285  -37.831 1.00 29.38 ? 215 ILE D N   1 
ATOM   5319  C  CA  . ILE D 1 131 ? 41.843 -6.394  -36.479 1.00 28.78 ? 215 ILE D CA  1 
ATOM   5320  C  C   . ILE D 1 131 ? 42.384 -7.733  -36.232 1.00 29.44 ? 215 ILE D C   1 
ATOM   5321  O  O   . ILE D 1 131 ? 41.810 -8.708  -36.642 1.00 30.72 ? 215 ILE D O   1 
ATOM   5322  C  CB  . ILE D 1 131 ? 40.798 -5.940  -35.403 1.00 29.95 ? 215 ILE D CB  1 
ATOM   5323  C  CG1 . ILE D 1 131 ? 41.365 -6.163  -33.969 1.00 28.82 ? 215 ILE D CG1 1 
ATOM   5324  C  CG2 . ILE D 1 131 ? 39.374 -6.518  -35.681 1.00 26.12 ? 215 ILE D CG2 1 
ATOM   5325  C  CD1 . ILE D 1 131 ? 40.462 -5.609  -32.760 1.00 25.34 ? 215 ILE D CD1 1 
ATOM   5326  N  N   . LEU D 1 132 ? 43.528 -7.779  -35.587 1.00 29.57 ? 216 LEU D N   1 
ATOM   5327  C  CA  . LEU D 1 132 ? 44.169 -9.027  -35.275 1.00 29.27 ? 216 LEU D CA  1 
ATOM   5328  C  C   . LEU D 1 132 ? 44.285 -9.096  -33.770 1.00 29.27 ? 216 LEU D C   1 
ATOM   5329  O  O   . LEU D 1 132 ? 44.997 -8.345  -33.158 1.00 30.25 ? 216 LEU D O   1 
ATOM   5330  C  CB  . LEU D 1 132 ? 45.521 -9.019  -35.935 1.00 28.81 ? 216 LEU D CB  1 
ATOM   5331  C  CG  . LEU D 1 132 ? 46.446 -10.141 -35.578 1.00 31.35 ? 216 LEU D CG  1 
ATOM   5332  C  CD1 . LEU D 1 132 ? 45.971 -11.342 -36.361 1.00 35.56 ? 216 LEU D CD1 1 
ATOM   5333  C  CD2 . LEU D 1 132 ? 47.846 -9.759  -36.004 1.00 34.65 ? 216 LEU D CD2 1 
ATOM   5334  N  N   . ASP D 1 133 ? 43.543 -9.981  -33.162 1.00 30.42 ? 217 ASP D N   1 
ATOM   5335  C  CA  . ASP D 1 133 ? 43.425 -10.014 -31.735 1.00 32.15 ? 217 ASP D CA  1 
ATOM   5336  C  C   . ASP D 1 133 ? 43.067 -11.454 -31.384 1.00 33.16 ? 217 ASP D C   1 
ATOM   5337  O  O   . ASP D 1 133 ? 42.219 -12.068 -32.039 1.00 33.46 ? 217 ASP D O   1 
ATOM   5338  C  CB  . ASP D 1 133 ? 42.356 -8.998  -31.276 1.00 31.87 ? 217 ASP D CB  1 
ATOM   5339  C  CG  . ASP D 1 133 ? 42.304 -8.814  -29.735 1.00 37.32 ? 217 ASP D CG  1 
ATOM   5340  O  OD1 . ASP D 1 133 ? 42.693 -9.709  -28.964 1.00 41.84 ? 217 ASP D OD1 1 
ATOM   5341  O  OD2 . ASP D 1 133 ? 41.845 -7.760  -29.259 1.00 43.03 ? 217 ASP D OD2 1 
ATOM   5342  N  N   . ASN D 1 134 ? 43.731 -12.023 -30.386 1.00 34.79 ? 218 ASN D N   1 
ATOM   5343  C  CA  . ASN D 1 134 ? 43.448 -13.385 -30.026 1.00 36.70 ? 218 ASN D CA  1 
ATOM   5344  C  C   . ASN D 1 134 ? 42.147 -13.501 -29.283 1.00 38.55 ? 218 ASN D C   1 
ATOM   5345  O  O   . ASN D 1 134 ? 41.707 -14.608 -28.988 1.00 40.53 ? 218 ASN D O   1 
ATOM   5346  C  CB  . ASN D 1 134 ? 44.561 -13.931 -29.155 1.00 37.34 ? 218 ASN D CB  1 
ATOM   5347  C  CG  . ASN D 1 134 ? 44.695 -13.183 -27.835 1.00 40.50 ? 218 ASN D CG  1 
ATOM   5348  O  OD1 . ASN D 1 134 ? 45.112 -12.011 -27.794 1.00 39.46 ? 218 ASN D OD1 1 
ATOM   5349  N  ND2 . ASN D 1 134 ? 44.325 -13.853 -26.744 1.00 42.00 ? 218 ASN D ND2 1 
ATOM   5350  N  N   . SER D 1 135 ? 41.526 -12.379 -28.944 1.00 39.36 ? 219 SER D N   1 
ATOM   5351  C  CA  . SER D 1 135 ? 40.321 -12.420 -28.114 1.00 41.04 ? 219 SER D CA  1 
ATOM   5352  C  C   . SER D 1 135 ? 39.073 -11.968 -28.861 1.00 41.07 ? 219 SER D C   1 
ATOM   5353  O  O   . SER D 1 135 ? 38.825 -10.754 -29.037 1.00 41.63 ? 219 SER D O   1 
ATOM   5354  C  CB  . SER D 1 135 ? 40.519 -11.610 -26.822 1.00 41.34 ? 219 SER D CB  1 
ATOM   5355  O  OG  . SER D 1 135 ? 41.424 -12.287 -25.932 1.00 45.22 ? 219 SER D OG  1 
ATOM   5356  N  N   . PRO D 1 136 ? 38.278 -12.935 -29.314 1.00 40.57 ? 220 PRO D N   1 
ATOM   5357  C  CA  . PRO D 1 136 ? 37.034 -12.697 -30.080 1.00 40.24 ? 220 PRO D CA  1 
ATOM   5358  C  C   . PRO D 1 136 ? 36.075 -11.747 -29.355 1.00 39.17 ? 220 PRO D C   1 
ATOM   5359  O  O   . PRO D 1 136 ? 35.309 -11.047 -29.948 1.00 39.30 ? 220 PRO D O   1 
ATOM   5360  C  CB  . PRO D 1 136 ? 36.435 -14.101 -30.257 1.00 40.13 ? 220 PRO D CB  1 
ATOM   5361  C  CG  . PRO D 1 136 ? 37.256 -15.018 -29.432 1.00 40.83 ? 220 PRO D CG  1 
ATOM   5362  C  CD  . PRO D 1 136 ? 38.575 -14.355 -29.141 1.00 40.76 ? 220 PRO D CD  1 
ATOM   5363  N  N   . ALA D 1 137 ? 36.201 -11.636 -28.062 1.00 39.20 ? 221 ALA D N   1 
ATOM   5364  C  CA  . ALA D 1 137 ? 35.355 -10.713 -27.333 1.00 38.14 ? 221 ALA D CA  1 
ATOM   5365  C  C   . ALA D 1 137 ? 35.699 -9.275  -27.659 1.00 37.18 ? 221 ALA D C   1 
ATOM   5366  O  O   . ALA D 1 137 ? 34.806 -8.420  -27.596 1.00 36.66 ? 221 ALA D O   1 
ATOM   5367  C  CB  . ALA D 1 137 ? 35.465 -10.977 -25.834 1.00 39.34 ? 221 ALA D CB  1 
ATOM   5368  N  N   . SER D 1 138 ? 36.965 -9.028  -28.023 1.00 34.96 ? 222 SER D N   1 
ATOM   5369  C  CA  . SER D 1 138 ? 37.429 -7.709  -28.442 1.00 34.25 ? 222 SER D CA  1 
ATOM   5370  C  C   . SER D 1 138 ? 36.735 -7.204  -29.657 1.00 33.34 ? 222 SER D C   1 
ATOM   5371  O  O   . SER D 1 138 ? 36.560 -6.015  -29.774 1.00 33.29 ? 222 SER D O   1 
ATOM   5372  C  CB  . SER D 1 138 ? 38.897 -7.727  -28.851 1.00 35.29 ? 222 SER D CB  1 
ATOM   5373  O  OG  . SER D 1 138 ? 39.726 -8.326  -27.874 1.00 41.89 ? 222 SER D OG  1 
ATOM   5374  N  N   . TYR D 1 139 ? 36.417 -8.078  -30.606 1.00 33.21 ? 223 TYR D N   1 
ATOM   5375  C  CA  . TYR D 1 139 ? 35.774 -7.663  -31.859 1.00 34.08 ? 223 TYR D CA  1 
ATOM   5376  C  C   . TYR D 1 139 ? 34.337 -8.160  -32.079 1.00 33.78 ? 223 TYR D C   1 
ATOM   5377  O  O   . TYR D 1 139 ? 33.864 -8.234  -33.198 1.00 34.04 ? 223 TYR D O   1 
ATOM   5378  C  CB  . TYR D 1 139 ? 36.619 -8.031  -33.077 1.00 35.00 ? 223 TYR D CB  1 
ATOM   5379  C  CG  . TYR D 1 139 ? 37.080 -9.459  -33.151 1.00 34.54 ? 223 TYR D CG  1 
ATOM   5380  C  CD1 . TYR D 1 139 ? 36.200 -10.466 -33.497 1.00 33.18 ? 223 TYR D CD1 1 
ATOM   5381  C  CD2 . TYR D 1 139 ? 38.427 -9.785  -32.935 1.00 35.57 ? 223 TYR D CD2 1 
ATOM   5382  C  CE1 . TYR D 1 139 ? 36.612 -11.799 -33.611 1.00 35.51 ? 223 TYR D CE1 1 
ATOM   5383  C  CE2 . TYR D 1 139 ? 38.873 -11.110 -33.027 1.00 38.05 ? 223 TYR D CE2 1 
ATOM   5384  C  CZ  . TYR D 1 139 ? 37.942 -12.130 -33.375 1.00 39.80 ? 223 TYR D CZ  1 
ATOM   5385  O  OH  . TYR D 1 139 ? 38.334 -13.459 -33.484 1.00 39.39 ? 223 TYR D OH  1 
ATOM   5386  N  N   . ILE D 1 140 ? 33.649 -8.477  -31.000 1.00 33.53 ? 224 ILE D N   1 
ATOM   5387  C  CA  . ILE D 1 140 ? 32.258 -8.836  -31.028 1.00 33.30 ? 224 ILE D CA  1 
ATOM   5388  C  C   . ILE D 1 140 ? 31.344 -7.852  -31.775 1.00 32.64 ? 224 ILE D C   1 
ATOM   5389  O  O   . ILE D 1 140 ? 30.332 -8.260  -32.229 1.00 33.83 ? 224 ILE D O   1 
ATOM   5390  C  CB  . ILE D 1 140 ? 31.738 -9.085  -29.613 1.00 33.50 ? 224 ILE D CB  1 
ATOM   5391  C  CG1 . ILE D 1 140 ? 30.407 -9.831  -29.650 1.00 37.28 ? 224 ILE D CG1 1 
ATOM   5392  C  CG2 . ILE D 1 140 ? 31.536 -7.824  -28.897 1.00 32.00 ? 224 ILE D CG2 1 
ATOM   5393  C  CD1 . ILE D 1 140 ? 30.474 -11.342 -29.271 1.00 42.18 ? 224 ILE D CD1 1 
ATOM   5394  N  N   . PHE D 1 141 ? 31.696 -6.580  -31.895 1.00 32.64 ? 225 PHE D N   1 
ATOM   5395  C  CA  . PHE D 1 141 ? 30.896 -5.584  -32.652 1.00 31.54 ? 225 PHE D CA  1 
ATOM   5396  C  C   . PHE D 1 141 ? 31.312 -5.525  -34.146 1.00 32.24 ? 225 PHE D C   1 
ATOM   5397  O  O   . PHE D 1 141 ? 30.613 -4.933  -34.922 1.00 32.85 ? 225 PHE D O   1 
ATOM   5398  C  CB  . PHE D 1 141 ? 30.978 -4.154  -32.034 1.00 30.08 ? 225 PHE D CB  1 
ATOM   5399  C  CG  . PHE D 1 141 ? 30.136 -3.957  -30.820 1.00 32.34 ? 225 PHE D CG  1 
ATOM   5400  C  CD1 . PHE D 1 141 ? 30.572 -4.377  -29.578 1.00 34.09 ? 225 PHE D CD1 1 
ATOM   5401  C  CD2 . PHE D 1 141 ? 28.860 -3.364  -30.913 1.00 33.55 ? 225 PHE D CD2 1 
ATOM   5402  C  CE1 . PHE D 1 141 ? 29.750 -4.245  -28.433 1.00 36.26 ? 225 PHE D CE1 1 
ATOM   5403  C  CE2 . PHE D 1 141 ? 28.061 -3.207  -29.790 1.00 35.13 ? 225 PHE D CE2 1 
ATOM   5404  C  CZ  . PHE D 1 141 ? 28.496 -3.644  -28.528 1.00 31.46 ? 225 PHE D CZ  1 
ATOM   5405  N  N   . HIS D 1 142 ? 32.455 -6.092  -34.549 1.00 32.07 ? 226 HIS D N   1 
ATOM   5406  C  CA  . HIS D 1 142 ? 32.814 -6.111  -35.980 1.00 32.48 ? 226 HIS D CA  1 
ATOM   5407  C  C   . HIS D 1 142 ? 33.528 -7.385  -36.300 1.00 32.89 ? 226 HIS D C   1 
ATOM   5408  O  O   . HIS D 1 142 ? 34.675 -7.365  -36.680 1.00 34.65 ? 226 HIS D O   1 
ATOM   5409  C  CB  . HIS D 1 142 ? 33.680 -4.893  -36.391 1.00 31.28 ? 226 HIS D CB  1 
ATOM   5410  C  CG  . HIS D 1 142 ? 33.091 -3.590  -35.960 1.00 31.34 ? 226 HIS D CG  1 
ATOM   5411  N  ND1 . HIS D 1 142 ? 32.136 -2.917  -36.704 1.00 31.37 ? 226 HIS D ND1 1 
ATOM   5412  C  CD2 . HIS D 1 142 ? 33.226 -2.905  -34.808 1.00 27.65 ? 226 HIS D CD2 1 
ATOM   5413  C  CE1 . HIS D 1 142 ? 31.754 -1.841  -36.049 1.00 31.91 ? 226 HIS D CE1 1 
ATOM   5414  N  NE2 . HIS D 1 142 ? 32.411 -1.803  -34.900 1.00 32.34 ? 226 HIS D NE2 1 
ATOM   5415  N  N   . PRO D 1 143 ? 32.867 -8.512  -36.156 1.00 33.75 ? 227 PRO D N   1 
ATOM   5416  C  CA  . PRO D 1 143 ? 33.733 -9.705  -36.333 1.00 34.16 ? 227 PRO D CA  1 
ATOM   5417  C  C   . PRO D 1 143 ? 33.973 -9.938  -37.836 1.00 34.61 ? 227 PRO D C   1 
ATOM   5418  O  O   . PRO D 1 143 ? 34.891 -10.654 -38.210 1.00 35.40 ? 227 PRO D O   1 
ATOM   5419  C  CB  . PRO D 1 143 ? 32.901 -10.834 -35.707 1.00 33.80 ? 227 PRO D CB  1 
ATOM   5420  C  CG  . PRO D 1 143 ? 31.443 -10.375 -35.992 1.00 34.06 ? 227 PRO D CG  1 
ATOM   5421  C  CD  . PRO D 1 143 ? 31.445 -8.848  -35.926 1.00 32.87 ? 227 PRO D CD  1 
ATOM   5422  N  N   . GLU D 1 144 ? 33.190 -9.283  -38.690 1.00 35.17 ? 228 GLU D N   1 
ATOM   5423  C  CA  . GLU D 1 144 ? 33.488 -9.274  -40.158 1.00 35.50 ? 228 GLU D CA  1 
ATOM   5424  C  C   . GLU D 1 144 ? 34.843 -8.678  -40.546 1.00 35.20 ? 228 GLU D C   1 
ATOM   5425  O  O   . GLU D 1 144 ? 35.279 -8.887  -41.656 1.00 36.02 ? 228 GLU D O   1 
ATOM   5426  C  CB  . GLU D 1 144 ? 32.374 -8.585  -41.005 1.00 34.59 ? 228 GLU D CB  1 
ATOM   5427  C  CG  . GLU D 1 144 ? 32.147 -7.157  -40.696 1.00 33.60 ? 228 GLU D CG  1 
ATOM   5428  C  CD  . GLU D 1 144 ? 31.102 -6.958  -39.629 1.00 35.11 ? 228 GLU D CD  1 
ATOM   5429  O  OE1 . GLU D 1 144 ? 30.324 -5.922  -39.672 1.00 30.78 ? 228 GLU D OE1 1 
ATOM   5430  O  OE2 . GLU D 1 144 ? 31.078 -7.859  -38.744 1.00 36.80 ? 228 GLU D OE2 1 
ATOM   5431  N  N   . ASN D 1 145 ? 35.438 -7.889  -39.652 1.00 34.74 ? 229 ASN D N   1 
ATOM   5432  C  CA  . ASN D 1 145 ? 36.715 -7.205  -39.832 1.00 34.41 ? 229 ASN D CA  1 
ATOM   5433  C  C   . ASN D 1 145 ? 37.867 -7.987  -39.153 1.00 34.58 ? 229 ASN D C   1 
ATOM   5434  O  O   . ASN D 1 145 ? 39.027 -7.602  -39.292 1.00 34.29 ? 229 ASN D O   1 
ATOM   5435  C  CB  . ASN D 1 145 ? 36.641 -5.793  -39.185 1.00 33.58 ? 229 ASN D CB  1 
ATOM   5436  C  CG  . ASN D 1 145 ? 35.868 -4.777  -40.031 1.00 35.15 ? 229 ASN D CG  1 
ATOM   5437  O  OD1 . ASN D 1 145 ? 34.671 -4.579  -39.818 1.00 37.44 ? 229 ASN D OD1 1 
ATOM   5438  N  ND2 . ASN D 1 145 ? 36.536 -4.152  -41.014 1.00 29.98 ? 229 ASN D ND2 1 
ATOM   5439  N  N   . ALA D 1 146 ? 37.575 -9.047  -38.398 1.00 34.60 ? 230 ALA D N   1 
ATOM   5440  C  CA  . ALA D 1 146 ? 38.664 -9.710  -37.643 1.00 36.63 ? 230 ALA D CA  1 
ATOM   5441  C  C   . ALA D 1 146 ? 39.465 -10.691 -38.460 1.00 37.79 ? 230 ALA D C   1 
ATOM   5442  O  O   . ALA D 1 146 ? 38.970 -11.281 -39.426 1.00 39.62 ? 230 ALA D O   1 
ATOM   5443  C  CB  . ALA D 1 146 ? 38.156 -10.381 -36.480 1.00 35.57 ? 230 ALA D CB  1 
ATOM   5444  N  N   . VAL D 1 147 ? 40.721 -10.849 -38.106 1.00 38.59 ? 231 VAL D N   1 
ATOM   5445  C  CA  . VAL D 1 147 ? 41.525 -11.967 -38.648 1.00 39.26 ? 231 VAL D CA  1 
ATOM   5446  C  C   . VAL D 1 147 ? 41.940 -12.713 -37.440 1.00 39.94 ? 231 VAL D C   1 
ATOM   5447  O  O   . VAL D 1 147 ? 42.848 -12.254 -36.784 1.00 41.84 ? 231 VAL D O   1 
ATOM   5448  C  CB  . VAL D 1 147 ? 42.816 -11.513 -39.350 1.00 38.27 ? 231 VAL D CB  1 
ATOM   5449  C  CG1 . VAL D 1 147 ? 43.643 -12.718 -39.657 1.00 39.64 ? 231 VAL D CG1 1 
ATOM   5450  C  CG2 . VAL D 1 147 ? 42.495 -10.816 -40.631 1.00 37.56 ? 231 VAL D CG2 1 
ATOM   5451  N  N   . PRO D 1 148 ? 41.303 -13.849 -37.131 1.00 40.51 ? 232 PRO D N   1 
ATOM   5452  C  CA  . PRO D 1 148 ? 41.475 -14.512 -35.849 1.00 40.57 ? 232 PRO D CA  1 
ATOM   5453  C  C   . PRO D 1 148 ? 42.878 -15.103 -35.657 1.00 40.83 ? 232 PRO D C   1 
ATOM   5454  O  O   . PRO D 1 148 ? 43.495 -15.510 -36.604 1.00 40.83 ? 232 PRO D O   1 
ATOM   5455  C  CB  . PRO D 1 148 ? 40.453 -15.663 -35.916 1.00 40.33 ? 232 PRO D CB  1 
ATOM   5456  C  CG  . PRO D 1 148 ? 39.523 -15.310 -37.021 1.00 39.83 ? 232 PRO D CG  1 
ATOM   5457  C  CD  . PRO D 1 148 ? 40.413 -14.638 -38.005 1.00 41.59 ? 232 PRO D CD  1 
ATOM   5458  N  N   . VAL D 1 149 ? 43.355 -15.117 -34.426 1.00 40.99 ? 233 VAL D N   1 
ATOM   5459  C  CA  . VAL D 1 149 ? 44.548 -15.786 -34.065 1.00 42.07 ? 233 VAL D CA  1 
ATOM   5460  C  C   . VAL D 1 149 ? 44.344 -16.538 -32.741 1.00 43.94 ? 233 VAL D C   1 
ATOM   5461  O  O   . VAL D 1 149 ? 43.516 -16.204 -31.892 1.00 43.18 ? 233 VAL D O   1 
ATOM   5462  C  CB  . VAL D 1 149 ? 45.785 -14.796 -34.001 1.00 42.72 ? 233 VAL D CB  1 
ATOM   5463  C  CG1 . VAL D 1 149 ? 45.849 -14.032 -32.651 1.00 41.21 ? 233 VAL D CG1 1 
ATOM   5464  C  CG2 . VAL D 1 149 ? 47.074 -15.527 -34.208 1.00 38.42 ? 233 VAL D CG2 1 
ATOM   5465  N  N   . GLN D 1 150 ? 45.122 -17.588 -32.588 1.00 46.86 ? 234 GLN D N   1 
ATOM   5466  C  CA  . GLN D 1 150 ? 45.102 -18.420 -31.400 1.00 49.82 ? 234 GLN D CA  1 
ATOM   5467  C  C   . GLN D 1 150 ? 45.927 -17.664 -30.353 1.00 49.11 ? 234 GLN D C   1 
ATOM   5468  O  O   . GLN D 1 150 ? 46.931 -17.004 -30.710 1.00 49.45 ? 234 GLN D O   1 
ATOM   5469  C  CB  . GLN D 1 150 ? 45.770 -19.768 -31.760 1.00 50.11 ? 234 GLN D CB  1 
ATOM   5470  C  CG  . GLN D 1 150 ? 45.039 -21.044 -31.234 1.00 54.45 ? 234 GLN D CG  1 
ATOM   5471  C  CD  . GLN D 1 150 ? 45.949 -22.270 -31.278 1.00 54.23 ? 234 GLN D CD  1 
ATOM   5472  O  OE1 . GLN D 1 150 ? 46.851 -22.456 -30.420 1.00 58.20 ? 234 GLN D OE1 1 
ATOM   5473  N  NE2 . GLN D 1 150 ? 45.737 -23.108 -32.302 1.00 57.84 ? 234 GLN D NE2 1 
ATOM   5474  N  N   . SER D 1 151 ? 45.503 -17.756 -29.093 1.00 48.17 ? 235 SER D N   1 
ATOM   5475  C  CA  . SER D 1 151 ? 46.224 -17.201 -27.962 1.00 47.34 ? 235 SER D CA  1 
ATOM   5476  C  C   . SER D 1 151 ? 47.529 -17.945 -27.733 1.00 47.92 ? 235 SER D C   1 
ATOM   5477  O  O   . SER D 1 151 ? 47.518 -19.166 -27.593 1.00 48.49 ? 235 SER D O   1 
ATOM   5478  C  CB  . SER D 1 151 ? 45.400 -17.376 -26.691 1.00 46.84 ? 235 SER D CB  1 
ATOM   5479  O  OG  . SER D 1 151 ? 44.035 -17.388 -26.950 1.00 47.01 ? 235 SER D OG  1 
ATOM   5480  N  N   . TRP D 1 152 ? 48.636 -17.213 -27.628 1.00 48.28 ? 236 TRP D N   1 
ATOM   5481  C  CA  . TRP D 1 152 ? 49.967 -17.799 -27.424 1.00 48.16 ? 236 TRP D CA  1 
ATOM   5482  C  C   . TRP D 1 152 ? 50.621 -17.470 -26.067 1.00 49.52 ? 236 TRP D C   1 
ATOM   5483  O  O   . TRP D 1 152 ? 50.642 -16.316 -25.609 1.00 48.56 ? 236 TRP D O   1 
ATOM   5484  C  CB  . TRP D 1 152 ? 50.895 -17.359 -28.517 1.00 47.00 ? 236 TRP D CB  1 
ATOM   5485  C  CG  . TRP D 1 152 ? 52.179 -18.076 -28.508 1.00 46.87 ? 236 TRP D CG  1 
ATOM   5486  C  CD1 . TRP D 1 152 ? 52.451 -19.261 -29.125 1.00 47.49 ? 236 TRP D CD1 1 
ATOM   5487  C  CD2 . TRP D 1 152 ? 53.404 -17.659 -27.901 1.00 46.97 ? 236 TRP D CD2 1 
ATOM   5488  N  NE1 . TRP D 1 152 ? 53.756 -19.621 -28.927 1.00 45.14 ? 236 TRP D NE1 1 
ATOM   5489  C  CE2 . TRP D 1 152 ? 54.369 -18.661 -28.174 1.00 46.50 ? 236 TRP D CE2 1 
ATOM   5490  C  CE3 . TRP D 1 152 ? 53.785 -16.542 -27.147 1.00 47.78 ? 236 TRP D CE3 1 
ATOM   5491  C  CZ2 . TRP D 1 152 ? 55.689 -18.585 -27.715 1.00 45.87 ? 236 TRP D CZ2 1 
ATOM   5492  C  CZ3 . TRP D 1 152 ? 55.100 -16.464 -26.699 1.00 48.24 ? 236 TRP D CZ3 1 
ATOM   5493  C  CH2 . TRP D 1 152 ? 56.033 -17.486 -26.985 1.00 46.98 ? 236 TRP D CH2 1 
ATOM   5494  N  N   . PHE D 1 153 ? 51.214 -18.503 -25.470 1.00 51.03 ? 237 PHE D N   1 
ATOM   5495  C  CA  . PHE D 1 153 ? 51.809 -18.417 -24.157 1.00 52.32 ? 237 PHE D CA  1 
ATOM   5496  C  C   . PHE D 1 153 ? 53.278 -18.789 -24.208 1.00 53.58 ? 237 PHE D C   1 
ATOM   5497  O  O   . PHE D 1 153 ? 54.116 -17.994 -23.898 1.00 53.28 ? 237 PHE D O   1 
ATOM   5498  C  CB  . PHE D 1 153 ? 51.047 -19.332 -23.198 1.00 52.27 ? 237 PHE D CB  1 
ATOM   5499  C  CG  . PHE D 1 153 ? 49.608 -18.993 -23.078 1.00 51.92 ? 237 PHE D CG  1 
ATOM   5500  C  CD1 . PHE D 1 153 ? 48.676 -19.570 -23.927 1.00 52.99 ? 237 PHE D CD1 1 
ATOM   5501  C  CD2 . PHE D 1 153 ? 49.184 -18.038 -22.151 1.00 53.38 ? 237 PHE D CD2 1 
ATOM   5502  C  CE1 . PHE D 1 153 ? 47.319 -19.241 -23.839 1.00 52.51 ? 237 PHE D CE1 1 
ATOM   5503  C  CE2 . PHE D 1 153 ? 47.844 -17.682 -22.065 1.00 54.12 ? 237 PHE D CE2 1 
ATOM   5504  C  CZ  . PHE D 1 153 ? 46.903 -18.299 -22.912 1.00 53.10 ? 237 PHE D CZ  1 
ATOM   5505  N  N   . ASP D 1 154 ? 53.611 -20.007 -24.600 1.00 56.15 ? 238 ASP D N   1 
ATOM   5506  C  CA  . ASP D 1 154 ? 55.029 -20.398 -24.535 1.00 58.26 ? 238 ASP D CA  1 
ATOM   5507  C  C   . ASP D 1 154 ? 55.450 -21.362 -25.623 1.00 58.77 ? 238 ASP D C   1 
ATOM   5508  O  O   . ASP D 1 154 ? 56.651 -21.496 -25.898 1.00 59.60 ? 238 ASP D O   1 
ATOM   5509  C  CB  . ASP D 1 154 ? 55.400 -20.948 -23.154 1.00 58.47 ? 238 ASP D CB  1 
ATOM   5510  C  CG  . ASP D 1 154 ? 54.532 -22.127 -22.731 1.00 61.32 ? 238 ASP D CG  1 
ATOM   5511  O  OD1 . ASP D 1 154 ? 53.675 -22.618 -23.517 1.00 63.49 ? 238 ASP D OD1 1 
ATOM   5512  O  OD2 . ASP D 1 154 ? 54.718 -22.559 -21.575 1.00 65.18 ? 238 ASP D OD2 1 
ATOM   5513  N  N   . ASP D 1 155 ? 54.451 -21.981 -26.252 1.00 59.17 ? 239 ASP D N   1 
ATOM   5514  C  CA  . ASP D 1 155 ? 54.633 -22.944 -27.345 1.00 59.37 ? 239 ASP D CA  1 
ATOM   5515  C  C   . ASP D 1 155 ? 55.552 -22.431 -28.473 1.00 58.90 ? 239 ASP D C   1 
ATOM   5516  O  O   . ASP D 1 155 ? 55.124 -21.667 -29.328 1.00 58.98 ? 239 ASP D O   1 
ATOM   5517  C  CB  . ASP D 1 155 ? 53.248 -23.326 -27.868 1.00 59.68 ? 239 ASP D CB  1 
ATOM   5518  C  CG  . ASP D 1 155 ? 53.266 -24.516 -28.803 1.00 62.25 ? 239 ASP D CG  1 
ATOM   5519  O  OD1 . ASP D 1 155 ? 54.360 -24.951 -29.236 1.00 66.38 ? 239 ASP D OD1 1 
ATOM   5520  O  OD2 . ASP D 1 155 ? 52.166 -25.015 -29.116 1.00 62.59 ? 239 ASP D OD2 1 
ATOM   5521  N  N   . MET D 1 156 ? 56.817 -22.853 -28.459 1.00 58.58 ? 240 MET D N   1 
ATOM   5522  C  CA  . MET D 1 156 ? 57.783 -22.442 -29.487 1.00 58.43 ? 240 MET D CA  1 
ATOM   5523  C  C   . MET D 1 156 ? 57.617 -23.198 -30.788 1.00 58.47 ? 240 MET D C   1 
ATOM   5524  O  O   . MET D 1 156 ? 58.255 -22.862 -31.777 1.00 59.08 ? 240 MET D O   1 
ATOM   5525  C  CB  . MET D 1 156 ? 59.225 -22.540 -29.013 1.00 58.11 ? 240 MET D CB  1 
ATOM   5526  C  CG  . MET D 1 156 ? 59.522 -21.773 -27.726 1.00 59.16 ? 240 MET D CG  1 
ATOM   5527  S  SD  . MET D 1 156 ? 59.069 -20.009 -27.705 1.00 60.01 ? 240 MET D SD  1 
ATOM   5528  C  CE  . MET D 1 156 ? 60.346 -19.238 -28.686 1.00 58.40 ? 240 MET D CE  1 
ATOM   5529  N  N   . ALA D 1 157 ? 56.745 -24.199 -30.805 1.00 58.50 ? 241 ALA D N   1 
ATOM   5530  C  CA  . ALA D 1 157 ? 56.308 -24.786 -32.073 1.00 59.13 ? 241 ALA D CA  1 
ATOM   5531  C  C   . ALA D 1 157 ? 55.302 -23.918 -32.858 1.00 58.97 ? 241 ALA D C   1 
ATOM   5532  O  O   . ALA D 1 157 ? 55.166 -24.114 -34.059 1.00 60.08 ? 241 ALA D O   1 
ATOM   5533  C  CB  . ALA D 1 157 ? 55.709 -26.182 -31.851 1.00 59.96 ? 241 ALA D CB  1 
ATOM   5534  N  N   . ASP D 1 158 ? 54.598 -22.989 -32.197 1.00 57.35 ? 242 ASP D N   1 
ATOM   5535  C  CA  . ASP D 1 158 ? 53.562 -22.162 -32.842 1.00 55.72 ? 242 ASP D CA  1 
ATOM   5536  C  C   . ASP D 1 158 ? 53.938 -21.652 -34.221 1.00 54.05 ? 242 ASP D C   1 
ATOM   5537  O  O   . ASP D 1 158 ? 55.019 -21.126 -34.369 1.00 53.28 ? 242 ASP D O   1 
ATOM   5538  C  CB  . ASP D 1 158 ? 53.233 -20.941 -31.978 1.00 56.20 ? 242 ASP D CB  1 
ATOM   5539  C  CG  . ASP D 1 158 ? 52.039 -20.161 -32.508 1.00 56.88 ? 242 ASP D CG  1 
ATOM   5540  O  OD1 . ASP D 1 158 ? 52.254 -19.132 -33.204 1.00 56.32 ? 242 ASP D OD1 1 
ATOM   5541  O  OD2 . ASP D 1 158 ? 50.886 -20.607 -32.249 1.00 56.39 ? 242 ASP D OD2 1 
ATOM   5542  N  N   . THR D 1 159 ? 53.028 -21.776 -35.203 1.00 52.97 ? 243 THR D N   1 
ATOM   5543  C  CA  . THR D 1 159 ? 53.266 -21.252 -36.574 1.00 51.78 ? 243 THR D CA  1 
ATOM   5544  C  C   . THR D 1 159 ? 52.262 -20.198 -37.054 1.00 50.71 ? 243 THR D C   1 
ATOM   5545  O  O   . THR D 1 159 ? 52.332 -19.707 -38.196 1.00 50.38 ? 243 THR D O   1 
ATOM   5546  C  CB  . THR D 1 159 ? 53.506 -22.344 -37.648 1.00 51.58 ? 243 THR D CB  1 
ATOM   5547  O  OG1 . THR D 1 159 ? 52.718 -23.514 -37.368 1.00 53.60 ? 243 THR D OG1 1 
ATOM   5548  C  CG2 . THR D 1 159 ? 54.943 -22.729 -37.620 1.00 51.02 ? 243 THR D CG2 1 
ATOM   5549  N  N   . GLU D 1 160 ? 51.395 -19.799 -36.137 1.00 49.05 ? 244 GLU D N   1 
ATOM   5550  C  CA  . GLU D 1 160 ? 50.335 -18.850 -36.424 1.00 47.94 ? 244 GLU D CA  1 
ATOM   5551  C  C   . GLU D 1 160 ? 50.770 -17.548 -37.114 1.00 46.12 ? 244 GLU D C   1 
ATOM   5552  O  O   . GLU D 1 160 ? 50.198 -17.176 -38.122 1.00 46.46 ? 244 GLU D O   1 
ATOM   5553  C  CB  . GLU D 1 160 ? 49.492 -18.609 -35.150 1.00 48.71 ? 244 GLU D CB  1 
ATOM   5554  C  CG  . GLU D 1 160 ? 48.696 -19.834 -34.685 1.00 49.70 ? 244 GLU D CG  1 
ATOM   5555  C  CD  . GLU D 1 160 ? 47.571 -20.187 -35.653 1.00 56.90 ? 244 GLU D CD  1 
ATOM   5556  O  OE1 . GLU D 1 160 ? 47.803 -21.117 -36.475 1.00 54.14 ? 244 GLU D OE1 1 
ATOM   5557  O  OE2 . GLU D 1 160 ? 46.479 -19.493 -35.609 1.00 59.59 ? 244 GLU D OE2 1 
ATOM   5558  N  N   . LEU D 1 161 ? 51.771 -16.862 -36.600 1.00 44.57 ? 245 LEU D N   1 
ATOM   5559  C  CA  . LEU D 1 161 ? 52.198 -15.630 -37.258 1.00 44.30 ? 245 LEU D CA  1 
ATOM   5560  C  C   . LEU D 1 161 ? 52.770 -15.872 -38.634 1.00 44.55 ? 245 LEU D C   1 
ATOM   5561  O  O   . LEU D 1 161 ? 52.520 -15.099 -39.559 1.00 46.00 ? 245 LEU D O   1 
ATOM   5562  C  CB  . LEU D 1 161 ? 53.156 -14.766 -36.417 1.00 43.19 ? 245 LEU D CB  1 
ATOM   5563  C  CG  . LEU D 1 161 ? 52.653 -14.329 -35.024 1.00 42.16 ? 245 LEU D CG  1 
ATOM   5564  C  CD1 . LEU D 1 161 ? 53.728 -13.611 -34.250 1.00 37.35 ? 245 LEU D CD1 1 
ATOM   5565  C  CD2 . LEU D 1 161 ? 51.348 -13.491 -35.090 1.00 40.22 ? 245 LEU D CD2 1 
ATOM   5566  N  N   . LEU D 1 162 ? 53.530 -16.939 -38.779 1.00 44.46 ? 246 LEU D N   1 
ATOM   5567  C  CA  . LEU D 1 162 ? 54.023 -17.335 -40.085 1.00 44.37 ? 246 LEU D CA  1 
ATOM   5568  C  C   . LEU D 1 162 ? 52.861 -17.500 -41.047 1.00 43.77 ? 246 LEU D C   1 
ATOM   5569  O  O   . LEU D 1 162 ? 52.857 -16.888 -42.107 1.00 43.67 ? 246 LEU D O   1 
ATOM   5570  C  CB  . LEU D 1 162 ? 54.809 -18.655 -39.975 1.00 45.36 ? 246 LEU D CB  1 
ATOM   5571  C  CG  . LEU D 1 162 ? 55.628 -19.027 -41.200 1.00 43.76 ? 246 LEU D CG  1 
ATOM   5572  C  CD1 . LEU D 1 162 ? 56.374 -17.802 -41.717 1.00 41.29 ? 246 LEU D CD1 1 
ATOM   5573  C  CD2 . LEU D 1 162 ? 56.543 -20.119 -40.817 1.00 43.57 ? 246 LEU D CD2 1 
ATOM   5574  N  N   . ASN D 1 163 ? 51.875 -18.301 -40.663 1.00 43.21 ? 247 ASN D N   1 
ATOM   5575  C  CA  . ASN D 1 163 ? 50.694 -18.484 -41.488 1.00 43.88 ? 247 ASN D CA  1 
ATOM   5576  C  C   . ASN D 1 163 ? 49.880 -17.245 -41.777 1.00 44.59 ? 247 ASN D C   1 
ATOM   5577  O  O   . ASN D 1 163 ? 49.170 -17.226 -42.788 1.00 44.70 ? 247 ASN D O   1 
ATOM   5578  C  CB  . ASN D 1 163 ? 49.792 -19.542 -40.919 1.00 43.91 ? 247 ASN D CB  1 
ATOM   5579  C  CG  . ASN D 1 163 ? 50.476 -20.865 -40.828 1.00 46.02 ? 247 ASN D CG  1 
ATOM   5580  O  OD1 . ASN D 1 163 ? 50.172 -21.671 -39.951 1.00 48.42 ? 247 ASN D OD1 1 
ATOM   5581  N  ND2 . ASN D 1 163 ? 51.425 -21.108 -41.744 1.00 45.06 ? 247 ASN D ND2 1 
ATOM   5582  N  N   . LEU D 1 164 ? 49.983 -16.206 -40.931 1.00 44.88 ? 248 LEU D N   1 
ATOM   5583  C  CA  . LEU D 1 164 ? 49.234 -14.965 -41.193 1.00 44.34 ? 248 LEU D CA  1 
ATOM   5584  C  C   . LEU D 1 164 ? 49.896 -14.196 -42.319 1.00 44.66 ? 248 LEU D C   1 
ATOM   5585  O  O   . LEU D 1 164 ? 49.254 -13.407 -43.015 1.00 44.29 ? 248 LEU D O   1 
ATOM   5586  C  CB  . LEU D 1 164 ? 49.007 -14.109 -39.915 1.00 43.65 ? 248 LEU D CB  1 
ATOM   5587  C  CG  . LEU D 1 164 ? 48.041 -14.790 -38.906 1.00 41.42 ? 248 LEU D CG  1 
ATOM   5588  C  CD1 . LEU D 1 164 ? 47.814 -14.072 -37.614 1.00 31.38 ? 248 LEU D CD1 1 
ATOM   5589  C  CD2 . LEU D 1 164 ? 46.739 -15.058 -39.568 1.00 39.95 ? 248 LEU D CD2 1 
ATOM   5590  N  N   . ILE D 1 165 ? 51.167 -14.443 -42.536 1.00 45.45 ? 249 ILE D N   1 
ATOM   5591  C  CA  . ILE D 1 165 ? 51.842 -13.587 -43.466 1.00 47.95 ? 249 ILE D CA  1 
ATOM   5592  C  C   . ILE D 1 165 ? 51.180 -13.645 -44.861 1.00 50.26 ? 249 ILE D C   1 
ATOM   5593  O  O   . ILE D 1 165 ? 50.773 -12.599 -45.404 1.00 51.69 ? 249 ILE D O   1 
ATOM   5594  C  CB  . ILE D 1 165 ? 53.337 -13.832 -43.505 1.00 47.94 ? 249 ILE D CB  1 
ATOM   5595  C  CG1 . ILE D 1 165 ? 53.976 -13.393 -42.176 1.00 47.83 ? 249 ILE D CG1 1 
ATOM   5596  C  CG2 . ILE D 1 165 ? 53.950 -13.026 -44.630 1.00 49.37 ? 249 ILE D CG2 1 
ATOM   5597  C  CD1 . ILE D 1 165 ? 55.444 -13.720 -42.071 1.00 44.90 ? 249 ILE D CD1 1 
ATOM   5598  N  N   . PRO D 1 166 ? 51.017 -14.863 -45.428 1.00 51.30 ? 250 PRO D N   1 
ATOM   5599  C  CA  . PRO D 1 166 ? 50.459 -14.975 -46.770 1.00 51.66 ? 250 PRO D CA  1 
ATOM   5600  C  C   . PRO D 1 166 ? 48.965 -14.658 -46.816 1.00 51.94 ? 250 PRO D C   1 
ATOM   5601  O  O   . PRO D 1 166 ? 48.433 -14.270 -47.874 1.00 52.49 ? 250 PRO D O   1 
ATOM   5602  C  CB  . PRO D 1 166 ? 50.705 -16.442 -47.116 1.00 52.62 ? 250 PRO D CB  1 
ATOM   5603  C  CG  . PRO D 1 166 ? 50.654 -17.122 -45.778 1.00 52.92 ? 250 PRO D CG  1 
ATOM   5604  C  CD  . PRO D 1 166 ? 51.333 -16.185 -44.851 1.00 51.18 ? 250 PRO D CD  1 
ATOM   5605  N  N   . ILE D 1 167 ? 48.283 -14.810 -45.688 1.00 51.58 ? 251 ILE D N   1 
ATOM   5606  C  CA  . ILE D 1 167 ? 46.925 -14.317 -45.593 1.00 50.55 ? 251 ILE D CA  1 
ATOM   5607  C  C   . ILE D 1 167 ? 46.846 -12.794 -45.721 1.00 50.65 ? 251 ILE D C   1 
ATOM   5608  O  O   . ILE D 1 167 ? 45.966 -12.274 -46.394 1.00 51.72 ? 251 ILE D O   1 
ATOM   5609  C  CB  . ILE D 1 167 ? 46.276 -14.744 -44.317 1.00 50.58 ? 251 ILE D CB  1 
ATOM   5610  C  CG1 . ILE D 1 167 ? 46.278 -16.278 -44.281 1.00 50.67 ? 251 ILE D CG1 1 
ATOM   5611  C  CG2 . ILE D 1 167 ? 44.868 -14.063 -44.207 1.00 49.74 ? 251 ILE D CG2 1 
ATOM   5612  C  CD1 . ILE D 1 167 ? 45.340 -16.911 -43.268 1.00 53.47 ? 251 ILE D CD1 1 
ATOM   5613  N  N   . PHE D 1 168 ? 47.757 -12.074 -45.096 1.00 49.82 ? 252 PHE D N   1 
ATOM   5614  C  CA  . PHE D 1 168 ? 47.672 -10.630 -45.137 1.00 49.68 ? 252 PHE D CA  1 
ATOM   5615  C  C   . PHE D 1 168 ? 48.133 -10.088 -46.452 1.00 51.06 ? 252 PHE D C   1 
ATOM   5616  O  O   . PHE D 1 168 ? 47.585 -9.098  -46.935 1.00 50.43 ? 252 PHE D O   1 
ATOM   5617  C  CB  . PHE D 1 168 ? 48.463 -9.981  -43.985 1.00 48.22 ? 252 PHE D CB  1 
ATOM   5618  C  CG  . PHE D 1 168 ? 47.657 -9.794  -42.743 1.00 45.04 ? 252 PHE D CG  1 
ATOM   5619  C  CD1 . PHE D 1 168 ? 47.796 -10.651 -41.682 1.00 38.95 ? 252 PHE D CD1 1 
ATOM   5620  C  CD2 . PHE D 1 168 ? 46.715 -8.764  -42.653 1.00 41.60 ? 252 PHE D CD2 1 
ATOM   5621  C  CE1 . PHE D 1 168 ? 47.042 -10.480 -40.526 1.00 36.46 ? 252 PHE D CE1 1 
ATOM   5622  C  CE2 . PHE D 1 168 ? 45.984 -8.591  -41.501 1.00 38.55 ? 252 PHE D CE2 1 
ATOM   5623  C  CZ  . PHE D 1 168 ? 46.152 -9.468  -40.433 1.00 38.32 ? 252 PHE D CZ  1 
ATOM   5624  N  N   . GLU D 1 169 ? 49.167 -10.726 -47.007 1.00 53.18 ? 253 GLU D N   1 
ATOM   5625  C  CA  . GLU D 1 169 ? 49.677 -10.380 -48.338 1.00 55.18 ? 253 GLU D CA  1 
ATOM   5626  C  C   . GLU D 1 169 ? 48.597 -10.284 -49.448 1.00 55.65 ? 253 GLU D C   1 
ATOM   5627  O  O   . GLU D 1 169 ? 48.596 -9.295  -50.221 1.00 55.12 ? 253 GLU D O   1 
ATOM   5628  C  CB  . GLU D 1 169 ? 50.794 -11.328 -48.734 1.00 55.69 ? 253 GLU D CB  1 
ATOM   5629  C  CG  . GLU D 1 169 ? 52.155 -10.684 -48.586 1.00 59.16 ? 253 GLU D CG  1 
ATOM   5630  C  CD  . GLU D 1 169 ? 53.308 -11.673 -48.645 1.00 63.97 ? 253 GLU D CD  1 
ATOM   5631  O  OE1 . GLU D 1 169 ? 53.069 -12.886 -48.811 1.00 65.28 ? 253 GLU D OE1 1 
ATOM   5632  O  OE2 . GLU D 1 169 ? 54.475 -11.229 -48.523 1.00 67.38 ? 253 GLU D OE2 1 
ATOM   5633  N  N   . GLU D 1 170 ? 47.706 -11.294 -49.489 1.00 55.43 ? 254 GLU D N   1 
ATOM   5634  C  CA  . GLU D 1 170 ? 46.541 -11.334 -50.365 1.00 57.50 ? 254 GLU D CA  1 
ATOM   5635  C  C   . GLU D 1 170 ? 45.552 -10.182 -50.057 1.00 56.51 ? 254 GLU D C   1 
ATOM   5636  O  O   . GLU D 1 170 ? 45.026 -9.557  -50.992 1.00 56.38 ? 254 GLU D O   1 
ATOM   5637  C  CB  . GLU D 1 170 ? 45.802 -12.695 -50.226 1.00 57.55 ? 254 GLU D CB  1 
ATOM   5638  C  CG  . GLU D 1 170 ? 44.990 -13.197 -51.477 1.00 60.95 ? 254 GLU D CG  1 
ATOM   5639  C  CD  . GLU D 1 170 ? 44.379 -14.651 -51.305 1.00 62.86 ? 254 GLU D CD  1 
ATOM   5640  O  OE1 . GLU D 1 170 ? 44.951 -15.677 -51.827 1.00 67.42 ? 254 GLU D OE1 1 
ATOM   5641  O  OE2 . GLU D 1 170 ? 43.305 -14.767 -50.654 1.00 68.21 ? 254 GLU D OE2 1 
ATOM   5642  N  N   . LEU D 1 171 ? 45.282 -9.937  -48.759 1.00 55.02 ? 255 LEU D N   1 
ATOM   5643  C  CA  . LEU D 1 171 ? 44.368 -8.862  -48.306 1.00 53.38 ? 255 LEU D CA  1 
ATOM   5644  C  C   . LEU D 1 171 ? 44.879 -7.485  -48.658 1.00 52.56 ? 255 LEU D C   1 
ATOM   5645  O  O   . LEU D 1 171 ? 44.076 -6.541  -48.793 1.00 53.14 ? 255 LEU D O   1 
ATOM   5646  C  CB  . LEU D 1 171 ? 44.193 -8.855  -46.771 1.00 53.57 ? 255 LEU D CB  1 
ATOM   5647  C  CG  . LEU D 1 171 ? 43.283 -9.883  -46.085 1.00 53.88 ? 255 LEU D CG  1 
ATOM   5648  C  CD1 . LEU D 1 171 ? 43.368 -9.800  -44.582 1.00 54.26 ? 255 LEU D CD1 1 
ATOM   5649  C  CD2 . LEU D 1 171 ? 41.854 -9.739  -46.529 1.00 55.21 ? 255 LEU D CD2 1 
ATOM   5650  N  N   . SER D 1 172 ? 46.203 -7.359  -48.754 1.00 50.30 ? 256 SER D N   1 
ATOM   5651  C  CA  . SER D 1 172 ? 46.837 -6.084  -48.602 1.00 48.75 ? 256 SER D CA  1 
ATOM   5652  C  C   . SER D 1 172 ? 46.473 -5.090  -49.668 1.00 48.70 ? 256 SER D C   1 
ATOM   5653  O  O   . SER D 1 172 ? 46.391 -3.904  -49.364 1.00 49.28 ? 256 SER D O   1 
ATOM   5654  C  CB  . SER D 1 172 ? 48.346 -6.219  -48.518 1.00 49.03 ? 256 SER D CB  1 
ATOM   5655  O  OG  . SER D 1 172 ? 48.916 -6.149  -49.788 1.00 48.44 ? 256 SER D OG  1 
ATOM   5656  N  N   . GLY D 1 173 ? 46.256 -5.531  -50.904 1.00 48.18 ? 257 GLY D N   1 
ATOM   5657  C  CA  . GLY D 1 173 ? 45.914 -4.585  -51.958 1.00 47.95 ? 257 GLY D CA  1 
ATOM   5658  C  C   . GLY D 1 173 ? 44.414 -4.294  -52.123 1.00 48.63 ? 257 GLY D C   1 
ATOM   5659  O  O   . GLY D 1 173 ? 44.052 -3.458  -52.945 1.00 49.37 ? 257 GLY D O   1 
ATOM   5660  N  N   . ALA D 1 174 ? 43.548 -4.971  -51.364 1.00 48.26 ? 258 ALA D N   1 
ATOM   5661  C  CA  . ALA D 1 174 ? 42.099 -4.959  -51.580 1.00 48.43 ? 258 ALA D CA  1 
ATOM   5662  C  C   . ALA D 1 174 ? 41.443 -3.605  -51.297 1.00 49.35 ? 258 ALA D C   1 
ATOM   5663  O  O   . ALA D 1 174 ? 41.717 -2.996  -50.277 1.00 50.60 ? 258 ALA D O   1 
ATOM   5664  C  CB  . ALA D 1 174 ? 41.453 -6.039  -50.711 1.00 48.27 ? 258 ALA D CB  1 
ATOM   5665  N  N   . GLU D 1 175 ? 40.567 -3.128  -52.175 1.00 49.90 ? 259 GLU D N   1 
ATOM   5666  C  CA  . GLU D 1 175 ? 39.847 -1.892  -51.886 1.00 50.62 ? 259 GLU D CA  1 
ATOM   5667  C  C   . GLU D 1 175 ? 38.749 -2.008  -50.816 1.00 49.05 ? 259 GLU D C   1 
ATOM   5668  O  O   . GLU D 1 175 ? 38.275 -1.008  -50.324 1.00 49.12 ? 259 GLU D O   1 
ATOM   5669  C  CB  . GLU D 1 175 ? 39.248 -1.281  -53.160 1.00 51.91 ? 259 GLU D CB  1 
ATOM   5670  C  CG  . GLU D 1 175 ? 40.233 -0.624  -54.174 1.00 59.53 ? 259 GLU D CG  1 
ATOM   5671  C  CD  . GLU D 1 175 ? 41.167 0.509   -53.599 1.00 69.58 ? 259 GLU D CD  1 
ATOM   5672  O  OE1 . GLU D 1 175 ? 40.966 1.019   -52.445 1.00 72.31 ? 259 GLU D OE1 1 
ATOM   5673  O  OE2 . GLU D 1 175 ? 42.122 0.887   -54.344 1.00 72.74 ? 259 GLU D OE2 1 
ATOM   5674  N  N   . ASP D 1 176 ? 38.350 -3.212  -50.461 1.00 48.43 ? 260 ASP D N   1 
ATOM   5675  C  CA  . ASP D 1 176 ? 37.247 -3.421  -49.561 1.00 48.78 ? 260 ASP D CA  1 
ATOM   5676  C  C   . ASP D 1 176 ? 37.422 -4.774  -48.859 1.00 48.55 ? 260 ASP D C   1 
ATOM   5677  O  O   . ASP D 1 176 ? 37.057 -5.801  -49.409 1.00 48.77 ? 260 ASP D O   1 
ATOM   5678  C  CB  . ASP D 1 176 ? 35.932 -3.357  -50.366 1.00 49.35 ? 260 ASP D CB  1 
ATOM   5679  C  CG  . ASP D 1 176 ? 34.670 -3.709  -49.543 1.00 52.77 ? 260 ASP D CG  1 
ATOM   5680  O  OD1 . ASP D 1 176 ? 34.744 -4.514  -48.567 1.00 54.12 ? 260 ASP D OD1 1 
ATOM   5681  O  OD2 . ASP D 1 176 ? 33.575 -3.192  -49.919 1.00 55.16 ? 260 ASP D OD2 1 
ATOM   5682  N  N   . VAL D 1 177 ? 37.936 -4.760  -47.623 1.00 47.90 ? 261 VAL D N   1 
ATOM   5683  C  CA  . VAL D 1 177 ? 38.308 -5.988  -46.931 1.00 47.59 ? 261 VAL D CA  1 
ATOM   5684  C  C   . VAL D 1 177 ? 37.166 -7.004  -46.900 1.00 48.67 ? 261 VAL D C   1 
ATOM   5685  O  O   . VAL D 1 177 ? 37.417 -8.209  -46.760 1.00 49.20 ? 261 VAL D O   1 
ATOM   5686  C  CB  . VAL D 1 177 ? 38.864 -5.717  -45.480 1.00 47.67 ? 261 VAL D CB  1 
ATOM   5687  C  CG1 . VAL D 1 177 ? 40.008 -4.717  -45.513 1.00 47.30 ? 261 VAL D CG1 1 
ATOM   5688  C  CG2 . VAL D 1 177 ? 37.790 -5.222  -44.523 1.00 44.82 ? 261 VAL D CG2 1 
ATOM   5689  N  N   . TYR D 1 178 ? 35.921 -6.520  -47.041 1.00 49.16 ? 262 TYR D N   1 
ATOM   5690  C  CA  . TYR D 1 178 ? 34.733 -7.338  -46.791 1.00 49.52 ? 262 TYR D CA  1 
ATOM   5691  C  C   . TYR D 1 178 ? 34.463 -8.257  -47.956 1.00 52.64 ? 262 TYR D C   1 
ATOM   5692  O  O   . TYR D 1 178 ? 33.494 -8.993  -47.906 1.00 53.21 ? 262 TYR D O   1 
ATOM   5693  C  CB  . TYR D 1 178 ? 33.458 -6.513  -46.508 1.00 47.00 ? 262 TYR D CB  1 
ATOM   5694  C  CG  . TYR D 1 178 ? 33.409 -5.736  -45.214 1.00 40.83 ? 262 TYR D CG  1 
ATOM   5695  C  CD1 . TYR D 1 178 ? 32.827 -4.497  -45.184 1.00 35.89 ? 262 TYR D CD1 1 
ATOM   5696  C  CD2 . TYR D 1 178 ? 33.917 -6.248  -44.019 1.00 38.77 ? 262 TYR D CD2 1 
ATOM   5697  C  CE1 . TYR D 1 178 ? 32.764 -3.739  -44.028 1.00 36.07 ? 262 TYR D CE1 1 
ATOM   5698  C  CE2 . TYR D 1 178 ? 33.853 -5.502  -42.833 1.00 38.20 ? 262 TYR D CE2 1 
ATOM   5699  C  CZ  . TYR D 1 178 ? 33.262 -4.231  -42.864 1.00 40.29 ? 262 TYR D CZ  1 
ATOM   5700  O  OH  . TYR D 1 178 ? 33.175 -3.425  -41.742 1.00 41.75 ? 262 TYR D OH  1 
ATOM   5701  N  N   . THR D 1 179 ? 35.307 -8.209  -48.995 1.00 56.42 ? 263 THR D N   1 
ATOM   5702  C  CA  . THR D 1 179 ? 35.391 -9.291  -49.993 1.00 60.45 ? 263 THR D CA  1 
ATOM   5703  C  C   . THR D 1 179 ? 36.410 -10.399 -49.586 1.00 64.01 ? 263 THR D C   1 
ATOM   5704  O  O   . THR D 1 179 ? 36.087 -11.321 -48.795 1.00 64.53 ? 263 THR D O   1 
ATOM   5705  C  CB  . THR D 1 179 ? 35.701 -8.733  -51.384 1.00 60.19 ? 263 THR D CB  1 
ATOM   5706  O  OG1 . THR D 1 179 ? 37.004 -8.130  -51.401 1.00 58.53 ? 263 THR D OG1 1 
ATOM   5707  C  CG2 . THR D 1 179 ? 34.655 -7.699  -51.757 1.00 60.27 ? 263 THR D CG2 1 
ATOM   5708  N  N   . SER D 1 180 ? 37.593 -10.336 -50.194 1.00 67.95 ? 264 SER D N   1 
ATOM   5709  C  CA  . SER D 1 180 ? 38.886 -10.710 -49.575 1.00 72.15 ? 264 SER D CA  1 
ATOM   5710  C  C   . SER D 1 180 ? 38.932 -11.627 -48.322 1.00 74.95 ? 264 SER D C   1 
ATOM   5711  O  O   . SER D 1 180 ? 39.854 -12.462 -48.181 1.00 75.69 ? 264 SER D O   1 
ATOM   5712  C  CB  . SER D 1 180 ? 39.643 -9.427  -49.195 1.00 71.88 ? 264 SER D CB  1 
ATOM   5713  O  OG  . SER D 1 180 ? 39.077 -8.260  -49.777 1.00 73.03 ? 264 SER D OG  1 
ATOM   5714  N  N   . LEU D 1 181 ? 37.996 -11.437 -47.389 1.00 77.51 ? 265 LEU D N   1 
ATOM   5715  C  CA  . LEU D 1 181 ? 38.076 -12.148 -46.109 1.00 79.56 ? 265 LEU D CA  1 
ATOM   5716  C  C   . LEU D 1 181 ? 37.410 -13.534 -46.111 1.00 80.89 ? 265 LEU D C   1 
ATOM   5717  O  O   . LEU D 1 181 ? 37.953 -14.495 -45.516 1.00 81.05 ? 265 LEU D O   1 
ATOM   5718  C  CB  . LEU D 1 181 ? 37.585 -11.264 -44.949 1.00 79.67 ? 265 LEU D CB  1 
ATOM   5719  C  CG  . LEU D 1 181 ? 38.680 -10.458 -44.231 1.00 79.10 ? 265 LEU D CG  1 
ATOM   5720  C  CD1 . LEU D 1 181 ? 38.068 -9.462  -43.258 1.00 77.35 ? 265 LEU D CD1 1 
ATOM   5721  C  CD2 . LEU D 1 181 ? 39.600 -11.412 -43.483 1.00 79.84 ? 265 LEU D CD2 1 
ATOM   5722  N  N   . GLY D 1 182 ? 36.240 -13.638 -46.758 1.00 81.80 ? 266 GLY D N   1 
ATOM   5723  C  CA  . GLY D 1 182 ? 35.675 -14.953 -47.080 1.00 81.95 ? 266 GLY D CA  1 
ATOM   5724  C  C   . GLY D 1 182 ? 36.461 -15.539 -48.252 1.00 82.25 ? 266 GLY D C   1 
ATOM   5725  O  O   . GLY D 1 182 ? 37.169 -14.800 -48.986 1.00 82.30 ? 266 GLY D O   1 
ATOM   5726  N  N   . CYS E 1 5   ? 13.302 19.629  -22.759 1.00 65.56 ? 89  CYS E N   1 
ATOM   5727  C  CA  . CYS E 1 5   ? 11.955 19.183  -23.284 1.00 65.64 ? 89  CYS E CA  1 
ATOM   5728  C  C   . CYS E 1 5   ? 11.885 19.097  -24.821 1.00 65.16 ? 89  CYS E C   1 
ATOM   5729  O  O   . CYS E 1 5   ? 12.151 20.088  -25.508 1.00 65.17 ? 89  CYS E O   1 
ATOM   5730  C  CB  . CYS E 1 5   ? 10.851 20.091  -22.753 1.00 66.20 ? 89  CYS E CB  1 
ATOM   5731  S  SG  . CYS E 1 5   ? 9.293  19.695  -23.472 1.00 66.84 ? 89  CYS E SG  1 
ATOM   5732  N  N   . LEU E 1 6   ? 11.464 17.932  -25.338 1.00 64.77 ? 90  LEU E N   1 
ATOM   5733  C  CA  . LEU E 1 6   ? 12.044 17.367  -26.587 1.00 64.17 ? 90  LEU E CA  1 
ATOM   5734  C  C   . LEU E 1 6   ? 11.214 16.315  -27.331 1.00 64.00 ? 90  LEU E C   1 
ATOM   5735  O  O   . LEU E 1 6   ? 11.412 16.129  -28.519 1.00 63.76 ? 90  LEU E O   1 
ATOM   5736  C  CB  . LEU E 1 6   ? 13.390 16.706  -26.233 1.00 64.59 ? 90  LEU E CB  1 
ATOM   5737  C  CG  . LEU E 1 6   ? 14.647 16.636  -27.089 1.00 63.29 ? 90  LEU E CG  1 
ATOM   5738  C  CD1 . LEU E 1 6   ? 15.232 18.013  -27.208 1.00 63.18 ? 90  LEU E CD1 1 
ATOM   5739  C  CD2 . LEU E 1 6   ? 15.670 15.680  -26.420 1.00 63.18 ? 90  LEU E CD2 1 
ATOM   5740  N  N   . LEU E 1 7   ? 10.341 15.599  -26.632 1.00 63.73 ? 91  LEU E N   1 
ATOM   5741  C  CA  . LEU E 1 7   ? 9.290  14.798  -27.281 1.00 64.19 ? 91  LEU E CA  1 
ATOM   5742  C  C   . LEU E 1 7   ? 8.003  15.610  -27.495 1.00 65.74 ? 91  LEU E C   1 
ATOM   5743  O  O   . LEU E 1 7   ? 7.694  16.480  -26.670 1.00 66.76 ? 91  LEU E O   1 
ATOM   5744  C  CB  . LEU E 1 7   ? 8.932  13.604  -26.408 1.00 62.87 ? 91  LEU E CB  1 
ATOM   5745  C  CG  . LEU E 1 7   ? 9.945  12.488  -26.353 1.00 60.92 ? 91  LEU E CG  1 
ATOM   5746  C  CD1 . LEU E 1 7   ? 9.526  11.484  -25.345 1.00 59.55 ? 91  LEU E CD1 1 
ATOM   5747  C  CD2 . LEU E 1 7   ? 10.112 11.867  -27.707 1.00 59.60 ? 91  LEU E CD2 1 
ATOM   5748  N  N   . PRO E 1 8   ? 7.227  15.313  -28.567 1.00 66.89 ? 92  PRO E N   1 
ATOM   5749  C  CA  . PRO E 1 8   ? 5.851  15.793  -28.711 1.00 67.51 ? 92  PRO E CA  1 
ATOM   5750  C  C   . PRO E 1 8   ? 5.022  15.702  -27.437 1.00 68.14 ? 92  PRO E C   1 
ATOM   5751  O  O   . PRO E 1 8   ? 5.224  14.789  -26.599 1.00 67.38 ? 92  PRO E O   1 
ATOM   5752  C  CB  . PRO E 1 8   ? 5.239  14.797  -29.727 1.00 67.66 ? 92  PRO E CB  1 
ATOM   5753  C  CG  . PRO E 1 8   ? 6.264  13.720  -29.935 1.00 67.03 ? 92  PRO E CG  1 
ATOM   5754  C  CD  . PRO E 1 8   ? 7.564  14.471  -29.723 1.00 67.39 ? 92  PRO E CD  1 
ATOM   5755  N  N   . GLU E 1 9   ? 4.079  16.640  -27.317 1.00 69.18 ? 93  GLU E N   1 
ATOM   5756  C  CA  . GLU E 1 9   ? 3.053  16.621  -26.267 1.00 70.08 ? 93  GLU E CA  1 
ATOM   5757  C  C   . GLU E 1 9   ? 2.534  15.187  -26.305 1.00 69.38 ? 93  GLU E C   1 
ATOM   5758  O  O   . GLU E 1 9   ? 2.348  14.664  -27.394 1.00 69.53 ? 93  GLU E O   1 
ATOM   5759  C  CB  . GLU E 1 9   ? 1.939  17.629  -26.627 1.00 69.94 ? 93  GLU E CB  1 
ATOM   5760  C  CG  . GLU E 1 9   ? 1.362  18.520  -25.477 1.00 71.73 ? 93  GLU E CG  1 
ATOM   5761  C  CD  . GLU E 1 9   ? 0.523  19.741  -25.999 1.00 72.52 ? 93  GLU E CD  1 
ATOM   5762  O  OE1 . GLU E 1 9   ? -0.606 19.515  -26.510 1.00 73.53 ? 93  GLU E OE1 1 
ATOM   5763  O  OE2 . GLU E 1 9   ? 0.986  20.922  -25.881 1.00 73.76 ? 93  GLU E OE2 1 
ATOM   5764  N  N   . VAL E 1 10  ? 2.333  14.531  -25.163 1.00 69.48 ? 94  VAL E N   1 
ATOM   5765  C  CA  . VAL E 1 10  ? 1.785  13.157  -25.185 1.00 69.82 ? 94  VAL E CA  1 
ATOM   5766  C  C   . VAL E 1 10  ? 0.477  13.049  -26.017 1.00 70.64 ? 94  VAL E C   1 
ATOM   5767  O  O   . VAL E 1 10  ? -0.051 14.045  -26.525 1.00 70.64 ? 94  VAL E O   1 
ATOM   5768  C  CB  . VAL E 1 10  ? 1.580  12.607  -23.754 1.00 69.39 ? 94  VAL E CB  1 
ATOM   5769  C  CG1 . VAL E 1 10  ? 0.252  13.090  -23.171 1.00 70.76 ? 94  VAL E CG1 1 
ATOM   5770  C  CG2 . VAL E 1 10  ? 1.604  11.089  -23.741 1.00 69.12 ? 94  VAL E CG2 1 
ATOM   5771  N  N   . THR E 1 11  ? -0.057 11.843  -26.167 1.00 71.61 ? 95  THR E N   1 
ATOM   5772  C  CA  . THR E 1 11  ? -1.325 11.698  -26.873 1.00 71.99 ? 95  THR E CA  1 
ATOM   5773  C  C   . THR E 1 11  ? -2.402 11.190  -25.958 1.00 73.61 ? 95  THR E C   1 
ATOM   5774  O  O   . THR E 1 11  ? -2.122 10.461  -24.999 1.00 73.33 ? 95  THR E O   1 
ATOM   5775  C  CB  . THR E 1 11  ? -1.268 10.670  -28.003 1.00 71.58 ? 95  THR E CB  1 
ATOM   5776  O  OG1 . THR E 1 11  ? -1.068 9.356   -27.437 1.00 69.15 ? 95  THR E OG1 1 
ATOM   5777  C  CG2 . THR E 1 11  ? -0.224 11.062  -29.081 1.00 69.78 ? 95  THR E CG2 1 
ATOM   5778  N  N   . GLU E 1 12  ? -3.645 11.522  -26.308 1.00 75.18 ? 96  GLU E N   1 
ATOM   5779  C  CA  . GLU E 1 12  ? -4.780 11.010  -25.564 1.00 76.93 ? 96  GLU E CA  1 
ATOM   5780  C  C   . GLU E 1 12  ? -4.643 9.486   -25.580 1.00 76.62 ? 96  GLU E C   1 
ATOM   5781  O  O   . GLU E 1 12  ? -4.817 8.842   -24.538 1.00 76.88 ? 96  GLU E O   1 
ATOM   5782  C  CB  . GLU E 1 12  ? -6.140 11.527  -26.121 1.00 76.94 ? 96  GLU E CB  1 
ATOM   5783  C  CG  . GLU E 1 12  ? -6.291 13.093  -26.106 1.00 78.27 ? 96  GLU E CG  1 
ATOM   5784  C  CD  . GLU E 1 12  ? -7.715 13.617  -26.478 1.00 79.17 ? 96  GLU E CD  1 
ATOM   5785  O  OE1 . GLU E 1 12  ? -8.157 13.394  -27.644 1.00 83.32 ? 96  GLU E OE1 1 
ATOM   5786  O  OE2 . GLU E 1 12  ? -8.379 14.273  -25.616 1.00 78.62 ? 96  GLU E OE2 1 
ATOM   5787  N  N   . GLU E 1 13  ? -4.261 8.908   -26.722 1.00 76.21 ? 97  GLU E N   1 
ATOM   5788  C  CA  . GLU E 1 13  ? -4.136 7.456   -26.736 1.00 76.48 ? 97  GLU E CA  1 
ATOM   5789  C  C   . GLU E 1 13  ? -3.073 6.925   -25.770 1.00 75.93 ? 97  GLU E C   1 
ATOM   5790  O  O   . GLU E 1 13  ? -3.218 5.809   -25.254 1.00 75.84 ? 97  GLU E O   1 
ATOM   5791  C  CB  . GLU E 1 13  ? -4.055 6.822   -28.148 1.00 76.74 ? 97  GLU E CB  1 
ATOM   5792  C  CG  . GLU E 1 13  ? -3.181 7.478   -29.236 1.00 78.03 ? 97  GLU E CG  1 
ATOM   5793  C  CD  . GLU E 1 13  ? -2.720 6.459   -30.350 1.00 78.10 ? 97  GLU E CD  1 
ATOM   5794  O  OE1 . GLU E 1 13  ? -2.793 5.211   -30.130 1.00 78.51 ? 97  GLU E OE1 1 
ATOM   5795  O  OE2 . GLU E 1 13  ? -2.274 6.915   -31.438 1.00 77.95 ? 97  GLU E OE2 1 
ATOM   5796  N  N   . ASP E 1 14  ? -2.042 7.733   -25.487 1.00 75.18 ? 98  ASP E N   1 
ATOM   5797  C  CA  . ASP E 1 14  ? -0.979 7.321   -24.544 1.00 74.48 ? 98  ASP E CA  1 
ATOM   5798  C  C   . ASP E 1 14  ? -1.154 7.860   -23.106 1.00 74.14 ? 98  ASP E C   1 
ATOM   5799  O  O   . ASP E 1 14  ? -0.597 7.295   -22.152 1.00 74.49 ? 98  ASP E O   1 
ATOM   5800  C  CB  . ASP E 1 14  ? 0.424  7.680   -25.088 1.00 74.42 ? 98  ASP E CB  1 
ATOM   5801  C  CG  . ASP E 1 14  ? 0.737  7.000   -26.426 1.00 73.06 ? 98  ASP E CG  1 
ATOM   5802  O  OD1 . ASP E 1 14  ? 0.428  5.797   -26.577 1.00 71.30 ? 98  ASP E OD1 1 
ATOM   5803  O  OD2 . ASP E 1 14  ? 1.309  7.669   -27.318 1.00 69.87 ? 98  ASP E OD2 1 
ATOM   5804  N  N   . GLN E 1 15  ? -1.895 8.967   -22.986 1.00 73.05 ? 99  GLN E N   1 
ATOM   5805  C  CA  . GLN E 1 15  ? -2.282 9.628   -21.729 1.00 71.72 ? 99  GLN E CA  1 
ATOM   5806  C  C   . GLN E 1 15  ? -1.493 9.239   -20.495 1.00 70.01 ? 99  GLN E C   1 
ATOM   5807  O  O   . GLN E 1 15  ? -0.609 9.994   -20.033 1.00 70.75 ? 99  GLN E O   1 
ATOM   5808  C  CB  . GLN E 1 15  ? -3.765 9.386   -21.468 1.00 72.78 ? 99  GLN E CB  1 
ATOM   5809  C  CG  . GLN E 1 15  ? -4.621 10.630  -21.025 1.00 73.39 ? 99  GLN E CG  1 
ATOM   5810  C  CD  . GLN E 1 15  ? -6.143 10.377  -21.221 1.00 73.57 ? 99  GLN E CD  1 
ATOM   5811  O  OE1 . GLN E 1 15  ? -6.621 9.224   -21.137 1.00 75.07 ? 99  GLN E OE1 1 
ATOM   5812  N  NE2 . GLN E 1 15  ? -6.892 11.448  -21.513 1.00 75.15 ? 99  GLN E NE2 1 
ATOM   5813  N  N   . GLY E 1 16  ? -1.786 8.072   -19.936 1.00 67.11 ? 100 GLY E N   1 
ATOM   5814  C  CA  . GLY E 1 16  ? -1.147 7.749   -18.664 1.00 63.68 ? 100 GLY E CA  1 
ATOM   5815  C  C   . GLY E 1 16  ? -0.197 6.587   -18.726 1.00 62.07 ? 100 GLY E C   1 
ATOM   5816  O  O   . GLY E 1 16  ? -0.049 5.829   -17.741 1.00 61.67 ? 100 GLY E O   1 
ATOM   5817  N  N   . ARG E 1 17  ? 0.452  6.405   -19.877 1.00 59.83 ? 101 ARG E N   1 
ATOM   5818  C  CA  . ARG E 1 17  ? 1.378  5.297   -19.932 1.00 57.71 ? 101 ARG E CA  1 
ATOM   5819  C  C   . ARG E 1 17  ? 2.793  5.778   -19.670 1.00 55.72 ? 101 ARG E C   1 
ATOM   5820  O  O   . ARG E 1 17  ? 3.155  6.943   -19.911 1.00 54.06 ? 101 ARG E O   1 
ATOM   5821  C  CB  . ARG E 1 17  ? 1.281  4.505   -21.236 1.00 58.24 ? 101 ARG E CB  1 
ATOM   5822  C  CG  . ARG E 1 17  ? 0.066  4.841   -22.040 1.00 59.95 ? 101 ARG E CG  1 
ATOM   5823  C  CD  . ARG E 1 17  ? 0.202  4.394   -23.470 1.00 64.09 ? 101 ARG E CD  1 
ATOM   5824  N  NE  . ARG E 1 17  ? -0.680 3.271   -23.783 1.00 67.69 ? 101 ARG E NE  1 
ATOM   5825  C  CZ  . ARG E 1 17  ? -1.131 3.034   -25.015 1.00 70.12 ? 101 ARG E CZ  1 
ATOM   5826  N  NH1 . ARG E 1 17  ? -0.759 3.834   -26.014 1.00 70.22 ? 101 ARG E NH1 1 
ATOM   5827  N  NH2 . ARG E 1 17  ? -1.945 2.008   -25.257 1.00 67.83 ? 101 ARG E NH2 1 
ATOM   5828  N  N   . ILE E 1 18  ? 3.571  4.841   -19.154 1.00 53.57 ? 102 ILE E N   1 
ATOM   5829  C  CA  . ILE E 1 18  ? 4.988  4.985   -19.058 1.00 51.98 ? 102 ILE E CA  1 
ATOM   5830  C  C   . ILE E 1 18  ? 5.649  5.113   -20.415 1.00 51.29 ? 102 ILE E C   1 
ATOM   5831  O  O   . ILE E 1 18  ? 5.474  4.257   -21.267 1.00 51.41 ? 102 ILE E O   1 
ATOM   5832  C  CB  . ILE E 1 18  ? 5.568  3.764   -18.430 1.00 51.97 ? 102 ILE E CB  1 
ATOM   5833  C  CG1 . ILE E 1 18  ? 4.892  3.537   -17.064 1.00 49.81 ? 102 ILE E CG1 1 
ATOM   5834  C  CG2 . ILE E 1 18  ? 7.129  3.911   -18.390 1.00 50.75 ? 102 ILE E CG2 1 
ATOM   5835  C  CD1 . ILE E 1 18  ? 5.230  2.164   -16.428 1.00 48.02 ? 102 ILE E CD1 1 
ATOM   5836  N  N   . CYS E 1 19  ? 6.413  6.183   -20.590 1.00 50.39 ? 103 CYS E N   1 
ATOM   5837  C  CA  . CYS E 1 19  ? 7.253  6.374   -21.750 1.00 48.81 ? 103 CYS E CA  1 
ATOM   5838  C  C   . CYS E 1 19  ? 8.400  5.377   -21.762 1.00 47.52 ? 103 CYS E C   1 
ATOM   5839  O  O   . CYS E 1 19  ? 9.079  5.231   -20.773 1.00 47.18 ? 103 CYS E O   1 
ATOM   5840  C  CB  . CYS E 1 19  ? 7.839  7.737   -21.688 1.00 47.85 ? 103 CYS E CB  1 
ATOM   5841  S  SG  . CYS E 1 19  ? 8.759  8.102   -23.137 1.00 52.72 ? 103 CYS E SG  1 
ATOM   5842  N  N   . VAL E 1 20  ? 8.570  4.633   -22.846 1.00 46.37 ? 104 VAL E N   1 
ATOM   5843  C  CA  . VAL E 1 20  ? 9.672  3.677   -22.906 1.00 45.57 ? 104 VAL E CA  1 
ATOM   5844  C  C   . VAL E 1 20  ? 10.510 4.050   -24.081 1.00 45.08 ? 104 VAL E C   1 
ATOM   5845  O  O   . VAL E 1 20  ? 10.022 4.289   -25.199 1.00 44.49 ? 104 VAL E O   1 
ATOM   5846  C  CB  . VAL E 1 20  ? 9.253  2.246   -23.042 1.00 45.84 ? 104 VAL E CB  1 
ATOM   5847  C  CG1 . VAL E 1 20  ? 10.437 1.300   -22.795 1.00 45.58 ? 104 VAL E CG1 1 
ATOM   5848  C  CG2 . VAL E 1 20  ? 8.201  1.956   -22.045 1.00 46.41 ? 104 VAL E CG2 1 
ATOM   5849  N  N   . VAL E 1 21  ? 11.793 4.152   -23.765 1.00 44.45 ? 105 VAL E N   1 
ATOM   5850  C  CA  . VAL E 1 21  ? 12.810 4.604   -24.693 1.00 42.74 ? 105 VAL E CA  1 
ATOM   5851  C  C   . VAL E 1 21  ? 13.707 3.412   -24.972 1.00 41.41 ? 105 VAL E C   1 
ATOM   5852  O  O   . VAL E 1 21  ? 14.116 2.652   -24.088 1.00 38.13 ? 105 VAL E O   1 
ATOM   5853  C  CB  . VAL E 1 21  ? 13.465 5.856   -24.208 1.00 42.49 ? 105 VAL E CB  1 
ATOM   5854  C  CG1 . VAL E 1 21  ? 14.842 5.943   -24.683 1.00 43.31 ? 105 VAL E CG1 1 
ATOM   5855  C  CG2 . VAL E 1 21  ? 12.651 7.010   -24.750 1.00 44.59 ? 105 VAL E CG2 1 
ATOM   5856  N  N   . ILE E 1 22  ? 13.849 3.218   -26.270 1.00 41.09 ? 106 ILE E N   1 
ATOM   5857  C  CA  . ILE E 1 22  ? 14.342 2.000   -26.830 1.00 40.99 ? 106 ILE E CA  1 
ATOM   5858  C  C   . ILE E 1 22  ? 15.330 2.425   -27.882 1.00 41.04 ? 106 ILE E C   1 
ATOM   5859  O  O   . ILE E 1 22  ? 15.058 3.360   -28.708 1.00 39.43 ? 106 ILE E O   1 
ATOM   5860  C  CB  . ILE E 1 22  ? 13.209 1.202   -27.488 1.00 41.72 ? 106 ILE E CB  1 
ATOM   5861  C  CG1 . ILE E 1 22  ? 11.993 1.124   -26.551 1.00 40.40 ? 106 ILE E CG1 1 
ATOM   5862  C  CG2 . ILE E 1 22  ? 13.669 -0.185  -27.820 1.00 42.48 ? 106 ILE E CG2 1 
ATOM   5863  C  CD1 . ILE E 1 22  ? 10.760 0.387   -27.175 1.00 40.33 ? 106 ILE E CD1 1 
ATOM   5864  N  N   . ASP E 1 23  ? 16.486 1.755   -27.788 1.00 40.17 ? 107 ASP E N   1 
ATOM   5865  C  CA  . ASP E 1 23  ? 17.569 1.876   -28.715 1.00 39.96 ? 107 ASP E CA  1 
ATOM   5866  C  C   . ASP E 1 23  ? 17.533 0.820   -29.820 1.00 39.12 ? 107 ASP E C   1 
ATOM   5867  O  O   . ASP E 1 23  ? 17.228 -0.342  -29.577 1.00 40.08 ? 107 ASP E O   1 
ATOM   5868  C  CB  . ASP E 1 23  ? 18.841 1.633   -27.926 1.00 41.83 ? 107 ASP E CB  1 
ATOM   5869  C  CG  . ASP E 1 23  ? 20.103 1.728   -28.783 1.00 43.25 ? 107 ASP E CG  1 
ATOM   5870  O  OD1 . ASP E 1 23  ? 20.367 2.800   -29.384 1.00 43.74 ? 107 ASP E OD1 1 
ATOM   5871  O  OD2 . ASP E 1 23  ? 20.805 0.701   -28.846 1.00 46.29 ? 107 ASP E OD2 1 
ATOM   5872  N  N   . LEU E 1 24  ? 18.001 1.219   -30.995 1.00 37.71 ? 108 LEU E N   1 
ATOM   5873  C  CA  . LEU E 1 24  ? 18.043 0.443   -32.222 1.00 35.60 ? 108 LEU E CA  1 
ATOM   5874  C  C   . LEU E 1 24  ? 19.177 -0.602  -32.319 1.00 35.70 ? 108 LEU E C   1 
ATOM   5875  O  O   . LEU E 1 24  ? 18.979 -1.822  -32.085 1.00 34.69 ? 108 LEU E O   1 
ATOM   5876  C  CB  . LEU E 1 24  ? 18.108 1.463   -33.366 1.00 35.96 ? 108 LEU E CB  1 
ATOM   5877  C  CG  . LEU E 1 24  ? 17.839 0.953   -34.772 1.00 36.53 ? 108 LEU E CG  1 
ATOM   5878  C  CD1 . LEU E 1 24  ? 16.504 0.280   -34.760 1.00 36.46 ? 108 LEU E CD1 1 
ATOM   5879  C  CD2 . LEU E 1 24  ? 17.937 2.058   -35.807 1.00 32.70 ? 108 LEU E CD2 1 
ATOM   5880  N  N   . ASP E 1 25  ? 20.369 -0.119  -32.632 1.00 36.37 ? 109 ASP E N   1 
ATOM   5881  C  CA  . ASP E 1 25  ? 21.562 -0.965  -32.799 1.00 37.58 ? 109 ASP E CA  1 
ATOM   5882  C  C   . ASP E 1 25  ? 21.888 -1.891  -31.669 1.00 36.49 ? 109 ASP E C   1 
ATOM   5883  O  O   . ASP E 1 25  ? 21.993 -1.492  -30.534 1.00 36.03 ? 109 ASP E O   1 
ATOM   5884  C  CB  . ASP E 1 25  ? 22.778 -0.112  -33.115 1.00 38.61 ? 109 ASP E CB  1 
ATOM   5885  C  CG  . ASP E 1 25  ? 22.727 0.431   -34.513 1.00 42.94 ? 109 ASP E CG  1 
ATOM   5886  O  OD1 . ASP E 1 25  ? 22.194 -0.289  -35.426 1.00 44.88 ? 109 ASP E OD1 1 
ATOM   5887  O  OD2 . ASP E 1 25  ? 23.212 1.582   -34.685 1.00 48.93 ? 109 ASP E OD2 1 
ATOM   5888  N  N   . GLU E 1 26  ? 22.030 -3.154  -32.011 1.00 36.56 ? 110 GLU E N   1 
ATOM   5889  C  CA  . GLU E 1 26  ? 22.328 -4.206  -31.045 1.00 36.89 ? 110 GLU E CA  1 
ATOM   5890  C  C   . GLU E 1 26  ? 21.290 -4.389  -29.954 1.00 37.53 ? 110 GLU E C   1 
ATOM   5891  O  O   . GLU E 1 26  ? 21.435 -5.276  -29.088 1.00 38.35 ? 110 GLU E O   1 
ATOM   5892  C  CB  . GLU E 1 26  ? 23.715 -4.040  -30.456 1.00 36.80 ? 110 GLU E CB  1 
ATOM   5893  C  CG  . GLU E 1 26  ? 24.826 -4.425  -31.411 1.00 35.82 ? 110 GLU E CG  1 
ATOM   5894  C  CD  . GLU E 1 26  ? 25.082 -3.405  -32.504 1.00 39.54 ? 110 GLU E CD  1 
ATOM   5895  O  OE1 . GLU E 1 26  ? 25.280 -2.200  -32.205 1.00 38.42 ? 110 GLU E OE1 1 
ATOM   5896  O  OE2 . GLU E 1 26  ? 25.074 -3.805  -33.713 1.00 43.74 ? 110 GLU E OE2 1 
ATOM   5897  N  N   . THR E 1 27  ? 20.245 -3.573  -29.985 1.00 37.71 ? 111 THR E N   1 
ATOM   5898  C  CA  . THR E 1 27  ? 19.123 -3.757  -29.065 1.00 38.52 ? 111 THR E CA  1 
ATOM   5899  C  C   . THR E 1 27  ? 17.984 -4.490  -29.819 1.00 38.42 ? 111 THR E C   1 
ATOM   5900  O  O   . THR E 1 27  ? 17.623 -5.600  -29.481 1.00 38.67 ? 111 THR E O   1 
ATOM   5901  C  CB  . THR E 1 27  ? 18.588 -2.430  -28.513 1.00 38.83 ? 111 THR E CB  1 
ATOM   5902  O  OG1 . THR E 1 27  ? 19.675 -1.601  -28.083 1.00 38.29 ? 111 THR E OG1 1 
ATOM   5903  C  CG2 . THR E 1 27  ? 17.570 -2.695  -27.365 1.00 37.86 ? 111 THR E CG2 1 
ATOM   5904  N  N   . LEU E 1 28  ? 17.507 -3.846  -30.872 1.00 38.25 ? 112 LEU E N   1 
ATOM   5905  C  CA  . LEU E 1 28  ? 16.433 -4.306  -31.718 1.00 37.89 ? 112 LEU E CA  1 
ATOM   5906  C  C   . LEU E 1 28  ? 16.984 -4.944  -32.961 1.00 38.22 ? 112 LEU E C   1 
ATOM   5907  O  O   . LEU E 1 28  ? 16.537 -6.014  -33.316 1.00 39.65 ? 112 LEU E O   1 
ATOM   5908  C  CB  . LEU E 1 28  ? 15.528 -3.112  -32.135 1.00 36.91 ? 112 LEU E CB  1 
ATOM   5909  C  CG  . LEU E 1 28  ? 14.673 -2.500  -31.011 1.00 34.74 ? 112 LEU E CG  1 
ATOM   5910  C  CD1 . LEU E 1 28  ? 13.599 -1.620  -31.589 1.00 34.18 ? 112 LEU E CD1 1 
ATOM   5911  C  CD2 . LEU E 1 28  ? 14.096 -3.611  -30.116 1.00 27.83 ? 112 LEU E CD2 1 
ATOM   5912  N  N   . VAL E 1 29  ? 17.925 -4.270  -33.631 1.00 37.98 ? 113 VAL E N   1 
ATOM   5913  C  CA  . VAL E 1 29  ? 18.607 -4.821  -34.825 1.00 37.89 ? 113 VAL E CA  1 
ATOM   5914  C  C   . VAL E 1 29  ? 20.119 -5.036  -34.706 1.00 39.02 ? 113 VAL E C   1 
ATOM   5915  O  O   . VAL E 1 29  ? 20.709 -4.935  -33.625 1.00 40.56 ? 113 VAL E O   1 
ATOM   5916  C  CB  . VAL E 1 29  ? 18.327 -4.028  -36.075 1.00 36.23 ? 113 VAL E CB  1 
ATOM   5917  C  CG1 . VAL E 1 29  ? 16.854 -4.064  -36.352 1.00 35.74 ? 113 VAL E CG1 1 
ATOM   5918  C  CG2 . VAL E 1 29  ? 18.742 -2.665  -35.902 1.00 34.28 ? 113 VAL E CG2 1 
ATOM   5919  N  N   . HIS E 1 30  ? 20.745 -5.388  -35.816 1.00 39.22 ? 114 HIS E N   1 
ATOM   5920  C  CA  . HIS E 1 30  ? 22.208 -5.410  -35.907 1.00 38.32 ? 114 HIS E CA  1 
ATOM   5921  C  C   . HIS E 1 30  ? 22.522 -5.267  -37.382 1.00 38.37 ? 114 HIS E C   1 
ATOM   5922  O  O   . HIS E 1 30  ? 21.981 -6.011  -38.194 1.00 39.57 ? 114 HIS E O   1 
ATOM   5923  C  CB  . HIS E 1 30  ? 22.812 -6.666  -35.366 1.00 38.00 ? 114 HIS E CB  1 
ATOM   5924  C  CG  . HIS E 1 30  ? 24.286 -6.731  -35.592 1.00 42.59 ? 114 HIS E CG  1 
ATOM   5925  N  ND1 . HIS E 1 30  ? 25.179 -5.906  -34.932 1.00 42.60 ? 114 HIS E ND1 1 
ATOM   5926  C  CD2 . HIS E 1 30  ? 25.022 -7.465  -36.456 1.00 41.87 ? 114 HIS E CD2 1 
ATOM   5927  C  CE1 . HIS E 1 30  ? 26.396 -6.145  -35.365 1.00 40.64 ? 114 HIS E CE1 1 
ATOM   5928  N  NE2 . HIS E 1 30  ? 26.333 -7.093  -36.281 1.00 43.26 ? 114 HIS E NE2 1 
ATOM   5929  N  N   . SER E 1 31  ? 23.337 -4.266  -37.723 1.00 37.79 ? 115 SER E N   1 
ATOM   5930  C  CA  . SER E 1 31  ? 23.651 -3.867  -39.095 1.00 36.42 ? 115 SER E CA  1 
ATOM   5931  C  C   . SER E 1 31  ? 25.080 -4.190  -39.420 1.00 35.32 ? 115 SER E C   1 
ATOM   5932  O  O   . SER E 1 31  ? 25.869 -4.498  -38.524 1.00 34.79 ? 115 SER E O   1 
ATOM   5933  C  CB  . SER E 1 31  ? 23.521 -2.382  -39.222 1.00 36.28 ? 115 SER E CB  1 
ATOM   5934  O  OG  . SER E 1 31  ? 22.167 -2.082  -39.320 1.00 41.42 ? 115 SER E OG  1 
ATOM   5935  N  N   . SER E 1 32  ? 25.408 -4.148  -40.708 1.00 33.62 ? 116 SER E N   1 
ATOM   5936  C  CA  . SER E 1 32  ? 26.748 -4.462  -41.137 1.00 32.42 ? 116 SER E CA  1 
ATOM   5937  C  C   . SER E 1 32  ? 26.850 -4.048  -42.550 1.00 31.57 ? 116 SER E C   1 
ATOM   5938  O  O   . SER E 1 32  ? 25.825 -4.056  -43.275 1.00 30.29 ? 116 SER E O   1 
ATOM   5939  C  CB  . SER E 1 32  ? 27.003 -5.971  -41.015 1.00 32.63 ? 116 SER E CB  1 
ATOM   5940  O  OG  . SER E 1 32  ? 28.221 -6.328  -41.613 1.00 32.90 ? 116 SER E OG  1 
ATOM   5941  N  N   . PHE E 1 33  ? 28.071 -3.631  -42.916 1.00 31.12 ? 117 PHE E N   1 
ATOM   5942  C  CA  . PHE E 1 33  ? 28.436 -3.270  -44.299 1.00 31.41 ? 117 PHE E CA  1 
ATOM   5943  C  C   . PHE E 1 33  ? 28.945 -4.480  -45.074 1.00 31.09 ? 117 PHE E C   1 
ATOM   5944  O  O   . PHE E 1 33  ? 29.055 -4.400  -46.263 1.00 30.81 ? 117 PHE E O   1 
ATOM   5945  C  CB  . PHE E 1 33  ? 29.514 -2.203  -44.400 1.00 31.11 ? 117 PHE E CB  1 
ATOM   5946  C  CG  . PHE E 1 33  ? 29.131 -0.875  -43.895 1.00 32.21 ? 117 PHE E CG  1 
ATOM   5947  C  CD1 . PHE E 1 33  ? 29.516 -0.471  -42.618 1.00 35.87 ? 117 PHE E CD1 1 
ATOM   5948  C  CD2 . PHE E 1 33  ? 28.484 0.022   -44.697 1.00 31.90 ? 117 PHE E CD2 1 
ATOM   5949  C  CE1 . PHE E 1 33  ? 29.173 0.782   -42.151 1.00 33.77 ? 117 PHE E CE1 1 
ATOM   5950  C  CE2 . PHE E 1 33  ? 28.138 1.251   -44.247 1.00 31.25 ? 117 PHE E CE2 1 
ATOM   5951  C  CZ  . PHE E 1 33  ? 28.470 1.637   -42.974 1.00 31.65 ? 117 PHE E CZ  1 
ATOM   5952  N  N   . LYS E 1 34  ? 29.264 -5.573  -44.410 1.00 31.21 ? 118 LYS E N   1 
ATOM   5953  C  CA  . LYS E 1 34  ? 29.541 -6.786  -45.129 1.00 33.58 ? 118 LYS E CA  1 
ATOM   5954  C  C   . LYS E 1 34  ? 28.247 -7.527  -45.549 1.00 35.07 ? 118 LYS E C   1 
ATOM   5955  O  O   . LYS E 1 34  ? 27.468 -7.920  -44.713 1.00 34.21 ? 118 LYS E O   1 
ATOM   5956  C  CB  . LYS E 1 34  ? 30.429 -7.698  -44.311 1.00 32.78 ? 118 LYS E CB  1 
ATOM   5957  C  CG  . LYS E 1 34  ? 30.286 -9.106  -44.729 1.00 35.11 ? 118 LYS E CG  1 
ATOM   5958  C  CD  . LYS E 1 34  ? 31.474 -9.892  -44.404 1.00 37.46 ? 118 LYS E CD  1 
ATOM   5959  C  CE  . LYS E 1 34  ? 31.756 -10.777 -45.572 1.00 39.96 ? 118 LYS E CE  1 
ATOM   5960  N  NZ  . LYS E 1 34  ? 32.277 -11.986 -44.892 1.00 47.92 ? 118 LYS E NZ  1 
ATOM   5961  N  N   . PRO E 1 35  ? 28.050 -7.741  -46.866 1.00 37.05 ? 119 PRO E N   1 
ATOM   5962  C  CA  . PRO E 1 35  ? 26.862 -8.371  -47.428 1.00 37.63 ? 119 PRO E CA  1 
ATOM   5963  C  C   . PRO E 1 35  ? 26.550 -9.657  -46.727 1.00 37.78 ? 119 PRO E C   1 
ATOM   5964  O  O   . PRO E 1 35  ? 27.416 -10.488 -46.601 1.00 36.98 ? 119 PRO E O   1 
ATOM   5965  C  CB  . PRO E 1 35  ? 27.281 -8.685  -48.865 1.00 37.03 ? 119 PRO E CB  1 
ATOM   5966  C  CG  . PRO E 1 35  ? 28.169 -7.601  -49.193 1.00 37.13 ? 119 PRO E CG  1 
ATOM   5967  C  CD  . PRO E 1 35  ? 28.995 -7.360  -47.932 1.00 37.29 ? 119 PRO E CD  1 
ATOM   5968  N  N   . ILE E 1 36  ? 25.330 -9.775  -46.230 1.00 39.03 ? 120 ILE E N   1 
ATOM   5969  C  CA  . ILE E 1 36  ? 24.813 -11.079 -45.894 1.00 40.46 ? 120 ILE E CA  1 
ATOM   5970  C  C   . ILE E 1 36  ? 23.629 -11.510 -46.717 1.00 40.14 ? 120 ILE E C   1 
ATOM   5971  O  O   . ILE E 1 36  ? 22.847 -10.722 -47.237 1.00 38.45 ? 120 ILE E O   1 
ATOM   5972  C  CB  . ILE E 1 36  ? 24.481 -11.325 -44.406 1.00 41.20 ? 120 ILE E CB  1 
ATOM   5973  C  CG1 . ILE E 1 36  ? 23.679 -10.190 -43.797 1.00 40.28 ? 120 ILE E CG1 1 
ATOM   5974  C  CG2 . ILE E 1 36  ? 25.823 -11.798 -43.622 1.00 44.97 ? 120 ILE E CG2 1 
ATOM   5975  C  CD1 . ILE E 1 36  ? 24.558 -9.254  -42.851 1.00 42.95 ? 120 ILE E CD1 1 
ATOM   5976  N  N   . ASN E 1 37  ? 23.550 -12.814 -46.813 1.00 40.43 ? 121 ASN E N   1 
ATOM   5977  C  CA  . ASN E 1 37  ? 22.521 -13.453 -47.523 1.00 42.77 ? 121 ASN E CA  1 
ATOM   5978  C  C   . ASN E 1 37  ? 21.237 -13.586 -46.676 1.00 42.99 ? 121 ASN E C   1 
ATOM   5979  O  O   . ASN E 1 37  ? 21.276 -13.927 -45.475 1.00 43.54 ? 121 ASN E O   1 
ATOM   5980  C  CB  . ASN E 1 37  ? 23.061 -14.787 -47.993 1.00 42.62 ? 121 ASN E CB  1 
ATOM   5981  C  CG  . ASN E 1 37  ? 22.085 -15.503 -48.794 1.00 47.65 ? 121 ASN E CG  1 
ATOM   5982  O  OD1 . ASN E 1 37  ? 21.160 -14.894 -49.373 1.00 51.65 ? 121 ASN E OD1 1 
ATOM   5983  N  ND2 . ASN E 1 37  ? 22.219 -16.808 -48.826 1.00 51.09 ? 121 ASN E ND2 1 
ATOM   5984  N  N   . ASN E 1 38  ? 20.083 -13.312 -47.271 1.00 44.00 ? 122 ASN E N   1 
ATOM   5985  C  CA  . ASN E 1 38  ? 18.835 -13.414 -46.475 1.00 44.53 ? 122 ASN E CA  1 
ATOM   5986  C  C   . ASN E 1 38  ? 18.888 -12.408 -45.312 1.00 43.75 ? 122 ASN E C   1 
ATOM   5987  O  O   . ASN E 1 38  ? 18.579 -12.738 -44.163 1.00 44.29 ? 122 ASN E O   1 
ATOM   5988  C  CB  . ASN E 1 38  ? 18.690 -14.869 -45.925 1.00 44.91 ? 122 ASN E CB  1 
ATOM   5989  C  CG  . ASN E 1 38  ? 17.231 -15.321 -45.755 1.00 45.95 ? 122 ASN E CG  1 
ATOM   5990  O  OD1 . ASN E 1 38  ? 16.971 -16.337 -45.117 1.00 46.24 ? 122 ASN E OD1 1 
ATOM   5991  N  ND2 . ASN E 1 38  ? 16.290 -14.578 -46.331 1.00 44.90 ? 122 ASN E ND2 1 
ATOM   5992  N  N   . ALA E 1 39  ? 19.346 -11.202 -45.593 1.00 42.26 ? 123 ALA E N   1 
ATOM   5993  C  CA  . ALA E 1 39  ? 19.140 -10.124 -44.669 1.00 41.80 ? 123 ALA E CA  1 
ATOM   5994  C  C   . ALA E 1 39  ? 17.631 -9.895  -44.528 1.00 41.64 ? 123 ALA E C   1 
ATOM   5995  O  O   . ALA E 1 39  ? 16.903 -10.025 -45.482 1.00 42.62 ? 123 ALA E O   1 
ATOM   5996  C  CB  . ALA E 1 39  ? 19.808 -8.857  -45.188 1.00 41.77 ? 123 ALA E CB  1 
ATOM   5997  N  N   . ASP E 1 40  ? 17.149 -9.520  -43.361 1.00 41.04 ? 124 ASP E N   1 
ATOM   5998  C  CA  . ASP E 1 40  ? 15.826 -8.889  -43.291 1.00 40.30 ? 124 ASP E CA  1 
ATOM   5999  C  C   . ASP E 1 40  ? 15.695 -7.546  -44.017 1.00 40.04 ? 124 ASP E C   1 
ATOM   6000  O  O   . ASP E 1 40  ? 14.714 -7.301  -44.689 1.00 40.25 ? 124 ASP E O   1 
ATOM   6001  C  CB  . ASP E 1 40  ? 15.456 -8.727  -41.853 1.00 39.73 ? 124 ASP E CB  1 
ATOM   6002  C  CG  . ASP E 1 40  ? 15.473 -9.992  -41.166 1.00 40.24 ? 124 ASP E CG  1 
ATOM   6003  O  OD1 . ASP E 1 40  ? 14.598 -10.800 -41.488 1.00 49.98 ? 124 ASP E OD1 1 
ATOM   6004  O  OD2 . ASP E 1 40  ? 16.324 -10.238 -40.309 1.00 42.57 ? 124 ASP E OD2 1 
ATOM   6005  N  N   . PHE E 1 41  ? 16.664 -6.657  -43.894 1.00 40.50 ? 125 PHE E N   1 
ATOM   6006  C  CA  . PHE E 1 41  ? 16.585 -5.396  -44.673 1.00 41.16 ? 125 PHE E CA  1 
ATOM   6007  C  C   . PHE E 1 41  ? 17.947 -5.086  -45.266 1.00 40.55 ? 125 PHE E C   1 
ATOM   6008  O  O   . PHE E 1 41  ? 18.995 -5.491  -44.694 1.00 40.33 ? 125 PHE E O   1 
ATOM   6009  C  CB  . PHE E 1 41  ? 16.068 -4.146  -43.874 1.00 42.58 ? 125 PHE E CB  1 
ATOM   6010  C  CG  . PHE E 1 41  ? 15.017 -4.452  -42.859 1.00 45.23 ? 125 PHE E CG  1 
ATOM   6011  C  CD1 . PHE E 1 41  ? 15.312 -4.400  -41.510 1.00 47.21 ? 125 PHE E CD1 1 
ATOM   6012  C  CD2 . PHE E 1 41  ? 13.740 -4.827  -43.247 1.00 48.15 ? 125 PHE E CD2 1 
ATOM   6013  C  CE1 . PHE E 1 41  ? 14.354 -4.718  -40.544 1.00 48.12 ? 125 PHE E CE1 1 
ATOM   6014  C  CE2 . PHE E 1 41  ? 12.765 -5.150  -42.283 1.00 48.11 ? 125 PHE E CE2 1 
ATOM   6015  C  CZ  . PHE E 1 41  ? 13.082 -5.099  -40.937 1.00 47.30 ? 125 PHE E CZ  1 
ATOM   6016  N  N   . ILE E 1 42  ? 17.901 -4.365  -46.395 1.00 39.14 ? 126 ILE E N   1 
ATOM   6017  C  CA  . ILE E 1 42  ? 19.045 -3.782  -47.006 1.00 38.99 ? 126 ILE E CA  1 
ATOM   6018  C  C   . ILE E 1 42  ? 18.744 -2.295  -47.262 1.00 40.74 ? 126 ILE E C   1 
ATOM   6019  O  O   . ILE E 1 42  ? 17.790 -1.948  -48.003 1.00 41.60 ? 126 ILE E O   1 
ATOM   6020  C  CB  . ILE E 1 42  ? 19.394 -4.491  -48.297 1.00 38.35 ? 126 ILE E CB  1 
ATOM   6021  C  CG1 . ILE E 1 42  ? 19.597 -5.968  -48.029 1.00 36.75 ? 126 ILE E CG1 1 
ATOM   6022  C  CG2 . ILE E 1 42  ? 20.694 -3.893  -48.922 1.00 38.94 ? 126 ILE E CG2 1 
ATOM   6023  C  CD1 . ILE E 1 42  ? 20.121 -6.766  -49.226 1.00 28.73 ? 126 ILE E CD1 1 
ATOM   6024  N  N   . VAL E 1 43  ? 19.518 -1.383  -46.675 1.00 40.49 ? 127 VAL E N   1 
ATOM   6025  C  CA  . VAL E 1 43  ? 19.147 0.028   -46.918 1.00 41.06 ? 127 VAL E CA  1 
ATOM   6026  C  C   . VAL E 1 43  ? 20.336 0.773   -47.455 1.00 41.07 ? 127 VAL E C   1 
ATOM   6027  O  O   . VAL E 1 43  ? 21.398 0.651   -46.920 1.00 40.20 ? 127 VAL E O   1 
ATOM   6028  C  CB  . VAL E 1 43  ? 18.410 0.759   -45.673 1.00 40.61 ? 127 VAL E CB  1 
ATOM   6029  C  CG1 . VAL E 1 43  ? 17.562 -0.231  -44.859 1.00 40.49 ? 127 VAL E CG1 1 
ATOM   6030  C  CG2 . VAL E 1 43  ? 19.369 1.434   -44.749 1.00 40.42 ? 127 VAL E CG2 1 
ATOM   6031  N  N   . PRO E 1 44  ? 20.153 1.493   -48.567 1.00 42.54 ? 128 PRO E N   1 
ATOM   6032  C  CA  . PRO E 1 44  ? 21.294 2.175   -49.181 1.00 43.19 ? 128 PRO E CA  1 
ATOM   6033  C  C   . PRO E 1 44  ? 21.536 3.438   -48.438 1.00 44.71 ? 128 PRO E C   1 
ATOM   6034  O  O   . PRO E 1 44  ? 20.595 4.105   -48.060 1.00 46.00 ? 128 PRO E O   1 
ATOM   6035  C  CB  . PRO E 1 44  ? 20.794 2.513   -50.593 1.00 42.83 ? 128 PRO E CB  1 
ATOM   6036  C  CG  . PRO E 1 44  ? 19.289 2.569   -50.494 1.00 41.71 ? 128 PRO E CG  1 
ATOM   6037  C  CD  . PRO E 1 44  ? 18.885 1.688   -49.323 1.00 41.94 ? 128 PRO E CD  1 
ATOM   6038  N  N   . ILE E 1 45  ? 22.778 3.800   -48.248 1.00 46.00 ? 129 ILE E N   1 
ATOM   6039  C  CA  . ILE E 1 45  ? 23.073 4.968   -47.456 1.00 48.38 ? 129 ILE E CA  1 
ATOM   6040  C  C   . ILE E 1 45  ? 24.170 5.789   -48.168 1.00 49.94 ? 129 ILE E C   1 
ATOM   6041  O  O   . ILE E 1 45  ? 25.053 5.222   -48.757 1.00 50.49 ? 129 ILE E O   1 
ATOM   6042  C  CB  . ILE E 1 45  ? 23.358 4.503   -45.990 1.00 48.23 ? 129 ILE E CB  1 
ATOM   6043  C  CG1 . ILE E 1 45  ? 22.025 4.290   -45.306 1.00 48.37 ? 129 ILE E CG1 1 
ATOM   6044  C  CG2 . ILE E 1 45  ? 24.137 5.499   -45.175 1.00 47.83 ? 129 ILE E CG2 1 
ATOM   6045  C  CD1 . ILE E 1 45  ? 22.073 3.325   -44.228 1.00 48.44 ? 129 ILE E CD1 1 
ATOM   6046  N  N   . GLU E 1 46  ? 24.068 7.108   -48.168 1.00 52.34 ? 130 GLU E N   1 
ATOM   6047  C  CA  . GLU E 1 46  ? 25.003 7.919   -48.909 1.00 55.95 ? 130 GLU E CA  1 
ATOM   6048  C  C   . GLU E 1 46  ? 26.066 8.360   -47.914 1.00 56.65 ? 130 GLU E C   1 
ATOM   6049  O  O   . GLU E 1 46  ? 25.761 8.964   -46.896 1.00 57.42 ? 130 GLU E O   1 
ATOM   6050  C  CB  . GLU E 1 46  ? 24.298 9.118   -49.580 1.00 56.80 ? 130 GLU E CB  1 
ATOM   6051  C  CG  . GLU E 1 46  ? 24.755 9.410   -51.073 1.00 63.62 ? 130 GLU E CG  1 
ATOM   6052  C  CD  . GLU E 1 46  ? 25.205 10.913  -51.360 1.00 70.85 ? 130 GLU E CD  1 
ATOM   6053  O  OE1 . GLU E 1 46  ? 25.843 11.170  -52.439 1.00 70.25 ? 130 GLU E OE1 1 
ATOM   6054  O  OE2 . GLU E 1 46  ? 24.930 11.823  -50.505 1.00 72.63 ? 130 GLU E OE2 1 
ATOM   6055  N  N   . ILE E 1 47  ? 27.312 7.993   -48.156 1.00 57.74 ? 131 ILE E N   1 
ATOM   6056  C  CA  . ILE E 1 47  ? 28.369 8.368   -47.220 1.00 58.83 ? 131 ILE E CA  1 
ATOM   6057  C  C   . ILE E 1 47  ? 29.525 8.967   -47.998 1.00 59.69 ? 131 ILE E C   1 
ATOM   6058  O  O   . ILE E 1 47  ? 30.201 8.270   -48.771 1.00 60.81 ? 131 ILE E O   1 
ATOM   6059  C  CB  . ILE E 1 47  ? 28.822 7.196   -46.290 1.00 58.72 ? 131 ILE E CB  1 
ATOM   6060  C  CG1 . ILE E 1 47  ? 27.647 6.710   -45.418 1.00 59.25 ? 131 ILE E CG1 1 
ATOM   6061  C  CG2 . ILE E 1 47  ? 29.966 7.648   -45.424 1.00 58.15 ? 131 ILE E CG2 1 
ATOM   6062  C  CD1 . ILE E 1 47  ? 27.936 5.538   -44.429 1.00 57.95 ? 131 ILE E CD1 1 
ATOM   6063  N  N   . GLU E 1 48  ? 29.689 10.277  -47.820 1.00 60.34 ? 132 GLU E N   1 
ATOM   6064  C  CA  . GLU E 1 48  ? 30.704 11.093  -48.501 1.00 60.58 ? 132 GLU E CA  1 
ATOM   6065  C  C   . GLU E 1 48  ? 30.643 11.016  -50.056 1.00 59.42 ? 132 GLU E C   1 
ATOM   6066  O  O   . GLU E 1 48  ? 31.664 10.978  -50.766 1.00 59.20 ? 132 GLU E O   1 
ATOM   6067  C  CB  . GLU E 1 48  ? 32.103 10.858  -47.859 1.00 61.08 ? 132 GLU E CB  1 
ATOM   6068  C  CG  . GLU E 1 48  ? 32.273 11.704  -46.563 1.00 65.49 ? 132 GLU E CG  1 
ATOM   6069  C  CD  . GLU E 1 48  ? 33.137 11.052  -45.451 1.00 72.19 ? 132 GLU E CD  1 
ATOM   6070  O  OE1 . GLU E 1 48  ? 34.285 10.603  -45.731 1.00 75.03 ? 132 GLU E OE1 1 
ATOM   6071  O  OE2 . GLU E 1 48  ? 32.675 11.013  -44.276 1.00 72.92 ? 132 GLU E OE2 1 
ATOM   6072  N  N   . GLY E 1 49  ? 29.414 11.002  -50.566 1.00 58.42 ? 133 GLY E N   1 
ATOM   6073  C  CA  . GLY E 1 49  ? 29.157 10.950  -52.010 1.00 56.97 ? 133 GLY E CA  1 
ATOM   6074  C  C   . GLY E 1 49  ? 28.975 9.556   -52.613 1.00 56.35 ? 133 GLY E C   1 
ATOM   6075  O  O   . GLY E 1 49  ? 28.792 9.419   -53.829 1.00 56.78 ? 133 GLY E O   1 
ATOM   6076  N  N   . THR E 1 50  ? 29.041 8.505   -51.799 1.00 54.40 ? 134 THR E N   1 
ATOM   6077  C  CA  . THR E 1 50  ? 28.998 7.165   -52.377 1.00 52.76 ? 134 THR E CA  1 
ATOM   6078  C  C   . THR E 1 50  ? 27.976 6.368   -51.616 1.00 50.43 ? 134 THR E C   1 
ATOM   6079  O  O   . THR E 1 50  ? 27.866 6.553   -50.403 1.00 50.64 ? 134 THR E O   1 
ATOM   6080  C  CB  . THR E 1 50  ? 30.391 6.448   -52.373 1.00 53.33 ? 134 THR E CB  1 
ATOM   6081  O  OG1 . THR E 1 50  ? 30.418 5.389   -51.393 1.00 54.32 ? 134 THR E OG1 1 
ATOM   6082  C  CG2 . THR E 1 50  ? 31.530 7.445   -52.121 1.00 53.42 ? 134 THR E CG2 1 
ATOM   6083  N  N   . THR E 1 51  ? 27.221 5.511   -52.304 1.00 47.32 ? 135 THR E N   1 
ATOM   6084  C  CA  . THR E 1 51  ? 26.175 4.777   -51.598 1.00 45.58 ? 135 THR E CA  1 
ATOM   6085  C  C   . THR E 1 51  ? 26.657 3.424   -51.139 1.00 43.82 ? 135 THR E C   1 
ATOM   6086  O  O   . THR E 1 51  ? 27.273 2.711   -51.906 1.00 43.17 ? 135 THR E O   1 
ATOM   6087  C  CB  . THR E 1 51  ? 24.822 4.667   -52.324 1.00 44.99 ? 135 THR E CB  1 
ATOM   6088  O  OG1 . THR E 1 51  ? 24.890 3.657   -53.287 1.00 44.48 ? 135 THR E OG1 1 
ATOM   6089  C  CG2 . THR E 1 51  ? 24.440 5.932   -53.026 1.00 46.89 ? 135 THR E CG2 1 
ATOM   6090  N  N   . HIS E 1 52  ? 26.418 3.098   -49.876 1.00 42.48 ? 136 HIS E N   1 
ATOM   6091  C  CA  . HIS E 1 52  ? 26.754 1.786   -49.403 1.00 41.94 ? 136 HIS E CA  1 
ATOM   6092  C  C   . HIS E 1 52  ? 25.494 1.077   -48.985 1.00 40.79 ? 136 HIS E C   1 
ATOM   6093  O  O   . HIS E 1 52  ? 24.572 1.693   -48.504 1.00 40.08 ? 136 HIS E O   1 
ATOM   6094  C  CB  . HIS E 1 52  ? 27.700 1.849   -48.233 1.00 43.15 ? 136 HIS E CB  1 
ATOM   6095  C  CG  . HIS E 1 52  ? 28.872 2.749   -48.443 1.00 47.85 ? 136 HIS E CG  1 
ATOM   6096  N  ND1 . HIS E 1 52  ? 30.133 2.271   -48.735 1.00 50.95 ? 136 HIS E ND1 1 
ATOM   6097  C  CD2 . HIS E 1 52  ? 28.972 4.100   -48.414 1.00 51.56 ? 136 HIS E CD2 1 
ATOM   6098  C  CE1 . HIS E 1 52  ? 30.962 3.288   -48.875 1.00 52.51 ? 136 HIS E CE1 1 
ATOM   6099  N  NE2 . HIS E 1 52  ? 30.287 4.409   -48.665 1.00 55.02 ? 136 HIS E NE2 1 
ATOM   6100  N  N   . GLN E 1 53  ? 25.467 -0.232  -49.177 1.00 39.96 ? 137 GLN E N   1 
ATOM   6101  C  CA  . GLN E 1 53  ? 24.363 -1.059  -48.735 1.00 38.77 ? 137 GLN E CA  1 
ATOM   6102  C  C   . GLN E 1 53  ? 24.482 -1.369  -47.245 1.00 37.84 ? 137 GLN E C   1 
ATOM   6103  O  O   . GLN E 1 53  ? 25.489 -1.899  -46.782 1.00 37.82 ? 137 GLN E O   1 
ATOM   6104  C  CB  . GLN E 1 53  ? 24.308 -2.363  -49.557 1.00 38.82 ? 137 GLN E CB  1 
ATOM   6105  C  CG  . GLN E 1 53  ? 23.989 -2.229  -51.096 1.00 39.34 ? 137 GLN E CG  1 
ATOM   6106  C  CD  . GLN E 1 53  ? 22.887 -1.212  -51.450 1.00 40.13 ? 137 GLN E CD  1 
ATOM   6107  O  OE1 . GLN E 1 53  ? 21.904 -1.063  -50.751 1.00 42.80 ? 137 GLN E OE1 1 
ATOM   6108  N  NE2 . GLN E 1 53  ? 23.055 -0.539  -52.553 1.00 41.38 ? 137 GLN E NE2 1 
ATOM   6109  N  N   . VAL E 1 54  ? 23.462 -1.048  -46.474 1.00 36.42 ? 138 VAL E N   1 
ATOM   6110  C  CA  . VAL E 1 54  ? 23.456 -1.584  -45.138 1.00 35.36 ? 138 VAL E CA  1 
ATOM   6111  C  C   . VAL E 1 54  ? 22.587 -2.813  -45.070 1.00 34.79 ? 138 VAL E C   1 
ATOM   6112  O  O   . VAL E 1 54  ? 21.481 -2.784  -45.549 1.00 35.43 ? 138 VAL E O   1 
ATOM   6113  C  CB  . VAL E 1 54  ? 23.121 -0.499  -44.038 1.00 35.82 ? 138 VAL E CB  1 
ATOM   6114  C  CG1 . VAL E 1 54  ? 23.291 -1.084  -42.646 1.00 34.33 ? 138 VAL E CG1 1 
ATOM   6115  C  CG2 . VAL E 1 54  ? 24.047 0.745   -44.194 1.00 34.58 ? 138 VAL E CG2 1 
ATOM   6116  N  N   . TYR E 1 55  ? 23.107 -3.864  -44.432 1.00 34.88 ? 139 TYR E N   1 
ATOM   6117  C  CA  . TYR E 1 55  ? 22.527 -5.177  -44.333 1.00 35.59 ? 139 TYR E CA  1 
ATOM   6118  C  C   . TYR E 1 55  ? 22.082 -5.411  -42.889 1.00 36.88 ? 139 TYR E C   1 
ATOM   6119  O  O   . TYR E 1 55  ? 22.930 -5.549  -41.985 1.00 39.28 ? 139 TYR E O   1 
ATOM   6120  C  CB  . TYR E 1 55  ? 23.554 -6.252  -44.779 1.00 34.64 ? 139 TYR E CB  1 
ATOM   6121  C  CG  . TYR E 1 55  ? 23.925 -6.128  -46.243 1.00 35.62 ? 139 TYR E CG  1 
ATOM   6122  C  CD1 . TYR E 1 55  ? 24.799 -5.124  -46.682 1.00 37.02 ? 139 TYR E CD1 1 
ATOM   6123  C  CD2 . TYR E 1 55  ? 23.374 -6.974  -47.209 1.00 37.62 ? 139 TYR E CD2 1 
ATOM   6124  C  CE1 . TYR E 1 55  ? 25.111 -4.978  -48.011 1.00 34.81 ? 139 TYR E CE1 1 
ATOM   6125  C  CE2 . TYR E 1 55  ? 23.686 -6.829  -48.582 1.00 34.10 ? 139 TYR E CE2 1 
ATOM   6126  C  CZ  . TYR E 1 55  ? 24.551 -5.814  -48.948 1.00 35.38 ? 139 TYR E CZ  1 
ATOM   6127  O  OH  . TYR E 1 55  ? 24.912 -5.635  -50.235 1.00 35.39 ? 139 TYR E OH  1 
ATOM   6128  N  N   . VAL E 1 56  ? 20.764 -5.474  -42.661 1.00 37.14 ? 140 VAL E N   1 
ATOM   6129  C  CA  . VAL E 1 56  ? 20.192 -5.460  -41.298 1.00 36.88 ? 140 VAL E CA  1 
ATOM   6130  C  C   . VAL E 1 56  ? 19.596 -6.832  -40.984 1.00 38.11 ? 140 VAL E C   1 
ATOM   6131  O  O   . VAL E 1 56  ? 18.907 -7.393  -41.820 1.00 39.34 ? 140 VAL E O   1 
ATOM   6132  C  CB  . VAL E 1 56  ? 19.127 -4.291  -41.186 1.00 36.80 ? 140 VAL E CB  1 
ATOM   6133  C  CG1 . VAL E 1 56  ? 18.677 -4.037  -39.789 1.00 34.31 ? 140 VAL E CG1 1 
ATOM   6134  C  CG2 . VAL E 1 56  ? 19.726 -3.022  -41.663 1.00 34.35 ? 140 VAL E CG2 1 
ATOM   6135  N  N   . LEU E 1 57  ? 19.929 -7.410  -39.839 1.00 38.71 ? 141 LEU E N   1 
ATOM   6136  C  CA  . LEU E 1 57  ? 19.148 -8.523  -39.290 1.00 40.02 ? 141 LEU E CA  1 
ATOM   6137  C  C   . LEU E 1 57  ? 18.239 -8.108  -38.132 1.00 39.79 ? 141 LEU E C   1 
ATOM   6138  O  O   . LEU E 1 57  ? 18.657 -7.387  -37.255 1.00 40.60 ? 141 LEU E O   1 
ATOM   6139  C  CB  . LEU E 1 57  ? 20.051 -9.620  -38.763 1.00 39.77 ? 141 LEU E CB  1 
ATOM   6140  C  CG  . LEU E 1 57  ? 21.038 -10.204 -39.768 1.00 42.01 ? 141 LEU E CG  1 
ATOM   6141  C  CD1 . LEU E 1 57  ? 22.130 -10.934 -38.961 1.00 36.24 ? 141 LEU E CD1 1 
ATOM   6142  C  CD2 . LEU E 1 57  ? 20.329 -11.103 -40.780 1.00 37.58 ? 141 LEU E CD2 1 
ATOM   6143  N  N   . LYS E 1 58  ? 17.003 -8.573  -38.135 1.00 40.10 ? 142 LYS E N   1 
ATOM   6144  C  CA  . LYS E 1 58  ? 16.109 -8.387  -36.999 1.00 40.49 ? 142 LYS E CA  1 
ATOM   6145  C  C   . LYS E 1 58  ? 16.451 -9.359  -35.875 1.00 39.67 ? 142 LYS E C   1 
ATOM   6146  O  O   . LYS E 1 58  ? 16.635 -10.542 -36.102 1.00 40.03 ? 142 LYS E O   1 
ATOM   6147  C  CB  . LYS E 1 58  ? 14.626 -8.554  -37.408 1.00 40.98 ? 142 LYS E CB  1 
ATOM   6148  C  CG  . LYS E 1 58  ? 14.150 -7.619  -38.506 1.00 42.70 ? 142 LYS E CG  1 
ATOM   6149  C  CD  . LYS E 1 58  ? 12.666 -7.209  -38.397 1.00 49.03 ? 142 LYS E CD  1 
ATOM   6150  C  CE  . LYS E 1 58  ? 11.704 -8.403  -38.221 1.00 53.97 ? 142 LYS E CE  1 
ATOM   6151  N  NZ  . LYS E 1 58  ? 11.340 -9.137  -39.461 1.00 54.71 ? 142 LYS E NZ  1 
ATOM   6152  N  N   . ARG E 1 59  ? 16.529 -8.865  -34.657 1.00 39.00 ? 143 ARG E N   1 
ATOM   6153  C  CA  . ARG E 1 59  ? 16.617 -9.755  -33.513 1.00 38.98 ? 143 ARG E CA  1 
ATOM   6154  C  C   . ARG E 1 59  ? 15.361 -10.655 -33.378 1.00 39.76 ? 143 ARG E C   1 
ATOM   6155  O  O   . ARG E 1 59  ? 14.238 -10.214 -33.700 1.00 40.11 ? 143 ARG E O   1 
ATOM   6156  C  CB  . ARG E 1 59  ? 16.730 -8.929  -32.264 1.00 37.92 ? 143 ARG E CB  1 
ATOM   6157  C  CG  . ARG E 1 59  ? 17.024 -9.749  -31.070 1.00 38.14 ? 143 ARG E CG  1 
ATOM   6158  C  CD  . ARG E 1 59  ? 17.186 -8.849  -29.859 1.00 39.28 ? 143 ARG E CD  1 
ATOM   6159  N  NE  . ARG E 1 59  ? 17.958 -9.536  -28.820 1.00 37.66 ? 143 ARG E NE  1 
ATOM   6160  C  CZ  . ARG E 1 59  ? 18.599 -8.896  -27.855 1.00 35.71 ? 143 ARG E CZ  1 
ATOM   6161  N  NH1 . ARG E 1 59  ? 18.594 -7.561  -27.813 1.00 36.55 ? 143 ARG E NH1 1 
ATOM   6162  N  NH2 . ARG E 1 59  ? 19.252 -9.578  -26.962 1.00 32.04 ? 143 ARG E NH2 1 
ATOM   6163  N  N   . PRO E 1 60  ? 15.536 -11.916 -32.947 1.00 39.75 ? 144 PRO E N   1 
ATOM   6164  C  CA  . PRO E 1 60  ? 14.361 -12.783 -32.773 1.00 40.69 ? 144 PRO E CA  1 
ATOM   6165  C  C   . PRO E 1 60  ? 13.239 -12.176 -31.875 1.00 41.74 ? 144 PRO E C   1 
ATOM   6166  O  O   . PRO E 1 60  ? 13.544 -11.604 -30.795 1.00 43.22 ? 144 PRO E O   1 
ATOM   6167  C  CB  . PRO E 1 60  ? 14.958 -14.024 -32.099 1.00 40.19 ? 144 PRO E CB  1 
ATOM   6168  C  CG  . PRO E 1 60  ? 16.388 -14.080 -32.729 1.00 41.24 ? 144 PRO E CG  1 
ATOM   6169  C  CD  . PRO E 1 60  ? 16.797 -12.635 -32.659 1.00 39.88 ? 144 PRO E CD  1 
ATOM   6170  N  N   . TYR E 1 61  ? 11.980 -12.291 -32.316 1.00 40.32 ? 145 TYR E N   1 
ATOM   6171  C  CA  . TYR E 1 61  ? 10.802 -11.942 -31.496 1.00 41.58 ? 145 TYR E CA  1 
ATOM   6172  C  C   . TYR E 1 61  ? 10.613 -10.448 -31.402 1.00 43.10 ? 145 TYR E C   1 
ATOM   6173  O  O   . TYR E 1 61  ? 9.952  -9.970  -30.449 1.00 44.63 ? 145 TYR E O   1 
ATOM   6174  C  CB  . TYR E 1 61  ? 10.815 -12.530 -30.071 1.00 41.29 ? 145 TYR E CB  1 
ATOM   6175  C  CG  . TYR E 1 61  ? 11.017 -14.052 -29.975 1.00 41.82 ? 145 TYR E CG  1 
ATOM   6176  C  CD1 . TYR E 1 61  ? 12.136 -14.573 -29.378 1.00 41.26 ? 145 TYR E CD1 1 
ATOM   6177  C  CD2 . TYR E 1 61  ? 10.044 -14.961 -30.476 1.00 45.92 ? 145 TYR E CD2 1 
ATOM   6178  C  CE1 . TYR E 1 61  ? 12.334 -15.987 -29.251 1.00 44.08 ? 145 TYR E CE1 1 
ATOM   6179  C  CE2 . TYR E 1 61  ? 10.212 -16.366 -30.377 1.00 45.00 ? 145 TYR E CE2 1 
ATOM   6180  C  CZ  . TYR E 1 61  ? 11.359 -16.872 -29.742 1.00 48.73 ? 145 TYR E CZ  1 
ATOM   6181  O  OH  . TYR E 1 61  ? 11.569 -18.284 -29.635 1.00 47.78 ? 145 TYR E OH  1 
ATOM   6182  N  N   . VAL E 1 62  ? 11.129 -9.698  -32.384 1.00 43.51 ? 146 VAL E N   1 
ATOM   6183  C  CA  . VAL E 1 62  ? 11.133 -8.243  -32.232 1.00 43.98 ? 146 VAL E CA  1 
ATOM   6184  C  C   . VAL E 1 62  ? 9.787  -7.719  -32.619 1.00 45.52 ? 146 VAL E C   1 
ATOM   6185  O  O   . VAL E 1 62  ? 9.254  -6.895  -31.931 1.00 46.06 ? 146 VAL E O   1 
ATOM   6186  C  CB  . VAL E 1 62  ? 12.350 -7.506  -32.959 1.00 42.60 ? 146 VAL E CB  1 
ATOM   6187  C  CG1 . VAL E 1 62  ? 12.612 -8.109  -34.297 1.00 43.11 ? 146 VAL E CG1 1 
ATOM   6188  C  CG2 . VAL E 1 62  ? 12.125 -6.017  -33.115 1.00 37.67 ? 146 VAL E CG2 1 
ATOM   6189  N  N   . ASP E 1 63  ? 9.269  -8.177  -33.755 1.00 48.75 ? 147 ASP E N   1 
ATOM   6190  C  CA  . ASP E 1 63  ? 7.908  -7.864  -34.224 1.00 50.09 ? 147 ASP E CA  1 
ATOM   6191  C  C   . ASP E 1 63  ? 6.861  -8.169  -33.122 1.00 50.20 ? 147 ASP E C   1 
ATOM   6192  O  O   . ASP E 1 63  ? 5.995  -7.352  -32.890 1.00 49.69 ? 147 ASP E O   1 
ATOM   6193  C  CB  . ASP E 1 63  ? 7.537  -8.715  -35.451 1.00 51.08 ? 147 ASP E CB  1 
ATOM   6194  C  CG  . ASP E 1 63  ? 8.453  -8.507  -36.653 1.00 54.04 ? 147 ASP E CG  1 
ATOM   6195  O  OD1 . ASP E 1 63  ? 8.531  -7.372  -37.206 1.00 57.71 ? 147 ASP E OD1 1 
ATOM   6196  O  OD2 . ASP E 1 63  ? 9.053  -9.529  -37.077 1.00 55.44 ? 147 ASP E OD2 1 
ATOM   6197  N  N   . GLU E 1 64  ? 6.923  -9.333  -32.474 1.00 50.86 ? 148 GLU E N   1 
ATOM   6198  C  CA  . GLU E 1 64  ? 5.938  -9.620  -31.435 1.00 53.11 ? 148 GLU E CA  1 
ATOM   6199  C  C   . GLU E 1 64  ? 6.192  -8.746  -30.236 1.00 53.71 ? 148 GLU E C   1 
ATOM   6200  O  O   . GLU E 1 64  ? 5.236  -8.231  -29.594 1.00 53.50 ? 148 GLU E O   1 
ATOM   6201  C  CB  . GLU E 1 64  ? 5.803  -11.104 -31.023 1.00 53.44 ? 148 GLU E CB  1 
ATOM   6202  C  CG  . GLU E 1 64  ? 6.893  -12.087 -31.432 1.00 59.54 ? 148 GLU E CG  1 
ATOM   6203  C  CD  . GLU E 1 64  ? 6.817  -12.556 -32.910 1.00 67.05 ? 148 GLU E CD  1 
ATOM   6204  O  OE1 . GLU E 1 64  ? 5.687  -12.858 -33.429 1.00 68.87 ? 148 GLU E OE1 1 
ATOM   6205  O  OE2 . GLU E 1 64  ? 7.910  -12.628 -33.537 1.00 67.33 ? 148 GLU E OE2 1 
ATOM   6206  N  N   . PHE E 1 65  ? 7.489  -8.548  -29.955 1.00 54.25 ? 149 PHE E N   1 
ATOM   6207  C  CA  . PHE E 1 65  ? 7.912  -7.640  -28.893 1.00 53.11 ? 149 PHE E CA  1 
ATOM   6208  C  C   . PHE E 1 65  ? 7.387  -6.232  -29.121 1.00 52.94 ? 149 PHE E C   1 
ATOM   6209  O  O   . PHE E 1 65  ? 6.735  -5.692  -28.258 1.00 53.35 ? 149 PHE E O   1 
ATOM   6210  C  CB  . PHE E 1 65  ? 9.420  -7.647  -28.715 1.00 53.04 ? 149 PHE E CB  1 
ATOM   6211  C  CG  . PHE E 1 65  ? 9.926  -6.543  -27.812 1.00 52.79 ? 149 PHE E CG  1 
ATOM   6212  C  CD1 . PHE E 1 65  ? 10.012 -6.749  -26.435 1.00 49.27 ? 149 PHE E CD1 1 
ATOM   6213  C  CD2 . PHE E 1 65  ? 10.288 -5.288  -28.356 1.00 50.41 ? 149 PHE E CD2 1 
ATOM   6214  C  CE1 . PHE E 1 65  ? 10.453 -5.773  -25.619 1.00 50.06 ? 149 PHE E CE1 1 
ATOM   6215  C  CE2 . PHE E 1 65  ? 10.724 -4.288  -27.550 1.00 51.76 ? 149 PHE E CE2 1 
ATOM   6216  C  CZ  . PHE E 1 65  ? 10.825 -4.530  -26.164 1.00 52.92 ? 149 PHE E CZ  1 
ATOM   6217  N  N   . LEU E 1 66  ? 7.646  -5.629  -30.260 1.00 53.02 ? 150 LEU E N   1 
ATOM   6218  C  CA  . LEU E 1 66  ? 7.194  -4.271  -30.461 1.00 54.78 ? 150 LEU E CA  1 
ATOM   6219  C  C   . LEU E 1 66  ? 5.690  -4.242  -30.543 1.00 57.11 ? 150 LEU E C   1 
ATOM   6220  O  O   . LEU E 1 66  ? 5.066  -3.174  -30.413 1.00 57.63 ? 150 LEU E O   1 
ATOM   6221  C  CB  . LEU E 1 66  ? 7.749  -3.683  -31.756 1.00 54.75 ? 150 LEU E CB  1 
ATOM   6222  C  CG  . LEU E 1 66  ? 9.215  -3.253  -31.934 1.00 54.38 ? 150 LEU E CG  1 
ATOM   6223  C  CD1 . LEU E 1 66  ? 9.360  -2.466  -33.243 1.00 53.23 ? 150 LEU E CD1 1 
ATOM   6224  C  CD2 . LEU E 1 66  ? 9.681  -2.398  -30.779 1.00 54.55 ? 150 LEU E CD2 1 
ATOM   6225  N  N   . ARG E 1 67  ? 5.101  -5.415  -30.807 1.00 59.00 ? 151 ARG E N   1 
ATOM   6226  C  CA  . ARG E 1 67  ? 3.656  -5.527  -30.946 1.00 60.22 ? 151 ARG E CA  1 
ATOM   6227  C  C   . ARG E 1 67  ? 3.065  -5.296  -29.569 1.00 59.11 ? 151 ARG E C   1 
ATOM   6228  O  O   . ARG E 1 67  ? 2.184  -4.460  -29.385 1.00 59.60 ? 151 ARG E O   1 
ATOM   6229  C  CB  . ARG E 1 67  ? 3.250  -6.909  -31.484 1.00 60.25 ? 151 ARG E CB  1 
ATOM   6230  C  CG  . ARG E 1 67  ? 1.949  -6.886  -32.358 1.00 63.68 ? 151 ARG E CG  1 
ATOM   6231  C  CD  . ARG E 1 67  ? 1.619  -8.244  -33.107 1.00 63.35 ? 151 ARG E CD  1 
ATOM   6232  N  NE  . ARG E 1 67  ? 2.683  -8.794  -33.998 1.00 65.96 ? 151 ARG E NE  1 
ATOM   6233  C  CZ  . ARG E 1 67  ? 3.232  -10.011 -33.859 1.00 66.03 ? 151 ARG E CZ  1 
ATOM   6234  N  NH1 . ARG E 1 67  ? 2.852  -10.808 -32.851 1.00 67.14 ? 151 ARG E NH1 1 
ATOM   6235  N  NH2 . ARG E 1 67  ? 4.161  -10.435 -34.715 1.00 62.38 ? 151 ARG E NH2 1 
ATOM   6236  N  N   . ARG E 1 68  ? 3.594  -6.020  -28.603 1.00 58.09 ? 152 ARG E N   1 
ATOM   6237  C  CA  . ARG E 1 68  ? 3.065  -5.985  -27.291 1.00 58.05 ? 152 ARG E CA  1 
ATOM   6238  C  C   . ARG E 1 68  ? 3.231  -4.600  -26.711 1.00 57.50 ? 152 ARG E C   1 
ATOM   6239  O  O   . ARG E 1 68  ? 2.236  -3.961  -26.379 1.00 57.98 ? 152 ARG E O   1 
ATOM   6240  C  CB  . ARG E 1 68  ? 3.740  -7.053  -26.432 1.00 59.08 ? 152 ARG E CB  1 
ATOM   6241  C  CG  . ARG E 1 68  ? 2.991  -7.394  -25.134 1.00 62.21 ? 152 ARG E CG  1 
ATOM   6242  C  CD  . ARG E 1 68  ? 1.452  -7.432  -25.313 1.00 64.25 ? 152 ARG E CD  1 
ATOM   6243  N  NE  . ARG E 1 68  ? 0.776  -7.578  -24.024 1.00 66.19 ? 152 ARG E NE  1 
ATOM   6244  C  CZ  . ARG E 1 68  ? -0.358 -6.957  -23.705 1.00 66.29 ? 152 ARG E CZ  1 
ATOM   6245  N  NH1 . ARG E 1 68  ? -0.946 -6.134  -24.574 1.00 65.49 ? 152 ARG E NH1 1 
ATOM   6246  N  NH2 . ARG E 1 68  ? -0.890 -7.147  -22.513 1.00 65.70 ? 152 ARG E NH2 1 
ATOM   6247  N  N   . MET E 1 69  ? 4.472  -4.114  -26.659 1.00 56.19 ? 153 MET E N   1 
ATOM   6248  C  CA  . MET E 1 69  ? 4.821  -2.813  -26.081 1.00 54.62 ? 153 MET E CA  1 
ATOM   6249  C  C   . MET E 1 69  ? 4.069  -1.621  -26.647 1.00 53.85 ? 153 MET E C   1 
ATOM   6250  O  O   . MET E 1 69  ? 3.815  -0.656  -25.947 1.00 53.93 ? 153 MET E O   1 
ATOM   6251  C  CB  . MET E 1 69  ? 6.344  -2.552  -26.207 1.00 54.75 ? 153 MET E CB  1 
ATOM   6252  C  CG  . MET E 1 69  ? 7.228  -3.704  -25.732 1.00 53.79 ? 153 MET E CG  1 
ATOM   6253  S  SD  . MET E 1 69  ? 7.514  -3.674  -23.964 1.00 52.42 ? 153 MET E SD  1 
ATOM   6254  C  CE  . MET E 1 69  ? 8.284  -2.068  -23.959 1.00 52.95 ? 153 MET E CE  1 
ATOM   6255  N  N   . GLY E 1 70  ? 3.740  -1.643  -27.915 1.00 53.66 ? 154 GLY E N   1 
ATOM   6256  C  CA  . GLY E 1 70  ? 2.997  -0.521  -28.482 1.00 54.85 ? 154 GLY E CA  1 
ATOM   6257  C  C   . GLY E 1 70  ? 1.534  -0.411  -28.012 1.00 55.50 ? 154 GLY E C   1 
ATOM   6258  O  O   . GLY E 1 70  ? 0.851  0.584   -28.306 1.00 54.82 ? 154 GLY E O   1 
ATOM   6259  N  N   . GLU E 1 71  ? 1.045  -1.442  -27.319 1.00 56.01 ? 155 GLU E N   1 
ATOM   6260  C  CA  . GLU E 1 71  ? -0.263 -1.390  -26.652 1.00 57.31 ? 155 GLU E CA  1 
ATOM   6261  C  C   . GLU E 1 71  ? -0.051 -0.855  -25.264 1.00 56.59 ? 155 GLU E C   1 
ATOM   6262  O  O   . GLU E 1 71  ? -0.803 -0.020  -24.796 1.00 57.09 ? 155 GLU E O   1 
ATOM   6263  C  CB  . GLU E 1 71  ? -0.883 -2.789  -26.493 1.00 57.76 ? 155 GLU E CB  1 
ATOM   6264  C  CG  . GLU E 1 71  ? -1.627 -3.319  -27.737 1.00 61.58 ? 155 GLU E CG  1 
ATOM   6265  C  CD  . GLU E 1 71  ? -1.561 -4.838  -27.849 1.00 65.23 ? 155 GLU E CD  1 
ATOM   6266  O  OE1 . GLU E 1 71  ? -1.383 -5.533  -26.807 1.00 65.94 ? 155 GLU E OE1 1 
ATOM   6267  O  OE2 . GLU E 1 71  ? -1.675 -5.327  -28.997 1.00 67.74 ? 155 GLU E OE2 1 
ATOM   6268  N  N   . LEU E 1 72  ? 0.973  -1.389  -24.612 1.00 55.61 ? 156 LEU E N   1 
ATOM   6269  C  CA  . LEU E 1 72  ? 1.227  -1.155  -23.226 1.00 54.31 ? 156 LEU E CA  1 
ATOM   6270  C  C   . LEU E 1 72  ? 1.945  0.141   -22.856 1.00 53.75 ? 156 LEU E C   1 
ATOM   6271  O  O   . LEU E 1 72  ? 1.861  0.530   -21.676 1.00 54.81 ? 156 LEU E O   1 
ATOM   6272  C  CB  . LEU E 1 72  ? 2.019  -2.312  -22.669 1.00 54.53 ? 156 LEU E CB  1 
ATOM   6273  C  CG  . LEU E 1 72  ? 1.341  -3.641  -22.466 1.00 55.05 ? 156 LEU E CG  1 
ATOM   6274  C  CD1 . LEU E 1 72  ? 2.184  -4.451  -21.489 1.00 57.68 ? 156 LEU E CD1 1 
ATOM   6275  C  CD2 . LEU E 1 72  ? -0.055 -3.462  -21.925 1.00 58.19 ? 156 LEU E CD2 1 
ATOM   6276  N  N   . PHE E 1 73  ? 2.638  0.820   -23.800 1.00 51.94 ? 157 PHE E N   1 
ATOM   6277  C  CA  . PHE E 1 73  ? 3.458  2.005   -23.445 1.00 48.92 ? 157 PHE E CA  1 
ATOM   6278  C  C   . PHE E 1 73  ? 3.457  3.087   -24.468 1.00 49.21 ? 157 PHE E C   1 
ATOM   6279  O  O   . PHE E 1 73  ? 2.789  2.959   -25.492 1.00 50.28 ? 157 PHE E O   1 
ATOM   6280  C  CB  . PHE E 1 73  ? 4.888  1.600   -23.245 1.00 47.71 ? 157 PHE E CB  1 
ATOM   6281  C  CG  . PHE E 1 73  ? 5.097  0.600   -22.173 1.00 43.91 ? 157 PHE E CG  1 
ATOM   6282  C  CD1 . PHE E 1 73  ? 5.064  -0.727  -22.459 1.00 38.03 ? 157 PHE E CD1 1 
ATOM   6283  C  CD2 . PHE E 1 73  ? 5.374  1.009   -20.883 1.00 42.85 ? 157 PHE E CD2 1 
ATOM   6284  C  CE1 . PHE E 1 73  ? 5.283  -1.653  -21.504 1.00 39.77 ? 157 PHE E CE1 1 
ATOM   6285  C  CE2 . PHE E 1 73  ? 5.628  0.104   -19.901 1.00 41.96 ? 157 PHE E CE2 1 
ATOM   6286  C  CZ  . PHE E 1 73  ? 5.573  -1.259  -20.207 1.00 42.75 ? 157 PHE E CZ  1 
ATOM   6287  N  N   . GLU E 1 74  ? 4.189  4.171   -24.205 1.00 48.75 ? 158 GLU E N   1 
ATOM   6288  C  CA  . GLU E 1 74  ? 4.367  5.224   -25.199 1.00 48.81 ? 158 GLU E CA  1 
ATOM   6289  C  C   . GLU E 1 74  ? 5.792  4.944   -25.629 1.00 49.87 ? 158 GLU E C   1 
ATOM   6290  O  O   . GLU E 1 74  ? 6.733  5.369   -24.911 1.00 51.03 ? 158 GLU E O   1 
ATOM   6291  C  CB  . GLU E 1 74  ? 4.260  6.644   -24.624 1.00 47.65 ? 158 GLU E CB  1 
ATOM   6292  C  CG  . GLU E 1 74  ? 4.570  7.729   -25.639 1.00 46.65 ? 158 GLU E CG  1 
ATOM   6293  C  CD  . GLU E 1 74  ? 4.793  9.195   -25.090 1.00 50.09 ? 158 GLU E CD  1 
ATOM   6294  O  OE1 . GLU E 1 74  ? 5.042  9.449   -23.880 1.00 52.57 ? 158 GLU E OE1 1 
ATOM   6295  O  OE2 . GLU E 1 74  ? 4.750  10.149  -25.908 1.00 52.19 ? 158 GLU E OE2 1 
ATOM   6296  N  N   . CYS E 1 75  ? 5.955  4.210   -26.754 1.00 48.63 ? 159 CYS E N   1 
ATOM   6297  C  CA  . CYS E 1 75  ? 7.272  3.739   -27.215 1.00 47.25 ? 159 CYS E CA  1 
ATOM   6298  C  C   . CYS E 1 75  ? 8.040  4.831   -27.908 1.00 46.00 ? 159 CYS E C   1 
ATOM   6299  O  O   . CYS E 1 75  ? 7.511  5.501   -28.782 1.00 46.33 ? 159 CYS E O   1 
ATOM   6300  C  CB  . CYS E 1 75  ? 7.135  2.505   -28.092 1.00 46.30 ? 159 CYS E CB  1 
ATOM   6301  S  SG  . CYS E 1 75  ? 6.846  1.031   -27.078 1.00 48.21 ? 159 CYS E SG  1 
ATOM   6302  N  N   . VAL E 1 76  ? 9.277  5.058   -27.492 1.00 44.75 ? 160 VAL E N   1 
ATOM   6303  C  CA  . VAL E 1 76  ? 10.109 6.006   -28.246 1.00 44.29 ? 160 VAL E CA  1 
ATOM   6304  C  C   . VAL E 1 76  ? 11.443 5.402   -28.741 1.00 42.82 ? 160 VAL E C   1 
ATOM   6305  O  O   . VAL E 1 76  ? 12.003 4.509   -28.115 1.00 42.82 ? 160 VAL E O   1 
ATOM   6306  C  CB  . VAL E 1 76  ? 10.348 7.291   -27.493 1.00 44.84 ? 160 VAL E CB  1 
ATOM   6307  C  CG1 . VAL E 1 76  ? 10.974 8.355   -28.455 1.00 46.38 ? 160 VAL E CG1 1 
ATOM   6308  C  CG2 . VAL E 1 76  ? 9.059  7.799   -26.910 1.00 45.48 ? 160 VAL E CG2 1 
ATOM   6309  N  N   . LEU E 1 77  ? 11.879 5.839   -29.914 1.00 42.05 ? 161 LEU E N   1 
ATOM   6310  C  CA  . LEU E 1 77  ? 13.178 5.439   -30.473 1.00 40.54 ? 161 LEU E CA  1 
ATOM   6311  C  C   . LEU E 1 77  ? 14.160 6.519   -30.120 1.00 39.80 ? 161 LEU E C   1 
ATOM   6312  O  O   . LEU E 1 77  ? 14.001 7.663   -30.575 1.00 38.50 ? 161 LEU E O   1 
ATOM   6313  C  CB  . LEU E 1 77  ? 13.159 5.273   -32.017 1.00 40.23 ? 161 LEU E CB  1 
ATOM   6314  C  CG  . LEU E 1 77  ? 14.475 4.625   -32.531 1.00 38.19 ? 161 LEU E CG  1 
ATOM   6315  C  CD1 . LEU E 1 77  ? 14.485 3.077   -32.385 1.00 33.93 ? 161 LEU E CD1 1 
ATOM   6316  C  CD2 . LEU E 1 77  ? 14.880 5.042   -33.937 1.00 33.03 ? 161 LEU E CD2 1 
ATOM   6317  N  N   . PHE E 1 78  ? 15.164 6.149   -29.318 1.00 39.58 ? 162 PHE E N   1 
ATOM   6318  C  CA  . PHE E 1 78  ? 16.237 7.064   -28.947 1.00 39.10 ? 162 PHE E CA  1 
ATOM   6319  C  C   . PHE E 1 78  ? 17.543 6.416   -29.266 1.00 39.15 ? 162 PHE E C   1 
ATOM   6320  O  O   . PHE E 1 78  ? 17.956 5.466   -28.585 1.00 39.46 ? 162 PHE E O   1 
ATOM   6321  C  CB  . PHE E 1 78  ? 16.195 7.419   -27.468 1.00 39.09 ? 162 PHE E CB  1 
ATOM   6322  C  CG  . PHE E 1 78  ? 16.847 8.738   -27.138 1.00 39.19 ? 162 PHE E CG  1 
ATOM   6323  C  CD1 . PHE E 1 78  ? 16.557 9.381   -25.945 1.00 38.63 ? 162 PHE E CD1 1 
ATOM   6324  C  CD2 . PHE E 1 78  ? 17.742 9.336   -28.009 1.00 40.78 ? 162 PHE E CD2 1 
ATOM   6325  C  CE1 . PHE E 1 78  ? 17.105 10.592  -25.630 1.00 35.77 ? 162 PHE E CE1 1 
ATOM   6326  C  CE2 . PHE E 1 78  ? 18.316 10.571  -27.685 1.00 41.42 ? 162 PHE E CE2 1 
ATOM   6327  C  CZ  . PHE E 1 78  ? 17.991 11.188  -26.500 1.00 37.47 ? 162 PHE E CZ  1 
ATOM   6328  N  N   . THR E 1 79  ? 18.198 6.925   -30.303 1.00 38.99 ? 163 THR E N   1 
ATOM   6329  C  CA  . THR E 1 79  ? 19.424 6.324   -30.802 1.00 38.86 ? 163 THR E CA  1 
ATOM   6330  C  C   . THR E 1 79  ? 20.569 7.355   -30.954 1.00 39.93 ? 163 THR E C   1 
ATOM   6331  O  O   . THR E 1 79  ? 20.333 8.529   -31.165 1.00 40.71 ? 163 THR E O   1 
ATOM   6332  C  CB  . THR E 1 79  ? 19.121 5.593   -32.184 1.00 39.64 ? 163 THR E CB  1 
ATOM   6333  O  OG1 . THR E 1 79  ? 20.237 4.768   -32.583 1.00 41.67 ? 163 THR E OG1 1 
ATOM   6334  C  CG2 . THR E 1 79  ? 18.821 6.597   -33.295 1.00 34.41 ? 163 THR E CG2 1 
ATOM   6335  N  N   . ALA E 1 80  ? 21.823 6.898   -30.872 1.00 41.32 ? 164 ALA E N   1 
ATOM   6336  C  CA  . ALA E 1 80  ? 23.020 7.703   -31.169 1.00 40.20 ? 164 ALA E CA  1 
ATOM   6337  C  C   . ALA E 1 80  ? 23.435 7.638   -32.671 1.00 40.75 ? 164 ALA E C   1 
ATOM   6338  O  O   . ALA E 1 80  ? 24.398 8.311   -33.132 1.00 39.97 ? 164 ALA E O   1 
ATOM   6339  C  CB  . ALA E 1 80  ? 24.116 7.238   -30.296 1.00 38.93 ? 164 ALA E CB  1 
ATOM   6340  N  N   . SER E 1 81  ? 22.723 6.828   -33.450 1.00 41.21 ? 165 SER E N   1 
ATOM   6341  C  CA  . SER E 1 81  ? 23.045 6.726   -34.869 1.00 42.03 ? 165 SER E CA  1 
ATOM   6342  C  C   . SER E 1 81  ? 22.619 8.001   -35.537 1.00 43.37 ? 165 SER E C   1 
ATOM   6343  O  O   . SER E 1 81  ? 21.811 8.758   -35.007 1.00 43.96 ? 165 SER E O   1 
ATOM   6344  C  CB  . SER E 1 81  ? 22.284 5.567   -35.466 1.00 42.68 ? 165 SER E CB  1 
ATOM   6345  O  OG  . SER E 1 81  ? 22.686 4.339   -34.842 1.00 43.78 ? 165 SER E OG  1 
ATOM   6346  N  N   . LEU E 1 82  ? 23.168 8.304   -36.699 1.00 44.80 ? 166 LEU E N   1 
ATOM   6347  C  CA  . LEU E 1 82  ? 22.571 9.378   -37.472 1.00 44.65 ? 166 LEU E CA  1 
ATOM   6348  C  C   . LEU E 1 82  ? 21.196 9.007   -38.051 1.00 44.69 ? 166 LEU E C   1 
ATOM   6349  O  O   . LEU E 1 82  ? 20.836 7.853   -38.219 1.00 44.32 ? 166 LEU E O   1 
ATOM   6350  C  CB  . LEU E 1 82  ? 23.509 9.782   -38.565 1.00 45.11 ? 166 LEU E CB  1 
ATOM   6351  C  CG  . LEU E 1 82  ? 24.804 10.429  -38.125 1.00 45.66 ? 166 LEU E CG  1 
ATOM   6352  C  CD1 . LEU E 1 82  ? 25.710 10.367  -39.359 1.00 45.68 ? 166 LEU E CD1 1 
ATOM   6353  C  CD2 . LEU E 1 82  ? 24.578 11.892  -37.660 1.00 43.51 ? 166 LEU E CD2 1 
ATOM   6354  N  N   . ALA E 1 83  ? 20.384 10.007  -38.309 1.00 46.07 ? 167 ALA E N   1 
ATOM   6355  C  CA  . ALA E 1 83  ? 19.032 9.705   -38.763 1.00 46.09 ? 167 ALA E CA  1 
ATOM   6356  C  C   . ALA E 1 83  ? 19.093 9.121   -40.169 1.00 45.95 ? 167 ALA E C   1 
ATOM   6357  O  O   . ALA E 1 83  ? 18.230 8.314   -40.536 1.00 46.04 ? 167 ALA E O   1 
ATOM   6358  C  CB  . ALA E 1 83  ? 18.176 10.948  -38.740 1.00 45.78 ? 167 ALA E CB  1 
ATOM   6359  N  N   . LYS E 1 84  ? 20.094 9.530   -40.951 1.00 45.65 ? 168 LYS E N   1 
ATOM   6360  C  CA  . LYS E 1 84  ? 20.158 9.093   -42.361 1.00 46.62 ? 168 LYS E CA  1 
ATOM   6361  C  C   . LYS E 1 84  ? 20.204 7.597   -42.489 1.00 46.01 ? 168 LYS E C   1 
ATOM   6362  O  O   . LYS E 1 84  ? 19.718 7.051   -43.473 1.00 46.78 ? 168 LYS E O   1 
ATOM   6363  C  CB  . LYS E 1 84  ? 21.310 9.729   -43.144 1.00 46.78 ? 168 LYS E CB  1 
ATOM   6364  C  CG  . LYS E 1 84  ? 22.665 9.203   -42.824 1.00 49.03 ? 168 LYS E CG  1 
ATOM   6365  C  CD  . LYS E 1 84  ? 23.712 10.123  -43.412 1.00 53.88 ? 168 LYS E CD  1 
ATOM   6366  C  CE  . LYS E 1 84  ? 25.028 9.419   -43.485 1.00 57.64 ? 168 LYS E CE  1 
ATOM   6367  N  NZ  . LYS E 1 84  ? 26.071 10.469  -43.588 1.00 62.36 ? 168 LYS E NZ  1 
ATOM   6368  N  N   . TYR E 1 85  ? 20.778 6.950   -41.473 1.00 45.51 ? 169 TYR E N   1 
ATOM   6369  C  CA  . TYR E 1 85  ? 20.707 5.504   -41.316 1.00 44.07 ? 169 TYR E CA  1 
ATOM   6370  C  C   . TYR E 1 85  ? 19.530 5.035   -40.496 1.00 44.22 ? 169 TYR E C   1 
ATOM   6371  O  O   . TYR E 1 85  ? 18.935 3.994   -40.828 1.00 44.77 ? 169 TYR E O   1 
ATOM   6372  C  CB  . TYR E 1 85  ? 22.002 4.947   -40.705 1.00 42.91 ? 169 TYR E CB  1 
ATOM   6373  C  CG  . TYR E 1 85  ? 21.865 3.603   -39.995 1.00 39.88 ? 169 TYR E CG  1 
ATOM   6374  C  CD1 . TYR E 1 85  ? 21.980 2.397   -40.664 1.00 36.56 ? 169 TYR E CD1 1 
ATOM   6375  C  CD2 . TYR E 1 85  ? 21.652 3.561   -38.621 1.00 37.33 ? 169 TYR E CD2 1 
ATOM   6376  C  CE1 . TYR E 1 85  ? 21.899 1.159   -39.931 1.00 35.40 ? 169 TYR E CE1 1 
ATOM   6377  C  CE2 . TYR E 1 85  ? 21.552 2.375   -37.904 1.00 33.69 ? 169 TYR E CE2 1 
ATOM   6378  C  CZ  . TYR E 1 85  ? 21.681 1.191   -38.551 1.00 37.80 ? 169 TYR E CZ  1 
ATOM   6379  O  OH  . TYR E 1 85  ? 21.561 0.061   -37.769 1.00 40.26 ? 169 TYR E OH  1 
ATOM   6380  N  N   . ALA E 1 86  ? 19.221 5.738   -39.401 1.00 43.55 ? 170 ALA E N   1 
ATOM   6381  C  CA  . ALA E 1 86  ? 18.238 5.187   -38.445 1.00 43.03 ? 170 ALA E CA  1 
ATOM   6382  C  C   . ALA E 1 86  ? 16.778 5.331   -38.885 1.00 42.31 ? 170 ALA E C   1 
ATOM   6383  O  O   . ALA E 1 86  ? 15.962 4.443   -38.613 1.00 41.40 ? 170 ALA E O   1 
ATOM   6384  C  CB  . ALA E 1 86  ? 18.446 5.722   -37.058 1.00 42.36 ? 170 ALA E CB  1 
ATOM   6385  N  N   . ASP E 1 87  ? 16.459 6.447   -39.532 1.00 42.19 ? 171 ASP E N   1 
ATOM   6386  C  CA  . ASP E 1 87  ? 15.130 6.649   -40.093 1.00 43.31 ? 171 ASP E CA  1 
ATOM   6387  C  C   . ASP E 1 87  ? 14.750 5.506   -41.029 1.00 44.00 ? 171 ASP E C   1 
ATOM   6388  O  O   . ASP E 1 87  ? 13.824 4.725   -40.690 1.00 44.14 ? 171 ASP E O   1 
ATOM   6389  C  CB  . ASP E 1 87  ? 15.014 8.000   -40.783 1.00 43.42 ? 171 ASP E CB  1 
ATOM   6390  C  CG  . ASP E 1 87  ? 14.105 8.947   -40.035 1.00 45.64 ? 171 ASP E CG  1 
ATOM   6391  O  OD1 . ASP E 1 87  ? 13.153 8.467   -39.344 1.00 49.28 ? 171 ASP E OD1 1 
ATOM   6392  O  OD2 . ASP E 1 87  ? 14.352 10.169  -40.098 1.00 46.76 ? 171 ASP E OD2 1 
ATOM   6393  N  N   . PRO E 1 88  ? 15.514 5.329   -42.155 1.00 44.92 ? 172 PRO E N   1 
ATOM   6394  C  CA  . PRO E 1 88  ? 15.081 4.292   -43.093 1.00 44.88 ? 172 PRO E CA  1 
ATOM   6395  C  C   . PRO E 1 88  ? 15.043 2.965   -42.404 1.00 45.03 ? 172 PRO E C   1 
ATOM   6396  O  O   . PRO E 1 88  ? 14.145 2.189   -42.688 1.00 47.09 ? 172 PRO E O   1 
ATOM   6397  C  CB  . PRO E 1 88  ? 16.116 4.336   -44.207 1.00 43.15 ? 172 PRO E CB  1 
ATOM   6398  C  CG  . PRO E 1 88  ? 17.287 4.950   -43.597 1.00 45.33 ? 172 PRO E CG  1 
ATOM   6399  C  CD  . PRO E 1 88  ? 16.753 5.974   -42.647 1.00 44.83 ? 172 PRO E CD  1 
ATOM   6400  N  N   . VAL E 1 89  ? 15.929 2.710   -41.456 1.00 44.38 ? 173 VAL E N   1 
ATOM   6401  C  CA  . VAL E 1 89  ? 15.875 1.404   -40.854 1.00 44.11 ? 173 VAL E CA  1 
ATOM   6402  C  C   . VAL E 1 89  ? 14.572 1.243   -40.082 1.00 44.56 ? 173 VAL E C   1 
ATOM   6403  O  O   . VAL E 1 89  ? 13.945 0.203   -40.174 1.00 45.25 ? 173 VAL E O   1 
ATOM   6404  C  CB  . VAL E 1 89  ? 17.147 1.035   -40.019 1.00 44.17 ? 173 VAL E CB  1 
ATOM   6405  C  CG1 . VAL E 1 89  ? 16.927 -0.226  -39.193 1.00 43.21 ? 173 VAL E CG1 1 
ATOM   6406  C  CG2 . VAL E 1 89  ? 18.309 0.808   -40.938 1.00 43.75 ? 173 VAL E CG2 1 
ATOM   6407  N  N   . THR E 1 90  ? 14.130 2.269   -39.354 1.00 44.83 ? 174 THR E N   1 
ATOM   6408  C  CA  . THR E 1 90  ? 12.953 2.116   -38.469 1.00 44.40 ? 174 THR E CA  1 
ATOM   6409  C  C   . THR E 1 90  ? 11.641 2.110   -39.299 1.00 43.91 ? 174 THR E C   1 
ATOM   6410  O  O   . THR E 1 90  ? 10.672 1.405   -38.990 1.00 42.00 ? 174 THR E O   1 
ATOM   6411  C  CB  . THR E 1 90  ? 12.912 3.263   -37.425 1.00 45.30 ? 174 THR E CB  1 
ATOM   6412  O  OG1 . THR E 1 90  ? 14.211 3.453   -36.862 1.00 46.08 ? 174 THR E OG1 1 
ATOM   6413  C  CG2 . THR E 1 90  ? 11.928 2.974   -36.317 1.00 44.04 ? 174 THR E CG2 1 
ATOM   6414  N  N   . ASP E 1 91  ? 11.625 2.942   -40.332 1.00 43.82 ? 175 ASP E N   1 
ATOM   6415  C  CA  . ASP E 1 91  ? 10.612 2.839   -41.354 1.00 44.83 ? 175 ASP E CA  1 
ATOM   6416  C  C   . ASP E 1 91  ? 10.348 1.356   -41.732 1.00 45.99 ? 175 ASP E C   1 
ATOM   6417  O  O   . ASP E 1 91  ? 9.200  0.988   -41.966 1.00 47.36 ? 175 ASP E O   1 
ATOM   6418  C  CB  . ASP E 1 91  ? 10.996 3.651   -42.593 1.00 43.99 ? 175 ASP E CB  1 
ATOM   6419  C  CG  . ASP E 1 91  ? 10.815 5.160   -42.408 1.00 44.03 ? 175 ASP E CG  1 
ATOM   6420  O  OD1 . ASP E 1 91  ? 10.224 5.629   -41.394 1.00 43.72 ? 175 ASP E OD1 1 
ATOM   6421  O  OD2 . ASP E 1 91  ? 11.250 5.908   -43.307 1.00 42.20 ? 175 ASP E OD2 1 
ATOM   6422  N  N   . LEU E 1 92  ? 11.355 0.486   -41.757 1.00 46.08 ? 176 LEU E N   1 
ATOM   6423  C  CA  . LEU E 1 92  ? 11.078 -0.902  -42.166 1.00 46.58 ? 176 LEU E CA  1 
ATOM   6424  C  C   . LEU E 1 92  ? 10.759 -1.848  -41.012 1.00 47.18 ? 176 LEU E C   1 
ATOM   6425  O  O   . LEU E 1 92  ? 10.118 -2.900  -41.180 1.00 47.08 ? 176 LEU E O   1 
ATOM   6426  C  CB  . LEU E 1 92  ? 12.255 -1.441  -42.989 1.00 46.24 ? 176 LEU E CB  1 
ATOM   6427  C  CG  . LEU E 1 92  ? 12.294 -0.880  -44.414 1.00 46.17 ? 176 LEU E CG  1 
ATOM   6428  C  CD1 . LEU E 1 92  ? 13.739 -0.738  -44.923 1.00 48.29 ? 176 LEU E CD1 1 
ATOM   6429  C  CD2 . LEU E 1 92  ? 11.461 -1.720  -45.388 1.00 44.02 ? 176 LEU E CD2 1 
ATOM   6430  N  N   . LEU E 1 93  ? 11.252 -1.471  -39.844 1.00 48.47 ? 177 LEU E N   1 
ATOM   6431  C  CA  . LEU E 1 93  ? 11.197 -2.278  -38.644 1.00 49.20 ? 177 LEU E CA  1 
ATOM   6432  C  C   . LEU E 1 93  ? 9.875  -2.029  -37.982 1.00 50.49 ? 177 LEU E C   1 
ATOM   6433  O  O   . LEU E 1 93  ? 9.270  -2.979  -37.514 1.00 50.95 ? 177 LEU E O   1 
ATOM   6434  C  CB  . LEU E 1 93  ? 12.348 -1.912  -37.688 1.00 48.58 ? 177 LEU E CB  1 
ATOM   6435  C  CG  . LEU E 1 93  ? 12.409 -2.627  -36.323 1.00 49.31 ? 177 LEU E CG  1 
ATOM   6436  C  CD1 . LEU E 1 93  ? 12.715 -4.101  -36.464 1.00 48.96 ? 177 LEU E CD1 1 
ATOM   6437  C  CD2 . LEU E 1 93  ? 13.365 -2.033  -35.301 1.00 48.40 ? 177 LEU E CD2 1 
ATOM   6438  N  N   . ASP E 1 94  ? 9.449  -0.758  -37.944 1.00 52.49 ? 178 ASP E N   1 
ATOM   6439  C  CA  . ASP E 1 94  ? 8.255  -0.281  -37.199 1.00 54.80 ? 178 ASP E CA  1 
ATOM   6440  C  C   . ASP E 1 94  ? 7.144  0.066   -38.183 1.00 56.77 ? 178 ASP E C   1 
ATOM   6441  O  O   . ASP E 1 94  ? 7.028  1.211   -38.675 1.00 55.70 ? 178 ASP E O   1 
ATOM   6442  C  CB  . ASP E 1 94  ? 8.579  0.964   -36.375 1.00 54.72 ? 178 ASP E CB  1 
ATOM   6443  C  CG  . ASP E 1 94  ? 7.371  1.468   -35.543 1.00 55.27 ? 178 ASP E CG  1 
ATOM   6444  O  OD1 . ASP E 1 94  ? 6.650  0.609   -34.986 1.00 56.63 ? 178 ASP E OD1 1 
ATOM   6445  O  OD2 . ASP E 1 94  ? 7.153  2.711   -35.435 1.00 52.16 ? 178 ASP E OD2 1 
ATOM   6446  N  N   . ARG E 1 95  ? 6.350  -0.957  -38.493 1.00 59.72 ? 179 ARG E N   1 
ATOM   6447  C  CA  . ARG E 1 95  ? 5.379  -0.876  -39.598 1.00 61.70 ? 179 ARG E CA  1 
ATOM   6448  C  C   . ARG E 1 95  ? 4.036  -0.314  -39.121 1.00 61.78 ? 179 ARG E C   1 
ATOM   6449  O  O   . ARG E 1 95  ? 3.503  0.664   -39.671 1.00 61.70 ? 179 ARG E O   1 
ATOM   6450  C  CB  . ARG E 1 95  ? 5.229  -2.248  -40.252 1.00 61.95 ? 179 ARG E CB  1 
ATOM   6451  C  CG  . ARG E 1 95  ? 4.929  -2.126  -41.727 1.00 65.30 ? 179 ARG E CG  1 
ATOM   6452  C  CD  . ARG E 1 95  ? 6.068  -1.511  -42.544 1.00 67.67 ? 179 ARG E CD  1 
ATOM   6453  N  NE  . ARG E 1 95  ? 6.839  -2.568  -43.184 1.00 71.24 ? 179 ARG E NE  1 
ATOM   6454  C  CZ  . ARG E 1 95  ? 7.542  -2.433  -44.312 1.00 74.25 ? 179 ARG E CZ  1 
ATOM   6455  N  NH1 . ARG E 1 95  ? 7.597  -1.263  -44.962 1.00 75.72 ? 179 ARG E NH1 1 
ATOM   6456  N  NH2 . ARG E 1 95  ? 8.206  -3.483  -44.790 1.00 74.80 ? 179 ARG E NH2 1 
ATOM   6457  N  N   . CYS E 1 96  ? 3.541  -0.916  -38.049 1.00 61.67 ? 180 CYS E N   1 
ATOM   6458  C  CA  . CYS E 1 96  ? 2.371  -0.444  -37.354 1.00 61.64 ? 180 CYS E CA  1 
ATOM   6459  C  C   . CYS E 1 96  ? 2.543  0.963   -36.809 1.00 60.97 ? 180 CYS E C   1 
ATOM   6460  O  O   . CYS E 1 96  ? 1.538  1.645   -36.558 1.00 61.82 ? 180 CYS E O   1 
ATOM   6461  C  CB  . CYS E 1 96  ? 2.071  -1.419  -36.235 1.00 61.85 ? 180 CYS E CB  1 
ATOM   6462  S  SG  . CYS E 1 96  ? 2.066  -3.109  -36.950 1.00 65.28 ? 180 CYS E SG  1 
ATOM   6463  N  N   . GLY E 1 97  ? 3.796  1.425   -36.665 1.00 59.34 ? 181 GLY E N   1 
ATOM   6464  C  CA  . GLY E 1 97  ? 4.071  2.767   -36.111 1.00 56.11 ? 181 GLY E CA  1 
ATOM   6465  C  C   . GLY E 1 97  ? 3.960  2.826   -34.592 1.00 54.10 ? 181 GLY E C   1 
ATOM   6466  O  O   . GLY E 1 97  ? 3.453  3.779   -34.033 1.00 53.36 ? 181 GLY E O   1 
ATOM   6467  N  N   . VAL E 1 98  ? 4.412  1.779   -33.922 1.00 52.56 ? 182 VAL E N   1 
ATOM   6468  C  CA  . VAL E 1 98  ? 4.669  1.843   -32.502 1.00 51.66 ? 182 VAL E CA  1 
ATOM   6469  C  C   . VAL E 1 98  ? 5.540  3.057   -32.063 1.00 51.69 ? 182 VAL E C   1 
ATOM   6470  O  O   . VAL E 1 98  ? 5.521  3.408   -30.893 1.00 52.32 ? 182 VAL E O   1 
ATOM   6471  C  CB  . VAL E 1 98  ? 5.346  0.555   -32.046 1.00 51.92 ? 182 VAL E CB  1 
ATOM   6472  C  CG1 . VAL E 1 98  ? 5.886  0.672   -30.678 1.00 51.73 ? 182 VAL E CG1 1 
ATOM   6473  C  CG2 . VAL E 1 98  ? 4.366  -0.597  -32.077 1.00 52.57 ? 182 VAL E CG2 1 
ATOM   6474  N  N   . PHE E 1 99  ? 6.273  3.722   -32.969 1.00 50.17 ? 183 PHE E N   1 
ATOM   6475  C  CA  . PHE E 1 99  ? 7.218  4.722   -32.513 1.00 48.47 ? 183 PHE E CA  1 
ATOM   6476  C  C   . PHE E 1 99  ? 6.657  6.080   -32.693 1.00 49.52 ? 183 PHE E C   1 
ATOM   6477  O  O   . PHE E 1 99  ? 6.697  6.675   -33.805 1.00 50.18 ? 183 PHE E O   1 
ATOM   6478  C  CB  . PHE E 1 99  ? 8.630  4.618   -33.164 1.00 47.73 ? 183 PHE E CB  1 
ATOM   6479  C  CG  . PHE E 1 99  ? 9.457  3.474   -32.644 1.00 43.60 ? 183 PHE E CG  1 
ATOM   6480  C  CD1 . PHE E 1 99  ? 9.906  2.492   -33.515 1.00 37.38 ? 183 PHE E CD1 1 
ATOM   6481  C  CD2 . PHE E 1 99  ? 9.732  3.350   -31.271 1.00 40.71 ? 183 PHE E CD2 1 
ATOM   6482  C  CE1 . PHE E 1 99  ? 10.629 1.401   -33.058 1.00 35.62 ? 183 PHE E CE1 1 
ATOM   6483  C  CE2 . PHE E 1 99  ? 10.482 2.252   -30.788 1.00 40.46 ? 183 PHE E CE2 1 
ATOM   6484  C  CZ  . PHE E 1 99  ? 10.943 1.281   -31.699 1.00 38.90 ? 183 PHE E CZ  1 
ATOM   6485  N  N   . ARG E 1 100 ? 6.175  6.609   -31.573 1.00 49.34 ? 184 ARG E N   1 
ATOM   6486  C  CA  . ARG E 1 100 ? 5.429  7.846   -31.634 1.00 49.22 ? 184 ARG E CA  1 
ATOM   6487  C  C   . ARG E 1 100 ? 6.434  8.945   -31.943 1.00 48.85 ? 184 ARG E C   1 
ATOM   6488  O  O   . ARG E 1 100 ? 6.099  9.993   -32.526 1.00 49.01 ? 184 ARG E O   1 
ATOM   6489  C  CB  . ARG E 1 100 ? 4.611  8.056   -30.345 1.00 50.12 ? 184 ARG E CB  1 
ATOM   6490  C  CG  . ARG E 1 100 ? 4.144  6.733   -29.603 1.00 49.36 ? 184 ARG E CG  1 
ATOM   6491  C  CD  . ARG E 1 100 ? 3.076  5.858   -30.355 1.00 52.73 ? 184 ARG E CD  1 
ATOM   6492  N  NE  . ARG E 1 100 ? 2.301  5.046   -29.394 1.00 54.84 ? 184 ARG E NE  1 
ATOM   6493  C  CZ  . ARG E 1 100 ? 1.671  3.878   -29.628 1.00 57.25 ? 184 ARG E CZ  1 
ATOM   6494  N  NH1 . ARG E 1 100 ? 1.676  3.273   -30.826 1.00 55.11 ? 184 ARG E NH1 1 
ATOM   6495  N  NH2 . ARG E 1 100 ? 1.015  3.296   -28.622 1.00 57.03 ? 184 ARG E NH2 1 
ATOM   6496  N  N   . ALA E 1 101 ? 7.697  8.669   -31.622 1.00 48.36 ? 185 ALA E N   1 
ATOM   6497  C  CA  . ALA E 1 101 ? 8.791  9.631   -31.899 1.00 47.02 ? 185 ALA E CA  1 
ATOM   6498  C  C   . ALA E 1 101 ? 10.120 8.965   -32.087 1.00 46.30 ? 185 ALA E C   1 
ATOM   6499  O  O   . ALA E 1 101 ? 10.346 7.827   -31.650 1.00 46.47 ? 185 ALA E O   1 
ATOM   6500  C  CB  . ALA E 1 101 ? 8.906  10.618  -30.778 1.00 46.89 ? 185 ALA E CB  1 
ATOM   6501  N  N   . ARG E 1 102 ? 11.025 9.722   -32.689 1.00 45.41 ? 186 ARG E N   1 
ATOM   6502  C  CA  . ARG E 1 102 ? 12.360 9.245   -32.976 1.00 43.81 ? 186 ARG E CA  1 
ATOM   6503  C  C   . ARG E 1 102 ? 13.369 10.277  -32.604 1.00 43.04 ? 186 ARG E C   1 
ATOM   6504  O  O   . ARG E 1 102 ? 13.341 11.423  -33.123 1.00 43.54 ? 186 ARG E O   1 
ATOM   6505  C  CB  . ARG E 1 102 ? 12.514 9.010   -34.452 1.00 44.00 ? 186 ARG E CB  1 
ATOM   6506  C  CG  . ARG E 1 102 ? 11.821 7.787   -34.946 1.00 45.70 ? 186 ARG E CG  1 
ATOM   6507  C  CD  . ARG E 1 102 ? 11.722 7.928   -36.432 1.00 48.93 ? 186 ARG E CD  1 
ATOM   6508  N  NE  . ARG E 1 102 ? 10.721 7.002   -36.905 1.00 53.10 ? 186 ARG E NE  1 
ATOM   6509  C  CZ  . ARG E 1 102 ? 10.664 6.553   -38.145 1.00 55.06 ? 186 ARG E CZ  1 
ATOM   6510  N  NH1 . ARG E 1 102 ? 11.589 6.939   -39.038 1.00 54.22 ? 186 ARG E NH1 1 
ATOM   6511  N  NH2 . ARG E 1 102 ? 9.697  5.705   -38.473 1.00 53.81 ? 186 ARG E NH2 1 
ATOM   6512  N  N   . LEU E 1 103 ? 14.297 9.867   -31.747 1.00 41.19 ? 187 LEU E N   1 
ATOM   6513  C  CA  . LEU E 1 103 ? 15.432 10.707  -31.467 1.00 40.38 ? 187 LEU E CA  1 
ATOM   6514  C  C   . LEU E 1 103 ? 16.821 10.100  -31.834 1.00 39.92 ? 187 LEU E C   1 
ATOM   6515  O  O   . LEU E 1 103 ? 17.145 8.941   -31.508 1.00 39.33 ? 187 LEU E O   1 
ATOM   6516  C  CB  . LEU E 1 103 ? 15.378 11.154  -30.026 1.00 40.74 ? 187 LEU E CB  1 
ATOM   6517  C  CG  . LEU E 1 103 ? 14.113 11.844  -29.509 1.00 40.04 ? 187 LEU E CG  1 
ATOM   6518  C  CD1 . LEU E 1 103 ? 14.226 11.863  -27.979 1.00 38.90 ? 187 LEU E CD1 1 
ATOM   6519  C  CD2 . LEU E 1 103 ? 14.045 13.229  -30.058 1.00 36.10 ? 187 LEU E CD2 1 
ATOM   6520  N  N   . PHE E 1 104 ? 17.639 10.934  -32.456 1.00 38.74 ? 188 PHE E N   1 
ATOM   6521  C  CA  . PHE E 1 104 ? 18.887 10.514  -33.043 1.00 39.55 ? 188 PHE E CA  1 
ATOM   6522  C  C   . PHE E 1 104 ? 20.082 11.166  -32.379 1.00 39.75 ? 188 PHE E C   1 
ATOM   6523  O  O   . PHE E 1 104 ? 19.928 11.889  -31.404 1.00 40.55 ? 188 PHE E O   1 
ATOM   6524  C  CB  . PHE E 1 104 ? 18.841 10.848  -34.553 1.00 40.23 ? 188 PHE E CB  1 
ATOM   6525  C  CG  . PHE E 1 104 ? 17.664 10.227  -35.264 1.00 39.15 ? 188 PHE E CG  1 
ATOM   6526  C  CD1 . PHE E 1 104 ? 16.649 11.033  -35.808 1.00 39.99 ? 188 PHE E CD1 1 
ATOM   6527  C  CD2 . PHE E 1 104 ? 17.545 8.854   -35.333 1.00 38.30 ? 188 PHE E CD2 1 
ATOM   6528  C  CE1 . PHE E 1 104 ? 15.540 10.473  -36.455 1.00 38.52 ? 188 PHE E CE1 1 
ATOM   6529  C  CE2 . PHE E 1 104 ? 16.433 8.266   -35.962 1.00 41.10 ? 188 PHE E CE2 1 
ATOM   6530  C  CZ  . PHE E 1 104 ? 15.436 9.083   -36.540 1.00 40.51 ? 188 PHE E CZ  1 
ATOM   6531  N  N   . ARG E 1 105 ? 21.277 10.911  -32.907 1.00 40.35 ? 189 ARG E N   1 
ATOM   6532  C  CA  . ARG E 1 105 ? 22.535 11.437  -32.373 1.00 40.17 ? 189 ARG E CA  1 
ATOM   6533  C  C   . ARG E 1 105 ? 22.415 12.822  -31.779 1.00 40.72 ? 189 ARG E C   1 
ATOM   6534  O  O   . ARG E 1 105 ? 22.866 13.080  -30.699 1.00 41.23 ? 189 ARG E O   1 
ATOM   6535  C  CB  . ARG E 1 105 ? 23.543 11.537  -33.507 1.00 40.16 ? 189 ARG E CB  1 
ATOM   6536  C  CG  . ARG E 1 105 ? 24.957 11.861  -33.044 1.00 40.37 ? 189 ARG E CG  1 
ATOM   6537  C  CD  . ARG E 1 105 ? 25.825 10.644  -33.186 1.00 40.75 ? 189 ARG E CD  1 
ATOM   6538  N  NE  . ARG E 1 105 ? 26.726 10.790  -34.300 1.00 42.52 ? 189 ARG E NE  1 
ATOM   6539  C  CZ  . ARG E 1 105 ? 27.191 9.778   -35.012 1.00 44.19 ? 189 ARG E CZ  1 
ATOM   6540  N  NH1 . ARG E 1 105 ? 26.815 8.536   -34.742 1.00 42.12 ? 189 ARG E NH1 1 
ATOM   6541  N  NH2 . ARG E 1 105 ? 28.012 10.028  -36.018 1.00 46.06 ? 189 ARG E NH2 1 
ATOM   6542  N  N   . GLU E 1 106 ? 21.815 13.739  -32.502 1.00 41.86 ? 190 GLU E N   1 
ATOM   6543  C  CA  . GLU E 1 106 ? 21.903 15.150  -32.123 1.00 42.62 ? 190 GLU E CA  1 
ATOM   6544  C  C   . GLU E 1 106 ? 21.004 15.532  -30.930 1.00 41.19 ? 190 GLU E C   1 
ATOM   6545  O  O   . GLU E 1 106 ? 21.117 16.627  -30.429 1.00 41.31 ? 190 GLU E O   1 
ATOM   6546  C  CB  . GLU E 1 106 ? 21.626 16.058  -33.333 1.00 43.50 ? 190 GLU E CB  1 
ATOM   6547  C  CG  . GLU E 1 106 ? 20.085 16.286  -33.644 1.00 47.62 ? 190 GLU E CG  1 
ATOM   6548  C  CD  . GLU E 1 106 ? 19.471 15.202  -34.510 1.00 53.44 ? 190 GLU E CD  1 
ATOM   6549  O  OE1 . GLU E 1 106 ? 20.241 14.250  -34.854 1.00 54.18 ? 190 GLU E OE1 1 
ATOM   6550  O  OE2 . GLU E 1 106 ? 18.233 15.305  -34.845 1.00 54.23 ? 190 GLU E OE2 1 
ATOM   6551  N  N   . SER E 1 107 ? 20.137 14.628  -30.501 1.00 39.65 ? 191 SER E N   1 
ATOM   6552  C  CA  . SER E 1 107 ? 19.355 14.768  -29.270 1.00 39.36 ? 191 SER E CA  1 
ATOM   6553  C  C   . SER E 1 107 ? 20.062 14.104  -28.034 1.00 38.94 ? 191 SER E C   1 
ATOM   6554  O  O   . SER E 1 107 ? 19.514 14.067  -26.942 1.00 39.17 ? 191 SER E O   1 
ATOM   6555  C  CB  . SER E 1 107 ? 17.958 14.097  -29.476 1.00 39.63 ? 191 SER E CB  1 
ATOM   6556  O  OG  . SER E 1 107 ? 17.240 14.615  -30.591 1.00 39.90 ? 191 SER E OG  1 
ATOM   6557  N  N   . CYS E 1 108 ? 21.230 13.510  -28.257 1.00 37.83 ? 192 CYS E N   1 
ATOM   6558  C  CA  . CYS E 1 108 ? 22.057 12.865  -27.236 1.00 36.96 ? 192 CYS E CA  1 
ATOM   6559  C  C   . CYS E 1 108 ? 22.930 13.932  -26.636 1.00 36.05 ? 192 CYS E C   1 
ATOM   6560  O  O   . CYS E 1 108 ? 23.221 14.915  -27.283 1.00 37.18 ? 192 CYS E O   1 
ATOM   6561  C  CB  . CYS E 1 108 ? 22.980 11.790  -27.896 1.00 35.48 ? 192 CYS E CB  1 
ATOM   6562  S  SG  . CYS E 1 108 ? 22.119 10.258  -28.208 1.00 36.06 ? 192 CYS E SG  1 
ATOM   6563  N  N   . VAL E 1 109 ? 23.406 13.759  -25.427 1.00 35.20 ? 193 VAL E N   1 
ATOM   6564  C  CA  . VAL E 1 109 ? 24.422 14.715  -25.001 1.00 34.80 ? 193 VAL E CA  1 
ATOM   6565  C  C   . VAL E 1 109 ? 25.768 14.074  -25.185 1.00 32.97 ? 193 VAL E C   1 
ATOM   6566  O  O   . VAL E 1 109 ? 25.892 12.875  -25.051 1.00 31.95 ? 193 VAL E O   1 
ATOM   6567  C  CB  . VAL E 1 109 ? 24.197 15.310  -23.577 1.00 35.67 ? 193 VAL E CB  1 
ATOM   6568  C  CG1 . VAL E 1 109 ? 23.406 14.442  -22.716 1.00 36.27 ? 193 VAL E CG1 1 
ATOM   6569  C  CG2 . VAL E 1 109 ? 25.524 15.544  -22.882 1.00 38.16 ? 193 VAL E CG2 1 
ATOM   6570  N  N   . PHE E 1 110 ? 26.766 14.876  -25.532 1.00 31.75 ? 194 PHE E N   1 
ATOM   6571  C  CA  . PHE E 1 110 ? 28.100 14.375  -25.786 1.00 30.98 ? 194 PHE E CA  1 
ATOM   6572  C  C   . PHE E 1 110 ? 28.843 14.411  -24.459 1.00 32.09 ? 194 PHE E C   1 
ATOM   6573  O  O   . PHE E 1 110 ? 28.974 15.476  -23.849 1.00 32.29 ? 194 PHE E O   1 
ATOM   6574  C  CB  . PHE E 1 110 ? 28.813 15.205  -26.869 1.00 30.59 ? 194 PHE E CB  1 
ATOM   6575  C  CG  . PHE E 1 110 ? 30.216 14.737  -27.146 1.00 30.01 ? 194 PHE E CG  1 
ATOM   6576  C  CD1 . PHE E 1 110 ? 30.449 13.614  -27.953 1.00 31.80 ? 194 PHE E CD1 1 
ATOM   6577  C  CD2 . PHE E 1 110 ? 31.288 15.347  -26.543 1.00 25.97 ? 194 PHE E CD2 1 
ATOM   6578  C  CE1 . PHE E 1 110 ? 31.743 13.124  -28.177 1.00 31.23 ? 194 PHE E CE1 1 
ATOM   6579  C  CE2 . PHE E 1 110 ? 32.580 14.877  -26.757 1.00 26.95 ? 194 PHE E CE2 1 
ATOM   6580  C  CZ  . PHE E 1 110 ? 32.814 13.751  -27.556 1.00 28.66 ? 194 PHE E CZ  1 
ATOM   6581  N  N   . HIS E 1 111 ? 29.290 13.247  -24.005 1.00 32.58 ? 195 HIS E N   1 
ATOM   6582  C  CA  . HIS E 1 111 ? 29.937 13.081  -22.725 1.00 33.67 ? 195 HIS E CA  1 
ATOM   6583  C  C   . HIS E 1 111 ? 31.361 12.475  -22.908 1.00 35.16 ? 195 HIS E C   1 
ATOM   6584  O  O   . HIS E 1 111 ? 31.535 11.268  -22.868 1.00 35.81 ? 195 HIS E O   1 
ATOM   6585  C  CB  . HIS E 1 111 ? 29.037 12.174  -21.912 1.00 33.13 ? 195 HIS E CB  1 
ATOM   6586  C  CG  . HIS E 1 111 ? 29.446 12.006  -20.490 1.00 36.02 ? 195 HIS E CG  1 
ATOM   6587  N  ND1 . HIS E 1 111 ? 30.350 11.049  -20.084 1.00 40.92 ? 195 HIS E ND1 1 
ATOM   6588  C  CD2 . HIS E 1 111 ? 29.070 12.664  -19.365 1.00 40.00 ? 195 HIS E CD2 1 
ATOM   6589  C  CE1 . HIS E 1 111 ? 30.504 11.116  -18.768 1.00 41.20 ? 195 HIS E CE1 1 
ATOM   6590  N  NE2 . HIS E 1 111 ? 29.742 12.092  -18.307 1.00 40.24 ? 195 HIS E NE2 1 
ATOM   6591  N  N   . GLN E 1 112 ? 32.379 13.309  -23.099 1.00 36.69 ? 196 GLN E N   1 
ATOM   6592  C  CA  . GLN E 1 112 ? 33.731 12.865  -23.533 1.00 38.53 ? 196 GLN E CA  1 
ATOM   6593  C  C   . GLN E 1 112 ? 33.804 11.666  -24.471 1.00 39.27 ? 196 GLN E C   1 
ATOM   6594  O  O   . GLN E 1 112 ? 34.242 10.598  -24.041 1.00 39.93 ? 196 GLN E O   1 
ATOM   6595  C  CB  . GLN E 1 112 ? 34.617 12.472  -22.355 1.00 38.69 ? 196 GLN E CB  1 
ATOM   6596  C  CG  . GLN E 1 112 ? 34.985 13.567  -21.477 1.00 38.56 ? 196 GLN E CG  1 
ATOM   6597  C  CD  . GLN E 1 112 ? 36.373 13.455  -20.876 1.00 33.98 ? 196 GLN E CD  1 
ATOM   6598  O  OE1 . GLN E 1 112 ? 37.125 14.394  -20.968 1.00 38.11 ? 196 GLN E OE1 1 
ATOM   6599  N  NE2 . GLN E 1 112 ? 36.658 12.388  -20.157 1.00 32.49 ? 196 GLN E NE2 1 
ATOM   6600  N  N   . GLY E 1 113 ? 33.411 11.813  -25.721 1.00 39.82 ? 197 GLY E N   1 
ATOM   6601  C  CA  . GLY E 1 113 ? 33.592 10.713  -26.689 1.00 41.30 ? 197 GLY E CA  1 
ATOM   6602  C  C   . GLY E 1 113 ? 32.339 9.886   -26.882 1.00 42.04 ? 197 GLY E C   1 
ATOM   6603  O  O   . GLY E 1 113 ? 32.130 9.317   -27.940 1.00 42.87 ? 197 GLY E O   1 
ATOM   6604  N  N   . CYS E 1 114 ? 31.464 9.968   -25.890 1.00 42.06 ? 198 CYS E N   1 
ATOM   6605  C  CA  . CYS E 1 114 ? 30.400 9.048   -25.585 1.00 42.64 ? 198 CYS E CA  1 
ATOM   6606  C  C   . CYS E 1 114 ? 28.999 9.671   -25.691 1.00 41.12 ? 198 CYS E C   1 
ATOM   6607  O  O   . CYS E 1 114 ? 28.779 10.798  -25.254 1.00 41.35 ? 198 CYS E O   1 
ATOM   6608  C  CB  . CYS E 1 114 ? 30.617 8.787   -24.136 1.00 43.53 ? 198 CYS E CB  1 
ATOM   6609  S  SG  . CYS E 1 114 ? 30.122 7.311   -23.615 1.00 52.39 ? 198 CYS E SG  1 
ATOM   6610  N  N   . TYR E 1 115 ? 28.025 8.960   -26.230 1.00 39.51 ? 199 TYR E N   1 
ATOM   6611  C  CA  . TYR E 1 115 ? 26.749 9.618   -26.468 1.00 37.80 ? 199 TYR E CA  1 
ATOM   6612  C  C   . TYR E 1 115 ? 25.755 9.190   -25.405 1.00 37.48 ? 199 TYR E C   1 
ATOM   6613  O  O   . TYR E 1 115 ? 25.434 8.009   -25.284 1.00 37.71 ? 199 TYR E O   1 
ATOM   6614  C  CB  . TYR E 1 115 ? 26.239 9.345   -27.885 1.00 37.12 ? 199 TYR E CB  1 
ATOM   6615  C  CG  . TYR E 1 115 ? 26.903 10.247  -28.895 1.00 35.87 ? 199 TYR E CG  1 
ATOM   6616  C  CD1 . TYR E 1 115 ? 27.865 9.765   -29.801 1.00 36.81 ? 199 TYR E CD1 1 
ATOM   6617  C  CD2 . TYR E 1 115 ? 26.612 11.602  -28.921 1.00 33.93 ? 199 TYR E CD2 1 
ATOM   6618  C  CE1 . TYR E 1 115 ? 28.526 10.643  -30.716 1.00 33.93 ? 199 TYR E CE1 1 
ATOM   6619  C  CE2 . TYR E 1 115 ? 27.229 12.441  -29.790 1.00 33.81 ? 199 TYR E CE2 1 
ATOM   6620  C  CZ  . TYR E 1 115 ? 28.176 11.959  -30.688 1.00 35.46 ? 199 TYR E CZ  1 
ATOM   6621  O  OH  . TYR E 1 115 ? 28.714 12.846  -31.555 1.00 38.43 ? 199 TYR E OH  1 
ATOM   6622  N  N   . VAL E 1 116 ? 25.276 10.144  -24.620 1.00 36.15 ? 200 VAL E N   1 
ATOM   6623  C  CA  . VAL E 1 116 ? 24.342 9.816   -23.569 1.00 35.65 ? 200 VAL E CA  1 
ATOM   6624  C  C   . VAL E 1 116 ? 22.921 10.280  -23.835 1.00 36.30 ? 200 VAL E C   1 
ATOM   6625  O  O   . VAL E 1 116 ? 22.685 11.352  -24.394 1.00 35.84 ? 200 VAL E O   1 
ATOM   6626  C  CB  . VAL E 1 116 ? 24.778 10.360  -22.237 1.00 35.49 ? 200 VAL E CB  1 
ATOM   6627  C  CG1 . VAL E 1 116 ? 23.694 10.022  -21.175 1.00 36.79 ? 200 VAL E CG1 1 
ATOM   6628  C  CG2 . VAL E 1 116 ? 26.100 9.791   -21.863 1.00 32.25 ? 200 VAL E CG2 1 
ATOM   6629  N  N   . LYS E 1 117 ? 21.982 9.441   -23.401 1.00 37.54 ? 201 LYS E N   1 
ATOM   6630  C  CA  . LYS E 1 117 ? 20.539 9.676   -23.517 1.00 37.30 ? 201 LYS E CA  1 
ATOM   6631  C  C   . LYS E 1 117 ? 20.072 10.213  -22.185 1.00 36.84 ? 201 LYS E C   1 
ATOM   6632  O  O   . LYS E 1 117 ? 19.961 9.495   -21.208 1.00 36.90 ? 201 LYS E O   1 
ATOM   6633  C  CB  . LYS E 1 117 ? 19.862 8.374   -23.896 1.00 37.49 ? 201 LYS E CB  1 
ATOM   6634  C  CG  . LYS E 1 117 ? 20.091 8.077   -25.322 1.00 38.97 ? 201 LYS E CG  1 
ATOM   6635  C  CD  . LYS E 1 117 ? 20.176 6.613   -25.587 1.00 41.80 ? 201 LYS E CD  1 
ATOM   6636  C  CE  . LYS E 1 117 ? 20.896 6.356   -26.931 1.00 39.56 ? 201 LYS E CE  1 
ATOM   6637  N  NZ  . LYS E 1 117 ? 20.963 4.900   -27.123 1.00 40.45 ? 201 LYS E NZ  1 
ATOM   6638  N  N   . ASP E 1 118 ? 19.886 11.521  -22.161 1.00 36.93 ? 202 ASP E N   1 
ATOM   6639  C  CA  . ASP E 1 118 ? 19.591 12.282  -20.961 1.00 36.85 ? 202 ASP E CA  1 
ATOM   6640  C  C   . ASP E 1 118 ? 18.060 12.323  -20.918 1.00 36.06 ? 202 ASP E C   1 
ATOM   6641  O  O   . ASP E 1 118 ? 17.397 13.140  -21.575 1.00 35.18 ? 202 ASP E O   1 
ATOM   6642  C  CB  . ASP E 1 118 ? 20.283 13.676  -21.041 1.00 35.83 ? 202 ASP E CB  1 
ATOM   6643  C  CG  . ASP E 1 118 ? 19.995 14.572  -19.833 1.00 39.32 ? 202 ASP E CG  1 
ATOM   6644  O  OD1 . ASP E 1 118 ? 19.160 14.177  -18.989 1.00 42.07 ? 202 ASP E OD1 1 
ATOM   6645  O  OD2 . ASP E 1 118 ? 20.606 15.695  -19.706 1.00 43.17 ? 202 ASP E OD2 1 
ATOM   6646  N  N   . LEU E 1 119 ? 17.521 11.399  -20.143 1.00 36.10 ? 203 LEU E N   1 
ATOM   6647  C  CA  . LEU E 1 119 ? 16.089 11.203  -19.986 1.00 36.43 ? 203 LEU E CA  1 
ATOM   6648  C  C   . LEU E 1 119 ? 15.349 12.439  -19.523 1.00 37.84 ? 203 LEU E C   1 
ATOM   6649  O  O   . LEU E 1 119 ? 14.154 12.569  -19.776 1.00 39.13 ? 203 LEU E O   1 
ATOM   6650  C  CB  . LEU E 1 119 ? 15.839 10.108  -18.979 1.00 35.65 ? 203 LEU E CB  1 
ATOM   6651  C  CG  . LEU E 1 119 ? 16.266 8.719   -19.437 1.00 35.62 ? 203 LEU E CG  1 
ATOM   6652  C  CD1 . LEU E 1 119 ? 15.532 7.632   -18.636 1.00 28.81 ? 203 LEU E CD1 1 
ATOM   6653  C  CD2 . LEU E 1 119 ? 16.061 8.573   -20.958 1.00 31.82 ? 203 LEU E CD2 1 
ATOM   6654  N  N   . SER E 1 120 ? 16.063 13.359  -18.881 1.00 38.48 ? 204 SER E N   1 
ATOM   6655  C  CA  . SER E 1 120 ? 15.457 14.463  -18.216 1.00 38.43 ? 204 SER E CA  1 
ATOM   6656  C  C   . SER E 1 120 ? 15.157 15.475  -19.230 1.00 38.81 ? 204 SER E C   1 
ATOM   6657  O  O   . SER E 1 120 ? 14.505 16.440  -18.899 1.00 40.53 ? 204 SER E O   1 
ATOM   6658  C  CB  . SER E 1 120 ? 16.404 15.070  -17.203 1.00 38.67 ? 204 SER E CB  1 
ATOM   6659  O  OG  . SER E 1 120 ? 17.341 15.952  -17.827 1.00 41.02 ? 204 SER E OG  1 
ATOM   6660  N  N   . ARG E 1 121 ? 15.661 15.304  -20.447 1.00 38.84 ? 205 ARG E N   1 
ATOM   6661  C  CA  . ARG E 1 121 ? 15.344 16.225  -21.577 1.00 38.91 ? 205 ARG E CA  1 
ATOM   6662  C  C   . ARG E 1 121 ? 14.129 15.764  -22.350 1.00 38.80 ? 205 ARG E C   1 
ATOM   6663  O  O   . ARG E 1 121 ? 13.637 16.453  -23.201 1.00 37.89 ? 205 ARG E O   1 
ATOM   6664  C  CB  . ARG E 1 121 ? 16.517 16.340  -22.542 1.00 39.48 ? 205 ARG E CB  1 
ATOM   6665  C  CG  . ARG E 1 121 ? 17.674 17.237  -22.027 1.00 42.88 ? 205 ARG E CG  1 
ATOM   6666  C  CD  . ARG E 1 121 ? 19.033 16.865  -22.649 1.00 43.35 ? 205 ARG E CD  1 
ATOM   6667  N  NE  . ARG E 1 121 ? 19.771 18.057  -23.070 1.00 47.08 ? 205 ARG E NE  1 
ATOM   6668  C  CZ  . ARG E 1 121 ? 20.771 18.607  -22.395 1.00 51.75 ? 205 ARG E CZ  1 
ATOM   6669  N  NH1 . ARG E 1 121 ? 21.352 19.683  -22.876 1.00 52.82 ? 205 ARG E NH1 1 
ATOM   6670  N  NH2 . ARG E 1 121 ? 21.199 18.085  -21.235 1.00 55.63 ? 205 ARG E NH2 1 
ATOM   6671  N  N   . LEU E 1 122 ? 13.650 14.571  -22.069 1.00 40.28 ? 206 LEU E N   1 
ATOM   6672  C  CA  . LEU E 1 122 ? 12.456 14.087  -22.763 1.00 43.45 ? 206 LEU E CA  1 
ATOM   6673  C  C   . LEU E 1 122 ? 11.206 14.990  -22.595 1.00 45.03 ? 206 LEU E C   1 
ATOM   6674  O  O   . LEU E 1 122 ? 10.584 15.361  -23.571 1.00 45.92 ? 206 LEU E O   1 
ATOM   6675  C  CB  . LEU E 1 122 ? 12.130 12.660  -22.336 1.00 42.29 ? 206 LEU E CB  1 
ATOM   6676  C  CG  . LEU E 1 122 ? 12.593 11.516  -23.218 1.00 42.50 ? 206 LEU E CG  1 
ATOM   6677  C  CD1 . LEU E 1 122 ? 13.580 11.937  -24.292 1.00 40.08 ? 206 LEU E CD1 1 
ATOM   6678  C  CD2 . LEU E 1 122 ? 13.098 10.375  -22.361 1.00 40.63 ? 206 LEU E CD2 1 
ATOM   6679  N  N   . GLY E 1 123 ? 10.850 15.341  -21.365 1.00 46.64 ? 207 GLY E N   1 
ATOM   6680  C  CA  . GLY E 1 123 ? 9.615  16.086  -21.147 1.00 48.56 ? 207 GLY E CA  1 
ATOM   6681  C  C   . GLY E 1 123 ? 8.547  15.166  -20.610 1.00 50.25 ? 207 GLY E C   1 
ATOM   6682  O  O   . GLY E 1 123 ? 7.361  15.395  -20.821 1.00 51.49 ? 207 GLY E O   1 
ATOM   6683  N  N   . ARG E 1 124 ? 8.988  14.102  -19.959 1.00 50.86 ? 208 ARG E N   1 
ATOM   6684  C  CA  . ARG E 1 124 ? 8.132  13.152  -19.324 1.00 52.00 ? 208 ARG E CA  1 
ATOM   6685  C  C   . ARG E 1 124 ? 8.496  13.246  -17.837 1.00 52.82 ? 208 ARG E C   1 
ATOM   6686  O  O   . ARG E 1 124 ? 9.140  14.195  -17.411 1.00 53.17 ? 208 ARG E O   1 
ATOM   6687  C  CB  . ARG E 1 124 ? 8.429  11.745  -19.858 1.00 52.36 ? 208 ARG E CB  1 
ATOM   6688  C  CG  . ARG E 1 124 ? 7.942  11.413  -21.276 1.00 52.72 ? 208 ARG E CG  1 
ATOM   6689  C  CD  . ARG E 1 124 ? 6.432  11.732  -21.500 1.00 51.61 ? 208 ARG E CD  1 
ATOM   6690  N  NE  . ARG E 1 124 ? 6.412  13.020  -22.162 1.00 50.90 ? 208 ARG E NE  1 
ATOM   6691  C  CZ  . ARG E 1 124 ? 6.056  13.212  -23.424 1.00 50.63 ? 208 ARG E CZ  1 
ATOM   6692  N  NH1 . ARG E 1 124 ? 5.598  12.178  -24.150 1.00 50.23 ? 208 ARG E NH1 1 
ATOM   6693  N  NH2 . ARG E 1 124 ? 6.154  14.444  -23.943 1.00 48.54 ? 208 ARG E NH2 1 
ATOM   6694  N  N   . ASP E 1 125 ? 8.087  12.274  -17.047 1.00 53.09 ? 209 ASP E N   1 
ATOM   6695  C  CA  . ASP E 1 125 ? 8.339  12.305  -15.630 1.00 54.38 ? 209 ASP E CA  1 
ATOM   6696  C  C   . ASP E 1 125 ? 9.148  11.059  -15.411 1.00 54.51 ? 209 ASP E C   1 
ATOM   6697  O  O   . ASP E 1 125 ? 8.715  9.932   -15.739 1.00 54.37 ? 209 ASP E O   1 
ATOM   6698  C  CB  . ASP E 1 125 ? 6.997  12.333  -14.826 1.00 55.38 ? 209 ASP E CB  1 
ATOM   6699  C  CG  . ASP E 1 125 ? 7.139  11.926  -13.327 1.00 58.66 ? 209 ASP E CG  1 
ATOM   6700  O  OD1 . ASP E 1 125 ? 7.962  12.495  -12.557 1.00 61.74 ? 209 ASP E OD1 1 
ATOM   6701  O  OD2 . ASP E 1 125 ? 6.386  11.029  -12.895 1.00 61.94 ? 209 ASP E OD2 1 
ATOM   6702  N  N   . LEU E 1 126 ? 10.342 11.255  -14.872 1.00 54.92 ? 210 LEU E N   1 
ATOM   6703  C  CA  . LEU E 1 126 ? 11.270 10.142  -14.775 1.00 55.68 ? 210 LEU E CA  1 
ATOM   6704  C  C   . LEU E 1 126 ? 10.749 9.060   -13.853 1.00 55.84 ? 210 LEU E C   1 
ATOM   6705  O  O   . LEU E 1 126 ? 11.320 7.963   -13.825 1.00 55.30 ? 210 LEU E O   1 
ATOM   6706  C  CB  . LEU E 1 126 ? 12.704 10.590  -14.422 1.00 55.57 ? 210 LEU E CB  1 
ATOM   6707  C  CG  . LEU E 1 126 ? 13.260 11.674  -15.355 1.00 56.23 ? 210 LEU E CG  1 
ATOM   6708  C  CD1 . LEU E 1 126 ? 14.598 12.236  -14.896 1.00 57.77 ? 210 LEU E CD1 1 
ATOM   6709  C  CD2 . LEU E 1 126 ? 13.363 11.182  -16.757 1.00 56.88 ? 210 LEU E CD2 1 
ATOM   6710  N  N   . ARG E 1 127 ? 9.660  9.363   -13.127 1.00 56.36 ? 211 ARG E N   1 
ATOM   6711  C  CA  . ARG E 1 127 ? 9.000  8.361   -12.272 1.00 57.21 ? 211 ARG E CA  1 
ATOM   6712  C  C   . ARG E 1 127 ? 8.247  7.343   -13.123 1.00 56.30 ? 211 ARG E C   1 
ATOM   6713  O  O   . ARG E 1 127 ? 8.056  6.208   -12.693 1.00 56.28 ? 211 ARG E O   1 
ATOM   6714  C  CB  . ARG E 1 127 ? 8.069  9.030   -11.267 1.00 58.04 ? 211 ARG E CB  1 
ATOM   6715  C  CG  . ARG E 1 127 ? 8.624  9.068   -9.833  1.00 63.60 ? 211 ARG E CG  1 
ATOM   6716  C  CD  . ARG E 1 127 ? 8.673  10.519  -9.247  1.00 71.45 ? 211 ARG E CD  1 
ATOM   6717  N  NE  . ARG E 1 127 ? 7.521  10.912  -8.410  1.00 76.88 ? 211 ARG E NE  1 
ATOM   6718  C  CZ  . ARG E 1 127 ? 6.479  11.684  -8.785  1.00 79.78 ? 211 ARG E CZ  1 
ATOM   6719  N  NH1 . ARG E 1 127 ? 6.360  12.186  -10.028 1.00 78.65 ? 211 ARG E NH1 1 
ATOM   6720  N  NH2 . ARG E 1 127 ? 5.528  11.955  -7.887  1.00 81.01 ? 211 ARG E NH2 1 
ATOM   6721  N  N   . LYS E 1 128 ? 7.842  7.773   -14.326 1.00 55.59 ? 212 LYS E N   1 
ATOM   6722  C  CA  . LYS E 1 128 ? 7.264  6.915   -15.379 1.00 55.75 ? 212 LYS E CA  1 
ATOM   6723  C  C   . LYS E 1 128 ? 8.070  6.949   -16.725 1.00 54.84 ? 212 LYS E C   1 
ATOM   6724  O  O   . LYS E 1 128 ? 7.484  7.194   -17.811 1.00 54.29 ? 212 LYS E O   1 
ATOM   6725  C  CB  . LYS E 1 128 ? 5.836  7.350   -15.703 1.00 56.33 ? 212 LYS E CB  1 
ATOM   6726  C  CG  . LYS E 1 128 ? 5.066  8.015   -14.581 1.00 59.73 ? 212 LYS E CG  1 
ATOM   6727  C  CD  . LYS E 1 128 ? 4.089  7.065   -13.954 1.00 65.17 ? 212 LYS E CD  1 
ATOM   6728  C  CE  . LYS E 1 128 ? 2.762  7.007   -14.753 1.00 68.36 ? 212 LYS E CE  1 
ATOM   6729  N  NZ  . LYS E 1 128 ? 1.999  5.799   -14.261 1.00 71.92 ? 212 LYS E NZ  1 
ATOM   6730  N  N   . THR E 1 129 ? 9.392  6.753   -16.652 1.00 52.29 ? 213 THR E N   1 
ATOM   6731  C  CA  . THR E 1 129 ? 10.150 6.506   -17.842 1.00 50.70 ? 213 THR E CA  1 
ATOM   6732  C  C   . THR E 1 129 ? 11.068 5.320   -17.749 1.00 49.37 ? 213 THR E C   1 
ATOM   6733  O  O   . THR E 1 129 ? 11.730 5.087   -16.731 1.00 49.55 ? 213 THR E O   1 
ATOM   6734  C  CB  . THR E 1 129 ? 10.920 7.670   -18.290 1.00 50.91 ? 213 THR E CB  1 
ATOM   6735  O  OG1 . THR E 1 129 ? 10.016 8.758   -18.464 1.00 53.48 ? 213 THR E OG1 1 
ATOM   6736  C  CG2 . THR E 1 129 ? 11.517 7.353   -19.660 1.00 51.41 ? 213 THR E CG2 1 
ATOM   6737  N  N   . LEU E 1 130 ? 11.096 4.541   -18.817 1.00 47.03 ? 214 LEU E N   1 
ATOM   6738  C  CA  . LEU E 1 130 ? 12.042 3.448   -18.859 1.00 45.63 ? 214 LEU E CA  1 
ATOM   6739  C  C   . LEU E 1 130 ? 12.946 3.537   -20.068 1.00 43.43 ? 214 LEU E C   1 
ATOM   6740  O  O   . LEU E 1 130 ? 12.549 4.046   -21.089 1.00 43.08 ? 214 LEU E O   1 
ATOM   6741  C  CB  . LEU E 1 130 ? 11.295 2.141   -18.852 1.00 46.02 ? 214 LEU E CB  1 
ATOM   6742  C  CG  . LEU E 1 130 ? 10.486 1.816   -17.618 1.00 46.61 ? 214 LEU E CG  1 
ATOM   6743  C  CD1 . LEU E 1 130 ? 9.821  0.483   -17.871 1.00 47.24 ? 214 LEU E CD1 1 
ATOM   6744  C  CD2 . LEU E 1 130 ? 11.422 1.713   -16.423 1.00 48.57 ? 214 LEU E CD2 1 
ATOM   6745  N  N   . ILE E 1 131 ? 14.148 3.005   -19.959 1.00 41.95 ? 215 ILE E N   1 
ATOM   6746  C  CA  . ILE E 1 131 ? 15.075 2.958   -21.100 1.00 40.14 ? 215 ILE E CA  1 
ATOM   6747  C  C   . ILE E 1 131 ? 15.482 1.541   -21.330 1.00 39.06 ? 215 ILE E C   1 
ATOM   6748  O  O   . ILE E 1 131 ? 15.951 0.880   -20.391 1.00 40.54 ? 215 ILE E O   1 
ATOM   6749  C  CB  . ILE E 1 131 ? 16.324 3.883   -20.902 1.00 40.71 ? 215 ILE E CB  1 
ATOM   6750  C  CG1 . ILE E 1 131 ? 17.378 3.646   -21.974 1.00 42.30 ? 215 ILE E CG1 1 
ATOM   6751  C  CG2 . ILE E 1 131 ? 17.002 3.706   -19.514 1.00 39.23 ? 215 ILE E CG2 1 
ATOM   6752  C  CD1 . ILE E 1 131 ? 18.102 4.925   -22.353 1.00 43.89 ? 215 ILE E CD1 1 
ATOM   6753  N  N   . LEU E 1 132 ? 15.270 1.031   -22.548 1.00 37.77 ? 216 LEU E N   1 
ATOM   6754  C  CA  . LEU E 1 132 ? 15.775 -0.303  -22.908 1.00 36.44 ? 216 LEU E CA  1 
ATOM   6755  C  C   . LEU E 1 132 ? 16.952 -0.115  -23.861 1.00 36.97 ? 216 LEU E C   1 
ATOM   6756  O  O   . LEU E 1 132 ? 16.832 0.606   -24.852 1.00 37.29 ? 216 LEU E O   1 
ATOM   6757  C  CB  . LEU E 1 132 ? 14.671 -1.132  -23.499 1.00 35.20 ? 216 LEU E CB  1 
ATOM   6758  C  CG  . LEU E 1 132 ? 15.024 -2.511  -23.993 1.00 34.37 ? 216 LEU E CG  1 
ATOM   6759  C  CD1 . LEU E 1 132 ? 15.345 -3.450  -22.888 1.00 33.54 ? 216 LEU E CD1 1 
ATOM   6760  C  CD2 . LEU E 1 132 ? 13.907 -3.029  -24.812 1.00 32.94 ? 216 LEU E CD2 1 
ATOM   6761  N  N   . ASP E 1 133 ? 18.114 -0.699  -23.525 1.00 37.21 ? 217 ASP E N   1 
ATOM   6762  C  CA  . ASP E 1 133 ? 19.394 -0.326  -24.194 1.00 36.33 ? 217 ASP E CA  1 
ATOM   6763  C  C   . ASP E 1 133 ? 20.399 -1.310  -23.760 1.00 35.27 ? 217 ASP E C   1 
ATOM   6764  O  O   . ASP E 1 133 ? 20.272 -1.848  -22.667 1.00 36.22 ? 217 ASP E O   1 
ATOM   6765  C  CB  . ASP E 1 133 ? 19.851 1.054   -23.777 1.00 36.12 ? 217 ASP E CB  1 
ATOM   6766  C  CG  . ASP E 1 133 ? 20.748 1.747   -24.835 1.00 40.36 ? 217 ASP E CG  1 
ATOM   6767  O  OD1 . ASP E 1 133 ? 21.747 1.091   -25.279 1.00 44.43 ? 217 ASP E OD1 1 
ATOM   6768  O  OD2 . ASP E 1 133 ? 20.494 2.975   -25.161 1.00 38.24 ? 217 ASP E OD2 1 
ATOM   6769  N  N   . ASN E 1 134 ? 21.374 -1.598  -24.613 1.00 34.45 ? 218 ASN E N   1 
ATOM   6770  C  CA  . ASN E 1 134 ? 22.373 -2.672  -24.338 1.00 33.41 ? 218 ASN E CA  1 
ATOM   6771  C  C   . ASN E 1 134 ? 23.684 -2.054  -23.879 1.00 33.48 ? 218 ASN E C   1 
ATOM   6772  O  O   . ASN E 1 134 ? 24.596 -2.782  -23.435 1.00 33.61 ? 218 ASN E O   1 
ATOM   6773  C  CB  . ASN E 1 134 ? 22.668 -3.502  -25.605 1.00 31.86 ? 218 ASN E CB  1 
ATOM   6774  C  CG  . ASN E 1 134 ? 23.281 -2.650  -26.709 1.00 30.30 ? 218 ASN E CG  1 
ATOM   6775  O  OD1 . ASN E 1 134 ? 22.664 -1.717  -27.214 1.00 29.82 ? 218 ASN E OD1 1 
ATOM   6776  N  ND2 . ASN E 1 134 ? 24.480 -2.962  -27.083 1.00 29.15 ? 218 ASN E ND2 1 
ATOM   6777  N  N   . SER E 1 135 ? 23.808 -0.735  -24.034 1.00 32.72 ? 219 SER E N   1 
ATOM   6778  C  CA  . SER E 1 135 ? 24.996 -0.033  -23.494 1.00 34.18 ? 219 SER E CA  1 
ATOM   6779  C  C   . SER E 1 135 ? 24.729 0.785   -22.237 1.00 32.90 ? 219 SER E C   1 
ATOM   6780  O  O   . SER E 1 135 ? 24.162 1.850   -22.302 1.00 32.31 ? 219 SER E O   1 
ATOM   6781  C  CB  . SER E 1 135 ? 25.617 0.910   -24.531 1.00 34.60 ? 219 SER E CB  1 
ATOM   6782  O  OG  . SER E 1 135 ? 25.536 0.310   -25.803 1.00 41.67 ? 219 SER E OG  1 
ATOM   6783  N  N   . PRO E 1 136 ? 25.239 0.333   -21.094 1.00 34.00 ? 220 PRO E N   1 
ATOM   6784  C  CA  . PRO E 1 136 ? 25.174 1.161   -19.853 1.00 33.61 ? 220 PRO E CA  1 
ATOM   6785  C  C   . PRO E 1 136 ? 25.652 2.593   -20.082 1.00 34.04 ? 220 PRO E C   1 
ATOM   6786  O  O   . PRO E 1 136 ? 25.108 3.485   -19.468 1.00 35.50 ? 220 PRO E O   1 
ATOM   6787  C  CB  . PRO E 1 136 ? 26.107 0.440   -18.907 1.00 33.07 ? 220 PRO E CB  1 
ATOM   6788  C  CG  . PRO E 1 136 ? 25.958 -0.992  -19.334 1.00 33.79 ? 220 PRO E CG  1 
ATOM   6789  C  CD  . PRO E 1 136 ? 25.936 -0.948  -20.868 1.00 32.87 ? 220 PRO E CD  1 
ATOM   6790  N  N   . ALA E 1 137 ? 26.605 2.850   -20.980 1.00 33.90 ? 221 ALA E N   1 
ATOM   6791  C  CA  . ALA E 1 137 ? 26.931 4.244   -21.306 1.00 33.96 ? 221 ALA E CA  1 
ATOM   6792  C  C   . ALA E 1 137 ? 25.776 5.082   -21.778 1.00 34.53 ? 221 ALA E C   1 
ATOM   6793  O  O   . ALA E 1 137 ? 25.761 6.273   -21.540 1.00 34.75 ? 221 ALA E O   1 
ATOM   6794  C  CB  . ALA E 1 137 ? 27.933 4.308   -22.295 1.00 34.57 ? 221 ALA E CB  1 
ATOM   6795  N  N   . SER E 1 138 ? 24.803 4.492   -22.449 1.00 34.25 ? 222 SER E N   1 
ATOM   6796  C  CA  . SER E 1 138 ? 23.685 5.279   -22.894 1.00 35.07 ? 222 SER E CA  1 
ATOM   6797  C  C   . SER E 1 138 ? 22.905 5.954   -21.789 1.00 35.19 ? 222 SER E C   1 
ATOM   6798  O  O   . SER E 1 138 ? 22.365 7.032   -22.009 1.00 35.67 ? 222 SER E O   1 
ATOM   6799  C  CB  . SER E 1 138 ? 22.772 4.440   -23.757 1.00 36.44 ? 222 SER E CB  1 
ATOM   6800  O  OG  . SER E 1 138 ? 23.369 4.374   -25.051 1.00 40.93 ? 222 SER E OG  1 
ATOM   6801  N  N   . TYR E 1 139 ? 22.890 5.370   -20.587 1.00 34.73 ? 223 TYR E N   1 
ATOM   6802  C  CA  . TYR E 1 139 ? 22.147 5.961   -19.508 1.00 34.19 ? 223 TYR E CA  1 
ATOM   6803  C  C   . TYR E 1 139 ? 22.947 6.303   -18.233 1.00 35.28 ? 223 TYR E C   1 
ATOM   6804  O  O   . TYR E 1 139 ? 22.511 5.984   -17.119 1.00 35.50 ? 223 TYR E O   1 
ATOM   6805  C  CB  . TYR E 1 139 ? 20.952 5.058   -19.181 1.00 34.27 ? 223 TYR E CB  1 
ATOM   6806  C  CG  . TYR E 1 139 ? 21.295 3.577   -19.056 1.00 33.72 ? 223 TYR E CG  1 
ATOM   6807  C  CD1 . TYR E 1 139 ? 21.879 3.085   -17.917 1.00 33.44 ? 223 TYR E CD1 1 
ATOM   6808  C  CD2 . TYR E 1 139 ? 21.002 2.678   -20.072 1.00 29.32 ? 223 TYR E CD2 1 
ATOM   6809  C  CE1 . TYR E 1 139 ? 22.187 1.753   -17.807 1.00 32.63 ? 223 TYR E CE1 1 
ATOM   6810  C  CE2 . TYR E 1 139 ? 21.265 1.375   -19.964 1.00 29.61 ? 223 TYR E CE2 1 
ATOM   6811  C  CZ  . TYR E 1 139 ? 21.877 0.892   -18.824 1.00 32.58 ? 223 TYR E CZ  1 
ATOM   6812  O  OH  . TYR E 1 139 ? 22.196 -0.468  -18.658 1.00 34.36 ? 223 TYR E OH  1 
ATOM   6813  N  N   . ILE E 1 140 ? 24.094 6.965   -18.398 1.00 35.18 ? 224 ILE E N   1 
ATOM   6814  C  CA  . ILE E 1 140 ? 24.969 7.330   -17.312 1.00 35.25 ? 224 ILE E CA  1 
ATOM   6815  C  C   . ILE E 1 140 ? 24.278 8.232   -16.305 1.00 35.56 ? 224 ILE E C   1 
ATOM   6816  O  O   . ILE E 1 140 ? 24.623 8.206   -15.132 1.00 36.75 ? 224 ILE E O   1 
ATOM   6817  C  CB  . ILE E 1 140 ? 26.259 8.042   -17.833 1.00 35.42 ? 224 ILE E CB  1 
ATOM   6818  C  CG1 . ILE E 1 140 ? 27.182 7.043   -18.440 1.00 36.89 ? 224 ILE E CG1 1 
ATOM   6819  C  CG2 . ILE E 1 140 ? 27.094 8.614   -16.672 1.00 36.66 ? 224 ILE E CG2 1 
ATOM   6820  C  CD1 . ILE E 1 140 ? 28.166 7.704   -19.444 1.00 44.34 ? 224 ILE E CD1 1 
ATOM   6821  N  N   . PHE E 1 141 ? 23.330 9.045   -16.758 1.00 35.86 ? 225 PHE E N   1 
ATOM   6822  C  CA  . PHE E 1 141 ? 22.642 9.986   -15.905 1.00 35.21 ? 225 PHE E CA  1 
ATOM   6823  C  C   . PHE E 1 141 ? 21.496 9.358   -15.241 1.00 35.40 ? 225 PHE E C   1 
ATOM   6824  O  O   . PHE E 1 141 ? 21.094 9.821   -14.207 1.00 37.00 ? 225 PHE E O   1 
ATOM   6825  C  CB  . PHE E 1 141 ? 22.150 11.207  -16.682 1.00 36.49 ? 225 PHE E CB  1 
ATOM   6826  C  CG  . PHE E 1 141 ? 23.255 11.958  -17.427 1.00 38.58 ? 225 PHE E CG  1 
ATOM   6827  C  CD1 . PHE E 1 141 ? 22.963 12.709  -18.545 1.00 40.27 ? 225 PHE E CD1 1 
ATOM   6828  C  CD2 . PHE E 1 141 ? 24.585 11.868  -17.032 1.00 39.34 ? 225 PHE E CD2 1 
ATOM   6829  C  CE1 . PHE E 1 141 ? 23.952 13.376  -19.216 1.00 39.26 ? 225 PHE E CE1 1 
ATOM   6830  C  CE2 . PHE E 1 141 ? 25.555 12.506  -17.701 1.00 36.81 ? 225 PHE E CE2 1 
ATOM   6831  C  CZ  . PHE E 1 141 ? 25.238 13.257  -18.797 1.00 40.25 ? 225 PHE E CZ  1 
ATOM   6832  N  N   . HIS E 1 142 ? 20.977 8.274   -15.795 1.00 35.92 ? 226 HIS E N   1 
ATOM   6833  C  CA  . HIS E 1 142 ? 19.782 7.612   -15.262 1.00 35.62 ? 226 HIS E CA  1 
ATOM   6834  C  C   . HIS E 1 142 ? 19.856 6.095   -15.217 1.00 37.12 ? 226 HIS E C   1 
ATOM   6835  O  O   . HIS E 1 142 ? 19.026 5.448   -15.820 1.00 37.26 ? 226 HIS E O   1 
ATOM   6836  C  CB  . HIS E 1 142 ? 18.590 8.027   -16.101 1.00 34.19 ? 226 HIS E CB  1 
ATOM   6837  C  CG  . HIS E 1 142 ? 18.478 9.514   -16.223 1.00 33.01 ? 226 HIS E CG  1 
ATOM   6838  N  ND1 . HIS E 1 142 ? 17.966 10.308  -15.218 1.00 33.96 ? 226 HIS E ND1 1 
ATOM   6839  C  CD2 . HIS E 1 142 ? 18.911 10.359  -17.182 1.00 31.78 ? 226 HIS E CD2 1 
ATOM   6840  C  CE1 . HIS E 1 142 ? 18.038 11.576  -15.583 1.00 35.24 ? 226 HIS E CE1 1 
ATOM   6841  N  NE2 . HIS E 1 142 ? 18.619 11.635  -16.771 1.00 33.68 ? 226 HIS E NE2 1 
ATOM   6842  N  N   . PRO E 1 143 ? 20.838 5.515   -14.495 1.00 38.25 ? 227 PRO E N   1 
ATOM   6843  C  CA  . PRO E 1 143 ? 20.916 4.056   -14.566 1.00 39.84 ? 227 PRO E CA  1 
ATOM   6844  C  C   . PRO E 1 143 ? 19.764 3.387   -13.812 1.00 42.67 ? 227 PRO E C   1 
ATOM   6845  O  O   . PRO E 1 143 ? 19.590 2.160   -13.903 1.00 43.35 ? 227 PRO E O   1 
ATOM   6846  C  CB  . PRO E 1 143 ? 22.229 3.733   -13.853 1.00 38.82 ? 227 PRO E CB  1 
ATOM   6847  C  CG  . PRO E 1 143 ? 22.396 4.848   -12.880 1.00 37.06 ? 227 PRO E CG  1 
ATOM   6848  C  CD  . PRO E 1 143 ? 21.879 6.076   -13.616 1.00 37.28 ? 227 PRO E CD  1 
ATOM   6849  N  N   . GLU E 1 144 ? 19.010 4.163   -13.039 1.00 44.65 ? 228 GLU E N   1 
ATOM   6850  C  CA  . GLU E 1 144 ? 17.943 3.571   -12.227 1.00 47.09 ? 228 GLU E CA  1 
ATOM   6851  C  C   . GLU E 1 144 ? 16.598 3.520   -12.987 1.00 46.35 ? 228 GLU E C   1 
ATOM   6852  O  O   . GLU E 1 144 ? 15.569 3.054   -12.454 1.00 46.92 ? 228 GLU E O   1 
ATOM   6853  C  CB  . GLU E 1 144 ? 17.818 4.308   -10.876 1.00 47.93 ? 228 GLU E CB  1 
ATOM   6854  C  CG  . GLU E 1 144 ? 18.147 5.783   -10.971 1.00 54.83 ? 228 GLU E CG  1 
ATOM   6855  C  CD  . GLU E 1 144 ? 19.571 6.133   -10.471 1.00 63.51 ? 228 GLU E CD  1 
ATOM   6856  O  OE1 . GLU E 1 144 ? 20.024 7.283   -10.831 1.00 65.65 ? 228 GLU E OE1 1 
ATOM   6857  O  OE2 . GLU E 1 144 ? 20.196 5.289   -9.726  1.00 60.69 ? 228 GLU E OE2 1 
ATOM   6858  N  N   . ASN E 1 145 ? 16.630 3.998   -14.231 1.00 45.09 ? 229 ASN E N   1 
ATOM   6859  C  CA  . ASN E 1 145 ? 15.508 3.971   -15.106 1.00 43.35 ? 229 ASN E CA  1 
ATOM   6860  C  C   . ASN E 1 145 ? 15.652 2.907   -16.169 1.00 43.18 ? 229 ASN E C   1 
ATOM   6861  O  O   . ASN E 1 145 ? 14.891 2.904   -17.143 1.00 43.66 ? 229 ASN E O   1 
ATOM   6862  C  CB  . ASN E 1 145 ? 15.433 5.274   -15.816 1.00 42.60 ? 229 ASN E CB  1 
ATOM   6863  C  CG  . ASN E 1 145 ? 14.747 6.282   -15.054 1.00 43.51 ? 229 ASN E CG  1 
ATOM   6864  O  OD1 . ASN E 1 145 ? 15.361 7.004   -14.301 1.00 45.72 ? 229 ASN E OD1 1 
ATOM   6865  N  ND2 . ASN E 1 145 ? 13.453 6.410   -15.271 1.00 45.57 ? 229 ASN E ND2 1 
ATOM   6866  N  N   . ALA E 1 146 ? 16.607 2.011   -15.994 1.00 42.14 ? 230 ALA E N   1 
ATOM   6867  C  CA  . ALA E 1 146 ? 17.059 1.177   -17.077 1.00 42.93 ? 230 ALA E CA  1 
ATOM   6868  C  C   . ALA E 1 146 ? 16.698 -0.269  -16.917 1.00 44.08 ? 230 ALA E C   1 
ATOM   6869  O  O   . ALA E 1 146 ? 16.821 -0.834  -15.834 1.00 44.21 ? 230 ALA E O   1 
ATOM   6870  C  CB  . ALA E 1 146 ? 18.606 1.291   -17.220 1.00 43.35 ? 230 ALA E CB  1 
ATOM   6871  N  N   . VAL E 1 147 ? 16.334 -0.900  -18.028 1.00 45.05 ? 231 VAL E N   1 
ATOM   6872  C  CA  . VAL E 1 147 ? 16.137 -2.325  -18.036 1.00 45.60 ? 231 VAL E CA  1 
ATOM   6873  C  C   . VAL E 1 147 ? 17.230 -2.823  -18.947 1.00 45.51 ? 231 VAL E C   1 
ATOM   6874  O  O   . VAL E 1 147 ? 17.106 -2.709  -20.143 1.00 46.77 ? 231 VAL E O   1 
ATOM   6875  C  CB  . VAL E 1 147 ? 14.746 -2.674  -18.656 1.00 47.02 ? 231 VAL E CB  1 
ATOM   6876  C  CG1 . VAL E 1 147 ? 14.441 -4.182  -18.532 1.00 46.70 ? 231 VAL E CG1 1 
ATOM   6877  C  CG2 . VAL E 1 147 ? 13.605 -1.793  -18.070 1.00 45.98 ? 231 VAL E CG2 1 
ATOM   6878  N  N   . PRO E 1 148 ? 18.332 -3.329  -18.406 1.00 45.31 ? 232 PRO E N   1 
ATOM   6879  C  CA  . PRO E 1 148 ? 19.393 -3.767  -19.306 1.00 44.84 ? 232 PRO E CA  1 
ATOM   6880  C  C   . PRO E 1 148 ? 18.966 -4.870  -20.225 1.00 44.13 ? 232 PRO E C   1 
ATOM   6881  O  O   . PRO E 1 148 ? 18.053 -5.601  -19.886 1.00 44.32 ? 232 PRO E O   1 
ATOM   6882  C  CB  . PRO E 1 148 ? 20.475 -4.284  -18.347 1.00 44.47 ? 232 PRO E CB  1 
ATOM   6883  C  CG  . PRO E 1 148 ? 20.250 -3.508  -17.130 1.00 45.08 ? 232 PRO E CG  1 
ATOM   6884  C  CD  . PRO E 1 148 ? 18.744 -3.473  -17.001 1.00 46.01 ? 232 PRO E CD  1 
ATOM   6885  N  N   . VAL E 1 149 ? 19.633 -4.974  -21.374 1.00 43.03 ? 233 VAL E N   1 
ATOM   6886  C  CA  . VAL E 1 149 ? 19.442 -6.072  -22.329 1.00 41.64 ? 233 VAL E CA  1 
ATOM   6887  C  C   . VAL E 1 149 ? 20.781 -6.359  -22.941 1.00 41.56 ? 233 VAL E C   1 
ATOM   6888  O  O   . VAL E 1 149 ? 21.469 -5.474  -23.377 1.00 42.32 ? 233 VAL E O   1 
ATOM   6889  C  CB  . VAL E 1 149 ? 18.376 -5.760  -23.469 1.00 41.60 ? 233 VAL E CB  1 
ATOM   6890  C  CG1 . VAL E 1 149 ? 18.737 -4.620  -24.329 1.00 37.06 ? 233 VAL E CG1 1 
ATOM   6891  C  CG2 . VAL E 1 149 ? 18.253 -6.910  -24.367 1.00 43.31 ? 233 VAL E CG2 1 
ATOM   6892  N  N   . GLN E 1 150 ? 21.153 -7.614  -22.943 1.00 41.87 ? 234 GLN E N   1 
ATOM   6893  C  CA  . GLN E 1 150 ? 22.308 -8.119  -23.621 1.00 42.00 ? 234 GLN E CA  1 
ATOM   6894  C  C   . GLN E 1 150 ? 22.340 -7.638  -25.042 1.00 41.81 ? 234 GLN E C   1 
ATOM   6895  O  O   . GLN E 1 150 ? 21.285 -7.554  -25.738 1.00 42.54 ? 234 GLN E O   1 
ATOM   6896  C  CB  . GLN E 1 150 ? 22.194 -9.634  -23.680 1.00 42.16 ? 234 GLN E CB  1 
ATOM   6897  C  CG  . GLN E 1 150 ? 23.441 -10.346 -23.256 1.00 48.47 ? 234 GLN E CG  1 
ATOM   6898  C  CD  . GLN E 1 150 ? 23.418 -11.835 -23.592 1.00 54.39 ? 234 GLN E CD  1 
ATOM   6899  O  OE1 . GLN E 1 150 ? 24.160 -12.283 -24.498 1.00 55.49 ? 234 GLN E OE1 1 
ATOM   6900  N  NE2 . GLN E 1 150 ? 22.563 -12.620 -22.866 1.00 51.62 ? 234 GLN E NE2 1 
ATOM   6901  N  N   . SER E 1 151 ? 23.555 -7.350  -25.488 1.00 40.61 ? 235 SER E N   1 
ATOM   6902  C  CA  . SER E 1 151 ? 23.813 -6.960  -26.862 1.00 39.44 ? 235 SER E CA  1 
ATOM   6903  C  C   . SER E 1 151 ? 23.386 -8.061  -27.876 1.00 38.45 ? 235 SER E C   1 
ATOM   6904  O  O   . SER E 1 151 ? 23.613 -9.212  -27.628 1.00 37.38 ? 235 SER E O   1 
ATOM   6905  C  CB  . SER E 1 151 ? 25.298 -6.608  -26.972 1.00 39.29 ? 235 SER E CB  1 
ATOM   6906  O  OG  . SER E 1 151 ? 25.543 -5.375  -26.338 1.00 38.49 ? 235 SER E OG  1 
ATOM   6907  N  N   . TRP E 1 152 ? 22.731 -7.724  -28.984 1.00 37.76 ? 236 TRP E N   1 
ATOM   6908  C  CA  . TRP E 1 152 ? 22.447 -8.770  -29.984 1.00 38.33 ? 236 TRP E CA  1 
ATOM   6909  C  C   . TRP E 1 152 ? 23.185 -8.538  -31.325 1.00 39.70 ? 236 TRP E C   1 
ATOM   6910  O  O   . TRP E 1 152 ? 23.221 -7.408  -31.844 1.00 39.63 ? 236 TRP E O   1 
ATOM   6911  C  CB  . TRP E 1 152 ? 20.920 -8.993  -30.199 1.00 36.64 ? 236 TRP E CB  1 
ATOM   6912  C  CG  . TRP E 1 152 ? 20.617 -10.150 -31.146 1.00 35.86 ? 236 TRP E CG  1 
ATOM   6913  C  CD1 . TRP E 1 152 ? 20.527 -11.502 -30.818 1.00 33.85 ? 236 TRP E CD1 1 
ATOM   6914  C  CD2 . TRP E 1 152 ? 20.403 -10.070 -32.575 1.00 30.83 ? 236 TRP E CD2 1 
ATOM   6915  N  NE1 . TRP E 1 152 ? 20.254 -12.253 -31.976 1.00 32.57 ? 236 TRP E NE1 1 
ATOM   6916  C  CE2 . TRP E 1 152 ? 20.188 -11.410 -33.055 1.00 29.31 ? 236 TRP E CE2 1 
ATOM   6917  C  CE3 . TRP E 1 152 ? 20.406 -9.024  -33.478 1.00 30.45 ? 236 TRP E CE3 1 
ATOM   6918  C  CZ2 . TRP E 1 152 ? 19.979 -11.706 -34.393 1.00 31.94 ? 236 TRP E CZ2 1 
ATOM   6919  C  CZ3 . TRP E 1 152 ? 20.201 -9.305  -34.816 1.00 32.35 ? 236 TRP E CZ3 1 
ATOM   6920  C  CH2 . TRP E 1 152 ? 19.967 -10.645 -35.265 1.00 34.73 ? 236 TRP E CH2 1 
ATOM   6921  N  N   . PHE E 1 153 ? 23.753 -9.600  -31.894 1.00 41.62 ? 237 PHE E N   1 
ATOM   6922  C  CA  . PHE E 1 153 ? 24.411 -9.489  -33.226 1.00 43.35 ? 237 PHE E CA  1 
ATOM   6923  C  C   . PHE E 1 153 ? 23.865 -10.433 -34.308 1.00 44.26 ? 237 PHE E C   1 
ATOM   6924  O  O   . PHE E 1 153 ? 23.417 -9.981  -35.359 1.00 45.88 ? 237 PHE E O   1 
ATOM   6925  C  CB  . PHE E 1 153 ? 25.932 -9.617  -33.106 1.00 42.58 ? 237 PHE E CB  1 
ATOM   6926  C  CG  . PHE E 1 153 ? 26.517 -8.804  -31.983 1.00 42.48 ? 237 PHE E CG  1 
ATOM   6927  C  CD1 . PHE E 1 153 ? 26.566 -9.333  -30.673 1.00 41.82 ? 237 PHE E CD1 1 
ATOM   6928  C  CD2 . PHE E 1 153 ? 26.987 -7.495  -32.221 1.00 41.02 ? 237 PHE E CD2 1 
ATOM   6929  C  CE1 . PHE E 1 153 ? 27.098 -8.571  -29.592 1.00 42.03 ? 237 PHE E CE1 1 
ATOM   6930  C  CE2 . PHE E 1 153 ? 27.508 -6.742  -31.190 1.00 40.77 ? 237 PHE E CE2 1 
ATOM   6931  C  CZ  . PHE E 1 153 ? 27.570 -7.293  -29.852 1.00 42.68 ? 237 PHE E CZ  1 
ATOM   6932  N  N   . ASP E 1 154 ? 23.873 -11.723 -34.045 1.00 44.96 ? 238 ASP E N   1 
ATOM   6933  C  CA  . ASP E 1 154 ? 23.569 -12.710 -35.075 1.00 46.18 ? 238 ASP E CA  1 
ATOM   6934  C  C   . ASP E 1 154 ? 22.996 -14.037 -34.474 1.00 46.77 ? 238 ASP E C   1 
ATOM   6935  O  O   . ASP E 1 154 ? 22.647 -14.939 -35.203 1.00 46.31 ? 238 ASP E O   1 
ATOM   6936  C  CB  . ASP E 1 154 ? 24.840 -12.985 -35.897 1.00 45.97 ? 238 ASP E CB  1 
ATOM   6937  C  CG  . ASP E 1 154 ? 25.877 -13.879 -35.139 1.00 48.17 ? 238 ASP E CG  1 
ATOM   6938  O  OD1 . ASP E 1 154 ? 26.217 -13.639 -33.962 1.00 45.06 ? 238 ASP E OD1 1 
ATOM   6939  O  OD2 . ASP E 1 154 ? 26.373 -14.853 -35.737 1.00 55.65 ? 238 ASP E OD2 1 
ATOM   6940  N  N   . ASP E 1 155 ? 22.891 -14.147 -33.155 1.00 47.71 ? 239 ASP E N   1 
ATOM   6941  C  CA  . ASP E 1 155 ? 22.564 -15.438 -32.562 1.00 49.54 ? 239 ASP E CA  1 
ATOM   6942  C  C   . ASP E 1 155 ? 21.085 -15.739 -32.646 1.00 50.18 ? 239 ASP E C   1 
ATOM   6943  O  O   . ASP E 1 155 ? 20.300 -15.178 -31.905 1.00 50.83 ? 239 ASP E O   1 
ATOM   6944  C  CB  . ASP E 1 155 ? 23.046 -15.520 -31.123 1.00 50.01 ? 239 ASP E CB  1 
ATOM   6945  C  CG  . ASP E 1 155 ? 22.501 -16.704 -30.393 1.00 52.59 ? 239 ASP E CG  1 
ATOM   6946  O  OD1 . ASP E 1 155 ? 22.116 -17.696 -31.042 1.00 55.94 ? 239 ASP E OD1 1 
ATOM   6947  O  OD2 . ASP E 1 155 ? 22.446 -16.644 -29.148 1.00 57.74 ? 239 ASP E OD2 1 
ATOM   6948  N  N   . MET E 1 156 ? 20.700 -16.633 -33.545 1.00 50.64 ? 240 MET E N   1 
ATOM   6949  C  CA  . MET E 1 156 ? 19.297 -16.802 -33.808 1.00 51.20 ? 240 MET E CA  1 
ATOM   6950  C  C   . MET E 1 156 ? 18.592 -17.659 -32.756 1.00 51.30 ? 240 MET E C   1 
ATOM   6951  O  O   . MET E 1 156 ? 17.444 -17.994 -32.932 1.00 51.33 ? 240 MET E O   1 
ATOM   6952  C  CB  . MET E 1 156 ? 19.064 -17.334 -35.217 1.00 51.45 ? 240 MET E CB  1 
ATOM   6953  C  CG  . MET E 1 156 ? 19.490 -16.385 -36.343 1.00 52.90 ? 240 MET E CG  1 
ATOM   6954  S  SD  . MET E 1 156 ? 18.632 -14.811 -36.560 1.00 54.56 ? 240 MET E SD  1 
ATOM   6955  C  CE  . MET E 1 156 ? 17.348 -15.280 -37.730 1.00 61.82 ? 240 MET E CE  1 
ATOM   6956  N  N   . ALA E 1 157 ? 19.275 -17.988 -31.661 1.00 51.61 ? 241 ALA E N   1 
ATOM   6957  C  CA  . ALA E 1 157 ? 18.669 -18.680 -30.524 1.00 52.01 ? 241 ALA E CA  1 
ATOM   6958  C  C   . ALA E 1 157 ? 18.340 -17.670 -29.447 1.00 52.67 ? 241 ALA E C   1 
ATOM   6959  O  O   . ALA E 1 157 ? 17.831 -18.002 -28.388 1.00 53.85 ? 241 ALA E O   1 
ATOM   6960  C  CB  . ALA E 1 157 ? 19.622 -19.739 -29.964 1.00 51.41 ? 241 ALA E CB  1 
ATOM   6961  N  N   . ASP E 1 158 ? 18.652 -16.420 -29.688 1.00 53.33 ? 242 ASP E N   1 
ATOM   6962  C  CA  . ASP E 1 158 ? 18.368 -15.404 -28.695 1.00 54.05 ? 242 ASP E CA  1 
ATOM   6963  C  C   . ASP E 1 158 ? 16.879 -15.384 -28.413 1.00 55.48 ? 242 ASP E C   1 
ATOM   6964  O  O   . ASP E 1 158 ? 16.060 -15.400 -29.341 1.00 56.03 ? 242 ASP E O   1 
ATOM   6965  C  CB  . ASP E 1 158 ? 18.807 -14.037 -29.182 1.00 52.74 ? 242 ASP E CB  1 
ATOM   6966  C  CG  . ASP E 1 158 ? 18.744 -13.017 -28.111 1.00 52.22 ? 242 ASP E CG  1 
ATOM   6967  O  OD1 . ASP E 1 158 ? 17.716 -12.301 -28.030 1.00 51.32 ? 242 ASP E OD1 1 
ATOM   6968  O  OD2 . ASP E 1 158 ? 19.723 -12.924 -27.338 1.00 52.82 ? 242 ASP E OD2 1 
ATOM   6969  N  N   . THR E 1 159 ? 16.525 -15.351 -27.134 1.00 56.90 ? 243 THR E N   1 
ATOM   6970  C  CA  . THR E 1 159 ? 15.127 -15.217 -26.772 1.00 58.14 ? 243 THR E CA  1 
ATOM   6971  C  C   . THR E 1 159 ? 14.895 -13.966 -25.935 1.00 58.17 ? 243 THR E C   1 
ATOM   6972  O  O   . THR E 1 159 ? 13.764 -13.750 -25.495 1.00 58.66 ? 243 THR E O   1 
ATOM   6973  C  CB  . THR E 1 159 ? 14.600 -16.479 -25.993 1.00 58.72 ? 243 THR E CB  1 
ATOM   6974  O  OG1 . THR E 1 159 ? 15.356 -16.662 -24.793 1.00 58.72 ? 243 THR E OG1 1 
ATOM   6975  C  CG2 . THR E 1 159 ? 14.727 -17.761 -26.845 1.00 60.52 ? 243 THR E CG2 1 
ATOM   6976  N  N   . GLU E 1 160 ? 15.938 -13.141 -25.735 1.00 57.90 ? 244 GLU E N   1 
ATOM   6977  C  CA  . GLU E 1 160 ? 15.918 -12.090 -24.681 1.00 57.34 ? 244 GLU E CA  1 
ATOM   6978  C  C   . GLU E 1 160 ? 14.721 -11.199 -24.752 1.00 56.62 ? 244 GLU E C   1 
ATOM   6979  O  O   . GLU E 1 160 ? 14.130 -10.915 -23.729 1.00 57.26 ? 244 GLU E O   1 
ATOM   6980  C  CB  . GLU E 1 160 ? 17.185 -11.221 -24.615 1.00 57.15 ? 244 GLU E CB  1 
ATOM   6981  C  CG  . GLU E 1 160 ? 18.514 -11.934 -24.270 1.00 59.92 ? 244 GLU E CG  1 
ATOM   6982  C  CD  . GLU E 1 160 ? 18.455 -12.911 -23.059 1.00 63.07 ? 244 GLU E CD  1 
ATOM   6983  O  OE1 . GLU E 1 160 ? 17.642 -12.727 -22.134 1.00 63.77 ? 244 GLU E OE1 1 
ATOM   6984  O  OE2 . GLU E 1 160 ? 19.242 -13.882 -23.034 1.00 63.29 ? 244 GLU E OE2 1 
ATOM   6985  N  N   . LEU E 1 161 ? 14.344 -10.786 -25.953 1.00 56.29 ? 245 LEU E N   1 
ATOM   6986  C  CA  . LEU E 1 161 ? 13.252 -9.855  -26.122 1.00 56.40 ? 245 LEU E CA  1 
ATOM   6987  C  C   . LEU E 1 161 ? 11.934 -10.505 -25.771 1.00 57.28 ? 245 LEU E C   1 
ATOM   6988  O  O   . LEU E 1 161 ? 10.993 -9.821  -25.355 1.00 56.87 ? 245 LEU E O   1 
ATOM   6989  C  CB  . LEU E 1 161 ? 13.171 -9.325  -27.556 1.00 56.21 ? 245 LEU E CB  1 
ATOM   6990  C  CG  . LEU E 1 161 ? 14.052 -8.199  -28.097 1.00 55.12 ? 245 LEU E CG  1 
ATOM   6991  C  CD1 . LEU E 1 161 ? 13.541 -7.801  -29.511 1.00 53.20 ? 245 LEU E CD1 1 
ATOM   6992  C  CD2 . LEU E 1 161 ? 14.104 -6.986  -27.155 1.00 51.88 ? 245 LEU E CD2 1 
ATOM   6993  N  N   . LEU E 1 162 ? 11.856 -11.821 -25.963 1.00 58.38 ? 246 LEU E N   1 
ATOM   6994  C  CA  . LEU E 1 162 ? 10.642 -12.560 -25.598 1.00 59.74 ? 246 LEU E CA  1 
ATOM   6995  C  C   . LEU E 1 162 ? 10.503 -12.708 -24.069 1.00 60.15 ? 246 LEU E C   1 
ATOM   6996  O  O   . LEU E 1 162 ? 9.429  -12.425 -23.517 1.00 60.39 ? 246 LEU E O   1 
ATOM   6997  C  CB  . LEU E 1 162 ? 10.527 -13.902 -26.343 1.00 59.30 ? 246 LEU E CB  1 
ATOM   6998  C  CG  . LEU E 1 162 ? 9.398  -14.819 -25.856 1.00 59.79 ? 246 LEU E CG  1 
ATOM   6999  C  CD1 . LEU E 1 162 ? 8.054  -14.391 -26.426 1.00 59.99 ? 246 LEU E CD1 1 
ATOM   7000  C  CD2 . LEU E 1 162 ? 9.662  -16.325 -26.115 1.00 60.20 ? 246 LEU E CD2 1 
ATOM   7001  N  N   . ASN E 1 163 ? 11.577 -13.107 -23.396 1.00 60.72 ? 247 ASN E N   1 
ATOM   7002  C  CA  . ASN E 1 163 ? 11.610 -13.087 -21.933 1.00 62.35 ? 247 ASN E CA  1 
ATOM   7003  C  C   . ASN E 1 163 ? 11.271 -11.705 -21.345 1.00 62.89 ? 247 ASN E C   1 
ATOM   7004  O  O   . ASN E 1 163 ? 10.966 -11.574 -20.167 1.00 63.32 ? 247 ASN E O   1 
ATOM   7005  C  CB  . ASN E 1 163 ? 12.970 -13.548 -21.399 1.00 62.90 ? 247 ASN E CB  1 
ATOM   7006  C  CG  . ASN E 1 163 ? 13.428 -14.924 -21.976 1.00 65.85 ? 247 ASN E CG  1 
ATOM   7007  O  OD1 . ASN E 1 163 ? 12.607 -15.793 -22.334 1.00 66.85 ? 247 ASN E OD1 1 
ATOM   7008  N  ND2 . ASN E 1 163 ? 14.755 -15.112 -22.055 1.00 67.19 ? 247 ASN E ND2 1 
ATOM   7009  N  N   . LEU E 1 164 ? 11.293 -10.667 -22.163 1.00 63.40 ? 248 LEU E N   1 
ATOM   7010  C  CA  . LEU E 1 164 ? 11.115 -9.338  -21.612 1.00 63.83 ? 248 LEU E CA  1 
ATOM   7011  C  C   . LEU E 1 164 ? 9.677  -8.865  -21.626 1.00 64.13 ? 248 LEU E C   1 
ATOM   7012  O  O   . LEU E 1 164 ? 9.324  -7.945  -20.887 1.00 64.88 ? 248 LEU E O   1 
ATOM   7013  C  CB  . LEU E 1 164 ? 12.018 -8.297  -22.312 1.00 63.74 ? 248 LEU E CB  1 
ATOM   7014  C  CG  . LEU E 1 164 ? 13.422 -7.967  -21.775 1.00 62.64 ? 248 LEU E CG  1 
ATOM   7015  C  CD1 . LEU E 1 164 ? 14.184 -7.111  -22.795 1.00 61.00 ? 248 LEU E CD1 1 
ATOM   7016  C  CD2 . LEU E 1 164 ? 13.377 -7.256  -20.442 1.00 60.79 ? 248 LEU E CD2 1 
ATOM   7017  N  N   . ILE E 1 165 ? 8.839  -9.455  -22.467 1.00 64.27 ? 249 ILE E N   1 
ATOM   7018  C  CA  . ILE E 1 165 ? 7.470  -8.921  -22.609 1.00 64.15 ? 249 ILE E CA  1 
ATOM   7019  C  C   . ILE E 1 165 ? 6.696  -8.970  -21.285 1.00 63.88 ? 249 ILE E C   1 
ATOM   7020  O  O   . ILE E 1 165 ? 6.025  -7.993  -20.930 1.00 62.84 ? 249 ILE E O   1 
ATOM   7021  C  CB  . ILE E 1 165 ? 6.684  -9.630  -23.721 1.00 64.31 ? 249 ILE E CB  1 
ATOM   7022  C  CG1 . ILE E 1 165 ? 7.118  -9.120  -25.092 1.00 63.75 ? 249 ILE E CG1 1 
ATOM   7023  C  CG2 . ILE E 1 165 ? 5.197  -9.370  -23.586 1.00 65.05 ? 249 ILE E CG2 1 
ATOM   7024  C  CD1 . ILE E 1 165 ? 7.032  -10.235 -26.168 1.00 63.64 ? 249 ILE E CD1 1 
ATOM   7025  N  N   . PRO E 1 166 ? 6.786  -10.102 -20.554 1.00 63.94 ? 250 PRO E N   1 
ATOM   7026  C  CA  . PRO E 1 166 ? 6.020  -10.137 -19.331 1.00 64.66 ? 250 PRO E CA  1 
ATOM   7027  C  C   . PRO E 1 166 ? 6.584  -9.203  -18.279 1.00 65.07 ? 250 PRO E C   1 
ATOM   7028  O  O   . PRO E 1 166 ? 5.849  -8.774  -17.383 1.00 65.20 ? 250 PRO E O   1 
ATOM   7029  C  CB  . PRO E 1 166 ? 6.127  -11.598 -18.886 1.00 64.20 ? 250 PRO E CB  1 
ATOM   7030  C  CG  . PRO E 1 166 ? 7.375  -12.068 -19.457 1.00 64.61 ? 250 PRO E CG  1 
ATOM   7031  C  CD  . PRO E 1 166 ? 7.485  -11.378 -20.780 1.00 64.24 ? 250 PRO E CD  1 
ATOM   7032  N  N   . ILE E 1 167 ? 7.874  -8.898  -18.395 1.00 65.53 ? 251 ILE E N   1 
ATOM   7033  C  CA  . ILE E 1 167 ? 8.544  -8.021  -17.442 1.00 65.52 ? 251 ILE E CA  1 
ATOM   7034  C  C   . ILE E 1 167 ? 8.003  -6.624  -17.591 1.00 65.41 ? 251 ILE E C   1 
ATOM   7035  O  O   . ILE E 1 167 ? 7.605  -6.005  -16.609 1.00 66.16 ? 251 ILE E O   1 
ATOM   7036  C  CB  . ILE E 1 167 ? 10.061 -8.052  -17.579 1.00 65.60 ? 251 ILE E CB  1 
ATOM   7037  C  CG1 . ILE E 1 167 ? 10.589 -9.391  -17.053 1.00 66.13 ? 251 ILE E CG1 1 
ATOM   7038  C  CG2 . ILE E 1 167 ? 10.686 -6.886  -16.813 1.00 65.98 ? 251 ILE E CG2 1 
ATOM   7039  C  CD1 . ILE E 1 167 ? 12.104 -9.598  -17.245 1.00 68.59 ? 251 ILE E CD1 1 
ATOM   7040  N  N   . PHE E 1 168 ? 7.928  -6.118  -18.807 1.00 65.14 ? 252 PHE E N   1 
ATOM   7041  C  CA  . PHE E 1 168 ? 7.276  -4.839  -18.937 1.00 65.22 ? 252 PHE E CA  1 
ATOM   7042  C  C   . PHE E 1 168 ? 5.799  -4.986  -18.642 1.00 65.57 ? 252 PHE E C   1 
ATOM   7043  O  O   . PHE E 1 168 ? 5.157  -4.032  -18.206 1.00 65.76 ? 252 PHE E O   1 
ATOM   7044  C  CB  . PHE E 1 168 ? 7.494  -4.228  -20.303 1.00 64.52 ? 252 PHE E CB  1 
ATOM   7045  C  CG  . PHE E 1 168 ? 8.917  -3.924  -20.603 1.00 64.59 ? 252 PHE E CG  1 
ATOM   7046  C  CD1 . PHE E 1 168 ? 9.787  -4.927  -20.992 1.00 64.57 ? 252 PHE E CD1 1 
ATOM   7047  C  CD2 . PHE E 1 168 ? 9.390  -2.631  -20.521 1.00 63.53 ? 252 PHE E CD2 1 
ATOM   7048  C  CE1 . PHE E 1 168 ? 11.106 -4.646  -21.295 1.00 64.01 ? 252 PHE E CE1 1 
ATOM   7049  C  CE2 . PHE E 1 168 ? 10.696 -2.349  -20.818 1.00 63.11 ? 252 PHE E CE2 1 
ATOM   7050  C  CZ  . PHE E 1 168 ? 11.555 -3.357  -21.215 1.00 63.33 ? 252 PHE E CZ  1 
ATOM   7051  N  N   . GLU E 1 169 ? 5.249  -6.174  -18.890 1.00 66.69 ? 253 GLU E N   1 
ATOM   7052  C  CA  . GLU E 1 169 ? 3.815  -6.378  -18.641 1.00 67.36 ? 253 GLU E CA  1 
ATOM   7053  C  C   . GLU E 1 169 ? 3.577  -6.097  -17.161 1.00 67.58 ? 253 GLU E C   1 
ATOM   7054  O  O   . GLU E 1 169 ? 2.741  -5.267  -16.815 1.00 67.13 ? 253 GLU E O   1 
ATOM   7055  C  CB  . GLU E 1 169 ? 3.317  -7.767  -19.098 1.00 67.13 ? 253 GLU E CB  1 
ATOM   7056  C  CG  . GLU E 1 169 ? 2.590  -7.748  -20.482 1.00 67.20 ? 253 GLU E CG  1 
ATOM   7057  C  CD  . GLU E 1 169 ? 2.224  -9.143  -21.023 1.00 67.73 ? 253 GLU E CD  1 
ATOM   7058  O  OE1 . GLU E 1 169 ? 2.866  -10.153 -20.601 1.00 66.05 ? 253 GLU E OE1 1 
ATOM   7059  O  OE2 . GLU E 1 169 ? 1.298  -9.218  -21.887 1.00 67.07 ? 253 GLU E OE2 1 
ATOM   7060  N  N   . GLU E 1 170 ? 4.376  -6.729  -16.308 1.00 68.18 ? 254 GLU E N   1 
ATOM   7061  C  CA  . GLU E 1 170 ? 4.338  -6.456  -14.884 1.00 69.61 ? 254 GLU E CA  1 
ATOM   7062  C  C   . GLU E 1 170 ? 4.460  -4.953  -14.561 1.00 69.10 ? 254 GLU E C   1 
ATOM   7063  O  O   . GLU E 1 170 ? 3.770  -4.474  -13.659 1.00 69.42 ? 254 GLU E O   1 
ATOM   7064  C  CB  . GLU E 1 170 ? 5.367  -7.316  -14.105 1.00 70.04 ? 254 GLU E CB  1 
ATOM   7065  C  CG  . GLU E 1 170 ? 5.022  -7.519  -12.581 1.00 74.75 ? 254 GLU E CG  1 
ATOM   7066  C  CD  . GLU E 1 170 ? 4.902  -9.020  -12.145 1.00 78.59 ? 254 GLU E CD  1 
ATOM   7067  O  OE1 . GLU E 1 170 ? 3.783  -9.479  -11.788 1.00 76.04 ? 254 GLU E OE1 1 
ATOM   7068  O  OE2 . GLU E 1 170 ? 5.931  -9.740  -12.162 1.00 81.27 ? 254 GLU E OE2 1 
ATOM   7069  N  N   . LEU E 1 171 ? 5.276  -4.202  -15.308 1.00 68.53 ? 255 LEU E N   1 
ATOM   7070  C  CA  . LEU E 1 171 ? 5.472  -2.768  -14.994 1.00 68.09 ? 255 LEU E CA  1 
ATOM   7071  C  C   . LEU E 1 171 ? 4.534  -1.823  -15.714 1.00 68.20 ? 255 LEU E C   1 
ATOM   7072  O  O   . LEU E 1 171 ? 4.443  -0.665  -15.332 1.00 68.51 ? 255 LEU E O   1 
ATOM   7073  C  CB  . LEU E 1 171 ? 6.910  -2.280  -15.250 1.00 67.87 ? 255 LEU E CB  1 
ATOM   7074  C  CG  . LEU E 1 171 ? 8.125  -3.131  -14.910 1.00 67.81 ? 255 LEU E CG  1 
ATOM   7075  C  CD1 . LEU E 1 171 ? 9.300  -2.649  -15.695 1.00 67.39 ? 255 LEU E CD1 1 
ATOM   7076  C  CD2 . LEU E 1 171 ? 8.441  -3.104  -13.431 1.00 68.54 ? 255 LEU E CD2 1 
ATOM   7077  N  N   . SER E 1 172 ? 3.873  -2.287  -16.766 1.00 68.21 ? 256 SER E N   1 
ATOM   7078  C  CA  . SER E 1 172 ? 2.995  -1.439  -17.565 1.00 68.90 ? 256 SER E CA  1 
ATOM   7079  C  C   . SER E 1 172 ? 2.158  -0.440  -16.753 1.00 69.76 ? 256 SER E C   1 
ATOM   7080  O  O   . SER E 1 172 ? 2.000  0.742   -17.136 1.00 68.82 ? 256 SER E O   1 
ATOM   7081  C  CB  . SER E 1 172 ? 2.066  -2.325  -18.381 1.00 69.16 ? 256 SER E CB  1 
ATOM   7082  O  OG  . SER E 1 172 ? 1.821  -3.548  -17.699 1.00 68.81 ? 256 SER E OG  1 
ATOM   7083  N  N   . GLY E 1 173 ? 1.612  -0.923  -15.635 1.00 70.67 ? 257 GLY E N   1 
ATOM   7084  C  CA  . GLY E 1 173 ? 0.699  -0.103  -14.833 1.00 72.23 ? 257 GLY E CA  1 
ATOM   7085  C  C   . GLY E 1 173 ? 1.218  0.296   -13.467 1.00 72.95 ? 257 GLY E C   1 
ATOM   7086  O  O   . GLY E 1 173 ? 0.443  0.390   -12.505 1.00 73.20 ? 257 GLY E O   1 
ATOM   7087  N  N   . ALA E 1 174 ? 2.530  0.505   -13.374 1.00 73.39 ? 258 ALA E N   1 
ATOM   7088  C  CA  . ALA E 1 174 ? 3.135  1.072   -12.178 1.00 73.53 ? 258 ALA E CA  1 
ATOM   7089  C  C   . ALA E 1 174 ? 3.164  2.597   -12.360 1.00 73.84 ? 258 ALA E C   1 
ATOM   7090  O  O   . ALA E 1 174 ? 3.073  3.099   -13.491 1.00 73.82 ? 258 ALA E O   1 
ATOM   7091  C  CB  . ALA E 1 174 ? 4.524  0.495   -11.944 1.00 73.56 ? 258 ALA E CB  1 
ATOM   7092  N  N   . GLU E 1 175 ? 3.215  3.330   -11.247 1.00 73.88 ? 259 GLU E N   1 
ATOM   7093  C  CA  . GLU E 1 175 ? 3.212  4.796   -11.299 1.00 74.03 ? 259 GLU E CA  1 
ATOM   7094  C  C   . GLU E 1 175 ? 4.498  5.350   -10.679 1.00 72.27 ? 259 GLU E C   1 
ATOM   7095  O  O   . GLU E 1 175 ? 4.756  6.558   -10.729 1.00 71.92 ? 259 GLU E O   1 
ATOM   7096  C  CB  . GLU E 1 175 ? 1.929  5.386   -10.666 1.00 74.32 ? 259 GLU E CB  1 
ATOM   7097  C  CG  . GLU E 1 175 ? 0.607  5.035   -11.448 1.00 76.77 ? 259 GLU E CG  1 
ATOM   7098  C  CD  . GLU E 1 175 ? -0.497 6.125   -11.372 1.00 77.29 ? 259 GLU E CD  1 
ATOM   7099  O  OE1 . GLU E 1 175 ? -0.537 6.887   -10.364 1.00 81.40 ? 259 GLU E OE1 1 
ATOM   7100  O  OE2 . GLU E 1 175 ? -1.323 6.221   -12.327 1.00 80.14 ? 259 GLU E OE2 1 
ATOM   7101  N  N   . ASP E 1 176 ? 5.290  4.436   -10.102 1.00 70.80 ? 260 ASP E N   1 
ATOM   7102  C  CA  . ASP E 1 176 ? 6.669  4.682   -9.674  1.00 69.11 ? 260 ASP E CA  1 
ATOM   7103  C  C   . ASP E 1 176 ? 7.531  3.501   -10.071 1.00 67.82 ? 260 ASP E C   1 
ATOM   7104  O  O   . ASP E 1 176 ? 7.710  2.534   -9.283  1.00 66.99 ? 260 ASP E O   1 
ATOM   7105  C  CB  . ASP E 1 176 ? 6.750  4.871   -8.171  1.00 69.73 ? 260 ASP E CB  1 
ATOM   7106  C  CG  . ASP E 1 176 ? 8.084  5.453   -7.720  1.00 71.43 ? 260 ASP E CG  1 
ATOM   7107  O  OD1 . ASP E 1 176 ? 9.078  4.676   -7.575  1.00 71.52 ? 260 ASP E OD1 1 
ATOM   7108  O  OD2 . ASP E 1 176 ? 8.112  6.693   -7.477  1.00 72.71 ? 260 ASP E OD2 1 
ATOM   7109  N  N   . VAL E 1 177 ? 8.080  3.603   -11.287 1.00 65.97 ? 261 VAL E N   1 
ATOM   7110  C  CA  . VAL E 1 177 ? 8.949  2.560   -11.856 1.00 64.39 ? 261 VAL E CA  1 
ATOM   7111  C  C   . VAL E 1 177 ? 10.145 2.256   -10.952 1.00 64.25 ? 261 VAL E C   1 
ATOM   7112  O  O   . VAL E 1 177 ? 10.653 1.131   -10.952 1.00 64.25 ? 261 VAL E O   1 
ATOM   7113  C  CB  . VAL E 1 177 ? 9.428  2.855   -13.342 1.00 64.07 ? 261 VAL E CB  1 
ATOM   7114  C  CG1 . VAL E 1 177 ? 8.248  3.202   -14.258 1.00 62.00 ? 261 VAL E CG1 1 
ATOM   7115  C  CG2 . VAL E 1 177 ? 10.535 3.909   -13.399 1.00 61.74 ? 261 VAL E CG2 1 
ATOM   7116  N  N   . TYR E 1 178 ? 10.568 3.232   -10.152 1.00 63.93 ? 262 TYR E N   1 
ATOM   7117  C  CA  . TYR E 1 178 ? 11.671 2.984   -9.221  1.00 64.22 ? 262 TYR E CA  1 
ATOM   7118  C  C   . TYR E 1 178 ? 11.399 1.871   -8.230  1.00 65.44 ? 262 TYR E C   1 
ATOM   7119  O  O   . TYR E 1 178 ? 12.272 1.076   -7.953  1.00 65.24 ? 262 TYR E O   1 
ATOM   7120  C  CB  . TYR E 1 178 ? 12.136 4.266   -8.532  1.00 62.41 ? 262 TYR E CB  1 
ATOM   7121  C  CG  . TYR E 1 178 ? 12.581 5.337   -9.509  1.00 60.54 ? 262 TYR E CG  1 
ATOM   7122  C  CD1 . TYR E 1 178 ? 11.999 6.602   -9.513  1.00 57.82 ? 262 TYR E CD1 1 
ATOM   7123  C  CD2 . TYR E 1 178 ? 13.566 5.075   -10.450 1.00 58.96 ? 262 TYR E CD2 1 
ATOM   7124  C  CE1 . TYR E 1 178 ? 12.417 7.573   -10.406 1.00 57.81 ? 262 TYR E CE1 1 
ATOM   7125  C  CE2 . TYR E 1 178 ? 13.975 6.037   -11.340 1.00 56.76 ? 262 TYR E CE2 1 
ATOM   7126  C  CZ  . TYR E 1 178 ? 13.412 7.275   -11.319 1.00 57.46 ? 262 TYR E CZ  1 
ATOM   7127  O  OH  . TYR E 1 178 ? 13.844 8.213   -12.221 1.00 57.59 ? 262 TYR E OH  1 
ATOM   7128  N  N   . THR E 1 179 ? 10.172 1.766   -7.744  1.00 68.49 ? 263 THR E N   1 
ATOM   7129  C  CA  . THR E 1 179 ? 9.858  0.727   -6.743  1.00 70.96 ? 263 THR E CA  1 
ATOM   7130  C  C   . THR E 1 179 ? 9.829  -0.662  -7.365  1.00 71.96 ? 263 THR E C   1 
ATOM   7131  O  O   . THR E 1 179 ? 10.588 -1.558  -6.947  1.00 72.14 ? 263 THR E O   1 
ATOM   7132  C  CB  . THR E 1 179 ? 8.530  0.996   -5.978  1.00 71.35 ? 263 THR E CB  1 
ATOM   7133  O  OG1 . THR E 1 179 ? 8.135  2.378   -6.123  1.00 72.53 ? 263 THR E OG1 1 
ATOM   7134  C  CG2 . THR E 1 179 ? 8.729  0.680   -4.503  1.00 71.74 ? 263 THR E CG2 1 
ATOM   7135  N  N   . SER E 1 180 ? 8.969  -0.816  -8.379  1.00 73.07 ? 264 SER E N   1 
ATOM   7136  C  CA  . SER E 1 180 ? 8.824  -2.060  -9.139  1.00 73.64 ? 264 SER E CA  1 
ATOM   7137  C  C   . SER E 1 180 ? 10.161 -2.657  -9.531  1.00 74.68 ? 264 SER E C   1 
ATOM   7138  O  O   . SER E 1 180 ? 10.292 -3.880  -9.615  1.00 75.54 ? 264 SER E O   1 
ATOM   7139  C  CB  . SER E 1 180 ? 8.016  -1.808  -10.395 1.00 73.48 ? 264 SER E CB  1 
ATOM   7140  O  OG  . SER E 1 180 ? 6.971  -0.863  -10.174 1.00 74.46 ? 264 SER E OG  1 
ATOM   7141  N  N   . LEU E 1 181 ? 11.153 -1.808  -9.777  1.00 75.06 ? 265 LEU E N   1 
ATOM   7142  C  CA  . LEU E 1 181 ? 12.447 -2.291  -10.206 1.00 76.28 ? 265 LEU E CA  1 
ATOM   7143  C  C   . LEU E 1 181 ? 13.274 -2.765  -9.032  1.00 77.53 ? 265 LEU E C   1 
ATOM   7144  O  O   . LEU E 1 181 ? 14.173 -3.607  -9.169  1.00 77.36 ? 265 LEU E O   1 
ATOM   7145  C  CB  . LEU E 1 181 ? 13.178 -1.217  -11.001 1.00 76.13 ? 265 LEU E CB  1 
ATOM   7146  C  CG  . LEU E 1 181 ? 12.903 -1.386  -12.502 1.00 76.70 ? 265 LEU E CG  1 
ATOM   7147  C  CD1 . LEU E 1 181 ? 12.948 -0.058  -13.233 1.00 77.29 ? 265 LEU E CD1 1 
ATOM   7148  C  CD2 . LEU E 1 181 ? 13.865 -2.417  -13.142 1.00 76.90 ? 265 LEU E CD2 1 
ATOM   7149  N  N   . GLY E 1 182 ? 12.960 -2.213  -7.864  1.00 79.11 ? 266 GLY E N   1 
ATOM   7150  C  CA  . GLY E 1 182 ? 13.544 -2.680  -6.614  1.00 80.26 ? 266 GLY E CA  1 
ATOM   7151  C  C   . GLY E 1 182 ? 12.989 -4.062  -6.393  1.00 81.09 ? 266 GLY E C   1 
ATOM   7152  O  O   . GLY E 1 182 ? 13.746 -4.982  -6.074  1.00 81.16 ? 266 GLY E O   1 
ATOM   7153  N  N   . GLN E 1 183 ? 11.671 -4.195  -6.599  1.00 81.63 ? 267 GLN E N   1 
ATOM   7154  C  CA  . GLN E 1 183 ? 10.963 -5.467  -6.432  1.00 82.95 ? 267 GLN E CA  1 
ATOM   7155  C  C   . GLN E 1 183 ? 10.911 -6.297  -7.736  1.00 82.63 ? 267 GLN E C   1 
ATOM   7156  O  O   . GLN E 1 183 ? 11.945 -6.820  -8.217  1.00 82.44 ? 267 GLN E O   1 
ATOM   7157  C  CB  . GLN E 1 183 ? 9.552  -5.229  -5.821  1.00 83.14 ? 267 GLN E CB  1 
ATOM   7158  C  CG  . GLN E 1 183 ? 8.384  -4.926  -6.828  1.00 84.65 ? 267 GLN E CG  1 
ATOM   7159  C  CD  . GLN E 1 183 ? 7.181  -4.099  -6.230  1.00 84.71 ? 267 GLN E CD  1 
ATOM   7160  O  OE1 . GLN E 1 183 ? 7.058  -3.941  -5.009  1.00 85.79 ? 267 GLN E OE1 1 
ATOM   7161  N  NE2 . GLN E 1 183 ? 6.308  -3.566  -7.117  1.00 85.37 ? 267 GLN E NE2 1 
ATOM   7162  N  N   . CYS F 1 5   ? 49.899 -6.559  11.383  1.00 43.40 ? 89  CYS F N   1 
ATOM   7163  C  CA  . CYS F 1 5   ? 48.595 -7.276  11.629  1.00 44.39 ? 89  CYS F CA  1 
ATOM   7164  C  C   . CYS F 1 5   ? 47.471 -6.793  10.744  1.00 41.81 ? 89  CYS F C   1 
ATOM   7165  O  O   . CYS F 1 5   ? 47.039 -5.670  10.821  1.00 42.08 ? 89  CYS F O   1 
ATOM   7166  C  CB  . CYS F 1 5   ? 48.153 -7.126  13.068  1.00 44.91 ? 89  CYS F CB  1 
ATOM   7167  S  SG  . CYS F 1 5   ? 49.270 -7.924  14.145  1.00 56.98 ? 89  CYS F SG  1 
ATOM   7168  N  N   . LEU F 1 6   ? 46.988 -7.650  9.885   1.00 40.98 ? 90  LEU F N   1 
ATOM   7169  C  CA  . LEU F 1 6   ? 45.830 -7.303  9.111   1.00 40.10 ? 90  LEU F CA  1 
ATOM   7170  C  C   . LEU F 1 6   ? 44.590 -7.173  10.024  1.00 39.59 ? 90  LEU F C   1 
ATOM   7171  O  O   . LEU F 1 6   ? 43.783 -6.282  9.819   1.00 39.19 ? 90  LEU F O   1 
ATOM   7172  C  CB  . LEU F 1 6   ? 45.626 -8.350  8.071   1.00 40.13 ? 90  LEU F CB  1 
ATOM   7173  C  CG  . LEU F 1 6   ? 46.358 -8.388  6.703   1.00 41.07 ? 90  LEU F CG  1 
ATOM   7174  C  CD1 . LEU F 1 6   ? 47.223 -7.232  6.358   1.00 38.35 ? 90  LEU F CD1 1 
ATOM   7175  C  CD2 . LEU F 1 6   ? 47.070 -9.735  6.558   1.00 38.50 ? 90  LEU F CD2 1 
ATOM   7176  N  N   . LEU F 1 7   ? 44.485 -7.995  11.069  1.00 38.42 ? 91  LEU F N   1 
ATOM   7177  C  CA  . LEU F 1 7   ? 43.268 -8.028  11.887  1.00 38.25 ? 91  LEU F CA  1 
ATOM   7178  C  C   . LEU F 1 7   ? 43.463 -7.479  13.280  1.00 39.49 ? 91  LEU F C   1 
ATOM   7179  O  O   . LEU F 1 7   ? 44.550 -7.552  13.829  1.00 39.72 ? 91  LEU F O   1 
ATOM   7180  C  CB  . LEU F 1 7   ? 42.699 -9.443  12.013  1.00 36.56 ? 91  LEU F CB  1 
ATOM   7181  C  CG  . LEU F 1 7   ? 42.227 -10.129 10.759  1.00 34.53 ? 91  LEU F CG  1 
ATOM   7182  C  CD1 . LEU F 1 7   ? 41.897 -11.516 11.134  1.00 31.41 ? 91  LEU F CD1 1 
ATOM   7183  C  CD2 . LEU F 1 7   ? 41.043 -9.349  10.060  1.00 33.90 ? 91  LEU F CD2 1 
ATOM   7184  N  N   . PRO F 1 8   ? 42.407 -6.900  13.858  1.00 40.70 ? 92  PRO F N   1 
ATOM   7185  C  CA  . PRO F 1 8   ? 42.505 -6.481  15.242  1.00 42.18 ? 92  PRO F CA  1 
ATOM   7186  C  C   . PRO F 1 8   ? 42.532 -7.654  16.202  1.00 43.93 ? 92  PRO F C   1 
ATOM   7187  O  O   . PRO F 1 8   ? 42.360 -8.759  15.775  1.00 43.86 ? 92  PRO F O   1 
ATOM   7188  C  CB  . PRO F 1 8   ? 41.239 -5.677  15.425  1.00 42.19 ? 92  PRO F CB  1 
ATOM   7189  C  CG  . PRO F 1 8   ? 40.276 -6.282  14.416  1.00 40.86 ? 92  PRO F CG  1 
ATOM   7190  C  CD  . PRO F 1 8   ? 41.126 -6.508  13.252  1.00 40.18 ? 92  PRO F CD  1 
ATOM   7191  N  N   . GLU F 1 9   ? 42.776 -7.407  17.486  1.00 47.11 ? 93  GLU F N   1 
ATOM   7192  C  CA  . GLU F 1 9   ? 42.558 -8.423  18.534  1.00 50.83 ? 93  GLU F CA  1 
ATOM   7193  C  C   . GLU F 1 9   ? 41.163 -8.961  18.454  1.00 50.11 ? 93  GLU F C   1 
ATOM   7194  O  O   . GLU F 1 9   ? 40.164 -8.192  18.335  1.00 50.09 ? 93  GLU F O   1 
ATOM   7195  C  CB  . GLU F 1 9   ? 42.721 -7.865  19.955  1.00 50.79 ? 93  GLU F CB  1 
ATOM   7196  C  CG  . GLU F 1 9   ? 43.899 -8.452  20.763  1.00 55.94 ? 93  GLU F CG  1 
ATOM   7197  C  CD  . GLU F 1 9   ? 44.090 -7.779  22.163  1.00 57.15 ? 93  GLU F CD  1 
ATOM   7198  O  OE1 . GLU F 1 9   ? 43.425 -6.722  22.439  1.00 59.85 ? 93  GLU F OE1 1 
ATOM   7199  O  OE2 . GLU F 1 9   ? 44.931 -8.313  22.966  1.00 63.80 ? 93  GLU F OE2 1 
ATOM   7200  N  N   . VAL F 1 10  ? 41.134 -10.285 18.562  1.00 49.79 ? 94  VAL F N   1 
ATOM   7201  C  CA  . VAL F 1 10  ? 39.942 -11.115 18.608  1.00 49.38 ? 94  VAL F CA  1 
ATOM   7202  C  C   . VAL F 1 10  ? 39.013 -10.721 19.775  1.00 50.61 ? 94  VAL F C   1 
ATOM   7203  O  O   . VAL F 1 10  ? 39.442 -10.215 20.833  1.00 50.06 ? 94  VAL F O   1 
ATOM   7204  C  CB  . VAL F 1 10  ? 40.378 -12.615 18.643  1.00 48.66 ? 94  VAL F CB  1 
ATOM   7205  C  CG1 . VAL F 1 10  ? 40.976 -12.949 19.987  1.00 48.33 ? 94  VAL F CG1 1 
ATOM   7206  C  CG2 . VAL F 1 10  ? 39.271 -13.538 18.302  1.00 46.17 ? 94  VAL F CG2 1 
ATOM   7207  N  N   . THR F 1 11  ? 37.728 -10.944 19.569  1.00 52.45 ? 95  THR F N   1 
ATOM   7208  C  CA  . THR F 1 11  ? 36.739 -10.444 20.504  1.00 54.83 ? 95  THR F CA  1 
ATOM   7209  C  C   . THR F 1 11  ? 36.413 -11.592 21.420  1.00 56.70 ? 95  THR F C   1 
ATOM   7210  O  O   . THR F 1 11  ? 36.682 -12.752 21.046  1.00 56.68 ? 95  THR F O   1 
ATOM   7211  C  CB  . THR F 1 11  ? 35.466 -9.966  19.774  1.00 54.45 ? 95  THR F CB  1 
ATOM   7212  O  OG1 . THR F 1 11  ? 34.897 -11.053 19.049  1.00 52.95 ? 95  THR F OG1 1 
ATOM   7213  C  CG2 . THR F 1 11  ? 35.800 -8.849  18.785  1.00 54.73 ? 95  THR F CG2 1 
ATOM   7214  N  N   . GLU F 1 12  ? 35.854 -11.275 22.600  1.00 58.78 ? 96  GLU F N   1 
ATOM   7215  C  CA  . GLU F 1 12  ? 35.307 -12.292 23.536  1.00 61.75 ? 96  GLU F CA  1 
ATOM   7216  C  C   . GLU F 1 12  ? 34.624 -13.413 22.783  1.00 61.95 ? 96  GLU F C   1 
ATOM   7217  O  O   . GLU F 1 12  ? 34.963 -14.587 22.962  1.00 62.20 ? 96  GLU F O   1 
ATOM   7218  C  CB  . GLU F 1 12  ? 34.250 -11.699 24.451  1.00 61.52 ? 96  GLU F CB  1 
ATOM   7219  C  CG  . GLU F 1 12  ? 34.681 -11.173 25.813  1.00 64.20 ? 96  GLU F CG  1 
ATOM   7220  C  CD  . GLU F 1 12  ? 33.430 -10.865 26.679  1.00 65.61 ? 96  GLU F CD  1 
ATOM   7221  O  OE1 . GLU F 1 12  ? 32.482 -11.702 26.683  1.00 67.33 ? 96  GLU F OE1 1 
ATOM   7222  O  OE2 . GLU F 1 12  ? 33.386 -9.785  27.323  1.00 70.19 ? 96  GLU F OE2 1 
ATOM   7223  N  N   . GLU F 1 13  ? 33.677 -13.042 21.920  1.00 63.08 ? 97  GLU F N   1 
ATOM   7224  C  CA  . GLU F 1 13  ? 32.855 -14.031 21.236  1.00 64.99 ? 97  GLU F CA  1 
ATOM   7225  C  C   . GLU F 1 13  ? 33.722 -15.089 20.571  1.00 64.01 ? 97  GLU F C   1 
ATOM   7226  O  O   . GLU F 1 13  ? 33.394 -16.266 20.620  1.00 64.54 ? 97  GLU F O   1 
ATOM   7227  C  CB  . GLU F 1 13  ? 31.864 -13.388 20.238  1.00 65.40 ? 97  GLU F CB  1 
ATOM   7228  C  CG  . GLU F 1 13  ? 32.154 -13.609 18.707  1.00 68.30 ? 97  GLU F CG  1 
ATOM   7229  C  CD  . GLU F 1 13  ? 30.858 -13.693 17.849  1.00 68.98 ? 97  GLU F CD  1 
ATOM   7230  O  OE1 . GLU F 1 13  ? 29.779 -13.346 18.430  1.00 73.08 ? 97  GLU F OE1 1 
ATOM   7231  O  OE2 . GLU F 1 13  ? 30.925 -14.107 16.634  1.00 69.26 ? 97  GLU F OE2 1 
ATOM   7232  N  N   . ASP F 1 14  ? 34.852 -14.678 20.006  1.00 63.40 ? 98  ASP F N   1 
ATOM   7233  C  CA  . ASP F 1 14  ? 35.638 -15.568 19.163  1.00 62.74 ? 98  ASP F CA  1 
ATOM   7234  C  C   . ASP F 1 14  ? 36.926 -16.059 19.806  1.00 62.27 ? 98  ASP F C   1 
ATOM   7235  O  O   . ASP F 1 14  ? 37.703 -16.779 19.178  1.00 62.27 ? 98  ASP F O   1 
ATOM   7236  C  CB  . ASP F 1 14  ? 35.914 -14.882 17.829  1.00 62.66 ? 98  ASP F CB  1 
ATOM   7237  C  CG  . ASP F 1 14  ? 34.695 -14.852 16.941  1.00 64.15 ? 98  ASP F CG  1 
ATOM   7238  O  OD1 . ASP F 1 14  ? 33.997 -15.892 16.869  1.00 67.17 ? 98  ASP F OD1 1 
ATOM   7239  O  OD2 . ASP F 1 14  ? 34.424 -13.804 16.320  1.00 65.16 ? 98  ASP F OD2 1 
ATOM   7240  N  N   . GLN F 1 15  ? 37.121 -15.688 21.066  1.00 61.78 ? 99  GLN F N   1 
ATOM   7241  C  CA  . GLN F 1 15  ? 38.359 -15.924 21.806  1.00 62.05 ? 99  GLN F CA  1 
ATOM   7242  C  C   . GLN F 1 15  ? 38.962 -17.328 21.581  1.00 59.92 ? 99  GLN F C   1 
ATOM   7243  O  O   . GLN F 1 15  ? 40.134 -17.483 21.210  1.00 60.76 ? 99  GLN F O   1 
ATOM   7244  C  CB  . GLN F 1 15  ? 38.118 -15.634 23.299  1.00 62.55 ? 99  GLN F CB  1 
ATOM   7245  C  CG  . GLN F 1 15  ? 39.281 -14.988 24.104  1.00 64.64 ? 99  GLN F CG  1 
ATOM   7246  C  CD  . GLN F 1 15  ? 38.923 -14.879 25.630  1.00 65.75 ? 99  GLN F CD  1 
ATOM   7247  O  OE1 . GLN F 1 15  ? 39.517 -15.561 26.503  1.00 65.42 ? 99  GLN F OE1 1 
ATOM   7248  N  NE2 . GLN F 1 15  ? 37.916 -14.031 25.936  1.00 70.72 ? 99  GLN F NE2 1 
ATOM   7249  N  N   . GLY F 1 16  ? 38.194 -18.374 21.749  1.00 57.12 ? 100 GLY F N   1 
ATOM   7250  C  CA  . GLY F 1 16  ? 38.849 -19.643 21.535  1.00 54.86 ? 100 GLY F CA  1 
ATOM   7251  C  C   . GLY F 1 16  ? 39.007 -20.145 20.110  1.00 53.45 ? 100 GLY F C   1 
ATOM   7252  O  O   . GLY F 1 16  ? 39.645 -21.164 19.886  1.00 54.45 ? 100 GLY F O   1 
ATOM   7253  N  N   . ARG F 1 17  ? 38.413 -19.490 19.126  1.00 51.09 ? 101 ARG F N   1 
ATOM   7254  C  CA  . ARG F 1 17  ? 38.173 -20.219 17.925  1.00 48.56 ? 101 ARG F CA  1 
ATOM   7255  C  C   . ARG F 1 17  ? 39.297 -20.101 16.981  1.00 48.06 ? 101 ARG F C   1 
ATOM   7256  O  O   . ARG F 1 17  ? 40.061 -19.179 17.056  1.00 48.55 ? 101 ARG F O   1 
ATOM   7257  C  CB  . ARG F 1 17  ? 36.912 -19.757 17.255  1.00 48.52 ? 101 ARG F CB  1 
ATOM   7258  C  CG  . ARG F 1 17  ? 35.690 -20.070 18.021  1.00 47.77 ? 101 ARG F CG  1 
ATOM   7259  C  CD  . ARG F 1 17  ? 34.478 -19.769 17.232  1.00 44.88 ? 101 ARG F CD  1 
ATOM   7260  N  NE  . ARG F 1 17  ? 33.400 -19.432 18.144  1.00 45.95 ? 101 ARG F NE  1 
ATOM   7261  C  CZ  . ARG F 1 17  ? 32.213 -18.985 17.741  1.00 45.35 ? 101 ARG F CZ  1 
ATOM   7262  N  NH1 . ARG F 1 17  ? 31.957 -18.811 16.439  1.00 42.53 ? 101 ARG F NH1 1 
ATOM   7263  N  NH2 . ARG F 1 17  ? 31.282 -18.729 18.638  1.00 43.56 ? 101 ARG F NH2 1 
ATOM   7264  N  N   . ILE F 1 18  ? 39.372 -21.063 16.078  1.00 47.39 ? 102 ILE F N   1 
ATOM   7265  C  CA  . ILE F 1 18  ? 40.263 -21.072 14.947  1.00 45.97 ? 102 ILE F CA  1 
ATOM   7266  C  C   . ILE F 1 18  ? 39.738 -20.064 13.963  1.00 45.58 ? 102 ILE F C   1 
ATOM   7267  O  O   . ILE F 1 18  ? 38.541 -19.967 13.809  1.00 46.16 ? 102 ILE F O   1 
ATOM   7268  C  CB  . ILE F 1 18  ? 40.254 -22.479 14.341  1.00 45.89 ? 102 ILE F CB  1 
ATOM   7269  C  CG1 . ILE F 1 18  ? 41.020 -23.451 15.253  1.00 45.59 ? 102 ILE F CG1 1 
ATOM   7270  C  CG2 . ILE F 1 18  ? 40.796 -22.508 12.932  1.00 45.35 ? 102 ILE F CG2 1 
ATOM   7271  C  CD1 . ILE F 1 18  ? 40.631 -24.887 14.999  1.00 47.05 ? 102 ILE F CD1 1 
ATOM   7272  N  N   . CYS F 1 19  ? 40.635 -19.298 13.332  1.00 45.37 ? 103 CYS F N   1 
ATOM   7273  C  CA  . CYS F 1 19  ? 40.289 -18.276 12.334  1.00 43.99 ? 103 CYS F CA  1 
ATOM   7274  C  C   . CYS F 1 19  ? 40.300 -18.903 10.947  1.00 42.34 ? 103 CYS F C   1 
ATOM   7275  O  O   . CYS F 1 19  ? 41.234 -19.546 10.572  1.00 43.66 ? 103 CYS F O   1 
ATOM   7276  C  CB  . CYS F 1 19  ? 41.284 -17.090 12.422  1.00 44.35 ? 103 CYS F CB  1 
ATOM   7277  S  SG  . CYS F 1 19  ? 41.073 -15.702 11.173  1.00 47.60 ? 103 CYS F SG  1 
ATOM   7278  N  N   . VAL F 1 20  ? 39.256 -18.766 10.176  1.00 40.36 ? 104 VAL F N   1 
ATOM   7279  C  CA  . VAL F 1 20  ? 39.299 -19.352 8.870   1.00 38.11 ? 104 VAL F CA  1 
ATOM   7280  C  C   . VAL F 1 20  ? 39.143 -18.181 7.984   1.00 37.99 ? 104 VAL F C   1 
ATOM   7281  O  O   . VAL F 1 20  ? 38.261 -17.354 8.213   1.00 38.82 ? 104 VAL F O   1 
ATOM   7282  C  CB  . VAL F 1 20  ? 38.104 -20.274 8.629   1.00 37.89 ? 104 VAL F CB  1 
ATOM   7283  C  CG1 . VAL F 1 20  ? 38.084 -20.818 7.174   1.00 36.82 ? 104 VAL F CG1 1 
ATOM   7284  C  CG2 . VAL F 1 20  ? 38.150 -21.395 9.599   1.00 38.52 ? 104 VAL F CG2 1 
ATOM   7285  N  N   . VAL F 1 21  ? 39.946 -18.143 6.939   1.00 36.19 ? 105 VAL F N   1 
ATOM   7286  C  CA  . VAL F 1 21  ? 40.028 -17.044 6.050   1.00 34.48 ? 105 VAL F CA  1 
ATOM   7287  C  C   . VAL F 1 21  ? 39.443 -17.482 4.698   1.00 34.52 ? 105 VAL F C   1 
ATOM   7288  O  O   . VAL F 1 21  ? 39.878 -18.439 4.145   1.00 34.04 ? 105 VAL F O   1 
ATOM   7289  C  CB  . VAL F 1 21  ? 41.502 -16.656 6.038   1.00 34.33 ? 105 VAL F CB  1 
ATOM   7290  C  CG1 . VAL F 1 21  ? 42.020 -16.352 4.681   1.00 33.88 ? 105 VAL F CG1 1 
ATOM   7291  C  CG2 . VAL F 1 21  ? 41.744 -15.548 7.045   1.00 34.71 ? 105 VAL F CG2 1 
ATOM   7292  N  N   . ILE F 1 22  ? 38.440 -16.800 4.170   1.00 34.66 ? 106 ILE F N   1 
ATOM   7293  C  CA  . ILE F 1 22  ? 37.703 -17.359 3.070   1.00 36.26 ? 106 ILE F CA  1 
ATOM   7294  C  C   . ILE F 1 22  ? 37.622 -16.409 1.893   1.00 37.06 ? 106 ILE F C   1 
ATOM   7295  O  O   . ILE F 1 22  ? 37.371 -15.226 2.047   1.00 36.70 ? 106 ILE F O   1 
ATOM   7296  C  CB  . ILE F 1 22  ? 36.215 -17.753 3.490   1.00 36.89 ? 106 ILE F CB  1 
ATOM   7297  C  CG1 . ILE F 1 22  ? 36.208 -18.546 4.804   1.00 36.77 ? 106 ILE F CG1 1 
ATOM   7298  C  CG2 . ILE F 1 22  ? 35.472 -18.504 2.305   1.00 36.40 ? 106 ILE F CG2 1 
ATOM   7299  C  CD1 . ILE F 1 22  ? 34.821 -18.815 5.416   1.00 37.54 ? 106 ILE F CD1 1 
ATOM   7300  N  N   . ASP F 1 23  ? 37.798 -16.945 0.703   1.00 38.05 ? 107 ASP F N   1 
ATOM   7301  C  CA  . ASP F 1 23  ? 37.786 -16.138 -0.493  1.00 39.03 ? 107 ASP F CA  1 
ATOM   7302  C  C   . ASP F 1 23  ? 36.367 -16.083 -0.989  1.00 39.99 ? 107 ASP F C   1 
ATOM   7303  O  O   . ASP F 1 23  ? 35.539 -16.871 -0.574  1.00 42.25 ? 107 ASP F O   1 
ATOM   7304  C  CB  . ASP F 1 23  ? 38.608 -16.878 -1.487  1.00 39.03 ? 107 ASP F CB  1 
ATOM   7305  C  CG  . ASP F 1 23  ? 38.749 -16.163 -2.787  1.00 41.97 ? 107 ASP F CG  1 
ATOM   7306  O  OD1 . ASP F 1 23  ? 38.390 -14.964 -2.961  1.00 44.16 ? 107 ASP F OD1 1 
ATOM   7307  O  OD2 . ASP F 1 23  ? 39.251 -16.856 -3.686  1.00 44.76 ? 107 ASP F OD2 1 
ATOM   7308  N  N   . LEU F 1 24  ? 36.053 -15.204 -1.909  1.00 39.65 ? 108 LEU F N   1 
ATOM   7309  C  CA  . LEU F 1 24  ? 34.677 -15.076 -2.311  1.00 39.05 ? 108 LEU F CA  1 
ATOM   7310  C  C   . LEU F 1 24  ? 34.530 -15.625 -3.711  1.00 39.89 ? 108 LEU F C   1 
ATOM   7311  O  O   . LEU F 1 24  ? 33.894 -16.631 -3.911  1.00 40.39 ? 108 LEU F O   1 
ATOM   7312  C  CB  . LEU F 1 24  ? 34.200 -13.647 -2.176  1.00 37.38 ? 108 LEU F CB  1 
ATOM   7313  C  CG  . LEU F 1 24  ? 32.790 -13.345 -2.667  1.00 39.84 ? 108 LEU F CG  1 
ATOM   7314  C  CD1 . LEU F 1 24  ? 31.673 -13.907 -1.734  1.00 41.81 ? 108 LEU F CD1 1 
ATOM   7315  C  CD2 . LEU F 1 24  ? 32.578 -11.825 -2.955  1.00 38.32 ? 108 LEU F CD2 1 
ATOM   7316  N  N   . ASP F 1 25  ? 35.148 -14.987 -4.681  1.00 41.99 ? 109 ASP F N   1 
ATOM   7317  C  CA  . ASP F 1 25  ? 34.988 -15.359 -6.088  1.00 42.97 ? 109 ASP F CA  1 
ATOM   7318  C  C   . ASP F 1 25  ? 35.505 -16.715 -6.389  1.00 42.85 ? 109 ASP F C   1 
ATOM   7319  O  O   . ASP F 1 25  ? 36.567 -17.095 -5.930  1.00 43.53 ? 109 ASP F O   1 
ATOM   7320  C  CB  . ASP F 1 25  ? 35.618 -14.339 -6.973  1.00 43.26 ? 109 ASP F CB  1 
ATOM   7321  C  CG  . ASP F 1 25  ? 34.778 -13.117 -7.053  1.00 48.04 ? 109 ASP F CG  1 
ATOM   7322  O  OD1 . ASP F 1 25  ? 33.544 -13.295 -7.187  1.00 52.67 ? 109 ASP F OD1 1 
ATOM   7323  O  OD2 . ASP F 1 25  ? 35.319 -11.991 -6.948  1.00 54.22 ? 109 ASP F OD2 1 
ATOM   7324  N  N   . GLU F 1 26  ? 34.680 -17.465 -7.108  1.00 42.75 ? 110 GLU F N   1 
ATOM   7325  C  CA  . GLU F 1 26  ? 34.953 -18.850 -7.423  1.00 42.48 ? 110 GLU F CA  1 
ATOM   7326  C  C   . GLU F 1 26  ? 35.013 -19.833 -6.261  1.00 41.06 ? 110 GLU F C   1 
ATOM   7327  O  O   . GLU F 1 26  ? 35.278 -21.010 -6.513  1.00 41.37 ? 110 GLU F O   1 
ATOM   7328  C  CB  . GLU F 1 26  ? 36.190 -18.973 -8.326  1.00 42.57 ? 110 GLU F CB  1 
ATOM   7329  C  CG  . GLU F 1 26  ? 35.835 -18.667 -9.773  1.00 44.73 ? 110 GLU F CG  1 
ATOM   7330  C  CD  . GLU F 1 26  ? 35.623 -17.205 -10.024 1.00 51.37 ? 110 GLU F CD  1 
ATOM   7331  O  OE1 . GLU F 1 26  ? 36.586 -16.410 -9.842  1.00 54.55 ? 110 GLU F OE1 1 
ATOM   7332  O  OE2 . GLU F 1 26  ? 34.495 -16.826 -10.411 1.00 55.28 ? 110 GLU F OE2 1 
ATOM   7333  N  N   . THR F 1 27  ? 34.756 -19.377 -5.031  1.00 38.87 ? 111 THR F N   1 
ATOM   7334  C  CA  . THR F 1 27  ? 34.730 -20.248 -3.851  1.00 37.18 ? 111 THR F CA  1 
ATOM   7335  C  C   . THR F 1 27  ? 33.312 -20.274 -3.255  1.00 37.90 ? 111 THR F C   1 
ATOM   7336  O  O   . THR F 1 27  ? 32.840 -21.310 -2.798  1.00 39.01 ? 111 THR F O   1 
ATOM   7337  C  CB  . THR F 1 27  ? 35.719 -19.759 -2.722  1.00 37.62 ? 111 THR F CB  1 
ATOM   7338  O  OG1 . THR F 1 27  ? 37.038 -19.564 -3.244  1.00 36.04 ? 111 THR F OG1 1 
ATOM   7339  C  CG2 . THR F 1 27  ? 35.761 -20.703 -1.503  1.00 33.37 ? 111 THR F CG2 1 
ATOM   7340  N  N   . LEU F 1 28  ? 32.634 -19.149 -3.206  1.00 37.41 ? 112 LEU F N   1 
ATOM   7341  C  CA  . LEU F 1 28  ? 31.295 -19.155 -2.639  1.00 38.29 ? 112 LEU F CA  1 
ATOM   7342  C  C   . LEU F 1 28  ? 30.233 -18.628 -3.630  1.00 38.86 ? 112 LEU F C   1 
ATOM   7343  O  O   . LEU F 1 28  ? 29.032 -18.906 -3.452  1.00 38.90 ? 112 LEU F O   1 
ATOM   7344  C  CB  . LEU F 1 28  ? 31.239 -18.373 -1.332  1.00 38.19 ? 112 LEU F CB  1 
ATOM   7345  C  CG  . LEU F 1 28  ? 32.321 -18.625 -0.263  1.00 40.64 ? 112 LEU F CG  1 
ATOM   7346  C  CD1 . LEU F 1 28  ? 32.270 -17.593 0.894   1.00 37.97 ? 112 LEU F CD1 1 
ATOM   7347  C  CD2 . LEU F 1 28  ? 32.270 -20.038 0.282   1.00 40.15 ? 112 LEU F CD2 1 
ATOM   7348  N  N   . VAL F 1 29  ? 30.687 -17.891 -4.656  1.00 37.87 ? 113 VAL F N   1 
ATOM   7349  C  CA  . VAL F 1 29  ? 29.831 -17.343 -5.642  1.00 38.22 ? 113 VAL F CA  1 
ATOM   7350  C  C   . VAL F 1 29  ? 30.578 -17.335 -6.962  1.00 39.92 ? 113 VAL F C   1 
ATOM   7351  O  O   . VAL F 1 29  ? 31.696 -17.784 -7.024  1.00 41.97 ? 113 VAL F O   1 
ATOM   7352  C  CB  . VAL F 1 29  ? 29.314 -15.923 -5.274  1.00 38.03 ? 113 VAL F CB  1 
ATOM   7353  C  CG1 . VAL F 1 29  ? 28.457 -15.923 -3.970  1.00 35.98 ? 113 VAL F CG1 1 
ATOM   7354  C  CG2 . VAL F 1 29  ? 30.436 -14.919 -5.225  1.00 36.69 ? 113 VAL F CG2 1 
ATOM   7355  N  N   . HIS F 1 30  ? 29.944 -16.878 -8.023  1.00 40.64 ? 114 HIS F N   1 
ATOM   7356  C  CA  . HIS F 1 30  ? 30.601 -16.537 -9.263  1.00 42.82 ? 114 HIS F CA  1 
ATOM   7357  C  C   . HIS F 1 30  ? 29.667 -15.485 -9.828  1.00 43.86 ? 114 HIS F C   1 
ATOM   7358  O  O   . HIS F 1 30  ? 28.449 -15.710 -9.886  1.00 43.74 ? 114 HIS F O   1 
ATOM   7359  C  CB  . HIS F 1 30  ? 30.749 -17.753 -10.224 1.00 42.53 ? 114 HIS F CB  1 
ATOM   7360  C  CG  . HIS F 1 30  ? 30.938 -17.371 -11.667 1.00 45.49 ? 114 HIS F CG  1 
ATOM   7361  N  ND1 . HIS F 1 30  ? 32.165 -17.017 -12.201 1.00 46.91 ? 114 HIS F ND1 1 
ATOM   7362  C  CD2 . HIS F 1 30  ? 30.045 -17.265 -12.691 1.00 48.75 ? 114 HIS F CD2 1 
ATOM   7363  C  CE1 . HIS F 1 30  ? 32.028 -16.738 -13.489 1.00 48.02 ? 114 HIS F CE1 1 
ATOM   7364  N  NE2 . HIS F 1 30  ? 30.749 -16.871 -13.812 1.00 51.14 ? 114 HIS F NE2 1 
ATOM   7365  N  N   . SER F 1 31  ? 30.233 -14.325 -10.167 1.00 45.04 ? 115 SER F N   1 
ATOM   7366  C  CA  . SER F 1 31  ? 29.508 -13.214 -10.793 1.00 46.88 ? 115 SER F CA  1 
ATOM   7367  C  C   . SER F 1 31  ? 30.085 -12.893 -12.161 1.00 47.75 ? 115 SER F C   1 
ATOM   7368  O  O   . SER F 1 31  ? 31.225 -13.253 -12.463 1.00 47.92 ? 115 SER F O   1 
ATOM   7369  C  CB  . SER F 1 31  ? 29.603 -11.965 -9.953  1.00 46.49 ? 115 SER F CB  1 
ATOM   7370  O  OG  . SER F 1 31  ? 30.691 -12.097 -9.077  1.00 49.87 ? 115 SER F OG  1 
ATOM   7371  N  N   . SER F 1 32  ? 29.285 -12.217 -12.977 1.00 48.09 ? 116 SER F N   1 
ATOM   7372  C  CA  . SER F 1 32  ? 29.684 -11.876 -14.301 1.00 49.08 ? 116 SER F CA  1 
ATOM   7373  C  C   . SER F 1 32  ? 29.032 -10.563 -14.678 1.00 49.40 ? 116 SER F C   1 
ATOM   7374  O  O   . SER F 1 32  ? 27.997 -10.171 -14.093 1.00 47.94 ? 116 SER F O   1 
ATOM   7375  C  CB  . SER F 1 32  ? 29.254 -12.997 -15.281 1.00 50.02 ? 116 SER F CB  1 
ATOM   7376  O  OG  . SER F 1 32  ? 29.033 -12.526 -16.626 1.00 51.82 ? 116 SER F OG  1 
ATOM   7377  N  N   . PHE F 1 33  ? 29.614 -9.903  -15.682 1.00 50.07 ? 117 PHE F N   1 
ATOM   7378  C  CA  . PHE F 1 33  ? 28.946 -8.746  -16.251 1.00 51.43 ? 117 PHE F CA  1 
ATOM   7379  C  C   . PHE F 1 33  ? 28.000 -9.101  -17.390 1.00 53.73 ? 117 PHE F C   1 
ATOM   7380  O  O   . PHE F 1 33  ? 27.296 -8.224  -17.909 1.00 54.98 ? 117 PHE F O   1 
ATOM   7381  C  CB  . PHE F 1 33  ? 29.927 -7.688  -16.720 1.00 49.47 ? 117 PHE F CB  1 
ATOM   7382  C  CG  . PHE F 1 33  ? 30.700 -7.077  -15.641 1.00 46.34 ? 117 PHE F CG  1 
ATOM   7383  C  CD1 . PHE F 1 33  ? 31.948 -7.636  -15.246 1.00 45.09 ? 117 PHE F CD1 1 
ATOM   7384  C  CD2 . PHE F 1 33  ? 30.227 -5.950  -14.999 1.00 43.60 ? 117 PHE F CD2 1 
ATOM   7385  C  CE1 . PHE F 1 33  ? 32.726 -7.051  -14.187 1.00 40.03 ? 117 PHE F CE1 1 
ATOM   7386  C  CE2 . PHE F 1 33  ? 30.994 -5.348  -13.935 1.00 44.57 ? 117 PHE F CE2 1 
ATOM   7387  C  CZ  . PHE F 1 33  ? 32.235 -5.919  -13.535 1.00 42.48 ? 117 PHE F CZ  1 
ATOM   7388  N  N   . LYS F 1 34  ? 27.969 -10.364 -17.787 1.00 56.00 ? 118 LYS F N   1 
ATOM   7389  C  CA  . LYS F 1 34  ? 27.135 -10.741 -18.905 1.00 58.62 ? 118 LYS F CA  1 
ATOM   7390  C  C   . LYS F 1 34  ? 25.747 -11.091 -18.341 1.00 60.68 ? 118 LYS F C   1 
ATOM   7391  O  O   . LYS F 1 34  ? 25.578 -12.136 -17.667 1.00 60.82 ? 118 LYS F O   1 
ATOM   7392  C  CB  . LYS F 1 34  ? 27.794 -11.896 -19.664 1.00 58.93 ? 118 LYS F CB  1 
ATOM   7393  C  CG  . LYS F 1 34  ? 27.248 -12.177 -21.058 1.00 60.44 ? 118 LYS F CG  1 
ATOM   7394  C  CD  . LYS F 1 34  ? 28.347 -12.831 -21.954 1.00 63.25 ? 118 LYS F CD  1 
ATOM   7395  C  CE  . LYS F 1 34  ? 27.797 -13.384 -23.313 1.00 62.93 ? 118 LYS F CE  1 
ATOM   7396  N  NZ  . LYS F 1 34  ? 26.773 -14.497 -23.245 1.00 61.47 ? 118 LYS F NZ  1 
ATOM   7397  N  N   . PRO F 1 35  ? 24.747 -10.198 -18.572 1.00 62.59 ? 119 PRO F N   1 
ATOM   7398  C  CA  . PRO F 1 35  ? 23.369 -10.461 -18.071 1.00 63.66 ? 119 PRO F CA  1 
ATOM   7399  C  C   . PRO F 1 35  ? 22.961 -11.913 -18.236 1.00 64.62 ? 119 PRO F C   1 
ATOM   7400  O  O   . PRO F 1 35  ? 23.163 -12.485 -19.284 1.00 64.94 ? 119 PRO F O   1 
ATOM   7401  C  CB  . PRO F 1 35  ? 22.495 -9.532  -18.919 1.00 63.39 ? 119 PRO F CB  1 
ATOM   7402  C  CG  . PRO F 1 35  ? 23.417 -8.343  -19.263 1.00 62.36 ? 119 PRO F CG  1 
ATOM   7403  C  CD  . PRO F 1 35  ? 24.836 -8.903  -19.302 1.00 62.89 ? 119 PRO F CD  1 
ATOM   7404  N  N   . ILE F 1 36  ? 22.473 -12.517 -17.163 1.00 66.34 ? 120 ILE F N   1 
ATOM   7405  C  CA  . ILE F 1 36  ? 21.929 -13.878 -17.192 1.00 67.33 ? 120 ILE F CA  1 
ATOM   7406  C  C   . ILE F 1 36  ? 20.707 -13.990 -16.261 1.00 67.70 ? 120 ILE F C   1 
ATOM   7407  O  O   . ILE F 1 36  ? 19.713 -13.257 -16.404 1.00 68.18 ? 120 ILE F O   1 
ATOM   7408  C  CB  . ILE F 1 36  ? 22.974 -14.940 -16.769 1.00 67.58 ? 120 ILE F CB  1 
ATOM   7409  C  CG1 . ILE F 1 36  ? 23.234 -14.861 -15.248 1.00 68.05 ? 120 ILE F CG1 1 
ATOM   7410  C  CG2 . ILE F 1 36  ? 24.259 -14.848 -17.637 1.00 67.74 ? 120 ILE F CG2 1 
ATOM   7411  C  CD1 . ILE F 1 36  ? 24.174 -15.933 -14.693 1.00 67.74 ? 120 ILE F CD1 1 
ATOM   7412  N  N   . ALA F 1 39  ? 19.920 -15.513 -12.000 1.00 46.77 ? 123 ALA F N   1 
ATOM   7413  C  CA  . ALA F 1 39  ? 20.951 -15.016 -11.059 1.00 47.76 ? 123 ALA F CA  1 
ATOM   7414  C  C   . ALA F 1 39  ? 20.305 -14.788 -9.709  1.00 47.69 ? 123 ALA F C   1 
ATOM   7415  O  O   . ALA F 1 39  ? 19.240 -14.178 -9.634  1.00 47.33 ? 123 ALA F O   1 
ATOM   7416  C  CB  . ALA F 1 39  ? 21.610 -13.684 -11.548 1.00 46.22 ? 123 ALA F CB  1 
ATOM   7417  N  N   . ASP F 1 40  ? 20.973 -15.242 -8.656  1.00 47.63 ? 124 ASP F N   1 
ATOM   7418  C  CA  . ASP F 1 40  ? 20.502 -15.005 -7.315  1.00 48.05 ? 124 ASP F CA  1 
ATOM   7419  C  C   . ASP F 1 40  ? 20.457 -13.535 -6.983  1.00 47.96 ? 124 ASP F C   1 
ATOM   7420  O  O   . ASP F 1 40  ? 19.515 -13.127 -6.361  1.00 48.45 ? 124 ASP F O   1 
ATOM   7421  C  CB  . ASP F 1 40  ? 21.334 -15.780 -6.301  1.00 47.24 ? 124 ASP F CB  1 
ATOM   7422  C  CG  . ASP F 1 40  ? 21.231 -17.253 -6.519  1.00 50.31 ? 124 ASP F CG  1 
ATOM   7423  O  OD1 . ASP F 1 40  ? 20.136 -17.848 -6.253  1.00 57.68 ? 124 ASP F OD1 1 
ATOM   7424  O  OD2 . ASP F 1 40  ? 22.223 -17.839 -6.995  1.00 51.67 ? 124 ASP F OD2 1 
ATOM   7425  N  N   . PHE F 1 41  ? 21.488 -12.760 -7.344  1.00 48.45 ? 125 PHE F N   1 
ATOM   7426  C  CA  . PHE F 1 41  ? 21.455 -11.285 -7.160  1.00 47.95 ? 125 PHE F CA  1 
ATOM   7427  C  C   . PHE F 1 41  ? 22.053 -10.535 -8.320  1.00 47.49 ? 125 PHE F C   1 
ATOM   7428  O  O   . PHE F 1 41  ? 22.925 -11.053 -9.058  1.00 46.01 ? 125 PHE F O   1 
ATOM   7429  C  CB  . PHE F 1 41  ? 22.235 -10.730 -5.936  1.00 49.21 ? 125 PHE F CB  1 
ATOM   7430  C  CG  . PHE F 1 41  ? 22.518 -11.712 -4.851  1.00 48.02 ? 125 PHE F CG  1 
ATOM   7431  C  CD1 . PHE F 1 41  ? 23.809 -12.167 -4.666  1.00 47.60 ? 125 PHE F CD1 1 
ATOM   7432  C  CD2 . PHE F 1 41  ? 21.515 -12.100 -3.965  1.00 47.69 ? 125 PHE F CD2 1 
ATOM   7433  C  CE1 . PHE F 1 41  ? 24.101 -13.057 -3.685  1.00 47.68 ? 125 PHE F CE1 1 
ATOM   7434  C  CE2 . PHE F 1 41  ? 21.791 -12.968 -2.942  1.00 47.65 ? 125 PHE F CE2 1 
ATOM   7435  C  CZ  . PHE F 1 41  ? 23.094 -13.471 -2.816  1.00 49.77 ? 125 PHE F CZ  1 
ATOM   7436  N  N   . ILE F 1 42  ? 21.598 -9.286  -8.416  1.00 47.38 ? 126 ILE F N   1 
ATOM   7437  C  CA  . ILE F 1 42  ? 22.142 -8.327  -9.325  1.00 48.88 ? 126 ILE F CA  1 
ATOM   7438  C  C   . ILE F 1 42  ? 22.645 -7.188  -8.474  1.00 50.14 ? 126 ILE F C   1 
ATOM   7439  O  O   . ILE F 1 42  ? 21.912 -6.734  -7.589  1.00 50.98 ? 126 ILE F O   1 
ATOM   7440  C  CB  . ILE F 1 42  ? 21.137 -7.859  -10.342 1.00 48.58 ? 126 ILE F CB  1 
ATOM   7441  C  CG1 . ILE F 1 42  ? 20.908 -8.981  -11.355 1.00 50.03 ? 126 ILE F CG1 1 
ATOM   7442  C  CG2 . ILE F 1 42  ? 21.690 -6.659  -11.112 1.00 49.03 ? 126 ILE F CG2 1 
ATOM   7443  C  CD1 . ILE F 1 42  ? 19.527 -8.946  -12.009 1.00 52.11 ? 126 ILE F CD1 1 
ATOM   7444  N  N   . VAL F 1 43  ? 23.910 -6.793  -8.689  1.00 49.59 ? 127 VAL F N   1 
ATOM   7445  C  CA  . VAL F 1 43  ? 24.484 -5.652  -7.993  1.00 50.33 ? 127 VAL F CA  1 
ATOM   7446  C  C   . VAL F 1 43  ? 25.068 -4.651  -8.964  1.00 50.19 ? 127 VAL F C   1 
ATOM   7447  O  O   . VAL F 1 43  ? 26.039 -4.949  -9.686  1.00 49.62 ? 127 VAL F O   1 
ATOM   7448  C  CB  . VAL F 1 43  ? 25.576 -6.044  -6.949  1.00 49.84 ? 127 VAL F CB  1 
ATOM   7449  C  CG1 . VAL F 1 43  ? 24.914 -6.417  -5.698  1.00 52.27 ? 127 VAL F CG1 1 
ATOM   7450  C  CG2 . VAL F 1 43  ? 26.348 -7.263  -7.405  1.00 51.27 ? 127 VAL F CG2 1 
ATOM   7451  N  N   . PRO F 1 44  ? 24.495 -3.452  -8.978  1.00 50.15 ? 128 PRO F N   1 
ATOM   7452  C  CA  . PRO F 1 44  ? 25.044 -2.386  -9.798  1.00 50.85 ? 128 PRO F CA  1 
ATOM   7453  C  C   . PRO F 1 44  ? 26.417 -1.986  -9.273  1.00 51.06 ? 128 PRO F C   1 
ATOM   7454  O  O   . PRO F 1 44  ? 26.595 -1.868  -8.085  1.00 50.69 ? 128 PRO F O   1 
ATOM   7455  C  CB  . PRO F 1 44  ? 24.033 -1.259  -9.637  1.00 51.04 ? 128 PRO F CB  1 
ATOM   7456  C  CG  . PRO F 1 44  ? 23.400 -1.530  -8.336  1.00 52.23 ? 128 PRO F CG  1 
ATOM   7457  C  CD  . PRO F 1 44  ? 23.309 -3.024  -8.235  1.00 50.35 ? 128 PRO F CD  1 
ATOM   7458  N  N   . ILE F 1 45  ? 27.393 -1.853  -10.152 1.00 51.79 ? 129 ILE F N   1 
ATOM   7459  C  CA  . ILE F 1 45  ? 28.717 -1.432  -9.738  1.00 53.64 ? 129 ILE F CA  1 
ATOM   7460  C  C   . ILE F 1 45  ? 29.158 -0.339  -10.690 1.00 55.07 ? 129 ILE F C   1 
ATOM   7461  O  O   . ILE F 1 45  ? 29.052 -0.520  -11.915 1.00 55.96 ? 129 ILE F O   1 
ATOM   7462  C  CB  . ILE F 1 45  ? 29.661 -2.627  -9.738  1.00 53.13 ? 129 ILE F CB  1 
ATOM   7463  C  CG1 . ILE F 1 45  ? 29.529 -3.325  -8.405  1.00 53.32 ? 129 ILE F CG1 1 
ATOM   7464  C  CG2 . ILE F 1 45  ? 31.075 -2.185  -9.855  1.00 53.84 ? 129 ILE F CG2 1 
ATOM   7465  C  CD1 . ILE F 1 45  ? 29.046 -4.668  -8.520  1.00 54.18 ? 129 ILE F CD1 1 
ATOM   7466  N  N   . GLU F 1 46  ? 29.587 0.801   -10.157 1.00 56.10 ? 130 GLU F N   1 
ATOM   7467  C  CA  . GLU F 1 46  ? 29.969 1.885   -11.024 1.00 58.45 ? 130 GLU F CA  1 
ATOM   7468  C  C   . GLU F 1 46  ? 31.405 1.658   -11.445 1.00 59.18 ? 130 GLU F C   1 
ATOM   7469  O  O   . GLU F 1 46  ? 32.189 1.117   -10.686 1.00 60.53 ? 130 GLU F O   1 
ATOM   7470  C  CB  . GLU F 1 46  ? 29.780 3.245   -10.353 1.00 58.61 ? 130 GLU F CB  1 
ATOM   7471  C  CG  . GLU F 1 46  ? 31.078 3.923   -9.895  1.00 64.53 ? 130 GLU F CG  1 
ATOM   7472  C  CD  . GLU F 1 46  ? 31.508 5.120   -10.787 1.00 71.29 ? 130 GLU F CD  1 
ATOM   7473  O  OE1 . GLU F 1 46  ? 30.624 5.952   -11.133 1.00 72.04 ? 130 GLU F OE1 1 
ATOM   7474  O  OE2 . GLU F 1 46  ? 32.729 5.236   -11.125 1.00 73.85 ? 130 GLU F OE2 1 
ATOM   7475  N  N   . ILE F 1 47  ? 31.734 2.063   -12.666 1.00 60.21 ? 131 ILE F N   1 
ATOM   7476  C  CA  . ILE F 1 47  ? 33.071 1.984   -13.226 1.00 60.79 ? 131 ILE F CA  1 
ATOM   7477  C  C   . ILE F 1 47  ? 33.382 3.256   -14.007 1.00 61.99 ? 131 ILE F C   1 
ATOM   7478  O  O   . ILE F 1 47  ? 32.632 3.634   -14.922 1.00 61.94 ? 131 ILE F O   1 
ATOM   7479  C  CB  . ILE F 1 47  ? 33.181 0.842   -14.238 1.00 60.39 ? 131 ILE F CB  1 
ATOM   7480  C  CG1 . ILE F 1 47  ? 32.452 -0.427  -13.762 1.00 59.71 ? 131 ILE F CG1 1 
ATOM   7481  C  CG2 . ILE F 1 47  ? 34.640 0.603   -14.588 1.00 61.21 ? 131 ILE F CG2 1 
ATOM   7482  C  CD1 . ILE F 1 47  ? 33.335 -1.563  -13.368 1.00 57.16 ? 131 ILE F CD1 1 
ATOM   7483  N  N   . GLU F 1 48  ? 34.510 3.894   -13.685 1.00 63.67 ? 132 GLU F N   1 
ATOM   7484  C  CA  . GLU F 1 48  ? 34.960 5.135   -14.376 1.00 64.61 ? 132 GLU F CA  1 
ATOM   7485  C  C   . GLU F 1 48  ? 33.717 6.007   -14.616 1.00 64.20 ? 132 GLU F C   1 
ATOM   7486  O  O   . GLU F 1 48  ? 33.635 6.763   -15.595 1.00 64.94 ? 132 GLU F O   1 
ATOM   7487  C  CB  . GLU F 1 48  ? 35.715 4.852   -15.720 1.00 64.81 ? 132 GLU F CB  1 
ATOM   7488  C  CG  . GLU F 1 48  ? 37.269 4.632   -15.646 1.00 67.93 ? 132 GLU F CG  1 
ATOM   7489  C  CD  . GLU F 1 48  ? 37.721 3.124   -15.474 1.00 71.83 ? 132 GLU F CD  1 
ATOM   7490  O  OE1 . GLU F 1 48  ? 37.090 2.200   -16.047 1.00 73.37 ? 132 GLU F OE1 1 
ATOM   7491  O  OE2 . GLU F 1 48  ? 38.725 2.857   -14.763 1.00 71.38 ? 132 GLU F OE2 1 
ATOM   7492  N  N   . GLY F 1 49  ? 32.728 5.878   -13.739 1.00 62.65 ? 133 GLY F N   1 
ATOM   7493  C  CA  . GLY F 1 49  ? 31.546 6.679   -13.920 1.00 60.43 ? 133 GLY F CA  1 
ATOM   7494  C  C   . GLY F 1 49  ? 30.277 5.994   -14.358 1.00 58.53 ? 133 GLY F C   1 
ATOM   7495  O  O   . GLY F 1 49  ? 29.212 6.408   -13.921 1.00 57.96 ? 133 GLY F O   1 
ATOM   7496  N  N   . THR F 1 50  ? 30.358 4.992   -15.233 1.00 56.14 ? 134 THR F N   1 
ATOM   7497  C  CA  . THR F 1 50  ? 29.123 4.356   -15.721 1.00 54.27 ? 134 THR F CA  1 
ATOM   7498  C  C   . THR F 1 50  ? 28.752 3.178   -14.829 1.00 53.01 ? 134 THR F C   1 
ATOM   7499  O  O   . THR F 1 50  ? 29.593 2.576   -14.203 1.00 52.78 ? 134 THR F O   1 
ATOM   7500  C  CB  . THR F 1 50  ? 29.134 3.975   -17.293 1.00 54.87 ? 134 THR F CB  1 
ATOM   7501  O  OG1 . THR F 1 50  ? 29.030 2.557   -17.516 1.00 54.70 ? 134 THR F OG1 1 
ATOM   7502  C  CG2 . THR F 1 50  ? 30.342 4.543   -18.055 1.00 54.06 ? 134 THR F CG2 1 
ATOM   7503  N  N   . THR F 1 51  ? 27.492 2.822   -14.756 1.00 51.56 ? 135 THR F N   1 
ATOM   7504  C  CA  . THR F 1 51  ? 27.170 1.806   -13.806 1.00 50.04 ? 135 THR F CA  1 
ATOM   7505  C  C   . THR F 1 51  ? 26.750 0.607   -14.575 1.00 48.38 ? 135 THR F C   1 
ATOM   7506  O  O   . THR F 1 51  ? 25.903 0.690   -15.415 1.00 48.01 ? 135 THR F O   1 
ATOM   7507  C  CB  . THR F 1 51  ? 26.109 2.276   -12.727 1.00 51.07 ? 135 THR F CB  1 
ATOM   7508  O  OG1 . THR F 1 51  ? 24.774 1.984   -13.143 1.00 52.68 ? 135 THR F OG1 1 
ATOM   7509  C  CG2 . THR F 1 51  ? 26.215 3.764   -12.448 1.00 51.53 ? 135 THR F CG2 1 
ATOM   7510  N  N   . HIS F 1 52  ? 27.388 -0.512  -14.293 1.00 47.39 ? 136 HIS F N   1 
ATOM   7511  C  CA  . HIS F 1 52  ? 27.069 -1.778  -14.912 1.00 46.24 ? 136 HIS F CA  1 
ATOM   7512  C  C   . HIS F 1 52  ? 26.440 -2.719  -13.889 1.00 46.21 ? 136 HIS F C   1 
ATOM   7513  O  O   . HIS F 1 52  ? 26.539 -2.488  -12.696 1.00 45.96 ? 136 HIS F O   1 
ATOM   7514  C  CB  . HIS F 1 52  ? 28.353 -2.422  -15.422 1.00 46.19 ? 136 HIS F CB  1 
ATOM   7515  C  CG  . HIS F 1 52  ? 29.092 -1.598  -16.423 1.00 44.40 ? 136 HIS F CG  1 
ATOM   7516  N  ND1 . HIS F 1 52  ? 28.919 -1.757  -17.783 1.00 41.96 ? 136 HIS F ND1 1 
ATOM   7517  C  CD2 . HIS F 1 52  ? 30.025 -0.631  -16.261 1.00 43.62 ? 136 HIS F CD2 1 
ATOM   7518  C  CE1 . HIS F 1 52  ? 29.696 -0.896  -18.412 1.00 45.26 ? 136 HIS F CE1 1 
ATOM   7519  N  NE2 . HIS F 1 52  ? 30.386 -0.210  -17.515 1.00 43.01 ? 136 HIS F NE2 1 
ATOM   7520  N  N   . GLN F 1 53  ? 25.840 -3.802  -14.364 1.00 46.17 ? 137 GLN F N   1 
ATOM   7521  C  CA  . GLN F 1 53  ? 25.213 -4.772  -13.477 1.00 46.21 ? 137 GLN F CA  1 
ATOM   7522  C  C   . GLN F 1 53  ? 26.092 -5.970  -13.384 1.00 45.72 ? 137 GLN F C   1 
ATOM   7523  O  O   . GLN F 1 53  ? 26.707 -6.417  -14.356 1.00 45.75 ? 137 GLN F O   1 
ATOM   7524  C  CB  . GLN F 1 53  ? 23.886 -5.269  -14.019 1.00 47.27 ? 137 GLN F CB  1 
ATOM   7525  C  CG  . GLN F 1 53  ? 22.903 -4.205  -14.506 1.00 49.82 ? 137 GLN F CG  1 
ATOM   7526  C  CD  . GLN F 1 53  ? 22.128 -3.632  -13.387 1.00 53.69 ? 137 GLN F CD  1 
ATOM   7527  O  OE1 . GLN F 1 53  ? 22.608 -2.748  -12.685 1.00 54.95 ? 137 GLN F OE1 1 
ATOM   7528  N  NE2 . GLN F 1 53  ? 20.912 -4.159  -13.174 1.00 56.43 ? 137 GLN F NE2 1 
ATOM   7529  N  N   . VAL F 1 54  ? 26.129 -6.521  -12.196 1.00 45.25 ? 138 VAL F N   1 
ATOM   7530  C  CA  . VAL F 1 54  ? 26.865 -7.721  -11.968 1.00 44.30 ? 138 VAL F CA  1 
ATOM   7531  C  C   . VAL F 1 54  ? 25.860 -8.755  -11.582 1.00 43.46 ? 138 VAL F C   1 
ATOM   7532  O  O   . VAL F 1 54  ? 25.085 -8.581  -10.659 1.00 43.00 ? 138 VAL F O   1 
ATOM   7533  C  CB  . VAL F 1 54  ? 27.873 -7.519  -10.871 1.00 43.79 ? 138 VAL F CB  1 
ATOM   7534  C  CG1 . VAL F 1 54  ? 28.464 -8.843  -10.435 1.00 45.76 ? 138 VAL F CG1 1 
ATOM   7535  C  CG2 . VAL F 1 54  ? 28.939 -6.667  -11.386 1.00 44.15 ? 138 VAL F CG2 1 
ATOM   7536  N  N   . TYR F 1 55  ? 25.892 -9.833  -12.341 1.00 43.97 ? 139 TYR F N   1 
ATOM   7537  C  CA  . TYR F 1 55  ? 25.021 -10.984 -12.156 1.00 43.61 ? 139 TYR F CA  1 
ATOM   7538  C  C   . TYR F 1 55  ? 25.800 -11.922 -11.263 1.00 42.32 ? 139 TYR F C   1 
ATOM   7539  O  O   . TYR F 1 55  ? 26.939 -12.273 -11.584 1.00 42.06 ? 139 TYR F O   1 
ATOM   7540  C  CB  . TYR F 1 55  ? 24.673 -11.554 -13.552 1.00 44.83 ? 139 TYR F CB  1 
ATOM   7541  C  CG  . TYR F 1 55  ? 23.994 -10.454 -14.363 1.00 46.05 ? 139 TYR F CG  1 
ATOM   7542  C  CD1 . TYR F 1 55  ? 24.721 -9.422  -14.933 1.00 43.50 ? 139 TYR F CD1 1 
ATOM   7543  C  CD2 . TYR F 1 55  ? 22.604 -10.406 -14.453 1.00 49.18 ? 139 TYR F CD2 1 
ATOM   7544  C  CE1 . TYR F 1 55  ? 24.094 -8.380  -15.589 1.00 46.99 ? 139 TYR F CE1 1 
ATOM   7545  C  CE2 . TYR F 1 55  ? 21.946 -9.388  -15.131 1.00 48.81 ? 139 TYR F CE2 1 
ATOM   7546  C  CZ  . TYR F 1 55  ? 22.683 -8.362  -15.693 1.00 50.22 ? 139 TYR F CZ  1 
ATOM   7547  O  OH  . TYR F 1 55  ? 21.987 -7.331  -16.363 1.00 51.04 ? 139 TYR F OH  1 
ATOM   7548  N  N   . VAL F 1 56  ? 25.232 -12.235 -10.101 1.00 40.93 ? 140 VAL F N   1 
ATOM   7549  C  CA  . VAL F 1 56  ? 25.874 -13.129 -9.133  1.00 39.74 ? 140 VAL F CA  1 
ATOM   7550  C  C   . VAL F 1 56  ? 25.121 -14.453 -8.940  1.00 41.45 ? 140 VAL F C   1 
ATOM   7551  O  O   . VAL F 1 56  ? 23.893 -14.448 -8.657  1.00 41.29 ? 140 VAL F O   1 
ATOM   7552  C  CB  . VAL F 1 56  ? 25.929 -12.459 -7.737  1.00 38.93 ? 140 VAL F CB  1 
ATOM   7553  C  CG1 . VAL F 1 56  ? 26.490 -13.413 -6.710  1.00 34.94 ? 140 VAL F CG1 1 
ATOM   7554  C  CG2 . VAL F 1 56  ? 26.701 -11.211 -7.803  1.00 37.05 ? 140 VAL F CG2 1 
ATOM   7555  N  N   . LEU F 1 57  ? 25.869 -15.560 -8.991  1.00 42.97 ? 141 LEU F N   1 
ATOM   7556  C  CA  . LEU F 1 57  ? 25.343 -16.890 -8.673  1.00 44.80 ? 141 LEU F CA  1 
ATOM   7557  C  C   . LEU F 1 57  ? 25.892 -17.517 -7.413  1.00 44.91 ? 141 LEU F C   1 
ATOM   7558  O  O   . LEU F 1 57  ? 27.092 -17.587 -7.266  1.00 44.81 ? 141 LEU F O   1 
ATOM   7559  C  CB  . LEU F 1 57  ? 25.559 -17.838 -9.877  1.00 45.64 ? 141 LEU F CB  1 
ATOM   7560  C  CG  . LEU F 1 57  ? 24.480 -17.423 -10.920 1.00 48.60 ? 141 LEU F CG  1 
ATOM   7561  C  CD1 . LEU F 1 57  ? 24.742 -17.893 -12.372 1.00 48.23 ? 141 LEU F CD1 1 
ATOM   7562  C  CD2 . LEU F 1 57  ? 23.015 -17.766 -10.405 1.00 46.57 ? 141 LEU F CD2 1 
ATOM   7563  N  N   . LYS F 1 58  ? 25.012 -17.976 -6.519  1.00 45.76 ? 142 LYS F N   1 
ATOM   7564  C  CA  . LYS F 1 58  ? 25.414 -18.676 -5.280  1.00 47.09 ? 142 LYS F CA  1 
ATOM   7565  C  C   . LYS F 1 58  ? 25.855 -20.144 -5.485  1.00 47.82 ? 142 LYS F C   1 
ATOM   7566  O  O   . LYS F 1 58  ? 25.080 -20.978 -5.969  1.00 49.30 ? 142 LYS F O   1 
ATOM   7567  C  CB  . LYS F 1 58  ? 24.306 -18.651 -4.202  1.00 47.30 ? 142 LYS F CB  1 
ATOM   7568  C  CG  . LYS F 1 58  ? 23.562 -17.331 -3.987  1.00 49.02 ? 142 LYS F CG  1 
ATOM   7569  C  CD  . LYS F 1 58  ? 23.245 -17.056 -2.512  1.00 51.33 ? 142 LYS F CD  1 
ATOM   7570  C  CE  . LYS F 1 58  ? 22.661 -18.257 -1.759  1.00 53.16 ? 142 LYS F CE  1 
ATOM   7571  N  NZ  . LYS F 1 58  ? 21.164 -18.269 -1.546  1.00 54.24 ? 142 LYS F NZ  1 
ATOM   7572  N  N   . ARG F 1 59  ? 27.077 -20.484 -5.095  1.00 46.93 ? 143 ARG F N   1 
ATOM   7573  C  CA  . ARG F 1 59  ? 27.437 -21.865 -5.076  1.00 46.55 ? 143 ARG F CA  1 
ATOM   7574  C  C   . ARG F 1 59  ? 26.395 -22.583 -4.249  1.00 47.09 ? 143 ARG F C   1 
ATOM   7575  O  O   . ARG F 1 59  ? 25.811 -21.968 -3.344  1.00 48.04 ? 143 ARG F O   1 
ATOM   7576  C  CB  . ARG F 1 59  ? 28.810 -22.069 -4.437  1.00 46.89 ? 143 ARG F CB  1 
ATOM   7577  C  CG  . ARG F 1 59  ? 29.520 -23.319 -4.961  1.00 47.45 ? 143 ARG F CG  1 
ATOM   7578  C  CD  . ARG F 1 59  ? 30.834 -23.558 -4.342  1.00 49.32 ? 143 ARG F CD  1 
ATOM   7579  N  NE  . ARG F 1 59  ? 31.571 -24.528 -5.137  1.00 53.11 ? 143 ARG F NE  1 
ATOM   7580  C  CZ  . ARG F 1 59  ? 32.897 -24.624 -5.188  1.00 55.61 ? 143 ARG F CZ  1 
ATOM   7581  N  NH1 . ARG F 1 59  ? 33.644 -23.763 -4.521  1.00 58.11 ? 143 ARG F NH1 1 
ATOM   7582  N  NH2 . ARG F 1 59  ? 33.484 -25.565 -5.932  1.00 57.16 ? 143 ARG F NH2 1 
ATOM   7583  N  N   . PRO F 1 60  ? 26.081 -23.862 -4.601  1.00 47.07 ? 144 PRO F N   1 
ATOM   7584  C  CA  . PRO F 1 60  ? 25.196 -24.776 -3.819  1.00 45.40 ? 144 PRO F CA  1 
ATOM   7585  C  C   . PRO F 1 60  ? 25.652 -25.016 -2.380  1.00 44.35 ? 144 PRO F C   1 
ATOM   7586  O  O   . PRO F 1 60  ? 26.811 -25.378 -2.135  1.00 44.09 ? 144 PRO F O   1 
ATOM   7587  C  CB  . PRO F 1 60  ? 25.298 -26.069 -4.610  1.00 45.36 ? 144 PRO F CB  1 
ATOM   7588  C  CG  . PRO F 1 60  ? 25.492 -25.541 -6.067  1.00 46.42 ? 144 PRO F CG  1 
ATOM   7589  C  CD  . PRO F 1 60  ? 26.487 -24.471 -5.895  1.00 46.44 ? 144 PRO F CD  1 
ATOM   7590  N  N   . TYR F 1 61  ? 24.731 -24.831 -1.443  1.00 42.41 ? 145 TYR F N   1 
ATOM   7591  C  CA  . TYR F 1 61  ? 24.967 -25.070 0.017   1.00 43.17 ? 145 TYR F CA  1 
ATOM   7592  C  C   . TYR F 1 61  ? 25.551 -23.891 0.738   1.00 43.76 ? 145 TYR F C   1 
ATOM   7593  O  O   . TYR F 1 61  ? 25.676 -23.860 1.989   1.00 44.41 ? 145 TYR F O   1 
ATOM   7594  C  CB  . TYR F 1 61  ? 25.739 -26.398 0.281   1.00 43.40 ? 145 TYR F CB  1 
ATOM   7595  C  CG  . TYR F 1 61  ? 24.974 -27.494 -0.415  1.00 42.52 ? 145 TYR F CG  1 
ATOM   7596  C  CD1 . TYR F 1 61  ? 25.449 -28.033 -1.572  1.00 43.07 ? 145 TYR F CD1 1 
ATOM   7597  C  CD2 . TYR F 1 61  ? 23.697 -27.896 0.025   1.00 44.28 ? 145 TYR F CD2 1 
ATOM   7598  C  CE1 . TYR F 1 61  ? 24.749 -29.016 -2.261  1.00 44.57 ? 145 TYR F CE1 1 
ATOM   7599  C  CE2 . TYR F 1 61  ? 22.950 -28.886 -0.671  1.00 42.98 ? 145 TYR F CE2 1 
ATOM   7600  C  CZ  . TYR F 1 61  ? 23.519 -29.408 -1.813  1.00 43.65 ? 145 TYR F CZ  1 
ATOM   7601  O  OH  . TYR F 1 61  ? 22.894 -30.328 -2.596  1.00 45.86 ? 145 TYR F OH  1 
ATOM   7602  N  N   . VAL F 1 62  ? 25.835 -22.855 -0.036  1.00 45.60 ? 146 VAL F N   1 
ATOM   7603  C  CA  . VAL F 1 62  ? 26.508 -21.710 0.537   1.00 46.34 ? 146 VAL F CA  1 
ATOM   7604  C  C   . VAL F 1 62  ? 25.863 -21.231 1.834   1.00 47.64 ? 146 VAL F C   1 
ATOM   7605  O  O   . VAL F 1 62  ? 26.549 -21.110 2.843   1.00 48.32 ? 146 VAL F O   1 
ATOM   7606  C  CB  . VAL F 1 62  ? 26.798 -20.612 -0.482  1.00 45.90 ? 146 VAL F CB  1 
ATOM   7607  C  CG1 . VAL F 1 62  ? 25.554 -19.848 -0.844  1.00 44.21 ? 146 VAL F CG1 1 
ATOM   7608  C  CG2 . VAL F 1 62  ? 27.892 -19.703 0.092   1.00 46.28 ? 146 VAL F CG2 1 
ATOM   7609  N  N   . ASP F 1 63  ? 24.550 -21.038 1.839   1.00 49.10 ? 147 ASP F N   1 
ATOM   7610  C  CA  . ASP F 1 63  ? 23.909 -20.501 3.022   1.00 50.50 ? 147 ASP F CA  1 
ATOM   7611  C  C   . ASP F 1 63  ? 24.213 -21.403 4.210   1.00 50.95 ? 147 ASP F C   1 
ATOM   7612  O  O   . ASP F 1 63  ? 24.520 -20.931 5.325   1.00 50.67 ? 147 ASP F O   1 
ATOM   7613  C  CB  . ASP F 1 63  ? 22.400 -20.308 2.801   1.00 50.71 ? 147 ASP F CB  1 
ATOM   7614  C  CG  . ASP F 1 63  ? 22.086 -19.245 1.732   1.00 54.53 ? 147 ASP F CG  1 
ATOM   7615  O  OD1 . ASP F 1 63  ? 22.701 -18.142 1.780   1.00 55.24 ? 147 ASP F OD1 1 
ATOM   7616  O  OD2 . ASP F 1 63  ? 21.218 -19.513 0.839   1.00 57.71 ? 147 ASP F OD2 1 
ATOM   7617  N  N   . GLU F 1 64  ? 24.166 -22.712 3.980   1.00 51.51 ? 148 GLU F N   1 
ATOM   7618  C  CA  . GLU F 1 64  ? 24.154 -23.577 5.148   1.00 52.85 ? 148 GLU F CA  1 
ATOM   7619  C  C   . GLU F 1 64  ? 25.574 -23.908 5.596   1.00 52.00 ? 148 GLU F C   1 
ATOM   7620  O  O   . GLU F 1 64  ? 25.805 -24.218 6.775   1.00 52.08 ? 148 GLU F O   1 
ATOM   7621  C  CB  . GLU F 1 64  ? 23.145 -24.769 5.072   1.00 53.44 ? 148 GLU F CB  1 
ATOM   7622  C  CG  . GLU F 1 64  ? 22.791 -25.347 3.672   1.00 58.58 ? 148 GLU F CG  1 
ATOM   7623  C  CD  . GLU F 1 64  ? 22.033 -24.372 2.712   1.00 64.54 ? 148 GLU F CD  1 
ATOM   7624  O  OE1 . GLU F 1 64  ? 20.777 -24.476 2.641   1.00 67.88 ? 148 GLU F OE1 1 
ATOM   7625  O  OE2 . GLU F 1 64  ? 22.683 -23.540 2.001   1.00 64.87 ? 148 GLU F OE2 1 
ATOM   7626  N  N   . PHE F 1 65  ? 26.518 -23.757 4.673   1.00 50.91 ? 149 PHE F N   1 
ATOM   7627  C  CA  . PHE F 1 65  ? 27.947 -23.745 5.020   1.00 50.62 ? 149 PHE F CA  1 
ATOM   7628  C  C   . PHE F 1 65  ? 28.301 -22.535 5.908   1.00 50.10 ? 149 PHE F C   1 
ATOM   7629  O  O   . PHE F 1 65  ? 28.867 -22.698 7.007   1.00 49.79 ? 149 PHE F O   1 
ATOM   7630  C  CB  . PHE F 1 65  ? 28.766 -23.749 3.741   1.00 51.25 ? 149 PHE F CB  1 
ATOM   7631  C  CG  . PHE F 1 65  ? 30.241 -23.745 3.952   1.00 52.43 ? 149 PHE F CG  1 
ATOM   7632  C  CD1 . PHE F 1 65  ? 30.945 -24.925 4.023   1.00 54.28 ? 149 PHE F CD1 1 
ATOM   7633  C  CD2 . PHE F 1 65  ? 30.953 -22.547 3.979   1.00 53.85 ? 149 PHE F CD2 1 
ATOM   7634  C  CE1 . PHE F 1 65  ? 32.315 -24.912 4.186   1.00 53.92 ? 149 PHE F CE1 1 
ATOM   7635  C  CE2 . PHE F 1 65  ? 32.318 -22.537 4.152   1.00 52.68 ? 149 PHE F CE2 1 
ATOM   7636  C  CZ  . PHE F 1 65  ? 32.993 -23.710 4.262   1.00 53.38 ? 149 PHE F CZ  1 
ATOM   7637  N  N   . LEU F 1 66  ? 27.943 -21.326 5.456   1.00 48.88 ? 150 LEU F N   1 
ATOM   7638  C  CA  . LEU F 1 66  ? 28.310 -20.129 6.200   1.00 47.87 ? 150 LEU F CA  1 
ATOM   7639  C  C   . LEU F 1 66  ? 27.715 -20.079 7.587   1.00 48.76 ? 150 LEU F C   1 
ATOM   7640  O  O   . LEU F 1 66  ? 28.399 -19.645 8.530   1.00 49.40 ? 150 LEU F O   1 
ATOM   7641  C  CB  . LEU F 1 66  ? 27.981 -18.850 5.445   1.00 46.27 ? 150 LEU F CB  1 
ATOM   7642  C  CG  . LEU F 1 66  ? 28.858 -18.582 4.234   1.00 45.35 ? 150 LEU F CG  1 
ATOM   7643  C  CD1 . LEU F 1 66  ? 28.421 -17.300 3.508   1.00 38.71 ? 150 LEU F CD1 1 
ATOM   7644  C  CD2 . LEU F 1 66  ? 30.367 -18.591 4.613   1.00 41.86 ? 150 LEU F CD2 1 
ATOM   7645  N  N   . ARG F 1 67  ? 26.459 -20.510 7.719   1.00 49.00 ? 151 ARG F N   1 
ATOM   7646  C  CA  . ARG F 1 67  ? 25.807 -20.589 9.020   1.00 50.26 ? 151 ARG F CA  1 
ATOM   7647  C  C   . ARG F 1 67  ? 26.599 -21.502 9.949   1.00 48.74 ? 151 ARG F C   1 
ATOM   7648  O  O   . ARG F 1 67  ? 26.861 -21.151 11.107  1.00 48.21 ? 151 ARG F O   1 
ATOM   7649  C  CB  . ARG F 1 67  ? 24.362 -21.092 8.854   1.00 51.10 ? 151 ARG F CB  1 
ATOM   7650  C  CG  . ARG F 1 67  ? 23.498 -21.223 10.164  1.00 53.50 ? 151 ARG F CG  1 
ATOM   7651  C  CD  . ARG F 1 67  ? 22.071 -21.863 9.859   1.00 55.10 ? 151 ARG F CD  1 
ATOM   7652  N  NE  . ARG F 1 67  ? 21.408 -21.282 8.656   1.00 63.21 ? 151 ARG F NE  1 
ATOM   7653  C  CZ  . ARG F 1 67  ? 21.083 -21.971 7.548   1.00 64.25 ? 151 ARG F CZ  1 
ATOM   7654  N  NH1 . ARG F 1 67  ? 21.322 -23.287 7.480   1.00 65.99 ? 151 ARG F NH1 1 
ATOM   7655  N  NH2 . ARG F 1 67  ? 20.516 -21.357 6.505   1.00 62.83 ? 151 ARG F NH2 1 
ATOM   7656  N  N   . ARG F 1 68  ? 26.997 -22.668 9.439   1.00 48.15 ? 152 ARG F N   1 
ATOM   7657  C  CA  . ARG F 1 68  ? 27.766 -23.599 10.257  1.00 48.48 ? 152 ARG F CA  1 
ATOM   7658  C  C   . ARG F 1 68  ? 29.160 -23.086 10.643  1.00 48.34 ? 152 ARG F C   1 
ATOM   7659  O  O   . ARG F 1 68  ? 29.517 -23.094 11.838  1.00 47.61 ? 152 ARG F O   1 
ATOM   7660  C  CB  . ARG F 1 68  ? 27.906 -24.961 9.589   1.00 48.86 ? 152 ARG F CB  1 
ATOM   7661  C  CG  . ARG F 1 68  ? 28.475 -26.029 10.549  1.00 49.50 ? 152 ARG F CG  1 
ATOM   7662  C  CD  . ARG F 1 68  ? 27.485 -26.344 11.698  1.00 48.98 ? 152 ARG F CD  1 
ATOM   7663  N  NE  . ARG F 1 68  ? 28.026 -27.367 12.600  1.00 48.18 ? 152 ARG F NE  1 
ATOM   7664  C  CZ  . ARG F 1 68  ? 28.064 -27.293 13.932  1.00 45.53 ? 152 ARG F CZ  1 
ATOM   7665  N  NH1 . ARG F 1 68  ? 27.601 -26.229 14.588  1.00 41.91 ? 152 ARG F NH1 1 
ATOM   7666  N  NH2 . ARG F 1 68  ? 28.593 -28.306 14.601  1.00 44.04 ? 152 ARG F NH2 1 
ATOM   7667  N  N   . MET F 1 69  ? 29.925 -22.650 9.629   1.00 47.25 ? 153 MET F N   1 
ATOM   7668  C  CA  . MET F 1 69  ? 31.230 -22.058 9.864   1.00 47.47 ? 153 MET F CA  1 
ATOM   7669  C  C   . MET F 1 69  ? 31.094 -21.003 10.927  1.00 47.24 ? 153 MET F C   1 
ATOM   7670  O  O   . MET F 1 69  ? 31.846 -20.997 11.910  1.00 47.42 ? 153 MET F O   1 
ATOM   7671  C  CB  . MET F 1 69  ? 31.851 -21.447 8.593   1.00 48.07 ? 153 MET F CB  1 
ATOM   7672  C  CG  . MET F 1 69  ? 32.020 -22.397 7.396   1.00 47.52 ? 153 MET F CG  1 
ATOM   7673  S  SD  . MET F 1 69  ? 33.208 -23.713 7.723   1.00 51.15 ? 153 MET F SD  1 
ATOM   7674  C  CE  . MET F 1 69  ? 34.737 -22.791 7.835   1.00 51.62 ? 153 MET F CE  1 
ATOM   7675  N  N   . GLY F 1 70  ? 30.118 -20.127 10.745  1.00 47.06 ? 154 GLY F N   1 
ATOM   7676  C  CA  . GLY F 1 70  ? 29.846 -19.085 11.723  1.00 47.47 ? 154 GLY F CA  1 
ATOM   7677  C  C   . GLY F 1 70  ? 29.549 -19.533 13.140  1.00 47.90 ? 154 GLY F C   1 
ATOM   7678  O  O   . GLY F 1 70  ? 29.780 -18.780 14.057  1.00 47.35 ? 154 GLY F O   1 
ATOM   7679  N  N   . GLU F 1 71  ? 28.997 -20.730 13.339  1.00 49.65 ? 155 GLU F N   1 
ATOM   7680  C  CA  . GLU F 1 71  ? 28.810 -21.253 14.726  1.00 51.60 ? 155 GLU F CA  1 
ATOM   7681  C  C   . GLU F 1 71  ? 30.152 -21.633 15.319  1.00 51.46 ? 155 GLU F C   1 
ATOM   7682  O  O   . GLU F 1 71  ? 30.416 -21.419 16.512  1.00 51.90 ? 155 GLU F O   1 
ATOM   7683  C  CB  . GLU F 1 71  ? 27.906 -22.506 14.773  1.00 52.09 ? 155 GLU F CB  1 
ATOM   7684  C  CG  . GLU F 1 71  ? 26.378 -22.260 14.703  1.00 54.66 ? 155 GLU F CG  1 
ATOM   7685  C  CD  . GLU F 1 71  ? 25.687 -23.306 13.842  1.00 61.19 ? 155 GLU F CD  1 
ATOM   7686  O  OE1 . GLU F 1 71  ? 26.298 -24.387 13.570  1.00 63.85 ? 155 GLU F OE1 1 
ATOM   7687  O  OE2 . GLU F 1 71  ? 24.542 -23.048 13.405  1.00 63.91 ? 155 GLU F OE2 1 
ATOM   7688  N  N   . LEU F 1 72  ? 30.985 -22.183 14.446  1.00 51.24 ? 156 LEU F N   1 
ATOM   7689  C  CA  . LEU F 1 72  ? 32.202 -22.843 14.826  1.00 51.75 ? 156 LEU F CA  1 
ATOM   7690  C  C   . LEU F 1 72  ? 33.514 -22.066 14.783  1.00 51.37 ? 156 LEU F C   1 
ATOM   7691  O  O   . LEU F 1 72  ? 34.441 -22.485 15.437  1.00 52.56 ? 156 LEU F O   1 
ATOM   7692  C  CB  . LEU F 1 72  ? 32.397 -24.059 13.936  1.00 52.02 ? 156 LEU F CB  1 
ATOM   7693  C  CG  . LEU F 1 72  ? 31.345 -25.142 13.854  1.00 52.99 ? 156 LEU F CG  1 
ATOM   7694  C  CD1 . LEU F 1 72  ? 31.904 -26.160 12.895  1.00 53.79 ? 156 LEU F CD1 1 
ATOM   7695  C  CD2 . LEU F 1 72  ? 31.028 -25.754 15.218  1.00 53.56 ? 156 LEU F CD2 1 
ATOM   7696  N  N   . PHE F 1 73  ? 33.630 -20.997 13.991  1.00 50.71 ? 157 PHE F N   1 
ATOM   7697  C  CA  . PHE F 1 73  ? 34.930 -20.352 13.767  1.00 48.41 ? 157 PHE F CA  1 
ATOM   7698  C  C   . PHE F 1 73  ? 34.857 -18.874 13.892  1.00 47.83 ? 157 PHE F C   1 
ATOM   7699  O  O   . PHE F 1 73  ? 33.852 -18.350 14.309  1.00 47.81 ? 157 PHE F O   1 
ATOM   7700  C  CB  . PHE F 1 73  ? 35.426 -20.643 12.401  1.00 47.43 ? 157 PHE F CB  1 
ATOM   7701  C  CG  . PHE F 1 73  ? 35.730 -22.061 12.181  1.00 48.82 ? 157 PHE F CG  1 
ATOM   7702  C  CD1 . PHE F 1 73  ? 34.822 -22.879 11.519  1.00 48.47 ? 157 PHE F CD1 1 
ATOM   7703  C  CD2 . PHE F 1 73  ? 36.956 -22.594 12.593  1.00 47.88 ? 157 PHE F CD2 1 
ATOM   7704  C  CE1 . PHE F 1 73  ? 35.125 -24.225 11.270  1.00 49.83 ? 157 PHE F CE1 1 
ATOM   7705  C  CE2 . PHE F 1 73  ? 37.258 -23.931 12.358  1.00 48.70 ? 157 PHE F CE2 1 
ATOM   7706  C  CZ  . PHE F 1 73  ? 36.332 -24.747 11.685  1.00 49.46 ? 157 PHE F CZ  1 
ATOM   7707  N  N   . GLU F 1 74  ? 35.978 -18.215 13.595  1.00 47.22 ? 158 GLU F N   1 
ATOM   7708  C  CA  . GLU F 1 74  ? 36.036 -16.781 13.411  1.00 45.34 ? 158 GLU F CA  1 
ATOM   7709  C  C   . GLU F 1 74  ? 36.169 -16.649 11.911  1.00 44.12 ? 158 GLU F C   1 
ATOM   7710  O  O   . GLU F 1 74  ? 37.173 -17.018 11.348  1.00 44.54 ? 158 GLU F O   1 
ATOM   7711  C  CB  . GLU F 1 74  ? 37.255 -16.193 14.094  1.00 45.11 ? 158 GLU F CB  1 
ATOM   7712  C  CG  . GLU F 1 74  ? 37.290 -14.687 13.979  1.00 45.29 ? 158 GLU F CG  1 
ATOM   7713  C  CD  . GLU F 1 74  ? 38.592 -14.068 14.482  1.00 46.50 ? 158 GLU F CD  1 
ATOM   7714  O  OE1 . GLU F 1 74  ? 39.592 -14.821 14.567  1.00 50.10 ? 158 GLU F OE1 1 
ATOM   7715  O  OE2 . GLU F 1 74  ? 38.623 -12.838 14.775  1.00 40.82 ? 158 GLU F OE2 1 
ATOM   7716  N  N   . CYS F 1 75  ? 35.120 -16.203 11.248  1.00 42.87 ? 159 CYS F N   1 
ATOM   7717  C  CA  . CYS F 1 75  ? 35.146 -16.194 9.803   1.00 41.79 ? 159 CYS F CA  1 
ATOM   7718  C  C   . CYS F 1 75  ? 35.609 -14.846 9.322   1.00 39.24 ? 159 CYS F C   1 
ATOM   7719  O  O   . CYS F 1 75  ? 35.151 -13.831 9.819   1.00 39.07 ? 159 CYS F O   1 
ATOM   7720  C  CB  . CYS F 1 75  ? 33.768 -16.534 9.254   1.00 42.97 ? 159 CYS F CB  1 
ATOM   7721  S  SG  . CYS F 1 75  ? 33.227 -18.158 9.811   1.00 46.46 ? 159 CYS F SG  1 
ATOM   7722  N  N   . VAL F 1 76  ? 36.566 -14.860 8.409   1.00 35.75 ? 160 VAL F N   1 
ATOM   7723  C  CA  . VAL F 1 76  ? 37.162 -13.673 7.938   1.00 33.22 ? 160 VAL F CA  1 
ATOM   7724  C  C   . VAL F 1 76  ? 37.115 -13.688 6.419   1.00 32.71 ? 160 VAL F C   1 
ATOM   7725  O  O   . VAL F 1 76  ? 37.573 -14.656 5.806   1.00 30.66 ? 160 VAL F O   1 
ATOM   7726  C  CB  . VAL F 1 76  ? 38.571 -13.605 8.416   1.00 33.60 ? 160 VAL F CB  1 
ATOM   7727  C  CG1 . VAL F 1 76  ? 39.329 -12.475 7.705   1.00 32.79 ? 160 VAL F CG1 1 
ATOM   7728  C  CG2 . VAL F 1 76  ? 38.612 -13.436 9.948   1.00 33.06 ? 160 VAL F CG2 1 
ATOM   7729  N  N   . LEU F 1 77  ? 36.507 -12.655 5.808   1.00 31.53 ? 161 LEU F N   1 
ATOM   7730  C  CA  . LEU F 1 77  ? 36.484 -12.594 4.347   1.00 31.31 ? 161 LEU F CA  1 
ATOM   7731  C  C   . LEU F 1 77  ? 37.831 -12.082 3.876   1.00 31.98 ? 161 LEU F C   1 
ATOM   7732  O  O   . LEU F 1 77  ? 38.331 -11.104 4.401   1.00 32.49 ? 161 LEU F O   1 
ATOM   7733  C  CB  . LEU F 1 77  ? 35.395 -11.668 3.844   1.00 30.73 ? 161 LEU F CB  1 
ATOM   7734  C  CG  . LEU F 1 77  ? 35.372 -11.508 2.313   1.00 32.47 ? 161 LEU F CG  1 
ATOM   7735  C  CD1 . LEU F 1 77  ? 34.750 -12.744 1.714   1.00 31.11 ? 161 LEU F CD1 1 
ATOM   7736  C  CD2 . LEU F 1 77  ? 34.602 -10.248 1.836   1.00 29.62 ? 161 LEU F CD2 1 
ATOM   7737  N  N   . PHE F 1 78  ? 38.447 -12.717 2.897   1.00 31.79 ? 162 PHE F N   1 
ATOM   7738  C  CA  . PHE F 1 78  ? 39.753 -12.241 2.491   1.00 31.15 ? 162 PHE F CA  1 
ATOM   7739  C  C   . PHE F 1 78  ? 39.814 -12.490 1.025   1.00 30.62 ? 162 PHE F C   1 
ATOM   7740  O  O   . PHE F 1 78  ? 40.106 -13.574 0.615   1.00 31.36 ? 162 PHE F O   1 
ATOM   7741  C  CB  . PHE F 1 78  ? 40.837 -12.996 3.243   1.00 31.17 ? 162 PHE F CB  1 
ATOM   7742  C  CG  . PHE F 1 78  ? 42.220 -12.373 3.176   1.00 32.07 ? 162 PHE F CG  1 
ATOM   7743  C  CD1 . PHE F 1 78  ? 43.238 -12.818 4.049   1.00 31.06 ? 162 PHE F CD1 1 
ATOM   7744  C  CD2 . PHE F 1 78  ? 42.549 -11.378 2.245   1.00 33.68 ? 162 PHE F CD2 1 
ATOM   7745  C  CE1 . PHE F 1 78  ? 44.584 -12.269 3.979   1.00 32.17 ? 162 PHE F CE1 1 
ATOM   7746  C  CE2 . PHE F 1 78  ? 43.887 -10.807 2.219   1.00 33.91 ? 162 PHE F CE2 1 
ATOM   7747  C  CZ  . PHE F 1 78  ? 44.882 -11.263 3.082   1.00 27.58 ? 162 PHE F CZ  1 
ATOM   7748  N  N   . THR F 1 79  ? 39.521 -11.480 0.228   1.00 30.47 ? 163 THR F N   1 
ATOM   7749  C  CA  . THR F 1 79  ? 39.415 -11.632 -1.191  1.00 30.81 ? 163 THR F CA  1 
ATOM   7750  C  C   . THR F 1 79  ? 40.465 -10.756 -1.890  1.00 33.31 ? 163 THR F C   1 
ATOM   7751  O  O   . THR F 1 79  ? 40.899 -9.776  -1.305  1.00 34.19 ? 163 THR F O   1 
ATOM   7752  C  CB  . THR F 1 79  ? 38.054 -11.137 -1.598  1.00 30.24 ? 163 THR F CB  1 
ATOM   7753  O  OG1 . THR F 1 79  ? 37.979 -10.999 -3.008  1.00 32.03 ? 163 THR F OG1 1 
ATOM   7754  C  CG2 . THR F 1 79  ? 37.745 -9.781  -0.999  1.00 25.81 ? 163 THR F CG2 1 
ATOM   7755  N  N   . ALA F 1 80  ? 40.829 -11.061 -3.141  1.00 35.21 ? 164 ALA F N   1 
ATOM   7756  C  CA  . ALA F 1 80  ? 41.745 -10.186 -3.930  1.00 37.53 ? 164 ALA F CA  1 
ATOM   7757  C  C   . ALA F 1 80  ? 41.010 -9.138  -4.715  1.00 38.98 ? 164 ALA F C   1 
ATOM   7758  O  O   . ALA F 1 80  ? 41.631 -8.468  -5.545  1.00 40.53 ? 164 ALA F O   1 
ATOM   7759  C  CB  . ALA F 1 80  ? 42.612 -10.991 -4.910  1.00 35.97 ? 164 ALA F CB  1 
ATOM   7760  N  N   . SER F 1 81  ? 39.694 -9.026  -4.536  1.00 39.79 ? 165 SER F N   1 
ATOM   7761  C  CA  . SER F 1 81  ? 38.956 -8.028  -5.296  1.00 39.95 ? 165 SER F CA  1 
ATOM   7762  C  C   . SER F 1 81  ? 38.869 -6.756  -4.520  1.00 40.21 ? 165 SER F C   1 
ATOM   7763  O  O   . SER F 1 81  ? 39.420 -6.614  -3.439  1.00 39.46 ? 165 SER F O   1 
ATOM   7764  C  CB  . SER F 1 81  ? 37.579 -8.541  -5.690  1.00 40.60 ? 165 SER F CB  1 
ATOM   7765  O  OG  . SER F 1 81  ? 36.999 -9.242  -4.615  1.00 42.81 ? 165 SER F OG  1 
ATOM   7766  N  N   . LEU F 1 82  ? 38.212 -5.787  -5.093  1.00 41.58 ? 166 LEU F N   1 
ATOM   7767  C  CA  . LEU F 1 82  ? 38.150 -4.512  -4.429  1.00 43.37 ? 166 LEU F CA  1 
ATOM   7768  C  C   . LEU F 1 82  ? 36.858 -4.382  -3.682  1.00 43.32 ? 166 LEU F C   1 
ATOM   7769  O  O   . LEU F 1 82  ? 35.847 -4.913  -4.101  1.00 43.42 ? 166 LEU F O   1 
ATOM   7770  C  CB  . LEU F 1 82  ? 38.285 -3.402  -5.463  1.00 44.39 ? 166 LEU F CB  1 
ATOM   7771  C  CG  . LEU F 1 82  ? 39.683 -3.488  -6.118  1.00 46.07 ? 166 LEU F CG  1 
ATOM   7772  C  CD1 . LEU F 1 82  ? 39.609 -2.814  -7.495  1.00 47.44 ? 166 LEU F CD1 1 
ATOM   7773  C  CD2 . LEU F 1 82  ? 40.805 -2.886  -5.206  1.00 43.16 ? 166 LEU F CD2 1 
ATOM   7774  N  N   . ALA F 1 83  ? 36.895 -3.659  -2.575  1.00 43.98 ? 167 ALA F N   1 
ATOM   7775  C  CA  . ALA F 1 83  ? 35.718 -3.485  -1.732  1.00 44.50 ? 167 ALA F CA  1 
ATOM   7776  C  C   . ALA F 1 83  ? 34.535 -3.184  -2.596  1.00 44.85 ? 167 ALA F C   1 
ATOM   7777  O  O   . ALA F 1 83  ? 33.481 -3.763  -2.387  1.00 45.49 ? 167 ALA F O   1 
ATOM   7778  C  CB  . ALA F 1 83  ? 35.928 -2.365  -0.724  1.00 44.41 ? 167 ALA F CB  1 
ATOM   7779  N  N   . LYS F 1 84  ? 34.750 -2.334  -3.605  1.00 45.73 ? 168 LYS F N   1 
ATOM   7780  C  CA  . LYS F 1 84  ? 33.680 -1.781  -4.480  1.00 46.06 ? 168 LYS F CA  1 
ATOM   7781  C  C   . LYS F 1 84  ? 32.727 -2.861  -4.952  1.00 44.26 ? 168 LYS F C   1 
ATOM   7782  O  O   . LYS F 1 84  ? 31.530 -2.568  -5.057  1.00 42.96 ? 168 LYS F O   1 
ATOM   7783  C  CB  . LYS F 1 84  ? 34.218 -0.905  -5.667  1.00 46.29 ? 168 LYS F CB  1 
ATOM   7784  C  CG  . LYS F 1 84  ? 34.328 -1.593  -7.082  1.00 48.47 ? 168 LYS F CG  1 
ATOM   7785  C  CD  . LYS F 1 84  ? 34.909 -0.673  -8.272  1.00 48.83 ? 168 LYS F CD  1 
ATOM   7786  C  CE  . LYS F 1 84  ? 35.200 -1.537  -9.570  1.00 51.73 ? 168 LYS F CE  1 
ATOM   7787  N  NZ  . LYS F 1 84  ? 36.277 -1.157  -10.626 1.00 49.40 ? 168 LYS F NZ  1 
ATOM   7788  N  N   . TYR F 1 85  ? 33.304 -4.059  -5.198  1.00 43.25 ? 169 TYR F N   1 
ATOM   7789  C  CA  . TYR F 1 85  ? 32.666 -5.285  -5.673  1.00 43.17 ? 169 TYR F CA  1 
ATOM   7790  C  C   . TYR F 1 85  ? 32.358 -6.305  -4.578  1.00 43.09 ? 169 TYR F C   1 
ATOM   7791  O  O   . TYR F 1 85  ? 31.270 -6.876  -4.553  1.00 43.76 ? 169 TYR F O   1 
ATOM   7792  C  CB  . TYR F 1 85  ? 33.577 -6.023  -6.649  1.00 44.31 ? 169 TYR F CB  1 
ATOM   7793  C  CG  . TYR F 1 85  ? 33.214 -7.507  -6.742  1.00 46.10 ? 169 TYR F CG  1 
ATOM   7794  C  CD1 . TYR F 1 85  ? 32.089 -7.918  -7.456  1.00 49.52 ? 169 TYR F CD1 1 
ATOM   7795  C  CD2 . TYR F 1 85  ? 33.969 -8.499  -6.100  1.00 48.64 ? 169 TYR F CD2 1 
ATOM   7796  C  CE1 . TYR F 1 85  ? 31.710 -9.277  -7.538  1.00 48.42 ? 169 TYR F CE1 1 
ATOM   7797  C  CE2 . TYR F 1 85  ? 33.595 -9.881  -6.166  1.00 48.95 ? 169 TYR F CE2 1 
ATOM   7798  C  CZ  . TYR F 1 85  ? 32.444 -10.251 -6.901  1.00 48.54 ? 169 TYR F CZ  1 
ATOM   7799  O  OH  . TYR F 1 85  ? 32.006 -11.567 -7.020  1.00 46.97 ? 169 TYR F OH  1 
ATOM   7800  N  N   . ALA F 1 86  ? 33.328 -6.594  -3.711  1.00 41.99 ? 170 ALA F N   1 
ATOM   7801  C  CA  . ALA F 1 86  ? 33.126 -7.607  -2.664  1.00 41.44 ? 170 ALA F CA  1 
ATOM   7802  C  C   . ALA F 1 86  ? 32.028 -7.180  -1.685  1.00 40.86 ? 170 ALA F C   1 
ATOM   7803  O  O   . ALA F 1 86  ? 31.198 -7.975  -1.320  1.00 40.45 ? 170 ALA F O   1 
ATOM   7804  C  CB  . ALA F 1 86  ? 34.456 -7.977  -1.917  1.00 39.41 ? 170 ALA F CB  1 
ATOM   7805  N  N   . ASP F 1 87  ? 32.017 -5.916  -1.286  1.00 40.97 ? 171 ASP F N   1 
ATOM   7806  C  CA  . ASP F 1 87  ? 31.104 -5.469  -0.238  1.00 41.02 ? 171 ASP F CA  1 
ATOM   7807  C  C   . ASP F 1 87  ? 29.620 -5.676  -0.579  1.00 41.54 ? 171 ASP F C   1 
ATOM   7808  O  O   . ASP F 1 87  ? 28.909 -6.307  0.185   1.00 42.76 ? 171 ASP F O   1 
ATOM   7809  C  CB  . ASP F 1 87  ? 31.346 -4.018  0.067   1.00 39.84 ? 171 ASP F CB  1 
ATOM   7810  C  CG  . ASP F 1 87  ? 32.412 -3.811  1.098   1.00 41.73 ? 171 ASP F CG  1 
ATOM   7811  O  OD1 . ASP F 1 87  ? 32.756 -4.796  1.815   1.00 40.45 ? 171 ASP F OD1 1 
ATOM   7812  O  OD2 . ASP F 1 87  ? 32.870 -2.623  1.217   1.00 41.72 ? 171 ASP F OD2 1 
ATOM   7813  N  N   . PRO F 1 88  ? 29.137 -5.110  -1.708  1.00 40.93 ? 172 PRO F N   1 
ATOM   7814  C  CA  . PRO F 1 88  ? 27.715 -5.323  -2.006  1.00 39.63 ? 172 PRO F CA  1 
ATOM   7815  C  C   . PRO F 1 88  ? 27.383 -6.776  -2.319  1.00 38.83 ? 172 PRO F C   1 
ATOM   7816  O  O   . PRO F 1 88  ? 26.287 -7.210  -2.018  1.00 39.54 ? 172 PRO F O   1 
ATOM   7817  C  CB  . PRO F 1 88  ? 27.447 -4.386  -3.200  1.00 40.01 ? 172 PRO F CB  1 
ATOM   7818  C  CG  . PRO F 1 88  ? 28.854 -4.138  -3.826  1.00 40.37 ? 172 PRO F CG  1 
ATOM   7819  C  CD  . PRO F 1 88  ? 29.825 -4.245  -2.693  1.00 39.67 ? 172 PRO F CD  1 
ATOM   7820  N  N   . VAL F 1 89  ? 28.319 -7.546  -2.865  1.00 38.19 ? 173 VAL F N   1 
ATOM   7821  C  CA  . VAL F 1 89  ? 28.160 -9.028  -2.923  1.00 37.35 ? 173 VAL F CA  1 
ATOM   7822  C  C   . VAL F 1 89  ? 28.005 -9.678  -1.553  1.00 37.09 ? 173 VAL F C   1 
ATOM   7823  O  O   . VAL F 1 89  ? 26.941 -10.240 -1.319  1.00 38.41 ? 173 VAL F O   1 
ATOM   7824  C  CB  . VAL F 1 89  ? 29.221 -9.738  -3.806  1.00 38.29 ? 173 VAL F CB  1 
ATOM   7825  C  CG1 . VAL F 1 89  ? 29.052 -11.210 -3.815  1.00 36.00 ? 173 VAL F CG1 1 
ATOM   7826  C  CG2 . VAL F 1 89  ? 29.103 -9.267  -5.276  1.00 41.15 ? 173 VAL F CG2 1 
ATOM   7827  N  N   . THR F 1 90  ? 28.979 -9.541  -0.634  1.00 35.63 ? 174 THR F N   1 
ATOM   7828  C  CA  . THR F 1 90  ? 28.943 -10.107 0.735   1.00 34.51 ? 174 THR F CA  1 
ATOM   7829  C  C   . THR F 1 90  ? 27.765 -9.622  1.570   1.00 35.66 ? 174 THR F C   1 
ATOM   7830  O  O   . THR F 1 90  ? 27.234 -10.340 2.410   1.00 35.43 ? 174 THR F O   1 
ATOM   7831  C  CB  . THR F 1 90  ? 30.263 -9.734  1.475   1.00 34.55 ? 174 THR F CB  1 
ATOM   7832  O  OG1 . THR F 1 90  ? 31.367 -10.135 0.672   1.00 35.35 ? 174 THR F OG1 1 
ATOM   7833  C  CG2 . THR F 1 90  ? 30.435 -10.436 2.840   1.00 31.81 ? 174 THR F CG2 1 
ATOM   7834  N  N   . ASP F 1 91  ? 27.360 -8.374  1.371   1.00 36.72 ? 175 ASP F N   1 
ATOM   7835  C  CA  . ASP F 1 91  ? 26.198 -7.848  2.079   1.00 37.79 ? 175 ASP F CA  1 
ATOM   7836  C  C   . ASP F 1 91  ? 24.994 -8.753  1.843   1.00 37.56 ? 175 ASP F C   1 
ATOM   7837  O  O   . ASP F 1 91  ? 24.222 -8.955  2.759   1.00 37.44 ? 175 ASP F O   1 
ATOM   7838  C  CB  . ASP F 1 91  ? 25.871 -6.408  1.680   1.00 37.52 ? 175 ASP F CB  1 
ATOM   7839  C  CG  . ASP F 1 91  ? 26.918 -5.420  2.169   1.00 43.75 ? 175 ASP F CG  1 
ATOM   7840  O  OD1 . ASP F 1 91  ? 27.748 -5.798  3.042   1.00 45.82 ? 175 ASP F OD1 1 
ATOM   7841  O  OD2 . ASP F 1 91  ? 26.926 -4.248  1.690   1.00 51.00 ? 175 ASP F OD2 1 
ATOM   7842  N  N   . LEU F 1 92  ? 24.865 -9.301  0.630   1.00 37.89 ? 176 LEU F N   1 
ATOM   7843  C  CA  . LEU F 1 92  ? 23.679 -10.056 0.232   1.00 38.56 ? 176 LEU F CA  1 
ATOM   7844  C  C   . LEU F 1 92  ? 23.928 -11.514 0.471   1.00 39.60 ? 176 LEU F C   1 
ATOM   7845  O  O   . LEU F 1 92  ? 23.018 -12.229 0.794   1.00 41.22 ? 176 LEU F O   1 
ATOM   7846  C  CB  . LEU F 1 92  ? 23.295 -9.848  -1.240  1.00 37.35 ? 176 LEU F CB  1 
ATOM   7847  C  CG  . LEU F 1 92  ? 22.827 -8.448  -1.656  1.00 38.38 ? 176 LEU F CG  1 
ATOM   7848  C  CD1 . LEU F 1 92  ? 22.865 -8.244  -3.116  1.00 38.77 ? 176 LEU F CD1 1 
ATOM   7849  C  CD2 . LEU F 1 92  ? 21.428 -8.079  -1.116  1.00 43.83 ? 176 LEU F CD2 1 
ATOM   7850  N  N   . LEU F 1 93  ? 25.160 -11.955 0.317   1.00 39.72 ? 177 LEU F N   1 
ATOM   7851  C  CA  . LEU F 1 93  ? 25.465 -13.336 0.509   1.00 40.29 ? 177 LEU F CA  1 
ATOM   7852  C  C   . LEU F 1 93  ? 25.375 -13.722 1.957   1.00 41.07 ? 177 LEU F C   1 
ATOM   7853  O  O   . LEU F 1 93  ? 24.704 -14.642 2.270   1.00 43.97 ? 177 LEU F O   1 
ATOM   7854  C  CB  . LEU F 1 93  ? 26.877 -13.628 0.041   1.00 39.99 ? 177 LEU F CB  1 
ATOM   7855  C  CG  . LEU F 1 93  ? 27.279 -15.088 0.100   1.00 38.49 ? 177 LEU F CG  1 
ATOM   7856  C  CD1 . LEU F 1 93  ? 26.633 -15.785 -1.119  1.00 36.18 ? 177 LEU F CD1 1 
ATOM   7857  C  CD2 . LEU F 1 93  ? 28.773 -15.200 0.067   1.00 32.25 ? 177 LEU F CD2 1 
ATOM   7858  N  N   . ASP F 1 94  ? 26.024 -13.010 2.847   1.00 42.28 ? 178 ASP F N   1 
ATOM   7859  C  CA  . ASP F 1 94  ? 26.244 -13.444 4.217   1.00 43.33 ? 178 ASP F CA  1 
ATOM   7860  C  C   . ASP F 1 94  ? 25.030 -13.113 5.097   1.00 44.98 ? 178 ASP F C   1 
ATOM   7861  O  O   . ASP F 1 94  ? 25.023 -12.135 5.863   1.00 43.33 ? 178 ASP F O   1 
ATOM   7862  C  CB  . ASP F 1 94  ? 27.524 -12.731 4.644   1.00 44.33 ? 178 ASP F CB  1 
ATOM   7863  C  CG  . ASP F 1 94  ? 27.873 -12.900 6.086   1.00 45.26 ? 178 ASP F CG  1 
ATOM   7864  O  OD1 . ASP F 1 94  ? 27.679 -14.006 6.644   1.00 49.39 ? 178 ASP F OD1 1 
ATOM   7865  O  OD2 . ASP F 1 94  ? 28.382 -11.905 6.642   1.00 42.88 ? 178 ASP F OD2 1 
ATOM   7866  N  N   . ARG F 1 95  ? 23.974 -13.931 4.989   1.00 47.29 ? 179 ARG F N   1 
ATOM   7867  C  CA  . ARG F 1 95  ? 22.730 -13.620 5.774   1.00 49.70 ? 179 ARG F CA  1 
ATOM   7868  C  C   . ARG F 1 95  ? 22.871 -13.670 7.319   1.00 48.63 ? 179 ARG F C   1 
ATOM   7869  O  O   . ARG F 1 95  ? 22.234 -12.886 8.023   1.00 48.74 ? 179 ARG F O   1 
ATOM   7870  C  CB  . ARG F 1 95  ? 21.419 -14.269 5.210   1.00 49.94 ? 179 ARG F CB  1 
ATOM   7871  C  CG  . ARG F 1 95  ? 21.446 -15.742 4.682   1.00 52.02 ? 179 ARG F CG  1 
ATOM   7872  C  CD  . ARG F 1 95  ? 20.481 -15.944 3.439   1.00 53.69 ? 179 ARG F CD  1 
ATOM   7873  N  NE  . ARG F 1 95  ? 19.351 -16.886 3.657   1.00 63.93 ? 179 ARG F NE  1 
ATOM   7874  C  CZ  . ARG F 1 95  ? 18.577 -17.452 2.693   1.00 67.16 ? 179 ARG F CZ  1 
ATOM   7875  N  NH1 . ARG F 1 95  ? 18.772 -17.235 1.373   1.00 64.44 ? 179 ARG F NH1 1 
ATOM   7876  N  NH2 . ARG F 1 95  ? 17.572 -18.260 3.048   1.00 68.81 ? 179 ARG F NH2 1 
ATOM   7877  N  N   . CYS F 1 96  ? 23.754 -14.524 7.839   1.00 48.63 ? 180 CYS F N   1 
ATOM   7878  C  CA  . CYS F 1 96  ? 24.017 -14.528 9.298   1.00 49.55 ? 180 CYS F CA  1 
ATOM   7879  C  C   . CYS F 1 96  ? 25.068 -13.554 9.793   1.00 47.52 ? 180 CYS F C   1 
ATOM   7880  O  O   . CYS F 1 96  ? 25.335 -13.573 10.991  1.00 47.33 ? 180 CYS F O   1 
ATOM   7881  C  CB  . CYS F 1 96  ? 24.445 -15.902 9.850   1.00 49.92 ? 180 CYS F CB  1 
ATOM   7882  S  SG  . CYS F 1 96  ? 23.567 -17.276 9.201   1.00 58.66 ? 180 CYS F SG  1 
ATOM   7883  N  N   . GLY F 1 97  ? 25.701 -12.762 8.915   1.00 45.68 ? 181 GLY F N   1 
ATOM   7884  C  CA  . GLY F 1 97  ? 26.716 -11.812 9.383   1.00 43.61 ? 181 GLY F CA  1 
ATOM   7885  C  C   . GLY F 1 97  ? 27.815 -12.612 10.070  1.00 42.07 ? 181 GLY F C   1 
ATOM   7886  O  O   . GLY F 1 97  ? 28.194 -12.359 11.184  1.00 41.55 ? 181 GLY F O   1 
ATOM   7887  N  N   . VAL F 1 98  ? 28.255 -13.631 9.391   1.00 40.95 ? 182 VAL F N   1 
ATOM   7888  C  CA  . VAL F 1 98  ? 29.276 -14.499 9.855   1.00 41.75 ? 182 VAL F CA  1 
ATOM   7889  C  C   . VAL F 1 98  ? 30.639 -13.785 9.706   1.00 40.77 ? 182 VAL F C   1 
ATOM   7890  O  O   . VAL F 1 98  ? 31.588 -14.082 10.402  1.00 40.09 ? 182 VAL F O   1 
ATOM   7891  C  CB  . VAL F 1 98  ? 29.204 -15.787 8.955   1.00 42.31 ? 182 VAL F CB  1 
ATOM   7892  C  CG1 . VAL F 1 98  ? 30.352 -16.689 9.152   1.00 43.04 ? 182 VAL F CG1 1 
ATOM   7893  C  CG2 . VAL F 1 98  ? 27.972 -16.552 9.283   1.00 44.92 ? 182 VAL F CG2 1 
ATOM   7894  N  N   . PHE F 1 99  ? 30.724 -12.864 8.752   1.00 39.92 ? 183 PHE F N   1 
ATOM   7895  C  CA  . PHE F 1 99  ? 31.972 -12.165 8.440   1.00 38.07 ? 183 PHE F CA  1 
ATOM   7896  C  C   . PHE F 1 99  ? 32.068 -10.877 9.270   1.00 38.69 ? 183 PHE F C   1 
ATOM   7897  O  O   . PHE F 1 99  ? 31.586 -9.820  8.876   1.00 39.65 ? 183 PHE F O   1 
ATOM   7898  C  CB  . PHE F 1 99  ? 31.993 -11.847 6.943   1.00 36.03 ? 183 PHE F CB  1 
ATOM   7899  C  CG  . PHE F 1 99  ? 32.124 -13.052 6.057   1.00 32.94 ? 183 PHE F CG  1 
ATOM   7900  C  CD1 . PHE F 1 99  ? 31.197 -13.296 5.045   1.00 36.35 ? 183 PHE F CD1 1 
ATOM   7901  C  CD2 . PHE F 1 99  ? 33.165 -13.930 6.207   1.00 30.44 ? 183 PHE F CD2 1 
ATOM   7902  C  CE1 . PHE F 1 99  ? 31.315 -14.417 4.185   1.00 34.43 ? 183 PHE F CE1 1 
ATOM   7903  C  CE2 . PHE F 1 99  ? 33.291 -15.057 5.390   1.00 29.48 ? 183 PHE F CE2 1 
ATOM   7904  C  CZ  . PHE F 1 99  ? 32.369 -15.309 4.381   1.00 32.19 ? 183 PHE F CZ  1 
ATOM   7905  N  N   . ARG F 1 100 ? 32.622 -10.961 10.452  1.00 38.81 ? 184 ARG F N   1 
ATOM   7906  C  CA  . ARG F 1 100 ? 32.880 -9.745  11.201  1.00 39.13 ? 184 ARG F CA  1 
ATOM   7907  C  C   . ARG F 1 100 ? 34.076 -8.972  10.671  1.00 37.46 ? 184 ARG F C   1 
ATOM   7908  O  O   . ARG F 1 100 ? 34.232 -7.823  10.977  1.00 38.12 ? 184 ARG F O   1 
ATOM   7909  C  CB  . ARG F 1 100 ? 33.152 -10.083 12.653  1.00 40.27 ? 184 ARG F CB  1 
ATOM   7910  C  CG  . ARG F 1 100 ? 32.982 -8.912  13.641  1.00 44.31 ? 184 ARG F CG  1 
ATOM   7911  C  CD  . ARG F 1 100 ? 34.378 -8.394  14.032  1.00 49.32 ? 184 ARG F CD  1 
ATOM   7912  N  NE  . ARG F 1 100 ? 34.397 -7.088  14.676  1.00 51.35 ? 184 ARG F NE  1 
ATOM   7913  C  CZ  . ARG F 1 100 ? 35.466 -6.639  15.322  1.00 56.07 ? 184 ARG F CZ  1 
ATOM   7914  N  NH1 . ARG F 1 100 ? 35.445 -5.445  15.926  1.00 55.59 ? 184 ARG F NH1 1 
ATOM   7915  N  NH2 . ARG F 1 100 ? 36.560 -7.414  15.376  1.00 56.76 ? 184 ARG F NH2 1 
ATOM   7916  N  N   . ALA F 1 101 ? 34.960 -9.592  9.924   1.00 35.03 ? 185 ALA F N   1 
ATOM   7917  C  CA  . ALA F 1 101 ? 36.093 -8.852  9.440   1.00 32.80 ? 185 ALA F CA  1 
ATOM   7918  C  C   . ALA F 1 101 ? 36.163 -9.072  7.925   1.00 31.29 ? 185 ALA F C   1 
ATOM   7919  O  O   . ALA F 1 101 ? 35.687 -10.050 7.446   1.00 32.12 ? 185 ALA F O   1 
ATOM   7920  C  CB  . ALA F 1 101 ? 37.298 -9.321  10.124  1.00 32.65 ? 185 ALA F CB  1 
ATOM   7921  N  N   . ARG F 1 102 ? 36.705 -8.140  7.177   1.00 29.78 ? 186 ARG F N   1 
ATOM   7922  C  CA  . ARG F 1 102 ? 36.812 -8.211  5.694   1.00 28.39 ? 186 ARG F CA  1 
ATOM   7923  C  C   . ARG F 1 102 ? 38.141 -7.562  5.253   1.00 28.40 ? 186 ARG F C   1 
ATOM   7924  O  O   . ARG F 1 102 ? 38.470 -6.469  5.667   1.00 28.50 ? 186 ARG F O   1 
ATOM   7925  C  CB  . ARG F 1 102 ? 35.662 -7.459  5.047   1.00 27.06 ? 186 ARG F CB  1 
ATOM   7926  C  CG  . ARG F 1 102 ? 34.290 -8.031  5.337   1.00 29.23 ? 186 ARG F CG  1 
ATOM   7927  C  CD  . ARG F 1 102 ? 33.234 -7.349  4.521   1.00 32.76 ? 186 ARG F CD  1 
ATOM   7928  N  NE  . ARG F 1 102 ? 31.882 -7.485  5.073   1.00 39.81 ? 186 ARG F NE  1 
ATOM   7929  C  CZ  . ARG F 1 102 ? 30.752 -7.136  4.443   1.00 38.94 ? 186 ARG F CZ  1 
ATOM   7930  N  NH1 . ARG F 1 102 ? 30.775 -6.655  3.209   1.00 42.89 ? 186 ARG F NH1 1 
ATOM   7931  N  NH2 . ARG F 1 102 ? 29.587 -7.325  5.025   1.00 35.10 ? 186 ARG F NH2 1 
ATOM   7932  N  N   . LEU F 1 103 ? 38.906 -8.254  4.432   1.00 28.19 ? 187 LEU F N   1 
ATOM   7933  C  CA  . LEU F 1 103 ? 40.167 -7.768  3.904   1.00 26.91 ? 187 LEU F CA  1 
ATOM   7934  C  C   . LEU F 1 103 ? 40.071 -7.893  2.430   1.00 26.87 ? 187 LEU F C   1 
ATOM   7935  O  O   . LEU F 1 103 ? 39.462 -8.827  1.949   1.00 26.01 ? 187 LEU F O   1 
ATOM   7936  C  CB  . LEU F 1 103 ? 41.298 -8.622  4.417   1.00 26.72 ? 187 LEU F CB  1 
ATOM   7937  C  CG  . LEU F 1 103 ? 41.374 -8.759  5.943   1.00 27.89 ? 187 LEU F CG  1 
ATOM   7938  C  CD1 . LEU F 1 103 ? 42.317 -9.874  6.339   1.00 25.41 ? 187 LEU F CD1 1 
ATOM   7939  C  CD2 . LEU F 1 103 ? 41.859 -7.442  6.524   1.00 27.42 ? 187 LEU F CD2 1 
ATOM   7940  N  N   . PHE F 1 104 ? 40.653 -6.943  1.690   1.00 28.29 ? 188 PHE F N   1 
ATOM   7941  C  CA  . PHE F 1 104 ? 40.514 -6.924  0.209   1.00 28.70 ? 188 PHE F CA  1 
ATOM   7942  C  C   . PHE F 1 104 ? 41.857 -6.904  -0.539  1.00 28.61 ? 188 PHE F C   1 
ATOM   7943  O  O   . PHE F 1 104 ? 42.874 -7.323  -0.022  1.00 28.12 ? 188 PHE F O   1 
ATOM   7944  C  CB  . PHE F 1 104 ? 39.616 -5.774  -0.282  1.00 28.84 ? 188 PHE F CB  1 
ATOM   7945  C  CG  . PHE F 1 104 ? 38.367 -5.615  0.483   1.00 28.81 ? 188 PHE F CG  1 
ATOM   7946  C  CD1 . PHE F 1 104 ? 38.342 -4.813  1.637   1.00 29.81 ? 188 PHE F CD1 1 
ATOM   7947  C  CD2 . PHE F 1 104 ? 37.205 -6.265  0.077   1.00 29.22 ? 188 PHE F CD2 1 
ATOM   7948  C  CE1 . PHE F 1 104 ? 37.147 -4.672  2.422   1.00 32.61 ? 188 PHE F CE1 1 
ATOM   7949  C  CE2 . PHE F 1 104 ? 36.014 -6.142  0.833   1.00 32.94 ? 188 PHE F CE2 1 
ATOM   7950  C  CZ  . PHE F 1 104 ? 35.977 -5.335  2.017   1.00 29.18 ? 188 PHE F CZ  1 
ATOM   7951  N  N   . ARG F 1 105 ? 41.836 -6.417  -1.766  1.00 30.01 ? 189 ARG F N   1 
ATOM   7952  C  CA  . ARG F 1 105 ? 43.019 -6.424  -2.576  1.00 32.48 ? 189 ARG F CA  1 
ATOM   7953  C  C   . ARG F 1 105 ? 44.206 -5.824  -1.839  1.00 33.22 ? 189 ARG F C   1 
ATOM   7954  O  O   . ARG F 1 105 ? 45.222 -6.472  -1.725  1.00 33.85 ? 189 ARG F O   1 
ATOM   7955  C  CB  . ARG F 1 105 ? 42.803 -5.764  -3.917  1.00 32.58 ? 189 ARG F CB  1 
ATOM   7956  C  CG  . ARG F 1 105 ? 43.922 -6.049  -4.865  1.00 33.16 ? 189 ARG F CG  1 
ATOM   7957  C  CD  . ARG F 1 105 ? 43.320 -6.603  -6.118  1.00 35.81 ? 189 ARG F CD  1 
ATOM   7958  N  NE  . ARG F 1 105 ? 43.103 -5.567  -7.086  1.00 40.66 ? 189 ARG F NE  1 
ATOM   7959  C  CZ  . ARG F 1 105 ? 42.227 -5.654  -8.075  1.00 44.12 ? 189 ARG F CZ  1 
ATOM   7960  N  NH1 . ARG F 1 105 ? 41.449 -6.729  -8.198  1.00 42.60 ? 189 ARG F NH1 1 
ATOM   7961  N  NH2 . ARG F 1 105 ? 42.114 -4.632  -8.924  1.00 47.54 ? 189 ARG F NH2 1 
ATOM   7962  N  N   . GLU F 1 106 ? 44.044 -4.656  -1.241  1.00 34.24 ? 190 GLU F N   1 
ATOM   7963  C  CA  . GLU F 1 106 ? 45.151 -4.023  -0.496  1.00 35.25 ? 190 GLU F CA  1 
ATOM   7964  C  C   . GLU F 1 106 ? 45.749 -4.874  0.632   1.00 35.02 ? 190 GLU F C   1 
ATOM   7965  O  O   . GLU F 1 106 ? 46.839 -4.635  1.065   1.00 34.73 ? 190 GLU F O   1 
ATOM   7966  C  CB  . GLU F 1 106 ? 44.701 -2.664  0.040   1.00 35.42 ? 190 GLU F CB  1 
ATOM   7967  C  CG  . GLU F 1 106 ? 44.073 -1.747  -1.054  1.00 41.23 ? 190 GLU F CG  1 
ATOM   7968  C  CD  . GLU F 1 106 ? 42.687 -2.277  -1.460  1.00 49.70 ? 190 GLU F CD  1 
ATOM   7969  O  OE1 . GLU F 1 106 ? 42.512 -2.579  -2.646  1.00 54.55 ? 190 GLU F OE1 1 
ATOM   7970  O  OE2 . GLU F 1 106 ? 41.800 -2.479  -0.593  1.00 50.19 ? 190 GLU F OE2 1 
ATOM   7971  N  N   . SER F 1 107 ? 45.026 -5.852  1.150   1.00 35.50 ? 191 SER F N   1 
ATOM   7972  C  CA  . SER F 1 107 ? 45.610 -6.716  2.159   1.00 35.28 ? 191 SER F CA  1 
ATOM   7973  C  C   . SER F 1 107 ? 46.399 -7.937  1.587   1.00 35.31 ? 191 SER F C   1 
ATOM   7974  O  O   . SER F 1 107 ? 47.126 -8.632  2.333   1.00 34.35 ? 191 SER F O   1 
ATOM   7975  C  CB  . SER F 1 107 ? 44.514 -7.179  3.054   1.00 35.33 ? 191 SER F CB  1 
ATOM   7976  O  OG  . SER F 1 107 ? 43.983 -6.085  3.748   1.00 37.57 ? 191 SER F OG  1 
ATOM   7977  N  N   . CYS F 1 108 ? 46.240 -8.199  0.283   1.00 34.36 ? 192 CYS F N   1 
ATOM   7978  C  CA  . CYS F 1 108 ? 47.054 -9.206  -0.377  1.00 35.49 ? 192 CYS F CA  1 
ATOM   7979  C  C   . CYS F 1 108 ? 48.395 -8.571  -0.694  1.00 34.44 ? 192 CYS F C   1 
ATOM   7980  O  O   . CYS F 1 108 ? 48.484 -7.367  -0.704  1.00 34.92 ? 192 CYS F O   1 
ATOM   7981  C  CB  . CYS F 1 108 ? 46.379 -9.720  -1.644  1.00 34.93 ? 192 CYS F CB  1 
ATOM   7982  S  SG  . CYS F 1 108 ? 44.679 -10.267 -1.334  1.00 40.33 ? 192 CYS F SG  1 
ATOM   7983  N  N   . VAL F 1 109 ? 49.439 -9.364  -0.896  1.00 34.09 ? 193 VAL F N   1 
ATOM   7984  C  CA  . VAL F 1 109 ? 50.639 -8.858  -1.535  1.00 34.02 ? 193 VAL F CA  1 
ATOM   7985  C  C   . VAL F 1 109 ? 50.730 -9.383  -2.919  1.00 34.41 ? 193 VAL F C   1 
ATOM   7986  O  O   . VAL F 1 109 ? 50.673 -10.563 -3.111  1.00 36.08 ? 193 VAL F O   1 
ATOM   7987  C  CB  . VAL F 1 109 ? 51.973 -9.104  -0.697  1.00 35.38 ? 193 VAL F CB  1 
ATOM   7988  C  CG1 . VAL F 1 109 ? 51.748 -9.866  0.581   1.00 34.07 ? 193 VAL F CG1 1 
ATOM   7989  C  CG2 . VAL F 1 109 ? 53.147 -9.643  -1.538  1.00 33.33 ? 193 VAL F CG2 1 
ATOM   7990  N  N   . PHE F 1 110 ? 50.823 -8.515  -3.902  1.00 34.63 ? 194 PHE F N   1 
ATOM   7991  C  CA  . PHE F 1 110 ? 51.117 -8.937  -5.258  1.00 36.13 ? 194 PHE F CA  1 
ATOM   7992  C  C   . PHE F 1 110 ? 52.453 -9.741  -5.306  1.00 36.76 ? 194 PHE F C   1 
ATOM   7993  O  O   . PHE F 1 110 ? 53.491 -9.224  -4.960  1.00 36.77 ? 194 PHE F O   1 
ATOM   7994  C  CB  . PHE F 1 110 ? 51.272 -7.686  -6.102  1.00 36.28 ? 194 PHE F CB  1 
ATOM   7995  C  CG  . PHE F 1 110 ? 51.269 -7.933  -7.593  1.00 37.21 ? 194 PHE F CG  1 
ATOM   7996  C  CD1 . PHE F 1 110 ? 50.187 -8.562  -8.209  1.00 39.47 ? 194 PHE F CD1 1 
ATOM   7997  C  CD2 . PHE F 1 110 ? 52.330 -7.497  -8.373  1.00 39.72 ? 194 PHE F CD2 1 
ATOM   7998  C  CE1 . PHE F 1 110 ? 50.151 -8.753  -9.586  1.00 41.49 ? 194 PHE F CE1 1 
ATOM   7999  C  CE2 . PHE F 1 110 ? 52.335 -7.672  -9.750  1.00 41.84 ? 194 PHE F CE2 1 
ATOM   8000  C  CZ  . PHE F 1 110 ? 51.226 -8.302  -10.367 1.00 43.12 ? 194 PHE F CZ  1 
ATOM   8001  N  N   . HIS F 1 111 ? 52.415 -10.992 -5.748  1.00 38.18 ? 195 HIS F N   1 
ATOM   8002  C  CA  . HIS F 1 111 ? 53.597 -11.848 -5.804  1.00 39.15 ? 195 HIS F CA  1 
ATOM   8003  C  C   . HIS F 1 111 ? 53.607 -12.666 -7.065  1.00 39.58 ? 195 HIS F C   1 
ATOM   8004  O  O   . HIS F 1 111 ? 52.730 -13.479 -7.285  1.00 39.85 ? 195 HIS F O   1 
ATOM   8005  C  CB  . HIS F 1 111 ? 53.589 -12.729 -4.575  1.00 39.46 ? 195 HIS F CB  1 
ATOM   8006  C  CG  . HIS F 1 111 ? 54.673 -13.749 -4.547  1.00 43.41 ? 195 HIS F CG  1 
ATOM   8007  N  ND1 . HIS F 1 111 ? 54.481 -15.049 -4.973  1.00 45.53 ? 195 HIS F ND1 1 
ATOM   8008  C  CD2 . HIS F 1 111 ? 55.944 -13.683 -4.083  1.00 44.45 ? 195 HIS F CD2 1 
ATOM   8009  C  CE1 . HIS F 1 111 ? 55.594 -15.732 -4.787  1.00 45.96 ? 195 HIS F CE1 1 
ATOM   8010  N  NE2 . HIS F 1 111 ? 56.488 -14.932 -4.230  1.00 46.38 ? 195 HIS F NE2 1 
ATOM   8011  N  N   . GLN F 1 112 ? 54.607 -12.430 -7.909  1.00 42.14 ? 196 GLN F N   1 
ATOM   8012  C  CA  . GLN F 1 112 ? 54.751 -13.057 -9.251  1.00 42.95 ? 196 GLN F CA  1 
ATOM   8013  C  C   . GLN F 1 112 ? 53.415 -13.305 -9.934  1.00 44.50 ? 196 GLN F C   1 
ATOM   8014  O  O   . GLN F 1 112 ? 52.978 -14.463 -10.109 1.00 44.51 ? 196 GLN F O   1 
ATOM   8015  C  CB  . GLN F 1 112 ? 55.587 -14.315 -9.242  1.00 43.33 ? 196 GLN F CB  1 
ATOM   8016  C  CG  . GLN F 1 112 ? 56.085 -14.744 -7.917  1.00 45.90 ? 196 GLN F CG  1 
ATOM   8017  C  CD  . GLN F 1 112 ? 57.304 -15.652 -7.973  1.00 48.63 ? 196 GLN F CD  1 
ATOM   8018  O  OE1 . GLN F 1 112 ? 58.454 -15.188 -8.087  1.00 48.04 ? 196 GLN F OE1 1 
ATOM   8019  N  NE2 . GLN F 1 112 ? 57.059 -16.960 -7.826  1.00 49.87 ? 196 GLN F NE2 1 
ATOM   8020  N  N   . GLY F 1 113 ? 52.760 -12.196 -10.256 1.00 44.10 ? 197 GLY F N   1 
ATOM   8021  C  CA  . GLY F 1 113 ? 51.544 -12.228 -10.959 1.00 45.60 ? 197 GLY F CA  1 
ATOM   8022  C  C   . GLY F 1 113 ? 50.240 -12.362 -10.198 1.00 46.27 ? 197 GLY F C   1 
ATOM   8023  O  O   . GLY F 1 113 ? 49.226 -11.938 -10.715 1.00 45.29 ? 197 GLY F O   1 
ATOM   8024  N  N   . CYS F 1 114 ? 50.265 -12.954 -9.005  1.00 47.43 ? 198 CYS F N   1 
ATOM   8025  C  CA  . CYS F 1 114 ? 49.035 -13.175 -8.227  1.00 48.64 ? 198 CYS F CA  1 
ATOM   8026  C  C   . CYS F 1 114 ? 49.030 -12.395 -6.954  1.00 47.90 ? 198 CYS F C   1 
ATOM   8027  O  O   . CYS F 1 114 ? 50.110 -12.015 -6.454  1.00 48.55 ? 198 CYS F O   1 
ATOM   8028  C  CB  . CYS F 1 114 ? 48.843 -14.647 -7.842  1.00 48.77 ? 198 CYS F CB  1 
ATOM   8029  S  SG  . CYS F 1 114 ? 49.645 -15.779 -9.006  1.00 56.75 ? 198 CYS F SG  1 
ATOM   8030  N  N   . TYR F 1 115 ? 47.809 -12.206 -6.414  1.00 46.62 ? 199 TYR F N   1 
ATOM   8031  C  CA  . TYR F 1 115 ? 47.583 -11.673 -5.070  1.00 43.58 ? 199 TYR F CA  1 
ATOM   8032  C  C   . TYR F 1 115 ? 47.614 -12.743 -3.997  1.00 43.07 ? 199 TYR F C   1 
ATOM   8033  O  O   . TYR F 1 115 ? 46.708 -13.518 -3.803  1.00 43.79 ? 199 TYR F O   1 
ATOM   8034  C  CB  . TYR F 1 115 ? 46.313 -10.799 -4.998  1.00 43.78 ? 199 TYR F CB  1 
ATOM   8035  C  CG  . TYR F 1 115 ? 46.445 -9.505  -5.789  1.00 41.37 ? 199 TYR F CG  1 
ATOM   8036  C  CD1 . TYR F 1 115 ? 45.831 -9.391  -7.027  1.00 41.46 ? 199 TYR F CD1 1 
ATOM   8037  C  CD2 . TYR F 1 115 ? 47.246 -8.450  -5.339  1.00 39.02 ? 199 TYR F CD2 1 
ATOM   8038  C  CE1 . TYR F 1 115 ? 45.973 -8.280  -7.783  1.00 41.43 ? 199 TYR F CE1 1 
ATOM   8039  C  CE2 . TYR F 1 115 ? 47.430 -7.312  -6.111  1.00 38.67 ? 199 TYR F CE2 1 
ATOM   8040  C  CZ  . TYR F 1 115 ? 46.763 -7.237  -7.339  1.00 43.01 ? 199 TYR F CZ  1 
ATOM   8041  O  OH  . TYR F 1 115 ? 46.845 -6.141  -8.173  1.00 44.68 ? 199 TYR F OH  1 
ATOM   8042  N  N   . VAL F 1 116 ? 48.695 -12.759 -3.268  1.00 41.61 ? 200 VAL F N   1 
ATOM   8043  C  CA  . VAL F 1 116 ? 48.929 -13.771 -2.295  1.00 40.32 ? 200 VAL F CA  1 
ATOM   8044  C  C   . VAL F 1 116 ? 48.263 -13.431 -0.976  1.00 40.52 ? 200 VAL F C   1 
ATOM   8045  O  O   . VAL F 1 116 ? 48.243 -12.305 -0.567  1.00 41.13 ? 200 VAL F O   1 
ATOM   8046  C  CB  . VAL F 1 116 ? 50.441 -13.923 -2.151  1.00 39.40 ? 200 VAL F CB  1 
ATOM   8047  C  CG1 . VAL F 1 116 ? 50.799 -14.474 -0.886  1.00 38.44 ? 200 VAL F CG1 1 
ATOM   8048  C  CG2 . VAL F 1 116 ? 50.937 -14.817 -3.260  1.00 41.73 ? 200 VAL F CG2 1 
ATOM   8049  N  N   . LYS F 1 117 ? 47.728 -14.424 -0.305  1.00 40.99 ? 201 LYS F N   1 
ATOM   8050  C  CA  . LYS F 1 117 ? 47.139 -14.256 0.966   1.00 41.63 ? 201 LYS F CA  1 
ATOM   8051  C  C   . LYS F 1 117 ? 48.078 -14.759 2.044   1.00 43.29 ? 201 LYS F C   1 
ATOM   8052  O  O   . LYS F 1 117 ? 48.026 -15.906 2.462   1.00 43.63 ? 201 LYS F O   1 
ATOM   8053  C  CB  . LYS F 1 117 ? 45.786 -14.956 1.006   1.00 41.24 ? 201 LYS F CB  1 
ATOM   8054  C  CG  . LYS F 1 117 ? 44.693 -14.060 0.543   1.00 40.42 ? 201 LYS F CG  1 
ATOM   8055  C  CD  . LYS F 1 117 ? 43.559 -14.791 0.029   1.00 39.50 ? 201 LYS F CD  1 
ATOM   8056  C  CE  . LYS F 1 117 ? 43.003 -14.092 -1.186  1.00 40.93 ? 201 LYS F CE  1 
ATOM   8057  N  NZ  . LYS F 1 117 ? 42.217 -15.049 -2.061  1.00 44.38 ? 201 LYS F NZ  1 
ATOM   8058  N  N   . ASP F 1 118 ? 48.922 -13.860 2.521   1.00 44.79 ? 202 ASP F N   1 
ATOM   8059  C  CA  . ASP F 1 118 ? 49.916 -14.217 3.477   1.00 45.68 ? 202 ASP F CA  1 
ATOM   8060  C  C   . ASP F 1 118 ? 49.419 -14.197 4.886   1.00 45.37 ? 202 ASP F C   1 
ATOM   8061  O  O   . ASP F 1 118 ? 49.183 -13.140 5.466   1.00 45.71 ? 202 ASP F O   1 
ATOM   8062  C  CB  . ASP F 1 118 ? 51.116 -13.276 3.395   1.00 46.93 ? 202 ASP F CB  1 
ATOM   8063  C  CG  . ASP F 1 118 ? 52.305 -13.793 4.209   1.00 47.98 ? 202 ASP F CG  1 
ATOM   8064  O  OD1 . ASP F 1 118 ? 52.150 -14.186 5.401   1.00 47.21 ? 202 ASP F OD1 1 
ATOM   8065  O  OD2 . ASP F 1 118 ? 53.385 -13.824 3.611   1.00 51.57 ? 202 ASP F OD2 1 
ATOM   8066  N  N   . LEU F 1 119 ? 49.372 -15.372 5.475   1.00 44.74 ? 203 LEU F N   1 
ATOM   8067  C  CA  . LEU F 1 119 ? 48.900 -15.509 6.845   1.00 44.67 ? 203 LEU F CA  1 
ATOM   8068  C  C   . LEU F 1 119 ? 49.889 -15.172 7.990   1.00 45.23 ? 203 LEU F C   1 
ATOM   8069  O  O   . LEU F 1 119 ? 49.468 -15.158 9.148   1.00 45.00 ? 203 LEU F O   1 
ATOM   8070  C  CB  . LEU F 1 119 ? 48.292 -16.913 7.020   1.00 44.01 ? 203 LEU F CB  1 
ATOM   8071  C  CG  . LEU F 1 119 ? 47.550 -17.423 5.783   1.00 39.64 ? 203 LEU F CG  1 
ATOM   8072  C  CD1 . LEU F 1 119 ? 47.262 -18.900 5.930   1.00 40.94 ? 203 LEU F CD1 1 
ATOM   8073  C  CD2 . LEU F 1 119 ? 46.298 -16.697 5.676   1.00 36.14 ? 203 LEU F CD2 1 
ATOM   8074  N  N   . SER F 1 120 ? 51.174 -14.889 7.708   1.00 46.06 ? 204 SER F N   1 
ATOM   8075  C  CA  . SER F 1 120 ? 52.075 -14.362 8.804   1.00 46.79 ? 204 SER F CA  1 
ATOM   8076  C  C   . SER F 1 120 ? 51.697 -12.947 9.259   1.00 47.72 ? 204 SER F C   1 
ATOM   8077  O  O   . SER F 1 120 ? 51.968 -12.550 10.386  1.00 47.25 ? 204 SER F O   1 
ATOM   8078  C  CB  . SER F 1 120 ? 53.555 -14.347 8.397   1.00 46.80 ? 204 SER F CB  1 
ATOM   8079  O  OG  . SER F 1 120 ? 53.719 -14.209 6.988   1.00 48.17 ? 204 SER F OG  1 
ATOM   8080  N  N   . ARG F 1 121 ? 51.077 -12.187 8.350   1.00 48.59 ? 205 ARG F N   1 
ATOM   8081  C  CA  . ARG F 1 121 ? 50.679 -10.797 8.600   1.00 49.52 ? 205 ARG F CA  1 
ATOM   8082  C  C   . ARG F 1 121 ? 49.325 -10.684 9.287   1.00 47.49 ? 205 ARG F C   1 
ATOM   8083  O  O   . ARG F 1 121 ? 48.872 -9.614  9.601   1.00 47.19 ? 205 ARG F O   1 
ATOM   8084  C  CB  . ARG F 1 121 ? 50.587 -10.090 7.245   1.00 49.87 ? 205 ARG F CB  1 
ATOM   8085  C  CG  . ARG F 1 121 ? 51.742 -9.100  6.926   1.00 54.14 ? 205 ARG F CG  1 
ATOM   8086  C  CD  . ARG F 1 121 ? 51.832 -8.784  5.392   1.00 53.86 ? 205 ARG F CD  1 
ATOM   8087  N  NE  . ARG F 1 121 ? 50.576 -8.356  4.740   1.00 60.51 ? 205 ARG F NE  1 
ATOM   8088  C  CZ  . ARG F 1 121 ? 50.448 -7.249  3.984   1.00 64.59 ? 205 ARG F CZ  1 
ATOM   8089  N  NH1 . ARG F 1 121 ? 49.286 -6.928  3.405   1.00 64.62 ? 205 ARG F NH1 1 
ATOM   8090  N  NH2 . ARG F 1 121 ? 51.485 -6.437  3.796   1.00 67.35 ? 205 ARG F NH2 1 
ATOM   8091  N  N   . LEU F 1 122 ? 48.653 -11.800 9.490   1.00 46.49 ? 206 LEU F N   1 
ATOM   8092  C  CA  . LEU F 1 122 ? 47.226 -11.777 9.789   1.00 45.30 ? 206 LEU F CA  1 
ATOM   8093  C  C   . LEU F 1 122 ? 46.844 -11.380 11.213  1.00 44.03 ? 206 LEU F C   1 
ATOM   8094  O  O   . LEU F 1 122 ? 45.907 -10.646 11.399  1.00 42.39 ? 206 LEU F O   1 
ATOM   8095  C  CB  . LEU F 1 122 ? 46.637 -13.124 9.439   1.00 45.30 ? 206 LEU F CB  1 
ATOM   8096  C  CG  . LEU F 1 122 ? 45.198 -13.135 9.036   1.00 44.12 ? 206 LEU F CG  1 
ATOM   8097  C  CD1 . LEU F 1 122 ? 45.039 -12.563 7.641   1.00 42.06 ? 206 LEU F CD1 1 
ATOM   8098  C  CD2 . LEU F 1 122 ? 44.778 -14.600 9.127   1.00 46.37 ? 206 LEU F CD2 1 
ATOM   8099  N  N   . GLY F 1 123 ? 47.579 -11.874 12.203  1.00 43.92 ? 207 GLY F N   1 
ATOM   8100  C  CA  . GLY F 1 123 ? 47.487 -11.369 13.572  1.00 43.59 ? 207 GLY F CA  1 
ATOM   8101  C  C   . GLY F 1 123 ? 46.888 -12.443 14.421  1.00 44.05 ? 207 GLY F C   1 
ATOM   8102  O  O   . GLY F 1 123 ? 46.426 -12.201 15.532  1.00 44.72 ? 207 GLY F O   1 
ATOM   8103  N  N   . ARG F 1 124 ? 46.840 -13.628 13.844  1.00 44.27 ? 208 ARG F N   1 
ATOM   8104  C  CA  . ARG F 1 124 ? 46.267 -14.775 14.473  1.00 45.08 ? 208 ARG F CA  1 
ATOM   8105  C  C   . ARG F 1 124 ? 47.402 -15.785 14.497  1.00 45.53 ? 208 ARG F C   1 
ATOM   8106  O  O   . ARG F 1 124 ? 48.243 -15.812 13.594  1.00 45.63 ? 208 ARG F O   1 
ATOM   8107  C  CB  . ARG F 1 124 ? 45.128 -15.350 13.620  1.00 44.29 ? 208 ARG F CB  1 
ATOM   8108  C  CG  . ARG F 1 124 ? 43.827 -14.532 13.480  1.00 46.19 ? 208 ARG F CG  1 
ATOM   8109  C  CD  . ARG F 1 124 ? 42.933 -14.330 14.713  1.00 44.80 ? 208 ARG F CD  1 
ATOM   8110  N  NE  . ARG F 1 124 ? 43.241 -13.029 15.284  1.00 48.27 ? 208 ARG F NE  1 
ATOM   8111  C  CZ  . ARG F 1 124 ? 42.465 -11.939 15.332  1.00 46.69 ? 208 ARG F CZ  1 
ATOM   8112  N  NH1 . ARG F 1 124 ? 41.217 -11.896 14.891  1.00 41.76 ? 208 ARG F NH1 1 
ATOM   8113  N  NH2 . ARG F 1 124 ? 42.992 -10.853 15.866  1.00 48.45 ? 208 ARG F NH2 1 
ATOM   8114  N  N   . ASP F 1 125 ? 47.395 -16.635 15.508  1.00 46.73 ? 209 ASP F N   1 
ATOM   8115  C  CA  . ASP F 1 125 ? 48.379 -17.695 15.686  1.00 48.11 ? 209 ASP F CA  1 
ATOM   8116  C  C   . ASP F 1 125 ? 48.226 -18.644 14.522  1.00 47.60 ? 209 ASP F C   1 
ATOM   8117  O  O   . ASP F 1 125 ? 47.122 -18.984 14.158  1.00 47.64 ? 209 ASP F O   1 
ATOM   8118  C  CB  . ASP F 1 125 ? 48.121 -18.350 17.054  1.00 49.02 ? 209 ASP F CB  1 
ATOM   8119  C  CG  . ASP F 1 125 ? 48.992 -19.579 17.348  1.00 53.03 ? 209 ASP F CG  1 
ATOM   8120  O  OD1 . ASP F 1 125 ? 49.430 -20.323 16.411  1.00 57.30 ? 209 ASP F OD1 1 
ATOM   8121  O  OD2 . ASP F 1 125 ? 49.183 -19.847 18.570  1.00 55.64 ? 209 ASP F OD2 1 
ATOM   8122  N  N   . LEU F 1 126 ? 49.352 -19.033 13.926  1.00 47.82 ? 210 LEU F N   1 
ATOM   8123  C  CA  . LEU F 1 126 ? 49.373 -19.858 12.724  1.00 48.18 ? 210 LEU F CA  1 
ATOM   8124  C  C   . LEU F 1 126 ? 48.899 -21.267 12.950  1.00 48.95 ? 210 LEU F C   1 
ATOM   8125  O  O   . LEU F 1 126 ? 48.484 -21.935 11.993  1.00 49.67 ? 210 LEU F O   1 
ATOM   8126  C  CB  . LEU F 1 126 ? 50.765 -19.886 12.071  1.00 47.63 ? 210 LEU F CB  1 
ATOM   8127  C  CG  . LEU F 1 126 ? 51.117 -18.917 10.917  1.00 48.26 ? 210 LEU F CG  1 
ATOM   8128  C  CD1 . LEU F 1 126 ? 52.368 -19.359 10.186  1.00 46.73 ? 210 LEU F CD1 1 
ATOM   8129  C  CD2 . LEU F 1 126 ? 49.977 -18.772 9.907   1.00 43.66 ? 210 LEU F CD2 1 
ATOM   8130  N  N   . ARG F 1 127 ? 48.992 -21.731 14.196  1.00 49.29 ? 211 ARG F N   1 
ATOM   8131  C  CA  . ARG F 1 127 ? 48.448 -23.024 14.596  1.00 49.98 ? 211 ARG F CA  1 
ATOM   8132  C  C   . ARG F 1 127 ? 46.899 -22.999 14.676  1.00 49.48 ? 211 ARG F C   1 
ATOM   8133  O  O   . ARG F 1 127 ? 46.240 -24.047 14.614  1.00 49.34 ? 211 ARG F O   1 
ATOM   8134  C  CB  . ARG F 1 127 ? 49.018 -23.398 15.959  1.00 51.00 ? 211 ARG F CB  1 
ATOM   8135  C  CG  . ARG F 1 127 ? 50.399 -24.033 15.926  1.00 54.99 ? 211 ARG F CG  1 
ATOM   8136  C  CD  . ARG F 1 127 ? 51.344 -23.400 16.948  1.00 61.55 ? 211 ARG F CD  1 
ATOM   8137  N  NE  . ARG F 1 127 ? 51.025 -23.659 18.358  1.00 67.88 ? 211 ARG F NE  1 
ATOM   8138  C  CZ  . ARG F 1 127 ? 50.777 -22.720 19.288  1.00 71.30 ? 211 ARG F CZ  1 
ATOM   8139  N  NH1 . ARG F 1 127 ? 50.783 -21.419 18.988  1.00 69.62 ? 211 ARG F NH1 1 
ATOM   8140  N  NH2 . ARG F 1 127 ? 50.534 -23.090 20.548  1.00 72.62 ? 211 ARG F NH2 1 
ATOM   8141  N  N   . LYS F 1 128 ? 46.339 -21.792 14.810  1.00 47.93 ? 212 LYS F N   1 
ATOM   8142  C  CA  . LYS F 1 128 ? 44.911 -21.589 14.927  1.00 46.48 ? 212 LYS F CA  1 
ATOM   8143  C  C   . LYS F 1 128 ? 44.350 -20.796 13.755  1.00 44.80 ? 212 LYS F C   1 
ATOM   8144  O  O   . LYS F 1 128 ? 43.581 -19.849 13.970  1.00 44.76 ? 212 LYS F O   1 
ATOM   8145  C  CB  . LYS F 1 128 ? 44.612 -20.860 16.224  1.00 46.78 ? 212 LYS F CB  1 
ATOM   8146  C  CG  . LYS F 1 128 ? 45.149 -21.558 17.435  1.00 48.78 ? 212 LYS F CG  1 
ATOM   8147  C  CD  . LYS F 1 128 ? 44.158 -22.550 17.969  1.00 52.98 ? 212 LYS F CD  1 
ATOM   8148  C  CE  . LYS F 1 128 ? 43.267 -21.893 19.044  1.00 57.93 ? 212 LYS F CE  1 
ATOM   8149  N  NZ  . LYS F 1 128 ? 42.172 -22.802 19.486  1.00 59.22 ? 212 LYS F NZ  1 
ATOM   8150  N  N   . THR F 1 129 ? 44.705 -21.209 12.529  1.00 42.30 ? 213 THR F N   1 
ATOM   8151  C  CA  . THR F 1 129 ? 44.317 -20.497 11.305  1.00 39.80 ? 213 THR F CA  1 
ATOM   8152  C  C   . THR F 1 129 ? 44.159 -21.389 10.089  1.00 38.04 ? 213 THR F C   1 
ATOM   8153  O  O   . THR F 1 129 ? 45.038 -22.157 9.813   1.00 38.56 ? 213 THR F O   1 
ATOM   8154  C  CB  . THR F 1 129 ? 45.402 -19.426 10.943  1.00 39.44 ? 213 THR F CB  1 
ATOM   8155  O  OG1 . THR F 1 129 ? 45.375 -18.384 11.920  1.00 40.48 ? 213 THR F OG1 1 
ATOM   8156  C  CG2 . THR F 1 129 ? 45.159 -18.833 9.602   1.00 37.02 ? 213 THR F CG2 1 
ATOM   8157  N  N   . LEU F 1 130 ? 43.076 -21.238 9.335   1.00 36.19 ? 214 LEU F N   1 
ATOM   8158  C  CA  . LEU F 1 130 ? 42.864 -21.979 8.092   1.00 36.02 ? 214 LEU F CA  1 
ATOM   8159  C  C   . LEU F 1 130 ? 42.547 -21.094 6.934   1.00 36.27 ? 214 LEU F C   1 
ATOM   8160  O  O   . LEU F 1 130 ? 42.079 -19.976 7.128   1.00 36.96 ? 214 LEU F O   1 
ATOM   8161  C  CB  . LEU F 1 130 ? 41.665 -22.924 8.250   1.00 35.94 ? 214 LEU F CB  1 
ATOM   8162  C  CG  . LEU F 1 130 ? 41.978 -24.023 9.257   1.00 36.56 ? 214 LEU F CG  1 
ATOM   8163  C  CD1 . LEU F 1 130 ? 40.697 -24.600 9.727   1.00 32.71 ? 214 LEU F CD1 1 
ATOM   8164  C  CD2 . LEU F 1 130 ? 43.061 -25.067 8.612   1.00 29.97 ? 214 LEU F CD2 1 
ATOM   8165  N  N   . ILE F 1 131 ? 42.743 -21.594 5.728   1.00 36.15 ? 215 ILE F N   1 
ATOM   8166  C  CA  . ILE F 1 131 ? 42.363 -20.848 4.594   1.00 37.08 ? 215 ILE F CA  1 
ATOM   8167  C  C   . ILE F 1 131 ? 41.576 -21.687 3.615   1.00 38.62 ? 215 ILE F C   1 
ATOM   8168  O  O   . ILE F 1 131 ? 42.006 -22.785 3.250   1.00 39.43 ? 215 ILE F O   1 
ATOM   8169  C  CB  . ILE F 1 131 ? 43.551 -20.185 3.921   1.00 37.58 ? 215 ILE F CB  1 
ATOM   8170  C  CG1 . ILE F 1 131 ? 43.177 -19.653 2.510   1.00 39.77 ? 215 ILE F CG1 1 
ATOM   8171  C  CG2 . ILE F 1 131 ? 44.756 -21.105 3.837   1.00 36.45 ? 215 ILE F CG2 1 
ATOM   8172  C  CD1 . ILE F 1 131 ? 44.039 -18.388 2.053   1.00 38.11 ? 215 ILE F CD1 1 
ATOM   8173  N  N   . LEU F 1 132 ? 40.411 -21.170 3.217   1.00 38.69 ? 216 LEU F N   1 
ATOM   8174  C  CA  . LEU F 1 132 ? 39.633 -21.720 2.152   1.00 39.88 ? 216 LEU F CA  1 
ATOM   8175  C  C   . LEU F 1 132 ? 39.666 -20.827 0.893   1.00 40.22 ? 216 LEU F C   1 
ATOM   8176  O  O   . LEU F 1 132 ? 39.165 -19.724 0.909   1.00 41.67 ? 216 LEU F O   1 
ATOM   8177  C  CB  . LEU F 1 132 ? 38.199 -21.949 2.666   1.00 40.42 ? 216 LEU F CB  1 
ATOM   8178  C  CG  . LEU F 1 132 ? 37.159 -22.531 1.707   1.00 41.14 ? 216 LEU F CG  1 
ATOM   8179  C  CD1 . LEU F 1 132 ? 37.355 -23.983 1.763   1.00 45.07 ? 216 LEU F CD1 1 
ATOM   8180  C  CD2 . LEU F 1 132 ? 35.704 -22.202 2.076   1.00 41.03 ? 216 LEU F CD2 1 
ATOM   8181  N  N   . ASP F 1 133 ? 40.227 -21.296 -0.208  1.00 41.03 ? 217 ASP F N   1 
ATOM   8182  C  CA  . ASP F 1 133 ? 40.375 -20.471 -1.403  1.00 42.28 ? 217 ASP F CA  1 
ATOM   8183  C  C   . ASP F 1 133 ? 40.449 -21.452 -2.570  1.00 42.99 ? 217 ASP F C   1 
ATOM   8184  O  O   . ASP F 1 133 ? 41.138 -22.451 -2.484  1.00 43.58 ? 217 ASP F O   1 
ATOM   8185  C  CB  . ASP F 1 133 ? 41.703 -19.656 -1.309  1.00 42.07 ? 217 ASP F CB  1 
ATOM   8186  C  CG  . ASP F 1 133 ? 41.706 -18.343 -2.146  1.00 44.59 ? 217 ASP F CG  1 
ATOM   8187  O  OD1 . ASP F 1 133 ? 41.470 -18.324 -3.403  1.00 42.94 ? 217 ASP F OD1 1 
ATOM   8188  O  OD2 . ASP F 1 133 ? 42.009 -17.303 -1.513  1.00 46.36 ? 217 ASP F OD2 1 
ATOM   8189  N  N   . ASN F 1 134 ? 39.807 -21.165 -3.682  1.00 44.16 ? 218 ASN F N   1 
ATOM   8190  C  CA  . ASN F 1 134 ? 39.913 -22.075 -4.816  1.00 46.38 ? 218 ASN F CA  1 
ATOM   8191  C  C   . ASN F 1 134 ? 41.219 -22.061 -5.580  1.00 47.84 ? 218 ASN F C   1 
ATOM   8192  O  O   . ASN F 1 134 ? 41.407 -22.845 -6.513  1.00 48.57 ? 218 ASN F O   1 
ATOM   8193  C  CB  . ASN F 1 134 ? 38.809 -21.789 -5.796  1.00 46.01 ? 218 ASN F CB  1 
ATOM   8194  C  CG  . ASN F 1 134 ? 38.739 -20.358 -6.158  1.00 47.19 ? 218 ASN F CG  1 
ATOM   8195  O  OD1 . ASN F 1 134 ? 38.353 -19.529 -5.340  1.00 48.59 ? 218 ASN F OD1 1 
ATOM   8196  N  ND2 . ASN F 1 134 ? 39.074 -20.042 -7.395  1.00 47.95 ? 218 ASN F ND2 1 
ATOM   8197  N  N   . SER F 1 135 ? 42.116 -21.152 -5.225  1.00 50.18 ? 219 SER F N   1 
ATOM   8198  C  CA  . SER F 1 135 ? 43.352 -20.932 -5.996  1.00 51.71 ? 219 SER F CA  1 
ATOM   8199  C  C   . SER F 1 135 ? 44.523 -21.179 -5.088  1.00 53.30 ? 219 SER F C   1 
ATOM   8200  O  O   . SER F 1 135 ? 44.691 -20.478 -4.091  1.00 54.42 ? 219 SER F O   1 
ATOM   8201  C  CB  . SER F 1 135 ? 43.419 -19.504 -6.487  1.00 51.38 ? 219 SER F CB  1 
ATOM   8202  O  OG  . SER F 1 135 ? 42.251 -19.225 -7.206  1.00 52.81 ? 219 SER F OG  1 
ATOM   8203  N  N   . PRO F 1 136 ? 45.321 -22.204 -5.399  1.00 54.21 ? 220 PRO F N   1 
ATOM   8204  C  CA  . PRO F 1 136 ? 46.444 -22.582 -4.537  1.00 54.03 ? 220 PRO F CA  1 
ATOM   8205  C  C   . PRO F 1 136 ? 47.502 -21.463 -4.552  1.00 53.45 ? 220 PRO F C   1 
ATOM   8206  O  O   . PRO F 1 136 ? 48.272 -21.292 -3.589  1.00 53.57 ? 220 PRO F O   1 
ATOM   8207  C  CB  . PRO F 1 136 ? 46.968 -23.870 -5.187  1.00 54.19 ? 220 PRO F CB  1 
ATOM   8208  C  CG  . PRO F 1 136 ? 45.804 -24.332 -6.092  1.00 55.42 ? 220 PRO F CG  1 
ATOM   8209  C  CD  . PRO F 1 136 ? 45.204 -23.066 -6.586  1.00 54.44 ? 220 PRO F CD  1 
ATOM   8210  N  N   . ALA F 1 137 ? 47.510 -20.687 -5.628  1.00 52.26 ? 221 ALA F N   1 
ATOM   8211  C  CA  . ALA F 1 137 ? 48.404 -19.533 -5.720  1.00 51.31 ? 221 ALA F CA  1 
ATOM   8212  C  C   . ALA F 1 137 ? 48.189 -18.585 -4.527  1.00 50.17 ? 221 ALA F C   1 
ATOM   8213  O  O   . ALA F 1 137 ? 49.171 -18.091 -3.951  1.00 50.11 ? 221 ALA F O   1 
ATOM   8214  C  CB  . ALA F 1 137 ? 48.222 -18.824 -7.028  1.00 51.37 ? 221 ALA F CB  1 
ATOM   8215  N  N   . SER F 1 138 ? 46.923 -18.397 -4.125  1.00 48.01 ? 222 SER F N   1 
ATOM   8216  C  CA  . SER F 1 138 ? 46.592 -17.607 -2.935  1.00 46.01 ? 222 SER F CA  1 
ATOM   8217  C  C   . SER F 1 138 ? 47.362 -17.986 -1.705  1.00 44.15 ? 222 SER F C   1 
ATOM   8218  O  O   . SER F 1 138 ? 47.776 -17.124 -0.951  1.00 42.17 ? 222 SER F O   1 
ATOM   8219  C  CB  . SER F 1 138 ? 45.118 -17.706 -2.592  1.00 46.23 ? 222 SER F CB  1 
ATOM   8220  O  OG  . SER F 1 138 ? 44.356 -16.851 -3.425  1.00 49.93 ? 222 SER F OG  1 
ATOM   8221  N  N   . TYR F 1 139 ? 47.544 -19.281 -1.474  1.00 43.46 ? 223 TYR F N   1 
ATOM   8222  C  CA  . TYR F 1 139 ? 48.149 -19.694 -0.207  1.00 42.44 ? 223 TYR F CA  1 
ATOM   8223  C  C   . TYR F 1 139 ? 49.516 -20.317 -0.338  1.00 41.62 ? 223 TYR F C   1 
ATOM   8224  O  O   . TYR F 1 139 ? 50.017 -21.039 0.552   1.00 41.48 ? 223 TYR F O   1 
ATOM   8225  C  CB  . TYR F 1 139 ? 47.212 -20.606 0.555   1.00 43.73 ? 223 TYR F CB  1 
ATOM   8226  C  CG  . TYR F 1 139 ? 46.661 -21.752 -0.237  1.00 46.26 ? 223 TYR F CG  1 
ATOM   8227  C  CD1 . TYR F 1 139 ? 47.422 -22.915 -0.440  1.00 46.59 ? 223 TYR F CD1 1 
ATOM   8228  C  CD2 . TYR F 1 139 ? 45.361 -21.705 -0.748  1.00 46.24 ? 223 TYR F CD2 1 
ATOM   8229  C  CE1 . TYR F 1 139 ? 46.906 -23.988 -1.141  1.00 47.06 ? 223 TYR F CE1 1 
ATOM   8230  C  CE2 . TYR F 1 139 ? 44.835 -22.772 -1.459  1.00 49.03 ? 223 TYR F CE2 1 
ATOM   8231  C  CZ  . TYR F 1 139 ? 45.614 -23.926 -1.649  1.00 48.35 ? 223 TYR F CZ  1 
ATOM   8232  O  OH  . TYR F 1 139 ? 45.102 -25.013 -2.329  1.00 47.43 ? 223 TYR F OH  1 
ATOM   8233  N  N   . ILE F 1 140 ? 50.130 -20.016 -1.461  1.00 41.16 ? 224 ILE F N   1 
ATOM   8234  C  CA  . ILE F 1 140 ? 51.437 -20.517 -1.780  1.00 41.05 ? 224 ILE F CA  1 
ATOM   8235  C  C   . ILE F 1 140 ? 52.493 -20.289 -0.692  1.00 39.98 ? 224 ILE F C   1 
ATOM   8236  O  O   . ILE F 1 140 ? 53.478 -20.933 -0.731  1.00 41.37 ? 224 ILE F O   1 
ATOM   8237  C  CB  . ILE F 1 140 ? 51.877 -19.945 -3.113  1.00 41.16 ? 224 ILE F CB  1 
ATOM   8238  C  CG1 . ILE F 1 140 ? 52.893 -20.887 -3.774  1.00 43.30 ? 224 ILE F CG1 1 
ATOM   8239  C  CG2 . ILE F 1 140 ? 52.350 -18.492 -2.945  1.00 41.10 ? 224 ILE F CG2 1 
ATOM   8240  C  CD1 . ILE F 1 140 ? 53.230 -20.545 -5.269  1.00 43.76 ? 224 ILE F CD1 1 
ATOM   8241  N  N   . PHE F 1 141 ? 52.286 -19.421 0.287   1.00 39.32 ? 225 PHE F N   1 
ATOM   8242  C  CA  . PHE F 1 141 ? 53.242 -19.243 1.409   1.00 38.57 ? 225 PHE F CA  1 
ATOM   8243  C  C   . PHE F 1 141 ? 52.802 -20.045 2.638   1.00 39.91 ? 225 PHE F C   1 
ATOM   8244  O  O   . PHE F 1 141 ? 53.609 -20.212 3.578   1.00 40.51 ? 225 PHE F O   1 
ATOM   8245  C  CB  . PHE F 1 141 ? 53.427 -17.740 1.812   1.00 37.42 ? 225 PHE F CB  1 
ATOM   8246  C  CG  . PHE F 1 141 ? 54.329 -16.923 0.863   1.00 36.05 ? 225 PHE F CG  1 
ATOM   8247  C  CD1 . PHE F 1 141 ? 53.853 -16.478 -0.371  1.00 33.91 ? 225 PHE F CD1 1 
ATOM   8248  C  CD2 . PHE F 1 141 ? 55.650 -16.565 1.238   1.00 36.02 ? 225 PHE F CD2 1 
ATOM   8249  C  CE1 . PHE F 1 141 ? 54.669 -15.736 -1.246  1.00 35.93 ? 225 PHE F CE1 1 
ATOM   8250  C  CE2 . PHE F 1 141 ? 56.475 -15.810 0.377   1.00 32.94 ? 225 PHE F CE2 1 
ATOM   8251  C  CZ  . PHE F 1 141 ? 56.007 -15.409 -0.870  1.00 34.57 ? 225 PHE F CZ  1 
ATOM   8252  N  N   . HIS F 1 142 ? 51.545 -20.530 2.676   1.00 39.82 ? 226 HIS F N   1 
ATOM   8253  C  CA  . HIS F 1 142 ? 51.132 -21.391 3.787   1.00 41.22 ? 226 HIS F CA  1 
ATOM   8254  C  C   . HIS F 1 142 ? 50.177 -22.496 3.323   1.00 42.98 ? 226 HIS F C   1 
ATOM   8255  O  O   . HIS F 1 142 ? 48.974 -22.481 3.660   1.00 43.76 ? 226 HIS F O   1 
ATOM   8256  C  CB  . HIS F 1 142 ? 50.549 -20.570 4.969   1.00 41.31 ? 226 HIS F CB  1 
ATOM   8257  C  CG  . HIS F 1 142 ? 51.387 -19.383 5.349   1.00 41.47 ? 226 HIS F CG  1 
ATOM   8258  N  ND1 . HIS F 1 142 ? 52.332 -19.427 6.352   1.00 41.00 ? 226 HIS F ND1 1 
ATOM   8259  C  CD2 . HIS F 1 142 ? 51.496 -18.156 4.788   1.00 41.03 ? 226 HIS F CD2 1 
ATOM   8260  C  CE1 . HIS F 1 142 ? 52.955 -18.265 6.425   1.00 40.61 ? 226 HIS F CE1 1 
ATOM   8261  N  NE2 . HIS F 1 142 ? 52.469 -17.477 5.482   1.00 43.14 ? 226 HIS F NE2 1 
ATOM   8262  N  N   . PRO F 1 143 ? 50.705 -23.481 2.547   1.00 43.80 ? 227 PRO F N   1 
ATOM   8263  C  CA  . PRO F 1 143 ? 49.822 -24.491 1.953   1.00 43.36 ? 227 PRO F CA  1 
ATOM   8264  C  C   . PRO F 1 143 ? 49.485 -25.516 2.990   1.00 43.79 ? 227 PRO F C   1 
ATOM   8265  O  O   . PRO F 1 143 ? 48.459 -26.187 2.886   1.00 45.05 ? 227 PRO F O   1 
ATOM   8266  C  CB  . PRO F 1 143 ? 50.659 -25.095 0.832   1.00 43.70 ? 227 PRO F CB  1 
ATOM   8267  C  CG  . PRO F 1 143 ? 52.081 -24.809 1.195   1.00 42.88 ? 227 PRO F CG  1 
ATOM   8268  C  CD  . PRO F 1 143 ? 52.132 -23.712 2.206   1.00 43.47 ? 227 PRO F CD  1 
ATOM   8269  N  N   . GLU F 1 144 ? 50.319 -25.579 4.019   1.00 43.60 ? 228 GLU F N   1 
ATOM   8270  C  CA  . GLU F 1 144 ? 50.018 -26.312 5.214   1.00 43.36 ? 228 GLU F CA  1 
ATOM   8271  C  C   . GLU F 1 144 ? 48.784 -25.871 5.952   1.00 43.70 ? 228 GLU F C   1 
ATOM   8272  O  O   . GLU F 1 144 ? 48.349 -26.581 6.864   1.00 46.31 ? 228 GLU F O   1 
ATOM   8273  C  CB  . GLU F 1 144 ? 51.209 -26.330 6.187   1.00 43.22 ? 228 GLU F CB  1 
ATOM   8274  C  CG  . GLU F 1 144 ? 51.683 -24.999 6.712   1.00 43.33 ? 228 GLU F CG  1 
ATOM   8275  C  CD  . GLU F 1 144 ? 52.769 -24.356 5.821   1.00 42.81 ? 228 GLU F CD  1 
ATOM   8276  O  OE1 . GLU F 1 144 ? 53.736 -23.790 6.411   1.00 42.67 ? 228 GLU F OE1 1 
ATOM   8277  O  OE2 . GLU F 1 144 ? 52.657 -24.412 4.559   1.00 38.02 ? 228 GLU F OE2 1 
ATOM   8278  N  N   . ASN F 1 145 ? 48.230 -24.703 5.630   1.00 43.48 ? 229 ASN F N   1 
ATOM   8279  C  CA  . ASN F 1 145 ? 47.031 -24.223 6.321   1.00 42.23 ? 229 ASN F CA  1 
ATOM   8280  C  C   . ASN F 1 145 ? 45.828 -24.274 5.387   1.00 42.71 ? 229 ASN F C   1 
ATOM   8281  O  O   . ASN F 1 145 ? 44.732 -23.877 5.766   1.00 42.43 ? 229 ASN F O   1 
ATOM   8282  C  CB  . ASN F 1 145 ? 47.186 -22.788 6.797   1.00 41.39 ? 229 ASN F CB  1 
ATOM   8283  C  CG  . ASN F 1 145 ? 48.186 -22.620 7.887   1.00 40.46 ? 229 ASN F CG  1 
ATOM   8284  O  OD1 . ASN F 1 145 ? 49.406 -22.619 7.631   1.00 40.05 ? 229 ASN F OD1 1 
ATOM   8285  N  ND2 . ASN F 1 145 ? 47.697 -22.394 9.120   1.00 36.28 ? 229 ASN F ND2 1 
ATOM   8286  N  N   . ALA F 1 146 ? 46.038 -24.701 4.159   1.00 42.50 ? 230 ALA F N   1 
ATOM   8287  C  CA  . ALA F 1 146 ? 44.959 -24.709 3.222   1.00 44.11 ? 230 ALA F CA  1 
ATOM   8288  C  C   . ALA F 1 146 ? 43.999 -25.883 3.423   1.00 45.07 ? 230 ALA F C   1 
ATOM   8289  O  O   . ALA F 1 146 ? 44.332 -26.874 4.045   1.00 45.97 ? 230 ALA F O   1 
ATOM   8290  C  CB  . ALA F 1 146 ? 45.517 -24.730 1.828   1.00 45.07 ? 230 ALA F CB  1 
ATOM   8291  N  N   . VAL F 1 147 ? 42.791 -25.728 2.916   1.00 45.31 ? 231 VAL F N   1 
ATOM   8292  C  CA  . VAL F 1 147 ? 41.827 -26.773 2.794   1.00 45.27 ? 231 VAL F CA  1 
ATOM   8293  C  C   . VAL F 1 147 ? 41.309 -26.481 1.404   1.00 46.68 ? 231 VAL F C   1 
ATOM   8294  O  O   . VAL F 1 147 ? 40.518 -25.554 1.231   1.00 47.50 ? 231 VAL F O   1 
ATOM   8295  C  CB  . VAL F 1 147 ? 40.698 -26.573 3.817   1.00 45.71 ? 231 VAL F CB  1 
ATOM   8296  C  CG1 . VAL F 1 147 ? 39.454 -27.373 3.455   1.00 43.69 ? 231 VAL F CG1 1 
ATOM   8297  C  CG2 . VAL F 1 147 ? 41.179 -26.900 5.227   1.00 44.51 ? 231 VAL F CG2 1 
ATOM   8298  N  N   . PRO F 1 148 ? 41.766 -27.231 0.396   1.00 47.61 ? 232 PRO F N   1 
ATOM   8299  C  CA  . PRO F 1 148 ? 41.442 -26.894 -1.001  1.00 48.87 ? 232 PRO F CA  1 
ATOM   8300  C  C   . PRO F 1 148 ? 39.965 -26.962 -1.332  1.00 49.74 ? 232 PRO F C   1 
ATOM   8301  O  O   . PRO F 1 148 ? 39.202 -27.525 -0.591  1.00 49.82 ? 232 PRO F O   1 
ATOM   8302  C  CB  . PRO F 1 148 ? 42.220 -27.947 -1.833  1.00 49.15 ? 232 PRO F CB  1 
ATOM   8303  C  CG  . PRO F 1 148 ? 43.212 -28.600 -0.841  1.00 49.12 ? 232 PRO F CG  1 
ATOM   8304  C  CD  . PRO F 1 148 ? 42.606 -28.444 0.522   1.00 48.33 ? 232 PRO F CD  1 
ATOM   8305  N  N   . VAL F 1 149 ? 39.579 -26.404 -2.468  1.00 51.41 ? 233 VAL F N   1 
ATOM   8306  C  CA  . VAL F 1 149 ? 38.199 -26.467 -2.948  1.00 52.83 ? 233 VAL F CA  1 
ATOM   8307  C  C   . VAL F 1 149 ? 38.213 -26.124 -4.437  1.00 53.99 ? 233 VAL F C   1 
ATOM   8308  O  O   . VAL F 1 149 ? 39.043 -25.313 -4.891  1.00 54.51 ? 233 VAL F O   1 
ATOM   8309  C  CB  . VAL F 1 149 ? 37.242 -25.515 -2.138  1.00 52.91 ? 233 VAL F CB  1 
ATOM   8310  C  CG1 . VAL F 1 149 ? 37.761 -24.080 -2.135  1.00 53.84 ? 233 VAL F CG1 1 
ATOM   8311  C  CG2 . VAL F 1 149 ? 35.852 -25.527 -2.705  1.00 52.03 ? 233 VAL F CG2 1 
ATOM   8312  N  N   . GLN F 1 150 ? 37.326 -26.734 -5.208  1.00 54.96 ? 234 GLN F N   1 
ATOM   8313  C  CA  . GLN F 1 150 ? 37.358 -26.533 -6.661  1.00 56.80 ? 234 GLN F CA  1 
ATOM   8314  C  C   . GLN F 1 150 ? 36.872 -25.124 -6.941  1.00 55.56 ? 234 GLN F C   1 
ATOM   8315  O  O   . GLN F 1 150 ? 35.969 -24.613 -6.256  1.00 53.83 ? 234 GLN F O   1 
ATOM   8316  C  CB  . GLN F 1 150 ? 36.361 -27.462 -7.407  1.00 57.72 ? 234 GLN F CB  1 
ATOM   8317  C  CG  . GLN F 1 150 ? 36.638 -29.009 -7.618  1.00 61.14 ? 234 GLN F CG  1 
ATOM   8318  C  CD  . GLN F 1 150 ? 35.760 -29.605 -8.807  1.00 60.78 ? 234 GLN F CD  1 
ATOM   8319  O  OE1 . GLN F 1 150 ? 35.135 -28.849 -9.600  1.00 63.77 ? 234 GLN F OE1 1 
ATOM   8320  N  NE2 . GLN F 1 150 ? 35.745 -30.948 -8.928  1.00 62.97 ? 234 GLN F NE2 1 
ATOM   8321  N  N   . SER F 1 151 ? 37.429 -24.525 -7.985  1.00 54.91 ? 235 SER F N   1 
ATOM   8322  C  CA  . SER F 1 151 ? 36.841 -23.337 -8.555  1.00 54.56 ? 235 SER F CA  1 
ATOM   8323  C  C   . SER F 1 151 ? 35.441 -23.636 -9.012  1.00 54.57 ? 235 SER F C   1 
ATOM   8324  O  O   . SER F 1 151 ? 35.268 -24.464 -9.868  1.00 54.75 ? 235 SER F O   1 
ATOM   8325  C  CB  . SER F 1 151 ? 37.650 -22.900 -9.751  1.00 54.24 ? 235 SER F CB  1 
ATOM   8326  O  OG  . SER F 1 151 ? 38.992 -22.681 -9.393  1.00 55.71 ? 235 SER F OG  1 
ATOM   8327  N  N   . TRP F 1 152 ? 34.446 -22.948 -8.467  1.00 55.02 ? 236 TRP F N   1 
ATOM   8328  C  CA  . TRP F 1 152 ? 33.061 -23.120 -8.905  1.00 55.24 ? 236 TRP F CA  1 
ATOM   8329  C  C   . TRP F 1 152 ? 32.666 -22.022 -9.862  1.00 55.74 ? 236 TRP F C   1 
ATOM   8330  O  O   . TRP F 1 152 ? 33.098 -20.917 -9.668  1.00 56.31 ? 236 TRP F O   1 
ATOM   8331  C  CB  . TRP F 1 152 ? 32.105 -23.136 -7.712  1.00 54.54 ? 236 TRP F CB  1 
ATOM   8332  C  CG  . TRP F 1 152 ? 30.683 -23.279 -8.121  1.00 54.86 ? 236 TRP F CG  1 
ATOM   8333  C  CD1 . TRP F 1 152 ? 30.047 -24.430 -8.523  1.00 55.52 ? 236 TRP F CD1 1 
ATOM   8334  C  CD2 . TRP F 1 152 ? 29.707 -22.244 -8.198  1.00 52.06 ? 236 TRP F CD2 1 
ATOM   8335  N  NE1 . TRP F 1 152 ? 28.725 -24.162 -8.828  1.00 52.17 ? 236 TRP F NE1 1 
ATOM   8336  C  CE2 . TRP F 1 152 ? 28.501 -22.830 -8.657  1.00 52.56 ? 236 TRP F CE2 1 
ATOM   8337  C  CE3 . TRP F 1 152 ? 29.730 -20.891 -7.927  1.00 51.12 ? 236 TRP F CE3 1 
ATOM   8338  C  CZ2 . TRP F 1 152 ? 27.351 -22.099 -8.861  1.00 53.71 ? 236 TRP F CZ2 1 
ATOM   8339  C  CZ3 . TRP F 1 152 ? 28.594 -20.171 -8.121  1.00 53.21 ? 236 TRP F CZ3 1 
ATOM   8340  C  CH2 . TRP F 1 152 ? 27.410 -20.773 -8.585  1.00 54.42 ? 236 TRP F CH2 1 
ATOM   8341  N  N   . PHE F 1 153 ? 31.823 -22.309 -10.864 1.00 56.85 ? 237 PHE F N   1 
ATOM   8342  C  CA  . PHE F 1 153 ? 31.399 -21.291 -11.854 1.00 57.86 ? 237 PHE F CA  1 
ATOM   8343  C  C   . PHE F 1 153 ? 29.903 -21.131 -12.107 1.00 58.71 ? 237 PHE F C   1 
ATOM   8344  O  O   . PHE F 1 153 ? 29.396 -20.011 -12.140 1.00 57.85 ? 237 PHE F O   1 
ATOM   8345  C  CB  . PHE F 1 153 ? 32.069 -21.509 -13.219 1.00 57.23 ? 237 PHE F CB  1 
ATOM   8346  C  CG  . PHE F 1 153 ? 33.539 -21.305 -13.207 1.00 57.31 ? 237 PHE F CG  1 
ATOM   8347  C  CD1 . PHE F 1 153 ? 34.397 -22.389 -13.100 1.00 55.71 ? 237 PHE F CD1 1 
ATOM   8348  C  CD2 . PHE F 1 153 ? 34.074 -20.019 -13.275 1.00 58.40 ? 237 PHE F CD2 1 
ATOM   8349  C  CE1 . PHE F 1 153 ? 35.755 -22.200 -13.073 1.00 56.23 ? 237 PHE F CE1 1 
ATOM   8350  C  CE2 . PHE F 1 153 ? 35.445 -19.818 -13.254 1.00 55.97 ? 237 PHE F CE2 1 
ATOM   8351  C  CZ  . PHE F 1 153 ? 36.281 -20.910 -13.166 1.00 56.43 ? 237 PHE F CZ  1 
ATOM   8352  N  N   . ASP F 1 154 ? 29.225 -22.249 -12.371 1.00 60.60 ? 238 ASP F N   1 
ATOM   8353  C  CA  . ASP F 1 154 ? 27.802 -22.217 -12.785 1.00 62.19 ? 238 ASP F CA  1 
ATOM   8354  C  C   . ASP F 1 154 ? 27.106 -23.560 -12.680 1.00 62.04 ? 238 ASP F C   1 
ATOM   8355  O  O   . ASP F 1 154 ? 25.929 -23.629 -12.954 1.00 62.10 ? 238 ASP F O   1 
ATOM   8356  C  CB  . ASP F 1 154 ? 27.614 -21.644 -14.228 1.00 62.52 ? 238 ASP F CB  1 
ATOM   8357  C  CG  . ASP F 1 154 ? 28.126 -22.600 -15.341 1.00 63.86 ? 238 ASP F CG  1 
ATOM   8358  O  OD1 . ASP F 1 154 ? 28.626 -23.715 -15.040 1.00 62.33 ? 238 ASP F OD1 1 
ATOM   8359  O  OD2 . ASP F 1 154 ? 28.011 -22.222 -16.535 1.00 65.99 ? 238 ASP F OD2 1 
ATOM   8360  N  N   . ASP F 1 155 ? 27.855 -24.592 -12.307 1.00 62.61 ? 239 ASP F N   1 
ATOM   8361  C  CA  . ASP F 1 155 ? 27.398 -25.971 -12.273 1.00 63.60 ? 239 ASP F CA  1 
ATOM   8362  C  C   . ASP F 1 155 ? 26.585 -26.289 -11.037 1.00 63.32 ? 239 ASP F C   1 
ATOM   8363  O  O   . ASP F 1 155 ? 27.133 -26.621 -9.976  1.00 62.86 ? 239 ASP F O   1 
ATOM   8364  C  CB  . ASP F 1 155 ? 28.616 -26.904 -12.386 1.00 64.82 ? 239 ASP F CB  1 
ATOM   8365  C  CG  . ASP F 1 155 ? 28.370 -28.307 -11.805 1.00 68.90 ? 239 ASP F CG  1 
ATOM   8366  O  OD1 . ASP F 1 155 ? 27.206 -28.823 -11.869 1.00 71.37 ? 239 ASP F OD1 1 
ATOM   8367  O  OD2 . ASP F 1 155 ? 29.367 -28.895 -11.282 1.00 72.48 ? 239 ASP F OD2 1 
ATOM   8368  N  N   . MET F 1 156 ? 25.267 -26.237 -11.190 1.00 63.82 ? 240 MET F N   1 
ATOM   8369  C  CA  . MET F 1 156 ? 24.356 -26.397 -10.052 1.00 64.58 ? 240 MET F CA  1 
ATOM   8370  C  C   . MET F 1 156 ? 24.340 -27.808 -9.457  1.00 64.72 ? 240 MET F C   1 
ATOM   8371  O  O   . MET F 1 156 ? 23.590 -28.084 -8.518  1.00 65.10 ? 240 MET F O   1 
ATOM   8372  C  CB  . MET F 1 156 ? 22.945 -25.937 -10.420 1.00 64.57 ? 240 MET F CB  1 
ATOM   8373  C  CG  . MET F 1 156 ? 22.834 -24.412 -10.738 1.00 65.46 ? 240 MET F CG  1 
ATOM   8374  S  SD  . MET F 1 156 ? 23.337 -23.269 -9.398  1.00 63.26 ? 240 MET F SD  1 
ATOM   8375  C  CE  . MET F 1 156 ? 22.498 -24.008 -7.982  1.00 63.02 ? 240 MET F CE  1 
ATOM   8376  N  N   . ALA F 1 157 ? 25.201 -28.675 -9.983  1.00 64.75 ? 241 ALA F N   1 
ATOM   8377  C  CA  . ALA F 1 157 ? 25.381 -30.019 -9.466  1.00 65.17 ? 241 ALA F CA  1 
ATOM   8378  C  C   . ALA F 1 157 ? 26.489 -30.156 -8.417  1.00 65.12 ? 241 ALA F C   1 
ATOM   8379  O  O   . ALA F 1 157 ? 26.786 -31.277 -7.971  1.00 65.52 ? 241 ALA F O   1 
ATOM   8380  C  CB  . ALA F 1 157 ? 25.674 -30.972 -10.630 1.00 66.03 ? 241 ALA F CB  1 
ATOM   8381  N  N   . ASP F 1 158 ? 27.116 -29.037 -8.046  1.00 64.72 ? 242 ASP F N   1 
ATOM   8382  C  CA  . ASP F 1 158 ? 28.292 -29.038 -7.139  1.00 63.00 ? 242 ASP F CA  1 
ATOM   8383  C  C   . ASP F 1 158 ? 27.886 -29.332 -5.715  1.00 62.29 ? 242 ASP F C   1 
ATOM   8384  O  O   . ASP F 1 158 ? 26.857 -28.849 -5.257  1.00 62.28 ? 242 ASP F O   1 
ATOM   8385  C  CB  . ASP F 1 158 ? 29.040 -27.693 -7.225  1.00 62.52 ? 242 ASP F CB  1 
ATOM   8386  C  CG  . ASP F 1 158 ? 30.145 -27.556 -6.174  1.00 60.84 ? 242 ASP F CG  1 
ATOM   8387  O  OD1 . ASP F 1 158 ? 29.847 -27.174 -5.027  1.00 55.20 ? 242 ASP F OD1 1 
ATOM   8388  O  OD2 . ASP F 1 158 ? 31.318 -27.833 -6.497  1.00 59.69 ? 242 ASP F OD2 1 
ATOM   8389  N  N   . THR F 1 159 ? 28.689 -30.118 -5.008  1.00 62.38 ? 243 THR F N   1 
ATOM   8390  C  CA  . THR F 1 159 ? 28.403 -30.356 -3.575  1.00 62.93 ? 243 THR F CA  1 
ATOM   8391  C  C   . THR F 1 159 ? 29.571 -30.114 -2.588  1.00 62.52 ? 243 THR F C   1 
ATOM   8392  O  O   . THR F 1 159 ? 29.479 -30.459 -1.386  1.00 62.03 ? 243 THR F O   1 
ATOM   8393  C  CB  . THR F 1 159 ? 27.652 -31.725 -3.305  1.00 63.52 ? 243 THR F CB  1 
ATOM   8394  O  OG1 . THR F 1 159 ? 27.955 -32.682 -4.326  1.00 63.59 ? 243 THR F OG1 1 
ATOM   8395  C  CG2 . THR F 1 159 ? 26.114 -31.516 -3.276  1.00 64.21 ? 243 THR F CG2 1 
ATOM   8396  N  N   . GLU F 1 160 ? 30.623 -29.448 -3.097  1.00 62.07 ? 244 GLU F N   1 
ATOM   8397  C  CA  . GLU F 1 160 ? 31.876 -29.191 -2.353  1.00 60.93 ? 244 GLU F CA  1 
ATOM   8398  C  C   . GLU F 1 160 ? 31.677 -28.637 -0.969  1.00 59.33 ? 244 GLU F C   1 
ATOM   8399  O  O   . GLU F 1 160 ? 32.276 -29.095 -0.022  1.00 59.70 ? 244 GLU F O   1 
ATOM   8400  C  CB  . GLU F 1 160 ? 32.802 -28.277 -3.144  1.00 61.64 ? 244 GLU F CB  1 
ATOM   8401  C  CG  . GLU F 1 160 ? 33.630 -28.996 -4.223  1.00 65.02 ? 244 GLU F CG  1 
ATOM   8402  C  CD  . GLU F 1 160 ? 34.832 -29.775 -3.645  1.00 69.55 ? 244 GLU F CD  1 
ATOM   8403  O  OE1 . GLU F 1 160 ? 34.767 -31.032 -3.600  1.00 72.45 ? 244 GLU F OE1 1 
ATOM   8404  O  OE2 . GLU F 1 160 ? 35.835 -29.143 -3.236  1.00 69.20 ? 244 GLU F OE2 1 
ATOM   8405  N  N   . LEU F 1 161 ? 30.819 -27.657 -0.824  1.00 58.44 ? 245 LEU F N   1 
ATOM   8406  C  CA  . LEU F 1 161 ? 30.678 -27.054 0.487   1.00 57.52 ? 245 LEU F CA  1 
ATOM   8407  C  C   . LEU F 1 161 ? 30.043 -27.991 1.474   1.00 58.39 ? 245 LEU F C   1 
ATOM   8408  O  O   . LEU F 1 161 ? 30.482 -28.050 2.614   1.00 58.59 ? 245 LEU F O   1 
ATOM   8409  C  CB  . LEU F 1 161 ? 29.933 -25.718 0.411   1.00 56.97 ? 245 LEU F CB  1 
ATOM   8410  C  CG  . LEU F 1 161 ? 30.516 -24.660 -0.540  1.00 53.62 ? 245 LEU F CG  1 
ATOM   8411  C  CD1 . LEU F 1 161 ? 29.681 -23.425 -0.466  1.00 50.05 ? 245 LEU F CD1 1 
ATOM   8412  C  CD2 . LEU F 1 161 ? 31.951 -24.370 -0.192  1.00 47.46 ? 245 LEU F CD2 1 
ATOM   8413  N  N   . LEU F 1 162 ? 29.019 -28.735 1.018   1.00 59.48 ? 246 LEU F N   1 
ATOM   8414  C  CA  . LEU F 1 162 ? 28.406 -29.846 1.767   1.00 59.41 ? 246 LEU F CA  1 
ATOM   8415  C  C   . LEU F 1 162 ? 29.472 -30.837 2.234   1.00 59.43 ? 246 LEU F C   1 
ATOM   8416  O  O   . LEU F 1 162 ? 29.537 -31.187 3.432   1.00 59.57 ? 246 LEU F O   1 
ATOM   8417  C  CB  . LEU F 1 162 ? 27.370 -30.569 0.888   1.00 59.92 ? 246 LEU F CB  1 
ATOM   8418  C  CG  . LEU F 1 162 ? 26.099 -31.266 1.439   1.00 60.43 ? 246 LEU F CG  1 
ATOM   8419  C  CD1 . LEU F 1 162 ? 25.172 -30.339 2.257   1.00 58.27 ? 246 LEU F CD1 1 
ATOM   8420  C  CD2 . LEU F 1 162 ? 25.319 -31.905 0.282   1.00 59.79 ? 246 LEU F CD2 1 
ATOM   8421  N  N   . ASN F 1 163 ? 30.327 -31.260 1.305   1.00 58.37 ? 247 ASN F N   1 
ATOM   8422  C  CA  . ASN F 1 163 ? 31.437 -32.102 1.684   1.00 58.97 ? 247 ASN F CA  1 
ATOM   8423  C  C   . ASN F 1 163 ? 32.464 -31.478 2.659   1.00 58.67 ? 247 ASN F C   1 
ATOM   8424  O  O   . ASN F 1 163 ? 33.264 -32.223 3.273   1.00 59.28 ? 247 ASN F O   1 
ATOM   8425  C  CB  . ASN F 1 163 ? 32.127 -32.652 0.435   1.00 60.31 ? 247 ASN F CB  1 
ATOM   8426  C  CG  . ASN F 1 163 ? 31.167 -33.493 -0.454  1.00 62.87 ? 247 ASN F CG  1 
ATOM   8427  O  OD1 . ASN F 1 163 ? 30.136 -33.991 0.023   1.00 63.76 ? 247 ASN F OD1 1 
ATOM   8428  N  ND2 . ASN F 1 163 ? 31.502 -33.626 -1.747  1.00 63.42 ? 247 ASN F ND2 1 
ATOM   8429  N  N   . LEU F 1 164 ? 32.425 -30.143 2.838   1.00 57.08 ? 248 LEU F N   1 
ATOM   8430  C  CA  . LEU F 1 164 ? 33.415 -29.427 3.659   1.00 55.43 ? 248 LEU F CA  1 
ATOM   8431  C  C   . LEU F 1 164 ? 33.006 -29.229 5.100   1.00 54.79 ? 248 LEU F C   1 
ATOM   8432  O  O   . LEU F 1 164 ? 33.841 -29.231 6.017   1.00 54.02 ? 248 LEU F O   1 
ATOM   8433  C  CB  . LEU F 1 164 ? 33.781 -28.092 3.019   1.00 55.62 ? 248 LEU F CB  1 
ATOM   8434  C  CG  . LEU F 1 164 ? 34.773 -28.193 1.846   1.00 55.06 ? 248 LEU F CG  1 
ATOM   8435  C  CD1 . LEU F 1 164 ? 34.759 -26.961 1.031   1.00 52.85 ? 248 LEU F CD1 1 
ATOM   8436  C  CD2 . LEU F 1 164 ? 36.143 -28.409 2.386   1.00 55.41 ? 248 LEU F CD2 1 
ATOM   8437  N  N   . ILE F 1 165 ? 31.709 -29.089 5.299   1.00 54.19 ? 249 ILE F N   1 
ATOM   8438  C  CA  . ILE F 1 165 ? 31.159 -28.947 6.631   1.00 54.11 ? 249 ILE F CA  1 
ATOM   8439  C  C   . ILE F 1 165 ? 31.722 -29.981 7.656   1.00 54.36 ? 249 ILE F C   1 
ATOM   8440  O  O   . ILE F 1 165 ? 32.250 -29.576 8.705   1.00 54.11 ? 249 ILE F O   1 
ATOM   8441  C  CB  . ILE F 1 165 ? 29.619 -28.889 6.569   1.00 54.07 ? 249 ILE F CB  1 
ATOM   8442  C  CG1 . ILE F 1 165 ? 29.187 -27.675 5.720   1.00 54.55 ? 249 ILE F CG1 1 
ATOM   8443  C  CG2 . ILE F 1 165 ? 29.013 -28.875 7.974   1.00 54.27 ? 249 ILE F CG2 1 
ATOM   8444  C  CD1 . ILE F 1 165 ? 27.700 -27.200 5.919   1.00 54.19 ? 249 ILE F CD1 1 
ATOM   8445  N  N   . PRO F 1 166 ? 31.689 -31.310 7.323   1.00 54.70 ? 250 PRO F N   1 
ATOM   8446  C  CA  . PRO F 1 166 ? 32.142 -32.308 8.304   1.00 54.18 ? 250 PRO F CA  1 
ATOM   8447  C  C   . PRO F 1 166 ? 33.648 -32.184 8.556   1.00 53.16 ? 250 PRO F C   1 
ATOM   8448  O  O   . PRO F 1 166 ? 34.089 -32.045 9.699   1.00 51.64 ? 250 PRO F O   1 
ATOM   8449  C  CB  . PRO F 1 166 ? 31.796 -33.651 7.629   1.00 53.77 ? 250 PRO F CB  1 
ATOM   8450  C  CG  . PRO F 1 166 ? 30.809 -33.292 6.580   1.00 54.72 ? 250 PRO F CG  1 
ATOM   8451  C  CD  . PRO F 1 166 ? 31.292 -31.983 6.067   1.00 54.73 ? 250 PRO F CD  1 
ATOM   8452  N  N   . ILE F 1 167 ? 34.405 -32.233 7.468   1.00 53.53 ? 251 ILE F N   1 
ATOM   8453  C  CA  . ILE F 1 167 ? 35.831 -31.820 7.442   1.00 53.95 ? 251 ILE F CA  1 
ATOM   8454  C  C   . ILE F 1 167 ? 36.119 -30.676 8.400   1.00 54.12 ? 251 ILE F C   1 
ATOM   8455  O  O   . ILE F 1 167 ? 36.986 -30.788 9.265   1.00 53.90 ? 251 ILE F O   1 
ATOM   8456  C  CB  . ILE F 1 167 ? 36.251 -31.446 6.020   1.00 53.58 ? 251 ILE F CB  1 
ATOM   8457  C  CG1 . ILE F 1 167 ? 36.291 -32.728 5.193   1.00 52.33 ? 251 ILE F CG1 1 
ATOM   8458  C  CG2 . ILE F 1 167 ? 37.597 -30.694 6.023   1.00 54.06 ? 251 ILE F CG2 1 
ATOM   8459  C  CD1 . ILE F 1 167 ? 36.468 -32.537 3.728   1.00 56.72 ? 251 ILE F CD1 1 
ATOM   8460  N  N   . PHE F 1 168 ? 35.330 -29.610 8.276   1.00 54.74 ? 252 PHE F N   1 
ATOM   8461  C  CA  . PHE F 1 168 ? 35.493 -28.455 9.135   1.00 55.29 ? 252 PHE F CA  1 
ATOM   8462  C  C   . PHE F 1 168 ? 35.129 -28.705 10.584  1.00 56.46 ? 252 PHE F C   1 
ATOM   8463  O  O   . PHE F 1 168 ? 35.789 -28.189 11.496  1.00 56.09 ? 252 PHE F O   1 
ATOM   8464  C  CB  . PHE F 1 168 ? 34.797 -27.201 8.551   1.00 54.29 ? 252 PHE F CB  1 
ATOM   8465  C  CG  . PHE F 1 168 ? 35.687 -26.420 7.643   1.00 51.88 ? 252 PHE F CG  1 
ATOM   8466  C  CD1 . PHE F 1 168 ? 35.499 -26.452 6.269   1.00 50.71 ? 252 PHE F CD1 1 
ATOM   8467  C  CD2 . PHE F 1 168 ? 36.778 -25.716 8.162   1.00 52.24 ? 252 PHE F CD2 1 
ATOM   8468  C  CE1 . PHE F 1 168 ? 36.346 -25.758 5.421   1.00 52.30 ? 252 PHE F CE1 1 
ATOM   8469  C  CE2 . PHE F 1 168 ? 37.661 -25.005 7.325   1.00 50.07 ? 252 PHE F CE2 1 
ATOM   8470  C  CZ  . PHE F 1 168 ? 37.448 -25.012 5.965   1.00 52.62 ? 252 PHE F CZ  1 
ATOM   8471  N  N   . GLU F 1 169 ? 34.066 -29.486 10.780  1.00 58.19 ? 253 GLU F N   1 
ATOM   8472  C  CA  . GLU F 1 169 ? 33.658 -29.956 12.110  1.00 59.41 ? 253 GLU F CA  1 
ATOM   8473  C  C   . GLU F 1 169 ? 34.771 -30.715 12.826  1.00 58.40 ? 253 GLU F C   1 
ATOM   8474  O  O   . GLU F 1 169 ? 35.070 -30.430 13.966  1.00 57.43 ? 253 GLU F O   1 
ATOM   8475  C  CB  . GLU F 1 169 ? 32.395 -30.813 11.988  1.00 59.41 ? 253 GLU F CB  1 
ATOM   8476  C  CG  . GLU F 1 169 ? 31.141 -30.162 12.603  1.00 62.79 ? 253 GLU F CG  1 
ATOM   8477  C  CD  . GLU F 1 169 ? 29.808 -30.463 11.860  1.00 62.56 ? 253 GLU F CD  1 
ATOM   8478  O  OE1 . GLU F 1 169 ? 29.687 -31.486 11.118  1.00 65.72 ? 253 GLU F OE1 1 
ATOM   8479  O  OE2 . GLU F 1 169 ? 28.876 -29.645 12.047  1.00 65.59 ? 253 GLU F OE2 1 
ATOM   8480  N  N   . GLU F 1 170 ? 35.407 -31.658 12.144  1.00 59.24 ? 254 GLU F N   1 
ATOM   8481  C  CA  . GLU F 1 170 ? 36.486 -32.412 12.785  1.00 61.92 ? 254 GLU F CA  1 
ATOM   8482  C  C   . GLU F 1 170 ? 37.591 -31.459 13.299  1.00 60.96 ? 254 GLU F C   1 
ATOM   8483  O  O   . GLU F 1 170 ? 38.074 -31.649 14.425  1.00 60.34 ? 254 GLU F O   1 
ATOM   8484  C  CB  . GLU F 1 170 ? 37.048 -33.555 11.890  1.00 61.36 ? 254 GLU F CB  1 
ATOM   8485  C  CG  . GLU F 1 170 ? 36.285 -34.934 12.065  1.00 66.01 ? 254 GLU F CG  1 
ATOM   8486  C  CD  . GLU F 1 170 ? 36.853 -36.101 11.185  1.00 66.49 ? 254 GLU F CD  1 
ATOM   8487  O  OE1 . GLU F 1 170 ? 36.229 -36.412 10.134  1.00 69.87 ? 254 GLU F OE1 1 
ATOM   8488  O  OE2 . GLU F 1 170 ? 37.912 -36.705 11.543  1.00 72.13 ? 254 GLU F OE2 1 
ATOM   8489  N  N   . LEU F 1 171 ? 37.938 -30.440 12.473  1.00 60.12 ? 255 LEU F N   1 
ATOM   8490  C  CA  . LEU F 1 171 ? 38.934 -29.401 12.803  1.00 59.44 ? 255 LEU F CA  1 
ATOM   8491  C  C   . LEU F 1 171 ? 38.490 -28.457 13.879  1.00 59.65 ? 255 LEU F C   1 
ATOM   8492  O  O   . LEU F 1 171 ? 39.295 -28.051 14.719  1.00 60.03 ? 255 LEU F O   1 
ATOM   8493  C  CB  . LEU F 1 171 ? 39.300 -28.576 11.587  1.00 58.70 ? 255 LEU F CB  1 
ATOM   8494  C  CG  . LEU F 1 171 ? 40.104 -29.381 10.580  1.00 59.36 ? 255 LEU F CG  1 
ATOM   8495  C  CD1 . LEU F 1 171 ? 40.101 -28.797 9.164   1.00 58.93 ? 255 LEU F CD1 1 
ATOM   8496  C  CD2 . LEU F 1 171 ? 41.518 -29.576 11.104  1.00 59.63 ? 255 LEU F CD2 1 
ATOM   8497  N  N   . SER F 1 172 ? 37.200 -28.141 13.868  1.00 59.51 ? 256 SER F N   1 
ATOM   8498  C  CA  . SER F 1 172 ? 36.652 -27.038 14.623  1.00 59.64 ? 256 SER F CA  1 
ATOM   8499  C  C   . SER F 1 172 ? 37.282 -26.919 16.016  1.00 60.08 ? 256 SER F C   1 
ATOM   8500  O  O   . SER F 1 172 ? 37.550 -25.823 16.496  1.00 60.14 ? 256 SER F O   1 
ATOM   8501  C  CB  . SER F 1 172 ? 35.106 -27.111 14.623  1.00 59.69 ? 256 SER F CB  1 
ATOM   8502  O  OG  . SER F 1 172 ? 34.536 -27.374 15.893  1.00 59.44 ? 256 SER F OG  1 
ATOM   8503  N  N   . GLY F 1 173 ? 37.592 -28.049 16.632  1.00 60.66 ? 257 GLY F N   1 
ATOM   8504  C  CA  . GLY F 1 173 ? 37.980 -28.036 18.032  1.00 61.87 ? 257 GLY F CA  1 
ATOM   8505  C  C   . GLY F 1 173 ? 39.447 -28.308 18.311  1.00 62.39 ? 257 GLY F C   1 
ATOM   8506  O  O   . GLY F 1 173 ? 39.859 -28.422 19.479  1.00 62.70 ? 257 GLY F O   1 
ATOM   8507  N  N   . ALA F 1 174 ? 40.234 -28.411 17.250  1.00 62.74 ? 258 ALA F N   1 
ATOM   8508  C  CA  . ALA F 1 174 ? 41.659 -28.692 17.385  1.00 63.69 ? 258 ALA F CA  1 
ATOM   8509  C  C   . ALA F 1 174 ? 42.415 -27.561 18.068  1.00 64.61 ? 258 ALA F C   1 
ATOM   8510  O  O   . ALA F 1 174 ? 42.015 -26.386 18.035  1.00 65.33 ? 258 ALA F O   1 
ATOM   8511  C  CB  . ALA F 1 174 ? 42.259 -28.975 16.049  1.00 63.52 ? 258 ALA F CB  1 
ATOM   8512  N  N   . GLU F 1 175 ? 43.499 -27.924 18.732  1.00 65.25 ? 259 GLU F N   1 
ATOM   8513  C  CA  . GLU F 1 175 ? 44.336 -26.934 19.353  1.00 65.47 ? 259 GLU F CA  1 
ATOM   8514  C  C   . GLU F 1 175 ? 45.571 -26.752 18.469  1.00 64.88 ? 259 GLU F C   1 
ATOM   8515  O  O   . GLU F 1 175 ? 46.397 -25.904 18.748  1.00 65.38 ? 259 GLU F O   1 
ATOM   8516  C  CB  . GLU F 1 175 ? 44.708 -27.364 20.769  1.00 66.38 ? 259 GLU F CB  1 
ATOM   8517  C  CG  . GLU F 1 175 ? 43.524 -27.526 21.744  1.00 70.05 ? 259 GLU F CG  1 
ATOM   8518  C  CD  . GLU F 1 175 ? 43.325 -26.311 22.677  1.00 75.56 ? 259 GLU F CD  1 
ATOM   8519  O  OE1 . GLU F 1 175 ? 43.999 -25.253 22.474  1.00 77.30 ? 259 GLU F OE1 1 
ATOM   8520  O  OE2 . GLU F 1 175 ? 42.487 -26.424 23.615  1.00 76.91 ? 259 GLU F OE2 1 
ATOM   8521  N  N   . ASP F 1 176 ? 45.692 -27.523 17.392  1.00 63.57 ? 260 ASP F N   1 
ATOM   8522  C  CA  . ASP F 1 176 ? 46.775 -27.281 16.463  1.00 63.43 ? 260 ASP F CA  1 
ATOM   8523  C  C   . ASP F 1 176 ? 46.375 -27.794 15.112  1.00 62.72 ? 260 ASP F C   1 
ATOM   8524  O  O   . ASP F 1 176 ? 46.450 -28.985 14.865  1.00 63.85 ? 260 ASP F O   1 
ATOM   8525  C  CB  . ASP F 1 176 ? 48.071 -27.959 16.947  1.00 63.82 ? 260 ASP F CB  1 
ATOM   8526  C  CG  . ASP F 1 176 ? 49.265 -27.740 16.002  1.00 64.98 ? 260 ASP F CG  1 
ATOM   8527  O  OD1 . ASP F 1 176 ? 49.092 -27.593 14.765  1.00 67.89 ? 260 ASP F OD1 1 
ATOM   8528  O  OD2 . ASP F 1 176 ? 50.400 -27.741 16.509  1.00 65.39 ? 260 ASP F OD2 1 
ATOM   8529  N  N   . VAL F 1 177 ? 45.975 -26.911 14.216  1.00 61.92 ? 261 VAL F N   1 
ATOM   8530  C  CA  . VAL F 1 177 ? 45.383 -27.369 12.950  1.00 61.24 ? 261 VAL F CA  1 
ATOM   8531  C  C   . VAL F 1 177 ? 46.338 -28.230 12.126  1.00 61.32 ? 261 VAL F C   1 
ATOM   8532  O  O   . VAL F 1 177 ? 45.920 -28.955 11.229  1.00 60.87 ? 261 VAL F O   1 
ATOM   8533  C  CB  . VAL F 1 177 ? 44.858 -26.212 12.112  1.00 60.75 ? 261 VAL F CB  1 
ATOM   8534  C  CG1 . VAL F 1 177 ? 43.707 -25.527 12.854  1.00 60.30 ? 261 VAL F CG1 1 
ATOM   8535  C  CG2 . VAL F 1 177 ? 45.990 -25.227 11.783  1.00 59.73 ? 261 VAL F CG2 1 
ATOM   8536  N  N   . TYR F 1 178 ? 47.618 -28.161 12.455  1.00 61.28 ? 262 TYR F N   1 
ATOM   8537  C  CA  . TYR F 1 178 ? 48.602 -28.899 11.692  1.00 62.45 ? 262 TYR F CA  1 
ATOM   8538  C  C   . TYR F 1 178 ? 48.539 -30.386 11.993  1.00 64.17 ? 262 TYR F C   1 
ATOM   8539  O  O   . TYR F 1 178 ? 48.623 -31.221 11.089  1.00 64.49 ? 262 TYR F O   1 
ATOM   8540  C  CB  . TYR F 1 178 ? 50.003 -28.334 11.944  1.00 61.39 ? 262 TYR F CB  1 
ATOM   8541  C  CG  . TYR F 1 178 ? 50.221 -26.958 11.324  1.00 58.94 ? 262 TYR F CG  1 
ATOM   8542  C  CD1 . TYR F 1 178 ? 50.814 -25.946 12.045  1.00 54.21 ? 262 TYR F CD1 1 
ATOM   8543  C  CD2 . TYR F 1 178 ? 49.799 -26.687 10.012  1.00 56.07 ? 262 TYR F CD2 1 
ATOM   8544  C  CE1 . TYR F 1 178 ? 51.004 -24.731 11.492  1.00 54.17 ? 262 TYR F CE1 1 
ATOM   8545  C  CE2 . TYR F 1 178 ? 49.971 -25.473 9.465   1.00 55.19 ? 262 TYR F CE2 1 
ATOM   8546  C  CZ  . TYR F 1 178 ? 50.591 -24.494 10.201  1.00 56.22 ? 262 TYR F CZ  1 
ATOM   8547  O  OH  . TYR F 1 178 ? 50.789 -23.253 9.637   1.00 57.03 ? 262 TYR F OH  1 
ATOM   8548  N  N   . THR F 1 179 ? 48.352 -30.710 13.267  1.00 65.90 ? 263 THR F N   1 
ATOM   8549  C  CA  . THR F 1 179 ? 48.206 -32.084 13.674  1.00 67.56 ? 263 THR F CA  1 
ATOM   8550  C  C   . THR F 1 179 ? 46.845 -32.636 13.223  1.00 68.94 ? 263 THR F C   1 
ATOM   8551  O  O   . THR F 1 179 ? 46.768 -33.669 12.536  1.00 68.81 ? 263 THR F O   1 
ATOM   8552  C  CB  . THR F 1 179 ? 48.351 -32.215 15.177  1.00 67.82 ? 263 THR F CB  1 
ATOM   8553  O  OG1 . THR F 1 179 ? 49.457 -31.425 15.630  1.00 66.46 ? 263 THR F OG1 1 
ATOM   8554  C  CG2 . THR F 1 179 ? 48.588 -33.672 15.525  1.00 69.76 ? 263 THR F CG2 1 
ATOM   8555  N  N   . SER F 1 180 ? 45.780 -31.922 13.585  1.00 70.29 ? 264 SER F N   1 
ATOM   8556  C  CA  . SER F 1 180 ? 44.430 -32.332 13.243  1.00 71.33 ? 264 SER F CA  1 
ATOM   8557  C  C   . SER F 1 180 ? 44.121 -32.381 11.773  1.00 72.21 ? 264 SER F C   1 
ATOM   8558  O  O   . SER F 1 180 ? 43.192 -33.056 11.362  1.00 73.11 ? 264 SER F O   1 
ATOM   8559  C  CB  . SER F 1 180 ? 43.423 -31.461 13.952  1.00 71.48 ? 264 SER F CB  1 
ATOM   8560  O  OG  . SER F 1 180 ? 43.350 -31.849 15.317  1.00 73.05 ? 264 SER F OG  1 
ATOM   8561  N  N   . LEU F 1 181 ? 44.872 -31.670 10.955  1.00 73.74 ? 265 LEU F N   1 
ATOM   8562  C  CA  . LEU F 1 181 ? 44.692 -31.834 9.506   1.00 74.95 ? 265 LEU F CA  1 
ATOM   8563  C  C   . LEU F 1 181 ? 45.288 -33.161 9.013   1.00 75.64 ? 265 LEU F C   1 
ATOM   8564  O  O   . LEU F 1 181 ? 44.741 -33.785 8.104   1.00 75.92 ? 265 LEU F O   1 
ATOM   8565  C  CB  . LEU F 1 181 ? 45.260 -30.639 8.723   1.00 75.16 ? 265 LEU F CB  1 
ATOM   8566  C  CG  . LEU F 1 181 ? 44.315 -29.507 8.285   1.00 75.23 ? 265 LEU F CG  1 
ATOM   8567  C  CD1 . LEU F 1 181 ? 45.060 -28.186 8.263   1.00 74.92 ? 265 LEU F CD1 1 
ATOM   8568  C  CD2 . LEU F 1 181 ? 43.719 -29.807 6.915   1.00 75.30 ? 265 LEU F CD2 1 
ATOM   8569  N  N   . GLY F 1 182 ? 46.398 -33.587 9.614   1.00 76.18 ? 266 GLY F N   1 
ATOM   8570  C  CA  . GLY F 1 182 ? 46.984 -34.896 9.300   1.00 77.27 ? 266 GLY F CA  1 
ATOM   8571  C  C   . GLY F 1 182 ? 46.136 -36.094 9.718   1.00 77.72 ? 266 GLY F C   1 
ATOM   8572  O  O   . GLY F 1 182 ? 45.945 -37.037 8.935   1.00 77.79 ? 266 GLY F O   1 
ATOM   8573  N  N   . GLN F 1 183 ? 45.639 -36.056 10.953  1.00 78.01 ? 267 GLN F N   1 
ATOM   8574  C  CA  . GLN F 1 183 ? 44.671 -37.036 11.446  1.00 78.75 ? 267 GLN F CA  1 
ATOM   8575  C  C   . GLN F 1 183 ? 43.468 -37.083 10.491  1.00 79.67 ? 267 GLN F C   1 
ATOM   8576  O  O   . GLN F 1 183 ? 43.064 -38.168 10.047  1.00 80.33 ? 267 GLN F O   1 
ATOM   8577  C  CB  . GLN F 1 183 ? 44.267 -36.732 12.906  1.00 78.43 ? 267 GLN F CB  1 
ATOM   8578  C  CG  . GLN F 1 183 ? 45.509 -36.381 13.772  1.00 78.21 ? 267 GLN F CG  1 
ATOM   8579  C  CD  . GLN F 1 183 ? 45.366 -36.628 15.274  1.00 78.14 ? 267 GLN F CD  1 
ATOM   8580  O  OE1 . GLN F 1 183 ? 46.367 -36.840 15.981  1.00 75.46 ? 267 GLN F OE1 1 
ATOM   8581  N  NE2 . GLN F 1 183 ? 44.137 -36.583 15.772  1.00 77.29 ? 267 GLN F NE2 1 
ATOM   8582  N  N   . LEU F 1 184 ? 42.945 -35.908 10.136  1.00 80.23 ? 268 LEU F N   1 
ATOM   8583  C  CA  . LEU F 1 184 ? 41.925 -35.761 9.085   1.00 81.04 ? 268 LEU F CA  1 
ATOM   8584  C  C   . LEU F 1 184 ? 42.271 -36.529 7.782   1.00 81.21 ? 268 LEU F C   1 
ATOM   8585  O  O   . LEU F 1 184 ? 41.413 -37.183 7.165   1.00 80.65 ? 268 LEU F O   1 
ATOM   8586  C  CB  . LEU F 1 184 ? 41.709 -34.268 8.765   1.00 81.13 ? 268 LEU F CB  1 
ATOM   8587  C  CG  . LEU F 1 184 ? 40.472 -33.908 7.931   1.00 81.83 ? 268 LEU F CG  1 
ATOM   8588  C  CD1 . LEU F 1 184 ? 39.336 -33.509 8.864   1.00 82.76 ? 268 LEU F CD1 1 
ATOM   8589  C  CD2 . LEU F 1 184 ? 40.742 -32.806 6.875   1.00 81.82 ? 268 LEU F CD2 1 
ATOM   8590  N  N   . CYS G 1 5   ? 75.446 4.187   7.577   1.00 66.19 ? 89  CYS G N   1 
ATOM   8591  C  CA  . CYS G 1 5   ? 76.372 3.148   8.153   1.00 66.66 ? 89  CYS G CA  1 
ATOM   8592  C  C   . CYS G 1 5   ? 75.687 2.259   9.138   1.00 65.72 ? 89  CYS G C   1 
ATOM   8593  O  O   . CYS G 1 5   ? 75.011 2.761   10.035  1.00 65.86 ? 89  CYS G O   1 
ATOM   8594  C  CB  . CYS G 1 5   ? 77.556 3.786   8.828   1.00 66.80 ? 89  CYS G CB  1 
ATOM   8595  S  SG  . CYS G 1 5   ? 78.514 4.605   7.610   1.00 71.57 ? 89  CYS G SG  1 
ATOM   8596  N  N   . LEU G 1 6   ? 75.935 0.953   8.981   1.00 64.48 ? 90  LEU G N   1 
ATOM   8597  C  CA  . LEU G 1 6   ? 75.098 -0.122  9.491   1.00 63.35 ? 90  LEU G CA  1 
ATOM   8598  C  C   . LEU G 1 6   ? 75.860 -1.438  9.369   1.00 63.98 ? 90  LEU G C   1 
ATOM   8599  O  O   . LEU G 1 6   ? 75.720 -2.341  10.201  1.00 63.83 ? 90  LEU G O   1 
ATOM   8600  C  CB  . LEU G 1 6   ? 73.831 -0.211  8.646   1.00 63.30 ? 90  LEU G CB  1 
ATOM   8601  C  CG  . LEU G 1 6   ? 72.436 -0.138  9.290   1.00 62.50 ? 90  LEU G CG  1 
ATOM   8602  C  CD1 . LEU G 1 6   ? 72.208 1.127   10.157  1.00 62.29 ? 90  LEU G CD1 1 
ATOM   8603  C  CD2 . LEU G 1 6   ? 71.366 -0.260  8.217   1.00 61.32 ? 90  LEU G CD2 1 
ATOM   8604  N  N   . LEU G 1 7   ? 76.629 -1.546  8.285   1.00 64.28 ? 91  LEU G N   1 
ATOM   8605  C  CA  . LEU G 1 7   ? 77.747 -2.471  8.174   1.00 64.35 ? 91  LEU G CA  1 
ATOM   8606  C  C   . LEU G 1 7   ? 78.998 -1.788  8.705   1.00 66.24 ? 91  LEU G C   1 
ATOM   8607  O  O   . LEU G 1 7   ? 79.297 -0.663  8.321   1.00 65.86 ? 91  LEU G O   1 
ATOM   8608  C  CB  . LEU G 1 7   ? 78.039 -2.836  6.729   1.00 62.58 ? 91  LEU G CB  1 
ATOM   8609  C  CG  . LEU G 1 7   ? 76.954 -3.311  5.820   1.00 59.23 ? 91  LEU G CG  1 
ATOM   8610  C  CD1 . LEU G 1 7   ? 77.599 -3.713  4.534   1.00 56.42 ? 91  LEU G CD1 1 
ATOM   8611  C  CD2 . LEU G 1 7   ? 76.226 -4.438  6.455   1.00 56.09 ? 91  LEU G CD2 1 
ATOM   8612  N  N   . PRO G 1 8   ? 79.778 -2.498  9.526   1.00 68.61 ? 92  PRO G N   1 
ATOM   8613  C  CA  . PRO G 1 8   ? 81.087 -1.981  9.937   1.00 70.06 ? 92  PRO G CA  1 
ATOM   8614  C  C   . PRO G 1 8   ? 81.983 -1.823  8.722   1.00 70.90 ? 92  PRO G C   1 
ATOM   8615  O  O   . PRO G 1 8   ? 81.630 -2.284  7.625   1.00 70.67 ? 92  PRO G O   1 
ATOM   8616  C  CB  . PRO G 1 8   ? 81.643 -3.114  10.800  1.00 70.09 ? 92  PRO G CB  1 
ATOM   8617  C  CG  . PRO G 1 8   ? 80.953 -4.373  10.238  1.00 70.70 ? 92  PRO G CG  1 
ATOM   8618  C  CD  . PRO G 1 8   ? 79.541 -3.853  10.063  1.00 69.21 ? 92  PRO G CD  1 
ATOM   8619  N  N   . GLU G 1 9   ? 83.141 -1.208  8.941   1.00 72.10 ? 93  GLU G N   1 
ATOM   8620  C  CA  . GLU G 1 9   ? 84.164 -1.009  7.903   1.00 73.60 ? 93  GLU G CA  1 
ATOM   8621  C  C   . GLU G 1 9   ? 84.522 -2.272  7.102   1.00 72.49 ? 93  GLU G C   1 
ATOM   8622  O  O   . GLU G 1 9   ? 84.586 -3.377  7.639   1.00 72.03 ? 93  GLU G O   1 
ATOM   8623  C  CB  . GLU G 1 9   ? 85.425 -0.326  8.500   1.00 73.49 ? 93  GLU G CB  1 
ATOM   8624  C  CG  . GLU G 1 9   ? 85.381 1.259   8.478   1.00 76.12 ? 93  GLU G CG  1 
ATOM   8625  C  CD  . GLU G 1 9   ? 86.720 1.964   8.887   1.00 77.15 ? 93  GLU G CD  1 
ATOM   8626  O  OE1 . GLU G 1 9   ? 87.702 1.264   9.279   1.00 81.94 ? 93  GLU G OE1 1 
ATOM   8627  O  OE2 . GLU G 1 9   ? 86.784 3.226   8.817   1.00 79.82 ? 93  GLU G OE2 1 
ATOM   8628  N  N   . VAL G 1 10  ? 84.747 -2.094  5.808   1.00 72.29 ? 94  VAL G N   1 
ATOM   8629  C  CA  . VAL G 1 10  ? 85.026 -3.227  4.928   1.00 72.27 ? 94  VAL G CA  1 
ATOM   8630  C  C   . VAL G 1 10  ? 86.460 -3.781  5.095   1.00 72.71 ? 94  VAL G C   1 
ATOM   8631  O  O   . VAL G 1 10  ? 87.457 -3.108  4.774   1.00 72.65 ? 94  VAL G O   1 
ATOM   8632  C  CB  . VAL G 1 10  ? 84.671 -2.903  3.458   1.00 71.82 ? 94  VAL G CB  1 
ATOM   8633  C  CG1 . VAL G 1 10  ? 85.131 -1.486  3.070   1.00 72.78 ? 94  VAL G CG1 1 
ATOM   8634  C  CG2 . VAL G 1 10  ? 85.190 -3.967  2.499   1.00 71.55 ? 94  VAL G CG2 1 
ATOM   8635  N  N   . THR G 1 11  ? 86.533 -5.004  5.623   1.00 72.75 ? 95  THR G N   1 
ATOM   8636  C  CA  . THR G 1 11  ? 87.782 -5.737  5.823   1.00 72.92 ? 95  THR G CA  1 
ATOM   8637  C  C   . THR G 1 11  ? 88.690 -5.750  4.601   1.00 73.65 ? 95  THR G C   1 
ATOM   8638  O  O   . THR G 1 11  ? 88.219 -5.623  3.452   1.00 73.37 ? 95  THR G O   1 
ATOM   8639  C  CB  . THR G 1 11  ? 87.523 -7.216  6.101   1.00 72.80 ? 95  THR G CB  1 
ATOM   8640  O  OG1 . THR G 1 11  ? 87.125 -7.856  4.878   1.00 70.82 ? 95  THR G OG1 1 
ATOM   8641  C  CG2 . THR G 1 11  ? 86.489 -7.418  7.241   1.00 72.88 ? 95  THR G CG2 1 
ATOM   8642  N  N   . GLU G 1 12  ? 89.983 -5.970  4.868   1.00 74.06 ? 96  GLU G N   1 
ATOM   8643  C  CA  . GLU G 1 12  ? 91.028 -5.972  3.841   1.00 74.59 ? 96  GLU G CA  1 
ATOM   8644  C  C   . GLU G 1 12  ? 90.843 -7.033  2.739   1.00 73.89 ? 96  GLU G C   1 
ATOM   8645  O  O   . GLU G 1 12  ? 91.133 -6.758  1.565   1.00 73.16 ? 96  GLU G O   1 
ATOM   8646  C  CB  . GLU G 1 12  ? 92.428 -6.071  4.484   1.00 75.56 ? 96  GLU G CB  1 
ATOM   8647  C  CG  . GLU G 1 12  ? 92.777 -4.922  5.490   1.00 79.20 ? 96  GLU G CG  1 
ATOM   8648  C  CD  . GLU G 1 12  ? 94.231 -4.345  5.334   1.00 83.43 ? 96  GLU G CD  1 
ATOM   8649  O  OE1 . GLU G 1 12  ? 95.077 -4.964  4.620   1.00 83.22 ? 96  GLU G OE1 1 
ATOM   8650  O  OE2 . GLU G 1 12  ? 94.508 -3.264  5.933   1.00 82.32 ? 96  GLU G OE2 1 
ATOM   8651  N  N   . GLU G 1 13  ? 90.342 -8.222  3.091   1.00 73.58 ? 97  GLU G N   1 
ATOM   8652  C  CA  . GLU G 1 13  ? 90.133 -9.269  2.063   1.00 74.21 ? 97  GLU G CA  1 
ATOM   8653  C  C   . GLU G 1 13  ? 89.119 -8.826  1.001   1.00 73.54 ? 97  GLU G C   1 
ATOM   8654  O  O   . GLU G 1 13  ? 89.298 -9.120  -0.193  1.00 73.71 ? 97  GLU G O   1 
ATOM   8655  C  CB  . GLU G 1 13  ? 89.816 -10.685 2.650   1.00 74.30 ? 97  GLU G CB  1 
ATOM   8656  C  CG  . GLU G 1 13  ? 88.338 -11.023 3.066   1.00 75.60 ? 97  GLU G CG  1 
ATOM   8657  C  CD  . GLU G 1 13  ? 88.068 -12.552 3.306   1.00 75.83 ? 97  GLU G CD  1 
ATOM   8658  O  OE1 . GLU G 1 13  ? 87.988 -13.329 2.310   1.00 77.86 ? 97  GLU G OE1 1 
ATOM   8659  O  OE2 . GLU G 1 13  ? 87.909 -12.966 4.489   1.00 75.26 ? 97  GLU G OE2 1 
ATOM   8660  N  N   . ASP G 1 14  ? 88.089 -8.093  1.442   1.00 72.29 ? 98  ASP G N   1 
ATOM   8661  C  CA  . ASP G 1 14  ? 86.951 -7.751  0.591   1.00 71.35 ? 98  ASP G CA  1 
ATOM   8662  C  C   . ASP G 1 14  ? 87.116 -6.455  -0.227  1.00 71.25 ? 98  ASP G C   1 
ATOM   8663  O  O   . ASP G 1 14  ? 86.394 -6.277  -1.217  1.00 71.06 ? 98  ASP G O   1 
ATOM   8664  C  CB  . ASP G 1 14  ? 85.661 -7.684  1.427   1.00 71.05 ? 98  ASP G CB  1 
ATOM   8665  C  CG  . ASP G 1 14  ? 85.175 -9.051  1.886   1.00 69.32 ? 98  ASP G CG  1 
ATOM   8666  O  OD1 . ASP G 1 14  ? 84.959 -9.933  1.028   1.00 68.90 ? 98  ASP G OD1 1 
ATOM   8667  O  OD2 . ASP G 1 14  ? 84.968 -9.234  3.104   1.00 66.40 ? 98  ASP G OD2 1 
ATOM   8668  N  N   . GLN G 1 15  ? 88.031 -5.562  0.196   1.00 70.54 ? 99  GLN G N   1 
ATOM   8669  C  CA  . GLN G 1 15  ? 88.387 -4.321  -0.537  1.00 70.49 ? 99  GLN G CA  1 
ATOM   8670  C  C   . GLN G 1 15  ? 87.747 -4.158  -1.950  1.00 68.73 ? 99  GLN G C   1 
ATOM   8671  O  O   . GLN G 1 15  ? 86.776 -3.394  -2.147  1.00 68.21 ? 99  GLN G O   1 
ATOM   8672  C  CB  . GLN G 1 15  ? 89.924 -4.182  -0.672  1.00 70.95 ? 99  GLN G CB  1 
ATOM   8673  C  CG  . GLN G 1 15  ? 90.708 -3.377  0.427   1.00 73.22 ? 99  GLN G CG  1 
ATOM   8674  C  CD  . GLN G 1 15  ? 92.252 -3.757  0.507   1.00 73.86 ? 99  GLN G CD  1 
ATOM   8675  O  OE1 . GLN G 1 15  ? 92.940 -3.898  -0.526  1.00 75.77 ? 99  GLN G OE1 1 
ATOM   8676  N  NE2 . GLN G 1 15  ? 92.773 -3.913  1.746   1.00 76.24 ? 99  GLN G NE2 1 
ATOM   8677  N  N   . GLY G 1 16  ? 88.293 -4.858  -2.943  1.00 66.65 ? 100 GLY G N   1 
ATOM   8678  C  CA  . GLY G 1 16  ? 87.869 -4.590  -4.329  1.00 64.32 ? 100 GLY G CA  1 
ATOM   8679  C  C   . GLY G 1 16  ? 86.428 -4.969  -4.662  1.00 62.00 ? 100 GLY G C   1 
ATOM   8680  O  O   . GLY G 1 16  ? 85.978 -4.795  -5.798  1.00 61.18 ? 100 GLY G O   1 
ATOM   8681  N  N   . ARG G 1 17  ? 85.707 -5.476  -3.664  1.00 60.02 ? 101 ARG G N   1 
ATOM   8682  C  CA  . ARG G 1 17  ? 84.450 -6.203  -3.909  1.00 58.10 ? 101 ARG G CA  1 
ATOM   8683  C  C   . ARG G 1 17  ? 83.116 -5.411  -3.807  1.00 55.37 ? 101 ARG G C   1 
ATOM   8684  O  O   . ARG G 1 17  ? 82.855 -4.654  -2.864  1.00 53.47 ? 101 ARG G O   1 
ATOM   8685  C  CB  . ARG G 1 17  ? 84.369 -7.440  -3.012  1.00 58.20 ? 101 ARG G CB  1 
ATOM   8686  C  CG  . ARG G 1 17  ? 85.215 -8.608  -3.445  1.00 60.23 ? 101 ARG G CG  1 
ATOM   8687  C  CD  . ARG G 1 17  ? 85.321 -9.577  -2.275  1.00 63.39 ? 101 ARG G CD  1 
ATOM   8688  N  NE  . ARG G 1 17  ? 86.232 -10.691 -2.530  1.00 67.91 ? 101 ARG G NE  1 
ATOM   8689  C  CZ  . ARG G 1 17  ? 86.453 -11.701 -1.686  1.00 69.03 ? 101 ARG G CZ  1 
ATOM   8690  N  NH1 . ARG G 1 17  ? 85.806 -11.776 -0.529  1.00 69.32 ? 101 ARG G NH1 1 
ATOM   8691  N  NH2 . ARG G 1 17  ? 87.306 -12.655 -2.016  1.00 66.78 ? 101 ARG G NH2 1 
ATOM   8692  N  N   . ILE G 1 18  ? 82.299 -5.638  -4.829  1.00 53.18 ? 102 ILE G N   1 
ATOM   8693  C  CA  . ILE G 1 18  ? 80.854 -5.444  -4.778  1.00 50.91 ? 102 ILE G CA  1 
ATOM   8694  C  C   . ILE G 1 18  ? 80.183 -6.119  -3.583  1.00 50.06 ? 102 ILE G C   1 
ATOM   8695  O  O   . ILE G 1 18  ? 80.413 -7.292  -3.275  1.00 50.47 ? 102 ILE G O   1 
ATOM   8696  C  CB  . ILE G 1 18  ? 80.210 -5.994  -6.016  1.00 49.96 ? 102 ILE G CB  1 
ATOM   8697  C  CG1 . ILE G 1 18  ? 80.755 -5.238  -7.196  1.00 47.14 ? 102 ILE G CG1 1 
ATOM   8698  C  CG2 . ILE G 1 18  ? 78.671 -5.878  -5.901  1.00 50.98 ? 102 ILE G CG2 1 
ATOM   8699  C  CD1 . ILE G 1 18  ? 80.319 -5.811  -8.483  1.00 46.28 ? 102 ILE G CD1 1 
ATOM   8700  N  N   . CYS G 1 19  ? 79.329 -5.351  -2.929  1.00 49.34 ? 103 CYS G N   1 
ATOM   8701  C  CA  . CYS G 1 19  ? 78.554 -5.810  -1.797  1.00 48.20 ? 103 CYS G CA  1 
ATOM   8702  C  C   . CYS G 1 19  ? 77.250 -6.431  -2.289  1.00 47.71 ? 103 CYS G C   1 
ATOM   8703  O  O   . CYS G 1 19  ? 76.526 -5.847  -3.083  1.00 47.77 ? 103 CYS G O   1 
ATOM   8704  C  CB  . CYS G 1 19  ? 78.287 -4.630  -0.929  1.00 47.13 ? 103 CYS G CB  1 
ATOM   8705  S  SG  . CYS G 1 19  ? 77.493 -5.054  0.533   1.00 49.44 ? 103 CYS G SG  1 
ATOM   8706  N  N   . VAL G 1 20  ? 76.995 -7.662  -1.885  1.00 47.63 ? 104 VAL G N   1 
ATOM   8707  C  CA  . VAL G 1 20  ? 75.744 -8.320  -2.239  1.00 46.67 ? 104 VAL G CA  1 
ATOM   8708  C  C   . VAL G 1 20  ? 75.024 -8.604  -0.977  1.00 46.20 ? 104 VAL G C   1 
ATOM   8709  O  O   . VAL G 1 20  ? 75.528 -9.289  -0.095  1.00 46.21 ? 104 VAL G O   1 
ATOM   8710  C  CB  . VAL G 1 20  ? 75.901 -9.603  -2.944  1.00 46.27 ? 104 VAL G CB  1 
ATOM   8711  C  CG1 . VAL G 1 20  ? 74.529 -10.059 -3.456  1.00 46.79 ? 104 VAL G CG1 1 
ATOM   8712  C  CG2 . VAL G 1 20  ? 76.859 -9.430  -4.081  1.00 46.59 ? 104 VAL G CG2 1 
ATOM   8713  N  N   . VAL G 1 21  ? 73.835 -8.017  -0.909  1.00 46.31 ? 105 VAL G N   1 
ATOM   8714  C  CA  . VAL G 1 21  ? 72.922 -8.133  0.228   1.00 45.23 ? 105 VAL G CA  1 
ATOM   8715  C  C   . VAL G 1 21  ? 71.880 -9.206  -0.049  1.00 43.99 ? 105 VAL G C   1 
ATOM   8716  O  O   . VAL G 1 21  ? 71.267 -9.223  -1.117  1.00 42.41 ? 105 VAL G O   1 
ATOM   8717  C  CB  . VAL G 1 21  ? 72.363 -6.753  0.553   1.00 44.99 ? 105 VAL G CB  1 
ATOM   8718  C  CG1 . VAL G 1 21  ? 70.861 -6.785  0.795   1.00 45.11 ? 105 VAL G CG1 1 
ATOM   8719  C  CG2 . VAL G 1 21  ? 73.142 -6.231  1.738   1.00 46.14 ? 105 VAL G CG2 1 
ATOM   8720  N  N   . ILE G 1 22  ? 71.748 -10.150 0.886   1.00 44.14 ? 106 ILE G N   1 
ATOM   8721  C  CA  . ILE G 1 22  ? 70.988 -11.399 0.585   1.00 44.40 ? 106 ILE G CA  1 
ATOM   8722  C  C   . ILE G 1 22  ? 69.942 -11.718 1.616   1.00 44.54 ? 106 ILE G C   1 
ATOM   8723  O  O   . ILE G 1 22  ? 70.197 -11.628 2.841   1.00 44.65 ? 106 ILE G O   1 
ATOM   8724  C  CB  . ILE G 1 22  ? 71.877 -12.665 0.270   1.00 44.80 ? 106 ILE G CB  1 
ATOM   8725  C  CG1 . ILE G 1 22  ? 73.135 -12.298 -0.574  1.00 44.91 ? 106 ILE G CG1 1 
ATOM   8726  C  CG2 . ILE G 1 22  ? 71.034 -13.751 -0.440  1.00 43.81 ? 106 ILE G CG2 1 
ATOM   8727  C  CD1 . ILE G 1 22  ? 73.794 -13.494 -1.319  1.00 43.97 ? 106 ILE G CD1 1 
ATOM   8728  N  N   . ASP G 1 23  ? 68.741 -12.015 1.107   1.00 44.04 ? 107 ASP G N   1 
ATOM   8729  C  CA  . ASP G 1 23  ? 67.613 -12.345 1.988   1.00 43.82 ? 107 ASP G CA  1 
ATOM   8730  C  C   . ASP G 1 23  ? 67.505 -13.859 2.219   1.00 43.43 ? 107 ASP G C   1 
ATOM   8731  O  O   . ASP G 1 23  ? 67.890 -14.692 1.384   1.00 43.36 ? 107 ASP G O   1 
ATOM   8732  C  CB  . ASP G 1 23  ? 66.323 -11.720 1.439   1.00 44.40 ? 107 ASP G CB  1 
ATOM   8733  C  CG  . ASP G 1 23  ? 65.076 -12.266 2.052   1.00 44.07 ? 107 ASP G CG  1 
ATOM   8734  O  OD1 . ASP G 1 23  ? 64.692 -11.924 3.206   1.00 43.72 ? 107 ASP G OD1 1 
ATOM   8735  O  OD2 . ASP G 1 23  ? 64.442 -13.039 1.317   1.00 49.12 ? 107 ASP G OD2 1 
ATOM   8736  N  N   . LEU G 1 24  ? 67.009 -14.182 3.395   1.00 42.66 ? 108 LEU G N   1 
ATOM   8737  C  CA  . LEU G 1 24  ? 66.834 -15.530 3.859   1.00 42.28 ? 108 LEU G CA  1 
ATOM   8738  C  C   . LEU G 1 24  ? 65.565 -16.154 3.257   1.00 41.78 ? 108 LEU G C   1 
ATOM   8739  O  O   . LEU G 1 24  ? 65.610 -16.646 2.143   1.00 41.72 ? 108 LEU G O   1 
ATOM   8740  C  CB  . LEU G 1 24  ? 66.789 -15.445 5.378   1.00 41.66 ? 108 LEU G CB  1 
ATOM   8741  C  CG  . LEU G 1 24  ? 66.846 -16.739 6.143   1.00 43.85 ? 108 LEU G CG  1 
ATOM   8742  C  CD1 . LEU G 1 24  ? 68.108 -17.490 5.722   1.00 46.10 ? 108 LEU G CD1 1 
ATOM   8743  C  CD2 . LEU G 1 24  ? 66.833 -16.439 7.625   1.00 45.51 ? 108 LEU G CD2 1 
ATOM   8744  N  N   . ASP G 1 25  ? 64.430 -16.079 3.969   1.00 42.28 ? 109 ASP G N   1 
ATOM   8745  C  CA  . ASP G 1 25  ? 63.115 -16.705 3.538   1.00 42.16 ? 109 ASP G CA  1 
ATOM   8746  C  C   . ASP G 1 25  ? 62.710 -16.595 2.093   1.00 41.27 ? 109 ASP G C   1 
ATOM   8747  O  O   . ASP G 1 25  ? 62.765 -15.540 1.498   1.00 41.73 ? 109 ASP G O   1 
ATOM   8748  C  CB  . ASP G 1 25  ? 61.964 -16.199 4.375   1.00 42.26 ? 109 ASP G CB  1 
ATOM   8749  C  CG  . ASP G 1 25  ? 62.240 -16.328 5.860   1.00 45.60 ? 109 ASP G CG  1 
ATOM   8750  O  OD1 . ASP G 1 25  ? 62.973 -17.274 6.237   1.00 48.96 ? 109 ASP G OD1 1 
ATOM   8751  O  OD2 . ASP G 1 25  ? 61.745 -15.495 6.653   1.00 49.43 ? 109 ASP G OD2 1 
ATOM   8752  N  N   . GLU G 1 26  ? 62.319 -17.733 1.553   1.00 41.08 ? 110 GLU G N   1 
ATOM   8753  C  CA  . GLU G 1 26  ? 61.916 -17.941 0.152   1.00 40.65 ? 110 GLU G CA  1 
ATOM   8754  C  C   . GLU G 1 26  ? 62.967 -17.633 -0.853  1.00 40.71 ? 110 GLU G C   1 
ATOM   8755  O  O   . GLU G 1 26  ? 62.723 -17.767 -2.027  1.00 40.62 ? 110 GLU G O   1 
ATOM   8756  C  CB  . GLU G 1 26  ? 60.526 -17.372 -0.198  1.00 40.58 ? 110 GLU G CB  1 
ATOM   8757  C  CG  . GLU G 1 26  ? 59.376 -18.115 0.535   1.00 40.52 ? 110 GLU G CG  1 
ATOM   8758  C  CD  . GLU G 1 26  ? 59.261 -17.783 2.031   1.00 43.43 ? 110 GLU G CD  1 
ATOM   8759  O  OE1 . GLU G 1 26  ? 59.210 -16.567 2.368   1.00 45.53 ? 110 GLU G OE1 1 
ATOM   8760  O  OE2 . GLU G 1 26  ? 59.236 -18.723 2.882   1.00 43.17 ? 110 GLU G OE2 1 
ATOM   8761  N  N   . THR G 1 27  ? 64.146 -17.227 -0.381  1.00 41.48 ? 111 THR G N   1 
ATOM   8762  C  CA  . THR G 1 27  ? 65.260 -16.964 -1.279  1.00 43.22 ? 111 THR G CA  1 
ATOM   8763  C  C   . THR G 1 27  ? 66.320 -18.097 -1.174  1.00 44.02 ? 111 THR G C   1 
ATOM   8764  O  O   . THR G 1 27  ? 66.550 -18.850 -2.138  1.00 44.63 ? 111 THR G O   1 
ATOM   8765  C  CB  . THR G 1 27  ? 65.980 -15.567 -1.011  1.00 43.63 ? 111 THR G CB  1 
ATOM   8766  O  OG1 . THR G 1 27  ? 65.119 -14.654 -0.314  1.00 45.14 ? 111 THR G OG1 1 
ATOM   8767  C  CG2 . THR G 1 27  ? 66.405 -14.951 -2.296  1.00 41.82 ? 111 THR G CG2 1 
ATOM   8768  N  N   . LEU G 1 28  ? 66.969 -18.167 -0.017  1.00 43.54 ? 112 LEU G N   1 
ATOM   8769  C  CA  . LEU G 1 28  ? 67.831 -19.269 0.352   1.00 44.39 ? 112 LEU G CA  1 
ATOM   8770  C  C   . LEU G 1 28  ? 67.105 -20.461 1.005   1.00 45.56 ? 112 LEU G C   1 
ATOM   8771  O  O   . LEU G 1 28  ? 67.508 -21.589 0.774   1.00 47.06 ? 112 LEU G O   1 
ATOM   8772  C  CB  . LEU G 1 28  ? 68.935 -18.797 1.324   1.00 43.50 ? 112 LEU G CB  1 
ATOM   8773  C  CG  . LEU G 1 28  ? 69.902 -17.729 0.798   1.00 39.71 ? 112 LEU G CG  1 
ATOM   8774  C  CD1 . LEU G 1 28  ? 71.041 -17.484 1.762   1.00 34.99 ? 112 LEU G CD1 1 
ATOM   8775  C  CD2 . LEU G 1 28  ? 70.350 -18.037 -0.657  1.00 34.30 ? 112 LEU G CD2 1 
ATOM   8776  N  N   . VAL G 1 29  ? 66.098 -20.214 1.844   1.00 45.50 ? 113 VAL G N   1 
ATOM   8777  C  CA  . VAL G 1 29  ? 65.377 -21.264 2.540   1.00 45.24 ? 113 VAL G CA  1 
ATOM   8778  C  C   . VAL G 1 29  ? 63.828 -21.097 2.560   1.00 47.07 ? 113 VAL G C   1 
ATOM   8779  O  O   . VAL G 1 29  ? 63.256 -20.120 2.035   1.00 46.71 ? 113 VAL G O   1 
ATOM   8780  C  CB  . VAL G 1 29  ? 65.834 -21.389 3.991   1.00 44.96 ? 113 VAL G CB  1 
ATOM   8781  C  CG1 . VAL G 1 29  ? 67.340 -21.488 4.116   1.00 44.46 ? 113 VAL G CG1 1 
ATOM   8782  C  CG2 . VAL G 1 29  ? 65.310 -20.277 4.807   1.00 43.09 ? 113 VAL G CG2 1 
ATOM   8783  N  N   . HIS G 1 30  ? 63.157 -22.082 3.150   1.00 47.82 ? 114 HIS G N   1 
ATOM   8784  C  CA  . HIS G 1 30  ? 61.758 -21.987 3.441   1.00 49.21 ? 114 HIS G CA  1 
ATOM   8785  C  C   . HIS G 1 30  ? 61.366 -22.715 4.697   1.00 49.23 ? 114 HIS G C   1 
ATOM   8786  O  O   . HIS G 1 30  ? 61.411 -23.911 4.742   1.00 50.41 ? 114 HIS G O   1 
ATOM   8787  C  CB  . HIS G 1 30  ? 60.888 -22.513 2.303   1.00 49.61 ? 114 HIS G CB  1 
ATOM   8788  C  CG  . HIS G 1 30  ? 59.456 -22.667 2.720   1.00 53.46 ? 114 HIS G CG  1 
ATOM   8789  N  ND1 . HIS G 1 30  ? 58.684 -21.597 3.134   1.00 52.17 ? 114 HIS G ND1 1 
ATOM   8790  C  CD2 . HIS G 1 30  ? 58.688 -23.773 2.879   1.00 56.27 ? 114 HIS G CD2 1 
ATOM   8791  C  CE1 . HIS G 1 30  ? 57.490 -22.034 3.476   1.00 54.88 ? 114 HIS G CE1 1 
ATOM   8792  N  NE2 . HIS G 1 30  ? 57.466 -23.350 3.337   1.00 57.55 ? 114 HIS G NE2 1 
ATOM   8793  N  N   . SER G 1 31  ? 60.917 -21.985 5.691   1.00 49.89 ? 115 SER G N   1 
ATOM   8794  C  CA  . SER G 1 31  ? 60.558 -22.546 6.966   1.00 50.19 ? 115 SER G CA  1 
ATOM   8795  C  C   . SER G 1 31  ? 59.064 -22.713 7.090   1.00 51.22 ? 115 SER G C   1 
ATOM   8796  O  O   . SER G 1 31  ? 58.289 -22.306 6.205   1.00 51.76 ? 115 SER G O   1 
ATOM   8797  C  CB  . SER G 1 31  ? 61.029 -21.622 8.046   1.00 49.83 ? 115 SER G CB  1 
ATOM   8798  O  OG  . SER G 1 31  ? 62.404 -21.402 7.845   1.00 52.30 ? 115 SER G OG  1 
ATOM   8799  N  N   . SER G 1 32  ? 58.666 -23.307 8.206   1.00 51.70 ? 116 SER G N   1 
ATOM   8800  C  CA  . SER G 1 32  ? 57.314 -23.787 8.392   1.00 52.56 ? 116 SER G CA  1 
ATOM   8801  C  C   . SER G 1 32  ? 57.192 -24.317 9.794   1.00 52.82 ? 116 SER G C   1 
ATOM   8802  O  O   . SER G 1 32  ? 58.170 -24.749 10.384  1.00 52.11 ? 116 SER G O   1 
ATOM   8803  C  CB  . SER G 1 32  ? 56.941 -24.851 7.356   1.00 52.34 ? 116 SER G CB  1 
ATOM   8804  O  OG  . SER G 1 32  ? 55.635 -25.315 7.590   1.00 53.48 ? 116 SER G OG  1 
ATOM   8805  N  N   . PHE G 1 33  ? 55.997 -24.198 10.345  1.00 53.74 ? 117 PHE G N   1 
ATOM   8806  C  CA  . PHE G 1 33  ? 55.778 -24.561 11.732  1.00 55.49 ? 117 PHE G CA  1 
ATOM   8807  C  C   . PHE G 1 33  ? 55.229 -25.991 11.771  1.00 56.60 ? 117 PHE G C   1 
ATOM   8808  O  O   . PHE G 1 33  ? 55.091 -26.571 12.836  1.00 56.86 ? 117 PHE G O   1 
ATOM   8809  C  CB  . PHE G 1 33  ? 54.771 -23.603 12.417  1.00 55.43 ? 117 PHE G CB  1 
ATOM   8810  C  CG  . PHE G 1 33  ? 55.339 -22.272 12.808  1.00 54.30 ? 117 PHE G CG  1 
ATOM   8811  C  CD1 . PHE G 1 33  ? 54.787 -21.094 12.294  1.00 53.05 ? 117 PHE G CD1 1 
ATOM   8812  C  CD2 . PHE G 1 33  ? 56.410 -22.187 13.680  1.00 51.01 ? 117 PHE G CD2 1 
ATOM   8813  C  CE1 . PHE G 1 33  ? 55.296 -19.866 12.646  1.00 52.17 ? 117 PHE G CE1 1 
ATOM   8814  C  CE2 . PHE G 1 33  ? 56.938 -20.958 14.026  1.00 52.58 ? 117 PHE G CE2 1 
ATOM   8815  C  CZ  . PHE G 1 33  ? 56.379 -19.791 13.527  1.00 53.36 ? 117 PHE G CZ  1 
ATOM   8816  N  N   . LYS G 1 34  ? 54.897 -26.521 10.600  1.00 57.82 ? 118 LYS G N   1 
ATOM   8817  C  CA  . LYS G 1 34  ? 54.419 -27.874 10.476  1.00 59.93 ? 118 LYS G CA  1 
ATOM   8818  C  C   . LYS G 1 34  ? 55.577 -28.871 10.365  1.00 61.08 ? 118 LYS G C   1 
ATOM   8819  O  O   . LYS G 1 34  ? 56.402 -28.775 9.452   1.00 61.10 ? 118 LYS G O   1 
ATOM   8820  C  CB  . LYS G 1 34  ? 53.544 -27.981 9.242   1.00 60.02 ? 118 LYS G CB  1 
ATOM   8821  C  CG  . LYS G 1 34  ? 52.882 -29.321 9.027   1.00 60.97 ? 118 LYS G CG  1 
ATOM   8822  C  CD  . LYS G 1 34  ? 52.857 -29.573 7.521   1.00 68.20 ? 118 LYS G CD  1 
ATOM   8823  C  CE  . LYS G 1 34  ? 51.827 -30.658 7.097   1.00 73.04 ? 118 LYS G CE  1 
ATOM   8824  N  NZ  . LYS G 1 34  ? 52.086 -31.103 5.664   1.00 72.06 ? 118 LYS G NZ  1 
ATOM   8825  N  N   . PRO G 1 35  ? 55.630 -29.845 11.286  1.00 62.30 ? 119 PRO G N   1 
ATOM   8826  C  CA  . PRO G 1 35  ? 56.563 -30.976 11.181  1.00 62.58 ? 119 PRO G CA  1 
ATOM   8827  C  C   . PRO G 1 35  ? 56.691 -31.620 9.806   1.00 62.64 ? 119 PRO G C   1 
ATOM   8828  O  O   . PRO G 1 35  ? 55.716 -32.107 9.217   1.00 61.55 ? 119 PRO G O   1 
ATOM   8829  C  CB  . PRO G 1 35  ? 56.015 -31.960 12.214  1.00 62.58 ? 119 PRO G CB  1 
ATOM   8830  C  CG  . PRO G 1 35  ? 55.555 -31.034 13.316  1.00 63.23 ? 119 PRO G CG  1 
ATOM   8831  C  CD  . PRO G 1 35  ? 54.837 -29.927 12.532  1.00 62.74 ? 119 PRO G CD  1 
ATOM   8832  N  N   . ILE G 1 36  ? 57.913 -31.627 9.296   1.00 63.90 ? 120 ILE G N   1 
ATOM   8833  C  CA  . ILE G 1 36  ? 58.140 -32.399 8.081   1.00 65.19 ? 120 ILE G CA  1 
ATOM   8834  C  C   . ILE G 1 36  ? 59.353 -33.386 8.068   1.00 65.48 ? 120 ILE G C   1 
ATOM   8835  O  O   . ILE G 1 36  ? 59.227 -34.570 7.659   1.00 65.21 ? 120 ILE G O   1 
ATOM   8836  C  CB  . ILE G 1 36  ? 58.028 -31.522 6.842   1.00 65.39 ? 120 ILE G CB  1 
ATOM   8837  C  CG1 . ILE G 1 36  ? 59.022 -30.357 6.889   1.00 66.04 ? 120 ILE G CG1 1 
ATOM   8838  C  CG2 . ILE G 1 36  ? 56.601 -30.984 6.735   1.00 65.40 ? 120 ILE G CG2 1 
ATOM   8839  C  CD1 . ILE G 1 36  ? 59.384 -29.862 5.448   1.00 66.52 ? 120 ILE G CD1 1 
ATOM   8840  N  N   . ALA G 1 39  ? 62.960 -32.709 5.787   1.00 68.04 ? 123 ALA G N   1 
ATOM   8841  C  CA  . ALA G 1 39  ? 63.427 -31.557 6.551   1.00 68.32 ? 123 ALA G CA  1 
ATOM   8842  C  C   . ALA G 1 39  ? 64.927 -31.453 6.415   1.00 68.37 ? 123 ALA G C   1 
ATOM   8843  O  O   . ALA G 1 39  ? 65.550 -32.409 5.970   1.00 69.32 ? 123 ALA G O   1 
ATOM   8844  C  CB  . ALA G 1 39  ? 63.031 -31.684 8.011   1.00 68.18 ? 123 ALA G CB  1 
ATOM   8845  N  N   . ASP G 1 40  ? 65.502 -30.303 6.773   1.00 68.12 ? 124 ASP G N   1 
ATOM   8846  C  CA  . ASP G 1 40  ? 66.952 -30.091 6.666   1.00 67.70 ? 124 ASP G CA  1 
ATOM   8847  C  C   . ASP G 1 40  ? 67.560 -29.608 7.954   1.00 67.86 ? 124 ASP G C   1 
ATOM   8848  O  O   . ASP G 1 40  ? 68.568 -30.152 8.365   1.00 68.60 ? 124 ASP G O   1 
ATOM   8849  C  CB  . ASP G 1 40  ? 67.327 -29.201 5.500   1.00 66.87 ? 124 ASP G CB  1 
ATOM   8850  C  CG  . ASP G 1 40  ? 67.029 -29.858 4.161   1.00 69.30 ? 124 ASP G CG  1 
ATOM   8851  O  OD1 . ASP G 1 40  ? 67.272 -31.089 4.028   1.00 70.23 ? 124 ASP G OD1 1 
ATOM   8852  O  OD2 . ASP G 1 40  ? 66.529 -29.161 3.229   1.00 70.81 ? 124 ASP G OD2 1 
ATOM   8853  N  N   . PHE G 1 41  ? 66.971 -28.607 8.601   1.00 68.03 ? 125 PHE G N   1 
ATOM   8854  C  CA  . PHE G 1 41  ? 67.286 -28.338 10.018  1.00 68.53 ? 125 PHE G CA  1 
ATOM   8855  C  C   . PHE G 1 41  ? 65.969 -28.241 10.717  1.00 68.92 ? 125 PHE G C   1 
ATOM   8856  O  O   . PHE G 1 41  ? 64.926 -28.176 10.057  1.00 69.34 ? 125 PHE G O   1 
ATOM   8857  C  CB  . PHE G 1 41  ? 68.056 -27.032 10.232  1.00 68.50 ? 125 PHE G CB  1 
ATOM   8858  C  CG  . PHE G 1 41  ? 68.851 -26.614 9.051   1.00 69.23 ? 125 PHE G CG  1 
ATOM   8859  C  CD1 . PHE G 1 41  ? 68.331 -25.699 8.146   1.00 69.10 ? 125 PHE G CD1 1 
ATOM   8860  C  CD2 . PHE G 1 41  ? 70.108 -27.152 8.821   1.00 70.00 ? 125 PHE G CD2 1 
ATOM   8861  C  CE1 . PHE G 1 41  ? 69.032 -25.323 7.019   1.00 68.44 ? 125 PHE G CE1 1 
ATOM   8862  C  CE2 . PHE G 1 41  ? 70.822 -26.776 7.705   1.00 71.85 ? 125 PHE G CE2 1 
ATOM   8863  C  CZ  . PHE G 1 41  ? 70.263 -25.850 6.789   1.00 70.56 ? 125 PHE G CZ  1 
ATOM   8864  N  N   . ILE G 1 42  ? 66.008 -28.215 12.042  1.00 69.06 ? 126 ILE G N   1 
ATOM   8865  C  CA  . ILE G 1 42  ? 64.803 -28.092 12.832  1.00 69.57 ? 126 ILE G CA  1 
ATOM   8866  C  C   . ILE G 1 42  ? 65.198 -27.234 13.993  1.00 70.35 ? 126 ILE G C   1 
ATOM   8867  O  O   . ILE G 1 42  ? 65.829 -27.703 14.931  1.00 70.98 ? 126 ILE G O   1 
ATOM   8868  C  CB  . ILE G 1 42  ? 64.267 -29.470 13.303  1.00 69.34 ? 126 ILE G CB  1 
ATOM   8869  C  CG1 . ILE G 1 42  ? 63.825 -30.309 12.097  1.00 68.91 ? 126 ILE G CG1 1 
ATOM   8870  C  CG2 . ILE G 1 42  ? 63.138 -29.305 14.301  1.00 68.30 ? 126 ILE G CG2 1 
ATOM   8871  C  CD1 . ILE G 1 42  ? 63.384 -31.710 12.441  1.00 67.32 ? 126 ILE G CD1 1 
ATOM   8872  N  N   . VAL G 1 43  ? 64.857 -25.959 13.918  1.00 71.18 ? 127 VAL G N   1 
ATOM   8873  C  CA  . VAL G 1 43  ? 65.310 -25.015 14.924  1.00 72.14 ? 127 VAL G CA  1 
ATOM   8874  C  C   . VAL G 1 43  ? 64.182 -24.552 15.836  1.00 73.41 ? 127 VAL G C   1 
ATOM   8875  O  O   . VAL G 1 43  ? 63.048 -24.337 15.380  1.00 73.15 ? 127 VAL G O   1 
ATOM   8876  C  CB  . VAL G 1 43  ? 66.153 -23.864 14.295  1.00 71.80 ? 127 VAL G CB  1 
ATOM   8877  C  CG1 . VAL G 1 43  ? 66.043 -23.907 12.799  1.00 71.52 ? 127 VAL G CG1 1 
ATOM   8878  C  CG2 . VAL G 1 43  ? 65.753 -22.481 14.834  1.00 71.36 ? 127 VAL G CG2 1 
ATOM   8879  N  N   . PRO G 1 44  ? 64.480 -24.473 17.148  1.00 74.88 ? 128 PRO G N   1 
ATOM   8880  C  CA  . PRO G 1 44  ? 63.558 -24.033 18.204  1.00 75.64 ? 128 PRO G CA  1 
ATOM   8881  C  C   . PRO G 1 44  ? 63.581 -22.530 18.508  1.00 76.37 ? 128 PRO G C   1 
ATOM   8882  O  O   . PRO G 1 44  ? 64.646 -21.921 18.573  1.00 76.34 ? 128 PRO G O   1 
ATOM   8883  C  CB  . PRO G 1 44  ? 64.019 -24.842 19.433  1.00 75.90 ? 128 PRO G CB  1 
ATOM   8884  C  CG  . PRO G 1 44  ? 65.439 -25.362 19.090  1.00 75.35 ? 128 PRO G CG  1 
ATOM   8885  C  CD  . PRO G 1 44  ? 65.784 -24.899 17.701  1.00 75.23 ? 128 PRO G CD  1 
ATOM   8886  N  N   . ILE G 1 45  ? 62.384 -21.975 18.715  1.00 77.76 ? 129 ILE G N   1 
ATOM   8887  C  CA  . ILE G 1 45  ? 62.130 -20.543 18.944  1.00 79.07 ? 129 ILE G CA  1 
ATOM   8888  C  C   . ILE G 1 45  ? 61.103 -20.328 20.073  1.00 80.06 ? 129 ILE G C   1 
ATOM   8889  O  O   . ILE G 1 45  ? 60.093 -21.029 20.121  1.00 79.61 ? 129 ILE G O   1 
ATOM   8890  C  CB  . ILE G 1 45  ? 61.576 -19.882 17.656  1.00 79.03 ? 129 ILE G CB  1 
ATOM   8891  C  CG1 . ILE G 1 45  ? 62.529 -20.132 16.479  1.00 78.38 ? 129 ILE G CG1 1 
ATOM   8892  C  CG2 . ILE G 1 45  ? 61.271 -18.383 17.888  1.00 78.22 ? 129 ILE G CG2 1 
ATOM   8893  C  CD1 . ILE G 1 45  ? 62.270 -19.258 15.288  1.00 79.97 ? 129 ILE G CD1 1 
ATOM   8894  N  N   . GLU G 1 46  ? 61.358 -19.360 20.961  1.00 81.78 ? 130 GLU G N   1 
ATOM   8895  C  CA  . GLU G 1 46  ? 60.463 -19.099 22.100  1.00 83.37 ? 130 GLU G CA  1 
ATOM   8896  C  C   . GLU G 1 46  ? 59.489 -17.941 21.862  1.00 83.90 ? 130 GLU G C   1 
ATOM   8897  O  O   . GLU G 1 46  ? 59.777 -16.793 22.208  1.00 84.29 ? 130 GLU G O   1 
ATOM   8898  C  CB  . GLU G 1 46  ? 61.227 -18.920 23.441  1.00 83.32 ? 130 GLU G CB  1 
ATOM   8899  C  CG  . GLU G 1 46  ? 60.270 -18.583 24.636  1.00 83.31 ? 130 GLU G CG  1 
ATOM   8900  C  CD  . GLU G 1 46  ? 60.960 -18.314 25.994  1.00 84.57 ? 130 GLU G CD  1 
ATOM   8901  O  OE1 . GLU G 1 46  ? 61.716 -19.188 26.490  1.00 84.49 ? 130 GLU G OE1 1 
ATOM   8902  O  OE2 . GLU G 1 46  ? 60.702 -17.228 26.579  1.00 85.13 ? 130 GLU G OE2 1 
ATOM   8903  N  N   . ILE G 1 47  ? 58.326 -18.263 21.300  1.00 84.61 ? 131 ILE G N   1 
ATOM   8904  C  CA  . ILE G 1 47  ? 57.301 -17.265 20.973  1.00 85.18 ? 131 ILE G CA  1 
ATOM   8905  C  C   . ILE G 1 47  ? 56.301 -17.060 22.112  1.00 85.97 ? 131 ILE G C   1 
ATOM   8906  O  O   . ILE G 1 47  ? 55.457 -17.932 22.411  1.00 86.02 ? 131 ILE G O   1 
ATOM   8907  C  CB  . ILE G 1 47  ? 56.536 -17.612 19.661  1.00 85.39 ? 131 ILE G CB  1 
ATOM   8908  C  CG1 . ILE G 1 47  ? 57.537 -17.963 18.536  1.00 84.98 ? 131 ILE G CG1 1 
ATOM   8909  C  CG2 . ILE G 1 47  ? 55.548 -16.471 19.308  1.00 85.45 ? 131 ILE G CG2 1 
ATOM   8910  C  CD1 . ILE G 1 47  ? 56.941 -18.388 17.210  1.00 84.50 ? 131 ILE G CD1 1 
ATOM   8911  N  N   . GLU G 1 48  ? 56.391 -15.882 22.726  1.00 86.49 ? 132 GLU G N   1 
ATOM   8912  C  CA  . GLU G 1 48  ? 55.562 -15.553 23.876  1.00 86.68 ? 132 GLU G CA  1 
ATOM   8913  C  C   . GLU G 1 48  ? 55.629 -16.737 24.832  1.00 86.02 ? 132 GLU G C   1 
ATOM   8914  O  O   . GLU G 1 48  ? 54.631 -17.406 25.098  1.00 86.44 ? 132 GLU G O   1 
ATOM   8915  C  CB  . GLU G 1 48  ? 54.122 -15.198 23.441  1.00 87.05 ? 132 GLU G CB  1 
ATOM   8916  C  CG  . GLU G 1 48  ? 53.973 -13.730 22.956  1.00 89.49 ? 132 GLU G CG  1 
ATOM   8917  C  CD  . GLU G 1 48  ? 53.035 -13.532 21.735  1.00 91.58 ? 132 GLU G CD  1 
ATOM   8918  O  OE1 . GLU G 1 48  ? 52.404 -14.511 21.271  1.00 93.46 ? 132 GLU G OE1 1 
ATOM   8919  O  OE2 . GLU G 1 48  ? 52.928 -12.385 21.237  1.00 90.25 ? 132 GLU G OE2 1 
ATOM   8920  N  N   . GLY G 1 49  ? 56.847 -17.019 25.282  1.00 85.22 ? 133 GLY G N   1 
ATOM   8921  C  CA  . GLY G 1 49  ? 57.093 -17.921 26.401  1.00 84.43 ? 133 GLY G CA  1 
ATOM   8922  C  C   . GLY G 1 49  ? 57.282 -19.381 26.042  1.00 83.60 ? 133 GLY G C   1 
ATOM   8923  O  O   . GLY G 1 49  ? 58.062 -20.100 26.683  1.00 83.38 ? 133 GLY G O   1 
ATOM   8924  N  N   . THR G 1 50  ? 56.559 -19.818 25.016  1.00 82.71 ? 134 THR G N   1 
ATOM   8925  C  CA  . THR G 1 50  ? 56.480 -21.240 24.691  1.00 81.52 ? 134 THR G CA  1 
ATOM   8926  C  C   . THR G 1 50  ? 57.271 -21.486 23.432  1.00 80.14 ? 134 THR G C   1 
ATOM   8927  O  O   . THR G 1 50  ? 57.085 -20.806 22.412  1.00 79.98 ? 134 THR G O   1 
ATOM   8928  C  CB  . THR G 1 50  ? 55.009 -21.766 24.529  1.00 81.63 ? 134 THR G CB  1 
ATOM   8929  O  OG1 . THR G 1 50  ? 54.719 -22.027 23.148  1.00 81.85 ? 134 THR G OG1 1 
ATOM   8930  C  CG2 . THR G 1 50  ? 53.980 -20.771 25.115  1.00 82.26 ? 134 THR G CG2 1 
ATOM   8931  N  N   . THR G 1 51  ? 58.161 -22.462 23.503  1.00 78.50 ? 135 THR G N   1 
ATOM   8932  C  CA  . THR G 1 51  ? 59.014 -22.711 22.362  1.00 76.76 ? 135 THR G CA  1 
ATOM   8933  C  C   . THR G 1 51  ? 58.220 -23.414 21.267  1.00 75.41 ? 135 THR G C   1 
ATOM   8934  O  O   . THR G 1 51  ? 57.270 -24.141 21.548  1.00 75.04 ? 135 THR G O   1 
ATOM   8935  C  CB  . THR G 1 51  ? 60.380 -23.383 22.730  1.00 76.77 ? 135 THR G CB  1 
ATOM   8936  O  OG1 . THR G 1 51  ? 60.475 -24.699 22.175  1.00 75.37 ? 135 THR G OG1 1 
ATOM   8937  C  CG2 . THR G 1 51  ? 60.605 -23.382 24.249  1.00 76.77 ? 135 THR G CG2 1 
ATOM   8938  N  N   . HIS G 1 52  ? 58.583 -23.120 20.027  1.00 73.38 ? 136 HIS G N   1 
ATOM   8939  C  CA  . HIS G 1 52  ? 58.038 -23.796 18.883  1.00 71.78 ? 136 HIS G CA  1 
ATOM   8940  C  C   . HIS G 1 52  ? 59.211 -24.284 18.059  1.00 69.93 ? 136 HIS G C   1 
ATOM   8941  O  O   . HIS G 1 52  ? 60.310 -23.811 18.217  1.00 69.59 ? 136 HIS G O   1 
ATOM   8942  C  CB  . HIS G 1 52  ? 57.224 -22.826 18.036  1.00 72.32 ? 136 HIS G CB  1 
ATOM   8943  C  CG  . HIS G 1 52  ? 56.091 -22.170 18.757  1.00 74.89 ? 136 HIS G CG  1 
ATOM   8944  N  ND1 . HIS G 1 52  ? 55.003 -22.870 19.238  1.00 77.42 ? 136 HIS G ND1 1 
ATOM   8945  C  CD2 . HIS G 1 52  ? 55.846 -20.865 19.021  1.00 77.02 ? 136 HIS G CD2 1 
ATOM   8946  C  CE1 . HIS G 1 52  ? 54.150 -22.025 19.792  1.00 78.32 ? 136 HIS G CE1 1 
ATOM   8947  N  NE2 . HIS G 1 52  ? 54.637 -20.800 19.667  1.00 78.12 ? 136 HIS G NE2 1 
ATOM   8948  N  N   . GLN G 1 53  ? 58.969 -25.209 17.152  1.00 68.07 ? 137 GLN G N   1 
ATOM   8949  C  CA  . GLN G 1 53  ? 60.035 -25.738 16.341  1.00 67.03 ? 137 GLN G CA  1 
ATOM   8950  C  C   . GLN G 1 53  ? 59.822 -25.319 14.898  1.00 65.30 ? 137 GLN G C   1 
ATOM   8951  O  O   . GLN G 1 53  ? 58.674 -25.326 14.408  1.00 64.74 ? 137 GLN G O   1 
ATOM   8952  C  CB  . GLN G 1 53  ? 60.041 -27.272 16.428  1.00 68.20 ? 137 GLN G CB  1 
ATOM   8953  C  CG  . GLN G 1 53  ? 60.325 -27.846 17.830  1.00 70.31 ? 137 GLN G CG  1 
ATOM   8954  C  CD  . GLN G 1 53  ? 61.776 -28.224 17.985  1.00 73.01 ? 137 GLN G CD  1 
ATOM   8955  O  OE1 . GLN G 1 53  ? 62.480 -27.691 18.848  1.00 74.37 ? 137 GLN G OE1 1 
ATOM   8956  N  NE2 . GLN G 1 53  ? 62.244 -29.139 17.127  1.00 73.02 ? 137 GLN G NE2 1 
ATOM   8957  N  N   . VAL G 1 54  ? 60.917 -24.988 14.207  1.00 62.32 ? 138 VAL G N   1 
ATOM   8958  C  CA  . VAL G 1 54  ? 60.794 -24.529 12.828  1.00 60.09 ? 138 VAL G CA  1 
ATOM   8959  C  C   . VAL G 1 54  ? 61.439 -25.513 11.844  1.00 58.42 ? 138 VAL G C   1 
ATOM   8960  O  O   . VAL G 1 54  ? 62.609 -25.766 11.953  1.00 58.54 ? 138 VAL G O   1 
ATOM   8961  C  CB  . VAL G 1 54  ? 61.328 -23.024 12.614  1.00 60.22 ? 138 VAL G CB  1 
ATOM   8962  C  CG1 . VAL G 1 54  ? 60.935 -22.486 11.219  1.00 58.72 ? 138 VAL G CG1 1 
ATOM   8963  C  CG2 . VAL G 1 54  ? 60.835 -22.070 13.718  1.00 57.29 ? 138 VAL G CG2 1 
ATOM   8964  N  N   . TYR G 1 55  ? 60.679 -26.023 10.877  1.00 56.20 ? 139 TYR G N   1 
ATOM   8965  C  CA  . TYR G 1 55  ? 61.174 -27.002 9.926   1.00 54.92 ? 139 TYR G CA  1 
ATOM   8966  C  C   . TYR G 1 55  ? 61.657 -26.327 8.676   1.00 53.95 ? 139 TYR G C   1 
ATOM   8967  O  O   . TYR G 1 55  ? 60.867 -25.948 7.814   1.00 54.18 ? 139 TYR G O   1 
ATOM   8968  C  CB  . TYR G 1 55  ? 60.093 -28.055 9.583   1.00 56.54 ? 139 TYR G CB  1 
ATOM   8969  C  CG  . TYR G 1 55  ? 59.725 -28.840 10.800  1.00 58.57 ? 139 TYR G CG  1 
ATOM   8970  C  CD1 . TYR G 1 55  ? 58.837 -28.307 11.738  1.00 59.31 ? 139 TYR G CD1 1 
ATOM   8971  C  CD2 . TYR G 1 55  ? 60.344 -30.060 11.084  1.00 59.82 ? 139 TYR G CD2 1 
ATOM   8972  C  CE1 . TYR G 1 55  ? 58.535 -28.977 12.903  1.00 61.40 ? 139 TYR G CE1 1 
ATOM   8973  C  CE2 . TYR G 1 55  ? 60.049 -30.744 12.282  1.00 62.16 ? 139 TYR G CE2 1 
ATOM   8974  C  CZ  . TYR G 1 55  ? 59.139 -30.185 13.179  1.00 60.22 ? 139 TYR G CZ  1 
ATOM   8975  O  OH  . TYR G 1 55  ? 58.806 -30.819 14.339  1.00 60.02 ? 139 TYR G OH  1 
ATOM   8976  N  N   . VAL G 1 56  ? 62.971 -26.225 8.548   1.00 52.30 ? 140 VAL G N   1 
ATOM   8977  C  CA  . VAL G 1 56  ? 63.595 -25.459 7.497   1.00 50.48 ? 140 VAL G CA  1 
ATOM   8978  C  C   . VAL G 1 56  ? 64.090 -26.333 6.332   1.00 50.88 ? 140 VAL G C   1 
ATOM   8979  O  O   . VAL G 1 56  ? 64.676 -27.367 6.571   1.00 51.33 ? 140 VAL G O   1 
ATOM   8980  C  CB  . VAL G 1 56  ? 64.775 -24.713 8.125   1.00 50.49 ? 140 VAL G CB  1 
ATOM   8981  C  CG1 . VAL G 1 56  ? 65.400 -23.758 7.138   1.00 48.93 ? 140 VAL G CG1 1 
ATOM   8982  C  CG2 . VAL G 1 56  ? 64.335 -24.033 9.428   1.00 46.23 ? 140 VAL G CG2 1 
ATOM   8983  N  N   . LEU G 1 57  ? 63.856 -25.912 5.087   1.00 50.59 ? 141 LEU G N   1 
ATOM   8984  C  CA  . LEU G 1 57  ? 64.366 -26.590 3.886   1.00 50.26 ? 141 LEU G CA  1 
ATOM   8985  C  C   . LEU G 1 57  ? 65.308 -25.715 3.044   1.00 50.91 ? 141 LEU G C   1 
ATOM   8986  O  O   . LEU G 1 57  ? 64.915 -24.671 2.567   1.00 51.36 ? 141 LEU G O   1 
ATOM   8987  C  CB  . LEU G 1 57  ? 63.215 -27.043 2.988   1.00 49.51 ? 141 LEU G CB  1 
ATOM   8988  C  CG  . LEU G 1 57  ? 62.193 -27.984 3.649   1.00 49.92 ? 141 LEU G CG  1 
ATOM   8989  C  CD1 . LEU G 1 57  ? 61.007 -28.250 2.757   1.00 46.85 ? 141 LEU G CD1 1 
ATOM   8990  C  CD2 . LEU G 1 57  ? 62.812 -29.305 4.080   1.00 51.18 ? 141 LEU G CD2 1 
ATOM   8991  N  N   . LYS G 1 58  ? 66.545 -26.159 2.839   1.00 51.00 ? 142 LYS G N   1 
ATOM   8992  C  CA  . LYS G 1 58  ? 67.499 -25.457 2.007   1.00 50.68 ? 142 LYS G CA  1 
ATOM   8993  C  C   . LYS G 1 58  ? 67.054 -25.509 0.560   1.00 49.84 ? 142 LYS G C   1 
ATOM   8994  O  O   . LYS G 1 58  ? 66.618 -26.531 0.072   1.00 49.94 ? 142 LYS G O   1 
ATOM   8995  C  CB  . LYS G 1 58  ? 68.854 -26.139 2.112   1.00 50.82 ? 142 LYS G CB  1 
ATOM   8996  C  CG  . LYS G 1 58  ? 69.552 -26.032 3.460   1.00 51.61 ? 142 LYS G CG  1 
ATOM   8997  C  CD  . LYS G 1 58  ? 70.672 -27.126 3.570   1.00 53.17 ? 142 LYS G CD  1 
ATOM   8998  C  CE  . LYS G 1 58  ? 71.578 -27.297 2.288   1.00 57.61 ? 142 LYS G CE  1 
ATOM   8999  N  NZ  . LYS G 1 58  ? 72.267 -28.678 2.106   1.00 53.81 ? 142 LYS G NZ  1 
ATOM   9000  N  N   . ARG G 1 59  ? 67.165 -24.401 -0.143  1.00 49.32 ? 143 ARG G N   1 
ATOM   9001  C  CA  . ARG G 1 59  ? 66.900 -24.390 -1.564  1.00 48.53 ? 143 ARG G CA  1 
ATOM   9002  C  C   . ARG G 1 59  ? 68.008 -25.213 -2.243  1.00 49.23 ? 143 ARG G C   1 
ATOM   9003  O  O   . ARG G 1 59  ? 69.180 -25.169 -1.828  1.00 49.60 ? 143 ARG G O   1 
ATOM   9004  C  CB  . ARG G 1 59  ? 66.924 -22.944 -2.080  1.00 47.66 ? 143 ARG G CB  1 
ATOM   9005  C  CG  . ARG G 1 59  ? 66.663 -22.764 -3.563  1.00 45.69 ? 143 ARG G CG  1 
ATOM   9006  C  CD  . ARG G 1 59  ? 66.371 -21.310 -3.860  1.00 43.91 ? 143 ARG G CD  1 
ATOM   9007  N  NE  . ARG G 1 59  ? 65.725 -21.158 -5.163  1.00 48.17 ? 143 ARG G NE  1 
ATOM   9008  C  CZ  . ARG G 1 59  ? 65.070 -20.074 -5.581  1.00 47.79 ? 143 ARG G CZ  1 
ATOM   9009  N  NH1 . ARG G 1 59  ? 64.983 -19.020 -4.762  1.00 46.24 ? 143 ARG G NH1 1 
ATOM   9010  N  NH2 . ARG G 1 59  ? 64.512 -20.056 -6.811  1.00 44.68 ? 143 ARG G NH2 1 
ATOM   9011  N  N   . PRO G 1 60  ? 67.645 -25.978 -3.286  1.00 49.18 ? 144 PRO G N   1 
ATOM   9012  C  CA  . PRO G 1 60  ? 68.677 -26.638 -4.097  1.00 48.83 ? 144 PRO G CA  1 
ATOM   9013  C  C   . PRO G 1 60  ? 69.868 -25.718 -4.460  1.00 49.24 ? 144 PRO G C   1 
ATOM   9014  O  O   . PRO G 1 60  ? 69.663 -24.510 -4.763  1.00 50.97 ? 144 PRO G O   1 
ATOM   9015  C  CB  . PRO G 1 60  ? 67.905 -27.067 -5.343  1.00 48.29 ? 144 PRO G CB  1 
ATOM   9016  C  CG  . PRO G 1 60  ? 66.524 -27.404 -4.778  1.00 47.79 ? 144 PRO G CG  1 
ATOM   9017  C  CD  . PRO G 1 60  ? 66.275 -26.331 -3.727  1.00 48.55 ? 144 PRO G CD  1 
ATOM   9018  N  N   . TYR G 1 61  ? 71.082 -26.302 -4.389  1.00 46.85 ? 145 TYR G N   1 
ATOM   9019  C  CA  . TYR G 1 61  ? 72.359 -25.710 -4.726  1.00 45.31 ? 145 TYR G CA  1 
ATOM   9020  C  C   . TYR G 1 61  ? 72.842 -24.577 -3.868  1.00 46.00 ? 145 TYR G C   1 
ATOM   9021  O  O   . TYR G 1 61  ? 73.766 -23.864 -4.261  1.00 45.04 ? 145 TYR G O   1 
ATOM   9022  C  CB  . TYR G 1 61  ? 72.369 -25.291 -6.168  1.00 45.70 ? 145 TYR G CB  1 
ATOM   9023  C  CG  . TYR G 1 61  ? 72.124 -26.456 -7.118  1.00 47.24 ? 145 TYR G CG  1 
ATOM   9024  C  CD1 . TYR G 1 61  ? 70.967 -26.492 -7.900  1.00 46.63 ? 145 TYR G CD1 1 
ATOM   9025  C  CD2 . TYR G 1 61  ? 73.062 -27.546 -7.233  1.00 47.59 ? 145 TYR G CD2 1 
ATOM   9026  C  CE1 . TYR G 1 61  ? 70.719 -27.562 -8.796  1.00 47.56 ? 145 TYR G CE1 1 
ATOM   9027  C  CE2 . TYR G 1 61  ? 72.795 -28.660 -8.117  1.00 44.67 ? 145 TYR G CE2 1 
ATOM   9028  C  CZ  . TYR G 1 61  ? 71.636 -28.648 -8.895  1.00 47.77 ? 145 TYR G CZ  1 
ATOM   9029  O  OH  . TYR G 1 61  ? 71.338 -29.670 -9.835  1.00 44.72 ? 145 TYR G OH  1 
ATOM   9030  N  N   . VAL G 1 62  ? 72.264 -24.438 -2.673  1.00 47.10 ? 146 VAL G N   1 
ATOM   9031  C  CA  . VAL G 1 62  ? 72.578 -23.294 -1.841  1.00 48.07 ? 146 VAL G CA  1 
ATOM   9032  C  C   . VAL G 1 62  ? 74.003 -23.262 -1.315  1.00 48.79 ? 146 VAL G C   1 
ATOM   9033  O  O   . VAL G 1 62  ? 74.666 -22.212 -1.258  1.00 49.65 ? 146 VAL G O   1 
ATOM   9034  C  CB  . VAL G 1 62  ? 71.542 -23.099 -0.705  1.00 47.71 ? 146 VAL G CB  1 
ATOM   9035  C  CG1 . VAL G 1 62  ? 71.683 -24.134 0.346   1.00 47.67 ? 146 VAL G CG1 1 
ATOM   9036  C  CG2 . VAL G 1 62  ? 71.720 -21.717 -0.084  1.00 48.65 ? 146 VAL G CG2 1 
ATOM   9037  N  N   . ASP G 1 63  ? 74.464 -24.424 -0.894  1.00 50.25 ? 147 ASP G N   1 
ATOM   9038  C  CA  . ASP G 1 63  ? 75.787 -24.575 -0.326  1.00 50.36 ? 147 ASP G CA  1 
ATOM   9039  C  C   . ASP G 1 63  ? 76.843 -24.219 -1.375  1.00 50.11 ? 147 ASP G C   1 
ATOM   9040  O  O   . ASP G 1 63  ? 77.764 -23.493 -1.123  1.00 48.66 ? 147 ASP G O   1 
ATOM   9041  C  CB  . ASP G 1 63  ? 75.918 -26.007 0.151   1.00 50.98 ? 147 ASP G CB  1 
ATOM   9042  C  CG  . ASP G 1 63  ? 75.359 -26.199 1.536   1.00 52.41 ? 147 ASP G CG  1 
ATOM   9043  O  OD1 . ASP G 1 63  ? 75.506 -25.294 2.370   1.00 54.24 ? 147 ASP G OD1 1 
ATOM   9044  O  OD2 . ASP G 1 63  ? 74.783 -27.268 1.797   1.00 57.37 ? 147 ASP G OD2 1 
ATOM   9045  N  N   . GLU G 1 64  ? 76.650 -24.711 -2.575  1.00 51.08 ? 148 GLU G N   1 
ATOM   9046  C  CA  . GLU G 1 64  ? 77.538 -24.403 -3.620  1.00 53.54 ? 148 GLU G CA  1 
ATOM   9047  C  C   . GLU G 1 64  ? 77.373 -22.942 -4.048  1.00 54.44 ? 148 GLU G C   1 
ATOM   9048  O  O   . GLU G 1 64  ? 78.230 -22.372 -4.757  1.00 56.03 ? 148 GLU G O   1 
ATOM   9049  C  CB  . GLU G 1 64  ? 77.381 -25.404 -4.794  1.00 53.65 ? 148 GLU G CB  1 
ATOM   9050  C  CG  . GLU G 1 64  ? 76.023 -26.184 -4.907  1.00 57.87 ? 148 GLU G CG  1 
ATOM   9051  C  CD  . GLU G 1 64  ? 75.724 -27.233 -3.780  1.00 60.68 ? 148 GLU G CD  1 
ATOM   9052  O  OE1 . GLU G 1 64  ? 75.705 -28.466 -4.066  1.00 58.99 ? 148 GLU G OE1 1 
ATOM   9053  O  OE2 . GLU G 1 64  ? 75.476 -26.821 -2.611  1.00 61.73 ? 148 GLU G OE2 1 
ATOM   9054  N  N   . PHE G 1 65  ? 76.275 -22.314 -3.627  1.00 55.02 ? 149 PHE G N   1 
ATOM   9055  C  CA  . PHE G 1 65  ? 75.944 -20.982 -4.132  1.00 53.72 ? 149 PHE G CA  1 
ATOM   9056  C  C   . PHE G 1 65  ? 76.738 -19.956 -3.354  1.00 53.50 ? 149 PHE G C   1 
ATOM   9057  O  O   . PHE G 1 65  ? 77.347 -19.084 -3.956  1.00 52.65 ? 149 PHE G O   1 
ATOM   9058  C  CB  . PHE G 1 65  ? 74.445 -20.676 -4.025  1.00 53.39 ? 149 PHE G CB  1 
ATOM   9059  C  CG  . PHE G 1 65  ? 74.100 -19.255 -4.408  1.00 53.93 ? 149 PHE G CG  1 
ATOM   9060  C  CD1 . PHE G 1 65  ? 73.950 -18.897 -5.757  1.00 51.99 ? 149 PHE G CD1 1 
ATOM   9061  C  CD2 . PHE G 1 65  ? 73.989 -18.266 -3.438  1.00 51.20 ? 149 PHE G CD2 1 
ATOM   9062  C  CE1 . PHE G 1 65  ? 73.679 -17.594 -6.105  1.00 48.75 ? 149 PHE G CE1 1 
ATOM   9063  C  CE2 . PHE G 1 65  ? 73.698 -16.975 -3.798  1.00 49.05 ? 149 PHE G CE2 1 
ATOM   9064  C  CZ  . PHE G 1 65  ? 73.538 -16.649 -5.120  1.00 49.13 ? 149 PHE G CZ  1 
ATOM   9065  N  N   . LEU G 1 66  ? 76.723 -20.089 -2.031  1.00 53.04 ? 150 LEU G N   1 
ATOM   9066  C  CA  . LEU G 1 66  ? 77.436 -19.187 -1.144  1.00 54.95 ? 150 LEU G CA  1 
ATOM   9067  C  C   . LEU G 1 66  ? 78.944 -19.345 -1.064  1.00 56.05 ? 150 LEU G C   1 
ATOM   9068  O  O   . LEU G 1 66  ? 79.638 -18.472 -0.543  1.00 56.64 ? 150 LEU G O   1 
ATOM   9069  C  CB  . LEU G 1 66  ? 76.919 -19.349 0.281   1.00 54.76 ? 150 LEU G CB  1 
ATOM   9070  C  CG  . LEU G 1 66  ? 75.427 -19.196 0.535   1.00 56.47 ? 150 LEU G CG  1 
ATOM   9071  C  CD1 . LEU G 1 66  ? 75.088 -19.520 2.020   1.00 56.26 ? 150 LEU G CD1 1 
ATOM   9072  C  CD2 . LEU G 1 66  ? 74.950 -17.805 0.098   1.00 54.92 ? 150 LEU G CD2 1 
ATOM   9073  N  N   . ARG G 1 67  ? 79.438 -20.502 -1.479  1.00 57.27 ? 151 ARG G N   1 
ATOM   9074  C  CA  . ARG G 1 67  ? 80.836 -20.820 -1.360  1.00 57.65 ? 151 ARG G CA  1 
ATOM   9075  C  C   . ARG G 1 67  ? 81.478 -20.012 -2.469  1.00 57.69 ? 151 ARG G C   1 
ATOM   9076  O  O   . ARG G 1 67  ? 82.411 -19.235 -2.224  1.00 57.34 ? 151 ARG G O   1 
ATOM   9077  C  CB  . ARG G 1 67  ? 81.023 -22.328 -1.544  1.00 58.25 ? 151 ARG G CB  1 
ATOM   9078  C  CG  . ARG G 1 67  ? 82.464 -22.878 -1.375  1.00 59.94 ? 151 ARG G CG  1 
ATOM   9079  C  CD  . ARG G 1 67  ? 83.312 -23.064 -2.699  1.00 60.98 ? 151 ARG G CD  1 
ATOM   9080  N  NE  . ARG G 1 67  ? 82.577 -23.498 -3.888  1.00 59.24 ? 151 ARG G NE  1 
ATOM   9081  C  CZ  . ARG G 1 67  ? 82.911 -23.115 -5.128  1.00 64.89 ? 151 ARG G CZ  1 
ATOM   9082  N  NH1 . ARG G 1 67  ? 83.964 -22.306 -5.340  1.00 65.66 ? 151 ARG G NH1 1 
ATOM   9083  N  NH2 . ARG G 1 67  ? 82.204 -23.522 -6.174  1.00 65.37 ? 151 ARG G NH2 1 
ATOM   9084  N  N   . ARG G 1 68  ? 80.936 -20.175 -3.677  1.00 57.18 ? 152 ARG G N   1 
ATOM   9085  C  CA  . ARG G 1 68  ? 81.335 -19.377 -4.806  1.00 57.36 ? 152 ARG G CA  1 
ATOM   9086  C  C   . ARG G 1 68  ? 81.221 -17.869 -4.541  1.00 57.92 ? 152 ARG G C   1 
ATOM   9087  O  O   . ARG G 1 68  ? 82.256 -17.179 -4.527  1.00 58.37 ? 152 ARG G O   1 
ATOM   9088  C  CB  . ARG G 1 68  ? 80.504 -19.764 -6.011  1.00 57.86 ? 152 ARG G CB  1 
ATOM   9089  C  CG  . ARG G 1 68  ? 81.082 -19.258 -7.354  1.00 58.86 ? 152 ARG G CG  1 
ATOM   9090  C  CD  . ARG G 1 68  ? 82.619 -19.075 -7.285  1.00 56.62 ? 152 ARG G CD  1 
ATOM   9091  N  NE  . ARG G 1 68  ? 83.226 -18.842 -8.602  1.00 54.86 ? 152 ARG G NE  1 
ATOM   9092  C  CZ  . ARG G 1 68  ? 84.445 -18.322 -8.779  1.00 53.10 ? 152 ARG G CZ  1 
ATOM   9093  N  NH1 . ARG G 1 68  ? 85.207 -17.965 -7.743  1.00 51.61 ? 152 ARG G NH1 1 
ATOM   9094  N  NH2 . ARG G 1 68  ? 84.892 -18.146 -9.999  1.00 52.05 ? 152 ARG G NH2 1 
ATOM   9095  N  N   . MET G 1 69  ? 79.978 -17.371 -4.321  1.00 57.55 ? 153 MET G N   1 
ATOM   9096  C  CA  . MET G 1 69  ? 79.682 -15.944 -4.009  1.00 56.32 ? 153 MET G CA  1 
ATOM   9097  C  C   . MET G 1 69  ? 80.598 -15.399 -2.923  1.00 55.89 ? 153 MET G C   1 
ATOM   9098  O  O   . MET G 1 69  ? 81.060 -14.280 -3.020  1.00 55.40 ? 153 MET G O   1 
ATOM   9099  C  CB  . MET G 1 69  ? 78.216 -15.706 -3.546  1.00 56.36 ? 153 MET G CB  1 
ATOM   9100  C  CG  . MET G 1 69  ? 77.097 -16.137 -4.472  1.00 54.40 ? 153 MET G CG  1 
ATOM   9101  S  SD  . MET G 1 69  ? 76.874 -15.140 -5.923  1.00 56.67 ? 153 MET G SD  1 
ATOM   9102  C  CE  . MET G 1 69  ? 76.595 -13.611 -5.067  1.00 58.45 ? 153 MET G CE  1 
ATOM   9103  N  N   . GLY G 1 70  ? 80.815 -16.191 -1.879  1.00 55.70 ? 154 GLY G N   1 
ATOM   9104  C  CA  . GLY G 1 70  ? 81.770 -15.881 -0.831  1.00 55.72 ? 154 GLY G CA  1 
ATOM   9105  C  C   . GLY G 1 70  ? 83.195 -15.666 -1.330  1.00 56.20 ? 154 GLY G C   1 
ATOM   9106  O  O   . GLY G 1 70  ? 83.985 -15.049 -0.645  1.00 55.89 ? 154 GLY G O   1 
ATOM   9107  N  N   . GLU G 1 71  ? 83.545 -16.150 -2.514  1.00 56.70 ? 155 GLU G N   1 
ATOM   9108  C  CA  . GLU G 1 71  ? 84.843 -15.763 -3.062  1.00 58.54 ? 155 GLU G CA  1 
ATOM   9109  C  C   . GLU G 1 71  ? 84.737 -14.447 -3.872  1.00 58.68 ? 155 GLU G C   1 
ATOM   9110  O  O   . GLU G 1 71  ? 85.596 -13.549 -3.790  1.00 59.90 ? 155 GLU G O   1 
ATOM   9111  C  CB  . GLU G 1 71  ? 85.459 -16.835 -3.972  1.00 59.39 ? 155 GLU G CB  1 
ATOM   9112  C  CG  . GLU G 1 71  ? 85.653 -18.268 -3.430  1.00 61.36 ? 155 GLU G CG  1 
ATOM   9113  C  CD  . GLU G 1 71  ? 85.589 -19.264 -4.609  1.00 66.79 ? 155 GLU G CD  1 
ATOM   9114  O  OE1 . GLU G 1 71  ? 85.417 -18.755 -5.765  1.00 65.89 ? 155 GLU G OE1 1 
ATOM   9115  O  OE2 . GLU G 1 71  ? 85.681 -20.521 -4.396  1.00 68.74 ? 155 GLU G OE2 1 
ATOM   9116  N  N   . LEU G 1 72  ? 83.702 -14.324 -4.683  1.00 57.32 ? 156 LEU G N   1 
ATOM   9117  C  CA  . LEU G 1 72  ? 83.592 -13.108 -5.455  1.00 55.45 ? 156 LEU G CA  1 
ATOM   9118  C  C   . LEU G 1 72  ? 83.140 -11.827 -4.716  1.00 54.05 ? 156 LEU G C   1 
ATOM   9119  O  O   . LEU G 1 72  ? 83.255 -10.769 -5.312  1.00 53.64 ? 156 LEU G O   1 
ATOM   9120  C  CB  . LEU G 1 72  ? 82.743 -13.358 -6.688  1.00 55.69 ? 156 LEU G CB  1 
ATOM   9121  C  CG  . LEU G 1 72  ? 83.182 -14.602 -7.459  1.00 56.01 ? 156 LEU G CG  1 
ATOM   9122  C  CD1 . LEU G 1 72  ? 82.153 -15.029 -8.509  1.00 54.52 ? 156 LEU G CD1 1 
ATOM   9123  C  CD2 . LEU G 1 72  ? 84.539 -14.327 -8.085  1.00 56.65 ? 156 LEU G CD2 1 
ATOM   9124  N  N   . PHE G 1 73  ? 82.674 -11.882 -3.457  1.00 51.92 ? 157 PHE G N   1 
ATOM   9125  C  CA  . PHE G 1 73  ? 81.922 -10.707 -2.896  1.00 50.37 ? 157 PHE G CA  1 
ATOM   9126  C  C   . PHE G 1 73  ? 81.975 -10.524 -1.399  1.00 50.70 ? 157 PHE G C   1 
ATOM   9127  O  O   . PHE G 1 73  ? 82.264 -11.452 -0.641  1.00 51.26 ? 157 PHE G O   1 
ATOM   9128  C  CB  . PHE G 1 73  ? 80.411 -10.733 -3.223  1.00 48.69 ? 157 PHE G CB  1 
ATOM   9129  C  CG  . PHE G 1 73  ? 80.080 -10.871 -4.659  1.00 45.63 ? 157 PHE G CG  1 
ATOM   9130  C  CD1 . PHE G 1 73  ? 79.678 -12.084 -5.170  1.00 47.17 ? 157 PHE G CD1 1 
ATOM   9131  C  CD2 . PHE G 1 73  ? 80.087 -9.795  -5.484  1.00 41.57 ? 157 PHE G CD2 1 
ATOM   9132  C  CE1 . PHE G 1 73  ? 79.322 -12.226 -6.547  1.00 46.16 ? 157 PHE G CE1 1 
ATOM   9133  C  CE2 . PHE G 1 73  ? 79.744 -9.916  -6.825  1.00 43.56 ? 157 PHE G CE2 1 
ATOM   9134  C  CZ  . PHE G 1 73  ? 79.374 -11.134 -7.370  1.00 45.59 ? 157 PHE G CZ  1 
ATOM   9135  N  N   . GLU G 1 74  ? 81.646 -9.323  -0.951  1.00 50.76 ? 158 GLU G N   1 
ATOM   9136  C  CA  . GLU G 1 74  ? 81.366 -9.169  0.451   1.00 51.04 ? 158 GLU G CA  1 
ATOM   9137  C  C   . GLU G 1 74  ? 79.853 -9.501  0.574   1.00 51.51 ? 158 GLU G C   1 
ATOM   9138  O  O   . GLU G 1 74  ? 79.006 -8.666  0.232   1.00 52.72 ? 158 GLU G O   1 
ATOM   9139  C  CB  . GLU G 1 74  ? 81.687 -7.745  0.872   1.00 50.43 ? 158 GLU G CB  1 
ATOM   9140  C  CG  . GLU G 1 74  ? 81.359 -7.450  2.304   1.00 50.46 ? 158 GLU G CG  1 
ATOM   9141  C  CD  . GLU G 1 74  ? 81.570 -6.006  2.627   1.00 52.29 ? 158 GLU G CD  1 
ATOM   9142  O  OE1 . GLU G 1 74  ? 81.491 -5.218  1.664   1.00 55.30 ? 158 GLU G OE1 1 
ATOM   9143  O  OE2 . GLU G 1 74  ? 81.807 -5.639  3.818   1.00 53.42 ? 158 GLU G OE2 1 
ATOM   9144  N  N   . CYS G 1 75  ? 79.525 -10.731 0.969   1.00 50.83 ? 159 CYS G N   1 
ATOM   9145  C  CA  . CYS G 1 75  ? 78.147 -11.156 1.188   1.00 49.82 ? 159 CYS G CA  1 
ATOM   9146  C  C   . CYS G 1 75  ? 77.608 -10.678 2.560   1.00 49.86 ? 159 CYS G C   1 
ATOM   9147  O  O   . CYS G 1 75  ? 78.174 -10.958 3.629   1.00 49.52 ? 159 CYS G O   1 
ATOM   9148  C  CB  . CYS G 1 75  ? 78.056 -12.666 1.076   1.00 49.09 ? 159 CYS G CB  1 
ATOM   9149  S  SG  . CYS G 1 75  ? 78.290 -13.329 -0.568  1.00 52.60 ? 159 CYS G SG  1 
ATOM   9150  N  N   . VAL G 1 76  ? 76.504 -9.943  2.522   1.00 49.77 ? 160 VAL G N   1 
ATOM   9151  C  CA  . VAL G 1 76  ? 75.787 -9.600  3.736   1.00 49.71 ? 160 VAL G CA  1 
ATOM   9152  C  C   . VAL G 1 76  ? 74.439 -10.314 3.783   1.00 49.35 ? 160 VAL G C   1 
ATOM   9153  O  O   . VAL G 1 76  ? 73.850 -10.659 2.750   1.00 50.45 ? 160 VAL G O   1 
ATOM   9154  C  CB  . VAL G 1 76  ? 75.565 -8.102  3.794   1.00 50.41 ? 160 VAL G CB  1 
ATOM   9155  C  CG1 . VAL G 1 76  ? 74.751 -7.726  5.016   1.00 48.31 ? 160 VAL G CG1 1 
ATOM   9156  C  CG2 . VAL G 1 76  ? 76.927 -7.399  3.784   1.00 51.93 ? 160 VAL G CG2 1 
ATOM   9157  N  N   . LEU G 1 77  ? 73.942 -10.560 4.975   1.00 48.45 ? 161 LEU G N   1 
ATOM   9158  C  CA  . LEU G 1 77  ? 72.614 -11.125 5.086   1.00 47.50 ? 161 LEU G CA  1 
ATOM   9159  C  C   . LEU G 1 77  ? 71.759 -10.017 5.609   1.00 46.55 ? 161 LEU G C   1 
ATOM   9160  O  O   . LEU G 1 77  ? 72.107 -9.443  6.669   1.00 45.90 ? 161 LEU G O   1 
ATOM   9161  C  CB  . LEU G 1 77  ? 72.585 -12.287 6.078   1.00 47.82 ? 161 LEU G CB  1 
ATOM   9162  C  CG  . LEU G 1 77  ? 71.161 -12.831 6.239   1.00 49.20 ? 161 LEU G CG  1 
ATOM   9163  C  CD1 . LEU G 1 77  ? 70.824 -13.893 5.186   1.00 48.08 ? 161 LEU G CD1 1 
ATOM   9164  C  CD2 . LEU G 1 77  ? 70.958 -13.362 7.613   1.00 49.37 ? 161 LEU G CD2 1 
ATOM   9165  N  N   . PHE G 1 78  ? 70.671 -9.697  4.864   1.00 45.37 ? 162 PHE G N   1 
ATOM   9166  C  CA  . PHE G 1 78  ? 69.699 -8.599  5.222   1.00 42.97 ? 162 PHE G CA  1 
ATOM   9167  C  C   . PHE G 1 78  ? 68.286 -9.174  5.238   1.00 43.22 ? 162 PHE G C   1 
ATOM   9168  O  O   . PHE G 1 78  ? 67.766 -9.616  4.160   1.00 42.87 ? 162 PHE G O   1 
ATOM   9169  C  CB  . PHE G 1 78  ? 69.759 -7.453  4.201   1.00 41.47 ? 162 PHE G CB  1 
ATOM   9170  C  CG  . PHE G 1 78  ? 69.395 -6.090  4.768   1.00 39.15 ? 162 PHE G CG  1 
ATOM   9171  C  CD1 . PHE G 1 78  ? 69.892 -4.930  4.185   1.00 36.83 ? 162 PHE G CD1 1 
ATOM   9172  C  CD2 . PHE G 1 78  ? 68.566 -5.965  5.881   1.00 35.91 ? 162 PHE G CD2 1 
ATOM   9173  C  CE1 . PHE G 1 78  ? 69.572 -3.657  4.714   1.00 32.73 ? 162 PHE G CE1 1 
ATOM   9174  C  CE2 . PHE G 1 78  ? 68.242 -4.735  6.407   1.00 33.36 ? 162 PHE G CE2 1 
ATOM   9175  C  CZ  . PHE G 1 78  ? 68.748 -3.574  5.834   1.00 35.44 ? 162 PHE G CZ  1 
ATOM   9176  N  N   . THR G 1 79  ? 67.663 -9.217  6.416   1.00 41.95 ? 163 THR G N   1 
ATOM   9177  C  CA  . THR G 1 79  ? 66.360 -9.872  6.473   1.00 43.08 ? 163 THR G CA  1 
ATOM   9178  C  C   . THR G 1 79  ? 65.308 -9.108  7.272   1.00 43.78 ? 163 THR G C   1 
ATOM   9179  O  O   . THR G 1 79  ? 65.636 -8.454  8.267   1.00 44.05 ? 163 THR G O   1 
ATOM   9180  C  CB  . THR G 1 79  ? 66.448 -11.393 6.898   1.00 43.37 ? 163 THR G CB  1 
ATOM   9181  O  OG1 . THR G 1 79  ? 65.173 -12.047 6.783   1.00 43.43 ? 163 THR G OG1 1 
ATOM   9182  C  CG2 . THR G 1 79  ? 66.934 -11.549 8.306   1.00 42.49 ? 163 THR G CG2 1 
ATOM   9183  N  N   . ALA G 1 80  ? 64.051 -9.175  6.812   1.00 44.77 ? 164 ALA G N   1 
ATOM   9184  C  CA  . ALA G 1 80  ? 62.950 -8.474  7.500   1.00 46.02 ? 164 ALA G CA  1 
ATOM   9185  C  C   . ALA G 1 80  ? 62.471 -9.292  8.648   1.00 46.64 ? 164 ALA G C   1 
ATOM   9186  O  O   . ALA G 1 80  ? 61.605 -8.837  9.386   1.00 47.10 ? 164 ALA G O   1 
ATOM   9187  C  CB  . ALA G 1 80  ? 61.794 -8.160  6.583   1.00 45.19 ? 164 ALA G CB  1 
ATOM   9188  N  N   . SER G 1 81  ? 63.045 -10.493 8.784   1.00 47.65 ? 165 SER G N   1 
ATOM   9189  C  CA  . SER G 1 81  ? 62.697 -11.436 9.845   1.00 48.73 ? 165 SER G CA  1 
ATOM   9190  C  C   . SER G 1 81  ? 63.478 -11.190 11.104  1.00 48.43 ? 165 SER G C   1 
ATOM   9191  O  O   . SER G 1 81  ? 64.524 -10.609 11.071  1.00 48.79 ? 165 SER G O   1 
ATOM   9192  C  CB  . SER G 1 81  ? 62.950 -12.849 9.376   1.00 49.32 ? 165 SER G CB  1 
ATOM   9193  O  OG  . SER G 1 81  ? 64.341 -13.083 9.407   1.00 53.67 ? 165 SER G OG  1 
ATOM   9194  N  N   . LEU G 1 82  ? 62.958 -11.642 12.226  1.00 49.74 ? 166 LEU G N   1 
ATOM   9195  C  CA  . LEU G 1 82  ? 63.566 -11.348 13.514  1.00 50.76 ? 166 LEU G CA  1 
ATOM   9196  C  C   . LEU G 1 82  ? 64.896 -12.081 13.802  1.00 51.65 ? 166 LEU G C   1 
ATOM   9197  O  O   . LEU G 1 82  ? 65.114 -13.226 13.383  1.00 50.74 ? 166 LEU G O   1 
ATOM   9198  C  CB  . LEU G 1 82  ? 62.558 -11.573 14.636  1.00 50.09 ? 166 LEU G CB  1 
ATOM   9199  C  CG  . LEU G 1 82  ? 61.538 -10.453 14.829  1.00 52.61 ? 166 LEU G CG  1 
ATOM   9200  C  CD1 . LEU G 1 82  ? 60.253 -10.973 15.517  1.00 54.83 ? 166 LEU G CD1 1 
ATOM   9201  C  CD2 . LEU G 1 82  ? 62.125 -9.271  15.629  1.00 53.86 ? 166 LEU G CD2 1 
ATOM   9202  N  N   . ALA G 1 83  ? 65.766 -11.386 14.538  1.00 53.67 ? 167 ALA G N   1 
ATOM   9203  C  CA  . ALA G 1 83  ? 67.096 -11.890 14.935  1.00 55.81 ? 167 ALA G CA  1 
ATOM   9204  C  C   . ALA G 1 83  ? 67.030 -13.295 15.525  1.00 56.12 ? 167 ALA G C   1 
ATOM   9205  O  O   . ALA G 1 83  ? 67.829 -14.171 15.153  1.00 56.40 ? 167 ALA G O   1 
ATOM   9206  C  CB  . ALA G 1 83  ? 67.755 -10.932 15.953  1.00 56.09 ? 167 ALA G CB  1 
ATOM   9207  N  N   . LYS G 1 84  ? 66.059 -13.463 16.429  1.00 56.17 ? 168 LYS G N   1 
ATOM   9208  C  CA  . LYS G 1 84  ? 65.809 -14.686 17.189  1.00 56.51 ? 168 LYS G CA  1 
ATOM   9209  C  C   . LYS G 1 84  ? 65.461 -15.811 16.288  1.00 55.65 ? 168 LYS G C   1 
ATOM   9210  O  O   . LYS G 1 84  ? 65.593 -16.943 16.675  1.00 56.25 ? 168 LYS G O   1 
ATOM   9211  C  CB  . LYS G 1 84  ? 64.654 -14.480 18.163  1.00 56.88 ? 168 LYS G CB  1 
ATOM   9212  C  CG  . LYS G 1 84  ? 63.251 -14.568 17.526  1.00 57.90 ? 168 LYS G CG  1 
ATOM   9213  C  CD  . LYS G 1 84  ? 62.138 -14.182 18.554  1.00 58.10 ? 168 LYS G CD  1 
ATOM   9214  C  CE  . LYS G 1 84  ? 60.704 -14.421 17.978  1.00 59.69 ? 168 LYS G CE  1 
ATOM   9215  N  NZ  . LYS G 1 84  ? 59.603 -13.705 18.785  1.00 59.31 ? 168 LYS G NZ  1 
ATOM   9216  N  N   . TYR G 1 85  ? 64.983 -15.497 15.094  1.00 54.79 ? 169 TYR G N   1 
ATOM   9217  C  CA  . TYR G 1 85  ? 64.686 -16.520 14.147  1.00 53.82 ? 169 TYR G CA  1 
ATOM   9218  C  C   . TYR G 1 85  ? 65.816 -16.661 13.171  1.00 54.41 ? 169 TYR G C   1 
ATOM   9219  O  O   . TYR G 1 85  ? 66.038 -17.749 12.647  1.00 55.51 ? 169 TYR G O   1 
ATOM   9220  C  CB  . TYR G 1 85  ? 63.421 -16.201 13.350  1.00 52.65 ? 169 TYR G CB  1 
ATOM   9221  C  CG  . TYR G 1 85  ? 63.366 -16.920 12.004  1.00 48.65 ? 169 TYR G CG  1 
ATOM   9222  C  CD1 . TYR G 1 85  ? 62.900 -18.193 11.907  1.00 48.24 ? 169 TYR G CD1 1 
ATOM   9223  C  CD2 . TYR G 1 85  ? 63.812 -16.315 10.852  1.00 46.30 ? 169 TYR G CD2 1 
ATOM   9224  C  CE1 . TYR G 1 85  ? 62.835 -18.850 10.674  1.00 49.46 ? 169 TYR G CE1 1 
ATOM   9225  C  CE2 . TYR G 1 85  ? 63.778 -16.940 9.640   1.00 47.63 ? 169 TYR G CE2 1 
ATOM   9226  C  CZ  . TYR G 1 85  ? 63.278 -18.216 9.553   1.00 50.21 ? 169 TYR G CZ  1 
ATOM   9227  O  OH  . TYR G 1 85  ? 63.224 -18.876 8.341   1.00 52.63 ? 169 TYR G OH  1 
ATOM   9228  N  N   . ALA G 1 86  ? 66.497 -15.568 12.873  1.00 54.23 ? 170 ALA G N   1 
ATOM   9229  C  CA  . ALA G 1 86  ? 67.371 -15.579 11.707  1.00 54.68 ? 170 ALA G CA  1 
ATOM   9230  C  C   . ALA G 1 86  ? 68.840 -15.915 11.990  1.00 54.64 ? 170 ALA G C   1 
ATOM   9231  O  O   . ALA G 1 86  ? 69.494 -16.481 11.128  1.00 54.73 ? 170 ALA G O   1 
ATOM   9232  C  CB  . ALA G 1 86  ? 67.209 -14.289 10.881  1.00 54.36 ? 170 ALA G CB  1 
ATOM   9233  N  N   . ASP G 1 87  ? 69.336 -15.567 13.176  1.00 55.28 ? 171 ASP G N   1 
ATOM   9234  C  CA  . ASP G 1 87  ? 70.665 -16.018 13.668  1.00 56.46 ? 171 ASP G CA  1 
ATOM   9235  C  C   . ASP G 1 87  ? 70.774 -17.554 13.646  1.00 57.10 ? 171 ASP G C   1 
ATOM   9236  O  O   . ASP G 1 87  ? 71.602 -18.115 12.885  1.00 56.70 ? 171 ASP G O   1 
ATOM   9237  C  CB  . ASP G 1 87  ? 70.943 -15.491 15.092  1.00 56.33 ? 171 ASP G CB  1 
ATOM   9238  C  CG  . ASP G 1 87  ? 71.704 -14.174 15.105  1.00 57.60 ? 171 ASP G CG  1 
ATOM   9239  O  OD1 . ASP G 1 87  ? 72.560 -13.931 14.222  1.00 59.84 ? 171 ASP G OD1 1 
ATOM   9240  O  OD2 . ASP G 1 87  ? 71.463 -13.368 16.018  1.00 58.81 ? 171 ASP G OD2 1 
ATOM   9241  N  N   . PRO G 1 88  ? 69.918 -18.239 14.453  1.00 57.61 ? 172 PRO G N   1 
ATOM   9242  C  CA  . PRO G 1 88  ? 69.861 -19.679 14.435  1.00 57.61 ? 172 PRO G CA  1 
ATOM   9243  C  C   . PRO G 1 88  ? 69.969 -20.150 13.012  1.00 57.73 ? 172 PRO G C   1 
ATOM   9244  O  O   . PRO G 1 88  ? 70.983 -20.728 12.616  1.00 58.79 ? 172 PRO G O   1 
ATOM   9245  C  CB  . PRO G 1 88  ? 68.450 -19.959 14.976  1.00 57.97 ? 172 PRO G CB  1 
ATOM   9246  C  CG  . PRO G 1 88  ? 68.231 -18.919 15.991  1.00 58.03 ? 172 PRO G CG  1 
ATOM   9247  C  CD  . PRO G 1 88  ? 68.955 -17.690 15.440  1.00 58.18 ? 172 PRO G CD  1 
ATOM   9248  N  N   . VAL G 1 89  ? 68.953 -19.844 12.222  1.00 57.18 ? 173 VAL G N   1 
ATOM   9249  C  CA  . VAL G 1 89  ? 68.879 -20.420 10.913  1.00 56.32 ? 173 VAL G CA  1 
ATOM   9250  C  C   . VAL G 1 89  ? 70.130 -20.117 10.135  1.00 57.05 ? 173 VAL G C   1 
ATOM   9251  O  O   . VAL G 1 89  ? 70.508 -20.880 9.259   1.00 57.20 ? 173 VAL G O   1 
ATOM   9252  C  CB  . VAL G 1 89  ? 67.622 -19.986 10.173  1.00 55.86 ? 173 VAL G CB  1 
ATOM   9253  C  CG1 . VAL G 1 89  ? 67.649 -20.466 8.729   1.00 53.48 ? 173 VAL G CG1 1 
ATOM   9254  C  CG2 . VAL G 1 89  ? 66.407 -20.530 10.898  1.00 54.62 ? 173 VAL G CG2 1 
ATOM   9255  N  N   . THR G 1 90  ? 70.808 -19.025 10.454  1.00 57.86 ? 174 THR G N   1 
ATOM   9256  C  CA  . THR G 1 90  ? 71.984 -18.681 9.635   1.00 59.48 ? 174 THR G CA  1 
ATOM   9257  C  C   . THR G 1 90  ? 73.271 -19.445 10.099  1.00 59.72 ? 174 THR G C   1 
ATOM   9258  O  O   . THR G 1 90  ? 74.010 -20.001 9.265   1.00 60.28 ? 174 THR G O   1 
ATOM   9259  C  CB  . THR G 1 90  ? 72.084 -17.137 9.422   1.00 59.72 ? 174 THR G CB  1 
ATOM   9260  O  OG1 . THR G 1 90  ? 70.894 -16.729 8.738   1.00 61.38 ? 174 THR G OG1 1 
ATOM   9261  C  CG2 . THR G 1 90  ? 73.298 -16.714 8.574   1.00 58.67 ? 174 THR G CG2 1 
ATOM   9262  N  N   . ASP G 1 91  ? 73.487 -19.533 11.409  1.00 59.20 ? 175 ASP G N   1 
ATOM   9263  C  CA  . ASP G 1 91  ? 74.519 -20.419 11.946  1.00 59.27 ? 175 ASP G CA  1 
ATOM   9264  C  C   . ASP G 1 91  ? 74.516 -21.837 11.293  1.00 60.57 ? 175 ASP G C   1 
ATOM   9265  O  O   . ASP G 1 91  ? 75.585 -22.399 11.016  1.00 60.29 ? 175 ASP G O   1 
ATOM   9266  C  CB  . ASP G 1 91  ? 74.402 -20.522 13.468  1.00 58.17 ? 175 ASP G CB  1 
ATOM   9267  C  CG  . ASP G 1 91  ? 74.713 -19.199 14.184  1.00 56.78 ? 175 ASP G CG  1 
ATOM   9268  O  OD1 . ASP G 1 91  ? 75.638 -18.459 13.750  1.00 53.81 ? 175 ASP G OD1 1 
ATOM   9269  O  OD2 . ASP G 1 91  ? 74.047 -18.919 15.217  1.00 53.46 ? 175 ASP G OD2 1 
ATOM   9270  N  N   . LEU G 1 92  ? 73.339 -22.421 11.035  1.00 61.14 ? 176 LEU G N   1 
ATOM   9271  C  CA  . LEU G 1 92  ? 73.331 -23.739 10.409  1.00 61.49 ? 176 LEU G CA  1 
ATOM   9272  C  C   . LEU G 1 92  ? 73.403 -23.625 8.904   1.00 61.93 ? 176 LEU G C   1 
ATOM   9273  O  O   . LEU G 1 92  ? 73.848 -24.548 8.223   1.00 62.19 ? 176 LEU G O   1 
ATOM   9274  C  CB  . LEU G 1 92  ? 72.112 -24.579 10.814  1.00 61.79 ? 176 LEU G CB  1 
ATOM   9275  C  CG  . LEU G 1 92  ? 71.505 -24.413 12.213  1.00 63.64 ? 176 LEU G CG  1 
ATOM   9276  C  CD1 . LEU G 1 92  ? 70.095 -25.027 12.244  1.00 65.08 ? 176 LEU G CD1 1 
ATOM   9277  C  CD2 . LEU G 1 92  ? 72.380 -24.942 13.374  1.00 64.48 ? 176 LEU G CD2 1 
ATOM   9278  N  N   . LEU G 1 93  ? 72.962 -22.512 8.347   1.00 62.43 ? 177 LEU G N   1 
ATOM   9279  C  CA  . LEU G 1 93  ? 73.019 -22.455 6.916   1.00 63.07 ? 177 LEU G CA  1 
ATOM   9280  C  C   . LEU G 1 93  ? 74.364 -21.913 6.453   1.00 64.45 ? 177 LEU G C   1 
ATOM   9281  O  O   . LEU G 1 93  ? 74.867 -22.360 5.416   1.00 65.20 ? 177 LEU G O   1 
ATOM   9282  C  CB  . LEU G 1 93  ? 71.828 -21.715 6.313   1.00 62.40 ? 177 LEU G CB  1 
ATOM   9283  C  CG  . LEU G 1 93  ? 71.840 -21.403 4.804   1.00 61.43 ? 177 LEU G CG  1 
ATOM   9284  C  CD1 . LEU G 1 93  ? 71.345 -22.512 3.859   1.00 58.36 ? 177 LEU G CD1 1 
ATOM   9285  C  CD2 . LEU G 1 93  ? 71.066 -20.132 4.558   1.00 58.81 ? 177 LEU G CD2 1 
ATOM   9286  N  N   . ASP G 1 94  ? 74.940 -20.961 7.199   1.00 65.63 ? 178 ASP G N   1 
ATOM   9287  C  CA  . ASP G 1 94  ? 76.160 -20.258 6.758   1.00 67.42 ? 178 ASP G CA  1 
ATOM   9288  C  C   . ASP G 1 94  ? 77.337 -21.107 7.215   1.00 69.34 ? 178 ASP G C   1 
ATOM   9289  O  O   . ASP G 1 94  ? 78.000 -20.781 8.221   1.00 69.28 ? 178 ASP G O   1 
ATOM   9290  C  CB  . ASP G 1 94  ? 76.236 -18.851 7.375   1.00 66.27 ? 178 ASP G CB  1 
ATOM   9291  C  CG  . ASP G 1 94  ? 77.466 -18.028 6.893   1.00 65.17 ? 178 ASP G CG  1 
ATOM   9292  O  OD1 . ASP G 1 94  ? 77.864 -18.178 5.705   1.00 62.30 ? 178 ASP G OD1 1 
ATOM   9293  O  OD2 . ASP G 1 94  ? 78.012 -17.212 7.709   1.00 61.05 ? 178 ASP G OD2 1 
ATOM   9294  N  N   . ARG G 1 95  ? 77.566 -22.221 6.508   1.00 71.25 ? 179 ARG G N   1 
ATOM   9295  C  CA  . ARG G 1 95  ? 78.407 -23.313 7.085   1.00 73.39 ? 179 ARG G CA  1 
ATOM   9296  C  C   . ARG G 1 95  ? 79.899 -23.064 6.940   1.00 73.51 ? 179 ARG G C   1 
ATOM   9297  O  O   . ARG G 1 95  ? 80.639 -23.132 7.928   1.00 73.25 ? 179 ARG G O   1 
ATOM   9298  C  CB  . ARG G 1 95  ? 77.975 -24.749 6.679   1.00 72.72 ? 179 ARG G CB  1 
ATOM   9299  C  CG  . ARG G 1 95  ? 77.863 -25.085 5.196   1.00 74.00 ? 179 ARG G CG  1 
ATOM   9300  C  CD  . ARG G 1 95  ? 77.127 -26.474 5.010   1.00 75.52 ? 179 ARG G CD  1 
ATOM   9301  N  NE  . ARG G 1 95  ? 77.809 -27.585 5.699   1.00 80.18 ? 179 ARG G NE  1 
ATOM   9302  C  CZ  . ARG G 1 95  ? 77.609 -28.897 5.505   1.00 80.77 ? 179 ARG G CZ  1 
ATOM   9303  N  NH1 . ARG G 1 95  ? 76.717 -29.358 4.624   1.00 79.76 ? 179 ARG G NH1 1 
ATOM   9304  N  NH2 . ARG G 1 95  ? 78.323 -29.762 6.223   1.00 80.40 ? 179 ARG G NH2 1 
ATOM   9305  N  N   . CYS G 1 96  ? 80.302 -22.719 5.721   1.00 73.88 ? 180 CYS G N   1 
ATOM   9306  C  CA  . CYS G 1 96  ? 81.638 -22.201 5.449   1.00 74.75 ? 180 CYS G CA  1 
ATOM   9307  C  C   . CYS G 1 96  ? 81.749 -20.662 5.641   1.00 73.35 ? 180 CYS G C   1 
ATOM   9308  O  O   . CYS G 1 96  ? 82.466 -19.992 4.884   1.00 72.96 ? 180 CYS G O   1 
ATOM   9309  C  CB  . CYS G 1 96  ? 81.994 -22.564 4.011   1.00 75.82 ? 180 CYS G CB  1 
ATOM   9310  S  SG  . CYS G 1 96  ? 80.697 -21.999 2.829   1.00 81.87 ? 180 CYS G SG  1 
ATOM   9311  N  N   . GLY G 1 97  ? 81.002 -20.122 6.618   1.00 72.41 ? 181 GLY G N   1 
ATOM   9312  C  CA  . GLY G 1 97  ? 81.119 -18.716 7.116   1.00 70.65 ? 181 GLY G CA  1 
ATOM   9313  C  C   . GLY G 1 97  ? 81.118 -17.519 6.157   1.00 69.16 ? 181 GLY G C   1 
ATOM   9314  O  O   . GLY G 1 97  ? 81.785 -16.511 6.410   1.00 68.95 ? 181 GLY G O   1 
ATOM   9315  N  N   . VAL G 1 98  ? 80.343 -17.617 5.082   1.00 67.53 ? 182 VAL G N   1 
ATOM   9316  C  CA  . VAL G 1 98  ? 80.292 -16.609 4.023   1.00 65.80 ? 182 VAL G CA  1 
ATOM   9317  C  C   . VAL G 1 98  ? 79.752 -15.188 4.392   1.00 64.19 ? 182 VAL G C   1 
ATOM   9318  O  O   . VAL G 1 98  ? 80.111 -14.200 3.750   1.00 63.27 ? 182 VAL G O   1 
ATOM   9319  C  CB  . VAL G 1 98  ? 79.504 -17.211 2.874   1.00 66.33 ? 182 VAL G CB  1 
ATOM   9320  C  CG1 . VAL G 1 98  ? 79.273 -16.223 1.743   1.00 65.78 ? 182 VAL G CG1 1 
ATOM   9321  C  CG2 . VAL G 1 98  ? 80.243 -18.456 2.374   1.00 67.76 ? 182 VAL G CG2 1 
ATOM   9322  N  N   . PHE G 1 99  ? 78.929 -15.073 5.431   1.00 62.32 ? 183 PHE G N   1 
ATOM   9323  C  CA  . PHE G 1 99  ? 78.317 -13.781 5.743   1.00 60.67 ? 183 PHE G CA  1 
ATOM   9324  C  C   . PHE G 1 99  ? 79.150 -12.840 6.598   1.00 59.55 ? 183 PHE G C   1 
ATOM   9325  O  O   . PHE G 1 99  ? 79.263 -13.003 7.813   1.00 58.82 ? 183 PHE G O   1 
ATOM   9326  C  CB  . PHE G 1 99  ? 76.890 -13.952 6.319   1.00 60.70 ? 183 PHE G CB  1 
ATOM   9327  C  CG  . PHE G 1 99  ? 75.898 -14.410 5.298   1.00 61.00 ? 183 PHE G CG  1 
ATOM   9328  C  CD1 . PHE G 1 99  ? 75.226 -15.610 5.456   1.00 61.17 ? 183 PHE G CD1 1 
ATOM   9329  C  CD2 . PHE G 1 99  ? 75.683 -13.657 4.133   1.00 62.24 ? 183 PHE G CD2 1 
ATOM   9330  C  CE1 . PHE G 1 99  ? 74.326 -16.073 4.471   1.00 62.97 ? 183 PHE G CE1 1 
ATOM   9331  C  CE2 . PHE G 1 99  ? 74.777 -14.080 3.140   1.00 63.52 ? 183 PHE G CE2 1 
ATOM   9332  C  CZ  . PHE G 1 99  ? 74.097 -15.302 3.304   1.00 63.14 ? 183 PHE G CZ  1 
ATOM   9333  N  N   . ARG G 1 100 ? 79.687 -11.805 5.969   1.00 58.78 ? 184 ARG G N   1 
ATOM   9334  C  CA  . ARG G 1 100 ? 80.407 -10.775 6.729   1.00 58.08 ? 184 ARG G CA  1 
ATOM   9335  C  C   . ARG G 1 100 ? 79.535 -10.069 7.773   1.00 56.94 ? 184 ARG G C   1 
ATOM   9336  O  O   . ARG G 1 100 ? 80.000 -9.769  8.872   1.00 56.74 ? 184 ARG G O   1 
ATOM   9337  C  CB  . ARG G 1 100 ? 81.073 -9.759  5.800   1.00 58.31 ? 184 ARG G CB  1 
ATOM   9338  C  CG  . ARG G 1 100 ? 81.652 -10.340 4.504   1.00 60.33 ? 184 ARG G CG  1 
ATOM   9339  C  CD  . ARG G 1 100 ? 82.807 -11.359 4.653   1.00 64.09 ? 184 ARG G CD  1 
ATOM   9340  N  NE  . ARG G 1 100 ? 83.544 -11.408 3.379   1.00 67.55 ? 184 ARG G NE  1 
ATOM   9341  C  CZ  . ARG G 1 100 ? 84.052 -12.508 2.814   1.00 69.38 ? 184 ARG G CZ  1 
ATOM   9342  N  NH1 . ARG G 1 100 ? 83.918 -13.701 3.400   1.00 71.14 ? 184 ARG G NH1 1 
ATOM   9343  N  NH2 . ARG G 1 100 ? 84.676 -12.420 1.642   1.00 66.83 ? 184 ARG G NH2 1 
ATOM   9344  N  N   . ALA G 1 101 ? 78.262 -9.836  7.442   1.00 55.73 ? 185 ALA G N   1 
ATOM   9345  C  CA  . ALA G 1 101 ? 77.318 -9.201  8.379   1.00 54.44 ? 185 ALA G CA  1 
ATOM   9346  C  C   . ALA G 1 101 ? 75.889 -9.756  8.229   1.00 53.45 ? 185 ALA G C   1 
ATOM   9347  O  O   . ALA G 1 101 ? 75.507 -10.224 7.160   1.00 53.77 ? 185 ALA G O   1 
ATOM   9348  C  CB  . ALA G 1 101 ? 77.332 -7.663  8.186   1.00 54.18 ? 185 ALA G CB  1 
ATOM   9349  N  N   . ARG G 1 102 ? 75.107 -9.685  9.302   1.00 52.08 ? 186 ARG G N   1 
ATOM   9350  C  CA  . ARG G 1 102 ? 73.715 -10.107 9.293   1.00 50.79 ? 186 ARG G CA  1 
ATOM   9351  C  C   . ARG G 1 102 ? 72.859 -8.963  9.803   1.00 49.80 ? 186 ARG G C   1 
ATOM   9352  O  O   . ARG G 1 102 ? 73.059 -8.491  10.936  1.00 49.16 ? 186 ARG G O   1 
ATOM   9353  C  CB  . ARG G 1 102 ? 73.475 -11.301 10.221  1.00 51.35 ? 186 ARG G CB  1 
ATOM   9354  C  CG  . ARG G 1 102 ? 74.316 -12.542 9.973   1.00 50.96 ? 186 ARG G CG  1 
ATOM   9355  C  CD  . ARG G 1 102 ? 74.383 -13.359 11.265  1.00 52.73 ? 186 ARG G CD  1 
ATOM   9356  N  NE  . ARG G 1 102 ? 74.788 -14.746 11.028  1.00 54.63 ? 186 ARG G NE  1 
ATOM   9357  C  CZ  . ARG G 1 102 ? 74.459 -15.758 11.823  1.00 56.39 ? 186 ARG G CZ  1 
ATOM   9358  N  NH1 . ARG G 1 102 ? 73.717 -15.537 12.897  1.00 56.88 ? 186 ARG G NH1 1 
ATOM   9359  N  NH2 . ARG G 1 102 ? 74.850 -17.000 11.531  1.00 57.85 ? 186 ARG G NH2 1 
ATOM   9360  N  N   . LEU G 1 103 ? 71.909 -8.503  8.977   1.00 48.52 ? 187 LEU G N   1 
ATOM   9361  C  CA  . LEU G 1 103 ? 70.961 -7.474  9.433   1.00 47.06 ? 187 LEU G CA  1 
ATOM   9362  C  C   . LEU G 1 103 ? 69.507 -7.941  9.484   1.00 46.93 ? 187 LEU G C   1 
ATOM   9363  O  O   . LEU G 1 103 ? 69.036 -8.783  8.664   1.00 47.49 ? 187 LEU G O   1 
ATOM   9364  C  CB  . LEU G 1 103 ? 71.125 -6.206  8.650   1.00 46.60 ? 187 LEU G CB  1 
ATOM   9365  C  CG  . LEU G 1 103 ? 72.545 -5.656  8.766   1.00 45.44 ? 187 LEU G CG  1 
ATOM   9366  C  CD1 . LEU G 1 103 ? 72.938 -5.225  7.396   1.00 47.09 ? 187 LEU G CD1 1 
ATOM   9367  C  CD2 . LEU G 1 103 ? 72.689 -4.536  9.814   1.00 40.97 ? 187 LEU G CD2 1 
ATOM   9368  N  N   . PHE G 1 104 ? 68.824 -7.410  10.479  1.00 45.32 ? 188 PHE G N   1 
ATOM   9369  C  CA  . PHE G 1 104 ? 67.555 -7.920  10.884  1.00 45.99 ? 188 PHE G CA  1 
ATOM   9370  C  C   . PHE G 1 104 ? 66.432 -6.889  10.742  1.00 46.14 ? 188 PHE G C   1 
ATOM   9371  O  O   . PHE G 1 104 ? 66.645 -5.761  10.315  1.00 46.42 ? 188 PHE G O   1 
ATOM   9372  C  CB  . PHE G 1 104 ? 67.698 -8.486  12.324  1.00 45.81 ? 188 PHE G CB  1 
ATOM   9373  C  CG  . PHE G 1 104 ? 68.658 -9.656  12.399  1.00 46.13 ? 188 PHE G CG  1 
ATOM   9374  C  CD1 . PHE G 1 104 ? 69.768 -9.624  13.229  1.00 47.65 ? 188 PHE G CD1 1 
ATOM   9375  C  CD2 . PHE G 1 104 ? 68.499 -10.751 11.554  1.00 45.93 ? 188 PHE G CD2 1 
ATOM   9376  C  CE1 . PHE G 1 104 ? 70.677 -10.685 13.241  1.00 46.96 ? 188 PHE G CE1 1 
ATOM   9377  C  CE2 . PHE G 1 104 ? 69.406 -11.809 11.550  1.00 44.90 ? 188 PHE G CE2 1 
ATOM   9378  C  CZ  . PHE G 1 104 ? 70.481 -11.785 12.395  1.00 45.77 ? 188 PHE G CZ  1 
ATOM   9379  N  N   . ARG G 1 105 ? 65.232 -7.283  11.106  1.00 46.32 ? 189 ARG G N   1 
ATOM   9380  C  CA  . ARG G 1 105 ? 64.082 -6.412  11.015  1.00 47.20 ? 189 ARG G CA  1 
ATOM   9381  C  C   . ARG G 1 105 ? 64.342 -4.979  11.449  1.00 48.10 ? 189 ARG G C   1 
ATOM   9382  O  O   . ARG G 1 105 ? 63.833 -4.026  10.830  1.00 48.91 ? 189 ARG G O   1 
ATOM   9383  C  CB  . ARG G 1 105 ? 62.925 -6.969  11.825  1.00 46.44 ? 189 ARG G CB  1 
ATOM   9384  C  CG  . ARG G 1 105 ? 61.676 -6.276  11.448  1.00 45.59 ? 189 ARG G CG  1 
ATOM   9385  C  CD  . ARG G 1 105 ? 60.571 -6.639  12.337  1.00 43.63 ? 189 ARG G CD  1 
ATOM   9386  N  NE  . ARG G 1 105 ? 59.983 -7.817  11.773  1.00 41.79 ? 189 ARG G NE  1 
ATOM   9387  C  CZ  . ARG G 1 105 ? 59.096 -8.555  12.412  1.00 43.64 ? 189 ARG G CZ  1 
ATOM   9388  N  NH1 . ARG G 1 105 ? 58.626 -9.640  11.789  1.00 41.18 ? 189 ARG G NH1 1 
ATOM   9389  N  NH2 . ARG G 1 105 ? 58.679 -8.199  13.666  1.00 40.13 ? 189 ARG G NH2 1 
ATOM   9390  N  N   . GLU G 1 106 ? 65.147 -4.828  12.494  1.00 48.35 ? 190 GLU G N   1 
ATOM   9391  C  CA  . GLU G 1 106 ? 65.362 -3.534  13.133  1.00 48.56 ? 190 GLU G CA  1 
ATOM   9392  C  C   . GLU G 1 106 ? 66.201 -2.611  12.237  1.00 47.65 ? 190 GLU G C   1 
ATOM   9393  O  O   . GLU G 1 106 ? 66.140 -1.379  12.338  1.00 48.03 ? 190 GLU G O   1 
ATOM   9394  C  CB  . GLU G 1 106 ? 66.059 -3.781  14.463  1.00 49.33 ? 190 GLU G CB  1 
ATOM   9395  C  CG  . GLU G 1 106 ? 66.254 -5.312  14.765  1.00 55.08 ? 190 GLU G CG  1 
ATOM   9396  C  CD  . GLU G 1 106 ? 67.740 -5.754  14.779  1.00 61.90 ? 190 GLU G CD  1 
ATOM   9397  O  OE1 . GLU G 1 106 ? 68.158 -6.483  15.735  1.00 63.34 ? 190 GLU G OE1 1 
ATOM   9398  O  OE2 . GLU G 1 106 ? 68.494 -5.359  13.854  1.00 62.23 ? 190 GLU G OE2 1 
ATOM   9399  N  N   . SER G 1 107 ? 66.996 -3.216  11.360  1.00 46.01 ? 191 SER G N   1 
ATOM   9400  C  CA  . SER G 1 107 ? 67.735 -2.445  10.391  1.00 44.61 ? 191 SER G CA  1 
ATOM   9401  C  C   . SER G 1 107 ? 66.947 -2.048  9.136   1.00 43.47 ? 191 SER G C   1 
ATOM   9402  O  O   . SER G 1 107 ? 67.395 -1.155  8.425   1.00 44.07 ? 191 SER G O   1 
ATOM   9403  C  CB  . SER G 1 107 ? 69.006 -3.161  10.035  1.00 44.05 ? 191 SER G CB  1 
ATOM   9404  O  OG  . SER G 1 107 ? 69.792 -3.208  11.217  1.00 47.56 ? 191 SER G OG  1 
ATOM   9405  N  N   . CYS G 1 108 ? 65.805 -2.708  8.871   1.00 41.07 ? 192 CYS G N   1 
ATOM   9406  C  CA  . CYS G 1 108 ? 64.912 -2.372  7.761   1.00 39.00 ? 192 CYS G CA  1 
ATOM   9407  C  C   . CYS G 1 108 ? 64.202 -1.072  8.071   1.00 37.96 ? 192 CYS G C   1 
ATOM   9408  O  O   . CYS G 1 108 ? 64.017 -0.757  9.236   1.00 38.97 ? 192 CYS G O   1 
ATOM   9409  C  CB  . CYS G 1 108 ? 63.852 -3.456  7.581   1.00 38.57 ? 192 CYS G CB  1 
ATOM   9410  S  SG  . CYS G 1 108 ? 64.524 -4.909  6.997   1.00 38.01 ? 192 CYS G SG  1 
ATOM   9411  N  N   . VAL G 1 109 ? 63.779 -0.337  7.045   1.00 35.85 ? 193 VAL G N   1 
ATOM   9412  C  CA  . VAL G 1 109 ? 62.876 0.776   7.258   1.00 34.47 ? 193 VAL G CA  1 
ATOM   9413  C  C   . VAL G 1 109 ? 61.418 0.331   7.057   1.00 33.12 ? 193 VAL G C   1 
ATOM   9414  O  O   . VAL G 1 109 ? 61.153 -0.658  6.388   1.00 32.02 ? 193 VAL G O   1 
ATOM   9415  C  CB  . VAL G 1 109 ? 63.228 2.007   6.419   1.00 35.61 ? 193 VAL G CB  1 
ATOM   9416  C  CG1 . VAL G 1 109 ? 64.760 2.321   6.503   1.00 32.18 ? 193 VAL G CG1 1 
ATOM   9417  C  CG2 . VAL G 1 109 ? 62.797 1.814   5.067   1.00 35.67 ? 193 VAL G CG2 1 
ATOM   9418  N  N   . PHE G 1 110 ? 60.490 0.976   7.757   1.00 31.15 ? 194 PHE G N   1 
ATOM   9419  C  CA  . PHE G 1 110 ? 59.085 0.569   7.723   1.00 29.65 ? 194 PHE G CA  1 
ATOM   9420  C  C   . PHE G 1 110 ? 58.342 1.510   6.806   1.00 29.61 ? 194 PHE G C   1 
ATOM   9421  O  O   . PHE G 1 110 ? 58.197 2.691   7.110   1.00 30.47 ? 194 PHE G O   1 
ATOM   9422  C  CB  . PHE G 1 110 ? 58.536 0.614   9.101   1.00 28.73 ? 194 PHE G CB  1 
ATOM   9423  C  CG  . PHE G 1 110 ? 57.084 0.351   9.178   1.00 30.56 ? 194 PHE G CG  1 
ATOM   9424  C  CD1 . PHE G 1 110 ? 56.611 -0.931  9.388   1.00 30.95 ? 194 PHE G CD1 1 
ATOM   9425  C  CD2 . PHE G 1 110 ? 56.168 1.394   9.115   1.00 27.44 ? 194 PHE G CD2 1 
ATOM   9426  C  CE1 . PHE G 1 110 ? 55.209 -1.172  9.465   1.00 31.36 ? 194 PHE G CE1 1 
ATOM   9427  C  CE2 . PHE G 1 110 ? 54.826 1.161   9.213   1.00 29.00 ? 194 PHE G CE2 1 
ATOM   9428  C  CZ  . PHE G 1 110 ? 54.339 -0.132  9.388   1.00 28.30 ? 194 PHE G CZ  1 
ATOM   9429  N  N   . HIS G 1 111 ? 57.945 1.009   5.653   1.00 29.06 ? 195 HIS G N   1 
ATOM   9430  C  CA  . HIS G 1 111 ? 57.263 1.780   4.666   1.00 29.92 ? 195 HIS G CA  1 
ATOM   9431  C  C   . HIS G 1 111 ? 55.782 1.391   4.619   1.00 31.06 ? 195 HIS G C   1 
ATOM   9432  O  O   . HIS G 1 111 ? 55.410 0.489   3.900   1.00 31.37 ? 195 HIS G O   1 
ATOM   9433  C  CB  . HIS G 1 111 ? 57.927 1.383   3.391   1.00 28.84 ? 195 HIS G CB  1 
ATOM   9434  C  CG  . HIS G 1 111 ? 57.574 2.219   2.208   1.00 28.84 ? 195 HIS G CG  1 
ATOM   9435  N  ND1 . HIS G 1 111 ? 56.580 1.863   1.316   1.00 29.18 ? 195 HIS G ND1 1 
ATOM   9436  C  CD2 . HIS G 1 111 ? 58.168 3.323   1.694   1.00 27.37 ? 195 HIS G CD2 1 
ATOM   9437  C  CE1 . HIS G 1 111 ? 56.583 2.717   0.310   1.00 30.85 ? 195 HIS G CE1 1 
ATOM   9438  N  NE2 . HIS G 1 111 ? 57.537 3.614   0.517   1.00 28.15 ? 195 HIS G NE2 1 
ATOM   9439  N  N   . GLN G 1 112 ? 54.938 2.037   5.418   1.00 32.93 ? 196 GLN G N   1 
ATOM   9440  C  CA  . GLN G 1 112 ? 53.456 1.805   5.433   1.00 33.31 ? 196 GLN G CA  1 
ATOM   9441  C  C   . GLN G 1 112 ? 53.102 0.301   5.355   1.00 35.80 ? 196 GLN G C   1 
ATOM   9442  O  O   . GLN G 1 112 ? 52.478 -0.195  4.379   1.00 35.99 ? 196 GLN G O   1 
ATOM   9443  C  CB  . GLN G 1 112 ? 52.792 2.618   4.337   1.00 33.15 ? 196 GLN G CB  1 
ATOM   9444  C  CG  . GLN G 1 112 ? 51.280 2.826   4.477   1.00 33.34 ? 196 GLN G CG  1 
ATOM   9445  C  CD  . GLN G 1 112 ? 50.746 3.986   3.637   1.00 32.66 ? 196 GLN G CD  1 
ATOM   9446  O  OE1 . GLN G 1 112 ? 50.482 5.078   4.162   1.00 31.94 ? 196 GLN G OE1 1 
ATOM   9447  N  NE2 . GLN G 1 112 ? 50.594 3.755   2.320   1.00 29.06 ? 196 GLN G NE2 1 
ATOM   9448  N  N   . GLY G 1 113 ? 53.591 -0.429  6.358   1.00 37.14 ? 197 GLY G N   1 
ATOM   9449  C  CA  . GLY G 1 113 ? 53.284 -1.846  6.545   1.00 38.76 ? 197 GLY G CA  1 
ATOM   9450  C  C   . GLY G 1 113 ? 54.181 -2.830  5.838   1.00 40.20 ? 197 GLY G C   1 
ATOM   9451  O  O   . GLY G 1 113 ? 53.976 -4.023  5.961   1.00 39.94 ? 197 GLY G O   1 
ATOM   9452  N  N   . CYS G 1 114 ? 55.115 -2.317  5.046   1.00 41.42 ? 198 CYS G N   1 
ATOM   9453  C  CA  . CYS G 1 114 ? 56.252 -3.068  4.496   1.00 43.50 ? 198 CYS G CA  1 
ATOM   9454  C  C   . CYS G 1 114 ? 57.621 -2.800  5.142   1.00 42.43 ? 198 CYS G C   1 
ATOM   9455  O  O   . CYS G 1 114 ? 57.941 -1.684  5.510   1.00 43.91 ? 198 CYS G O   1 
ATOM   9456  C  CB  . CYS G 1 114 ? 56.502 -2.551  3.122   1.00 44.14 ? 198 CYS G CB  1 
ATOM   9457  S  SG  . CYS G 1 114 ? 55.797 -3.489  2.058   1.00 54.21 ? 198 CYS G SG  1 
ATOM   9458  N  N   . TYR G 1 115 ? 58.500 -3.774  5.132   1.00 41.19 ? 199 TYR G N   1 
ATOM   9459  C  CA  . TYR G 1 115 ? 59.864 -3.509  5.550   1.00 38.27 ? 199 TYR G CA  1 
ATOM   9460  C  C   . TYR G 1 115 ? 60.748 -3.403  4.355   1.00 37.01 ? 199 TYR G C   1 
ATOM   9461  O  O   . TYR G 1 115 ? 60.778 -4.278  3.556   1.00 39.12 ? 199 TYR G O   1 
ATOM   9462  C  CB  . TYR G 1 115 ? 60.298 -4.634  6.433   1.00 37.07 ? 199 TYR G CB  1 
ATOM   9463  C  CG  . TYR G 1 115 ? 59.680 -4.511  7.767   1.00 35.32 ? 199 TYR G CG  1 
ATOM   9464  C  CD1 . TYR G 1 115 ? 58.617 -5.307  8.139   1.00 34.56 ? 199 TYR G CD1 1 
ATOM   9465  C  CD2 . TYR G 1 115 ? 60.133 -3.543  8.654   1.00 34.53 ? 199 TYR G CD2 1 
ATOM   9466  C  CE1 . TYR G 1 115 ? 58.052 -5.171  9.418   1.00 32.87 ? 199 TYR G CE1 1 
ATOM   9467  C  CE2 . TYR G 1 115 ? 59.597 -3.414  9.892   1.00 32.36 ? 199 TYR G CE2 1 
ATOM   9468  C  CZ  . TYR G 1 115 ? 58.553 -4.222  10.262  1.00 33.45 ? 199 TYR G CZ  1 
ATOM   9469  O  OH  . TYR G 1 115 ? 58.049 -4.050  11.509  1.00 37.53 ? 199 TYR G OH  1 
ATOM   9470  N  N   . VAL G 1 116 ? 61.454 -2.321  4.206   1.00 34.76 ? 200 VAL G N   1 
ATOM   9471  C  CA  . VAL G 1 116 ? 62.233 -2.111  3.028   1.00 32.93 ? 200 VAL G CA  1 
ATOM   9472  C  C   . VAL G 1 116 ? 63.672 -2.176  3.490   1.00 32.85 ? 200 VAL G C   1 
ATOM   9473  O  O   . VAL G 1 116 ? 63.971 -1.661  4.555   1.00 32.78 ? 200 VAL G O   1 
ATOM   9474  C  CB  . VAL G 1 116 ? 61.993 -0.681  2.471   1.00 31.89 ? 200 VAL G CB  1 
ATOM   9475  C  CG1 . VAL G 1 116 ? 63.091 -0.286  1.385   1.00 30.07 ? 200 VAL G CG1 1 
ATOM   9476  C  CG2 . VAL G 1 116 ? 60.661 -0.576  1.942   1.00 29.83 ? 200 VAL G CG2 1 
ATOM   9477  N  N   . LYS G 1 117 ? 64.550 -2.768  2.691   1.00 32.39 ? 201 LYS G N   1 
ATOM   9478  C  CA  . LYS G 1 117 ? 65.966 -2.702  2.936   1.00 34.31 ? 201 LYS G CA  1 
ATOM   9479  C  C   . LYS G 1 117 ? 66.594 -1.512  2.191   1.00 35.68 ? 201 LYS G C   1 
ATOM   9480  O  O   . LYS G 1 117 ? 66.712 -1.457  0.942   1.00 35.98 ? 201 LYS G O   1 
ATOM   9481  C  CB  . LYS G 1 117 ? 66.581 -4.010  2.545   1.00 35.23 ? 201 LYS G CB  1 
ATOM   9482  C  CG  . LYS G 1 117 ? 66.157 -5.160  3.501   1.00 37.20 ? 201 LYS G CG  1 
ATOM   9483  C  CD  . LYS G 1 117 ? 65.929 -6.447  2.695   1.00 38.68 ? 201 LYS G CD  1 
ATOM   9484  C  CE  . LYS G 1 117 ? 65.054 -7.464  3.421   1.00 38.89 ? 201 LYS G CE  1 
ATOM   9485  N  NZ  . LYS G 1 117 ? 65.031 -8.711  2.572   1.00 42.99 ? 201 LYS G NZ  1 
ATOM   9486  N  N   . ASP G 1 118 ? 66.919 -0.494  2.964   1.00 36.75 ? 202 ASP G N   1 
ATOM   9487  C  CA  . ASP G 1 118 ? 67.372 0.763   2.392   1.00 37.61 ? 202 ASP G CA  1 
ATOM   9488  C  C   . ASP G 1 118 ? 68.864 0.623   2.195   1.00 37.60 ? 202 ASP G C   1 
ATOM   9489  O  O   . ASP G 1 118 ? 69.642 0.712   3.126   1.00 37.81 ? 202 ASP G O   1 
ATOM   9490  C  CB  . ASP G 1 118 ? 67.009 1.931   3.334   1.00 37.33 ? 202 ASP G CB  1 
ATOM   9491  C  CG  . ASP G 1 118 ? 67.409 3.257   2.793   1.00 39.08 ? 202 ASP G CG  1 
ATOM   9492  O  OD1 . ASP G 1 118 ? 68.130 3.260   1.792   1.00 45.36 ? 202 ASP G OD1 1 
ATOM   9493  O  OD2 . ASP G 1 118 ? 67.010 4.309   3.334   1.00 41.78 ? 202 ASP G OD2 1 
ATOM   9494  N  N   . LEU G 1 119 ? 69.255 0.362   0.966   1.00 38.61 ? 203 LEU G N   1 
ATOM   9495  C  CA  . LEU G 1 119 ? 70.652 0.116   0.664   1.00 39.09 ? 203 LEU G CA  1 
ATOM   9496  C  C   . LEU G 1 119 ? 71.510 1.376   0.947   1.00 40.37 ? 203 LEU G C   1 
ATOM   9497  O  O   . LEU G 1 119 ? 72.728 1.272   1.059   1.00 42.19 ? 203 LEU G O   1 
ATOM   9498  C  CB  . LEU G 1 119 ? 70.815 -0.369  -0.783  1.00 38.00 ? 203 LEU G CB  1 
ATOM   9499  C  CG  . LEU G 1 119 ? 70.124 -1.687  -1.181  1.00 37.39 ? 203 LEU G CG  1 
ATOM   9500  C  CD1 . LEU G 1 119 ? 70.692 -2.184  -2.463  1.00 34.95 ? 203 LEU G CD1 1 
ATOM   9501  C  CD2 . LEU G 1 119 ? 70.281 -2.751  -0.145  1.00 34.57 ? 203 LEU G CD2 1 
ATOM   9502  N  N   . SER G 1 120 ? 70.880 2.543   1.086   1.00 39.65 ? 204 SER G N   1 
ATOM   9503  C  CA  . SER G 1 120 ? 71.611 3.789   1.201   1.00 39.10 ? 204 SER G CA  1 
ATOM   9504  C  C   . SER G 1 120 ? 72.089 3.902   2.640   1.00 39.14 ? 204 SER G C   1 
ATOM   9505  O  O   . SER G 1 120 ? 72.812 4.819   2.984   1.00 37.74 ? 204 SER G O   1 
ATOM   9506  C  CB  . SER G 1 120 ? 70.709 4.995   0.838   1.00 39.08 ? 204 SER G CB  1 
ATOM   9507  O  OG  . SER G 1 120 ? 69.784 5.312   1.913   1.00 38.52 ? 204 SER G OG  1 
ATOM   9508  N  N   . ARG G 1 121 ? 71.643 2.981   3.485   1.00 39.59 ? 205 ARG G N   1 
ATOM   9509  C  CA  . ARG G 1 121 ? 72.027 2.990   4.891   1.00 40.16 ? 205 ARG G CA  1 
ATOM   9510  C  C   . ARG G 1 121 ? 73.200 2.006   5.176   1.00 41.72 ? 205 ARG G C   1 
ATOM   9511  O  O   . ARG G 1 121 ? 73.700 1.926   6.296   1.00 41.56 ? 205 ARG G O   1 
ATOM   9512  C  CB  . ARG G 1 121 ? 70.816 2.615   5.705   1.00 39.44 ? 205 ARG G CB  1 
ATOM   9513  C  CG  . ARG G 1 121 ? 69.805 3.723   5.922   1.00 40.87 ? 205 ARG G CG  1 
ATOM   9514  C  CD  . ARG G 1 121 ? 68.426 3.166   6.297   1.00 41.11 ? 205 ARG G CD  1 
ATOM   9515  N  NE  . ARG G 1 121 ? 67.782 3.951   7.354   1.00 43.47 ? 205 ARG G NE  1 
ATOM   9516  C  CZ  . ARG G 1 121 ? 66.877 4.918   7.173   1.00 46.71 ? 205 ARG G CZ  1 
ATOM   9517  N  NH1 . ARG G 1 121 ? 66.408 5.550   8.253   1.00 43.18 ? 205 ARG G NH1 1 
ATOM   9518  N  NH2 . ARG G 1 121 ? 66.423 5.258   5.937   1.00 46.24 ? 205 ARG G NH2 1 
ATOM   9519  N  N   . LEU G 1 122 ? 73.615 1.245   4.160   1.00 43.01 ? 206 LEU G N   1 
ATOM   9520  C  CA  . LEU G 1 122 ? 74.707 0.248   4.298   1.00 44.91 ? 206 LEU G CA  1 
ATOM   9521  C  C   . LEU G 1 122 ? 76.101 0.902   4.581   1.00 45.88 ? 206 LEU G C   1 
ATOM   9522  O  O   . LEU G 1 122 ? 76.811 0.515   5.522   1.00 46.29 ? 206 LEU G O   1 
ATOM   9523  C  CB  . LEU G 1 122 ? 74.794 -0.630  3.021   1.00 44.51 ? 206 LEU G CB  1 
ATOM   9524  C  CG  . LEU G 1 122 ? 74.245 -2.066  2.821   1.00 45.95 ? 206 LEU G CG  1 
ATOM   9525  C  CD1 . LEU G 1 122 ? 73.137 -2.511  3.795   1.00 43.74 ? 206 LEU G CD1 1 
ATOM   9526  C  CD2 . LEU G 1 122 ? 73.838 -2.327  1.354   1.00 43.67 ? 206 LEU G CD2 1 
ATOM   9527  N  N   . GLY G 1 123 ? 76.467 1.898   3.771   1.00 46.04 ? 207 GLY G N   1 
ATOM   9528  C  CA  . GLY G 1 123 ? 77.750 2.566   3.891   1.00 46.23 ? 207 GLY G CA  1 
ATOM   9529  C  C   . GLY G 1 123 ? 78.622 2.071   2.764   1.00 47.09 ? 207 GLY G C   1 
ATOM   9530  O  O   . GLY G 1 123 ? 79.788 1.858   2.968   1.00 47.34 ? 207 GLY G O   1 
ATOM   9531  N  N   . ARG G 1 124 ? 78.045 1.863   1.578   1.00 47.32 ? 208 ARG G N   1 
ATOM   9532  C  CA  . ARG G 1 124 ? 78.741 1.268   0.443   1.00 47.27 ? 208 ARG G CA  1 
ATOM   9533  C  C   . ARG G 1 124 ? 78.402 2.003   -0.843  1.00 48.06 ? 208 ARG G C   1 
ATOM   9534  O  O   . ARG G 1 124 ? 77.252 2.383   -1.069  1.00 49.04 ? 208 ARG G O   1 
ATOM   9535  C  CB  . ARG G 1 124 ? 78.348 -0.211  0.280   1.00 46.61 ? 208 ARG G CB  1 
ATOM   9536  C  CG  . ARG G 1 124 ? 78.732 -1.133  1.466   1.00 46.54 ? 208 ARG G CG  1 
ATOM   9537  C  CD  . ARG G 1 124 ? 80.268 -1.394  1.609   1.00 46.17 ? 208 ARG G CD  1 
ATOM   9538  N  NE  . ARG G 1 124 ? 80.607 -1.226  3.009   1.00 46.17 ? 208 ARG G NE  1 
ATOM   9539  C  CZ  . ARG G 1 124 ? 81.029 -2.201  3.784   1.00 46.84 ? 208 ARG G CZ  1 
ATOM   9540  N  NH1 . ARG G 1 124 ? 81.242 -3.395  3.265   1.00 47.18 ? 208 ARG G NH1 1 
ATOM   9541  N  NH2 . ARG G 1 124 ? 81.252 -1.980  5.067   1.00 46.10 ? 208 ARG G NH2 1 
ATOM   9542  N  N   . ASP G 1 125 ? 79.381 2.222   -1.705  1.00 48.48 ? 209 ASP G N   1 
ATOM   9543  C  CA  . ASP G 1 125 ? 79.045 2.825   -2.960  1.00 48.89 ? 209 ASP G CA  1 
ATOM   9544  C  C   . ASP G 1 125 ? 77.939 1.954   -3.566  1.00 48.82 ? 209 ASP G C   1 
ATOM   9545  O  O   . ASP G 1 125 ? 78.113 0.746   -3.786  1.00 48.27 ? 209 ASP G O   1 
ATOM   9546  C  CB  . ASP G 1 125 ? 80.258 2.954   -3.881  1.00 49.37 ? 209 ASP G CB  1 
ATOM   9547  C  CG  . ASP G 1 125 ? 79.893 3.464   -5.292  1.00 53.08 ? 209 ASP G CG  1 
ATOM   9548  O  OD1 . ASP G 1 125 ? 78.694 3.789   -5.546  1.00 53.58 ? 209 ASP G OD1 1 
ATOM   9549  O  OD2 . ASP G 1 125 ? 80.818 3.543   -6.159  1.00 56.67 ? 209 ASP G OD2 1 
ATOM   9550  N  N   . LEU G 1 126 ? 76.803 2.590   -3.829  1.00 48.20 ? 210 LEU G N   1 
ATOM   9551  C  CA  . LEU G 1 126 ? 75.713 1.918   -4.454  1.00 47.80 ? 210 LEU G CA  1 
ATOM   9552  C  C   . LEU G 1 126 ? 76.011 1.479   -5.843  1.00 48.12 ? 210 LEU G C   1 
ATOM   9553  O  O   . LEU G 1 126 ? 75.257 0.708   -6.409  1.00 48.38 ? 210 LEU G O   1 
ATOM   9554  C  CB  . LEU G 1 126 ? 74.478 2.792   -4.452  1.00 47.52 ? 210 LEU G CB  1 
ATOM   9555  C  CG  . LEU G 1 126 ? 73.882 2.943   -3.058  1.00 47.22 ? 210 LEU G CG  1 
ATOM   9556  C  CD1 . LEU G 1 126 ? 72.661 3.873   -3.190  1.00 47.92 ? 210 LEU G CD1 1 
ATOM   9557  C  CD2 . LEU G 1 126 ? 73.539 1.613   -2.396  1.00 43.38 ? 210 LEU G CD2 1 
ATOM   9558  N  N   . ARG G 1 127 ? 77.099 1.970   -6.410  1.00 48.96 ? 211 ARG G N   1 
ATOM   9559  C  CA  . ARG G 1 127 ? 77.497 1.574   -7.758  1.00 49.82 ? 211 ARG G CA  1 
ATOM   9560  C  C   . ARG G 1 127 ? 78.218 0.206   -7.740  1.00 49.20 ? 211 ARG G C   1 
ATOM   9561  O  O   . ARG G 1 127 ? 78.526 -0.385  -8.804  1.00 48.16 ? 211 ARG G O   1 
ATOM   9562  C  CB  . ARG G 1 127 ? 78.372 2.682   -8.340  1.00 50.63 ? 211 ARG G CB  1 
ATOM   9563  C  CG  . ARG G 1 127 ? 77.554 3.804   -8.982  1.00 55.91 ? 211 ARG G CG  1 
ATOM   9564  C  CD  . ARG G 1 127 ? 77.840 5.171   -8.346  1.00 64.90 ? 211 ARG G CD  1 
ATOM   9565  N  NE  . ARG G 1 127 ? 79.275 5.485   -8.349  1.00 71.15 ? 211 ARG G NE  1 
ATOM   9566  C  CZ  . ARG G 1 127 ? 79.911 6.170   -7.396  1.00 72.75 ? 211 ARG G CZ  1 
ATOM   9567  N  NH1 . ARG G 1 127 ? 79.257 6.628   -6.318  1.00 72.12 ? 211 ARG G NH1 1 
ATOM   9568  N  NH2 . ARG G 1 127 ? 81.213 6.378   -7.521  1.00 72.60 ? 211 ARG G NH2 1 
ATOM   9569  N  N   . LYS G 1 128 ? 78.468 -0.256  -6.505  1.00 48.68 ? 212 LYS G N   1 
ATOM   9570  C  CA  . LYS G 1 128 ? 79.137 -1.509  -6.151  1.00 48.94 ? 212 LYS G CA  1 
ATOM   9571  C  C   . LYS G 1 128 ? 78.328 -2.245  -5.051  1.00 48.58 ? 212 LYS G C   1 
ATOM   9572  O  O   . LYS G 1 128 ? 78.908 -2.666  -4.001  1.00 48.49 ? 212 LYS G O   1 
ATOM   9573  C  CB  . LYS G 1 128 ? 80.574 -1.217  -5.623  1.00 49.65 ? 212 LYS G CB  1 
ATOM   9574  C  CG  . LYS G 1 128 ? 81.541 -0.606  -6.689  1.00 51.18 ? 212 LYS G CG  1 
ATOM   9575  C  CD  . LYS G 1 128 ? 82.097 -1.651  -7.676  1.00 53.61 ? 212 LYS G CD  1 
ATOM   9576  C  CE  . LYS G 1 128 ? 83.440 -2.278  -7.197  1.00 55.00 ? 212 LYS G CE  1 
ATOM   9577  N  NZ  . LYS G 1 128 ? 83.779 -3.599  -7.944  1.00 54.38 ? 212 LYS G NZ  1 
ATOM   9578  N  N   . THR G 1 129 ? 77.001 -2.347  -5.275  1.00 46.49 ? 213 THR G N   1 
ATOM   9579  C  CA  . THR G 1 129 ? 76.071 -3.016  -4.372  1.00 44.74 ? 213 THR G CA  1 
ATOM   9580  C  C   . THR G 1 129 ? 74.956 -3.649  -5.158  1.00 44.10 ? 213 THR G C   1 
ATOM   9581  O  O   . THR G 1 129 ? 74.493 -3.125  -6.161  1.00 43.04 ? 213 THR G O   1 
ATOM   9582  C  CB  . THR G 1 129 ? 75.473 -2.075  -3.345  1.00 45.41 ? 213 THR G CB  1 
ATOM   9583  O  OG1 . THR G 1 129 ? 76.529 -1.557  -2.551  1.00 46.20 ? 213 THR G OG1 1 
ATOM   9584  C  CG2 . THR G 1 129 ? 74.516 -2.802  -2.375  1.00 44.42 ? 213 THR G CG2 1 
ATOM   9585  N  N   . LEU G 1 130 ? 74.564 -4.834  -4.703  1.00 43.50 ? 214 LEU G N   1 
ATOM   9586  C  CA  . LEU G 1 130 ? 73.505 -5.602  -5.338  1.00 42.44 ? 214 LEU G CA  1 
ATOM   9587  C  C   . LEU G 1 130 ? 72.653 -6.185  -4.237  1.00 40.75 ? 214 LEU G C   1 
ATOM   9588  O  O   . LEU G 1 130 ? 73.127 -6.425  -3.139  1.00 39.13 ? 214 LEU G O   1 
ATOM   9589  C  CB  . LEU G 1 130 ? 74.069 -6.717  -6.220  1.00 42.37 ? 214 LEU G CB  1 
ATOM   9590  C  CG  . LEU G 1 130 ? 74.745 -6.325  -7.551  1.00 45.78 ? 214 LEU G CG  1 
ATOM   9591  C  CD1 . LEU G 1 130 ? 75.606 -7.482  -8.130  1.00 43.23 ? 214 LEU G CD1 1 
ATOM   9592  C  CD2 . LEU G 1 130 ? 73.762 -5.813  -8.616  1.00 44.38 ? 214 LEU G CD2 1 
ATOM   9593  N  N   . ILE G 1 131 ? 71.387 -6.377  -4.557  1.00 39.89 ? 215 ILE G N   1 
ATOM   9594  C  CA  . ILE G 1 131 ? 70.449 -7.026  -3.662  1.00 39.62 ? 215 ILE G CA  1 
ATOM   9595  C  C   . ILE G 1 131 ? 69.833 -8.253  -4.361  1.00 40.89 ? 215 ILE G C   1 
ATOM   9596  O  O   . ILE G 1 131 ? 69.292 -8.186  -5.498  1.00 41.60 ? 215 ILE G O   1 
ATOM   9597  C  CB  . ILE G 1 131 ? 69.394 -6.010  -3.046  1.00 39.43 ? 215 ILE G CB  1 
ATOM   9598  C  CG1 . ILE G 1 131 ? 68.402 -6.745  -2.148  1.00 39.73 ? 215 ILE G CG1 1 
ATOM   9599  C  CG2 . ILE G 1 131 ? 68.653 -5.155  -4.150  1.00 38.55 ? 215 ILE G CG2 1 
ATOM   9600  C  CD1 . ILE G 1 131 ? 67.739 -5.908  -0.959  1.00 35.15 ? 215 ILE G CD1 1 
ATOM   9601  N  N   . LEU G 1 132 ? 69.958 -9.397  -3.700  1.00 41.60 ? 216 LEU G N   1 
ATOM   9602  C  CA  . LEU G 1 132 ? 69.320 -10.629 -4.195  1.00 42.17 ? 216 LEU G CA  1 
ATOM   9603  C  C   . LEU G 1 132 ? 68.195 -10.946 -3.205  1.00 41.14 ? 216 LEU G C   1 
ATOM   9604  O  O   . LEU G 1 132 ? 68.460 -11.108 -1.997  1.00 39.19 ? 216 LEU G O   1 
ATOM   9605  C  CB  . LEU G 1 132 ? 70.328 -11.790 -4.301  1.00 42.17 ? 216 LEU G CB  1 
ATOM   9606  C  CG  . LEU G 1 132 ? 69.619 -13.146 -4.449  1.00 45.13 ? 216 LEU G CG  1 
ATOM   9607  C  CD1 . LEU G 1 132 ? 69.092 -13.302 -5.857  1.00 48.43 ? 216 LEU G CD1 1 
ATOM   9608  C  CD2 . LEU G 1 132 ? 70.478 -14.327 -4.084  1.00 43.98 ? 216 LEU G CD2 1 
ATOM   9609  N  N   . ASP G 1 133 ? 66.957 -10.929 -3.734  1.00 41.05 ? 217 ASP G N   1 
ATOM   9610  C  CA  . ASP G 1 133 ? 65.709 -11.049 -2.945  1.00 41.29 ? 217 ASP G CA  1 
ATOM   9611  C  C   . ASP G 1 133 ? 64.572 -11.548 -3.832  1.00 40.64 ? 217 ASP G C   1 
ATOM   9612  O  O   . ASP G 1 133 ? 64.555 -11.226 -5.031  1.00 41.28 ? 217 ASP G O   1 
ATOM   9613  C  CB  . ASP G 1 133 ? 65.336 -9.711  -2.333  1.00 40.80 ? 217 ASP G CB  1 
ATOM   9614  C  CG  . ASP G 1 133 ? 64.533 -9.848  -1.037  1.00 46.88 ? 217 ASP G CG  1 
ATOM   9615  O  OD1 . ASP G 1 133 ? 63.415 -10.495 -1.017  1.00 50.69 ? 217 ASP G OD1 1 
ATOM   9616  O  OD2 . ASP G 1 133 ? 65.004 -9.247  -0.020  1.00 50.05 ? 217 ASP G OD2 1 
ATOM   9617  N  N   . ASN G 1 134 ? 63.644 -12.344 -3.275  1.00 39.98 ? 218 ASN G N   1 
ATOM   9618  C  CA  . ASN G 1 134 ? 62.385 -12.699 -3.995  1.00 39.62 ? 218 ASN G CA  1 
ATOM   9619  C  C   . ASN G 1 134 ? 61.234 -11.660 -3.877  1.00 39.83 ? 218 ASN G C   1 
ATOM   9620  O  O   . ASN G 1 134 ? 60.304 -11.690 -4.667  1.00 39.88 ? 218 ASN G O   1 
ATOM   9621  C  CB  . ASN G 1 134 ? 61.821 -14.019 -3.496  1.00 38.74 ? 218 ASN G CB  1 
ATOM   9622  C  CG  . ASN G 1 134 ? 61.484 -13.981 -2.017  1.00 38.93 ? 218 ASN G CG  1 
ATOM   9623  O  OD1 . ASN G 1 134 ? 62.341 -13.649 -1.181  1.00 39.33 ? 218 ASN G OD1 1 
ATOM   9624  N  ND2 . ASN G 1 134 ? 60.246 -14.344 -1.672  1.00 35.82 ? 218 ASN G ND2 1 
ATOM   9625  N  N   . SER G 1 135 ? 61.257 -10.801 -2.845  1.00 38.98 ? 219 SER G N   1 
ATOM   9626  C  CA  . SER G 1 135 ? 60.235 -9.728  -2.700  1.00 37.03 ? 219 SER G CA  1 
ATOM   9627  C  C   . SER G 1 135 ? 60.719 -8.345  -3.168  1.00 36.49 ? 219 SER G C   1 
ATOM   9628  O  O   . SER G 1 135 ? 61.508 -7.689  -2.487  1.00 36.82 ? 219 SER G O   1 
ATOM   9629  C  CB  . SER G 1 135 ? 59.781 -9.621  -1.262  1.00 35.91 ? 219 SER G CB  1 
ATOM   9630  O  OG  . SER G 1 135 ? 59.721 -10.915 -0.744  1.00 36.16 ? 219 SER G OG  1 
ATOM   9631  N  N   . PRO G 1 136 ? 60.231 -7.891  -4.321  1.00 35.50 ? 220 PRO G N   1 
ATOM   9632  C  CA  . PRO G 1 136 ? 60.503 -6.545  -4.793  1.00 35.27 ? 220 PRO G CA  1 
ATOM   9633  C  C   . PRO G 1 136 ? 60.160 -5.452  -3.716  1.00 35.86 ? 220 PRO G C   1 
ATOM   9634  O  O   . PRO G 1 136 ? 60.856 -4.455  -3.573  1.00 35.84 ? 220 PRO G O   1 
ATOM   9635  C  CB  . PRO G 1 136 ? 59.599 -6.410  -5.998  1.00 35.00 ? 220 PRO G CB  1 
ATOM   9636  C  CG  . PRO G 1 136 ? 59.213 -7.811  -6.383  1.00 35.66 ? 220 PRO G CG  1 
ATOM   9637  C  CD  . PRO G 1 136 ? 59.382 -8.686  -5.227  1.00 35.03 ? 220 PRO G CD  1 
ATOM   9638  N  N   . ALA G 1 137 ? 59.121 -5.667  -2.930  1.00 36.37 ? 221 ALA G N   1 
ATOM   9639  C  CA  . ALA G 1 137 ? 58.798 -4.740  -1.845  1.00 36.41 ? 221 ALA G CA  1 
ATOM   9640  C  C   . ALA G 1 137 ? 60.000 -4.548  -1.028  1.00 36.14 ? 221 ALA G C   1 
ATOM   9641  O  O   . ALA G 1 137 ? 60.167 -3.485  -0.504  1.00 36.40 ? 221 ALA G O   1 
ATOM   9642  C  CB  . ALA G 1 137 ? 57.672 -5.233  -0.962  1.00 36.20 ? 221 ALA G CB  1 
ATOM   9643  N  N   . SER G 1 138 ? 60.863 -5.549  -0.948  1.00 35.98 ? 222 SER G N   1 
ATOM   9644  C  CA  . SER G 1 138 ? 62.093 -5.405  -0.137  1.00 36.29 ? 222 SER G CA  1 
ATOM   9645  C  C   . SER G 1 138 ? 63.068 -4.331  -0.623  1.00 34.94 ? 222 SER G C   1 
ATOM   9646  O  O   . SER G 1 138 ? 63.800 -3.777  0.157   1.00 35.93 ? 222 SER G O   1 
ATOM   9647  C  CB  . SER G 1 138 ? 62.816 -6.761  0.029   1.00 36.59 ? 222 SER G CB  1 
ATOM   9648  O  OG  . SER G 1 138 ? 62.089 -7.541  0.966   1.00 39.60 ? 222 SER G OG  1 
ATOM   9649  N  N   . TYR G 1 139 ? 63.069 -4.015  -1.901  1.00 33.91 ? 223 TYR G N   1 
ATOM   9650  C  CA  . TYR G 1 139 ? 64.022 -3.049  -2.410  1.00 32.77 ? 223 TYR G CA  1 
ATOM   9651  C  C   . TYR G 1 139 ? 63.320 -1.929  -3.148  1.00 32.09 ? 223 TYR G C   1 
ATOM   9652  O  O   . TYR G 1 139 ? 63.718 -1.570  -4.247  1.00 32.57 ? 223 TYR G O   1 
ATOM   9653  C  CB  . TYR G 1 139 ? 65.048 -3.758  -3.324  1.00 33.57 ? 223 TYR G CB  1 
ATOM   9654  C  CG  . TYR G 1 139 ? 64.485 -4.762  -4.360  1.00 31.74 ? 223 TYR G CG  1 
ATOM   9655  C  CD1 . TYR G 1 139 ? 64.051 -4.340  -5.608  1.00 32.00 ? 223 TYR G CD1 1 
ATOM   9656  C  CD2 . TYR G 1 139 ? 64.415 -6.120  -4.080  1.00 31.46 ? 223 TYR G CD2 1 
ATOM   9657  C  CE1 . TYR G 1 139 ? 63.529 -5.204  -6.546  1.00 28.49 ? 223 TYR G CE1 1 
ATOM   9658  C  CE2 . TYR G 1 139 ? 63.942 -7.003  -5.018  1.00 32.34 ? 223 TYR G CE2 1 
ATOM   9659  C  CZ  . TYR G 1 139 ? 63.499 -6.537  -6.251  1.00 33.36 ? 223 TYR G CZ  1 
ATOM   9660  O  OH  . TYR G 1 139 ? 63.054 -7.429  -7.198  1.00 33.15 ? 223 TYR G OH  1 
ATOM   9661  N  N   . ILE G 1 140 ? 62.274 -1.373  -2.535  1.00 31.77 ? 224 ILE G N   1 
ATOM   9662  C  CA  . ILE G 1 140 ? 61.443 -0.326  -3.136  1.00 30.26 ? 224 ILE G CA  1 
ATOM   9663  C  C   . ILE G 1 140 ? 62.302 0.866   -3.495  1.00 30.38 ? 224 ILE G C   1 
ATOM   9664  O  O   . ILE G 1 140 ? 62.137 1.445   -4.560  1.00 31.59 ? 224 ILE G O   1 
ATOM   9665  C  CB  . ILE G 1 140 ? 60.298 0.131   -2.177  1.00 30.27 ? 224 ILE G CB  1 
ATOM   9666  C  CG1 . ILE G 1 140 ? 59.183 -0.870  -2.155  1.00 32.56 ? 224 ILE G CG1 1 
ATOM   9667  C  CG2 . ILE G 1 140 ? 59.587 1.295   -2.703  1.00 28.27 ? 224 ILE G CG2 1 
ATOM   9668  C  CD1 . ILE G 1 140 ? 58.344 -0.734  -0.865  1.00 36.94 ? 224 ILE G CD1 1 
ATOM   9669  N  N   . PHE G 1 141 ? 63.231 1.253   -2.617  1.00 30.90 ? 225 PHE G N   1 
ATOM   9670  C  CA  . PHE G 1 141 ? 64.052 2.422   -2.898  1.00 30.28 ? 225 PHE G CA  1 
ATOM   9671  C  C   . PHE G 1 141 ? 65.143 2.135   -3.890  1.00 31.19 ? 225 PHE G C   1 
ATOM   9672  O  O   . PHE G 1 141 ? 65.666 3.056   -4.446  1.00 31.68 ? 225 PHE G O   1 
ATOM   9673  C  CB  . PHE G 1 141 ? 64.689 3.010   -1.660  1.00 30.09 ? 225 PHE G CB  1 
ATOM   9674  C  CG  . PHE G 1 141 ? 63.771 3.178   -0.491  1.00 28.22 ? 225 PHE G CG  1 
ATOM   9675  C  CD1 . PHE G 1 141 ? 64.278 3.066   0.772   1.00 24.49 ? 225 PHE G CD1 1 
ATOM   9676  C  CD2 . PHE G 1 141 ? 62.419 3.530   -0.647  1.00 32.05 ? 225 PHE G CD2 1 
ATOM   9677  C  CE1 . PHE G 1 141 ? 63.493 3.283   1.880   1.00 25.24 ? 225 PHE G CE1 1 
ATOM   9678  C  CE2 . PHE G 1 141 ? 61.610 3.729   0.455   1.00 27.90 ? 225 PHE G CE2 1 
ATOM   9679  C  CZ  . PHE G 1 141 ? 62.177 3.612   1.740   1.00 27.82 ? 225 PHE G CZ  1 
ATOM   9680  N  N   . HIS G 1 142 ? 65.491 0.877   -4.140  1.00 32.64 ? 226 HIS G N   1 
ATOM   9681  C  CA  . HIS G 1 142 ? 66.615 0.600   -5.055  1.00 34.55 ? 226 HIS G CA  1 
ATOM   9682  C  C   . HIS G 1 142 ? 66.382 -0.514  -6.091  1.00 35.69 ? 226 HIS G C   1 
ATOM   9683  O  O   . HIS G 1 142 ? 67.216 -1.397  -6.260  1.00 35.11 ? 226 HIS G O   1 
ATOM   9684  C  CB  . HIS G 1 142 ? 67.920 0.348   -4.279  1.00 34.18 ? 226 HIS G CB  1 
ATOM   9685  C  CG  . HIS G 1 142 ? 68.148 1.322   -3.156  1.00 35.75 ? 226 HIS G CG  1 
ATOM   9686  N  ND1 . HIS G 1 142 ? 68.762 2.546   -3.336  1.00 34.58 ? 226 HIS G ND1 1 
ATOM   9687  C  CD2 . HIS G 1 142 ? 67.830 1.250   -1.841  1.00 34.63 ? 226 HIS G CD2 1 
ATOM   9688  C  CE1 . HIS G 1 142 ? 68.822 3.175   -2.181  1.00 36.59 ? 226 HIS G CE1 1 
ATOM   9689  N  NE2 . HIS G 1 142 ? 68.257 2.413   -1.258  1.00 36.82 ? 226 HIS G NE2 1 
ATOM   9690  N  N   . PRO G 1 143 ? 65.291 -0.432  -6.861  1.00 36.15 ? 227 PRO G N   1 
ATOM   9691  C  CA  . PRO G 1 143 ? 65.068 -1.562  -7.755  1.00 36.55 ? 227 PRO G CA  1 
ATOM   9692  C  C   . PRO G 1 143 ? 66.185 -1.723  -8.811  1.00 37.10 ? 227 PRO G C   1 
ATOM   9693  O  O   . PRO G 1 143 ? 66.195 -2.683  -9.552  1.00 37.37 ? 227 PRO G O   1 
ATOM   9694  C  CB  . PRO G 1 143 ? 63.769 -1.161  -8.488  1.00 35.18 ? 227 PRO G CB  1 
ATOM   9695  C  CG  . PRO G 1 143 ? 63.787 0.303   -8.515  1.00 35.08 ? 227 PRO G CG  1 
ATOM   9696  C  CD  . PRO G 1 143 ? 64.327 0.651   -7.108  1.00 36.34 ? 227 PRO G CD  1 
ATOM   9697  N  N   . GLU G 1 144 ? 67.054 -0.748  -8.974  1.00 38.79 ? 228 GLU G N   1 
ATOM   9698  C  CA  . GLU G 1 144 ? 67.987 -0.843  -10.095 1.00 40.49 ? 228 GLU G CA  1 
ATOM   9699  C  C   . GLU G 1 144 ? 69.276 -1.591  -9.698  1.00 39.90 ? 228 GLU G C   1 
ATOM   9700  O  O   . GLU G 1 144 ? 70.053 -2.003  -10.542 1.00 40.82 ? 228 GLU G O   1 
ATOM   9701  C  CB  . GLU G 1 144 ? 68.192 0.503   -10.816 1.00 41.20 ? 228 GLU G CB  1 
ATOM   9702  C  CG  . GLU G 1 144 ? 68.704 1.643   -9.975  1.00 47.74 ? 228 GLU G CG  1 
ATOM   9703  C  CD  . GLU G 1 144 ? 67.677 2.232   -8.972  1.00 52.79 ? 228 GLU G CD  1 
ATOM   9704  O  OE1 . GLU G 1 144 ? 68.113 2.423   -7.800  1.00 55.86 ? 228 GLU G OE1 1 
ATOM   9705  O  OE2 . GLU G 1 144 ? 66.491 2.521   -9.347  1.00 52.34 ? 228 GLU G OE2 1 
ATOM   9706  N  N   . ASN G 1 145 ? 69.402 -1.819  -8.396  1.00 39.49 ? 229 ASN G N   1 
ATOM   9707  C  CA  . ASN G 1 145 ? 70.412 -2.605  -7.741  1.00 39.30 ? 229 ASN G CA  1 
ATOM   9708  C  C   . ASN G 1 145 ? 70.005 -4.073  -7.529  1.00 39.68 ? 229 ASN G C   1 
ATOM   9709  O  O   . ASN G 1 145 ? 70.713 -4.817  -6.829  1.00 40.05 ? 229 ASN G O   1 
ATOM   9710  C  CB  . ASN G 1 145 ? 70.615 -2.029  -6.374  1.00 38.28 ? 229 ASN G CB  1 
ATOM   9711  C  CG  . ASN G 1 145 ? 71.435 -0.813  -6.404  1.00 41.52 ? 229 ASN G CG  1 
ATOM   9712  O  OD1 . ASN G 1 145 ? 70.925 0.313   -6.487  1.00 46.37 ? 229 ASN G OD1 1 
ATOM   9713  N  ND2 . ASN G 1 145 ? 72.726 -0.999  -6.339  1.00 42.66 ? 229 ASN G ND2 1 
ATOM   9714  N  N   . ALA G 1 146 ? 68.876 -4.491  -8.101  1.00 38.71 ? 230 ALA G N   1 
ATOM   9715  C  CA  . ALA G 1 146 ? 68.299 -5.747  -7.679  1.00 38.78 ? 230 ALA G CA  1 
ATOM   9716  C  C   . ALA G 1 146 ? 68.565 -6.829  -8.697  1.00 39.62 ? 230 ALA G C   1 
ATOM   9717  O  O   . ALA G 1 146 ? 68.462 -6.595  -9.900  1.00 39.03 ? 230 ALA G O   1 
ATOM   9718  C  CB  . ALA G 1 146 ? 66.817 -5.610  -7.435  1.00 37.60 ? 230 ALA G CB  1 
ATOM   9719  N  N   . VAL G 1 147 ? 68.919 -8.013  -8.194  1.00 39.90 ? 231 VAL G N   1 
ATOM   9720  C  CA  . VAL G 1 147 ? 68.970 -9.197  -9.018  1.00 40.46 ? 231 VAL G CA  1 
ATOM   9721  C  C   . VAL G 1 147 ? 67.866 -10.086 -8.478  1.00 40.69 ? 231 VAL G C   1 
ATOM   9722  O  O   . VAL G 1 147 ? 68.061 -10.774 -7.492  1.00 42.68 ? 231 VAL G O   1 
ATOM   9723  C  CB  . VAL G 1 147 ? 70.301 -9.946  -8.881  1.00 40.67 ? 231 VAL G CB  1 
ATOM   9724  C  CG1 . VAL G 1 147 ? 70.351 -11.078 -9.891  1.00 41.14 ? 231 VAL G CG1 1 
ATOM   9725  C  CG2 . VAL G 1 147 ? 71.451 -9.004  -9.096  1.00 40.73 ? 231 VAL G CG2 1 
ATOM   9726  N  N   . PRO G 1 148 ? 66.709 -10.053 -9.103  1.00 40.00 ? 232 PRO G N   1 
ATOM   9727  C  CA  . PRO G 1 148 ? 65.547 -10.725 -8.649  1.00 40.84 ? 232 PRO G CA  1 
ATOM   9728  C  C   . PRO G 1 148 ? 65.634 -12.253 -8.773  1.00 41.57 ? 232 PRO G C   1 
ATOM   9729  O  O   . PRO G 1 148 ? 66.128 -12.742 -9.772  1.00 40.88 ? 232 PRO G O   1 
ATOM   9730  C  CB  . PRO G 1 148 ? 64.464 -10.178 -9.594  1.00 40.90 ? 232 PRO G CB  1 
ATOM   9731  C  CG  . PRO G 1 148 ? 65.053 -8.974  -10.171 1.00 40.34 ? 232 PRO G CG  1 
ATOM   9732  C  CD  . PRO G 1 148 ? 66.447 -9.283  -10.316 1.00 40.05 ? 232 PRO G CD  1 
ATOM   9733  N  N   . VAL G 1 149 ? 65.151 -12.980 -7.756  1.00 41.45 ? 233 VAL G N   1 
ATOM   9734  C  CA  . VAL G 1 149 ? 65.020 -14.411 -7.851  1.00 41.30 ? 233 VAL G CA  1 
ATOM   9735  C  C   . VAL G 1 149 ? 63.606 -14.899 -7.561  1.00 42.64 ? 233 VAL G C   1 
ATOM   9736  O  O   . VAL G 1 149 ? 62.951 -14.462 -6.606  1.00 42.71 ? 233 VAL G O   1 
ATOM   9737  C  CB  . VAL G 1 149 ? 66.031 -15.147 -6.937  1.00 42.23 ? 233 VAL G CB  1 
ATOM   9738  C  CG1 . VAL G 1 149 ? 65.608 -15.114 -5.477  1.00 38.98 ? 233 VAL G CG1 1 
ATOM   9739  C  CG2 . VAL G 1 149 ? 66.267 -16.616 -7.434  1.00 41.41 ? 233 VAL G CG2 1 
ATOM   9740  N  N   . GLN G 1 150 ? 63.138 -15.810 -8.412  1.00 43.62 ? 234 GLN G N   1 
ATOM   9741  C  CA  . GLN G 1 150 ? 61.951 -16.611 -8.187  1.00 44.44 ? 234 GLN G CA  1 
ATOM   9742  C  C   . GLN G 1 150 ? 61.930 -17.046 -6.722  1.00 44.50 ? 234 GLN G C   1 
ATOM   9743  O  O   . GLN G 1 150 ? 62.936 -17.513 -6.191  1.00 45.23 ? 234 GLN G O   1 
ATOM   9744  C  CB  . GLN G 1 150 ? 62.035 -17.846 -9.044  1.00 44.19 ? 234 GLN G CB  1 
ATOM   9745  C  CG  . GLN G 1 150 ? 60.874 -18.143 -9.868  1.00 47.36 ? 234 GLN G CG  1 
ATOM   9746  C  CD  . GLN G 1 150 ? 61.198 -19.265 -10.831 1.00 54.19 ? 234 GLN G CD  1 
ATOM   9747  O  OE1 . GLN G 1 150 ? 61.062 -20.435 -10.485 1.00 58.75 ? 234 GLN G OE1 1 
ATOM   9748  N  NE2 . GLN G 1 150 ? 61.656 -18.921 -12.044 1.00 55.47 ? 234 GLN G NE2 1 
ATOM   9749  N  N   . SER G 1 151 ? 60.792 -16.825 -6.070  1.00 44.22 ? 235 SER G N   1 
ATOM   9750  C  CA  . SER G 1 151 ? 60.513 -17.303 -4.717  1.00 43.18 ? 235 SER G CA  1 
ATOM   9751  C  C   . SER G 1 151 ? 60.619 -18.834 -4.687  1.00 42.73 ? 235 SER G C   1 
ATOM   9752  O  O   . SER G 1 151 ? 60.202 -19.502 -5.619  1.00 41.81 ? 235 SER G O   1 
ATOM   9753  C  CB  . SER G 1 151 ? 59.074 -16.866 -4.347  1.00 42.74 ? 235 SER G CB  1 
ATOM   9754  O  OG  . SER G 1 151 ? 59.056 -15.702 -3.538  1.00 41.94 ? 235 SER G OG  1 
ATOM   9755  N  N   . TRP G 1 152 ? 61.155 -19.372 -3.604  1.00 43.44 ? 236 TRP G N   1 
ATOM   9756  C  CA  . TRP G 1 152 ? 61.340 -20.820 -3.430  1.00 43.63 ? 236 TRP G CA  1 
ATOM   9757  C  C   . TRP G 1 152 ? 60.647 -21.345 -2.176  1.00 44.60 ? 236 TRP G C   1 
ATOM   9758  O  O   . TRP G 1 152 ? 60.840 -20.823 -1.093  1.00 43.38 ? 236 TRP G O   1 
ATOM   9759  C  CB  . TRP G 1 152 ? 62.844 -21.176 -3.362  1.00 43.12 ? 236 TRP G CB  1 
ATOM   9760  C  CG  . TRP G 1 152 ? 63.062 -22.648 -3.386  1.00 42.71 ? 236 TRP G CG  1 
ATOM   9761  C  CD1 . TRP G 1 152 ? 63.079 -23.474 -4.504  1.00 41.52 ? 236 TRP G CD1 1 
ATOM   9762  C  CD2 . TRP G 1 152 ? 63.226 -23.500 -2.250  1.00 38.66 ? 236 TRP G CD2 1 
ATOM   9763  N  NE1 . TRP G 1 152 ? 63.254 -24.777 -4.110  1.00 40.94 ? 236 TRP G NE1 1 
ATOM   9764  C  CE2 . TRP G 1 152 ? 63.340 -24.825 -2.736  1.00 40.90 ? 236 TRP G CE2 1 
ATOM   9765  C  CE3 . TRP G 1 152 ? 63.275 -23.273 -0.877  1.00 39.80 ? 236 TRP G CE3 1 
ATOM   9766  C  CZ2 . TRP G 1 152 ? 63.525 -25.921 -1.883  1.00 41.00 ? 236 TRP G CZ2 1 
ATOM   9767  C  CZ3 . TRP G 1 152 ? 63.450 -24.350 -0.021  1.00 41.56 ? 236 TRP G CZ3 1 
ATOM   9768  C  CH2 . TRP G 1 152 ? 63.568 -25.667 -0.525  1.00 42.47 ? 236 TRP G CH2 1 
ATOM   9769  N  N   . PHE G 1 153 ? 59.867 -22.416 -2.334  1.00 47.19 ? 237 PHE G N   1 
ATOM   9770  C  CA  . PHE G 1 153 ? 59.076 -22.965 -1.209  1.00 49.06 ? 237 PHE G CA  1 
ATOM   9771  C  C   . PHE G 1 153 ? 59.395 -24.418 -0.854  1.00 50.72 ? 237 PHE G C   1 
ATOM   9772  O  O   . PHE G 1 153 ? 59.633 -24.720 0.320   1.00 51.74 ? 237 PHE G O   1 
ATOM   9773  C  CB  . PHE G 1 153 ? 57.573 -22.813 -1.491  1.00 49.03 ? 237 PHE G CB  1 
ATOM   9774  C  CG  . PHE G 1 153 ? 57.123 -21.386 -1.710  1.00 47.18 ? 237 PHE G CG  1 
ATOM   9775  C  CD1 . PHE G 1 153 ? 57.021 -20.872 -3.006  1.00 46.86 ? 237 PHE G CD1 1 
ATOM   9776  C  CD2 . PHE G 1 153 ? 56.822 -20.568 -0.628  1.00 42.89 ? 237 PHE G CD2 1 
ATOM   9777  C  CE1 . PHE G 1 153 ? 56.615 -19.544 -3.218  1.00 45.19 ? 237 PHE G CE1 1 
ATOM   9778  C  CE2 . PHE G 1 153 ? 56.418 -19.275 -0.830  1.00 42.21 ? 237 PHE G CE2 1 
ATOM   9779  C  CZ  . PHE G 1 153 ? 56.323 -18.760 -2.137  1.00 44.47 ? 237 PHE G CZ  1 
ATOM   9780  N  N   . ASP G 1 154 ? 59.392 -25.310 -1.856  1.00 52.26 ? 238 ASP G N   1 
ATOM   9781  C  CA  . ASP G 1 154 ? 59.625 -26.748 -1.648  1.00 53.01 ? 238 ASP G CA  1 
ATOM   9782  C  C   . ASP G 1 154 ? 59.924 -27.553 -2.933  1.00 54.10 ? 238 ASP G C   1 
ATOM   9783  O  O   . ASP G 1 154 ? 60.065 -28.759 -2.836  1.00 55.20 ? 238 ASP G O   1 
ATOM   9784  C  CB  . ASP G 1 154 ? 58.424 -27.373 -0.933  1.00 52.57 ? 238 ASP G CB  1 
ATOM   9785  C  CG  . ASP G 1 154 ? 57.129 -27.381 -1.809  1.00 54.29 ? 238 ASP G CG  1 
ATOM   9786  O  OD1 . ASP G 1 154 ? 57.117 -26.797 -2.936  1.00 53.07 ? 238 ASP G OD1 1 
ATOM   9787  O  OD2 . ASP G 1 154 ? 56.110 -27.972 -1.356  1.00 53.19 ? 238 ASP G OD2 1 
ATOM   9788  N  N   . ASP G 1 155 ? 60.004 -26.929 -4.115  1.00 55.11 ? 239 ASP G N   1 
ATOM   9789  C  CA  . ASP G 1 155 ? 60.248 -27.657 -5.387  1.00 56.73 ? 239 ASP G CA  1 
ATOM   9790  C  C   . ASP G 1 155 ? 61.726 -28.091 -5.558  1.00 58.21 ? 239 ASP G C   1 
ATOM   9791  O  O   . ASP G 1 155 ? 62.647 -27.260 -5.695  1.00 57.59 ? 239 ASP G O   1 
ATOM   9792  C  CB  . ASP G 1 155 ? 59.737 -26.847 -6.596  1.00 57.12 ? 239 ASP G CB  1 
ATOM   9793  C  CG  . ASP G 1 155 ? 60.425 -27.212 -7.927  1.00 59.53 ? 239 ASP G CG  1 
ATOM   9794  O  OD1 . ASP G 1 155 ? 60.482 -28.399 -8.321  1.00 62.93 ? 239 ASP G OD1 1 
ATOM   9795  O  OD2 . ASP G 1 155 ? 60.922 -26.288 -8.607  1.00 63.50 ? 239 ASP G OD2 1 
ATOM   9796  N  N   . MET G 1 156 ? 61.950 -29.403 -5.563  1.00 59.33 ? 240 MET G N   1 
ATOM   9797  C  CA  . MET G 1 156 ? 63.313 -29.895 -5.429  1.00 60.15 ? 240 MET G CA  1 
ATOM   9798  C  C   . MET G 1 156 ? 64.080 -29.870 -6.754  1.00 60.91 ? 240 MET G C   1 
ATOM   9799  O  O   . MET G 1 156 ? 65.310 -29.997 -6.765  1.00 61.39 ? 240 MET G O   1 
ATOM   9800  C  CB  . MET G 1 156 ? 63.326 -31.249 -4.752  1.00 60.12 ? 240 MET G CB  1 
ATOM   9801  C  CG  . MET G 1 156 ? 63.082 -31.163 -3.235  1.00 60.10 ? 240 MET G CG  1 
ATOM   9802  S  SD  . MET G 1 156 ? 64.205 -29.976 -2.478  1.00 59.28 ? 240 MET G SD  1 
ATOM   9803  C  CE  . MET G 1 156 ? 64.731 -30.722 -0.942  1.00 60.14 ? 240 MET G CE  1 
ATOM   9804  N  N   . ALA G 1 157 ? 63.349 -29.629 -7.843  1.00 60.64 ? 241 ALA G N   1 
ATOM   9805  C  CA  . ALA G 1 157 ? 63.908 -29.430 -9.165  1.00 60.52 ? 241 ALA G CA  1 
ATOM   9806  C  C   . ALA G 1 157 ? 64.248 -27.952 -9.462  1.00 61.03 ? 241 ALA G C   1 
ATOM   9807  O  O   . ALA G 1 157 ? 64.380 -27.543 -10.649 1.00 61.05 ? 241 ALA G O   1 
ATOM   9808  C  CB  . ALA G 1 157 ? 62.905 -29.938 -10.196 1.00 60.93 ? 241 ALA G CB  1 
ATOM   9809  N  N   . ASP G 1 158 ? 64.380 -27.139 -8.413  1.00 60.74 ? 242 ASP G N   1 
ATOM   9810  C  CA  . ASP G 1 158 ? 64.694 -25.728 -8.616  1.00 60.55 ? 242 ASP G CA  1 
ATOM   9811  C  C   . ASP G 1 158 ? 66.178 -25.568 -8.877  1.00 61.48 ? 242 ASP G C   1 
ATOM   9812  O  O   . ASP G 1 158 ? 66.983 -25.940 -8.013  1.00 61.86 ? 242 ASP G O   1 
ATOM   9813  C  CB  . ASP G 1 158 ? 64.315 -24.926 -7.375  1.00 60.59 ? 242 ASP G CB  1 
ATOM   9814  C  CG  . ASP G 1 158 ? 64.692 -23.466 -7.476  1.00 58.22 ? 242 ASP G CG  1 
ATOM   9815  O  OD1 . ASP G 1 158 ? 65.593 -23.021 -6.760  1.00 59.35 ? 242 ASP G OD1 1 
ATOM   9816  O  OD2 . ASP G 1 158 ? 64.100 -22.746 -8.267  1.00 57.32 ? 242 ASP G OD2 1 
ATOM   9817  N  N   . THR G 1 159 ? 66.541 -25.002 -10.037 1.00 61.74 ? 243 THR G N   1 
ATOM   9818  C  CA  . THR G 1 159 ? 67.946 -24.759 -10.369 1.00 62.51 ? 243 THR G CA  1 
ATOM   9819  C  C   . THR G 1 159 ? 68.320 -23.281 -10.461 1.00 62.70 ? 243 THR G C   1 
ATOM   9820  O  O   . THR G 1 159 ? 69.269 -22.887 -11.188 1.00 62.09 ? 243 THR G O   1 
ATOM   9821  C  CB  . THR G 1 159 ? 68.379 -25.481 -11.671 1.00 62.73 ? 243 THR G CB  1 
ATOM   9822  O  OG1 . THR G 1 159 ? 67.607 -25.003 -12.780 1.00 62.67 ? 243 THR G OG1 1 
ATOM   9823  C  CG2 . THR G 1 159 ? 68.214 -26.986 -11.514 1.00 63.74 ? 243 THR G CG2 1 
ATOM   9824  N  N   . GLU G 1 160 ? 67.603 -22.460 -9.703  1.00 62.79 ? 244 GLU G N   1 
ATOM   9825  C  CA  . GLU G 1 160 ? 67.732 -21.021 -9.904  1.00 63.16 ? 244 GLU G CA  1 
ATOM   9826  C  C   . GLU G 1 160 ? 68.972 -20.472 -9.246  1.00 62.22 ? 244 GLU G C   1 
ATOM   9827  O  O   . GLU G 1 160 ? 69.642 -19.642 -9.839  1.00 61.79 ? 244 GLU G O   1 
ATOM   9828  C  CB  . GLU G 1 160 ? 66.432 -20.242 -9.567  1.00 64.30 ? 244 GLU G CB  1 
ATOM   9829  C  CG  . GLU G 1 160 ? 65.357 -20.316 -10.711 1.00 65.82 ? 244 GLU G CG  1 
ATOM   9830  C  CD  . GLU G 1 160 ? 65.658 -19.385 -11.921 1.00 71.16 ? 244 GLU G CD  1 
ATOM   9831  O  OE1 . GLU G 1 160 ? 66.694 -18.636 -11.941 1.00 69.37 ? 244 GLU G OE1 1 
ATOM   9832  O  OE2 . GLU G 1 160 ? 64.825 -19.405 -12.870 1.00 74.41 ? 244 GLU G OE2 1 
ATOM   9833  N  N   . LEU G 1 161 ? 69.314 -20.981 -8.069  1.00 61.83 ? 245 LEU G N   1 
ATOM   9834  C  CA  . LEU G 1 161 ? 70.575 -20.589 -7.425  1.00 62.35 ? 245 LEU G CA  1 
ATOM   9835  C  C   . LEU G 1 161 ? 71.810 -20.909 -8.273  1.00 63.44 ? 245 LEU G C   1 
ATOM   9836  O  O   . LEU G 1 161 ? 72.794 -20.167 -8.264  1.00 63.49 ? 245 LEU G O   1 
ATOM   9837  C  CB  . LEU G 1 161 ? 70.708 -21.174 -6.018  1.00 61.87 ? 245 LEU G CB  1 
ATOM   9838  C  CG  . LEU G 1 161 ? 69.775 -20.530 -4.969  1.00 59.97 ? 245 LEU G CG  1 
ATOM   9839  C  CD1 . LEU G 1 161 ? 70.307 -20.784 -3.576  1.00 53.78 ? 245 LEU G CD1 1 
ATOM   9840  C  CD2 . LEU G 1 161 ? 69.584 -19.014 -5.237  1.00 57.15 ? 245 LEU G CD2 1 
ATOM   9841  N  N   . LEU G 1 162 ? 71.705 -22.014 -9.015  1.00 64.56 ? 246 LEU G N   1 
ATOM   9842  C  CA  . LEU G 1 162 ? 72.649 -22.452 -10.033 1.00 64.83 ? 246 LEU G CA  1 
ATOM   9843  C  C   . LEU G 1 162 ? 72.747 -21.478 -11.183 1.00 64.44 ? 246 LEU G C   1 
ATOM   9844  O  O   . LEU G 1 162 ? 73.825 -21.002 -11.459 1.00 64.59 ? 246 LEU G O   1 
ATOM   9845  C  CB  . LEU G 1 162 ? 72.224 -23.823 -10.584 1.00 65.45 ? 246 LEU G CB  1 
ATOM   9846  C  CG  . LEU G 1 162 ? 73.304 -24.796 -11.067 1.00 65.82 ? 246 LEU G CG  1 
ATOM   9847  C  CD1 . LEU G 1 162 ? 73.572 -25.866 -10.002 1.00 63.51 ? 246 LEU G CD1 1 
ATOM   9848  C  CD2 . LEU G 1 162 ? 72.893 -25.427 -12.412 1.00 67.35 ? 246 LEU G CD2 1 
ATOM   9849  N  N   . ASN G 1 163 ? 71.637 -21.209 -11.867 1.00 64.46 ? 247 ASN G N   1 
ATOM   9850  C  CA  . ASN G 1 163 ? 71.610 -20.181 -12.936 1.00 64.68 ? 247 ASN G CA  1 
ATOM   9851  C  C   . ASN G 1 163 ? 72.234 -18.822 -12.556 1.00 63.64 ? 247 ASN G C   1 
ATOM   9852  O  O   . ASN G 1 163 ? 72.767 -18.107 -13.420 1.00 64.05 ? 247 ASN G O   1 
ATOM   9853  C  CB  . ASN G 1 163 ? 70.193 -19.985 -13.481 1.00 64.85 ? 247 ASN G CB  1 
ATOM   9854  C  CG  . ASN G 1 163 ? 69.547 -21.311 -13.864 1.00 68.23 ? 247 ASN G CG  1 
ATOM   9855  O  OD1 . ASN G 1 163 ? 70.266 -22.290 -14.104 1.00 70.65 ? 247 ASN G OD1 1 
ATOM   9856  N  ND2 . ASN G 1 163 ? 68.189 -21.367 -13.893 1.00 68.35 ? 247 ASN G ND2 1 
ATOM   9857  N  N   . LEU G 1 164 ? 72.196 -18.496 -11.269 1.00 61.69 ? 248 LEU G N   1 
ATOM   9858  C  CA  . LEU G 1 164 ? 72.677 -17.213 -10.812 1.00 60.38 ? 248 LEU G CA  1 
ATOM   9859  C  C   . LEU G 1 164 ? 74.188 -17.102 -10.812 1.00 60.04 ? 248 LEU G C   1 
ATOM   9860  O  O   . LEU G 1 164 ? 74.726 -16.010 -11.001 1.00 59.27 ? 248 LEU G O   1 
ATOM   9861  C  CB  . LEU G 1 164 ? 72.126 -16.891 -9.416  1.00 60.03 ? 248 LEU G CB  1 
ATOM   9862  C  CG  . LEU G 1 164 ? 70.664 -16.448 -9.553  1.00 57.81 ? 248 LEU G CG  1 
ATOM   9863  C  CD1 . LEU G 1 164 ? 69.999 -16.400 -8.217  1.00 53.57 ? 248 LEU G CD1 1 
ATOM   9864  C  CD2 . LEU G 1 164 ? 70.528 -15.149 -10.329 1.00 53.69 ? 248 LEU G CD2 1 
ATOM   9865  N  N   . ILE G 1 165 ? 74.856 -18.238 -10.606 1.00 59.70 ? 249 ILE G N   1 
ATOM   9866  C  CA  . ILE G 1 165 ? 76.313 -18.275 -10.448 1.00 59.44 ? 249 ILE G CA  1 
ATOM   9867  C  C   . ILE G 1 165 ? 77.070 -17.695 -11.653 1.00 58.99 ? 249 ILE G C   1 
ATOM   9868  O  O   . ILE G 1 165 ? 77.869 -16.801 -11.471 1.00 59.09 ? 249 ILE G O   1 
ATOM   9869  C  CB  . ILE G 1 165 ? 76.827 -19.664 -10.045 1.00 59.52 ? 249 ILE G CB  1 
ATOM   9870  C  CG1 . ILE G 1 165 ? 76.530 -19.905 -8.559  1.00 59.11 ? 249 ILE G CG1 1 
ATOM   9871  C  CG2 . ILE G 1 165 ? 78.320 -19.745 -10.275 1.00 58.95 ? 249 ILE G CG2 1 
ATOM   9872  C  CD1 . ILE G 1 165 ? 76.251 -21.382 -8.180  1.00 58.74 ? 249 ILE G CD1 1 
ATOM   9873  N  N   . PRO G 1 166 ? 76.806 -18.176 -12.865 1.00 58.69 ? 250 PRO G N   1 
ATOM   9874  C  CA  . PRO G 1 166 ? 77.327 -17.486 -14.025 1.00 59.56 ? 250 PRO G CA  1 
ATOM   9875  C  C   . PRO G 1 166 ? 76.787 -16.084 -14.187 1.00 60.25 ? 250 PRO G C   1 
ATOM   9876  O  O   . PRO G 1 166 ? 77.318 -15.308 -14.999 1.00 60.48 ? 250 PRO G O   1 
ATOM   9877  C  CB  . PRO G 1 166 ? 76.824 -18.332 -15.211 1.00 60.18 ? 250 PRO G CB  1 
ATOM   9878  C  CG  . PRO G 1 166 ? 75.672 -19.116 -14.672 1.00 60.20 ? 250 PRO G CG  1 
ATOM   9879  C  CD  . PRO G 1 166 ? 76.073 -19.393 -13.239 1.00 59.12 ? 250 PRO G CD  1 
ATOM   9880  N  N   . ILE G 1 167 ? 75.721 -15.744 -13.467 1.00 60.59 ? 251 ILE G N   1 
ATOM   9881  C  CA  . ILE G 1 167 ? 75.235 -14.372 -13.573 1.00 60.39 ? 251 ILE G CA  1 
ATOM   9882  C  C   . ILE G 1 167 ? 76.002 -13.468 -12.601 1.00 59.60 ? 251 ILE G C   1 
ATOM   9883  O  O   . ILE G 1 167 ? 76.570 -12.465 -13.012 1.00 59.27 ? 251 ILE G O   1 
ATOM   9884  C  CB  . ILE G 1 167 ? 73.670 -14.272 -13.574 1.00 60.17 ? 251 ILE G CB  1 
ATOM   9885  C  CG1 . ILE G 1 167 ? 73.161 -14.805 -14.918 1.00 60.22 ? 251 ILE G CG1 1 
ATOM   9886  C  CG2 . ILE G 1 167 ? 73.210 -12.819 -13.365 1.00 59.89 ? 251 ILE G CG2 1 
ATOM   9887  C  CD1 . ILE G 1 167 ? 71.596 -14.710 -15.218 1.00 61.60 ? 251 ILE G CD1 1 
ATOM   9888  N  N   . PHE G 1 168 ? 76.079 -13.841 -11.340 1.00 59.38 ? 252 PHE G N   1 
ATOM   9889  C  CA  . PHE G 1 168 ? 76.911 -13.082 -10.455 1.00 61.09 ? 252 PHE G CA  1 
ATOM   9890  C  C   . PHE G 1 168 ? 78.394 -13.115 -10.860 1.00 62.86 ? 252 PHE G C   1 
ATOM   9891  O  O   . PHE G 1 168 ? 79.141 -12.160 -10.596 1.00 63.32 ? 252 PHE G O   1 
ATOM   9892  C  CB  . PHE G 1 168 ? 76.735 -13.538 -9.022  1.00 60.91 ? 252 PHE G CB  1 
ATOM   9893  C  CG  . PHE G 1 168 ? 75.492 -12.994 -8.356  1.00 61.95 ? 252 PHE G CG  1 
ATOM   9894  C  CD1 . PHE G 1 168 ? 74.291 -13.706 -8.393  1.00 61.32 ? 252 PHE G CD1 1 
ATOM   9895  C  CD2 . PHE G 1 168 ? 75.524 -11.757 -7.694  1.00 61.37 ? 252 PHE G CD2 1 
ATOM   9896  C  CE1 . PHE G 1 168 ? 73.155 -13.198 -7.775  1.00 61.96 ? 252 PHE G CE1 1 
ATOM   9897  C  CE2 . PHE G 1 168 ? 74.403 -11.242 -7.077  1.00 61.29 ? 252 PHE G CE2 1 
ATOM   9898  C  CZ  . PHE G 1 168 ? 73.211 -11.958 -7.115  1.00 61.75 ? 252 PHE G CZ  1 
ATOM   9899  N  N   . GLU G 1 169 ? 78.827 -14.206 -11.490 1.00 64.08 ? 253 GLU G N   1 
ATOM   9900  C  CA  . GLU G 1 169 ? 80.222 -14.345 -11.869 1.00 65.59 ? 253 GLU G CA  1 
ATOM   9901  C  C   . GLU G 1 169 ? 80.603 -13.285 -12.894 1.00 65.98 ? 253 GLU G C   1 
ATOM   9902  O  O   . GLU G 1 169 ? 81.664 -12.678 -12.797 1.00 65.94 ? 253 GLU G O   1 
ATOM   9903  C  CB  . GLU G 1 169 ? 80.492 -15.749 -12.424 1.00 65.84 ? 253 GLU G CB  1 
ATOM   9904  C  CG  . GLU G 1 169 ? 80.928 -16.767 -11.342 1.00 66.14 ? 253 GLU G CG  1 
ATOM   9905  C  CD  . GLU G 1 169 ? 81.365 -18.108 -11.916 1.00 66.81 ? 253 GLU G CD  1 
ATOM   9906  O  OE1 . GLU G 1 169 ? 81.016 -18.379 -13.104 1.00 65.79 ? 253 GLU G OE1 1 
ATOM   9907  O  OE2 . GLU G 1 169 ? 82.072 -18.863 -11.173 1.00 68.56 ? 253 GLU G OE2 1 
ATOM   9908  N  N   . GLU G 1 170 ? 79.706 -13.079 -13.858 1.00 66.10 ? 254 GLU G N   1 
ATOM   9909  C  CA  . GLU G 1 170 ? 79.816 -12.077 -14.923 1.00 66.43 ? 254 GLU G CA  1 
ATOM   9910  C  C   . GLU G 1 170 ? 79.714 -10.630 -14.425 1.00 66.13 ? 254 GLU G C   1 
ATOM   9911  O  O   . GLU G 1 170 ? 79.972 -9.686  -15.170 1.00 65.73 ? 254 GLU G O   1 
ATOM   9912  C  CB  . GLU G 1 170 ? 78.670 -12.328 -15.888 1.00 66.73 ? 254 GLU G CB  1 
ATOM   9913  C  CG  . GLU G 1 170 ? 78.496 -11.312 -16.990 1.00 70.85 ? 254 GLU G CG  1 
ATOM   9914  C  CD  . GLU G 1 170 ? 77.942 -11.949 -18.262 1.00 76.78 ? 254 GLU G CD  1 
ATOM   9915  O  OE1 . GLU G 1 170 ? 77.346 -13.067 -18.181 1.00 78.39 ? 254 GLU G OE1 1 
ATOM   9916  O  OE2 . GLU G 1 170 ? 78.115 -11.337 -19.344 1.00 77.75 ? 254 GLU G OE2 1 
ATOM   9917  N  N   . LEU G 1 171 ? 79.283 -10.468 -13.177 1.00 65.73 ? 255 LEU G N   1 
ATOM   9918  C  CA  . LEU G 1 171 ? 79.144 -9.162  -12.569 1.00 64.86 ? 255 LEU G CA  1 
ATOM   9919  C  C   . LEU G 1 171 ? 80.292 -8.865  -11.640 1.00 64.15 ? 255 LEU G C   1 
ATOM   9920  O  O   . LEU G 1 171 ? 80.542 -7.721  -11.340 1.00 64.21 ? 255 LEU G O   1 
ATOM   9921  C  CB  . LEU G 1 171 ? 77.836 -9.085  -11.772 1.00 65.01 ? 255 LEU G CB  1 
ATOM   9922  C  CG  . LEU G 1 171 ? 76.552 -9.041  -12.587 1.00 64.80 ? 255 LEU G CG  1 
ATOM   9923  C  CD1 . LEU G 1 171 ? 75.349 -9.408  -11.738 1.00 63.81 ? 255 LEU G CD1 1 
ATOM   9924  C  CD2 . LEU G 1 171 ? 76.388 -7.680  -13.173 1.00 63.77 ? 255 LEU G CD2 1 
ATOM   9925  N  N   . SER G 1 172 ? 80.982 -9.903  -11.195 1.00 64.15 ? 256 SER G N   1 
ATOM   9926  C  CA  . SER G 1 172 ? 81.911 -9.825  -10.062 1.00 64.42 ? 256 SER G CA  1 
ATOM   9927  C  C   . SER G 1 172 ? 82.985 -8.734  -10.171 1.00 64.72 ? 256 SER G C   1 
ATOM   9928  O  O   . SER G 1 172 ? 83.397 -8.154  -9.146  1.00 63.41 ? 256 SER G O   1 
ATOM   9929  C  CB  . SER G 1 172 ? 82.576 -11.180 -9.854  1.00 64.51 ? 256 SER G CB  1 
ATOM   9930  O  OG  . SER G 1 172 ? 83.047 -11.703 -11.084 1.00 63.83 ? 256 SER G OG  1 
ATOM   9931  N  N   . GLY G 1 173 ? 83.418 -8.490  -11.416 1.00 65.23 ? 257 GLY G N   1 
ATOM   9932  C  CA  . GLY G 1 173 ? 84.380 -7.444  -11.766 1.00 66.54 ? 257 GLY G CA  1 
ATOM   9933  C  C   . GLY G 1 173 ? 83.808 -6.371  -12.692 1.00 67.32 ? 257 GLY G C   1 
ATOM   9934  O  O   . GLY G 1 173 ? 84.268 -6.193  -13.832 1.00 67.68 ? 257 GLY G O   1 
ATOM   9935  N  N   . ALA G 1 174 ? 82.771 -5.689  -12.195 1.00 67.75 ? 258 ALA G N   1 
ATOM   9936  C  CA  . ALA G 1 174 ? 82.174 -4.502  -12.812 1.00 67.34 ? 258 ALA G CA  1 
ATOM   9937  C  C   . ALA G 1 174 ? 82.507 -3.319  -11.885 1.00 67.24 ? 258 ALA G C   1 
ATOM   9938  O  O   . ALA G 1 174 ? 82.572 -3.486  -10.657 1.00 67.05 ? 258 ALA G O   1 
ATOM   9939  C  CB  . ALA G 1 174 ? 80.675 -4.694  -12.940 1.00 67.13 ? 258 ALA G CB  1 
ATOM   9940  N  N   . GLU G 1 175 ? 82.771 -2.134  -12.425 1.00 66.97 ? 259 GLU G N   1 
ATOM   9941  C  CA  . GLU G 1 175 ? 83.095 -1.061  -11.481 1.00 66.98 ? 259 GLU G CA  1 
ATOM   9942  C  C   . GLU G 1 175 ? 81.838 -0.246  -11.179 1.00 65.39 ? 259 GLU G C   1 
ATOM   9943  O  O   . GLU G 1 175 ? 81.735 0.376   -10.126 1.00 64.94 ? 259 GLU G O   1 
ATOM   9944  C  CB  . GLU G 1 175 ? 84.343 -0.229  -11.892 1.00 67.94 ? 259 GLU G CB  1 
ATOM   9945  C  CG  . GLU G 1 175 ? 85.753 -0.965  -11.700 1.00 70.89 ? 259 GLU G CG  1 
ATOM   9946  C  CD  . GLU G 1 175 ? 86.168 -1.263  -10.209 1.00 74.32 ? 259 GLU G CD  1 
ATOM   9947  O  OE1 . GLU G 1 175 ? 86.295 -0.310  -9.378  1.00 74.28 ? 259 GLU G OE1 1 
ATOM   9948  O  OE2 . GLU G 1 175 ? 86.382 -2.465  -9.883  1.00 72.62 ? 259 GLU G OE2 1 
ATOM   9949  N  N   . ASP G 1 176 ? 80.875 -0.333  -12.095 1.00 63.95 ? 260 ASP G N   1 
ATOM   9950  C  CA  . ASP G 1 176 ? 79.530 0.217   -11.936 1.00 63.14 ? 260 ASP G CA  1 
ATOM   9951  C  C   . ASP G 1 176 ? 78.479 -0.856  -12.221 1.00 61.62 ? 260 ASP G C   1 
ATOM   9952  O  O   . ASP G 1 176 ? 78.311 -1.212  -13.398 1.00 61.28 ? 260 ASP G O   1 
ATOM   9953  C  CB  . ASP G 1 176 ? 79.318 1.356   -12.944 1.00 63.66 ? 260 ASP G CB  1 
ATOM   9954  C  CG  . ASP G 1 176 ? 77.986 2.083   -12.747 1.00 66.43 ? 260 ASP G CG  1 
ATOM   9955  O  OD1 . ASP G 1 176 ? 77.051 1.923   -13.587 1.00 65.69 ? 260 ASP G OD1 1 
ATOM   9956  O  OD2 . ASP G 1 176 ? 77.891 2.830   -11.737 1.00 70.82 ? 260 ASP G OD2 1 
ATOM   9957  N  N   . VAL G 1 177 ? 77.750 -1.330  -11.190 1.00 59.59 ? 261 VAL G N   1 
ATOM   9958  C  CA  . VAL G 1 177 ? 76.709 -2.373  -11.398 1.00 58.03 ? 261 VAL G CA  1 
ATOM   9959  C  C   . VAL G 1 177 ? 75.473 -1.962  -12.200 1.00 57.64 ? 261 VAL G C   1 
ATOM   9960  O  O   . VAL G 1 177 ? 74.724 -2.827  -12.649 1.00 57.41 ? 261 VAL G O   1 
ATOM   9961  C  CB  . VAL G 1 177 ? 76.199 -3.089  -10.104 1.00 58.03 ? 261 VAL G CB  1 
ATOM   9962  C  CG1 . VAL G 1 177 ? 77.333 -3.567  -9.214  1.00 56.79 ? 261 VAL G CG1 1 
ATOM   9963  C  CG2 . VAL G 1 177 ? 75.210 -2.217  -9.322  1.00 57.95 ? 261 VAL G CG2 1 
ATOM   9964  N  N   . TYR G 1 178 ? 75.229 -0.670  -12.390 1.00 57.27 ? 262 TYR G N   1 
ATOM   9965  C  CA  . TYR G 1 178 ? 74.111 -0.288  -13.270 1.00 57.34 ? 262 TYR G CA  1 
ATOM   9966  C  C   . TYR G 1 178 ? 74.426 -0.533  -14.727 1.00 59.06 ? 262 TYR G C   1 
ATOM   9967  O  O   . TYR G 1 178 ? 73.557 -0.971  -15.474 1.00 59.65 ? 262 TYR G O   1 
ATOM   9968  C  CB  . TYR G 1 178 ? 73.650 1.153   -13.051 1.00 55.42 ? 262 TYR G CB  1 
ATOM   9969  C  CG  . TYR G 1 178 ? 73.398 1.461   -11.613 1.00 52.24 ? 262 TYR G CG  1 
ATOM   9970  C  CD1 . TYR G 1 178 ? 74.142 2.433   -10.958 1.00 48.72 ? 262 TYR G CD1 1 
ATOM   9971  C  CD2 . TYR G 1 178 ? 72.455 0.751   -10.891 1.00 48.22 ? 262 TYR G CD2 1 
ATOM   9972  C  CE1 . TYR G 1 178 ? 73.946 2.711   -9.629  1.00 48.02 ? 262 TYR G CE1 1 
ATOM   9973  C  CE2 . TYR G 1 178 ? 72.222 1.038   -9.566  1.00 49.81 ? 262 TYR G CE2 1 
ATOM   9974  C  CZ  . TYR G 1 178 ? 72.980 2.022   -8.930  1.00 50.45 ? 262 TYR G CZ  1 
ATOM   9975  O  OH  . TYR G 1 178 ? 72.770 2.310   -7.592  1.00 50.58 ? 262 TYR G OH  1 
ATOM   9976  N  N   . THR G 1 179 ? 75.675 -0.263  -15.122 1.00 61.40 ? 263 THR G N   1 
ATOM   9977  C  CA  . THR G 1 179 ? 76.126 -0.473  -16.498 1.00 63.18 ? 263 THR G CA  1 
ATOM   9978  C  C   . THR G 1 179 ? 75.986 -1.947  -16.915 1.00 64.44 ? 263 THR G C   1 
ATOM   9979  O  O   . THR G 1 179 ? 75.351 -2.261  -17.934 1.00 64.56 ? 263 THR G O   1 
ATOM   9980  C  CB  . THR G 1 179 ? 77.566 -0.011  -16.676 1.00 63.32 ? 263 THR G CB  1 
ATOM   9981  O  OG1 . THR G 1 179 ? 77.674 1.352   -16.262 1.00 63.51 ? 263 THR G OG1 1 
ATOM   9982  C  CG2 . THR G 1 179 ? 77.957 -0.099  -18.140 1.00 64.76 ? 263 THR G CG2 1 
ATOM   9983  N  N   . SER G 1 180 ? 76.568 -2.838  -16.112 1.00 65.46 ? 264 SER G N   1 
ATOM   9984  C  CA  . SER G 1 180 ? 76.361 -4.264  -16.279 1.00 66.45 ? 264 SER G CA  1 
ATOM   9985  C  C   . SER G 1 180 ? 74.906 -4.624  -16.418 1.00 67.08 ? 264 SER G C   1 
ATOM   9986  O  O   . SER G 1 180 ? 74.480 -4.946  -17.518 1.00 67.83 ? 264 SER G O   1 
ATOM   9987  C  CB  . SER G 1 180 ? 76.946 -5.040  -15.132 1.00 66.13 ? 264 SER G CB  1 
ATOM   9988  O  OG  . SER G 1 180 ? 78.325 -4.818  -15.074 1.00 68.21 ? 264 SER G OG  1 
ATOM   9989  N  N   . LEU G 1 181 ? 74.137 -4.581  -15.335 1.00 67.74 ? 265 LEU G N   1 
ATOM   9990  C  CA  . LEU G 1 181 ? 72.748 -5.058  -15.412 1.00 69.08 ? 265 LEU G CA  1 
ATOM   9991  C  C   . LEU G 1 181 ? 72.048 -4.447  -16.618 1.00 71.07 ? 265 LEU G C   1 
ATOM   9992  O  O   . LEU G 1 181 ? 71.115 -5.060  -17.204 1.00 71.57 ? 265 LEU G O   1 
ATOM   9993  C  CB  . LEU G 1 181 ? 71.962 -4.740  -14.154 1.00 68.27 ? 265 LEU G CB  1 
ATOM   9994  C  CG  . LEU G 1 181 ? 72.385 -5.381  -12.835 1.00 67.14 ? 265 LEU G CG  1 
ATOM   9995  C  CD1 . LEU G 1 181 ? 71.875 -4.558  -11.672 1.00 64.90 ? 265 LEU G CD1 1 
ATOM   9996  C  CD2 . LEU G 1 181 ? 71.906 -6.812  -12.756 1.00 65.79 ? 265 LEU G CD2 1 
ATOM   9997  N  N   . GLY G 1 182 ? 72.507 -3.244  -16.989 1.00 72.66 ? 266 GLY G N   1 
ATOM   9998  C  CA  . GLY G 1 182 ? 72.050 -2.566  -18.204 1.00 74.92 ? 266 GLY G CA  1 
ATOM   9999  C  C   . GLY G 1 182 ? 72.297 -3.406  -19.443 1.00 76.58 ? 266 GLY G C   1 
ATOM   10000 O  O   . GLY G 1 182 ? 71.371 -3.679  -20.221 1.00 76.50 ? 266 GLY G O   1 
ATOM   10001 N  N   . GLN G 1 183 ? 73.548 -3.842  -19.598 1.00 78.49 ? 267 GLN G N   1 
ATOM   10002 C  CA  . GLN G 1 183 ? 73.962 -4.621  -20.764 1.00 80.61 ? 267 GLN G CA  1 
ATOM   10003 C  C   . GLN G 1 183 ? 73.365 -6.033  -20.770 1.00 81.37 ? 267 GLN G C   1 
ATOM   10004 O  O   . GLN G 1 183 ? 73.049 -6.565  -21.833 1.00 81.43 ? 267 GLN G O   1 
ATOM   10005 C  CB  . GLN G 1 183 ? 75.503 -4.569  -21.000 1.00 80.39 ? 267 GLN G CB  1 
ATOM   10006 C  CG  . GLN G 1 183 ? 76.427 -4.962  -19.814 1.00 81.23 ? 267 GLN G CG  1 
ATOM   10007 C  CD  . GLN G 1 183 ? 77.693 -4.051  -19.671 1.00 81.75 ? 267 GLN G CD  1 
ATOM   10008 O  OE1 . GLN G 1 183 ? 77.757 -2.952  -20.246 1.00 81.67 ? 267 GLN G OE1 1 
ATOM   10009 N  NE2 . GLN G 1 183 ? 78.686 -4.512  -18.881 1.00 80.72 ? 267 GLN G NE2 1 
ATOM   10010 N  N   . LEU G 1 184 ? 73.147 -6.606  -19.587 1.00 83.17 ? 268 LEU G N   1 
ATOM   10011 C  CA  . LEU G 1 184 ? 72.593 -7.975  -19.465 1.00 84.80 ? 268 LEU G CA  1 
ATOM   10012 C  C   . LEU G 1 184 ? 71.231 -8.179  -20.107 1.00 85.42 ? 268 LEU G C   1 
ATOM   10013 O  O   . LEU G 1 184 ? 70.893 -9.314  -20.462 1.00 85.92 ? 268 LEU G O   1 
ATOM   10014 C  CB  . LEU G 1 184 ? 72.506 -8.431  -18.004 1.00 84.83 ? 268 LEU G CB  1 
ATOM   10015 C  CG  . LEU G 1 184 ? 73.529 -9.454  -17.510 1.00 85.43 ? 268 LEU G CG  1 
ATOM   10016 C  CD1 . LEU G 1 184 ? 74.967 -9.091  -17.929 1.00 86.44 ? 268 LEU G CD1 1 
ATOM   10017 C  CD2 . LEU G 1 184 ? 73.423 -9.577  -15.988 1.00 85.19 ? 268 LEU G CD2 1 
ATOM   10018 N  N   . ARG G 1 185 ? 70.442 -7.107  -20.218 1.00 85.89 ? 269 ARG G N   1 
ATOM   10019 C  CA  . ARG G 1 185 ? 69.165 -7.180  -20.935 1.00 86.51 ? 269 ARG G CA  1 
ATOM   10020 C  C   . ARG G 1 185 ? 69.178 -6.219  -22.132 1.00 86.15 ? 269 ARG G C   1 
ATOM   10021 O  O   . ARG G 1 185 ? 69.413 -6.623  -23.270 1.00 85.98 ? 269 ARG G O   1 
ATOM   10022 C  CB  . ARG G 1 185 ? 67.947 -6.879  -20.026 1.00 86.60 ? 269 ARG G CB  1 
ATOM   10023 C  CG  . ARG G 1 185 ? 68.087 -7.060  -18.484 1.00 87.43 ? 269 ARG G CG  1 
ATOM   10024 C  CD  . ARG G 1 185 ? 67.241 -5.949  -17.738 1.00 87.40 ? 269 ARG G CD  1 
ATOM   10025 N  NE  . ARG G 1 185 ? 66.876 -6.239  -16.335 1.00 88.76 ? 269 ARG G NE  1 
ATOM   10026 C  CZ  . ARG G 1 185 ? 67.693 -6.109  -15.284 1.00 89.39 ? 269 ARG G CZ  1 
ATOM   10027 N  NH1 . ARG G 1 185 ? 68.945 -5.708  -15.463 1.00 89.74 ? 269 ARG G NH1 1 
ATOM   10028 N  NH2 . ARG G 1 185 ? 67.262 -6.385  -14.049 1.00 88.25 ? 269 ARG G NH2 1 
ATOM   10029 N  N   . CYS H 1 5   ? 46.646 -0.582  14.046  1.00 42.31 ? 89  CYS H N   1 
ATOM   10030 C  CA  . CYS H 1 5   ? 47.910 0.211   14.268  1.00 43.31 ? 89  CYS H CA  1 
ATOM   10031 C  C   . CYS H 1 5   ? 48.772 0.602   13.093  1.00 40.58 ? 89  CYS H C   1 
ATOM   10032 O  O   . CYS H 1 5   ? 49.097 -0.196  12.218  1.00 41.29 ? 89  CYS H O   1 
ATOM   10033 C  CB  . CYS H 1 5   ? 48.785 -0.405  15.336  1.00 43.64 ? 89  CYS H CB  1 
ATOM   10034 S  SG  . CYS H 1 5   ? 48.162 0.281   16.848  1.00 55.64 ? 89  CYS H SG  1 
ATOM   10035 N  N   . LEU H 1 6   ? 49.191 1.848   13.134  1.00 38.20 ? 90  LEU H N   1 
ATOM   10036 C  CA  . LEU H 1 6   ? 49.856 2.437   12.017  1.00 36.98 ? 90  LEU H CA  1 
ATOM   10037 C  C   . LEU H 1 6   ? 51.353 2.088   12.045  1.00 36.94 ? 90  LEU H C   1 
ATOM   10038 O  O   . LEU H 1 6   ? 51.931 1.689   11.033  1.00 35.34 ? 90  LEU H O   1 
ATOM   10039 C  CB  . LEU H 1 6   ? 49.572 3.927   12.057  1.00 36.23 ? 90  LEU H CB  1 
ATOM   10040 C  CG  . LEU H 1 6   ? 48.739 4.579   10.941  1.00 35.98 ? 90  LEU H CG  1 
ATOM   10041 C  CD1 . LEU H 1 6   ? 47.919 3.661   10.045  1.00 34.54 ? 90  LEU H CD1 1 
ATOM   10042 C  CD2 . LEU H 1 6   ? 47.922 5.713   11.459  1.00 33.04 ? 90  LEU H CD2 1 
ATOM   10043 N  N   . LEU H 1 7   ? 51.953 2.195   13.225  1.00 36.73 ? 91  LEU H N   1 
ATOM   10044 C  CA  . LEU H 1 7   ? 53.360 1.865   13.382  1.00 38.37 ? 91  LEU H CA  1 
ATOM   10045 C  C   . LEU H 1 7   ? 53.613 0.491   14.007  1.00 39.59 ? 91  LEU H C   1 
ATOM   10046 O  O   . LEU H 1 7   ? 52.785 -0.030  14.743  1.00 40.71 ? 91  LEU H O   1 
ATOM   10047 C  CB  . LEU H 1 7   ? 54.051 2.923   14.247  1.00 37.60 ? 91  LEU H CB  1 
ATOM   10048 C  CG  . LEU H 1 7   ? 54.108 4.292   13.614  1.00 36.53 ? 91  LEU H CG  1 
ATOM   10049 C  CD1 . LEU H 1 7   ? 54.477 5.270   14.672  1.00 35.23 ? 91  LEU H CD1 1 
ATOM   10050 C  CD2 . LEU H 1 7   ? 55.069 4.272   12.429  1.00 34.40 ? 91  LEU H CD2 1 
ATOM   10051 N  N   . PRO H 1 8   ? 54.767 -0.089  13.741  1.00 40.47 ? 92  PRO H N   1 
ATOM   10052 C  CA  . PRO H 1 8   ? 55.139 -1.240  14.515  1.00 42.27 ? 92  PRO H CA  1 
ATOM   10053 C  C   . PRO H 1 8   ? 55.659 -0.863  15.908  1.00 44.02 ? 92  PRO H C   1 
ATOM   10054 O  O   . PRO H 1 8   ? 55.812 0.314   16.210  1.00 43.18 ? 92  PRO H O   1 
ATOM   10055 C  CB  . PRO H 1 8   ? 56.270 -1.833  13.689  1.00 41.78 ? 92  PRO H CB  1 
ATOM   10056 C  CG  . PRO H 1 8   ? 56.879 -0.727  13.094  1.00 41.35 ? 92  PRO H CG  1 
ATOM   10057 C  CD  . PRO H 1 8   ? 55.785 0.225   12.735  1.00 40.94 ? 92  PRO H CD  1 
ATOM   10058 N  N   . GLU H 1 9   ? 55.933 -1.888  16.720  1.00 46.98 ? 93  GLU H N   1 
ATOM   10059 C  CA  . GLU H 1 9   ? 56.528 -1.782  18.077  1.00 50.49 ? 93  GLU H CA  1 
ATOM   10060 C  C   . GLU H 1 9   ? 57.789 -0.937  18.022  1.00 49.21 ? 93  GLU H C   1 
ATOM   10061 O  O   . GLU H 1 9   ? 58.641 -1.195  17.187  1.00 47.76 ? 93  GLU H O   1 
ATOM   10062 C  CB  . GLU H 1 9   ? 56.920 -3.200  18.567  1.00 51.01 ? 93  GLU H CB  1 
ATOM   10063 C  CG  . GLU H 1 9   ? 57.203 -3.337  20.112  1.00 56.05 ? 93  GLU H CG  1 
ATOM   10064 C  CD  . GLU H 1 9   ? 57.510 -4.815  20.572  1.00 56.15 ? 93  GLU H CD  1 
ATOM   10065 O  OE1 . GLU H 1 9   ? 58.536 -5.397  20.088  1.00 61.19 ? 93  GLU H OE1 1 
ATOM   10066 O  OE2 . GLU H 1 9   ? 56.727 -5.363  21.420  1.00 58.42 ? 93  GLU H OE2 1 
ATOM   10067 N  N   . VAL H 1 10  ? 57.908 0.051   18.903  1.00 49.20 ? 94  VAL H N   1 
ATOM   10068 C  CA  . VAL H 1 10  ? 59.113 0.858   18.964  1.00 50.44 ? 94  VAL H CA  1 
ATOM   10069 C  C   . VAL H 1 10  ? 60.376 -0.023  19.047  1.00 51.25 ? 94  VAL H C   1 
ATOM   10070 O  O   . VAL H 1 10  ? 60.440 -0.989  19.780  1.00 51.54 ? 94  VAL H O   1 
ATOM   10071 C  CB  . VAL H 1 10  ? 59.046 1.907   20.124  1.00 50.80 ? 94  VAL H CB  1 
ATOM   10072 C  CG1 . VAL H 1 10  ? 59.165 1.247   21.482  1.00 52.53 ? 94  VAL H CG1 1 
ATOM   10073 C  CG2 . VAL H 1 10  ? 60.121 3.011   19.974  1.00 50.70 ? 94  VAL H CG2 1 
ATOM   10074 N  N   . THR H 1 11  ? 61.369 0.282   18.245  1.00 52.72 ? 95  THR H N   1 
ATOM   10075 C  CA  . THR H 1 11  ? 62.587 -0.512  18.279  1.00 54.49 ? 95  THR H CA  1 
ATOM   10076 C  C   . THR H 1 11  ? 63.509 -0.115  19.455  1.00 56.45 ? 95  THR H C   1 
ATOM   10077 O  O   . THR H 1 11  ? 63.297 0.914   20.120  1.00 56.71 ? 95  THR H O   1 
ATOM   10078 C  CB  . THR H 1 11  ? 63.395 -0.449  16.973  1.00 53.85 ? 95  THR H CB  1 
ATOM   10079 O  OG1 . THR H 1 11  ? 64.167 0.757   16.969  1.00 51.25 ? 95  THR H OG1 1 
ATOM   10080 C  CG2 . THR H 1 11  ? 62.487 -0.569  15.750  1.00 52.29 ? 95  THR H CG2 1 
ATOM   10081 N  N   . GLU H 1 12  ? 64.517 -0.960  19.688  1.00 58.22 ? 96  GLU H N   1 
ATOM   10082 C  CA  . GLU H 1 12  ? 65.433 -0.810  20.819  1.00 60.73 ? 96  GLU H CA  1 
ATOM   10083 C  C   . GLU H 1 12  ? 66.054 0.560   20.911  1.00 59.43 ? 96  GLU H C   1 
ATOM   10084 O  O   . GLU H 1 12  ? 66.040 1.144   21.987  1.00 58.98 ? 96  GLU H O   1 
ATOM   10085 C  CB  . GLU H 1 12  ? 66.517 -1.910  20.826  1.00 60.60 ? 96  GLU H CB  1 
ATOM   10086 C  CG  . GLU H 1 12  ? 67.181 -2.127  22.228  1.00 64.20 ? 96  GLU H CG  1 
ATOM   10087 C  CD  . GLU H 1 12  ? 67.829 -3.544  22.399  1.00 64.86 ? 96  GLU H CD  1 
ATOM   10088 O  OE1 . GLU H 1 12  ? 69.097 -3.635  22.387  1.00 67.39 ? 96  GLU H OE1 1 
ATOM   10089 O  OE2 . GLU H 1 12  ? 67.064 -4.545  22.539  1.00 68.98 ? 96  GLU H OE2 1 
ATOM   10090 N  N   . GLU H 1 13  ? 66.572 1.079   19.799  1.00 59.30 ? 97  GLU H N   1 
ATOM   10091 C  CA  . GLU H 1 13  ? 67.238 2.379   19.837  1.00 60.74 ? 97  GLU H CA  1 
ATOM   10092 C  C   . GLU H 1 13  ? 66.315 3.567   20.152  1.00 60.12 ? 97  GLU H C   1 
ATOM   10093 O  O   . GLU H 1 13  ? 66.764 4.539   20.765  1.00 60.61 ? 97  GLU H O   1 
ATOM   10094 C  CB  . GLU H 1 13  ? 68.104 2.644   18.599  1.00 61.94 ? 97  GLU H CB  1 
ATOM   10095 C  CG  . GLU H 1 13  ? 67.714 1.833   17.347  1.00 67.66 ? 97  GLU H CG  1 
ATOM   10096 C  CD  . GLU H 1 13  ? 66.968 2.672   16.299  1.00 74.06 ? 97  GLU H CD  1 
ATOM   10097 O  OE1 . GLU H 1 13  ? 67.633 3.526   15.627  1.00 77.48 ? 97  GLU H OE1 1 
ATOM   10098 O  OE2 . GLU H 1 13  ? 65.729 2.470   16.139  1.00 75.56 ? 97  GLU H OE2 1 
ATOM   10099 N  N   . ASP H 1 14  ? 65.030 3.463   19.806  1.00 58.63 ? 98  ASP H N   1 
ATOM   10100 C  CA  . ASP H 1 14  ? 64.094 4.568   19.987  1.00 56.88 ? 98  ASP H CA  1 
ATOM   10101 C  C   . ASP H 1 14  ? 63.222 4.454   21.274  1.00 56.48 ? 98  ASP H C   1 
ATOM   10102 O  O   . ASP H 1 14  ? 62.320 5.251   21.524  1.00 55.78 ? 98  ASP H O   1 
ATOM   10103 C  CB  . ASP H 1 14  ? 63.296 4.743   18.681  1.00 56.24 ? 98  ASP H CB  1 
ATOM   10104 C  CG  . ASP H 1 14  ? 64.139 5.419   17.543  1.00 56.21 ? 98  ASP H CG  1 
ATOM   10105 O  OD1 . ASP H 1 14  ? 64.762 6.471   17.822  1.00 55.39 ? 98  ASP H OD1 1 
ATOM   10106 O  OD2 . ASP H 1 14  ? 64.155 4.940   16.368  1.00 54.93 ? 98  ASP H OD2 1 
ATOM   10107 N  N   . GLN H 1 15  ? 63.575 3.501   22.125  1.00 56.08 ? 99  GLN H N   1 
ATOM   10108 C  CA  . GLN H 1 15  ? 62.778 3.080   23.294  1.00 56.55 ? 99  GLN H CA  1 
ATOM   10109 C  C   . GLN H 1 15  ? 62.064 4.079   24.231  1.00 53.63 ? 99  GLN H C   1 
ATOM   10110 O  O   . GLN H 1 15  ? 60.861 3.901   24.517  1.00 54.20 ? 99  GLN H O   1 
ATOM   10111 C  CB  . GLN H 1 15  ? 63.537 2.019   24.142  1.00 57.38 ? 99  GLN H CB  1 
ATOM   10112 C  CG  . GLN H 1 15  ? 62.922 0.534   24.151  1.00 60.15 ? 99  GLN H CG  1 
ATOM   10113 C  CD  . GLN H 1 15  ? 64.009 -0.560  24.549  1.00 60.95 ? 99  GLN H CD  1 
ATOM   10114 O  OE1 . GLN H 1 15  ? 65.197 -0.236  24.797  1.00 66.46 ? 99  GLN H OE1 1 
ATOM   10115 N  NE2 . GLN H 1 15  ? 63.594 -1.829  24.598  1.00 61.33 ? 99  GLN H NE2 1 
ATOM   10116 N  N   . GLY H 1 16  ? 62.740 5.077   24.769  1.00 49.56 ? 100 GLY H N   1 
ATOM   10117 C  CA  . GLY H 1 16  ? 61.962 5.973   25.636  1.00 45.60 ? 100 GLY H CA  1 
ATOM   10118 C  C   . GLY H 1 16  ? 61.717 7.325   25.005  1.00 43.68 ? 100 GLY H C   1 
ATOM   10119 O  O   . GLY H 1 16  ? 61.540 8.334   25.682  1.00 42.88 ? 100 GLY H O   1 
ATOM   10120 N  N   . ARG H 1 17  ? 61.721 7.383   23.688  1.00 41.15 ? 101 ARG H N   1 
ATOM   10121 C  CA  . ARG H 1 17  ? 61.738 8.688   23.125  1.00 39.80 ? 101 ARG H CA  1 
ATOM   10122 C  C   . ARG H 1 17  ? 60.330 9.078   22.800  1.00 38.31 ? 101 ARG H C   1 
ATOM   10123 O  O   . ARG H 1 17  ? 59.463 8.230   22.615  1.00 37.47 ? 101 ARG H O   1 
ATOM   10124 C  CB  . ARG H 1 17  ? 62.642 8.737   21.887  1.00 40.35 ? 101 ARG H CB  1 
ATOM   10125 C  CG  . ARG H 1 17  ? 64.116 8.482   22.169  1.00 39.84 ? 101 ARG H CG  1 
ATOM   10126 C  CD  . ARG H 1 17  ? 64.895 8.834   20.933  1.00 42.78 ? 101 ARG H CD  1 
ATOM   10127 N  NE  . ARG H 1 17  ? 66.251 8.329   20.915  1.00 42.79 ? 101 ARG H NE  1 
ATOM   10128 C  CZ  . ARG H 1 17  ? 67.096 8.558   19.923  1.00 42.98 ? 101 ARG H CZ  1 
ATOM   10129 N  NH1 . ARG H 1 17  ? 66.710 9.315   18.893  1.00 43.77 ? 101 ARG H NH1 1 
ATOM   10130 N  NH2 . ARG H 1 17  ? 68.319 8.046   19.960  1.00 38.79 ? 101 ARG H NH2 1 
ATOM   10131 N  N   . ILE H 1 18  ? 60.105 10.379  22.749  1.00 36.90 ? 102 ILE H N   1 
ATOM   10132 C  CA  . ILE H 1 18  ? 58.857 10.924  22.172  1.00 34.74 ? 102 ILE H CA  1 
ATOM   10133 C  C   . ILE H 1 18  ? 58.782 10.577  20.687  1.00 34.02 ? 102 ILE H C   1 
ATOM   10134 O  O   . ILE H 1 18  ? 59.793 10.665  19.994  1.00 34.97 ? 102 ILE H O   1 
ATOM   10135 C  CB  . ILE H 1 18  ? 58.820 12.454  22.458  1.00 33.85 ? 102 ILE H CB  1 
ATOM   10136 C  CG1 . ILE H 1 18  ? 58.543 12.634  23.954  1.00 33.95 ? 102 ILE H CG1 1 
ATOM   10137 C  CG2 . ILE H 1 18  ? 57.818 13.168  21.623  1.00 30.72 ? 102 ILE H CG2 1 
ATOM   10138 C  CD1 . ILE H 1 18  ? 59.018 13.894  24.561  1.00 34.98 ? 102 ILE H CD1 1 
ATOM   10139 N  N   . CYS H 1 19  ? 57.615 10.162  20.187  1.00 33.71 ? 103 CYS H N   1 
ATOM   10140 C  CA  . CYS H 1 19  ? 57.430 9.993   18.735  1.00 32.13 ? 103 CYS H CA  1 
ATOM   10141 C  C   . CYS H 1 19  ? 57.043 11.299  18.086  1.00 30.69 ? 103 CYS H C   1 
ATOM   10142 O  O   . CYS H 1 19  ? 56.139 11.918  18.559  1.00 31.57 ? 103 CYS H O   1 
ATOM   10143 C  CB  . CYS H 1 19  ? 56.376 8.988   18.388  1.00 31.18 ? 103 CYS H CB  1 
ATOM   10144 S  SG  . CYS H 1 19  ? 56.413 8.647   16.599  1.00 38.64 ? 103 CYS H SG  1 
ATOM   10145 N  N   . VAL H 1 20  ? 57.729 11.702  17.017  1.00 28.91 ? 104 VAL H N   1 
ATOM   10146 C  CA  . VAL H 1 20  ? 57.470 12.967  16.317  1.00 28.29 ? 104 VAL H CA  1 
ATOM   10147 C  C   . VAL H 1 20  ? 57.119 12.641  14.910  1.00 27.50 ? 104 VAL H C   1 
ATOM   10148 O  O   . VAL H 1 20  ? 57.875 12.012  14.158  1.00 26.79 ? 104 VAL H O   1 
ATOM   10149 C  CB  . VAL H 1 20  ? 58.640 14.065  16.352  1.00 28.51 ? 104 VAL H CB  1 
ATOM   10150 C  CG1 . VAL H 1 20  ? 58.176 15.353  15.758  1.00 27.27 ? 104 VAL H CG1 1 
ATOM   10151 C  CG2 . VAL H 1 20  ? 58.964 14.426  17.812  1.00 31.28 ? 104 VAL H CG2 1 
ATOM   10152 N  N   . VAL H 1 21  ? 55.927 13.090  14.565  1.00 27.40 ? 105 VAL H N   1 
ATOM   10153 C  CA  . VAL H 1 21  ? 55.278 12.784  13.263  1.00 26.52 ? 105 VAL H CA  1 
ATOM   10154 C  C   . VAL H 1 21  ? 55.424 14.064  12.425  1.00 24.41 ? 105 VAL H C   1 
ATOM   10155 O  O   . VAL H 1 21  ? 55.037 15.142  12.863  1.00 24.66 ? 105 VAL H O   1 
ATOM   10156 C  CB  . VAL H 1 21  ? 53.808 12.346  13.644  1.00 26.30 ? 105 VAL H CB  1 
ATOM   10157 C  CG1 . VAL H 1 21  ? 52.917 12.561  12.606  1.00 29.85 ? 105 VAL H CG1 1 
ATOM   10158 C  CG2 . VAL H 1 21  ? 53.799 10.935  13.932  1.00 27.05 ? 105 VAL H CG2 1 
ATOM   10159 N  N   . ILE H 1 22  ? 56.024 13.979  11.264  1.00 23.20 ? 106 ILE H N   1 
ATOM   10160 C  CA  . ILE H 1 22  ? 56.475 15.179  10.575  1.00 22.22 ? 106 ILE H CA  1 
ATOM   10161 C  C   . ILE H 1 22  ? 55.986 15.169  9.120   1.00 24.34 ? 106 ILE H C   1 
ATOM   10162 O  O   . ILE H 1 22  ? 56.148 14.141  8.450   1.00 21.52 ? 106 ILE H O   1 
ATOM   10163 C  CB  . ILE H 1 22  ? 58.040 15.262  10.584  1.00 23.12 ? 106 ILE H CB  1 
ATOM   10164 C  CG1 . ILE H 1 22  ? 58.605 15.414  12.013  1.00 21.12 ? 106 ILE H CG1 1 
ATOM   10165 C  CG2 . ILE H 1 22  ? 58.575 16.363  9.643   1.00 21.78 ? 106 ILE H CG2 1 
ATOM   10166 C  CD1 . ILE H 1 22  ? 60.249 15.226  12.095  1.00 20.44 ? 106 ILE H CD1 1 
ATOM   10167 N  N   . ASP H 1 23  ? 55.345 16.280  8.640   1.00 24.98 ? 107 ASP H N   1 
ATOM   10168 C  CA  . ASP H 1 23  ? 54.941 16.314  7.246   1.00 27.40 ? 107 ASP H CA  1 
ATOM   10169 C  C   . ASP H 1 23  ? 56.103 16.679  6.269   1.00 28.96 ? 107 ASP H C   1 
ATOM   10170 O  O   . ASP H 1 23  ? 57.131 17.225  6.670   1.00 29.64 ? 107 ASP H O   1 
ATOM   10171 C  CB  . ASP H 1 23  ? 53.731 17.204  7.076   1.00 28.40 ? 107 ASP H CB  1 
ATOM   10172 C  CG  . ASP H 1 23  ? 53.256 17.300  5.599   1.00 34.75 ? 107 ASP H CG  1 
ATOM   10173 O  OD1 . ASP H 1 23  ? 53.444 16.358  4.782   1.00 40.22 ? 107 ASP H OD1 1 
ATOM   10174 O  OD2 . ASP H 1 23  ? 52.703 18.365  5.236   1.00 42.25 ? 107 ASP H OD2 1 
ATOM   10175 N  N   . LEU H 1 24  ? 55.933 16.425  4.992   1.00 29.30 ? 108 LEU H N   1 
ATOM   10176 C  CA  . LEU H 1 24  ? 56.931 16.813  4.002   1.00 31.85 ? 108 LEU H CA  1 
ATOM   10177 C  C   . LEU H 1 24  ? 56.648 18.210  3.402   1.00 33.38 ? 108 LEU H C   1 
ATOM   10178 O  O   . LEU H 1 24  ? 57.297 19.183  3.758   1.00 34.60 ? 108 LEU H O   1 
ATOM   10179 C  CB  . LEU H 1 24  ? 56.987 15.720  2.913   1.00 30.93 ? 108 LEU H CB  1 
ATOM   10180 C  CG  . LEU H 1 24  ? 58.042 15.781  1.815   1.00 35.00 ? 108 LEU H CG  1 
ATOM   10181 C  CD1 . LEU H 1 24  ? 59.536 15.638  2.363   1.00 37.72 ? 108 LEU H CD1 1 
ATOM   10182 C  CD2 . LEU H 1 24  ? 57.778 14.700  0.783   1.00 32.96 ? 108 LEU H CD2 1 
ATOM   10183 N  N   . ASP H 1 25  ? 55.613 18.314  2.555   1.00 35.22 ? 109 ASP H N   1 
ATOM   10184 C  CA  . ASP H 1 25  ? 55.323 19.445  1.688   1.00 34.99 ? 109 ASP H CA  1 
ATOM   10185 C  C   . ASP H 1 25  ? 54.933 20.657  2.445   1.00 33.94 ? 109 ASP H C   1 
ATOM   10186 O  O   . ASP H 1 25  ? 54.108 20.598  3.290   1.00 34.41 ? 109 ASP H O   1 
ATOM   10187 C  CB  . ASP H 1 25  ? 54.195 19.058  0.756   1.00 36.40 ? 109 ASP H CB  1 
ATOM   10188 C  CG  . ASP H 1 25  ? 54.677 18.178  -0.373  1.00 43.62 ? 109 ASP H CG  1 
ATOM   10189 O  OD1 . ASP H 1 25  ? 55.772 18.436  -0.933  1.00 50.43 ? 109 ASP H OD1 1 
ATOM   10190 O  OD2 . ASP H 1 25  ? 53.991 17.194  -0.692  1.00 53.16 ? 109 ASP H OD2 1 
ATOM   10191 N  N   . GLU H 1 26  ? 55.560 21.771  2.117   1.00 33.90 ? 110 GLU H N   1 
ATOM   10192 C  CA  . GLU H 1 26  ? 55.400 23.048  2.779   1.00 32.61 ? 110 GLU H CA  1 
ATOM   10193 C  C   . GLU H 1 26  ? 55.725 23.078  4.211   1.00 31.90 ? 110 GLU H C   1 
ATOM   10194 O  O   . GLU H 1 26  ? 55.367 24.019  4.851   1.00 32.17 ? 110 GLU H O   1 
ATOM   10195 C  CB  . GLU H 1 26  ? 54.018 23.707  2.523   1.00 33.80 ? 110 GLU H CB  1 
ATOM   10196 C  CG  . GLU H 1 26  ? 53.758 24.173  1.059   1.00 33.29 ? 110 GLU H CG  1 
ATOM   10197 C  CD  . GLU H 1 26  ? 53.558 23.021  0.102   1.00 39.21 ? 110 GLU H CD  1 
ATOM   10198 O  OE1 . GLU H 1 26  ? 52.586 22.252  0.316   1.00 44.50 ? 110 GLU H OE1 1 
ATOM   10199 O  OE2 . GLU H 1 26  ? 54.345 22.831  -0.869  1.00 40.49 ? 110 GLU H OE2 1 
ATOM   10200 N  N   . THR H 1 27  ? 56.414 22.069  4.733   1.00 31.88 ? 111 THR H N   1 
ATOM   10201 C  CA  . THR H 1 27  ? 56.886 22.095  6.142   1.00 31.78 ? 111 THR H CA  1 
ATOM   10202 C  C   . THR H 1 27  ? 58.420 21.961  6.129   1.00 31.90 ? 111 THR H C   1 
ATOM   10203 O  O   . THR H 1 27  ? 59.147 22.696  6.833   1.00 31.38 ? 111 THR H O   1 
ATOM   10204 C  CB  . THR H 1 27  ? 56.259 20.910  7.021   1.00 32.75 ? 111 THR H CB  1 
ATOM   10205 O  OG1 . THR H 1 27  ? 54.841 21.007  7.023   1.00 35.09 ? 111 THR H OG1 1 
ATOM   10206 C  CG2 . THR H 1 27  ? 56.704 20.945  8.490   1.00 31.09 ? 111 THR H CG2 1 
ATOM   10207 N  N   . LEU H 1 28  ? 58.895 21.020  5.317   1.00 30.57 ? 112 LEU H N   1 
ATOM   10208 C  CA  . LEU H 1 28  ? 60.328 20.717  5.184   1.00 31.49 ? 112 LEU H CA  1 
ATOM   10209 C  C   . LEU H 1 28  ? 60.886 21.191  3.836   1.00 32.65 ? 112 LEU H C   1 
ATOM   10210 O  O   . LEU H 1 28  ? 61.935 21.830  3.835   1.00 34.30 ? 112 LEU H O   1 
ATOM   10211 C  CB  . LEU H 1 28  ? 60.648 19.198  5.368   1.00 28.91 ? 112 LEU H CB  1 
ATOM   10212 C  CG  . LEU H 1 28  ? 60.363 18.575  6.736   1.00 30.26 ? 112 LEU H CG  1 
ATOM   10213 C  CD1 . LEU H 1 28  ? 60.835 17.153  6.811   1.00 29.27 ? 112 LEU H CD1 1 
ATOM   10214 C  CD2 . LEU H 1 28  ? 60.810 19.336  7.976   1.00 27.94 ? 112 LEU H CD2 1 
ATOM   10215 N  N   . VAL H 1 29  ? 60.197 20.834  2.740   1.00 32.38 ? 113 VAL H N   1 
ATOM   10216 C  CA  . VAL H 1 29  ? 60.503 21.197  1.414   1.00 32.99 ? 113 VAL H CA  1 
ATOM   10217 C  C   . VAL H 1 29  ? 59.247 21.850  0.781   1.00 35.67 ? 113 VAL H C   1 
ATOM   10218 O  O   . VAL H 1 29  ? 58.220 22.003  1.417   1.00 36.78 ? 113 VAL H O   1 
ATOM   10219 C  CB  . VAL H 1 29  ? 60.868 19.924  0.536   1.00 34.50 ? 113 VAL H CB  1 
ATOM   10220 C  CG1 . VAL H 1 29  ? 62.132 19.090  1.027   1.00 26.22 ? 113 VAL H CG1 1 
ATOM   10221 C  CG2 . VAL H 1 29  ? 59.634 19.051  0.331   1.00 32.31 ? 113 VAL H CG2 1 
ATOM   10222 N  N   . HIS H 1 30  ? 59.359 22.251  -0.478  1.00 36.38 ? 114 HIS H N   1 
ATOM   10223 C  CA  . HIS H 1 30  ? 58.272 22.641  -1.321  1.00 37.97 ? 114 HIS H CA  1 
ATOM   10224 C  C   . HIS H 1 30  ? 58.593 22.179  -2.771  1.00 38.50 ? 114 HIS H C   1 
ATOM   10225 O  O   . HIS H 1 30  ? 59.708 22.324  -3.235  1.00 39.09 ? 114 HIS H O   1 
ATOM   10226 C  CB  . HIS H 1 30  ? 58.028 24.173  -1.230  1.00 39.49 ? 114 HIS H CB  1 
ATOM   10227 C  CG  . HIS H 1 30  ? 57.102 24.697  -2.290  1.00 44.27 ? 114 HIS H CG  1 
ATOM   10228 N  ND1 . HIS H 1 30  ? 55.885 24.105  -2.585  1.00 46.45 ? 114 HIS H ND1 1 
ATOM   10229 C  CD2 . HIS H 1 30  ? 57.254 25.703  -3.186  1.00 48.80 ? 114 HIS H CD2 1 
ATOM   10230 C  CE1 . HIS H 1 30  ? 55.311 24.751  -3.584  1.00 46.96 ? 114 HIS H CE1 1 
ATOM   10231 N  NE2 . HIS H 1 30  ? 56.119 25.726  -3.966  1.00 50.32 ? 114 HIS H NE2 1 
ATOM   10232 N  N   . SER H 1 31  ? 57.633 21.587  -3.465  1.00 39.14 ? 115 SER H N   1 
ATOM   10233 C  CA  . SER H 1 31  ? 57.852 21.119  -4.825  1.00 40.19 ? 115 SER H CA  1 
ATOM   10234 C  C   . SER H 1 31  ? 56.867 21.739  -5.787  1.00 39.14 ? 115 SER H C   1 
ATOM   10235 O  O   . SER H 1 31  ? 55.803 22.104  -5.386  1.00 39.18 ? 115 SER H O   1 
ATOM   10236 C  CB  . SER H 1 31  ? 57.622 19.630  -4.906  1.00 40.59 ? 115 SER H CB  1 
ATOM   10237 O  OG  . SER H 1 31  ? 58.410 18.990  -3.928  1.00 48.67 ? 115 SER H OG  1 
ATOM   10238 N  N   . SER H 1 32  ? 57.244 21.835  -7.063  1.00 38.30 ? 116 SER H N   1 
ATOM   10239 C  CA  . SER H 1 32  ? 56.409 22.379  -8.079  1.00 37.21 ? 116 SER H CA  1 
ATOM   10240 C  C   . SER H 1 32  ? 56.796 21.651  -9.323  1.00 36.98 ? 116 SER H C   1 
ATOM   10241 O  O   . SER H 1 32  ? 57.934 21.225  -9.355  1.00 36.79 ? 116 SER H O   1 
ATOM   10242 C  CB  . SER H 1 32  ? 56.705 23.848  -8.276  1.00 36.75 ? 116 SER H CB  1 
ATOM   10243 O  OG  . SER H 1 32  ? 56.450 24.158  -9.647  1.00 36.44 ? 116 SER H OG  1 
ATOM   10244 N  N   . PHE H 1 33  ? 55.879 21.497  -10.307 1.00 36.20 ? 117 PHE H N   1 
ATOM   10245 C  CA  . PHE H 1 33  ? 56.197 20.892  -11.615 1.00 36.52 ? 117 PHE H CA  1 
ATOM   10246 C  C   . PHE H 1 33  ? 56.706 21.940  -12.606 1.00 37.74 ? 117 PHE H C   1 
ATOM   10247 O  O   . PHE H 1 33  ? 57.092 21.628  -13.744 1.00 36.79 ? 117 PHE H O   1 
ATOM   10248 C  CB  . PHE H 1 33  ? 55.013 20.135  -12.280 1.00 35.38 ? 117 PHE H CB  1 
ATOM   10249 C  CG  . PHE H 1 33  ? 54.606 18.846  -11.597 1.00 32.68 ? 117 PHE H CG  1 
ATOM   10250 C  CD1 . PHE H 1 33  ? 53.779 18.860  -10.489 1.00 31.10 ? 117 PHE H CD1 1 
ATOM   10251 C  CD2 . PHE H 1 33  ? 54.999 17.604  -12.109 1.00 34.36 ? 117 PHE H CD2 1 
ATOM   10252 C  CE1 . PHE H 1 33  ? 53.406 17.655  -9.839  1.00 34.17 ? 117 PHE H CE1 1 
ATOM   10253 C  CE2 . PHE H 1 33  ? 54.603 16.375  -11.489 1.00 33.46 ? 117 PHE H CE2 1 
ATOM   10254 C  CZ  . PHE H 1 33  ? 53.834 16.402  -10.345 1.00 34.61 ? 117 PHE H CZ  1 
ATOM   10255 N  N   . LYS H 1 34  ? 56.713 23.182  -12.170 1.00 40.66 ? 118 LYS H N   1 
ATOM   10256 C  CA  . LYS H 1 34  ? 57.176 24.279  -13.023 1.00 44.52 ? 118 LYS H CA  1 
ATOM   10257 C  C   . LYS H 1 34  ? 58.713 24.236  -13.086 1.00 45.81 ? 118 LYS H C   1 
ATOM   10258 O  O   . LYS H 1 34  ? 59.394 24.279  -12.056 1.00 46.60 ? 118 LYS H O   1 
ATOM   10259 C  CB  . LYS H 1 34  ? 56.661 25.625  -12.507 1.00 44.65 ? 118 LYS H CB  1 
ATOM   10260 C  CG  . LYS H 1 34  ? 56.804 26.781  -13.485 1.00 46.58 ? 118 LYS H CG  1 
ATOM   10261 C  CD  . LYS H 1 34  ? 55.797 27.879  -13.112 1.00 46.70 ? 118 LYS H CD  1 
ATOM   10262 C  CE  . LYS H 1 34  ? 55.805 29.028  -14.106 1.00 47.22 ? 118 LYS H CE  1 
ATOM   10263 N  NZ  . LYS H 1 34  ? 56.731 30.188  -13.717 1.00 50.01 ? 118 LYS H NZ  1 
ATOM   10264 N  N   . PRO H 1 35  ? 59.258 24.054  -14.289 1.00 46.83 ? 119 PRO H N   1 
ATOM   10265 C  CA  . PRO H 1 35  ? 60.720 23.905  -14.365 1.00 47.88 ? 119 PRO H CA  1 
ATOM   10266 C  C   . PRO H 1 35  ? 61.450 25.084  -13.742 1.00 48.32 ? 119 PRO H C   1 
ATOM   10267 O  O   . PRO H 1 35  ? 61.057 26.201  -13.978 1.00 48.59 ? 119 PRO H O   1 
ATOM   10268 C  CB  . PRO H 1 35  ? 60.969 23.770  -15.884 1.00 47.61 ? 119 PRO H CB  1 
ATOM   10269 C  CG  . PRO H 1 35  ? 59.686 23.100  -16.372 1.00 46.14 ? 119 PRO H CG  1 
ATOM   10270 C  CD  . PRO H 1 35  ? 58.624 23.897  -15.608 1.00 46.18 ? 119 PRO H CD  1 
ATOM   10271 N  N   . ILE H 1 36  ? 62.463 24.842  -12.902 1.00 49.49 ? 120 ILE H N   1 
ATOM   10272 C  CA  . ILE H 1 36  ? 63.234 25.982  -12.292 1.00 49.52 ? 120 ILE H CA  1 
ATOM   10273 C  C   . ILE H 1 36  ? 64.774 25.860  -12.345 1.00 49.38 ? 120 ILE H C   1 
ATOM   10274 O  O   . ILE H 1 36  ? 65.308 24.823  -12.756 1.00 49.36 ? 120 ILE H O   1 
ATOM   10275 C  CB  . ILE H 1 36  ? 62.734 26.412  -10.848 1.00 49.13 ? 120 ILE H CB  1 
ATOM   10276 C  CG1 . ILE H 1 36  ? 62.903 25.295  -9.819  1.00 48.35 ? 120 ILE H CG1 1 
ATOM   10277 C  CG2 . ILE H 1 36  ? 61.319 26.974  -10.907 1.00 49.06 ? 120 ILE H CG2 1 
ATOM   10278 C  CD1 . ILE H 1 36  ? 62.458 25.649  -8.447  1.00 46.06 ? 120 ILE H CD1 1 
ATOM   10279 N  N   . ALA H 1 39  ? 67.164 25.015  -7.499  1.00 44.31 ? 123 ALA H N   1 
ATOM   10280 C  CA  . ALA H 1 39  ? 66.533 23.709  -7.171  1.00 44.83 ? 123 ALA H CA  1 
ATOM   10281 C  C   . ALA H 1 39  ? 67.534 22.716  -6.560  1.00 44.70 ? 123 ALA H C   1 
ATOM   10282 O  O   . ALA H 1 39  ? 68.560 22.306  -7.196  1.00 44.52 ? 123 ALA H O   1 
ATOM   10283 C  CB  . ALA H 1 39  ? 65.844 23.066  -8.359  1.00 43.83 ? 123 ALA H CB  1 
ATOM   10284 N  N   . ASP H 1 40  ? 67.216 22.331  -5.328  1.00 43.13 ? 124 ASP H N   1 
ATOM   10285 C  CA  . ASP H 1 40  ? 68.037 21.416  -4.622  1.00 41.48 ? 124 ASP H CA  1 
ATOM   10286 C  C   . ASP H 1 40  ? 67.950 20.070  -5.282  1.00 41.37 ? 124 ASP H C   1 
ATOM   10287 O  O   . ASP H 1 40  ? 68.985 19.438  -5.510  1.00 41.38 ? 124 ASP H O   1 
ATOM   10288 C  CB  . ASP H 1 40  ? 67.617 21.451  -3.194  1.00 40.97 ? 124 ASP H CB  1 
ATOM   10289 C  CG  . ASP H 1 40  ? 67.884 22.785  -2.607  1.00 41.18 ? 124 ASP H CG  1 
ATOM   10290 O  OD1 . ASP H 1 40  ? 69.063 23.107  -2.496  1.00 46.28 ? 124 ASP H OD1 1 
ATOM   10291 O  OD2 . ASP H 1 40  ? 66.979 23.573  -2.328  1.00 41.61 ? 124 ASP H OD2 1 
ATOM   10292 N  N   . PHE H 1 41  ? 66.734 19.633  -5.615  1.00 40.85 ? 125 PHE H N   1 
ATOM   10293 C  CA  . PHE H 1 41  ? 66.558 18.317  -6.227  1.00 40.55 ? 125 PHE H CA  1 
ATOM   10294 C  C   . PHE H 1 41  ? 65.587 18.386  -7.351  1.00 40.20 ? 125 PHE H C   1 
ATOM   10295 O  O   . PHE H 1 41  ? 64.617 19.157  -7.304  1.00 38.82 ? 125 PHE H O   1 
ATOM   10296 C  CB  . PHE H 1 41  ? 65.964 17.211  -5.285  1.00 40.75 ? 125 PHE H CB  1 
ATOM   10297 C  CG  . PHE H 1 41  ? 66.404 17.273  -3.899  1.00 41.58 ? 125 PHE H CG  1 
ATOM   10298 C  CD1 . PHE H 1 41  ? 65.460 17.422  -2.888  1.00 43.01 ? 125 PHE H CD1 1 
ATOM   10299 C  CD2 . PHE H 1 41  ? 67.762 17.170  -3.577  1.00 43.26 ? 125 PHE H CD2 1 
ATOM   10300 C  CE1 . PHE H 1 41  ? 65.834 17.518  -1.582  1.00 42.45 ? 125 PHE H CE1 1 
ATOM   10301 C  CE2 . PHE H 1 41  ? 68.168 17.241  -2.256  1.00 43.57 ? 125 PHE H CE2 1 
ATOM   10302 C  CZ  . PHE H 1 41  ? 67.182 17.414  -1.245  1.00 44.38 ? 125 PHE H CZ  1 
ATOM   10303 N  N   . ILE H 1 42  ? 65.803 17.479  -8.297  1.00 39.98 ? 126 ILE H N   1 
ATOM   10304 C  CA  . ILE H 1 42  ? 64.858 17.241  -9.339  1.00 41.26 ? 126 ILE H CA  1 
ATOM   10305 C  C   . ILE H 1 42  ? 64.624 15.774  -9.339  1.00 42.05 ? 126 ILE H C   1 
ATOM   10306 O  O   . ILE H 1 42  ? 65.564 14.988  -9.233  1.00 41.77 ? 126 ILE H O   1 
ATOM   10307 C  CB  . ILE H 1 42  ? 65.385 17.677  -10.686 1.00 41.40 ? 126 ILE H CB  1 
ATOM   10308 C  CG1 . ILE H 1 42  ? 65.373 19.197  -10.728 1.00 41.37 ? 126 ILE H CG1 1 
ATOM   10309 C  CG2 . ILE H 1 42  ? 64.473 17.147  -11.782 1.00 43.81 ? 126 ILE H CG2 1 
ATOM   10310 C  CD1 . ILE H 1 42  ? 66.334 19.761  -11.647 1.00 44.85 ? 126 ILE H CD1 1 
ATOM   10311 N  N   . VAL H 1 43  ? 63.352 15.382  -9.351  1.00 43.02 ? 127 VAL H N   1 
ATOM   10312 C  CA  . VAL H 1 43  ? 63.033 13.950  -9.293  1.00 42.37 ? 127 VAL H CA  1 
ATOM   10313 C  C   . VAL H 1 43  ? 61.985 13.728  -10.353 1.00 42.82 ? 127 VAL H C   1 
ATOM   10314 O  O   . VAL H 1 43  ? 61.068 14.529  -10.479 1.00 42.33 ? 127 VAL H O   1 
ATOM   10315 C  CB  . VAL H 1 43  ? 62.671 13.455  -7.822  1.00 41.68 ? 127 VAL H CB  1 
ATOM   10316 C  CG1 . VAL H 1 43  ? 63.268 14.342  -6.788  1.00 42.21 ? 127 VAL H CG1 1 
ATOM   10317 C  CG2 . VAL H 1 43  ? 61.236 13.407  -7.549  1.00 43.70 ? 127 VAL H CG2 1 
ATOM   10318 N  N   . PRO H 1 44  ? 62.193 12.719  -11.206 1.00 43.55 ? 128 PRO H N   1 
ATOM   10319 C  CA  . PRO H 1 44  ? 61.246 12.286  -12.235 1.00 43.66 ? 128 PRO H CA  1 
ATOM   10320 C  C   . PRO H 1 44  ? 60.079 11.484  -11.670 1.00 43.82 ? 128 PRO H C   1 
ATOM   10321 O  O   . PRO H 1 44  ? 60.296 10.528  -10.946 1.00 44.62 ? 128 PRO H O   1 
ATOM   10322 C  CB  . PRO H 1 44  ? 62.114 11.393  -13.138 1.00 42.87 ? 128 PRO H CB  1 
ATOM   10323 C  CG  . PRO H 1 44  ? 63.013 10.727  -12.188 1.00 43.16 ? 128 PRO H CG  1 
ATOM   10324 C  CD  . PRO H 1 44  ? 63.429 11.925  -11.280 1.00 43.92 ? 128 PRO H CD  1 
ATOM   10325 N  N   . ILE H 1 45  ? 58.864 11.854  -12.045 1.00 44.43 ? 129 ILE H N   1 
ATOM   10326 C  CA  . ILE H 1 45  ? 57.645 11.244  -11.533 1.00 45.67 ? 129 ILE H CA  1 
ATOM   10327 C  C   . ILE H 1 45  ? 56.719 10.828  -12.684 1.00 46.36 ? 129 ILE H C   1 
ATOM   10328 O  O   . ILE H 1 45  ? 56.369 11.650  -13.527 1.00 46.71 ? 129 ILE H O   1 
ATOM   10329 C  CB  . ILE H 1 45  ? 56.999 12.226  -10.544 1.00 45.69 ? 129 ILE H CB  1 
ATOM   10330 C  CG1 . ILE H 1 45  ? 57.762 12.145  -9.223  1.00 45.29 ? 129 ILE H CG1 1 
ATOM   10331 C  CG2 . ILE H 1 45  ? 55.532 11.953  -10.331 1.00 45.82 ? 129 ILE H CG2 1 
ATOM   10332 C  CD1 . ILE H 1 45  ? 57.438 13.229  -8.287  1.00 47.51 ? 129 ILE H CD1 1 
ATOM   10333 N  N   . GLU H 1 46  ? 56.329 9.566   -12.751 1.00 47.62 ? 130 GLU H N   1 
ATOM   10334 C  CA  . GLU H 1 46  ? 55.493 9.148   -13.878 1.00 50.53 ? 130 GLU H CA  1 
ATOM   10335 C  C   . GLU H 1 46  ? 54.019 9.297   -13.537 1.00 50.88 ? 130 GLU H C   1 
ATOM   10336 O  O   . GLU H 1 46  ? 53.564 8.878   -12.512 1.00 52.07 ? 130 GLU H O   1 
ATOM   10337 C  CB  . GLU H 1 46  ? 55.826 7.738   -14.335 1.00 50.60 ? 130 GLU H CB  1 
ATOM   10338 C  CG  . GLU H 1 46  ? 54.787 6.684   -13.894 1.00 58.05 ? 130 GLU H CG  1 
ATOM   10339 C  CD  . GLU H 1 46  ? 53.593 6.545   -14.866 1.00 63.23 ? 130 GLU H CD  1 
ATOM   10340 O  OE1 . GLU H 1 46  ? 53.854 6.587   -16.093 1.00 64.61 ? 130 GLU H OE1 1 
ATOM   10341 O  OE2 . GLU H 1 46  ? 52.418 6.381   -14.405 1.00 63.17 ? 130 GLU H OE2 1 
ATOM   10342 N  N   . ILE H 1 47  ? 53.268 9.905   -14.414 1.00 52.39 ? 131 ILE H N   1 
ATOM   10343 C  CA  . ILE H 1 47  ? 51.890 10.233  -14.139 1.00 52.68 ? 131 ILE H CA  1 
ATOM   10344 C  C   . ILE H 1 47  ? 51.045 9.706   -15.275 1.00 53.40 ? 131 ILE H C   1 
ATOM   10345 O  O   . ILE H 1 47  ? 51.176 10.151  -16.407 1.00 52.13 ? 131 ILE H O   1 
ATOM   10346 C  CB  . ILE H 1 47  ? 51.721 11.755  -14.113 1.00 52.73 ? 131 ILE H CB  1 
ATOM   10347 C  CG1 . ILE H 1 47  ? 52.413 12.357  -12.895 1.00 51.66 ? 131 ILE H CG1 1 
ATOM   10348 C  CG2 . ILE H 1 47  ? 50.261 12.139  -14.187 1.00 53.50 ? 131 ILE H CG2 1 
ATOM   10349 C  CD1 . ILE H 1 47  ? 51.610 12.270  -11.643 1.00 54.76 ? 131 ILE H CD1 1 
ATOM   10350 N  N   . GLU H 1 48  ? 50.132 8.784   -14.978 1.00 55.30 ? 132 GLU H N   1 
ATOM   10351 C  CA  . GLU H 1 48  ? 49.265 8.279   -16.044 1.00 56.91 ? 132 GLU H CA  1 
ATOM   10352 C  C   . GLU H 1 48  ? 50.186 8.114   -17.252 1.00 55.49 ? 132 GLU H C   1 
ATOM   10353 O  O   . GLU H 1 48  ? 49.917 8.636   -18.347 1.00 56.58 ? 132 GLU H O   1 
ATOM   10354 C  CB  . GLU H 1 48  ? 48.084 9.247   -16.333 1.00 56.54 ? 132 GLU H CB  1 
ATOM   10355 C  CG  . GLU H 1 48  ? 46.783 8.958   -15.484 1.00 60.56 ? 132 GLU H CG  1 
ATOM   10356 C  CD  . GLU H 1 48  ? 46.000 10.252  -15.106 1.00 60.89 ? 132 GLU H CD  1 
ATOM   10357 O  OE1 . GLU H 1 48  ? 45.513 10.930  -16.058 1.00 65.74 ? 132 GLU H OE1 1 
ATOM   10358 O  OE2 . GLU H 1 48  ? 45.880 10.591  -13.879 1.00 61.00 ? 132 GLU H OE2 1 
ATOM   10359 N  N   . GLY H 1 49  ? 51.317 7.445   -17.023 1.00 53.53 ? 133 GLY H N   1 
ATOM   10360 C  CA  . GLY H 1 49  ? 52.186 7.054   -18.117 1.00 50.34 ? 133 GLY H CA  1 
ATOM   10361 C  C   . GLY H 1 49  ? 53.259 8.031   -18.543 1.00 48.49 ? 133 GLY H C   1 
ATOM   10362 O  O   . GLY H 1 49  ? 54.208 7.614   -19.165 1.00 48.37 ? 133 GLY H O   1 
ATOM   10363 N  N   . THR H 1 50  ? 53.133 9.322   -18.258 1.00 46.82 ? 134 THR H N   1 
ATOM   10364 C  CA  . THR H 1 50  ? 54.196 10.240  -18.694 1.00 45.22 ? 134 THR H CA  1 
ATOM   10365 C  C   . THR H 1 50  ? 55.017 10.808  -17.543 1.00 44.29 ? 134 THR H C   1 
ATOM   10366 O  O   . THR H 1 50  ? 54.472 11.310  -16.559 1.00 43.92 ? 134 THR H O   1 
ATOM   10367 C  CB  . THR H 1 50  ? 53.742 11.405  -19.624 1.00 45.30 ? 134 THR H CB  1 
ATOM   10368 O  OG1 . THR H 1 50  ? 54.055 12.671  -19.021 1.00 47.13 ? 134 THR H OG1 1 
ATOM   10369 C  CG2 . THR H 1 50  ? 52.281 11.349  -20.011 1.00 43.96 ? 134 THR H CG2 1 
ATOM   10370 N  N   . THR H 1 51  ? 56.333 10.776  -17.691 1.00 42.79 ? 135 THR H N   1 
ATOM   10371 C  CA  . THR H 1 51  ? 57.189 11.245  -16.622 1.00 41.81 ? 135 THR H CA  1 
ATOM   10372 C  C   . THR H 1 51  ? 57.514 12.703  -16.703 1.00 41.58 ? 135 THR H C   1 
ATOM   10373 O  O   . THR H 1 51  ? 57.971 13.177  -17.723 1.00 42.81 ? 135 THR H O   1 
ATOM   10374 C  CB  . THR H 1 51  ? 58.477 10.388  -16.427 1.00 41.51 ? 135 THR H CB  1 
ATOM   10375 O  OG1 . THR H 1 51  ? 59.636 11.205  -16.500 1.00 43.03 ? 135 THR H OG1 1 
ATOM   10376 C  CG2 . THR H 1 51  ? 58.534 9.250   -17.329 1.00 37.26 ? 135 THR H CG2 1 
ATOM   10377 N  N   . HIS H 1 52  ? 57.262 13.391  -15.598 1.00 40.97 ? 136 HIS H N   1 
ATOM   10378 C  CA  . HIS H 1 52  ? 57.372 14.831  -15.420 1.00 39.74 ? 136 HIS H CA  1 
ATOM   10379 C  C   . HIS H 1 52  ? 58.463 14.958  -14.402 1.00 40.81 ? 136 HIS H C   1 
ATOM   10380 O  O   . HIS H 1 52  ? 58.750 13.996  -13.717 1.00 41.19 ? 136 HIS H O   1 
ATOM   10381 C  CB  . HIS H 1 52  ? 56.092 15.382  -14.788 1.00 39.00 ? 136 HIS H CB  1 
ATOM   10382 C  CG  . HIS H 1 52  ? 54.924 15.406  -15.711 1.00 36.87 ? 136 HIS H CG  1 
ATOM   10383 N  ND1 . HIS H 1 52  ? 54.625 16.499  -16.514 1.00 38.25 ? 136 HIS H ND1 1 
ATOM   10384 C  CD2 . HIS H 1 52  ? 54.004 14.456  -16.002 1.00 32.94 ? 136 HIS H CD2 1 
ATOM   10385 C  CE1 . HIS H 1 52  ? 53.556 16.211  -17.248 1.00 33.46 ? 136 HIS H CE1 1 
ATOM   10386 N  NE2 . HIS H 1 52  ? 53.157 14.985  -16.945 1.00 29.92 ? 136 HIS H NE2 1 
ATOM   10387 N  N   . GLN H 1 53  ? 59.082 16.131  -14.295 1.00 41.26 ? 137 GLN H N   1 
ATOM   10388 C  CA  . GLN H 1 53  ? 60.181 16.311  -13.383 1.00 41.47 ? 137 GLN H CA  1 
ATOM   10389 C  C   . GLN H 1 53  ? 59.597 17.143  -12.321 1.00 40.18 ? 137 GLN H C   1 
ATOM   10390 O  O   . GLN H 1 53  ? 58.919 18.100  -12.613 1.00 42.59 ? 137 GLN H O   1 
ATOM   10391 C  CB  . GLN H 1 53  ? 61.337 17.108  -14.021 1.00 42.52 ? 137 GLN H CB  1 
ATOM   10392 C  CG  . GLN H 1 53  ? 61.995 16.500  -15.233 1.00 47.48 ? 137 GLN H CG  1 
ATOM   10393 C  CD  . GLN H 1 53  ? 62.865 15.310  -14.901 1.00 59.21 ? 137 GLN H CD  1 
ATOM   10394 O  OE1 . GLN H 1 53  ? 62.370 14.254  -14.489 1.00 63.54 ? 137 GLN H OE1 1 
ATOM   10395 N  NE2 . GLN H 1 53  ? 64.185 15.460  -15.096 1.00 64.11 ? 137 GLN H NE2 1 
ATOM   10396 N  N   . VAL H 1 54  ? 59.869 16.840  -11.075 1.00 38.45 ? 138 VAL H N   1 
ATOM   10397 C  CA  . VAL H 1 54  ? 59.435 17.736  -10.032 1.00 36.44 ? 138 VAL H CA  1 
ATOM   10398 C  C   . VAL H 1 54  ? 60.687 18.348  -9.477  1.00 36.50 ? 138 VAL H C   1 
ATOM   10399 O  O   . VAL H 1 54  ? 61.709 17.652  -9.327  1.00 37.17 ? 138 VAL H O   1 
ATOM   10400 C  CB  . VAL H 1 54  ? 58.630 16.976  -8.939  1.00 36.40 ? 138 VAL H CB  1 
ATOM   10401 C  CG1 . VAL H 1 54  ? 58.115 17.906  -7.867  1.00 32.14 ? 138 VAL H CG1 1 
ATOM   10402 C  CG2 . VAL H 1 54  ? 57.488 16.274  -9.602  1.00 35.92 ? 138 VAL H CG2 1 
ATOM   10403 N  N   . TYR H 1 55  ? 60.555 19.623  -9.122  1.00 36.03 ? 139 TYR H N   1 
ATOM   10404 C  CA  . TYR H 1 55  ? 61.596 20.533  -8.790  1.00 35.67 ? 139 TYR H CA  1 
ATOM   10405 C  C   . TYR H 1 55  ? 61.459 20.890  -7.333  1.00 34.98 ? 139 TYR H C   1 
ATOM   10406 O  O   . TYR H 1 55  ? 60.515 21.570  -6.931  1.00 36.09 ? 139 TYR H O   1 
ATOM   10407 C  CB  . TYR H 1 55  ? 61.441 21.779  -9.674  1.00 36.61 ? 139 TYR H CB  1 
ATOM   10408 C  CG  . TYR H 1 55  ? 61.637 21.446  -11.125 1.00 38.25 ? 139 TYR H CG  1 
ATOM   10409 C  CD1 . TYR H 1 55  ? 60.557 21.060  -11.962 1.00 41.39 ? 139 TYR H CD1 1 
ATOM   10410 C  CD2 . TYR H 1 55  ? 62.911 21.471  -11.671 1.00 39.86 ? 139 TYR H CD2 1 
ATOM   10411 C  CE1 . TYR H 1 55  ? 60.771 20.717  -13.346 1.00 38.45 ? 139 TYR H CE1 1 
ATOM   10412 C  CE2 . TYR H 1 55  ? 63.147 21.144  -13.001 1.00 38.42 ? 139 TYR H CE2 1 
ATOM   10413 C  CZ  . TYR H 1 55  ? 62.101 20.774  -13.847 1.00 38.41 ? 139 TYR H CZ  1 
ATOM   10414 O  OH  . TYR H 1 55  ? 62.466 20.396  -15.144 1.00 36.44 ? 139 TYR H OH  1 
ATOM   10415 N  N   . VAL H 1 56  ? 62.430 20.476  -6.533  1.00 34.19 ? 140 VAL H N   1 
ATOM   10416 C  CA  . VAL H 1 56  ? 62.278 20.554  -5.093  1.00 33.63 ? 140 VAL H CA  1 
ATOM   10417 C  C   . VAL H 1 56  ? 63.260 21.513  -4.489  1.00 34.05 ? 140 VAL H C   1 
ATOM   10418 O  O   . VAL H 1 56  ? 64.445 21.412  -4.778  1.00 35.81 ? 140 VAL H O   1 
ATOM   10419 C  CB  . VAL H 1 56  ? 62.429 19.119  -4.415  1.00 33.21 ? 140 VAL H CB  1 
ATOM   10420 C  CG1 . VAL H 1 56  ? 62.332 19.184  -2.912  1.00 29.02 ? 140 VAL H CG1 1 
ATOM   10421 C  CG2 . VAL H 1 56  ? 61.403 18.103  -5.004  1.00 31.09 ? 140 VAL H CG2 1 
ATOM   10422 N  N   . LEU H 1 57  ? 62.772 22.393  -3.628  1.00 32.87 ? 141 LEU H N   1 
ATOM   10423 C  CA  . LEU H 1 57  ? 63.596 23.294  -2.881  1.00 33.25 ? 141 LEU H CA  1 
ATOM   10424 C  C   . LEU H 1 57  ? 63.548 22.950  -1.363  1.00 33.73 ? 141 LEU H C   1 
ATOM   10425 O  O   . LEU H 1 57  ? 62.468 22.869  -0.766  1.00 34.07 ? 141 LEU H O   1 
ATOM   10426 C  CB  . LEU H 1 57  ? 63.051 24.712  -3.077  1.00 33.47 ? 141 LEU H CB  1 
ATOM   10427 C  CG  . LEU H 1 57  ? 63.194 25.457  -4.401  1.00 34.56 ? 141 LEU H CG  1 
ATOM   10428 C  CD1 . LEU H 1 57  ? 62.467 26.762  -4.309  1.00 34.29 ? 141 LEU H CD1 1 
ATOM   10429 C  CD2 . LEU H 1 57  ? 64.651 25.713  -4.751  1.00 37.15 ? 141 LEU H CD2 1 
ATOM   10430 N  N   . LYS H 1 58  ? 64.710 22.773  -0.726  1.00 33.85 ? 142 LYS H N   1 
ATOM   10431 C  CA  . LYS H 1 58  ? 64.773 22.498  0.697   1.00 32.97 ? 142 LYS H CA  1 
ATOM   10432 C  C   . LYS H 1 58  ? 64.501 23.791  1.368   1.00 32.27 ? 142 LYS H C   1 
ATOM   10433 O  O   . LYS H 1 58  ? 64.805 24.791  0.783   1.00 33.04 ? 142 LYS H O   1 
ATOM   10434 C  CB  . LYS H 1 58  ? 66.121 21.991  1.068   1.00 31.74 ? 142 LYS H CB  1 
ATOM   10435 C  CG  . LYS H 1 58  ? 66.567 21.000  0.153   1.00 36.16 ? 142 LYS H CG  1 
ATOM   10436 C  CD  . LYS H 1 58  ? 67.572 20.041  0.809   1.00 44.74 ? 142 LYS H CD  1 
ATOM   10437 C  CE  . LYS H 1 58  ? 68.708 20.725  1.581   1.00 48.51 ? 142 LYS H CE  1 
ATOM   10438 N  NZ  . LYS H 1 58  ? 69.779 19.716  1.956   1.00 51.25 ? 142 LYS H NZ  1 
ATOM   10439 N  N   . ARG H 1 59  ? 63.875 23.756  2.537   1.00 31.27 ? 143 ARG H N   1 
ATOM   10440 C  CA  . ARG H 1 59  ? 63.536 24.925  3.338   1.00 31.96 ? 143 ARG H CA  1 
ATOM   10441 C  C   . ARG H 1 59  ? 64.774 25.188  4.185   1.00 33.46 ? 143 ARG H C   1 
ATOM   10442 O  O   . ARG H 1 59  ? 65.466 24.220  4.516   1.00 34.37 ? 143 ARG H O   1 
ATOM   10443 C  CB  . ARG H 1 59  ? 62.341 24.581  4.242   1.00 30.69 ? 143 ARG H CB  1 
ATOM   10444 C  CG  . ARG H 1 59  ? 62.028 25.582  5.290   1.00 29.48 ? 143 ARG H CG  1 
ATOM   10445 C  CD  . ARG H 1 59  ? 60.875 25.205  6.146   1.00 28.84 ? 143 ARG H CD  1 
ATOM   10446 N  NE  . ARG H 1 59  ? 60.282 26.332  6.838   1.00 29.18 ? 143 ARG H NE  1 
ATOM   10447 C  CZ  . ARG H 1 59  ? 59.035 26.359  7.309   1.00 31.53 ? 143 ARG H CZ  1 
ATOM   10448 N  NH1 . ARG H 1 59  ? 58.259 25.306  7.192   1.00 31.75 ? 143 ARG H NH1 1 
ATOM   10449 N  NH2 . ARG H 1 59  ? 58.581 27.423  7.933   1.00 31.52 ? 143 ARG H NH2 1 
ATOM   10450 N  N   . PRO H 1 60  ? 65.075 26.469  4.554   1.00 34.42 ? 144 PRO H N   1 
ATOM   10451 C  CA  . PRO H 1 60  ? 66.362 26.691  5.184   1.00 34.00 ? 144 PRO H CA  1 
ATOM   10452 C  C   . PRO H 1 60  ? 66.488 25.870  6.456   1.00 33.45 ? 144 PRO H C   1 
ATOM   10453 O  O   . PRO H 1 60  ? 65.558 25.828  7.224   1.00 32.77 ? 144 PRO H O   1 
ATOM   10454 C  CB  . PRO H 1 60  ? 66.286 28.158  5.608   1.00 32.56 ? 144 PRO H CB  1 
ATOM   10455 C  CG  . PRO H 1 60  ? 65.479 28.708  4.669   1.00 34.71 ? 144 PRO H CG  1 
ATOM   10456 C  CD  . PRO H 1 60  ? 64.366 27.748  4.446   1.00 34.71 ? 144 PRO H CD  1 
ATOM   10457 N  N   . TYR H 1 61  ? 67.668 25.271  6.663   1.00 33.45 ? 145 TYR H N   1 
ATOM   10458 C  CA  . TYR H 1 61  ? 68.080 24.740  7.964   1.00 33.91 ? 145 TYR H CA  1 
ATOM   10459 C  C   . TYR H 1 61  ? 67.373 23.416  8.217   1.00 34.40 ? 145 TYR H C   1 
ATOM   10460 O  O   . TYR H 1 61  ? 67.281 22.968  9.358   1.00 33.84 ? 145 TYR H O   1 
ATOM   10461 C  CB  . TYR H 1 61  ? 67.717 25.713  9.061   1.00 34.60 ? 145 TYR H CB  1 
ATOM   10462 C  CG  . TYR H 1 61  ? 68.444 27.038  8.954   1.00 36.02 ? 145 TYR H CG  1 
ATOM   10463 C  CD1 . TYR H 1 61  ? 67.773 28.191  8.616   1.00 38.92 ? 145 TYR H CD1 1 
ATOM   10464 C  CD2 . TYR H 1 61  ? 69.833 27.140  9.231   1.00 37.60 ? 145 TYR H CD2 1 
ATOM   10465 C  CE1 . TYR H 1 61  ? 68.480 29.443  8.526   1.00 40.11 ? 145 TYR H CE1 1 
ATOM   10466 C  CE2 . TYR H 1 61  ? 70.535 28.347  9.121   1.00 32.64 ? 145 TYR H CE2 1 
ATOM   10467 C  CZ  . TYR H 1 61  ? 69.855 29.470  8.783   1.00 38.12 ? 145 TYR H CZ  1 
ATOM   10468 O  OH  . TYR H 1 61  ? 70.533 30.680  8.718   1.00 40.29 ? 145 TYR H OH  1 
ATOM   10469 N  N   . VAL H 1 62  ? 66.868 22.814  7.132   1.00 34.36 ? 146 VAL H N   1 
ATOM   10470 C  CA  . VAL H 1 62  ? 66.192 21.536  7.200   1.00 35.00 ? 146 VAL H CA  1 
ATOM   10471 C  C   . VAL H 1 62  ? 67.180 20.439  7.628   1.00 36.05 ? 146 VAL H C   1 
ATOM   10472 O  O   . VAL H 1 62  ? 66.894 19.677  8.572   1.00 36.76 ? 146 VAL H O   1 
ATOM   10473 C  CB  . VAL H 1 62  ? 65.396 21.225  5.896   1.00 34.53 ? 146 VAL H CB  1 
ATOM   10474 C  CG1 . VAL H 1 62  ? 66.271 21.062  4.734   1.00 30.69 ? 146 VAL H CG1 1 
ATOM   10475 C  CG2 . VAL H 1 62  ? 64.560 19.994  6.092   1.00 35.99 ? 146 VAL H CG2 1 
ATOM   10476 N  N   . ASP H 1 63  ? 68.346 20.420  6.984   1.00 36.00 ? 147 ASP H N   1 
ATOM   10477 C  CA  . ASP H 1 63  ? 69.503 19.598  7.375   1.00 36.65 ? 147 ASP H CA  1 
ATOM   10478 C  C   . ASP H 1 63  ? 69.862 19.663  8.853   1.00 36.09 ? 147 ASP H C   1 
ATOM   10479 O  O   . ASP H 1 63  ? 69.995 18.609  9.497   1.00 37.33 ? 147 ASP H O   1 
ATOM   10480 C  CB  . ASP H 1 63  ? 70.724 19.903  6.513   1.00 36.53 ? 147 ASP H CB  1 
ATOM   10481 C  CG  . ASP H 1 63  ? 70.439 19.712  4.988   1.00 41.90 ? 147 ASP H CG  1 
ATOM   10482 O  OD1 . ASP H 1 63  ? 69.977 18.597  4.607   1.00 42.88 ? 147 ASP H OD1 1 
ATOM   10483 O  OD2 . ASP H 1 63  ? 70.650 20.700  4.177   1.00 43.64 ? 147 ASP H OD2 1 
ATOM   10484 N  N   . GLU H 1 64  ? 69.979 20.844  9.420   1.00 34.92 ? 148 GLU H N   1 
ATOM   10485 C  CA  . GLU H 1 64  ? 70.303 20.894  10.845  1.00 36.95 ? 148 GLU H CA  1 
ATOM   10486 C  C   . GLU H 1 64  ? 69.131 20.521  11.755  1.00 37.27 ? 148 GLU H C   1 
ATOM   10487 O  O   . GLU H 1 64  ? 69.297 19.887  12.773  1.00 37.91 ? 148 GLU H O   1 
ATOM   10488 C  CB  . GLU H 1 64  ? 71.004 22.212  11.283  1.00 37.52 ? 148 GLU H CB  1 
ATOM   10489 C  CG  . GLU H 1 64  ? 70.670 23.490  10.523  1.00 42.92 ? 148 GLU H CG  1 
ATOM   10490 C  CD  . GLU H 1 64  ? 71.431 23.678  9.176   1.00 49.76 ? 148 GLU H CD  1 
ATOM   10491 O  OE1 . GLU H 1 64  ? 72.489 24.381  9.193   1.00 53.81 ? 148 GLU H OE1 1 
ATOM   10492 O  OE2 . GLU H 1 64  ? 70.954 23.177  8.103   1.00 49.13 ? 148 GLU H OE2 1 
ATOM   10493 N  N   . PHE H 1 65  ? 67.930 20.902  11.356  1.00 37.56 ? 149 PHE H N   1 
ATOM   10494 C  CA  . PHE H 1 65  ? 66.737 20.470  12.009  1.00 36.35 ? 149 PHE H CA  1 
ATOM   10495 C  C   . PHE H 1 65  ? 66.650 18.922  12.062  1.00 36.18 ? 149 PHE H C   1 
ATOM   10496 O  O   . PHE H 1 65  ? 66.527 18.362  13.136  1.00 36.10 ? 149 PHE H O   1 
ATOM   10497 C  CB  . PHE H 1 65  ? 65.515 21.115  11.316  1.00 36.11 ? 149 PHE H CB  1 
ATOM   10498 C  CG  . PHE H 1 65  ? 64.226 20.721  11.935  1.00 34.78 ? 149 PHE H CG  1 
ATOM   10499 C  CD1 . PHE H 1 65  ? 63.855 21.242  13.156  1.00 33.09 ? 149 PHE H CD1 1 
ATOM   10500 C  CD2 . PHE H 1 65  ? 63.445 19.743  11.352  1.00 31.05 ? 149 PHE H CD2 1 
ATOM   10501 C  CE1 . PHE H 1 65  ? 62.691 20.834  13.771  1.00 32.96 ? 149 PHE H CE1 1 
ATOM   10502 C  CE2 . PHE H 1 65  ? 62.303 19.324  11.969  1.00 34.17 ? 149 PHE H CE2 1 
ATOM   10503 C  CZ  . PHE H 1 65  ? 61.914 19.867  13.172  1.00 33.53 ? 149 PHE H CZ  1 
ATOM   10504 N  N   . LEU H 1 66  ? 66.708 18.235  10.922  1.00 35.79 ? 150 LEU H N   1 
ATOM   10505 C  CA  . LEU H 1 66  ? 66.514 16.782  10.898  1.00 35.48 ? 150 LEU H CA  1 
ATOM   10506 C  C   . LEU H 1 66  ? 67.518 16.032  11.729  1.00 36.91 ? 150 LEU H C   1 
ATOM   10507 O  O   . LEU H 1 66  ? 67.139 15.142  12.501  1.00 37.42 ? 150 LEU H O   1 
ATOM   10508 C  CB  . LEU H 1 66  ? 66.500 16.226  9.464   1.00 34.76 ? 150 LEU H CB  1 
ATOM   10509 C  CG  . LEU H 1 66  ? 65.181 16.510  8.657   1.00 34.82 ? 150 LEU H CG  1 
ATOM   10510 C  CD1 . LEU H 1 66  ? 65.147 15.879  7.248   1.00 32.84 ? 150 LEU H CD1 1 
ATOM   10511 C  CD2 . LEU H 1 66  ? 63.947 16.082  9.389   1.00 29.58 ? 150 LEU H CD2 1 
ATOM   10512 N  N   . ARG H 1 67  ? 68.804 16.369  11.569  1.00 38.16 ? 151 ARG H N   1 
ATOM   10513 C  CA  . ARG H 1 67  ? 69.862 15.748  12.352  1.00 39.30 ? 151 ARG H CA  1 
ATOM   10514 C  C   . ARG H 1 67  ? 69.516 15.812  13.812  1.00 37.63 ? 151 ARG H C   1 
ATOM   10515 O  O   . ARG H 1 67  ? 69.545 14.839  14.511  1.00 36.86 ? 151 ARG H O   1 
ATOM   10516 C  CB  . ARG H 1 67  ? 71.197 16.458  12.123  1.00 40.61 ? 151 ARG H CB  1 
ATOM   10517 C  CG  . ARG H 1 67  ? 72.448 15.706  12.677  1.00 42.32 ? 151 ARG H CG  1 
ATOM   10518 C  CD  . ARG H 1 67  ? 73.764 16.270  12.073  1.00 44.33 ? 151 ARG H CD  1 
ATOM   10519 N  NE  . ARG H 1 67  ? 74.446 15.436  11.019  1.00 54.45 ? 151 ARG H NE  1 
ATOM   10520 C  CZ  . ARG H 1 67  ? 74.509 15.709  9.683   1.00 56.75 ? 151 ARG H CZ  1 
ATOM   10521 N  NH1 . ARG H 1 67  ? 73.900 16.800  9.120   1.00 53.63 ? 151 ARG H NH1 1 
ATOM   10522 N  NH2 . ARG H 1 67  ? 75.212 14.874  8.891   1.00 54.38 ? 151 ARG H NH2 1 
ATOM   10523 N  N   . ARG H 1 68  ? 69.137 16.973  14.274  1.00 37.47 ? 152 ARG H N   1 
ATOM   10524 C  CA  . ARG H 1 68  ? 69.028 17.136  15.678  1.00 37.74 ? 152 ARG H CA  1 
ATOM   10525 C  C   . ARG H 1 68  ? 67.879 16.293  16.196  1.00 37.56 ? 152 ARG H C   1 
ATOM   10526 O  O   . ARG H 1 68  ? 68.006 15.660  17.248  1.00 37.37 ? 152 ARG H O   1 
ATOM   10527 C  CB  . ARG H 1 68  ? 68.927 18.614  16.011  1.00 37.76 ? 152 ARG H CB  1 
ATOM   10528 C  CG  . ARG H 1 68  ? 68.986 18.930  17.475  1.00 39.97 ? 152 ARG H CG  1 
ATOM   10529 C  CD  . ARG H 1 68  ? 70.321 18.544  18.138  1.00 41.90 ? 152 ARG H CD  1 
ATOM   10530 N  NE  . ARG H 1 68  ? 70.273 18.898  19.570  1.00 39.76 ? 152 ARG H NE  1 
ATOM   10531 C  CZ  . ARG H 1 68  ? 70.754 18.109  20.520  1.00 38.80 ? 152 ARG H CZ  1 
ATOM   10532 N  NH1 . ARG H 1 68  ? 71.313 16.985  20.148  1.00 35.92 ? 152 ARG H NH1 1 
ATOM   10533 N  NH2 . ARG H 1 68  ? 70.663 18.418  21.821  1.00 38.39 ? 152 ARG H NH2 1 
ATOM   10534 N  N   . MET H 1 69  ? 66.808 16.219  15.398  1.00 37.26 ? 153 MET H N   1 
ATOM   10535 C  CA  . MET H 1 69  ? 65.555 15.497  15.751  1.00 35.76 ? 153 MET H CA  1 
ATOM   10536 C  C   . MET H 1 69  ? 65.851 14.054  15.811  1.00 34.61 ? 153 MET H C   1 
ATOM   10537 O  O   . MET H 1 69  ? 65.458 13.388  16.755  1.00 35.18 ? 153 MET H O   1 
ATOM   10538 C  CB  . MET H 1 69  ? 64.405 15.750  14.726  1.00 36.04 ? 153 MET H CB  1 
ATOM   10539 C  CG  . MET H 1 69  ? 64.007 17.251  14.628  1.00 34.55 ? 153 MET H CG  1 
ATOM   10540 S  SD  . MET H 1 69  ? 63.236 17.834  16.141  1.00 40.05 ? 153 MET H SD  1 
ATOM   10541 C  CE  . MET H 1 69  ? 61.749 16.881  15.935  1.00 39.35 ? 153 MET H CE  1 
ATOM   10542 N  N   . GLY H 1 70  ? 66.542 13.568  14.792  1.00 33.54 ? 154 GLY H N   1 
ATOM   10543 C  CA  . GLY H 1 70  ? 67.046 12.199  14.781  1.00 33.50 ? 154 GLY H CA  1 
ATOM   10544 C  C   . GLY H 1 70  ? 67.811 11.828  16.042  1.00 33.43 ? 154 GLY H C   1 
ATOM   10545 O  O   . GLY H 1 70  ? 67.812 10.698  16.459  1.00 33.58 ? 154 GLY H O   1 
ATOM   10546 N  N   . GLU H 1 71  ? 68.450 12.787  16.682  1.00 34.54 ? 155 GLU H N   1 
ATOM   10547 C  CA  . GLU H 1 71  ? 69.195 12.447  17.893  1.00 35.26 ? 155 GLU H CA  1 
ATOM   10548 C  C   . GLU H 1 71  ? 68.280 12.464  19.078  1.00 34.34 ? 155 GLU H C   1 
ATOM   10549 O  O   . GLU H 1 71  ? 68.630 11.947  20.130  1.00 35.42 ? 155 GLU H O   1 
ATOM   10550 C  CB  . GLU H 1 71  ? 70.324 13.420  18.189  1.00 34.12 ? 155 GLU H CB  1 
ATOM   10551 C  CG  . GLU H 1 71  ? 71.414 13.512  17.152  1.00 37.99 ? 155 GLU H CG  1 
ATOM   10552 C  CD  . GLU H 1 71  ? 72.228 14.813  17.397  1.00 45.34 ? 155 GLU H CD  1 
ATOM   10553 O  OE1 . GLU H 1 71  ? 71.747 15.728  18.099  1.00 49.64 ? 155 GLU H OE1 1 
ATOM   10554 O  OE2 . GLU H 1 71  ? 73.348 14.928  16.927  1.00 47.02 ? 155 GLU H OE2 1 
ATOM   10555 N  N   . LEU H 1 72  ? 67.138 13.109  18.960  1.00 32.54 ? 156 LEU H N   1 
ATOM   10556 C  CA  . LEU H 1 72  ? 66.404 13.307  20.169  1.00 31.91 ? 156 LEU H CA  1 
ATOM   10557 C  C   . LEU H 1 72  ? 65.077 12.581  20.189  1.00 30.43 ? 156 LEU H C   1 
ATOM   10558 O  O   . LEU H 1 72  ? 64.559 12.371  21.246  1.00 30.30 ? 156 LEU H O   1 
ATOM   10559 C  CB  . LEU H 1 72  ? 66.206 14.788  20.464  1.00 32.97 ? 156 LEU H CB  1 
ATOM   10560 C  CG  . LEU H 1 72  ? 67.410 15.672  20.716  1.00 35.67 ? 156 LEU H CG  1 
ATOM   10561 C  CD1 . LEU H 1 72  ? 66.965 17.050  20.528  1.00 40.16 ? 156 LEU H CD1 1 
ATOM   10562 C  CD2 . LEU H 1 72  ? 67.958 15.526  22.140  1.00 40.56 ? 156 LEU H CD2 1 
ATOM   10563 N  N   . PHE H 1 73  ? 64.547 12.196  19.041  1.00 29.15 ? 157 PHE H N   1 
ATOM   10564 C  CA  . PHE H 1 73  ? 63.166 11.716  18.962  1.00 29.05 ? 157 PHE H CA  1 
ATOM   10565 C  C   . PHE H 1 73  ? 63.111 10.461  18.129  1.00 29.38 ? 157 PHE H C   1 
ATOM   10566 O  O   . PHE H 1 73  ? 64.026 10.171  17.383  1.00 30.62 ? 157 PHE H O   1 
ATOM   10567 C  CB  . PHE H 1 73  ? 62.226 12.802  18.357  1.00 28.43 ? 157 PHE H CB  1 
ATOM   10568 C  CG  . PHE H 1 73  ? 62.037 14.028  19.258  1.00 27.29 ? 157 PHE H CG  1 
ATOM   10569 C  CD1 . PHE H 1 73  ? 62.892 15.129  19.175  1.00 27.10 ? 157 PHE H CD1 1 
ATOM   10570 C  CD2 . PHE H 1 73  ? 61.037 14.064  20.191  1.00 24.09 ? 157 PHE H CD2 1 
ATOM   10571 C  CE1 . PHE H 1 73  ? 62.730 16.249  19.996  1.00 27.17 ? 157 PHE H CE1 1 
ATOM   10572 C  CE2 . PHE H 1 73  ? 60.863 15.173  21.013  1.00 25.29 ? 157 PHE H CE2 1 
ATOM   10573 C  CZ  . PHE H 1 73  ? 61.701 16.272  20.919  1.00 26.88 ? 157 PHE H CZ  1 
ATOM   10574 N  N   . GLU H 1 74  ? 62.061 9.680   18.266  1.00 29.36 ? 158 GLU H N   1 
ATOM   10575 C  CA  . GLU H 1 74  ? 61.716 8.791   17.192  1.00 28.55 ? 158 GLU H CA  1 
ATOM   10576 C  C   . GLU H 1 74  ? 60.921 9.610   16.096  1.00 28.22 ? 158 GLU H C   1 
ATOM   10577 O  O   . GLU H 1 74  ? 59.848 10.124  16.351  1.00 27.61 ? 158 GLU H O   1 
ATOM   10578 C  CB  . GLU H 1 74  ? 60.905 7.667   17.762  1.00 27.16 ? 158 GLU H CB  1 
ATOM   10579 C  CG  . GLU H 1 74  ? 60.594 6.710   16.684  1.00 29.75 ? 158 GLU H CG  1 
ATOM   10580 C  CD  . GLU H 1 74  ? 59.509 5.696   17.019  1.00 34.55 ? 158 GLU H CD  1 
ATOM   10581 O  OE1 . GLU H 1 74  ? 58.764 5.817   18.054  1.00 36.53 ? 158 GLU H OE1 1 
ATOM   10582 O  OE2 . GLU H 1 74  ? 59.412 4.759   16.188  1.00 38.70 ? 158 GLU H OE2 1 
ATOM   10583 N  N   . CYS H 1 75  ? 61.503 9.746   14.917  1.00 28.62 ? 159 CYS H N   1 
ATOM   10584 C  CA  . CYS H 1 75  ? 61.057 10.620  13.804  1.00 29.89 ? 159 CYS H CA  1 
ATOM   10585 C  C   . CYS H 1 75  ? 60.383 9.788   12.755  1.00 29.33 ? 159 CYS H C   1 
ATOM   10586 O  O   . CYS H 1 75  ? 60.985 8.794   12.293  1.00 29.43 ? 159 CYS H O   1 
ATOM   10587 C  CB  . CYS H 1 75  ? 62.270 11.302  13.109  1.00 29.58 ? 159 CYS H CB  1 
ATOM   10588 S  SG  . CYS H 1 75  ? 63.056 12.518  14.193  1.00 38.10 ? 159 CYS H SG  1 
ATOM   10589 N  N   . VAL H 1 76  ? 59.158 10.200  12.379  1.00 28.32 ? 160 VAL H N   1 
ATOM   10590 C  CA  . VAL H 1 76  ? 58.286 9.460   11.439  1.00 26.68 ? 160 VAL H CA  1 
ATOM   10591 C  C   . VAL H 1 76  ? 57.733 10.405  10.365  1.00 26.16 ? 160 VAL H C   1 
ATOM   10592 O  O   . VAL H 1 76  ? 57.096 11.400  10.671  1.00 24.93 ? 160 VAL H O   1 
ATOM   10593 C  CB  . VAL H 1 76  ? 57.107 8.868   12.233  1.00 27.21 ? 160 VAL H CB  1 
ATOM   10594 C  CG1 . VAL H 1 76  ? 56.049 8.167   11.321  1.00 26.27 ? 160 VAL H CG1 1 
ATOM   10595 C  CG2 . VAL H 1 76  ? 57.584 7.924   13.285  1.00 26.11 ? 160 VAL H CG2 1 
ATOM   10596 N  N   . LEU H 1 77  ? 57.975 10.127  9.101   1.00 25.84 ? 161 LEU H N   1 
ATOM   10597 C  CA  . LEU H 1 77  ? 57.380 10.948  8.071   1.00 25.23 ? 161 LEU H CA  1 
ATOM   10598 C  C   . LEU H 1 77  ? 55.899 10.606  7.997   1.00 26.52 ? 161 LEU H C   1 
ATOM   10599 O  O   . LEU H 1 77  ? 55.547 9.449   7.894   1.00 27.18 ? 161 LEU H O   1 
ATOM   10600 C  CB  . LEU H 1 77  ? 57.996 10.613  6.748   1.00 25.78 ? 161 LEU H CB  1 
ATOM   10601 C  CG  . LEU H 1 77  ? 57.466 11.475  5.589   1.00 27.64 ? 161 LEU H CG  1 
ATOM   10602 C  CD1 . LEU H 1 77  ? 58.095 12.876  5.603   1.00 24.70 ? 161 LEU H CD1 1 
ATOM   10603 C  CD2 . LEU H 1 77  ? 57.833 10.774  4.332   1.00 23.64 ? 161 LEU H CD2 1 
ATOM   10604 N  N   . PHE H 1 78  ? 55.008 11.580  8.080   1.00 26.83 ? 162 PHE H N   1 
ATOM   10605 C  CA  . PHE H 1 78  ? 53.632 11.256  7.939   1.00 25.65 ? 162 PHE H CA  1 
ATOM   10606 C  C   . PHE H 1 78  ? 53.086 12.260  6.967   1.00 25.72 ? 162 PHE H C   1 
ATOM   10607 O  O   . PHE H 1 78  ? 52.774 13.423  7.316   1.00 22.92 ? 162 PHE H O   1 
ATOM   10608 C  CB  . PHE H 1 78  ? 52.924 11.347  9.299   1.00 26.64 ? 162 PHE H CB  1 
ATOM   10609 C  CG  . PHE H 1 78  ? 51.567 10.627  9.364   1.00 24.66 ? 162 PHE H CG  1 
ATOM   10610 C  CD1 . PHE H 1 78  ? 50.991 10.313  10.608  1.00 24.53 ? 162 PHE H CD1 1 
ATOM   10611 C  CD2 . PHE H 1 78  ? 50.873 10.282  8.205   1.00 25.57 ? 162 PHE H CD2 1 
ATOM   10612 C  CE1 . PHE H 1 78  ? 49.734 9.623   10.668  1.00 26.97 ? 162 PHE H CE1 1 
ATOM   10613 C  CE2 . PHE H 1 78  ? 49.602 9.580   8.241   1.00 26.86 ? 162 PHE H CE2 1 
ATOM   10614 C  CZ  . PHE H 1 78  ? 49.056 9.242   9.466   1.00 24.91 ? 162 PHE H CZ  1 
ATOM   10615 N  N   . THR H 1 79  ? 52.919 11.817  5.736   1.00 26.11 ? 163 THR H N   1 
ATOM   10616 C  CA  . THR H 1 79  ? 52.518 12.785  4.726   1.00 28.78 ? 163 THR H CA  1 
ATOM   10617 C  C   . THR H 1 79  ? 51.138 12.474  4.075   1.00 29.40 ? 163 THR H C   1 
ATOM   10618 O  O   . THR H 1 79  ? 50.770 11.308  4.028   1.00 30.65 ? 163 THR H O   1 
ATOM   10619 C  CB  . THR H 1 79  ? 53.639 12.867  3.669   1.00 28.25 ? 163 THR H CB  1 
ATOM   10620 O  OG1 . THR H 1 79  ? 53.244 13.713  2.591   1.00 33.81 ? 163 THR H OG1 1 
ATOM   10621 C  CG2 . THR H 1 79  ? 53.906 11.535  3.067   1.00 26.37 ? 163 THR H CG2 1 
ATOM   10622 N  N   . ALA H 1 80  ? 50.432 13.473  3.503   1.00 30.16 ? 164 ALA H N   1 
ATOM   10623 C  CA  . ALA H 1 80  ? 49.156 13.193  2.783   1.00 31.01 ? 164 ALA H CA  1 
ATOM   10624 C  C   . ALA H 1 80  ? 49.349 12.832  1.344   1.00 33.07 ? 164 ALA H C   1 
ATOM   10625 O  O   . ALA H 1 80  ? 48.358 12.564  0.613   1.00 34.00 ? 164 ALA H O   1 
ATOM   10626 C  CB  . ALA H 1 80  ? 48.157 14.322  2.893   1.00 30.38 ? 164 ALA H CB  1 
ATOM   10627 N  N   . SER H 1 81  ? 50.619 12.780  0.936   1.00 33.55 ? 165 SER H N   1 
ATOM   10628 C  CA  . SER H 1 81  ? 50.959 12.559  -0.443  1.00 33.64 ? 165 SER H CA  1 
ATOM   10629 C  C   . SER H 1 81  ? 51.218 11.117  -0.686  1.00 33.81 ? 165 SER H C   1 
ATOM   10630 O  O   . SER H 1 81  ? 51.225 10.346  0.240   1.00 34.11 ? 165 SER H O   1 
ATOM   10631 C  CB  . SER H 1 81  ? 52.135 13.446  -0.852  1.00 33.80 ? 165 SER H CB  1 
ATOM   10632 O  OG  . SER H 1 81  ? 53.296 13.176  -0.114  1.00 40.77 ? 165 SER H OG  1 
ATOM   10633 N  N   . LEU H 1 82  ? 51.408 10.734  -1.938  1.00 35.01 ? 166 LEU H N   1 
ATOM   10634 C  CA  . LEU H 1 82  ? 51.608 9.372   -2.282  1.00 36.40 ? 166 LEU H CA  1 
ATOM   10635 C  C   . LEU H 1 82  ? 53.079 8.988   -2.316  1.00 37.37 ? 166 LEU H C   1 
ATOM   10636 O  O   . LEU H 1 82  ? 53.949 9.801   -2.608  1.00 38.36 ? 166 LEU H O   1 
ATOM   10637 C  CB  . LEU H 1 82  ? 51.015 9.178   -3.643  1.00 38.03 ? 166 LEU H CB  1 
ATOM   10638 C  CG  . LEU H 1 82  ? 49.481 9.306   -3.708  1.00 39.52 ? 166 LEU H CG  1 
ATOM   10639 C  CD1 . LEU H 1 82  ? 49.035 9.361   -5.207  1.00 42.59 ? 166 LEU H CD1 1 
ATOM   10640 C  CD2 . LEU H 1 82  ? 48.781 8.158   -3.000  1.00 37.27 ? 166 LEU H CD2 1 
ATOM   10641 N  N   . ALA H 1 83  ? 53.373 7.742   -2.010  1.00 38.93 ? 167 ALA H N   1 
ATOM   10642 C  CA  . ALA H 1 83  ? 54.763 7.270   -1.879  1.00 39.94 ? 167 ALA H CA  1 
ATOM   10643 C  C   . ALA H 1 83  ? 55.573 7.576   -3.120  1.00 41.22 ? 167 ALA H C   1 
ATOM   10644 O  O   . ALA H 1 83  ? 56.747 7.924   -3.007  1.00 42.18 ? 167 ALA H O   1 
ATOM   10645 C  CB  . ALA H 1 83  ? 54.788 5.796   -1.609  1.00 39.56 ? 167 ALA H CB  1 
ATOM   10646 N  N   . LYS H 1 84  ? 54.922 7.463   -4.286  1.00 41.81 ? 168 LYS H N   1 
ATOM   10647 C  CA  . LYS H 1 84  ? 55.517 7.707   -5.593  1.00 42.40 ? 168 LYS H CA  1 
ATOM   10648 C  C   . LYS H 1 84  ? 56.159 9.064   -5.633  1.00 41.55 ? 168 LYS H C   1 
ATOM   10649 O  O   . LYS H 1 84  ? 57.196 9.202   -6.243  1.00 43.07 ? 168 LYS H O   1 
ATOM   10650 C  CB  . LYS H 1 84  ? 54.530 7.529   -6.766  1.00 42.41 ? 168 LYS H CB  1 
ATOM   10651 C  CG  . LYS H 1 84  ? 53.690 8.797   -7.120  1.00 44.65 ? 168 LYS H CG  1 
ATOM   10652 C  CD  . LYS H 1 84  ? 52.764 8.585   -8.350  1.00 45.16 ? 168 LYS H CD  1 
ATOM   10653 C  CE  . LYS H 1 84  ? 51.801 9.812   -8.600  1.00 49.01 ? 168 LYS H CE  1 
ATOM   10654 N  NZ  . LYS H 1 84  ? 50.893 9.721   -9.845  1.00 46.82 ? 168 LYS H NZ  1 
ATOM   10655 N  N   . TYR H 1 85  ? 55.573 10.051  -4.983  1.00 40.48 ? 169 TYR H N   1 
ATOM   10656 C  CA  . TYR H 1 85  ? 56.189 11.356  -4.948  1.00 40.15 ? 169 TYR H CA  1 
ATOM   10657 C  C   . TYR H 1 85  ? 57.093 11.465  -3.735  1.00 40.52 ? 169 TYR H C   1 
ATOM   10658 O  O   . TYR H 1 85  ? 58.127 12.077  -3.832  1.00 40.83 ? 169 TYR H O   1 
ATOM   10659 C  CB  . TYR H 1 85  ? 55.150 12.462  -4.841  1.00 40.22 ? 169 TYR H CB  1 
ATOM   10660 C  CG  . TYR H 1 85  ? 55.670 13.754  -4.203  1.00 39.90 ? 169 TYR H CG  1 
ATOM   10661 C  CD1 . TYR H 1 85  ? 56.440 14.649  -4.924  1.00 41.35 ? 169 TYR H CD1 1 
ATOM   10662 C  CD2 . TYR H 1 85  ? 55.353 14.088  -2.886  1.00 42.24 ? 169 TYR H CD2 1 
ATOM   10663 C  CE1 . TYR H 1 85  ? 56.895 15.844  -4.349  1.00 42.56 ? 169 TYR H CE1 1 
ATOM   10664 C  CE2 . TYR H 1 85  ? 55.796 15.267  -2.286  1.00 43.38 ? 169 TYR H CE2 1 
ATOM   10665 C  CZ  . TYR H 1 85  ? 56.586 16.138  -3.041  1.00 44.40 ? 169 TYR H CZ  1 
ATOM   10666 O  OH  . TYR H 1 85  ? 57.060 17.306  -2.498  1.00 45.96 ? 169 TYR H OH  1 
ATOM   10667 N  N   . ALA H 1 86  ? 56.701 10.878  -2.596  1.00 39.38 ? 170 ALA H N   1 
ATOM   10668 C  CA  . ALA H 1 86  ? 57.290 11.275  -1.344  1.00 38.52 ? 170 ALA H CA  1 
ATOM   10669 C  C   . ALA H 1 86  ? 58.534 10.469  -0.996  1.00 38.82 ? 170 ALA H C   1 
ATOM   10670 O  O   . ALA H 1 86  ? 59.376 10.965  -0.255  1.00 39.54 ? 170 ALA H O   1 
ATOM   10671 C  CB  . ALA H 1 86  ? 56.285 11.227  -0.232  1.00 37.45 ? 170 ALA H CB  1 
ATOM   10672 N  N   . ASP H 1 87  ? 58.640 9.247   -1.516  1.00 38.50 ? 171 ASP H N   1 
ATOM   10673 C  CA  . ASP H 1 87  ? 59.805 8.376   -1.328  1.00 38.86 ? 171 ASP H CA  1 
ATOM   10674 C  C   . ASP H 1 87  ? 61.021 8.927   -2.076  1.00 38.72 ? 171 ASP H C   1 
ATOM   10675 O  O   . ASP H 1 87  ? 62.085 9.133   -1.476  1.00 38.58 ? 171 ASP H O   1 
ATOM   10676 C  CB  . ASP H 1 87  ? 59.521 6.996   -1.900  1.00 39.26 ? 171 ASP H CB  1 
ATOM   10677 C  CG  . ASP H 1 87  ? 58.804 6.094   -0.938  1.00 41.48 ? 171 ASP H CG  1 
ATOM   10678 O  OD1 . ASP H 1 87  ? 58.972 6.300   0.296   1.00 40.22 ? 171 ASP H OD1 1 
ATOM   10679 O  OD2 . ASP H 1 87  ? 58.125 5.132   -1.442  1.00 43.96 ? 171 ASP H OD2 1 
ATOM   10680 N  N   . PRO H 1 88  ? 60.844 9.215   -3.379  1.00 38.04 ? 172 PRO H N   1 
ATOM   10681 C  CA  . PRO H 1 88  ? 61.981 9.814   -4.047  1.00 37.53 ? 172 PRO H CA  1 
ATOM   10682 C  C   . PRO H 1 88  ? 62.374 11.141  -3.413  1.00 37.43 ? 172 PRO H C   1 
ATOM   10683 O  O   . PRO H 1 88  ? 63.575 11.401  -3.280  1.00 39.83 ? 172 PRO H O   1 
ATOM   10684 C  CB  . PRO H 1 88  ? 61.538 9.971   -5.522  1.00 38.55 ? 172 PRO H CB  1 
ATOM   10685 C  CG  . PRO H 1 88  ? 60.160 9.268   -5.669  1.00 37.45 ? 172 PRO H CG  1 
ATOM   10686 C  CD  . PRO H 1 88  ? 59.651 9.041   -4.252  1.00 37.58 ? 172 PRO H CD  1 
ATOM   10687 N  N   . VAL H 1 89  ? 61.434 11.947  -2.944  1.00 35.70 ? 173 VAL H N   1 
ATOM   10688 C  CA  . VAL H 1 89  ? 61.833 13.201  -2.363  1.00 33.44 ? 173 VAL H CA  1 
ATOM   10689 C  C   . VAL H 1 89  ? 62.524 13.043  -1.040  1.00 34.62 ? 173 VAL H C   1 
ATOM   10690 O  O   . VAL H 1 89  ? 63.495 13.750  -0.766  1.00 35.10 ? 173 VAL H O   1 
ATOM   10691 C  CB  . VAL H 1 89  ? 60.661 14.163  -2.235  1.00 34.06 ? 173 VAL H CB  1 
ATOM   10692 C  CG1 . VAL H 1 89  ? 61.001 15.465  -1.326  1.00 30.24 ? 173 VAL H CG1 1 
ATOM   10693 C  CG2 . VAL H 1 89  ? 60.171 14.563  -3.599  1.00 31.37 ? 173 VAL H CG2 1 
ATOM   10694 N  N   . THR H 1 90  ? 62.061 12.099  -0.214  1.00 34.84 ? 174 THR H N   1 
ATOM   10695 C  CA  . THR H 1 90  ? 62.594 11.902  1.159   1.00 33.65 ? 174 THR H CA  1 
ATOM   10696 C  C   . THR H 1 90  ? 63.993 11.242  1.138   1.00 33.52 ? 174 THR H C   1 
ATOM   10697 O  O   . THR H 1 90  ? 64.860 11.542  1.933   1.00 31.60 ? 174 THR H O   1 
ATOM   10698 C  CB  . THR H 1 90  ? 61.639 10.999  1.940   1.00 34.40 ? 174 THR H CB  1 
ATOM   10699 O  OG1 . THR H 1 90  ? 60.342 11.603  1.986   1.00 34.31 ? 174 THR H OG1 1 
ATOM   10700 C  CG2 . THR H 1 90  ? 62.146 10.682  3.390   1.00 34.05 ? 174 THR H CG2 1 
ATOM   10701 N  N   . ASP H 1 91  ? 64.158 10.304  0.219   1.00 34.53 ? 175 ASP H N   1 
ATOM   10702 C  CA  . ASP H 1 91  ? 65.405 9.649   -0.009  1.00 35.91 ? 175 ASP H CA  1 
ATOM   10703 C  C   . ASP H 1 91  ? 66.469 10.692  -0.107  1.00 37.08 ? 175 ASP H C   1 
ATOM   10704 O  O   . ASP H 1 91  ? 67.395 10.625  0.640   1.00 38.55 ? 175 ASP H O   1 
ATOM   10705 C  CB  . ASP H 1 91  ? 65.336 8.820   -1.280  1.00 35.54 ? 175 ASP H CB  1 
ATOM   10706 C  CG  . ASP H 1 91  ? 64.520 7.538   -1.086  1.00 39.90 ? 175 ASP H CG  1 
ATOM   10707 O  OD1 . ASP H 1 91  ? 64.206 7.190   0.090   1.00 41.19 ? 175 ASP H OD1 1 
ATOM   10708 O  OD2 . ASP H 1 91  ? 64.166 6.862   -2.106  1.00 48.86 ? 175 ASP H OD2 1 
ATOM   10709 N  N   . LEU H 1 92  ? 66.285 11.718  -0.950  1.00 38.90 ? 176 LEU H N   1 
ATOM   10710 C  CA  . LEU H 1 92  ? 67.284 12.773  -1.160  1.00 38.57 ? 176 LEU H CA  1 
ATOM   10711 C  C   . LEU H 1 92  ? 67.371 13.713  -0.025  1.00 38.67 ? 176 LEU H C   1 
ATOM   10712 O  O   . LEU H 1 92  ? 68.433 14.196  0.250   1.00 41.53 ? 176 LEU H O   1 
ATOM   10713 C  CB  . LEU H 1 92  ? 67.038 13.562  -2.442  1.00 38.83 ? 176 LEU H CB  1 
ATOM   10714 C  CG  . LEU H 1 92  ? 67.207 12.629  -3.647  1.00 40.32 ? 176 LEU H CG  1 
ATOM   10715 C  CD1 . LEU H 1 92  ? 66.550 13.144  -4.909  1.00 40.62 ? 176 LEU H CD1 1 
ATOM   10716 C  CD2 . LEU H 1 92  ? 68.674 12.329  -3.893  1.00 40.97 ? 176 LEU H CD2 1 
ATOM   10717 N  N   . LEU H 1 93  ? 66.288 13.987  0.666   1.00 38.23 ? 177 LEU H N   1 
ATOM   10718 C  CA  . LEU H 1 93  ? 66.335 15.001  1.738   1.00 37.05 ? 177 LEU H CA  1 
ATOM   10719 C  C   . LEU H 1 93  ? 66.812 14.508  3.099   1.00 39.08 ? 177 LEU H C   1 
ATOM   10720 O  O   . LEU H 1 93  ? 67.270 15.286  3.898   1.00 40.28 ? 177 LEU H O   1 
ATOM   10721 C  CB  . LEU H 1 93  ? 64.975 15.680  1.886   1.00 36.14 ? 177 LEU H CB  1 
ATOM   10722 C  CG  . LEU H 1 93  ? 64.659 16.335  3.215   1.00 36.32 ? 177 LEU H CG  1 
ATOM   10723 C  CD1 . LEU H 1 93  ? 65.279 17.715  3.142   1.00 32.79 ? 177 LEU H CD1 1 
ATOM   10724 C  CD2 . LEU H 1 93  ? 63.125 16.408  3.618   1.00 31.60 ? 177 LEU H CD2 1 
ATOM   10725 N  N   . ASP H 1 94  ? 66.668 13.215  3.369   1.00 41.44 ? 178 ASP H N   1 
ATOM   10726 C  CA  . ASP H 1 94  ? 66.854 12.637  4.699   1.00 42.02 ? 178 ASP H CA  1 
ATOM   10727 C  C   . ASP H 1 94  ? 68.245 12.034  4.622   1.00 42.57 ? 178 ASP H C   1 
ATOM   10728 O  O   . ASP H 1 94  ? 68.417 10.859  4.353   1.00 44.22 ? 178 ASP H O   1 
ATOM   10729 C  CB  . ASP H 1 94  ? 65.791 11.542  4.952   1.00 41.29 ? 178 ASP H CB  1 
ATOM   10730 C  CG  . ASP H 1 94  ? 65.936 10.881  6.353   1.00 42.65 ? 178 ASP H CG  1 
ATOM   10731 O  OD1 . ASP H 1 94  ? 66.497 11.551  7.248   1.00 42.67 ? 178 ASP H OD1 1 
ATOM   10732 O  OD2 . ASP H 1 94  ? 65.481 9.713   6.571   1.00 40.25 ? 178 ASP H OD2 1 
ATOM   10733 N  N   . ARG H 1 95  ? 69.252 12.855  4.793   1.00 42.74 ? 179 ARG H N   1 
ATOM   10734 C  CA  . ARG H 1 95  ? 70.597 12.405  4.529   1.00 43.81 ? 179 ARG H CA  1 
ATOM   10735 C  C   . ARG H 1 95  ? 71.206 11.679  5.742   1.00 41.75 ? 179 ARG H C   1 
ATOM   10736 O  O   . ARG H 1 95  ? 72.012 10.800  5.545   1.00 41.26 ? 179 ARG H O   1 
ATOM   10737 C  CB  . ARG H 1 95  ? 71.466 13.531  3.931   1.00 42.54 ? 179 ARG H CB  1 
ATOM   10738 C  CG  . ARG H 1 95  ? 71.373 14.846  4.688   1.00 47.65 ? 179 ARG H CG  1 
ATOM   10739 C  CD  . ARG H 1 95  ? 71.883 16.079  3.853   1.00 49.94 ? 179 ARG H CD  1 
ATOM   10740 N  NE  . ARG H 1 95  ? 73.154 16.603  4.390   1.00 63.09 ? 179 ARG H NE  1 
ATOM   10741 C  CZ  . ARG H 1 95  ? 73.697 17.799  4.116   1.00 66.29 ? 179 ARG H CZ  1 
ATOM   10742 N  NH1 . ARG H 1 95  ? 73.102 18.671  3.272   1.00 65.71 ? 179 ARG H NH1 1 
ATOM   10743 N  NH2 . ARG H 1 95  ? 74.858 18.117  4.703   1.00 64.41 ? 179 ARG H NH2 1 
ATOM   10744 N  N   . CYS H 1 96  ? 70.756 11.993  6.962   1.00 41.07 ? 180 CYS H N   1 
ATOM   10745 C  CA  . CYS H 1 96  ? 71.037 11.166  8.180   1.00 40.52 ? 180 CYS H CA  1 
ATOM   10746 C  C   . CYS H 1 96  ? 70.237 9.865   8.394   1.00 38.04 ? 180 CYS H C   1 
ATOM   10747 O  O   . CYS H 1 96  ? 70.527 9.147   9.356   1.00 37.17 ? 180 CYS H O   1 
ATOM   10748 C  CB  . CYS H 1 96  ? 70.914 11.996  9.448   1.00 40.12 ? 180 CYS H CB  1 
ATOM   10749 S  SG  . CYS H 1 96  ? 72.096 13.385  9.529   1.00 50.25 ? 180 CYS H SG  1 
ATOM   10750 N  N   . GLY H 1 97  ? 69.234 9.584   7.539   1.00 36.70 ? 181 GLY H N   1 
ATOM   10751 C  CA  . GLY H 1 97  ? 68.302 8.438   7.697   1.00 34.00 ? 181 GLY H CA  1 
ATOM   10752 C  C   . GLY H 1 97  ? 67.513 8.515   8.991   1.00 33.04 ? 181 GLY H C   1 
ATOM   10753 O  O   . GLY H 1 97  ? 67.302 7.556   9.685   1.00 34.14 ? 181 GLY H O   1 
ATOM   10754 N  N   . VAL H 1 98  ? 67.065 9.685   9.335   1.00 32.53 ? 182 VAL H N   1 
ATOM   10755 C  CA  . VAL H 1 98  ? 66.261 9.868   10.533  1.00 32.05 ? 182 VAL H CA  1 
ATOM   10756 C  C   . VAL H 1 98  ? 64.843 9.222   10.515  1.00 31.36 ? 182 VAL H C   1 
ATOM   10757 O  O   . VAL H 1 98  ? 64.295 8.877   11.566  1.00 31.51 ? 182 VAL H O   1 
ATOM   10758 C  CB  . VAL H 1 98  ? 66.165 11.345  10.737  1.00 31.87 ? 182 VAL H CB  1 
ATOM   10759 C  CG1 . VAL H 1 98  ? 65.396 11.630  11.932  1.00 34.62 ? 182 VAL H CG1 1 
ATOM   10760 C  CG2 . VAL H 1 98  ? 67.534 11.864  10.967  1.00 34.29 ? 182 VAL H CG2 1 
ATOM   10761 N  N   . PHE H 1 99  ? 64.226 9.109   9.346   1.00 30.61 ? 183 PHE H N   1 
ATOM   10762 C  CA  . PHE H 1 99  ? 62.858 8.572   9.257   1.00 30.39 ? 183 PHE H CA  1 
ATOM   10763 C  C   . PHE H 1 99  ? 62.977 7.107   9.121   1.00 30.97 ? 183 PHE H C   1 
ATOM   10764 O  O   . PHE H 1 99  ? 63.240 6.644   8.041   1.00 31.39 ? 183 PHE H O   1 
ATOM   10765 C  CB  . PHE H 1 99  ? 62.102 9.129   8.007   1.00 28.89 ? 183 PHE H CB  1 
ATOM   10766 C  CG  . PHE H 1 99  ? 61.881 10.599  8.055   1.00 26.63 ? 183 PHE H CG  1 
ATOM   10767 C  CD1 . PHE H 1 99  ? 62.383 11.429  7.069   1.00 26.41 ? 183 PHE H CD1 1 
ATOM   10768 C  CD2 . PHE H 1 99  ? 61.219 11.176  9.127   1.00 26.24 ? 183 PHE H CD2 1 
ATOM   10769 C  CE1 . PHE H 1 99  ? 62.209 12.827  7.143   1.00 25.52 ? 183 PHE H CE1 1 
ATOM   10770 C  CE2 . PHE H 1 99  ? 61.035 12.587  9.187   1.00 27.03 ? 183 PHE H CE2 1 
ATOM   10771 C  CZ  . PHE H 1 99  ? 61.542 13.395  8.205   1.00 23.88 ? 183 PHE H CZ  1 
ATOM   10772 N  N   . ARG H 1 100 ? 62.844 6.348   10.198  1.00 33.68 ? 184 ARG H N   1 
ATOM   10773 C  CA  . ARG H 1 100 ? 62.849 4.905   10.016  1.00 36.35 ? 184 ARG H CA  1 
ATOM   10774 C  C   . ARG H 1 100 ? 61.453 4.451   9.565   1.00 34.62 ? 184 ARG H C   1 
ATOM   10775 O  O   . ARG H 1 100 ? 61.328 3.467   8.884   1.00 36.33 ? 184 ARG H O   1 
ATOM   10776 C  CB  . ARG H 1 100 ? 63.323 4.076   11.227  1.00 35.96 ? 184 ARG H CB  1 
ATOM   10777 C  CG  . ARG H 1 100 ? 62.977 2.548   10.907  1.00 42.58 ? 184 ARG H CG  1 
ATOM   10778 C  CD  . ARG H 1 100 ? 63.288 1.441   11.873  1.00 42.33 ? 184 ARG H CD  1 
ATOM   10779 N  NE  . ARG H 1 100 ? 62.095 0.731   12.378  1.00 50.04 ? 184 ARG H NE  1 
ATOM   10780 C  CZ  . ARG H 1 100 ? 61.774 -0.539  12.112  1.00 50.51 ? 184 ARG H CZ  1 
ATOM   10781 N  NH1 . ARG H 1 100 ? 60.699 -1.069  12.679  1.00 54.43 ? 184 ARG H NH1 1 
ATOM   10782 N  NH2 . ARG H 1 100 ? 62.506 -1.286  11.287  1.00 52.93 ? 184 ARG H NH2 1 
ATOM   10783 N  N   . ALA H 1 101 ? 60.409 5.146   9.950   1.00 33.60 ? 185 ALA H N   1 
ATOM   10784 C  CA  . ALA H 1 101 ? 59.085 4.804   9.460   1.00 32.07 ? 185 ALA H CA  1 
ATOM   10785 C  C   . ALA H 1 101 ? 58.671 5.934   8.546   1.00 31.27 ? 185 ALA H C   1 
ATOM   10786 O  O   . ALA H 1 101 ? 58.977 7.097   8.816   1.00 30.86 ? 185 ALA H O   1 
ATOM   10787 C  CB  . ALA H 1 101 ? 58.122 4.659   10.619  1.00 30.32 ? 185 ALA H CB  1 
ATOM   10788 N  N   . ARG H 1 102 ? 57.966 5.573   7.476   1.00 30.52 ? 186 ARG H N   1 
ATOM   10789 C  CA  . ARG H 1 102 ? 57.283 6.486   6.530   1.00 28.73 ? 186 ARG H CA  1 
ATOM   10790 C  C   . ARG H 1 102 ? 55.798 6.030   6.365   1.00 28.48 ? 186 ARG H C   1 
ATOM   10791 O  O   . ARG H 1 102 ? 55.529 4.856   6.135   1.00 27.82 ? 186 ARG H O   1 
ATOM   10792 C  CB  . ARG H 1 102 ? 57.957 6.401   5.192   1.00 26.43 ? 186 ARG H CB  1 
ATOM   10793 C  CG  . ARG H 1 102 ? 59.403 6.873   5.148   1.00 30.03 ? 186 ARG H CG  1 
ATOM   10794 C  CD  . ARG H 1 102 ? 59.987 6.658   3.703   1.00 32.06 ? 186 ARG H CD  1 
ATOM   10795 N  NE  . ARG H 1 102 ? 61.407 7.019   3.622   1.00 40.89 ? 186 ARG H NE  1 
ATOM   10796 C  CZ  . ARG H 1 102 ? 62.101 7.190   2.488   1.00 42.44 ? 186 ARG H CZ  1 
ATOM   10797 N  NH1 . ARG H 1 102 ? 61.546 7.003   1.292   1.00 42.90 ? 186 ARG H NH1 1 
ATOM   10798 N  NH2 . ARG H 1 102 ? 63.377 7.543   2.549   1.00 41.37 ? 186 ARG H NH2 1 
ATOM   10799 N  N   . LEU H 1 103 ? 54.863 6.966   6.508   1.00 27.88 ? 187 LEU H N   1 
ATOM   10800 C  CA  . LEU H 1 103 ? 53.419 6.768   6.393   1.00 27.85 ? 187 LEU H CA  1 
ATOM   10801 C  C   . LEU H 1 103 ? 52.855 7.734   5.312   1.00 29.31 ? 187 LEU H C   1 
ATOM   10802 O  O   . LEU H 1 103 ? 53.298 8.878   5.189   1.00 31.70 ? 187 LEU H O   1 
ATOM   10803 C  CB  . LEU H 1 103 ? 52.782 7.077   7.727   1.00 25.91 ? 187 LEU H CB  1 
ATOM   10804 C  CG  . LEU H 1 103 ? 53.137 6.136   8.892   1.00 26.36 ? 187 LEU H CG  1 
ATOM   10805 C  CD1 . LEU H 1 103 ? 52.456 6.526   10.183  1.00 23.73 ? 187 LEU H CD1 1 
ATOM   10806 C  CD2 . LEU H 1 103 ? 52.798 4.650   8.585   1.00 25.77 ? 187 LEU H CD2 1 
ATOM   10807 N  N   . PHE H 1 104 ? 51.896 7.308   4.509   1.00 29.60 ? 188 PHE H N   1 
ATOM   10808 C  CA  . PHE H 1 104 ? 51.487 8.145   3.410   1.00 30.10 ? 188 PHE H CA  1 
ATOM   10809 C  C   . PHE H 1 104 ? 49.956 8.307   3.358   1.00 31.50 ? 188 PHE H C   1 
ATOM   10810 O  O   . PHE H 1 104 ? 49.252 8.088   4.331   1.00 30.50 ? 188 PHE H O   1 
ATOM   10811 C  CB  . PHE H 1 104 ? 51.988 7.528   2.145   1.00 29.83 ? 188 PHE H CB  1 
ATOM   10812 C  CG  . PHE H 1 104 ? 53.465 7.340   2.110   1.00 31.51 ? 188 PHE H CG  1 
ATOM   10813 C  CD1 . PHE H 1 104 ? 54.016 6.087   2.208   1.00 32.48 ? 188 PHE H CD1 1 
ATOM   10814 C  CD2 . PHE H 1 104 ? 54.317 8.439   1.970   1.00 35.31 ? 188 PHE H CD2 1 
ATOM   10815 C  CE1 . PHE H 1 104 ? 55.400 5.908   2.145   1.00 34.48 ? 188 PHE H CE1 1 
ATOM   10816 C  CE2 . PHE H 1 104 ? 55.700 8.285   1.923   1.00 35.21 ? 188 PHE H CE2 1 
ATOM   10817 C  CZ  . PHE H 1 104 ? 56.239 7.008   2.002   1.00 33.63 ? 188 PHE H CZ  1 
ATOM   10818 N  N   . ARG H 1 105 ? 49.451 8.678   2.196   1.00 32.37 ? 189 ARG H N   1 
ATOM   10819 C  CA  . ARG H 1 105 ? 48.081 9.060   2.060   1.00 32.81 ? 189 ARG H CA  1 
ATOM   10820 C  C   . ARG H 1 105 ? 47.165 7.959   2.620   1.00 32.07 ? 189 ARG H C   1 
ATOM   10821 O  O   . ARG H 1 105 ? 46.387 8.223   3.525   1.00 32.29 ? 189 ARG H O   1 
ATOM   10822 C  CB  . ARG H 1 105 ? 47.784 9.470   0.615   1.00 32.99 ? 189 ARG H CB  1 
ATOM   10823 C  CG  . ARG H 1 105 ? 46.299 9.588   0.296   1.00 36.68 ? 189 ARG H CG  1 
ATOM   10824 C  CD  . ARG H 1 105 ? 46.012 10.847  -0.457  1.00 42.37 ? 189 ARG H CD  1 
ATOM   10825 N  NE  . ARG H 1 105 ? 46.451 10.861  -1.851  1.00 46.94 ? 189 ARG H NE  1 
ATOM   10826 C  CZ  . ARG H 1 105 ? 46.821 11.986  -2.452  1.00 50.63 ? 189 ARG H CZ  1 
ATOM   10827 N  NH1 . ARG H 1 105 ? 46.820 13.113  -1.760  1.00 55.24 ? 189 ARG H NH1 1 
ATOM   10828 N  NH2 . ARG H 1 105 ? 47.210 12.007  -3.704  1.00 53.08 ? 189 ARG H NH2 1 
ATOM   10829 N  N   . GLU H 1 106 ? 47.322 6.736   2.161   1.00 31.39 ? 190 GLU H N   1 
ATOM   10830 C  CA  . GLU H 1 106 ? 46.599 5.609   2.709   1.00 32.42 ? 190 GLU H CA  1 
ATOM   10831 C  C   . GLU H 1 106 ? 46.486 5.485   4.256   1.00 31.74 ? 190 GLU H C   1 
ATOM   10832 O  O   . GLU H 1 106 ? 45.614 4.812   4.771   1.00 32.45 ? 190 GLU H O   1 
ATOM   10833 C  CB  . GLU H 1 106 ? 47.171 4.335   2.127   1.00 33.17 ? 190 GLU H CB  1 
ATOM   10834 C  CG  . GLU H 1 106 ? 47.195 4.296   0.558   1.00 41.32 ? 190 GLU H CG  1 
ATOM   10835 C  CD  . GLU H 1 106 ? 48.383 5.111   -0.079  1.00 49.15 ? 190 GLU H CD  1 
ATOM   10836 O  OE1 . GLU H 1 106 ? 48.357 5.426   -1.309  1.00 52.08 ? 190 GLU H OE1 1 
ATOM   10837 O  OE2 . GLU H 1 106 ? 49.343 5.438   0.662   1.00 50.25 ? 190 GLU H OE2 1 
ATOM   10838 N  N   . SER H 1 107 ? 47.364 6.125   4.992   1.00 31.69 ? 191 SER H N   1 
ATOM   10839 C  CA  . SER H 1 107 ? 47.374 6.067   6.411   1.00 30.62 ? 191 SER H CA  1 
ATOM   10840 C  C   . SER H 1 107 ? 46.701 7.281   6.930   1.00 31.35 ? 191 SER H C   1 
ATOM   10841 O  O   . SER H 1 107 ? 46.525 7.397   8.111   1.00 32.19 ? 191 SER H O   1 
ATOM   10842 C  CB  . SER H 1 107 ? 48.811 6.057   6.925   1.00 31.27 ? 191 SER H CB  1 
ATOM   10843 O  OG  . SER H 1 107 ? 49.532 4.931   6.407   1.00 32.90 ? 191 SER H OG  1 
ATOM   10844 N  N   . CYS H 1 108 ? 46.330 8.216   6.074   1.00 31.16 ? 192 CYS H N   1 
ATOM   10845 C  CA  . CYS H 1 108 ? 45.557 9.331   6.549   1.00 32.59 ? 192 CYS H CA  1 
ATOM   10846 C  C   . CYS H 1 108 ? 44.081 9.025   6.398   1.00 32.71 ? 192 CYS H C   1 
ATOM   10847 O  O   . CYS H 1 108 ? 43.686 8.103   5.670   1.00 33.20 ? 192 CYS H O   1 
ATOM   10848 C  CB  . CYS H 1 108 ? 45.822 10.569  5.721   1.00 33.41 ? 192 CYS H CB  1 
ATOM   10849 S  SG  . CYS H 1 108 ? 47.471 11.165  5.626   1.00 34.69 ? 192 CYS H SG  1 
ATOM   10850 N  N   . VAL H 1 109 ? 43.257 9.839   7.030   1.00 32.29 ? 193 VAL H N   1 
ATOM   10851 C  CA  . VAL H 1 109 ? 41.824 9.710   6.821   1.00 31.99 ? 193 VAL H CA  1 
ATOM   10852 C  C   . VAL H 1 109 ? 41.234 10.961  6.211   1.00 31.06 ? 193 VAL H C   1 
ATOM   10853 O  O   . VAL H 1 109 ? 41.383 12.054  6.701   1.00 32.35 ? 193 VAL H O   1 
ATOM   10854 C  CB  . VAL H 1 109 ? 41.077 9.232   8.109   1.00 32.68 ? 193 VAL H CB  1 
ATOM   10855 C  CG1 . VAL H 1 109 ? 41.706 9.784   9.318   1.00 34.36 ? 193 VAL H CG1 1 
ATOM   10856 C  CG2 . VAL H 1 109 ? 39.614 9.630   8.089   1.00 33.14 ? 193 VAL H CG2 1 
ATOM   10857 N  N   . PHE H 1 110 ? 40.588 10.786  5.093   1.00 30.76 ? 194 PHE H N   1 
ATOM   10858 C  CA  . PHE H 1 110 ? 39.827 11.827  4.453   1.00 30.56 ? 194 PHE H CA  1 
ATOM   10859 C  C   . PHE H 1 110 ? 38.649 12.262  5.304   1.00 30.70 ? 194 PHE H C   1 
ATOM   10860 O  O   . PHE H 1 110 ? 37.691 11.517  5.468   1.00 30.52 ? 194 PHE H O   1 
ATOM   10861 C  CB  . PHE H 1 110 ? 39.261 11.262  3.168   1.00 30.70 ? 194 PHE H CB  1 
ATOM   10862 C  CG  . PHE H 1 110 ? 38.868 12.278  2.204   1.00 32.34 ? 194 PHE H CG  1 
ATOM   10863 C  CD1 . PHE H 1 110 ? 39.768 13.195  1.752   1.00 37.31 ? 194 PHE H CD1 1 
ATOM   10864 C  CD2 . PHE H 1 110 ? 37.595 12.330  1.733   1.00 34.53 ? 194 PHE H CD2 1 
ATOM   10865 C  CE1 . PHE H 1 110 ? 39.400 14.159  0.803   1.00 38.55 ? 194 PHE H CE1 1 
ATOM   10866 C  CE2 . PHE H 1 110 ? 37.242 13.248  0.795   1.00 36.19 ? 194 PHE H CE2 1 
ATOM   10867 C  CZ  . PHE H 1 110 ? 38.148 14.166  0.327   1.00 34.71 ? 194 PHE H CZ  1 
ATOM   10868 N  N   . HIS H 1 111 ? 38.684 13.519  5.720   1.00 30.96 ? 195 HIS H N   1 
ATOM   10869 C  CA  . HIS H 1 111 ? 37.748 14.066  6.619   1.00 31.66 ? 195 HIS H CA  1 
ATOM   10870 C  C   . HIS H 1 111 ? 37.330 15.473  6.168   1.00 31.97 ? 195 HIS H C   1 
ATOM   10871 O  O   . HIS H 1 111 ? 38.085 16.416  6.325   1.00 32.43 ? 195 HIS H O   1 
ATOM   10872 C  CB  . HIS H 1 111 ? 38.416 14.133  8.023   1.00 31.89 ? 195 HIS H CB  1 
ATOM   10873 C  CG  . HIS H 1 111 ? 37.573 14.832  9.049   1.00 33.62 ? 195 HIS H CG  1 
ATOM   10874 N  ND1 . HIS H 1 111 ? 37.789 16.142  9.424   1.00 34.76 ? 195 HIS H ND1 1 
ATOM   10875 C  CD2 . HIS H 1 111 ? 36.444 14.430  9.701   1.00 36.37 ? 195 HIS H CD2 1 
ATOM   10876 C  CE1 . HIS H 1 111 ? 36.865 16.501  10.309  1.00 36.02 ? 195 HIS H CE1 1 
ATOM   10877 N  NE2 . HIS H 1 111 ? 36.032 15.483  10.484  1.00 36.87 ? 195 HIS H NE2 1 
ATOM   10878 N  N   . GLN H 1 112 ? 36.123 15.656  5.641   1.00 32.31 ? 196 GLN H N   1 
ATOM   10879 C  CA  . GLN H 1 112 ? 35.649 17.019  5.421   1.00 33.10 ? 196 GLN H CA  1 
ATOM   10880 C  C   . GLN H 1 112 ? 36.536 17.824  4.455   1.00 33.31 ? 196 GLN H C   1 
ATOM   10881 O  O   . GLN H 1 112 ? 36.778 18.989  4.608   1.00 32.29 ? 196 GLN H O   1 
ATOM   10882 C  CB  . GLN H 1 112 ? 35.469 17.727  6.773   1.00 32.31 ? 196 GLN H CB  1 
ATOM   10883 C  CG  . GLN H 1 112 ? 34.142 17.274  7.434   1.00 36.34 ? 196 GLN H CG  1 
ATOM   10884 C  CD  . GLN H 1 112 ? 33.865 17.693  8.905   1.00 34.59 ? 196 GLN H CD  1 
ATOM   10885 O  OE1 . GLN H 1 112 ? 33.047 17.058  9.577   1.00 40.90 ? 196 GLN H OE1 1 
ATOM   10886 N  NE2 . GLN H 1 112 ? 34.497 18.715  9.373   1.00 30.87 ? 196 GLN H NE2 1 
ATOM   10887 N  N   . GLY H 1 113 ? 37.024 17.161  3.437   1.00 35.15 ? 197 GLY H N   1 
ATOM   10888 C  CA  . GLY H 1 113 ? 37.890 17.820  2.489   1.00 36.97 ? 197 GLY H CA  1 
ATOM   10889 C  C   . GLY H 1 113 ? 39.390 17.560  2.546   1.00 37.50 ? 197 GLY H C   1 
ATOM   10890 O  O   . GLY H 1 113 ? 40.052 17.629  1.513   1.00 37.12 ? 197 GLY H O   1 
ATOM   10891 N  N   . CYS H 1 114 ? 39.901 17.252  3.730   1.00 37.84 ? 198 CYS H N   1 
ATOM   10892 C  CA  . CYS H 1 114 ? 41.325 17.100  3.930   1.00 39.10 ? 198 CYS H CA  1 
ATOM   10893 C  C   . CYS H 1 114 ? 41.718 15.754  4.415   1.00 37.76 ? 198 CYS H C   1 
ATOM   10894 O  O   . CYS H 1 114 ? 40.922 15.077  5.056   1.00 38.80 ? 198 CYS H O   1 
ATOM   10895 C  CB  . CYS H 1 114 ? 41.773 17.989  5.074   1.00 40.10 ? 198 CYS H CB  1 
ATOM   10896 S  SG  . CYS H 1 114 ? 40.880 19.424  5.203   1.00 47.47 ? 198 CYS H SG  1 
ATOM   10897 N  N   . TYR H 1 115 ? 43.001 15.454  4.243   1.00 36.78 ? 199 TYR H N   1 
ATOM   10898 C  CA  . TYR H 1 115 ? 43.650 14.273  4.802   1.00 34.82 ? 199 TYR H CA  1 
ATOM   10899 C  C   . TYR H 1 115 ? 44.169 14.625  6.164   1.00 35.04 ? 199 TYR H C   1 
ATOM   10900 O  O   . TYR H 1 115 ? 44.985 15.541  6.341   1.00 35.71 ? 199 TYR H O   1 
ATOM   10901 C  CB  . TYR H 1 115 ? 44.726 13.794  3.886   1.00 33.77 ? 199 TYR H CB  1 
ATOM   10902 C  CG  . TYR H 1 115 ? 44.124 13.208  2.684   1.00 32.61 ? 199 TYR H CG  1 
ATOM   10903 C  CD1 . TYR H 1 115 ? 44.000 13.920  1.515   1.00 34.16 ? 199 TYR H CD1 1 
ATOM   10904 C  CD2 . TYR H 1 115 ? 43.578 11.956  2.743   1.00 37.18 ? 199 TYR H CD2 1 
ATOM   10905 C  CE1 . TYR H 1 115 ? 43.374 13.344  0.364   1.00 35.61 ? 199 TYR H CE1 1 
ATOM   10906 C  CE2 . TYR H 1 115 ? 42.961 11.366  1.646   1.00 37.85 ? 199 TYR H CE2 1 
ATOM   10907 C  CZ  . TYR H 1 115 ? 42.874 12.066  0.470   1.00 37.47 ? 199 TYR H CZ  1 
ATOM   10908 O  OH  . TYR H 1 115 ? 42.262 11.421  -0.544  1.00 39.20 ? 199 TYR H OH  1 
ATOM   10909 N  N   . VAL H 1 116 ? 43.617 13.913  7.126   1.00 33.66 ? 200 VAL H N   1 
ATOM   10910 C  CA  . VAL H 1 116 ? 43.761 14.165  8.529   1.00 32.91 ? 200 VAL H CA  1 
ATOM   10911 C  C   . VAL H 1 116 ? 44.693 13.031  9.033   1.00 33.85 ? 200 VAL H C   1 
ATOM   10912 O  O   . VAL H 1 116 ? 44.665 11.884  8.519   1.00 34.38 ? 200 VAL H O   1 
ATOM   10913 C  CB  . VAL H 1 116 ? 42.304 14.171  9.108   1.00 32.19 ? 200 VAL H CB  1 
ATOM   10914 C  CG1 . VAL H 1 116 ? 42.153 13.498  10.377  1.00 30.20 ? 200 VAL H CG1 1 
ATOM   10915 C  CG2 . VAL H 1 116 ? 41.792 15.550  9.232   1.00 33.70 ? 200 VAL H CG2 1 
ATOM   10916 N  N   . LYS H 1 117 ? 45.527 13.338  10.003  1.00 34.11 ? 201 LYS H N   1 
ATOM   10917 C  CA  . LYS H 1 117 ? 46.469 12.368  10.532  1.00 35.07 ? 201 LYS H CA  1 
ATOM   10918 C  C   . LYS H 1 117 ? 46.078 12.184  11.943  1.00 35.88 ? 201 LYS H C   1 
ATOM   10919 O  O   . LYS H 1 117 ? 46.358 13.059  12.781  1.00 36.75 ? 201 LYS H O   1 
ATOM   10920 C  CB  . LYS H 1 117 ? 47.854 12.951  10.533  1.00 35.13 ? 201 LYS H CB  1 
ATOM   10921 C  CG  . LYS H 1 117 ? 48.385 13.049  9.149   1.00 37.70 ? 201 LYS H CG  1 
ATOM   10922 C  CD  . LYS H 1 117 ? 49.201 14.285  8.944   1.00 37.16 ? 201 LYS H CD  1 
ATOM   10923 C  CE  . LYS H 1 117 ? 49.750 14.213  7.595   1.00 36.30 ? 201 LYS H CE  1 
ATOM   10924 N  NZ  . LYS H 1 117 ? 50.040 15.562  7.146   1.00 41.97 ? 201 LYS H NZ  1 
ATOM   10925 N  N   . ASP H 1 118 ? 45.472 11.045  12.211  1.00 36.15 ? 202 ASP H N   1 
ATOM   10926 C  CA  . ASP H 1 118 ? 44.809 10.803  13.433  1.00 37.76 ? 202 ASP H CA  1 
ATOM   10927 C  C   . ASP H 1 118 ? 45.712 9.933   14.226  1.00 37.71 ? 202 ASP H C   1 
ATOM   10928 O  O   . ASP H 1 118 ? 45.902 8.764   13.927  1.00 38.64 ? 202 ASP H O   1 
ATOM   10929 C  CB  . ASP H 1 118 ? 43.504 10.062  13.157  1.00 39.58 ? 202 ASP H CB  1 
ATOM   10930 C  CG  . ASP H 1 118 ? 42.773 9.616   14.430  1.00 42.25 ? 202 ASP H CG  1 
ATOM   10931 O  OD1 . ASP H 1 118 ? 43.365 9.628   15.536  1.00 45.11 ? 202 ASP H OD1 1 
ATOM   10932 O  OD2 . ASP H 1 118 ? 41.577 9.254   14.298  1.00 47.88 ? 202 ASP H OD2 1 
ATOM   10933 N  N   . LEU H 1 119 ? 46.225 10.514  15.286  1.00 37.58 ? 203 LEU H N   1 
ATOM   10934 C  CA  . LEU H 1 119 ? 47.310 9.963   16.020  1.00 37.41 ? 203 LEU H CA  1 
ATOM   10935 C  C   . LEU H 1 119 ? 46.890 8.881   16.986  1.00 38.91 ? 203 LEU H C   1 
ATOM   10936 O  O   . LEU H 1 119 ? 47.743 8.128   17.459  1.00 39.79 ? 203 LEU H O   1 
ATOM   10937 C  CB  . LEU H 1 119 ? 47.969 11.066  16.808  1.00 36.27 ? 203 LEU H CB  1 
ATOM   10938 C  CG  . LEU H 1 119 ? 48.366 12.344  16.097  1.00 34.54 ? 203 LEU H CG  1 
ATOM   10939 C  CD1 . LEU H 1 119 ? 49.132 13.187  17.112  1.00 31.19 ? 203 LEU H CD1 1 
ATOM   10940 C  CD2 . LEU H 1 119 ? 49.154 12.085  14.780  1.00 28.83 ? 203 LEU H CD2 1 
ATOM   10941 N  N   . SER H 1 120 ? 45.600 8.808   17.298  1.00 39.51 ? 204 SER H N   1 
ATOM   10942 C  CA  . SER H 1 120 ? 45.114 7.820   18.225  1.00 40.62 ? 204 SER H CA  1 
ATOM   10943 C  C   . SER H 1 120 ? 45.306 6.463   17.618  1.00 41.64 ? 204 SER H C   1 
ATOM   10944 O  O   . SER H 1 120 ? 45.231 5.490   18.320  1.00 42.62 ? 204 SER H O   1 
ATOM   10945 C  CB  . SER H 1 120 ? 43.635 8.009   18.531  1.00 41.40 ? 204 SER H CB  1 
ATOM   10946 O  OG  . SER H 1 120 ? 42.847 7.906   17.349  1.00 40.86 ? 204 SER H OG  1 
ATOM   10947 N  N   . ARG H 1 121 ? 45.579 6.404   16.327  1.00 42.37 ? 205 ARG H N   1 
ATOM   10948 C  CA  . ARG H 1 121 ? 45.771 5.161   15.591  1.00 44.40 ? 205 ARG H CA  1 
ATOM   10949 C  C   . ARG H 1 121 ? 47.239 4.844   15.435  1.00 42.18 ? 205 ARG H C   1 
ATOM   10950 O  O   . ARG H 1 121 ? 47.607 3.878   14.750  1.00 42.01 ? 205 ARG H O   1 
ATOM   10951 C  CB  . ARG H 1 121 ? 45.307 5.371   14.163  1.00 44.32 ? 205 ARG H CB  1 
ATOM   10952 C  CG  . ARG H 1 121 ? 43.903 4.910   13.768  1.00 51.24 ? 205 ARG H CG  1 
ATOM   10953 C  CD  . ARG H 1 121 ? 43.497 5.760   12.484  1.00 51.42 ? 205 ARG H CD  1 
ATOM   10954 N  NE  . ARG H 1 121 ? 42.365 5.259   11.677  1.00 63.68 ? 205 ARG H NE  1 
ATOM   10955 C  CZ  . ARG H 1 121 ? 41.110 5.745   11.703  1.00 66.95 ? 205 ARG H CZ  1 
ATOM   10956 N  NH1 . ARG H 1 121 ? 40.183 5.210   10.885  1.00 66.62 ? 205 ARG H NH1 1 
ATOM   10957 N  NH2 . ARG H 1 121 ? 40.775 6.755   12.532  1.00 65.20 ? 205 ARG H NH2 1 
ATOM   10958 N  N   . LEU H 1 122 ? 48.087 5.688   16.001  1.00 40.52 ? 206 LEU H N   1 
ATOM   10959 C  CA  . LEU H 1 122 ? 49.500 5.665   15.646  1.00 38.96 ? 206 LEU H CA  1 
ATOM   10960 C  C   . LEU H 1 122 ? 50.227 4.440   16.135  1.00 38.37 ? 206 LEU H C   1 
ATOM   10961 O  O   . LEU H 1 122 ? 50.968 3.832   15.397  1.00 38.70 ? 206 LEU H O   1 
ATOM   10962 C  CB  . LEU H 1 122 ? 50.193 6.932   16.130  1.00 38.67 ? 206 LEU H CB  1 
ATOM   10963 C  CG  . LEU H 1 122 ? 51.428 7.423   15.403  1.00 36.25 ? 206 LEU H CG  1 
ATOM   10964 C  CD1 . LEU H 1 122 ? 51.127 7.793   14.007  1.00 33.21 ? 206 LEU H CD1 1 
ATOM   10965 C  CD2 . LEU H 1 122 ? 51.898 8.611   16.169  1.00 37.49 ? 206 LEU H CD2 1 
ATOM   10966 N  N   . GLY H 1 123 ? 49.965 4.050   17.366  1.00 38.84 ? 207 GLY H N   1 
ATOM   10967 C  CA  . GLY H 1 123 ? 50.645 2.908   17.979  1.00 38.87 ? 207 GLY H CA  1 
ATOM   10968 C  C   . GLY H 1 123 ? 51.656 3.340   19.014  1.00 38.51 ? 207 GLY H C   1 
ATOM   10969 O  O   . GLY H 1 123 ? 52.633 2.651   19.215  1.00 40.23 ? 207 GLY H O   1 
ATOM   10970 N  N   . ARG H 1 124 ? 51.405 4.490   19.636  1.00 37.91 ? 208 ARG H N   1 
ATOM   10971 C  CA  . ARG H 1 124 ? 52.307 5.212   20.496  1.00 37.60 ? 208 ARG H CA  1 
ATOM   10972 C  C   . ARG H 1 124 ? 51.469 5.928   21.563  1.00 38.19 ? 208 ARG H C   1 
ATOM   10973 O  O   . ARG H 1 124 ? 50.362 6.392   21.295  1.00 37.88 ? 208 ARG H O   1 
ATOM   10974 C  CB  . ARG H 1 124 ? 53.095 6.322   19.725  1.00 37.16 ? 208 ARG H CB  1 
ATOM   10975 C  CG  . ARG H 1 124 ? 54.064 5.958   18.601  1.00 35.57 ? 208 ARG H CG  1 
ATOM   10976 C  CD  . ARG H 1 124 ? 55.444 5.408   19.046  1.00 37.69 ? 208 ARG H CD  1 
ATOM   10977 N  NE  . ARG H 1 124 ? 55.236 4.028   18.783  1.00 40.22 ? 208 ARG H NE  1 
ATOM   10978 C  CZ  . ARG H 1 124 ? 55.835 3.274   17.893  1.00 37.80 ? 208 ARG H CZ  1 
ATOM   10979 N  NH1 . ARG H 1 124 ? 56.945 3.661   17.263  1.00 34.93 ? 208 ARG H NH1 1 
ATOM   10980 N  NH2 . ARG H 1 124 ? 55.296 2.071   17.721  1.00 33.88 ? 208 ARG H NH2 1 
ATOM   10981 N  N   . ASP H 1 125 ? 52.028 6.088   22.753  1.00 38.66 ? 209 ASP H N   1 
ATOM   10982 C  CA  . ASP H 1 125 ? 51.339 6.798   23.808  1.00 40.39 ? 209 ASP H CA  1 
ATOM   10983 C  C   . ASP H 1 125 ? 51.176 8.272   23.386  1.00 39.96 ? 209 ASP H C   1 
ATOM   10984 O  O   . ASP H 1 125 ? 52.149 8.930   23.007  1.00 41.39 ? 209 ASP H O   1 
ATOM   10985 C  CB  . ASP H 1 125 ? 52.123 6.570   25.104  1.00 40.78 ? 209 ASP H CB  1 
ATOM   10986 C  CG  . ASP H 1 125 ? 51.681 7.450   26.258  1.00 47.49 ? 209 ASP H CG  1 
ATOM   10987 O  OD1 . ASP H 1 125 ? 50.659 8.187   26.116  1.00 52.13 ? 209 ASP H OD1 1 
ATOM   10988 O  OD2 . ASP H 1 125 ? 52.378 7.397   27.346  1.00 53.16 ? 209 ASP H OD2 1 
ATOM   10989 N  N   . LEU H 1 126 ? 49.945 8.781   23.395  1.00 38.85 ? 210 LEU H N   1 
ATOM   10990 C  CA  . LEU H 1 126 ? 49.682 10.170  23.013  1.00 37.57 ? 210 LEU H CA  1 
ATOM   10991 C  C   . LEU H 1 126 ? 50.401 11.200  23.899  1.00 38.01 ? 210 LEU H C   1 
ATOM   10992 O  O   . LEU H 1 126 ? 50.598 12.373  23.525  1.00 37.76 ? 210 LEU H O   1 
ATOM   10993 C  CB  . LEU H 1 126 ? 48.184 10.449  22.988  1.00 36.32 ? 210 LEU H CB  1 
ATOM   10994 C  CG  . LEU H 1 126 ? 47.441 10.070  21.702  1.00 36.95 ? 210 LEU H CG  1 
ATOM   10995 C  CD1 . LEU H 1 126 ? 45.992 10.175  21.912  1.00 31.20 ? 210 LEU H CD1 1 
ATOM   10996 C  CD2 . LEU H 1 126 ? 47.785 10.943  20.528  1.00 33.92 ? 210 LEU H CD2 1 
ATOM   10997 N  N   . ARG H 1 127 ? 50.762 10.768  25.096  1.00 38.41 ? 211 ARG H N   1 
ATOM   10998 C  CA  . ARG H 1 127 ? 51.464 11.624  26.037  1.00 39.13 ? 211 ARG H CA  1 
ATOM   10999 C  C   . ARG H 1 127 ? 52.932 11.710  25.660  1.00 37.69 ? 211 ARG H C   1 
ATOM   11000 O  O   . ARG H 1 127 ? 53.694 12.380  26.334  1.00 39.33 ? 211 ARG H O   1 
ATOM   11001 C  CB  . ARG H 1 127 ? 51.355 11.040  27.429  1.00 39.58 ? 211 ARG H CB  1 
ATOM   11002 C  CG  . ARG H 1 127 ? 50.212 11.599  28.219  1.00 47.48 ? 211 ARG H CG  1 
ATOM   11003 C  CD  . ARG H 1 127 ? 49.562 10.556  29.117  1.00 54.80 ? 211 ARG H CD  1 
ATOM   11004 N  NE  . ARG H 1 127 ? 50.528 10.001  30.044  1.00 63.23 ? 211 ARG H NE  1 
ATOM   11005 C  CZ  . ARG H 1 127 ? 51.081 8.786   29.943  1.00 69.58 ? 211 ARG H CZ  1 
ATOM   11006 N  NH1 . ARG H 1 127 ? 50.738 7.965   28.945  1.00 69.66 ? 211 ARG H NH1 1 
ATOM   11007 N  NH2 . ARG H 1 127 ? 51.977 8.383   30.861  1.00 70.75 ? 211 ARG H NH2 1 
ATOM   11008 N  N   . LYS H 1 128 ? 53.348 10.970  24.639  1.00 35.53 ? 212 LYS H N   1 
ATOM   11009 C  CA  . LYS H 1 128 ? 54.727 11.005  24.197  1.00 33.36 ? 212 LYS H CA  1 
ATOM   11010 C  C   . LYS H 1 128 ? 54.734 11.099  22.659  1.00 32.23 ? 212 LYS H C   1 
ATOM   11011 O  O   . LYS H 1 128 ? 55.536 10.463  22.010  1.00 30.08 ? 212 LYS H O   1 
ATOM   11012 C  CB  . LYS H 1 128 ? 55.470 9.772   24.693  1.00 34.18 ? 212 LYS H CB  1 
ATOM   11013 C  CG  . LYS H 1 128 ? 55.525 9.560   26.230  1.00 34.47 ? 212 LYS H CG  1 
ATOM   11014 C  CD  . LYS H 1 128 ? 56.876 9.835   26.828  1.00 42.20 ? 212 LYS H CD  1 
ATOM   11015 C  CE  . LYS H 1 128 ? 57.973 8.901   26.276  1.00 46.87 ? 212 LYS H CE  1 
ATOM   11016 N  NZ  . LYS H 1 128 ? 59.247 8.922   27.069  1.00 46.27 ? 212 LYS H NZ  1 
ATOM   11017 N  N   . THR H 1 129 ? 53.812 11.913  22.106  1.00 31.17 ? 213 THR H N   1 
ATOM   11018 C  CA  . THR H 1 129 ? 53.640 12.069  20.661  1.00 30.90 ? 213 THR H CA  1 
ATOM   11019 C  C   . THR H 1 129 ? 53.430 13.522  20.257  1.00 29.45 ? 213 THR H C   1 
ATOM   11020 O  O   . THR H 1 129 ? 52.709 14.244  20.909  1.00 28.56 ? 213 THR H O   1 
ATOM   11021 C  CB  . THR H 1 129 ? 52.516 11.188  20.093  1.00 30.85 ? 213 THR H CB  1 
ATOM   11022 O  OG1 . THR H 1 129 ? 52.806 9.820   20.405  1.00 36.05 ? 213 THR H OG1 1 
ATOM   11023 C  CG2 . THR H 1 129 ? 52.493 11.285  18.627  1.00 30.18 ? 213 THR H CG2 1 
ATOM   11024 N  N   . LEU H 1 130 ? 54.137 13.951  19.219  1.00 27.65 ? 214 LEU H N   1 
ATOM   11025 C  CA  . LEU H 1 130 ? 54.030 15.329  18.761  1.00 27.07 ? 214 LEU H CA  1 
ATOM   11026 C  C   . LEU H 1 130 ? 53.880 15.270  17.279  1.00 25.04 ? 214 LEU H C   1 
ATOM   11027 O  O   . LEU H 1 130 ? 54.340 14.290  16.671  1.00 25.73 ? 214 LEU H O   1 
ATOM   11028 C  CB  . LEU H 1 130 ? 55.263 16.118  19.107  1.00 27.10 ? 214 LEU H CB  1 
ATOM   11029 C  CG  . LEU H 1 130 ? 55.512 16.435  20.578  1.00 29.62 ? 214 LEU H CG  1 
ATOM   11030 C  CD1 . LEU H 1 130 ? 56.980 17.123  20.739  1.00 29.04 ? 214 LEU H CD1 1 
ATOM   11031 C  CD2 . LEU H 1 130 ? 54.407 17.344  21.080  1.00 25.96 ? 214 LEU H CD2 1 
ATOM   11032 N  N   . ILE H 1 131 ? 53.231 16.276  16.718  1.00 22.42 ? 215 ILE H N   1 
ATOM   11033 C  CA  . ILE H 1 131 ? 53.053 16.366  15.288  1.00 23.48 ? 215 ILE H CA  1 
ATOM   11034 C  C   . ILE H 1 131 ? 53.517 17.705  14.849  1.00 24.34 ? 215 ILE H C   1 
ATOM   11035 O  O   . ILE H 1 131 ? 53.146 18.704  15.431  1.00 25.30 ? 215 ILE H O   1 
ATOM   11036 C  CB  . ILE H 1 131 ? 51.583 16.124  14.866  1.00 23.04 ? 215 ILE H CB  1 
ATOM   11037 C  CG1 . ILE H 1 131 ? 51.320 16.579  13.457  1.00 25.91 ? 215 ILE H CG1 1 
ATOM   11038 C  CG2 . ILE H 1 131 ? 50.631 16.859  15.657  1.00 23.30 ? 215 ILE H CG2 1 
ATOM   11039 C  CD1 . ILE H 1 131 ? 50.412 15.477  12.633  1.00 30.04 ? 215 ILE H CD1 1 
ATOM   11040 N  N   . LEU H 1 132 ? 54.350 17.743  13.840  1.00 26.09 ? 216 LEU H N   1 
ATOM   11041 C  CA  . LEU H 1 132 ? 54.795 18.996  13.223  1.00 27.97 ? 216 LEU H CA  1 
ATOM   11042 C  C   . LEU H 1 132 ? 54.276 19.024  11.798  1.00 28.38 ? 216 LEU H C   1 
ATOM   11043 O  O   . LEU H 1 132 ? 54.797 18.286  10.994  1.00 29.56 ? 216 LEU H O   1 
ATOM   11044 C  CB  . LEU H 1 132 ? 56.320 19.028  13.156  1.00 27.69 ? 216 LEU H CB  1 
ATOM   11045 C  CG  . LEU H 1 132 ? 56.956 20.132  12.303  1.00 31.49 ? 216 LEU H CG  1 
ATOM   11046 C  CD1 . LEU H 1 132 ? 56.844 21.470  13.037  1.00 34.07 ? 216 LEU H CD1 1 
ATOM   11047 C  CD2 . LEU H 1 132 ? 58.404 19.838  11.946  1.00 30.89 ? 216 LEU H CD2 1 
ATOM   11048 N  N   . ASP H 1 133 ? 53.283 19.864  11.486  1.00 28.82 ? 217 ASP H N   1 
ATOM   11049 C  CA  . ASP H 1 133 ? 52.637 19.867  10.169  1.00 30.19 ? 217 ASP H CA  1 
ATOM   11050 C  C   . ASP H 1 133 ? 52.214 21.332  9.928   1.00 30.70 ? 217 ASP H C   1 
ATOM   11051 O  O   . ASP H 1 133 ? 51.819 21.997  10.853  1.00 30.29 ? 217 ASP H O   1 
ATOM   11052 C  CB  . ASP H 1 133 ? 51.375 18.951  10.175  1.00 30.38 ? 217 ASP H CB  1 
ATOM   11053 C  CG  . ASP H 1 133 ? 50.769 18.700  8.753   1.00 32.42 ? 217 ASP H CG  1 
ATOM   11054 O  OD1 . ASP H 1 133 ? 50.361 19.656  8.042   1.00 32.99 ? 217 ASP H OD1 1 
ATOM   11055 O  OD2 . ASP H 1 133 ? 50.661 17.519  8.350   1.00 33.08 ? 217 ASP H OD2 1 
ATOM   11056 N  N   . ASN H 1 134 ? 52.324 21.826  8.697   1.00 31.03 ? 218 ASN H N   1 
ATOM   11057 C  CA  . ASN H 1 134 ? 52.005 23.201  8.392   1.00 32.45 ? 218 ASN H CA  1 
ATOM   11058 C  C   . ASN H 1 134 ? 50.494 23.524  8.331   1.00 33.51 ? 218 ASN H C   1 
ATOM   11059 O  O   . ASN H 1 134 ? 50.079 24.660  8.607   1.00 34.88 ? 218 ASN H O   1 
ATOM   11060 C  CB  . ASN H 1 134 ? 52.739 23.609  7.158   1.00 30.73 ? 218 ASN H CB  1 
ATOM   11061 C  CG  . ASN H 1 134 ? 52.229 22.939  5.923   1.00 35.22 ? 218 ASN H CG  1 
ATOM   11062 O  OD1 . ASN H 1 134 ? 52.677 21.831  5.524   1.00 32.61 ? 218 ASN H OD1 1 
ATOM   11063 N  ND2 . ASN H 1 134 ? 51.339 23.662  5.208   1.00 39.80 ? 218 ASN H ND2 1 
ATOM   11064 N  N   . SER H 1 135 ? 49.683 22.509  8.080   1.00 33.52 ? 219 SER H N   1 
ATOM   11065 C  CA  . SER H 1 135 ? 48.239 22.645  7.957   1.00 34.65 ? 219 SER H CA  1 
ATOM   11066 C  C   . SER H 1 135 ? 47.570 22.159  9.196   1.00 34.57 ? 219 SER H C   1 
ATOM   11067 O  O   . SER H 1 135 ? 47.472 20.958  9.401   1.00 34.59 ? 219 SER H O   1 
ATOM   11068 C  CB  . SER H 1 135 ? 47.715 21.716  6.848   1.00 35.08 ? 219 SER H CB  1 
ATOM   11069 O  OG  . SER H 1 135 ? 48.259 21.996  5.553   1.00 39.55 ? 219 SER H OG  1 
ATOM   11070 N  N   . PRO H 1 136 ? 46.996 23.064  9.972   1.00 35.01 ? 220 PRO H N   1 
ATOM   11071 C  CA  . PRO H 1 136 ? 46.299 22.606  11.168  1.00 36.01 ? 220 PRO H CA  1 
ATOM   11072 C  C   . PRO H 1 136 ? 45.045 21.699  10.935  1.00 37.04 ? 220 PRO H C   1 
ATOM   11073 O  O   . PRO H 1 136 ? 44.561 21.111  11.913  1.00 38.25 ? 220 PRO H O   1 
ATOM   11074 C  CB  . PRO H 1 136 ? 45.917 23.915  11.867  1.00 36.25 ? 220 PRO H CB  1 
ATOM   11075 C  CG  . PRO H 1 136 ? 45.835 24.882  10.769  1.00 35.91 ? 220 PRO H CG  1 
ATOM   11076 C  CD  . PRO H 1 136 ? 46.923 24.521  9.817   1.00 33.80 ? 220 PRO H CD  1 
ATOM   11077 N  N   . ALA H 1 137 ? 44.557 21.560  9.699   1.00 36.09 ? 221 ALA H N   1 
ATOM   11078 C  CA  . ALA H 1 137 ? 43.468 20.606  9.408   1.00 36.44 ? 221 ALA H CA  1 
ATOM   11079 C  C   . ALA H 1 137 ? 43.946 19.174  9.601   1.00 36.28 ? 221 ALA H C   1 
ATOM   11080 O  O   . ALA H 1 137 ? 43.168 18.335  10.057  1.00 36.19 ? 221 ALA H O   1 
ATOM   11081 C  CB  . ALA H 1 137 ? 42.892 20.768  8.000   1.00 36.37 ? 221 ALA H CB  1 
ATOM   11082 N  N   . SER H 1 138 ? 45.228 18.924  9.277   1.00 35.04 ? 222 SER H N   1 
ATOM   11083 C  CA  . SER H 1 138 ? 45.921 17.644  9.543   1.00 32.23 ? 222 SER H CA  1 
ATOM   11084 C  C   . SER H 1 138 ? 45.787 17.247  10.948  1.00 30.49 ? 222 SER H C   1 
ATOM   11085 O  O   . SER H 1 138 ? 45.845 16.092  11.230  1.00 31.09 ? 222 SER H O   1 
ATOM   11086 C  CB  . SER H 1 138 ? 47.421 17.755  9.361   1.00 32.01 ? 222 SER H CB  1 
ATOM   11087 O  OG  . SER H 1 138 ? 47.713 18.231  8.099   1.00 34.63 ? 222 SER H OG  1 
ATOM   11088 N  N   . TYR H 1 139 ? 45.639 18.161  11.872  1.00 29.01 ? 223 TYR H N   1 
ATOM   11089 C  CA  . TYR H 1 139 ? 45.738 17.666  13.252  1.00 28.78 ? 223 TYR H CA  1 
ATOM   11090 C  C   . TYR H 1 139 ? 44.515 18.077  14.057  1.00 28.42 ? 223 TYR H C   1 
ATOM   11091 O  O   . TYR H 1 139 ? 44.537 18.261  15.266  1.00 27.98 ? 223 TYR H O   1 
ATOM   11092 C  CB  . TYR H 1 139 ? 47.092 18.058  13.921  1.00 29.27 ? 223 TYR H CB  1 
ATOM   11093 C  CG  . TYR H 1 139 ? 47.513 19.503  13.839  1.00 25.90 ? 223 TYR H CG  1 
ATOM   11094 C  CD1 . TYR H 1 139 ? 46.944 20.464  14.629  1.00 22.85 ? 223 TYR H CD1 1 
ATOM   11095 C  CD2 . TYR H 1 139 ? 48.558 19.871  13.006  1.00 27.75 ? 223 TYR H CD2 1 
ATOM   11096 C  CE1 . TYR H 1 139 ? 47.404 21.817  14.582  1.00 27.57 ? 223 TYR H CE1 1 
ATOM   11097 C  CE2 . TYR H 1 139 ? 49.028 21.179  12.961  1.00 28.95 ? 223 TYR H CE2 1 
ATOM   11098 C  CZ  . TYR H 1 139 ? 48.455 22.138  13.732  1.00 31.37 ? 223 TYR H CZ  1 
ATOM   11099 O  OH  . TYR H 1 139 ? 48.964 23.394  13.614  1.00 31.96 ? 223 TYR H OH  1 
ATOM   11100 N  N   . ILE H 1 140 ? 43.410 18.220  13.344  1.00 29.44 ? 224 ILE H N   1 
ATOM   11101 C  CA  . ILE H 1 140 ? 42.204 18.650  13.987  1.00 27.72 ? 224 ILE H CA  1 
ATOM   11102 C  C   . ILE H 1 140 ? 41.646 17.711  15.063  1.00 27.11 ? 224 ILE H C   1 
ATOM   11103 O  O   . ILE H 1 140 ? 41.028 18.164  15.991  1.00 28.01 ? 224 ILE H O   1 
ATOM   11104 C  CB  . ILE H 1 140 ? 41.209 19.047  12.971  1.00 28.65 ? 224 ILE H CB  1 
ATOM   11105 C  CG1 . ILE H 1 140 ? 40.241 20.092  13.580  1.00 30.38 ? 224 ILE H CG1 1 
ATOM   11106 C  CG2 . ILE H 1 140 ? 40.536 17.826  12.327  1.00 25.58 ? 224 ILE H CG2 1 
ATOM   11107 C  CD1 . ILE H 1 140 ? 39.393 20.853  12.554  1.00 35.20 ? 224 ILE H CD1 1 
ATOM   11108 N  N   . PHE H 1 141 ? 41.915 16.423  14.995  1.00 26.65 ? 225 PHE H N   1 
ATOM   11109 C  CA  . PHE H 1 141 ? 41.532 15.536  16.088  1.00 28.33 ? 225 PHE H CA  1 
ATOM   11110 C  C   . PHE H 1 141 ? 42.512 15.610  17.291  1.00 30.20 ? 225 PHE H C   1 
ATOM   11111 O  O   . PHE H 1 141 ? 42.177 15.150  18.364  1.00 31.12 ? 225 PHE H O   1 
ATOM   11112 C  CB  . PHE H 1 141 ? 41.405 14.093  15.607  1.00 26.97 ? 225 PHE H CB  1 
ATOM   11113 C  CG  . PHE H 1 141 ? 40.239 13.861  14.730  1.00 26.62 ? 225 PHE H CG  1 
ATOM   11114 C  CD1 . PHE H 1 141 ? 40.270 14.269  13.386  1.00 19.75 ? 225 PHE H CD1 1 
ATOM   11115 C  CD2 . PHE H 1 141 ? 39.068 13.195  15.252  1.00 25.01 ? 225 PHE H CD2 1 
ATOM   11116 C  CE1 . PHE H 1 141 ? 39.146 14.074  12.577  1.00 28.42 ? 225 PHE H CE1 1 
ATOM   11117 C  CE2 . PHE H 1 141 ? 37.953 12.964  14.448  1.00 22.74 ? 225 PHE H CE2 1 
ATOM   11118 C  CZ  . PHE H 1 141 ? 37.928 13.414  13.143  1.00 25.92 ? 225 PHE H CZ  1 
ATOM   11119 N  N   . HIS H 1 142 ? 43.710 16.183  17.115  1.00 30.62 ? 226 HIS H N   1 
ATOM   11120 C  CA  . HIS H 1 142 ? 44.706 16.193  18.191  1.00 31.04 ? 226 HIS H CA  1 
ATOM   11121 C  C   . HIS H 1 142 ? 45.559 17.500  18.243  1.00 32.17 ? 226 HIS H C   1 
ATOM   11122 O  O   . HIS H 1 142 ? 46.811 17.475  18.268  1.00 32.77 ? 226 HIS H O   1 
ATOM   11123 C  CB  . HIS H 1 142 ? 45.602 14.947  18.095  1.00 29.04 ? 226 HIS H CB  1 
ATOM   11124 C  CG  . HIS H 1 142 ? 44.839 13.664  18.091  1.00 26.77 ? 226 HIS H CG  1 
ATOM   11125 N  ND1 . HIS H 1 142 ? 44.424 13.040  19.250  1.00 25.15 ? 226 HIS H ND1 1 
ATOM   11126 C  CD2 . HIS H 1 142 ? 44.414 12.889  17.065  1.00 22.40 ? 226 HIS H CD2 1 
ATOM   11127 C  CE1 . HIS H 1 142 ? 43.810 11.914  18.930  1.00 24.21 ? 226 HIS H CE1 1 
ATOM   11128 N  NE2 . HIS H 1 142 ? 43.797 11.801  17.612  1.00 23.82 ? 226 HIS H NE2 1 
ATOM   11129 N  N   . PRO H 1 143 ? 44.890 18.640  18.293  1.00 31.89 ? 227 PRO H N   1 
ATOM   11130 C  CA  . PRO H 1 143 ? 45.714 19.826  18.145  1.00 31.87 ? 227 PRO H CA  1 
ATOM   11131 C  C   . PRO H 1 143 ? 46.583 20.065  19.382  1.00 32.28 ? 227 PRO H C   1 
ATOM   11132 O  O   . PRO H 1 143 ? 47.506 20.885  19.333  1.00 34.52 ? 227 PRO H O   1 
ATOM   11133 C  CB  . PRO H 1 143 ? 44.674 20.943  17.994  1.00 31.66 ? 227 PRO H CB  1 
ATOM   11134 C  CG  . PRO H 1 143 ? 43.484 20.434  18.827  1.00 28.73 ? 227 PRO H CG  1 
ATOM   11135 C  CD  . PRO H 1 143 ? 43.462 18.952  18.518  1.00 31.52 ? 227 PRO H CD  1 
ATOM   11136 N  N   . GLU H 1 144 ? 46.307 19.346  20.456  1.00 31.66 ? 228 GLU H N   1 
ATOM   11137 C  CA  . GLU H 1 144 ? 47.101 19.399  21.691  1.00 31.86 ? 228 GLU H CA  1 
ATOM   11138 C  C   . GLU H 1 144 ? 48.473 18.667  21.655  1.00 32.25 ? 228 GLU H C   1 
ATOM   11139 O  O   . GLU H 1 144 ? 49.293 18.828  22.547  1.00 32.61 ? 228 GLU H O   1 
ATOM   11140 C  CB  . GLU H 1 144 ? 46.296 18.836  22.858  1.00 31.79 ? 228 GLU H CB  1 
ATOM   11141 C  CG  . GLU H 1 144 ? 45.931 17.344  22.682  1.00 32.48 ? 228 GLU H CG  1 
ATOM   11142 C  CD  . GLU H 1 144 ? 44.511 17.140  22.222  1.00 29.45 ? 228 GLU H CD  1 
ATOM   11143 O  OE1 . GLU H 1 144 ? 43.925 16.156  22.659  1.00 27.06 ? 228 GLU H OE1 1 
ATOM   11144 O  OE2 . GLU H 1 144 ? 43.972 17.987  21.487  1.00 29.64 ? 228 GLU H OE2 1 
ATOM   11145 N  N   . ASN H 1 145 ? 48.685 17.860  20.633  1.00 31.83 ? 229 ASN H N   1 
ATOM   11146 C  CA  . ASN H 1 145 ? 49.942 17.263  20.352  1.00 31.91 ? 229 ASN H CA  1 
ATOM   11147 C  C   . ASN H 1 145 ? 50.679 18.072  19.265  1.00 32.68 ? 229 ASN H C   1 
ATOM   11148 O  O   . ASN H 1 145 ? 51.752 17.657  18.766  1.00 31.36 ? 229 ASN H O   1 
ATOM   11149 C  CB  . ASN H 1 145 ? 49.693 15.821  19.919  1.00 31.52 ? 229 ASN H CB  1 
ATOM   11150 C  CG  . ASN H 1 145 ? 49.196 14.958  21.080  1.00 32.90 ? 229 ASN H CG  1 
ATOM   11151 O  OD1 . ASN H 1 145 ? 47.975 14.909  21.389  1.00 31.44 ? 229 ASN H OD1 1 
ATOM   11152 N  ND2 . ASN H 1 145 ? 50.144 14.280  21.757  1.00 29.50 ? 229 ASN H ND2 1 
ATOM   11153 N  N   . ALA H 1 146 ? 50.094 19.212  18.861  1.00 32.91 ? 230 ALA H N   1 
ATOM   11154 C  CA  . ALA H 1 146 ? 50.684 19.905  17.709  1.00 33.59 ? 230 ALA H CA  1 
ATOM   11155 C  C   . ALA H 1 146 ? 51.747 20.963  18.021  1.00 33.09 ? 230 ALA H C   1 
ATOM   11156 O  O   . ALA H 1 146 ? 51.618 21.779  18.936  1.00 32.26 ? 230 ALA H O   1 
ATOM   11157 C  CB  . ALA H 1 146 ? 49.622 20.415  16.734  1.00 32.29 ? 230 ALA H CB  1 
ATOM   11158 N  N   . VAL H 1 147 ? 52.814 20.928  17.254  1.00 33.09 ? 231 VAL H N   1 
ATOM   11159 C  CA  . VAL H 1 147 ? 53.723 22.062  17.245  1.00 33.44 ? 231 VAL H CA  1 
ATOM   11160 C  C   . VAL H 1 147 ? 53.573 22.751  15.904  1.00 33.54 ? 231 VAL H C   1 
ATOM   11161 O  O   . VAL H 1 147 ? 54.030 22.272  14.901  1.00 33.66 ? 231 VAL H O   1 
ATOM   11162 C  CB  . VAL H 1 147 ? 55.171 21.625  17.477  1.00 33.88 ? 231 VAL H CB  1 
ATOM   11163 C  CG1 . VAL H 1 147 ? 56.151 22.746  17.034  1.00 33.72 ? 231 VAL H CG1 1 
ATOM   11164 C  CG2 . VAL H 1 147 ? 55.394 21.319  18.958  1.00 33.93 ? 231 VAL H CG2 1 
ATOM   11165 N  N   . PRO H 1 148 ? 52.913 23.877  15.880  1.00 34.55 ? 232 PRO H N   1 
ATOM   11166 C  CA  . PRO H 1 148 ? 52.599 24.544  14.600  1.00 35.47 ? 232 PRO H CA  1 
ATOM   11167 C  C   . PRO H 1 148 ? 53.863 25.115  13.943  1.00 36.16 ? 232 PRO H C   1 
ATOM   11168 O  O   . PRO H 1 148 ? 54.844 25.375  14.620  1.00 35.85 ? 232 PRO H O   1 
ATOM   11169 C  CB  . PRO H 1 148 ? 51.691 25.721  15.008  1.00 34.21 ? 232 PRO H CB  1 
ATOM   11170 C  CG  . PRO H 1 148 ? 51.401 25.536  16.459  1.00 34.72 ? 232 PRO H CG  1 
ATOM   11171 C  CD  . PRO H 1 148 ? 52.443 24.635  17.044  1.00 35.20 ? 232 PRO H CD  1 
ATOM   11172 N  N   . VAL H 1 149 ? 53.777 25.329  12.632  1.00 36.47 ? 233 VAL H N   1 
ATOM   11173 C  CA  . VAL H 1 149 ? 54.846 25.781  11.809  1.00 36.61 ? 233 VAL H CA  1 
ATOM   11174 C  C   . VAL H 1 149 ? 54.181 26.379  10.575  1.00 36.88 ? 233 VAL H C   1 
ATOM   11175 O  O   . VAL H 1 149 ? 53.218 25.834  10.057  1.00 36.97 ? 233 VAL H O   1 
ATOM   11176 C  CB  . VAL H 1 149 ? 55.759 24.594  11.420  1.00 37.21 ? 233 VAL H CB  1 
ATOM   11177 C  CG1 . VAL H 1 149 ? 55.118 23.690  10.375  1.00 33.28 ? 233 VAL H CG1 1 
ATOM   11178 C  CG2 . VAL H 1 149 ? 57.053 25.114  10.881  1.00 38.33 ? 233 VAL H CG2 1 
ATOM   11179 N  N   . GLN H 1 150 ? 54.715 27.476  10.065  1.00 37.43 ? 234 GLN H N   1 
ATOM   11180 C  CA  . GLN H 1 150 ? 54.082 28.138  8.960   1.00 39.20 ? 234 GLN H CA  1 
ATOM   11181 C  C   . GLN H 1 150 ? 54.422 27.477  7.628   1.00 36.67 ? 234 GLN H C   1 
ATOM   11182 O  O   . GLN H 1 150 ? 55.519 26.964  7.430   1.00 36.48 ? 234 GLN H O   1 
ATOM   11183 C  CB  . GLN H 1 150 ? 54.508 29.591  8.959   1.00 40.07 ? 234 GLN H CB  1 
ATOM   11184 C  CG  . GLN H 1 150 ? 53.656 30.591  9.810   1.00 44.78 ? 234 GLN H CG  1 
ATOM   11185 C  CD  . GLN H 1 150 ? 54.065 32.092  9.519   1.00 47.79 ? 234 GLN H CD  1 
ATOM   11186 O  OE1 . GLN H 1 150 ? 54.709 32.393  8.467   1.00 56.51 ? 234 GLN H OE1 1 
ATOM   11187 N  NE2 . GLN H 1 150 ? 53.693 33.027  10.452  1.00 53.70 ? 234 GLN H NE2 1 
ATOM   11188 N  N   . SER H 1 151 ? 53.496 27.472  6.693   1.00 35.33 ? 235 SER H N   1 
ATOM   11189 C  CA  . SER H 1 151 ? 53.848 26.900  5.405   1.00 35.36 ? 235 SER H CA  1 
ATOM   11190 C  C   . SER H 1 151 ? 55.007 27.646  4.697   1.00 35.15 ? 235 SER H C   1 
ATOM   11191 O  O   . SER H 1 151 ? 55.103 28.818  4.837   1.00 35.76 ? 235 SER H O   1 
ATOM   11192 C  CB  . SER H 1 151 ? 52.607 26.765  4.500   1.00 35.14 ? 235 SER H CB  1 
ATOM   11193 O  OG  . SER H 1 151 ? 51.490 27.363  5.103   1.00 36.40 ? 235 SER H OG  1 
ATOM   11194 N  N   . TRP H 1 152 ? 55.842 26.936  3.933   1.00 34.71 ? 236 TRP H N   1 
ATOM   11195 C  CA  . TRP H 1 152 ? 56.989 27.434  3.260   1.00 33.73 ? 236 TRP H CA  1 
ATOM   11196 C  C   . TRP H 1 152 ? 56.957